3OVRA

Crystal structure of hrpe and d-xylulose 5-phosphate complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovrA00
4DBEA 1LYXA 2X1TA 3L2IA 4NZJA 2Y61A 2NUYA 2YXGA 3E49A 1OYBA 5F2LA 1OX4A 4GXMA 1W56A 2QCFA 1DKWA 3LCHA 3O6DA 3O8AA 2F7FA 4HKPA 1OX5A 2HTMA 1HG3A 3ABSA 2D73A 3B8DA 3EWYA 5K4ZA 5C2XA 4JTSA 2R94A 4BFAA 3IV3A 3G8RA 3NQDA 3G24A 3IIOA 1DJQA 1HUVA 1AL8A 2B4GA 3ABOA 3EX2A 2AGKA 3I6RA 3NPXA 1K7EA 2ISVA 3MBDA 3LRKA 1JQVA 4KFPA 3G1XA 4OU1A 3TSDA 1A5CA 4JTUA 5LSMA 3N34A 4WJEA 5SWUA 2NWRA 4AWTA 4PCFA 3UWWA 1XDLA 1BWLA 2HMCA 4K6AA 2ISWA 1F6KA 2X1RA 2NXHA 5DCEA 3KAOA 2FLIA 2ZZ2A 4WOQA 3L21A 4JTJA 4IQLA 3PG9A 5U4NA 1W54A 1BKSA 1IIHA 2QR6A 4OBTA 3P5YA 5I3HA 2QCEA 4MZ8A 2IQTA 3ZWSA 2C1HA 1L6SA 4GRSA 1KBJA 1VS1A 1TPWA 2C6QA 3DGRA 3L66A 1XBYA 4AXKA 2QUTA 3CB8A 1OFEA 4JR5A 1KTCA 1IXNA 3IVSA 3LTYA 1DQWA 3G1YA 1M7OA 1NF7A 4ZQMA 1KFLA 3KHJA 3QZEA 3VI2A 1K8YA 5G1TA 3L0NA 2DJLA 3NQ2A 2FQIA 3HB9A 3MP3A 4IPJA 1TQJA 4OV4A 5KSWA 3UWQA 1W1ZA 3W6YA 2W79A 2A1YA 3W1RA 3A23A 3GDMA 2B7PA 1T96A 2NUXA 1PE1A 2Z0IA 4GUGA 2FB2A 3FJ6A 1XI3A 4CCDA 2H3DA 5EPDA 3SGZA 5BRBA 2ABAA 2QCDA 2WSYA 3STFA 4RK8A 2BTMA 1GQNA 3CEUA 3N9RA 4UMAA 3STGA 3CIWA 4IMFA 2BLEA 1H63A 2A85A 2HS8A 3WJZA 3MYPA 2DZTA 1VCGA 3WK2A 3P81A 3C56A 4MOZA 4MJMA 4JX4A 3S1VA 2Y7FA 2NX3A 3DH7A 3AO0A 4MYAA 5LNVA 2YW3A 4Y8FA 3TH6A 3R89A 3W23A 4R33A 3M7WA 4I7UA 3W84A 1OYCA 8TIMA 3GDKA 2NX1A 3NQCA 1R2TA 3G1SA 4UTHA 4TO8A 1AW1A 3P8IA 4MYXA 3PR2A 4UMBA 3S1UA 1G4EA 3TW6A 2VKZG 4JDYA 5CZJA 1G6CA 3OVRA 1R30A 5I3JA 3B0UX 3BG5A 4O14A 4FXRA 5EYWA 4UTUA 3QJAA 3ABRA 5HWNA 2XN2A 1O5KA 1QAPA 4FX7A 3S5NA 1TYGA 1GVSA 2H8ZA 2ATSA 1KM3A 2GUUA 3WJYA 3HOJA 3W7LA 2EF9A 4FEZA 5K9DA 2AQWA 4UTJA 3D0CA 2V5BA 4GUHA 3PUDA 1YLVA 1SFJA 3KXQA 5K2ZA 2E5DA 1BWKA 3GDLA 3LHZA 3V1PA 5IBXA 2ZZ1A 3MBFA 4GNJA 4L4MA 3S5OA 3LI1A 5DN1A 3A5VA 1KV8A 3EX3A 1I2QA 4JTLA 5D2VA 3W73A 2EPHA 3G8EA 3UWYA 4JYDA 4AMAA 1FCUA 1L2UA 1BTMA 5HUPA 3GDTA 4RXFA 2VEPA 1OABA 2C16A 4FNSA 3W1TA 5H2ZA 3BPWA 3HO8A 5FI8A 5I3FA 1ZY9A 3N9SA 3W7JA 1OFAA 2TRSA 4BI6A 3H54A 3GLCA 1IGSA 4RJEA 2AAMA 4ICNA 1RZMA 1QFEA 4AHOA 3HGRA 2I1OA 1GG1A 3N2MA 2ATMA 4POCA 3NG3A 1OYAA 3IVUA 4NU7A 1QO5A 3EX1A 4NNAA 5FEXA 3IIPA 1TV8A 1R47A 5AC8A 4UIOA 1DHPA 3FLUA 1OX6A 2DZSA 3DFSA 1YTDA 1TJRA 1W8SA 3OVQA 4QIUA 1JCXA 5K3VA 1RVGA 1EA0A 3PWAA 4FX8A 2YYUA 3T7VA 3GXTA 5BMWA 4Z1DA 3VKJA 4FX6M 1WDWA 3DFPA 1OFPA 2ISSA 4XTIA 1I8JA 3U8GA 1QPRA 3L67A 3LRLA 1XBZA 2X30A 4GUFA 5KTLA 2NZLA 2CLKA 1HL2A 3STEA 1YPIA 3BW2A 3VNDA 2ZYFA 4PL2A 4UNLA 1EP2A 3USBA 3DKLA 4QISA 1WBHA 2QJHA 3FIGA 3P8JA 2ZRUA 4E38A 3ZS4A 3W2LA 4M6VA 3G1DA 3MP4A 3O07A 4LUIA 3HG5A 2HS6A 4HT3A 1Q6RA 3FOKA 1M6JA 4LVGA 1JCNA 2PURA 3GK0A 3M5XA 1ICPA 1VRDA 3C2OA 3NZ1A 1G69A 3ZWTA 2CWNA 1IXPA 1LROA 3NPVA 1E51A 2BXVA 3OG3A 5CZSA 3NL6A 5E0KA 4FO4A 4RX0A 3ABQA 3HPZA 2E68A 4WX2A 1OFDA 1OFBA 4O10A 4XTDA 1Z41A 3I7QA 3HBLA 3QMRA 1GVFA 3M47A 5KZMA 4UR8A 4WUIA 4S2CA 4UTWC 3C4UA 1L6WA 3VFLA 3MW7A 4ZQRA 4XBKA 1VQTA 5HUOA 4NX5A 2QCGA 3G0SA 4XBSA 3QM3A 4IMCA 3LERA 4BI7A 4JICA 3W7RA 1ZCOA 2J24A 3KVLA 4N9EA 3NAVA 1KW1A 1PV8A 2CFFA 4N4PA 1SO3A 1TRIA 3LDVA 4S2BA 1QOPA 4IWWA 1Q45A 3WJWA 4XQ6A 3UZ5A 3PBWA 1EIXA 3DZ1A 2ZFAA 4LVFA 4IX0A 4LV4A 2PRLA 3IIXA 1KM4A 3BLIA 3NGJA 5J5DA 1WOBA 3S42A 4HHPA 1UJPA 1AMKA 4N6FA 3S6DA 1FBAA 2DP3A 3C61A 1R46A 2DZVA 1OFRA 2A7PA 3NZRA 2QCNA 4UTTA 3CQ0A 4MLRA 1ONRA 4UFLA 2OCZA 4HNNA 2NV2A 2C18A 2GJLA 3LHYA 3DFOA 1G4SA 1KM0A 3NXFA 4NJHA 1WBJA 4Z1CA 3A24A 1TPB1 4JTFA 4N6EA 2WO5A 2FFCA 4K7YA 4KFOA 4CQ8A 4YCPA 1SZGA 4CQ9A 3UPWA 2V81A 1SFLA 2GVJA 2QCHA 1KM5A 1MXSA 1V7YA 1Q3NA 2XN0A 1GTHA 1RQHA 4IXXA 5HNRA 3OVPA 2ABBA 4NJJA 5D2XA 3GXNA 3W76A 3C2VA 2WNQA 4JS3A 5C5YA 4Y96A 2VENA 2ZRXA 3EXRA 3DAQA 1JCMP 2V9DA 1W5PA 2ZRWA 5LNRA 4HN4A 2WV8A 4Z1BA 1RR2A 4IMDA 1GVQA 1ME7A 3TDFA 1X1OA 3GAYA 1WAUA 2E6FA 3LHWA 2A6NA 1HO4A 1T0OA 1XC4A 4LNYA 1AG1O 1OF6A 5AN7A 3TSBA 3NQVA 3STCA 2FJKA 2DU2A 3FEMA 2WNZA 4OWGA 1OFQA 3W7KA 1QWGA 4PODA 3DFTA 1QPOA 2VEKA 1KV5A 4MLJA 3EWBX 4O57A 4EF9A 4DF2A 1TPVA 2QAFA 4CCCA 1LBFA 5C6MA 3PVFA 1T99A 3P67A 2CLMA 4K39A 5EA9A 3LI0A 4O11A 1QO2A 4ADSA 3G1VA 4QM1A 4QITA 1TPFA 1CW2A 4Y6GA 5DBUA 2RKXA 3C52A 4DF1A 3HGOA 3UPBA 2YCEA 3LXBA 3KFTA 4RZ4A 4QNWA 5EMUA 4DEFA 1MEWA 4LVDA 3QMSA 3N14A 3NQFA 3RFAA 3GVGA 4J9JA 2VFHA 1Z44A 4UXDA 4LT9A 5K4XA 3CWOX 3NOEA 4O53A 3EX6A 3O1NA 1K8ZA 2CZFA 2B7QA 3SGUA 2V8ZA 1Z42A 3P80A 4HNUA 2P0OA 3MI2A 4YCOA 3QF0A 4LC8A 2H8XA 3NL5A 1MO0A 4AH7A 3H53A 1PIIA 1ZALA 1W0MA 4Z08A 4FIRA 1X1ZA 3HPXA 1XXXA 4TIMA 4Q32A 4EVZA 1LOSA 5G4EA 1KTNA 4PTNA 2B0MA 2J9XA 3M5VA 3IVTA 4W9TA 1Q6OA 4DO4A 1A5AA 5AC7A 1FUYA 5D2WA 1UUOA 2C3ZA 4PH6A 1SSDA 3W7HA 5D38A 4ZQCA 1JR1A 4JYEA 1TPC1 1VHNA 5G4WA 3W9ZA 1GTEA 2QAPA 2PE4A 1AK5A 1JCJA 3SY5A 5DCBA 1QOQA 1JUBA 1ZNNA 5AYZA 3GYEA 1KM1A 2Y85A 1P5BA 4LWWA 4AF0A 4BWLA 3IGSA 4MFEA 3CLMA 3K30A 3P61A 5FF2A 5AYYA 4DELA 2J88A 1FCVA 2GOUA 3PULA 1W5QA 5AYXA 1DV7A 5G2WA 1AL7A 5E1QA 2ZBTA 1I2NA 1B3OA 2J27A 3TE9A 3P62A 3UWZA 2RDTA 3QFEA 4R53A 3DI0A 3GAKA 3S5YA 3HMJG 2PC4A 4XWUA 3A5FA 3FA5A 2E5CA 1RQBA 4DO5A 5J5RA 2FPTA 4MKNA 5K9CA 4MJZA 3PG8A 2YDAA 4N9DA 2R8WA 2TYSA 2I14A 5LHFA 2YFOA 4MIMA 1RD5A 2Z1BA 2QUVA 5C55A 3CPRA 4FXSA 1JUEA 1JVNA 2CLOA 4GFSA 3G3MA 4I9AA 1G7UA 1L6YA 4JIPA 2FDSA 3TKFA 5CPMA 1R2RA 3UWVA 5T26A 3NQMA 4RZ6A 3M5YA 3TFCA 4UFKA 3NNTA 3DFQA 5AOUA 5A8GA 1JUKA 3QQ1A 6ALDA 1KFCA 1OX4B 1WOAA 4FNQA 1ZJIA 4N9CA 4X9SA 4UMCA 1KA9F 2NV1A 1ADOA 3P74A 3QPZA 1VH7A 2TMDA 4AHQA 4DXVA 1ICSA 3G22A 3FKRA 2E5BA 2VFEA 2QF7A 3E02A 3RK8A 1S5VA 3DI1A 1H1YA 2V2HA 2NXIA 2ZA1A 5G5IA 4ONVA 5AHFA 1ZHAA 1EWDA 4LRSA 1VZWA 4OE7A 3T44A 2RFGA 3NQ8A 2YW4A 3I7RA 5F2IA 4LC6A 1GT8A 5AHLA 2CLLA 1L9WA 2QCLA 1UCWA 4Z1AA 1NEYA 3W87A 1VJIA 3PAJA 1LDCA 4G1KA 3DHDA 3NPUA 4LTSA 4O8RA 3MI6A 4N4QA 4RKAA 3GR8A 1A5BA 3TW7A 3ANYA 1ZFJA 4ORMA 4CNNA 5EBUA 2R91A 4JEQA 1H7NA 4ZVJA 1TSIA 1FWRA 2ZZ5A 4O1CA 3QRHA 3UXDA 5BOOA 3W7QA 3R13A 2YZRA 3LB0A 1F7BA 4NJIA 5HINA 5KINA 5MHBA 1YXDA 1S5TA 1CX9A 1O4UA 3NVTA 3DHFA 1A50A 3KVMA 3NL3A 1YDVA 1FQ0A 4A3UA 3C2RA 3MHUA 2A6LA 1TPDA 1JCYA 3TJXA 4XUGA 1VC4A 2NWSA 5F2MA 1T8XA 2FTPA 3HGJA 3IRDA 4JIQA 2Y7GA 4Y9AA 2TSYA 3NL2A 3TJLA 1EX5A 3B04A 4ZZ9A 1I2OA 2VEMA 2NLIA 3M44A 5EKYA 4RCXA 1VHCA 1K7FA 3SW6A 3LHVA 4ZQPA 1QR7A 5CZTA 3HJZA 1M7PA 3QSRA 1TREA 3R12A 3G1AA 4FIQA 3SSJA 1P4CA 5U7SA 2CLIA 1F05A 1GVRA 3DENA 3LV5A 1PCKA 1VLIA 4RR4A 4IJBA 5KZEA 3MI3A 3MWAA 1IF2A 3NQGA 1JRCA 1A53A 1OHLA 4FHAA 4MPQA 5AB3A 3M16A 2ALDA 4O16A 1P0KA 4EF8A 4LUJA 3LCXA 5FEPA 4JTKA 3NEVA 5FF4A 3UXAA 3G3DA 1PHQA 4ZQNA 4O1AA 4M6QA 1C9DA 4QJ1A 5DXXA 4FNPA 2WSRA 4IX2A 1QDSA 2O7SA 2QDGA 4A29A 2P10A 3IIZA 4U28A 5H91A 1LLZA 4UTKA 2PRHA 4N9BA 3NM1A 3CT7A 1IIGA 1W5OA 1W3IA 1MZHA 3TR2A 2X2GA 4O52A 4LV9A 1SW3A 1J4EA 1UBSA 4K8EA 3FFSA 5AC6A 5D37A 2ZZ4A 1YXYA 3M6YA 3E9AA 1UASA 2CLFA 3LCLA 2A2IA 3MYOA 1NFBA 1KFEA 2P1FA 3EWWA 1KFKA 3R2GA 4AVFA 3LCFA 4X3ZA 5BMXA 2FPYA 4O13A 3T55A 3SR7A 3TA6A 1X8FA 2OJPA 1H61A 3INPA 3PBYA 4DPPA 2ZA3A 4HPXA 4O4VA 3ATYA 3PS7A 2Q8ZA 3W7DA 1H7XA 3L65A 1I45A 3NQ6A 3MMTA 2Y6ZA 1PCWA 2YR1A 1SR9A 3O15A 2JGQA 1XKYA 2QDHA 1TV5A 5TQLA 4S1FA 3B0PA 4UNKA 3W7PA 5KMYA 1H62A 3JR2A 3W7CA 2GQ9A 3GR7A 2FIQA 1LM1A 1U5JA 4BR1A 3TU9A 3OBKA 1W37A 3SZ8A 4H6KA 3SFKA 1O60A 1WX0A 3BVJA 4LVAA 3G1HA 5TIMA 1OVDA 1GYLA 4O1BA 1X7FA 3S0CA 5IM51 5CG7A 5F4SA 2RHGA 2Q8LA 2WJZA 4O0ZA 3G0XA 4LY8A 5FEWA 4M7SA 2J6XA 4GE8A 5K9XA 5L9FA 3RLUA 2YGYA 4YLWA 2E6DA 4AAJA 6TIMA 5D05A 3W1PA 5LNWA 4A21A 1F73A 4TMCA 2H3BA 5EY5A 2Y70A 1HO1A 3GXPA 4UCGA 4CNOA 3LTSA 3PF3A 4EWND 4JYFA 3E12A 1YTKA 4BF9A 1FDYA 1X6UA 3QSTA 4Y90A 3M43A 1QCWA 5D2YA 5CZ0A 3THAA 3BK0A 2WSQA 4WXYA 1TTQA 3BG3A 4K8HA 1QPNA 3A22A 4TX9A 4LS1A 5DLCA 1XUZA 3B0VC 3KVKA 3TXZA 3TIMA 4HNTA 2ZZ7A 3W3OA 5CPNA 1PVNA 3N3MA 2ZZ3A 5FF0A 3M41A 4TU1A 3NQEA 4RLIA 4QSHA 4HSNA 5LKYA 3CM4A 4P2VA 2GQ8A 3EEGA 2EHHA 1Z48A 2DZWA 2QJGA 3GKAA 4JTEA 1KLYA 4GUJA 1B57A 4QNEA 4FB7A 5HJLA 4R34A 4GUIA 2JKEA 3S5ZA 4DF0A 4MZYA 2E6YA 1B4KA 4H3DA 5C54A 1EEPA 4E0CA 2CZEA 4E2DA 2EAWA 3LHTA 5FF7A 5AFDA 2ZRVA 3TC6A 3GDRA 1RQEA 1Q6QA 1JCLA 3N19B 3TSMA 3VCRA 2ZTJA 3IIVA 1D9EA 4UTTC 3BLFA 4HIBA 1ALDA 1TTIA 3FS2A 4GC4A 3LCIA 2RH9A 3TAOA 5DCDA 4IUOA 4O4WA 1SO4A 3NQAA 4NXKA 3MUXA 5HR6A 1H60A 1ZAIA 3BLEA 1SW7A 5BW6A 3BW4A 3R8RA 1F76A 4GWEA 4TMBA 3W2JA 3LLFA 1G67A 2DORA 3SECA 4UTMA 3TROA 4XKYB 3OA3A 1S3HA 3W2KA 2O7QA 3JS3A 3W7IA 3Q2DA 3QQ0A 3M5ZA 4O0KA 3PBVA 3W7MA 4E2BA 1NVMA 2QJIA 1N7KA 1XBVA 3GNNA 4LVBA 1XBXA 3S1XA 4YL2A 1G7VA 2VFFA 5D32A 3W71A 4JY8A 4RZ5A 1XUUA 3EXTA 4K38A 1VCVA 4XKYA 3W74A 1W3NA 5F2GA 3T78A 1ME8A 1Q6LA 3W7EA 2Y62A 2JKAA 2ZRZA 4IPIA 1YDOA 1SZEA 1PS9A 1F2JA 4JGDA 1GOXA 5F1VA 1SSGA 3PSWA 4JTGA 1EUNA 3P60A 4RXGA 1ME9A 2GJNA 2TPSA 4PEKA 3Q37A 2OX1A 2E1DA 1DJNA 4WOZA 4NXSA 4Q4KA 1ML1A 2Q3RA 1B4EA 5D30A 2WPBA 4WD0A 4WY0A 4AF0B 3O63A 3KOFA 4KFNA 4LS2A 1FCBA 3TX9A 3NQ7A 4GBUA 4ZL1A 2VEIA 4C1KA 5LZLA 3LTPA 1KTBA 3BO9A 4UC5A 2NXGA 2R14A 2V0TA 2DZUA 1FXPA 4EIVA 2Y7EA 2FB3A 4IGHA 1SZNA 4NT0A 2CW6A 3M9YA 5DY2A 3UD6A 4ADTA 1V5XA 1XL9A 5HULA 2NUWA 5BNKA 5D02A 2CU0A 4DPQA 3W70A 1MEIA 3L0KA 4NNCA 1J2WA 3FYOA 2Y63A 2V2CA 1WA3A 3NO5A 4UUIA 1O94A 5HWMA 3RU6A 5A5WA 1YPFA 5CSRA 3HGSA 5FF3A 2ZZ6A 3F03K 1W5MA 1O95A 3TNOA 3H55A 3O16A 1UB3A 3CU2A 4D2JA 1FX6A 4QAIA 3HQ1A 1K02A 1TTJA 4M5PA 1AW2A 1OG0A 3OEXA 5HWJA 2JBMA 3KVJA 1R2SA 3PM6A 1WXJA 1I2PA 3QW3A 1IXOA 3W86A 1DL3A 4B5NA 1ICQA 4JNMA 1G4PA 2JKPA 5FESA 4UFMA 4BI5A 4RV8A 3LM7A 4MY8A 1THFD 3CTLA 4KWWA 3IGXA 4O12A 3EB2A 3W75A 4I7VA 1LRTA 2KZHA 2WKJA 3HG2A 3AJXA 1W3TA 3W2UA 4ALDA 2V30A 2JK2A 2HSAA 4N02A 5D33A 1LTDA 4NX0A 3TCEA 3EX4A 2VFDA 3O6CA 3W83A 3FKKA 4BWLC 1KFJA 4DO6A 3DBPA 1SPQA 4UR7A 1NF0A 3UY7A 2QUUA 5AHEA 3SI9A 3GIYA 1LORA 3LGEA 4ZQOA 3CHVA 3TQKA 4LS0A 3ZFHA 4OGZA 2NX9A 4JX6A 3N2XA 3QW4B 1SO5A 1N8FA 5ABTA 3S9YA 3F1QA 3EWXA 5HMSA 4CQAA 4NVTA 3E0IA 1LP6A 1XM3A 5AHIA 3DKJA 1LRQA 1TPEA 5CPOA 5LGXA 5I3IA 3W1MA 4BK9A 4C1LA 3DXIA 5LNUA 1F5ZA 3S1WA 4WZHA 5LNSA 1VYSX 2DZPA 3HIJA 5CGQA 3NPWA 3C0JA 2JGYA 2Y7DA 4IMEA 4AB4A 1GJPA 3B05A 1HFBA 5AHNA 2CZDA 1OK6A 2ZA2A 3TK7A 3TAKA 3GB6A 4QQ3A 1H1ZA 1OFOA 3KRZA 3LV6A 4M7TA 3WJSA 1DVJA 5EL1A 1YYAA 3UWUA 3LX9A 3UY8A 1DOSA 1TV7A 1H7WA 1O5XA 4FF7A 3CEPA 1LOQA 4GJ1A 2RDUA 2V2DA 4NUWA 1GG0A 2YYTA 4CLMA 3W1UA 3MP5A 1H50A 2I9EA 1SUXA 4H4IA 1ZAJA 3S8HA 3M1ZA 5HQEA 4CNPA 1H7PA 1VCFA 4Z0SA 3O05A 2X1UA 3WK1A 2E09A 2GQAA 3PC0A 4FNRA 4ADUA 1TMHA 3GKFA 4MY9A 2J9YA 2V82A 3C6CA 3U6WA 5G1YA 1TB3A 1IXQA 3V75A 3L9CA 3N73A 3TQ0A 2Y89A 4NJKA 2Z6IA 1NSJA 3TUUA 4PA8A 2A21A 2YPIA 3U2OA 1VYPX 3G0UA 1B9BA 4JTTA 3SJ3A 3L5AA 2GVLA 3L68A 1SO6A 1CI1A 1ZENA 1SU5A 4XZ9A 1W31A 3W7NA 3W1XA 1EB3A 4JN6A 3KRUA 4UTLA 1XDMA 1S5WA 4UFHA 4K36A 1N55A 4O54A 3BGJA 4K37A 4O18A 2A7NA 2A5HA 1YXCA 1DQXA 2C15A 4JXCA 4OT7A 3GZ3A 3W1LA 4X22A 1UUMA 3FJLA 3R5EA 5D2TA 1OJXA 2OT0A 5DELA 1A5SA 3PB2A 2X1SA 3W1NA 1JRBA 4OQVA 2X16A 3I68A 3G18A 3T4CA 1VGAA 2Q3OA 1TPH1 3WFAA 3W22A 4MVAA 4FNUA 2QEZA 1GWJA 1H51A 4AEOA 3TV8A 3NA8A 1EUAA 1LZOA 3LXCA 1JULA 2G97A 2LLEA 1VYRA 4UTWA 2W0UA 5AHMA 3C3NA 3W72A 3HG4A 3WK0A 3NDOA 1D3GA 3TC7A 1QMLA 1AW5A 3P82A 1FWNA 1FWTA 2VFGA 2ZDRA 1XFBA 3I65A 3LXAA 3PUEA 2C13A 4CCEA 1I2RA 5F4XA 1BEUA 2BZNA 4M19A 2G96A 3UYCA 3W2NA 5CPLA 3HPSA 4O15A 4O28A 5F4WA 3ZR4A 2DJXA 5IBXC 5KITA 2XFWA 4MZ1A 4MY1A 3LBMA 4DBDA 2Z6JA 3PSVA 1M5WA 3F4WA 3W7OA 4L4LA 3NR0A 3QH2A 5HR7A 4LW7A 1WYIA 2VELA 1FDJA 1GYNA 1P0NA 1VLWA 1FCQA 1TJPA 3GX9A 3M0ZA 1F74A 2Z2UA 3W1AA 3CC1A 3LCWA 1TTPA 1YTEA 2WQPA 3TQVA 4M6PA 3TFXA 1LBLA 4ZMGA 1D3HA 5G2HA 3QMTA 2EGZA 2FPVA 4MFDA 4X2RA 2WNNA 4PFMA 1NAL1 2PRMA 4PL1A 4TR9A 1J5TA 3EWUA 3G1FA 4Q33A 1FDZA 4I7WA 2GPTA 3LLDA 1TQXA 3B06A 3QEZA 3HF3A 3QPYA 3W07A 1XCFA 5D03A 3BG9A 5F1UA 1EWEA 2W6RA 3TXVA 4O19A 5D04C 1GPWA 3Q58A 1OK4A 3B4UA 1TPUA 3SIZA 1ZAHA 3BGGA 4A2SA 1QPQA 4IOTA 4KKXA 3NYZA 5TBOA 3ATZA 4U4MA 5DXYA 2VFIA 3KX6A 3EKZA 5L6UA 3YPIA 2A4AA 4JY9A 2OT1A 2CLHA 1P1XA 2E6AA 3L5MA 2BX7A 5LHEA 2H6RA 3F4NA 2G5WA 4O1DA 5I3KA 1TCDA 4YMZA 1W5NA 3GNDA 2GVGA 1LBMA 3PUOA 3P5ZA 2BWGA 5CKSA 4HSOA 1H5YA 4LRTA 3OIXA 3A9IA 1OF8A 1TIMA 2CLEA 3OHIA 4PC8A 4HNVA 5LGZA 3MHGA 4NNBA 2B7OA 4UFIA 2J9ZA 4LOCA 4WQ6A 1PHWA 1RPXA 1K03A 2E77A 5E93A 4A22A 2EKCA 4LU0A 2ZRYA 3LBCA 4KWVA 4OV9A 2OZ0A 3WK3A 1KLZA 4O50A 3TMLA 1YDNA 1KFBA 3PY2A 4OHQA 5K7JA 1GVOA 4NZFA 2OMAA 1LRNA 2C0AA 4Z0JA 1VR6A 3QYQA 1SW0A 3L5LA 3P84A 3RMJA 2RDWA 1FY6A 3JRKA 1C29A 2ZQ0A 3B03A 1JJKA 3LCGA 4HPJA 3W2MA 4UFJA 3WJXA 3RF9A 3BW3A 3C2EA 4R7JA 3LHUA 1VPXA 4WXZA 1FXQA 1MEHA 2QKFA 5GVJA 4O17A 2PCQA 2F84A 3BV4A 1EPXA 2G95A 3PB0A 3LOTA 3MJYA 4JD4A 5FEZA 5I3GA 3EXSA 3W88A 4JTIA 4AWSA 2A0NA 3P7YA 3ELFA 2A7RA 4AHPA 1FWWA 4NJGA 4AWUA 2VOMA 3VE7A 1H7OA 4K7VA 4YXGA 3DFNA 3W85A 3BARA 2DZXA 1GEQA 3RLVA 4EOUA 5KZDA 1C8VA 1Y0EA 2QCCA 3TMQA 3EWZA 3W7GA 4IXHA 1K3UA 2H90A 5G2IA 3IEBA 3UQNA 2ZTKA 4FNTA 4JX5A 1PL9A 2V5LA 1SZFA 2QCDB 2QCMA 4N2YA 4JDBA 3I7SA 1U83A 1KBIA 3MO7A 3CWNA 7TIMA 1LOLA 3UNDA 2VC6A 2ZCGA 1JQXA 1TO3A 3UZJA 3HG3A 4MUZA 3DU0A 3IGUA 4ML9A 2B7NA 1I4NA 3NM3A 1HTIA 4A2RA 1K8XA 2VXNA 3EKLA 1YADA 5CSSA 2YX0A 1LLWA 4DQWA 1LCOA 3A21A 1KM6A 3C2FA 3T40A 2YSWA 1F6PA 1WQ5A 2CZ5A 4WY0B 4WY0F 5DBTA 3O6YX 4UTIA 1MSSA 4YWIA 2Y88A 2YFNA 4JTHA 1EP3A 2BSLA 4NQ1A 3QC3A 3PBUA 3CIXA 3Q94A 1RV8A 3L0GA 1KM2A 3KRSA 1GZGA 3O06A 2C19A 1FWSA 1H7RA 5D09A 1K7XA 3RNDA 1TRDA 3THQA 3VE9A 4P61A 3LRMA 2XN1A 1DORA 4ORIA 1G4TA 2C14A 2WOQA 4IMGA 3FYPA 1WV2A 3W1QA 1DBTA 3E96A 1EP1A 3C8FA 1QNVA 1SQ7A 2UV8G 3MHFA 5DY3A
chains in the Genus database with same CATH superfamily
3HURA 4NAFB 1JPIA 1NWSA 1JGIA 3SB0A 4QJ4B 1OYBA 1XLKA 5F2LA 4HOXA 5I3DA 2I5GA 3UG4A 2WHKA 2J7CA 3O8AA 2VHLA 3SCUA 5K4ZA 4Q8QA 1B1YA 3AZRA 2XU2A 4JTSA 3URAA 3IV3A 3L4WA 1VBHA 4L9ZA 4P8XA 2OYLA 1HUVA 3KS5A 2PDKA 3VD9A 3QOMA 1ZTVA 3I6RA 1L6FA 2OGYA 4KFPA 3G1XA 4C7DA 5JVLA 4Q8VA 1E0WA 5CAKA 4AWTA 4PCFA 1Y65A 5G1MA 1FWJC 3UWWA 2IXUA 2DT0A 4D1JA 2ISWA 3W38A 1ZBVA 2FLIA 2ACUA 4WOQA 2YDSA 3E6EA 3WF1A 5U4NA 4OBTA 4H9YA 2P0IA 3P5YA 2JEQA 3URNA 3E2VA 1EJVC 1TPWA 3WLNA 2PTDA 1XBYA 2QUTA 1OFEA 1XGZA 4AZCA 1V0NA 2PCEA 4S3BA 4IPLA 1T6MA 3M0KA 1EYEA 4ZQMA 3BAXA 3ZT5A 3FSTA 3L0NA 2DJLA 3ZLHA 3NQ2A 2FQIA 3VGDA 4Y9OA 5TNVA 2OODA 4P7NA 4M6UA 4IGSA 2VR2A 3W6YA 4G7EA 1ONEA 2W79A 1NOWA 1T96A 2Z0IA 4GUGA 3FJ6A 1F4HA 1XI3A 1Z6KA 4U31A 2H3DA 3SGZA 2ACRA 2BGSA 1ZS2A 3STFA 5EFDA 3FN9A 3STGA 2BLEA 4EPEC 1J18A 3WJZA 3MYPA 2DZTA 1X39A 1E1CB 3T1GA 1NTHA 4MJMA 3KBMA 1MQQA 3NSMA 2YW3A 3WZ0E 2ZX8A 5DQPA 4R33A 3FV9A 1OZQA 1W9XA 3GDKA 4D6CA 3BMXA 3MU7A 1R2TA 1AW1A 4MYXA 1J12A 2VMFA 1G6CA 3OVRA 4M0XA 4DWDA 4IH3A 3BG5A 4KRTA 4FXRA 3R8GA 1KO0A 2H9AA 1UPPA 3MSRA 1GVSA 2GUUA 2DSZA 1LUCA 1QASA 1VD6A 2DVXA 3D0CA 4NSBA 4S38A 4GUHA 1YLVA 5AVHA 2PZ0A 3AOFA 2IKHA 3RHGA 3AMCA 5A69A 2ZZ1A 3LI1A 2XWEA 4GQ0A 3BURA 3RM4A 4JTLA 3CQHA 2Z27A 3UESA 4N0RA 3WQ8A 1I1WA 3HTWA 3UERA 5A6BA 4XZBA 1R3TA 5ECVA 3GDTA 4RXFA 4GMEA 3WLPA 1OABA 1RBLA 5H2ZA 4FR6A 5FI8A 3N9SA 3W0KA 4EANA 2TRSA 1WB0A 2E28A 3MWCA 3AYSA 1IGSA 3WN6A 1IEQA 2AAMA 3R0KA 1NDZA 3EMQA 4C1NA 4AHOA 3HGRA 4XG1A 2I1OA 1GG1A 3NG3A 3N2CA 3IVUA 3URBA 3NWRA 1QO5A 4TUFA 1TV8A 1R47A 3BMWA 5KZ6A 4UIOA 4LUSA 4LYKA 2PWHA 5H6HA 1J8VA 2DZSA 2HROA 3ITLA 1YTDA 2PWUA 3SCSA 1W8SA 3OVQA 1JCXA 2G41A 1AD4A 3APYA 1DTUA 4AZBA 1EA0A 3PWAA 1M53A 3VDBA 3REQB 1WCGA 3T7VA 3WBYA 4PBGA 1V0LA 5BMWA 4Z1DA 1WDWA 3Q45A 4XAYA 1OFPA 2YL9A 1N2VA 1TZZA 1NDWA 1ADSA 1DIKA 3GNPA 3L67A 1XBZA 4GUFA 5KTLA 3BWWA 2NZLA 1JNDA 3STEA 2ZICA 2JEPA 4V1XA 4PL2A 2G37A 4LBSA 1EP2A 3FIGA 2ZRUA 4C6NA 2R1PA 5CC3A 3B8IA 1E0VA 1KGXA 3T0AA 3F2BA 2HS6A 4QR6A 2D24A 1Q6RA 1UMYA 1L8NA 4DB7A 1FP8A 4LVGA 8XIMA 1BGAA 1MFUA 4HU0A 1ICPA 3RUBL 1C93A 1GOKA 3PBGA 1U5VA 5CZSA 1E51A 5E0KA 2BXVA 1W91A 3OG3A 3MMUA 3QV6A 3HPZA 4WX2A 1UR1A 3H2MA 1OFBA 2PLKA 3HBLA 1MXGA 1GVFA 3AJ7A 3C4UA 1L6WA 1MQPA 4ZQRA 3UG5A 1BVZA 3PPCA 2WYSA 5HUOA 4C5ZA 1PTDA 3PUGA 4HZMA 5AKQA 3LERA 1J0HA 4JICA 5JQ9A 2YKKA 2ZX9A 1T7LA 1JI2A 1ZCOA 1LL6A 2OKOA 3A47A 4V2XA 4OBRA 1GKRA 4YHEA 3WJWA 4XQ6A 2BNJA 2PZNA 3A12A 3PBWA 1EIXA 4LVFA 4IX0A 3IIXA 3RR4A 2AQOA 3BLIA 3NGJA 2VD9A 3GIPA 1AMKA 3D46A 4Q8NA 1YBQA 3R10A 5CJ5A 4UTTA 3N3TA 4UFLA 2NV2A 4P7RA 4GX8A 2WCSA 3L4TA 1WBJA 4Z1CA 3A24A 2VD8A 4JTFA 2WO5A 2IPJA 1PKNA 2GSHA 4KFOA 4J1OA 4RNHA 3S46A 4CQ9A 1SFLA 1MXDA 4CD5A 3FVDA 1MXSA 3MTWA 1V7YA 2XN0A 4DWSA 3OVPA 1D8CA 1EJ7L 3UA3A 2WB5A 4JS3A 3CL8A 4Y96A 3VOJA 5J04A 3EEZA 3EDKA 2ALRA 3R43A 2V9DA 1EBHA 3HPFA 5BRQA 5CSYA 4HN4A 4IZGA 1W1TA 3TDFA 4HVXA 5JBDA 3GAYA 1WAUA 2E6FA 2A6NA 1XC4A 5RUBA 3COTA 3KOXA 3TSBA 3NQVA 3STCA 1CLVA 2HBXA 1TWDA 2XIBA 3FEMA 1KCZA 1F6YA 4DN1A 4AXNA 3EYPA 4OTKA 3W7KA 4F79A 1QWGA 1QPOA 4NF7A 1Q65A 2NVCA 4PE8A 4GHRA 2VOTA 4CCCA 4WKAA 1P0BA 5A6KA 3PVFA 1M9HA 2V69A 1T99A 4HGXA 1AH0A 4ADSA 3ARRA 4M82A 4Y6GA 1CW2A 1KC7A 2BVDA 5DBUA 3C0SA 1PIFA 3PJUA 3J7HA 3HGOA 3UPBA 4DXXA 3II1A 3KFTA 3LK6A 4QNWA 3OZPA 3EZ4A 4LVDA 1QUMA 4F0KA 2BDQA 4GIYA 1RCQA 3KHDA 2P76A 4F2UA 2B7QA 3MI2A 3QF0A 4LC8A 2QW5A 2BODX 2PTWA 1W0MA 4Q32A 4G9PA 3FA3A 2YIHA 5G4EA 2AAAA 9XIMA 2OOFA 4QDMA 4LYPA 3M5VA 1XC6A 3UR7A 5DRIA 1KQZA 1SSDA 2EPLX 2NQJA 1JR1A 1TPC1 4I5UA 4TVCA 1E6QM 1AK5A 2OSXA 2HCVA 2J13A 5DCBA 1QOQA 3WQ6A 5AYZA 1KM1A 4BWLA 2PWDA 3QR1A 3MV11 1GJWA 3K30A 5FF2A 6A3HA 4DELA 2GL5A 2J88A 1FCVA 3PULA 1W5QA 3WD4A 2FJUB 3MQTA 5D8WA 1AL7A 3WDQA 2ZX5A 4U3AA 4B5TA 3UT0A 4I5XA 4GD0A 3TE9A 4W86A 1OT2A 5LYRA 2RDTA 3BOXA 4US5A 4IJRA 3DI0A 4MUPA 3GAKA 3CV2A 2YZ5A 3VXGA 3B8TA 1CECA 1G94A 1PUDA 2OVLA 1HT6A 2E5CA 4F40A 4PMNA 2RJGA 4MJ4A 3SCNA 5J5RA 5K9CA 1M7JA 4MJZA 4AVOA 4M1BA 5LHFA 2VT0A 1IE7C 2Z1BA 2QUVA 5C55A 1D7KA 4JTCA 4QSFA 3CPRA 3E74A 4GFSA 2DIJA 4IQDA 2QDEA 5CPMA 1P43A 1KRBC 5HNUA 4XD4A 3R25A 3QQ1A 5G4HC 1OX4B 3WLMA 3WLLA 4W7VA 4X9SA 4UMCA 2NV1A 3P74A 3QR0A 3QPZA 2J25A 4LF1A 1PB0A 3LY0A 5LXEA 3E02A 3DI1A 3SQMA 2H9AB 1H1YA 2ZA1A 4PRRA 2WBGA 3AZSA 4JHOA 5AHFA 3W26A 3BZJA 3CHDA 2XJ7A 1VZWA 2D1ZA 1KGWA 2WMJA 5AHLA 1GT8A 3OZYA 2CLLA 3AROA 2VDHA 1L9WA 2QCLA 1SYTA 4Z1AA 4LAUA 1YDYA 1VJIA 4IQEA 2G50A 3WDJA 3AAMA 1UW9A 3JU2A 3CBWA 3TW7A 4ORMA 4ZENA 4CNNA 5EBUA 3BAJA 4M24A 1NQ6A 4ECLA 4J3UA 4HU8A 4HJWA 4LX4A 2ZZ5A 2ZUUA 3UXDA 5BOOA 2XZ7A 1F7BA 5HINA 3VA8A 3EPNA 2F2HA 1CX9A 1S5TA 1R6WA 1A50A 2E0PA 5DMNA 1D7FA 1FQ0A 3MHUA 1W1YA 1PO9A 3I3DA 4XUGA 1GQIA 4Y7EA 2W61A 1NFGA 1SJBA 3VGHA 3GC5A 1XP3A 2FKPA 5PTDA 4WSHA 1I2OA 2NLIA 4ASTA 1LQ2A 4WR3A 1QATA 4C60A 3ZR5A 1BYDA 2VDIA 1TREA 2VX7A 3G1AA 3REQA 1P4CA 2CLIA 1F05A 4DAIA 1BRLA 4U3CA 1H4PA 4D8ZA 4LB3A 3AXXA 2ZIDA 3MWAA 3QTPA 2INFA 3VZZA 3PK7A 3M16A 3B8SA 1P0KA 4LUJA 3LCXA 4JTKA 3NEVA 5FF4A 2HNHA 3G3DA 1PHQA 3PP7A 4G2DA 4QJ1A 3U2CA 1AD1A 1KXHA 4FNPA 4A29A 2P10A 4GVHA 2X8RA 3GW3A 1LLZA 3CV1A 3U2ZA 2NT1A 4OUIA 2PRHA 3CT7A 3WNNA 3GZAA 1LL4A 2VGFA 1CPUA 4LV9A 1HJVA 2NVAA 1J4EA 4XAFA 3SCTA 1UBSA 3FFSA 3I4EA 3MUCA 5AC6A 5D37A 3E38A 5D8ZA 2BOGX 2CLFA 4X63A 1NFBA 4CD4A 4JFWA 2P1FA 1KFKA 3R2GA 4AVFA 2FPYA 4FLQA 4M80A 1FWBC 4GG9A 4ZOEA 1S2WA 2Y2WA 3OBEA 2ZA3A 4O4VA 1XIBA 1K8CA 4I3GA 2Q8ZA 1EIBA 8CGTA 3SCPA 3L65A 3MB9A 4JN8A 3MMTA 2Y6ZA 1E70M 4WK9A 4A3QA 3VCNA 1I1XA 1XKYA 2QDHA 2PS2A 5C9WA 1UKPA 4UNKA 3VD7A 5FA5A 3W7PA 1H62A 1W3KA 3IGHX 5A8PA 1BQCA 3TN5A 3JR2A 2BY1A 3W7CA 2BFGA 1U5JA 4KEZA 1PYFA 1W37A 3CHCA 3EOSA 3MC5A 1X7FA 3MSYA 5CG7A 5DO8A 2RHGA 2PWEA 4O0ZA 3A4WA 4EACA 2J8GA 4Q6XA 3GE7A 3M0IA 3RLUA 3F4CA 1V6XA 4NKCA 3ZSSA 3RJYA 2W4XA 2UZ9A 3GVQA 1UYQA 3RX4A 2H3BA 2PDCA 3SCRA 3GXPA 4H2HA 5IHSA 3POCA 2IUZA 4EWND 1XLLA 4J3ZA 3E12A 3ZVHA 2YL6A 3T05A 3L2MA 3IJ9A 2GJRA 4Y90A 1QCWA 1UBPC 2WSQA 1TTQA 4K8HA 1QPNA 1NELA 2J6VA 1S5MA 1XUZA 3AYVA 5AECA 4HNTA 2EKGA 5FF0A 5T8GA 3NQEA 5LKYA 5E0CA 3CM4A 3GM8A 4P2VA 1RY0A 2Z1VA 2PDMA 3WO8A 2EHHA 3DOPA 3NVDA 2QJGA 5BXSA 4JTEA 4F2TA 4ZO6A 3AC0A 2WVVB 3LENA 3RM8A 1QI0A 1CXHA 3TLQA 3KLLA 3MA8A 4E2DA 1XSIA 1RQEA 1V3MA 3TA9A 3VCRA 4GBDA 2ZTJA 4HMDA 3FS2A 3V35A 4PUUA 1TWSA 2RH9A 3TAOA 3EOUA 4O4WA 2PSNA 1ONWA 3BAIA 4BA0A 1JPHA 1H60A 2DSKA 3BLEA 4FS9A 2GVYA 3R8RA 1F76A 4BKNA 1E0TA 1G0CA 2IS7A 4C6OA 3W2JA 4ZODA 4CGTA 3LLFA 4XKMA 4P7LA 1MZRA 4XKYB 4F48A 2PDBA 3OA3A 3W2KA 4JEJA 4OUEA 3Q2DA 4S3EA 3SRFA 1E9YB 1K9EA 1XX1A 3NO3A 4E2BA 1NVMA 1XBVA 1VPYA 2Z1WA 4RZ5A 1XUUA 4F0MA 3LSBA 5BZAA 4XKYA 3T78A 4C1NB 1TVLA 4GC3A 1Q6LA 3W7EA 2JKAA 2CKSA 2YBVA 2OO6A 2ZRZA 1XFCA 4YHGA 3WQEA 1YDOA 1Q7QA 5BYWA 5F1VA 1SSGA 3LD5A 2YLAA 5CLWA 3PSWA 4AX7A 4RXGA 4WHBA 5D9NA 4PEKA 5JBFA 1FKXA 5EMMA 4WOZA 4Q4KA 1AQMA 5D30A 3VOHA 4KFNA 4LS2A 1K4GA 3F7JA 2XVNA 4F0HA 5LZLA 1IWAA 2OOGA 4UC5A 1UD6A 4H83A 5LXXA 2Y5JA 2NW0A 1FXPA 3QV7A 3Q67A 4IGHA 3UYIA 3HA1A 3M9YA 3OLDA 3W00A 3GG1A 1W9BM 5H1WA 2VEGA 1M03A 4AD2A 5CC6A 2CU0A 1QW9A 2HISA 1MEIA 1QTWA 2E40A 2XSAA 4BEUA 1Q85A 4NNCA 3WQFA 1ELSA 3FYOA 2WHLA 1MWOA 4AC7C 4C6MA 4UUIA 3AFBA 5A5WA 1YHTA 1YPFA 3SEPA 4KS0A 4AY7A 5A8QA 3F03K 1O95A 2E9BA 4H6EA 4DZHA 4ZO9A 1UB3A 4D2JA 2WHJA 2CHNA 1TTJA 4C6CA 2JBMA 1R2SA 4HHMA 3QW3A 4IP7A 1DL3A 1ICQA 4A4AA 4BQ2A 2W67A 1XGDA 2R1MA 5FESA 1VB9A 3G1RA 3SRHA 1J6OA 3WBWA 5A6LA 1THFD 4GI9A 4KWWA 4AQLA 3S47A 2J7DA 1TKKA 2P8BA 4I7VA 1UR8A 1LRTA 3IK2A 4PMRA 3AJXA 4FP1A 3W2UA 4ALDA 4CU7A 5I79A 2HSAA 4N02A 2ZWYA 1B2YA 5D33A 1LTDA 4NX0A 1DJXA 3EX4A 4IIFA 1CGUA 4BWLC 1R0MA 5AVNA 3PTKA 5TAOA 1OBAA 4ZSUA 5AHEA 3SRKA 2OX4A 3QY8A 3CHVA 2YLLA 1L6GA 2I5IA 4OGZA 2W9MA 1ITUA 1N8FA 3OYXA 3GRIA 5CPQA 1W1PA 1TPEA 3H24A 5LA0A 4S3JA 4PMQA 3DXIA 4BCEA 4A05A 4ZOAA 3H6OA 4WZHA 5CGQA 3GNRA 4IMEA 3RJXA 3B05A 4GNKB 4NAEA 3EMZA 1HJSA 1OK6A 1JPKA 2ZA2A 3TAKA 3GB6A 4Y9PA 3KRZA 4M7TA 2PDHA 3LV6A 2QPUA 3ZLGA 3EDEA 2VZOA 1MUMA 3UWUA 3VDAA 3KZSA 1TV7A 3FEQA 4YTUA 5D9MA 2OLSA 1LOQA 4GJ1A 2QGHA 3IACA 4CLMA 1E0XA 2I9EA 1SUXA 1ZAJA 4C65A 5HQEA 4S3GA 4CNPA 3B8VA 2X1UA 4UB9A 3WK1A 3CUXA 2E09A 1UD4A 3PC0A 1IYXA 4FPSA 4DBSA 1TB3A 3V36A 3V75A 5FL1A 1X7IA 4Q3MA 3TQ0A 2Y89A 2O9PA 1DEDA 7PTDA 2VC7A 1B9BA 1BRLB 3L5AA 2CHOA 3L68A 1NOFA 4LGXA 1J0ZA 3LPGA 2E67A 1EPVA 1HJXA 4JOMA 4QDPA 2PGRA 3V5CA 1V0KA 3WNOA 4J3TA 5BOEA 1TE1A 1AQ0A 2RDXA 1XV8A 2CC0A 3BGJA 4O18A 3VYLA 3WLRA 1YXCA 1CENA 2C15A 2DH2A 1QNRA 4A3RA 1F8MA 5I24A 3EA2A 3RX3A 4PMVA 1M65A 4Q8TA 4RNIA 1NWUA 1JRBA 3T4CA 5FAJA 1EEXA 3WFAA 2XDFA 1GWJA 3NA8A 1EUAA 4YYFA 4OJYA 2NQHA 4MNJA 3LXCA 1JULA 3RO8A 4WDWA 4UTWA 1MDRA 1J93A 3K4DA 4MDOA 1HNYA 1R3QA 1HIZA 1UWQA 4GZJA 1ZJHA 3WK0A 4INFA 1D3GA 5ABFB 1HVQA 3F4DA 1RAKA 4W7WA 1R9ZA 1FWNA 1FWTA 4HSHA 4QP0A 1DP0A 4JNZA 3VZXA 1XFBA 3M0LA 3FHQA 3LXAA 3UVAA 2DGAA 3PUEA 4WVXA 1UD8A 4E4UA 1BEUA 1GVIA 1WPCA 4YS1A 2UY4A 1K4HA 2G96A 3FY1A 1X8CA 1ZSXA 3W2NA 4F0RA 4O15A 5IBXC 2DJXA 5KITA 5REQA 4MY1A 3RLGA 1VFHA 3IAPA 3RPDA 3ONCA 2OQYA 3PSVA 2WM0A 2XG9A 1GYNA 1TJPA 2PGEA 4DLMA 1JGMA 2RUSA 3O6AA 4ZB2A 2GSEA 3TQVA 2P5NA 3PNZA 1LBLA 1D3HA 1EDTA 1MUCA 3WEZA 3QMTA 2FPVA 4MFDA 1NAL1 5DEZA 4QE4A 4HJFA 1PWMA 4PL1A 4Q33A 2D22A 1VEOA 5A6BD 5JH1A 3RRAA 3V18A 1RA5A 1JYXA 1EKOA 4O19A 3Q58A 1E0UA 3KEHA 1Q8AA 3K13A 3TZNA 1TPUA 4W88A 3UGRA 1ZAHA 3BGGA 1DXIA 3AMDA 4KMQA 4KKXA 3WELA 5DXYA 3IPWA 4ILSA 3KX6A 4ZXOA 1AQFA 2A4AA 2FMOA 1P1XA 2BX7A 5LHEA 3OB8A 1V3JA 3HV9A 1Q4NX 1RJPA 2VX4A 3N04A 4HA3A 4H7CA 2PBOA 3UBPC 3VM7A 1H41A 1T8QA 4KCTA 3P5ZA 1H5YA 4LRTA 3K8MA 3OIXA 1OF8A 3OHIA 1UKSA 2W62A 2QVHA 3MHGA 2QIIA 4NNBA 5HAOA 1O5RA 3L4XA 2E77A 2DW6A 4PUJA 4A22A 3V0UA 3QY7A 3CHEA 4OV9A 1V51A 1XF0A 3C5QA 2OEJA 5BWFA 1KFBA 5K7JA 4JKKA 2AL1A 2D2JA 1I0BA 4NZFA 1S39A 3FJ4A 4AZHA 3GFYA 2RDWA 4JAWA 5DANA 2ZQ0A 4Y9NA 2CLPA 4HPJA 4IUGA 1VPXA 3PWIA 4O17A 2PCQA 3SY8A 5FJTA 3VZYA 1EPXA 3ORWA 3MJYA 3SUSA 2QV4A 3KBVA 1XIFA 3N9KA 2VWTA 2VRQA 2DT2A 4AHPA 1DIEA 3AHZA 1JZ3A 3MDUA 3DHPA 1AJ2A 1H7OA 1EJSC 3T42A 1XIGA 2XISA 3DFNA 1XISA 1C8VA 3QY6A 4KETA 1WKEA 4D9PA 1OGBA 3KUMA 3OJGA 1K3UA 3OU8A 5G2IA 4QDWA 3G77A 1DJHA 1WXYA 5M5DA 2V5LA 2PLCA 2QF8A 2HPMA 2VCAA 1J11A 3DYOA 3FX4A 1KBIA 3MO7A 7TIMA 4XD5A 1BYBA 3BAKA 1TO3A 4W8AA 2D0HA 4NP7A 1G01A 4MUZA 3AUOA 2FHBA 3NM3A 1HTIA 4A2RA 1K8XA 2CBUA 1YADA 1V03A 4FLRA 3ZJKA 4UOJA 2G8ZA 3T40A 1XD0A 2YSWA 1QNSA 1WQ5A 4ICMA 2IQDA 1ZL1A 4TXEA 2TAAA 1UWRA 1EP3A 2VRKA 4C6PA 3GXMA 3TONA 3H2NA 3KZPA 5C7HA 3KRSA 4E4FA 1FWSA 3GXDA 2ZUNA 2POZA 4MB1A 3OHMB 1MRQA 1LF1A 1XH0A 4W93A 4ORIA 1G4TA 3VGBA 4NILA 1YPXA 2VVSA 4DWSC 3C8NA 1X97A 1VFFA 4OU1A 2UV8G 3MHFA 5DY3A 1W1A1 1LYXA 2X1TA 3L2IA 1GHSA 2WCGA 2ZADA 3B9OA 3E49A 4HA1A 4PBFA 1A80A 3GG8A 4AC1X 7REQB 3LCHA 3O6DA 1H5VA 2F7FA 4HKPA 4RZBA 3A3HA 3K46A 5ABGA 3ITGA 2OSWA 1E4NA 2R94A 1JDFA 3IIOA 1DJQA 3ABOA 3ZQ9A 3MBDA 1JQVA 3KCOA 4REQA 3BZGA 3TSDA 1A5CA 5LSMA 3UCCA 3QC0A 4B9ZA 4BF7A 1M41A 3TOPA 3APTA 1BF6A 3WQCA 5DCEA 4DZ5A 1ECEA 5M17A 4KF1A 4DZAA 4JTJA 2VC9A 3PG9A 3E2QA 4E3TA 1BKSA 4M29A 4F4RA 2D3LA 2QCEA 4Q7IA 3CPGA 2IQTA 3ZWSA 2G3JA 3U48A 3FDKA 2C1HA 1L6SA 3KL3A 2C6QA 3BL3A 2PP0A 4CU8A 2C91A 4QE5A 4MPKA 5CG0A 4EAYA 2E9MA 5BU9A 2XM2A 1J0JA 1M7OA 5CBBA 1KFLA 5LA2A 1EGVA 3N6QA 3ITTA 3ZXWA 3W4RA 3NJ3A 4GH3A 2C1GA 2A3HA 3TC3A 3GG0A 1HXJA 1W1ZA 2FYMA 2A1YA 3USZA 2WC3A 3S2JA 4H2CA 2B7PA 2NUXA 4WLCA 2EPMX 2FB2A 3VIKA 5BRBA 2YB1A 1R9XA 4K1WA 4RK8A 4A8IA 1GQNA 2B81A 2POTA 3N9RA 1TX0A 1PTAA 3XINA 3CIWA 4XUYA 2A85A 2G3FA 1XIIA 1NM9A 2HVOA 3P81A 4MOZA 2OWCA 1H11A 4QEEA 3CT2A 3GU2A 4H9VA 3VTRA 2QHAA 3QBUA 3RGTA 3R89A 3RRXA 4HNOA 2CNCA 3L7RA 4FF5A 1P7TA 4MWAB 4ACZB 1R30A 3AHXA 4O14A 4UTUA 3QJAA 8RUCA 4GZEA 3KP0A 1CGTA 4EAMA 3UGVA 1EC9A 1SMDA 1BVNP 2VJXA 3NURA 1O5KA 2WZTA 2HK1A 4KERA 1XS2A 2ATSA 1S1RA 9CGTA 2ICSA 1E6SM 3MCNA 4FEZA 4ACZA 1JZ2A 2AQWA 1EZWA 3ES8A 3FHAA 5KETA 1SFJA 3KCLA 1Z3NA 2Z28A 3KXQA 3SURA 1V8EA 2YCKX 3GDLA 1XLBA 3MBFA 4GNJA 4PR4A 1TE6A 5FOOA 1PDZA 4L4MA 3S5OA 5DN1A 3IJLA 1KV8A 3EX3A 3TCSA 3TYZA 5HMDA 5FSEC 4L6HA 4AMAA 1FCUA 4MM1A 1L2UA 1BTMA 3B9DA 2PFHA 2R1NA 4KESA 3DFHA 1VFTA 1BG9A 1XPGA 4CNSA 3W7JA 3CZGA 1KXVA 1V3KA 3GLCA 3THCA 3WDPP 1O7AA 2JF6A 1OYAA 5BXRA 3EAUA 1EOMA 5AC8A 4ZO7A 2I17A 3PZNA 5H8UA 3I6EA 3MY9A 1TJRA 4QIUA 1HKIA 3O7UA 2QT3A 2Y8VA 2YXOA 4DYJA 3BANA 3RLHA 4L56A 4ZB0A 3WFLA 3LMYA 4FX6M 4GK8A 1S2UA 3LNPA 2ISSA 2PDIA 3POHA 5AYBA 3LRLA 3CMFA 4PGLA 3BAYA 3IARA 4L5ZA 1TR9A 1B90A 4H6QA 2PTZA 2BGNE 3H4WA 3USBA 3NCOA 3EWDA 3TNBA 3MCMA 3ZS4A 3W2LA 4M6VA 3H22A 3W6MA 4LUIA 2OG9A 2Y5SA 4HT3A 3V4BA 3FOKA 4LF2A 3KBNA 4FR1A 3UU0A 3V3WA 3M5XA 3CAVA 5DRCA 3ZWTA 2W27A 4MTVA 3JUGA 3VIOA 4OIFA 1E4LA 4RX0A 4C6EA 3DBNA 4DUVA 4NYYA 3ALFA 3MZ2A 4YVXA 1E73M 4O10A 4XTDA 4FZIA 1IZCA 1Z41A 3C0LA 3M47A 4UR8A 3AICA 4WUIA 3VDHA 4S2CA 4UTWC 3MW7A 2ZOXA 1VQTA 4XV0A 4CN6A 5E9XA 4NX5A 4XBSA 3BSHA 3SBFA 4IMCA 1Z9AA 1BTCA 4HK6A 4N9EA 3V0SA 4N4PA 3UWEA 1QOPA 4IWWA 1Q45A 3CV7A 4QJ3B 3AMKA 5T9CE 3D6NA 2GGJA 2RGMA 3WD2A 3DZ1A 4PMOA 4PMZA 4LV4A 1Q6GA 1MW3A 3N6HA 1JZ5A 5J5DA 1WOBA 4WSJA 3PTQA 1PWLA 2W3ZA 3EMCA 1FBAA 3C61A 1JCTA 2A7PA 3NZRA 2QCNA 2CEQA 2VTFA 3U5YA 3UJEA 3CQ0A 7CGTA 1K77A 3S2NA 4HNNA 2D3NA 3WUFA 1G4SA 4Q4OA 1DTNA 4NJHA 1W9PA 4RPQA 2PDPA 1TPB1 1M68A 2FFCA 4QS5A 4NRRA 3MUY1 1XH2A 3G2GA 1QW8A 1FWCC 3H23A 1SZGA 1C91A 3UPWA 1KWGA 1KM5A 1YE4A 1DWJM 1Q3NA 1GTHA 5HNRA 1VBRA 1US0A 4NJJA 3CUGA 2WNQA 3AYTA 2CIPA 3ERPA 2ZRXA 3QR3A 5GNXA 3WLOA 1W5PA 1XINA 2ZRWA 5LNRA 3RILA 3WD3A 1LWHA 2WV8A 1EO7A 2INZA 4RDVA 2VVNA 4AZ5A 1HO4A 3SDOA 5AC5A 2VUYA 2FZ9A 3NQBA 1AG1O 3LA4A 2FJKA 4EXAA 4DI8A 2GYIA 1BD0A 1VRXA 3I3BA 1OFQA 4FOJA 3CO8A 4OWGA 1FVPA 3ITOA 3CO4A 3ZR6A 1EJWC 2A3LA 1KV5A 2C7FA 1EX1A 2V5JA 4QCEA 1EGMA 3QFWA 3EA1A 4IG2A 2E1WA 3HFTA 4RE4A 4IFKB 1QK2A 5I5RA 2WMHA 4JFTA 3T81A 4MDPA 3P67A 2VZSA 4P8WA 4K39A 5EA9A 3KWSA 3ZVHB 4GPNA 4Q4MA 3VOGA 1K70A 4QITA 1FHDA 1TPFA 1KBKA 1U33A 4H8UA 2OZ8A 2PI6A 2YJQA 4HZ8A 2YCEA 3LXBA 4GKTA 4JQ4A 4O1FA 4BQ3A 1YBQB 3QMSA 3BMVA 2CESA 4J9JA 2VFHA 2XZ9A 4D6JA 3V5FA 4LT9A 4Z2LA 3CWOX 2IPFA 1E3XA 3E0LA 2CZFA 4N42A 4IF2A 7REQA 4HNUA 1N8WA 4YCOA 4KWOA 2BBFA 2PGWA 3NL5A 1MO0A 4QLLA 4TV6A 3H53A 1ZALA 3OZOA 4KPLA 1TVNA 4FIRA 2GGGA 3WDRA 3P0WA 3T0CA 3UZYA 3IJ8A 2R82A 3ZIZA 2J78A 5T91A 1PX4A 4OZOA 3DX5A 2DSVA 3WNPA 1XYZA 3CZLA 2ZE3A 4FSAA 4W9TA 4DO4A 3GVVA 1A5AA 3QLLA 4DYEA 5AC7A 2J7FA 1IT7A 1ENUA 3G6MA 3QV8A 1UUOA 2C3ZA 4S3DA 2FFIA 4U10A 3FAXA 5D38A 1P0DA 3UXKA 3WLTA 4H8HA 4PUDA 3UJ2A 5G4WA 3W9ZA 1AUSL 3RO6A 1GZJA 4JTAA 5XIMA 3VMPA 1P5BA 2VZTA 5AYYA 2ZXAA 4O8AA 2FVLA 2DQWA 1DV7A 5G2WA 2WVTA 3TLLA 4YTSA 2WKGA 1I2NA 5HNTA 1B3OA 2YA1A 1F61A 3SN1A 1FWDC 3KWXA 4QJ5B 3GHRA 3S5YA 3HMJG 4Q7NA 3FXYA 2PC4A 4XWUA 3A5FA 3RYSA 1RUSA 1VJSA 3FA5A 4B16A 4X2PA 2FPTA 5CGTA 3BH4A 1ZP3A 4UQDA 4C91A 5CGMA 3C86A 1FP9A 1X6NA 4D6GA 2XTKA 2YFOA 1WZAA 1AQHA 1FFRA 1J5SA 7TAAA 2DT3A 2VQUA 1JUEA 2CLOA 1RK6A 1SJCA 2OKTA 3TKFA 4AVNA 5HMFA 5T26A 3R4IA 2X09A 3DERA 2NV9A 3F2CA 4LB4A 2XUCA 3CQJA 2NQ5A 1YKWA 3DFQA 3T2PA 5EMJA 5AOUA 4J27A 5A8GA 1JUKA 1XD1A 5BWAA 3OPSA 1SFTA 3FA4A 1ZJIA 2BB0A 2X0SA 1KA9F 1M04A 3KDOA 2VR4A 1ADOA 2IXVA 1H0GA 3M0YA 2V3DA 3IUIA 1H49A 2A79A 3TYBA 3FKRA 3NO1A 2VFEA 2V2HA 2NXIA 2QPSA 1DQUA 3GFZA 1A0EA 3TN6A 1EWDA 3E5PA 5AC4A 4YPJA 3S5SA 1IEVA 1S2AA 4OE7A 2EBNA 4LJ3A 1N82A 2YW4A 5C2CA 5F2IA 4LC6A 1J0YA 1IWPA 1C92A 5E6ZA 1L0PA 1HP5A 3OQEA 3OLIA 3ZOAA 2Q09A 4B5UA 3UR2A 2PWFA 3DHDA 2I16A 3MI6A 5FJRA 4N4QA 4RKAA 2VYOA 4EPBC 1H1NA 4CD7A 1E6XM 2WWDA 3OG2A 4JEQA 4V15A 4B4HA 3VC5A 4RDYA 1E1FA 1H7NA 1W17A 4HK5A 4D1IA 3W7QA 1NARA 3LB0A 5ABEA 1XRSA 5KINA 4NJIA 2FTYA 4GQGA 1UR0A 1YXDA 4IM4A 3NVTA 3DHFA 4P5UA 3KVMA 3AWNA 1KNWA 2A6LA 3TJXA 4ERIA 1VC4A 3MDWA 4K2SA 2C0HA 4KWUA 5F2MA 1T8XA 3K1DA 1RHCA 1XGEA 3IRDA 5EBAA 4G7EB 1B3YA 4JIQA 2Y7GA 2A3EA 4QG8A 2VEFA 3TJLA 1EX5A 3B04A 4W7UA 4RCXA 1E6RA 1K7FA 3ISIX 4B9YA 3VOIA 1Q8JA 3QSRA 5U7SA 5FJPA 1CNVA 2BHZA 3DENA 2WJFA 3RPMA 3BE7A 1VLIA 4RR4A 5KZEA 3MI3A 1PTGA 4DM1A 1A53A 1OHLA 5A8OA 4FHAA 4MPQA 5AB3A 2HEJA 2YA2A 3BSGA 1V02E 4WGXA 3AXMA 1JD9A 4ZQNA 1DIDA 4O1AA 1UR3M 5HDRA 1ZBKA 2WSRA 2O7SA 2XYLA 4XIAA 3IIZA 4ICCX 3PFMA 4UTKA 3NM1A 1W3IA 2HE5A 5FJIA 5A3HA 1SW3A 3OYZA 1F3XA 4K8EA 1N8IA 2BY2A 3I10A 1YXYA 3M6YA 4F9DA 2A2IA 2WZHA 3MYOA 3H21A 3LCFA 5BMXA 2C71A 4O13A 2C1IA 3QXBA 2QLYA 1A47A 4AZ7A 1H61A 5HQLA 3CWHA 3PBYA 2OELA 3ATYA 4GZIA 4XVEA 4H6RA 5IOBA 3APGA 3BJSA 3NQ6A 1PCWA 3CIVA 3HQOA 3UXIA 4IISA 2HRWA 1FWIC 2W66A 1TR1A 1TV5A 2DVTA 3B0PA 4L6DA 2PLJA 4S3CA 3W27A 5KMYA 2PWVA 1MFVA 4M56A 2F9RA 1LM1A 2FVMA 2OQLA 3VILA 2HBVA 1GYMA 4GABA 3AU2A 1R87A 3NOYA 4H6KA 5IDIA 3SSZA 4HHLA 4GKLA 2Y8UA 1R86A 3KTCA 3GC4A 3PZVA 5TIMA 1Q6FA 3IK4A 1OVDA 4O1BA 4BZYA 3S0CA 5F4SA 2DT1A 1J2BA 1HKJA 5FJOA 5FEWA 2YOCA 2YGYA 1V6TA 2G4JA 4YLWA 1FHVA 1RP9A 5D05A 5LNWA 1A5MC 4DUXA 4Q8PA 1F73A 4TMCA 2E7FA 2WWCA 4QLJA 2Y70A 1U5HA 1HO1A 1PX3A 3PF3A 1ISYA 4S39A 1ODZA 1YTKA 4BF9A 1FDYA 1X6UA 6TAAA 4MWAE 3KOYA 4JIHA 4ZCWA 3THAA 1E6ZA 3BK0A 1WDDA 3BG3A 2OR2A 3A22A 5A1AA 1WXZA 5DLCA 1EJUC 4OECA 1C8QA 1KRMA 5CPNA 3N3MA 5XINA 3N17A 4H41A 1DWIM 4QSHA 2GQ8A 4PMUA 4HBKA 2I9UA 3MZNA 4QNEA 4FB7A 1TZ7A 5HJLA 2JKEA 3S5ZA 4AY1A 4DO7A 1NIUA 5C54A 1EEPA 2EAWA 5FF7A 3KOZA 2WSPA 1Q6QA 1JCLA 3TSMA 4UOZA 4A3HA 3UVIA 2V63A 3BLFA 4HIBA 1J9YA 1TTIA 3WLHA 1BWVA 5DCDA 4IUOA 1HX0A 1V79A 5FKYA 2F6KA 3KRBA 1H2JA 3UZZA 4Z2JA 1SW7A 5LIKX 3BW4A 1HW6A 1MNSA 1XH1A 4L64A 1XR2A 3MT1A 3GTHA 3SECA 5CPTA 3F5LA 1S3HA 1IWBA 3W7IA 2Q8XA 4O0KA 3QYSA 3GNNA 4AIBA 4LVBA 2XIQA 2MNRA 1IT8A 1VFSA 3S1XA 1R3RA 1XRTA 2P3EA 1AJZA 4X9YA 3CB3A 1DHKA 3EXTA 3TYUA 4EXQA 3CPUA 3LZ3A 1ME8A 1UWTA 2Y4SA 3RCMA 1WDRA 2PMQA 1K9DA 3PFRA 4AYSA 5C70A 3MUAA 2X40A 1F2JA 4JGDA 1GOXA 3S2MA 4ZE5A 4GVFA 2PDUA 3B8WA 3P60A 1HL8A 3TEVA 1P6WA 1ME9A 2GJNA 3JZUA 5GJMA 3DYMA 4LAKA 4W4QA 5JUVA 4YVVA 2ON3A 4XZIA 2Z24A 1B4EA 3VIMA 2WPBA 4WY0A 3WMSA 3KOFA 5CZKA 1FCBA 4XZMX 3OTRA 4GBUA 4ZL1A 3LTPA 3BO9A 3R0DA 2QULA 2V0TA 2DZUA 4PRWA 3WQ5A 1OT1A 1OWQA 4G6CA 1D2KA 1HJUA 4H9MA 4ADTA 4DUOA 1VEMA 5HULA 5BNKA 2CKRA 1HKWA 1IEIA 1A3WA 1LG1A 4BS0A 4JBRA 3L0KA 5BU6A 4ENLA 1PYMA 1XCWA 3W01A 1UROA 2DY3A 4MB3A 3CH9A 1W9VA 2V2CA 3NO5A 4M81A 3FGCA 1RD6A 5FF3A 4PMXA 3H2AA 3CK5A 1PZ0A 5EU9A 5I23A 1BGGA 4QHRA 1DE6A 1AW2A 3WQOA 1OG0A 3PM6A 1WXJA 1IXOA 4S23A 2QDDA 4ZXLA 4JNMA 3GYCA 1AH4A 2X7VA 4UFMA 1GKPA 4BI5A 4RV8A 3LM7A 3SY1A 4O12A 3UEQA 4RDWA 1F8IA 2OLAA 2JK2A 3IUHA 1MW0A 3BLLA 1A5OC 2I5QA 3T08A 3UCQA 1D8WA 4NZ5A 3FKKA 3PTMA 3DESA 4DAFA 3WUBA 4DO6A 3DBPA 1SPQA 4C6LA 3CAKA 3VD4A 1GQKA 3UY7A 2PTYA 1QBBA 1A4LA 1LORA 5CC7A 4PB4A 3M46A 4ZQOA 3TQKA 4LS0A 1POKA 4MAZA 3ZFHA 3AZTA 2P3ZA 3N2XA 3QW4B 4B3KA 4P8UA 5ABTA 3S9YA 3EWXA 3RIKA 2GGIA 4AU0A 1V6UA 1XYAA 3F4VA 2YCLB 3CUZA 5C9XA 3U7VA 3L4ZA 5LGXA 1YQ2A 2KX9A 3IWPA 5CQ1A 2P8CA 3PZIA 4B5SA 3JVAA 4K8GA 5GJPA 3NTYA 4MKVA 1M01A 1JZ7A 3VIHA 3S1WA 1VYSX 3HIJA 3UETA 1E40A 1HFBA 1O68A 4QQ3A 1H1ZA 1OFOA 3KOWA 3M7SA 4JQ2A 4ZA0A 5EL1A 3LX9A 4DJDA 1KD0A 1UPMB 2DQXA 2JQXA 5A2BA 1O5XA 4FF7A 3K5XA 3B9NA 1JF5A 4TTUA 2RDUA 3E2SA 2V2DA 4UQCA 1AA1B 1B31A 4PTDA 2OEMA 3W1UA 1MI3A 2WZIA 3MP5A 4NAEB 1H50A 1NQKA 2WKLA 3KL0A 1A0CA 2OB3A 1TJ2A 2GDQA 1BQGA 3H7RA 1Z69A 4ADUA 1TMHA 2ZE0A 2V82A 2YDRA 1CIUA 1IXQA 1ZCCA 2VDGA 4MGGA 3GH7A 4NJKA 4B15A 3P14A 4JTTA 4HU4A 1SO6A 1CI1A 3VIFA 4I90A 1FA2A 2WHMA 1SU5A 4XZ9A 3W7NA 5D4YA 4EKJA 4JN6A 4XO6A 1WUEA 4K36A 4LALA 1N55A 4O54A 1KR0A 3LNMA 4EP8C 4JXCA 1GHRA 1O5QA 1B3XA 2HVMA 4X22A 4K1GA 1OJXA 2OT0A 5DELA 4ATDA 1A5SA 3PB2A 3U4AA 2X1SA 3AIUA 4ML4A 4LUYA 2X16A 4MVAA 3QVQA 4W85A 4FNUA 2PPGA 1XW8A 4PFHA 2EG7A 2J77A 3TV8A 2TODA 4NYUA 3UG8A 3VVGA 3PHAA 4B2DD 1V02A 2G97A 1P6CA 1TG7A 5AHMA 5DMLA 3C3NA 1QU4A 3DC8A 4GYKA 1QMLA 4PCNA 2VFGA 2ZDRA 3I65A 3L4YA 3M64A 2C13A 3OBAA 4CCEA 1I2RA 3VKAA 4DJEC 4C6FA 3QOKA 4PEEA 5CPLA 4O28A 5F4WA 1FKWA 3BLPX 3BOLA 4IPPA 1Z8AA 3IJIA 2ISFA 5J8LA 3ZZ1A 1YNQA 1NY1A 1M3UA 1M5WA 3F4WA 2WM1A 3QH2A 5HR7A 2JALA 3KS6A 2PWGA 4E3VA 5BXTA 1P0NA 1VLWA 3GX9A 4WRHA 3W1AA 3CC1A 4HNLA 3SJNA 3DG6A 1IR2A 1CB7B 3TFXA 4ZMGA 5G2HA 2EGZA 2F2KA 2WNNA 4X2RA 3NZQA 2PRMA 3AS1A 4TR9A 1QHOA 4DIAA 2GPTA 3VC6A 3QEZA 5GNZA 4EX4A 3GO2A 5ENLA 4CQDA 1POJA 3T9PA 2W6RA 2JIEA 1JAKA 3TXVA 5C71A 1MYRA 5D04C 1GPWA 3B4UA 2XFYA 4YU1A 2EPNA 5I2UA 1QPQA 4IP4A 2IPWA 3ATZA 5JBEA 3OGRA 5LIUX 2VFIA 3CLWA 3VNLA 3M6DA 5GPRA 2CLHA 2E6AA 3BCDA 3WQGA 3BV7A 4HD5A 1WAWA 1E3ZA 5I3KA 1WZLA 1W5NA 2FHCA 1SM9A 2EQDA 1LBMA 4PTVA 1PKMA 3RAOA 2BWGA 3QGAC 2ZXQA 3VIPA 7ODCA 1Q2RA 4PC8A 4HNVA 5LGZA 3VK5A 4GQRA 3WMCA 3LU2A 3EGJA 2J9ZA 1PHWA 5E70A 5GJNA 4NG3A 2EKCA 2X1IA 3MUIA 4KWVA 4JL1A 2YCIX 4REQB 3WK3A 1KLZA 4O50A 3TMLA 1YDNA 4IL2A 3U0HA 3ENLA 1GVOA 4F0LA 4ZFCA 1VR6A 3AXIA 1FRBA 2BGQA 1X98A 3RMJA 3B03A 1JJKA 4PUWA 5FJUA 3W2MA 4UFJA 3WJXA 3MMDA 5I02A 3C2EA 3UPMA 3SUWA 5GVJA 1HKKA 2GWNA 3BV4A 3WDHA 5FEZA 3DDMA 4L1GA 5CPSA 4TQTA 2A0NA 3P7YA 2XH7A 2X41A 4UQBA 4NJGA 2VOMA 1QRQA 1EDQA 1REQB 4K7VA 2GGHA 2ACSA 3W85A 2DZXA 4EOUA 1Y0EA 3TMQA 2H90A 3U2EA 3UQNA 3CZJA 3RITA 1JXJA 4JX5A 4NI8A 1PL9A 1SZFA 2QCMA 4N7QA 1UOZA 2WMIB 3LLXA 2QNEA 2C8NA 5C9UA 2IPGA 3HG3A 3N2OA 2B7NA 1W3HA 4A35A 4PTMA 3WF3A 1P48A 4GIEA 1BG4A 2OWWA 5BRPA 3EKLA 5CSSA 4S3FA 4I6KA 3MKKA 1LCOA 3TYDA 3W29A 2O9RA 5I7GA 5B80A 4GZ7A 2E4TA 1NFPA 4WY0F 5FACA 2NVDA 1MSSA 4YWIA 1F4AA 3BJTA 2Y88A 4JTHA 2BSLA 1V08A 3SM0A 3NEHA 5MF5A 1JNEA 1CGYA 4IIDA 1RV8A 3L0GA 2GSJA 1L2QA 1GZGA 3O06A 4I8YA 1H7RA 1U30A 1K7XA 4W89A 1XLAA 1J79A 1TRDA 1R3SA 4P61A 1OCNA 1DORA 2Q02A 2WOQA 4DWSB 3GH4A 4MB5A 2PDQA 6PTDA 1SQ7A 2O92A 4AZGA 4DBEA 3TWAA 2Y61A 2NUYA 2YXGA 4M51A 1GONA 4GY1A 3NIYA 3WQDA 5CH9A 8A3HA 2QPXA 2VZVA 4GXMA 1OCJA 3HN3A 1W3JA 2QCFA 3T2OA 1EC7A 1DKWA 3ABXA 1OX5A 2UBPC 3ABSA 3B8DA 1NWTA 2IQ0A 5HPCA 1XDJA 3WIJA 4WSKA 1CXIA 3MSDA 3G8RA 3G24A 4U5KA 4CUCA 1CZ1A 1WDPA 2B4GA 3EX2A 2AGKA 1E4IA 1K7EA 2ISVA 4J3XA 3T6CA 3LRKA 4GXWA 4QE1A 3N34A 1NU5A 4EXBA 4WJEA 2NWRA 4LYRA 1YX1A 2V68A 1BWLA 4K6AA 1VFUA 4JKMA 2DH3A 3VGEA 2Q01A 3DYPA 1W54A 1IIHA 5I3HA 3PZGA 1JAEA 1KBJA 1VS1A 1FOBA 1Q63A 1DIOA 3DGRA 1GOIA 2ADAA 3L66A 4AXKA 4AD5A 1TMLA 3CB8A 4JR5A 3AXKA 3VKCA 3H8AA 1WP6A 1NF7A 2PTXA 1K8YA 2VRJA 1B5TA 1R3VA 5XIAA 1XRFA 1QWKA 1MW1A 3E0WA 3VDCA 3KLKA 5EMLA 3HB9A 4J40A 2VX5A 4IPJA 3CS2A 1TQJA 4OV4A 5KSWA 3UWQA 4CQBA 1Z32X 3W1RA 1PE1A 1C7TA 2P50A 4I9JA 8XIAA 3QLDA 3DIPA 3GBEA 1JDEA 3KP1A 4DM2A 2WSYA 3RR1A 3U7BA 4XO7A 2BTMA 4UMAA 3TJIA 4DJED 2X42A 4IMFA 3RG6A 3RX2A 4DJDC 5FIPA 1XYCA 4U2YA 1ADDA 1KR1A 3WK2A 3E0FA 3S1VA 1AODA 3PPHA 2Y7FA 2NX3A 4MYAA 3AO0A 3QKEA 1T5AA 3W25A 2Z2BA 3W23A 4HPNA 4I7UA 3W84A 4Z2KA 1OYCA 5E6YA 4HZ6A 1EQCA 4TX8A 4FA3A 3NQCA 2PDFA 2VL4A 4HPHA 3G1SA 3LMZA 1UH4A 4UTHA 2PP1A 1QJWA 3P8IA 3ZT7A 2GDVA 3PR2A 4UMBA 2VKZG 3WBXA 4OKDA 3UA4A 5I3JA 5AZ1A 1X1NA 4Q8MA 2ISDA 4LQ1A 2Z1SA 2XN2A 1QAPA 3OQ8A 2CXGA 1TYGA 4B3ZA 1KM3A 2FZMA 3WBEA 3W7LA 1A0DA 4E6MA 4PUKA 2EF9A 5K9DA 1W2VA 4G56A 2V5BA 4ACYA 1EHNA 1WZMA 4Q7BA 4JIEA 3OODA 1R3YA 3FJNA 3ANVA 4YJ5A 3K4WA 4AIEA 5K2ZA 1P0EA 3BICA 1BWKA 3LHZA 2G3IA 2CBIA 3R8HA 3ARSA 3RMEA 1TMQA 3T2QA 3A5VA 2NT0A 1XLCA 1IQ8A 2EPHA 3G8EA 4JYDA 4HOZA 1Q7ZA 4R3UA 3ZLFA 3BPWA 3HO8A 4QFUA 3PZTA 1OFAA 2BVWA 4BI6A 3H54A 1O1ZA 3LEPA 4RJEA 4IGNA 2BHYA 3PNUA 4ICNA 1CYGA 2ATMA 1R9YA 3WBAA 4GISA 3DECA 4NNAA 4XK2A 2WC4A 3IIPA 3TYCA 1UD3A 3LN3A 3DFSA 4LFYA 2REQB 3N29A 6XIMA 2CITA 1B0IA 2YYUA 3WCZA 3NGFA 3KBWA 2B31A 2W5FA 2XGBA 4XTIA 2AGTA 4XAPA 1R7OA 2X30A 4KT2A 3CGTA 2CLKA 1HL2A 3SCVA 1YPIA 3CQIA 1ZJBA 2AOSA 3BDKA 1KBLA 4C6IA 2RJHA 3H70A 3DKLA 3LYEA 3P8JA 4QISA 4E38A 3A64A 2G4FA 5DMYA 1HL9A 3G1DA 3MP4A 3O07A 2AL2A 4H8VA 2R1KA 1PX8A 1E1CA 2ASHA 1M6JA 3GK0A 3N13A 3C2OA 2CPUA 4DJEA 4PBEA 1V3IA 2FZ8A 1IXPA 1GNXA 3NL6A 3ABQA 4AG0A 2E68A 2PLMA 3OGVA 4BJHA 1E6NA 3ARZA 4LUTA 1VFMA 3I7QA 1MW2A 3VFLA 4WGHA 1E9IA 5CJNA 2PDWA 2QCGA 2QYGA 1JYWA 3QM3A 5BROA 3KW3A 1YRRA 1I6NA 2XVLA 4GVGA 1KCXA 1KW1A 2BG5A 1PV8A 1ZPTA 1EL3A 2FDMA 1E9ZB 2INEA 1TRIA 4HA0A 3VNZA 2EJ1A 3RCNA 4GJIA 3LPPA 2PRLA 3SIMA 4QTGA 4EE9A 4GI8A 1W1VA 2VZUA 1WNOA 3QQWA 3BCFA 3S6DA 2DP3A 1DJIA 1R46A 2DZVA 1OFRA 2F6UA 2OCZA 4K68A 5CLTA 2C18A 3LHYA 3DFOA 4TX6A 3GXIA 2Z25A 4N6EA 3V16A 3WMBA 1VEPA 1RK5A 4KRZA 4YCPA 2GVJA 1OC6A 2R1LA 3FSUA 3URQA 3ZSTA 1RQHA 4IXXA 1MRAA 3GXNA 3W76A 3IJDA 2EEXA 4LUSB 3GNOA 5A6SA 1E4MM 2VENA 3EXRA 1RSCA 3DAQA 1XSKA 4IFKA 1LQ0A 1JF6A 1XPYA 3ZYZA 3S4TA 1GVQA 1ME7A 3QGVA 1V3HA 1OM0A 3LHWA 4HTBA 4AIUA 2ONEA 1T0OA 4LNYA 5AN7A 1HKVA 3CQKA 4MWAC 1QBAA 2DU2A 3A6OA 4Y9MA 4P8VA 2Y1HA 3U5UA 4KWSA 3PWGA 1VIWA 4MNKA 3R11A 4PODA 2GQ3A 4QG6A 1WKDA 3EWBX 5IFTA 4O57A 2X7WA 4EF9A 4GACA 1ZP4A 2QAFA 1LBFA 1UZHA 2FGLA 2HNEA 1UC4A 3CMJA 2CLMA 1JL8A 1LT8A 7XIMA 4O11A 1Y5VA 1B30A 4QM1A 3E5BA 3ME3A 1RCOB 2RKXA 3C52A 4DF1A 1P6BA 4C7GA 2V3FA 4RE0A 4RZ4A 1Y5WA 1MEWA 4AZIA 4UQ9A 3NQFA 3VKKA 3RFAA 1P7TB 4MWAA 3PANA 1R7AA 3A4XA 1KKOA 3R6IA 1IT0A 2BVTA 4O53A 3EX6A 4FLOA 3O1NA 1ZBCA 3SGUA 3P80A 2P0OA 1EXBA 2H8XA 4AH7A 1PIIA 1I0DA 1X1ZA 1XXXA 4TIMA 1OD8A 4V28A 4M8UA 1KTNA 2Z1XA 3WQ4A 1EF2A 2J9XA 3IVTA 4PCTA 4DBWA 4PH6A 6CGTA 4ZQCA 4JYEA 1JD7A 5HA7A 1VHNA 1E1EA 5I0DA 1GTEA 2QAPA 1K6WA 1YMYA 1RPKA 3PJXA 4TVUA 3RDKA 1JCJA 1JUBA 1ZNNA 2BXZA 3H2FA 2ZVRA 3GYEA 1YIXA 4LWWA 4AF0A 3IGSA 3AS2A 1RXOB 1FHLA 3CL6A 2CCRA 5AY7A 4PN2A 3V7PA 3CZEA 1UIOA 4UCFA 3WENA 4GI6A 4HCHA 2Z2AA 5E1QA 2PD5A 2ZBTA 1UWIA 1H3GA 3P3BA 2KAUC 3WH8A 1ISVA 1KWKA 1UR2A 2BY3A 4JQAA 3VM5A 5HPOA 4G1NA 1KQYA 4NL1A 5DT5A 1PKYA 2YXXA 3CJPA 3ALGA 4MKNA 2YDAA 2NLYA 4N9DA 4E4PA 4C90A 2I14A 4A8NA 3TTEA 4XD6A 1UA7A 3AXHA 4IIEA 4L4OA 3KTXA 3OA5A 4GYJA 3G3MA 3U4FA 1G7UA 4JIPA 1C3FA 2FDSA 1R2RA 1V77A 1ECQA 2A3AA 4RZ6A 1OIFA 4UFKA 4WKHA 6ALDA 1PZ1A 1OCBA 3U3HA 1KFCA 2D0GA 3EBVA 4FNQA 3S6OA 1UD2A 1VH7A 2TMDA 3ONBA 4DXVA 1V3LA 1BXNA 2PBGA 1XYFA 1Q6DA 2E5BA 1S5VA 3T0TA 1HGYA 2XIOA 4PTXA 2XH2A 1LWJA 2OWXA 2FZNA 1IEXA 4JCMA 4LRSA 2WMKA 4FAMA 3MVTA 5CC5A 3G5EA 3QV9A 1F9CA 3W87A 1FTXA 3M4HA 4U5IA 1LDCA 2PUZA 2RGLA 3PZOA 3NPUA 1YW1A 4AD4A 3RCYA 3C3UA 1B54A 1E15A 1HJWA 4MHBA 4B91A 3VCCA 3QRHA 3G6LA 5M2FX 4G7FA 4L9XA 4QRNA 1YDVA 3R94A 3QHMA 3C2RA 3WH5A 2ZXDA 2P53A 5HQMA 1W1IE 1JI1A 2FTPA 3HGJA 3AU6A 4I6VA 4Y9AA 2Y8KA 4OOZA 3M44A 5EKYA 4KBXA 3BOFA 1I60A 3SW6A 3HZ3A 2WC7A 3HM7A 2DUZA 3CYVA 4XZWA 1BVWA 3ARTA 4FIQA 3KTSA 3CUIA 5BOFA 2E9LA 3A4JA 1EZ2A 3UFYA 3ITYA 1PCKA 2JIWA 4IJBA 3FDGA 2PA6A 1JRCA 2ALDA 4WJ8A 4MAVA 1O6IA 2V38A 4XZLX 3VOFA 2O56A 1JDCA 4M6QA 4FXFA 3MPGA 1XHGA 2BVYA 4JTRA 4KGLA 5DXXA 3ZM8A 1XIJA 4IX2A 3RPTA 3OLGA 2V3GA 4O0QA 3AMLA 3VINA 4TVDA 4N9BA 4LSBA 1IIGA 1W5OA 1DJYA 3TR2A 2XFFA 4O52A 4B90A 1XQKA