3OVRA

Crystal structure of hrpe and d-xylulose 5-phosphate complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose-phosphate 3-epimerase
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovrA00
1MZHA 1ZAJA 2CW6A 2VEIA 4PL2A 3W7KA 1KFJA 4Y8FA 2ZDRA 4LRTA 1DQWA 1DKWA 4O15A 3STFA 1OHLA 5CPMA 2FPVA 1J4EA 3L66A 3STEA 2ZZ7A 5DCEA 1EP2A 4GE8A 4ADSA 2W79A 3DENA 3CWNA 4JTTA 1VYSX 4DELA 5T26A 4KFOA 4JS3A 2VENA 3O05A 5AFDA 3S1WA 1JQXA 1TJPA 5I3FA 2X30A 5BMXA 2QJHA 3QQ0A 4LY8A 4NNAA 1S5VA 2CLOA 4FIQA 5E93A 4IWWA 1TPB1 3I7QA 4JTIA 5DCDA 3P62A 4KFNA 3C0JA 1HO4A 3IEBA 3CM4A 3VE9A 2NX1A 2WNZA 2Y89A 3DFNA 3IVTA 2Y7GA 3SI9A 4Z1BA 2V9DA 1TREA 3GNDA 4JY9A 3LB0A 3C2FA 1UBSA 4R7JA 3U2OA 5I3JA 3BVJA 5D2TA 5EY5A 4NJIA 3W2KA 1CI1A 2G96A 4O0KA 2VFEA 5LKYA 4PC8A 1DBTA 1M5WA 5E0KA 1F2JA 5EL1A 1ZJIA 3L0GA 2ISWA 5AC6A 1HFBA 4NZJA 1YXDA 2CU0A 4UFIA 2IQTA 4OWGA 2GPTA 3W1UA 4LS2A 1H63A 1L9WA 1X7FA 1UUMA 4NU7A 1EWEA 3PS7A 4LC8A 1P0NA 1WX0A 1XFBA 3U6WA 1QWGA 2EAWA 3LBCA 1ZHAA 3EXTA 3RF9A 4UFLA 3GYEA 3L65A 2R14A 3TFCA 1H7OA 1R46A 3S1VA 3LGEA 4LW7A 4N02A 1CX9A 1CW2A 1KFEA 3VKJA 4O1DA 3UPBA 2X1RA 3T55A 2O7SA 3TXVA 3G3DA 1YTDA 5AN7A 4LS1A 4ZL1A 4MPQA 4N9EA 1QPOA 4O8RA 2JK2A 4DPPA 3OEXA 2QJIA 3MBFA 2RDUA 4HSNA 4YMZA 2QAPA 1OFDA 5CPOA 1EWDA 4DEFA 1MEWA 1ICPA 3DHFA 1JCNA 3PC0A 3U8GA 1EIXA 1X8FA 1IGSA 1OYAA 1TIMA 1QPRA 2F84A 5K4XA 2B4GA 2JBMA 2X2GA 2ZTKA 4CQAA 3PB2A 2ZFAA 4ADTA 3EKLA 4NNBA 2YX0A 4XBKA 3W23A 3NG3A 5K9XA 1K8XA 3MYOA 3A9IA 1GVRA 1P1XA 1YYAA 4GRSA 2WSYA 5G4EA 2QCDB 3ATYA 3BG5A 3HF3A 4OBTA 3W1LA 4K36A 3TK7A 5D2XA 5LGXA 2PCQA 2ZA1A 4NX0A 4PTNA 4DO5A 2Y6ZA 1S5TA 3NQ2A 2CLEA 1PS9A 3NQ7A 3G1FA 4QJ1A 4UTWC 3H54A 3MMTA 4QM1A 1GWJA 3PR2A 3JRKA 5D02A 3EWUA 1PHQA 2NXIA 3S5NA 1GTHA 1G67A 2TYSA 2B7PA 4S2BA 1X6UA 3A24A 3N19B 4LVGA 1IXQA 4LRSA 1YDVA 4NXSA 4BK9A 4JR5A 3HPXA 1VRDA 1I2PA 3PBVA 4WOZA 3PAJA 1VHNA 5DBUA 1QNVA 5HMSA 1X1ZA 4QNWA 2E1DA 1RVGA 4I7VA 1OFEA 3MP5A 1SR9A 4FB7A 3R5EA 3TA6A 2V81A 2YCEA 3ZFHA 1U5JA 4TO8A 5CG7A 4AH7A 4LVFA 5D32A 3W3OA 4Z08A 1ZALA 1MXSA 2C18A 3E02A 5EBUA 3HGSA 1G69A 4K38A 1OFRA 3O63A 2FB3A 3NVTA 3THQA 2QR6A 4UTWA 5C2XA 4J9JA 4YLWA 5HNRA 2DORA 5G1YA 3SECA 1WOAA 4WXZA 1XDMA 1SW7A 3OHIA 2DZSA 2ZZ3A 2QKFA 1I2NA 3NQEA 5KZDA 3LRMA 2E6AA 4JTJA 5ABTA 2Q3RA 2HSAA 1EUAA 1RZMA 2VELA 4Y90A 3VNDA 2V5BA 1Q3NA 1XKYA 2G95A 1I4NA 4Y6GA 3STGA 4Y96A 4MZYA 1BWLA 1KLYA 4N9BA 3DGRA 2R91A 4O12A 3LBMA 5HR6A 3G1DA 1F76A 3P80A 3WK1A 1L6YA 4RX0A 3TNOA 1TTPA 1UCWA 4POCA 4JD4A 4O17A 1TPDA 3BARA 1GJPA 4MFEA 3GLCA 1TYGA 5DY2A 4FIRA 3TJLA 3UWQA 3HG3A 3BW3A 1HG3A 3USBA 2FDSA 3CTLA 1HUVA 1IIHA 3UYCA 4A2RA 1JCMP 2JGQA 2QUUA 3QF0A 4PFMA 3W7QA 1LBFA 4LV4A 1F6KA 3NPXA 3FKRA 3ZR4A 5FF3A 4JXCA 4C1KA 1OFPA 1B3OA 3KXQA 3E49A 1W0MA 3QQ1A 2VFFA 1XL9A 4UFHA 2GJLA 4NXKA 2C14A 5A5WA 3QYQA 1W37A 5DBTA 1X1OA 1IIGA 2DJLA 2WKJA 3BV4A 4O14A 1EUNA 4M6QA 1XBYA 1MSSA 3EEGA 3EWWA 2G97A 3SGUA 2I9EA 2QCMA 3W2MA 4AHPA 4N9CA 1WBJA 1UJPA 1GG0A 1WAUA 3PB0A 4XZ9A 4MLRA 5C54A 4WQ6A 2YDAA 1H5YA 2PRLA 3T44A 2YR1A 2JKEA 4O18A 3N3MA 1RD5A 3GNNA 3DKJA 4O11A 1KBJA 1H7NA 3GDRA 1QMLA 2C15A 3TAKA 5C6MA 3N34A 3TQKA 3T40A 1KV5A 4K7YA 4JTKA 2VKZG 4TMBA 4LUJA 2RDWA 5LZLA 1ZY9A 1XBZA 5FF4A 3I7RA 3W7MA 2YFOA 1H1ZA 1WYIA 3LCXA 3DH7A 2A7PA 3QW4B 4QSHA 1PVNA 2WOQA 3W76A 2JGYA 1EX5A 2A7RA 4GFSA 4E38A 4TMCA 3LRLA 3LX9A 3RK8A 2BZNA 5LNSA 3P8JA 1P0KA 2QCFA 3GKFA 3KRZA 3LLDA 4GBUA 4JYDA 5HUOA 3GXNA 3AJXA 3G0UA 2B7NA 1NEYA 3I7SA 5IBXA 2Y7EA 4MUZA 4K8HA 1BTMA 4AAJA 1I2RA 4PL1A 3C56A 3GR7A 4HIBA 2Y85A 3S1XA 3B8DA 3S5OA 1XCFA 3K30A 4GC4A 3NAVA 3QRHA 3UZJA 3HJZA 4CLMA 1QR7A 2P0OA 1DQXA 3NO5A 2FPYA 3WJWA 1JULA 4LOCA 3QC3A 5D03A 1WXJA 1K02A 4JIPA 1VH7A 2Q3OA 3O06A 3VFLA 1Z44A 3C2RA 1DHPA 5TQLA 4MJMA 2A1YA 4NJJA 4JNMA 4I7WA 4MY8A 1KM3A 2ABAA 2E77A 2V2CA 4ICNA 1JUBA 5E1QA 1H61A 3FEMA 1B4EA 3NZRA 4RJEA 2CLHA 2J9YA 1SZGA 2NUXA 1VLIA 2W0UA 2Y7FA 1VYPX 4RXGA 3CEPA 4X22A 2B7QA 1FWWA 4EVZA 1QFEA 2A4AA 3FOKA 4ZQCA 1G7UA 3NQVA 1DJNA 3UWZA 3UXAA 1ME8A 3TMQA 3M0ZA 5LGZA 4LVBA 3PF3A 1V7YA 4OGZA 5AHNA 3DFOA 2A2IA 2AQWA 3NOEA 3LHYA 1KA9F 5AYZA 2CWNA 2H90A 4RLIA 3HG5A 5C55A 1XXXA 2ZA3A 3W1QA 4QAIA 2ZA2A 3HMJG 4AWSA 3PG9A 4NNCA 3FA5A 4JTGA 1UASA 1OX4A 4BWLC 2GVLA 3SGZA 3M41A 1VZWA 3M5ZA 5K3VA 1YLVA 2D73A 1TJRA 2WSQA 3GR8A 1AW5A 3W86A 4R33A 3S1UA 3EWYA 5G4WA 2R8WA 1LLWA 3KVMA 1H62A 5LHFA 3TV8A 3C2VA 3LXCA 3O1NA 2J6XA 4DBDA 3IRDA 4AF0A 3A21A 4FHAA 3NPVA 1VQTA 1JCLA 4PH6A 4FNRA 1THFD 1SU5A 5SWUA 1LYXA 5F2LA 4FNTA 1GVOA 3CLMA 4RCXA 1LBLA 2EPHA 1C9DA 3EX3A 4PA8A 5AB3A 2OZ0A 1Z42A 1AMKA 4BR1A 5FF0A 3TROA 4N9DA 5C5YA 1VJIA 1KM4A 3BG9A 3STCA 3UWWA 3GK0A 1ZNNA 1ALDA 5D2VA 1YTKA 1FDZA 4MOZA 4UTTC 2RH9A 2OT0A 1ZAIA 2QJGA 3HOJA 1NF7A 1RPXA 3TAOA 3TQVA 5AYXA 1R47A 1N55A 2RKXA 3CU2A 2CZEA 5MHBA 2J27A 2KZHA 3QJAA 3F4NA 2CZDA 4RXFA 2ISSA 4BWLA 1XUUA 3LCGA 3W83A 1Q45A 4RR4A 4M7TA 4AXKA 4EWND 2QUTA 3BW2A 4ZZ9A 2VEMA 1W54A 4OQVA 2J88A 3W7DA 4FX6M 3GDMA 3DI1A 3KX6A 3B03A 1IXNA 2Q8ZA 1LBMA 3MHGA 3W1RA 1WA3A 2ZQ0A 3WK3A 4O1CA 3IGXA 4XKYB 5DN1A 1T8XA 5BNKA 2QCGA 2DU2A 1TPWA 1LZOA 1WQ5A 5H2ZA 4IXXA 3GZ3A 3EX6A 3F1QA 3UPWA 3EWBX 2C6QA 1C29A 1ZFJA 4UTTA 2F7FA 1K8YA 6TIMA 5G2HA 4NUWA 2NUYA 5EPDA 3I6RA 3V1PA 2BX7A 2ATMA 1ZAHA 4IGHA 4JTEA 3MI3A 4XUGA 3NQMA 5LNRA 3HIJA 1K7FA 2VFGA 2DZPA 3TSDA 2DJXA 2YPIA 1IXOA 1OX6A 2OJPA 4AHOA 2R94A 4X9SA 4KWVA 5D33A 2VXNA 4EOUA 1TO3A 4FO4A 1EA0A 2A5HA 5J5RA 4N6EA 4AHQA 1LRQA 5HQEA 1VHCA 4JEQA 4QIUA 1QO2A 1G4PA 1QDSA 3OA3A 4JTHA 2OCZA 3ABOA 3B05A 2V2DA 3P5YA 2YYTA 1Y0EA 3UWYA 1FWSA 4A21A 1G4EA 2NUWA 3QW3A 4HSOA 4EIVA 4XTDA 2ZZ4A 3G8RA 2QF7A 4O53A 2G5WA 2GJNA 2PURA 3M5XA 3LM7A 2FB2A 4CNNA 5AC7A 1OFBA 2C0AA 1HO1A 4NVTA 5DXYA 4CQ8A 1LROA 4AVFA 3MW7A 5KMYA 3QMRA 2Y62A 3WK0A 4R53A 8TIMA 4P2VA 3W7JA 4M5PA 3RLUA 2ISVA 4NT0A 4UFMA 4UNKA 2ZZ5A 1PL9A 1W8SA 4ZMGA 5HWNA 1I2OA 2FJKA 4D2JA 1TPC1 1TB3A 2ZRXA 4DF0A 5F1UA 3BLIA 1D3GA 3S9YA 4JYEA 1LOSA 3TE9A 3P84A 5AYYA 3N73A 1YPFA 3CIXA 1EP1A 3NPUA 1F73A 3OIXA 3IVUA 3W2NA 4MZ1A 1B9BA 3UWUA 3ABRA 3LCWA 3B04A 3LV5A 2FTPA 1W31A 5LSMA 4UMAA 4BF9A 3O16A 4OU1A 5FF7A 3CQ0A 3TJXA 4JICA 3T78A 2CLKA 4FX7A 3A22A 3PVFA 4QQ3A 1W5MA 3SR7A 1W3TA 2X1UA 5BMWA 5D37A 3TC7A 3M9YA 1H60A 2ZZ2A 1OJXA 3WJYA 1T96A 3W1NA 2H6RA 2VFIA 3F03K 5K9CA 4YXGA 3QFEA 4JYFA 1TTJA 1NAL1 4NJGA 3BK0A 1FWRA 2I14A 3NXFA 1TTIA 3DZ1A 4IMCA 4LUIA 3L2IA 1NSJA 1YDOA 4O52A 2XFWA 2WNNA 3Q2DA 4ZQRA 5F2MA 3EWXA 2YGYA 3NQFA 4Z1CA 1MEHA 1TV5A 2CLFA 1LP6A 5AHLA 3NL5A 4YL2A 1WV2A 4MIMA 2H8ZA 4MLJA 3ABSA 1K7XA 3E0IA 3DFPA 4WOQA 4Z0SA 1P5BA 4GXMA 4ML9A 1L6WA 4OT7A 3MYPA 3IIXA 4DQWA 2HTMA 4LU0A 3ZWTA 3ZWSA 4RZ6A 1OK4A 3M44A 3C2OA 2QDHA 2W6RA 3N9SA 3M5YA 1OX5A 2RHGA 4LWWA 3LHUA 3NM3A 1K7EA 2GQAA 5KSWA 5HR7A 1TPFA 2PE4A 4IMGA 3M6YA 1SO6A 3L68A 2C3ZA 4FXSA 3KVKA 5I3GA 5F2IA 3QSTA 3LDVA 1FX6A 2PC4A 5K4ZA 3LRKA 1K03A 5HWMA 4BI5A 4TU1A 4HKPA 4OE7A 5FESA 3OBKA 4C1LA 3W07A 3ATZA 5K2ZA 3OVPA 3PG8A 3W7PA 3G0SA 1YADA 1KFLA 1KM5A 3W22A 2Y63A 1JRBA 1FUYA 1U83A 3G1SA 1Q6OA 1EP3A 1A5SA 1KM6A 3DAQA 3LCHA 4UTIA 3P7YA 4DPQA 4DO6A 1QO5A 1OABA 3N2MA 3I65A 3F4WA 5CZJA 2NV2A 3IGUA 2CZFA 4HPXA 1SSDA 4K6AA 3S8HA 1L2UA 1TRIA 4CCEA 3NNTA 3NQAA 3HBLA 4MJZA 5D38A 2C1HA 1SQ7A 3LHWA 3WJZA 3I68A 2QCNA 1W5NA 4O54A 1L6SA 3GAYA 4UTMA 1TQXA 1H1YA 5IBXC 2E6FA 3LERA 3TFXA 3W85A 3ZS4A 3N14A 3TSMA 3NL3A 5CSSA 1GVQA 3W7NA 3LTSA 3INPA 3W2LA 2AAMA 3KFTA 3W1XA 5LNUA 3NPWA 1LTDA 3W84A 2AGKA 1OG0A 3LI1A 1XM3A 1M7PA 2DZUA 4CCCA 5BOOA 4JDYA 2QDGA 3O6YX 4E0CA 2J24A 1C8VA 4ORIA 1PHWA 1W5OA 3PM6A 4Z1DA 4A29A 4WY0B 1G4TA 3HPSA 3IIOA 2FQIA 2Z1BA 2VEPA 3W72A 3UD6A 3GXPA 3TDFA 5EMUA 1R30A 4IMEA 3W9ZA 5AC8A 1N8FA 4LS0A 3BG3A 3W75A 3LHZA 3R2GA 3THAA 2NZLA 2GUUA 4CQ9A 3C52A 1XBXA 1BKSA 3W7CA 4KWWA 4IQLA 2QCCA 3QZEA 3BO9A 3IIPA 1KM2A 4ORMA 3ABQA 2FPTA 1EPXA 1F7BA 1KM0A 5G5IA 1G6CA 1S5WA 2ATSA 3NA8A 1AW2A 4WD0A 2HS6A 5FF2A 5F4SA 2Y70A 3NQ8A 4CNOA 1P4CA 4GWEA 1K3UA 5U4NA 4ONVA 4DBEA 4R34A 2NWSA 3C8FA 3RFAA 1TPVA 2B0MA 1H7WA 3L0NA 2GQ9A 2ZRUA 5LNVA 3MI6A 1DV7A 3CIWA 1M6JA 1TPH1 4NQ1A 1QOPA 2E5BA 2WJZA 4UTUA 1H7PA 5G2IA 3C2EA 1FCBA 4X3ZA 3SY5A 5BRBA 1W5PA 1BEUA 5D04C 1FWTA 3FFSA 1FWNA 1YXCA 3P81A 2NX9A 3W6YA 1M7OA 1EEPA 1OVDA 1LRTA 4LVAA 3S5ZA 1OYBA 1JCJA 5HINA 3KVJA 5K7JA 1W5QA 4U28A 1SZFA 5AHMA 1XDLA 4RV8A 5AHFA 3GDLA 5KTLA 4Z0JA 3GDKA 1FCUA 2BSLA 1GYNA 4UMCA 2H3DA 5TBOA 3IIZA 3PSWA 2J9XA 4Q4KA 4QISA 2B7OA 2XN2A 3JR2A 4HNUA 3NDOA 1OYCA 2CZ5A 2VFHA 5DELA 3MP4A 4A22A 5FEXA 4UTLA 4EF9A 3FIGA 4ZQPA 5KZEA 1J2WA 1T0OA 2BWGA 1UB3A 2GVGA 4UFKA 1KFCA 2TMDA 4U4MA 3S42A 4Q32A 4H3DA 2X16A 1YPIA 3NEVA 1KFKA 1XUZA 4UMBA 1F6PA 3P67A 2QCEA 4K39A 2BTMA 3EX2A 1KTNA 3FLUA 5CZ0A 1GVSA 1O5XA 3DBPA 3WK2A 4K37A 5LHEA 4YCPA 2VC6A 4LT9A 2P10A 2E6DA 3L5MA 3GAKA 2JKPA 2GQ8A 4O4WA 3W70A 3P61A 3NYZA 1OF6A 5DLCA 3YPIA 5DXXA 1SO5A 2CLIA 1VCGA 2V30A 3G0XA 3PSVA 1SPQA 2WSRA 3R8RA 1ONRA 1V5XA 3TSBA 4MZ8A 3NQDA 1GOXA 1Q6QA 1QCWA 2NWRA 3HO8A 3P8IA 4RK8A 3BPWA 5A8GA 1QAPA 3CC1A 3QH2A 3TXZA 3Q94A 1W3NA 3T4CA 4RZ5A 5H91A 5FI8A 2X1TA 3P74A 2DP3A 3W87A 3NQ6A 1VC4A 4A2SA 2Z6JA 3HG2A 1TQJA 5F4XA 1LOLA 1I2QA 4HNNA 1QOQA 4JTSA 1KTBA 4UTHA 4LC6A 1KTCA 2PRMA 4KKXA 1SO3A 3LTYA 4N2YA 3W7GA 3UY7A 3KOFA 3MI2A 3C6CA 4JTLA 4AMAA 3IIVA 2NLIA 1SZNA 3B4UA 4BFAA 4O57A 4WJEA 2FFCA 4CNPA 4GUGA 2Z0IA 4MY9A 4Z1AA 4L4MA 1TV7A 1W56A 3PUDA 3LCIA 1Z48A 1NF0A 5F1VA 3HGOA 3OVQA 3W2UA 1KLZA 3TMLA 3MO7A 1I45A 5HWJA 1TTQA 1SZEA 4Y9AA 3EX1A 3TW6A 3G22A 4FNQA 1R2TA 4AWUA 3SZ8A 1PV8A 2DZTA 2HS8A 5G2WA 4JDBA 1Q6RA 4PEKA 1RQEA 5BW6A 3UXDA 2ABBA 5EKYA 3WJXA 5KINA 1GYLA 3HB9A 1F05A 3W2JA 1LM1A 4BI7A 1OFOA 3GDTA 3UY8A 3TIMA 1DL3A 1H50A 2E6YA 1SUXA 1QPNA 1FDJA 3W1AA 4O16A 4JX5A 3A5VA 1SO4A 2H8XA 3M7WA 3PWAA 3MHFA 4YCOA 1LORA 4IMFA 5HJLA 3DFSA 1VYRA 3TKFA 4I7UA 3RU6A 5D05A 1BWKA 3RNDA 1DOSA 3WJSA 2ZRZA 3EX4A 1SSGA 1PCKA 4IPJA 1G4SA 2I1OA 3PULA 2OT1A 3EB2A 2HMCA 5CPLA 2ZZ1A 3TW7A 3OG3A 2GVJA 5GVJA 2E68A 2X1SA 3MWAA 1KW1A 4IJBA 3B06A 4H6KA 2XN0A 3LXAA 3IVSA 3P5ZA 1T99A 3W7LA 3ANYA 1AL7A 1SW0A 4M6PA 3UZ5A 5EYWA 1YXYA 3M16A 4UC5A 3RLVA 1YTEA 4E2DA 2QCLA 3E12A 3KHJA 3LCLA 2ZTJA 1AW1A 1ZCOA 3T7VA 3W1TA 5CPNA 7TIMA 4Q33A 3QSRA 1F74A 1WOBA 4B5NA 5I3HA 1LOQA 1TSIA 3TCEA 3SIZA 4O1BA 1GTEA 3VE7A 1OK6A 3CEUA 1B4KA 4A3UA 2VFDA 3BLFA 3G3MA 4JX6A 3ELFA 3QPYA 2ALDA 2E5DA 5AOUA 1JQVA 1XI3A 2YSWA 4KFPA 4PCFA 3WFAA 4ZQMA 4DO4A 4JN6A 1ZENA 1DORA 1VCFA 2YXGA 2ZCGA 1A53A 3NQCA 1B57A 2LLEA 2XN1A 5I3IA 2Y61A 1WBHA 3M1ZA 1A5BA 4WY0F 1A5CA 3PBUA 1TV8A 5K9DA 4O4VA 3KRSA 1LLZA 2A21A 3EWZA 1VCVA 3M43A 5J5DA 1E51A 4JIQA 5FEZA 3LCFA 2EGZA 3L5LA 2Z6IA 3CHVA 3W1PA 3W71A 3PBYA 5CZTA 4X2RA 4HN4A 4UR8A 4QITA 4FNPA 4XKYA 3GKAA 3A5FA 3B0VC 1R2SA 2V82A 3DKLA 2CFFA 3LI0A 1Z41A 3S5YA 3PY2A 4ZQOA 2WNQA 3TU9A 4GJ1A 1ICSA 4PODA 3G1XA 4EF8A 3NR0A 3C61A 3CWOX 2H3BA 1LRNA 3LHVA 4JTFA 1ML1A 3GX9A 2NV1A 3GIYA 2QEZA 3PBWA 1OF8A 5EA9A 2NX3A 4NJKA 3DU0A 2YW4A 2ZBTA 1XC4A 2P1FA 4GUHA 1GPWA 1JUEA 1UUOA 3Q37A 3W7RA 3W74A 3HPZA 4UIOA 4L4LA 2FLIA 1WDWA 4AB4A 4RZ4A 3G1HA 2NXHA 1FXQA 3KAOA 3SW6A 5DCBA 1PIIA 4G1KA 4JTUA 1FCQA 1FDYA 2A85A 4XWUA 1KBIA 1O4UA 3MHUA 4H4IA 2PRHA 1VPXA 3QM3A 4M7SA 3D0CA 1K8ZA 3H55A 3QMSA 4JY8A 5AHEA 4FEZA 3LTPA 1EB3A 4MFDA 3RMJA 1H7XA 3N2XA 3S6DA 3GXTA 3R12A 4FX8A 3LHTA 4LTSA 3MUXA 3W1MA 2C13A 3LXBA 5D2YA 2C19A 1D9EA 4O19A 3DFTA 1RV8A 4O0ZA 2Q8LA 3E96A 1O94A 3QMTA 3KRUA 4UXDA 1MO0A 1ADOA 2WQPA 1VR6A 3UWVA 5G1TA 5HULA 3UNDA 4GUIA 3FKKA 3FYOA 2V2HA 4NX5A 4IMDA 2Y7DA 1FCVA 1FY6A 3G8EA 3L67A 3G1YA 3SJ3A 2QCDA 4OV4A 4OV9A 1JVNA 4ADUA 5L9FA 1KFBA 5TIMA 4DF1A 2ZRYA 1JCYA 2YYUA 1QPQA 4MVAA 4HNTA 3BGGA 1IF2A 5D2WA 4OHQA 1TRDA 3B0PA 3EKZA 4RKAA 3QEZA 1RQBA 6ALDA 1OFQA 3OVRA 1NFBA 4GUFA 3AO0A 3S0CA 1VLWA 1LCOA 2O7QA 1KV8A 4UTJA 2GOUA 5F4WA 4HT3A 4K8EA 4FF7A 2FIQA 2TRSA 3DI0A 4K7VA 1TPUA 1O95A 3CB8A 3NZ1A 3TC6A 2RDTA 3NL6A 1ICQA 3EXRA 3G1VA 1HL2A 4NJHA 3DFQA 2YW3A 3FYPA 4UR7A 1JRCA 4IPIA 1O60A 2WV8A 4NZFA 2NXGA 1TPEA 4E2BA 3GB6A 2YFNA 1A50A 3CT7A 1OX4B 1PE1A 4DF2A 4IXHA 4JX4A 2Z2UA 3P82A 4AEOA 2TSYA 1D3HA 4DXVA 1GEQA 1JR1A 4LVDA 1H51A 1ME7A 1VS1A 2ZRWA 1G7VA 4GUJA 1OFAA 3VCRA 5U7SA 1MEIA 1S3HA 3R13A 4N4QA 4W9TA 4UCGA 3VI2A 4AF0B 1GQNA 1GT8A 1R2RA 1SFLA 1FXPA 5KZMA 1XBVA 1RR2A 4O1AA 1AG1O 3KVLA 3L0KA 4M6VA 1N7KA 3FJLA 1O5KA 3L9CA 2ZZ6A 2Y88A 3LV6A 4I9AA 3NQGA 1RQHA 3NL2A 2V8ZA 4YWIA 1ME9A 1H7RA 2V5LA 4N6FA 3G24A 2J9ZA 2OX1A 4QNEA 5DY3A 4IX0A 4JGDA 4O50A 2EHHA 4UFJA 4P61A 1SW3A 2E5CA 3O15A 1HTIA 2A6LA 1DJQA 4LNYA 4WZHA 1PCWA 3N9RA 4UTKA 1JUKA 4UNLA 1YDNA 1AL8A 4FNUA 2DZXA 1FBAA 4S2CA 3W7EA 1NVMA 4LV9A 3SSJA 4IUOA 3O6CA 3W88A 3R89A 3JS3A 4IX2A 2QAFA 1JJKA 3C3NA 2C16A 2UV8G 1GZGA 2CLMA 3G18A 3V75A 5IM51 3FS2A 3CPRA 1LDCA 3TX9A 2QUVA 4WXYA 2VEKA 3LLFA 3DXIA 3DHDA 2WO5A 1TMHA 2DZWA 4GNJA 3HQ1A 3M47A 2WPBA 4XBSA 5FEPA 3EXSA 2A6NA 3M5VA 4FNSA 5F2GA 4O28A 3P60A 5CSRA 4ZQNA 4WUIA 3QPZA 1AK5A 3HG4A 5I3KA 3O8AA 1TCDA 2E09A 2ZRVA 4MYXA 5HUPA 3O6DA 5LNWA 4CCDA 1SFJA 1J5TA 4MYAA 4N4PA 4TX9A 3TUUA 1FQ0A 1GVFA 3L5AA 3L21A 1KM1A 4O13A 3Q58A 2BXVA 2RFGA 5CKSA 1I8JA 4BI6A 1W3IA 1JCXA 3BGJA 1F5ZA 1A5AA 1GG1A 4AWTA 3GVGA 5FEWA 2A0NA 4UUIA 3BLEA 3FJ6A 3UQNA 3HGJA 4HNVA 3IGSA 1DVJA 3MP3A 4HPJA 3H53A 3SFKA 3W73A 2A7NA 3W7OA 2CLLA 3PUOA 3TH6A 4IOTA 2DZVA 1IXPA 3LOTA 5CZSA 1Q6LA 5L6UA 2JKAA 3G1AA 4MKNA 5CGQA 2OMAA 1VGAA 2YZRA 4ZVJA 5AHIA 3O07A 4MY1A 4FXRA 3HGRA 3IV3A 2EF9A 4M19A 3W7IA 3PUEA 3E9AA 4WY0A 4ALDA 3C4UA 2QCHA 2EKCA 4HHPA 4XQ6A 4TIMA 5D09A 5D30A 4O10A 3MJYA 2ZYFA 2V0TA 4XTIA 2BLEA 3MBDA 3TR2A 3B0UX 4S1FA 2VOMA 5KITA 4WX2A 1W1ZA 3BW4A 3A23A 2TPSA 4TR9A 3TQ0A 3W7HA 3NM1A 3NGJA
chains in the Genus database with same CATH superfamily
1ZAJA 2JF7A 2GYIA 2PDYA 2FH6A 4S3DA 3CMFA 4L1WA 4CQDA 1KGXA 1HW6A 2FPVA 3O3RA 1RCOB 5JBDA 2ZZ7A 3LK6A 1H3GA 4WDWA 3CWNA 3BC9A 3LS9A 2IPFA 4KFOA 2J7HA 1TJPA 2Z7GA 4GBDA 1BRLA 3BMXA 5E93A 3O6AA 4RL3A 4JTIA 4DZIA 1M01A 1FWBC 2RDXA 2V68A 4KFNA 3C0JA 1HO4A 4UQBA 1Q7MA 1E73M 5FJIA 3DFNA 2XUCA 4Z1BA 3TOYA 2J25A 4XG1A 3AHVA 4JY9A 2FFIA 1JFXA 4WR3A 1P43A 1K9EA 5EY5A 3GU1A 2OPJA 2Z1KA 1JDFA 2FYMA 4AY7A 4WK9A 3ARPA 5EL1A 2CHRA 1YXDA 4OWGA 3W1UA 1H63A 4NU7A 2ODOA 1EWEA 2W67A 1ZL1A 2J79A 1JPHA 1XFBA 3U6WA 4P7QA 3AC0A 2X1IA 2ZUSA 4UTFA 2GK1A 4JKKA 1XCWA 3TFCA 1BAGA 1R46A 4N02A 5AVHA 1CX9A 1CW2A 4O1DA 3T55A 3TXVA 2NLYA 3PZNA 1UA7A 1HKVA 3EDJA 1A4MA 2RDUA 1TCMA 1JDAA 2QAPA 1QASA 4Y9OA 4N0RA 4E8CA 1PEZA 1UYQA 5I06A 1MW1A 1TIMA 1QPRA 3CZLA 3KOXA 4QHRA 2VRJA 4NF7A 2ZFAA 3CB3A 3TTOA 3WH5A 2W62A 3UZZA 2PDXA 5G4EA 3ATYA 3WLMA 4OBTA 4K36A 5LGXA 1AD4A 4NX0A 4GGBA 1S5TA 1Q66A 1PS9A 2Z00A 4QJ1A 4QM1A 3WUFA 3VNIA 1PHQA 1KXVA 3N19B 4LVGA 4LRSA 3V1HA 1E6ZA 2HK1A 3HPXA 3PBVA 4WOZA 3PAJA 1QNVA 4H2CA 3N2TA 2E1DA 4JEJA 1SR9A 1EGZA 2BG5A 3GTXA 4AH7A 5D32A 3GW0A 3QOKA 2PTXA 3W3OA 4GIYA 1YNQA 5EBUA 4NZCA 3BOLA 1HJUA 3I4EA 1CNVA 4K2SA 4BQ5A 2PPGA 3THQA 2YA0A 4H9MA 3QR0A 1XDMA 3WLHA 3OHIA 2DZSA 2QMJA 1I0BA 4G7FA 1XRTA 2QKFA 5BRPA 4A6GA 2WK2A 2VZTA 2JE8A 1LG1A 4C6EA 1EUAA 1QUMA 1XKYA 2J62A 3FV9A 5GNZA 4MZYA 2VX7A 3LBMA 1TMLA 2Y2WA 3P80A 1L6YA 4RX0A 4YN5A 3TNOA 4KCUA 3WBWA 4J27A 1CLKA 1WB0A 2VWTA 2OEKA 3W28A 1TPDA 3WQPA 1GJPA 2A3LA 3L4YA 3GLCA 2QPXA 1CECA 4G9PA 3WD0A 4FIRA 1PKNA 1EKOA 1SFSA 3USBA 3CTLA 1HUVA 1HZYA 2OEMA 3BJFA 1V3IA 3PAOA 2YIHA 1KD0A 3MB9A 2DUAA 3NPXA 4F40A 4C1KA 1OFPA 4NRRA 1B3OA 1CGYA 4E8DA 1XL9A 3KDNA 4UFHA 3FYYA 4NXKA 5JUVA 1HJXA 1K9DA 1W37A 1X1OA 4LEQA 4P8XA 2OLSA 1FWCC 2DIKA 1VD6A 1E40A 3KCJA 3WQGA 5KZ6A 3DYPA 1POJA 4IM4A 3EWWA 3LPPA 1KQZA 2I9EA 2QCMA 4N9CA 1HL8A 3EDEA 2BBFA 3T4WA 3PFMA 3DYOA 3IS4A 2PLMA 3CL8A 1WAUA 5C0QA 2QGYA 1BYBA 1Q2SA 4WQ6A 1V0LA 1LWJA 3T44A 3WEZA 1IR1A 2YR1A 4FLRA 4O18A 3GNXA 2GL5A 3GNNA 5BOEA 1E1CB 4L80A 4LAOA 3GDRA 1C9WA 1FRBA 3TYEA 4PUUA 4QJ5B 5FJOA 1UWQA 1IWPA 3GQYA 3TQKA 1VFOA 4K7YA 2XZ9A 4UR9A 4LUJA 3WG6A 4JQ4A 5FF4A 3I7RA 3W7MA 3RJYA 1P6WA 2HNEA 3HN3A 1AJ0A 1EX5A 2ZICA 3VKAA 4GFSA 2I9UA 2ON3A 4GINA 2BZNA 1PYMA 2AOSA 1OZQA 4RNFA 3I10A 3KRZA 4FOKA 5HUOA 3G0UA 2B7NA 2DZAA 1OY0A 4MUZA 3GC5A 3GR7A 1K9TA 2Y4SA 4KMQA 3S1XA 3B8DA 1XCFA 3K30A 4QDPA 3TYBA 3UZJA 4B3ZA 1QR7A 2HVOA 1RSCA 1O12A 1DQXA 3QC3A 3RIKA 5D03A 4DJFD 1EFZA 3SN4A 4JIPA 3QZAA 1VH7A 2O9TA 1Z44A 3C2RA 3ARUA 4C5ZA 3MDUA 4GI6A 1RXOB 4PGLA 2VQUA 4I7WA 1QBBA 3MMWA 4X61A 2VRKA 3V3WA 2VZVA 1MXDA 1GGOA 3FEMA 3NZRA 4RJEA 4ZO9A 1LQAA 2J9YA 2VL4A 2W0UA 3RPTA 3ZIZA 2VP8A 4JIHA 2B7QA 1GVYA 4EVZA 3N1AA 1TWSA 3FOKA 1RAKA 4RV3A 3AALA 1MWOA 3MKKA 4ZXLA 2VR4A 4LVBA 2OQLA 3WY1A 1V7YA 1HVXA 3GM8A 1KRCC 1XS2A 3WMLA 3LHYA 5AYZA 4HU8A 4RDWA 4PEEA 1K6WA 4S3BA 2QQ6A 1XXXA 3W1QA 1B3YA 3PG9A 4ACYA 2VURA 1QU4A 4JTGA 4G5DA 3AIWA 1M04A 3SGZA 3N11A 3M41A 3M5ZA 5K3VA 4GNVA 3OLGA 1E4LA 1EDGA 3HTWA 3AZTA 3OZYA 3EMCA 1KWKA 4U2ZA 2ZIDA 3QGVA 1H62A 3E1F1 3TV8A 2J6XA 4W8BA 3IRDA 3Q45A 3NPVA 2VVSA 2OG9A 1JCLA 3CLMA 2EPHA 2QVNA 2OZ0A 1Z42A 3R58A 4LAUA 3PK7A 2Z1WA 1AMKA 4N9DA 5C5YA 4AC1X 1KM4A 3BG9A 3UWWA 1W1VA 3GK0A 4DXKA 3GXDA 4UTTC 4O1EA 5JVLA 1ZAIA 2XFRA 4GY7A 3VKKA 5E6YA 4AIUA 1AZ1A 5EGRA 4F2UA 2JEPA 3SRDA 4H83A 2KZHA 1XDJA 4QLKA 3W83A 2Z1SA 3QBUA 4M7TA 1D7FA 1Q6EA 4AXKA 3V4BA 2QUTA 4ZZ9A 4U31A 4OQVA 1FA2A 3VC6A 4AW7A 4IJRA 3T9PA 3ARXA 3AU6A 1IXNA 1LBMA 3MHGA 3W1RA 4CN6A 4GC3A 3WF0A 1LL4A 4BF7A 3ES8A 4HA3A 1T8XA 4L6DA 2QCGA 3QZ6A 1TPWA 5E9XA 3WLJA 1LZOA 1WQ5A 3UJRA 3EX6A 5CPSA 1UUQA 1BG9A 2IMRA 2PDLA 4Z2GA 1C29A 1JIBA 2ZKMX 5T8GA 4UTTA 3GTHA 1RD6A 1UQYA 2PCEA 3CV2A 3MPGA 4JTEA 3SQLA 5LNRA 1EGMA 1K7FA 2DJXA 2YPIA 3APTA 5H1WA 1IXOA 4AHOA 2VXNA 3VZXA 4EOUA 4OOZA 2A5HA 4IUGA 5HQEA 1VHCA 4B4FA 3B0YA 1XQLA 5F7UA 3AISA 4JTHA 2OCZA 2NVDA 1CEOA 1VEOA 2YYTA 3UWYA 3UA3A 3WQ8A 4JPGA 3H21A 4ZB5A 4HSOA 2ZZ4A 1GKPA 2XDFA 2QF7A 4CD8A 4K1GA 2PURA 3LM7A 1RLDA 2FB2A 1OFBA 1H49A 2EJAA 4UOQA 3WDJA 1RA5A 4OECA 5G1MA 4H9UA 4BCEA 1YE6A 1VFUA 3MW7A 2Y62A 3WK0A 1MYRA 3I3EA 4R53A 5FJJA 8TIMA 1BSIA 3N17A 4P2VA 3LPGA 4BF5A 3CHDA 3AFBA 3O9NA 4PMUA 4UNKA 4CNTA 1W8SA 4CD5A 1I2OA 2FJKA 3NYDA 3BLIA 4J2PA 4JYEA 1LOSA 3K4WA 2EG8A 4RPPA 1JPMA 1VPYA 1QRQA 4JQ1A 1F73A 3IVUA 1GOWA 4ZE5A 3UXLA 3E0LA 2XIBA 3AS0A 2WMIB 3SSZA 3PZMA 4UMAA 4BF9A 5EMYA 4H8VA 2I7GA 4AZBA 2YCIX 1B5TA 3GBEA 5DMYA 3CYVA 4FX7A 3ZT5A 4QQ3A 2ZUVA 1Z8AA 1NWUA 2Q09A 1ZTVA 5BMWA 2B81A 2J8GA 4AD1A 2HVNA 4X9YA 3G6LA 1GQJA 3CNYA 2YL8A 1J9YA 1DJYA 3W1NA 2VFIA 4F3HA 4YXGA 1TX2A 3NGFA 4JIIX 3NXFA 4LUIA 2IS7A 2XFWA 3T0DA 5AC4A 2O4QA 3CZKA 5AHLA 3W53A 3USZA 1CXIA 3PJXA 2X42A 1V6VA 5AY7A 4WSJA 3RO8A 1UR8A 3EWCA 1KKRA 3MKCA 4LH8A 4ML9A 1L6WA 3IIXA 3T09A 1US2A 3S2NA 5EFDA 4G56A 4MUPA 3C2OA 4MWAD 1RJPA 2QVHA 3S2CA 4EE9A 1J0YA 2VD8A 5I3DA 5KSWA 2DIEA 5BYWA 1TPFA 3AUJA 1QPKA 4QAWA 2PDCA 3TCSA 1ZBWA 1DTNA 4RDVA 2C3ZA 2PDHA 4AFYA 2F6UA 4PBEA 2TODA 2X40A 4OJYA 4C1LA 2GJPA 3W02A 3AZRA 1PZ0A 4FXFA 3PG8A 1KCZA 3W7PA 1E6QM 3UR2A 2AKMA 3G0SA 1M9HA 3HQPA 3ITCA 4PBFA 5I23A 1YNPA 4REQB 3H2OA 1FUYA 2GVYA 1EP3A 1RHCA 4UTIA 3VIGA 4HA1A 1PDZA 1JZ7A 1Q6CA 4J1OA 2PI6A 5JBEA 5CZJA 4DWSD 1WDSA 2W61A 1SSDA 3WH6A 4LUYA 2VGBA 1TRIA 2YBVA 3NQAA 4IGMA 4MJZA 1GVIA 5A6MA 5D38A 4ZFCA 1SQ7A 3WEOA 3SADA 2VGGA 3GH5A 1H0GA 1Y8BA 4J3UA 3UG4A 3WD1A 4C6IA 1HGWA 2ANUA 2HVMA 3W85A 1TMQA 2CESA 3TSMA 3IUDA 4KGJA 1EJUC 1GVQA 3IANA 2BOFX 3LTSA 5CZKA 5DF0A 3SRHA 3QGAC 3NPWA 4FK9A 2XJ7A 4G1NA 1EBGA 1V03A 4UQDA 4R7OA 1I75A 4CCCA 5BOOA 2QDGA 3O6YX 2X05A 4E0CA 3QPEA 2OVLA 1W5OA 3PM6A 4Z1DA 4F0HA 4WY0B 4C1NA 3NOYA 3W72A 1SR0A 3GXPA 1BF2A 2PU0A 1BD0A 4HZ6A 5EMUA 1R30A 1N8FA 2BFGA 3MV11 4ZSTA 3R2GA 3THAA 2X7VA 3WDPP 2PTZA 3VIHA 1XBXA 1BKSA 3WKZA 1XX1A 1CDGA 3QZEA 3N2BA 2W4XA 3VGBA 1KRMA 3CQKA 2DY3A 3NA8A 2HS6A 2XSAA 9CGTA 2Y70A 2IPGA 1PZ2A 4CNOA 3VD9A 2BHUA 1K3UA 4RW5A 2BHZA 5U4NA 3FJNA 3VNJA 4GOAA 3MU7A 4QGCA 3RFAA 4DI9A 3R8GA 3H2CA 5LNVA 1Q4WA 5E0CA 1M6JA 3BAIA 1S1RA 2IXVA 3WF1A 4B15A 3ZOAA 1UWSA 1UP3A 4QS6A 5AZ0A 5BRBA 1VIWA 3IUHA 5D04C 1FWTA 3S5ZA 4AQLA 1UC4A 5HINA 1TJ0A 2MNRA 4P7RA 1EH9A 1XGDA 4RV8A 3A47A 4GO8A 3S6OA 2VX4A 1R3TA 5HAOA 3TOPA 2WSPA 5TBOA 3PSWA 4Q4KA 3CLWA 5BRQA 4HNUA 2HPMA 3QV9A 3F5LA 3M4HA 4F0KA 2PWVA 2WKGA 4WSHA 4AZIA 1UB3A 3UJ2A 3VIMA 2XFFA 3LA4A 1WZKA 2D0HA 2X16A 1YPIA 4H3DA 4LEFA 3PJTA 1XUZA 1F6PA 3P67A 2JEQA 2BTMA 4FR1A 3DDMA 3EX2A 2PTDA 2GK1B 4JAWA 3FLUA 1DXIA 4YTSA 2WVSA 2PLCA 2E9MA 2E6DA 2J47A 2JKPA 3RJXA 1LL6A 1CLXA 1OF6A 3E3HA 5A6AA 5CPTA 3G0XA 3A12A 2WSRA 3TSBA 2G3IA 4MZ8A 2KAUC 1R3SA 2WVVA 4OFCA 4E3VA 3EDDA 2CC0A 2P8BA 7ODCA 1KKOA 3CC1A 3NUKA 3QH2A 4EWJA 3AAMA 3T4CA 1ISYA 5FI8A 3UWEA 1LQ0A 4A8RA 4UOZA 2DP3A 3VKDA 3NQ6A 1BG4A 4A2SA 3IV8A 1GZJA 3PPGA 3T6CA 4BKNA 1KTCA 3SEPA 3W7GA 2WCSA 1S46A 3GUWA 3BJSA 3VC5A 1V0MA 4WJEA 4F0MA 3GXMA 3AYRA 5E9AA 2VGIA 4PMVA 5M5DA 4IF2A 4C6FA 3LCIA 4RNJA 2GGJA 5F1VA 4FPSA 2OGYA 1KBKA 1B3XA 3EX1A 1X97A 1R2TA 4LF2A 1PV8A 2DZTA 1AH0A 2HS8A 4JDBA 1FP8A 1RY0A 2QDDA 3OG2A 5EKYA 5KINA 4UCFA 2XVNA 4HNLA 4BI7A 1E72M 1XH2A 3B8SA 1SUXA 1C3FA 3T42A 3CAWA 5CCZA 4W8AA 4PTVA 2WJFA 3PWAA 1YIXA 3MHFA 1LORA 1CZ1A 3UP8A 3TKFA 1CT5A 3WF4A 1BWKA 1DOSA 3WJSA 2ESCA 2E1WA 1G4SA 1E4MM 4GY1A 2FMOA 5CPLA 2ZZ1A 3QY6A 5LYRA 1KW1A 3B06A 3BSGA 2OFJA 1V3HA 3LXAA 3P5ZA 2GDUA 1EIBA 1XR2A 4M6PA 3UZ5A 1RP8A 3RLVA 1CGWA 3KWXA 1H11A 1AW1A 3W6MA 3T7VA 7TIMA 4E8GA 3VOGA 1LOQA 3TCEA 2WKLA 3BH4A 4O1BA 5H8PA 3ZJ6A 4A8IA 4BS0A 4LCQA 1MNSA 4YVXA 1XLLA 2J7GA 3H2FA 3BLFA 3ELFA 2ALDA 4GQGA 4XVEA 2E5DA 1E6RA 4F4RA 3VIIA 2DQWA 3M0HA 1V3KA 2C7FA 4DNMA 1NDVA 2NQ5A 3SCTA 1XGZA 3VTRA 1C8YA 1GK8A 1ZENA 1H09A 2YXGA 4DN1A 4AG0A 1A53A 2PLKA 3QTPA 1HP4A 5K9DA 5GNYA 4O4VA 7REQA 3KRSA 2A21A 1HKKA 2VCCA 3M43A 1JI1A 3GNPA 2XVGA 4UWMA 1BVNP 3L5LA 5JIWA 2Z6IA 2VCBA 3POHA 3W71A 2OSWA 2QHAA 1ZU8A 1CBGA 4XKYA 4PR4A 1DTUA 3DKLA 3U7BA 3VA8A 1Z41A 2CKSA 3C86A 3PY2A 2WNQA 1EX1A 1S2AA 4WF7A 1K1DA 5GJNA 1O1HA 4I5UA 3GX9A 3RGTA 3T81A 3SY1A 3FHQA 1FWFC 1DHKA 4NJKA 3DU0A 4P7NA 4IFOA 5IRPA 4GUHA 3SCVA 3A4AA 3HPZA 3SQSA 4PCTA 1JZ2A 3QV6A 4RZ4A 3G1HA 1W1TA 3KAOA 1MQRA 4G1KA 4PMOA 1VFMA 4UQCA 2A85A 4W89A 4KEMA 1KXTA 1O4UA 3T07A 1BQGA 3F5JA 3UCDA 3UERA 4FEZA 1J0KA 4B5UA 4MFDA 3UZWA 4IIEA 3A6OA 3GVQA 4O19A 4O0ZA 4M56A 1UWAA 3DG6A 3E96A 3KRUA 4PRWA 4DI8A 1MO0A 3N2CA 3VDAA 1IR2A 4BQ3A 1Q6DA 5HULA 3RX4A 1VBHA 4AZ7A 3CK5A 1H41A 3EWDA 4LCRA 2Y7DA 4XZWA 2OGJA 2J66A 4DJDC 2QCDA 3JUGA 1UWIA 3HM7A 4ADUA 5L9FA 2OTDA 3LY0A 5TIMA 3AYSA 4DF1A 1EL3A 5G4HC 1KRBC 1QPQA 1HVQA 3B0PA 7XIMA 2DFAA 3B8UA 4RKAA 1FWDC 4GUFA 3AO0A 1E6SM 3S3GA 4UQ9A 2GOUA 3MANA 3DERA 2DEPA 3DI0A 4ZGYA 4K8GA 4R5EA 3O0KA 1O95A 3ZXWA 2J74A 1NOWA 1J6OA 1ICQA 3WLRA 5M1TA 3G1VA 3DFQA 3RM8A 4IP7A 2NXGA 2WVUA 4WCJA 4K3ZA 4E2BA 4DJDA 3CT7A 1DJGA 1PE1A 2Z4GA 3P82A 4DXVA 2GGGA 5HNNA 2ZRWA 7A3HA 4RUBA 2QF8A 4GQ0A 2RUSA 4L5ZA 4N4QA 4M29A 2PWEA 4JFSA 2HPIA 3VD7A 5AECA 5I6SA 1GCYA 1Q4NX 4EXBA 5KZMA 2OKOA 3K1GA 1RR2A 4O1AA 1AG1O 3FXYA 3L0KA 3CUZA 1EJ7L 2RAGA 2Y88A 4GY0A 2V8ZA 1V6UA 5A8NA 4Q4SA 3N25A 1YW1A 5FSEC 2CBJA 3A3XA 2WBKA 5DY3A 4IX0A 1VFLA 3B3DA 3MWCA 3ZLGA 2EHHA 3PTKA 1CXEA 4UFJA 3CQIA 1J10A 3M0IA 1M03A 3O15A 3L2LA 2E9LA 4DZHA 2VDIA 2FHBA 4AC7C 1AL8A 2V5JA 1TUXA 3SSJA 4IUOA 3WDHA 3W88A 1JJKA 2C16A 3SCPA 3UYIA 2BY2A 2WWCA 3N04A 3V75A 3FS2A 4EP8C 3CPRA 5H8MA 3UGVA 5FD0A 4FOJA 2YXXA 3BANA 4KCWA 3ZLFA 4J40A 3DHDA 2WO5A 1TMHA 2DZWA 4GGHA 2VEFA 1Z69A 3M47A 1ZUAX 4PZVA 1TWIA 2PDJA 5F2GA 4GKTA 4UQEA 4XZHA 4ENLA 1GJWA 2E09A 2ZRVA 3VUSA 1F9CA 7TAAA 4N4PA 4S3AA 1MI3A 2W66A 4TX9A 2YLLA 4FF5A 3IJ8A 3WYZA 1PTGA 4LUTA 2BXVA 2RFGA 5CKSA 1QI0A 3DC8A 4CNUA 1JCXA 3BGJA 2Z7KA 3HA1A 1A5AA 3TN6A 4GIRA 4AWTA 3OZMA 3VOCA 3NDYA 2UY4A 4ML4A 3S4TA 3FJ6A 3M0YA 2PDBA 3MCNA 3HGJA 3GO2A 3ZMRA 5BXTA 3W73A 1OBAA 3TTSA 2A7NA 2WZEA 2BVYA 3TH6A 4YTTA 3LOTA 1K8CA 3LN3A 5CZSA 3E38A 2JKAA 3G1AA 1OGSA 4HPNA 3O07A 2GFTA 4MY1A 4AD3A 3ERPA 2DW7A 3MO4A 4JTAA 3E9AA 1UD3A 1KGWA 3WFZA 2FHCA 3CUFA 4IQEA 4KPLA 2QCHA 2OZ3A 2EKCA 4HHPA 1RVKA 4O10A 1EOKA 3MJYA 2V0TA 4XTIA 3MBDA 5HPCA 3URNA 9XIMA 2ACRA 4G2DA 3BW4A 2NQZA 3A23A 4TR9A 1MZHA 3FAWA 4PL2A 4Q22A 4ZCWA 3CH9A 4IP5A 1DQWA 5IXEA 4O15A 1J4EA 1HKWA 3STEA 1PWMA 4QR6A 3O2LA 4GE8A 1ZSXA 1R3VA 4JTTA 1VYSX 1QTWA 1QW7A 4OVXA 4TUFA 1JZ4A 1OC7A 1IZKA 1UD2A 2O9OA 2X30A 1ODUA 4A3QA 3F4CA 3QQ0A 4NNAA 4AIEA 1HN1A 1K4HA 1WKDA 1XIMA 2IQDA 3QV7A 1TV3A 3I7QA 2I5IA 1RK6A 3P62A 6CGTA 3L12A 3IEBA 1JEZA 4ZO6A 1NFPA 4Q3MA 1EPVA 3UESA 1MNZA 3LGGA 1TWZA 1ITQA 3PZIA 2QUMA 2V9DA 1TREA 3GNDA 4H7CA 1UBSA 4GVFA 5C7VA 3RO6A 3WLTA 2ZE3A 3BVJA 3GSMA 5D2TA 3BAXA 3AXMA 4O0KA 1E70M 1WXYA 2REQA 1WDDA 2VFEA 4Q7IA 2FKPA 2R24A 1DBTA 1M5WA 2V69A 1C92A 1Z6KA 1HIZA 4TVCA 1F2JA 3L0GA 2C91A 4QEHA 3T2QA 1OT2A 1HFBA 2IQTA 4LS2A 4QQUA 3R25A 3PS7A 1WX0A 2XGBA 5FJPA 1PO9A 2PBGA 1OIMA 3LBCA 3RUBL 3AROA 3EXTA 1QW8A 1J8VA 3GYEA 3L65A 5EBAA 3EDKA 3S1VA 3MUAA 4GI4A 4QFUA 3VKJA 2O7SA 4PMZA 5AN7A 4KBXA 2OZ8A 4N9EA 4O8RA 2JK2A 3B9AA 4DPPA 1EOMA 1C91A 4L1GA 4PULA 3KE0A 4YMZA 1EWDA 1OM0A 1S2CA 2ASHA 2C1IA 4LBRA 3DHFA 3P14A 1PTDA 2B31A 2JBMA 2PP3A 3PB2A 5LXEA 4NNBA 3NTYA 1PYFA 4AVNA 3NG3A 2OWCA 2E8YA 5K9XA 1K8XA 3MYOA 3A9IA 1GVRA 1P1XA 1YYAA 4GRSA 5HMFA 2OKTA 3VM5A 5CJMA 1TG7A 1QNPA 2ZA1A 2FZMA 3ANUA 2Y6ZA 3NQ2A 3CH0A 2XH7A 1X8CA 1EXBA 1TR9A 4I9TA 3H54A 5EMJA 1IWAA 3D6NA 1GWJA 3ABXA 5A8OA 3EWUA 4LBSA 1J79A 1GTHA 3CAVA 1G67A 2TYSA 3TN4A 2FTWA 1X6UA 3A24A 1IXQA 2HNHA 3PZUA 1E9IA 4NXSA 4JR5A 1VRDA 1VHNA 2ZUTA 1FTXA 1BF6A 2IKGA 4I7VA 1OFEA 3DECA 4FB7A 3R5EA 1L6FA 3IPWA 2V81A 4GABA 1V79A 1C8QA 2PP0A 1D3CA 1OCJA 4LVFA 1G01A 3S2LA 5REQA 1B1YA 4CCZA 1MXSA 3E02A 4MAVA 4K38A 1OFRA 4C1NB 3O63A 1KQYA 1M65A 1UOZA 2QR6A 3II1A 4YLWA 5HNRA 1U2YA 2DORA 5B7ZA 3RPMA 4ILSA 1WOAA 1UZ4A 3MJMA 4KIRA 1A4LA 4JHMA 1YKWA 5ABTA 2Q3RA 2HSAA 1E9ZB 1BYCA 2XU2A 4XIMA 4HOZA 3KEHA 4Y6GA 2RGLA 1J93A 4Y96A 1BWLA 3ARQA 1KLYA 4N9BA 3DGRA 2R91A 4O12A 2NQ9A 4YPJA 1XIFA 4M8UA 3L7RA 3TYUA 3D47A 5JU6A 4QCFA 4QCEA 4PRTA 2PD9A 3PTQA 4QS5A 2VD9A 5DY2A 4D6EA 3UWQA 4DYKA 3RLGA 4TVDA 1KFWA 2I16A 1IIHA 3UYCA 4A2RA 5BZAA 2I57A 4LV4A 2EPMX 5DMNA 3ME3A 4MB3A 4S3EA 3M0XA 3GHRA 4OZOA 2VZSA 3OLEA 4GD0A 3E49A 1W0MA 3QQ1A 4NIRA 3UT0A 1V3JA 5CPQA 3VX1A 5DBTA 1WUEA 3HURA 4L65A 3BV4A 2WZTA 3DG7A 1EUNA 1EXPA 1XBYA 4B9YA 1V6WA 3CZEA 1R87A 1IE7C 3MVIA 1W3KA 3SGUA 4C90A 2G4FA 2NQLA 2YKKA 3K46A 2GDQA 4MMWA 3WQWA 4I8YA 2DT3A 2D1ZA 1Q5MA 5B80A 1H5YA 4Q8PA 3P3BA 2VNCA 1KBJA 2ZADA 4IISA 1XIBA 1BGGA 2ACSA 1JI2A 5C6MA 3N34A 3T40A 4JTKA 2VKZG 2ACQA 1LT8A 1ESWA 3OLIA 4KCVA 3WL0A 1M68A 2RDWA 3E2VA 1LT7A 2YFOA 4L64A 3LCXA 2HQAA 1PX4A 2DV0A 4XBJA 4A3RA 4UOJA 3L4UA 3ZT7A 3VIKA 3SCSA 5C2GA 1EYEA 1F3WA 4E38A 1XYMA 5A6TC 1AJZA 4GBUA 1OCBA 1KWGA 1Y5VA 4XX6A 3I7SA 2PFHA 2Y7EA 3KCLA 4X2PA 1BTMA 3NFUA 4PBGA 2PP1A 2WC4A 2Y85A 4XZLX 1ISZA 4JKMA 2UBPC 4PMRA 4CQBA 3NO5A 1J0IA 2FPYA 5CXPA 4QDMA 2Y5EA 1K02A 1UR1A 5A2BA 1QI4A 3M0LA 2Q3OA 3WLQA 2XVPA 1TVPA 3U7VA 2XWEA 2X2YA 3V7PA 4GIAA 2ABAA 1JUBA 2QV5A 1B4EA 5ECVA 1FWEC 3U4FA 2CLHA 1SZGA 1DQUA 3ECQA 2ZDSA 3CTTA 1ECQA 2Y7FA 3CL7A 4RXGA 2Y5JA 4XO7A 2Z26A 4H9YA 5E70A 2V5DA 1QFEA 1X96A 2A4AA 4EXAA 2VWSA 3E6EA 1G7UA 3H6OA 4W5ZA 3EYPA 3U0HA 3UXAA 1ZS2A 1R3WA 2OODA 1ME8A 2CCRA 3M0ZA 5LGZA 5DANA 3P0WA 4ZODA 5AHNA 3SN1A 1NDZA 4HMEA 1KA9F 4RLIA 2I5GA 5CLTA 1UR3M 2ZA3A 3WNMA 2ZA2A 1SYTA 4AWSA 1UR0A 1ZP4A 2HBVA 3OOQA 3PJUA 3E74A 4PB5A 3KL3A 1UASA 2GGHA 1OX4A 6ENLA 2QUNA 4IJCA 2UZ9A 5LIXX 1E1FA 4W87A 4AZGA 4US6A 1YLVA 1TJRA 3W86A 3ZLHA 3EWYA 4H41A 3LXCA 4AF0A 1UKPA 4NY2A 1E71M 2YA1A 3MY9A 3THUA 2P76A 2FMNA 3TP4A 1RJQA 1DWIM 1THFD 1ISVA 4FNTA 2OQHA 2DVXA 5AB3A 3NEHA 1GQIA 3TROA 2WBGA 4HJWA 1B90A 1VJIA 4TOQA 1ALDA 1YTKA 1FDZA 3NCOA 2RH9A 1UD4A 2QJGA 1EJSC 3BAJA 4NYYA 1DIOA 1MUCA 3LPFA 4J3VA 1JDDA 1R47A 4NAEA 7REQB 3F4NA 5JH1A 3N9KA 1C90A 4DBUA 2BXYA 3GH4A 1VFHA 3BW2A 4QE1A 2VEMA 4ROPA 4S38A 4Y9MA 4PB3A 2J88A 2JF6A 3W7DA 1JYVA 4GYPC 3KX6A 1H2JA 3B03A 2Q8ZA 3GTFA 1DYSA 2ZQ0A 3TJIA 3WK3A 4A3HA 4XKYB 5DN1A 3NO3A 3KL0A 1VAHA 1DIDA 4DX3A 5H2ZA 3F1QA 1KXHA 3EWBX 1CGTA 1BYAA 2C6QA 2GUYA 6TIMA 2E8ZA 4ZXOA 4AMCA 5EPDA 3UXKA 1A3HA 4HTYA 1ZAHA 4IGHA 1HQTA 5A3HA 1PZ3A 1I9CB 3S1GA 3RCNA 5PTDA 3ORWA 2R94A 4KWVA 3LMZA 3B4YA 5D33A 1EA0A 4FR6A 4AHQA 1LRQA 1QOXA 3GXFA 4W7WA 4JEQA 4GYPA 1G4PA 2YXOA 5EMMA 2BVDA 1R86A 1JL8A 3WBAA 2OB3A 1EO7A 1FWSA 3S83A 2NUWA 2CITA 3UEQA 5LIKX 1E0UA 2J7EA 3TN5A 3VMPA 2C0AA 3WQFA 3PNUA 3IJIA 1WP6A 2FGBA 1EJTC 4AVFA 5KMYA 4QDWA 4INFA 4DUXA 1GOMA 3VCCA 1A5KC 4XD5A 1NWRA 4M5PA 2ISVA 3RLUA 3S2MA 4HB7A 3H4GA 2DSUA 4D2JA 1TPC1 5HQLA 2ZRXA 2F6XA 5F1UA 1R3RA 1D3GA 3AHZA 5XIMA 2P53A 3ICJA 3TLLA 3P84A 4JQ2A 1YPFA 3N73A 3CIXA 1BSLA 4I3GA 1TV2A 3W2NA 3ABRA 3WO8A 3EA3A 3LZ5A 1Q85A 3CV7A 2WMJA 5LSMA 3RM9A 2UY5A 3CQ0A 3W82A 4JICA 3T78A 2CLKA 3PVFA 1OCNA 1W5MA 4Y9PA 3QKZA 1ZCCA 2X1UA 5CLWA 1R7OA 4MWAA 1W17A 6XIMA 3M9YA 1OJXA 3ONBA 3WJYA 2QDEA 3BE7A 5A6SA 3EOEA 3MCMA 4DWSC 5CSYA 3F03K 1TTJA 2QMKA 3C5QA 1NM9A 1FWRA 1R8LA 2I14A 3R4IA 2WHLA 3DZ1A 4IMCA 1K6AA 1NSJA 1NOFA 5FIPA 5A94A 1MXGA 5KEZA 2WNNA 4ZQRA 4P5UA 2YGYA 3KS6A 1MEHA 1TV5A 1JD9A 1WV2A 4UNIA 2H8ZA 1K7XA 1EC7A 4WOQA 3ARWA 2WZMA 2GUBA 2HTMA 4LU0A 3TTEA 3ZWSA 5ABFA 1OSEA 3EMZA 3UZXA 2WMGA 4W7UA 1NDWA 4FXJA 3RAOA 2QDHA 5HMDA 5HQMA 2D20A 3HU7A 1OX5A 1S5MA 3CASA 4ACZA 3UCQA 4LQ1A 4DWSA 2V67A 3QYSA 1LG2A 1V0NA 1BVWA 4LYKA 2OO6A 1HJQA 4HNOA 1ADDA 1J96A 1QJWA 3VGEA 4FXSA 3KVKA 3ARSA 3OA5A 2CHNA 5BCAA 3VOHA 5F2IA 3F4DA 3MSYA 1FX6A 1L2QA 1F61A 3BZJA 3LRKA 2PTWA 4LSBA 4BI5A 3PPCA 2ICSA 5FA5A 1KGUA 3QN3A 3A64A 3R0KA 5K2ZA 1W1B1 2E4TA 3W22A 2Y63A 1XSKA 3EA2A 4B3LA 3MCOA 4QE5A 1U83A 3DFHA 3KP1A 3G1SA 1A5SA 4NASA 3DAQA 2DZBA 3GZAA 3VK5A 2WXDM 8XIAA 2OZTA 3N2MA 1PSCA 2EPNA 4K6AA 4MNKA 4CCEA 1Q6FA 3PTMA 3WMSA 4LUTB 2C1HA 1VENA 2YZ5A 2FVKA 1TZZA 1W5NA 4HJFA 4UTMA 3S5SA 2XHYA 1AVAA 4Q6JA 3FDKA 4UBPC 5IBXC 3QY7A 4YTRA 2E6FA 1NJJA 4NI3A 3W24A 3WBEA 1RK5A 4S3FA 3IRSA 4DYEA 2AAMA 2EKGA 5LNUA 1TVNA 2AGKA 1OG0A 3LI1A 2EPOA 2DZUA 1XC6A 5D9MA 1EO5A 2WCGA 4JTDA 1J01A 2FQIA 2QZRA 3EKGA 4R27A 5KETA 4IMEA 2XVLA 3W9ZA 4IPNB 1SFTA 5AC8A 3BG3A 3W75A 4GG9A 4PSPA 3AXKA 3BL3A 4DVOA 1VF8A 4CQ9A 1UW9A 4OBSA 4KWWA 3FN9A 4Y9NA 1WCGA 2F9RA 1KM2A 2DUXA 2ZVIA 1KBLA 4YHEA 3ABQA 5G5IA 1S5WA 2ATSA 4WD0A 1AW2A 3IACA 1UR4A 2WZHA 3BCDA 3IAQA 2ACUA 3GHTA 3GIQA 4LB4A 4PUWA 4DHGA 3GU9A 4DBEA 4R34A 3C8FA 4DJDD 1TPVA 4DLMA 1EF2A 3MI6A 2PGRA 2WHJA 3CIWA 2XVKA 1G5AA 1KCKA 4HK6A 1H7PA 3R0DA 2BMBA 5G2IA 3C2EA 1FCBA 4X3ZA 3S47A 1BEUA 1YXCA 1PIFA 2NX9A 3W6YA 3U57A 1M7OA 1UWTA 1XLBA 1DEDA 1LRTA 2OWWA 1XLHA 3AXHA 1JCJA 3KVJA 5K7JA 3A9BA 5HANA 1W5QA 2D3NA 3GDLA 1FCUA 1UH2A 1HJSA 3HFYA 5D9PA 2BSLA 5CH9A 2H3DA 3IIZA 3LD5A 4Q8UA 2B7OA 2REQB 2MUCA 3JR2A 2FTYA 1XSIA 3AXIA 3D46A 5DELA 3MP4A 1WDRA 4D6FA 4A22A 3LQGA 3KBWA 1J2WA 1JPIA 3KBSA 4UFKA 1KFCA 1RALA 3WMCA 2GJRA 3S42A 4Q32A 4UMBA 2QCEA 4K39A 2Q71A 2X0SA 1EJXC 3C2YA 1GVSA 3V18A 4YCPA 4LT9A 4JTRA 3RDKA 2QLYA 4F0RA 4I5RA 1ZB5A 4O4WA 1JPKA 3P61A 2PDQA 3NYZA 1XH1A 2BODX 4V1XA 2DPEA 1E0VA 3R8RA 1ONRA 1V5XA 4TV6A 4IG2A 4XAGA 1XKJA 1GOXA 1RA0A 1A47A 1UZ1A 2HWGA 3OW1A 3P8IA 4RK8A 1QAPA 5I79A 5I03A 4KEZA 1XSJA 3Q94A 4WGHA 4RZ5A 5H91A 2PWHA 1WUFA 4NYUA 1F3EA 1FKWA 1X38A 2YB4A 2PUZA 2Z6JA 1SM9A 1KTBA 2PWGA 1UKQA 4A8NA 1AQHA 2D2JA 2PBOA 5J8LA 1PBGA 4KKXA 1SO3A 4N2YA 3QLLA 3MI2A 3C6CA 4M81A 4AMAA 1SVDA 4PTDA 3IIVA 2NLIA 4ICMA 3REQB 3B4UA 4BFAA 4Y7EA 3U5UA 1AQMA 4L4MA 3MUY1 2XM2A 2INEA 3I3DA 4RNIA 3MO7A 1I45A 3SY8A 3L2MA 3WF2A 4C7DA 1E56A 5EFFA 2QPSA 4AWUA 4D6IA 4JZ5A 2VC7A 3DC0A 1I1XA 5I07A 2QS8A 2ABBA 4S3JA 3WJXA 3HB9A 1F05A 3W2JA 3BLKA 3EAUA 3GDTA 3UY8A 3TIMA 1H50A 3L4WA 3SAZA 3N2OA 1UR9A 4D6HA 3VKCA 4V2XA 3W1AA 4JX5A 2BOGX 3GFZA 2GGIA 3RU6A 3BV7A 1SSGA 1PCKA 3HZ3A 4IPJA 3EB2A 2HMCA 3TW7A 1J5SA 2CHOA 2GVJA 3OG3A 2E68A 4MSSA 3MWAA 1VFFA 3R79A 4M82A 4Q6XA 1IT0A 3IVSA 5EYWA 3UR8A 1YXYA 3VNLA 4MWAE 3E12A 2FH8A 1CIUA 4PSRA 1MMFA 3K8LA 4R9XA 5I3HA 3G6MA 4GH3A 1S2WA 3SIZA 3AIBA 3TA9A 3WUEA 4XAPA 4H01A 4XZMX 3KHDA 1S39A 3CEUA 1B4KA 2WNWA 1XD1A 5AOUA 1BLIA 1JGIA 3H8AA 3DX5A 2XIIA 2YSWA 1Q2RA 3GVVA 1BYDA 3WBYA 4PCFA 1XINA 3H70A 1B54A 3BSHA 4TTGA 3H4XA 4JN6A 5BXRA 3B8IA 2ZUUA 1DORA 4GCAA 1VCFA 4ASTA 1U33A 3F5KA 3AMKA 1JDEA 2ZCGA 1W3HA 2Y61A 3F2DA 3VGHA 1T5AA 1A5CA 1PJ9A 1US0A 3V36A 3UVIA 1TV8A 3UA4A 3Q65A 2VX6A 4ERGA 3EOLA 5ABHA 3NWRA 4C6KA 4D6DA 1VCVA 1O1ZA 1DP0A 2HEJA 3LCFA 4DJEC 3MDWA 3CYJA 3V5CA 3CHVA 1T41A 3PBYA 4M51A 5CZTA 4J4KA 1UBPC 4X2RA 4HN4A 4QITA 2PEVA 4DBSA 3A5FA 3TWAA 2ZX8A 4Q4MA 1R2SA 2V82A 5LXXA 4P8WA 3GVRA 3S5YA 1UWRA 4ZQOA 1A0DA 1AQFA 4KETA 4L9YA 4GJ1A 4FLSA 4J35A 3G1XA 4EF8A 5C9RA 4Z2IA 1OWQA 4I8DA 3CWOX 1P0BA 3WX7A 3LHVA 4JTFA 3QQWA 1FH7A 1ONWA 4QP0A 1DXFA 2DT2A 5EA9A 4Z2KA 2NX3A 3A3WA 3ITYA 1XC4A 5CC3A 1E9YB 5DQPA 3WIJA 3W7RA 2ZX9A 3VZZA 4PMJA 4DJEA 4H7ZA 1FXQA 1TWDA 2JIWA 3SW6A 3AZSA 2EQDA 3TVAA 3VNKA 1UD5A 3MHUA 1DXEA 4PTWA 1Q6GA 3QM3A 3D0CA 5ABGA 2VI0A 1K8ZA 2G3MA 4HTBA 4Q7NA 1F4HA 3CAQA 1LLOA 2C0HA 5AHEA 3RITA 3WQDA 3GXTA 2VYOA 3LHTA 3B97A 3MUXA 3LXBA 2EG6A 2HRWA 3DFTA 2Q8LA 4DUWA 1ZJHA 3QMTA 5DMLA 1ELSA 4UXDA 1VR6A 3CGTA 3SCOA 3FW6A 3UNDA 3FKKA 3K2GA 1Y7VA 4IMDA 1VP5A 3WD4A 2OOFA 2G3FA 3L67A 3DESA 3I3BA 4CD6A 3G1YA 4B5VA 3EOOA 4W8LA 4LANA 1LL7A 3HQNA 3VD5A 1OG6A 2ZRYA 1JCYA 3Q4DA 3U2ZA 1TFVA 8XIMA 4HNTA 3FA4A 1TRDA 3EKZA 1PIGA 3QEZA 5M03A 1OFQA 2CIPA 2WAGA 2O7QA 4M80A 4ZB0A 4UTJA 1A49A 2NVAA 1ITCA 1VIZA 4PMXA 2VUYA 2ISFA 2FIQA 2TRSA 2XISA 1SMAA 4K7VA 5FAGA 1E4NA 3T0CA 3CB8A 4NZ4A 2RDTA 2DW6A 2ZXBA 3NL6A 1QNRA 3EXRA 1E6NA 4NJHA 2YW3A 3FYPA 4UR7A 1JRCA 4IPIA 1O60A 2WV8A 4NZFA 3LLXA 3PFRA 5CJNA 5GJMA 4MJ4A 2OLHA 5HDRA 2YFNA 3URQA 4GACA 3R10A 1OX4B 4XIAA 2J77A 4FLOA 4TTUA 4HPGA 4IXHA 2QT3A 1D3HA 5FACA 1ME7A 1G7VA 2G4JA 4GUJA 3OGSA 5U7SA 1C7TA 3R13A 5A2CA 1G9HA 1SMDA 4EANA 4O0QA 4AF0B 4LNCA 3ALGA 3AMLA 3A3HA 1GT8A 1FXPA 1XBVA 3PHAA 4M6VA 4QEEA 3SDOA 1VBJA 4I6KA 4IZGA 3LV6A 3WDQA 4I9AA 5E09A 1KBBA 4J3WA 3NL2A 3RXZA 3TR9A 1ME9A 1XYAA 2IPJA 1H7RA 2HBXA 1EC8A 2J9ZA 3AS1A 4JHZA 2FZDA 2OX1A 4QNEA 3OZOA 3GS6A 4O50A 1FWHC 3RLHA 1SW3A 2D2HA 4S23A 1DJQA 4LNYA 4H04A 2OYLA 3N9RA 4CVWA 4UTKA 1JUKA 4UNLA 4AEFA 3SRKA 3AWOA 1XIGA 1AH3A 1FBAA 4S2CA 3O6CA 2PB1A 3R89A 3SUWA 3BURA 3WNPA 3C3NA 3E2QA 3B0XA 4F2TA 3KUMA 1UA3A 1GZGA 1E1EA 4BEUA 3G18A 2J6VA 1R38A 4MNJA 1LDCA 4B5TA 1GOQA 4IT1A 4HU3A 3N4FA 2ZUWA 3OQ8A 3IJDA 2DIJA 1R5YA 3AU2A 5ABEA 4HD5A 2BGQA 3HQ1A 3FX4A 2P5NA 2X09A 5B7YA 1MW2A 1AK5A 4AIBA 3O8AA 4MYXA 1GKQA 3EZ4A 5EMLA 4GMEA 4DRSA 4ZOEA 1KM1A 1JG9A 4GX9A 4O13A 1UD6A 3GDBA 4PE8A 2YLAA 1W3IA 4BI6A 1GG1A 3LSBA 3K8MA 5CGTA 4Q8VA 3N3TA 5I09A 5DFAA 3O0FA 5FEWA 4UUIA 3ZJ8A 1DWJM 3ARVA 1E9LA 3UQNA 4HNVA 3VM7A 3M0JA 1UROA 3G2GA 4HPJA 4E6MA 1NP2A 3FY1A 3UGRA 1E1CA 5C70A 2DZVA 3HPAA 3WEMA 5FAJA 3W00A 3SCNA 4XO6A 2Y8UA 2VDHA 2OMAA 4PMYA 1E5JA 1M7XA 3VD4A 3CUJA 4MPKA 2JIEA 3WQ6A 1J6PA 1V3LA 3B8TA 3PUEA 3NO1A 4ALDA 1OIFA 4IQJA 4XQ6A 5D09A 1ITUA 2F61A 4S39A 4NZ3A 1XIJA 2BLEA 3B0UX 2GJXA 5KITA 2TPSA 4GJIA 2OYMA 4JCLA 4QBXA 3NM1A 4Z42C 3NGJA 2WPGA 1KFJA 5CQ1A 4JKLA 4LRTA 4W85A 3T1GA 3L66A 3VGDA 1OZMA 4ADSA 5D8ZA 3VABA 2W79A 3DENA 4C6QA 1GHSA 4DELA 5T26A 4MWAB 4JS3A 2Q02A 3S1WA 1DIKA 1JQXA 1U30A 3VX0A 4IFKB 1E6PA 3RPDA 5DRCA 3CZJA 5BMXA 2QJHA 2IXUA 4LY8A 4B4HA 4DM1A 4IWWA 5HK4A 2WZIA 2VCAA 3CM4A 2NX1A 4ZOBA 3IK4A 2Y89A 4MDPA 4RE0A 3IVTA 3SI9A 5FOOA 3LB0A 5JBFA 1BXBA 5I3JA 2HZGA 4WIWA 1FKXA 4EPKA 2PLJA 4NI8A 4H6RA 3TONA 3W6LA 2XSBA 3VILA 4PC8A 5E0KA 3GVWA 4LGXA 1ZJIA 5ABFB 4GI9A 4JHOA 4NZJA 3A13A 2ADAA 2CU0A 4UFIA 4YWSA 2GPTA 3VDHA 1PX8A 1WXZA 4LC8A 1P0NA 4NP7A 2DT1A 4LF1A 4ACZB 4DWSB 2BS9A 3UVAA 5CEWA 1QWGA 1QHOA 3ES7A 1H7OA 2Z1VA 4K68A 2PTYA 3WLKX 1D2KA 3LGEA 4LW7A 3T0TA 4JL1A 4J3XA 4HMNA 1LJYA 3G3DA 1YTDA 4ZL1A 1OADA 1QPOA 3UXIA 6PTDA 1XIIA 1OFDA 5CPOA 3S46A 1XGEA 2PF0A 1MEWA 3LQLA 3PC0A 1JCNA 2Q8XA 4XZIA 1FWAC 1EIXA 1X8FA 1IGSA 2Z27A 5K4XA 2X2GA 4TX8A 3BICA 2ZTKA 3PP7A 4CQAA 1LUCA 1AODA 1QT1A 2PGWA 2PD5A 4R88A 4ES4A 1N8WA 3G1RA 3N6HA 5J04A 3OGVA 3HF3A 3STPA 3TK7A 2VTFA 2YJQA 4DUOA 4PTNA 4Z2HA 3OTRA 2WVTA 1Q7QA 2O92A 4C6MA 2CLEA 3RYSA 4QRNA 1UQZA 2C79A 1XFCA 4UTWC 3KS5A 2YCJA 3MMTA 1YQ2A 3JRKA 2HE8A 1EZ2A 3LM3A 2V3DA 3S5NA 4D72A 4LFYA 4W5UA 2B7PA 3G77A 2F38A 1T7LA 3VIPA 3F7JA 5MKGA 3LNMA 4BK9A 1XPGA 4D1IA 4PCNA 5DBUA 1TV4A 1NH6A 5AVNA 3F2CA 1QK0A 1RVGA 3UETA 1XP3A 4LXFA 2E0PA 2Q6ZA 1I60A 1IV8A 2PZ0A 3TA6A 4HK5A 1SGJA 1U5JA 1X6NA 5CG7A 5LA0A 1HT6A 3NZPA 2YA2A 3AIRA 3IJ6A 4Z08A 2IUZA 2C18A 3A4JA 1OGBA 4JNYA 1FWJC 3HGSA 1G69A 2PDUA 3EOUA 3PNZA 2FB3A 1IHIA 3NVTA 4UTWA 3KP0A 1AD1A 4J9JA 5G1YA 5AYIA 2J7DA 3SECA 4WXZA 3NDZA 1RUSA 3Q67A 2ZZ3A 3NQEA 4IIBA 5KZDA 3LRMA 3RCYA 1TE6A 1V6XA 3H22A 3UG3A 1V51A 4XK2A 2PU1A 2E67A 4Y90A 3VNDA 2V5BA 1Q3NA 4LAZA 2G95A 1I4NA 3STGA 2PDGA 1UZHA 1Y5XA 3ANVA 4ATLA 2QULA 3S6TA 4NRSA 4DIAA 1EJVC 3ARTA 4NZ1A 4JTCA 1UCWA 4NZ5A 2E25A 2BY3A 4POCA 4JD4A 4O17A 1R85A 1AQ0A 4E2VA 3XINA 3PN8A 4YIWA 4ATWA 1XLKA 4NG3A 4MFEA 5H6HA 3TJLA 2NVCA 3WBXA 4Z2LA 1GVEA 1HG3A 3AIUA 1CTNA 2FDSA 4H6QA 2XSXA 2GGEA 3THCA 3AMGA 2JGQA 3QF0A 4XD3A 4BQ4A 3GG1A 3ZR4A 1TKKA 2WMIA 4S3KA 3KXQA 2R82A 3DOPA 4E5TA 2VFFA 1F8IA 4IPPA 1GORA 3WNLA 3E0FA 5A5WA 1UR2A 3MSGA 4JN8A 3QYQA 2D0FA 1IIGA 2R9RA 1WZMA 2WKJA 4LYQA 3B9EA 3BLDA 5A69A 1MSSA 1DWHM 1TZ9A 4QG6A 3FVDA 1DWAM 1U5VA 3W2MA 4EXQA 4AHPA 3ABZA 3CO4A 2DSZA 4NAFA 1GG0A 1R3QA 4X63A 4DBWA 4IP4A 2Z24A 3WD2A 3C3UA 4F9DA 1ZGDA 4XZ9A 1YBQB 3OZPA 2YDAA 2PRLA 4DUVA 2JKEA 3N3MA 1RD5A 3WLNA 4MKSA 4F79A 1XWYA 3DKJA 3TEVA 3SUUA 3DIPA 1H7NA 2A3BA 2C15A 2BP1A 1FWGC 4HU0A 1VFTA 4LAMA 5E0FA 1KV5A 3LSCA 4HGXA 4TMBA 3GC4A 1RBOB 4IG2B 2EG7A 1ZY9A 1XBZA 1H1ZA 1WYIA 1EHNA 2A7PA 3QW4B 3W76A 2JGYA 8CGTA 4JFVA 2A7RA 4YVVA 4F48A 1DWGM 4MG4A 4JNZA 3UF9A 3NIYA 4TMCA 3ARRA 3QGKC 2NSXA 4AZ6A 3P8JA 1P0KA 3TNBA 1TX0A 3TYDA 4JYDA 3LLDA 1CGUA 3QOMA 5HATA 3AJXA 2VEGA 1GKRA 1NEYA 2OYKA 1W9UA 3D3AA 4MKVA 1GUVA 3M0KA 4AAJA 4D1JA 4D71A 5XINA 3R8HA 3W4RA 3KOYA 3S5OA 4GC4A 2P50A 5CBJA 3QRHA 1VFSA 1KNWA 3AIVA 4UQAA 3UCCA 4CLMA 1M1BA 2FGZA 4GA8A 4L1XA 2G0WA 5IHSA 3AMDA 1MW3A 1WXJA 3O06A 2HISA 5TQLA 4MJMA 4NJJA 4JNMA 4AD2A 3R11A 4E4FA 4MY8A 1BRLB 3PJWA 3T05A 3TYAA 2V2CA 5D9OA 1H61A 3RRAA 4L9XA 5FSDC 3MKVA 2NUXA 4HPHA 3ITLA 4Q8MA 4U3CA 4CU7A 4ZQCA 1A5LC 2GDVA 3MT1A 3NQVA 1DJNA 3UWZA 3NZGA 3PZQA 3PF3A 4OGZA 5GNXA 3D3FA 4KERA 3H23A 9RUBA 1PAMA 4DAIA 2CWNA 3HG5A 5C55A 4ZA0A 4CU8A 5C9WA 3HMJG 1ZP3A 3AMCA 3FJ4A 1BKHA 4NNCA 5AKQA 1QVBA 3FA5A 2INZA 4B90A 1KCLA 1PX3A 4ZENA 2JFEX 3DHPA 1REQA 3GR4A 4BWLC 3CUHA 4JCMA 1K77A 1VZWA 1JF5A 4D8AA 8A3HA 3MUIA 4GLEA 1CXHA 2EXOA 2WM1A 2WSQA 1FH8A 3GR8A 1AW5A 4R33A 5IFPA 4C60A 5G4WA 4DY1A 3KVMA 5D9NA 5LHFA 4GKLA 4DBDA 3V0SA 4FHAA 5HJYA 1YEYA 2Z25A 4PH6A 4JFUA 5SWUA 1LYXA 4RCXA 1J0ZA 1LBLA 1C9DA 4CGTA 4KEVA 4BR1A 3R94A 5D2VA 3ZSTA 4MOZA 4HHHA 1RLCL 3WLOA 2OT0A 3HOJA 2G50A 1RPXA 3TAOA 4RZBA 3TQVA 5AYXA 5IDZA 2VGFA 2RKXA 3CU2A 2CZEA 5MHBA 2J27A 1WDQA 3M0MA 4BWLA 2WHMA 4RXFA 1XUUA 3WFLA 1Q45A 4RR4A 1RY8A 1W54A 3DFYA 5A6LA 3ENLA 2L5HA 2UWFA 3DI1A 3KDOA 1EQPA 4HA4A 3R1ZA 4EPEC 1WA3A 3IJ9A 2J13A 4GI8A 5I0DA 1UKSA 4UZUA 1XLJA 2DU2A 3SUTA 3V0TA 1XG3A 1X39A 1VRXA 1P7TA 4Q4QA 1UP2A 1ZFJA 4FS9A 5IFTA 2GWNA 5G2HA 3AYTA 3JZUA 3V1PA 2BX7A 2ATMA 1J0JA 2A79A 3NQMA 4ZO8A 2PDFA 2VFGA 1OX6A 4C6BA 3MUZ1 3LZ3A 3G5EA 1ENUA 2G41A 5J5RA 4N6EA 3ALFA 4W88A 3GBDA 4MNLA 1QDSA 3SCUA 3LU2A 2Y0FA 3B05A 5ECUA 2V2DA 5BU6A 3RX2A 2D2GA 1ZQ5A 2DSKA 4A21A 3QR1A 2CPUA 3QW3A 4XTDA 3G8RA 4GFIA 3KCOA 1W6TA 2QIWA 4CNNA 5AC7A 4GIEA 3VIFA 3EGJA 4O8AA 4NVTA 5A6KA 1QXLA 5DXYA 3LYEA 3OYZA 1LROA 1F3XA 1JXJA 3WQEA 1X1NA 3QMRA 5FKYA 1CLVA 1E3ZA 3PPFA 3QY8A 4JQ3A 3RRXA 1NIUA 2J7BA 3QV8A 3W7JA 4GHRA 1ZJAA 4NT0A 4UFMA 2ZZ5A 2PMQA 2Z2AA 1W9PA 4ZMGA 5BXPA 1FHUA 3CV6A 3MC5A 1TB3A 4IFRA 1V93A 3OYXA 1CWYA 1EP1A 3KTCA 3NPUA 1A0EA 1Z89A 1R7AA 4XSMA 1PPIA 4BA0A 3J7HA 4US5D 3B04A 2PF8A 2FTPA 7ENLA 1W31A 3H7RA 4A05A 3O16A 2WYSA 4E2OA 4OU1A 3TJXA 3FXGA 1GYMA 3CUGA 1W2VA 1NFGA 1W3TA 4PUEA 1K9FA 3W81A 4GJJA 2VO5A 1XYZA 1H60A 1F3TA 2ZZ2A 2CEQA 2YDRA 2POTA 4HYWA 1E6XM 2H6RA 2W63A 5K9CA 4JYFA 2QJMA 3EB4A 2XGZA 3KBMA 3GG0A 4EPBC 1TTIA 4QJ3B 3L2IA 3TTQA 1YDOA 4FOUA 1O5RA 4IHCA 3EPOA 5T9BG 1CENA 4XZNX 1BGAA 4Z1CA 5CSUA 1LP6A 3NL5A 4YL2A 2J8TA 1E3XA 4MLJA 3N29A 3ABSA 1JGMA 3DFPA 3FDGA 3ZYZA 1P5BA 4XZBA 4GXMA 1JDCA 4OT7A 2V63A 3DG3A 2ZX7A 3T0AA 1ZBVA 2PGEA 1OK4A 3M44A 5CC7A 4MB4A 3L23A 3FEQA 2W6RA 3N9SA 3LPOA 3M5YA 1JYXA 2RHGA 4LWWA 3LHUA 3NM3A 1K7EA 2GQAA 4U3AA 1DE5A 3CO8A