3OVRA

Crystal structure of hrpe and d-xylulose 5-phosphate complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovrA00
4RCXA 3P8JA 4I7VA 2E5CA 4ZQPA 2FPVA 3G1XA 3QC3A 3ZWTA 2RHGA 1W5QA 4MZ8A 4UTKA 3P80A 3ABQA 3NYZA 3I6RA 2C6QA 1IXPA 4JX6A 3PG9A 2AGKA 4X22A 3TA6A 4UNLA 3G0UA 4XKYA 1LOLA 1QOPA 4MFDA 1DBTA 1OFDA 4MKNA 3RMJA 3EWBX 3W7QA 4OU1A 2Y7FA 3P60A 2YGYA 2BWGA 4NJGA 2BX7A 1J4EA 1VR6A 2C15A 1W1ZA 2GPTA 4R34A 1XCFA 2C1HA 2B7QA 2OX1A 3DZ1A 4C1LA 5DXXA 4IWWA 2C0AA 2QCNA 3M7WA 3M6YA 5KZMA 4UFHA 3I7SA 3DGRA 3TX9A 4UFLA 4N9EA 3DU0A 3QPYA 3KXQA 3W7PA 2Z1BA 5FF2A 4JTTA 1B4EA 1TQJA 3TW7A 2G5WA 5AB3A 2JK2A 2EAWA 3N3MA 1LCOA 2WPBA 3LRKA 5DELA 4JTIA 2I9EA 4LVAA 3G3DA 4JR5A 3QEZA 3UWQA 4KFOA 2NLIA 4CQAA 1ZNNA 3S5ZA 2ABBA 3BVJA 3BLIA 3TE9A 3QMSA 2P10A 2CLOA 3I7QA 1OK4A 1K7EA 3F4NA 5BOOA 2W0UA 1SO3A 4MYAA 4IMCA 1JUKA 2NX9A 1JCMP 5IBXC 5HWJA 1MSSA 4HNNA 1OX4B 3P8IA 5E93A 2PCQA 2ISWA 2YCEA 2UV8G 1DVJA 2ZRXA 3BLEA 1ZAHA 2ZZ1A 3DKLA 1KA9F 3W6YA 3C8FA 3W1NA 1R2TA 2VFHA 1LOSA 4X3ZA 5KTLA 1O95A 3S1XA 4UTUA 1RQBA 1KM1A 4IMDA 4UTWC 2ZRUA 1FBAA 3GYEA 3EWYA 2GVLA 4NVTA 3ZS4A 4JTUA 5LHFA 4N2YA 1SZFA 4B5NA 2CZEA 1GOXA 3HPZA 4O53A 2V81A 4ORMA 3R12A 1S3HA 4ZVJA 4TO8A 2JGYA 3P62A 3VFLA 3T78A 2CZFA 4A3UA 3TCEA 5I3JA 1AMKA 4NJJA 1PE1A 2YFOA 4UFJA 3W1XA 2Y6ZA 5AYXA 1GT8A 2CZ5A 3GVGA 3C52A 1GZGA 1PV8A 2B0MA 4Z08A 1LZOA 4HIBA 4WJEA 1O60A 4O15A 4K7YA 1GQNA 3NQEA 3TU9A 2HTMA 1XFBA 1EEPA 2YFNA 2AQWA 5D30A 3B0UX 3CWNA 5I3KA 1XBYA 3RLUA 3MP4A 3DH7A 3HO8A 3S9YA 3L2IA 3LBMA 1GVOA 2NWSA 5HULA 2GVJA 4R33A 1K3UA 3IVTA 4FNRA 2JKEA 4UCGA 1Q6OA 3PF3A 3UWUA 4HPXA 3W7JA 5I3GA 2QCDA 3TH6A 2FDSA 1IXOA 2VFDA 1XDMA 4AHQA 5HJLA 4CQ8A 3A5VA 4EWND 5A8GA 5MHBA 1A5CA 2YX0A 1SPQA 2V30A 3KAOA 1JCXA 2GOUA 3GDKA 3MYPA 2B7OA 3RLVA 1TJRA 1LTDA 1PHWA 1TCDA 3SSJA 3TQ0A 5BW6A 1E51A 1S5TA 4JS3A 2BTMA 3DFSA 2EHHA 1OVDA 3TDFA 3NO5A 1S5WA 1K8ZA 3BV4A 5CGQA 3PC0A 3H55A 4GJ1A 4UTJA 4JTHA 1TRDA 2GQ9A 3S1UA 3N73A 5G5IA 4RR4A 1H62A 1Z44A 1A5SA 2C18A 1FY6A 1DV7A 2VENA 3LRMA 4N4QA 5DN1A 3OVQA 1QOQA 1FDZA 2QUUA 4K39A 5F1UA 1SO5A 1A50A 3IIPA 3TROA 3S8HA 1P0NA 3CHVA 4O13A 1YXYA 1TPB1 4JTEA 3QRHA 3EXRA 4WOZA 3L5LA 1LDCA 3BARA 1VYPX 3O06A 4H3DA 1LBFA 5FEZA 1F73A 1OFOA 5BNKA 4AWTA 1UUOA 2QCFA 3GXTA 3UY8A 3A24A 3FJ6A 1A5AA 1H1ZA 1OYBA 1H51A 4XZ9A 1YDVA 1OX6A 2F84A 2VFGA 3LCWA 2JBMA 5K4XA 1YPIA 4GWEA 2A21A 4MY8A 1T99A 3NQ7A 4LV4A 3TXVA 3TIMA 3CEPA 3LDVA 5DCDA 1S5VA 2NWRA 3W72A 2FPYA 2ZZ2A 3F03K 4OV4A 4AH7A 1VJIA 3TNOA 1AK5A 3PBVA 3THQA 1Z42A 4O16A 3VNDA 7TIMA 4DEFA 5EKYA 2C3ZA 1KBJA 1OFEA 1QPNA 2YR1A 1I2NA 1TREA 4JTGA 5C2XA 3WK1A 2H3BA 4LC6A 3CB8A 1BKSA 1X1ZA 2H3DA 3W7OA 1RR2A 1KM2A 4O52A 2AAMA 3MO7A 2E6FA 3R13A 3RNDA 3M5XA 3RK8A 2V5BA 1TV5A 3NM3A 4DPQA 1KV5A 1WYIA 1ICPA 5DCEA 1W54A 1ZY9A 2VXNA 1VS1A 1OF6A 1IIGA 1LYXA 4RXFA 3W1RA 1XC4A 3W1PA 1IXQA 3I7RA 4UMCA 1KLYA 5G1TA 1VPXA 5HINA 1TPEA 2A1YA 2R8WA 3LERA 5C55A 3L65A 1R2RA 4IPIA 4O57A 4EIVA 4GXMA 1K02A 4UTTC 4Z1DA 1GVFA 1SZNA 3L0GA 3G1VA 4ORIA 3STEA 5L6UA 1FWNA 5EA9A 1UCWA 1G4EA 3LCXA 3EX3A 1SSDA 1AW1A 1IF2A 2CWNA 4JYDA 3L0KA 1SW7A 2YPIA 5G4EA 3EB2A 3NQ2A 3E9AA 1I8JA 1KW1A 3LCHA 1UUMA 4FF7A 1FWWA 3CWOX 4AWSA 4WD0A 3HPXA 1TV7A 3W1LA 1GPWA 1YDNA 3O8AA 3NL2A 1OF8A 4A2RA 3PG8A 2VEPA 4PA8A 2VC6A 1Z41A 1GEQA 1C9DA 3G22A 5HUPA 2ZCGA 4OBTA 1HUVA 3JS3A 3QYQA 2PE4A 1TTQA 3QW3A 1MO0A 2ZRYA 1AL8A 1TTIA 4OV9A 1PS9A 3NM1A 3O15A 4UTIA 1ONRA 1KTNA 3PULA 4O8RA 3NQMA 3C2VA 3RF9A 2C16A 1G7UA 2V2CA 2X1SA 2Y7GA 5I3IA 3WJZA 2DZVA 4K38A 2NX3A 3QPZA 1KFCA 4N6FA 4PODA 1F6PA 3P81A 3USBA 3UWZA 3STCA 4N9CA 4JTJA 5CPNA 2EPHA 3DENA 4MFEA 1FDJA 1W31A 1TQXA 2FB2A 1DORA 2GUUA 5J5RA 1OFRA 4IMGA 2VFFA 3ABOA 4O54A 3ANYA 3VKJA 1FCQA 3W7NA 2JKAA 3W7KA 4UFIA 1SO4A 1R46A 4NUWA 4MZYA 2DJLA 5HNRA 3WK3A 2A4AA 3I65A 3QQ0A 2ZTJA 5BRBA 4N02A 4UMAA 5DCBA 3S5NA 1D9EA 3QMTA 1FXPA 4JYFA 3HJZA 1TPC1 1W3IA 5CPMA 2Z6JA 5K9DA 2GJNA 3UWWA 3ELFA 1KFLA 4MY9A 4I9AA 1AL7A 2YDAA 5AC8A 1F76A 1YYAA 4O1BA 4A29A 1HO4A 4HKPA 3DI1A 3W2LA 4MJMA 5DLCA 5A5WA 3EKZA 3PWAA 4EF8A 1YXCA 3HGSA 5F4SA 3FYOA 3NQCA 4HHPA 4CQ9A 4ZQNA 4HSNA 5AN7A 3MHGA 5AC6A 4Z1BA 5LNUA 3FEMA 1L6YA 4P2VA 4UNKA 1GJPA 3O63A 3TXZA 2J24A 2E5BA 1FCVA 5D2YA 2BSLA 2Z6IA 3DHDA 4JTSA 5LGZA 4LW7A 4P61A 2ZA2A 3EX4A 4NT0A 4NNAA 3W07A 4LVGA 3O07A 5IBXA 1GYNA 3TW6A 3W7EA 3W76A 2A6NA 3CU2A 3LXAA 2X2GA 5FEWA 4LVDA 5AHFA 4WQ6A 2VOMA 3LXBA 1XL9A 1JCYA 2CLIA 4RK8A 4M5PA 4Y9AA 1QO2A 3O05A 3ABSA 2E6AA 1DOSA 2V2DA 4BR1A 1KLZA 3LM7A 4GUJA 3SIZA 3GNDA 1YADA 2Y62A 4X9SA 3GB6A 4MLJA 3B03A 1JVNA 1WXJA 1ALDA 4JIPA 3GLCA 1I2QA 2A7RA 3IGUA 5DY3A 1NF7A 3N2MA 4AXKA 5ABTA 2OMAA 5F2LA 3UWYA 2QUVA 4MPQA 4NNBA 4XTDA 3BG9A 5HR7A 2A7NA 4G1KA 3NPUA 3KFTA 3NXFA 1JUEA 3Q94A 3MW7A 3KHJA 5K4ZA 1Q3NA 5F2IA 5K3VA 3SW6A 3UPWA 3HGOA 2YYUA 1YTDA 3GDTA 1DL3A 5F2MA 5EMUA 3ZWSA 1ZALA 4NZJA 4BWLC 3EWZA 4N9DA 5D09A 4M7TA 1CW2A 5SWUA 4RXGA 3UXAA 2A85A 1QCWA 2J88A 3M0ZA 3N2XA 4GBUA 2QJGA 3U8GA 1B57A 4FIRA 3TSDA 4LVFA 2ZYFA 5LGXA 4O10A 5D04C 1ZAJA 1JJKA 5H2ZA 1I2OA 1JCNA 1FQ0A 3TFCA 4HNVA 3G24A 1W56A 1CI1A 3MP3A 1VYSX 4FNPA 4BI5A 3HMJG 4RZ4A 3W7LA 4XTIA 2D73A 3NPWA 1TYGA 1GVRA 4OGZA 4PFMA 1LROA 3P84A 3M44A 3TSBA 1NVMA 2ZA1A 4MIMA 3GKFA 4U4MA 3JR2A 4MVAA 3E02A 3WJYA 1P1XA 2X1RA 2E77A 2DZSA 1T0OA 3LCGA 2V8ZA 4TR9A 3MI3A 1R30A 3E0IA 4ICNA 3T4CA 3NZRA 2YZRA 4GC4A 3HG4A 3C2EA 4X2RA 1HO1A 1JQVA 3QM3A 4O1DA 1K8YA 4RV8A 1GVSA 1OYCA 1Y0EA 3C0JA 2PC4A 4O12A 1UJPA 2VFEA 4BI6A 5LNSA 5TBOA 4K6AA 1XDLA 5I3FA 3N9SA 1UBSA 5H91A 2ZRVA 1W5OA 2QCHA 4LS0A 5KINA 2WSRA 3W2UA 4ADSA 4BK9A 5AOUA 3L5MA 1ZJIA 3PBYA 2TRSA 3DFPA 3S1VA 4OT7A 5AHLA 4YCPA 2VEKA 5LNVA 1I2PA 4A21A 4K37A 3V75A 4WZHA 3BO9A 1KFKA 4O19A 1AW5A 3TQVA 2Y85A 3T55A 3HQ1A 1FWTA 3TR2A 1OYAA 3MHUA 2HS8A 4NQ1A 1VCGA 2CU0A 3LCFA 5D2TA 5D32A 5KZDA 3S1WA 3G1HA 3P7YA 4IX0A 3T44A 4C1KA 1A53A 4FX6M 1SZEA 1DJNA 4YLWA 3LB0A 3G3MA 3NNTA 3PVFA 2G96A 3KVLA 1YXDA 2ZZ6A 3TJXA 1VYRA 3OA3A 2CLHA 1H5YA 3U2OA 4JNMA 3C4UA 4UXDA 3C61A 4DELA 3W2JA 3W88A 3E49A 3AO0A 4W9TA 3W2KA 1L6WA 3G0SA 5DXYA 1ZENA 2QCMA 3S6DA 1SUXA 3P5YA 3RU6A 2RDUA 2E6YA 3L66A 1W5MA 4LUIA 2OJPA 4TX9A 5EYWA 4JY8A 1I4NA 3BG3A 3S5OA 3STFA 4DO4A 5LKYA 3NQ6A 3QSRA 4BFAA 1LP6A 5FF7A 1BTMA 3QJAA 4CNNA 2CLMA 2QAPA 3IGXA 4GUIA 1X7FA 2RDWA 3P82A 1X6UA 3TJLA 4YXGA 2NUYA 4AF0B 3LTPA 1Q6LA 4H6KA 3C2OA 3M5YA 5C54A 5LSMA 2RKXA 3GR7A 3WJXA 2WV8A 3M16A 1H1YA 1LBMA 5TIMA 3O6DA 4WOQA 2F7FA 2O7QA 5CZ0A 4NZFA 2NV2A 3TUUA 5T26A 3M47A 5HR6A 3IIOA 1VCFA 4O28A 1TRIA 4LV9A 1HL2A 5HWMA 1ZCOA 4S1FA 4GE8A 1H63A 4LRSA 2EGZA 5CZJA 2WO5A 2J9YA 1OK6A 2V0TA 1SFLA 1O5KA 5FEPA 2H6RA 3B04A 4O11A 2DZUA 4LY8A 3NOEA 3W2NA 4NXSA 1QAPA 3MI6A 1RZMA 3NGJA 1QO5A 3NA8A 3IGSA 2BLEA 2ZA3A 1TPWA 1OFBA 4L4LA 4JYEA 2BZNA 3O6YX 3T40A 1LM1A 5CPLA 2RH9A 1YTKA 1H50A 4K8EA 3VCRA 2Y61A 1EP3A 4IX2A 3W86A 3SECA 3LHUA 5D03A 4NXKA 3W7MA 3LV5A 1OABA 1O94A 3QH2A 2CFFA 2QCCA 3Q58A 1HG3A 4M6QA 2B7NA 3S42A 1JRCA 4FX7A 8TIMA 3BW2A 3W7DA 4O18A 3WFAA 3LHYA 3UWVA 2ZDRA 5BMXA 1VCVA 3SI9A 3V1PA 1TPUA 1ZFJA 1M7OA 3MI2A 3HIJA 1W5NA 1N55A 3CEUA 1VZWA 2QJHA 1V5XA 5G2IA 4QQ3A 3CIXA 4IQLA 2WQPA 1P0KA 4MJZA 4S2CA 1OX5A 4CNPA 4Y8FA 1TTPA 3W7CA 5FF3A 2FLIA 5FF4A 5L9FA 4HN4A 1OHLA 2B7PA 5DBTA 4JY9A 1TPFA 1G69A 1QPQA 5KSWA 1NSJA 4QNEA 3M5VA 2NXGA 1LLWA 2XFWA 1KTBA 1XKYA 1KM5A 2GVGA 3P61A 4QIUA 4ZQCA 2J9XA 1W5PA 1THFD 3WK2A 1PVNA 3YPIA 3C56A 3BK0A 1WOBA 3DFQA 4DBDA 1MEIA 4D2JA 4YCOA 3IIZA 4ZMGA 1JUBA 3PBWA 4KWWA 4XBKA 1H7WA 1U83A 3UXDA 3H53A 5HWNA 3LX9A 4HNTA 1IIHA 3PB2A 3HGJA 3MBFA 4FX8A 4JTKA 3G1SA 1M5WA 2GQAA 2WSQA 4AAJA 3LCLA 1LRQA 1OJXA 4E0CA 2QCLA 4J9JA 1PHQA 2WNNA 4O14A 4JX5A 2Q3RA 3TKFA 5DBUA 1ME8A 4GFSA 2WNQA 1L6SA 3LV6A 1O4UA 1O5XA 5D38A 2CLFA 3KVKA 1H7PA 4EOUA 4OHQA 3KOFA 1FUYA 5F2GA 3PS7A 4JIQA 3W3OA 3LTYA 2FTPA 3KRSA 2ZQ0A 4Z0JA 3PR2A 4GRSA 3TMQA 1H7XA 1EPXA 5CG7A 4MZ1A 3L68A 4PTNA 3GX9A 1F2JA 1XUUA 4M19A 3QSTA 3B8DA 4DBEA 4LS1A 4IMFA 1P5BA 3LCIA 3N14A 1OFPA 4DO6A 1LRNA 1T8XA 3GAYA 3GNNA 4LS2A 4PC8A 5J5DA 1TIMA 1VLWA 4YL2A 2O7SA 3CIWA 3EX6A 1ME9A 4JX4A 1FDYA 3TAKA 2HMCA 3AJXA 5KMYA 4ALDA 4ZQOA 3G1YA 2EF9A 4PL1A 1JCJA 4WXZA 2JKPA 3INPA 2J9ZA 3BG5A 1KTCA 2FIQA 3EWWA 1G4SA 4WXYA 3U6WA 3W23A 3DAQA 3GR8A 3TMLA 2NUXA 2W79A 3O16A 3EXTA 4XBSA 1W3TA 3BGJA 5AHMA 3OVRA 3QFEA 4IJBA 4NJIA 2GQ8A 4N4PA 1QNVA 3PSWA 4DPPA 4LWWA 4QAIA 3FJLA 3NQ8A 1TPH1 2OCZA 5G2HA 2V82A 4RLIA 3UPBA 3B4UA 5EBUA 4QNWA 4AVFA 1VRDA 3EKLA 5CSRA 1T96A 4AF0A 1H60A 5AHNA 3BW4A 4XUGA 4MY1A 5C5YA 3W83A 1EWEA 3HB9A 2DP3A 2ZZ3A 1FCBA 4UTHA 4GUGA 5FESA 3M5ZA 3LBCA 4DF0A 4O4VA 4OQVA 1QFEA 3GDRA 1GG1A 3PB0A 3W1AA 1C8VA 3WJWA 3NL6A 3BW3A 2H8XA 1EX5A 4LRTA 1EIXA 4UR7A 2WJZA 3MYOA 1GYLA 2FQIA 3G0XA 2LLEA 3FA5A 3GIYA 3DFNA 3LOTA 2OZ0A 3UQNA 1F6KA 4MYXA 2E09A 1AW2A 4UTWA 4JXCA 3UZ5A 3NR0A 4H4IA 4WY0F 4GUFA 1Q6QA 1KM0A 1XBXA 4AB4A 2NUWA 3P5ZA 3OBKA 4O17A 3R8RA 4Z1AA 3EWXA 4QM1A 5E1QA 1DQWA 3ZFHA 4FNQA 3TFXA 1SQ7A 4PH6A 4AMAA 4O50A 2J27A 3HG3A 2RDTA 2NZLA 3EX1A 3DBPA 2A6LA 3CTLA 3O1NA 3PUOA 4AWUA 1NF0A 4JTFA 5LNRA 3NPXA 4WY0B 2A7PA 5E0KA 3LRLA 3TK7A 2QEZA 1J5TA 3UNDA 2ZZ5A 4O1CA 1SR9A 2Y88A 4JD4A 3TQKA 5EPDA 2FB3A 2FFCA 4EVZA 5D33A 3EX2A 2ZTKA 5LHEA 3OHIA 4O0KA 3NZ1A 2DORA 1F74A 1SW3A 2ISVA 2X1TA 3UYCA 4FNUA 1ZAIA 1K8XA 2TMDA 2FPTA 4MLRA 4L4MA 1KBIA 1TB3A 3G1DA 3P74A 3FOKA 5D02A 4Q32A 3FYPA 5BMWA 1WOAA 1Q6RA 1YPFA 1SSGA 4I7UA 4WX2A 3NG3A 1KFJA 3GXNA 3NQDA 1HTIA 1MEHA 5K2ZA 3W84A 3G8EA 4ONVA 4ZZ9A 3D0CA 2ISSA 4TMBA 1VGAA 3LTSA 4FB7A 2A5HA 1JRBA 3KVMA 1BWKA 5D2VA 4IXXA 3QW4B 1XBVA 3G1FA 2ZBTA 2W6RA 3BGGA 3FFSA 1G4PA 4IMEA 4I7WA 4Q33A 1ML1A 2QUTA 2OT1A 3S5YA 3GDLA 5CZTA 5F4WA 5D2WA 3A9IA 2R14A 3CT7A 1RQHA 4YWIA 3W70A 3G1AA 1MXSA 3PBUA 1TPVA 2QDHA 3H54A 1ZHAA 2CLEA 4XQ6A 1SU5A 3LLFA 2JGQA 2DZTA 2X16A 2HS6A 4FIQA 3PAJA 5AHIA 1F5ZA 1D3HA 4KKXA 6ALDA 2XN2A 2CW6A 3C3NA 4N9BA 1XM3A 5CZSA 4UMBA 3LI0A 3PY2A 5LZLA 2ZZ4A 3B06A 3DFTA 3GDMA 3GKAA 2QJIA 3DKJA 4PEKA 5U4NA 3MHFA 4KFNA 3IRDA 2A0NA 4RZ5A 3W1UA 4CLMA 2Z0IA 1BWLA 5FI8A 3VE9A 4UTMA 1VLIA 2VKZG 2ZRWA 1QPRA 1DHPA 1QR7A 1ICQA 3M43A 3CLMA 3MMTA 4LUJA 2CLKA 3EEGA 5D2XA 3LHTA 4ADTA 4UFMA 4FO4A 1A5BA 1SW0A 1XUZA 5AFDA 1Q45A 2C13A 2RFGA 3C2FA 4O0ZA 2NXIA 4TIMA 1W0MA 3FS2A 3DFOA 1G6CA 4QSHA 3LXCA 2CLLA 3K30A 2PRLA 4PCFA 3THAA 4OE7A 4UIOA 3UD6A 2DZPA 1ADOA 4CCDA 2G95A 1F05A 5GVJA 3N19B 1DQXA 4Y6GA 3HF3A 1IGSA 1GWJA 4ML9A 1MEWA 2PURA 3NQVA 3IIVA 1GVQA 3NQGA 1TSIA 4JN6A 2XN0A 2E68A 1M6JA 2ZZ7A 2R94A 4DXVA 3C6CA 4Q4KA 3LHWA 2DJXA 3W85A 4E2BA 1ICSA 2Y70A 2V9DA 3BLFA 3LI1A 4N6EA 3A21A 4KFPA 2YYTA 4Y90A 4QISA 3SGZA 3MP5A 4FXRA 1YDOA 3W2MA 3W1QA 2ABAA 1KM4A 3BPWA 1XI3A 4K8HA 1WBJA 4BI7A 5HQEA 4FNTA 5F4XA 2QF7A 4TMCA 4YMZA 2WNZA 3SFKA 2YW3A 2X1UA 2E1DA 3KX6A 2V5LA 2QCEA 3L0NA 4UTTA 2WKJA 3ABRA 2BXVA 4A22A 4NNCA 4RZ6A 1JQXA 2KZHA 2P0OA 3QF0A 3F1QA 2CZDA 2P1FA 3L21A 5AYZA 1G7VA 1KV8A 1X8FA 3KVJA 2I14A 1L9WA 1M7PA 2ATSA 3OEXA 4IOTA 1K7FA 1HFBA 2YXGA 2DU2A 3CM4A 3DHFA 4LVBA 1K03A 1NAL1 1SZGA 2QCGA 3W1MA 2NXHA 3Q2DA 5HMSA 3R89A 2Y63A 1EP2A 3MJYA 1VC4A 4NU7A 1KFEA 3GXPA 2A2IA 2H8ZA 4MOZA 1B3OA 3FIGA 4M6VA 4UUIA 1I2RA 2E5DA 1OFAA 2ALDA 3QMRA 4S2BA 3M1ZA 3B05A 1FX6A 1W37A 3IEBA 3W73A 4GNJA 3F4WA 1LOQA 1EUNA 1SFJA 4IUOA 1U5JA 4XWUA 2EKCA 5EL1A 1EP1A 4LT9A 2VEMA 2WOQA 5K7JA 3WJSA 3MUXA 5AYYA 3NQAA 4LNYA 3R5EA 4CNOA 2DZWA 2Q8LA 4POCA 4UC5A 4LU0A 1Z48A 3VE7A 1EWDA 1RQEA 5EY5A 2Q8ZA 3LHZA 1IXNA 2PRMA 4WY0A 4NX5A 1WDWA 1WV2A 1J2WA 4QITA 3B0VC 2Y7EA 3UY7A 3W1TA 1JULA 3TSMA 3FKKA 1RD5A 3GK0A 3W22A 1FWRA 4RX0A 1XBZA 1TMHA 3P67A 4E38A 1TPDA 4LC8A 1VHNA 4JTLA 4XKYB 3SY5A 5TQLA 4ZQRA 1EA0A 3NDOA 5U7SA 4UFKA 4O1AA 5KITA 3HPSA 2B4GA 4FEZA 1KM6A 3L9CA 3GAKA 1QDSA 4FNSA 3DI0A 2E6DA 4M6PA 5FF0A 5IM51 4QJ1A 3DXIA 1FCUA 4ADUA 3QZEA 1UB3A 1PIIA 5G1YA 3T7VA 3QQ1A 4Z1CA 1QPOA 1TO3A 4JDYA 1PCKA 3LHVA 3EXSA 3RFAA 2NX1A 3IIXA 1WX0A 1H7NA 3SJ3A 4RJEA 3A22A 2H90A 5C6MA 3ATYA 1L2UA 2Z2UA 3I68A 3G18A 3LLDA 4IGHA 4UTLA 5K9XA 5D05A 1VH7A 4LTSA 1PCWA 1V7YA 3SGUA 3TC7A 4M7SA 3HBLA 3IVUA 3M9YA 2QR6A 3IV3A 1QWGA 5AC7A 4KWVA 3TC6A 3EWUA 1EUAA 2FJKA 1LLZA 1GTEA 5CKSA 3N34A 4CCEA 3MBDA 1GTHA 1D3GA 3OIXA 3NAVA 1CX9A 4AHOA 1W8SA 2ATMA 4ZL1A 4AHPA 1B9BA 1QMLA 3ZR4A 3NEVA 3FKRA 1DJQA 3PM6A 1RV8A 1VQTA 3L67A 3NL5A 1LORA 1TJPA 1LRTA 1OX4A 4PL2A 3CPRA 2YW4A 3B0PA 3HG5A 2QDGA 2I1OA 3L5AA 3S0CA 3M41A 5G2WA 5KZEA 1EB3A 4UR8A 3TAOA 3NL3A 4O4WA 4Y96A 1H61A 4NX0A 3HG2A 1H7OA 3W9ZA 4DO5A 2TPSA 2IQTA 3LGEA 1K7XA 3STGA 4BWLA 3Q37A 2R91A 1P4CA 2VEIA 4HSOA 1YLVA 4IPJA 4DF1A 4LOCA 4HPJA 4R53A 1N8FA 2J6XA 3IVSA 3W75A 4E2DA 1OFQA 4JICA 1MZHA 2X30A 3ATZA 1VHCA 2PRHA 5HUOA 5CSSA 3VI2A 4JEQA 1ME7A 4GUHA 2TYSA 1UASA 1WBHA 2C14A 5I3HA 1R47A 3R2GA 4DF2A 1RVGA 3NQFA 3PUDA 5G4WA 2Y7DA 3NPVA 1B4KA 2XN1A 4R7JA 3W71A 2DZXA 5D37A 4U28A 2QCDB 2NV1A 1OG0A 2YSWA 4IXHA 3W7GA 4WUIA 4HT3A 3HOJA 2VELA 2C19A 4K7VA 5CPOA 5AHEA 3N9RA 1DKWA 3OVPA 1SO6A 3CQ0A 3CC1A 3PSVA 3W87A 3NVTA 1G67A 1KFBA 1TV8A 1KM3A 1PL9A 2Q3OA 5LNWA 4NJKA 3MWAA 1X1OA 2TSYA 3KRZA 3W7IA 1YTEA 4MUZA 5K9CA 1W3NA 2QKFA 1FWSA 4FHAA 1TTJA 1FXQA 1JR1A 1NFBA 3PUEA 1N7KA 1RPXA 2G97A 3O6CA 4TU1A 1C29A 4A2SA 3TV8A 3WK0A 3JRKA 4FXSA 1WQ5A 3GZ3A 1LBLA 3C2RA 4OWGA 2VFIA 2OT0A 3W7HA 1G4TA 3KRUA 3A23A 4Z0SA 2HSAA 1GG0A 5DY2A 2ZRZA 1I45A 1AG1O 1NEYA 2Y89A 2V2HA 4K36A 4AEOA 3W74A 3G8RA 3SZ8A 3HGRA 4ZQMA 1WAUA 1R2SA 5FEXA 3SR7A 1H7RA 1XXXA 2QAFA 5F1VA 4JGDA 4NJHA 6TIMA 4CCCA 2GJLA 1BEUA 2WSYA 4RKAA 4BF9A 1WA3A 1JCLA 3UZJA 4DQWA 3OG3A 3W7RA 4EF9A 3E12A 3A5FA 3FLUA 4HNUA 1F7BA 4JDBA 2ZFAA 3E96A
chains in the Genus database with same CATH superfamily
1SM9A 3P8JA 4I7VA 2E5CA 4LUTA 4IQJA 3GBDA 1DE5A 3RRXA 1Q6EA 4HYVA 1FWBC 4P8XA 3PG9A 3RRAA 3AIRA 5M5DA 1JCTA 1LOLA 1OFDA 4MKNA 3RMJA 4OU1A 1HJUA 4JNZA 1J4EA 2C15A 3R7MA 2PDWA 4YTUA 3WSUA 1XCFA 3KHDA 4DI8A 3CV1A 3GR4A 3LNPA 1HQTA 4U3CA 3CZKA 4L9ZA 3VKAA 5DXXA 4IWWA 3M7WA 4XZHA 3M6YA 3CQIA 4C65A 3NEHA 4AU0A 4JAWA 1HIZA 3GFXA 4RDYA 5FF2A 4B5XA 1TQJA 3A4JA 4W84A 4F2UA 3TW7A 2PLJA 3QV8A 1PAMA 2EAWA 3N3MA 1LCOA 2PTZA 3VAVA 4IIBA 3A3WA 4JR5A 2YJQA 3L7RA 5LIUX 1HGWA 3F5KA 3XINA 3AU2A 1R3YA 3N13A 1Z69A 3GD6A 4CQAA 3BVJA 3TE9A 3QMSA 1V6UA 2CLOA 3I7QA 4RPPA 5CPQA 2WSPA 3A3XA 5BOOA 1BG9A 4QCFA 5HWJA 1MSSA 4HNNA 3RYSA 1OCBA 1OX4B 2YCKX 3P8IA 5E93A 4LBRA 2PCQA 5FJJA 2ISWA 1DVJA 1GUVA 2ZRXA 1ZAHA 1J12A 1EXBA 3PTQA 5BOFA 4ROPA 1E4LA 4IGMA 3WF1A 4MB1A 4H9XA 2OLSA 2DT3A 3DFHA 4X3ZA 4Q8PA 1O95A 4LUYA 3RGTA 3BLKA 3S1XA 1I0BA 5A6BD 3HV9A 5GNZA 5JH1A 1OBAA 1W1VA 1WPCA 4NVTA 1OADA 2ZUWA 4H00A 3LBOA 2QPSA 4B5NA 2CZEA 2V81A 3FW6A 3KLLA 1S3HA 3MT1A 3ID7A 4ZVJA 4AVNA 2YL5A 3ORWA 3VUPA 2D2GA 3VFLA 3WYZA 4XZWA 3T78A 3HURA 1U5VA 2CZFA 1PDYA 3TCEA 3BC9A 3GVGA 4N42A 3RAOA 1V3HA 1LZOA 2E8ZA 2PDKA 3CS2A 3U2CA 1XFBA 1EEPA 2AQWA 3TYDA 4ZODA 1WDRA 3DH7A 3PZQA 3L2IA 3SY8A 2NWSA 2XINA 2GVJA 4R33A 3LENA 3TLQA 2Z7KA 4B3KA 3ITLA 3PF3A 3UWUA 3W7JA 2QCDA 2FDSA 2CESA 4HGXA 5HJLA 3QZAA 1ZU8A 4OKDA 4KCVA 2V30A 1O68A 3S83A 4Z2LA 1ITQA 3GDKA 1TCDA 4KCTA 5BW6A 1S5TA 3UG5A 4B91A 1F4AA 2CITA 3O9NA 3E0LA 3TDFA 5DMYA 1EH9A 1K8ZA 4GJ1A 4JTHA 3N73A 5G5IA 1H62A 4FLSA 2C18A 2JF6A 4QDPA 1R86A 5KZ6A 1FY6A 3OYXA 1XRVA 1ECQA 1MXDA 4D1JA 4KRTA 1L2QA 3M0LA 4ZTXA 2B31A 4FS9A 5F1UA 2ZUTA 2V5CA 1XQKA 1P0NA 1YXYA 2F6XA 1TPB1 3IJIA 1U30A 2V5DA 5C9RA 3BARA 5BXTA 4H3DA 1PKLA 1LBFA 1TR9A 4B5TA 5BNKA 1R8LA 4OBRA 1UUOA 4AX7A 2QCFA 3GXTA 4BQ4A 2AKZA 3B9DA 1VBJA 3A24A 1A5AA 4S39A 3WLHA 2BOFX 3QGKC 5LA0A 2JBMA 4GWEA 1T99A 1E43A 1EBGA 1Q5MA 2ZZ2A 4AH7A 3VNKA 4UCFA 4DYJA 4HHMA 4Y7EA 1V02A 3WH5A 4GVHA 2CERA 1OFEA 2YR1A 1TREA 3WD0A 3BAIA 1BKSA 5F7UA 3BAXA 1KM2A 2WZMA 3A3HA 3UJEA 1PJ9A 4O52A 3M5XA 1IEQA 2OZ3A 2FDMA 4KMQA 1RCXB 3HFTA 3K1DA 5DCEA 1DXFA 3WY1A 1VS1A 3BZGA 4KWSA 2A3EA 4HMCA 3CAWA 4RXFA 3W1RA 2YA2A 1XC4A 1IXQA 4HD5A 5HINA 2NVAA 4NAFB 1TPEA 2A1YA 2R8WA 3S2MA 1R2RA 1ZQ5A 1J10A 1PZ3A 3CUIA 1SZNA 2GFTA 3UR5A 5FOOA 3UP8A 2BVTA 4ORIA 1FWNA 3EPMA 1UCWA 1G4EA 3S2NA 1SSDA 4IQDA 4O1EA 3H23A 3EB2A 3APTA 1O6IA 3CQHA 1KW1A 3LCHA 3KDOA 4FF7A 1FWWA 4WD0A 3HPXA 1JD9A 3ARZA 3T09A 1R38A 4ACYA 4UR9A 4FZIA 3NL2A 4PA8A 4QLLA 4AQLA 5IXEA 3OLDA 4F0LA 3FJNA 2VDHA 5HUPA 3RCNA 1J8VA 2Y5SA 1TTQA 2J62A 2ZRYA 3LK6A 4MB5A 3PULA 2Y8UA 2I9UA 3TWBA 4AWEA 3VD9A 2O9RA 3C2VA 5IFTA 2FZDA 5CBBA 1E6SM 3AS1A 2FZNA 4C90A 2J7FA 2EPHA 3DYPA 3TN3A 2VCBA 2C1IA 1ZS2A 1DORA 4OUEA 5E6ZA 1P7TA 2GUUA 4IMGA 1B5TA 4O54A 1EYWA 1DJXA 4IIDA 1J0JA 4UFIA 1NOUA 1R46A 5CPSA 4P7RA 4MZYA 2DJLA 2FHFA 5BRBA 3AISA 4UMAA 1FXPA 3BMWA 3P93A 1LJYA 2A3CA 5CPMA 3ES7A 2GJNA 1EC8A 3VMOA 3CH0A 1BG4A 2AMGA 4ATDA 1YYAA 4A29A 1XRSA 3RM9A 1HO4A 1PYFA 3W2LA 4MJMA 2VP8A 4B2DD 3P0WA 3CYVA 3EKZA 2D2OA 4Q8OA 1MZRA 3K5XA 2HXTA 4Q8UA 3NQCA 5EMYA 2IW0A 2KAUC 3FEMA 1L6YA 4JL2A 1LQAA 4GYKA 1JYWA 5D2YA 3K4DA 4P61A 2ZA2A 4Q7BA 3E2SA 5FJOA 3W07A 2ZC8A 2EJ1A 4R9XA 4J3ZA 2XHYA 2GVYA 3W7EA 2WJEA 1QI2A 3LXAA 1YBQB 4IPPA 2XVGA 5AHFA 2Z1XA 3OYZA 4WQ6A 3QFWA 4PUWA 3LXBA 1OGGA 4Y9AA 2GYIA 1UWSA 1Q6FA 4HOWA 5GNXA 3ABSA 3MJMA 1DOSA 2V2DA 4IG2A 1NWSA 3WH6A 4Q8TA 3MVIA 3K1GA 4C6CA 1VFUA 3VXGA 1YADA 3POCA 4WRHA 2WB5A 5G1MA 3W02A 3B03A 4H8VA 1EJTC 5D9NA 2X1IA 4NF7A 1ODZA 4MB3A 1ZRQA 4AXKA 3R43A 5F2LA 3UWYA 4GG9A 3BG9A 3M7SA 2A7NA 3NPUA 4PEEA 3NXFA 5FJIA 3KHJA 1UD8A 5K4ZA 2XM1A 3EPNA 1VFFA 3UPWA 1G5AA 4QQUA 3KBNA 3GDTA 4PCTA 2A3AA 5F2MA 2DH2A 2AL2A 2EEXA 4BWLC 4M7TA 4U5KA 5IHSA 3AROA 3HTWA 3SB0A 3S2CA 2QPXA 1BKHA 2QJGA 3WN6A 3CL8A 4FIRA 3TSDA 4RNJA 4LVFA 1BPLB 1UOZA 4LH8A 1FHLA 1M7JA 1ZAJA 3WBXA 3TFCA 1VYSX 4FNPA 4GO9A 1QOXA 5EFDA 1R3QA 4PRWA 3TA9A 3NPWA 4OGZA 3P84A 2ZICA 1NVMA 3LQGA 4U4MA 4GH3A 1P1XA 4TX6A 1Q7MA 1R9ZA 2DZSA 3SRDA 1GQJA 1T0OA 2PTXA 3MKVA 2WKGA 4U2ZA 3E0IA 3EDEA 4ICNA 4NKCA 4YHEA 2YZRA 4E4FA 3UZWA 1KXQA 2XPKA 3C2EA 4X2RA 1PIGA 1SMDA 1HJWA 5A6SA 1M03A 2PDNA 3W38A 4G7EA 4MKSA 4QS6A 3BGAA 5D9OA 2OEJA 2CHNA 5TBOA 1XDLA 2QCHA 4RDVA 5AOUA 4G8TA 1CGTA 3PBYA 4L56A 2TRSA 3S1VA 1SJAA 1UQYA 4H9YA 2O56A 3UXLA 1FWHC 1UKPA 4K37A 5I00A 3V75A 3RCYA 4LY4A 2J7HA 1JYNA 1H41A 2VVNA 1E9LA 4MWAA 4AZCA 3HQ1A 1IEXA 1NDVA 4UWMA 5D32A 2CU0A 4LCRA 3NWRA 2V3DA 1W6TA 4FX6M 1SZEA 1DJNA 3CPUA 3H7RA 1BQGA 1OWQA 1XLCA 3G3MA 3S9IA 3PVFA 3LPPA 3VC6A 1VYRA 1REQA 3U2OA 2XZ7A 4UXDA 4BZYA 3C61A 1WUEA 3W2JA 3W88A 5CAHA 4W9TA 3W2KA 3H70A 3G0SA 4CCZA 2QCMA 4AD3A 1GOMA 3EZ4A 3P5YA 2HROA 1W5MA 2GVEA 5KEZA 4D8ZA 3WEOA 4JY8A 3BG3A 4S38A 1NFGA 2Y8VA 1B90A 3JU2A 1KWKA 3GFZA 5HPOA 4DO4A 3WLNA 2RJHA 1LP6A 4LFYA 1BTMA 3IGXA 2P3ZA 2D20A 2ZUUA 2VOTA 4YXGA 4AF0B 3W24A 1UKSA 3RX3A 4JFVA 3M5YA 2RKXA 1SJDA 3GR7A 2ZX9A 2YZ5A 5TIMA 1IYXA 2D0GA 5CZ0A 2NV2A 4OBSA 3GS6A 2ISDA 3M47A 1CENA 3CMJA 4LV9A 3ZT5A 1HL2A 4ENLA 4HNLA 3UCCA 1ZCOA 3WELA 2EGZA 5CZJA 2WO5A 3B0XA 3SFWA 2J9YA 1OK6A 3OGVA 2QV4A 5FEPA 2H6RA 3B04A 3CJPA 2W27A 4PMDA 2V67A 3WNOA 1ONEA 1QO5A 3M6DA 5AYIA 4XZNX 3RITA 4J2PA 1UMYA 3AZRA 4GIEA 4JYEA 4H8HA 1QXLA 3WDJA 4NHVA 2RH9A 5FA5A 5EGRA 1YTKA 1YMYA 4ROQA 1IT8A 2ASHA 3E1F1 1XLGA 4IX2A 1GKQA 3N11A 3SECA 4MJ4A 3LHUA 5D03A 3W7MA 3G2GA 1SR0A 2DW7A 3LV5A 3BV7A 3E2VA 3ITVA 5JMUA 3BMXA 1OABA 3QH2A 2PWVA 2QCCA 4M6QA 1EF2A 1MQQA 3S42A 2CCRA 2X8RA 4RE2A 3ITOA 1BYAA 5A6MA 1QK2A 2YA0A 3LHYA 3UWVA 3P6LA 2ZDRA 1RUSA 1VCVA 1AODA 4IL2A 3UZYA 3SI9A 3VOGA 1ZFJA 2OWCA 4E3TA 5A2AA 4F79A 3CEUA 2QJHA 4FLRA 1D2KA 4L61A 4QQ3A 2VRJA 3IV8A 1FWEC 1W3KA 4IQLA 1J96A 3MUAA 3ENLA 4YU1A 5IDZA 1OX5A 3GVRA 2UY5A 4AD0A 4CNPA 4AZ7A 1E1CB 2YDSA 5FF3A 5FF4A 1A47A 4H1ZA 4JY9A 1EXPA 2HK1A 1Z7AA 2OXNA 2FJUB 4GINA 4GO8A 1XKYA 3VZZA 2GVGA 2JIEA 2I56A 1XIHA 1THFD 3GTXA 2X0YA 3H2FA 1O5RA 3V1HA 2R1NA 3U2EA 2FGLA 2D2JA 3YPIA 4C6FA 3QPEA 3DFQA 3BK0A 4DBDA 2E67A 4DBSA 3O0KA 1DP0A 3CL6A 3UNTA 2IXVA 1MMFA 1O1HA 3PBWA 1EOMA 1H7WA 1U83A 1DJYA 4EK7A 4E4UA 3LX9A 1IIHA 4EPBC 1XW8A 2RGLA 1H5VA 4J28A 4PMOA 2OSWA 3GQYA 1M5WA 2WVSA 1E6NA 4AAJA 1UWQA 2QCLA 3RDKA 1PHQA 4WDXA 2Q3RA 1ME8A 1L6SA 2P50A 3EGJA 3AUJA 4GY7A 1O4UA 1O5XA 3WUFA 5D38A 4XSLA 3ZYZA 4OHQA 4R7WA 1V0NA 5T91A 4BHYA 1ISVA 2RAGA 2FTPA 3CO4A 2J25A 2ZQ0A 3PR2A 4GRSA 4XBJA 3PUGA 4CUCA 1RAKA 3U9IA 3L68A 4PTNA 3NZGA 4W87A 3VKBA 3T2PA 1UC5A 1GK8A 4M19A 4DBEA 4LS1A 1P5BA 3HZ3A 3SEPA 3VGDA 2G0WA 3LA4A 3EMQA 4OVXA 3GAYA 4IFKB 5J5DA 1L6FA 1R85A 3R8HA 4MGGA 4YL2A 2BGQA 4L1WA 1FDYA 4ZQOA 2GDQA 4A8NA 1JCJA 1JYVA 3TZFA 3K46A 4WXZA 4ZEPA 2PDFA 2JKPA 4LF1A 3BQ6A 3CO8A 1XIJA 5JXQA 1T40A 4IPLA 4FOJA 1RK5A 1Q6GA 1JDCA 3MMWA 1XP3A 1XYAA 3GR8A 3TMLA 4WSJA 3L4WA 2W79A 3NTYA 2C0HA 4XBSA 5HNUA 1XPYA 4DVOA 4M81A 3OVRA 4HPGA 3OGRA 3TYUA 4LF2A 4LWWA 3FJLA 1PTAA 2WJDA 1TPH1 2OCZA 3GIPA 4M1BA 4DJDC 1P6CA 2O0TA 5B80A 1KCKA 3CLWA 1TCMA 1JPMA 3K8KA 5EBUA 1VEMA 4AVFA 1RALA 1UIPA 5CSRA 2XGZA 5AHNA 3PN8A 3BW4A 1B3ZA 4Q8WA 3JVAA 1H3GA 2DP3A 3WQOA 3LBCA 1GG1A 3U48A 2W92A 1F3XA 2PCEA 2OYKA 1IR1A 3N2BA 4IZGA 2H8XA 1YE6A 1J0ZA 1BTCA 1GYLA 2QGYA 2FQIA 3G0XA 1XR2A 3OJGA 3TTSA 1O7AA 5CH9A 1JF6A 2E09A 3LU2A 4UZUA 4DXXA 4WY0F 3FK4A 3P5ZA 4O17A 4CGTA 1SFTA 1PKYA 4BEQA 3EWXA 1XCWA 4FNQA 1SQ7A 1C91A 1C7SA 1JZ4A 4O50A 4Q8MA 2J27A 3HG3A 1JYXA 3EX1A 2BFGA 1F9CA 4AWUA 4JTFA 5LNRA 3NPXA 3GU9A 2QEZA 3N15A 4UQEA 2ZZ5A 4HHHA 3QQWA 3TQKA 1V8EA 5GJPA 2DSWA 2ZTKA 2J79A 4GXPA 1M01A 2X1TA 3UYCA 1K8XA 2FPTA 2G3FA 4PUJA 3P74A 5D02A 2PDCA 3M46A 5BMWA 2HPIA 3ONBA 3FA4A 1SSGA 5LYRA 3W0KA 3GXNA 4NRSA 2ISSA 3BQ5A 4TMBA 4P8UA 3AZSA 1V0LA 4FB7A 3MSDA 2DVXA 1PUDA 4PCSA 5D2VA 3QW4B 2FMNA 4UQDA 1X1NA 3R0KA 3T2OA 2ZBTA 3KBSA 1E6XM 2W6RA 2WC7A 3BJTA 3FX4A 3MA8A 1R3RA 2PZ0A 4IMEA 1DXEA 5FSEC 3E0VA 1CXEA 3S5YA 4XO7A 1QU4A 4B92A 3CT7A 3OPSA 4PUDA 2PLCA 2DDXA 2GQ3A 2QDHA 1ZHAA 4V1YA 3W29A 1SU5A 2JGQA 3TTQA 2HS6A 4FIQA 1CXKA 5CAKA 1F5ZA 4KIEA 3OQ8A 1TG7A 5IDIA 5BXRA 1XM3A 2I17A 1R0MA 4YN5A 3LI0A 5BU9A 4FMVA 4AD1A 3DFTA 3T07A 1FFQA 3UZZA 1N2VA 3UZXA 3MUIA 4H6EA 4XV0A 4RZ5A 3B8IA 4I9TA 3S46A 9CGTA 3FXGA 1X97A 2BY2A 1QPRA 2O4MA 1ICQA 3RILA 3MMTA 1X6LA 1UR4A 3EEGA 5D2XA 4ADTA 1A5BA 1SW0A 3H12A 4YNGA 1IZJA 1Q45A 2ZC1A 2C13A 3GNPA 4OIFA 3C2FA 4O0ZA 1K9EA 3FS2A 2VGIA 1G6CA 3DFOA 4QSHA 3EOEA 1HW6A 1P0BA 2YLLA 3UD6A 4CCDA 4XD3A 4LGXA 2OO0A 5CPTA 3N19B 3EA1A 3HQNA 1DQXA 1XIFA 1Q66A 7REQA 3I6TA 3HF3A 4AFYA 4ML9A 4C6QA 4ASTA 4QR6A 1YHTA 2VZUA 3VGGA 2AQOA 1DJWA 3IJ6A 2XN0A 4R85A 1ELSA 5EMMA 1X6NA 2BXYA 5AVNA 4IIHA 3U7VA 2YCLB 2EG8A 4IH3A 4E2BA 1Z8AA 3BLFA 3LI1A 4N6EA 3CK5A 2DIJA 1V0MA 4Y90A 3W1QA 3AYTA 2DUXA 4EAYA 2IPGA 1WZMA 1AJZA 5F4XA 1SJBA 4XO6A 3SFKA 2YW3A 3KOYA 2QZRA 2V5LA 3MSRA 4AEFA 1M9HA 2QJMA 1V3MA 2PD5A 3GM8A 4UTTA 4Y9PA 3ABRA 4KRUA 3MWCA 4DZAA 3QF0A 1R9YA 2D3NA 5AYZA 3ITYA 3OIHA 1FWIC 1X8FA 2I14A 2VVSA 3EAUA 1M7PA 2ATSA 3OEXA 1K7FA 2OX4A 3L4TA 3SQMA 4CQDA 4LVBA 2FZ9A 3H2CA 3WH8A 4GQBA 4C6OA 3GG7A 1J79A 3W1MA 4CKQA 4GABA 4GQ0A 3Q2DA 4H04A 4KH2A 1EP2A 3MJYA 1RCOB 4EX4A 1KFEA 2H8ZA 2PGEA 1CLVA 3NJ3A 2ALDA 2ACSA 2V3FA 1ZBVA 1QNRA 4QX4A 3RX2A 3TTYA 2VT0A 1B3VA 1QI4A 3W73A 4BY3A 1TJ2A 3AHTA 4JTDA 4Y9OA 1JGMA 1YKWA 3GTFA 3UEQA 4PCPA 2EKCA 4GZJA 2C7FA 4LT9A 3KEHA 3PJWA 4LNYA 4CNOA 4O8AA 1GQKA 4POCA 1RQEA 2WVVB 1C9WA 4V28A 3QOKA 4J3XA 4WY0A 3AS3A 4FPSA 1J2WA 1G94A 5A1AA 2PP1A 4EPKA 4DX3A 1JULA 3EOSA 3GK0A 3W22A 1FWRA 5B7YA 1PX3A 2RJGA 1UG6A 4MWAC 3O6AA 1XLDA 5D9PA 4ZR8A 1EA0A 4UFKA 2XFFA 4JTCA 3HPSA 4GGBA 1B31A 3GAKA 4UBPC 3U3HA 3GG8A 1DIDA 4MMWA 1OINA 2XIQA 4ADUA 1XIDA 3H2EA 4Z1CA 5LXEA 4J3WA 4JDYA 3EXSA 1B54A 4NZ4A 3E5PA 3QV6A 4M82A 4QLJA 5FJTA 1BAGA 1PKMA 1RSCA 5REQB 4K1WA 3ARPA 1TWSA 3EEZA 3CH9A 1XIIA 1QNQA 3RJYA 1PCWA 3Q65A 3IVUA 1TWIA 3ARSA 4KWVA 4QTGA 3GU2A 3VILA 4JFUA 3TC6A 4LALA 5C7VA 1EUAA 4WLCA 4H9ZA 3SCOA 1GTEA 1UWIA 3SQLA 4CCEA 3MBDA 1GTHA 3OIXA 5GPRA 4AHOA 2ATMA 1QMLA 3NEVA 3FKRA 1DJQA 1TIWA 1UBPC 1XRTA 3PM6A 3REQA 4CEXC 4GVFA 4GHRA 1DWIM 3HMCA 3N9KA 1JPIA 2D0FA 1OX4A 2PAJA 4HQVA 3HG5A 3R4IA 3RO8A 4A3YA 1WKFA 4DWDA 3WQWA 3XIMA 3GU1A 1NARA 2DFAA 1ADSA 1EB3A 3TAOA 3WQEA 3HN3A 5HJYA 3NOYA 3W9ZA 4DO5A 2WM0A 4DRSA 3FCPA 3LGEA 1K7XA 4UZSA 2R91A 3H21A 3QR3A 4IFOA 1EJXC 4LOCA 4H19A 3IVSA 4E2DA 2J77A 3IUIA 1MZHA 3UXKA 3QKEA 2R6OA 5CSSA 3H26A 2AOSA 3SGGA 4AIBA 3QV7A 1RVGA 1KRBC 3NQFA 3PUDA 5G4WA 1BHGA 1DPMA 3EMZA 2QCDB 3MZ2A 2NV1A 5A3HA 2CXEA 2VGFA 4HT3A 1UZHA 3USZA 5CPOA 1QHZA 1SO6A 4YYFA 2P5NA 2VL4A 3KUMA 2DUZA 4L1GA 1KM3A 3WBEA 2NQHA 2PWHA 4U31A 3KRZA 1ZBKA 5K9CA 1W3NA 4LPCA 4FHAA 2OQHA 4U10A 1FXQA 3O0FA 3PUEA 1RPXA 4EXAA 2FZBA 4FI4A 1EHNA 2WNWA 3SN1A 4XSMA 3SCSA 1WQ5A 3C2RA 1XX1A 2CLPA 2IPJA 3BMVA 4Z0SA 3GFYA 5JBDA 3RXZA 1NEYA 4QEHA 3NSMA 3G8RA 3SZ8A 3GXFA 1EQPA 2BY3A 3RIKA 3A4XA 1H7RA 2OPJA 1TUFA 1PZ0A 1JPDX 4CCCA 2WSYA 1K8CA 1FTXA 3OU8A 4BF9A 1WA3A 1JCLA 6XIMA 3CZLA 1R6WA 1HJVA 1H0GA 3KBVA 4M3PA 3W7RA 5ECVA 1V3JA 3T8LA 1E3ZA 3E12A 4BF7A 4QJ5B 2ZWZA 3H6OA 3FLUA 4GC3A 3CZEA 2OG9A 2VZTA 4HNUA 1E6RA 1LT7A 1RPKA 1S5NA 1F7BA 1EYEA 3AHYA 1L8NA 3LYEA 5TF0A 4GZ7A 2V38A 3LUTA 4HCDA 1OEPA 2SFPA 4CEUC 1ISYA 3QC3A 3ZWTA 2RHGA 4Z17A 2PDJA 5CJMA 3NZQA 5E9AA 3ABQA 2C6QA 3RR1A 1SYTA 4JX6A 2AGKA 5CCZA 3TA6A 4EE9A 4XKYA 4MFDA 3KWXA 3W7QA 4MWAD 4NJGA 3DYOA 2HNHA 3JW7A 1E6PA 4V27A 3WLJA 2EPOA 3SN4A 3WD4A 2OX1A 4C1LA 2C0AA 3E0FA 3W82A 4YHGA 3DGRA 4N9EA 3QPYA 1JDEA 2D22A 4JTTA 3GHRA 1B4EA 4ZE5A 4QG9A 4AC7C 5AB3A 2JK2A 2NQ9A 2I9EA 1MNSA 2WMHA 1E55A 5D4YA 1XLJA 3IUDA 4KETA 3BLIA 4NAFA 2GUYA 2I57A 4C6LA 4B3LA 1K7EA 3E6EA 4MYAA 1XS2A 4IMCA 4W8LA 1MUMA 1EJWC 2A3LA 2YL9A 5IBXC 1HKKA 1TELA 4GYJA 4NI3A 4PSPA 1S46A 2YCEA 3BLEA 3Q45A 1YPXA 3DKLA 1E40A 2DVTA 1Z9AA 3SDOA 1KA9F 4AZHA 3C8FA 3AYSA 1Y5WA 4X9YA 3EOLA 1JG9A 4UTUA 4H9VA 4F4RA 4Q4RA 2ZRUA 1FBAA 4R27A 1V77A 3AZTA 2VZSA 3OZYA 4L4OA 3B4YA 3HPZA 3DFYA 2VGBA 4TVCA 5E9XA 3CHFA 4NZ5A 1AMKA 4TTGA 4NJJA 2YFOA 4UFJA 4B5VA 2Y6ZA 1GT8A 3T0TA 3W01A 5LIWX 1GZGA 2B0MA 2J7CA 4KCWA 3IJDA 4E5TA 4K7YA 3NQEA 1OGBA 1BYCA 4PMQA 5D30A 2ACUA 4ZOAA 3L2LA 3CWNA 5I3KA 1XBYA 3MP4A 4KWUA 3HO8A 3S9YA 2ZIDA 1WNOA 4LBUA 3IVTA 3OZPA 2JKEA 4UCGA 2PFHA 4HPXA 5I3GA 1V6TA 1IXOA 2VFDA 3A5VA 3IK4A 3M64A 2HBVA 2PTDA 3SURA 2QQ6A 2YX0A 1Z6KA 4KW2A 1XIGA 3KAOA 2PU1A 4HA4A 3VIKA 3N2TA 4GCAA 1PHWA 3S4TA 4Z2IA 4H9MA 3VGFA 1JDDA 4PYSA 1R5YA 4GZIA 5DMMA 1TRDA 4RR4A 2PDBA 1KBLA 3L4XA 2XJ7A 3GSMA 3DG6A 2IKIA 2P76A 2PI6A 2YIHA 1JDFA 5DN1A 1DEDA 1FDZA 3UVAA 3AS0A 2VGGA 2Y4SA 1SO5A 3EDDA 4IG2B 2WW5A 1E70M 1FRBA 3K13A 3IWPA 4ATWA 4O13A 2NQ5A 1DJHA 3QRHA 3VIFA 3EXRA 4DY1A 2C8NA 1S5MA 3C8NA 3L5LA 1LDCA 1VYPX 1OD0A 4C1NB 3O06A 3TZNA 3KLKA 1OFOA 4AWTA 5TAOA 4NL1A 3FJ6A 5E70A 1OYBA 1H51A 4GK8A 2HXUA 2OKTA 4S3EA 4NG3A 1GVEA 3MO4A 1UR3M 2A21A 4MY8A 4Z2JA 4IUGA 3TIMA 1TMLA 3NSXA 3HPAA 4GQGA 4ERGA 1S5VA 1JF5A 1XIEA 3W72A 2FPYA 3F03K 3RPTA 3VO0A 2VUNA 3THQA 2XISA 3VNDA 6CGTA 3AHXA 5EKYA 1QPNA 1I2NA 1QPKA 4MADA 5C2XA 2OSXA 3D6NA 4LC6A 4TOQA 3MQTA 2H3DA 4NASA 1RR2A 3FSUA 2E6FA 4BEUA 3B9OA 5CGTA 4E2OA 5HDRA 3RK8A 3NM3A 1TV5A 4XIMA 1ICPA 2ANUA 1SZRA 1W54A 4PBEA 4A6GA 1E4IA 3VOFA 4CQBA 4AD4A 1XV8A 5C9UA 3W1PA 4UMCA 1ENUA 4QE5A 1LG2A 5C55A 3L65A 7ENLA 4IPIA 4O57A 4XD6A 4GXMA 1K02A 1Y5VA 3C5QA 4UTTC 4Z1DA 1GVFA 3VOCA 3RMEA 2GK1B 1US0A 3R0DA 5EA9A 2PDHA 1AW1A 2YPIA 5BCAA 4U5IA 3E9AA 3THUA 3TTOA 5AZ0A 3NZPA 1YDNA 3GBEA 3AXXA 4HU0A 2UY4A 1OF8A 3PG8A 2VEPA 2DIKA 9XIMA 1LL4A 1Z41A 1GZ1A 3VGBA 3PPGA 3MKKA 1MUCA 3WO8A 3IUHA 3QYQA 3QW3A 1Y65A 3NM1A 4UTIA 2XSXA 4B5UA 2ACRA 4AZCB 2ON3A 1KTNA 3AMDA 4BQ2A 2O55A 4FXJA 1J11A 4KWOA 3VIOA 1G7UA 4F0KA 2RGMA 1ODUA 4YVPA 1Q2RA 2NX3A 3USBA 4ZB2A 4ZXLA 5CPNA 1REQB 4G9PA 1FDJA 4W85A 3BICA 3QGAC 7CGTA 3ZJ8A 1UH4A 2BODX 5A6JA 5J5RA 4NZ1A 3ABOA 4UOQA 3W7KA 5JBFA 4NUWA 3ZVHA 2XDFA 2OOGA 1AZ1A 5DCBA 3S5NA 1UH3A 1D9EA 1VPQA 4JYFA 3HJZA 1TPC1 5CGMA 2NW0A 1W3IA 5DANA 3DC8A 2VEFA 2FVKA 1IWBA 1VBUA 3F5LA 1GOQA 1K1DA 3ELFA 3GW3A 2OLAA 4MG4A 1ZGDA 3WX7A 2J47A 2PBGA 4MY9A 4I9AA 2W9MA 5AC8A 1KR0A 3VOHA 1VBHA 3LEPA 4HKPA 4LJ3A 3DI1A 2UZ9A 5DLCA 4EF8A 1YXCA 4WGXA 1KBKA 7PTDA 3WEMA 5F4SA 1W3LA 5I78A 4HHPA 2BDQA 1ECEA 4HSNA 3WDHA 5AN7A 1PDZA 4Z1BA 4UNKA 1GJPA 1ZJBA 3O63A 3TXZA 1FCVA 4DXKA 3DHDA 2YBVA 5LGZA 3LG3A 4NNAA 3GNOA 3AIBA 3O07A 3NO1A 4B16A 3TW6A 3CU2A 5FEWA 4LVDA 3CUJA 1BLIA 4E4PA 2HEJA 1JCYA 4M5PA 1QO2A 2E6AA 3TN4A 1KLZA 3LM7A 3GNDA 4ZB5A 5AVHA 3LZ5A 3GB6A 4MLJA 1OG6A 3HJEA 1WXJA 5H6HA 3BOFA 3KZSA 4DJEA 1I2QA 3LZ3A 4UOJA 5DY3A 3N2MA 4C5ZA 4PB4A 3BWWA 3UBPC 2OMAA 3NCOA 4MPQA 3DGBA 4XTDA 3UWEA 1NWTA 1JUEA 1UR8A 2FZMA 4M29A 2E28A 4GY0A 5HMFA 5F2IA 2G3JA 3SW6A 3UJRA 2VURA 1IE7C 4NZJA 3GC4A 1TWZA 2XIMA 4N9DA 5D09A 1V3KA 2J8TA 3NUKA 5SWUA 2W63A 2ZX5A 3WD1A 3UXAA 2A85A 3ZMRA 4AZ5A 3M4HA 3N2XA 3M0ZA 4QJ3B 3MS8A 2EKGA 3U8GA 2PPGA 1Q8AA 2ZYFA 1CB2A 3GWQA 3VM7A 4WIWA 3M0XA 2XM2A 1E1CA 1E56A 2GSHA 2ZX6A 2DUAA 1T41A 2QMJA 4BI5A 4RZ4A 5I06A 3W7LA 4MNKA 4EPDC 4WKAA 4IF2A 2OU4A 8CGTA 1B3WA 4PFMA 1LROA 4RV3A 3SUUA 3M44A 3TSBA 4W89A 3GKFA 3WLMA 4MVAA 3VZXA 2FHCA 2DH3A 2E77A 3H7UA 3LCGA 3O3RA 4TR9A 2GDUA 2PLKA 3FDGA 2QJNA 3HG4A 4H2CA 4J3TA 1IEIA 3LGGA 1E72M 2EPMX 2BNJA 3PPCA 1UJPA 2VFEA 5E0CA 5I2UA 5I3FA 4LS0A 1RLCL 4ADSA 5FJPA 3L5MA 3VU2A 3TN6A 4HYWA 3PZMA 1XLMA 4L6HA 4D1IA 3SCWA 3OVGA 4OT7A 4JPGA 5LNVA 4A21A 1UR1A 4PUNA 1Q4WA 3IAQA 4WZHA 2GSJA 3W25A 4C6MA 4O19A 2Y85A 3T55A 1FWTA 3TR2A 5FJRA 1DWJM 3I6EA 4NQ1A 1DJGA 5D2TA 3G1HA 4IX0A 3T44A 3VX1A 1H4PA 1OB0A 3TC3A 1US3A 4PBGA 1UA3A 3AMCA 2G96A 3JZUA 4DM1A 1EF3A 2YXXA 5DRIA 1YXDA 1H09A 1AQMA 3OA3A 4I8YA 4DELA 4IFKA 1L6WA 1ZENA 3S6DA 3WUEA 5FJUA 3RU6A 3L66A 2OJPA 4I8DA 3CAKA 1PYMA 2DSKA 5EYWA 2O92A 4HTYA 1AJ0A 2BG5A 3M0MA 3F2DA 1QASA 4RE3A 4INFA 3QJAA 2CLMA 5DQPA 2HPMA 2PD9A 4C7GA 2ESCA 4HZMA 3QHOA 2WHKA 2NUYA 3VMNA 2WV8A 3M16A 1EZ2A 4CU6A 3O6DA 4WOQA 1C7TA 2O7QA 1WKEA 3P14A 5A6LA 3S6TA 5A8MA 1BD0A 5T26A 3IIOA 2PWGA 5AY7A 4KEUA 1TRIA 4A3QA 1UD6A 4S1FA 4LRSA 3ARQA 1O5KA 4O11A 2DZUA 1GCYA 4LY8A 4XZMX 1SVDA 2QYGA 3NOEA 4NXSA 1QAPA 3AXMA 3MI6A 4ZB0A 3V36A 1BF6A 3GXIA 2I5IA 2BLEA 2ZA3A 1UHVA 2BY0A 1L8PA 3ZJ6A 5CPLA 1QNOA 1W1IE 3B40A 3H7VA 3RCMA 2Z24A 3VCRA 1VJSA 5DX7A 5I23A 3GIQA 1J0HA 3KBWA 1X7IA 1ZP3A 3WNNA 3BSHA 3TP4A 4NZ3A 3Q58A 5BXSA 1HG3A 5HXMA 2B7NA 1JRCA 2W67A 4FX7A 3W7DA 4O18A 4CD8A 4JQ3A 2X0HA 3H2OA 3SUTA 1A5LC 4V33A 4U3AA 2OYLA 3F4VA 2ZX7A 1TPUA 1JGIA 1M7OA 3MI2A 1W5NA 1VZWA 4K1GA 1ISWA 5G2IA 2V5JA 1QI5A 1HF6A 4YTRA 4MJZA 4S2CA 1TTPA 1NDYA 1AFSA 4HN4A 2B7PA 3LPOA 1E15A 5CC3A 3ALGA 4HZ7A 1G69A 3U7BA 1QPQA 2DSUA 5KSWA 4AZBA 1HJQA 1C90A 5CJ5A 1OIMA 5IFPA 4GVGA 3L2MA 2Y24A 3FY1A 1F07A 5D8WA 4GCXA 4GPNA 3WLSA 5LIYX 1QI3A 2JQXA 4REQB 1WOBA 1MEIA 1R7OA 4AG0A 1Y8BA 4ZMGA 2IUZA 2WBGA 3SO7A 4M24A 4DUXA 2VD8A 4KWWA 2VQTA 5HBFA 3WNPA 4E8DA 4HNTA 3HGJA 4WCJA 2XGBA 3MBFA 4FX8A 3G1SA 2UWFA 1CEOA 2QDDA 1UMLA 3LLXA 2EG6A 3LCLA 2VRQA 4E0CA 4E8GA 4ZGYA 3CBWA 4O14A 1VIWA 5DBUA 2PBOA 3C0QA 2WNQA 1R3VA 3WNLA 3MCNA 2O9PA 1H7PA 4QGCA 4O1FA 4GJIA 3KOFA 5BXPA 4JIQA 1VFHA 1HVXA 1QHOA 1PO9A 4PUMA 3SCTA 4Z0JA 1S2CA 3GZAA 3VX0A 2DT1A 3WCZA 3OOQA 5CG7A 2X7VA 4QSFA 5EMKA 3GC5A 2EPNA 1KKOA 4DNMA 3GX9A 3IPWA 1RH9A 1F2JA 1XUUA 4GD0A 3QSTA 1J6OA 4IMFA 3RR4A 1OFPA 4DO6A 4DZ5A 1LRNA 1FWCC 2WM1A 2DGAA 2D2HA 3GNNA 4PC8A 1A4LA 1TIMA 3R8GA 1ME9A 4JX4A 3PJTA 3ZO9A 3TAKA 2HMCA 3AJXA 5M03A 2V68A 3G1YA 2E9BA 1WXYA 3V16A 4HNOA 3BAJA 3W81A 2PWDA 3BE7A 2W5FA 5HQMA 1GZJA 3BG5A 1A3HA 1G4SA 4WXYA 1K70A 3AYVA 2VCAA 5B7ZA 2DW6A 3HA1A 3KRBA 4UTFA 2WJFA 1RJRA 3O16A 1W3TA 3BGJA 1V3LA 3QFEA 2R1PA 3GHSA 4IJBA 1Y7VA 4N4PA 4DPPA 3NQ8A 1UR0A 4CD5A 3ICJA 1V6YA 1VRDA 1T96A 1H60A 5IHRA 2XUCA 2IMRA 4XUGA 1MDRA 4H8UA 4MY1A 5C5YA 4F9DA 3W83A 1BRLA 1TX0A 5CBJA 1MUWA 1EWEA 1FCBA 3NDYA 4JHOA 2V3GA 1GJWA 5M2FX 1NP0A 3PB0A 3SADA 1TMQA 2VCCA 3WJWA 3T6CA 3NL6A 1KKRA 4MUPA 1JXJA 3AHZA 3BW3A 4LRTA 1EIXA 3V0SA 3B8VA 1E4MM 2I5GA 4QE1A 4QJ4B 4H9UA 4MNLA 3GIYA 3VGEA 3UQNA 1EJRC 2NT1A 3B8UA 3VIGA 3PBGA 1V93A 3NR0A 4FLOA 4WDUA 3BURA 1Q6QA 1KM0A 4GKTA 2NUWA 3DG7A 3T42A 3WD2A 4Z1AA 3WDIA 3F5JA 4QM1A 1G1YA 1DQWA 4AMAA 1DYSA 2BY1A 2PMQA 3MMDA 3QLLA 2HE8A 2OODA 2RDTA 3KWSA 1HVQA 3CTLA 4PBFA 3O1NA 3PUOA 1XSIA 3T0AA 4WY0B 4K68A 3KCOA 3LRLA 1QUMA 5A69A 1J5TA 4C6JA 4O1CA 4HK6A 3GTNA 2FFCA 4EVZA 5D33A 2YOCA 1UZ4A 1IZKA 4O0KA 1F74A 1UROA 4FNUA 4IFRA 4CN4A 1TWWA 4J3SA 4MLRA 4D6FA 1CLXA 3FOKA 1WKYA 4C6KA 2FMOA 2E0PA 4HB7A 3C86A 4OOZA 3BSMA 1WOAA 3GY1A 4G7FA 1OC6A 4I7UA 2VRKA 3NG3A 4WX2A 1HTIA 1MEHA 1M65A 3G8EA 3LD5A 4ONVA 1A5KC 1VGAA 4LBSA 1JRBA 1VPYA 2G3NA 1XBVA 3G1FA 4Z2KA 1WKDA 3BGGA 1X96A 4I7WA 4JTAA 5J04A 2OTDA 4AY7A 5CZTA 1MQPA 3UR8A 3W70A 1MXSA 2DQWA 1LF1A 5REQA 4NYYA 4W4QA 4PUKA 4EANA 3VD4A 3TQPA 4HHLA 3KCLA 2CW6A 4A8IA 1K6AA 1K6WA 4R9OA 2CBIA 3B06A 4W88A 4IP5A 5U4NA 4PEKA 2F9RA 1YDYA 4KFNA 3REQB 5IRPA 1OZMA 2HJPA 3W1UA 4UTMA 1BWLA 1Q65A 3VE9A 3GVVA 1VLIA 3KTXA 5T9CE 4WDWA 1ZJHA 3I3EA 1A0EA 4S23A 2ZRWA 1J9YA 1BYDA 3CV2A 4MF4A 5HNTA 1TE1A 3DYMA 4N0RA 4LUJA 2VQUA 4K3ZA 3HQPA 4DNHA 1MYRA 3S2JA 3TW9A 4JNYA 3RM8A 4J35A 3S9ZA 2ISFA 1XUZA 1KXVA 5AFDA 4TIMA 1XHGA 1AQ0A 5RUBA 3MV11 2PRLA 3PZTA 2DZPA 3TYZA 4P5UA 5M1TA 1F05A 4W8AA 2Q8XA 4DJEC 5JIWA 2PURA 3NQVA 3PP7A 1X98A 1GVQA 4X60A 1TSIA 3MDWA 4HCLA 2J7BA 1M6JA 3NURA 1IEVA 4DXVA 1KCXA 5FL1A 5I3DA 3CXOA 3M0VA 2CBJA 2DJXA 2PC8A 3W85A 2XSAA 4KFPA 3SGZA 5CLTA 3MP5A 1YDOA 5EFFA 2WCSA 2CC0A 2WCGA 1KM4A 1I1WA 1XI3A 3R79A 4K8HA 3QHMA 3MANA 5HQEA 3DG3A 2INFA 2X1UA 4MAVA 4A4AA 3DOPA 1CCWB 4XD4A 3H4WA 1NQKA 4ZA0A 2C79A 1O1ZA 3FV9A 4NNCA 1JQXA 2KZHA 2P0OA 3F1QA 4FR1A 2P1FA 4IGSA 4JFWA 1Q6CA 3L21A 1HN1A 1KV8A 3ANUA 5KETA 1D3CA 4L65A 5A6BA 3WLLA 1MQRA 2OEKA 4HU3A 3SRFA 1POJA 2YXOA 1NAL1 3R0UA 3IJ7A 3WIJA 3ZR5A 2QCGA 4BF5A 4GBDA 1FHVA 3ZT7A 1NY1A 3IK2A 5HMSA 1TE6A 4A3HA 2Y63A 3ABXA 4WVXA 4NU7A 2QT3A 3IGHX 1B3OA 1XGEA 4M6VA 5A95A 3UJ2A 2WQDA 6A3HA 4QLKA 3QMRA 4MWAE 3B05A 1W37A 2QHAA 3F4WA 1QWKA 1WP6A 4XWUA 4HMEA 3MCOA 4JL1A 5K7JA 3OLIA 3MUXA 4QRNA 5A8NA 3VNIA 5AYYA 3NQAA 2BVWA 3R5EA 3GO2A 3T05A 2Q8LA 4UC5A 5EY5A 2VMFA 1JXKA 3GNRA 3LHZA 3KTCA 1IXNA 3SUWA 3SSZA 4QITA 3ZZ1A 5IOBA 4J4KA 1KR1A 5GQBA 3TSMA 1FH9A 2IQDA 5DMNA 2UY3A 2DZAA 4RX0A 3P67A 1QJWA 1WCGA 3OLGA 4MTVA 1VHNA 4XKYB 3SY5A 3S2LA 5TQLA 1UD4A 5I79A 5KITA 1E73M 1R9XA 1KM6A 2GJPA 1H1NA 3FHQA 3N29A 4M80A 5IM51 2CKRA 1UKQA 1UB3A 2VTFA 5G1YA 1VEOA 1PSCA 1UD3A 3HU7A 3KZPA 3MPGA 1K4GA 5T8GA 2NSOA 4DJDA 1JAKA 4Q8VA 4L5ZA 4V15A 1WX0A 2J7GA 1H7NA 1EL3A 3SJ3A 1YNYA 2H90A 3ATYA 1L2UA 1JEZA 2Z2UA 3I68A 3LLDA 1E0TA 3QGVA 4UTLA 5K9XA 2HRWA 1VH7A 2HDJA 1BSIA 1V7YA 3LM3A 3TC7A 1PXGA 4HK7A 2DIEA 2IPWA 3M9YA 2QR6A 1GKPA 3IV3A 4NIRA 3T81A 3DERA 1EA9C 4KERA 1LLZA 5CKSA 1Q7QA 3AFBA 4ECLA 3TEVA 1KCLA 1FHUA 1LUCB 2WWCA 3N34A 2FGZA 2BHUA 1RJPA 5H8MA 1W8SA 4ZO7A 2AL1A 2OFJA 3NGFA 1IHIA 4DZHA 2CBUA 1B9BA 4AHPA 1UIOA 5FD0A 2PWEA 4W7VA 3NL5A 1LORA 4BA0A 2Z7GA 2HISA 4MSSA 4CNSA 1LRTA 4PL2A 3VNJA 2BHYA 2YL6A 4L4PA 4ZBCA 2I1OA 2NVDA 3L5AA 4CD7A 1VJZA 5KZEA 4UR8A 2BOGX 4Y96A 4TVUA 1U5HA 2QNEA 2XH2A 4ACZB 2IQTA 3Q37A 3H4XA 4HSOA 4J27A 4ZTYA 4HPJA 2J7EA 4L80A 2J6XA 5HANA 3ZVIA 4S3FA 3TTEA 1GHRA 3TJ4A 2WXDM 3QKZA 1LLOA 5HUOA 2HWGA 3T8QA 3QZ6A 3D3FA 3N6JA 4NYUA 4DJED 3N6QA 4MHBA 5I3HA 3R2GA 1KFWA 1MWOA 1GW1A 3NPVA 5CSYA 3KDNA 2XN1A 3OLEA 3ZSTA 2Z1SA 1F3EA 2X09A 3DDMA 3WBWA 4IXHA 3W7GA 4WUIA 3AJ7A 2F38A 1EPVA 2VELA 2X2YA 4S3GA 4K7VA 5JBEA 2P53A 2YDRA 3SM0A 1XCXA 4XIAA 3CC1A 3W87A 3NVTA 4LB4A 3AI0A 4B15A 1NH6A 1TV8A 3ZLGA 2BVYA 3URNA 4F3HA 1YTEA 3A13A 2REQB 4MUZA 5LIKX 1XDJA 1E9IA 3TOPA 1JR1A 3G77A 1C29A 4M0XA 4RL3A 1QRQA 4AYSA 4WK9A 1AH3A 4FXSA 2IKHA 3GZ3A 4OWGA 2VFIA 3W7HA 1E1FA 3KRUA 6REQB 2HSAA 1GG0A 5DY2A 4DUVA 8RUCA 5CEWA 2Y89A 1CWYA 2Y8KA 1EIBA 2PDIA 1TWDA 3HGRA 1WAUA 1R2SA 3KL0A 1TR1A 4DYEA 2OKOA 1CGVA 3FAWA 3J7HA 4JQ4A 6TIMA 2GJLA 2XH0A 3A4WA 3UZJA 3OQEA 4C1NA 4DB7A 3N2CA 2HVOA 3M0YA 1B0IA 4XUYA 4RCXA 4DJFA 1XQLA 1B9ZA 5HNNA 1W5QA 1OQFA 1P6BA 4GYPA 4UTKA 2QV5A 3I6RA 4TQTA 1AD1A 1IXPA 5HOSA 4R3UA 1VFOA 1JI1A 1XKJA 4UNLA 3G0UA 1E0VA 1QOPA 5CC6A 3VD5A 3CHEA 1GGOA 4YTQA 4JZ5A 2Y7FA 2BX7A 2PUZA 1W1ZA 3THDA 3FVMA 4D6JA 2F6UA 2C1HA 2EJAA 1TZZA 4I5RA 2HBXA 3TLLA 3WUBA 5KZMA 4UFHA 3SUSA 2WMJA 1ZPTA 4UFLA 1IWPA 4C60A 3DU0A 2J7DA 4H7ZA 3W7PA 2Z1BA 1HKVA 2BB0A 1AMYA 1N8IA 1U33A 2WPBA 2ZVRA 2V63A 3G3DA 4KESA 3VNMA 1XINA 3UWQA 2V69A 1JI2A 2ABBA 3IS4A 4GLEA 1RCQA 2WHJA 3AIQA 4TV5A 2R1LA 4ZSUA 1WZAA 1XYLA 1S2UA 1AD4A 1V0KA 2GK1A 4V1XA 2NX9A 1JCMP 6XIAA 1EHAA 5EU9A 2ZX8A 2UV8G 3WENA 2HZGA 3GYCA 1VD6A 3W6YA 3BSGA 1RQBA 4IMDA 3SCNA 3EWYA 2GVLA 3ZS4A 5C2CA 4LQ1A 3SIMA 4JTUA 5LHFA 4N2YA 4KF1A 4KIRA 2J8GA 5EMJA 4TO8A 3ABZA 2HK0A 3P62A 4J40A 4FXFA 5HPCA 4WEVX 2PEVA 1DIKA 3FEQA 1J0IA 5XINA 4URIA 5I0DA 3W1XA 3W28A 5AYXA 3ZVHB 2CZ5A 3BH4A 4WJEA 1GQNA 3TU9A 1I75A 3SY1A 3WQCA 4FR6A 1OD8A 4S3AA 3AU6A 5ABHA 4GACA 3RLUA 4LXFA 2BGSA 3FDKA 3UCDA 2PB1A 3PPFA 2GGIA 4H7VA 3TH6A 4GKLA 3KBMA 1XDMA 2OLHA 3DHPA 4EWND 5A8GA 4I9JA 4ZFMA 4Q4OA 5MHBA 4UB9A 1A5CA 1SPQA 1JCXA 2GOUA 4XZBA 3N2OA 3RLVA 1TJRA 4LUSB 3HM7A 3U0HA 1E51A 4JS3A 2BTMA 3B3DA 3DFSA 1UOKA 3DIPA 4TXEA 2BBFA 3ZJKA 3M07A 3NO5A 3BV4A 3EWDA 2E40A 3H55A 3PC0A 3VABA 1V4YA 2Y5JA 2GQ9A 4RW5A 4J5NA 1Z44A 1A5SA 2VENA 1T7LA 4N4QA 4LB3A 1EFZA 1XGDA 2IXUA 3UGRA 3IIPA 4AIUA 3RLGA 3S8HA 2Q6ZA 4DAIA 4JTEA 3MDUA 1US2A 4WOZA 1YEYA 1G0CA 2UY2A 4YTTA 2X05A 4KBXA 5FEZA 1ZJAA 2GGEA 1Q7ZA 1H1ZA 1YDVA 1NQ6A 1OX6A 3QVQA 2F84A 2VFGA 3LCWA 5K4XA 1YPIA 3VZYA 1JAEA 3EDFA 3NQ7A 5A2BA 3TXVA 2Q71A 4TV6A 3DX5A 5DCDA 2NWRA 3C2YA 4XVEA 4JIIX 4OV4A 1H11A 4C7FA 1VJIA 3TNOA 1AK5A 2NQZA 3VA8A 4GIRA 4O16A 3WMBA 1XLFA 1XLAA 4CU8A 5HA7A 2EPLX 3PAOA 3S3GA 3MV01 5C8BB 3WK1A 1LQ2A 3T9PA 2H3BA 4IJRA 3CB8A 3CQKA 4V2XA 3LQLA 4DLMA 3G1RA 3W7OA 4UOZA 2AAMA 3RNDA 5H1WA 2PDGA 4TTUA 2V5BA 2VC7A 4C6IA 1KV5A 2CEQA 3URBA 3TYBA 2VZVA 1ZL1A 1TJ1A 3VGHA 1E1EA 1ZY9A 3EDKA 3K8MA 1OF6A 1IIGA 3OB8A 2EBNA 1S1RA 4OZOA 1DJIA 1IEWA 1P0DA 1KLYA 3FVDA 4GGHA 5ECUA 1VPXA 4D6EA 1DHKA 3GXMA 3LPGA 3PFMA 2J74A 3AS2A 4CNUA 1JZ2A 1R3WA 3ZT6A 4HZ6A 5XIAA 1I60A 3BDKA 1XH2A 4B5WA 4YVXA 3FN9A 3L0GA 1W91A 3K8LA 4KEVA 4GISA 3EX3A 5I7GA 2CWNA 3WBAA 3L0KA 1RJQA 3U5YA 5G4EA 3IJLA 1I8JA 3B0YA 3RX4A 3MKCA 1UUMA 2L5HA 3Q67A 3CWOX 4AWSA 5HAOA 1TV7A 1W9DM 1GPWA 5AC5A 3O8AA 1C93A 3FHAA 2DZBA 1B1YA 4HYRA 1B3XA 1GEQA 4L7ZA 1WUFA 2XZ9A 2ZCGA 4OBTA 3WQ8A 1HUVA 2RDXA 3GVWA 3JS3A 1MO0A 1TTIA 4OV9A 1PS9A 3O15A 4DYKA 4BS0A 1ONRA 4AVOA 1MFVA 1YNQA 2YKKA 3RF9A 3AXKA 4UQ9A 3PWGA 4RE0A 2Y7GA 5I3IA 1WDPA 3WJZA 4K38A 4CQCA 3KE0A 1F6PA 3P81A 4N9CA 2CIPA 3DENA 4MFEA 2INEA 2FB2A 4US5D 3G5EA 5EB8A 4NRRA 2Z1WA 1RK6A 3FSTA 4GMEA 8XIMA 3ANYA 1UC4A 3VKJA 1FCQA 4A05A 3W7NA 2JKAA 5MF5A 4DWSB 5HNRA 3WK3A 2A4AA 3I65A 2ZTJA 4OUIA 1S38A 1C8QA 2WBKA 4H9TA 4LAUA 3I4EA 3WMSA 4F8XA 1AL7A 5I5RA 1Q85A 3UGVA 2ZUVA 3WNMA 4WKHA 5A5WA 4DBUA 3PWAA 3WQVA 4B5SA 1Q2SA 4ZQNA 2WMFA 5E09A 4QDMA 1A4MA 5LNUA 4IHCA 2XWEA 4P2VA 1C8XA 2J24A 3UJSA 3OZOA 4QG8A 4LW7A 3VK5A 1EQCA 3EB3A 4NT0A 4LVGA 1KD0A 5IBXA 3FGCA 4PMJA 4AY1A 1AQFA 3F7JA 4F48A 2X2GA 2VOMA 3NDZA 3WF2A 3W00A 3PNZA 3UETA 1XL9A 2CLIA 2QDEA 3O05A 3BXWA 1NELA 2X40A 4L6OA 3E2QA 4CD4A 4AX6A 2YL8A 3VDAA 2D0HA 3ISIX 2Y62A 4EWJA 3UW6A 4JIPA 4P7LA 2OELA 2HVMA 2A7RA 4CN1A 4W93A 3IGUA 4JKMA 2Z4GA 3R10A 2QUVA 4NNBA 1OT2A 3PZ9A 4HA3A 5HR7A 2GOKA 3KFTA 1YW1A 3Q94A 3MW7A 3WL0A 2WMKA 4W7UA 1Q3NA 2XGIA 2QLYA 3HGOA 2YYUA 3UFYA 1JDAA 3MMUA 4MNJA 4PULA 2J8FA 3V3WA 5EMUA 2UBPC 1CGWA 4ML4A 1NM9A 3LMYA 4RXGA 4XISA 2EG7A 4GBUA 1RBOB 1B57A 4D6IA 1DJZA 5LGXA 1PWMA 4GH1A 1RLDA 5D04C 5JQ9A 1JJKA 5H2ZA 1JCNA 4HNVA 1W56A 4KT2A 1CI1A 3MP3A 2VZOA 3HMJG 1B2YA 2CHOA 3VINA 5BRQA 1UR2A 2VDIA 3CASA 2NQJA 3PZUA 5EMLA 1U1HA 4MIMA 2VX5A 3ERPA 2Y1HA 1XJBA 2X1RA 2JEPA 2E8YA 4REQA 4O0QA 1GORA 2PGFA 1KXHA 3WDPP 3WQPA 2V8ZA 1MW3A 1RD6A 4C7DA 1R30A 5DT7A 3T4CA 3ITGA 3NZRA 3OA5A 3POHA 4GC4A 2PTWA 3RN6A 1YIXA 1HO1A 4C91A 4Q4PA 3AICA 4RV8A 1GVSA 1UA7A 1TFVA 1Y0EA 3C0JA 3N4AA 1EBHA 4HJWA 4ZO9A 1PIFA 2OGJA 1BXCA 3MB9A 1IT0A 5C0QA 3N9SA 1UBSA 2ZRVA 1W5OA 4Z2GA 5KINA 2WSRA 3CGTA 2CHRA 3Q4DA 4X0VA 5AHLA 4YCPA 2VEKA 2YBTA 3VNZA 2BGNE 3ZLHA 3RG6A 2PP3A 3QV9A 3BO9A 3C0SA 1KFKA 3VIIA 1AW5A 1RXOB 5ABFB 1MXGA 2I7GA 1OYAA 3MHUA 3SJNA 3VDHA 1VCGA 3CAVA 1F61A 3LCFA 5KZDA 3S1WA 3P7YA 3B8TA 2R1KA 1A53A 4C1KA 4YLWA 1GJUA 1QBAA 3NNTA 2Z28A 5G4HC 1PKNA 1H5YA 3C4UA 2QIWA 1W9PA 3E49A 3WQ6A 3AO0A 1RA5A 3UA3A 5DXYA 4JHMA 1V7AA 4GQQA 4DJFC 1SUXA 3T08A 4LUIA 4TX9A 4AYGA 1C8YA 1VKFA 4GYPC 1I4NA 4K8GA 3MSGA 5LKYA 4PMZA 4BFAA 3MTWA 5FF7A 3RM4A 4DUWA 3HFYA 5AECA 5I02A 5FSDC 2RDWA 1X6UA 1LL7A