3OVRA

Crystal structure of hrpe and d-xylulose 5-phosphate complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
221
structure length
221
Chain Sequence
GCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose-phosphate 3-epimerase
publication title Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 80
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ovrA00
3MW7A 3M5VA 2GQ8A 4AEOA 4WJEA 5BMWA 1VLWA 3LERA 1MZHA 4FB7A 3HGJA 4MJMA 4PCFA 4O19A 4EVZA 4JXCA 4OV9A 4M19A 3SECA 1HO4A 3W6YA 3H54A 3KRZA 5FI8A 3A23A 3DXIA 3ABQA 2W6RA 4NUWA 3PAJA 4R34A 4O1CA 1G6CA 2CLKA 4GE8A 4RXGA 3W75A 5LGXA 4LY8A 4UUIA 3L67A 3DH7A 3UWYA 2Y7GA 2V8ZA 3TFCA 1F6KA 3T78A 2TPSA 1SU5A 3PG9A 2CLOA 3UWQA 1EX5A 4JTIA 4OQVA 3RF9A 3LTYA 4KFNA 4AF0A 3CQ0A 3GB6A 4LWWA 1M5WA 2A0NA 3W23A 3ZFHA 2V5LA 1RPXA 1TPDA 3P8IA 3W7KA 1EA0A 3LCWA 2CZDA 3GYEA 2QKFA 2QUVA 3WJZA 3B04A 4X2RA 2R91A 3NL5A 4RXFA 3L68A 1RQBA 5DBTA 1DJQA 3W1QA 3A21A 1KV8A 4M6VA 2V9DA 1JR1A 2QCGA 1M7OA 3LXAA 4JNMA 3S5YA 2ZBTA 1TO3A 1U5JA 2TSYA 4LVFA 2G95A 5EKYA 1UJPA 2A85A 1UCWA 4LVGA 1OYAA 1I2RA 2BSLA 1ICQA 1M6JA 2QDGA 2D73A 3I7QA 3PF3A 4M7SA 3BARA 4X22A 1H1YA 1OFOA 3PS7A 2ISSA 3EWYA 2VELA 3HPXA 3I6RA 3GDMA 3ABOA 2WNQA 1ZHAA 1MEWA 1P1XA 3WK3A 1RR2A 1SO3A 3EX4A 2J24A 1TQXA 3WJXA 1GTEA 3HO8A 2NWRA 3M44A 3W7QA 1G7VA 2EHHA 5D33A 4XUGA 3W7NA 3NQ8A 4LV4A 4NZFA 3TCEA 2V0TA 3FKRA 1X8FA 2EGZA 3PR2A 3ATZA 1QOPA 4LS2A 4Z1DA 2BX7A 3IIVA 1NSJA 2VEKA 3W2LA 2DJLA 4JX6A 2VEPA 1R30A 1ZAJA 1RVGA 3OVPA 1E51A 1H7RA 4AWUA 3CLMA 4CNPA 2NUXA 1WOAA 1G4TA 1OF6A 4CCEA 2VXNA 1TMHA 1Q3NA 4UTIA 4N02A 2YX0A 1ZJIA 3LHVA 4GNJA 3PSVA 3HGSA 2DZWA 3IV3A 1L6SA 1NVMA 5HR7A 4OU1A 1IIHA 3WK1A 4EF9A 3L9CA 1KM0A 2VFGA 1OFBA 2E77A 2CU0A 3LHYA 1W0MA 4JIPA 1N55A 4LS0A 5C2XA 4UTUA 1QPOA 5G2WA 2A21A 3GAYA 3G1AA 4D2JA 1KBIA 4UXDA 4JD4A 3C61A 3MP4A 2J9XA 3S1VA 5AYXA 2VEIA 1FUYA 1MXSA 3HG5A 5FEPA 5F4SA 3GXTA 3W9ZA 3PG8A 1OX4A 3GK0A 5K4XA 2NXGA 4LU0A 4K6AA 2P1FA 4UR8A 3T55A 2A4AA 1H7OA 4H3DA 4GC4A 5IBXC 3M1ZA 3BO9A 4A2RA 1JVNA 4N4PA 4UTHA 2JBMA 1WBJA 2QCLA 1I45A 3Q2DA 4DO4A 2YDAA 4MKNA 4LV9A 2FJKA 1C9DA 4PEKA 3LHTA 2NZLA 4YL2A 3GDKA 4BWLA 3W07A 3STCA 5G2HA 2Y88A 2LLEA 4BI7A 4OHQA 2PRLA 3BG9A 4JX4A 3N9SA 4O15A 1S5TA 4UTTA 1FCQA 5ABTA 2PRHA 1KA9F 1P5BA 3TFXA 4YLWA 2ZDRA 4UFJA 4L4MA 2YW4A 2X16A 4POCA 5D04C 1GWJA 3W1PA 2P0OA 3TXVA 5KTLA 1LOQA 5D2TA 5D2VA 3TUUA 2A7RA 1BTMA 4M6QA 3S5ZA 1KFLA 4XTIA 1SFLA 4LUIA 3JS3A 3RLVA 2NXIA 2R94A 4IXXA 1Z44A 1YTDA 2A1YA 2E6YA 1XBXA 3A22A 3S6DA 1YPFA 3TJXA 4PA8A 1ZAIA 2NX1A 3I68A 3G1DA 4A22A 1KW1A 3BK0A 3LBCA 3TX9A 2ATMA 2B7PA 4DO6A 2EKCA 1SZFA 3MO7A 4X9SA 1TV5A 3C52A 1XBZA 4RV8A 3VFLA 1JCYA 3P8JA 2QUTA 1G4SA 1OFRA 4TX9A 3L5LA 3WJYA 4IQLA 3O1NA 4NZJA 4XWUA 1K7XA 3CU2A 1DV7A 1LBMA 4NNCA 4O1DA 1QPQA 4K36A 2ZTJA 4K8HA 3W7RA 3M5ZA 4Y9AA 3ZWSA 2E5CA 2HSAA 3LLFA 5K4ZA 3LI0A 3C2EA 2A5HA 4GWEA 1LDCA 1WBHA 4EWND 5BNKA 1LLZA 2JGYA 3MP5A 2YW3A 3NL2A 5D32A 5TIMA 5KZDA 3RK8A 4JEQA 1QOQA 4QM1A 3SGZA 3UPBA 4JTGA 2AGKA 1I4NA 3W1RA 2CZEA 4GUIA 3DBPA 4ML9A 3HB9A 4O0KA 4O1AA 1WX0A 2ZRVA 1DKWA 3BVJA 3IGSA 1EP3A 1WAUA 5CZJA 1AG1O 4O50A 1LBLA 3JR2A 2RFGA 3NGJA 3M0ZA 1KFJA 1XUUA 2CW6A 3NQAA 1LYXA 3W3OA 5KINA 3G1FA 1W56A 2XN0A 2A7NA 3MI3A 1D3GA 2FB2A 3TK7A 4WOZA 5LKYA 1VZWA 5I3FA 1OFDA 4IXHA 1OJXA 1TIMA 4Z08A 2QEZA 3L0NA 1G69A 2EF9A 1DL3A 1X1OA 1UB3A 1QO2A 2Y7FA 4ZQMA 1MEIA 3BG5A 4JTFA 1DQWA 3W73A 4NJJA 2NV2A 3W88A 1DQXA 1F74A 1DOSA 5G1TA 3G24A 3TH6A 1Z48A 1UUOA 1B9BA 3ANYA 3TMLA 3B0UX 1KTNA 3IGXA 1TTIA 5CPMA 1EUAA 1OK6A 3GZ3A 3NL3A 3F03K 3NQGA 1J5TA 1VS1A 3M5XA 1CW2A 1LORA 2V2HA 2FLIA 4A21A 1R47A 1FWRA 4LUJA 2XN1A 1VCGA 4ZQPA 3NAVA 1G4PA 3QFEA 1Y0EA 3NG3A 3P82A 4KKXA 1VJIA 1VYRA 1AL8A 1GG0A 3S0CA 2TMDA 4QIUA 4BK9A 3EX2A 3G0SA 4P2VA 3MBDA 2XFWA 1FQ0A 1ICSA 2QAFA 3INPA 4YXGA 1I2QA 1V5XA 5HMSA 2RHGA 1XDLA 2RH9A 5DY2A 3F1QA 1IF2A 2W0UA 3FA5A 4AMAA 4EOUA 2DZVA 3R89A 4MLJA 3QW3A 2ZRWA 2BXVA 1ICPA 1F76A 3LCFA 3S8HA 2B0MA 3ZS4A 2WNNA 2PURA 3EWBX 3NM1A 2C3ZA 4BFAA 5E0KA 3BV4A 4JDBA 4KFPA 4DXVA 1FY6A 3FOKA 4ZMGA 2NXHA 3EXTA 3P62A 1PCKA 4IX0A 3FJ6A 3LX9A 1IIGA 4NJKA 1SPQA 4WQ6A 4Q32A 3C2FA 4LNYA 3M16A 1OYCA 3W1LA 2Z1BA 4AVFA 1D9EA 5DN1A 4QJ1A 4ZVJA 3VCRA 2ZZ1A 3HPZA 1TPUA 1VHNA 1LRNA 1SFJA 3KOFA 4ZQNA 1LOSA 4DPPA 1PHWA 3GXNA 1LBFA 4FHAA 1QWGA 1D3HA 4O13A 3K30A 1I8JA 5HUOA 1A5SA 1JRCA 1H62A 4M7TA 3NOEA 3CWNA 1K8ZA 1GJPA 1H7PA 3C3NA 4I7UA 3CIWA 4LT9A 5EA9A 1FWSA 4MFEA 2WSYA 1EWEA 1G67A 1HUVA 5FF7A 3QEZA 5F2GA 2BTMA 3STEA 1EIXA 5K3VA 3AJXA 1FCVA 4M6PA 2NUWA 4FX7A 1Q6LA 4MFDA 3DFSA 2RDTA 2WOQA 4FXSA 3DHDA 2YXGA 2V2DA 5CZSA 3TV8A 4O1BA 2ZZ5A 3FIGA 1GVRA 3QM3A 3PC0A 2NV1A 3O63A 4MZ8A 1K8YA 1ZCOA 2IQTA 1Q6OA 1SUXA 3UNDA 3U6WA 3TW6A 2DORA 5LZLA 3QC3A 3W1UA 3TNOA 4FIRA 5CG7A 4UR7A 2YCEA 5G5IA 1FDYA 4NT0A 2FPTA 2QCFA 1AW1A 4MIMA 2FPVA 3ABRA 3LCXA 3TQVA 3SGUA 1M7PA 3R12A 2VFDA 2QDHA 1LLWA 3SI9A 2E1DA 4TR9A 5CGQA 3CTLA 2DZSA 2E5BA 3USBA 3IIXA 4U28A 1OFEA 4RCXA 4GUHA 3GX9A 3P7YA 1PIIA 3TSBA 3W86A 4QNEA 2C6QA 3EWWA 4WZHA 3BGJA 3QQ0A 5KSWA 4UFHA 4FNQA 3LI1A 1XI3A 4YCOA 5L6UA 3LBMA 4FIQA 2J88A 2ZRUA 1F7BA 1FBAA 4MUZA 2C0AA 2OMAA 1A5AA 4Y6GA 4HT3A 4EIVA 1GVSA 3GXPA 1FCUA 1OX6A 3KX6A 2WNZA 3L5MA 3D0CA 1GOXA 1VYPX 2QAPA 3NL6A 4AHPA 3OBKA 3KRSA 2B7QA 1IXNA 3IVUA 1OK4A 1JCXA 4W9TA 3UWWA 4AHQA 4TMCA 3C2RA 5CSSA 3UD6A 3FKKA 3NQMA 5DLCA 5AC7A 2OJPA 1JCJA 3P5ZA 3QJAA 2V82A 2WV8A 1SW3A 3G1XA 3PY2A 1TTPA 5FF2A 3EEGA 4JR5A 1TQJA 2Y7DA 1I2NA 1TPH1 5DXXA 1TREA 3PULA 5CKSA 5K7JA 1WXJA 3LOTA 2A6NA 4WY0B 2V5BA 3GLCA 3PB0A 1W37A 2C16A 3OG3A 1I2OA 2CZ5A 3IGUA 3NQFA 4FNRA 4IGHA 5CZ0A 1GEQA 4K7VA 2CWNA 2YGYA 3TROA 2ABBA 4O17A 3V75A 4TO8A 4UTLA 2GQ9A 3IVTA 3UZ5A 3QQ1A 4OT7A 1MO0A 2GVGA 5U4NA 5K9DA 3LLDA 1C29A 3PM6A 1KM5A 4CCDA 1T8XA 4R7JA 3CB8A 1ONRA 2TYSA 1KM4A 2OCZA 3LCGA 2C19A 4IJBA 2E5DA 1ZY9A 4HN4A 1LCOA 3UQNA 4JTUA 4QISA 3DI0A 2QJGA 4S1FA 4U4MA 5BW6A 4FNPA 3LTSA 3R8RA 4H4IA 2A2IA 4FNTA 3TSMA 1G7UA 1ME8A 1PCWA 4CQ8A 2ZZ7A 3PUOA 4ORMA 1KM1A 4G1KA 4S2CA 3W2MA 1HL2A 5G4WA 1HTIA 3Q37A 1GZGA 1R2TA 4UIOA 3C8FA 1L2UA 3UXDA 2PRMA 1UASA 3W1AA 4TU1A 4PH6A 2FFCA 4QQ3A 3W84A 3O15A 5KZMA 3RU6A 3LCIA 5IM51 5DELA 2ZZ2A 1NF0A 3CC1A 3UWZA 4MY1A 2Y7EA 5CPLA 1YPIA 1FDJA 4NX5A 3HPSA 1OFPA 1S5VA 4DEFA 2ZQ0A 2X1SA 1VGAA 3DFQA 4NNBA 5CPNA 5I3KA 5LSMA 1WA3A 3DU0A 3WK0A 5G1YA 3PB2A 3EB2A 3C2OA 5AHMA 1XCFA 4IMFA 1FDZA 3T40A 1EP1A 1QPNA 4A29A 3QF0A 3C0JA 1PV8A 1GYNA 5H2ZA 3HIJA 3TJLA 4AWSA 5K9CA 4ZQRA 3R5EA 3LCHA 2HTMA 1CX9A 3QW4B 3OEXA 1TPFA 1KFEA 3DZ1A 2XN2A 3DI1A 4LW7A 5CPOA 1A50A 4I7WA 1FXQA 4DO5A 3LCLA 4IMCA 4GUJA 5C54A 2WSQA 3B4UA 3G1YA 4FX8A 4RR4A 3P74A 2JKEA 4HHPA 1JULA 1SZEA 2ZZ4A 1W5QA 1YXDA 3M41A 5AN7A 3W1NA 3L2IA 3WK2A 1BEUA 3SFKA 2VFIA 4P61A 1W3IA 2Q3RA 1RV8A 1YTKA 5HWNA 3G0UA 4IMEA 2B7NA 5DXYA 3NA8A 3U2OA 4R53A 1SQ7A 3FYPA 4Z0JA 4N9EA 2R8WA 4DF0A 1QDSA 2ZRZA 3VE7A 1KM2A 1QAPA 3GDLA 2H6RA 1PE1A 1F2JA 1RQEA 3GR8A 4MYXA 2YYUA 3NNTA 3EX6A 4JTHA 1N7KA 3UYCA 1TPB1 3GVGA 1XL9A 1A53A 1PS9A 2F84A 4WUIA 4HPJA 3STFA 5CSRA 3W7GA 5H91A 2I9EA 3GIYA 1GPWA 3PBUA 1H5YA 1LRQA 3C4UA 1TV7A 4HNTA 1H60A 5D02A 4UTKA 1TPWA 1EUNA 1OG0A 2E68A 2G5WA 3NPWA 1W3NA 2C15A 3NQEA 3QH2A 1S5WA 4MZYA 2RDWA 3G1VA 4XBSA 4DF1A 5I3JA 4MLRA 3G18A 3EXRA 4JTJA 3GKAA 3I7RA 1F73A 3A9IA 3HF3A 3FLUA 1YADA 5HUPA 2H3DA 4HSNA 3GNNA 4IUOA 5FEZA 1YDOA 3E49A 4ORIA 3NR0A 1IXPA 3N9RA 3NM3A 1FWWA 4O14A 5F4XA 3W7DA 1O5XA 2BLEA 4HIBA 4XKYA 2NX9A 3W71A 3GNDA 4O57A 5F2IA 3H55A 5FF4A 3W7IA 1TJRA 4GFSA 1LRTA 2I1OA 1CI1A 2NUYA 1SR9A 4MYAA 2EPHA 3KHJA 4QITA 1YDVA 4LVBA 2H90A 1KLZA 4JX5A 2Z6IA 1N8FA 2JGQA 3W83A 3LM7A 4LVAA 2DZPA 4N2YA 3LXCA 5HWJA 3G22A 2WPBA 2QCDB 3DKJA 3CPRA 4MZ1A 5AYZA 2GJNA 1NF7A 3LTPA 5LGZA 1RQHA 3QYQA 1SZNA 4UFMA 3NPXA 3L65A 5EMUA 4PL1A 1AK5A 3CEPA 1LROA 2FDSA 4PTNA 3B05A 3HG3A 3L66A 5DCEA 5HR6A 7TIMA 3S42A 1F5ZA 3Q94A 3THAA 4UMCA 1P4CA 3EWUA 2RDUA 3OVRA 4JTLA 1GG1A 3ATYA 1NEYA 4O16A 3S5NA 1Z41A 2PC4A 3OVQA 5AHNA 3W70A 4WY0F 3W7MA 1AW2A 2QCHA 4J9JA 4UFIA 2ZA2A 5HNRA 3KVLA 2AQWA 3BGGA 2OX1A 3A5VA 3DHFA 3P67A 3OIXA 1TRDA 2JKPA 1F05A 3W7OA 1O94A 4MVAA 4Q4KA 1LP6A 1W5OA 1YXYA 2FPYA 3KXQA 1UUMA 2A6LA 3IEBA 1QMLA 3M43A 1OYBA 5F1UA 3P5YA 3GR7A 4DF2A 4RJEA 1PHQA 4Q33A 3TXZA 4OE7A 3KVKA 5LNUA 3NYZA 2V81A 3TMQA 3LRLA 3N2XA 2ZA1A 5HINA 3FS2A 2FTPA 3NEVA 3L0GA 1JCNA 3PWAA 4L4LA 4WD0A 2GJLA 2V30A 4AHOA 3KRUA 5HQEA 1PL9A 3WJWA 3TA6A 1W54A 3G8EA 1L9WA 2W79A 5AHLA 1EWDA 3T44A 3TR2A 3Q58A 4UTMA 3MHUA 3MJYA 3UXAA 4BR1A 3VI2A 4ADSA 4WXZA 4XQ6A 3GKFA 2GVJA 4WOQA 3TDFA 2H3BA 3BLEA 2QJHA 3NQ7A 3NVTA 1TJPA 5AYYA 1K7EA 3S1UA 4Z0SA 1EEPA 3TE9A 5BRBA 2VOMA 3W85A 4ADTA 4JYEA 2VKZG 4UC5A 1OFAA 1TB3A 1RZMA 3RLUA 1C8VA 2QCNA 3W1XA 1X6UA 4Y96A 5G4EA 4HPXA 1BWKA 2Z6JA 4KFOA 5AC8A 4O54A 3EX1A 3PVFA 4Z1CA 4ADUA 5AHFA 3HG2A 2WQPA 4N9DA 4FEZA 4JN6A 2AAMA 1LZOA 2DZXA 3W22A 4NX0A 3O6DA 1VYSX 1QR7A 5LNSA 3W1TA 3MHGA 2ZRXA 1O95A 3BW3A 4TMBA 3MHFA 4XBKA 1R46A 3N3MA 3N73A 3HMJG 2ZTKA 1TPC1 1XC4A 1W5NA 2F7FA 4BWLC 4E2DA 3UPWA 1J2WA 1WV2A 4CNNA 1TRIA 5E93A 3FFSA 3LHUA 2VFFA 4UTTC 3M9YA 1XUZA 2ZA3A 5AC6A 1F6PA 3FJLA 4CQAA 3LHZA 1W8SA 2X1UA 4FNSA 3TIMA 5IBXA 4OV4A 2X1RA 5C6MA 3R2GA 4IPJA 4JS3A 5I3GA 4AXKA 3A5FA 1VH7A 1B57A 4QNWA 3P60A 5BMXA 2YPIA 4QAIA 1VR6A 4K38A 2Z2UA 4DBEA 5F1VA 3EKLA 5I3IA 8TIMA 4WY0A 5MHBA 1AMKA 1PVNA 2DP3A 5F2LA 3W2NA 4MPQA 1OABA 3PBWA 3QMSA 1U83A 4HNUA 5D37A 3SZ8A 1R2SA 1Q6RA 1ALDA 1YLVA 1GVOA 1QNVA 2VFHA 4JTEA 1DHPA 1Q6QA 1OVDA 3RMJA 4JYDA 1GQNA 3QZEA 1K03A 1T99A 3SJ3A 3MMTA 1H50A 2J6XA 5D2WA 1ADOA 1IXOA 1WDWA 3TC7A 4O28A 3NDOA 1SSDA 5A8GA 4N6EA 4FX6M 1HFBA 4RZ4A 1SSGA 1KTCA 4UNLA 1XKYA 1YDNA 4YCPA 1EB3A 3TAOA 5HULA 3HG4A 5BOOA 1K8XA 4NXSA 2GUUA 4NVTA 2JK2A 3E12A 1KM3A 4JTKA 2WO5A 4I9AA 3G3MA 4HNVA 4CCCA 1HG3A 1T0OA 1ZENA 3NZRA 4R33A 1JRBA 3UY8A 2GOUA 5U7SA 1WYIA 2YSWA 3LB0A 5DCBA 3LV5A 4PODA 2Y70A 4C1LA 2GVLA 2BZNA 3ABSA 3W74A 2WSRA 1W5MA 4UMBA 3RFAA 2KZHA 5EY5A 1V7YA 3WJSA 4ZL1A 1VHCA 2J9YA 4JTSA 1TYGA 4MY8A 5D38A 3TU9A 2ALDA 3NPVA 5E1QA 3VNDA 3DFNA 3L5AA 2H8XA 3O07A 3N34A 2ZZ3A 3N14A 4ZZ9A 4MOZA 2ZCGA 1H61A 4HNNA 2JKAA 3KAOA 3EWXA 2CLMA 1EPXA 2RKXA 4O12A 2ZRYA 1S3HA 4JICA 2O7QA 3C6CA 3S9YA 1LOLA 3CHVA 4NNAA 1J4EA 2DZTA 3G3DA 4BF9A 4LVDA 4FNUA 3QPYA 4NQ1A 5LNRA 1JQXA 4E38A 3M7WA 1G4EA 3O6YX 2Y62A 4B5NA 4PC8A 1VQTA 5KITA 4IWWA 2Q8LA 1XBVA 4WXYA 4HKPA 2CZFA 3LRKA 1WQ5A 3NZ1A 3EWZA 3HJZA 3HQ1A 5F2MA 4O4VA 3IIZA 5GVJA 4MY9A 3FYOA 3O06A 3V1PA 1BWLA 2WJZA 2QJIA 2X2GA 4GUFA 2ZYFA 3N19B 3C2VA 1R2RA 3S1XA 1QFEA 2YYTA 4RX0A 1OHLA 4UFLA 3NQDA 3P61A 4O11A 4S2BA 3B0PA 4IPIA 5EBUA 3E9AA 1K3UA 2YR1A 3DFTA 4K7YA 4AF0B 3KVMA 2YZRA 1KM6A 5DY3A 1KFBA 4NJIA 4QSHA 1OFQA 3W7LA 1K7FA 4UTJA 2UV8G 1Q45A 5KZEA 4XTDA 3W72A 1EP2A 3MI2A 2X1TA 4O0ZA 3B8DA 4LC6A 3W1MA 1VC4A 4GXMA 2YFOA 1KBJA 1W3TA 3W7HA 1WOBA 1JCMP 4LRTA 3YPIA 2I14A 3DGRA 2TRSA 3W2UA 1GVFA 3UWVA 4ICNA 4K39A 3LRMA 4N9CA 3NQCA 1DBTA 1H1ZA 1LM1A 3I65A 4JDYA 4CLMA 4LRSA 3DAQA 3MP3A 3GAKA 3AO0A 3OHIA 1SW0A 1BKSA 4DQWA 4NU7A 5FESA 4CNOA 1L6WA 3B0VC 2E6DA 4TIMA 1MEHA 3MUXA 1SZGA 2QCEA 2C14A 6TIMA 3VE9A 1XBYA 3E0IA 3SIZA 4FXRA 3UWUA 3GDTA 1JUEA 5D09A 3GDRA 4H6KA 3IVSA 3IIPA 2FIQA 2GPTA 4UTWC 3LHWA 2VENA 2Y85A 4KWWA 4NJHA 4FF7A 3DFPA 1DORA 4OBTA 3W7EA 1JUBA 1GT8A 1DVJA 2B4GA 3OA3A 4X3ZA 4FO4A 1GTHA 4Y90A 1TTQA 2QR6A 5A5WA 2V2CA 4JY9A 4GBUA 2QCDA 5AHIA 2Z0IA 1VPXA 2Q3OA 4K37A 1H7NA 2ABAA 2DZUA 3G1SA 3JRKA 3FEMA 1SO5A 5AOUA 2CFFA 3T4CA 4UCGA 4YWIA 5DBUA 5D03A 2HS6A 1GVQA 1FWTA 6ALDA 3CEUA 1QO5A 5HJLA 5EL1A 3F4NA 3U8GA 2VFEA 3TKFA 2E09A 4O10A 4N4QA 3ELFA 1H7XA 1XDMA 3O05A 1TPVA 1VCFA 3TC6A 1W5PA 2FQIA 2NWSA 2Y89A 3HBLA 3MYOA 5TQLA 5DCDA 4IMGA 1ZFJA 2VEMA 4N9BA 2J27A 3MBFA 3THQA 1A5BA 1ZALA 1B3OA 5G2IA 3QSRA 1OX5A 3M5YA 3TQKA 3H53A 3WFAA 3SR7A 3QRHA 1AW5A 1FX6A 2QF7A 4NJGA 3G0XA 3R13A 2CLFA 1ZAHA 2WKJA 2C18A 3LXBA 4ZQOA 4O53A 3PBVA 4DBDA 5SWUA 5LNWA 1TPEA 2PCQA 3IRDA 3NPUA 1OX4B 2CLEA 3PBYA 4Z1AA 4O4WA 1SO4A 2J9ZA 1QCWA 4DELA 4ZQCA 3TW7A 5HWMA 3HGRA 3ZR4A 5C55A 1KFCA 2QUUA 2GQAA 3LV6A 1KLYA 1JQVA 2BWGA 2E6AA 3KFTA 1VLIA 1TV8A 1A5CA 4YMZA 4AAJA 3UY7A 5C5YA 2QCMA 4C1KA 4ALDA 5TBOA 4LC8A 2Y6ZA 1IXQA 3I7SA 1QPRA 3NQVA 3ZWTA 3W7JA 5AFDA 3SW6A 1TSIA 4O52A 1THFD 3S5OA 3L0KA 1IGSA 5FF3A 1TCDA 2ISVA 2B7OA 3DKLA 3CT7A 3VKJA 5FF0A 4RZ6A 3TAKA 3F4WA 5CZTA 5T26A 3MI6A 2CLLA 3TSDA 1TTJA 3LDVA 3BW4A 4K8EA 3S1WA 2X30A 2O7SA 2OT1A 2HS8A 4Y8FA 3W76A 4AH7A 4RKAA 5LNVA 1XM3A 1ME7A 2QCCA 3L21A 3QMRA 3QMTA 1MSSA 4LS1A 1JUKA 3CIXA 2DJXA 2PE4A 3O8AA 4I7VA 5L9FA 4HSOA 4AB4A 4LOCA 1B4KA 4E2BA 3DENA 3E96A 4A3UA 5D2YA 3HGOA 3DFOA 3QPZA 4Z1BA 3NQ2A 2R14A 4CQ9A 5J5RA 4JY8A 4XKYB 4XZ9A 3W2KA 4UMAA 1Z42A 3SY5A 5D2XA 1VRDA 3T7VA 1ZNNA 5J5DA 1LTDA 3M6YA 2Y61A 3BW2A 4WX2A 3NXFA 2A7PA 5F4WA 4UNKA 4O8RA 1KTBA 2CLHA 5AHEA 4JYFA 3CM4A 4RZ5A 2CLIA 1O4UA 3P80A 1O5KA 4BI6A 1FXPA 4E0CA 3O6CA 1L6YA 2H8ZA 1JJKA 5KMYA 3EX3A 3P84A 2OT0A 1P0KA 1HO1A 1OF8A 1P0NA 4JIQA 4EF8A 5LHFA 4GUGA 3PUEA 4IMDA 2NLIA 1FWNA 1K02A 3MYPA 4DPQA 1UBSA 5EPDA 4OGZA 2Q8ZA 4O18A 1XFBA 2Y63A 4GJ1A 3N2MA 3B03A 5D30A 2NX3A 2YFNA 4IX2A 4ONVA 4BI5A 1SO6A 4JGDA 3KVJA 3PUDA 1XXXA 4PL2A 2OZ0A 5AB3A 3M47A 3BLIA 3W87A 1RD5A 1W31A 4N6FA 2EAWA 3EKZA 3W2JA 3BLFA 1DJNA 2G96A 4UFKA 1ME9A 4LTSA 4GRSA 4RK8A 3TQ0A 1NFBA 1T96A 3A24A 1KV5A 3G1HA 3W7PA 1YXCA 1YTEA 3E02A 1VCVA 1I2PA 1KFKA 2FB3A 1GYLA 3IIOA 2P10A 3BPWA 1B4EA 3O16A 1SW7A 4IOTA 3G8RA 3NO5A 4JTTA 2G97A 1NAL1 3QSTA 3CWOX 1FCBA 5EYWA 3STGA 1ML1A 1H63A 2DU2A 1AL7A 4KWVA 1W1ZA 1YYAA 4UTWA 3EXSA 4A2SA 2ISWA 2ZZ6A 4PFMA 3BG3A 5LHEA 2E6FA 2ATSA 1JCLA 3P81A 4M5PA 5I3HA 5FEWA 4AWTA 2VC6A 1O60A 2C1HA 5D05A 4MJZA 3HOJA 2C13A 3C56A 3RNDA 3LGEA 5K9XA 3W7CA 5K2ZA 4OWGA 2HMCA 5FEXA 4NXKA 4RLIA 3MWAA 1H51A 3UZJA 1X1ZA 3SSJA 1X7FA 3B06A 2ZFAA 1H7WA 3NQ6A 3PSWA
chains in the Genus database with same CATH superfamily
1MRAA 4EK7A 3M0VA 3K4WA 4DVOA 1FHLA 4GH3A 4GACA 1T5AA 3LERA 1MZHA 3RRXA 3MSRA 3V0TA 3SUSA 1CB7B 2FHBA 4WLCA 4E2VA 3EB3A 3AOFA 5FA5A 4I8YA 1HO4A 2YCLB 4NYYA 3RRAA 3W6YA 2BY3A 4L4PA 2VZSA 2QJNA 3AMCA 3VO0A 3NXLA 1I1XA 4B5SA 2PDUA 4GXWA 3QN3A 4O1CA 4GE8A 3W75A 1XCXA 1I75A 4E4FA 2Y5SA 1H5VA 1XP3A 1CZ1A 2Y7GA 1NJJA 1UKTA 3I4KA 3DFYA 1HJSA 5ABEA 3QY8A 5HANA 3UWQA 3MVTA 4AF0A 4OQVA 3LTYA 3M4HA 1M5WA 5CC6A 3BOXA 3R11A 3W38A 4ATWA 4KQNA 3E0FA 3LCWA 3N6QA 3WJZA 4HOXA 4X2RA 4RXFA 3K46A 3ICJA 5DFAA 2WHLA 2Y2WA 3LXAA 3MUIA 4JNMA 4MKVA 3GIQA 4XD6A 2PDYA 1UJPA 1UCWA 3AYVA 1POJA 4Y9MA 1OYAA 1I2RA 1QNRA 1Q7QA 1ZBWA 1ICQA 5LIXX 4DUXA 4AEFA 1M6JA 2QDGA 3I7QA 2OU4A 4M7SA 2ASHA 3BARA 4ZFCA 4KGJA 5CBJA 2ISSA 3POHA 1J01A 3EWYA 3RYSA 1QNPA 3GDMA 1RAKA 1A3XA 1A5MC 1ZHAA 2DT3A 1SO3A 3EX4A 1TQXA 3SQLA 3VM5A 2W61A 3W7QA 2DIKA 5D33A 4XUGA 1OEPA 1WO2A 4LV4A 1IHIA 4LUTA 3TCEA 1DWHM 3BJTA 3WCZA 4K1GA 1W2VA 5CG0A 3PPHA 3ATZA 3IUHA 4Z1DA 2BX7A 2DVUA 2DJLA 5A6KA 1ITXA 4JX6A 2VEPA 1RVGA 3UVIA 1E51A 2INFA 1V6WA 3CLMA 2E7FA 3S6TA 1OF6A 2VXNA 4UTIA 4MJ4A 1A0EA 4GNJA 4JFTA 4DO7A 1L6SA 1NVMA 2CXEA 5HR7A 4HBKA 3RUBL 3AYTA 2ICSA 3WK1A 3CGTA 1OFBA 2E77A 2CU0A 3I3BA 3LHYA 3T8QA 5H8MA 4LS0A 4GYPC 3D47A 3SRFA 2OGYA 3WNLA 4D2JA 1ZP4A 5JH1A 3C61A 3S83A 4DUOA 3QOMA 3WBWA 2G41A 2GGHA 5AYXA 2VEIA 3HG5A 2QV5A 1RBOB 3WQOA 3AIWA 5CC5A 4GABA 3GFXA 4G7FA 5BCAA 1FFQA 5F4SA 4Y2WA 2G3JA 3W9ZA 1X97A 4FXFA 5H1WA 4R85A 3GK0A 4G5DA 3A4WA 3OYZA 2NXGA 4AUBA 2VJXA 4LU0A 3GG8A 1T7LA 3OZOA 4UR8A 4B5UA 1BVZA 1XINA 3BH4A 2A4AA 1FWAC 2F6XA 1H7OA 4KCWA 4H3DA 3UG5A 1JYNA 4A8LA 3AAMA 4Z2LA 3BO9A 4I3GA 2E9BA 4N4PA 3U2CA 4UTHA 2JBMA 2QCLA 3ZJKA 1I45A 2ISFA 3UJEA 4CU6A 3ARPA 2HVNA 1RLDA 1VBHA 1NM9A 2FJKA 3WQGA 2EPKX 3GDKA 1XR2A 1YE4A 5HPOA 3STCA 3TC3A 2Y88A 3ZLHA 3W24A 3BG9A 1XLHA 4O15A 3TFXA 1B3ZA 2ZDRA 3NDZA 4L4MA 2YW4A 4ZOCA 1OCQA 1LOQA 1WUFA 3OGRA 1US2A 2A7RA 3LSCA 3UXLA 1R9YA 4EX4A 2NXIA 1Z44A 5DT7A 1YTDA 2A1YA 3B8UA 5DMLA 1YPFA 3TJXA 4PA8A 4AC1X 3WF0A 4A22A 3PZ9A 1KQZA 2B7PA 1SZFA 3MT1A 3MO7A 2PP1A 2IMRA 4XG1A 4C91A 4QE5A 1W1A1 3WJYA 2G3IA 4IQDA 4K36A 4DYKA 1WZKA 4GVIA 1XYMA 3ZWSA 2E5CA 1R7OA 4JCMA 5K4ZA 3VIKA 3C2EA 2A5HA 4R7OA 4H9TA 4XD5A 1BYAA 4PMDA 1LLZA 2JGYA 1JPDX 1KGWA 5HATA 3AXIA 5TIMA 4KIEA 4BEQA 1M04A 3TJ4A 3SGZA 4JTGA 2AGKA 2Q09A 3W1RA 2CZEA 3RX2A 4O0KA 3HJEA 4NHVA 2ZRVA 1XW8A 4ILSA 2X8RA 3VNLA 1WAUA 4NZ5A 5I00A 2RFGA 5CEWA 3M0ZA 2V5KA 4NRSA 2I7GA 3GW3A 3FXYA 4KS0A 3ZLFA 3G1FA 3TK7A 5I3FA 3T09A 3FCPA 4BZYA 4D1JA 3OZPA 1VP5A 1DL3A 1X1OA 3CO4A 3RDKA 1QO2A 4JTFA 1DQWA 2AL1A 1VBUA 3W88A 1F07A 1F74A 3S2LA 3TNBA 2FTYA 1EFZA 1DOSA 4MADA 4ZR8A 3DYOA 3G24A 4L64A 5ECVA 4RL3A 3VIPA 1B9BA 4H8VA 3TMLA 3NSXA 1KTNA 1EC9A 5CPMA 3GZ3A 2BHZA 3NQGA 4GZEA 4H7CA 4XZLX 4AXNA 2V2HA 2GL5A 1R47A 1JFHA 4MHBA 2PA6A 2XISA 3NAVA 4A4AA 3CBWA 4KMQA 4PCNA 1VYRA 1AL8A 5E70A 2AQVA 3H2OA 1B54A 1UZHA 3BAKA 2QAFA 3INPA 4XZHA 1J8VA 1PZ3A 4QBXA 2R6OA 4AMAA 4EOUA 2WMIA 1ICPA 1F76A 3GIPA 3LCFA 4XAPA 4DNHA 2QS8A 4DZIA 3FOKA 4G7EB 1WDPA 4LBRA 3AS1A 1D3CA 3ZT7A 3LX9A 3L4WA 3SQSA 3EOUA 2XSBA 4WQ6A 2VVNA 3SRHA 2JALA 2Z1KA 3M16A 1OYCA 4AVFA 3VCRA 4C6DA 3HPZA 2HVMA 1VRXA 1TPUA 1VHNA 2AOSA 1LRNA 3VMOA 3MZNA 4XO6A 1VD6A 4Q7IA 4GK8A 1DHKA 5HUOA 1H62A 3WENA 3NOEA 3CWNA 4DYJA 4I7UA 1JL8A 3CIWA 4LT9A 1BF2A 4YIWA 5FF7A 3JU2A 2C0HA 1EQPA 5K3VA 2QJMA 3IWPA 4FX7A 4AIOA 1CEOA 3DFSA 2EEXA 3UG3A 1UWQA 2Q6ZA 1NDYA 1TR9A 2WOQA 4FXSA 4Q4MA 1M41A 1KR0A 3LGDA 2PAJA 4GY0A 1GVRA 1BSLA 3PC0A 3LS9A 1JYVA 2NV1A 3CHFA 1RHCA 1K8YA 1W3KA 2PLKA 4E6MA 1U1JA 5LZLA 5J8LA 3TNOA 4E5TA 1FDYA 1Y5VA 2EO7A 1UH4A 2AMXA 2QCFA 1HIZA 4MIMA 2FPVA 1ZUAX 3ABRA 1R0MA 3SGUA 3R12A 4RNIA 1JYWA 2C1IA 3NIYA 5IFPA 2Y4SA 4Q8PA 1A5NC 2GVEA 4C6CA 3CTLA 2DZSA 3NO3A 4ZXLA 4JZ5A 3GX9A 2EBNA 2X40A 3MSGA 3P7YA 1PIIA 4R3UA 3SN0A 3NZGA 2C6QA 4AD4A 3BGJA 5I03A 3AMKA 5G1MA 4X61A 2F2HA 4UQ9A 1J18A 3VVGA 3LQLA 3ES7A 3PPGA 1F7BA 1VPYA 4GFIA 2C0AA 2XWEA 3N15A 3UXKA 4Y6GA 4HT3A 4EIVA 4GQRA 3GXPA 1FCUA 4R9XA 1XLMA 1US3A 3L5MA 2E28A 5CSUA 3KRSA 4XSLA 1OK4A 3GHTA 1SZRA 4W9TA 2JFEX 4UQEA 3NFUA 4TMCA 1HKMA 1UQYA 3C2RA 3FKKA 2BVDA 5DLCA 3B9NA 1XYCA 2OFJA 2VX4A 5REQA 2XFFA 3HM7A 2RDXA 3N1AA 5LIWX 2YCJA 1I2NA 4F2UA 1VEOA 4PMYA 3BANA 1TELA 4E4UA 1WXYA 2A6NA 2V5BA 1EIBA 2C16A 1XH0A 3OG3A 3BL3A 5CZ0A 4CU8A 3VGFA 3TROA 4B5XA 3UZ5A 3U57A 3SUWA 5U4NA 4PFHA 5I3DA 2G4JA 3PZIA 3H70A 2OCZA 1TA3A 4Q8NA 1R8LA 1Q2SA 1ZY9A 4M81A 1LCOA 3UQNA 2VMFA 3KOXA 3PTQA 4S1FA 3EA3A 2DV0A 4PB5A 3R8RA 4RE2A 5HNUA 1G7UA 1ME8A 2QXWA 3APGA 1HL2A 3VGHA 3Q37A 3T0BA 3BLKA 3F4CA 4LAMA 1GJUA 4E8GA 3EMQA 3A3XA 2AKMA 2PWVA 3VDAA 3RU6A 1UHVA 3DX5A 5DELA 5A6SA 3CC1A 2XH7A 1CBGA 2Z25A 5BROA 3CXOA 2Y7EA 5CPLA 1E1CA 4PUUA 4PGLA 1OFPA 5B80A 1S5VA 4RNHA 1H41A 3OLEA 1D8CA 4JQ1A 4HA0A 5I5RA 4RNFA 1WA3A 4FK9A 4MG4A 4ZB5A 4ACZB 3MMDA 1YHTA 1XCFA 4PULA 4A29A 3WKZA 4AD0A 1W3JA 5H2ZA 4CNTA 3TJLA 3VZZA 1GONA 4HZ7A 4LW7A 4I7WA 3M0HA 3LCLA 4PRRA 4GUJA 1U1HA 2UY5A 3UP8A 2ZWYA 3G1YA 3EDDA 2JKEA 2DIJA 2C7FA 3RR1A 1KKOA 3CPUA 4J3XA 3M41A 5M17A 3SFKA 4P61A 3VPLA 1YTKA 1ZP3A 1V02E 5JU6A 4J2PA 3FA3A 3WQDA 2R8WA 4DF0A 1QDSA 3AXHA 3VE7A 3N2TA 3B9EA 4XZWA 5IFTA 1F2JA 4LUTB 2PCEA 2YYUA 4MYXA 4C1NB 3EX6A 1R3TA 1EH9A 4WUIA 1UD3A 4HPJA 3RCYA 1R86A 3W7GA 4JIRA 2PF8A 2I9EA 1CGUA 3HFTA 2W27A 3C4UA 2J6VA 5EMKA 4HNTA 1V3HA 4D6CA 4UTKA 1TPWA 4Q8VA 1EUNA 5LA0A 2FFIA 3CUHA 1ZJAA 4MZYA 1OWQA 2RDWA 3G1VA 5I3JA 3QV9A 3CIVA 1Y5XA 1O7AA 3GR4A 4PTXA 5LA1A 1K4GA 3APTA 4U33A 3FAXA 1YDOA 1XPGA 2DSWA 4H01A 1OCBA 1CXLA 1TVNA 5F4XA 3W7DA 1E40A 2BLEA 3PAOA 5C71A 1RY0A 3BAXA 3H55A 5FF4A 1L8PA 1E9ZB 3OGVA 3UZWA 3VOIA 2YBTA 4F2TA 4GFSA 2GOKA 5A8MA 2NUYA 4W88A 2WQDA 4IFKA 1QI3A 2EPHA 1IT7A 3C86A 3KHJA 3B4YA 4QITA 2E67A 3JZUA 4LVBA 3K4DA 4J3ZA 1KLZA 4JTQA 1UQZA 3GXFA 2Z6IA 3W29A 3GXDA 2VDIA 4QJ4B 1TMQA 4F9JA 3LXCA 1U30A 1HF6A 5LGZA 3R43A 1EYWA 3DIPA 1VEPA 2VRJA 5CC3A 4NI8A 3QVQA 1UIPA 3CEPA 1M65A 1LROA 3ITYA 3S9ZA 3EBVA 4TX6A 4PTNA 2WJFA 4DUWA 1DPMA 3U5YA 1VFOA 4IUGA 5DCEA 1FRBA 2WLYA 2HISA 1GQKA 3KTCA 4JTLA 4EAYA 4I9TA 3UPMA 3THCA 3VOFA 2XU2A 3NO1A 3S5NA 1P0BA 1DIKA 1H49A 1Z41A 2PC4A 5AHNA 4LCSA 2O56A 3BICA 4UFIA 3K5XA 1CNVA 2XM1A 5HNRA 4Q8OA 2POTA 3KBNA 3OIXA 2JKPA 4AY8A 1S39A 1O94A 3CH9A 1LP6A 4D71A 1W5OA 1QMLA 3M43A 1NWTA 5F1UA 4B92A 2WSKA 2ZUUA 3E2VA 4M24A 4DY1A 4RJEA 4U2ZA 2D1ZA 4HPGA 4YTTA 2E0PA 1POKA 4FS9A 1PDYA 3NYZA 1J0HA 1IEQA 3TMQA 3LRLA 3N2XA 2ZA1A 5HINA 3W26A 2FTPA 3WLMA 3NEVA 4ZB0A 3PWAA 1GQJA 2GJLA 2V30A 4PCPA 5C2CA 5AYBA 4GIRA 4HU4A 3G8EA 1IV8A 3WZ0E 1M01A 1KGXA 1MI3A 1EWDA 4JBRA 3Q58A 1AQFA 1PUDA 3VI2A 1MXGA 2RAGA 4F3HA 4EPKA 2GVJA 1VKFA 3N25A 2Z1SA 3BLEA 2QJHA 5H6HA 3SM0A 1TJPA 5A6TC 3HFYA 3TE9A 4HHMA 3RMEA 2QPXA 1GW1A 1XV8A 1RZMA 1UP3A 4B3KA 3W1XA 1X6UA 4DNMA 3EX1A 2VQTA 4I8DA 2WQPA 1TV4A 4N9DA 4AZIA 2AAMA 3NGFA 4S38A 4CEXC 4NX0A 4MWAA 4S3JA 3BJFA 2BB0A 5JBDA 2RJHA 3CZGA 1S2AA 4J7RA 2EJ1A 1E0WA 1PPIA 3AIUA 1O95A 4GO8A 2GGEA 2OQLA 3VK5A 2ZUWA 4N42A 3N3MA 4IICA 1ZZMA 1IWAA 3A3WA 4H6EA 1R5YA 1CIUA 1V3IA 2VFFA 3PBGA 4H8HA 5AC6A 5DMYA 3DG6A 1QT1A 1EC7A 1PSCA 1E0TA 1QW9A 4IPJA 5I3GA 3VDBA 5FJRA 1F9CA 3QHNA 4PMUA 1B57A 2DZAA 2YPIA 1EJXC 3ARYA 1M68A 1W9BM 4LXFA 4DBEA 3GHUA 3EKLA 8TIMA 4WY0A 3QV8A 5MHBA 1AMKA 1XIIA 2F9RA 3B8SA 3W2NA 4RPPA 1U83A 4HNUA 3SZ8A 4J3SA 4DIAA 4FLRA 3WD2A 1F3WA 4IZGA 5BXSA 1B30A 1DHPA 3RMJA 3UA4A 3QZEA 3AXXA 2NQHA 3SJ3A 1E6XM 4NAFB 5FKYA 4O28A 4LUSA 2O9PA 3CZLA 1FOBA 1XKYA 3CL6A 4ZFMA 1VBGA 3IK2A 1QRQA 2Q71A 1I0DA 5I02A 3AWNA 2QVHA 3WLJA 1EDGA 1BAGA 3E12A 1KM3A 2WO5A 3PZNA 3QBUA 1HG3A 3HPFA 1ZENA 4LSBA 1JRBA 2REQA 3GU9A 3WNPA 4IGMA 1NDZA 5U7SA 4EKJA 4KBXA 1TJ2A 1KXQA 3S9IA 4H6RA 3LV5A 4PODA 2Y70A 5DANA 4HPNA 3L2MA 3ABSA 4ERIA 3GBEA 2KZHA 5EY5A 1V7YA 4GGHA 3VX1A 4XV0A 2ALRA 3EA2A 2J9YA 5HQMA 1TYGA 2XWDA 3WLOA 1BHGA 3A4AA 5D38A 1UZ4A 1QTWA 2Z26A 3NPVA 3H24A 3ARSA 5DO8A 4WR3A 3ALFA 3N34A 4HCHA 1E5JA 3ZT5A 1J2BA 4MOZA 2YDQA 6PTDA 1ITCA 3EWXA 1UZDA 4O12A 2O7QA 3CHVA 3QR0A 4NNAA 2AQOA 1J4EA 2DZTA 3G3DA 1K9EA 2OKOA 4FNUA 1BXCA 5LNRA 1C91A 4QJ3B 3M7WA 3WH8A 4B5NA 5EMMA 1XJBA 3WBYA 2Q8LA 4WXYA 1O66A 4WDTA 3S46A 3NZ1A 4QGCA 3EWZA 5F2MA 4OFCA 1L0PA 4HQVA 4PTWA 1XLBA 2WJZA 1XSIA 4Z2JA 4GUFA 3SUVA 2CBUA 3P2VA 3C2VA 1R2RA 3Q4DA 2YYTA 1HNYA 1GVYA 4O11A 4S2BA 2DEPA 1B1YA 4RDYA 5CC7A 3ZO9A 1MUWA 3BLLA 3RAOA 5TNVA 1O1ZA 1SM9A 1K8CA 4QSHA 2R82A 1AVAA 4UTJA 2UV8G 1EBHA 4C6FA 3LUTA 2X1TA 3N6JA 1HGWA 3M64A 2E25A 1E6RA 2YFOA 3VUPA 1KBJA 1WOBA 1JCMP 3YPIA 1W1IE 2I14A 3DGRA 1Q8AA 3W2UA 2QIIA 1WPCA 1PX8A 4V33A 1H1ZA 2WMHA 3T2PA 3WLTA 4CLMA 5REQB 1GW9A 3ZMRA 1LUCA 2YCKX 2GK1B 1T41A 2J7FA 4NIRA 4DZHA 1SW0A 4XD3A 4DQWA 4NU7A 5FESA 2GDQA 1L6WA 1DWAM 2E6DA 1R7AA 2JF7A 2C14A 4AX7A 3B8WA 3E0IA 3QY7A 4JHMA 3UWUA 1PX4A 4UTWC 5A6MA 2VENA 3COTA 1R85A 4KEUA 2JEPA 1UOZA 4EANA 4PMNA 3SCQA 9XIAA 3DC8A 1TA3B 3MCOA 1Q6EA 2F61A 1JUBA 4AZ6A 1CECA 4V27A 2B4GA 3NSMA 1QI2A 1AD4A 4JY9A 3VC6A 3B3DA 5AHIA 1RCQA 2Z0IA 2WZEA 4D6IA 3JW7A 3MSDA 1XLLA 4BA0A 3O2LA 1SO5A 4YYFA 3HMCA 2MUCA 5MF5A 4D9PA 4YWIA 3WDPP 2IKJA 1FHDA 6ALDA 1QI5A 5HJLA 4MKSA 1ISVA 3BXWA 3GY1A 3F4NA 4XBJA 2VFEA 3R6IA 2E09A 3ELFA 2BOEX 1EA9C 1JXKA 1H7XA 1RA0A 2HV5A 5JBFA 3O05A 1VCFA 2BG5A 3TC6A 1OZQA 3WEOA 1LQ0A 2Y89A 1M7JA 2OB3A 5DCDA 4IMGA 7REQA 4KRZA 3L7RA 4N9BA 1XX1A 3THQA 2UWFA 4RW5A 4JNZA 3M5YA 1AW5A 1V0LA 2V63A 3G0XA 3AICA 4H19A 3M0KA 1UA7A 3FGCA 4BQ3A 5D8ZA 3P93A 4O53A 4DN1A 4W93A 2CBIA 3H2MA 2PCQA 3IRDA 3VXGA 3URAA 3NPUA 2OYLA 4E2OA 2D3LA 1SO4A 1QCWA 3LNMA 4ZQCA 5GNZA 2NT0A 5C55A 1KFCA 2QUUA 1Q63A 2NQZA 4XB3A 1KLYA 1EO7A 1JQVA 2ZXBA 1R9XA 2E6AA 3UY7A 1YNYA 3KP1A 2XYLA 5TBOA 2R1LA 4MTVA 1QPRA 4PUNA 2DY3A 1SYTA 3CMJA 4HK7A 3S5OA 3DYMA 3L0KA 1M53A 1EBGA 5CZTA 2CLLA 4K8EA 3CV7A 1XGDA 4MAZA 2O7SA 3BMWA 1HVXA 1XM3A 3REQB 4B5WA 3QMRA 5C7VA 4RNJA 1MSSA 2YZ5A 1S2CA 3CIXA 3V4BA 5L9FA 2DUZA 3HURA 4TUFA 2BMBA 3DFOA 3AYSA 3NQ2A 4CQ9A 3QV6A 5JVLA 2Z00A 4JY8A 4XZ9A 4QQUA 4UMAA 4DJEA 3FYYA 3MU7A 3SY5A 1S5NA 1VRDA 4H9ZA 4LAZA 1ZNNA 5J5DA 3M6YA 2Y61A 4WX2A 4TTUA 1TUXA 4JIEA 5F4WA 4UNKA 2CLHA 4JYFA 4HYWA 5FCZA 3MY9A 4RZ5A 1LWJA 1R3YA 3P80A 4WDUA 2XHYA 4FF5A 2HK1A 7CGTA 3EX3A 4QS5A 2OT0A 3CZEA 1OF8A 3GTHA 5LHFA 4QROA 3W01A 4IMDA 3GXMA 1ITUA 3VKCA 2Q8ZA 4NL1A 2ZADA 4HK6A 4FPSA 4GI9A 4O18A 4RE0A 4QTGA 3B03A 4HNLA 4S3CA 2DH2A 1PB0A 2NX3A 4IX2A 2H9AA 4BI5A 1OT1A 5C9UA 3IJIA 2P8BA 5EGRA 3CK5A 3PUDA 3FEQA 1XXXA 1W91A 4P7NA 2OZ0A 5CAKA 4GQGA 1CB2A 3M47A 5A95A 2VD9A 4N6FA 3SAZA 1FHUA 3PUGA 3SY8A 1ME9A 4GRSA 3WH9A 1JD7A 1BVWA 1KV5A 2NVCA 3H2EA 4JNYA 1EPVA 2WMGA 4FXJA 2P10A 4Y7EA 4QP0A 5A8OA 3BPWA 1B4EA 3O16A 1W9DM 3G8RA 4B5TA 1GHRA 1NAL1 3QSTA 1FCBA 5EYWA 3STGA 2DU2A 1AL7A 3M6DA 1FH9A 1W1ZA 3FHQA 4UTWA 3A47A 5BXTA 1JF5A 4FZIA 2E6FA 2ATSA 1HQTA 3IUIA 4M5PA 4HHLA 3KL0A 4L9ZA 1KR1A 2VC6A 4Q8TA 1O60A 5D05A 3C56A 1GOMA 4GC3A 5K2ZA 3IJQA 1Q4WA 4QCEA 3VIMA 1BQGA 1W9PA 4GD0A 2J7CA 1GOQA 1KB3A 4IP7A 4G56A 1YDYA 3PSWA 5D9NA 1W1VA 3ME3A 4DUVA 3W82A 3H21A 1VLWA 4Q4SA 3N2CA 3OJGA 3MMUA 4MJMA 4PCFA 4EVZA 4M82A 1J12A 4JXCA 2QUNA 4XKMA 3I4EA 4ECLA 5IHRA 2WWCA 3H54A 3AI0A 4NUWA 4DWSC 3OGSA 4R34A 1G6CA 5D9PA 4RXGA 5LGXA 4MWAB 3E74A 4UUIA 1BF6A 3L67A 1J0JA 2YL9A 1J79A 2GWGA 2V8ZA 1E9LA 3FDKA 4D72A 3J7HA 2HPIA 3RF9A 2QF8A 3SSZA 4KFNA 3WH6A 3BLDA 3CQ0A 3VNZA 3GB6A 4AW7A 4TV5A 2GFTA 1CGTA 1FWIC 1SJDA 3CASA 3W23A 3ZFHA 2V5LA 4DM2A 5KZ6A 1RPXA 3OZMA 4X60A 4PBFA 4BJHA 2QKFA 2Q01A 1HJXA 1JDDA 3B04A 2W91A 3NL5A 4MDOA 1PO9A 4TTGA 4G1NA 5IDZA 1KV8A 1TX0A 3F2CA 4L5ZA 1JR1A 2QCGA 1M7OA 1TO3A 3RCNA 4LVFA 2OLAA 5C9RA 2XJ7A 2EPNA 3U4FA 3BURA 2GYIA 3Q65A 4X22A 2XM2A 3HPXA 1RJPA 1Y65A 1GZ1A 1CXEA 2OZTA 5M3WA 1UYQA 1V77A 2J24A 3WJXA 3OPSA 1GTEA 5IHSA 1XG3A 4MPKA 1G7VA 4MAVA 3MQTA 2JE8A 3PPFA 1WAWA 4CD6A 2PWDA 3CH0A 3NQ8A 2G4FA 4NZFA 1XS2A 1UWUA 4AD5A 3FKRA 3CB3A 1ISXA 3WH5A 3IIVA 3OHMB 1XDJA 4XIMA 3FSUA 3MZ2A 1R30A 3OVPA 4PTDA 4ERAA 3THUA 3MUY1 5HOSA 4K8GA 2X1IA 3WD3A 1QU4A 3M0MA 3WF1A 4N02A 1JZ6A 3DCPA 3HGSA 2WCSA 4AISA 1E9IA 2X7VA 1C7TA 4AZ7A 3GG1A 5FSEC 1G9HA 4W84A 1QK0A 1IIHA 4EF9A 1KM0A 2VFGA 4JIPA 1ADDA 4B9ZA 2QZRA 3NJ3A 4PUEA 5C2XA 4JOMA 2Q8XA 1AMYA 3G1AA 1QOXA 1KBIA 3TONA 4GNKB 4JD4A 3SCRA 1DE6A 1HVQA 2VD8A 1UROA 4RW3A 3PNUA 2A3LA 5A6LA 2HBXA 1JGMA 2XVLA 3E0LA 1WDSA 1J0KA 1CXFA 3PN8A 3UJ2A 1XIMA 3VDGA 3CYJA 5FEPA 3OOQA 4AG0A 1PZ0A 5K4XA 5JIWA 2E4TA 1MNSA 2WYSA 4AZHA 2BV9A 3SURA 3MUAA 2O4QA 2PDBA 2P8CA 1V3JA 3AZSA 4FOKA 4ZSUA 4PUDA 4GC4A 3ARRA 1NOFA 1EJ7L 1JVNA 3RLHA 1UG6A 1WBJA 3Q2DA 5TAOA 4LV9A 3HQOA 4PEKA 1C9DA 3LHTA 5I23A 1DJWA 2LLEA 5C8BB 4OHQA 2PRLA 3EGJA 2ZUMA 4P7OA 4JX4A 1S5TA 1KA9F 4H7ZA 3PHAA 2X16A 4POCA 5D04C 1GWJA 2CIPA 1JZ7A 2Y8KA 2G3NA 2O4MA 5D2TA 5D2VA 1V0KA 2OYMA 3S5ZA 1XH2A 1PWMA 3AIQA 4OJYA 2NSXA 3F5LA 3JS3A 3VU2A 3HU7A 1B9ZA 2E6YA 1XBXA 3A22A 1TFVA 1ZAIA 1ZJHA 2NX1A 3GVRA 3G1DA 3BK0A 6A3HA 2EKCA 1GKRA 3MB9A 4GZ7A 3C52A 1DYSA 4RV8A 1GNXA 1JCYA 2OQHA 1OFRA 2VTFA 4GPNA 2E8YA 3PTMA 1LUCB 3PZOA 1A80A 1JCTA 4F2BA 3ALGA 2PDIA 1U5HA 4Y9AA 1BFNA 1C93A 4C6LA 2C8NA 4A3YA 4EWND 1RH9A 1UWIA 2XIOA 3MP5A 4YHGA 3WD4A 3RK8A 4JEQA 1MXDA 1WCGA 4KRUA 3GH7A 3UA3A 4DI9A 4ML9A 3VOHA 3HB9A 3NSNA 2A79A 3KLKA 1K9TA 1WX0A 4INFA 1EP3A 4PMQA 4R7WA 4KCTA 1LBLA 3JR2A 1DWFM 5C70A 2PDNA 3CZ8A 3W3OA 5FD0A 2XN0A 3B9DA 2A7NA 3MI3A 1D3GA 2ZXQA 1YIXA 2FB2A 4XIAA 3BLPX 2Z2BA 5LKYA 5FIPA 1OFDA 1S38A 4IXHA 2VOTA 4W8BA 1Z32X 2ZWZA 1C8QA 3OBEA 2QEZA 3B9OA 1KRAC 1JDEA 3L0NA 3GC2A 1BLIA 3BG5A 3MKKA 2CC0A 6CGTA 3LSBA 2O9TA 3WQ5A 5CLWA 4GZIA 3TP4A 3ZM8A 1UUOA 2WW5A 4Q8UA 3U48A 4HU8A 1S2UA 3B0UX 3IGXA 4U2YA 1B3WA 7REQB 3F03K 3IRSA 3OIHA 3R1ZA 2FLIA 4A21A 1FWRA 3UF9A 3S3GA 2YIHA 4JKMA 1K9FA 1G4PA 4TQTA 3P82A 5HPCA 2VGGA 1XRTA 5D8WA 3GHRA 4C6PA 1CLVA 1OIFA 1EKOA 2DFAA 1GG0A 4PEEA 3EX2A 3QPEA 2EG8A 3KBWA 1L6FA 3MTWA 3BOFA 1IZKA 1I2QA 1UWRA 2FZ8A 4OOZA 2X0YA 2RH9A 5DY2A 1PYMA 2W0UA 2VYOA 2DZVA 4JTDA 4MLJA 3QW3A 2ZRWA 2PD5A 4XAGA 4B2DD 4H2HA 1M7XA 3S8HA 3BUVA 1U5VA 3AC0A 1REQA 3EWBX 4C6JA 3B8TA 4BFAA 3UEQA 3AHXA 4KFPA 4DXVA 1FY6A 1DJXA 2NXHA 1H2JA 3GS6A 3C5QA 4P7QA 3EXTA 1V3KA 3K8KA 4IX0A 2Z1XA 1SPQA 4F48A 3SO7A 5CBBA 3E2RA 4LNYA 3IJ6A 4LEQA 3CHDA 2YCLA 4QJ1A 1XIEA 4LB4A 2PBOA 1B90A 2FHFA 2R1MA 2TODA 1L8NA 1H0IA 3SFWA 4U5IA 1F4HA 4ZQNA 4OOUA 1PHWA 5CPSA 3GXNA 1LBFA 3BJSA 1QWGA 2OGJA 1D3HA 7A3HA 3K30A 1I8JA 5CJMA 1E1EA 1WB0A 5I06A 1I6NA 1K8ZA 5ABFB 1H7PA 4L6DA 3XINA 3RIKA 3C3NA 1XIBA 3BCDA 5CGTA 3A9BA 4MFEA 4I5RA 1WKYA 3QLLA 5F2GA 1QJWA 3VDHA 3STEA 4PCSA 7PTDA 4FLQA 1IEXA 1Q6LA 1UPPA 2XIMA 4MFDA 4MB4A 4NY2A 2YXOA 2R1NA 1UKSA 5CZKA 2V2DA 4QR6A 1GVEA 2WKLA 4MSSA 4P7RA 1XSJA 1DIEA 4Z2GA 3EAUA 3UNDA 3U6WA 3QC3A 3W1UA 1XYLA 3OLGA 4UR7A 2QMKA 2FPTA 2WVTA 1SJBA 3TQVA 4IPLA 5M03A 1RK6A 4WF7A 5CGQA 2HVOA 4KRTA 4EP8C 4DJFC 3UCDA 3IIXA 3USBA 4U28A 1KNWA 1TIWA 4F8XA 4JQ3A 3CQJA 3W86A 3EDEA 3PWIA 3QQ0A 1CXHA 4UFHA 2UY3A 4PE8A 1UWTA 4YCOA 2YLAA 1RCXB 5L6UA 4CN4A 4XZBA 3KL3A 1GPFA 1FBAA 1KBBA 2OMAA 2W63A 1A5AA 1GKPA 2NQLA 4W7VA 3R8GA 5AC4A 1UC5A 3D6NA 2WNZA 1OD0A 1VYPX 3VGGA 5A6AA 4AHPA 4I5UA 1XLIA 1IXNA 3IVUA 2XPKA 2YL5A 1JCXA 4AHQA 1GUVA 3MANA 5I09A 5CSSA 8A3HA 4KH2A 4HGXA 2OJPA 3P5ZA 1ISZA 2V82A 3L4UA 3QHOA 2WV8A 1SW3A 1TKKA 1A49A 3PY2A 1TTPA 4MUPA 4JR5A 2Y7DA 4H9VA 3RU8X 1TREA 5K7JA 3LOTA 4LYKA 4FNRA 1V51A 1GEQA 2CCRA 1MRQA 4K7VA 5DF0A 3T2OA 3D5HA 4ZOEA 4O17A 3V75A 4Q7NA 1XYFA 4G2DA 2PC8A 3VGEA 2INEA 3QQ1A 4OT7A 5E9AA 5LIUX 1XRVA 4Q3MA 1C29A 1KM5A 4R7JA 4A3HA 4GI8A 4ICMA 4UOJA 3GNOA 1MQRA 1Q66A 3S2JA 3EOLA 2QJGA 5BW6A 5T8GA 2PU1A 3LTSA 1NOWA 3BWWA 4FNTA 4OTKA 4QDMA 3TYDA 1EX1A 4S2CA 3W2MA 1B3YA 2YOCA 2ZUSA 3C8FA 1L2UA 2IPWA 4YWSA 2J7GA 4PH6A 2FFCA 3C8NA 3VIOA 4QQ3A 2DSKA 1G94A 1TWWA 4LYRA 1DEDA 4CQCA 2WZMA 1FWFC 1NF0A 4HJFA 3MVIA 1E15A 2VCAA 2ISDA 4D6GA 4DJED 1AH3A 4NX5A 3HPSA 4NF7A 2X1SA 5CPNA 5LSMA 4QE4A 3WK0A 4W8AA 3DC0A 4QRNA 4J35A 5AHMA 4WHBA 5AECA 1EP1A 1QPNA 3CUJA 3QF0A 4GCXA 4FSAA 3B0YA 1PV8A 3VKAA 5K9CA 3R5EA 3LCHA 2VR4A 2PZ0A 1UZ1A 4HCLA 2XZ7A 1FWJC 1TPFA 1KFEA 3BZGA 3BE7A 3DZ1A 3EOSA 4W4QA 3DI1A 3W4RA 1A0CA 2VL4A 3N29A 4IMCA 1V3LA 1P0DA 3B4UA 4XISA 4NYUA 3NCOA 1JAKA 4HHPA 1SZEA 2ZZ4A 3PJXA 1W5QA 5AN7A 4M1BA 5FSDC 3W1NA 5J04A 3WK2A 1BEUA 1JNEA 1RV8A 2Q3RA 1DXEA 4Q6XA 5HWNA 3G0UA 4R53A 3OVGA 4QLKA 4YNGA 3TJIA 1KM2A 2PGFA 3FDGA 2H6RA 4HYRA 1A5UA 3WLIA 3GR8A 1BPLB 1N7KA 1TPB1 4JAWA 1XSKA 3R8HA 4TV6A 1PS9A 3T9PA 3PZMA 4KEVA 3UG8A 5H91A 5PTDA 3PBUA 1PTDA 2QHAA 2IQDA 1AH0A 1H60A 5E9XA 2CHRA 2G5WA 4LCRA 2C15A 3NQEA 3QH2A 2YDRA 4DF1A 3IARA 3LPFA 4MLRA 1XGZA 3G18A 3EXRA 3GKAA 3I7RA 3HF3A 1YADA 3ARQA 5HUPA 4IUOA 2GVYA 3GG7A 4ORIA 2QPSA 4HVXA 1MQQA 1FWWA 1W9XA 1BWVA 3M0YA 3CQHA 1V3MA 2NX9A 3W71A 1Q8JA 3CMFA 3GNDA 3ARUA 1X38A 3W7IA 3OG2A 3GTFA 1TJRA 2VCBA 3OTRA 4DM1A 1LRTA 3TLLA 2HDJA 2Z29A 3FVDA 1JZ5A 4H00A 4AX6A 4XZMX 3UJRA 3ARVA 3VOCA 3WQCA 4JX5A 5B7ZA 1N8FA 4S3EA 3BGAA 3W83A 3F5JA 3VD4A 3DESA 2DZPA 2WPBA 4DJDA 3DKJA 1XYBA 3BOLA 3RX3A 4H9UA 1WZAA 3QYQA 2YCIX 1PZ1A 1IT0A 3L65A 4G7EA 2FDSA 2XVPA 3B05A 3L66A 1MFUA 1F5ZA 2ZOXA 2WZIA 2OO0A 2O0TA 2RDUA 3OVRA 5GJNA 2HNEA 5XIAA 3IV8A 2WMKA 4O1FA 4J3UA 4O16A 4WEVX 4WDWA 3W7MA 2GSHA 1F4AA 1DIOA 1FA2A 2QCHA 3OP2A 1SGJA 2ZA2A 4ZENA 1DXFA 4AD1A 4FAMA 3ZZ1A 5A2BA 3UFYA 3JVAA 2OX4A 2EG6A 4YN5A 1C3FA 2AQWA 2HROA 3A5VA 4BF7A 1KD0A 3GG0A 3R0KA 5BYWA 1F05A 3A4JA 3QZAA 4Q4KA 3KE0A 2HZGA 4L6OA 2FPYA 3DHPA 2D23A 3IEBA 4PN2A 2VVSA 3EWDA 3I3EA 4AEEA 4A8IA 4DXXA 4DF2A 1FWEC 1UWAA 3CQIA 4K2SA 4AC7C 3W6LA 2OELA 3KVKA 5C2GA 5LNUA 1OGSA 1QW7A 2VX5A 4U3AA 1UJQA 4RDZA 1KO0A 4L4LA 1LT8A 2ZX7A 3WJWA 1W54A 3IGHX 4LY4A 4W8LA 3TZNA 3GD6A 2NW0A 1DJGA 8RUCA 2WC3A 3TR2A 4CEUC 2VC9A 1BKHA 1DTUA 4UTMA 4GX8A 4OKDA 4BR1A 4L61A 4WXZA 4XQ6A 3SIMA 1NWSA 5FAJA 3NQ7A 4KEMA 1EJUC 3UR5A 5AYYA 1K7EA 3NVDA 4Z0SA 4N0RA 1EEPA 4PR4A 3CHEA 2VOMA 4ADTA 2WVUA 3SRDA 4JYEA 1V6XA 3O9NA 1UBPC 3II1A 4Y96A 5G4EA 4HPXA 3VOJA 3RPTA 2Z6JA 3U7VA 1VFFA 2OWXA 4KFOA 5AC8A 6TAAA 3PVFA 3DBNA 1YEYA 4ADUA 5CSYA 2J4GA 2PBGA 4FEZA 3EA1A 5FL1A 4Q6JA 3W22A 2BY2A 2V68A 1BVNP 5LNSA 2FTWA 2PB1A 4AD3A 4IGSA 1WZMA 3BW3A 3F4VA 4TMBA 4XBKA 2CYGA 1TWIA 2J75A 4GH1A 4M1RA 1J2WA 4DAFA 5E93A 4CQBA 5ENLA 4F0LA 1TVLA 3LHUA 1XUZA 3AUJA 3TYZA 3FJLA 4GJIA 4S3KA 1ONXA 2ANUA 3TIMA 4Q7BA 5IBXA 5HXMA 4W7UA 1LWIA 2X1RA 5C6MA 2ACSA 4J40A 4JS3A 3QGKC 3VILA 4W85A 1TE1A 5EB8A 4JKKA 3FK4A 1NP2A 3ABZA 4QNWA 2FVLA 1VR6A 1CGWA 2Z2UA 4YTRA 5F1VA 1NFGA 5I3IA 1RVKA 1PVNA 2DP3A 3DEQA 2QT3A 4FI4A 4HU0A 1OB0A 2PPGA 2I57A 4WIWA 1RD6A 2FJUB 5D37A 1R2SA 1ALDA 1EZ2A 1YLVA 3S2NA 1QPKA 2DH3A 1Q6QA 3PJUA 3BAYA 4JYDA 5HAOA 2XH0A 2PU0A 5D2WA 1ADOA 1E3ZA 3NDOA 1HFBA 4RZ4A 3W37A 2OEMA 2PF0A 4HK5A 1FFRA 2CHNA 3HG4A 1Q6FA 2W9MA 2OVLA 2JK2A 4I9AA 4C6OA 4CCCA 1T0OA 2DVXA 3UY8A 2J8FA 3HZ3A 4GVHA 2GDUA 5BOFA 1EGMA 5LYRA 5A69A 4J2MA 3LB0A 2FVMA 5C9WA 4UQDA 4C1LA 2GVLA 5MKGA 2WSRA 1W5MA 3UESA 1FH8A 4GVFA 2F38A 2VUNA 3ARXA 3MUZ1 3WJSA 4ZL1A 1NIUA 1VHCA 3UU0A 1IZCA 2X0HA 4ACZA 3TU9A 1UR8A 3H2CA 4B9YA 1D2KA 2PGEA 4DWSD 3RM9A 1UH2A 2NSOA 3DFNA 3WIJA 3L5AA 4A05A 3LY0A 2H8XA 3O07A 4IIDA 2PLMA 2C91A 4ZZ9A 4K68A 2ZCGA 3KAOA 1EPXA 4MNMA 2ZRYA 1KXVA 3F7JA 3H7UA 3KBJA 4LVDA 3QPYA 1JQXA 1G4EA 4A8RA 1VQTA 3B8IA 5KITA 1XBVA 2BGQA 4UCFA 3PK7A 2VC5A 1XH1A 1V93A 2PWFA 3URBA 1Z69A 3O06A 2PP0A 3QKZA 3AXMA 3GUWA 1WZLA 4O8AA 1RBAA 2BVWA 3S1GA 4UFLA 3P61A 1UWSA 2BVYA 2VGIA 1J96A 3ANUA 4ZEPA 4C1NA 5EBUA 4LQ1A 4P7LA 1UR0A 2YR1A 3PJTA 5CLTA 1CENA 3IAPA 3VFCA 3TN5A 3WFZA 5BRQA 4NJIA 3WY1A 1K7FA 1DJHA 4HCDA 1Q45A 4XTDA 1EP2A 3MI2A 2DIEA 3TLQA 3W1MA 1W17A 4D6FA 4GXMA 5HMDA 3H2NA 3ZIZA 3TTEA 4HA3A 2TRSA 3UWVA 3LRMA 4N9CA 4F66A 4LALA 1ZU8A 1DBTA 4J4KA 4LRSA 5GJMA 4BKNA 2WM0A 3MP3A 3BLOA 1A5KC 5DT5A 3AO0A 3OHIA 2DDXA 2O92A 4J5NA 3OYXA 4JQ2A 4KETA 3WX7A 4L65A 2QDEA 1SZGA 2QCEA 4GY1A 2ZXAA 3WO8A 2X42A 4FXRA 2G37A 5JH2A 3GDTA 4H6KA 1F8IA 5GQBA 3IIPA 2VP8A 2GDVA 4FF7A 1RP9A 2WK2A 3CQKA 1H1NA 4OBTA 1LQ2A 1DVJA 4RE4A 4XZIA 4FALA 2VZVA 2VR2A 3KCJA 1C8XA 4X3ZA 1GTHA 3VD7A 1TTQA 4ML4A 5A5WA 1XRFA 2V2CA 1V6YA 3WN6A 4JHOA 1HGYA 1BYBA 2PDPA 1H7NA 4L4OA 3G1SA 1N8WA 1SJCA 4AZ5A 3T1GA 5AOUA 3T4CA 4UCGA 4CVUA 5DBUA 5D03A 4JKLA 1D7FA 4AU0A 3DDMA 3CEUA 1QO5A 4KPLA 1JPMA 1RXOB 1OT2A 4N4QA 2CEQA 2PDXA 2XG9A 1XIHA 5B7YA 4GGBA 2NWSA 3TVAA 4S3FA 1ZFJA 2GLKA 2YA0A 2J27A 4ZO8A 1A5BA 1MW0A 3BDKA 1B3OA 3QSRA 1OX5A 5TF0A 4M3PA 2BP1A 4C6BA 3QRHA 4GVGA 1FX6A 3N4FA 4ATDA 5GPRA 3UJSA 1ZAHA 2WKJA 2C18A 3PBVA 3EWCA 3D46A 1OX4B 3PBYA 3GNXA 2ZKMX 5EMLA 2DPEA 2J9ZA 1M03A 4CCZA 4D8LA 2KX9A 3SCPA 3ZR4A 3O0KA 7ODCA 3LV6A 1Z8AA 2NQ9A 1A5CA 3TQPA 5C5YA 2QCMA 1PZ2A 3PP7A 3GTNA 1IXQA 9RUBA 3W7JA 1R6WA 3VGBA 2ISVA 5DMMA 1XLDA 3A4XA 4YTSA 2WMJA 1WXZA 3F4WA 3L4TA 3MI6A 4RDWA 4HPHA 3TSDA 4L56A 5FL0A 5JBEA 2VEFA 2B31A 3GE7A 4Y8FA 4AH7A 1YKWA 4RKAA 4V2XA 5LNVA 4MB1A 4Y9NA 2P0IA 2PDQA 5LIYX 3O8AA 1M3UA 1MMFA 4HSOA 2A3BA 2UY4A 3E96A 1UIOA 3M0JA 4M51A 2PFHA 1E1FA 2O9RA 3QGAC 4GJJA 2R14A 4HTBA 4ZB2A 2OOFA 2YBUA 2HE8A 3ITVA 1FH7A 1MW1A 1R9ZA 1VFHA 5D2XA 2VQUA 3KEHA 4LPCA 5I2UA 3NXFA 4ACYA 1P6CA 1J5SA 3WEZA 1O4UA 1O5KA 2PLJA 2V69A 4BI6A 1J6PA 1U22A 3O6CA 3WEMA 2OWWA 1L6YA 3N13A 2H8ZA 1JJKA 5KMYA 1BXBA 2ZE0A 3L2LA 1Q13A 1K70A 2D69A 4EF8A 1S5MA 3ARWA 2W62A 4GUGA 3EDJA 1K02A 3MYPA 5EPDA 4OGZA 2CBVA 2Y63A 5A2CA 4PMRA 1SMAA 5IOBA 4GNVA 1S1PA 1OADA 3KVJA 3GH5A 4PL2A 2HJPA 5AB3A 4V1YA 2EAWA 1DJNA 3WLQA 2G96A 5BOEA 2G50A 4UFKA 4F0RA 1AH4A 4JTCA 4NAFA 1NFBA 3A24A 3G1HA 4EXQA 2PODA 3E02A 1VCVA 4HZ6A 5HBFA 3UCCA 4DZAA 4CD4A 1RALA 1ZGDA 4IOTA 3LNPA 3NO5A 2NQ5A 4ZA0A 4WRHA 4E3TA 1FKXA 3WDIA 3ZJ8A 3CWOX 1MYRA 1H11A 1X1NA 1ML1A 1H63A 5C7HA 1RK5A 4KCVA 1Q2RA 1YYAA 3DN5A 3EXSA 4S39A 2XDFA 1YMYA 4WKHA 4H1ZA 1NH6A 3CLWA 1W9VA 5LHEA 1CLXA 1CGVA 3AS2A 1ZB5A 5I3HA 2CERA 4AWTA 1UH3A 1KCLA 4MJZA 1EDQA 2C13A 3SRKA 1EGVA 1O6IA 5FEXA 3CHCA 2YKKA 3MWAA 1H51A 2ZICA 3RITA 2PDMA 2WBGA 3RR4A 3P14A 3LU2A 1H7WA 3MW7A 2CPUA 2GQ8A 2CITA 4JTAA 5BMWA 2OLSA 5KEZA 1YPXA 3HGJA 4L80A 4X0NA 5FJPA 4OV9A 2PDCA 4UB9A 3CUZA 4J3TA 3KRZA 5FI8A 2YDSA 2BXZA 4O0QA 3PAJA 3KCLA 1KRCC 1HJUA 2CLKA 3GTIA 5CJNA 5ABGA 4ZGYA 4LY8A 2WAGA 3E2SA 2L5HA 3UNTA 2MNRA 3SN1A 4PMZA 3T78A 4WGHA 1XWYA 3EDFA 3SJNA 1B0IA 2CLOA 3OBAA 3WLLA 4LWWA 2A0NA 3WH7A 4JIIX 4A3QA 1RUSA 1TUFA 2WCAA 2BOGX 1EA0A 2YLLA 1I1WA 5IDIA 3FW6A 1VIWA 3CUGA 4DJFD 4C60A 3DECA 4C6EA 3W1QA 1FVPA 4UTFA 1NWUA 3A21A 3VX0A 4M6VA 2V9DA 1BD0A 2XUCA 1P43A 5E6ZA 2ZBTA 1U5JA 5E0FA 2TSYA 3MV01 5EKYA 2A85A 2FMOA 2GK1A 1VEMA 4LVGA 2BSLA 4DX3A 1RJQA 4PRTA 3A3HA 1MW2A 2R9RA 4DJDD 3M0IA 1H1YA 1TV3A 5BWAA 2VELA 5A1AA 3ABOA 2WNQA 4JFVA 4XX6A 1Z6KA 1MEWA 3V18A 3FAWA 2OG9A 4HNOA 3M44A 4G8TA 4I5XA 3IK4A 2EHHA 1UKQA 4F40A 3T0CA 4JN7A 4XSMA 1UUQA 3W7NA 1BRLB 2IQ0A 1ONWA 4L9XA 2EGZA 4GG9A 3RPDA 3VNIA 4PB4A 3FSTA 1QOPA 4LS2A 1SR0A 2VEKA 3W2LA 5C9ZA 1VENA 4S3AA 2VZUA 2EPLX 3PZQA 4AWUA 1ZQ5A 1J10A 1WOAA 1G4TA 1EL3A 1GOOA 1TMHA 4LNCA 4XAYA 1GVIA 3R94A 1FWCC 4IMAA 2R1KA 2DZWA 4B16A 1S46A 1R3QA 4OU1A 4PTVA 5MKGB 1AUSL 3L9CA 1HL9A 5I07A 3N04A 1LG2A 1YW1A 1W0MA 1E5NA 3QR3A 4UTUA 3E38A 1QPOA 3N4AA 3KTSA 2GUBA 4HP5A 2A21A 4US6A 4UXDA 3MP4A 4MWAC 2R24A 3Q67A 1J93A 9CGTA 1FUYA 1MXSA 5FJUA 3MPGA 2WC4A 2P5NA 3GDBA 4D6DA 2YA1A 3SB0A 1E6NA 3N2OA 2V38A 3UBPC 2E9MA 1MQPA 3T55A 3K2GA 3CWHA 4XK2A 3M1ZA 2OO6A 4A2RA 8XIMA 3WF4A 1J0ZA 4MKNA 1PDZA 4QAWA 4BWLA 3W07A 4BI7A 3VMNA 4UTTA 3N9SA 1FCQA 3G6LA 1P5BA 4HMNA 2HEJA 4YLWA 4UFJA 1OIMA 3W1PA 3FNDA 3TYCA 4HNCA 1JPKA 1BTMA 2VZOA 3ITXA 3K1DA 1K4HA 4XTIA 1SFLA 3RLVA 3I6TA 4E8CA 1QBAA 3MUCA 3ARTA 4FOJA 4LEFA 3S6DA 3AISA 3QZ6A 3ZYZA 4UWMA 2QJJA 1FWBC 1KW1A 3FA4A 3REQA 3WQ6A 7ENLA 4X9SA 1XBZA 3TN3A 3VFLA 3P8JA 4CKQA 5TD4A 2ZC1A 1F61A 4JTRA 4AY7A 1WKEA 3L5LA 4WKFA 4CD7A 1KGUA 3DFHA 3O1NA 4XWUA 1K7XA 1DV7A 1LBMA 4GO9A 4O1DA 1X98A 2YA2A 1LT7A 1F8MA 2ZTJA 1FHVA 3AFBA 3M5ZA 3DOPA 4IH3A 3R0UA 2HSAA 4FP1A 4J3VA 3LLFA 2D2OA 1QI0A 3WF2A 1DIDA 1LDCA 3WL0A 3AMLA 3NL2A 3BC9A 1HJQA 3UPBA 1O5QA 3DBPA 1CLKA 1YNQA 4MGGA 3IGSA 5CZJA 2VCCA 4RPQA 1KFJA 2X09A 2CW6A 2DT1A 3U5UA 5LXXA 5KINA 1QUMA 1UD2A 3LQGA 1W56A 1UPMB 1GOWA 5I79A 2PDFA 3BCFA 1VZWA 2P53A 1OJXA 1TIMA 3ONCA 2WSPA 2Y1HA 1G69A 4XUYA 1W1PA 2Y7FA 1A3WA 1OGBA 1IQ8A 4UQBA 3BAIA 2NV2A 3RG6A 2BBFA 1DQXA 3TW9A 5G1TA 1P6WA 1KXTA 4L1XA 3TH6A 3UZXA 1Z48A 2I9UA 2VDGA 3UJFA 1Z7AA 1VS1A 1CW2A 4DYEA 1P7TA 3GSMA 4LYQA 4MDPA 4LUJA 2XN1A 3NG3A 4KKXA 4Y9PA 1VJIA 2C79A 1IR2A 2ZC8A 1KCXA 2D22A 5JMUA 3UWEA 4BQ2A 3S0CA 1JD9A 4GISA 3S2MA 4BK9A 5M5DA 3G0SA 4P2VA 3MBDA 3UT0A 1FQ0A 3SDOA 1KBKA 3VINA 1V5XA 2RHGA 3V1HA 3CUIA 4AIUA 5GNYA 1RBLA 1E4MM 3BQ6A 1J9YA 3GO2A 3R89A 3ABXA 2AL2B 1RY8A 3ITGA 1EYEA 3ZS4A 2WNNA 1QHOA 5AZ1A 3E5PA 2C3ZA 3RPMA 3VIJA 2BY0A 4AZCB 4YPJA 5RUBA 4IIFA 2BY1A 1PJ9A 2PDGA 2WANA 4TVCA 4EE9A 1RSCA 3P62A 4ZE4A 1PCKA 1PKMA 3C2FA 4GYFA 3GUGA 3V5OA 2YB1A 1NDVA 3PZGA 1NP0A 1S2VA 5E5CA 1E55A 4M80A 1GYMA 3W1LA 3H7VA 5DN1A 1AQMA 4ZVJA 3UYIA 4V1XA 5GJPA 1SFJA 1EOMA 1LOSA 3GNPA 4CD8A 1NWRA 4FHAA 1F3TA 3AIRA 2ZXDA 2W66A 4O13A 1VFSA 4M7TA 2W3ZA 4Q4RA 4B3LA 4F9DA 1GJPA 1EJRC 2VGBA 1US0A 5EA9A 1G67A 4NRRA 3QEZA 2BTMA 4REQA 1EIXA 1XD1A 3AJXA 4M6PA 3SCTA 3ZJ6A 2GGIA 2RDTA 1KRMA 1M1BA 3OB8A 3P6LA 4URIA 2YXGA 3V7PA 3TV8A 4O1BA 3FIGA 3QM3A 3SGGA 3O63A 1Q6OA 2DORA 4ZTYA 4FIRA 5CG7A 4DRSA 4BEUA 2YCEA 4NT0A 1AW1A 4X9YA 3LCXA 2OQYA 2FH8A 1M7PA 1KKRA 1UR2A 2VFDA 3MV11 1LLWA 2E1DA 4TR9A 2HXUA 2J13A 2PWEA 4F79A 2QGHA 2E5BA 2GQ3A 1V0MA 1OFEA 4ZO6A 4GUHA 2VRKA 4KWOA 4WKAA 1KWKA 1O12A 1VJSA 3A12A 2PSNA 1V0NA 4QNEA 1OINA 3E0VA 3EWWA 4WZHA 5KSWA 3KCOA 4FNQA 3LI1A 3L4YA 1XI3A 2J88A 3PBMA 2ZRUA 4J28A 2ZX6A 4MUZA 1PKNA 4U10A 2PUZA 2Y8VA 4CU7A 1FP9A 4QE1A 1GVSA 1OX6A 2GJXB 3KX6A 2I16A 3N3TA 4FR1A 3D0CA 3AU6A 1LG1A 3OBKA 3OODA 5CQ1A 2GWNA 4Y8EA 2CBJA 3UD6A 1BXNA 4LCQA 1JCJA 3WG6A 2V5JA 1EJVC 2Z1WA 1JXJA 2OOGA 3W0KA 4L6HA 5FF2A 2XSAA 2EQDA 4H9MA 1H4PA 1MZRA 3TEVA 4M8UA 3P3BA 5DXXA 3MCMA 3PULA 2OTDA 2D3NA 1AA1B 3RO6A 1S3TC 2VEGA 1E4IA 3PB0A 1W37A 4H04A 4EXBA 1I2OA 2CZ5A 3MDUA 4LBSA 3IGUA 3NQFA 4IGHA 4FLSA 2CWNA 2XIBA 2YGYA 2ABBA 4TO8A 4UTLA 2GQ9A 3IVTA 4GHRA 2E8ZA 1ZL1A 1EDTA 1J6OA 3VD5A 1PKLA 2HQAA 1XYAA 2IKGA 3EOOA 4Q4QA 1XLJA 5K9DA 3LLDA 4DJEC 4CCDA 1T8XA 3CB8A 1CXKA 1ONRA 4MWAE 4YHEA 3LCGA 2QYGA 2C19A 4GYKA 4IJBA 3LN3A 4MF4A 5F7UA 2QPUA 4I6VA 4JTUA 3DI0A 1GJWA 1YE6A 4FNPA 1XQKA 3GFZA 4H4IA 4KCUA 3UR7A 1MUCA 3TSMA 3E5BA 4CQ8A 1PCWA 5FACA 4AQLA 2ZZ7A 1KM1A 4HOZA 1KWGA 2I5IA 5G4WA 8CGTA 1GZGA 3B0XA 1R2TA 1Z3NA 4UIOA 2NT1A 2J74A 2OKTA 4MB3A 1IWBA 4GI6A 1Q7MA 1QWKA 1Q6GA 2WVSA 4CNUA 4MY1A 4ZBCA 2PDKA 1FDJA 3ZT6A 1NELA 4CN1A 4JL2A 4DEFA 2Z24A 1VGAA 4NNBA 4MMWA 3QQWA 3DU0A 1HX0A 5G1YA 3EB2A 3N12A 1UW9A 4IMFA 3T40A 1TJ1A 1EHAA 5D9MA 1GYNA 3HIJA