3C52A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
296
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 110
structure length 296
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c52A00
1KBJA 4KKXA 2NUXA 1QWGA 1SO6A 2ZRVA 5LZLA 3I65A 3A22A 4JTGA 4TO8A 1ZAIA 3G22A 4R53A 1LRNA 1TYGA 1KLZA 2ZRUA 4Z08A 3TJXA 1OFBA 4I7UA 3P81A 4K8HA 5HUOA 3QMSA 1B3OA 4AWUA 2V2CA 5DY2A 1MEHA 4MYAA 5J5RA 3FKKA 3VNDA 4P61A 3BW3A 3ZWSA 1F74A 4NNCA 2BSLA 3QYQA 2A7PA 1MO0A 5AOUA 5BMXA 4FEZA 3NG3A 3A21A 1KV5A 2VFHA 5TIMA 3S1UA 3M44A 1LBLA 3JS3A 1WDWA 3MI3A 1F76A 2WSRA 2A0NA 3GAYA 4LT9A 5IM51 3QM3A 3TJLA 1VCGA 1OK4A 1HFBA 3LHZA 4LUIA 3UPWA 2DZUA 2DORA 3RF9A 1LLZA 2J88A 4ADUA 1H7XA 2V8ZA 4QAIA 1SZGA 3F4WA 4A2SA 2XN2A 2D73A 4AWTA 3RK8A 3SJ3A 2OT0A 3IIOA 4X3ZA 2FIQA 4UFIA 4JTJA 4H3DA 1DL3A 5KMYA 1LORA 3O6YX 5C2XA 4RZ4A 3LBMA 3DGRA 5HNRA 1P0KA 4AWSA 4XZ9A 1LP6A 3F1QA 2ISWA 2ZZ4A 4LVAA 2HTMA 3PUDA 5LGZA 3E12A 1SFJA 3IGSA 3LCWA 2H90A 4BR1A 5BOOA 3HG2A 1VQTA 4GUJA 1QCWA 2Y89A 4KWWA 3D0CA 4WQ6A 5F1VA 1W8SA 5HINA 1TPH1 4HKPA 3TCEA 1GVQA 3O8AA 3DFOA 3C8FA 1DKWA 3R8RA 2EF9A 5MHBA 3EB2A 4UTWC 3C2FA 4FNTA 2QCLA 1LDCA 4IOTA 3PS7A 2X1UA 3W85A 4AVFA 1S3HA 3A5FA 2ZTKA 3GNDA 4IGHA 1EP3A 3W7EA 1VYRA 1B9BA 4WY0A 3P60A 3FJ6A 4QSHA 2XN1A 4EF8A 5FF7A 1ML1A 2VEKA 1AMKA 3W2MA 4AH7A 4ZQOA 2TYSA 3KRSA 1SW7A 1FXQA 2GJNA 3OVPA 3PBYA 2VENA 3V75A 3DFNA 2QCHA 3A23A 3MBDA 2GQAA 1I45A 1ZAJA 1DJNA 1OABA 2P1FA 3P80A 1B57A 1C8VA 1VRDA 2ZZ7A 1W31A 4DBEA 5TBOA 2WJZA 4JN6A 2R14A 4UFMA 1Z42A 5D30A 3W2NA 4IXXA 5EBUA 3G1XA 5AHEA 3ZS4A 5K9DA 3WJXA 1O60A 5FEPA 5KSWA 1ZY9A 3EEGA 5EPDA 2DZSA 4M6VA 3B0PA 1DV7A 1I2PA 1QOQA 3W72A 3LOTA 2ZRXA 1TCDA 1LRTA 2E6YA 4CQAA 5C6MA 5DCBA 4YWIA 3C3NA 2FPTA 3ZR4A 3OVQA 5EA9A 3W86A 3PB0A 1WOBA 4O10A 3IGUA 1G67A 2WO5A 1SQ7A 3OIXA 1TPEA 1FCVA 4UTLA 3W1NA 3LLFA 1YDOA 1EWDA 2FDSA 3DFTA 3G0SA 3DH7A 2GOUA 4R7JA 4MLRA 3ATYA 3MBFA 2CW6A 3USBA 4BI6A 2FPYA 1KM5A 4NNBA 4Q33A 5CSRA 3S9YA 3U2OA 4I7WA 3R12A 5FI8A 2H6RA 4UTTC 1TV5A 1DBTA 2E1DA 2E6FA 1LTDA 3UYCA 2W79A 3MYPA 3IIVA 3SI9A 1NEYA 1RV8A 2R94A 1K02A 2NXHA 4MOZA 2RDWA 4NXSA 4AF0B 4LVFA 1YXYA 2VOMA 4K6AA 4WZHA 1O94A 5HR6A 3CU2A 2Z2UA 3H55A 1EEPA 3CHVA 3HGJA 4JGDA 3NM1A 1RQBA 1KTNA 2BTMA 2WNQA 4U28A 4FNUA 2A21A 1KM3A 5K9XA 4MYXA 3CT7A 3O15A 3UWWA 2QCDA 4WY0F 3LDVA 3FEMA 3E9AA 4WUIA 2VEMA 3TQVA 5AC8A 4YL2A 3LTSA 1H61A 1VHCA 2NX3A 1EP1A 4MPQA 3HF3A 1H7OA 3EKLA 1OJXA 3GDMA 3TROA 1CX9A 4PFMA 3PR2A 4D2JA 4A3UA 1QFEA 4TR9A 1ZALA 3TFCA 3LCLA 2NLIA 1MEIA 1IGSA 4I9AA 3TMQA 3U6WA 4ORIA 1P1XA 1U83A 4NX5A 4A21A 3LRLA 3NQ6A 1DOSA 1M7OA 3P62A 5KTLA 2C6QA 2YW3A 4O28A 3LCHA 5LNSA 4ICNA 5AB3A 1N55A 2GVLA 3N34A 2NWSA 4MZ8A 4Y8FA 1QAPA 5D2YA 1TIMA 2E5CA 4GXMA 4TIMA 1HTIA 1Q6RA 3SY5A 1THFD 1IXOA 1L9WA 2YYTA 1JJKA 3LCIA 3NL2A 5KZEA 3EX6A 5IBXC 1G6CA 5K9CA 3N2XA 5AYYA 4GE8A 2ZZ3A 3W6YA 3L68A 4UNKA 2VFGA 4UTUA 3IVSA 4LWWA 4O57A 4ADSA 3PUEA 3UY7A 3LHVA 4UTJA 1AL8A 1TPVA 3DFPA 1TPB1 2RFGA 4JTEA 1G4TA 3GR7A 4CCCA 3UWYA 1W54A 1GYLA 1OFDA 3EWZA 5D2XA 4UMAA 3P5ZA 4QITA 4TU1A 5K4ZA 1TV8A 3MJYA 3BG5A 4ZQPA 4UMBA 3TAKA 2CWNA 1G4PA 2QJGA 3GXTA 1SSDA 2YCEA 3NQCA 3CWOX 4DEFA 1B4EA 1KLYA 1PHWA 3CIXA 1YLVA 3THAA 1EUAA 3G18A 4CQ9A 1SO4A 3L2IA 4O13A 3PUOA 1QOPA 3P82A 1GWJA 2B7NA 5HR7A 4J9JA 4KFPA 4L4LA 2VC6A 2DZTA 3QQ0A 5D37A 5KITA 3BV4A 1VJIA 2BX7A 4O11A 3FOKA 2RDTA 3L5AA 1JULA 4GC4A 3QPZA 2HMCA 3DU0A 4XKYA 4S1FA 2OMAA 4EWND 3GXPA 4JD4A 3UXDA 3EX1A 4TMCA 3NQAA 3OG3A 1TPDA 1ME9A 1XDLA 4JTSA 4WY0B 4GFSA 4JX4A 3W7MA 3C2EA 5F4XA 4JTLA 1OX6A 1KFKA 5D09A 4AMAA 4PEKA 3TU9A 4DPPA 1F5ZA 3VI2A 4DO6A 4UMCA 4IPJA 4Z1CA 3GK0A 2VEIA 3QW3A 3W1AA 4O14A 3KAOA 2ZA3A 1D9EA 1JCXA 1NAL1 1KM1A 1SUXA 1VCVA 4HNVA 4WD0A 3IRDA 3MHGA 4K7VA 2PCQA 3TFXA 1F6PA 1PS9A 4MJMA 4YCOA 2WNNA 1UBSA 4AEOA 3P74A 4RKAA 3W1XA 3CM4A 3LHTA 3C52A 3TIMA 1FWSA 3PULA 4BF9A 3G1AA 3PSWA 1WQ5A 3OVRA 1LOLA 1F2JA 3H54A 5I3HA 2PURA 4JIPA 1GVSA 2QJIA 5AC7A 3KX6A 3WK1A 3WK3A 4DO5A 1K8ZA 3GX9A 4Y90A 1WBHA 4WOQA 3M47A 1ZAHA 2ZRYA 2QCGA 3BO9A 3LXCA 3NQEA 3LCFA 1W37A 4JYEA 3L5MA 4QJ1A 2KZHA 3VCRA 1YXDA 1K03A 5F2GA 3L65A 3KFTA 4YCPA 4HT3A 2J6XA 4QIUA 4JYDA 3W2LA 2H8XA 5F2IA 1R30A 1SSGA 1XCFA 4MIMA 1I2OA 5L9FA 5FF2A 1JUEA 1WYIA 3W7CA 5DXXA 3NL3A 4PA8A 1GTHA 1XL9A 4HN4A 3ABQA 4Q4KA 3W88A 1GVOA 4QNEA 4DPQA 2Q3RA 1A5AA 1F6KA 1DJQA 4UNLA 2QCDB 4NUWA 3W1RA 3MHFA 1Z48A 4IXHA 4MZYA 3OEXA 5ABTA 5HWMA 4IUOA 3T44A 2CU0A 2OT1A 4GBUA 1A5BA 3CEUA 3FA5A 3ABRA 4S2CA 3IGXA 3NQMA 3M41A 3KRUA 2Y85A 1HO1A 1Z44A 4FX8A 1TRDA 1AK5A 1GTEA 3B0VC 3HPZA 2NV2A 2X16A 4Y9AA 3DENA 2FB3A 5F2MA 2X1SA 4O1CA 3SGZA 5AYZA 3KVLA 2CLHA 2TRSA 1OYBA 1NSJA 3UWZA 3LHYA 3MMTA 4GWEA 5TQLA 1OFPA 3T4CA 3RMJA 1ZFJA 4O1BA 1ALDA 1QDSA 2EGZA 2V5BA 1RR2A 4O15A 3W7QA 4LRSA 4NU7A 3W7IA 3HG3A 5C5YA 1TSIA 4JY9A 2E6DA 4IX2A 2DJLA 4X9SA 4AHQA 1KW1A 2QCNA 4RZ6A 1VPXA 1VYSX 4N6EA 3INPA 3NPXA 3O63A 3F03K 2Q8LA 2YZRA 3G3MA 3VKJA 2I1OA 2WKJA 3LTPA 2CZDA 4NJGA 3DI0A 3MUXA 4JTHA 5AHFA 2VFFA 6ALDA 4RXGA 3IVUA 1LYXA 3M43A 1OHLA 1GG0A 1ICPA 3PM6A 1UUMA 4NZFA 4EF9A 2FJKA 1JQXA 2CLMA 1BWLA 3I7RA 4O12A 3LTYA 3NPWA 3R2GA 2C19A 3HQ1A 1V7YA 4U4MA 1YYAA 3OA3A 2BLEA 4QM1A 1VYPX 3QMTA 5FEWA 3G0XA 1C29A 2BWGA 4LTSA 3TXVA 3S5ZA 3W1PA 5K2ZA 3TSDA 1EB3A 1ONRA 3TA6A 2C15A 2C1HA 5DCEA 5U7SA 3TR2A 5H2ZA 3L5LA 4XWUA 3S1XA 1GEQA 4R34A 1I4NA 1OF8A 1N8FA 1FBAA 2Q3OA 1DHPA 1PIIA 1IXPA 4X22A 2AGKA 2PRLA 1KFJA 1MSSA 4FXSA 3W22A 1PL9A 1TREA 4Q32A 1RZMA 1OYAA 3GVGA 1L6SA 4UR7A 1LBFA 2V2DA 1BWKA 1UB3A 1FWNA 3M5VA 3E96A 1UASA 3JR2A 4UFHA 3CPRA 4MY8A 4NNAA 3B8DA 5EMUA 4AAJA 4FIQA 3PG8A 4M7TA 3VE9A 3GDLA 3PG9A 5BRBA 1I2NA 1A5SA 1Q45A 4XKYB 2V82A 8TIMA 4CCDA 2Y7EA 4MJZA 4NX0A 1XUZA 2O7SA 1EX5A 2NV1A 1Z41A 3G8RA 3KOFA 4GUHA 2G5WA 3W1LA 4AXKA 4POCA 5U4NA 3UWVA 1D3GA 4UTIA 5D33A 5FEZA 4OHQA 4OV9A 4AHPA 4FX7A 4PCFA 3LHUA 1XC4A 4LS1A 1SPQA 5D2VA 3WJZA 1W5MA 1OFQA 1VGAA 1W1ZA 1BTMA 1H62A 1WOAA 1AG1O 1NF0A 1ICQA 1TB3A 4O0KA 2G97A 4E0CA 3HPSA 1FCQA 4G1KA 3W23A 1PHQA 1W3IA 1FDZA 2HSAA 1G7UA 4LC6A 3QW4B 5D2TA 2OX1A 1U5JA 3B05A 1ZENA 4IQLA 4DF2A 3PB2A 3NQ2A 3IIXA 4IPIA 4K39A 4YMZA 3R5EA 1KTBA 1UUOA 2NXGA 4OWGA 3W71A 1O5XA 3EXTA 1IF2A 1YTEA 1YPIA 2QCEA 3G1DA 1S5VA 4FO4A 1MEWA 3Q94A 3VFLA 3P67A 3BG9A 4JICA 2ABBA 5CZ0A 3FFSA 4JX6A 3T55A 1FWTA 3WJYA 4AHOA 3KVKA 3LBCA 5LHEA 1O95A 2NX9A 1GVRA 4IWWA 1TTIA 1J5TA 3PAJA 3W73A 1IIHA 2A7NA 4OV4A 3KXQA 4M6QA 1W3NA 1ZNNA 4FNPA 5LSMA 1JQVA 3LCGA 3L21A 1H51A 1OX5A 2VEPA 4ALDA 2H3DA 1X7FA 5CPMA 1FX6A 2Z1BA 3FS2A 2JK2A 3UZ5A 1SZNA 4HPJA 3ZWTA 3DZ1A 3S5NA 4HNUA 4MFDA 2C0AA 4BWLA 3C56A 2Y63A 3W84A 4BFAA 1TPWA 4NQ1A 1H63A 4ZQNA 2YYUA 1EUNA 1RVGA 3GB6A 4O53A 3NQ7A 4PODA 2GPTA 4DO4A 2Y6ZA 4N9CA 1D3HA 3TKFA 3WFAA 2VKZG 4DF0A 4WJEA 3UNDA 5E1QA 1V5XA 2QJHA 3WJWA 3EWUA 1OFAA 1I8JA 4M6PA 1H7NA 3W2UA 2CLKA 3EKZA 4CLMA 1SZFA 5K4XA 2A85A 4JR5A 4N9EA 3G8EA 3JRKA 3W7HA 3B4UA 3TNOA 3S5OA 1PVNA 3LHWA 4M7SA 5CZSA 4JTIA 4RR4A 1EP2A 3C2VA 2B7PA 4Z0JA 3STEA 2Y70A 3SZ8A 4DQWA 1H1YA 4RCXA 1Q3NA 3W7OA 3DXIA 3LERA 3EXRA 4PTNA 1T0OA 1L6YA 1FXPA 1XFBA 3NOEA 1AW2A 1GVFA 2DP3A 3NL6A 4K37A 1YTDA 1C9DA 3C2RA 3TMLA 3M5ZA 1R47A 2F7FA 2E68A 2A6LA 1DORA 2AAMA 3B0UX 1BEUA 2EPHA 3DKJA 4FHAA 3W7JA 3BK0A 4EOUA 1ZCOA 3G0UA 2CLOA 1NVMA 5G2HA 2A7RA 3STFA 3EXSA 3STCA 3LCXA 4N02A 1TQJA 2CZEA 3CQ0A 5F1UA 5DLCA 4OQVA 2ZTJA 4RXFA 3O05A 1XDMA 3FJLA 2LLEA 5J5DA 5DBTA 1A53A 3CLMA 3S1VA 2CFFA 3KVMA 3GYEA 5GVJA 4JNMA 4MLJA 2E5BA 3RNDA 3MI6A 1T96A 5FEXA 4MY1A 3UQNA 1R2TA 5HQEA 2TSYA 1P4CA 3HIJA 3FIGA 1WAUA 4MVAA 1CW2A 4MFEA 1VC4A 2C13A 1ME8A 3O06A 1PCKA 2Y61A 3IV3A 4WXYA 4BI7A 3W7PA 1K3UA 3G1SA 5G4WA 4IMFA 2X1RA 3HOJA 4JYFA 4O1DA 1SFLA 1UCWA 3BW2A 2Y7DA 4UR8A 4FNQA 3NA8A 2QR6A 2Y62A 1PE1A 4LS2A 1H60A 3U8GA 2Q8ZA 3E0IA 3I7QA 3S0CA 3I7SA 1TPFA 4JTUA 2NUYA 4ZVJA 1HL2A 4MZ1A 4UFKA 2J24A 2VFIA 1FCBA 1YTKA 4OGZA 4LVDA 1W3TA 2QAFA 4JX5A 2ZDRA 4S2BA 1WBJA 2CLEA 2B7QA 5KINA 1H7WA 3M5YA 4ZMGA 1W56A 3G1HA 1FY6A 4UTMA 3CB8A 4OE7A 2DZXA 1YDVA 3ABSA 3EX3A 4O52A 3RU6A 1KM4A 4GNJA 4BI5A 1G7VA 2YR1A 3C0JA 3C61A 3TW7A 2TPSA 3O1NA 2F84A 5LNVA 2A6NA 4O19A 4QQ3A 1VLWA 5G1YA 3ELFA 5LNUA 5G1TA 3TC7A 4YXGA 4ML9A 4RV8A 1SW0A 3TK7A 1OFOA 2TMDA 2QF7A 4FNSA 2R91A 2GVGA 1P0NA 4DBDA 2EAWA 4XTIA 3L67A 4K38A 1HUVA 2J9XA 1AL7A 5D38A 3S1WA 2Z6IA 1RD5A 2ZA2A 4LY8A 3HGOA 4XQ6A 3L66A 1QO5A 2J9ZA 5I3GA 3HPXA 4LRTA 3CC1A 3HJZA 1W5OA 4O54A 5D05A 2QCCA 4WXZA 5A5WA 1JR1A 2NUWA 1ADOA 5CPNA 4GJ1A 3MW7A 4JY8A 2ALDA 1EWEA 4HPXA 3FYOA 1TTPA 3DBPA 1LBMA 5CSSA 1IIGA 2QUTA 3W2KA 3R13A 4IMEA 2ATMA 4UCGA 4LU0A 1P5BA 3MI2A 4O4VA 1K8YA 3W74A 4AB4A 1A5CA 1XM3A 4JTFA 6TIMA 1M5WA 1PCWA 4NZJA 4PL1A 4UIOA 2ZA1A 2FQIA 4XUGA 3GXNA 3MP4A 1XBVA 2UV8G 3QRHA 5SWUA 1OG0A 2VFEA 3M7WA 3TE9A 3DFSA 2WSQA 3KRZA 1SO5A 1G4SA 2A5HA 1HO4A 4Y6GA 2OZ0A 1CI1A 3PY2A 3A5VA 3OBKA 4N6FA 3TQ0A 3QF0A 3W75A 1W0MA 2ISVA 4O0ZA 2QCFA 4OBTA 1WX0A 2QCMA 2H3BA 4FNRA 3MP5A 4CQ8A 4K7YA 3IEBA 1FDYA 5K7JA 3N73A 2JGQA 3EWWA 4ZQCA 3NEVA 3GAKA 5T26A 1KFEA 3B04A 4N4QA 3A24A 3M6YA 4PH6A 1KV8A 4JIQA 3NQDA 1G69A 3NAVA 4O50A 3VE7A 3TW6A 2A4AA 4Z1DA 5G2WA 1JVNA 1H1ZA 3W87A 4E2DA 2X30A 5E0KA 2WOQA 4X2RA 2DZPA 4JXCA 3NM3A 1R2SA 2P10A 3SGUA 2QDHA 4NT0A 3CTLA 1XI3A 3AJXA 2CLIA 3V1PA 4GUFA 3TXZA 5D2WA 3NDOA 4ZQRA 3MYOA 3NZRA 3BGGA 4H6KA 7TIMA 1H5YA 3E02A 3W07A 3IIZA 3QSTA 4XBKA 3EX2A 3W3OA 3LX9A 3H53A 5HWJA 3BVJA 5I3JA 3PC0A 1T99A 4HHPA 4EIVA 4RX0A 3PBVA 3NQ8A 2DZVA 1TRIA 1K8XA 3BARA 1YXCA 3PBWA 3TDFA 1OX4A 3QJAA 3EX4A 2RHGA 3FYPA 1IXQA 1VLIA 3PBUA 4GUGA 4C1KA 3P61A 4RJEA 2YPIA 1W5PA 1KFLA 3SW6A 1A50A 2Y88A 3G3DA 3KHJA 4H4IA 1WA3A 2P0OA 2AQWA 3CEPA 1XBXA 3IVTA 3NVTA 2JGYA 3GKAA 4UTKA 4HNTA 1XBZA 4JTKA 2DU2A 1QO2A 5F4SA 1X6UA 3BG3A 3M16A 2E5DA 2QEZA 2YFNA 2NXIA 3MP3A 1IXNA 1TJRA 3ZFHA 3E49A 4RZ5A 1K7XA 3W7NA 5AFDA 1YDNA 2QKFA 3TC6A 1OFRA 1FWRA 2WQPA 1W5NA 3DHFA 3LB0A 1GG1A 3QZEA 4NJKA 1OK6A 2G96A 3EWBX 3W7RA 1QPOA 4O1AA 2V30A 4MKNA 2YGYA 2QUUA 1ME7A 2XN0A 2NWRA 3P8JA 3W1MA 3L9CA 4FF7A 5FF0A 3WK2A 3M1ZA 1ZJIA 1JCMP 1O4UA 4CNOA 1GJPA 5HMSA 3LV6A 2VELA 4UUIA 2JBMA 2XFWA 3W1TA 2QAPA 3NNTA 4O16A 3IIPA 1Q6QA 4O18A 2WSYA 1F73A 3G24A 5F2LA 4PC8A 4OT7A 5I3KA 2ZFAA 3QH2A 2B7OA 5C54A 5KZDA 2V5LA 3L0NA 4A22A 4LV9A 2GUUA 3N14A 3Q37A 5G5IA 3NO5A 1QNVA 2RKXA 2JKEA 1T8XA 1LOSA 2NZLA 4ZL1A 3GR8A 3HGSA 4NJJA 4IMCA 4UTWA 1NFBA 3HG4A 1HG3A 5A8GA 3OHIA 3Q58A 4JTTA 5CPLA 3W1QA 2WNZA 3NGJA 4UXDA 3G1VA 1TMHA 2V2HA 3QPYA 2PRMA 4OU1A 3NQGA 4MY9A 3YPIA 5CKSA 1QMLA 1K7EA 5AHIA 4I7VA 4EVZA 2QUVA 5DELA 5LGXA 1AW1A 3LI1A 3W7DA 5BNKA 1FCUA 3LXAA 2C16A 4UFLA 3W7LA 1JRCA 3M0ZA 3TQKA 5CG7A 2ZRWA 3FKRA 2IQTA 1XKYA 1LLWA 4HSOA 2X2GA 2A2IA 1VS1A 4M5PA 2C14A 3UY8A 3W2JA 3I6RA 2YW4A 1EIXA 5DN1A 1GPWA 1JRBA 3GZ3A 3SSJA 3LLDA 3I68A 4XTDA 5I3IA 1W5QA 4JDYA 3CWNA 3QC3A 3C4UA 1JUKA 1LOQA 4Z1BA 2J27A 1WXJA 1MXSA 3TAOA 2R8WA 3N3MA 4BWLC 4CNPA 3F4NA 4C1LA 4DF1A 1NF7A 3N9RA 3P5YA 2G95A 4IMDA 1SR9A 4JS3A 1J2WA 1SU5A 4IMGA 5CPOA 3N19B 5LHFA 1DVJA 2VFDA 1S5TA 1JUBA 3O6CA 4Y96A 3W83A 2ZZ5A 4A2RA 3HBLA 3UXAA 1LCOA 1QPRA 1I2RA 1KM6A 3UZJA 3TH6A 2HS8A 3PF3A 4L4MA 4XBSA 1KBIA 2YSWA 4FX6M 3HG5A 4GUIA 5F4WA 2E6AA 3S6DA 2GQ9A 2Z6JA 3A9IA 4UTTA 3M5XA 3TSBA 2ZZ1A 1H7RA 3QSRA 5HWNA 1TTJA 2X1TA 5CGQA 1EPXA 2GJLA 5LKYA 4LVBA 4LW7A 1QPQA 3RLUA 2JKAA 1XUUA 3W70A 3BLFA 3SFKA 1TO3A 1AW5A 2O7QA 1XBYA 2ZYFA 1GT8A 3P84A 1LRQA 4W9TA 4JEQA 3BLEA 4KFNA 2BXVA 2DJXA 5KZMA 2QDGA 3QEZA 1JCLA 1X8FA 1O5KA 1F05A 3LV5A 2A1YA 1TQXA 2C18A 1TPC1 4TMBA 2Y7GA 5HUPA 3EWYA 4WOZA 5AYXA 5HULA 5EYWA 3HO8A 3GKFA 4IJBA 3SIZA 1VHNA 4HSNA 3LRMA 3T78A 3T7VA 1TV7A 2Y7FA 5E93A 2ATSA 2ZRZA 4UFJA 4LS0A 1TTQA 4FIRA 1GZGA 3THQA 3W1UA 4ADTA 4FXRA 1VR6A 3O07A 1H7PA 1YPFA 4O4WA 4NJHA 3UWQA 3NPUA 1QR7A 1KM0A 2GQ8A 4O17A 3MWAA 3BGJA 3O6DA 3QQ1A 5D32A 1JCYA 1ZHAA 3T40A 4R33A 5AC6A 3PWAA 3HMJG 1OX4B 2DZWA 2YX0A 4LUJA 3DAQA 1R2RA 5C55A 4IX0A 1KFBA 1XXXA 1GQNA 4ONVA 3AO0A 4UC5A 5EKYA 2EHHA 4B5NA 2W6RA 5I3FA 1UJPA 3BLIA 2HS6A 2FPVA 4HIBA 4Z0SA 3UD6A 1BKSA 3LI0A 5IBXA 2V81A 4JDBA 2FTPA 5DCDA 3L0GA 1OYCA 5AHLA 3DI1A 3STGA 2ZZ6A 3HGRA 3TUUA 5K3VA 4YLWA 2J9YA 3M9YA 4UTHA 5CZJA 1MZHA 4KWVA 3ATZA 4N9DA 1SO3A 2Z0IA 4WX2A 1KFCA 2W0UA 1OF6A 4ORMA 1R46A 4LVGA 4PL2A 5EL1A 5FF4A 4KFOA 3QMRA 1JCNA 2CZFA 2H8ZA 3W7KA 1ICSA 3S42A 3K30A 3NPVA 5HJLA 1J4EA 3GDRA 2PC4A 1L2UA 1DQXA 1S5WA 3EWXA 5EY5A 5AHMA 2FB2A 1M6JA 5D03A 3GLCA 1K7FA 4HNNA 4NXKA 3C2OA 1RPXA 1VH7A 1QPNA 4QNWA 4P2VA 3SECA 3NYZA 1RQHA 3TV8A 2WV8A 3G1FA 4DELA 3O16A 3N9SA 4GRSA 4RK8A 1F7BA 3TX9A 1FQ0A 1Q6OA 5G4EA 5DY3A 3ABOA 2OCZA 3BW4A 3GDKA 2PE4A 1FWWA 1G4EA 4NVTA 3GDTA 3WK0A 4FB7A 1N7KA 2ZZ2A 2V0TA 3L0KA 5AHNA 5LNWA 2FFCA 5DXYA 1FUYA 2OJPA 3NQVA 1I2QA 1PV8A 3W76A 2V9DA 2PRHA 3WJSA 4N2YA 2E77A 5BW6A 2I9EA 3DHDA 3CIWA 4DXVA 3GIYA 1LZOA 1RQEA 5FESA 3NR0A 2JKPA 3B06A 2WPBA 1VCFA 1FDJA 1L6WA 2CZ5A 4M19A 5FF3A 1X1OA 3MHUA 3W7GA 4N4PA 1LROA 1TPUA 3PSVA 1KA9F 3DKLA 1JCJA 4K8EA 5L6UA 4E2BA 4ZQMA 3RLVA 4MUZA 1GOXA 3LM7A 1Q6LA 3LXBA 2ABAA 1LM1A 1DQWA 2BZNA 2EKCA 3N2MA 3C6CA 3DFQA 2ISSA 2FLIA 3NL5A 3S5YA 5BMWA 4N9BA 2I14A 1KTCA 4K36A 3UPBA 1GYNA 2E09A 3NZ1A 3QFEA 2GVJA 3NXFA 1OFEA 2B0MA 1SW3A 4CNNA 3PVFA 4NJIA 2YDAA 5H91A 2ZCGA 4AF0A 4A29A 1YADA 4O8RA 4TX9A 2NX1A 3FLUA 3R89A 1E51A 2CLLA 1EA0A 4E38A 1SZEA 3BPWA 5DBUA 3P7YA 1TJPA 3HB9A 1Y0EA 5D04C 3SR7A 3TSMA 5LNRA 3LGEA 5G2IA 2C3ZA 3G1YA 3KVJA 1KM2A 3Q2DA 3ANYA 1H50A 4LC8A 2YXGA 4RLIA 3GNNA 5CZTA 2RH9A 2ZQ0A 1B4KA 2VXNA 4QISA 5D02A 1WV2A 3P8IA 5AN7A 1VZWA 4LNYA 3UWUA 4Z1AA 2B4GA 1OVDA 3B03A 4LOCA 1X1ZA 2ZBTA 4BK9A 1M7PA 3MO7A 2YFOA 3LRKA 3RFAA 3NQFA 3S8HA 2CLFA 4CCEA 4LV4A 4ZZ9A 2RDUA 3W9ZA
chains in the Genus database with same CATH superfamily
1KBJA 2XVKA 2ZRVA 5DRIA 3I65A 4JTGA 1ZAIA 4GQQA 1EGZA 3G22A 1TJ1A 1H09A 2V3FA 3B0YA 4Z08A 1OFBA 3MUAA 2GGJA 1Q7MA 3VC5A 4J1OA 2G3MA 4E8CA 4PMXA 5DY2A 4CVUA 2F6KA 2VR5A 2D24A 3N25A 1SYTA 1DYSA 2BSLA 3QYQA 1MQRA 3NG3A 2EXOA 3M44A 1F76A 2MNRA 4D8ZA 4DZIA 3T0TA 5ECVA 3A12A 3QM3A 3N4FA 3LHZA 1EJWC 4LUIA 3UPWA 2DZUA 8XIAA 2DORA 3WENA 3H21A 4ADUA 1H7XA 1KQYA 4FR6A 4A2SA 3DHPA 2XN2A 2PD5A 3XISA 3SJ3A 2ZUTA 2WLYA 3VOHA 4JFVA 1OM0A 4H8VA 2Z1KA 2FIQA 4JTJA 1MNZA 2J7DA 3K4WA 4LANA 3OQ8A 1LP6A 2ISWA 2ZZ4A 4LVAA 1M3UA 3PUDA 5IHRA 2VMFA 3XINA 1GQKA 1BYAA 2H90A 3PWIA 3HG2A 3H8AA 3LK6A 3AS1A 3E5PA 1DWAM 3WQDA 1E6ZA 3D0CA 2BMBA 3ZT7A 1TPH1 1GVQA 3O8AA 3BAXA 3MUIA 1EJVC 2D22A 4UTWC 3VOCA 2QCLA 1JPHA 3PS7A 4GXPA 4WKFA 4F0LA 2ZTKA 1EP3A 2DQXA 1VYRA 1I60A 1B9BA 2OKTA 3L4YA 3FX4A 3P60A 3TCSA 2WJEA 3FJ6A 4QSHA 2WBKA 2WZMA 1RP9A 2VEKA 3SM0A 1MUCA 2VX5A 1AMKA 2C7FA 5IXEA 4AH7A 3T4WA 3N04A 2ZXDA 1E3ZA 2F2HA 3ITYA 1CIUA 3ME3A 3BLOA 3N6HA 2QCHA 1NP2A 3DFYA 1OABA 3BAIA 2P1FA 1C8VA 2VEGA 4CQCA 5I0DA 1TA3B 5LA2A 3PWGA 4JN6A 5FD0A 5D30A 2VDGA 5EBUA 1AODA 1GK8A 1O60A 1NWRA 5KSWA 1UC5A 1ZY9A 3EEGA 1B0IA 4M6VA 4GZIA 3WBAA 3LOTA 2E6YA 3GXFA 3GH5A 3KCLA 3OVQA 4AEFA 4P7RA 3OIXA 5H1WA 4YPJA 4G7EA 3WLIA 4UTLA 3W1NA 4I9TA 4ICCX 1BYDA 3USZA 4GPNA 3VIPA 3DH7A 4MLRA 1LF1A 3DG3A 3USBA 3ZSTA 3ZVHB 4DNHA 4P8WA 2Z4GA 2GGGA 3TVAA 1ADDA 2H6RA 4UTTC 5FI8A 5HATA 4GVGA 1LTDA 5XINA 1NEYA 2BS9A 4CEXC 2RDWA 3FW6A 2G37A 2DSVA 4AF0B 4LVFA 1YXYA 1QI5A 5HR6A 4YS1A 2QJNA 2YBVA 3H55A 1ZPTA 1HZYA 1Q4NX 3FN9A 1RQBA 1KTNA 4GQBA 2DSZA 3CT7A 2XWEA 5A8OA 1I75A 3O15A 3LDVA 4S3JA 4DXXA 4WUIA 2PWVA 1FFQA 1JZ7A 2NQHA 4MPQA 4TTUA 5FSDC 1A5MC 2CWXA 1GZJA 3EKLA 3GDMA 3I3DA 4YIWA 2ACSA 4EWJA 3WF4A 4TR9A 2D0FA 1MEIA 1IGSA 5PTDA 1XRTA 3WLPA 3TMQA 4RPPA 1FWDC 4ORIA 2VCCA 2RGMA 3LRLA 4W85A 2P0IA 2O9OA 3P62A 4P8UA 1AUSL 4HNCA 4NRSA 4ICNA 4GIEA 4JCMA 2NWSA 1BG4A 3UPMA 1F3EA 1TIMA 4GXMA 3WH5A 1FH8A 3BOLA 1UR9A 4FXJA 1IXOA 1CBGA 1JJKA 1GOIA 3OIHA 5KZEA 3EX6A 1R3WA 1G6CA 4B5XA 3LQGA 3WDHA 4DJED 1UH2A 4MWAE 3V5OA 1UUQA 3E2QA 4O57A 1A5KC 1GKPA 3UY7A 4UTJA 5A3HA 3DFPA 5IFPA 2AKMA 2RFGA 3GR4A 4JTEA 5EMKA 2QIWA 1W54A 1ZGDA 3ZT6A 4UMAA 4A8IA 2XU2A 2D69A 3ANVA 2Z27A 1JYVA 4PB3A 3TAKA 2CWNA 1T8QA 3D3FA 1YDYA 2CLPA 3K46A 2QJGA 3GXTA 2YCEA 2P3EA 3CWOX 3CASA 1LL4A 5IRPA 1B4EA 4V33A 3TZNA 1DIEA 3OZOA 3EB4A 4E3TA 1EUAA 3G18A 4P5UA 4CQ9A 3LU2A 3L2IA 1YNYA 5C9WA 3NSNA 1DEDA 3CNYA 4KFPA 4L4LA 2VC6A 2DZTA 4GNVA 4J28A 3UXLA 1DWFM 1EOKA 4B9ZA 2BX7A 1UWUA 4O11A 2V5CA 4DWSC 3L5AA 2HMCA 3CT2A 3VZXA 1X98A 4TMCA 3OG3A 2W4XA 4JTSA 3BL3A 1UH4A 3O7UA 1KD0A 1KRBC 4WY0B 2ASHA 2BY2A 7REQB 4DPPA 3CIVA 2RDXA 3VI2A 1QNPA 4Y7EA 4UMCA 4Z1CA 3AWOA 3KAOA 1CGTA 1UMLA 1I6NA 1G94A 4WHBA 2OR2A 1JZ4A 2V5JA 1NFGA 3KWSA 2J7HA 3QOMA 3MT1A 1PYMA 3MHGA 1M65A 1U33A 3FVDA 4HYRA 3TFXA 2G8ZA 2DH2A 1PS9A 4BY3A 1XYZA 1ZB5A 4Y9MA 2WNNA 4AEOA 1Z7AA 3S6TA 3W1XA 3TIMA 2YCLA 1FWSA 4YTQA 4MMWA 1LOLA 4GIYA 9XIMA 1XIIA 4M1RA 1V6XA 4AIBA 2WXDM 3SRHA 5AC7A 3WK1A 5HPOA 4DO5A 3DUGA 3GX9A 4Y90A 1WBHA 2HVMA 4WOQA 1HVXA 4KPLA 1ZAHA 1V03A 5AVNA 1OC6A 5HQLA 3BO9A 3NQEA 4YJ5A 3LQLA 3TN5A 2VQTA 2PP3A 1UD3A 2QGHA 4M80A 2QW5A 1SJBA 4QJ1A 1E73M 4NAEA 3VA8A 3EOOA 3RG6A 3KS5A 4QIUA 4Q8OA 3H7RA 4KS0A 4TXEA 1LT8A 1R30A 3IK2A 2YL8A 5JIPA 1XCFA 2Z1XA 2VHLA 3S4TA 5IOBA 3R6IA 1WYIA 3M0HA 4EX4A 3O9NA 4S38A 2HVOA 1PDYA 3NL3A 1J93A 1XL9A 1W32A 4HN4A 1XHGA 3LG3A 2JEQA 3AIVA 1GVOA 1M7JA 4QNEA 3EMZA 2BHUA 1XFCA 1DJQA 2QCDB 3O3RA 4PMUA 1Z48A 4ECLA 4XBJA 2X7WA 4IUOA 3T44A 4JHMA 1A5BA 3CEUA 3FA5A 1KRCC 4PUMA 1Q2RA 3ZVIA 3KRBA 4FX8A 2QV5A 4FLOA 1XIBA 2PODA 2X1SA 3KBVA 5AYZA 3KVLA 2DVXA 4A8NA 1NSJA 2ZIDA 2E3ZA 1SMAA 1EZWA 1OFPA 1A5OC 4XV0A 2WHMA 3T4CA 1ZFJA 3BAKA 1QDSA 2J79A 4O15A 1XSJA 2E7FA 4LRSA 4NU7A 3W7IA 1NY1A 3VNZA 2C0HA 2DJLA 1UH3A 3WMLA 3E5BA 4AHQA 2GGIA 4RZ6A 1Z32X 2VC5A 3NPXA 3O63A 3PTQA 4GQGA 1KC7A 2Q8LA 3UCQA 2Y8UA 3VKJA 2I1OA 2WKJA 1NH6A 3FY1A 1R86A 4CUCA 1NDWA 4RXGA 2VQUA 4L9YA 5I78A 1XG4A 4NZFA 3VOJA 3OPSA 1F3XA 2FJKA 2CLMA 4GFIA 3OTRA 5CSYA 3K13A 1E56A 1GORA 2MUCA 4HNLA 1YYAA 1E3XA 2BLEA 3VIKA 3HU7A 1C29A 2FZNA 3TXVA 4M6UA 4AFYA 3FJ4A 4AD5A 3S5ZA 1XX1A 5U7SA 3LS9A 3S1XA 3N3TA 3CMGA 3TTEA 4LALA 1KXHA 1I4NA 3IJ6A 1N8FA 2Q3OA 2AGKA 2PRLA 1MSSA 2QHAA 3Q65A 3GVGA 3NJ3A 4Z2IA 1L6SA 3CWHA 1XLIA 4O8AA 1KBLA 3ONCA 3KS6A 3ZSSA 4AD2A 1CGYA 4AAJA 4WIWA 3VE9A 3PNUA 1ONWA 3GDLA 4BQ5A 5CH9A 4EACA 2V82A 8TIMA 4GO9A 2GWGA 4Q7IA 2J4GA 3AZTA 4Q8MA 3GVQA 4YVXA 3S83A 4WDTA 1Z41A 4AXKA 4ZODA 1CWYA 1MWOA 1D3GA 5D33A 3BLLA 5BRQA 3KUMA 4AHPA 2XZ7A 4QFUA 1JD7A 2REQA 3MV01 1XC4A 1SPQA 2XGBA 3FEQA 4P7OA 5D2VA 4PMJA 1VENA 4NYUA 3RPDA 3AZRA 4N42A 3T81A 1WOAA 1AG1O 1ICQA 4O0KA 4GI9A 4E0CA 3B8SA 3HPSA 1FCQA 2DQWA 2OTDA 3W23A 1PHQA 1W3IA 4LCQA 3N4AA 3VDAA 5D2TA 3P0WA 5CLWA 3RPMA 1HT6A 2ZUMA 4XSLA 2R1NA 3PB2A 3W38A 5I03A 3IIXA 3FXGA 3CPGA 1V8EA 1K77A 3WLQA 4I5XA 3W71A 1O5XA 4BKNA 3OYZA 4FLRA 3POCA 4X0VA 1POKA 3V16A 4AY1A 3KL0A 1MRAA 4MUPA 2W67A 1S5VA 3KHDA 1XGEA 4S3CA 1V3LA 2GK1A 1IZJA 4GC3A 2ABBA 3UG8A 3GIPA 4W93A 3AFBA 4B2DD 3M0XA 3KVKA 4DZHA 3OHMB 3GC2A 3VM5A 3UU0A 3A64A 4FOUA 3PAJA 3W73A 1VD6A 3D6NA 3R25A 2Q09A 3L2MA 3KXQA 5JMUA 3B9NA 5LSMA 2GDQA 2CITA 2NQZA 4B15A 1RVKA 3TN4A 4ZE5A 3L21A 3UZWA 1W2VA 4C5YA 1B3YA 2JF6A 1C92A 3CV2A 1X7FA 5CPMA 4HCHA 2Z1BA 3OLIA 1RBOB 3S5NA 1N2VA 4DBSA 3MUCA 4AD3A 4DNMA 2PBGA 2G3JA 4QQUA 3W84A 2YYUA 4X60A 1P6WA 4L6DA 3R11A 4O53A 4PODA 4DO4A 1D3HA 3NZGA 3WFAA 5FA5A 2GFTA 4DF0A 2QJHA 3SIMA 4F48A 1GUVA 4PRRA 4QJ5B 1PWMA 1JG9A 1H7NA 4HZ8A 2CLKA 3W2UA 3EWDA 1SZFA 4JR5A 1VB9A 3JRKA 3B4UA 4AZCB 1PZ2A 3TNOA 2PLMA 1XV8A 3B3DA 4LXFA 3LHWA 1TWDA 2BP1A 4H7VA 4Z0JA 2HK1A 3U57A 3R79A 1JD9A 4D1JA 1EF3A 1QI4A 3GUWA 2A3EA 1UYQA 3BJSA 3W7OA 3DXIA 3WNKA 3EXRA 1T0OA 1FXPA 1XFBA 4HYWA 3AISA 1FRBA 3NOEA 2IW0A 1U22A 3CS2A 4QX4A 1AW2A 2PTZA 1C9DA 3C2RA 4A35A 1CYGA 1R47A 5CAKA 2A6LA 5I3DA 1DORA 3B9DA 3B0UX 3WBEA 1WUEA 4FHAA 3BK0A 2DVUA 3G0UA 3UVAA 1VRXA 2W9MA 2WAGA 3LLXA 2CZEA 3CQ0A 4B91A 4ATLA 1RA5A 1SFSA 1MQQA 1S1PA 4GI4A 3DX5A 3HFYA 1A53A 3LENA 1UD2A 6XIAA 2D0GA 3HPFA 4JNMA 5GVJA 1WKEA 1LL6A 3EA1A 3MI6A 5MKGB 1T96A 1T41A 2FZMA 9RUBA 4MADA 2BY0A 3TN3A 3UQNA 4D6JA 3QN3A 5C8BB 2WZIA 1P4CA 2AAAA 3FIGA 2J74A 1WAUA 1CW2A 1WZKA 2PFHA 4IFKA 2PSNA 1PCKA 4L56A 3W7PA 1K3UA 5G4WA 3GFYA 2X1RA 4XZBA 4FA3A 5TNVA 4HZMA 1JI1A 3BW2A 4KW2A 4UR8A 1E70M 1KWKA 3KTXA 1AFSA 4GVFA 4LYKA 2HCVA 4LS2A 3T8LA 2Q8ZA 4EPDC 1XINA 4Q4MA 1RALA 4ES4A 4Z2JA 4C7DA 4ZVJA 1BXNA 4F3HA 2J24A 3SCOA 1FCBA 3OGRA 1XW8A 4OGZA 4AC1X 2QAFA 4D6HA 2VZSA 3B9OA 3SN1A 1BVWA 1FY6A 4GY7A 3CB8A 4O52A 2DZXA 1HW6A 1GEHA 2PDGA 3VIFA 1ZTVA 3RM4A 1V0NA 4F9DA 4LUTB 3T09A 1E71M 1KKOA 3RO6A 5G1TA 3D5HA 1IQ8A 4RV8A 3RLGA 3V1HA 1A3HA 3WF0A 2GVGA 3PNZA 2ZXQA 4HMCA 2AL2B 4ASTA 1HUVA 4DI9A 2J9XA 4KEMA 5D38A 3W24A 3WDIA 2Z6IA 4H6EA 3WBWA 4HPHA 2FGLA 4H7ZA 2NW0A 4LRTA 3WD0A 3HJZA 4PGLA 1W5OA 4B9YA 4WXZA 1ADOA 3QC0A 1UD6A 5CPNA 3MW7A 4BZYA 5A8MA 5LIXX 3L23A 3FYOA 4C6MA 2QUTA 3W2KA 2PDYA 2CHNA 4U3CA 4PBFA 2X8RA 3MZ2A 3F5KA 2C71A 1XLHA 4E4UA 1PCWA 4NZJA 3PJTA 4PL1A 1SJCA 4UIOA 4XUGA 1RPKA 1XBVA 4Q8TA 2Z00A 1S46A 3DFSA 1S2WA 3KRZA 1YNQA 1G4SA 3UR7A 1E9IA 4Y6GA 1CI1A 3A5VA 3TQ0A 3DDMA 2V3EA 4XZIA 3M0JA 2XH4A 1WX0A 4FNRA 2DUAA 4CQ8A 1E40A 5K7JA 2JGQA 3MB9A 3EWWA 3GAKA 2NVCA 1KFEA 3B04A 3PBMA 4RDWA 3NAVA 3BCJA 4C7GA 3S9ZA 5G2WA 2D2OA 1O7AA 5A2BA 4DN1A 1JVNA 2X30A 3E0VA 1E0XA 1HIZA 2YL9A 4X2RA 1W3HA 2QDHA 3EA2A 3AJXA 4XIAA 3V1PA 2H9AA 2CBIA 3NZRA 4KRZA 4HQVA 3QHNA 3HV9A 1OCBA 3QSTA 3KLKA 3IV8A 5HWJA 3BVJA 3CV1A 1T99A 2BVWA 2QPUA 4P7QA 1A49A 4RX0A 3HTWA 3NVDA 2P8BA 2DZVA 3AI0A 2GSEA 3PBWA 4XAFA 4GKTA 2D1ZA 4GUGA 1IXQA 4BA0A 3P61A 1HVQA 1FWCC 1JGMA 2V6AA 3SW6A 2NLYA 1XYLA 5CGTA 2XIQA 1WA3A 3GBEA 4PZVA 3UERA 1XR2A 4B3KA 1XBXA 3GC4A 1BVZA 3H7VA 1CCWB 2VX6A 1XDJA 1UMYA 2DU2A 1M03A 2E5DA 2QEZA 1E4IA 3THDA 2YFNA 1AH3A 3M0KA 3MP3A 3KW3A 1EJRC 3KBMA 2JF7A 2VTFA 2D2HA 5A6BD 1K7XA 2ACQA 1OFRA 1FWRA 4CKQA 2WQPA 1EHNA 3DHFA 2VGGA 1OK6A 1BXBA 2POTA 4CNTA 1Q6EA 1I1WA 4MGGA 2G96A 4MKNA 3L4WA 2VWTA 4LF1A 3EOEA 1RHCA 5FF0A 3ZJ7A 1XH0A 2BNJA 1O4UA 1ZUAX 2Y8KA 2JBMA 4EPBC 3UESA 3W1TA 2R1KA 3BCDA 1BHGA 3IIPA 1MQPA 1XKJA 2GZXA 4PC8A 3KCOA 4OT7A 2ZFAA 2CKRA 3NXLA 2V5LA 1US2A 3VD4A 1E1FA 3QXBA 3Q37A 1GVYA 5J8LA 3TYDA 1L8NA 4HVXA 4W87A 4WDUA 3BOXA 1LOSA 2NZLA 4NJJA 2FGBA 4JTTA 1F6YA 3VMOA 1Q65A 2W92A 3W1QA 6TAAA 3I4EA 5HBFA 4H8HA 2EPOA 4WSHA 4IICA 2V2HA 4WKAA 2RJGA 1F3TA 3RDKA 3JZUA 4OU1A 1SVDA 2E67A 1V6VA 4UOZA 4JKMA 4Q4PA 3YPIA 5CKSA 2WB5A 3VX1A 5AHIA 3WH7A 2XSBA 4JQAA 5EFDA 2WC3A 3LXAA 3UZZA 4U31A 1XKYA 1W6TA 4DZAA 4GY1A 2C14A 4MKVA 2V69A 4X61A 5DF0A 2INEA 3ERPA 4ACYA 3I6RA 5ABEA 3RJXA 3LLDA 2XINA 3CQIA 5I3IA 4Q8WA 3KBWA 3CWNA 3C4UA 1JUKA 4LJ3A 4UTFA 1MXSA 3R94A 3F4NA 4DF1A 5I5RA 1ESWA 1VPYA 4JS3A 1TVNA 1SU5A 4PMNA 5I06A 5LHFA 2VRKA 2YB1A 3FGCB 3WF1A 2Z28A 3A9BA 3GW0A 2WHLA 2DVTA 3N2BA 1QHZA 1KM6A 3URAA 4WDXA 3UGVA 3TC3A 1XIDA 3PF3A 6CGTA 5HMEA 4XBSA 2YSWA 4DB7A 2CBJA 1KWGA 1XRVA 1H7RA 1TE1A 3QSRA 3KTSA 2WYSA 1B54A 3P0XA 1TTJA 4DAIA 5CGQA 2WCSA 2GJLA 4QCEA 4F40A 1QPQA 3RLUA 1UKSA 1XUUA 5JBDA 1AW5A 4LSBA 1PYFA 4PUEA 1XBYA 2ZYFA 4G6CA 2HBXA 2BXVA 1W9XA 3GVWA 5A8NA 4H83A 3H4GA 2VD8A 2VWSA 1UR0A 2BOGX 3UWEA 2KAUC 3LV5A 4Q22A 1TQXA 1VEMA 3WLKX 4A3QA 1TPC1 4Y9NA 4IG2B 5HDRA 5HUPA 4WOZA 5EYWA 3MTWA 2ZC1A 3QV8A 5C2CA 1C90A 4PUWA 4IJBA 2I5GA 2PDPA 4HSNA 1MRQA 3LRMA 1EF2A 4Q7NA 2EJ1A 4IPNB 2OU4A 1TTQA 4GH1A 1TJ2A 4PMDA 2ZADA 4UQ9A 4O17A 4US5D 5FKYA 3ALGA 3CK5A 1JCYA 5H8PA 3OO2A 2DZWA 1EOMA 1QNSA 4HCLA 3ARVA 3J7HA 1KFBA 4B90A 1XXXA 3CUIA 2ISDA 4HU4A 3S2NA 1OCQA 2ZWYA 4NHVA 4Z0SA 3UD6A 4S3FA 1G01A 5IBXA 1POJA 1XIGA 1Q6DA 4R85A 3K4AA 3DI1A 1IWBA 1EFZA 1MDRA 4LQ1A 3TUUA 4UQBA 5K3VA 4X63A 4GBDA 2J9YA 1PBGA 3CJPA 3ZIZA 1EA9C 1SO3A 1JZ2A 3GRIA 2Z0IA 4ORMA 1L0PA 1OF6A 1D3CA 5EL1A 3N15A 1JCNA 1H0IA 2PDMA 5DFAA 1Z8AA 3L7RA 3S42A 1O66A 2WPGA 4U33A 3QV9A 1OG6A 3NPVA 1J4EA 3GDRA 3V0UA 4I90A 4AVOA 1S5WA 1T5AA 3EWXA 4S3KA 3M0IA 5AHMA 4XK2A 4WCJA 3ZT5A 3GLCA 4Y9OA 4PSPA 2J7EA 1VH7A 4HK6A 4AWEA 3SECA 2V63A 1CGUA 1TWSA 4QLJA 1ZSXA 4GYPA 4IIEA 4GRSA 4BCEA 3AIUA 3ZR6A 3HQNA 3TX9A 1Q6OA 5G4EA 4LYRA 3ABOA 2OCZA 1FWWA 1TA3A 3DC0A 3GDTA 4FB7A 3L0KA 3OP2A 5C9ZA 3SRDA 4KEUA 3NQVA 1X97A 1Q13A 3VM7A 1DWHM 1I2QA 3W76A 3SCSA 3FJNA 3TYUA 3WO8A 5DEZA 3PZUA 2F8QA 5FESA 3NR0A 2AKZA 3W26A 3B06A 2WPBA 4M19A 2FDMA 5FF3A 1X1OA 2GJPA 2OGYA 1TPUA 3PSVA 3U7VA 4LBUA 3CO8A 5L6UA 1Q6LA 1LM1A 1Z6KA 3ZVHA 4KRUA 2CNCA 2BFGA 3MO4A 2J62A 1NDZA 5BMWA 4IP7A 4AU0A 1KTCA 3NZ1A 5H91A 4AF0A 2ZCGA 5IDZA 4TX9A 1OSEA 1E51A 3IGHX 5JBEA 4C6DA 2Y24A 5DBUA 3NWRA 3HB9A 4IIFA 1ONEA 5CJMA 5G2IA 2C3ZA 2Z1VA 4D1IA 1KM2A 3Q2DA 4Q8QA 3WUBA 4JQ4A 3UEQA 4PMZA 2YXGA 4RLIA 5CZTA 2ZQ0A 1OINA 1B4KA 1YHTA 1B9ZA 4L4PA 2CHOA 3EDJA 1VZWA 4Q6XA 3CPUA 1QNQA 4C1NB 2D3LA 4Z1AA 3B03A 4LOCA 1X1ZA 2DEPA 3KCJA 1FWBC 1GCYA 4E6MA 1CLKA 3WDJA 4YU1A 3LRKA 4IQJA 3WQ4A 1DJZA 3S8HA 1MYRA 1K9EA 4WEVX 4LV4A 5EB8A 4K2SA 2RDUA 4AD4A 2A3AA 3VD5A 4V1YA 5LZLA 4ZE4A 4TO8A 1CGVA 3U5UA 3AHZA 2ZRUA 4I7UA 4F0HA 4AVNA 3KEHA 3QMSA 3G6LA 3H2OA 4MYAA 3FKKA 3VNDA 3C86A 5HAOA 1WNOA 4NNCA 1MO0A 3SADA 4FEZA 2F38A 5TIMA 3JS3A 1X1NA 4GGBA 1NOFA 3RJYA 3GAYA 5IM51 1V0MA 3TJLA 3F2DA 1HFBA 1XC6A 4H01A 3WY1A 1WKYA 3RF9A 4NZCA 1DJWA 2J88A 1GVIA 2V8ZA 4P8XA 5EMLA 3CTTA 3RCMA 3ZM8A 1SZGA 4X0NA 4QAIA 5I24A 4K1WA 3DG6A 1AD4A 4C6FA 4AZ7A 5CEWA 1QW9A 4DJFA 1W17A 1J12A 2C8NA 3UCDA 4EPEC 4UFIA 2XVGA 1WAWA 4FK9A 1VBRA 4RZ4A 4MWAB 4NZ4A 5JUVA 4HPNA 5D8WA 4PUNA 4AWSA 3EOSA 4IL2A 3SCQA 1A5LC 1F61A 1FHVA 1G1YA 3IGSA 3A4WA 3LCWA 4BR1A 4DBUA 1BTCA 3CZLA 2IMRA 4R9XA 4KWWA 3WD1A 1A5UA 1MUMA 1U1UA 2FH6A 4HKPA 3TCEA 3DFOA 1VFOA 3BSMA 3S6OA 2EF9A 5MHBA 1E4LA 5T9CE 4M8UA 3U2ZA 3E3HA 4IOTA 3VNKA 3BC9A 2X1UA 3W85A 4GIRA 3W7EA 3UETA 1FP8A 1UPMB 4WY0A 4YYFA 1QK0A 1U1HA 5FF7A 4IGSA 1ML1A 2WCGA 2XWDA 2VX4A 1Q2SA 2ZC8A 3W6MA 4ZQOA 1SR0A 3NUKA 4I8DA 2J6VA 3NZPA 1R3YA 1TX0A 4B5UA 3DFNA 3VIHA 1YRRA 1E1CB 3A23A 3MBDA 2GQAA 4MF4A 1I45A 1ZAJA 1DJNA 2J7CA 2ZZ7A 4A8LA 2BHZA 2O92A 4DBEA 5TBOA 3RXZA 3R10A 2R14A 4C90A 5E0FA 3AOFA 3AS3A 3URBA 3G1XA 5AHEA 5FEPA 4JFWA 4F0KA 2YA1A 1J01A 2FH8A 3A13A 3B0PA 1DV7A 1I2PA 4AUBA 1QOQA 3W72A 4CQAA 5C6MA 5DCBA 4ZO8A 5BU9A 4I8YA 2XISA 3PB0A 4DO7A 3A3WA 1TPEA 1FCVA 3EPNA 3DBNA 4QSFA 1YDOA 2OSXA 3AALA 2W63A 1V93A 3BMXA 1G0CA 3CUJA 2GOUA 4R7JA 3WNLA 4LX4A 1C93A 1DWGM 3E1F1 2FPYA 1GQLA 3SUVA 4NNBA 5CSRA 3S9YA 1LJYA 3LPPA 4I7WA 3R12A 1TV5A 2WVUA 1DBTA 2E1DA 1I9CB 3MYPA 1ADSA 1RV8A 2I5QA 1O1HA 2PDIA 3VU2A 2ZX7A 3KOYA 4HJFA 2OOGA 3GY1A 2O9RA 5I07A 4BHYA 1IEIA 1W3KA 1XF0A 2OELA 2WNQA 1SJAA 2OQLA 4QDMA 5K9XA 4Q4SA 4DUOA 2QCDA 3WQ6A 3FEMA 4MJ4A 2VEMA 3W29A 3TQVA 4YL2A 3LTSA 1H61A 1E6RA 1UP3A 2J66A 2WWDA 4KEZA 1OJXA 1HKIA 4LH8A 1QW7A 4A3UA 2YDSA 1ZALA 3CHCA 3LCLA 4EXAA 4MDPA 1KQZA 3U6WA 1P1XA 4EAMA 1J0HA 1U83A 1RXOB 4NX5A 4A21A 3NQ6A 1M7OA 1XLCA 1B2YA 4S39A 2I56A 3LCHA 1O6IA 4HGXA 2IKIA 3W6LA 5IHSA 4PTMA 5D2YA 1Q63A 1BFNA 3FSTA 4FZIA 4AZHA 3SY5A 1THFD 4ZFMA 5FAGA 5JIWA 4GH3A 5IBXC 5AYYA 3LYEA 4GE8A 2GLKA 2ZZ3A 2NT0A 1J9YA 2WMHA 2OWWA 4QRNA 2O9TA 4UNKA 2FZ8A 4V28A 4QLKA 2D2GA 4LWWA 5DT7A 4DAFA 2D2JA 4PFHA 1IE7C 5I6SA 4IZGA 1AL8A 1TPVA 1TPB1 2X09A 3MU7A 1G4TA 1JDCA 4C6LA 3UWYA 2NSXA 1QTWA 3U0HA 4QITA 1XPGA 3DOPA 1TV8A 5LIWX 1K6AA 1BGAA 2XFYA 3TN6A 2CC0A 4L5ZA 3VOGA 3B40A 8A3HA 3NQCA 4IP5A 4RNIA 2GL5A 2POZA 1KLYA 3H7UA 1IGWA 3D3AA 3D46A 1GQIA 5HPCA 4HB7A 4O13A 2PDJA 3P82A 3VNYA 1GWJA 3GFZA 3BQ6A 2B7NA 5HR7A 3APYA 4GYPC 4B2DA 5DANA 4ZTXA 3BGAA 3QQ0A 3ZLFA 5KITA 2XFFA 3N2OA 1ISZA 1VJIA 2W3ZA 3DGBA 1G9HA 3FOKA 2CEQA 2ZX5A 3IK4A 3QFWA 1KCZA 4GC4A 1VF8A 2G3IA 2G50A 1KCXA 2OMAA 3GYCA 3JZEA 3RM9A 2WZHA 3UXDA 3EX1A 4LBSA 1W1TA 2PUZA 1E5NA 3NQAA 1V3HA 1ME9A 2FMOA 3PN8A 1MI3A 4HMDA 4YVPA 1AJZA 4O0QA 1TCMA 2J7FA 2OXNA 3LEPA 4GFSA 3W7MA 1FKWA 2EPLX 4IPPA 1KFKA 4AMAA 3JVAA 1J0KA 3TU9A 1PWLA 3BZGA 4L65A 3SCWA 5D8ZA 4DJDA 1ZLPA 3W1AA 3UFYA 4O14A 2ZA3A 3L12A 1JCXA 3B9EA 1SUXA 2V67A 2QVNA 1EO7A 3IRDA 4WD0A 2DFAA 1CXLA 1XYBA 4K7VA 2PCQA 2O0TA 1F6PA 3LZ5A 4MJMA 2CYGA 1UBSA 3P74A 3CL8A 3VNMA 1DIOA 3M7SA 4JTRA 3C52A 3E6EA 2PDBA 1HKJA 3OLEA 4BF9A 3VIMA 3TQPA 3VOFA 4QLLA 5I3HA 2PWHA 2Z29A 2YLAA 3QLDA 1IEVA 1GVSA 4RNJA 4XZHA 3SY8A 1K8ZA 1D7FA 2A3LA 5BZAA 1R87A 4F0RA 3M47A 2PLKA 3SCTA 3LY0A 2V5DA 2QCGA 3LXCA 3SFWA 3WSUA 2QV4A 1W37A 3FSUA 2YIHA 4LAKA 1KNWA 3GDBA 5DMMA 3QY6A 3L2LA 3VZYA 1W1YA 1K03A 3G5EA 5F2GA 1S39A 3P14A 3L65A 2QPXA 3KFTA 3OA5A 1VAHA 4IHCA 3WQPA 1ITCA 4JYDA 3IJ9A 3AMDA 4LCSA 5F2IA 4F9JA 1I2OA 2INFA 5A6KA 5FF2A 4RDYA 4XG1A 2VGFA 3AJ7A 3REQA 3VC6A 2R1MA 3CV6A 4QE1A 1XRSA 1MNSA 5DXXA 3TP4A 4PA8A 4LNCA 1EL3A 1YX1A 3ARUA 1V7AA 1E6XM 3HN3A 4QEHA 1WDRA 2DT1A 4DPQA 1F6KA 3AXMA 1JGIA 4UNLA 2HEJA 1GHSA 4OVXA 4L1WA 3OW1A 4FI4A 5ABTA 1CXFA 1HNYA 4GBUA 2RGLA 3DYPA 4S2CA 4A8RA 1OIFA 2F9RA 2Z2AA 3OU8A 5EGRA 1QWKA 4ZSTA 1F4HA 1JI2A 1R9XA 1A47A 3DENA 2FB3A 3FA3A 4JL1A 4O1CA 2OODA 3SGZA 2JIWA 4OFCA 4XD3A 3BQ5A 4HZ6A 1CECA 3S1GA 2EGZA 2V5BA 1RR2A 4QR6A 3AHXA 3RN6A 4MB4A 4AZCA 5D9OA 1TSIA 1DTNA 3EA3A 2PCEA 4Y9PA 2BY3A 2O4MA 1AVAA 4GISA 4M82A 4DJFC 4HHMA 4ROPA 2PDQA 3CUXA 4FLSA 4NJGA 3DI0A 1JZ5A 2VFFA 3ZO9A 6ALDA 4UQCA 3IVUA 3QOKA 4IISA 1OHLA 1GG0A 1ICPA 2PGEA 2FZBA 1JQXA 1BWLA 4W7VA 4O12A 3LTYA 3FAWA 3R2GA 4UQEA 1O12A 3HQ1A 3IUHA 1UIOA 4WSKA 4M51A 3OA3A 2TODA 3G0XA 3TR9A 1NELA 2W91A 1Q66A 3TSDA 1H41A 3FYYA 3GNPA 4CD7A 1ONRA 2C15A 1Q5MA 2Z26A 5H2ZA 4XWUA 2HXTA 5GNXA 5D9NA 1FBAA 4OKDA 1DHPA 3IJQA 1PIIA 4X22A 5MKGA 4AX7A 3MMUA 4FXSA 3SDOA 4Q32A 3TYZA 4U3AA 4DYEA 3E96A 1UASA 3JR2A 3QY7A 2ZX9A 4UFHA 3W4RA 1WDDA 1G5AA 1A5NC 3B8DA 3QKEA 4FIQA 3WFLA 4KCWA 1GOOA 2FVLA 1A5SA 4XKYB 2VRQA 3BTNA 2Y7EA 4PUKA 1DTUA 1XUZA 5AZ0A 2O7SA 3W82A 4F2TA 4HCDA 4K1GA 5HQMA 2G5WA 3RAOA 2HZGA 5U4NA 4MKSA 1IEXA 3UZYA 1ZJHA 3PTMA 3K1GA 1W3JA 3LHUA 3APGA 4DWSB 4XIMA 4G5DA 2PP0A 2ZVIA 1OFQA 5A6AA 3NYDA 4RDVA 3RYSA 1SMDA 1NF0A 1TB3A 2XTKA 5T8GA 4LUTA 1J10A 3N9KA 4G1KA 1M41A 3UNTA 5A8QA 2Y5EA 3F7JA 4LC6A 5GQBA 1EIBA 2XPKA 3QW4B 3TJ4A 2AL2A 3EZ4A 1CLVA 4CU8A 1NIUA 1US3A 4DF2A 1SFTA 1S2UA 3O2LA 4DYJA 1HGWA 3WMBA 2NQJA 4B4FA 3R5EA 1JL8A 1KTBA 3MPGA 4DUXA 4XD5A 2ZE3A 4LCRA 2R1LA 1REQB 8RUCA 2QCEA 3G1DA 4GCXA 4PMRA 4YWSA 3Q94A 3VFLA 2WW5A 5CZ0A 3ZZ1A 3CUZA 3VMPA 1OQFA 1O95A 3CH9A 1HJQA 1R9ZA 4HU0A 4B5WA 4RE0A 4QAWA 4EXBA 1QNOA 2VCBA 4IWWA 5A6TC 1J5TA 2A7NA 5C9XA 3CQJA 4M6QA 2QJJA 4CQBA 1QT1A 4CNSA 4S3DA 1JQVA 2WQDA 4XZWA 2VZUA 3EWCA 1OX5A 2VEPA 3RMEA 4CN4A 3U7BA 4AXNA 2I7GA 5AECA 1LQAA 1QK2A 3ISIX 3UZ5A 1XCWA 4DWSD 4GQRA 1JF6A 1ZJBA 3ONBA 2C0AA 2Y63A 4BFAA 1TPWA 4NQ1A 1QW8A 1M7XA 3GB6A 3NQ7A 1BVNP 4V1XA 2UY3A 2DSKA 1PIFA 5I2UA 1DJHA 3TKFA 2WMFA 3TJIA 3L4VA 1HP5A 3SB0A 3WJWA 3EWUA 1OFAA 4NF7A 1ZQ5A 4PMOA 3EKZA 2GOKA 3WQEA 3TOYA 3CLWA 3WQFA 1JYXA 3RRAA 3UA3A 3S5OA 1PVNA 4IQDA 4M7SA 3MSGA 3C2VA 4KQNA 4AZ5A 2Y70A 5B7ZA 4J40A 5I79A 2X1IA 5CBJA 5CAHA 1EH9A 4G8TA 2XH2A 4MM1A 4C6NA 2WBGA 4ZB0A 1TVPA 3TMLA 3M5ZA 4BQ2A 2F7FA 5AYIA 3SCVA 3IS4A 1UKTA 3WH6A 1E0WA 1EQPA 1VFMA 3DKJA 1PXGA 3W7JA 1ZCOA 1A4LA 3AU2A 3STFA 1UIPA 4GZJA 1XYFA 3NO1A 1WUFA 2ZTJA 3O05A 2B31A 4YTTA 1RY0A 4PUUA 2EPKX 3ZLHA 5DBTA 3PTDA 1FWHC 1KGWA 2CFFA 1Y8BA 3GYEA 1KRMA 1JNDA 1XH1A 1YPXA 3RCYA 4NI3A 3CAKA 4D6EA 1R2TA 4WSJA 1CTNA 4DJDC 3L4XA 3BJTA 2E8YA 3IJLA 3S47A 2Y61A 3GU2A 2J78A 1X7IA 4IMFA 3RU8X 3EPMA 4O1DA 1QUMA 4ACZB 3WLRA 4CD6A 1DE5A 4WJ8A 4NZ5A 1B3ZA 1S2VA 4ERIA 3NOYA 1H3GA 3NA8A 2Y62A 2CETA 1PE1A 3ITTA 2GJXB 3U8GA 3I7QA 4TVUA 2GGEA 3S0CA 3I7SA 2E0PA 4L61A 1LWJA 4MZ1A 1XLGA 1W3TA 4IM4A 4S2BA 3WDPP 1WBJA 2CLEA 2EJAA 2WANA 2IPFA 1CGXA 1W56A 2UY5A 4OE7A 4UBPC 4H1ZA 3UR5A 1MFUA 1C8QA 4GNJA 4BI5A 1XLLA 3NIYA 3C61A 3WL1A 1QASA 4O19A 1FOBA 3ELFA 4XAYA 2WC7A 4KIEA 2TMDA 2BVTA 4FNSA 2FHBA 4A3HA 1P0NA 2EAWA 4XTIA 3C2YA 3QV7A 4K38A 1OT1A 3P6LA 4F0MA 3S1WA 3KP0A 4XSMA 2Q71A 3RHGA 1D7KA 4LY8A 3HGOA 3GXMA 4GXWA 4E8DA 3SGGA 1AZ1A 3HPXA 2XHYA 3MUZ1 1KCKA 2QCCA 3BICA 1QI0A 5FJJA 1R0MA 4H00A 4RE4A 5JQ9A 3CUGA 1EWEA 5EMMA 1EKOA 4IIGA 5H8UA 5A6LA 4HOZA 3TONA 1RK6A 2EBNA 2VYOA 3MI2A 1A5CA 4JTFA 3F4CA 2OO6A 2ZA1A 4XO7A 4PTWA 1ZP4A 3FGCA 5FACA 4WRHA 5IDIA 2DSUA 1SO5A 2UY4A 2DDXA 2OZ0A 3SRKA 2XIBA 2YL5A 2OSYA 3H70A 1CT5A 3W75A 2ISVA 4O0ZA 2GUBA 1GQJA 7A3HA 2BBFA 2D23A 2H3BA 5CXPA 3VK5A 2AMGA 3THUA 5T26A 3R0UA 3A24A 4JIQA 1G69A 2QLYA 4Z1DA 3T42A 4RW3A 1H1ZA 3W87A 5E0KA 2WOQA 4DY1A 1OT2A 3LUTA 1R2SA 4JXCA 4LUSA 4E2VA 2XIJA 3CTLA 4KWOA 1EJTC 3T0AA 1K6WA 3SURA 5TF0A 4CCZA 1XI3A 4MDOA 4HYVA 3TXZA 5D2WA 1K8CA 4IG2A 3MYOA 2WKLA 3BGGA 4GYKA 1K9DA 2OYKA 4GZEA 4B92A 1OD8A 3IIZA 4H8UA 3WH8A 2W61A 4XBKA 3W3OA 4HOWA 2E1WA 1DE6A 3H53A 5HANA 1FWEC 3PC0A 2EQDA 3UA4A 2WMKA 1H4PA 1K8XA 3V7PA 4DUVA 2YA0A 3QJAA 3PBUA 2RHGA 4A4AA 2VM8A 4RJEA 2VC9A 1W5PA 3HPAA 4ZA0A 2CESA 1A50A 3GO2A 1OEPA 2VVNA 4H4IA 1RJQA 3NZQA 2P0OA 2AQWA 4YHGA 3TTQA 3I4KA 3NVTA 2X41A 4HNTA 1MZRA 1JAEA 3UJEA 1QO2A 1X6UA 4HZ7A 2NXIA 3FDKA 1TZ9A 2XSAA 2XJ7A 3W28A 1TJRA 1Y5XA 3ZFHA 4PRWA 5HNTA 2WJDA 3TTSA 1OY0A 1E43A 3TC6A 2FZ9A 4W8BA 1ZRQA 1NOWA 4NJKA 3KDOA 2BODX 1QOXA 2Z24A 5DQPA 4IL0A 1EC9A 3WF2A 3EWBX 1Q8JA 1P0EA 5C2GA 2YGYA 1ME7A 2XN0A 1DWJM 1O68A 4H7CA 3WK2A 3AZSA 2WJFA 3PJWA 1AMYA 4Z2HA 3LV6A 2VELA 1NU5A 2J13A 4O16A 1Q6QA 4O18A 2WSYA 4GX8A 5REQB 1PX8A 5I3KA 3H26A 3ITVA 5C54A 5KZDA 3IARA 1DJIA 3OYXA 5FJIA 4HA0A 2RKXA 2QJMA 1E55A 5FOOA 3STPA 1YKWA 3N13A 4IMCA 5A8GA 3Q58A 1A80A 4WGHA 3WNMA 2WNZA 4UXDA 2GQ3A 2ZUSA 4TX8A 3I6TA 4LY4A 4JNYA 2HDJA 1TUXA 2WM0A 5DELA 4R9OA 3G2GA 1W1IE 1JIBA 3M0ZA 3PK7A 2ZRWA 1KBKA 2Z25A 1IT7A 4CGTA 2A2IA 3ZYZA 1CGWA 5ABFB 3S2LA 3W2JA 3MMDA 4XD6A 2VGBA 1EIXA 4V15A 1GPWA 3GZ3A 5LXEA 3EMCA 3AU6A 1M01A 2P8CA 2GSHA 4JDYA 4XD4A 3QC3A 2O9PA 2J25A 2KX9A 2IKGA 1WXJA 2BGQA 4GD0A 4M1BA 3TAOA 3N3MA 1QBAA 4JHOA 4J3UA 2DW6A 4CNPA 4YYCA 5CC6A 1NF7A 1HJWA 3N9RA 3M0LA 1SR9A 3ARXA 3CAWA 4QJ3B 5DT5A 3BLPX 4PSRA 2VFDA 1DXIA 1XCXA 3C0LA 2ZZ5A 2Q8XA 5AZ1A 1GJUA 2FFIA 1LCOA 1QPRA 1R9YA 5J04A 5C71A 4L4MA 4FX6M 3AXIA 3HG5A 4GUIA 3PZIA 2Z6JA 4ZGYA 1XQKA 4C1NA 1V0KA 3CUHA 4M56A 2W62A 4J4KA 3VKAA 2X1TA 1XD1A 4C6JA 3H2AA 4NASA 1S38A 3OVGA 2Y5JA 3WELA 1TV3A 4C65A 2O7QA 4W5ZA 4PCPA 1GT8A 1LRQA 3ARWA 4BEQA 2DJXA 3AHTA 1WZMA 3WCZA 3VDBA 2OEJA 2PPGA 4C6CA 3QEZA 3U9IA 4ZENA 1IYXA 1X8FA 3SCNA 2Y7GA 2FMNA 3ARYA 1R3QA 5HULA 1HKVA 3WKZA 3GKFA 5M03A 1VHNA 3CZ8A 3KL5A 1TMQA 3GBDA 4WF7A 3W00A 1Y7VA 5E93A 2ATSA 4UFJA 4IFRA 4FIRA 5AVHA 2C1GA 3THQA 3W1UA 2PU1A 3QTGA 4O4WA 1VR6A 3O07A 1X6LA 3NPUA 5CSUA 2GQ8A 4XZLX 4TV5A 2I5IA 1LWHA 3QQ1A 3VGGA 4NYYA 4CN1A 4R33A 5AC6A 3VOIA 2IPJA 4LUJA 5CQ1A 2QXWA 3DAQA 3RX4A 1GQNA 1XLKA 4N7QA 1X38A 2DUXA 3N11A 4AISA 5HMDA 5EKYA 2VL4A 2W6RA 3CV7A 3LSCA 2IXUA 3I3BA 5I3FA 3FHAA 3MCNA 4XVDA 2FPVA 1WZAA 4MWAA 1K4GA 1JZ8A 4JDBA 1EX1A 2FTPA 1AD1A 3L0GA 1OYCA 5AHLA 2PDXA 2OYMA 3HGRA 3VGEA 3VIJA 5CLTA 4Q4RA 1MZHA 2XH7A 4KWVA 2OZ8A 3GS6A 3ATZA 3LZ3A 2P50A 2OKOA 3UYIA 4I3GA 1KFCA 4LVGA 4KFOA 2CZFA 2R82A 3MSYA 4R5EA 1W9VA 4HK7A 3UJRA 1WXZA 1YMYA 1CDGA 1L2UA 1DQXA 1LL7A 5EY5A 3U4FA 4HTYA 3N18A 2FB2A 1M6JA 4KWSA 4MAVA 1B30A 1K7FA 4HNNA 1IEWA 1BQGA 3DHUA 3TV8A 3FXYA 2REQB 3G1FA 3O16A 3N9SA 1BSIA 3H2NA 1E1CA 2FKPA 1GOKA 4RK8A 1F7BA 3GDKA 1E4NA 1G4EA 2V3GA 2FZDA 4XB3A 3W53A 3WK0A 1N7KA 2V0TA 4H04A 5I23A 1V3IA 4I5UA 5AHNA 5DXYA 2OJPA 5A6MA 3GG0A 1PV8A 2CCRA 2V9DA 2PRHA 3CL7A 1UD4A 2E77A 5BW6A 1UWSA 2I9EA 3DHDA 1FWIC 4M29A 3FK4A 1L6WA 4Q4QA 3MHUA 5HNNA 4N4PA 2PAJA 3S9IA 3U2CA 1R3TA 1JCJA 4L6OA 4K8EA 5BOEA 1ONXA 3GQYA 3RLVA 4MUZA 1GOXA 3CGTA 2QPSA 3GC5A 2BZNA 2EKCA 2J77A 3N2MA 3N17A 1JFHA 2XYLA 4MNJA 1BLIA 5DMYA 1XIEA 2I14A 4OUIA 3OZYA 2E09A 2OLSA 3QFEA 4FS9A 4ZB5A 4DXKA 3VZZA 2QDDA 3UXKA 1HGYA 2QULA 3FLUA 3R89A 3SEPA 3E0WA 1TZZA 1B90A 1TJPA 1Y0EA 1FFRA 4KF1A 2WVTA 3SR7A 3VUPA 2X05A 3PAOA 1KGXA 2DZBA 3WQ8A 3M4HA 3KVJA 3S2MA 3WMCA 3BSHA 2W5FA 4LC8A 1KCLA 2R6OA 2RH9A 1AJ0A 5H6HA 4IJRA 4LNYA 4MJ2A 3G6MA 2ISFA 1XPYA 3UWUA 3T1GA 2ZBTA 4WK9A 3VX0A 1M7PA 4C6EA 2YFOA 3RFAA 4D8AA 1QHPA 4B3LA 3W9ZA 3VXGA 4KKXA 4NI8A 2NUXA 1QWGA 4ZSUA 1VIZA 2WSPA 4JKKA 3MZNA 1K1DA 3ORWA 1A0DA 1I0BA 1J8VA 5FJRA 1PKNA 4R53A 1WPCA 1TYGA 2OFJA 1CXIA 4YVVA 3TJXA 3HM7A 3P81A 3LGDA 2OLAA 4GCAA 1OWQA 1MEHA 1RY8A 1LG1A 2CXEA 5HNUA 4P61A 1J96A 4PEEA 2ZX8A 2A7PA 3UR8A 3ZXWA 2PDKA 5AOUA 5BMXA 3A21A 4DX3A 3LPFA 1LBLA 3MI3A 4D8LA 1VCGA 3NCOA 3A3XA 1LLZA 3N2CA 1WDQA 3S2CA 2HNEA 3T6CA 3ZQ9A 2GGHA 3AYTA 4AWTA 4H9ZA 1S1RA 1BRLB 2OT0A 1GVEA 3W0KA 3ARPA 5KMYA 1CZ1A 3QPEA 1H0GA 3O6YX 5C2XA 3CQKA 2V5KA 4GABA 4GA8A 4WLCA 3UT0A 5FAJA 3DGRA 5HNRA 1JPKA 1P0KA 4HHLA 2HTMA 2X0SA 5LGZA 2WLZA 1SFJA 4A3RA 3DN5A 1XWYA 1VQTA 1XH2A 3ARSA 2Y89A 4WQ6A 5F1VA 1W8SA 5HINA 1NWTA 2YDRA 3R8RA 3EB2A 5FJUA 4AZ6A 2VJXA 2NT1A 5G4HC 4H9YA 1H49A 1ITUA 1LDCA 1S2CA 3E0FA 4R88A 3RM8A 4AVFA 3A5FA 3MCMA 3GNDA 2G3NA 1VJSA 2EKGA 2GVYA 3T2QA 1F8IA 4EF8A 3KP1A 4GACA 2VEFA 1MW0A 3VNLA 4R7WA 3W2MA 3MA8A 3KRSA 1FXQA 2GJNA 3EBVA 1LT7A 3OVPA 3T08A 2PTXA 3VGFA 1BGGA 1B3VA 1IT8A 4Q8NA 3TLQA 3P80A 1B57A 3M46A 2ZE0A 4C6BA 1F9CA 1A0EA 1Z42A 3W2NA 4YTRA 2ZX6A 4ZXOA 3ZS4A 3WJXA 3ALFA 3VINA 3WQWA 5EPDA 3UJFA 1P43A 4LAMA 1LRTA 2FPTA 3ZR4A 1TR1A 4S23A 2CIPA 5EA9A 2YDQA 3W86A 1RP8A 1WOBA 4O10A 3IGUA 4JL2A 1QJWA 1EWDA 2FDSA 3VD9A 3DFTA 2D0HA 4U5KA 3EDEA 1TWWA 1O5QA 1UWTA 4BI6A 3F2BA 1KM5A 3O0KA 3GHTA 4Q33A 1HKWA 4DYKA 3C0SA 5D9MA 4FP1A 1RLDA 3UYCA 3IIVA 3SI9A 2R94A 4GLEA 1K02A 5F7UA 2NXHA 4UQAA 4NXSA 5AC4A 1HF6A 2VOMA 4K6AA 4WZHA 3T05A 2QZRA 4M24A 3RIKA 5MF5A 4Y2WA 3CU2A 1T6MA 4LGXA 1EEPA 3CHVA 3HGJA 4OBSA 3SN0A 4JGDA 3GHUA 4RZBA 2BTMA 1H1NA 1ITQA 4FNUA 1KM3A 3AIWA 5HXMA 1VKFA 1JDFA 4IIHA 4H41A 1DIDA 4WY0F 3SCRA 4XZMX 3E9AA 4OECA 4ZXLA 5AC8A 4OOZA 3GZAA 1EP1A 3HF3A 1H7OA 1UQZA 1XJBA 3PR2A 4PFMA 2OQHA 4C60A 2E25A 1U1JA 3VABA 3TFCA 2NLIA 1U5VA 2I17A 4RE2A 4I9AA 3UW6A 1TWZA 4S3EA 1JYNA 1R3SA 1BF6A 2UWFA 3LN3A 2WVSA 1GOQA 3R43A 1DHKA 1XIMA 3LNMA 1YIXA 1XISA 3ARQA 4O28A 4IT1A 4AZBA 4X2PA 1C3FA 5AB3A 2GVLA 3N34A 1OD0A 3ES7A 4MZ8A 4KGLA 4Y8FA 4ZCWA 3V0TA 4ZO6A 4PE8A 1QXLA 3GWQA 3MKKA 1J79A 4TIMA 1HTIA 1Q6RA 2ALRA 1VFLA 3RO8A 1L9WA 2YYTA 3LCIA 3NL2A 1Y5WA 2NVAA 4HPGA 4MPKA 4IP4A 4MWAC 3E38A 3N2XA 1BQCA 3W6YA 4OZOA 3L68A 5A2AA 1TE6A 4I9JA 4UTUA 1MDLA 3LHVA 3WLNA 3QKZA 4WVXA 1MW1A 3RX3A 2IXVA 3SSZA 1JNEA 1UZDA 3GR7A 4YTUA 4CCCA 1TUFA 5EBAA 1GYLA 3EWZA 5CCZA 1S5NA 4NP7A 3QGKC 4LAZA 5K4ZA 3BG5A 3PJUA 3QYSA 2VVSA 4E8GA 3PP7A 1XSKA 3VKKA 1G4PA 8XIMA 2PDFA 4QHRA 1J6PA 4DEFA 3UJSA 1W91A 1PHWA 1VBUA 3BE7A 3CIXA 4CU6A 4JPGA 1O5RA 4QXIA 5HMFA 2PS2A 4B5SA 2A3BA 1GGOA 3A6OA 3MSRA 1C7TA 4J2PA 4UWMA 1R3VA 1UWIA 4EPKA 4Z2LA 2RDTA 4UOJA 1J0IA 3QPZA 3DU0A 4XKYA 4DWDA 4EWND 3GXPA 1CXEA 4JD4A 5HK4A 1XLMA 5B7YA 3EEZA 4ILSA 3CZJA 3AWNA 5F4XA 3BMWA 1K9FA 1OX6A 5D09A 4PEKA 3GE7A 3PPGA 4C6OA 1F5ZA 4DO6A 4JEJA 4DWSA 2VEIA 3OGVA 5I02A 3QW3A 2J47A 1P0DA 4I5RA 5FL0A 5H8MA 3SRFA 4QS6A 2INZA 3PANA 2OB3A 4REQB 1HL9A 1VCVA 1MUWA 4LAUA 3RR4A 3VIIA 4HNVA 3T9PA 1V3MA 5BU6A 1U30A 1E72M 4YCOA 2BOFX 1FA2A 1S3TC 2RJHA 3CM4A 4DLMA 3PULA 1P48A 4K68A 3OVRA 4RL3A 1F2JA 1YBQB 4TVDA 3H54A 2FHCA 4JIPA 3LPGA 5BYWA 1REQA 4HU3A 1UZ4A 3APTA 2R24A 2E4TA 2GUYA 2ZRYA 2V3DA 3LCFA 2PA6A 1XYAA 4Q4OA 2KZHA 1EZ2A 3PZOA 1XIFA 2GDVA 2QMJA 2ZWZA 4IUGA 1EJUC 3KBSA 4HT3A 3W2LA 3ARTA 2WK2A 1FH9A 1XSIA 4PULA 4NAFB 4J3XA 4MIMA 5BXTA 4GNKB 3FNDA 1OZMA 1V6TA 3A4XA 1GTHA 3ABQA 3HJEA 3W88A 7XIMA 4PCSA 3K8MA 1A5AA 1UJQA 2EPMX 3W1RA 4DZ5A 4IXHA 4MZYA 2VZOA 1VBGA 3VTRA 4ML4A 3ANUA 5LYRA 2CU0A 2OT1A 3GHRA 2VCAA 3OQEA 3ABRA 2SFPA 3M41A 1D8WA 3KRUA 1HO1A 3IRSA 4US6A 1TRDA 1XG3A 4JQ1A 3B0VC 4ENLA 1M9HA 3HPZA 4Y9AA 2WCAA 2XH0A 2BHYA 1KBBA 4DLFA 2CLHA 2JALA 4F4RA 3UWZA 3MMTA 1CXKA 4GWEA 3RMJA 4DHGA 4O1BA 1ALDA 5CZKA 2WM1A 1AJ2A 4L9XA 2OYLA 1UWAA 3HG3A 5C5YA 1W1PA 4EANA 3GW3A 4JY9A 4IX2A 5T9BG 2QQ6A 4X9SA 4JTDA 1VPXA 1GKRA 4N6EA 3INPA 3OODA 3G3MA 2ZUVA 3GG8A 4LPCA 3LTPA 1ZBVA 3GNRA 4JTHA 4O1EA 1LYXA 3AIQA 4HSHA 1ITXA 3M43A 3PM6A 1UUMA 5T91A 4EF9A 4YTSA 1BWVA 4J3ZA 2C19A 1V7YA 6ENLA 4HTBA 2VI0A 2A3CA 3NSMA 5FJPA 3QMTA 1NQ6A 2BWGA 2X2YA 4OUEA 3W1PA 3VILA 4N0RA 3ITGA 3AXKA 2I16A 3MKCA 4AIEA 2OEKA 3AMLA 3BMVA 5DCEA 3TR2A 3MDWA 1WO2A 3DEQA 4GYFA 3L5LA 3TNBA 4R34A 1OF8A 2JEPA 1UZHA 4QDPA 1HQTA 1JEZA 2YB4A 1KXQA 4EP8C 1UOZA 1PL9A 2ODOA 4B16A 2AGTA 1RZMA 3M64A 1W2PA 1GOWA 1LBFA 1Y65A 4UR7A 4B4HA 2V2DA 1UB3A 1F4AA 3BURA 3M5VA 1DJXA 4PUDA 3F4DA 2ONEA 3UF9A 1R5YA 2Q01A 4HJWA 4MY8A 4NNAA 2VRJA 4EXQA 4FALA 3PG8A 4M7TA 1GONA 1IT0A 4H19A 3PG9A 1I2NA 1Q45A 3VAVA 5C0QA 4ACZA 2VUYA 3AHYA 4CCDA 1EXBA 4MJZA 4NX0A 4S3GA 1EX5A 3KOFA 4GUHA 3W1LA 2NV9A 4POCA 2GJXA