3C52A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
296
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 110
structure length 296
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c52A00
1XDMA 3UPBA 3NDOA 4IMCA 3GK0A 1AW2A 3TSMA 4LS2A 4LT9A 1A50A 5FF2A 3S6DA 4S2BA 3R8RA 1EP1A 2QDHA 3U6WA 3CTLA 4NNCA 2FPVA 4LS0A 5CZ0A 1QCWA 4UTKA 4N02A 4Q4KA 1TV7A 2V5LA 1IIHA 3BW4A 1B9BA 1LRTA 1GPWA 1FDJA 3HGJA 3E49A 3LCWA 1BKSA 1SFJA 4MOZA 3IEBA 4AF0A 2RH9A 2E6DA 3BG9A 1WBHA 3N34A 4DXVA 2VKZG 3GAYA 1KTNA 4ZQNA 4FXSA 4M7TA 1DVJA 1RQHA 1OX4B 3CU2A 3TJXA 4BFAA 3HG4A 1WDWA 5FEXA 4BI7A 2X30A 1OK6A 4GBUA 4LS1A 4EVZA 1OABA 4N9BA 1TCDA 1SZFA 3HPSA 4JIQA 2JKAA 4A3UA 1ME7A 1H1ZA 1O95A 1X1OA 1FX6A 2TPSA 4K7VA 2B4GA 4UCGA 3LRKA 4I7WA 3MI2A 3A5VA 2B0MA 1V5XA 3TQVA 2A7PA 2NUXA 4MKNA 5DCBA 3G18A 5F4SA 1QDSA 1VLWA 3GIYA 3TH6A 1HUVA 2VXNA 5C54A 3T40A 3PULA 3MWAA 1TPDA 3C0JA 4JY8A 5I3IA 1UUMA 2QR6A 3W2NA 3A9IA 5G2WA 1AK5A 1X7FA 2CLHA 1T96A 2DU2A 1JRBA 5CPLA 5AHFA 3M5XA 5AHEA 1MO0A 1SO4A 4RCXA 3AJXA 3ZWSA 1YLVA 3W7MA 4C1LA 2C19A 3GDRA 1GG1A 1FWNA 4LVAA 3EEGA 3LI0A 4QJ1A 5BNKA 1K7EA 2E5DA 4HSOA 2CLMA 4DO4A 3H54A 4UTJA 2X2GA 2ZDRA 3EWXA 4O15A 1XKYA 1GT8A 5LNVA 4FIQA 4P61A 3G3DA 4CNNA 1M5WA 4IJBA 4NNBA 3LRMA 1LROA 3U2OA 1HL2A 3S5NA 1T0OA 4O1BA 3B05A 5G5IA 3TXZA 4NXSA 3GDKA 1FWSA 1RQBA 3GXPA 2H8XA 4XBSA 2QEZA 2C6QA 1G7VA 3NQ7A 4AF0B 1RD5A 2BZNA 1QPRA 4TR9A 2JK2A 4FX8A 2H8ZA 1BEUA 5HQEA 5LNUA 2RDTA 2J9XA 2CZ5A 1WAUA 3BO9A 2VELA 4JEQA 3SGUA 3HMJG 4MZ1A 1H63A 1O5KA 5AOUA 2OX1A 4UFLA 3M16A 1H51A 3M5ZA 2J6XA 1Z41A 2GUUA 4YCOA 1KM0A 4QNWA 1Q45A 1TJRA 4O50A 2P10A 1EA0A 3M47A 3EWYA 3SW6A 3FIGA 3M9YA 1TPC1 4UR8A 3W72A 3TROA 3W7PA 3C2VA 5J5RA 4JS3A 2KZHA 1LOLA 4M19A 5C6MA 2FLIA 5EYWA 3B06A 2V82A 3MHGA 2ZRVA 3FLUA 2VFIA 1H61A 3KXQA 3A22A 1I2OA 2QAPA 5I3FA 4MZ8A 1XL9A 4JR5A 3M43A 4QAIA 3W7LA 3ZR4A 1JCJA 3DFNA 1S5TA 3ATYA 1GEQA 1MZHA 2V2HA 1XXXA 1W3TA 2YPIA 4K7YA 3B0VC 5KSWA 3EX6A 1W3IA 3Q2DA 3D0CA 4IXXA 4RK8A 2D73A 3G8EA 4K39A 2CU0A 1AL8A 2JGQA 3HJZA 3PB2A 1YTDA 1KFEA 1TB3A 3P74A 4UTHA 5IM51 3WK1A 4DO5A 2Z1BA 3TU9A 2WNNA 1FUYA 3KFTA 3UXAA 1C9DA 3SECA 2V5BA 5HULA 1PL9A 4DQWA 4TO8A 3BG3A 4LWWA 3YPIA 2VFHA 3ELFA 1VJIA 5BMXA 5KZMA 1GYNA 4OQVA 3GLCA 5D2TA 1KFBA 3S5OA 4QM1A 5I3JA 4AHQA 3W22A 4O28A 3DFTA 5LGXA 3GX9A 4OE7A 4X2RA 3FJ6A 3MP3A 3OEXA 3NQMA 1VCVA 5TIMA 4MPQA 1GVRA 1ZJIA 2FB3A 3P81A 1DJNA 2Y7DA 3DKLA 3QQ0A 4XQ6A 2E6FA 3LOTA 2DZPA 3P8IA 5D03A 1W31A 3PF3A 1VS1A 3GZ3A 3O6YX 5AC8A 4MY9A 3JS3A 2Q8ZA 4KFNA 3BLEA 1K7FA 1P0NA 5DN1A 4UTLA 3NQFA 3W9ZA 4MLJA 4LV9A 2ZZ2A 4M5PA 2ZZ1A 3G1HA 4BI5A 1NEYA 4RXGA 1YXYA 3W7HA 3C52A 4JN6A 4M6PA 2ZYFA 3GR8A 1SO5A 3QMRA 5CZTA 3QMTA 3ZWTA 3NM1A 3NYZA 3GAKA 2I1OA 3B4UA 2ISWA 1SSDA 2YCEA 2NWRA 1LBFA 4ZL1A 3M1ZA 2DZSA 2H6RA 3LBCA 6ALDA 3MBDA 3WJZA 3Q94A 3TAOA 3N19B 2OJPA 3FKKA 3WJSA 1LRNA 3DAQA 3KVKA 1WYIA 4GJ1A 4OV4A 1G4EA 3EB2A 1RZMA 5D2XA 1XBYA 1LDCA 1VHNA 4XUGA 3CHVA 3GNDA 1PIIA 5HUOA 1A5SA 1D9EA 2ZRYA 3W1MA 4NU7A 3LTSA 2F7FA 2EPHA 3N73A 1U83A 5FI8A 4WQ6A 5HWNA 4ADUA 5L6UA 3W7NA 1MEWA 2QCMA 3EX1A 1I2QA 4FNPA 3MBFA 1HG3A 2ZTJA 4EIVA 4MYXA 3PUEA 4O1DA 1OHLA 4LVFA 3KVLA 3IRDA 3I7QA 3HGOA 5F2MA 3OBKA 4UXDA 4AMAA 3EX3A 3S1UA 1TPH1 4WX2A 1C8VA 4HNTA 1KFJA 2VFDA 2CFFA 1VHCA 3QQ1A 4HT3A 3W88A 5LZLA 2Y7FA 3N3MA 3PS7A 4YL2A 3PG9A 4IMGA 4DELA 3FEMA 4I7UA 4O19A 4DF1A 2DZTA 2HMCA 3NPXA 3PUDA 4MJZA 2JBMA 3UWQA 3NPVA 3LHYA 1GWJA 3THQA 5KITA 1DOSA 2WSYA 3TV8A 3DFQA 2GVGA 3W2KA 1OYBA 3PG8A 3S1XA 3V75A 2NX3A 3S9YA 3DGRA 4XKYA 4EF8A 4R33A 2ZTKA 5G4EA 1JVNA 2QCDA 4PL1A 3OVPA 3SGZA 1LOQA 2PRLA 4N6FA 4N9EA 3MI3A 1BWLA 2QCHA 2VFEA 1RVGA 2AQWA 1SSGA 4L4LA 1N55A 4WY0B 3B0PA 3BLIA 3P62A 3LBMA 1F05A 4JTKA 4Z1BA 5E1QA 5AHIA 3PBWA 1EWEA 3HO8A 1X8FA 3KRSA 5DBUA 1NVMA 2TRSA 3W1NA 5HWMA 3LLDA 3TUUA 4LC6A 1GJPA 4L4MA 3TMLA 5C2XA 3IIZA 3RLUA 3O05A 4K36A 1I45A 4NZFA 1EWDA 1Q6LA 3UNDA 5AHMA 3TSDA 3W76A 2PURA 3DBPA 3H53A 4UTIA 3DZ1A 3S42A 1KTBA 4FIRA 4G1KA 1DORA 5HR6A 4XTIA 3W1UA 5FESA 7TIMA 4JXCA 3TW7A 1WV2A 2WV8A 2Y7GA 5KZDA 5KMYA 4JTUA 4WXYA 2V30A 2ZRWA 4IGHA 3THAA 5GVJA 3P60A 3EX2A 4N4QA 1OFBA 4IPIA 5I3KA 3G22A 1TJPA 3MYPA 1TTIA 2FPTA 3FYPA 4N6EA 4Z0SA 1EUNA 3C8FA 3GKFA 5FF7A 1V7YA 3LM7A 1DHPA 2VEMA 1QPQA 2X1RA 2JKPA 4OT7A 1VH7A 2YSWA 4UMAA 2QF7A 4ZQCA 5IBXC 2Z0IA 2FDSA 2QKFA 3TFCA 4S2CA 3R13A 1ICSA 3UY7A 3PAJA 2OZ0A 4ZQRA 3W2UA 3PSWA 3E0IA 4NJJA 1LOSA 1OFQA 2GQ9A 1H50A 1MSSA 2J27A 1OFEA 1QO5A 2PC4A 1P5BA 3KOFA 3LRLA 2PRHA 3M44A 3DU0A 8TIMA 2E1DA 3NR0A 4JICA 3MUXA 5BW6A 2VEKA 3NXFA 1O5XA 3BARA 1LM1A 2E77A 4AWSA 1L6SA 4QQ3A 3F4WA 4ONVA 1XI3A 2C13A 1DKWA 5KTLA 1N8FA 4CCCA 2B7OA 1SZEA 3KVMA 1FBAA 3W73A 4AHPA 4WD0A 1ME9A 3E12A 3W2LA 3IVTA 3JRKA 1L2UA 1TTQA 3KRUA 1NFBA 1PCKA 2E6AA 1I2NA 1YADA 1WQ5A 3OVQA 1H7PA 2DJXA 3W87A 5HMSA 1RR2A 1AL7A 3W74A 3T4CA 4O17A 1TQJA 2VFFA 3VE7A 4MIMA 4PH6A 4HPXA 4TX9A 3TXVA 1LRQA 3NQ2A 1GYLA 3NG3A 3W7JA 1F7BA 3PC0A 2Y61A 3RK8A 4HIBA 4O0ZA 1H5YA 2QCFA 2VEPA 4O1AA 3TQ0A 4OBTA 2V81A 5K3VA 1XBXA 2BXVA 3G1AA 3TIMA 1KV5A 3MYOA 3RNDA 2HS8A 3TC7A 3STFA 3P5YA 4AEOA 2QJIA 2NUYA 1QPNA 2QCGA 1Q6OA 2JGYA 2RDWA 1DV7A 3UXDA 4ZQOA 1A5BA 5FEWA 3G1DA 3C2EA 5E93A 3BVJA 3Q58A 1FCQA 3GNNA 1BTMA 4MUZA 4RKAA 1DJQA 1W5OA 4AVFA 1SPQA 1EP3A 2Z6IA 5DXYA 2NUWA 3U8GA 5K9DA 1N7KA 1AW1A 5F1UA 2RKXA 1S3HA 2X1SA 4IWWA 2CLOA 4RV8A 1GVSA 3B8DA 3W7EA 1UUOA 3UWZA 3VE9A 1W37A 1F6KA 2A7NA 4IX0A 5D37A 1K03A 5CPOA 4Y96A 2QCEA 2V0TA 3DFOA 4K8HA 5CSSA 1TRDA 3WK0A 2XN0A 1ME8A 1EPXA 1NAL1 1TO3A 2AGKA 3EWUA 5G1YA 4IPJA 5BMWA 4GWEA 3HF3A 1W1ZA 1YXDA 1WA3A 2YW4A 1PHWA 4JGDA 4AWTA 1UASA 3LXBA 2H90A 4O14A 3LHZA 5FF0A 1LZOA 1DQWA 3P67A 3QSRA 3S0CA 1G7UA 4Z1AA 1Q6RA 3B0UX 1I4NA 2DP3A 3PVFA 1F6PA 3PSVA 2ZZ6A 3QSTA 4EWND 6TIMA 3N9RA 3N9SA 2Z2UA 3SI9A 4GC4A 4MFDA 1HO4A 4DPQA 2G5WA 1QWGA 1KA9F 1S5WA 1WBJA 1XC4A 4UTUA 5SWUA 1X6UA 3TA6A 4O10A 3ABOA 4ORMA 3P5ZA 2ZBTA 4UNKA 4NT0A 3TKFA 3W70A 5F2GA 3W7QA 3NZ1A 3T44A 3NQCA 4M6VA 1OYCA 1O60A 3VKJA 3TJLA 1YPIA 5TBOA 4O57A 3QJAA 3GDTA 1EUAA 4A29A 3LERA 4CLMA 1Q6QA 2BTMA 3L5AA 1OFDA 3L0GA 3LHUA 1EP2A 2CWNA 4UNLA 4M7SA 5G1TA 5AFDA 1JCXA 4YWIA 2NX1A 3HB9A 3EX4A 3S5YA 3GVGA 2ISSA 3LCIA 2NLIA 4ADTA 3S1WA 5LGZA 1JCYA 1ZHAA 5HR7A 1YYAA 3QFEA 2CZEA 4H4IA 3WJWA 3FKRA 2O7QA 2Y85A 2V2DA 4NVTA 2J9ZA 1FXQA 1VLIA 4MFEA 4LW7A 1KLYA 4H6KA 3GR7A 3FFSA 1WOBA 2BSLA 4NJKA 1CW2A 4HHPA 4I7VA 3AO0A 1F2JA 5LKYA 3L9CA 2Q8LA 4JNMA 4MY1A 1R2SA 2YW3A 3T7VA 5K2ZA 1IXQA 3MP4A 4OHQA 4IX2A 1Z42A 4HSNA 4ICNA 3C61A 1OVDA 3EKZA 1ZAIA 2JKEA 1TQXA 4Y6GA 1OFRA 2C14A 5AYYA 1CX9A 4LRSA 3IIVA 1OK4A 3NQDA 5CZSA 2DJLA 3LV5A 1KM4A 3KHJA 2FPYA 4JX5A 3CB8A 1TYGA 3A24A 4QISA 3A5FA 1DBTA 1L9WA 4RR4A 4WUIA 2V9DA 2X1UA 4C1KA 4ALDA 2Y70A 3R2GA 5LSMA 1JRCA 1KLZA 2DZUA 4IOTA 3G1FA 5CZJA 3UYCA 3M7WA 2VOMA 4JTHA 5DCEA 3W1QA 3PBVA 1EEPA 2PCQA 1Z48A 3E9AA 3QW4B 1XM3A 1OFOA 2R91A 5FEZA 2WJZA 3OA3A 5D04C 3NZRA 3TX9A 1I8JA 4UTTA 3CT7A 3G0SA 4RJEA 3NL2A 3NNTA 4ZZ9A 2GQ8A 3R12A 3LV6A 5KZEA 4UTTC 4RZ4A 3IVSA 1LORA 4UMCA 3IGSA 1LBMA 4GUIA 4NJIA 4JIPA 1F73A 2DZWA 1QMLA 4BR1A 4GUJA 1KM3A 3BK0A 4WY0A 3BG5A 4TIMA 1W56A 2QCNA 3C2FA 4CQAA 3FOKA 3DFSA 4LRTA 1F74A 4OV9A 5E0KA 3RLVA 1VZWA 4JTTA 2EKCA 4LC8A 2EAWA 5FF4A 1G4SA 1UBSA 2B7PA 1XBVA 3ATZA 1M6JA 3W7DA 1TIMA 3TE9A 4D2JA 4UIOA 4YXGA 1OYAA 1H7OA 4ADSA 5AC7A 1NSJA 3T78A 5K9XA 2FIQA 4W9TA 3O6DA 1JUKA 3TMQA 1D3GA 1FWRA 3M5YA 1KM1A 3EXSA 4UR7A 2H3BA 3TCEA 2B7QA 3LB0A 4O0KA 5EKYA 3TR2A 1K3UA 4DPPA 3LTYA 1TTJA 5K4ZA 4GRSA 2NXGA 3KRZA 4HNUA 1LLWA 4UTWC 3W2MA 3TDFA 3LCFA 1U5JA 3RU6A 2FQIA 4LVBA 3TK7A 2V8ZA 2F84A 1KW1A 2BWGA 3NA8A 3O07A 3I6RA 4E38A 4FHAA 3W83A 2OT1A 2C15A 3HOJA 4JYFA 4RZ5A 4JTSA 1YDOA 2GVLA 1Q3NA 4FNUA 1ALDA 4FNTA 4TMBA 3WJYA 2NV2A 1HFBA 4WZHA 5AYXA 4J9JA 4EF9A 3QEZA 3NM3A 3GXNA 2GPTA 1G67A 1PS9A 3DI1A 1B4EA 2DZXA 4X9SA 2FB2A 5DBTA 3BLFA 2ZRXA 3L2IA 4FO4A 2H3DA 3G24A 2VFGA 4DBDA 5D33A 3IIPA 3NPWA 1P4CA 1W5MA 1KTCA 4LNYA 3L65A 4NJHA 2WSQA 2XN1A 3SFKA 3WFAA 1YPFA 3F03K 3F4NA 1C29A 5CPMA 4HPJA 1Z44A 2QDGA 1RPXA 1YDVA 4TU1A 4E2BA 3IVUA 5EMUA 1G69A 2P0OA 3W1XA 1XDLA 2QCCA 5G2HA 4LVDA 2ALDA 3O8AA 5D30A 2CLKA 1FWTA 2ZRUA 3CC1A 4O1CA 2WOQA 5CGQA 1VC4A 1ZNNA 3PM6A 2J9YA 2E5CA 2Y62A 3NL3A 4Q33A 1XCFA 4KWWA 3STEA 5C5YA 2ZZ7A 3CM4A 1P1XA 1K8ZA 3L0KA 4JYDA 1SZNA 3CLMA 2W79A 1WXJA 1M7OA 1CI1A 3NPUA 4NZJA 3DKJA 3L68A 4N9DA 3MJYA 3KX6A 4Z1CA 4K6AA 3N2XA 2WPBA 1QFEA 1RQEA 3EWZA 4AXKA 1H7NA 1TPWA 1XBZA 2E68A 4DBEA 3IIOA 4LVGA 1T8XA 5IBXA 5AB3A 4BK9A 1OFAA 4A2SA 2NZLA 2DORA 1PE1A 3I7RA 3ABSA 3Q37A 4GUFA 3TSBA 5F2LA 2B7NA 3LI1A 4PC8A 3LXCA 3O06A 1FCBA 3P61A 1ZAJA 3C3NA 3W1RA 3BPWA 1WX0A 1DQXA 3FYOA 5CPNA 3W85A 3LLFA 3SSJA 2A6NA 4FX7A 1GQNA 1SZGA 4OU1A 2R8WA 1OJXA 4PL2A 4RX0A 2EHHA 3S1VA 2ABBA 3ZFHA 1TMHA 4JTLA 1ZAHA 4CCEA 3UD6A 2W6RA 1G4TA 4BWLA 3MI6A 1SW3A 2Y7EA 2X16A 3EXTA 4PA8A 5HWJA 4BWLC 1OG0A 1SW0A 4JTEA 4HNVA 5H91A 2NWSA 4R7JA 1K8XA 2C16A 1TPFA 4IMEA 3HGRA 3NEVA 4UFKA 2IQTA 1EX5A 3QH2A 3W07A 2RHGA 3PR2A 4E2DA 3ABQA 3WK3A 2YX0A 3LDVA 3SY5A 4DO6A 4DF2A 1UB3A 4FNQA 1MEIA 3C4UA 4XBKA 1S5VA 4PCFA 1IIGA 1PCWA 4GFSA 1IXOA 4KWVA 1MXSA 1KBJA 3LTPA 3E02A 2E6YA 5G2IA 2TYSA 4LV4A 4B5NA 4YMZA 3TW6A 3CPRA 4CNPA 1BWKA 3FA5A 3GB6A 1H1YA 5DY2A 2GJNA 2E09A 1R46A 4U4MA 1JQVA 5F1VA 5I3HA 4NUWA 3G1YA 1IXPA 4GNJA 4O4WA 3LCXA 3W1LA 4MJMA 1W8SA 3HBLA 2Q3RA 4ZQMA 1ML1A 3DFPA 1R47A 3MP5A 3PWAA 4NXKA 4UFHA 1GOXA 1FDYA 1TPVA 1KM6A 1SO3A 3LCHA 4S1FA 1ZCOA 3P82A 2YFOA 4A2RA 4BF9A 5D38A 2A85A 1FWWA 3H55A 4FX6M 1YXCA 1W5PA 4GE8A 3TQKA 5D2YA 1ZENA 1ZY9A 4X3ZA 1KM2A 4R53A 4Y90A 4XWUA 5T26A 2X1TA 4JYEA 5D09A 1KFCA 2ZZ5A 5TQLA 2Y63A 5LNSA 3S8HA 1W0MA 1OF8A 3A21A 2Q3OA 4K8EA 5A8GA 4YCPA 3EKLA 4DEFA 3NVTA 5CSRA 1QPOA 4JDYA 2OMAA 3G1SA 1W5QA 2NXIA 2PE4A 2Y6ZA 3MO7A 3PBUA 1R2RA 5K7JA 4MZYA 2AAMA 3S5ZA 1F5ZA 3P7YA 3NL5A 2GOUA 1I2RA 4Z1DA 2OT0A 1ADOA 3UQNA 4Y8FA 5DY3A 3NQEA 2RDUA 5CG7A 3MMTA 4LY8A 2CW6A 1F76A 3B04A 4I9AA 1KBIA 2HS6A 5K4XA 3QC3A 1KV8A 3LHTA 1THFD 1T99A 2YYTA 4HNNA 2WO5A 1TRIA 3TNOA 4K37A 4KKXA 1K02A 4POCA 2BLEA 3OVRA 2ZQ0A 4PEKA 3L5LA 4UTMA 1XUZA 2CLFA 3LXAA 3W7GA 2CZDA 4IMDA 1JULA 3C6CA 3FS2A 2I14A 1AW5A 4MYAA 1SU5A 1PVNA 5DCDA 3CQ0A 2V2CA 2ZZ4A 2YXGA 1H7XA 3QRHA 1A5CA 2VENA 1VPXA 3JR2A 3W1TA 3IGUA 3CWOX 3NO5A 5KINA 1R30A 5H2ZA 1XUUA 3QPZA 1WOAA 3W1PA 2FTPA 2RFGA 2C0AA 1E51A 1D3HA 5G4WA 2I9EA 2J24A 3GDMA 3OG3A 3BW2A 1SR9A 3E96A 2ABAA 3M5VA 2A4AA 1A5AA 4IXHA 3DHFA 2QJGA 2HTMA 1W54A 1VGAA 3VFLA 3IGXA 3NQ8A 4O13A 5D05A 1SW7A 4UFMA 1G4PA 4OWGA 3HG2A 2OCZA 1J4EA 1O4UA 3O15A 4GUHA 4O16A 3G8RA 4BI6A 3DI0A 3HPXA 1L6YA 3F1QA 3HPZA 4ORIA 2FFCA 1VYPX 3L67A 3MHFA 1XFBA 3LHWA 4CQ8A 2O7SA 4O53A 4RXFA 4ZQPA 3QF0A 2G96A 1VR6A 4O11A 4JDBA 3N2MA 5D32A 1Y0EA 3RMJA 2DZVA 4FF7A 2WSRA 3PY2A 3DH7A 2R94A 2PRMA 4UMBA 4Y9AA 2R14A 3NGJA 2ZA1A 2NX9A 3GKAA 3CIXA 2HSAA 4JTIA 5D2VA 1KFLA 2Z6JA 3LX9A 3UZJA 3KVJA 3I68A 1W5NA 2QCLA 1QO2A 2A7RA 1H7WA 1GTHA 2C18A 1SUXA 3INPA 2QUUA 3QM3A 2GVJA 3I65A 5EPDA 4CCDA 5AC6A 4CQ9A 4AWUA 3PUOA 5DLCA 1JCNA 1PHQA 4KFPA 5C55A 3BW3A 4NX0A 5DXXA 2YYUA 2QUTA 3OIXA 4QITA 3M6YA 3RFAA 3NOEA 3G0XA 1G6CA 4WOQA 3HGSA 2QJHA 4HKPA 3W84A 3G0UA 1H7RA 4UFJA 3O63A 2WKJA 3QZEA 4M6QA 3NQVA 1H62A 4DF0A 3HG5A 1FCVA 3HQ1A 3P80A 3UWYA 1KM5A 4LU0A 1AG1O 3C2OA 4UFIA 4PFMA 1IGSA 3NQ6A 1YTKA 5LNWA 4N2YA 4FEZA 4JD4A 1J5TA 1SO6A 2XFWA 4O18A 3MW7A 2CLIA 2ATMA 5AN7A 4P2VA 1TPEA 2A6LA 3BV4A 3CWNA 5F2IA 3USBA 2LLEA 5J5DA 3GDLA 2E5BA 3SJ3A 2NV1A 3W7CA 4LUIA 5AHNA 3ANYA 1ICPA 3K30A 1ZALA 2NXHA 1TPB1 2FJKA 3IIXA 4LUJA 2A5HA 3TC6A 5F4WA 5LHEA 3M41A 1VCFA 4AHOA 1OX5A 3QMSA 3W2JA 4AB4A 3EXRA 2UV8G 2XN2A 1TV5A 2TSYA 1ZFJA 2WQPA 3LGEA 2ISVA 3TAKA 4UTWA 2A1YA 3W1AA 2GJLA 5D2WA 1R2TA 1QOQA 3G1VA 1O94A 5BRBA 2G95A 2VEIA 4N4PA 1L6WA 1FDZA 1JJKA 4NNAA 3M0ZA 4Z0JA 4UUIA 2G97A 3UPWA 3W23A 3GYEA 1JUEA 3UWVA 5EBUA 3I7SA 4O8RA 2BX7A 3R89A 4U28A 4AH7A 2VC6A 3W7KA 3IV3A 4PTNA 2QAFA 5DELA 4JTFA 1LYXA 4PODA 3GXTA 3W3OA 2Y89A 2A2IA 1ICQA 3UWWA 3LCGA 1TV8A 3RF9A 1HO1A 3DHDA 4MVAA 4JY9A 4KFOA 5FEPA 5K9CA 2W0UA 3B03A 4JX6A 4EOUA 3C2RA 1SQ7A 4IQLA 4QSHA 3STCA 1VRDA 2Y88A 3UY8A 3LCLA 1NF0A 4JTGA 4NQ1A 1P0KA 3HG3A 5EA9A 1VQTA 4WOZA 4JX4A 2CLLA 3UWUA 1YDNA 1FCUA 4XZ9A 1DL3A 4YLWA 3WJXA 4A21A 3NQGA 5CKSA 1IF2A 1IXNA 2CLEA 4ZVJA 4WXZA 1X1ZA 2J88A 1GVQA 3W6YA 1A53A 4A22A 1M7PA 3QW3A 3WK2A 5BOOA 3W71A 2YFNA 3G3MA 4AAJA 5HNRA 1TREA 2EGZA 2P1FA 3G1XA 5HJLA 4RLIA 5D02A 5L9FA 2CZFA 3DXIA 1B4KA 1FQ0A 3P8JA 1EIXA 3ABRA 1RV8A 3ZS4A 1GTEA 3L0NA 4IMFA 2ATSA 3CEPA 4WY0F 2C1HA 1GVFA 4O54A 2ZA2A 1W3NA 3EWBX 5I3GA 1AMKA 5AHLA 3QPYA 1K8YA 3O1NA 3BGJA 4IUOA 1LP6A 1H60A 1GZGA 1LCOA 2YZRA 1SFLA 1VYSX 4WJEA 1JUBA 2WNZA 3PB0A 4ZMGA 1PV8A 1VCGA 3NQAA 4UC5A 1I2PA 4X22A 1JR1A 4QIUA 1JCMP 2ZA3A 4LTSA 1LLZA 4O4VA 4E0CA 5AYZA 1UCWA 3L21A 3W7OA 3STGA 3DENA 4MY8A 3SIZA 5U4NA 1EB3A 2A21A 4FNSA 3CEUA 3NAVA 3VI2A 1TTPA 2ZZ3A 1TSIA 4CNOA 3T55A 1VYRA 5LHFA 3L5MA 4QNEA 3R5EA 1UJPA 5MHBA 1QAPA 2A0NA 1YTEA 3C56A 5EL1A 4RZ6A 5U7SA 1OX4A 3V1PA 1ONRA 4GUGA 3MHUA 3VNDA 1KFKA 3PBYA 4MLRA 1B3OA 4LOCA 4Z08A 3BGGA 4OGZA 2C3ZA 3A23A 1NF7A 1FXPA 1GG0A 4HN4A 2QUVA 3NL6A 5EY5A 4O52A 3P84A 1JQXA 1K7XA 5A5WA 2ZFAA 2ZRZA 1MEHA 2WNQA 1TPUA 1OF6A 3L66A 5LNRA 4N9CA 3N14A 4H3DA 4FXRA 2ZCGA 4JTJA 5ABTA 1OX6A 3CIWA 5HINA 2YR1A 3HIJA 3O16A 2YGYA 3LHVA 4R34A 3W86A 3VCRA 2GQAA 3W7IA 4XTDA 1QOPA 3W7RA 4ML9A 1J2WA 1LTDA 3O6CA 4Q32A 5HUPA 3KAOA 5FF3A 3SR7A 1HTIA 1JCLA 3OHIA 3QYQA 4FNRA 4GXMA 5F4XA 4NX5A 1QNVA 1GVOA 3EWWA 3SZ8A 2YDAA 4O12A 3UZ5A 4XKYB 3FJLA 4TMCA 4K38A 1FY6A 2QCDB 3TFXA 3W75A 2TMDA 4NJGA 1B57A 1OFPA 1QR7A 1LBLA 2EF9A 4FB7A
chains in the Genus database with same CATH superfamily
5LXXA 3THUA 3J7HA 1AW2A 1HX0A 1TZ7A 2O9OA 3R8RA 4GXWA 1WNOA 4HCLA 3U6WA 3WQ6A 1TFVA 3MCMA 1P7TA 4UWMA 4WRHA 2FPVA 4ASTA 4Q4KA 3HFTA 2V5LA 1B9BA 1LRTA 1IQ8A 3HGJA 1AQ0A 1TE1A 4IIEA 3IEBA 5M17A 4AF0A 3BG9A 2VC9A 3CLWA 4DXVA 2VKZG 4C65A 2VUYA 4F2TA 4ZQNA 4A35A 1HGWA 4M7TA 1NOUA 1PTGA 4GGBA 1TKKA 2YOCA 3VD5A 2NQZA 3CU2A 1WDWA 5FEXA 4V1XA 2PTYA 4GBUA 4LS1A 4EVZA 1OABA 2ESCA 1GUVA 3JZEA 3KP0A 2JKAA 1V3MA 1ME7A 5DO8A 3B0XA 4PBFA 4U3CA 1FX6A 2TPSA 4IG2B 2B4GA 4DY1A 4ILSA 3NSXA 3TQVA 2ZUMA 2NUXA 5DCBA 3BOXA 3WQCA 1QDSA 5C54A 1FWAC 3BCFA 1MQQA 4PUWA 4JY8A 3WQFA 4DJDC 2E9BA 4S39A 1ELSA 2Y0FA 3NO1A 3A9IA 3ARUA 1MFVA 2YL5A 5BWAA 5A8NA 3M5XA 5AHEA 3TLLA 3AJXA 3WQGA 4J3XA 4GCAA 4DIAA 2JF7A 4IFKB 4QJ1A 2XH4A 3GSMA 4YNGA 3MKCA 3B9EA 4S3BA 3TW9A 2WHKA 2RJGA 2QIIA 2IPGA 4M6UA 3UJFA 1LROA 3S5NA 1T0OA 3VZXA 3TXZA 3DN5A 2FZ9A 1RQBA 3QFWA 1NIUA 2C6QA 1G7VA 1RD5A 3ZMRA 4KF1A 2JK2A 2WMIA 5I09A 2BG5A 5LNUA 2J9XA 4AZ6A 1NARA 1WAUA 1ZP3A 4UFLA 2CXGA 3M16A 3EMZA 1NH6A 1Z41A 2GUUA 4Y7EA 4HTYA 3OBEA 4QNWA 1TJRA 3WLQA 4BQ2A 2VL4A 4E8CA 3RR4A 3SW6A 4UR8A 1TPC1 3S46A 1CTNA 4JQ3A 4JQAA 1QNPA 2C8NA 3W7PA 4BEUA 1MXGA 2KZHA 3SO7A 2YCLA 2CITA 1HQTA 4ZO9A 4M19A 4NASA 3MHGA 1ZP4A 2ZRVA 4CN6A 3ITXA 4PB5A 1I2OA 2QAPA 5LIXX 2YBVA 1XL9A 3VPLA 3VCCA 2EPNA 5REQA 1XLIA 1XXXA 2YPIA 4K7YA 1ZS2A 2NSXA 5KSWA 3EX6A 1W3IA 3Q2DA 3KZSA 2D73A 1YTDA 1J93A 1AJ2A 1GYMA 5IM51 2W9MA 4DXXA 1EGMA 1TG7A 2HE8A 3KFTA 1BD0A 4HB7A 3SECA 1V3IA 4LWWA 3O6AA 3YPIA 1RP9A 5BMXA 1GYNA 3FA4A 3S5OA 4O28A 3WNKA 4KWSA 1GVRA 1UKTA 2OKOA 1ZJIA 4XQ6A 1DJNA 4QTGA 1U1UA 1YE4A 4IICA 1D8CA 3WD1A 2PDJA 1VS1A 3GZ3A 3LUTA 2DIJA 3CZLA 5AC8A 4MSSA 4MY9A 3JS3A 2NQHA 4KMQA 4KESA 5DN1A 3KWXA 3PJWA 3NQFA 2GQ3A 3E2RA 4LV9A 1UD8A 2ZZ1A 3WDPP 5FCZA 2E40A 3O0FA 3GR8A 4AX7A 3N2TA 2F8QA 1CYGA 3GAKA 4IZGA 2I1OA 4IM4A 4WDWA 1AD1A 2H6RA 3LBCA 2VZSA 3Q94A 4GINA 3TTEA 4FR6A 3TA9A 3TAOA 1C92A 5M5DA 3N19B 3GFXA 1QTWA 3WJSA 3DAQA 2GSJA 3LG3A 3KVKA 4RPPA 4EK7A 3O2LA 1G4EA 3VKBA 2CKRA 4F0RA 1WP6A 2E3ZA 2O9PA 3R0KA 1VAHA 4ICCX 5JVLA 2PS2A 4G9PA 2ZRYA 2ZVRA 4S3EA 3W1MA 4CKQA 5FI8A 4ADUA 2IXUA 3WQ4A 4FNPA 4ZE5A 1HG3A 4HOXA 4LVFA 3ZR5A 2Q09A 4AU0A 3HGOA 3FGCA 3IJ7A 2J75A 3L23A 3T42A 2PP0A 3EX3A 1C8VA 4HNTA 1XRTA 3QQ1A 4NAFA 3OYZA 2Y7FA 3CQIA 2EJ1A 4YU1A 4C6BA 3GVRA 4MJZA 2JBMA 4HPGA 4MWAE 3LHYA 4KEMA 1PTDA 4LAMA 3TV8A 2GVGA 1VEOA 1OYBA 3E2VA 3WLLA 4R33A 4S38A 3MQTA 1JVNA 2QCDA 1I1WA 3SGZA 2VURA 2PRLA 4N9EA 8XIAA 3MI3A 4PMXA 5A6LA 1RVGA 1HKIA 3DIPA 5DRIA 3P62A 4XSLA 3LBMA 1QI2A 3UG4A 4O0QA 3KRSA 4E4UA 1JPHA 3RCMA 4F0LA 3OLIA 1CIUA 1BHGA 1GJPA 4M29A 4MF4A 1Q6DA 3TMLA 5C2XA 3RLUA 4WIWA 3OZYA 3VDHA 2Q71A 2DT2A 4K36A 1P1MA 4IIHA 1I45A 3BXWA 3W0KA 2PURA 3WLKX 3S42A 4KW2A 1XPYA 4FIRA 1AVAA 5HR6A 3W1UA 3ISIX 3OZOA 5LIYX 3KOXA 1QATA 3CBWA 3A6OA 1HGYA 1UWIA 4JBRA 1NDZA 4WXYA 2ZRWA 4IGHA 4QHRA 3CHCA 5GVJA 3P60A 1HJXA 4BY3A 1PBGA 1GVYA 4EPEC 2NVCA 1IEIA 3TQPA 3U7BA 4G7FA 1JZ7A 1TTIA 2FPTA 3H2CA 1S5MA 2Z28A 6A3HA 2GJRA 1QK0A 4HPHA 4Z0SA 3C8FA 4O1FA 2EJAA 2VEMA 1QPQA 4WDUA 2JKPA 4OT7A 4UMAA 5EMKA 5IBXC 2Z0IA 2QKFA 4C6OA 4MGGA 1ICSA 3PAJA 5E6YA 1T40A 3VDBA 1W1A1 1OFQA 1H50A 3VABA 1MSSA 2H9AA 4LANA 1KQZA 1XSIA 3NR0A 5HJXA 1VFUA 3WD4A 2VEKA 3NXFA 3GXIA 1O5XA 3ICJA 3PZOA 4ONVA 1XI3A 2W63A 4CCCA 4XO6A 3ARXA 3M07A 5HQMA 3V1HA 3MSYA 1TTQA 3DECA 1WQ5A 1H7PA 2DJXA 3RU8X 3W87A 3DYMA 3W74A 3T4CA 4D8LA 3WQPA 4S3FA 3VE7A 4MIMA 4GX9A 4HPXA 4PE8A 4TX9A 1CXEA 3SAZA 3NG3A 5EMJA 2XH2A 2Y2WA 3HJEA 4W8AA 4O0ZA 3KS5A 3R58A 3TQ0A 3TVAA 4P7OA 5BXPA 3RG6A 2D2HA 1US3A 1XIEA 2PWFA 3MZNA 4NKCA 1XRFA 4M0XA 2BXVA 5FJPA 3QZAA 1RY8A 1P6WA 1JYVA 2VR5A 3RNDA 2HS8A 3FK4A 3STFA 1W9DM 1HVXA 2NT0A 3CGTA 4H9TA 4IQEA 2RDWA 1UWAA 2VX4A 3GG8A 5E93A 5FEWA 3G77A 1FCQA 3NEHA 1DJQA 1W5OA 3KZPA 2Q02A 2Z6IA 3PFMA 4NZ3A 5DXYA 1VBUA 4C6CA 3U8GA 3VDGA 5F1UA 2W92A 2PDPA 1S3HA 3QTPA 3S9ZA 4F40A 1XD1A 4FLSA 1RVKA 4DBUA 4NZ4A 5MF5A 4GH1A 1GVSA 5ENLA 2WM0A 4TUFA 3VE9A 1F6KA 4IX0A 3WDHA 3BWWA 2WQDA 6REQA 3DFOA 5CSSA 4F0MA 2BS9A 4EWJA 1TO3A 3EWUA 1S38A 4C1NA 4HVXA 4AWTA 1E9IA 4L56A 5JU6A 4QE1A 2QUNA 3N25A 1LZOA 3EYPA 3O9NA 1PIFA 3P67A 1JFXA 5JH2A 1B90A 1I4NA 3A4WA 1QBBA 4Q8VA 1X6NA 4Q6XA 1QHZA 3QSTA 2ASHA 3UBPC 3N9RA 6TIMA 3SI9A 3DC8A 1LUCB 3NSNA 1EIBA 4AYSA 1HO4A 3BMWA 1WKYA 3AXKA 1Z8AA 3GRIA 2G5WA 3WD3A 2HK0A 5CBIA 2D2JA 1B3VA 2VRJA 3BLDA 1QW8A 2V63A 3UGVA 4B2DA 4ORMA 5HQLA 1UKSA 3GTIA 3P5ZA 1OADA 3WD0A 2ZBTA 4GZ7A 1EOMA 3M0MA 4NT0A 1DP0A 4PUDA 1OYCA 1O60A 3SUVA 3TJLA 1YPIA 1D7KA 3N4EA 3OGSA 4O57A 3QJAA 2BDQA 3HA1A 4DJFD 1MNZA 3CUXA 3L5AA 2OB3A 2WMHA 3WKZA 4RW3A 4GIEA 3SRFA 4FI4A 3G6MA 4M7SA 3VGFA 1JCXA 4YWIA 1K70A 2NX1A 4JFSA 2PU0A 5FJJA 4K8GA 3N6QA 5BZAA 4C6EA 3A47A 4FP1A 3S1WA 3QFEA 2CZEA 5A6KA 3VXGA 1YIXA 5D8ZA 4LW7A 1KLYA 4H6KA 3BJSA 3FFSA 1WOBA 1GZ1A 2BSLA 1CW2A 1B30A 3AO0A 1KB3A 2Q8LA 4JNMA 3GD6A 3EAUA 2G8ZA 4XVDA 4ERIA 1EJRC 3T7VA 3GIPA 3KEHA 4OHQA 4MAVA 4Z42C 3NVDA 1OVDA 8A3HA 1U5HA 1OFRA 1U5VA 2C14A 3ABZA 4LRSA 5CZSA 2DJLA 3OP2A 1U30A 4JX5A 1TYGA 3K8LA 3ZVHA 3AI0A 2ZUNA 3QHNA 3BH4A 2Y70A 2PDMA 3B8WA 1JRCA 1KLZA 5LSMA 2J4GA 4IOTA 1C8QA 5CZJA 3M7WA 3GBEA 3LZ5A 3ITGA 3VUSA 2I16A 1BQCA 5FEZA 2WJZA 4NI3A 1I8JA 5XIMA 1GOQA 3CT7A 3PBMA 3SBFA 4GO9A 1BYCA 3NNTA 1XLBA 5KZEA 2QW5A 4UTTC 1LORA 1QNOA 3IGSA 1KGWA 1KRCC 5CEWA 1GKRA 3OIHA 1DE5A 1Z7AA 4PULA 2DT0A 3MVIA 2WVVB 1CXFA 3LQGA 1A47A 1RJQA 3PAOA 4QEHA 5LA0A 4TIMA 1R7AA 1YKWA 3M64A 3ZSSA 3OB8A 1EBHA 1QI4A 6TAAA 1J10A 2I56A 3IJIA 5KEZA 4UIOA 4Q8NA 5AC7A 4GO8A 1E6PA 1EGZA 3T78A 3M7SA 4MWAB 2ZC1A 4L6DA 3F2DA 1MW1A 4EXBA 3EXSA 2WAGA 4J3VA 3NCOA 3VMNA 1A4MA 1FHUA 2TODA 3LB0A 3DESA 1VPQA 3SJNA 2J79A 3RCYA 1K3UA 4EE9A 4DPPA 3VAVA 4Q8OA 4DVOA 3SN4A 4YVVA 4N7QA 2NXGA 2J74A 2AMXA 3MTWA 5XIAA 3TDFA 3VIGA 3LCFA 2IQ0A 3L12A 2RUSA 3UR2A 1SMDA 2BWGA 3BAJA 3I6RA 1YMYA 2F6XA 2NQ9A 5CPTA 2QIWA 4JYFA 5A2CA 3LENA 2QGHA 2WJEA 2Z2AA 4LAZA 2AOSA 2GVLA 2XZ7A 4FNTA 3RPDA 2DY3A 5FKYA 2NV2A 3GIQA 4J9JA 4GVIA 1DE6A 1O66A 3RIKA 1PS9A 4QDWA 4AD1A 1DJXA 1J0HA 4AY8A 3BLFA 3ZLFA 4FO4A 3EA1A 4ECLA 1U1JA 5D33A 3IIPA 1P4CA 1KTCA 3L65A 1TWZA 1KBBA 3WFAA 3WLTA 1TX0A 3TTSA 5CPMA 3GUWA 1RPXA 4TU1A 3IVUA 4F66A 3DUGA 3W1XA 4D9PA 1XDLA 1ONEA 3S2CA 3LNPA 3CL6A 1KBLA 2YBTA 1FWTA 5I03A 2UZ9A 4O1CA 1HJQA 3SN1A 1S1RA 3WG6A 4MDPA 3WNPA 5BOEA 1WUFA 3PM6A 4Q33A 2OZ3A 1XCFA 4KWWA 1NDYA 5C5YA 1FVPA 2W3ZA 3RAOA 2XIOA 1SZNA 3CLMA 4NP7A 1CI1A 1IWBA 4NZJA 2INFA 3DKJA 1MUMA 1E6XM 4HU3A 4N9DA 3MJYA 3BGAA 2CBIA 3LS9A 2PWGA 1S39A 3N2XA 4CQCA 4L9ZA 5FJIA 1X8CA 1V51A 4LNCA 2EBNA 2J66A 1UMLA 3IIOA 4U5KA 2OEKA 3A3XA 3QN3A 4B5TA 3ITVA 2VDHA 4BK9A 1OFAA 4HNCA 4D6JA 3APYA 3TSBA 3U4FA 4PC8A 2G3FA 2WZTA 4J3UA 3R1ZA 4LYRA 3WQDA 2C1GA 5G4HC 2IPJA 1DQUA 4H7VA 3C3NA 3W1RA 2XU2A 3VUPA 3VIHA 3FYOA 2PLMA 3S4TA 3P93A 3AXHA 1B3WA 1CCWB 3VKAA 4DYEA 2DUZA 4B5VA 4ZODA 3SFWA 1OJXA 4KGJA 1JPMA 3S1VA 4TXEA 2ABBA 4AD2A 3LEPA 4QGCA 1ZAHA 2W6RA 4H8NA 3WF4A 3S5SA 2X16A 3OBAA 6XIAA 4BWLC 3HN3A 5FJUA 1F3WA 4S3GA 1U1HA 3UESA 4F0SA 4IUGA 2NWSA 4RV3A 1K8XA 4NRRA 2P8BA 1R8LA 2C16A 3H23A 2WPGA 3B8TA 1GPFA 2I17A 1EX5A 3CZGA 3D5HA 3W07A 2RHGA 3TJ4A 3SY5A 1R3WA 1ISYA 1UB3A 3PPHA 4PMNA 4Q8QA 1S5VA 1HKMA 1PCWA 4MADA 4GFSA 2AQOA 5CLWA 3LTPA 3E02A 4PRWA 1UH2A 3L4XA 1KFWA 1TMLA 2FVMA 2JALA 2DV0A 3OGRA 2PA6A 2OTDA 5DY2A 2GJNA 4PFHA 2UY5A 3VOIA 3F5KA 5I3HA 2OR2A 2Y5EA 2FZ8A 4NUWA 3ALFA 3EOOA 1XLDA 1TV3A 2BOGX 4JTAA 2KAUC 1UHVA 4E2OA 3GHRA 3HBLA 1NDVA 5CGMA 3VMPA 1FH7A 1FDYA 4S1FA 3P82A 4F79A 2YFOA 1PDYA 2REQA 4GE8A 4REQB 1UKOA 1E9LA 3T2PA 3CZJA 4X3ZA 4Y90A 4JYEA 5D09A 1JF6A 5TQLA 4HMNA 4JEJA 1IYXA 4G5DA 1W0MA 3AYRA 2XIMA 4UZSA 4K8EA 3T8LA 4HSHA 1V6UA 5A8GA 1NQ6A 4QRNA 1H2JA 3G1SA 1D8WA 2PE4A 4J2PA 1OIMA 1VKFA 4PMUA 1SFTA 2AAMA 4AZIA 2OYKA 4GABA 3P7YA 1HF6A 3FYYA 3TWAA 2GOUA 3H6OA 4IISA 3DFHA 2PWHA 2DH3A 2OT0A 4LUSA 1JZ4A 1UR0A 3E2SA 3GTHA 3M0HA 1LL6A 1XQKA 3EB4A 5D8WA 4AIOA 1KBIA 5HATA 1OD0A 5K4XA 3PJUA 2WCAA 1KC7A 1M68A 1OEPA 2YYTA 2XVLA 3EPOA 1TRIA 1EZWA 2G37A 3BE7A 3TNOA 4K37A 4KKXA 4JHOA 3PJXA 4POCA 3HQPA 4L4OA 4UTMA 1WPCA 3IJ8A 1XUZA 1U22A 2Z29A 3LXAA 3OODA 4GJIA 1VBJA 1MQRA 1UR3M 3GNRA 5DCDA 3CQ0A 4ZB0A 3DYOA 1KO0A 1H7XA 3QRHA 2ACSA 1V77A 4IIBA 2ZX5A 3WFLA 1V3LA 1VPXA 2Z00A 3NO5A 4TVDA 3P0WA 1KGUA 1TA3B 1XUUA 3ONBA 3QPZA 4L64A 4KRTA 4KEUA 3ES7A 2RFGA 4OJYA 4Q22A 1Q2RA 4U3AA 3MVTA 5G4WA 5E6ZA 1X96A 3BW2A 3E96A 1RHCA 1EF2A 1POKA 3U48A 2QJGA 2P88A 4D8ZA 3M0JA 1R38A 3V3WA 3PNUA 1RBLA 2YDQA 1WXZA 2VI0A 1K9DA 2ZXDA 5D9PA 4BI6A 2PDCA 3HPXA 3LMYA 3UA4A 3BJTA 2CWXA 3HQOA 3T0BA 2EO7A 4MM1A 1T41A 1HKJA 4ZQPA 2G96A 4LCSA 4JDBA 3IANA 1Y0EA 3VDAA 2EKGA 1PIGA 1QXLA 2PRMA 2R94A 4UMBA 1C90A 3T0AA 4JTIA 5D2VA 3DERA 4M8UA 4UNIA 3QLDA 1K9TA 3LX9A 3KVJA 1W5NA 4XZNX 3FHQA 4JOMA 2QCLA 4ZOBA 3QKZA 1JD9A 1GTHA 4Z17A 1SUXA 2GVJA 5C0QA 3VNZA 4AWUA 4YS1A 5DLCA 1JCNA 1PHQA 4KFPA 4WGXA 4OTKA 5DXXA 1MFUA 3RUBL 1VJSA 1ZPTA 4QITA 5A3HA 2PC8A 2HBVA 3G0XA 1B3XA 1R85A 3NOEA 2PDQA 3W84A 2PDXA 3KDOA 1JFHA 1UZDA 5CGTA 3TNBA 2F6KA 5DEZA 3I6TA 3IPWA 3SUSA 4DF0A 3HQ1A 3UWYA 5IOBA 1EJWC 1AG1O 4UFIA 3L4WA 3ZT5A 1S2TA 4ZR8A 2GGIA 1N8IA 2CLIA 1GNXA 4Q8PA 2YDSA 2A6LA 3BV4A 5F2IA 3USBA 2LLEA 5J5DA 3LSCA 3FDKA 4AD5A 1WUEA 5EB8A 5DMNA 5BXSA 1T8QA 5E0FA 3WQWA 3IARA 2VGBA 4IP4A 1FTXA 1BVWA 3TOYA 2PLCA 1ZALA 3K2GA 2I9UA 1DIKA 3TC6A 4FR1A 5F4WA 3UJRA 5LHEA 2WC4A 2BBFA 2I5GA 1OX5A 4AY7A 2YKKA 2XN2A 1TV5A 3AIVA 1I9CB 2A1YA 3AXXA 4E4PA 1Z89A 3VKCA 3PZQA 1GKQA 2XGZA 3ZLGA 2G95A 3IWPA 5HNTA 3ZJKA 4ZENA 4KCUA 3M0ZA 4Z0JA 2XPKA 2G97A 4B3KA 2FHBA 5LYRA 4YTQA 2BX7A 4BJHA 4C60A 3W7KA 1Q85A 2DGAA 3URBA 2WSPA 1I75A 1GQLA 4EPDC 4IP5A 4ZB2A 1Q2SA 3UWWA 4DBWA 2W61A 2FZDA 3DHDA 4MVAA 4JY9A 1KRAC 4JX6A 4EOUA 1X97A 1BVNP 2AL2A 1SQ7A 5I00A 3LCLA 1NF0A 1TE6A 4WOZA 2PU1A 1E1EA 5FJRA 4HCHA 3UWUA 2BVYA 5EFFA 3WJXA 1G94A 4YIWA 3E6EA 1UQZA 1X6LA 3RGTA 1A53A 3BICA 1VFHA 3CZ8A 3FV9A 2OQLA 3JVAA 5BU9A 3MV11 3G3MA 2EG7A 4DB7A 2P1FA 1JZ5A 4W5UA 3G1XA 3E0WA 4AWEA 2YB1A 1FQ0A 3P8JA 3FSUA 4L5ZA 3ABXA 3W00A 3VCNA 4XBJA 1F9CA 2ATSA 1GOKA 4WY0F 2ZC8A 4FA3A 1GVFA 3CNYA 2ZA2A 3GYCA 1ZB5A 5I3GA 1XYAA 2XVNA 2OZTA 4IUOA 1LP6A 4FK9A 1H60A 3ANUA 1LCOA 1VYSX 1JUBA 2WNZA 4KRUA 4ZMGA 1V02A 1JYWA 2WMFA 4DLFA 4U2ZA 1I2PA 2MNRA 4KIEA 3MSRA 2CESA 1JCMP 1MUWA 1LLZA 2ADAA 3UZZA 2WWCA 1J0ZA 4E0CA 1UCWA 3STGA 4H83A 3VD9A 3SIZA 3VU2A 1JNDA 3VA8A 2A21A 1NJJA 4FNSA 1XG4A 3CASA 3VK5A 4F48A 2GYIA 1ITUA 3T55A 5LHFA 1J12A 2HVMA 1UJPA 2PODA 2A0NA 4GY7A 4U10A 3WF3A 2V38A 4RZ6A 5U7SA 1B0IA 3MDWA 1VBHA 4OBSA 2ICSA 3R25A 4OGZA 1JDCA 4HN4A 3HTWA 3BSMA 1W9UA 1VEPA 1K7XA 1TPUA 2DVTA 4N9CA 1M65A 1IV8A 2ZCGA 2O92A 2FMNA 5EMLA 3O16A 2O4MA 2ZUUA 3W86A 3VX0A 2GQAA 5AZ0A 1QOPA 1LTDA 3BMVA 3QYQA 4GXMA 4CN1A 4NX5A 1ZJHA 1QNVA 1GVOA 4U33A 1VBRA 4O12A 4CVUA 2OZ8A 2CZVA 3OOQA 4AZHA 3T81A 3TFXA 3LN3A 2CIPA 1S2CA 2TMDA 3WD2A 4J3TA 4H8HA 1ZZMA 2J47A 3SRDA 1GVEA 4IFRA 3E38A 4MB1A 4ICMA 1QR7A 2DPEA 1PZ3A 4E5TA 3NDOA 5M3WA 3F5JA 3GK0A 1M04A 2BY2A 2Z25A 4DZHA 2V3FA 4LS2A 1GOMA 4YJ5A 3KW3A 4S2BA 4M81A 5A2BA 1UG6A 1EP1A 2J62A 2QDHA 2SFPA 3PPCA 3ZVIA 4X0VA 1QCWA 4UTKA 4N02A 4O8AA 3VOGA 2OWXA 1TWSA 1TV7A 2X40A 3L4TA 1IIHA 3BW4A 4GVGA 2HCVA 2YCKX 4XZMX 3E49A 2WB5A 1SFJA 3KOZA 5JBDA 4WF7A 4BA0A 1WBHA 2OYMA 3N34A 3AMGA 1EYWA 1OD8A 4H9XA 3OZPA 3AISA 3SCQA 3EZ4A 4FXSA 4AZCB 1AFSA 4XAGA 1OX4B 3NFUA 1BVZA 1TZZA 3S83A 4G2DA 3AUOA 3VNLA 3GTXA 3MY9A 3EA2A 1SZFA 3PN8A 4UQBA 2GJXA 2VR2A 4IF2A 1BRLB 4LYQA 1V93A 1H1ZA 4IPLA 4YTRA 1X1OA 3WF1A 2RJHA 4ACZB 2V5DA 4UCGA 4GYFA 5IRPA 2EPLX 3LRKA 4Y9PA 2G50A 4I7WA 3A5VA 4CEXC 2PWEA 2WMKA 3G18A 1J2BA 4KRZA 3XIMA 3GIYA 3W6LA 1J0JA 1X1NA 4Q8MA 5I6SA 1RCOB 3MWAA 1M1BA 2WJFA 4JIIX 5I3IA 1PWMA 1JDEA 3W2NA 1GEHA 5G2WA 4PTDA 2DDXA 4D1JA 2AMGA 1D7FA 1JI2A 5CPLA 4X63A 3KTSA 3S47A 4RCXA 3SEPA 1WXYA 3ZWSA 3HPFA 4V15A 4YYCA 3T05A 3GDRA 1W91A 4F2UA 1VFSA 1FWNA 4LVAA 4CD7A 1J0YA 1BAGA 3EEGA 4IGMA 7REQA 4RNJA 4MNJA 2E8ZA 2E5DA 4HSOA 4CN4A 2P76A 3CHFA 1KXTA 3CUJA 2CBVA 3MDUA 4QS5A 3TTYA 3G3DA 4IJBA 2DZAA 2DW7A 4LYKA 2HXTA 3Q67A 1R3YA 1UA7A 3B05A 4R85A 2F2KA 4NXSA 4HOZA 3AIRA 2QEZA 3TJIA 4AF0B 1QHPA 2BZNA 1QPRA 4FX8A 3W53A 4IGSA 5HQEA 2ZXQA 2VELA 4JEQA 3SGUA 3ZZ1A 1H63A 3NTYA 5AOUA 1XJBA 1SGJA 2GGJA 1GOIA 4EANA 2GJPA 3LU2A 2J6XA 2BY1A 2D1ZA 4YCOA 2YXXA 4PTWA 4D6EA 2D2OA 3ITTA 1M7JA 1Q45A 4O50A 1EA0A 3UCCA 2OSXA 3IV8A 3M9YA 3RLHA 4XD4A 3BAYA 3PWGA 3ONCA 1LOLA 2J7HA 5EYWA 4GQQA 3FLUA 1H61A 3A22A 3FEQA 5I3FA 3W7LA 1J79A 3ERPA 1MZHA 2DSKA 1IR1A 4BF5A 3CPUA 1XIIA 1VPYA 3B0VC 3EOUA 2NT1A 2QQ6A 5IDZA 4RK8A 3G8EA 1AL8A 3PB2A 1KFEA 1Q8JA 1TB3A 3P74A 2VGFA 4UTHA 4LJ3A 1NWUA 2VX6A 1SFSA 2WNNA 4JQ4A 4HYRA 3UXAA 1E1CB 4A3HA 2V5BA 4PUJA 4DQWA 4M51A 1BSLA 2VFHA 5KZMA 4KEZA 4OQVA 3GLCA 1GZJA 4NYYA 4OIFA 5B7ZA 4J28A 3W22A 4WDTA 5LGXA 2O56A 3L4ZA 3NQMA 1KWKA 4MPQA 3P81A 1J6OA 2E6FA 3SY8A 1MMFA 2QMJA 3PZ9A 3WDJA 1JAKA 2ZVIA 2VJXA 3B40A 3PFRA 3PF3A 3TOPA 4GIYA 3O6YX 4LY4A 4PUEA 2Q8ZA 2E0PA 4H6RA 1K7FA 3FDGA 2OLHA 2VCCA 1HVQA 4UTLA 4M5PA 2ZXBA 4MDOA 4EPBC 4JFVA 3VKDA 3W7HA 1XIHA 4HZMA 4JN6A 1D2KA 4JTDA 5I24A 1DIDA 1ENUA 3QMTA 1E3XA 2OFJA 4YTSA 2NWRA 4H9MA 1IEVA 2DZSA 2X7WA 3KLKA 6ALDA 3GE7A 1VJZA 2YCLB 4A3RA 1JAEA 3QZ6A 3K46A 5LA2A 5TD4A 2OJPA 3FKKA 1XLMA 1WYIA 3EB2A 3N04A 1Z6KA 2DIEA 4FXJA 3FY1A 3CZKA 3EMCA 1XGEA 4NU7A 3LTSA 2F7FA 4J3WA 2P8CA 2OODA 1U83A 3AIEA 4WQ6A 2ZWYA 5HWNA 1SZRA 3W7NA 1MEWA 2QCMA 3EX1A 3MBFA 1XIDA 2ZTJA 1H41A 4EIVA 3PUEA 4O1DA 3IRDA 1DJHA 3TN6A 1VD6A 3W88A 1DJWA 3PS7A 2DSZA 5DX7A 1C91A 4I5XA 3PG9A 2I57A 4DELA 3FEMA 3AS2A 3QR3A 7ODCA 3WBWA 3PUDA 1E55A 1LQAA 4JKKA 1R3TA 4B5UA 3F5LA 1L2QA 2HNEA 2HNHA 5KITA 1GWJA 3THQA 4XK2A 2WSYA 3ZO9A 3W26A 3PG8A 1BYBA 1JEZA 4EAMA 2NX3A 4XKYA 1OC6A 2EQDA 4PL1A 4N6FA 2YL8A 2VFEA 2AQWA 1SSGA 3AXMA 2P0IA 1UBPC 3B0PA 4YVPA 1B5TA 1F05A 1YPXA 1BWVA 4Z1BA 5E1QA 3R43A 2D22A 2PWDA 5D9MA 5DBUA 1NVMA 1WDDA 5DMLA 1EA9C 3UR8A 4L4MA 4D6CA 4WSKA 5BCAA 3WQVA 3O05A 3U2EA 1EWDA 1HJWA 1Q6LA 5AHMA 3TSDA 2XISA 3UNDA 3K1GA 5CC5A 1IZCA 5FOOA 1KTBA 5T91A 3VZYA 1UROA 2CYGA 3T0TA 1DORA 1WZAA 2VX7A 5FESA 3MV01 3TW7A 2WV8A 2YLLA 1MQPA 4JTUA 4INFA 5A8QA 3EX2A 1OFBA 4IPIA 4GNVA 1TJPA 1GQJA 1FOBA 4IIGA 3K1DA 1GORA 2QPXA 3MMDA 1BQGA 4P7QA 3R4IA 3U5UA 3KL5A 4N6EA 3E0VA 4C90A 3GKFA 1TV2A 4XD6A 4CGTA 4I6KA 1W9XA 3WIJA 4C6LA 4F3HA 1VH7A 5HMDA 4DAIA 2E9LA 1EQCA 4S2CA 3L2MA 3UY7A 2OZ0A 1HJVA 3W2UA 5J04A 3MPGA 1FH9A 1GHRA 3KWSA 1VP5A 4IG2A 5H1WA 2BB0A 3BOFA 3V0TA 3M44A 5CCZA 3RX3A 3E74A 4CU6A 1CGVA 4JICA 3RO6A 3MUXA 2GL5A 2NV9A 5I5RA 1L6SA 4QQ3A 2C13A 5KTLA 2I7GA 3ARRA 1E73M 2QGYA 2XIQA 1UR1A 2CERA 3F7JA 3W73A 3CZEA 1PCKA 1Y5WA 2E6AA 1XLEA 3QR1A 1YADA 3VIFA 2VWTA 3CTTA 5HMSA 1B3YA 5AYIA 4O17A 1B1YA 2VFFA 1JYNA 3GU1A 1IWPA 2PGWA 4IFKA 1P48A 3FVDA 4K1WA 8CGTA 2YB4A 1F7BA 4IH3A 3PC0A 2Y61A 4HIBA 4QDPA 3AQUA 1H5YA 4O1AA 1UUQA 3BURA 1AD4A 2XH0A 3WF0A 5K3VA 3OYXA 4BQ5A 3NURA 3G1AA 2G4JA 3WEOA 2QJIA 2NUYA 3DG7A 3ANVA 2QPUA 3TONA 1XLLA 1CBGA 3V36A 3BVJA 1REQB 3Q58A 4MUZA 4A8IA 1UWQA 4HA4A 3PZGA 1DIOA 2GVEA 2FH6A 1EP3A 1M03A 1N7KA 5C9RA 1EO5A 3O3RA 5G1MA 4IWWA 5CJMA 3U0HA 3CQKA 3B8DA 3W4RA 1W37A 4A4AA 1K03A 4Y96A 2F9RA 3C0SA 1ZUAX 1G9HA 2XN0A 1ME8A 1EPXA 5BMWA 5G1YA 4GWEA 1R3RA 3VM5A 4W93A 3HF3A 1W1ZA 3UT0A 4IIDA 4CD4A 1L0PA 1PHWA 2PTZA 1MW3A 4AIBA 1EBGA 4DYJA 3WEMA 3LXBA 2H90A 3T07A 3LHZA 1E4IA 1T7LA 4F9JA 4B91A 2QXWA 1VEMA 3FN9A 1EJ7L 1Q6RA 4HNLA 1F6PA 4EWND 1W1B1 3D3FA 4GC4A 3S2NA 3TYAA 4XAZA 4XKMA 1QWGA 5HDRA 1GVIA 1XC4A 3A13A 4UTUA 3N1AA 3TA6A 1XH0A 5A6SA 4NI8A 3TYEA 4Q8UA 4UNKA 2BVDA 3W70A 1UZ4A 3W7QA 1C3FA 4LX4A 5H6HA 3HMCA 4AXNA 3A12A 3PPGA 2HEJA 5TBOA 3VIPA 2ZUTA 3M0YA 1EUAA 4A29A 3NZGA 3LERA 1S46A 4J3ZA 1EJSC 1OZQA 3UFYA 4KQNA 4W8LA 5G1TA 1XYLA 3HB9A 5FL0A 4AG0A 2NLIA 3LY0A 5HR7A 3CWHA 5A6BD 2PD9A 1VLIA 4WSJA 3GR7A 1DWIM 3CH9A 2AL1A 2WLYA 1F2JA 2CCRA 2OEMA 3WX7A 2OX4A 2O9TA 4F8XA 5A8MA 3GR4A 1XYFA 3QXBA 1EJVC 1UYQA 1JPIA 4EKJA 1ZAIA 2WVUA 5D9OA 1TQXA 1CX9A 1OK4A 3NQDA 2XVGA 3S3GA 1KM4A 3KHJA 1WZLA 2VX5A 1XS2A 1LT8A 1FHLA 2R9RA 1DBTA 4WUIA 2V9DA 1GOWA 5H8MA 4JNZA 4C1KA 4CD8A 2DH2A 4WKAA 3G1FA 4AVNA 3W1QA 4GJJA 1EEPA 1Z48A 5C9XA 2B81A 1UWUA 1XM3A 4GY0A 3TX9A 1PPIA 3NZRA 1AJZA 4UTTA 3SGGA 5CJ5A 4I8DA 3G0SA 2XM1A 2E9MA 3NL2A 3C86A 3R12A 5EU9A 4RZ4A 2BVTA 3SQLA 4M80A 3URNA 3GDBA 2ZOXA 1RA5A 4GUIA 3VIMA 4HMCA 4JIPA 1F73A 4ATLA 2WKGA 1QMLA 1KM3A 2BY3A 3BK0A 4C6FA 2RGLA 1WZKA 4RDWA 1J96A 1AQFA 3DFSA 4LRTA 1F74A 5E0KA 5CPQA 1M41A 3RLVA 2EKCA 3N29A 3LD5A 3BZGA 2B7PA 2VOTA 2HV5A 3W7DA 1TIMA 1OCJA 2ODOA 4YXGA 1OYAA 4W4QA 1H7OA 4ADSA 4EPKA 1DWHM 4MNKA 2PDFA 1TWDA 4IPPA 1V0NA 3VGGA 4TQTA 4QQUA 2C71A 3FSTA 2IUZA 3M5YA 2ZX9A 4L6OA 2ZX8A 4HHMA 5EKYA 4CNUA 4PMYA 3IJ9A 3TR2A 4AD4A 3KTCA 2D3NA 1XSKA 2XGBA 4GRSA 4C6MA 2PF8A 1JPDX 3RU6A 2FQIA 2WMGA 2V8ZA 2F84A 1TV4A 3NA8A 3N6HA 3LMZA 1E6RA 1PWLA 2OT1A 2C15A 3HOJA 3ZOAA 4RZ5A 3OQEA 1YDOA 3IS4A 3H2NA 3CO4A 3LM3A 3WJYA 5AYXA 4EF9A 3QEZA 3GXNA 1HJSA 1G67A 1F3TA 4PUMA 2H3DA 2VFGA 2PLKA 4L4PA 4Q4OA 3NPWA 1CGWA 1X39A 1ITCA 2XN1A 2DUAA 4V27A 3WFZA 4HPJA 1G01A 3B8VA 2VM8A 4NHVA 5GPRA 3RPMA 2QF8A 5EMUA 2P0OA 1SYTA 2OKTA 4J35A 3ZYZA 3DX5A 4JIRA 2OWCA 2WW5A 1YNQA 4JTRA 1DXIA 2ZRUA 3EDKA 3CC1A 3TYBA 5PTDA 4ZO7A 3T6CA 1VC4A 2WZHA 1ZNNA 1X98A 1HJUA 1UKPA 2UWFA 1MW0A 2Y62A 3EOSA 4MTVA 2OXNA 1Y7VA 1P1XA 4US5A 2G3JA 2VD8A 4OUIA 3HM7A 3L68A 1W1VA 1EJUC 4A8LA 2JEPA 3CQJA 1RQEA 3EWZA 3P14A 1H7NA 4KCWA 1BFNA 5H8PA 4NYUA 2E68A 3OW1A 1DPMA 5AB3A 1SJCA 1ADSA 5F7UA 4A2SA 1O6IA 4LPCA 3ABSA 3Q37A 3FAXA 1L6GA 1PJ9A 3TWBA 3M0IA 3LXCA 2G3IA 1E0UA 3CYJA 1XH1A 5ECUA 3CHDA 2J8GA 3BPWA 2FTWA 3H21A 2CKSA 4PR4A 3N2BA 1JZ8A 3LLFA 4PUUA 2GK1B 4I9TA 2A6NA 1O7AA 4JNYA 4Q4PA 1GQNA 4OU1A 2R8WA 1WKEA 3VOCA 4QEEA 2ISFA 3M46A 4CCEA 2GVYA 4BWLA 1K6AA 1SW3A 3V16A 2Y7EA 3ZJ6A 3EXTA 4GHRA 3FVMA 1BSIA 2YDRA 5HWJA 1OG0A 3UG8A 2ZE3A 1SW0A 2E8YA 1LUCA 3FX4A 4R7JA 3WO8A 2WCSA 3BQ6A 4IMEA 2CNCA 1GJWA 3HGRA 3NEVA 4EACA 4GCXA 1WO2A 3QH2A 1LJYA 1OM0A 4L9XA 1RCXB 1BYAA 4B5SA 4ZO8A 2PDBA 3LDVA 4DO6A 2CLPA 2BASA 3AYSA 1FP8A 2XFYA 4PCFA 2PDNA 4AC7C 3P0XA 3PZMA 4KWVA 2DT1A 1KBJA 2E6YA 2Z1KA 5G2IA 4Q8TA 1FHDA 1FWHC 4B5NA 4YMZA 1JXJA 3TW6A 3MSDA 1GQIA 2X0SA 2FGZA 1BWKA 3W37A 1P43A 1A0EA 3RX4A 1JQVA 2HBXA 4DAFA 2YCIX 1JDAA 2Z1XA 1ONWA 3PANA 2WCGA 1XIBA 2Q3RA 4ZQMA 2BVWA 1ML1A 1R47A 3MP5A 1QT1A 1A3HA 1E56A 4PMZA 1ZCOA 3JUGA 3L4YA 4IPNB 4PMJA 1FWWA 5HAOA 3SB0A 3H55A 2POZA 3PZUA 4BZYA 1Q4NX 3TQKA 1KFCA 3PBGA 4U5IA 5LNSA 1F8MA 1OF8A 1M7XA 2OPJA 4C6IA 4C6PA 4DEFA 5CSRA 3GG7A 3UGRA 2HXUA 1Y5VA 1W5QA 2NXIA 1R2RA 5K7JA 2HDJA 2OLAA 3NL5A 1I2RA 5CAHA 4HNOA 2C7FA 1JZ2A 3UQNA 4Y8FA 4KT2A 1EFZA 3MMTA 1A5LC 4LY8A 3B04A 4I9AA 4QJ3B 1POJA 2HS6A 3QC3A 5HA7A 4W8BA 2WO5A 3BV7A 2V67A 1NY1A 1K02A 1QWKA 5GJNA 3OVRA 4PEKA 4TTGA 3CT2A 1OSEA 4IMDA 4UOJA 3C6CA 1BLIA 4MYAA 3UCQA 2G3MA 1PVNA 4ZXLA 4QCEA 4R9XA 1E6SM 3DDMA 4LBUA 1A5CA 2VENA 2VZUA 1PKMA 2WC3A 3IGUA 4D1IA 2XIBA 5KETA 8RUCA 4H1ZA 2Q8XA 4S3CA 1US2A 1E51A 5HMFA 1ISVA 4KERA 3V0SA 3VOHA 4ENLA 2J24A 4DWSB 3OG3A 1UC4A 3VNJA 3WQOA 2BMBA 2ABAA 3CIVA 3M5VA 5EMYA 1A5AA 1KNWA 1H0GA 3NWRA 1VGAA 3IGXA 4GYPA 4O13A 3AIBA 5D05A 4UFMA 4MWAA 1G4PA 4GZIA 5E9AA 4V2XA 1O4UA 3HU7A 4LUTB 4GUHA 1UD3A 4FOUA 1OY0A 4AZGA 2ANUA 3AYTA 3HPZA 3DHUA 4ORIA 1VYPX 4DI8A 2WNWA 1FFRA 4O53A 2PGFA 4O11A 3QY8A 5D32A 2DSUA 4GZEA 4GH3A 2DZVA 3RMJA 4FF7A 3SRHA 2WSRA 3PY2A 3DH7A 2PB1A 3MJMA 4PGLA 3AFBA 4Q4QA 3OLGA 3NGJA 2GSEA 3GKAA 2PEVA 2HSAA 2PGEA 2C79A 5A1AA 3POCA 2Z6JA 3UZJA 4GYJA 1F4AA 4PUKA 4PUNA 4AX6A 1F61A 3DFYA 5EPDA 3INPA 2QUUA 3QM3A 3I65A 3QLLA 3T2QA 3F2BA 4CQ9A 1QASA 4HTBA 4GQBA 3PUOA 1RPKA 5C55A 2IW0A 3BW3A 3OIXA 4B16A 3N15A 1S3TC 3M6YA 1ZQ5A 3H7VA 4RL3A 2DFAA 3O63A 4M6QA 2GFTA 3NQVA 1RJPA 2PAJA 3E1F1 4FMVA 3AALA 5HNUA 4HHHA 4LU0A 4GZJA 1IGSA 3NQ6A 3VD3A 1Q8AA 1J5TA 1SO6A 2XFWA 4O18A 5AN7A 1TPEA 3CWNA 2GUBA 2E5BA 1O68A 3OHMB 3SJ3A 4FLOA 5AHNA 4HPNA 2PCEA 3GU9A 1EX1A 3B8UA 4WCJA 9XIMA 3WUBA 3K30A 4GY1A 2A5HA 4F9DA 3QMSA 3I6EA 1EEXA 3S2LA 3EXRA 3MUIA 1ZFJA 9XIAA 2WQPA 2PPGA 1W1YA 1KWGA 3ARZA 2HZGA 3EBVA 3SUWA 1R2TA 2FHCA 1RAKA 3WLJA 4HZ7A 1O94A 1DWGM 2G0WA 3HV8A 4N4PA 1N8WA 3GU2A 4UUIA 3GC2A 2WZIA 3W23A 2V69A 3GYEA 3UWVA 3DG6A 5C8BB 5IFTA 4C7GA 4O8RA 3R89A 4G8TA 4U28A 2VHLA 2R6OA 2VC6A 3ALGA 4JTFA 4PODA 4P5UA 3AU6A 4J4KA 3PWIA 1HO1A 5C71A 5HOSA 2YA0A 3IUHA 3EWCA 1CGTA 1P0KA 5EA9A 4AYGA 2J7CA 2BHZA 2JE8A 2CLLA 1FHVA 1LWIA 1FCUA 2GZXA 3CL7A 4B5WA 3B4YA 4ZCWA 3TN3A 2CLEA 4ZVJA 1NWTA 3EDJA 3BLKA 1W1PA 1EYEA 2RAGA 1M7PA 5BOOA 2YFNA 4AAJA 4DXKA 4E3TA 2EGZA 5DANA 5D02A 4QG8A 5L9FA 4C7DA 4GQRA 3ZS4A 1MRQA 4IMFA 4RE3A 1V6TA 4K2SA 3CEPA 1PTAA 2C1HA 3K5XA 2QDDA 1VFMA 1W3NA 3EWBX 4GKLA 3RILA 4AZBA 4D72A 2EXOA 3KL0A 1GZGA 2FVLA 4WJEA 1VCGA 1PX3A 4X22A 1JR1A 4UOQA 1NDWA 2VNCA 4O1EA 3VZZA 5AYZA 1LF1A 4PB4A 1JL8A 5FSEC 3VMOA 1QW9A 5U4NA 3DG3A 5D9NA 3RN6A 4C6JA 4QXIA 3VI2A 3UEQA 4P7NA 4CNOA 3R5EA 1M53A 3H24A 5MHBA 1YTEA 4Y9NA 2QV5A 4GUGA 1KFKA 3PBYA 4FLRA 4W5ZA 2C3ZA 1NF7A 3E5BA 3WNLA 4O52A 3KCJA 4G6CA 5DQPA 5BRQA 1VB9A 3L66A 4QR6A 5LNRA 3N14A 3KTXA 4FXRA 5A8PA 2X0YA 2YR1A 4ZGYA 2YGYA 2JEQA 3LHVA 4R34A 4DN1A 3IRSA 3O6CA 1TR9A 4ROQA 5HUPA 3KAOA 2QVHA 3ARVA 3SR7A 1HTIA 1JCLA 3OHIA 4FS9A 1ZBCA 3U2ZA 1VFLA 3UZ5A 3B9OA 3FJ4A 3FJLA 4TMCA 1ZJBA 2WBKA 3W75A 3MC5A 4YHGA 1IR2A 4XZIA 1ITXA 2EF9A 4FB7A 3MCOA 1IHIA 3QY6A 3LPOA 3OVGA 1PZ2A 2BHUA 1WAWA 1W1TA 5J8LA 2UY3A 4RE4A 4JCLA 3HPAA 1XYZA 3S6DA 1RJRA 3CTLA 4DUWA 1BGAA 1RUSA 1S5NA 4LS0A 2W91A 3GZAA 4GKTA 2E28A 1KD0A 4LAKA 2HPIA 1TA3A 1EJTC 3LCWA 2XYLA 1BKSA 1J11A 4MOZA 3BTNA 1R3SA 2ZX7A 2RH9A 2E6DA 4L65A 4L1XA 3ES8A 3GAYA 1BXCA 1KTNA 2C0HA 4L6HA 4X2PA 1DVJA 1F3XA 2BOEX 1OGGA 3TJXA 4BFAA 3HG4A 2XG9A 1CENA 2X30A 3H2MA 3L4VA 1N82A 4N9BA 1TCDA 4JIQA 1XC6A 5AY7A 4J1OA 4A3UA 4GI9A 3S9IA 4K7VA 3GC5A 3IJQA 2J7DA 3MI2A 2B0MA 4WLCA 3IGHX 1FH8A 4DZAA 1O5QA 2A7PA 4OUEA 1R9ZA 4LUYA 3K8MA 4JAWA 1VLWA 1KR0A 1E4MM 3UPMA 3T40A 1LL7A 3PULA 1XWYA 3B8IA 5TNVA 1R9XA 1UUMA 4NRSA 3RJYA 2QR6A 2D0GA 4Y2WA 7A3HA 1AK5A 3E3HA 1K6WA 1X7FA 2XSXA 1FKWA 2CLHA 1T96A 4RZBA 4AISA 3WBEA 1SO4A 3HZ3A 3W7MA 4F2BA 3LNMA 4JKLA 2C19A 1GG1A 3HQNA 4L1WA 2BFGA 3SUTA 1K7EA 5T9BG 4MMWA 4DO4A 2AQVA 2NW0A 2Y1HA 1XGZA 4ML4A 5FA5A 2FZMA 2V3EA 2X2GA 2PDLA 2ZDRA 3EWXA 4O15A 3ORWA 5LNVA 3O7UA 1RA0A 4CNNA 3V35A 1MVYA 3WMSA 2RDXA 5ABFB 4O1BA 1RCQA 1WE5A 2CBUA 3N9KA 2VQUA 2CEQA 3GDKA 1FWSA 4H9UA 3GXPA 4XBSA 3NQ7A 1W2PA 3V5OA 5I23A 4TR9A 2OVLA 5C9ZA 2H8ZA 1PKLA 2PSNA 2AGTA 3IK4A 4IGNA 3BO9A 1JDDA 3UW6A 3HMJG 4MZ1A 3U4AA 4TV6A 4LYPA 4R7WA 1YE6A 1L8NA 1H51A 3M5ZA 3VC5A 5GQBA 2CHRA 2P10A 7XIMA 4PBEA 4XIMA 3N6JA 3A4JA 2GJXB 3EWYA 4NZCA 3FIGA 4B92A 4LAUA 3W72A 1FWDC 5J5RA 3QV9A 4JS3A 3AMLA 4H2CA 4Q4RA 2FLIA 4X60A 1FFQA 4NF7A 4DUVA 1W32A 4IIFA 4MZ8A 4JR5A 3M43A 4QAIA 1G5AA 3MKVA 5H8UA 1GEQA 1H09A 2V2HA 1W3TA 2ACQA 3MSGA 3M0XA 3QV6A 1UOKA 3D0CA 1MZRA 5C9WA 2PDUA 3VFCA 1YDYA 4K39A 2JGQA 4AFYA 4UTFA 1ZJAA 4GVHA 3RM8A 1E71M 2Z1BA 2XSBA 3TU9A 1FUYA 3VVGA 1QBAA 2Y5JA 1C9DA 3W82A 1UKQA 3QY7A 4ATWA 2Y24A 3BG3A 4GGHA 1IZJA 2YA2A 1CDGA 1VJIA 3M4HA 2YXOA 1ZBKA 2WHLA 4QG6A 1OQFA 5I3JA 1WDQA 3UYIA 3DFTA 4OE7A 4X2RA 3OEXA 1K4HA 3ARYA 2FB3A 3GC4A 3QQ0A 3LOTA 1QNSA 3P8IA 3WLSA 4ZB5A 1V03A 3N4FA 4UCFA 3RLGA 1LT7A 3II1A 3MKKA 2V5CA 3LBOA 3W9ZA 4MLJA 2WZEA 2HVNA 4BI5A 2G4FA 4RXGA 1YXYA 3C52A 4D6FA 3ZT7A 4M6PA 2ZYFA 1QPKA 3MUCA 1GHSA 3W27A 3QMRA 1XICA 5CZTA 3ZWTA 3NYZA 2ISWA 1J8VA 2GLKA 1LBFA 4ZL1A 2P3EA 4AIUA 3MBDA 3WJZA 1MNSA 3AYVA 4GXPA 4UQCA 5A6BA 3OU8A 1J0KA 4RE0A 4BCEA 5A6AA 3NJ3A 1XIFA 1RZMA 3QGAC 5D2XA 2ONEA 4XUGA 3GNDA 1RALA 4HMDA 3SCUA 1A5SA 1D9EA 4GQGA 3GG1A 2EPHA 3N73A 3IACA 1IWAA 1A4LA 5M03A 1I2QA 3K4AA 5CXPA 2JIEA 4MYXA 1WKFA 4NSBA 3I7QA 1PEZA 5JBFA 4UXDA 3GNPA 4WX2A 2Y5SA 1LQ0A 1KFJA 3OQ8A 4G1NA 4XUYA 4E6MA 4HT3A 1A5UA 1V7AA 1KQYA 4YL2A 4IMGA 4O19A 2DZTA 2HMCA 3NPXA 2Z7GA 2J7FA 4KPLA 3UWQA 4EAYA 1BXNA 5CSUA 1PSCA 1FWJC 3S1XA 2V3GA 3S9YA 4GX8A 3DGRA 4EF8A 3H2AA 2ZTKA 5G4EA 3OVPA 1LOQA 3GTFA 5XINA 4BQ4A 3H4WA 2QCHA 1DIEA 3P3BA 4L4LA 1N55A 1ZL1A 4WY0B 3BLIA 3KBMA 1MW2A 4JTKA 4CUCA 1MWOA 3I3EA 4PTMA 5AHIA 1RK6A 3HO8A 4B9ZA 1X8FA 5HWMA 3LLDA 3TUUA 1TIWA 1ZCCA 2DZBA 2QHAA 3B97A 4DM1A 3MA8A 4ERGA 1CZ1A 4NZFA 4DUOA 1EQPA 3W76A 1JZ3A 3RHGA 3G6LA 3DBPA 3H53A 3DZ1A 1WCGA 3OO2A 1AZ1A 4UBPC 4XTIA 4YN5A 2IXVA 1WV2A 4DWSD 5KZDA 5KMYA 3CAKA 2BGNE 3THAA 4JN7A 3ZQ9A 4S23A 5I3KA 3WUGA 3G22A 4DO7A 2I5IA 4X9YA 4AZCA 3F4CA 3FYPA 4GI4A 4X61A 1A5NC 5FF7A 1YBQA 1VRXA 1DHPA 4OVXA 2X1RA 4XAYA 3VM7A 4ZQCA 2YSWA 3FNDA 3TFCA 1RY0A 3QGVA 3W28A 4ZQRA 3PSWA 3E0IA 1LOSA 2VUNA 2GQ9A 1QO5A 2PC4A 1P5BA 7PTDA 4W88A 3KOFA 3LRLA 2NVDA 2PRHA 1XLCA 3DU0A 8TIMA 3AZTA 3MO4A 5BW6A 3CUHA 2WYSA 1LM1A 2AAAA 1DKWA 2XGIA 4LGXA 1SR0A 1FBAA 3MZ2A 4AHPA 4WD0A 1ME9A 4RNFA 4CD5A 3E12A 3W2LA 1L2UA 2GGGA 1NFBA 4V28A 3H7RA 4JIHA 2IKIA 1SJDA 3UCDA 1RR2A 1AL7A 4GOAA 4E8DA 2JQXA 7TAAA 4JCMA 1TX2A 1WZMA 1TQJA 2QZRA 2J78A 1LRQA 2QVNA 1GYLA 3PTDA 4FOKA 3E2QA 2J6VA 2OLSA 4I5UA 2GOKA 1UD6A 4HOWA 1K9FA 2E1WA 4H01A 1XBXA 5MKGB 3IUIA 3TIMA 1KV5A 3MYOA 3TZNA 3ECQA 1A0CA 3GNXA 3KRBA 1HT6A 1P0EA 3P5YA 4GQ0A 3TZFA 1O12A 1QPNA 2QCGA 1SJAA 2JGYA 4ZQOA 1A5BA 3G1DA 2IPFA 3WUEA 1V3KA 4PB3A 4AVFA 3ITLA 1SPQA 5HJYA 4W7UA 2MUCA 3WH6A 4B15A 2NUWA 4H6QA 5K9DA 1AW1A 2RKXA 4RUBA 3TC3A 3UZXA 2WVSA 2X1SA 2X41A 1EZ2A 4ERAA 4ZFMA 3KP1A 1UUOA 3OJGA 1XLFA 3UWZA 2A7NA 3GHUA 5I77A 2V0TA 1O1HA 1TRDA 1QNQA 2PWUA 3TR9A 1KRBC 1NAL1 2AGKA 3A3HA 1VF8A 4IPJA 4KCTA 4FSAA 3KS6A 3WDQA 1KCKA 1YXDA 3LQLA 1WA3A 2YW4A 4JGDA 5CAKA 4DJEA 1QK2A 3GFZA 1UASA 4H41A 4O14A 5FF0A 3DGBA 2INZA 1DQWA 4RPQA 3S0CA 4Z1AA 4ZBCA 2QJNA 3N9SA 1PKNA 3RRXA 2OWWA 2E67A 2X2YA 4DPQA 1HZYA 1E1CA 3LPFA 4NAEB 1KA9F 1EHNA 1X6UA 1Q65A 5BRPA 3ABOA 4WDXA 1ECQA 4EP8C 2A3AA 5I07A 5IDIA 3AIQA 3TKFA 5F2GA 3NZ1A 1JXKA 1RBOB 1FWCC 5HK4A 4M6VA 4ROPA 3KHDA 5B80A 2WHJA 1KKOA 6ENLA 1M9HA 2BTMA 1OFDA 3MMWA 1L6FA 3L0GA 2BODX 3WBAA 1ZTVA 3LHUA 1EP2A 2CWNA 4YYFA 4DNMA 3QYSA 5AFDA 4QSFA 2CBJA 3GVGA 5D4YA 4XZLX 2ISSA 3LCIA 5LGZA 2ZICA 4QLKA 5LIWX 2O7QA 2Y85A 2V2DA 1JI1A 4DBSA 1FXQA 4MFEA 5I0DA 5JH1A 3RM4A 3F4VA 5DT7A 4D6GA 4HHPA 4WVXA 4I7VA 4WKFA 3L4UA 5LKYA 3R79A 1R2SA 3WL0A 4GYPC 5I3DA 4LCQA 1RD6A 4MWAC 1Z42A 3TP4A 4HSNA 4LH8A 3CUIA 2JKEA 1QHOA 4Y6GA 5AYYA 3IIVA 3LV5A 3VNKA 1E72M 2D23A 2DQXA 3G1RA 3CB8A 2PTDA 4HA3A 4QISA 3URAA 3A5FA 4JIEA 1P0BA 4RR4A 2ZDSA 3B9NA 3GVQA 3R2GA 2INEA 3TEVA 1OIFA 2DT3A 3UYCA 5JXQA 4QBXA 3WLPA 2VOMA 5DCEA 3SQSA 2QLYA 1JIBA 4KS0A 3CUZA 3E9AA 2R91A 1VFFA 3BZJA 3OA3A 4WK9A 1Q6GA 4QLLA 2XIJA 4W7VA 4OECA 4RJEA 2HWGA 3MMUA 2HQAA 1BG4A 4Q7NA 3LV6A 3V0UA 2VT0A 4OFCA 3I4KA 3NZPA 4NJIA 3GNOA 4AD0A 1NP2A 4BR1A 4GUJA 1UR2A