3C52A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
296
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 110
structure length 296
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c52A00
3RLUA 4JTLA 3PG8A 2YGYA 2XN1A 2DP3A 2G97A 1GVSA 4AB4A 2B7QA 3NA8A 3LRLA 1AL8A 4HHPA 2F84A 1MZHA 4WX2A 3TNOA 4CQ9A 3O16A 4CNPA 4JIPA 1JCMP 1F6PA 1A5SA 1GTEA 3WJYA 1K02A 2GVGA 2ZYFA 3W86A 4ZL1A 1R46A 3BG9A 2NWRA 5AHEA 4UTWC 3W7EA 2VEPA 2Z6JA 2R8WA 2J9YA 1S5TA 3A21A 4O17A 4E2DA 1GTHA 1MEIA 3MHFA 4E38A 1YXCA 3TUUA 4YCPA 5D03A 5G1YA 3E0IA 3PSVA 3RNDA 3W7QA 3HOJA 5D30A 3W1AA 1ICSA 3ATYA 3LHZA 3M5YA 1FCVA 3W07A 4AVFA 5I3IA 2X16A 1GVFA 1RPXA 4O57A 4ZQRA 2YX0A 2C1HA 4ZZ9A 2FPVA 1G4TA 3PVFA 2VC6A 3MWAA 4NZJA 3W83A 4UIOA 3NPUA 3OA3A 1OK6A 3C2FA 1TPC1 5FF7A 3PBWA 1Q6RA 4UMCA 1LM1A 4RJEA 2ZRZA 2H8XA 3FIGA 1S3HA 3GKAA 3NXFA 3DFOA 1WQ5A 1OF8A 3NNTA 5CGQA 1IIGA 3W7CA 1VC4A 3MHUA 1TIMA 5EY5A 2QDGA 3LXAA 5AFDA 2FLIA 3LLFA 3S9YA 1FCUA 4JD4A 4O1CA 2ISSA 1DKWA 2RDWA 3NQEA 3EKLA 4LW7A 1K03A 1IXPA 3CEPA 4LC8A 3U2OA 3IVTA 3GDLA 2E68A 2R94A 1R2TA 5G1TA 7TIMA 4IPIA 6ALDA 5IBXC 3NG3A 4JTUA 1OFDA 1O4UA 4RX0A 2A1YA 3G1YA 1TB3A 3NQ7A 1EEPA 3W88A 3CQ0A 1K8YA 4A29A 4QITA 4IMGA 1OFBA 4HSNA 3PS7A 4NJKA 1QMLA 1TQJA 3E02A 4RCXA 5LGZA 1KW1A 4JTEA 2VFEA 2ZZ3A 4N6EA 3HGRA 4M7SA 3NOEA 2X1UA 3M9YA 2A5HA 3LB0A 1A5AA 3R5EA 5C5YA 5KZMA 2VEKA 3BGGA 5LNVA 2J9XA 3P81A 1CI1A 4HSOA 3NPVA 1QR7A 1SZEA 4FNPA 3DAQA 2C6QA 3RK8A 3USBA 2ABBA 4OT7A 3TKFA 3K30A 1PVNA 4LWWA 2DJXA 3EX1A 3EWBX 1BKSA 4EVZA 4K8HA 1QPNA 2QDHA 3C8FA 3JS3A 1VRDA 3LBMA 3Q58A 4NNAA 3T78A 3UWQA 3S42A 3ABSA 3BGJA 4FXSA 1VYSX 4JTJA 1TPH1 1KM4A 2PCQA 2G5WA 3ZWSA 2OT0A 3G22A 4IWWA 3L2IA 3HGOA 4TMCA 4LS0A 3MYPA 4A22A 1O5KA 1M6JA 4BI5A 1PIIA 1VYPX 1XUZA 2E5BA 3W22A 3EX2A 5E1QA 5CZTA 1WDWA 3HG3A 3Q2DA 3U6WA 3W7MA 1HL2A 2X1RA 1TO3A 3PF3A 4M6QA 3T55A 3LHTA 3W7DA 3G1DA 4MLRA 3OIXA 1B9BA 4MYXA 1LORA 4O53A 1KM3A 5D04C 2E6YA 3S1WA 1ADOA 5G5IA 5LZLA 5BNKA 3RMJA 2E6AA 1SW3A 2A7RA 4NJIA 4JYEA 1SQ7A 3S1XA 1TPFA 4S1FA 4PODA 1YDNA 3DFPA 3EX4A 4PL1A 3HPXA 1WBJA 8TIMA 2AQWA 4AF0B 3P67A 3O63A 4UMAA 4FX8A 3ABRA 4WQ6A 2CU0A 1W31A 3SGZA 3STEA 3S8HA 2RKXA 4WY0A 5LNWA 1TSIA 3G18A 4EIVA 4O8RA 4O4VA 3GNNA 1VH7A 3P5YA 2A4AA 2C19A 1JJKA 2WKJA 3FJ6A 2WO5A 2O7SA 4JX6A 2NXGA 2QCFA 4CNOA 3GXPA 2J24A 3W85A 3DI0A 1RV8A 3BLIA 1AG1O 4JTTA 1N8FA 3W23A 3L5MA 1TV7A 4FX7A 5BMXA 5FEZA 1FWRA 1ME7A 3M47A 3A23A 5G4EA 2ZZ6A 1Z48A 1FXQA 1K8ZA 1H7OA 1XBXA 3TA6A 3EXSA 1VYRA 4RKAA 3I7QA 1TTIA 4HPJA 3GAKA 4JIQA 1WYIA 5CPNA 3L0GA 1H62A 1R2RA 2E09A 5E93A 3ELFA 4ONVA 2WV8A 3C2OA 4K6AA 2WNNA 3QQ1A 2PRMA 3NVTA 3S5NA 4UFIA 4LRTA 2ZZ5A 2YSWA 1MSSA 2ZQ0A 3DGRA 1I2RA 1UCWA 2NV1A 4DF2A 3NQ8A 5H2ZA 3TW7A 3VKJA 1U5JA 3LLDA 3LERA 3LRMA 3UZJA 5K9XA 4O4WA 2HTMA 3R12A 2GUUA 3TCEA 1WOAA 3LI0A 1IXNA 1VR6A 2JKEA 3HQ1A 1ML1A 4MZ8A 5AOUA 2J6XA 4DQWA 4IX2A 3D0CA 1H7RA 3FJLA 1HTIA 3BG3A 3FS2A 3THQA 5AYZA 3V75A 3PM6A 2VXNA 1TTQA 1LRTA 4QSHA 4MOZA 2G96A 3LCFA 1LOLA 4O1AA 2OT1A 3I6RA 4XBKA 1WAUA 2C14A 2QJIA 1J5TA 4MJZA 3CB8A 1GQNA 1YPIA 3W7NA 1P1XA 3BLFA 3QM3A 3W9ZA 2EF9A 3KFTA 2A2IA 2Z0IA 4QM1A 3W1MA 3G0UA 4L4MA 3FKKA 3CWOX 4AAJA 4LT9A 4HN4A 4BI7A 3WK3A 1EPXA 4POCA 1OX6A 1DQWA 4C1LA 3M7WA 4MY1A 4ZVJA 4EWND 3HO8A 2DZUA 3I7SA 2CW6A 2PRHA 4GRSA 4A21A 2QF7A 2JKAA 1YXDA 1JRBA 3SJ3A 2FB3A 2AAMA 2AGKA 3UNDA 4FB7A 4Q4KA 3CT7A 4RZ4A 1T96A 1XDLA 3W7PA 3QW3A 4E0CA 3LTSA 4JDBA 4CNNA 2BWGA 3DHFA 1D3GA 3CU2A 1GT8A 4OU1A 1W56A 3L66A 5LKYA 1X1ZA 1TPWA 2TSYA 1F73A 4BR1A 1YPFA 2CZ5A 5F4WA 3KXQA 3INPA 3G24A 3MYOA 5CKSA 2X1TA 3C6CA 5AC7A 1TREA 3LM7A 2WNZA 3PWAA 3JR2A 1QO2A 2BSLA 3IRDA 3GK0A 5L9FA 4K7YA 2NV2A 4PCFA 2ATSA 3W7HA 4CCDA 2O7QA 3EX3A 1KTNA 3YPIA 1GG1A 1S5WA 5A5WA 1RVGA 2ALDA 4XTDA 2ABAA 3CWNA 5HMSA 3N14A 4AH7A 1BWLA 1W3TA 2QCDA 2C16A 2GJNA 2CZDA 1OFAA 1G4EA 2OCZA 2PE4A 1SO3A 4IPJA 2YPIA 1X1OA 4R53A 3I68A 3VFLA 1IXQA 3GDTA 1GOXA 2YCEA 1H1YA 3VE9A 1AW1A 3N73A 4UTIA 2ZCGA 1TRDA 3KX6A 1EP3A 3OG3A 3N2XA 1L2UA 3T7VA 4HNVA 1I2OA 3W1TA 1LDCA 1OK4A 4Z1DA 3QYQA 4AF0A 4MY9A 4AWUA 4LOCA 1JUKA 3CIXA 2C13A 4O0KA 1ICQA 2Y7EA 3DKLA 2DZPA 3NQAA 4WD0A 2ZBTA 1H1ZA 1OFQA 4LY8A 4UC5A 4RZ5A 4CCCA 1EUNA 3L68A 2WSRA 1QWGA 1GZGA 3BLEA 5J5DA 3DKJA 5F2GA 4ZQOA 3KOFA 3TAKA 1XUUA 1ZENA 2CLOA 2NZLA 4O0ZA 3S5ZA 3PR2A 1TPDA 4O12A 3TU9A 3DFNA 4I7UA 2QCMA 3B8DA 4UTMA 3DENA 3NQVA 2CLEA 5HUOA 4Y90A 4C1KA 1Q3NA 5DXXA 3W7RA 3NO5A 3G0SA 3WK1A 2P10A 4RXFA 5CSSA 1N55A 4GC4A 2QKFA 3L21A 3TX9A 1NEYA 3BW3A 2OJPA 2V9DA 3NL6A 2YXGA 3PY2A 4KFNA 3UD6A 5LHFA 3LI1A 5F4XA 1FWTA 4UTHA 1H50A 4OV4A 1UUMA 2Y88A 5EA9A 3C3NA 3M5VA 3WJSA 3SZ8A 1XCFA 3IEBA 3KRUA 2FTPA 3GAYA 3P62A 5EKYA 3QPYA 3W1UA 3LHYA 1GYLA 2WJZA 3AJXA 1UBSA 4GE8A 3L0NA 3WFAA 1JVNA 5LGXA 4P61A 2QAPA 3EX6A 4R7JA 1SZGA 2A85A 5EYWA 5CG7A 2DZSA 3DH7A 3N2MA 5GVJA 1ZJIA 4ML9A 3S5YA 2PC4A 1R47A 1VLIA 3W76A 1OYAA 3H54A 5K4ZA 5HINA 2ISWA 5K7JA 3ZR4A 2OMAA 3UY7A 4GXMA 4IJBA 1L9WA 3LCWA 3CLMA 3H55A 5AHIA 2LLEA 1HG3A 1AK5A 4UNKA 2QCDB 3TQVA 4JY8A 4X22A 4MZ1A 5KINA 3LCLA 2BXVA 2YFOA 3O6CA 2Z6IA 2Y85A 4O1DA 3T4CA 1IGSA 3NL3A 3W87A 4GUHA 4ADTA 3HB9A 1H63A 1QPOA 1O60A 2Y7GA 2Y6ZA 1F5ZA 3ZFHA 3AO0A 3GNDA 2RH9A 2ZFAA 3FOKA 3P8JA 5DCBA 4WXYA 4HNNA 3HMJG 2FPYA 4HKPA 1I8JA 1SSDA 2V81A 4R34A 3RFAA 3GR8A 1OFOA 2NXIA 3B05A 1LYXA 2NX1A 3DFSA 1KM5A 1EP2A 4K8EA 2C18A 1ICPA 3G1HA 4WXZA 2B7OA 4O14A 4UFLA 1RQBA 2W79A 1F7BA 3P60A 2ZDRA 2V8ZA 1ME9A 3PAJA 4JTHA 3TQ0A 2QCLA 3DZ1A 1X6UA 2F7FA 4GJ1A 5I3JA 3LXCA 4DF0A 2VFGA 3VNDA 4U28A 4BWLC 4A2SA 1QNVA 3GYEA 3NQCA 3NZ1A 4N6FA 1ZAJA 5BRBA 2QUVA 3TXZA 1DL3A 5T26A 1RZMA 3PBUA 1W37A 5D2XA 1DORA 2QCHA 1W3IA 3A5FA 4M6VA 1VLWA 4JTGA 3PG9A 3STCA 4QAIA 4PTNA 1OFEA 2VOMA 5D32A 2E6FA 1GVQA 4JTIA 3OVRA 4KKXA 4QQ3A 4WUIA 5CPOA 1H61A 4WZHA 5KZDA 1TJRA 1KM0A 2EPHA 3TC7A 3RU6A 1TV8A 1T99A 2ZRYA 3JRKA 3PUDA 1FDYA 5D05A 1I4NA 4NZFA 4JDYA 3TJLA 1HO4A 1QOPA 3C52A 2XFWA 4CLMA 5LSMA 1T8XA 4O16A 4Y6GA 1KM6A 4JX4A 3HGJA 4PA8A 2QUTA 4NT0A 3F1QA 3TSMA 3TK7A 4A2RA 2CLLA 3UXDA 3TW6A 1WX0A 1LOSA 4XQ6A 1SO4A 2Q8ZA 4LV4A 4N9EA 3STFA 5EBUA 5CPMA 3MI2A 2H6RA 3BARA 4JYDA 3GZ3A 5D09A 3W1NA 4G1KA 3V1PA 5K3VA 5HULA 4O28A 5D2YA 1TQXA 4JGDA 2VKZG 2EKCA 1YDOA 5D38A 1H7XA 3E9AA 1LBMA 1JCJA 2R14A 4HIBA 3M41A 1H7WA 3CPRA 5KZEA 1SFLA 1VQTA 4XKYB 1OG0A 3P74A 2DU2A 3C4UA 4XZ9A 4ZQMA 1DOSA 5D37A 3EEGA 1OFRA 3NEVA 4BF9A 1OYCA 4GWEA 3N19B 3GXTA 5CZ0A 3STGA 1TPEA 4Q32A 4HPXA 5D02A 1OYBA 2A0NA 3TE9A 4X9SA 2X30A 4IMCA 2BX7A 3G1AA 3IIOA 2Y70A 5G2IA 3F4NA 4NXKA 4BK9A 2TMDA 4ZQPA 1LOQA 5BMWA 2GQ8A 1G6CA 1TMHA 4GFSA 3CIWA 2GPTA 2XN0A 3IIVA 2VFIA 1R2SA 4FNQA 4AWTA 4OQVA 3W6YA 4BWLA 5MHBA 1KFBA 4K38A 2Q3OA 4LUIA 1KFLA 1G4PA 2GQ9A 1K7EA 4KWVA 4OE7A 4JEQA 2H90A 4K39A 3TSBA 3WJZA 1Q6LA 1NF0A 2ZA2A 2ZRVA 3ANYA 3P82A 5I3GA 5I3HA 1SFJA 3B4UA 1KA9F 3W7GA 4GNJA 1OJXA 3O6YX 5EL1A 4LV9A 2YYTA 6TIMA 2TYSA 2A7PA 2Z1BA 4LVDA 2RHGA 3T40A 5HNRA 2DZVA 1JULA 3MO7A 4UTJA 2FB2A 1SUXA 1ONRA 1IIHA 1TPVA 3C2EA 3SY5A 3NQ2A 4UTKA 1C9DA 3TIMA 3N9RA 4YCOA 3C2VA 3CC1A 3TSDA 3B0PA 4K7VA 3UWZA 5DCEA 1JQVA 1EA0A 4ZMGA 2C15A 3QSRA 5K4XA 2Q3RA 2B0MA 1Z42A 1LROA 3LHWA 4YXGA 1YTDA 3MW7A 4IXXA 4TX9A 1SSGA 2CZEA 5K9CA 2C0AA 2P0OA 3WK2A 3S0CA 2H3BA 5AN7A 1M7OA 3W7OA 2IQTA 1W5MA 3W74A 1LLWA 5IBXA 4MUZA 3EWXA 1FCQA 4ADSA 1TV5A 3EXRA 4EF9A 1P4CA 3R13A 1LLZA 2QUUA 3L5LA 4Z0JA 4JY9A 5DY3A 3NYZA 4NQ1A 3SW6A 1P5BA 5CPLA 4FXRA 4FHAA 1L6SA 2Y89A 2RDTA 2HS8A 3WJWA 4FIRA 1WXJA 3EWUA 2W6RA 4N02A 5C2XA 4LRSA 1K7FA 1LRNA 5LNRA 1W5PA 3WJXA 1HO1A 4NU7A 4NJJA 2Y61A 4RK8A 1X7FA 4PFMA 1I2NA 1RD5A 2HS6A 3BO9A 4Z0SA 1XI3A 5F4SA 3TR2A 1EB3A 4ORIA 3KVKA 4PL2A 4DPPA 5HWNA 4IX0A 1XFBA 4LVAA 1JQXA 2ZZ4A 1KLZA 3VCRA 4IOTA 1FWNA 1W5NA 2VEIA 2E6DA 5DN1A 3BW2A 4O13A 3O6DA 2E77A 5HUPA 3A24A 2X2GA 4DO6A 4PC8A 4XBSA 1KBIA 1YADA 3HIJA 1CX9A 3FLUA 4UUIA 1GEQA 3LGEA 4DEFA 5U4NA 1KLYA 1PE1A 4DO5A 3MI3A 1BTMA 2V5BA 3W73A 4M5PA 3W71A 1T0OA 1VGAA 3LRKA 5F1VA 4N9BA 2E5CA 2B7PA 1XBYA 1KBJA 3PBVA 4RZ6A 4XKYA 3C61A 3O07A 1YTKA 1TTJA 3HJZA 4TO8A 4O52A 2W0UA 2WQPA 3UZ5A 3KAOA 3VI2A 3L67A 3C2RA 3O05A 1I2QA 4ZQNA 4BI6A 4LC6A 4MY8A 3NM3A 3MP3A 1GWJA 4WOQA 1XBVA 2ZZ7A 3LCGA 4IMEA 2A21A 5D2TA 4DBDA 3LCHA 4W9TA 4O19A 1SO6A 3PB2A 3M43A 3BW4A 4IMDA 2ZA1A 4O1BA 3UWWA 3FEMA 4O50A 2JK2A 1PS9A 5DCDA 1YYAA 1JCLA 1Z41A 3G0XA 3QMSA 1TPB1 4DBEA 4D2JA 4AHPA 3L65A 3KHJA 4A3UA 5IM51 4I9AA 5FF4A 4JTSA 3TXVA 1U83A 1KV5A 3PSWA 2WSYA 3NGJA 5TIMA 3W1PA 4H3DA 3M16A 5FF3A 3M1ZA 2EAWA 3UYCA 1MO0A 4XWUA 4DXVA 3HG4A 1LZOA 5DBTA 1THFD 3UWVA 3SSJA 3BPWA 4MFDA 2FDSA 1O95A 1YTEA 1M5WA 1W1ZA 5AHFA 3TROA 2BTMA 2E5DA 3CM4A 4TIMA 2R91A 3UWYA 4Z08A 2ZTKA 4JTFA 1SU5A 1JUEA 1N7KA 4IUOA 3W2MA 3KRZA 4UMBA 2YW3A 3PC0A 4S2CA 4AHQA 2GJLA 4YLWA 5L6UA 4N2YA 1RQHA 2NUXA 3W2UA 4FNTA 2KZHA 3W75A 3UWUA 4QNEA 3TJXA 3G1SA 4MPQA 1VJIA 4JN6A 1W5QA 4Z1BA 4N4PA 2BZNA 3G8EA 3UPWA 4IGHA 4EOUA 5FESA 1SZFA 5E0KA 5HR7A 4FNUA 2VENA 4MVAA 3IGXA 3N34A 4QIUA 1QFEA 1UJPA 2JBMA 5F2MA 3LXBA 5FF2A 3M5XA 4UCGA 5EPDA 4L4LA 2ZRWA 3M44A 4GUGA 5DXYA 1FWWA 1VCVA 2WPBA 1PCKA 3L0KA 1OFPA 4RXGA 3W84A 3W2JA 1H5YA 3A9IA 5HJLA 2G95A 3A5VA 3TH6A 2FIQA 1KV8A 1F6KA 3DBPA 4UFJA 4K37A 1R30A 1KM2A 3SIZA 2BLEA 5C54A 3NQ6A 1G7VA 4BFAA 4MKNA 2NLIA 3W2KA 1FBAA 1S5VA 3C56A 3RLVA 4LS1A 3LV6A 1DHPA 3F03K 3LHUA 4R33A 2CLIA 3LOTA 5TBOA 3QRHA 1D9EA 3WK0A 4UTTA 2YFNA 1QCWA 3MP4A 3NM1A 5AHLA 4DPQA 4QISA 1DVJA 3W7LA 2TPSA 1JCXA 3PUEA 4P2VA 2V5LA 3LCXA 2XN2A 3EWZA 5AB3A 4ICNA 1F76A 4NJHA 4NX5A 2QAFA 3EB2A 2A6LA 4TU1A 4CQAA 3UPBA 1XKYA 4UTUA 2J27A 3W2LA 1M7PA 3NDOA 1Y0EA 2CLFA 3W7KA 4AHOA 1H7PA 5LNSA 5AC8A 1H60A 4N9CA 3BV4A 3PUOA 1LRQA 1PV8A 4CCEA 2I14A 2YDAA 3IIZA 3B0VC 5HWJA 3LX9A 3U8GA 5K9DA 4AEOA 3IGSA 1DJQA 3LCIA 3SR7A 3TAOA 3R8RA 1EX5A 2Y7FA 2GVLA 3IV3A 3MP5A 2ATMA 3GVGA 4KFOA 4WY0F 1BEUA 2WNQA 3W70A 1A5CA 3P5ZA 1ZY9A 3QC3A 5I3KA 1W5OA 1ZFJA 1TPUA 1YLVA 1AL7A 2QCNA 1OF6A 1KFJA 2QCEA 3UQNA 5DY2A 5F1UA 1NF7A 3OEXA 3W3OA 1I2PA 3NPXA 1LCOA 4AXKA 4LVBA 1TTPA 3BK0A 1FWSA 5DELA 4UTWA 5G4WA 1KFKA 1LBLA 1GVRA 5D2VA 3THAA 2YZRA 4JR5A 1VPXA 1KFEA 3BG5A 4UTLA 4N4QA 4FNRA 2CWNA 3ATZA 4OHQA 4NX0A 2A6NA 4ZQCA 4NVTA 4TMBA 5D2WA 1W0MA 3DFTA 1B4EA 1IF2A 5FF0A 1UB3A 5KTLA 3P84A 3NL5A 1E51A 3MHGA 3VE7A 4DO4A 1EP1A 2ZRXA 3M5ZA 1TJPA 3DU0A 3TDFA 3GKFA 2FJKA 4ORMA 3QEZA 3B0UX 3E96A 4O11A 1K3UA 3HG5A 1J2WA 2V2DA 4UFMA 1H51A 4OGZA 3L9CA 4CQ8A 4OWGA 2QJHA 3Q94A 3SFKA 1PHWA 3HBLA 4UNLA 1ME8A 1UASA 5LHEA 1EUAA 3QW4B 4K36A 4MZYA 2YR1A 3W7JA 4O15A 3PBYA 2V82A 2Y7DA 3W72A 1FX6A 2Z2UA 4RV8A 1ZCOA 4XTIA 1DJNA 3GDRA 3W2NA 1NSJA 1BWKA 1WV2A 3SGUA 1EIXA 1X8FA 1ZALA 3S5OA 1WA3A 4FF7A 3O1NA 3EWWA 4YMZA 4Y9AA 1SZNA 2E1DA 1D3HA 3CTLA 3QPZA 4UR8A 2UV8G 3ZWTA 1EWEA 3A22A 4PH6A 2H8ZA 3QZEA 3HF3A 3DXIA 3G3MA 3MMTA 3B06A 4UR7A 3I7RA 4U4MA 3ZS4A 1VCGA 3P7YA 1L6WA 5C55A 3OVQA 4Q33A 1W3NA 4YL2A 4AWSA 1W54A 1Q45A 4JS3A 3KVJA 4UXDA 2GOUA 3MBFA 1TCDA 3TFXA 1ALDA 1FXPA 1QPRA 3G1VA 2TRSA 4AMAA 2QCCA 1WOBA 2V30A 1LTDA 5AYXA 5BOOA 5CZJA 1XC4A 3TV8A 1A5BA 1O94A 2PURA 1JCNA 1Q6QA 2H3DA 4QJ1A 2J88A 3UY8A 1G4SA 2VFDA 4X2RA 3W1QA 2NUYA 3SI9A 3PULA 5AHMA 2V2HA 3GX9A 2ZZ2A 3KRSA 2EGZA 2FFCA 4I7WA 3NQGA 4MLJA 2A7NA 3P61A 1FCBA 5FEWA 1C8VA 4JYFA 4UTTC 2VELA 1ZHAA 4GBUA 1F2JA 1GJPA 5SWUA 3NAVA 3GIYA 4GUFA 2Y62A 4WY0B 3NR0A 2Y63A 1ZAIA 1XBZA 5DLCA 3LTPA 1F74A 4ALDA 2PRLA 1J4EA 1FQ0A 3IVUA 3S1UA 3LDVA 5AC6A 4NNBA 4S2BA 3B04A 3OBKA 1K7XA 4GUIA 3RF9A 1ZNNA 2OX1A 3G1XA 4KWWA 5F2IA 4Z1CA 3R89A 4GUJA 1OVDA 4LVFA 2RDUA 3HPZA 4MYAA 3LTYA 1QOQA 1RR2A 4RLIA 3S1VA 1OABA 1EWDA 3NQFA 2HSAA 4IQLA 2I9EA 1LBFA 1AW2A 4JXCA 4QNWA 1V5XA 4IXHA 4IMFA 4O10A 1YDVA 3P80A 3DHDA 2YW4A 1FY6A 4Y96A 3W1RA 2QCGA 2B7NA 3IIXA 4NUWA 4PEKA 5HR6A 1VCFA 2ZTJA 5U7SA 2WSQA 4O54A 4Z1AA 3TMQA 1UUOA 3GR7A 5K2ZA 1GVOA 1XM3A 3C0JA 1Q6OA 3HG2A 2FPTA 3M0ZA 5G2HA 1G69A 1PL9A 3NL2A 1JUBA 2CZFA 4JICA 5D33A 4I7VA 4WJEA 3KVLA 2P1FA 5A8GA 5KMYA 1TRIA 4NJGA 3HPSA 2ZRUA 2VFHA 2Q8LA 3EXTA 3W1LA 4X3ZA 3CEUA 1K8XA 3G8RA 1V7YA 3GXNA 2C3ZA 5FEXA 3CHVA 1SPQA 3KVMA 3QF0A 4HT3A 3NZRA 3LV5A 3QFEA 4YWIA 3NPWA 3O06A 1MEHA 4FEZA 3F4WA 3N9SA 1B3OA 2NWSA 1NFBA 3FA5A 1HUVA 1NVMA 3E49A 3ABOA 3W1XA 4H6KA 1P0NA 3PB0A 4LUJA 5G2WA 1DV7A 5LNUA 5HQEA 1XL9A 3FYPA 2NX3A 3OHIA 4MIMA 2VFFA 1VS1A 3S6DA 5AHNA 4B5NA 4M19A 5BW6A 2ZZ1A 1VHNA 1H7NA 3O8AA 4NNCA 2CLMA 3G1FA 2DORA 3TQKA 4DELA 1SO5A 3L5AA 2YYUA 2D73A 4OBTA 1LP6A 2I1OA 4LTSA 4MFEA 5AYYA 4WOZA 2QJGA 1OHLA 2ZA3A 3G3DA 1KTCA 2NX9A 2ISVA 3E12A 3IVSA 4TR9A 3QJAA 3QMTA 1SR9A 2JGYA 4EF8A 3FFSA 4UFKA 1FUYA 2RFGA 1GPWA 3IGUA 5F2LA 3BVJA 3LHVA 2GVJA 3MBDA 1C29A 4HNTA 3R2GA 3OVPA 5J5RA 3QH2A 5CSRA 3FYOA 4FNSA 1XXXA 1HFBA 1JCYA 4KFPA 4ADUA 1VHCA 1QPQA 4DF1A 1GG0A 1DQXA 1O5XA 4H4IA 4MJMA 3GLCA 2CLKA 4LU0A 3Q37A 2WOQA 4NXSA 1FDZA 1QO5A 3P8IA 5EMUA 3TFCA 3EWYA 1IXOA 1MXSA 4JX5A 1KM1A 1PCWA 2B4GA 4M6PA 2EHHA 1AMKA 4Y8FA 3TMLA 4LNYA 3ABQA 4O18A 1B57A 1ZAHA 3W7IA 3M6YA 2HMCA 1JRCA 1JR1A 1L6YA 3MI6A 1QDSA 3I65A 3HGSA 2V2CA 4E2BA 4N9DA 1A50A 5CZSA 3O15A 3LBCA 2CFFA 1B4KA 5DBUA 2VEMA 2NUWA 3T44A 2DJLA 5HWMA 1DBTA 3GDMA 1NAL1 2QEZA 2FQIA 5H91A 1XDMA 1CW2A 2GQAA 3GB6A 1RQEA 3QSTA 3H53A 1KFCA 1OX4A 3IIPA 3MJYA 4UFHA 2OZ0A 4JTKA 3NQDA 5I3FA 3TC6A 5C6MA 2DZTA 5FEPA 1TYGA 4FIQA 2NXHA 4M7TA 1KTBA 4XUGA 3SECA 3UXAA 4FX6M 1G7UA 3DFQA 3QMRA 3MUXA 4J9JA 4HNUA 1G67A 1PHQA 1P0KA 1FDJA 1SW7A 4RR4A 5TQLA 1GYNA 2X1SA 5KSWA 2JGQA 4JNMA 2J9ZA 5FI8A 2QR6A 1QAPA 3QQ0A 4OV9A 3B03A 1SW0A 2V0TA 1YXYA 5ABTA 1W8SA 3N3MA 1OX4B 1VZWA 1Z44A 1MEWA 1A53A 4LVGA 2JKPA 4LS2A 2CLHA 5KITA 1OX5A 1WBHA 3FKRA 1F05A 1I45A 3EKZA 2DZWA 3GDKA 2DZXA 3DI1A 1AW5A 3NQMA 4FO4A
chains in the Genus database with same CATH superfamily
3T0CA 3RLUA 1CNVA 4JIEA 2XN1A 5FOOA 2DUZA 4A8LA 3ZOAA 4JHZA 3NA8A 2ZUMA 5ABGA 3EA3A 1XLCA 1MZHA 2X0SA 4LBRA 3A9BA 2J78A 3AXMA 3SCNA 2OVLA 4HCHA 3JVAA 4C6EA 1WDSA 4F0SA 2GVGA 2PA6A 2ZYFA 1UHVA 1NWRA 1R46A 3CPGA 4UTWC 1SFTA 3W7EA 3H7UA 3UG3A 4ZOBA 2W61A 3TN3A 3WUEA 2FGBA 3H26A 1XFCA 2I57A 3N9KA 4HMNA 5D30A 3W1AA 4XVEA 1OD0A 1ICSA 5FJIA 3TTYA 5I3IA 3MKVA 1PZ3A 2DSVA 1GVFA 3PPHA 3T0TA 2BNJA 4J3WA 4QG8A 3VPLA 1UQYA 4FA3A 1G4TA 2OSXA 3CZKA 4C6NA 4UIOA 3AMGA 3CZ8A 3OA3A 5FF7A 5FJJA 1LM1A 4DI8A 1SJBA 1BXBA 4DJDA 3FIGA 1S3HA 4RNJA 2Y1HA 3MUAA 1DPMA 2HBXA 3GKAA 1Q6EA 1R3WA 4C91A 5CGQA 4GZJA 4YVVA 4U3AA 3AXHA 2QDGA 3LXAA 2FLIA 3S9YA 2GSJA 1FCUA 2ISSA 4GZIA 1AZ1A 1OCBA 2I9UA 3KOYA 3U2OA 4J3VA 1YNYA 2WZEA 3GWQA 2R94A 7TIMA 4JOMA 4IPIA 5IBXC 3AHZA 3NG3A 1XIFA 4JTUA 1LUCB 3NQ7A 1MW2A 3WLJA 4Z17A 3QHNA 4A29A 1BTCA 4QITA 5EMKA 3PBMA 3E02A 1EPVA 3TLQA 4AD4A 5LGZA 3B9AA 1XH1A 2VFEA 2ZZ3A 2HPIA 3WBYA 4M7SA 3NOEA 1XPYA 3M9YA 2A5HA 2PDUA 1RUSA 5D9PA 2VEKA 1Q6GA 3P3BA 4XZMX 1UC5A 1YQ2A 1CI1A 1RCXB 4HSOA 1SZEA 4UQ9A 1GZ1A 4C6OA 3R6IA 1XISA 4CNSA 4ZR8A 5FKYA 2D69A 3K30A 1TCMA 3HMCA 4K8HA 3GNPA 2SFPA 3FJ4A 3C8FA 1VRDA 3GU1A 2GUYA 4PMZA 4A35A 3ABSA 1I1WA 4JTJA 1V0MA 2Y5SA 3WQCA 1B54A 4Q6JA 1TPH1 2UWFA 2F6UA 2CBIA 4J3ZA 2WKLA 3I4EA 5A6AA 2G5WA 3TN6A 1XS2A 3HGOA 1IZKA 4MGGA 1TE1A 1EX1A 4A22A 1PIIA 4PN2A 1NP2A 4H01A 2E5BA 4QXIA 4LSBA 3W22A 3EX2A 5CZTA 1PTAA 2BGSA 3HG3A 3Q2DA 1WUFA 5A2CA 3PF3A 3T55A 2CPUA 4Q6XA 4IICA 4MLRA 3R8HA 5D04C 1VFMA 1H1NA 1XSJA 4RE4A 5LZLA 2BHYA 5BNKA 3RMJA 2E9BA 4JYEA 1SQ7A 2WYSA 1NWUA 1XYFA 2QVHA 4IT1A 8TIMA 4AF0B 1UWIA 4UMAA 4DYJA 2OYKA 2V5JA 2Q8XA 4DZIA 4KEZA 2CZVA 4J3UA 2VZOA 2PP1A 2CERA 1E55A 3BCDA 4O4VA 3GNNA 3QN3A 3ARTA 5AVHA 3LQLA 5HOSA 2J24A 3CL7A 3W85A 4F79A 3DI0A 4HNOA 2HVNA 3BLIA 4JTTA 4QJ5B 3VNYA 3LMYA 1PX4A 1JAKA 3M47A 3A23A 5G4EA 3ARUA 1H7OA 4LAZA 2CBUA 3FVMA 3TA6A 1VYRA 3CV1A 4WCJA 4RKAA 3BAYA 4FLSA 2ACSA 3B8SA 1WYIA 1J01A 5LIUX 1H62A 1R2RA 5CC3A 4OUIA 3C2OA 3QQ1A 4GMEA 4JL1A 3B9NA 1J0YA 4D8LA 1PKLA 1GK8A 5C7VA 3KW3A 1I2RA 1UCWA 2NV1A 4E8CA 4TUFA 2OO6A 3NQ8A 3LLDA 3T08A 4HK7A 3ENLA 2F9RA 1PZ1A 5FJPA 2HTMA 3QQWA 3LD5A 4B3KA 1MDLA 2GUUA 3GTXA 3AYSA 3AIVA 1ML1A 4MZ8A 5AOUA 1J9YA 2J6XA 3O7UA 1E6QM 1EQCA 3GBDA 5ECUA 1XCWA 1HTIA 1PX8A 1XLHA 4EACA 3V75A 4DY1A 3AIEA 4QSHA 3ABXA 3DN5A 3POCA 3LCFA 5REQB 4TTUA 1GOOA 2AMGA 3I6RA 4MJZA 3CB8A 3P0WA 4G2DA 2WC7A 2MUCA 5HBFA 2PI6A 2Z0IA 1HXJA 4BQ4A 3LGGA 3Q65A 3WH6A 1PKNA 1UZDA 3D47A 3AYRA 4H6RA 4HN8A 3RYSA 3CWOX 1VBUA 1ITQA 1E71M 4POCA 3H24A 1QNQA 5CG0A 3OA5A 2PTZA 3ZJ6A 3ID7A 4MY1A 1JF5A 2XTKA 4EWND 1NU5A 3BAJA 1NTHA 1GUVA 4GRSA 5C0QA 2QF7A 1UR2A 2Y4SA 2AAMA 4CCZA 2Z7GA 3VCNA 1EJUC 2VZVA 3CT7A 1UD5A 1NWTA 2RAGA 2Z1XA 4JQAA 5LKYA 4C1NA 1E6PA 3V16A 1J5SA 1E3ZA 5F4WA 4E4FA 3INPA 3N4EA 3MYOA 1H41A 3UXIA 1OY0A 3JR2A 2BSLA 5E0FA 1CECA 2FFIA 1TIWA 4C5YA 2X7WA 1DIKA 5I24A 2HBVA 4K7YA 4OOZA 3GD6A 1XSIA 3QLDA 2WZMA 3W7HA 1KTNA 3F5JA 4KWUA 1JL8A 3U0HA 2DQXA 3VIGA 4PRRA 3A12A 2ALDA 4HA0A 2WJFA 4MKVA 3DBNA 5CJMA 2C16A 1OFAA 2REQB 3SCRA 1C8XA 6XIMA 3I68A 4UTIA 3N73A 4IFOA 4J40A 3OLIA 1GGOA 4HNVA 4Z1DA 4JPGA 2F8QA 2VGGA 2ZUNA 4AWUA 1EXPA 1R5YA 1Q65A 1R8LA 4LOCA 3UNTA 4LEQA 4Y8EA 4W5UA 4IQEA 3CIXA 4DN1A 2Q02A 1MW1A 4AW7A 5I6SA 2ZX5A 3TTOA 1KC7A 4MUPA 3MU7A 3RX4A 4QE1A 4WDXA 4PMDA 4M1RA 1XSKA 4HOZA 3CZEA 1WXZA 2WMJA 3B0YA 1MQPA 4IFKA 3DKJA 2PS2A 4ZQOA 2ICSA 2CEQA 3DGBA 1EJVC 4YHGA 2QCMA 2WWDA 6PTDA 3NQVA 3TP4A 4UQDA 1OZQA 4Y90A 6A3HA 2W5FA 5DXXA 3WK1A 4GVFA 1V3IA 1EIBA 2P10A 5D8WA 2J6VA 3L21A 4GNVA 3ZMRA 1NEYA 3BW3A 2HK0A 4OFCA 2V9DA 3SCPA 3SCSA 3UGVA 3MSYA 3ZYZA 4EKJA 3ZT7A 4KFNA 3UD6A 3LI1A 3VKCA 4UTHA 3NZGA 3AMLA 4DWSA 4G8TA 3SZ8A 3EWDA 4A8IA 1EHAA 3KRUA 1GKPA 1WZKA 3C0SA 5HQLA 3QPYA 3W1UA 3LHYA 4QHRA 4C6JA 1GQJA 3APGA 1UBSA 3IK4A 4D6EA 3ZSTA 1TV4A 1JVNA 5D9MA 3UG5A 2Y2WA 4R7JA 5EYWA 1FWBC 3DH7A 1ZJIA 2I5IA 4L1WA 3BXWA 3H54A 3T81A 5K4ZA 5HINA 2XSAA 5K7JA 1O1ZA 2A3CA 3CV6A 3UY7A 1EA9C 1R38A 2XVPA 1PZ2A 3URQA 3H55A 4CN6A 1AK5A 3M0MA 3VD5A 1MVYA 4D72A 2Z6IA 4O1DA 3W87A 3PZ9A 4GUHA 1KKOA 4DJFD 3HB9A 3WQDA 4GY1A 1H63A 1JD7A 4YIWA 2Y6ZA 5JIPA 3ZFHA 4XAYA 5T9BG 2ZFAA 1IWAA 3P8JA 4WXYA 3DG6A 3HMJG 2FPYA 1I8JA 2WSPA 2BDQA 1DHKA 2PDHA 4MWAE 3E2RA 3F4VA 4LNCA 3R11A 4LJ3A 2D0FA 3WQ6A 4JHOA 3QOKA 1HZYA 4O14A 3T07A 5ABHA 2Q09A 1D7KA 2QCLA 1TUXA 3WFZA 2VFGA 2R6OA 2OSYA 2WQDA 5H8PA 1VIWA 4BWLC 1HJWA 3NO1A 3NZ1A 3SCUA 3AIWA 2QULA 4D6GA 2QUVA 4Q4PA 2F61A 1H4PA 5T26A 3PBUA 1DORA 2YZ5A 3FAXA 4M6VA 1B1YA 2VQUA 3GVWA 3H2NA 3EEZA 4G1NA 4JTIA 4NL1A 3OVRA 1TFVA 4QQ3A 4DUOA 3N12A 4WZHA 3GVQA 4NAFB 1TJRA 1ZBWA 3BCFA 2W92A 2F6KA 4DJEC 3M0IA 4GHRA 3TC7A 6TAAA 1XLKA 4B90A 5AYIA 1ISWA 3TJLA 1J0KA 1HO4A 2CWXA 2QJJA 4Y6GA 1XICA 3TVAA 2QUTA 4NT0A 4DXKA 4H1ZA 3F1QA 3DHUA 1A5OC 5I2UA 1DXIA 1EH9A 3TK7A 3RO8A 4YTUA 3KZPA 4FS9A 2BG5A 3AALA 2I56A 4M3PA 1WDQA 2PDFA 2PGEA 3OZPA 3VU2A 3WD2A 4Q22A 4JYDA 5D09A 3W1NA 3V1PA 5K3VA 5HULA 4O28A 4DJEA 2GGEA 4XO6A 2WZTA 3MS8A 1YDOA 5AY7A 5D38A 1GZJA 4B4FA 1H7XA 4WKFA 3DERA 4LYKA 3UR5A 3SUTA 4CQCA 1JCJA 4J3TA 3H8AA 2R14A 3E0VA 5EU9A 1H7WA 5E6YA 2REQA 3NCOA 1OG0A 3P74A 1WKDA 2X05A 1C9WA 3NEVA 3L4WA 3GXTA 1P0BA 1WAWA 4F2TA 2XVNA 2Z1KA 4X9SA 2X30A 2BX7A 3IIOA 2Y70A 1UD3A 3CPUA 3F4NA 4I8DA 1LOQA 1XGZA 1TMHA 4GFSA 1EYEA 1WP6A 4BEUA 3VOHA 1P7TB 4B15A 4OQVA 4QX4A 1AQ0A 5MHBA 2R24A 2PU0A 2GQ9A 3WF3A 5HPCA 4OE7A 4JEQA 4IIFA 3TSBA 1TELA 4GVIA 2Q01A 2ZA2A 3ANYA 3GUWA 4DO7A 5I3HA 3B4UA 3W7GA 4ASTA 4XISA 1V0KA 4LXFA 5M1TA 6TIMA 1JPMA 2BVWA 1FKXA 4LAMA 4LVDA 3JUGA 3T40A 3VGGA 4D6IA 2FB2A 4MMWA 3HPAA 3C2EA 2PDWA 5T9CE 3B9DA 3NQ2A 3TIMA 1XGEA 4YCOA 3C2VA 4HMEA 3SCVA 3CZLA 3H2EA 3Q67A 4K7VA 3I6TA 2A79A 4XV0A 4Q7NA 2VP8A 1E6SM 3QSRA 3GSMA 3MUZ1 2B0MA 4YXGA 1YTDA 3EDDA 2CZEA 3WX7A 2DFAA 3OZMA 2WMHA 1RAKA 1M7OA 3W74A 3WDRA 2PZ0A 5BYWA 4LANA 4ADSA 2OXNA 3CO8A 2FH6A 3AS3A 1B3VA 4RUBA 2QUUA 4Z0JA 1JPHA 2FGZA 2PLKA 5CPLA 4QDPA 7ENLA 3AXXA 7TAAA 2Y89A 2RDTA 5M03A 1TMLA 3I10A 4PCPA 1GHSA 4B9ZA 3GU2A 1Y5XA 2BXYA 4PB5A 3RCNA 4NU7A 4Z2IA 4NJJA 2Y61A 1GONA 1RD5A 3DYMA 4F0MA 4IP7A 2OYMA 3BO9A 3WF4A 3L4UA 1EB3A 4IX0A 1XFBA 3KTXA 4IOTA 4TV6A 2E6DA 3BW2A 4O13A 3O6DA 1IR1A 4LBUA 1KBIA 1YADA 1CX9A 3MVIA 3FLUA 3DECA 3WD0A 4DEFA 5U4NA 2ZXAA 6XIAA 4DO5A 1TWDA 3MI3A 4Q8PA 2V5BA 3W73A 3BDKA 1VGAA 2E5CA 2J7CA 4Y2WA 1KBJA 3PBVA 2WLYA 5A8NA 4LB4A 4K2SA 1TTJA 4IZGA 3HJZA 4TO8A 5M2FX 3ALFA 1XLMA 2HPMA 1QASA 4ZFMA 2RUSA 3KAOA 1UP2A 3ITTA 3L67A 4LC6A 3MP3A 3UG8A 2DIEA 1ESWA 1QUMA 1YE6A 3MWCA 4PE8A 1UKTA 4KS0A 5D2TA 1ISXA 4EP8C 1SO6A 1K70A 2ZC8A 3DUGA 3M43A 4IMDA 4O1BA 4BHYA 2JK2A 1D8WA 1PS9A 2TODA 4KBXA 4UQCA 3W37A 3KS6A 2G3FA 5CH9A 9RUBA 3STPA 4D2JA 3KHJA 5DT7A 2FVKA 3FXGA 2HJPA 3WL1A 1M7XA 3AJ7A 5IHSA 3M16A 5FF3A 3M1ZA 2QJMA 5CJ5A 1WZAA 1IT8A 4QE4A 4XWUA 3AROA 1LZOA 4XZHA 4WJXA 5DBTA 2X0YA 2EG8A 3SSJA 4MFDA 3A13A 2FDSA 4V33A 4PBFA 2E5DA 3THUA 4JTFA 2WZIA 1F3XA 1UIOA 4DNHA 2WC4A 2YL8A 2NUXA 2KZHA 1KGWA 4W87A 1VJIA 4UWMA 3P2VA 2BZNA 4FXFA 1OGSA 3VKBA 1ITXA 1U2YA 1UWQA 3TYZA 1DJGA 5E0KA 5HR7A 3RCYA 4FNUA 3IGXA 1UJPA 5FF2A 3M5XA 1CXHA 1UJQA 2A3LA 5EPDA 2XGZA 4D6FA 4L4LA 3LGDA 5A2AA 1SR0A 1XIBA 2HEJA 1EJRC 4GUGA 3MPGA 1FWWA 2OWWA 4G9PA 2WHLA 3L0KA 4JTRA 3W84A 3A9IA 2FIQA 3GYCA 3TEVA 2Z2AA 1R30A 4LF1A 3WH5A 1P48A 2WMIA 3C56A 1GOQA 4F66A 1VBGA 2XVGA 4R33A 4KGLA 4EXQA 2CLIA 3LS9A 1XQKA 4GNKB 1Q8JA 1OCQA 5EFFA 3DFHA 3MP4A 2DT0A 2CITA 3NM1A 1X97A 1QNOA 2TPSA 2VURA 4RDVA 4RDZA 3WH7A 3EWZA 1F76A 4NJHA 4KPLA 3EOEA 2FZNA 1FH8A 1W91A 1S1RA 3CAKA 1XC6A 3GW0A 3W2LA 2XGBA 4W84A 1H7PA 1H60A 3R8GA 3PUOA 2BFGA 3DIPA 5HWJA 1RXOB 4AEOA 5I7GA 3CHCA 2ATMA 3GVGA 4KEVA 4KFOA 3W70A 3P5ZA 1ZY9A 1W5OA 5HNNA 1AL7A 1OF6A 5H8UA 1KFJA 3O3RA 3W3OA 5CAKA 3GQYA 4LVBA 2FDMA 5DELA 5JVLA 1LBLA 2BY1A 2AGTA 4JR5A 4BJHA 3LBOA 1KRBC 3QV9A 3ISIX 3UR8A 3A4AA 4I90A 4NX0A 2A6NA 3F4DA 5FF0A 3PZGA 2OWXA 4OJYA 3PZOA 1HF6A 2ZRXA 3NSNA 4Q8QA 3NEHA 5A6MA 3QEZA 2CXGA 3HG5A 1ZL1A 1J2WA 2V2DA 5FJTA 4PZVA 6ENLA 5MF5A 2NW0A 4CQ8A 1Z6KA 4H00A 2DSWA 3BQ6A 7PTDA 3V3WA 2WBGA 4WSHA 3PJXA 4L7ZA 4UNLA 4JKKA 1HJVA 1PUDA 3QW4B 2YR1A 2VI0A 3W72A 3TNBA 5GNXA 2QMJA 4RV8A 3UF9A 1UWRA 5C2CA 2WMKA 4XTIA 3GH4A 3N2CA 3QGVA 2PAJA 1EIXA 4IQJA 1X8FA 3SY1A 3S5OA 1WA3A 1SZNA 4H9YA 1EOKA 3QPZA 3ZWTA 4ECLA 3LPFA 4NZ4A 4GKLA 3QZEA 4FAMA 3HF3A 3PPCA 1IQ8A 1UKOA 2XZ9A 5HPOA 4B5UA 1E1FA 4ERGA 3VIHA 3UZWA 5IHRA 3CO4A 1VCGA 4C60A 4CU8A 3P7YA 2E8ZA 5C55A 2WM1A 2EBNA 3AHVA 3G2GA 3R43A 3BZGA 3CBWA 4UXDA 2GOUA 3AAMA 4V27A 3EOLA 2FHFA 3KWXA 3TFXA 1ALDA 1UD6A 1QRQA 4AMAA 1LTDA 3BJFA 5CZJA 1A5BA 1JCNA 4HJWA 4QJ1A 1MI3A 4GLEA 3W1QA 3VIOA 5AHMA 1JFHA 4PMYA 2ZZ2A 4MNLA 3M0VA 1XRTA 2D3LA 3QY8A 1YNPA 3N13A 3VZXA 4B92A 3K5XA 5FEWA 5I23A 1AD1A 3VABA 3VNMA 3FW6A 4QP0A 2CC0A 4GUFA 5I77A 2F6XA 1ISYA 2Y62A 1R86A 2DH3A 3NR0A 1UWAA 1ZAIA 2AKMA 1V3JA 3GO2A 2CHRA 2D2OA 4ALDA 2J8FA 3LENA 4W89A 3K8MA 1J4EA 3IVUA 2DVUA 3ALGA 2X2YA 2XVLA 4GD0A 3TZFA 1ZNNA 4GIEA 5LIYX 1GYMA 3H23A 4LVFA 2RDUA 4LUTA 1QOQA 3BAKA 3PZMA 4RLIA 3GIQA 4FPSA 1EWDA 3H6OA 4IMFA 4O10A 4PUJA 1FY6A 4Y96A 2QCGA 1ZUAX 1JPIA 3B9EA 4NUWA 2RJHA 1VCFA 5ENLA 2ZTJA 2OELA 3WNPA 1UUOA 3HM7A 1XM3A 1Q6OA 2X42A 2FPTA 3M0ZA 3KBVA 3LLXA 4JICA 1PSCA 4QRNA 3R0KA 3R25A 1MNSA 1OZMA 1TRIA 3MCOA 3CB3A 2DY3A 3M0HA 2PWFA 3V4BA 2Q8LA 4US5A 4YTQA 3UBPC 4Y9NA 3CEUA 3DG7A 3R4IA 1W1IE 3KTSA 4P8WA 3G8RA 1RP9A 1J0HA 2C3ZA 2X09A 2FHCA 3KVMA 3BLLA 3QFEA 4PUWA 3H4XA 3F4WA 4OTKA 1US3A 1NFBA 3FA5A 1SGJA 4M80A 1F07A 2NT0A 1ITUA 3PB0A 1K1DA 5HQEA 2CLPA 3OHIA 3ZJ7A 2PGWA 5FJOA 1VS1A 3S6DA 2R82A 2G8ZA 5AHNA 4B5NA 1VHNA 1H7NA 1ONEA 3B8TA 4F0RA 2Y8VA 4MWAC 2D73A 2I1OA 4MFEA 1I0DA 2W66A 2O9RA 3ARVA 4RV3A 4FSAA 1BGAA 2JGYA 4JTQA 2XIOA 2VRQA 2XFRA 3FEQA 4MJ4A 3IGUA 3N29A 3BVJA 3LHVA 1T5AA 3MBDA 4I9JA 3WLMA 1POJA 3ZQ9A 3T6CA 2ZADA 4RPQA 4IFRA 4KFPA 4ADUA 3S4TA 1QPQA 2WNWA 2PP0A 4CVWA 1R3VA 4H4IA 2R1NA 2WOQA 4ACZA 1B5TA 1J11A 1QO5A 3P8IA 1KBLA 2EPMX 3EWYA 2AAAA 4JX5A 1TWZA 2PWDA 3H12A 1DIEA 4BEQA 2AL1A 1ZCCA 1L6YA 4CVUA 2D24A 3GHSA 2BOGX 3AS0A 3I65A 1EQPA 3MT1A 3PNZA 4IMAA 3HGSA 4L56A 9CGTA 3RIKA 3AQUA 2ZUWA 3BUVA 2WSKA 5DBUA 1DBTA 1NAL1 1XDMA 2GQAA 1RQEA 3GXMA 3QSTA 5JQ9A 1W2PA 3NQDA 4HMCA 5I3FA 5C6MA 1JZ4A 5FEPA 1X6LA 2QQ6A 4LYQA 1MRAA 4QR6A 4XUGA 5HXMA 4R7WA 1U30A 4J9JA 3ONCA 1SW7A 5TQLA 1HVQA 4C6MA 5FI8A 3QQ0A 1SW0A 2QXWA 3VDCA 3PZQA 1H2JA 4H9XA 1VZWA 1MEWA 1A53A 4LVGA 3ECQA 3EPMA 3MMWA 5A1AA 1E6ZA 2CLHA 2VR5A 1OX5A 2ZX9A 4YNGA 1F05A 4NY2A 3IGHX 3GDKA 1W1VA 1AW5A 3NQMA 1TVNA 2DIJA 4OBRA 2ASHA 4JTLA 4LUTB 2UY5A 2YGYA 1ZZMA 1XYMA 4QTGA 4UCFA 1GVSA 2B7QA 4EPBC 1XG3A 3LRLA 3LSCA 3CQHA 4HHPA 3OBEA 1DTNA 4IHCA 2ACUA 4WX2A 3TNOA 3OZOA 4XAPA 4CNPA 3WENA 1NDYA 1F3TA 1P43A 3BSMA 4ML4A 3WBXA 1GTEA 3WJYA 5I09A 2B31A 1W9BM 3BG9A 1KCLA 3MSGA 1XYZA 3ITOA 3WUFA 2J9YA 4O17A 3GVVA 1JDFA 3KUMA 3MHFA 1YXCA 5D03A 5G1YA 2EJ1A 3E0IA 3W7QA 3HOJA 3D3AA 4UNIA 3ATYA 2PFHA 3WLKX 8XIMA 4D1JA 4TTGA 4NZ5A 3M5YA 1FCVA 5HK4A 5JIWA 1VPQA 4O57A 5C2GA 3E0LA 4C65A 4ZZ9A 3OODA 4H2HA 2NVDA 4QJ3B 1O66A 7REQA 1BHGA 4C5ZA 2VC6A 3MWAA 1SFSA 1UR4A 3W83A 3IANA 5D9OA 4W7UA 3GDBA 3EMCA 1Q6RA 4UMCA 4RJEA 3AI0A 5DEZA 5E09A 2ZRZA 4OBSA 5DRIA 1QI4A 2QGYA 3OG2A 3DFOA 1WQ5A 3PHAA 1IIGA 3ITYA 1XJBA 3MHUA 2E3ZA 1TIMA 3GVRA 5AFDA 2EPLX 1O68A 4O1CA 4JQ1A 4AIBA 4XBJA 5I02A 3NQEA 1MUMA 2V67A 3CEPA 3TONA 1UWTA 1R2TA 4R88A 3QZ6A 4I6VA 3CZGA 4GX8A 4EK7A 4IISA 3ES8A 4RX0A 2A1YA 1EEPA 3K4DA 4FI4A 1K8YA 3SQSA 1OFBA 4NJKA 1TQJA 4RCXA 1P6WA 1KW1A 4JTEA 4XD5A 3HGRA 2E0PA 3GRIA 1LWJA 5KZMA 2PUZA 3OLEA 3BGGA 1DJIA 5LNVA 3VD3A 4REQB 3IPWA 4GIAA 3KWSA 2C6QA 3USBA 4H8HA 2CBJA 3TKFA 4DWSB 2DJXA 1TR9A 4H9MA 1BKSA 2ZXDA 3WMBA 4MTVA 1UWSA 3Q58A 4NNAA 1JDCA 2UZ9A 3CWHA 1VYSX 3W25A 4ATLA 3ZJ8A 1US2A 3WLNA 2PCQA 3A4WA 1IZJA 2W3ZA 3L2IA 4LS0A 3KP1A 1MMFA 1GKRA 1LL6A 1W17A 2WCGA 5E5CA 3WD3A 4US5D 4MAZA 4JL2A 1XUZA 2ISFA 4IF2A 1HGYA 2IKGA 4KRUA 3MDUA 4AIOA 1WDWA 3W7MA 1HL2A 2XFFA 4MB1A 2X1RA 4M6QA 3G1DA 1B9BA 2ZVRA 4MB5A 2E6AA 1R3QA 1SW3A 2A7RA 4NJIA 3S1XA 4S1FA 5JBEA 4PODA 3DFPA 3QPEA 2VZUA 1CENA 2XWEA 2J66A 1P6BA 1WBJA 2AQWA 3BQ5A 3GE7A 2HXUA 3ABRA 3LEPA 2CU0A 5XIMA 2FHBA 1Y5VA 2RKXA 4WY0A 3CS2A 1Q7MA 1TSIA 3MV11 3SBFA 1PX3A 2A4AA 3EMZA 1KCXA 1YNQA 3WH8A 2QCFA 4CNOA 5EFDA 3GXPA 2QPSA 4HHHA 1ENUA 2BY0A 1ZPTA 4IPLA 1WKEA 1E0VA 3L5MA 3W23A 1DJZA 3I6EA 4FX7A 3VCCA 5BMXA 1FWRA 1ME7A 2HNEA 5FACA 1BRLB 1DWGM 1EBHA 4F48A 1XD0A 1Z48A 1WB0A 3AFBA 1C8QA 3K4AA 1RA5A 4KWSA 4WDWA 3I3DA 4DRSA 4HPJA 3BANA 3GAKA 4JIRA 3WQEA 3ELFA 2V3EA 4RE3A 4K6AA 2WNNA 2PRMA 4XD6A 5AC4A 4AFYA 4F0HA 4J27A 4YWSA 4DF2A 1MRQA 3VKJA 1K8CA 1P1MA 4XZWA 2HVOA 4OZOA 2OZ3A 4O4WA 1IEVA 5AC5A 1JPDX 1RBAA 1ZQ5A 1ONWA 3WCZA 3SUWA 4E4PA 5I06A 3BAIA 2DVXA 4A05A 1IXNA 3WYZA 1HKMA 2GJRA 4TX8A 1NOWA 3C5QA 3JZEA 4IX2A 1H7RA 5IRPA 3BG3A 3FS2A 2OLSA 3R0DA 2C7FA 1TTQA 4PCNA 3PANA 1LRTA 2G96A 1A4LA 4MAVA 1LOLA 4Q4QA 1Q6CA 4HGXA 4XBKA 2XH2A 1WAUA 3BLKA 1J5TA 1GQNA 3KDNA 3W7NA 3BLFA 1RALA 4H7VA 3W9ZA 5AECA 2EF9A 2FMOA 4EPKA 8CGTA 3W1MA 3G0UA 4XG1A 4L4MA 4XKMA 4L4OA 4AX7A 3FKKA 3VOJA 3CHFA 3MA8A 3TWBA 4BI7A 1AQMA 1D8CA 2GVEA 1OX6A 4C1LA 1RJRA 3CH9A 4ZVJA 3WBEA 2DZUA 3U7BA 2PRHA 3V18A 4A21A 3ZR5A 2G41A 3N25A 1K9TA 3SUVA 4Q8NA 3UGRA 1JRBA 3SJ3A 2FB3A 4YTTA 4MSSA 1WUEA 4FB7A 1X98A 1T96A 1XDLA 3S5SA 3VNJA 2OFJA 4E0CA 3N2BA 3DHFA 1D3GA 1GT8A 2C0HA 1W56A 4HYRA 4PEEA 1TPWA 2TSYA 4MNMA 4UB9A 4AIEA 5CKSA 2X1TA 1FFRA 5AC7A 4W4QA 3KBSA 4WRHA 2WNZA 1IZCA 5L9FA 1UZ1A 3VGDA 1QI3A 5LA1A 4OVXA 2HROA 2ATSA 4GQGA 4CCDA 2CIPA 2O7QA 3EX3A 1S5WA 4L9YA 4U5IA 4C7FA 3P14A 4OOUA 4DZ5A 4FOKA 3N14A 1DP0A 3E1F1 2QCDA 2GJNA 1W9UA 1G4EA 4DAIA 2OCZA 1TX2A 3VGFA 4QFUA 4R53A 3S1GA 4Z1YA 3LN3A 2WWCA 2HE5A 4L64A 2FZ8A 4A4AA 3WQVA 1EP3A 3OG3A 1L2UA 1I2OA 5EMLA 2F38A 1NJJA 4L6DA 2PCEA 4CU7A 4O0KA 1ICQA 2O9TA 1E0UA 3DKLA 4U10A 1CLKA 1E5JA 3D6NA 3BV7A 5ABFA 2ZBTA 3U4AA 1H1ZA 1OFQA 3LMZA 3MY9A 3GHUA 1G0CA 4UC5A 2YKKA 4RZ5A 4CCCA 1EUNA 2VTFA 2WSRA 2RGLA 3DHPA 5F2GA 3KOFA 3TAKA 1UC4A 2J7EA 2J77A 2CLOA 4M51A 1QNRA 4B5XA 2HWGA 3BMXA 3PR2A 4DI9A 4W7WA 4W8AA 3TU9A 5E9XA 4I7UA 3VC6A 3B8DA 3DENA 3RPTA 2QW5A 1CEOA 4LEFA 3W7RA 3IUIA 3G0SA 3OIHA 3UJEA 5FJRA 3RDKA 2QYGA 5CXPA 4GC4A 2QKFA 3TX9A 4CNTA 1SJCA 1QBAA 1JPKA 5LHFA 1Q4NX 4CQBA 2Z4GA 2XINA 1YHTA 3IEBA 1I1XA 4J3SA 1SMAA 5EKYA 5CGMA 4X61A 1XLFA 3RU8X 2YBVA 1AJ0A 3L0NA 3WFAA 1ZJBA 4C7GA 3BMVA 2V3FA 1Q4WA 2DZSA 5GVJA 4DYEA 3DYPA 1E1EA 2PDXA 1RBLA 2PC4A 2YDSA 1R47A 3WNOA 2PP3A 2PDCA 1S39A 3TYAA 2V3GA 3N2TA 3KOWA 5I03A 3KLKA 1MXDA 1L9WA 3CLMA 4UOZA 1HG3A 4WGHA 2VZTA 1JZ7A 2QCDB 5A94A 1BG4A 3TQVA 4JY8A 4PUNA 4MZ1A 2Y24A 3LCLA 3WUBA 2OOFA 4X0VA 1BGGA 3T4CA 1IGSA 4GI6A 2YLAA 3AS1A 1KR1A 1C90A 3NFUA 1GQLA 3QY6A 4S38A 3UESA 1VEPA 4A6GA 1XR2A 8RUCA 3FOKA 5DCBA 4HKPA 2V81A 1SSDA 3RFAA 3GR8A 1RK6A 1OFOA 4BS0A 1UA7A 1EP2A 2C18A 4RPPA 1ICPA 3PZIA 2VDGA 3AMDA 2CXEA 1X96A 3O9NA 3TQ0A 3PAJA 1ME9A 2P8BA 3DZ1A 3F7JA 4B4HA 5I3JA 4FR6A 3SIMA 4IG2A 3VNDA 4U28A 2OTDA 4JKMA 3GG1A 1QNVA 1GORA 3R7MA 1AJZA 1L0PA 4Q4SA 3WF1A 1ZAJA 1XLLA 3TXZA 3QKEA 1CGUA 1W3IA 1XYBA 4HSHA 2OZ8A 2PWHA 2QCHA 3NYDA 3THCA 3PG9A 1UR3M 2VOMA 2E6FA 1CXLA 1GVQA 5LXXA 3DCPA 4M0XA 4WUIA 2VC9A 1FHUA 2DSZA 4IIBA 2E1WA 2V5CA 2J7HA 1TV8A 3FGCB 2XVKA 3JRKA 4JDYA 8A3HA 4CLMA 1T8XA 3W38A 1FWEC 1DXFA 1PKYA 4QG6A 2CLLA 3RHGA 1UIPA 4XQ6A 3MTWA 4S3AA 3K46A 1SO4A 3STFA 1TG7A 5EBUA 5CPMA 4GACA 2GWGA 1OGBA 3BARA 4IIHA 1NP0A 4G1KA 5CPTA 2IMRA 2W4XA 4XUYA 5D2YA 1TQXA 3MDWA 2V5DA 1TA3A 4JGDA 4GZ7A 1XYLA 1B0IA 3SQLA 4Q8WA 4NYUA 4DWSC 4NHVA 5KZEA 1SFLA 2F2HA 2DU2A 4ZQMA 1DOSA 1OFRA 5I3DA 1J10A 2FH8A 4BF9A 1XRFA 5BWFA 4Q8TA 5JH2A 3BLOA 3STGA 5D02A 3TE9A 3RX2A 1J0IA 2YCLA 1RBOB 2XDFA 4DUXA 5G2IA 4BK9A 2TMDA 3CMJA 5TF0A 3WLLA 1NDWA 2G3NA 3UW6A 4PMUA 2IPJA 1G6CA 3CIWA 4JNZA 4HU8A 3OBAA 4MNJA 1BYCA 5CGTA 2YA1A 3IIVA 1R2SA 4FNQA 2FTYA 3F4CA 3W6YA 4BWLA 1KFBA 4K38A 4FOJA 1G4PA 3EB3A 1K7EA 3VD4A 3H2FA 4PMJA 2GUBA 2FTWA 3WJZA 5CPSA 4XZNX 4MHBA 2WLZA 4ZA0A 1D3CA 1Y65A 4GC3A 1WKFA 4LV9A 2L5HA 3SO7A 3OPSA 5BRQA 2Z1BA 5LA0A 2IW0A 2ZX7A 3D3FA 3DFYA 3QR3A 1SUXA 1HGWA 4N42A 4UTKA 3LPOA 4UQBA 3N9RA 1DQUA 5C9WA 4AZHA 2VD8A 3UZXA 4ZMGA 1HX0A 4A3RA 5K4XA 1Z42A 1XYCA 5FIPA 3DESA 1UBPC 3MW7A 1XLGA 2C0AA 4DM1A 2XIIA 2P0OA 3WK2A 3EOOA 3S0CA 2H3BA 2XGIA 3SURA 3MMDA 3QLLA 1LLWA 3PJUA 4MUZA 3B8UA 1ISZA 3WNNA 4DVOA 1UROA 3VDBA 3FNDA 4Q3MA 3EXRA 2WHMA 1EDGA 2OQYA 3ITLA 4UOQA 4CNUA 3NYZA 1XLDA 4NQ1A 3SW6A 1UMLA 4FXRA 3UCDA 4E2OA 2C1GA 4FHAA 1L6SA 3J7HA 3L4TA 2HS8A 3WJWA 3EWUA 2W6RA 5C2XA 1LJYA 1LRNA 5JBFA 3AUJA 3WJXA 2NQHA 4RK8A 1UD8A 1X7FA 4LCSA 1I2NA 1PO9A 1CB7B 1E0TA 1KCZA 1Q85A 1XI3A 4REQA 4W8LA 3TR2A 1F4HA 3TA9A 4PL2A 4ICMA 4LVAA 1CXEA 1JQXA 2ZZ4A 1KLZA 2ZXQA 1FWNA 1DEDA 3QV8A 4J7RA 2BBFA 2X2GA 1AQFA 1VKFA 4XBSA 3LU2A 1KLYA 1JXKA 4IJCA 4L9XA 4S3EA 1T0OA 3W71A 4QLJA 3FDGA 1XBYA 3C61A 2OSWA 2W0UA 3UZ5A 3M07A 3AIBA 3WLIA 1EC7A 4AZGA 3VD9A 2XHYA 1GWJA 2VWSA 1XBVA 2ZZ7A 4AIUA 3VDAA 2YBUA 2A21A 2VCBA 3LCHA 3NSXA 4W9TA 1F8MA 3KP0A 4ZCWA 2ZA1A 1UW9A 3UWWA 3FEMA 3WQOA 5DCDA 1YYAA 2D23A 2J4GA 5HJXA 1Z41A 3WKZA 1M53A 1LWHA 3QMSA 3V0TA 4ZGYA 4AHPA 3L65A 3BOXA 3NVDA 5A6SA 4JTSA 5I0DA 3VGEA 4UZUA 3PAOA 5XINA 3KBMA 3W1PA 3CIVA 1WKYA 1XYAA 1THFD 3UWVA 3W00A 5CBIA 4BY3A 1O95A 1YTEA 3VMNA 3XINA 4V15A 2FZMA 5AHFA 1JEZA 4HD5A 3TROA 2P3EA 1E4MM 3GW3A 3VNKA 1XLIA 4Z08A 1HJXA 1JUEA 1N7KA 3KRZA 4PTVA 4S2CA 1MW3A 4YLWA 4N2YA 3EYPA 4ATWA 3W2UA 4FNTA 3PTMA 2J7GA 3UWUA 1V3KA 3G1SA 3ZVHB 1FH9A 4Z42C 4Z1BA 4N4PA 4PGLA 3G8EA 1AFSA 5FCZA 1XLJA 3NSMA 4EOUA 4AD2A 3NIYA 4JFSA 5FESA 4LFYA 4RDYA 3FN9A 1OCNA 5EBAA 4QIUA 2JBMA 2UY3A 4H41A 2VX4A 3CZJA 1ZS2A 3AMCA 5I5RA 4GI8A 4JIIX 3FHAA 1DJYA 1UPMB 1VCVA 4Q4OA 2WPBA 4RXGA 2UBPC 2YOCA 3CQJA 3IV8A 3W2JA 3S2MA 2G95A 3A5VA 1QHZA 3SM0A 3SIZA 1KM2A 2HXTA 3U3HA 3WIJA 4CN4A 1FRBA 2BLEA 3NQ6A 5DX7A 5M3WA 4MKNA 1ZGDA 1E4NA 1G01A 3QBUA 2CHOA 2OEMA 3LHUA 3KZSA 4Y9PA 3UP8A 4ZO6A 3QRHA 4KWOA 4TX6A 4AVNA 4UTTA 4M56A 3TYUA 3LM3A 1QCWA 4I3GA 5AZ0A 4QISA 2OO0A 2Z27A 1V4YA 3QR1A 3U4FA 3LCXA 2XN2A 5AB3A 1ECEA 1OG6A 1C91A 1VFFA 3EB2A 2A6LA 4TU1A 5I00A 4YVPA 4CQAA 4ES4A 4R9OA 3WD4A 1FOBA 4UQEA 4AHOA 3W7KA 3TW9A 2Z25A 4QLLA 4ROQA 1PPIA 3BV4A 3ARRA 4TQTA 1LRQA 1PV8A 5CLWA 3IIZA 1IHIA 4H04A 2WZHA 3U8GA 3L12A 4ZSTA 1DJQA 3SR7A 2QVNA 3TAOA 2W27A 2VVSA 5A8OA 3VIIA 3L4VA 4WY0F 1BEUA 2PWEA 5I3KA 4TXEA 2QCNA 4GG9A 3OEXA 3NPXA 3MSDA 2WHKA 3BK0A 3MCNA 1GVRA 5D2VA 2XYLA 2BS9A 3D5HA 3WL0A 1KFEA 1O5QA 4UTLA 2EEXA 4N4QA 4FNRA 1KKRA 2CWNA 2DEPA 2PC8A 2PLCA 4NVTA 4PYSA 4TMBA 1B4EA 1IF2A 5KTLA 1E51A 3AXKA 3MHGA 4IL0A 4O1EA 3ZLHA 1T40A 4GYFA 1J18A 4NRSA 2X0HA 2D2GA 3IK2A 4IPPA 2UY2A 4O11A 3E96A 2VC7A 1H51A 1NM9A 4OGZA 2WVVB 3Q94A 1T7LA 3TYCA 1GVIA 3OP2A 1ME8A 1UASA 4GA8A 1X6NA 1Z3NA 3W7JA 1KGXA 3PBYA 2ZVIA 5HANA 4YPJA 2QIWA 1E3XA 1K77A 1KR0A 5CCZA 4J2MA 5GJMA 1ZCOA 3HJEA 1DJNA 2WVTA 1OWQA 3CGTA 1QNSA 3SGUA 2IUZA 1IEXA 3AYTA 1ZALA 4C6KA 4TVCA 2VX7A 4FF7A 4YMZA 3CTLA 4MJ2A 1XKJA 4UR8A 2UV8G 2E4TA 4HU3A 1EWEA 4PH6A 1VJZA 4AD3A 1EFZA 3FSUA 1X39A 3B0XA 1CIUA 2WCSA 3I7RA 2QNEA 3ZS4A 2WHJA 3OVQA 1KRMA 4NIRA 3HTWA 4H9VA 4YL2A 1FP9A 3IJ8A 1Q45A 4JS3A 3II1A 3SADA 3MBFA 4PMVA 4HP5A 4L9ZA 2QCCA 1A3XA 1XC4A 3ERPA 1U5VA 1K4GA 1SM9A 2A3HA 1RK5A 1V6XA 3MZNA 3SRDA 2V2HA 2EGZA 3PFMA 5DMNA 4LYRA 3ARQA 1NELA 3P61A 1FCBA 1WZLA 1Y7VA 1C8VA 4JYFA 4ZB0A 4GISA 1UA3A 1W1YA 2P76A 5SWUA 1RCOB 3GIYA 3SUUA 1LT7A 4KH2A 3L23A 1HKVA 2BB0A 2Y63A 3ORWA 3WLRA 1XBZA 4WHBA 3UCCA 4KIEA 1QATA 1POKA 3VOGA 1FQ0A 3S1UA 4NNBA 1B31A 1ZRQA 3B04A 2VO5A 1V08A 3KHDA 4JKLA 1EO5A 2OX1A 2XSXA 4AZCB 1UH4A 4PMNA 3R89A 3BGAA 2GZXA 3KCJA 5TAOA 2WVSA 4RNFA 4FF5A 1L6GA 3NQFA 3C2YA 2PGRA 1QNPA 4QNWA 3QHOA 4DB7A 2QUNA 4IXHA 1A5MC 1YDVA 2YW4A 1W1B1 3PTDA 3V36A 4F8XA 5HR6A 3LSBA 4NAFA 3EDJA 4O54A 4Z1AA 2PDNA 4JCLA 1BFNA 1V93A 1V3HA 1RP8A 1CGWA 5EGRA 2GGHA 4XO7A 1XLEA 1PL9A 1P0EA 5XIAA 5B7ZA 5D33A 1ODUA 4WJEA 3KVLA 1UP0A 2P1FA 4JTAA 2O0TA 1TR1A 5KMYA 3WELA 2ZRUA 4RW3A 1EDQA 2POTA 1RLCL 3EXTA 3FA4A 1KXVA 1WXYA 4X3ZA 4ILSA 1PTGA 4HB7A 1OT2A 3IUDA 4HT3A 3UWEA 1UP3A 3LV5A 3NPWA 4KEMA 1CBGA 1MEHA 2QZRA 4FEZA 3U2EA 3CMGA 1DIDA 1B3OA 2NWSA 1XDJA 2I17A 3E49A 3ABOA 3W1XA 4H6KA 4LUJA 1OQFA 1PYMA 1DV7A 1UD2A 2NX3A 5HA7A 2VMFA 4EAYA 3PUGA 4LX4A 4AY8A 5BW6A 3MJMA 4GY7A 4WF7A 3O8AA 4YS1A 1RPKA 3L2MA 2DORA 3ZLFA 3W26A 1N8WA 3L5AA 2YYUA 2WCAA 4OBTA 1NQKA 4N7QA 1HJQA 4AD0A 2GJXA 1MWOA 4P8XA 3VNLA 5A8MA 2Z24A 3REQB 3QJAA 2D3NA 4ZFCA 1R87A 3ARYA 3FFSA 4UFKA 1IEQA 1FUYA 3S9ZA 3B8VA 3F2BA 1N8IA 4DNMA 4L1XA 1C29A 4HNTA 3RITA 5J5RA 4R9XA 3OYZA 1BVWA 3FYOA 1XXXA 1JCYA 3B8IA 2J13A 4K1WA 4DF1A 1ZP3A 1V02A 3VAVA 3GLCA 2OKTA 3Q37A 3UT0A 1FDZA 4PUEA 5EMUA 3TFCA 1HKWA 1IXOA 1MXSA 4AD5A 1PCWA 1EC8A 2BHUA 1E9LA 4M6PA 2E9LA 1GOWA 4Y8FA 2QUMA 2OQHA 2J7DA 4CU6A 1JCTA 5GPRA 1B90A 3KOXA 2HMCA 1JRCA 3M6YA 1V02E 5IFTA 4DJFC 3W27A 3A3HA 3ZZ1A 3TYDA 3ANUA 4DHGA 1TV2A 1UZHA 2V2CA 1E4IA 4E2BA 3DC0A 1F4AA 3O0KA 2VGBA 5CZSA 3H4GA 3WMSA 2CFFA 1B4KA 5HWMA 2VEMA 2NUWA 2DJLA 2DW6A 4IH3A 3GDMA 2QEZA 2FQIA 5H91A 1CW2A 1W3JA 3VDGA 2IXUA 3QZAA 3H53A 1OX4A 4MDPA 2F2KA 3EOSA 1XHGA 6REQB 4JQ4A 2NXHA 1MXGA 4M7TA 1KTBA 1AD4A 2EJAA 3GXFA 3UXAA 4FX6M 1G7UA 3DFQA 3G77A 3QMRA 1J6OA 3MUXA 2W9MA 1VFSA 2V69A 5IDZA 3UJFA 3QOMA 4CQDA 4RR4A 1GYNA 2JGQA 4JNMA 3VGBA 3H2AA 1PIGA 1LF1A 1QAPA 4OV9A 3B03A 5CZKA 1YXYA 1HVXA 5LIKX 1R3TA 3Q4DA 1XPGA 5I78A 2D0HA 1Z44A 2JKPA 4HPGA 3B3DA 5KITA 1I45A 2DZWA 3IJIA 1LQ0A 1K7FA 3DI1A 4FO4A 3LNPA 3PG8A 3U5YA 2DP3A 1AL8A 4N0RA 4DXXA 1FWJC 2F84A 2ZDSA 3N4AA 2GFTA 1F6PA 3RM4A 1A5SA 2ADAA 1W9DM 3B40A 2OPJA 4ZL1A 4P7RA 3GG8A 4BF5A 1ZTVA 1GPFA 2VEPA 1JYVA 1IEIA 2YCLB 4JBRA 3A21A 4E2DA 1MEIA 4LPCA 3SY8A 2Y5EA 4ACZB 3TUUA 2OB3A 4YCPA 4LUSB 4CUCA 1JZ6A 3N1AA 4IPNB 3WN6A 2VJXA 3W07A 3W28A 3AHTA 1CCWB 1RPXA 3B4YA 1CXFA 3QHMA 2YX0A 2C1HA 1C8YA 3FYYA 2VHLA 3L4XA 3AZSA 3PVFA 3EAUA 4AD1A 3M0LA 1X38A 3C2FA 1ONXA 5MKGA 3M0JA 1FWGC 3EPOA 3GR4A 4V2XA 3KBNA 1RHCA 2HV5A 2WXDM 4JTCA 1CPUA 3W7CA 5GQBA 3WMCA 1VC4A 3T9PA 3ZR6A 1REQB 3N17A 2VDHA 4NZ3A 3URNA 1DKWA 2DT2A 2IQDA 3EKLA 1K03A 4B3ZA 2E68A 6ALDA 1VRXA 2ZXBA 4KETA 1PAMA 1YPXA 4ZO9A 1DYSA 3CQ0A 1WZMA 2J47A 4GJJA 1JIBA 2WMIB 1V0NA 4HSNA 4JFVA 3PS7A 1QMLA 1A4MA 1FHLA 3VTRA 4AQLA 4AY7A 2FMNA 3TR9A 3F5KA 3BAXA 1W32A 5CAHA 1IR2A 3U57A 3VOFA 2X1UA 4PMQA 5D4YA 1RCQA 3LZ5A 4HPNA 3LB0A 5C5YA 4YN5A 9XIMA 5FA5A 2CETA 4KF1A 3P81A 3BSHA 1EJ7L 3PN8A 3NPVA 1MUCA 3CAVA 1R9XA 4OT7A 4LWWA 1H5VA 1VEOA 3EX1A 1IT0A 4EVZA 1QPNA 2QDHA 4C6CA 5C70A 3T78A 5DRCA 5JH1A 4FXSA 5CLTA 1QOXA 4TV5A 3VM5A 3K4WA 1KM4A 3TCSA 1XIDA 3QR0A 3OOQA 4QAWA 1VB9A 4MKSA 2OT0A 3G22A 3HV9A 4IWWA 4TMCA 3CUZA 2OR2A 4BI5A 1KWKA 4HOWA 1VD6A 1OEPA 3F5LA 2EXOA 3POHA 4FK9A 5E1QA 3VIMA 3CMFA 3U6WA 5EB8A 3VMOA 4HTYA 4F9JA 3HA1A 3W7DA 1KRCC 3OIXA 3PPFA 4O53A 2VWTA 2E6YA 3S1WA 4ZO8A 5ABFB 5G5IA 1PJ9A 1NFGA 3FY1A 2XWDA 1J12A 3ARSA 3FXYA 4HHMA 3EX4A 3A3WA 4PL1A 4S3FA 2BV9A 3HPXA 1BD0A 3P67A 4KEUA 3O63A 5FL0A 4FX8A 5M5DA 4WQ6A 1PDZA 1W31A 4TVDA 3STEA 3VOIA 3S8HA 4DYKA 3G18A 4EIVA 4ZBCA 5TNVA 3T0AA 1VH7A 3HPFA 1PKMA 1S3TC 4R27A 1FWFC 2NXGA 4EE9A 4GBDA 4Y9MA 1U1HA 3MZ2A 4HBKA 1RV8A 1AG1O 1N8FA 4AISA 3SN4A 1B3WA 5CSYA 2OGJA 4CD7A 1TJ0A 5F7UA 4QBXA 4EXAA 1EDTA 1PWMA 4JCMA 4OIFA 2ZZ6A 1FXQA 5BXTA 4WVXA 4LAUA 4V28A 1C93A 4XK2A 2XG9A 3EXSA 3QGAC 2HE8A 3CNYA 3WG6A 1TTIA 4R3UA 4JIQA 3CTTA 3L0GA 2E09A 4ONVA 4QS6A 2WV8A 3WDHA 3S5NA 2WC3A 2YSWA 1MSSA 2ZQ0A 3DGRA 5JUVA 4YYCA 1DJXA 3OVGA 2VQTA 4U5KA 2CKRA 5H2ZA 1W6TA 5LIXX 3CYJA 1QI0A 1V3LA 2C8NA 3LRMA 2XM2A 1UQZA 4L65A 5E6ZA 3W01A 3R12A 2VEFA 1HKJA 3SUSA 3TCEA 4H19A 3BICA 1WOAA 3KRBA 3C3UA 3CV7A 1VR6A 4PUDA 2ZICA 4LCRA 2WANA 4PB3A 3FJLA 3DEQA 3S6TA 1Y8BA 1DWJM 1XH0A 3THQA 1GOMA 3WF0A 5AYZA 3RN6A 3BLDA 4O1FA 2VDIA 3W53A 1GVYA 3CUIA 1VAHA 1EJXC 4O1AA 2V63A 1FA2A 1P1XA 5IDIA 3QM3A 2XZ7A 1VENA 3KFTA 2A2IA 2PDKA 4PUKA 2O9OA 3V5FA 1HIZA 1Z8AA 3WK3A 3CQIA 1EPXA 1DQWA 3M7WA 4DJDC 3EGJA 3I7SA 2X40A 2CW6A 1CGYA 2BY2A 2YCKX 4XB3A 4IUGA 2AGKA 2VGIA 4BQ5A 4RZ4A 2VR2A 3QW3A 3LTSA 1RY8A 4CNNA 2VCCA 3CK5A 4OU1A 3CU2A 4TVUA 1AMYA 3L66A 1Z9AA 2Z2BA 1F73A 4LUSA 2CZ5A 3WH9A 4X0NA 1AH3A 1OIMA 3C6CA 2WB5A 3LM7A 4E5TA 4PMRA 4JIHA 1QO2A 3SRFA 1HL9A 3IRDA 1SZRA 5C9ZA 3K1GA 3MKCA 3N3TA 2O92A 3KM8A 2NV2A 4PCFA 3FJNA 2OX4A 4ICCX 3UFYA 3GTIA 3E3HA 3YPIA 1GG1A 3VIPA 4D8ZA 5A5WA 4ZO7A 1RVGA 3CWNA 2GOKA 1OINA 1JYNA 5HMSA 1ELSA 5AVNA 3HURA 2J79A 3WQ4A 3HFTA 4CEUC 3G1RA 2PE4A 4DZHA 4HA1A 1PWLA 1JGIA 1X1OA 4ATDA 1GOXA 1U33A 1H1YA 3VE9A 1AW1A 3U48A 2HQAA 2ZUVA 1TRDA 3N2XA 4WIWA 3T8LA 1QI5A 1LDCA 3WQ5A 3QYQA 4NF7A 1W1PA 1YIXA 3ME3A 5IOBA 4UR9A 1JUKA 2C13A 1R7OA 2Y7EA 2DZPA 3NQAA 4WD0A 2I16A 1RH9A 2QJNA 4LY8A 4LUYA 4W85A 2VZSA 1US0A 3GNOA 4GH3A 3ITGA 2V3DA 2YJQA 3L68A 1BG9A 1JZ2A 1LQAA 1GZGA 4EAMA 5GNZA 1A47A 5J04A 3MQTA 1XUUA 1ZENA 4H2CA 2NZLA 4O0ZA 4PFHA 1UYQA 2WW5A 4NSBA 3NZPA 4XIMA 5BU9A 1XG4A 4IM4A 2CLEA 2P5NA 2ZE0A 4C1KA 2PLMA 1E6XM 4PRTA 4H9UA 1FP8A 2Z1WA 1XIHA 4RXFA 3QV7A 5CSSA 1EZ2A 2YIHA 3OO2A 3EDEA 3WY1A 2YXGA 4FXJA 1TZZA 3PY2A 5F4XA 4CEXC 1FWTA 4U33A 1UUMA 1EXBA 3CV2A 3C3NA 3WJSA 4QDWA 1XCFA 5JMUA 3MUY1 3P62A 4YTRA 1R3RA 2BOEX 3K8LA 2GLKA 1XIIA 2I5GA 5EMJA 4C6FA 3RX3A 1XIEA 1GVEA 2R1PA 5LGXA 2Q71A 2PTYA 2P0IA 3ZM8A 3GXIA 2A85A 5CG7A 1O5RA 3U2ZA 3N2MA 3T2QA 2VL4A 3S5YA 1VLIA 2JF6A 1QW7A 3REQA 3W76A 2G50A 1M41A 1OYAA 4F9DA 3LQGA 2ISWA 3ZR4A 2OMAA 1GOKA 4W7VA 1WPCA 4GXMA 1ZBCA 3MVTA 2PDQA 3EDFA 3FDKA 1P6CA 5B7YA 4GGHA 3ES7A 3VILA 1XLAA 3MSRA 5KINA 2GVYA 1N82A 2BXVA 3M0XA 4H7ZA 2EPKX 3S47A 3NL3A 1RJPA 2GK1B 1JYWA 1QPOA 1XIMA 3QTPA 2Y7GA 3S2LA 3VVGA 4A8NA 3AO0A 4C6LA 3GNDA 2CCRA 2J7FA 1D2KA 2Z29A 1HW6A 1G9HA 2IKJA 5BRPA 1S2AA 4PTWA 3E5BA 2J25A 2NXIA 3BLPX 4GXPA 2JE8A 3FVDA 1LYXA 3DFSA 1KM5A 4GYPC 4L61A 3WLPA 1YKWA 4ZXLA 1HP5A 4IGMA 6REQA 3G1HA 3FK4A 3WLOA 3GBEA 2B7OA 4UFLA 4V1YA 3MO4A 1RQBA 2W79A 2I7GA 4WEVX 3P60A 2ZDRA 4JTHA 3VM7A 1X6UA 1GQKA 4IIDA 5AZ1A 4GJ1A 3LXCA 3SSZA 2XM1A 4GIRA 3GYEA 3S83A 1L8PA 3O0FA 3AWNA 1EC9A 5BRBA 3GHTA 1RZMA 2BY3A 1W37A 3E5PA 2NT1A 1FHVA 2WMGA 1NH6A 1VLWA 4JQ3A 3STCA 4QAIA 4LF2A 1CWYA 4PTNA 1OFEA 3WQGA 5CPOA 4JAWA 2YB1A 1H61A 3LPPA 3T4WA 2EPHA 3RU6A 4WJ8A 1T99A 3PZTA 5D05A 1I4NA 5DO8A 1OCJA 5ECVA 1JAEA 1IT7A 2YCIX 3C52A 2XFWA 1IV8A 2FGLA 4O16A 1EZWA 1KM6A 4AZIA 5G4HC 4PA8A 1JF6A 4GFIA 3LYEA 5JU6A 3NURA 1XV8A 3AICA 1GJWA 5A6TC 4A2RA 2G0WA 3UXDA 3TW6A 1WX0A 1XGDA 1WDPA 4D71A 2Q8ZA 4N9EA 5BXSA 1GJUA 4LALA 3MI2A 2H6RA 3GZ3A 3M7SA 4ZXOA 2VKZG 1AODA 1CGVA 1A80A 3E9AA 1LBMA 2IPWA 2BVDA 2ESCA 1AH0A 5GNYA 1P7TA 2ZUUA 3CPRA 4AZ7A 1VQTA 4XKYB 4XZ9A 5B80A 3OB8A 5D37A 3AISA 1YW1A 3AWOA 1OYCA 2Z00A 4GXWA 1TPEA