3C52A

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
296
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 110
structure length 296
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c52A00
1LRTA 1WDWA 3UWYA 3UXDA 3DH7A 4X3ZA 4FF7A 2ZA2A 1VLIA 2H8ZA 3S6DA 4UFJA 3BLIA 2PURA 3CEUA 3PBYA 1JCYA 1ICPA 4MZYA 1K8XA 3CHVA 3W1LA 1AW5A 1F76A 1S5VA 1EWDA 1TIMA 3DENA 3O16A 3DHFA 2NWSA 1THFD 4RR4A 3OEXA 4JDYA 4R34A 2ZZ7A 3NM3A 3P67A 3LXAA 3GZ3A 1OYBA 1QDSA 5KTLA 2C13A 2JKAA 2KZHA 3MYOA 2F7FA 1MXSA 1KM1A 3H54A 3CPRA 1FDJA 2DJLA 2DORA 5HULA 4JIQA 2Y89A 2XN2A 3RK8A 3L67A 1BKSA 3ZS4A 1N55A 1VZWA 2E09A 1RQHA 1F74A 3O6CA 3DFOA 4JYFA 4K6AA 1F05A 2XN0A 1SSDA 4DO4A 2CLEA 5LNRA 3H55A 3B8DA 2YYUA 3QRHA 1N7KA 1B57A 2YZRA 4GUHA 3LB0A 5U4NA 3PUDA 2FLIA 3NL6A 4XZ9A 3C2EA 2ZZ2A 1FDYA 3BO9A 4UFIA 3P82A 2BXVA 4RCXA 3UWVA 2FPYA 3BW2A 2NUWA 3LM7A 1JQVA 3W70A 4CQ9A 5LHEA 3PB2A 3C4UA 1RPXA 1UB3A 4G1KA 4M7TA 4N9DA 4DO5A 1NFBA 1W5MA 3LLDA 4NNBA 3PAJA 4N2YA 3FA5A 2B7PA 3TDFA 4LUJA 1S3HA 2H3BA 3VCRA 3LRMA 2OJPA 4O1CA 2X2GA 4M19A 3TU9A 1XXXA 2BWGA 5L9FA 2E6YA 3W7EA 3LHTA 1Q6LA 2QJHA 4XUGA 1OHLA 3QJAA 3TQ0A 4LUIA 3HF3A 2E6DA 2QCDB 1GG0A 4MY8A 3VE9A 2ZFAA 3G3DA 3NM1A 2R91A 1LBFA 3PS7A 4O12A 5F4SA 4O28A 3W7PA 1GZGA 4NNCA 5C6MA 3QMRA 1GYNA 3TUUA 1FCQA 5F2GA 4Z1CA 4IWWA 4AAJA 1VYPX 2OZ0A 5G4EA 1OX4B 3W1UA 1QO5A 3JS3A 3TXZA 3OVPA 2CLHA 5HQEA 1H7NA 4WOZA 3W1PA 2Y70A 1D3GA 3BLFA 2RKXA 2V2CA 3C8FA 3KRZA 4GC4A 1HUVA 4JTSA 4FNSA 4CQ8A 5D33A 3W83A 2DU2A 5HR7A 1TTQA 1JR1A 4IOTA 2RDWA 4MYXA 5DCDA 5BNKA 4XTIA 4BF9A 4MPQA 3TJXA 4IGHA 3W84A 5F1VA 5G4WA 1X6UA 4AVFA 2Y63A 1IXNA 3T78A 3FYOA 2UV8G 5D09A 3LLFA 4O0ZA 4FIRA 4ZL1A 3KOFA 3CM4A 1LP6A 4M7SA 3IGSA 1VCVA 4O19A 3S1XA 3W85A 3NAVA 4E0CA 3HGSA 4OQVA 3TFXA 1YADA 4LC8A 3S1WA 3CC1A 3ELFA 4UNLA 1NF0A 4AEOA 1M6JA 3KVMA 4LVDA 4LVFA 1K7EA 3A5VA 5G2IA 5LGXA 5D2XA 1RVGA 4UMBA 3NEVA 3EX6A 3I65A 3DU0A 4AF0A 4UIOA 4POCA 2NUYA 4Z0SA 4LOCA 1YXYA 3W7RA 3P80A 3K30A 3GKAA 4D2JA 1B4EA 2Q3RA 3L5LA 5IBXA 3C2VA 3BGJA 2R8WA 1PCWA 3G0XA 4UTUA 5HWNA 4K36A 3WJSA 3IVSA 4UTKA 4NX0A 3M5VA 5EYWA 3BV4A 2CFFA 1A5AA 5F4XA 1GJPA 2A7PA 3UPBA 1KV8A 1W0MA 3WK2A 1VH7A 1G4EA 3LTPA 3QEZA 3IRDA 1OVDA 1AW1A 1OFBA 3BG5A 4UFMA 1LYXA 5D04C 4NVTA 4WUIA 4IQLA 3W7HA 2TSYA 4IX2A 2X30A 3NOEA 2A5HA 1SO5A 2YW4A 1LLZA 2ZBTA 1X8FA 1Y0EA 2JKPA 1W56A 3TH6A 5LNSA 3B0VC 3IV3A 3BK0A 1LORA 5DBUA 1OX6A 3CTLA 1BTMA 3A24A 2X1SA 3BW3A 3HG4A 4Q32A 2GPTA 1TPUA 2CW6A 4Y96A 3W73A 1PE1A 3ATYA 2QCHA 4YCPA 4N6FA 4O0KA 4HPJA 2OX1A 2J6XA 1HFBA 5F4WA 1LZOA 4GNJA 3W74A 1KFBA 1DORA 3M6YA 2VFIA 3EKZA 3NL2A 4W9TA 3WK3A 4MUZA 2X1UA 5DBTA 4CNOA 3L2IA 4TIMA 5EMUA 3G0SA 4Z1BA 3TCEA 3NZRA 1YXDA 1OFEA 4MIMA 4O4WA 5D32A 2GJNA 5T26A 3SJ3A 3O05A 3M5YA 1VCGA 4ALDA 3M5ZA 1CW2A 4JTJA 1A5BA 2FTPA 5AHNA 4NJHA 2J9XA 4BWLA 2YXGA 3P81A 1P0NA 4K7VA 2FPVA 3W1RA 4MJZA 4FNTA 2AGKA 4BFAA 3GVGA 5CPLA 4OE7A 5KMYA 2HMCA 1YDOA 3I7SA 1ZAIA 3OIXA 4E38A 3MP4A 2A4AA 4X2RA 3LXCA 3LHWA 2OMAA 1JULA 3A22A 1Z48A 1UBSA 2YFOA 2V30A 5AHLA 4WQ6A 5K9CA 3QQ1A 3HGOA 4KFPA 2C16A 1AG1O 1ZAHA 1LOSA 3G22A 1H51A 3YPIA 1J4EA 3LCXA 1TQXA 3TFCA 1QCWA 1CX9A 4S1FA 1H7OA 5A8GA 2GVJA 1FXQA 4JXCA 1GTEA 3TAKA 4ZQRA 3C0JA 2XN1A 2Y61A 3NDOA 2BZNA 3NA8A 3DAQA 1LBLA 5FI8A 6ALDA 3W23A 2ATSA 1AK5A 4GUGA 1WYIA 4NQ1A 3W7LA 1GVOA 1TV7A 1M7OA 3A9IA 3GYEA 5DXXA 3B0UX 1Z44A 2NZLA 3NXFA 4JDBA 1SFJA 1RD5A 3FS2A 5E93A 5FEXA 3M0ZA 3TV8A 3CU2A 3P60A 4OU1A 3QF0A 1D9EA 1FWRA 4MLJA 4WD0A 1KM3A 3LHUA 3S1VA 5AHFA 3IGXA 4JN6A 1H63A 2ZQ0A 4C1LA 1GVSA 1GOXA 1EX5A 5HUOA 3OVQA 4FXRA 4AH7A 4K8EA 3DHDA 3EKLA 3TSMA 3TIMA 5D2WA 5G1TA 4GBUA 4O1AA 1EP3A 4AWUA 4GJ1A 4WZHA 1W3TA 3H53A 3GR8A 4E2BA 5AHEA 4FEZA 4UTJA 1QO2A 1TPVA 2V5LA 2QCEA 5CPMA 1K8YA 5FF0A 2G96A 2VELA 3NQ7A 3WJWA 3PG9A 2Y7GA 1KBJA 5HR6A 1VJIA 1I2OA 4QAIA 3G1SA 4UR8A 3FJ6A 5CGQA 1FWSA 3ABQA 3NO5A 4PA8A 1L6SA 1EUAA 1DKWA 4MY9A 3QYQA 4O57A 1KFJA 1WQ5A 1FX6A 4QNWA 5AYZA 2JK2A 2YCEA 4IUOA 1OG0A 3G0UA 3CEPA 3EWUA 3HPZA 3EXTA 3PB0A 5AC6A 3A21A 1LLWA 4LS0A 3ABRA 1LROA 3PUOA 2V82A 3M41A 5EPDA 3NQ6A 1CI1A 2NX1A 1R2TA 1TPEA 2C3ZA 4FNQA 2QDHA 2FB3A 2PE4A 2G97A 1XDMA 1H1ZA 1XM3A 3PF3A 1SZEA 3CIXA 2V5BA 3B06A 2X1RA 4JD4A 5H91A 1GQNA 2WO5A 4DPQA 3MI3A 3WJXA 2B7NA 4P2VA 4TO8A 3DFQA 3RU6A 3THAA 5LSMA 1H60A 1VQTA 3KX6A 4XKYB 1PHQA 2FB2A 3N19B 2DZTA 5BRBA 1EIXA 3E0IA 1ME7A 3P8JA 1WBJA 5KZEA 4EVZA 4O17A 1W31A 1ZCOA 1GT8A 3HB9A 4UNKA 2NX9A 2ZRXA 1W8SA 5E0KA 3T44A 4HN4A 1QPOA 4LS2A 3EEGA 2QUTA 3EX3A 2E6FA 3AJXA 2WNNA 3C2OA 1S5TA 3NQ2A 4NNAA 3O1NA 1KTNA 5MHBA 3MHGA 3SFKA 1FCUA 4JYEA 3W1MA 4GE8A 3CWNA 1G6CA 2NV1A 4U28A 3GK0A 1JCJA 4O50A 1T99A 2DZXA 1SSGA 4R33A 1XC4A 3USBA 3BW4A 3SZ8A 4JNMA 1SO3A 2QJGA 3LERA 1BWKA 1NAL1 2QR6A 3NZ1A 2X1TA 2A7RA 5K9XA 3Q2DA 3OVRA 1QOPA 5D02A 1L6YA 1W1ZA 5H2ZA 5K2ZA 1O95A 3I6RA 4PL1A 3C3NA 1SW3A 5D2TA 3HPXA 1OFOA 5BMWA 3G1HA 4NU7A 4UTIA 1SZFA 2O7SA 4PFMA 1I2QA 1OFDA 5K9DA 4YL2A 4QJ1A 1HG3A 2VOMA 3EX2A 2Z0IA 4N6EA 4RZ5A 5HWMA 4UFKA 3W7MA 5FF7A 4UTWC 3W1XA 3GDLA 3SW6A 1R30A 4LU0A 1DOSA 1E51A 2VEIA 4MFDA 5G2WA 3GNDA 1KLZA 2A6NA 3W2MA 1IXOA 3ZR4A 3STEA 1GVRA 3BPWA 3W76A 1EA0A 2C0AA 2ZA3A 4PL2A 4A2RA 3W7KA 3W2JA 2WV8A 1W3NA 2ZRVA 3PR2A 2ZZ5A 1ZFJA 2Y88A 3W7JA 1VYSX 3NPUA 2B4GA 3N14A 3S0CA 2P10A 3W7IA 2ISVA 2ABBA 2RFGA 1K7FA 4WY0A 3KHJA 4AXKA 1DV7A 4NT0A 1FWTA 4PH6A 1KTCA 4MFEA 2Y7DA 3L0GA 2ATMA 5G5IA 3W07A 1I4NA 3R13A 4JIPA 1H7WA 4MOZA 4ADUA 2J9ZA 1WV2A 4O15A 2A85A 1JCLA 1V5XA 2IQTA 4DELA 3W7DA 3EWYA 2ZTKA 4O54A 3PBUA 5FEWA 3EWXA 1Q45A 2GJLA 1BEUA 2ZDRA 3SIZA 2E5BA 5AHIA 2V2HA 5DN1A 2GUUA 4DQWA 5HMSA 3RLVA 4K39A 2H3DA 3V75A 2Y85A 5AB3A 1SO6A 1XUZA 3FFSA 3W2NA 3BGGA 3LTYA 1AL7A 1TPWA 3LTSA 1VC4A 4CCCA 3W87A 2CWNA 4LVBA 2PC4A 1ZENA 2NUXA 2V0TA 3LBCA 1H61A 1QAPA 3KVLA 5EY5A 3CIWA 3O15A 4ZQCA 3TX9A 1KTBA 4P61A 2AAMA 5KSWA 4ADTA 2C15A 3KVKA 2YYTA 3HBLA 4GUJA 4JTHA 5AFDA 2A1YA 4IX0A 2W0UA 3EWWA 1NF7A 3N9RA 3QMSA 4S2BA 4LRSA 5C2XA 3NL3A 1HL2A 3G1AA 1FCVA 1Q6QA 3GAKA 3A5FA 3Q37A 1WAUA 2JKEA 4AHQA 1DJQA 3L0KA 3UXAA 5J5DA 3G24A 1FWWA 1FXPA 4KFNA 1TV5A 3MW7A 3T40A 3M47A 4LC6A 1TPC1 4JY8A 4UTHA 1TSIA 3RNDA 5ABTA 2G5WA 2VXNA 3TQKA 1KM5A 3BG3A 3LHZA 4RKAA 1YXCA 4AWSA 1ONRA 4FX7A 3HG2A 1JCNA 3LI0A 3CQ0A 1GG1A 4DBEA 1WOAA 5D05A 1TCDA 4A3UA 3P5YA 1KLYA 2AQWA 4LW7A 4ML9A 4AHOA 1EUNA 1QPNA 2OT0A 3ABSA 3EXRA 3QMTA 7TIMA 3DI1A 2ABAA 4FHAA 3T4CA 1XL9A 5BW6A 3I7QA 4E2DA 2XFWA 3QM3A 3G18A 3R8RA 2EPHA 1UUMA 3MHUA 5BMXA 1YTDA 4EWND 1NVMA 1FUYA 3W2KA 4A21A 3LHYA 1OYAA 3DXIA 4O10A 4Q33A 4MY1A 2DZVA 3LXBA 3NQCA 4RXFA 3W9ZA 1TYGA 3NQ8A 5AC7A 2HS6A 4BI7A 3TA6A 4TX9A 1LRNA 4HNVA 4O14A 2PRHA 3B03A 2QUVA 5DXYA 3INPA 3GDRA 1VHNA 3S8HA 1MEWA 3HOJA 1QMLA 2NXGA 5CSRA 1LOQA 4QQ3A 4O4VA 2V8ZA 2TMDA 2GQ9A 3NQGA 1ZNNA 2GOUA 1P5BA 4YCOA 4UTTA 4R53A 3LCIA 5SWUA 1GVQA 3CLMA 3HJZA 2I1OA 3KAOA 2ISWA 2BTMA 3KXQA 3W1QA 4IMDA 4I7WA 3ANYA 3EB2A 2Z6JA 4DBDA 5CSSA 2H8XA 4NZJA 1LCOA 1OFRA 3LBMA 1YTEA 4UXDA 1G69A 1SW7A 4EF8A 1TMHA 3DZ1A 3N34A 3S5ZA 4JX6A 4LV9A 3HPSA 2CLOA 5AHMA 4H6KA 3TAOA 3LGEA 5HJLA 3PULA 1IXQA 1G4SA 3SGUA 2WOQA 3VFLA 4H3DA 1KFLA 1F2JA 1P1XA 1SW0A 5DY3A 1TJRA 3W1TA 3NPWA 4AF0B 1R2RA 2Q3OA 5C5YA 3W72A 1KV5A 4MVAA 3W7QA 3M7WA 1G7UA 1PV8A 3PBWA 4BI6A 2QUUA 1A5SA 4LVAA 4FX8A 2BSLA 3HO8A 3QFEA 1JCMP 5I3HA 4QSHA 3DI0A 1KFCA 1K03A 5FF2A 5D37A 1LBMA 3EWBX 2QJIA 3E02A 2YW3A 3MP3A 4GXMA 3I68A 4MLRA 2VEPA 4OV9A 1Q6RA 4OT7A 3STGA 3S9YA 1IGSA 4OHQA 2NXIA 2TRSA 1NSJA 4FX6M 4WXZA 5CZ0A 4IPIA 3DKLA 4CCDA 3QW4B 1VLWA 4Y90A 3NQDA 2YGYA 1TRDA 1ICSA 1XBYA 1VGAA 4UFHA 1O94A 2CZEA 3IIXA 2QAPA 1XCFA 1RR2A 2A7NA 3TKFA 2Y7EA 1XBVA 1W37A 3M16A 1VR6A 2DJXA 3Q94A 2FJKA 3C52A 3UWWA 1R2SA 3UZ5A 1GEQA 3TW6A 1PL9A 1YLVA 3JRKA 3AO0A 3LV6A 1T8XA 4NXSA 1K8ZA 2Z2UA 4RK8A 2CZDA 1H1YA 3G1FA 2DZWA 2E77A 2E1DA 2QCFA 1IXPA 1FCBA 4HT3A 3IGUA 1XDLA 2QDGA 2CLLA 3MWAA 2ZZ6A 1TPB1 4HSOA 3TQVA 4QITA 1S5WA 2V2DA 1B9BA 3L9CA 3C56A 3RLUA 2C1HA 1U83A 1H7PA 1R46A 3CT7A 3GXPA 3BVJA 2NV2A 1HTIA 4LVGA 1ZJIA 4BWLC 3P84A 4XTDA 5FESA 3HGRA 4ZQNA 1JCXA 4WX2A 4IJBA 2FQIA 4YLWA 4EF9A 3G1VA 4Z1DA 1R47A 3BLEA 1I45A 2JBMA 4ONVA 4ZMGA 1H62A 2GVGA 2WJZA 4FNPA 2VFGA 4UMAA 2V9DA 4UR7A 2CZ5A 2CLFA 2DZUA 3FYPA 5K7JA 1JJKA 3QW3A 2WPBA 2HSAA 4OGZA 2I9EA 3F4WA 3GLCA 3FEMA 3N2XA 4QM1A 1ICQA 3SGZA 4ORMA 4RLIA 3ZWTA 2CZFA 1Q3NA 1ML1A 3QH2A 3PG8A 3W1AA 2NX3A 1MEIA 3LHVA 4ORIA 3TNOA 3RMJA 4ZVJA 4ADSA 3E12A 2YX0A 3QQ0A 3EWZA 1OF8A 3PSWA 1EEPA 3RFAA 1G4TA 1KFKA 1UJPA 5KINA 2QCGA 1QPRA 1KW1A 3TSBA 5GVJA 2P0OA 1W5NA 3VE7A 3ATZA 3OA3A 4M6VA 2RDUA 1L9WA 3L0NA 3MJYA 5DCEA 4ZQMA 3M5XA 2QCLA 3UY8A 4KWVA 2WSQA 2WQPA 1WA3A 2NLIA 1FBAA 4LRTA 3WJZA 2YR1A 3C61A 3TXVA 5HINA 1T96A 1SU5A 4A22A 4JX5A 5BOOA 4N4PA 3PUEA 4DF1A 1JUEA 4UTWA 3R5EA 5EBUA 1G67A 5LNVA 4UTMA 2A2IA 3NNTA 1YDVA 1ZY9A 1H50A 2ZA1A 4O18A 5FEPA 5KZMA 4MZ1A 3MO7A 2J88A 2QCNA 3P74A 4RZ4A 3C2FA 3W86A 3HG5A 4HPXA 2PRMA 3LRKA 4ZZ9A 5AYXA 3UZJA 1DBTA 4I7UA 4DPPA 1GTHA 1QPQA 1F7BA 1JQXA 4KWWA 2WKJA 1LM1A 5FF4A 3TW7A 3F1QA 2QKFA 1YDNA 1AMKA 3DKJA 3S1UA 1TRIA 3GDTA 3P61A 4NXKA 1B4KA 1DHPA 1BWLA 3PWAA 3GX9A 3W7GA 5AN7A 1ME9A 3BARA 1OX4A 4IMEA 1A5CA 3NYZA 4XBKA 5A5WA 1W5PA 3NQAA 3L5MA 2X16A 1TPH1 4L4MA 1AW2A 3DFNA 3PY2A 3O06A 2LLEA 3MP5A 3QC3A 3W75A 1EP2A 3CWOX 4HHPA 1NEYA 5FF3A 5EA9A 2A0NA 1XI3A 3NG3A 2R14A 2ZRWA 2JGYA 4JYDA 2E68A 4OV4A 4DF2A 1F73A 3IVTA 1O4UA 1GPWA 3W2LA 3B4UA 3GNNA 2C6QA 3L66A 1L2UA 2FPTA 3U6WA 1Z42A 5AOUA 3EX4A 4LY8A 4ZQPA 1TQJA 3R12A 3LCGA 1LRQA 2A6LA 2FFCA 2CU0A 2F84A 4HSNA 1YPFA 3G1XA 4TMBA 5DY2A 3EX1A 4WY0F 5D38A 4K7YA 1MEHA 4YXGA 3LCLA 4NJKA 4N9EA 1IIHA 1GVFA 1YTKA 4NJGA 4EOUA 2VEKA 3FKRA 2VKZG 3MI6A 4XBSA 1YPIA 3P62A 1J5TA 1UASA 1VHCA 3E49A 4BK9A 4HNUA 1OYCA 1HO4A 1RQBA 5L6UA 2VFFA 4NUWA 4OBTA 4LWWA 3IIZA 5DCBA 1GYLA 3R89A 4Z0JA 4JR5A 2E5DA 3I7RA 5F2LA 4FIQA 3UY7A 1J2WA 3UWZA 1OX5A 3R2GA 3DGRA 3MUXA 4DEFA 1I2NA 3B04A 3HGJA 2YSWA 4MKNA 3RF9A 5LKYA 3KVJA 3LOTA 2ZCGA 2B7OA 3IVUA 4AHPA 1LTDA 3W7OA 1TO3A 3L21A 4EIVA 3VNDA 4JX4A 3LV5A 3TC7A 4LNYA 1XBZA 1PVNA 4IPJA 2W79A 4XWUA 2YDAA 5CKSA 4HKPA 1ADOA 3W1NA 4IXHA 4BR1A 3HMJG 1X1ZA 4IMFA 2ZZ4A 3G1YA 1MSSA 2C19A 3F03K 4LS1A 3NQMA 4J9JA 4DXVA 3B0PA 3N9SA 1DL3A 2B7QA 4JEQA 4BI5A 4U4MA 5AYYA 5HNRA 1KM4A 1HO1A 2RDTA 2J24A 2OT1A 4NX5A 1K7XA 3HG3A 1H5YA 1TPFA 3T55A 4DF0A 3LRLA 1MZHA 4JS3A 1VYRA 2YFNA 1XUUA 3W7CA 3IIVA 1KM2A 1M7PA 4PTNA 2HS8A 1WBHA 4JTGA 3PBVA 3OHIA 4FNUA 1PIIA 2EAWA 5D2YA 4A2SA 3KRSA 4UMCA 4GWEA 4JTUA 2VENA 1TTIA 4O52A 1XKYA 3NQFA 5HWJA 1SUXA 1SZNA 2C18A 3IIPA 1TTPA 3STCA 2WNQA 4RJEA 3FJLA 4FXSA 1G7VA 3C2RA 1QWGA 4X9SA 3TC6A 2QEZA 4JTLA 3NPXA 4RZ6A 4LV4A 3MBFA 4UFLA 1Z41A 1P0KA 5G2HA 5CG7A 1OF6A 1QNVA 5TBOA 1SPQA 2NWRA 3PM6A 2RHGA 3L65A 3NPVA 4TU1A 4YMZA 5LZLA 4K38A 4ICNA 3C6CA 4KKXA 5LHFA 1KA9F 3PSVA 3GB6A 3WJYA 3LX9A 4Y9AA 5KZDA 1FQ0A 3N73A 1QFEA 2H90A 1JRBA 4MZ8A 3EXSA 5D2VA 3SY5A 3U8GA 1X1OA 1QOQA 2H6RA 4WY0B 1TPDA 4PODA 3TE9A 4JY9A 4IMCA 2V81A 2GVLA 3SECA 1PHWA 3GXTA 3OBKA 3G8RA 4LT9A 5U7SA 4O16A 2QAFA 1L6WA 4IXXA 5TQLA 1VS1A 4CCEA 2TPSA 3B05A 1TJPA 4GUFA 3FKKA 1MO0A 4UUIA 1OFQA 4JICA 3IIOA 1LDCA 4JTIA 5AC8A 5EKYA 3MHFA 2OCZA 4Z08A 2GQAA 2CLKA 5F1UA 3HQ1A 1V7YA 3W2UA 4L4LA 2A21A 2Z1BA 3TJLA 5K3VA 4FO4A 1JUBA 3U2OA 3SSJA 1JRCA 1I2RA 2VFEA 3QPYA 3HIJA 3GKFA 3S5YA 3PC0A 2D73A 2QF7A 1C9DA 1AL8A 3GR7A 3G3MA 3MYPA 3NGJA 3S5OA 3M9YA 5I3IA 2Y62A 3PVFA 1ZAJA 3MBDA 4GUIA 5LNUA 3UYCA 4RX0A 4MJMA 3GDKA 6TIMA 1LOLA 4CLMA 3E96A 1YYAA 4JGDA 5FEZA 4DO6A 3LI1A 3O63A 2QCCA 3VKJA 1PCKA 1ME8A 1A50A 1F5ZA 5LGZA 4X22A 4AMAA 1O5XA 3LCFA 3LCHA 1SR9A 5F2IA 5I3KA 4N4QA 4NJJA 1KBIA 1I2PA 2CLMA 4CNPA 3GDMA 5IBXC 1PS9A 3L5AA 1B3OA 2PCQA 2J27A 4Y8FA 5KITA 2ZRUA 2O7QA 4PEKA 2J9YA 4O53A 4WJEA 2EGZA 3TROA 1XBXA 4R7JA 2VFHA 3NVTA 3M1ZA 1N8FA 2ALDA 3KRUA 4O11A 4HNTA 1OFAA 2Q8ZA 3ZFHA 4UTLA 3FLUA 3E9AA 1Q6OA 3STFA 4QIUA 3GIYA 2P1FA 1H7RA 4K37A 4JTTA 1KM0A 1O5KA 3ZWSA 4NJIA 4PC8A 1EP1A 4CQAA 4JTFA 2Y6ZA 4K8HA 4JTEA 3P7YA 2DZSA 5EL1A 5DELA 2ZTJA 4MYAA 4GFSA 4PCFA 4LTSA 2EF9A 3UWUA 1OK4A 1UCWA 2ZZ3A 1C8VA 1U5JA 3SR7A 1FDZA 3D0CA 3WK0A 2W6RA 3F4NA 4FNRA 2E5CA 3L68A 1GWJA 3GAYA 3IEBA 3W3OA 1I8JA 2WSYA 5E1QA 3THQA 2R94A 1FY6A 3UPWA 5D03A 2FDSA 3W6YA 2EHHA 2ZRZA 4AB4A 4O1BA 3A23A 2BLEA 3ABOA 1X7FA 1W3IA 4KFOA 3GXNA 3V1PA 1OK6A 2NXHA 2B0MA 3DBPA 4I9AA 4FB7A 1TTJA 1EB3A 4AWTA 1W5OA 3N3MA 2WNZA 4UTTC 3LCWA 4WXYA 3TMQA 2HTMA 5C55A 5I3GA 5J5RA 4TMCA 3M43A 3TR2A 2JGQA 3QSTA 3DFSA 4XKYA 5K4ZA 1QR7A 2C14A 5TIMA 3Q58A 5F2MA 2RH9A 2Y7FA 5I3FA 1EPXA 3MMTA 2ISSA 3QZEA 4N02A 1RQEA 3TMLA 3NL5A 4Y6GA 5CZJA 5CZTA 5D30A 1D3HA 1H7XA 4C1KA 1ALDA 2E6AA 3MI2A 1OABA 3O6YX 1T0OA 3NQVA 4A29A 1F6KA 1SZGA 1VRDA 2DP3A 3UD6A 5K4XA 4ZQOA 3P5ZA 4OWGA 2Z6IA 3VI2A 4Z1AA 3BG9A 3SI9A 3M44A 1G4PA 1W54A 1FWNA 3W7NA 1O60A 5IM51 4O8RA 3UWQA 4M6PA 2ZRYA 4I7VA 3FIGA 2VEMA 3NR0A 5LNWA 3OG3A 4N9CA 3W88A 3TK7A 1ZALA 2WSRA 1A53A 3WK1A 5G1YA 3UNDA 3W22A 1WOBA 3G8EA 4GRSA 2TYSA 5C54A 2G95A 3JR2A 1KFEA 1XFBA 5CPOA 1DVJA 1M5WA 1TREA 3O8AA 2VC6A 4XQ6A 5DLCA 3TSDA 3DFTA 1IF2A 1RZMA 3QSRA 1OJXA 1UUOA 3S5NA 3CB8A 4TR9A 4O13A 2ZYFA 1VPXA 2FIQA 4N9BA 4UC5A 1ZHAA 4QNEA 4UCGA 2YPIA 1TB3A 3O6DA 4WOQA 1IIGA 8TIMA 2GQ8A 1F6PA 4IMGA 1C29A 4B5NA 3WFAA 2BX7A 1P4CA 4M5PA 3S42A 1OFPA 3UQNA 1VCFA 3FOKA 1EWEA 1DQXA 5HUPA 1K3UA 2CLIA 1TV8A 4HIBA 1WX0A 5CZSA 4CNNA 3T7VA 1K02A 1KM6A 1DJNA 2I14A 4M6QA 1WXJA 4RV8A 3O07A 2VFDA 3P8IA 1RV8A 1SQ7A 4H4IA 4JTKA 2EKCA 5I3JA 2QCMA 3NQEA 3W71A 3DFPA 4YWIA 3QPZA 1JUKA 2Q8LA 2ZZ1A 3KFTA 4S2CA 2QCDA 1SO4A 1DQWA 1JVNA 4Q4KA 1W5QA 4O1DA 3N2MA 3LDVA 4RXGA 5CPNA 1SFLA 2PRLA 4QISA 4NZFA 2DZPA 4HNNA 3G1DA
chains in the Genus database with same CATH superfamily
1LRTA 1UOZA 3UXDA 3BE7A 4Q4SA 2ZA2A 3UW6A 3T42A 2ZE0A 2NT1A 3BLIA 4NYUA 1UWUA 4BQ4A 3W1LA 1AW5A 3AAMA 1GOKA 5DT7A 1THFD 4RR4A 4F0MA 3N2OA 1GNXA 4UQBA 3OZPA 1GOIA 2QS8A 2ZZ7A 1NIUA 4EXQA 3MYOA 4C65A 3H54A 5HULA 1PUDA 2BVDA 4QDWA 2PGWA 3N2CA 3L4UA 3JU2A 3MUIA 6PTDA 1JPDX 3VDHA 1E0VA 3RK8A 3VD4A 1RP9A 1F74A 4HHMA 4JYFA 4K6AA 1F05A 1KGWA 4HTYA 2XN0A 1PWLA 5LNRA 2P50A 3B8DA 3QRHA 2YZRA 2W4XA 3MCMA 2X09A 4HCDA 4NAEA 1L0PA 3UWVA 3FXYA 2HBVA 3BW2A 1DTUA 4FOJA 4G1KA 3AUJA 5E09A 4LB3A 5HPCA 4NNBA 1ZTVA 1VEMA 3I10A 1HW6A 3I3EA 4N2YA 3FA5A 3TDFA 3RX4A 3JZEA 5MF5A 1S3HA 1XXXA 3KOXA 3W7EA 4PGLA 4WKAA 9RUBA 5A8QA 1EJUC 1V51A 2QCDB 3G3DA 1LBFA 3W7PA 5C6MA 1GZGA 4FLQA 1BYDA 4HA4A 3POHA 1GYNA 1FCQA 3W00A 4Z1CA 3BAXA 1FWEC 3QHNA 1OY0A 1N8WA 2OZ0A 1BKHA 2ZX9A 1UMYA 1Z6KA 1B1YA 2PDLA 5HQEA 2GGGA 3PZUA 2W62A 3C8FA 4GC4A 1HUVA 2RGLA 4GQBA 1TTQA 2A79A 3EDJA 5DCDA 4BF9A 3CL7A 2G3MA 3GHUA 4AVFA 2Y63A 5D09A 3LLFA 1FWIC 3KOFA 3CM4A 3BAJA 3S1XA 1H09A 2WVVB 3F2DA 1J0JA 2XH7A 5E5CA 4BF7A 4C91A 4YTQA 1YEYA 2FTWA 5I02A 1YADA 4MM1A 3ELFA 4MDPA 4UNLA 1BVZA 4AEOA 1HKJA 1P6CA 4ZOEA 3E38A 3LENA 3VOIA 4QLJA 4LVFA 1DE6A 3N6QA 3TONA 5G2IA 5LGXA 1RVGA 1G94A 1DPMA 1R3VA 1VFTA 4AF0A 3WDHA 4UIOA 1SZRA 4Z0SA 3E0FA 1JNDA 2FVMA 3GKAA 3T07A 3L5LA 4DLMA 1TA3B 2G3FA 3WJSA 4BEUA 4FLRA 2JFEX 3IVSA 3BXWA 4UTKA 4NX0A 3H2CA 1OIFA 4MB4A 2ZKMX 1B3VA 5CPQA 4DJDD 2OZTA 4WKFA 2A7PA 3CMJA 3WK2A 1G4EA 2Z29A 4HZ6A 4X9YA 3OU8A 3QEZA 3WDPP 3IRDA 1NWSA 4DUXA 3BG5A 4JHOA 4C6EA 1CEOA 4NVTA 3T05A 4LYPA 3APYA 2FZ8A 1DIKA 5MKGA 4CN6A 3BJFA 3M46A 3IV3A 5DBUA 3CTLA 3DCPA 4GIAA 4YTRA 1ZUAX 4Q32A 1DIOA 1GONA 4DM2A 4N6FA 5CGMA 4AWEA 1LZOA 4MKVA 3PZIA 3CV1A 1ZZMA 4GNJA 2ZIDA 6XIAA 3OGSA 2VFIA 3EKZA 3M0JA 4F0HA 9XIAA 3NURA 3ZJ8A 3L2IA 5EMUA 4ZE5A 1EZ2A 4DJFD 4YNGA 4L5ZA 3VGDA 1JPMA 1X38A 1OFEA 5D32A 3O0KA 5T26A 1RD6A 3M5YA 1VCGA 4WDXA 1A5BA 3GXMA 2Z7GA 1I60A 1Y7VA 4DYJA 4NJHA 3KEHA 3HJEA 1Z32X 4FZIA 1ZS2A 2OEKA 3FJ4A 4OE7A 5KMYA 3I7SA 3THDA 1ZAIA 3OIXA 3UXKA 1HJUA 2A4AA 5LYRA 4X2RA 3LHWA 3ZMRA 3UT0A 3A22A 2NQZA 3EOUA 6CGTA 3I3DA 2GUYA 5AHLA 4WQ6A 3T2OA 3LNPA 1AG1O 4QSFA 3N6JA 3AFBA 1EO7A 3DUGA 5LA2A 5CC5A 4MWAB 1QCWA 1CX9A 2WZIA 5A8GA 2DT3A 5GJPA 2XN1A 4NP7A 2B81A 3NA8A 2YL8A 4FXJA 2ATSA 4GUGA 1WKFA 1F4AA 1K9TA 2WC7A 1ZBWA 5FL1A 3W7LA 1TV7A 2DVTA 2QPXA 4YYFA 1ONWA 2IPFA 1G0CA 1VB9A 4QG9A 1RD5A 5HMEA 1EIBA 3TV8A 4QTGA 2W5FA 4F40A 4OU1A 3QF0A 1FWRA 5DMLA 1KM3A 1UJQA 3QY6A 3LHUA 4M29A 1ZJHA 1SJCA 4L1GA 4QDPA 2XGIA 4KRUA 1H63A 5JMUA 4KMQA 4C1LA 4I9TA 1GVSA 1GOXA 4ZE4A 5HUOA 3EA2A 3DHDA 4GHRA 3VKCA 3OZMA 3TIMA 5E6ZA 5G1TA 4GBUA 4O1AA 1DTNA 3D46A 3WLPA 1M3UA 1W3TA 3F7JA 3H53A 5A94A 1Y5WA 5AHEA 4AX6A 3OBAA 2OGYA 1QO2A 3GY1A 2Q71A 3WJWA 1KBJA 1UH4A 4DB7A 4ACZB 1FWSA 1GHSA 3I6EA 3BZJA 3QYQA 4O57A 2CKRA 1ZL1A 1KC7A 5AYZA 1JXKA 5IRPA 1YBQB 3U48A 3EWUA 2GGJA 3LY0A 5EU9A 4JL1A 3EXTA 1OSEA 3A21A 2DGAA 4LS0A 4PMDA 1EQPA 4JKMA 2V82A 3M41A 5EPDA 4A3HA 3RITA 1CI1A 3MB9A 3VA8A 5DX7A 3W02A 4J40A 4O0QA 1TWWA 5HXMA 4LX4A 4FNQA 3H23A 1KCZA 1JDAA 3WMCA 1XM3A 1F3TA 3PF3A 3UU0A 4TV5A 4H9ZA 3NOYA 1FP9A 1FHLA 4DPQA 3WQFA 4TO8A 4OBRA 5LSMA 3WH9A 4XKYB 1T5AA 5JU6A 1QW8A 1PHQA 3N19B 2DZTA 2QNEA 1ME7A 1PIFA 2EO7A 2FDMA 2E7FA 4HD5A 4ZO8A 2AGTA 4O17A 2NX9A 1E0XA 3PZGA 4PCTA 1PO9A 1AD4A 2PDIA 4HN4A 4LS2A 4DNMA 3AJXA 5BWFA 2WNNA 3C2OA 1W3LA 2E9MA 1KTNA 5MHBA 4JQ4A 3SFKA 3VKBA 1FCUA 4EXAA 7CGTA 4PZVA 3R0KA 3BLDA 3CWNA 5CCZA 3TW9A 3BC9A 1GGOA 2NV1A 1M9HA 3GK0A 1Q7ZA 1H0IA 1UWRA 2DZXA 1SSGA 4AEEA 2J7DA 1R3RA 2YCKX 3USBA 2INEA 2VGGA 1RCOB 1KRMA 4IGSA 2X1TA 9XIMA 5D02A 4ATLA 5K2ZA 1X39A 3KE0A 4WF7A 5D2TA 3G1HA 4DJED 4UTIA 4RPQA 1Q5MA 1UP0A 2X0YA 1QK0A 4I5XA 1J5SA 1I2QA 4ZXOA 3OGVA 1UZHA 1DWAM 1ZBCA 4UFKA 2OVLA 3GC4A 4UTWC 3W1XA 3GDLA 1OT1A 1ZSXA 1XH1A 1E51A 3URBA 4OBSA 5REQA 4XG1A 4LH8A 1IEXA 3BPWA 1F61A 4PL2A 2GJRA 2WV8A 1W3NA 1J11A 1W1YA 4F66A 1ZFJA 2FGZA 2WCAA 3W7JA 1AH0A 4DJFC 1TWDA 5I09A 3ZXWA 5CGTA 1B3YA 1C90A 1K7FA 1X6LA 5A1AA 1ZU8A 2Y7DA 3L0GA 2ATMA 2J8TA 3R13A 2PODA 1BF6A 4ADUA 1WV2A 4AD3A 3QKZA 4O15A 2A85A 3HZ3A 1JCLA 1V5XA 3IANA 3W7DA 3EWYA 2WKLA 4REQB 4O54A 3K2GA 1H5VA 1JPHA 1IYXA 3GUWA 1I9CB 3M0KA 4QR6A 4QGCA 3SIZA 5AHIA 2V2HA 1PYFA 4DQWA 2MNRA 1UD3A 4JIHA 2J6VA 3AYVA 1FHUA 2NLYA 4AZ7A 3ZT5A 1JPIA 3CV7A 3LTYA 4L1WA 1VBGA 4KGLA 3IRSA 1TPWA 4CCCA 1DE5A 1Q13A 4KWOA 2YLLA 3RO6A 2NUXA 1CXKA 3LBCA 5EY5A 5CC3A 3CIWA 3O15A 3EWDA 1YRRA 4L1XA 2R24A 4P61A 3KLKA 2BGSA 2C15A 4ADTA 4IX0A 2W0UA 3EWWA 1NF7A 2OWXA 3QMSA 1CGWA 3CUGA 5C2XA 1S3TC 4E4UA 1XYZA 1FTXA 3G1AA 2REQA 6REQB 4QG6A 5D9NA 3AZRA 1HQTA 3SQMA 1QT1A 3UXAA 2Y4SA 4IZGA 4GFIA 1TV5A 3MW7A 3TN4A 1TPC1 3AS3A 4GMEA 3URNA 4NAEB 5ABTA 1JAEA 3LHZA 2F38A 4RKAA 4AWSA 4FX7A 4AD2A 3HG2A 2BVWA 4AD5A 3MDWA 3F4CA 1CECA 4V15A 3FVMA 2Z1XA 3EWCA 4A3UA 1MVYA 3TN3A 3TNBA 4D6IA 2AQWA 4LW7A 4AHOA 3RU8X 2ZX7A 1TUXA 1EUNA 2WW5A 1FFQA 3ABSA 1SFTA 3QMTA 4P8WA 3GRIA 3GSMA 4M1RA 4PFHA 5BW6A 2EEXA 3I7QA 4HU0A 3URQA 3WCZA 4F2BA 3AYSA 4CUCA 4PULA 1POJA 4QHRA 4RV3A 2GSHA 1NVMA 3D5HA 1FUYA 1Q8JA 4HYRA 2PDXA 1M04A 4IT1A 3RPMA 2R1PA 2J7GA 2HJPA 2DSUA 4MY1A 5CXPA 5HAOA 4YPJA 4GACA 3DN5A 2F6UA 4KEUA 3SUUA 1UH3A 1RLCL 3TA6A 1ESWA 2ZC1A 3KCOA 2PRHA 5DXYA 1V3LA 1ELSA 3AIWA 1BRLA 5HATA 1VHNA 2O0TA 1MEWA 1UWQA 3WLNA 2V8ZA 2TMDA 5C9ZA 3NQGA 3BQ5A 4YCOA 3TZNA 3PTMA 4Q8QA 1E4IA 1FHDA 4I9JA 2I1OA 2VQUA 2ISWA 3KAOA 4IM4A 3KXQA 3AIVA 3MVIA 2RDXA 4I7WA 2PAJA 3ANYA 5ABEA 1QI5A 4YTTA 2PWDA 4DBDA 4DWSA 5CSSA 2H8XA 4IPPA 3QZAA 4C6JA 2Y24A 4JX6A 2CHRA 3HPSA 2HBXA 1DQUA 4YTSA 3PULA 1G4SA 2ZXQA 1KFLA 1F2JA 4AF0B 4CEXC 3V16A 4LCQA 1G9HA 1M41A 4D6GA 3PBWA 3U7BA 2C0HA 3FHQA 4NASA 3VC6A 4AQLA 4KCTA 3E5PA 2E3ZA 4WSHA 3SGGA 4C6LA 4U3CA 3DI0A 1KFCA 3OYXA 4LBUA 5E70A 3VZXA 4GVHA 5TD4A 3TTYA 1IHIA 1S2UA 2QJIA 3SADA 2G3NA 2OTDA 3S83A 4PB4A 2ZX6A 4L6DA 2J13A 4QP0A 4L9ZA 3I68A 4OV9A 3ICJA 4Q7BA 4FX6M 4L7ZA 4NAFB 3AXXA 4IF2A 3W38A 3FSTA 2YGYA 3BAWA 4ROQA 2J79A 1HGYA 3SRHA 2CZEA 2QAPA 3BQ6A 1RR2A 3L2LA 1EGVA 3HQOA 3T81A 4GXPA 3S9ZA 1W37A 3M16A 2DJXA 1UKPA 2FJKA 3C52A 3TW6A 1PL9A 3L4VA 3T1GA 1E9ZB 3ZLFA 1K4GA 4ZXLA 1XW8A 1K8ZA 2Z2UA 1MZRA 2H9AA 3G1FA 5JUVA 4ML4A 1B3WA 4GZIA 2ON3A 1JI1A 3V1HA 2PWEA 2QCFA 1BQGA 1FCBA 5FJUA 4HT3A 3IGUA 2OO6A 2CLLA 1BFNA 3KM8A 3WF3A 3GHSA 1S5WA 5EBAA 3PBMA 5A6MA 3RLUA 4GC3A 5C7VA 5I7GA 4CEUC 2V6AA 4M82A 5E9XA 1R46A 3GH7A 3OW1A 3GG0A 3BVJA 2NV2A 1UW9A 1HTIA 4C5YA 2I5GA 2ACRA 5FESA 4ZQNA 4WX2A 3GW3A 4Z2HA 1QHOA 2VZVA 4FNPA 4IPNB 4TX8A 2OG9A 3AMKA 3UP8A 1GOQA 3L4XA 4OGZA 1J8VA 3GLCA 4GY0A 4ORMA 4RLIA 3CUZA 1Q3NA 1ML1A 1MEIA 1J0YA 2Y2WA 2F8QA 4ADSA 2FHCA 3PPCA 2E8YA 5AYBA 1HNYA 3KZPA 4ICMA 3RFAA 1G4TA 4MDOA 4YN5A 1TX2A 3AZSA 1KW1A 2X7VA 3TSBA 5GVJA 3WLKX 2P0OA 1V6TA 3OA3A 4JCMA 2RDUA 7TAAA 2TAAA 1BG9A 3UY8A 4KWVA 4YIWA 4U10A 3WJZA 3OIHA 3TEVA 1NM9A 1TJ2A 3UGRA 3TXVA 5I2UA 1SU5A 2DVXA 3PWGA 3PUEA 1UR1A 3R5EA 3ITVA 2A2IA 4PMZA 3KZSA 2ACQA 1V93A 3N12A 5KZMA 1B54A 4MZ1A 3MO7A 2AOSA 4RZ4A 3C2FA 3UZXA 3W86A 4CD7A 4HA1A 1EOMA 3LRKA 4ZZ9A 3U3HA 3UZJA 5JBDA 1DBTA 5FD0A 1Y65A 4DPPA 1F7BA 1XYBA 1XDJA 5DF0A 5FF4A 1QBAA 2BXYA 1CTNA 1SMDA 3SCPA 3KBSA 4J2MA 2E8ZA 4PTXA 3E2SA 5IFPA 2PDQA 3GWQA 1BWLA 3KP0A 1DJWA 1ME9A 3RG6A 2VGFA 3M0YA 3IV8A 3NYZA 5A5WA 3EOEA 2O9PA 4IFRA 1W32A 3O06A 4H2HA 3QC3A 3W75A 2WPGA 5EA9A 2A0NA 3NG3A 4J1OA 2ZRWA 2JGYA 3VDGA 4HPHA 1UP3A 1GPWA 2C6QA 4X61A 2Q01A 1O5QA 3TC3A 5AOUA 1KWKA 3AIEA 2Z4GA 4HSNA 4TMBA 4P8VA 4K7YA 4YXGA 3VD9A 1D7FA 1OC7A 5G1MA 4NJGA 2ICSA 4GX8A 3HN3A 3P62A 3VKKA 3MDUA 3N4EA 4DUVA 3E49A 1MXDA 5L6UA 1B0IA 4W85A 4PUUA 4OBTA 5DCBA 3TYCA 3R89A 1O7AA 4JR5A 5GNZA 3I7RA 4FIQA 1J2WA 1ONXA 1ZJAA 3H2NA 3UWZA 2V5CA 1A5LC 1CLKA 3B04A 4LPCA 1UH2A 4MKNA 3C86A 1EXBA 1VEPA 4HU4A 4BF5A 3W7OA 4W89A 4EIVA 4JX4A 3LV5A 3TC7A 4XKMA 2JQXA 2J7HA 2J78A 1XLFA 4XWUA 2YDAA 3IUHA 3POCA 3HMJG 1W17A 1F9CA 3V5FA 1X1ZA 3WUFA 4CD6A 5JVLA 3MSDA 3SQSA 2YBTA 3H26A 2Z28A 3CYJA 3B0PA 2B7QA 3GNXA 6XIMA 5AYYA 3MSYA 1XKJA 4AY1A 2RDTA 1AQFA 5LIYX 2BOFX 4EPKA 1TPFA 1MZHA 5FACA 1VYRA 1UA3A 3W7CA 1GW9A 2I5QA 4PTNA 4LF1A 1WBHA 5C70A 3BH4A 4FNUA 1M01A 4MG4A 2YDRA 2EAWA 1OB0A 3W0KA 3U57A 4JTUA 4GWEA 2IW0A 1TTIA 4O52A 5HWJA 3NQFA 4FXFA 1Q6FA 2C8NA 1SZNA 4IFOA 4Q6XA 3IIPA 3STCA 3OP2A 1C91A 2POZA 3T4WA 4IFKB 1FH9A 3V35A 1HKWA 1Q63A 4X9SA 3TC6A 4RZ6A 3MBFA 1Z41A 5REQB 3BICA 5TBOA 2NWRA 1UZ4A 4W5UA 4YMZA 3OZOA 2B31A 3U2CA 5LZLA 4K38A 4KEZA 4HNLA 3C6CA 3QGKC 3HQNA 1A0CA 1GCYA 5KZDA 1VIWA 3SURA 1X97A 2VX6A 4DUWA 3LEPA 2E40A 3QGAC 3EXSA 2G4JA 4I8YA 2H6RA 5DFAA 3E1F1 4HP5A 1K1DA 1IGWA 1WAWA 4IMCA 1W3HA 1QNSA 2PSNA 3QZ6A 3GXTA 4PB3A 3FHAA 4IXXA 5TQLA 4C7DA 2DSZA 3REQA 3DOPA 1JDCA 2DZBA 2P88A 1H0GA 3FKKA 4CNTA 1MO0A 4IQEA 4WCJA 1OFQA 5IHSA 3LSBA 1LDCA 3FVDA 4G6CA 4MJ4A 3Q65A 3MUCA 2GQAA 5F1UA 1V7YA 3PZTA 4FO4A 1JUBA 2WVUA 3S5YA 4GI9A 5D9PA 3G3MA 3UG3A 5PTDA 2Y62A 3PVFA 3PTKA 1E6RA 4FOKA 5LNUA 1PZ3A 4MJMA 2Z2BA 2DSWA 4E8CA 4F0RA 4CQDA 1E4MM 3GHTA 2D3LA 1GKRA 3USZA 1VJZA 1ME8A 5FKYA 3LA4A 5LGZA 3B40A 4AMAA 3F5JA 4KRZA 4CKQA 4YTUA 4N4QA 4D8AA 4ZB2A 1Q8AA 4RDWA 1A4LA 1PS9A 1TCMA 3WEZA 1B3OA 2PCQA 4UBPC 2J27A 1Z89A 4QDMA 2ZRUA 2O7QA 4PEKA 5FA5A 4C6MA 3QPEA 4US6A 3ARRA 1XBXA 1TZZA 4R7JA 2WBGA 3NVTA 3M1ZA 4O11A 4HNTA 1ZBVA 3WFLA 4L6OA 2J7FA 5HOSA 3VGGA 3UJFA 1KB3A 5HNNA 4IIGA 4PC8A 1EP1A 4CQAA 4JTFA 2Y6ZA 1VD6A 3QR1A 4JTEA 1WXYA 2DZSA 3CPUA 2VC9A 2PU1A 3BTNA 4GFSA 4LTSA 2EF9A 3SR7A 4HVXA 3D0CA 2W6RA 1BQCA 3F4NA 3GAYA 4PUMA 1P0EA 3W3OA 1WPCA 4I8DA 5E1QA 2FDSA 2CEQA 3CLWA 2EHHA 3HPFA 1NFPA 5CLTA 4IP7A 4LUSA 4O1BA 2VURA 4ZOAA 3BJTA 3ABOA 3GXNA 3WKZA 4C6DA 1BRLB 1OADA 4I9AA 5XINA 3AALA 1TTJA 3UJ2A 1EZWA 1W5OA 2W61A 4WXYA 4Q6JA 1TJ0A 2CIPA 5J5RA 2WWDA 3DFSA 2WZMA 1EF2A 5K4ZA 1QR7A 4CQBA 4QS6A 2Y7FA 5I3FA 3MMTA 1EKOA 4DWSB 3WENA 2ISSA 4FLOA 4KERA 3SCNA 4GPNA 3TMLA 3WMSA 2VZUA 2XISA 2F6XA 3P0WA 4UOZA 4C1KA 3MSGA 4G5DA 3SRDA 1TE1A 2XVPA 2BB0A 1U33A 1V3KA 1F6KA 3I4KA 3SM0A 1SZGA 3NXLA 3QV6A 4BQ2A 1R3QA 2DP3A 3UD6A 4XZLX 3P5ZA 3VI2A 3B9OA 3WNPA 3SI9A 3M44A 1W54A 3HMCA 1VPQA 1SMAA 2XDFA 2AKMA 2QMJA 5ABFB 1F8MA 4LUTB 1B90A 1LWHA 4K2SA 3UWQA 4M6PA 1UD2A 4YHGA 3W88A 4AZ6A 2WSRA 1A53A 4XV0A 5XIMA 2X2YA 3MY9A 2VR5A 4QJ4B 3GBDA 3B9NA 1LT7A 1UC5A 4EAMA 3CT2A 2CBVA 1M5WA 1TREA 3TSDA 2VC6A 3DFTA 1C8XA 1NFGA 2HZGA 2GUBA 3CB8A 4GYPC 5HJYA 2FIQA 3VINA 4UCGA 3EMQA 3RJYA 2WHJA 2XWDA 3EPMA 1TB3A 1NTHA 2G0WA 2ANUA 4WOQA 1UPPA 2WVSA 4H04A 3FGCA 1U30A 1F6PA 4IMGA 4IJRA 1C29A 3WFAA 1P4CA 1OFPA 1XR2A 4TTGA 3J7HA 1GPFA 1JDDA 2CLIA 1TV8A 4F2TA 4ENLA 1BAGA 2WMIA 1XIHA 3DHPA 2I14A 3THUA 1XLIA 2V5JA 4JPGA 1WXJA 3MWCA 4RV8A 2GZXA 3P8IA 1SQ7A 4JTKA 1BYAA 2Z27A 3ECQA 3W71A 3DFPA 1HIZA 4JHMA 3HV8A 3KFTA 7REQB 1DQWA 4J35A 2O92A 3XINA 3LDVA 3QOKA 3SY8A 3HFYA 1SFLA 2PRLA 5KEZA 4QISA 1UWIA 3MPGA 4HNNA 2F2KA 4GQ0A 3E5BA 4H83A 4X3ZA 1VLIA 4UFJA 3VDBA 1D8WA 2PURA 2XFYA 1JCYA 1ICPA 6A3HA 3IJIA 8RUCA 3DHFA 1EWDA 1TIMA 1S5NA 4P7OA 2DZAA 4KCUA 5LA1A 4R34A 1AODA 3R43A 3NM3A 3P67A 3LXAA 3PZNA 2GDQA 2JKAA 2ESCA 3CAWA 4J2PA 1FDJA 2DORA 2E1WA 2Y89A 3LMZA 4J28A 3VZZA 4C6QA 3UR8A 1N55A 1OZMA 1VZWA 3HV9A 3O6CA 1IR2A 1W3JA 2HV5A 4IUGA 5F7UA 4LAUA 4DO4A 1H49A 1IV8A 1JDEA 2Z1VA 3LB0A 3RCMA 1I1XA 2HE8A 1WDPA 4C1NA 3P82A 1VP5A 5H8PA 4RCXA 2NUWA 5LHEA 4NKCA 1JQVA 3ZLHA 4CQ9A 4A3YA 1MMFA 1F3EA 1MRQA 1NFBA 1CENA 3LLDA 1JZ6A 3R25A 3GM8A 3PAJA 3F2CA 2GGIA 1JF6A 2GSEA 1UZ1A 2R82A 2H3BA 1L8NA 2E6YA 5L9FA 3QHOA 4B2DD 3LQGA 4XUGA 4HN8A 1OHLA 5C9UA 1EBGA 2PU0A 4FK9A 1GG0A 4DYEA 1PKNA 2YJQA 2ZFAA 2R91A 2WKGA 2ZUWA 4HSHA 3H2EA 4NNCA 1NOFA 1SJDA 3WYZA 1R38A 4TVUA 4H9YA 3VUPA 3CV6A 4J5NA 4WEVX 3WX7A 2CLHA 3CH0A 4WOZA 2Z2AA 2VC5A 2RKXA 2V2CA 2GOKA 4K1WA 4JTSA 3PTDA 3PBGA 3A4WA 5HR7A 1PXGA 4IOTA 3RDKA 3EDFA 5EB8A 4H8HA 1HJXA 3W84A 4IP4A 4HMDA 1NARA 5F1VA 5G4WA 2E28A 3T78A 1GOMA 3WMLA 4M7SA 3IGSA 5T9CE 1VCVA 2P5NA 3S2CA 3W85A 3VGBA 4G1NA 3NAVA 4E0CA 2HPIA 4OQVA 1GKQA 4LC8A 2VHLA 1PTDA 1NF0A 1K7EA 3A5VA 3CO4A 3IJ7A 4IL0A 4LJ3A 4E2VA 3IK4A 5I6SA 4KPLA 3NEVA 4IP5A 3EX6A 3DU0A 3ZJ6A 2NUYA 2ZC8A 3SN4A 3Q4DA 4LOCA 3AS1A 3W7RA 1EDGA 2Q3RA 5IBXA 2I9UA 3A13A 1AQHA 1PCWA 1NP2A 4UTUA 5HWNA 4K36A 5D8WA 1ZB5A 1TIWA 1EF3A 1UIOA 3MU7A 3M5VA 2HVNA 1ZBKA 5I3DA 3TTQA 1A5AA 3VC5A 5F4XA 3ZVIA 2CETA 2VGIA 4QCEA 2DW7A 2NT0A 1LUCA 3LTPA 1JCTA 3IJ6A 4LEQA 1KRAC 2XIOA 1XSKA 4H6EA 3IUDA 1TZ9A 1AW1A 1OFBA 1XH2A 1LYXA 2I16A 4NY2A 4WUIA 2IPGA 1VF8A 2X30A 1SO5A 5I06A 2ZBTA 1X8FA 1Y0EA 2JKPA 4HOXA 3S47A 3BOXA 2XJ7A 1EGZA 4H00A 3B0VC 3P2VA 1GVEA 3A24A 2GPTA 2ODOA 3P14A 4NI3A 4B5VA 4Y96A 3W73A 2WHLA 2QCHA 4O0KA 2FKPA 1T40A 2J6XA 1TX0A 1Q4WA 1KFBA 3FAXA 3W74A 3KS6A 1ADSA 1BF2A 3M6YA 1W1PA 4XBJA 3NL2A 4K3ZA 3WK3A 4MUZA 2VDIA 2X1UA 5DBTA 4Q8WA 1TE6A 4E4FA 4LAZA 1WDDA 2I57A 4V33A 2HE5A 3TCEA 3UESA 3FDKA 4C6FA 2GJNA 3SJ3A 2VUNA 3GQYA 3ZR6A 3AHVA 2ZVIA 2FTPA 3PZQA 1XIIA 2QGHA 5AHNA 4ROPA 1CGTA 3NGFA 3XIMA 1OCQA 2J9XA 2NSXA 5HMDA 3AXMA 1P0NA 2EBNA 2IPJA 4H19A 2V5KA 4MJZA 1PTGA 3S1GA 4BFAA 2O9OA 3FY1A 4ECLA 5CPLA 1XIJA 2FMNA 1WB0A 1JULA 4JL2A 4M56A 1JYXA 3BGAA 1UBSA 1E0TA 3RRXA 4EK7A 2V30A 3QQ1A 5HPOA 4KFPA 3VOFA 4B5UA 1ITXA 2XVLA 1UD4A 3YPIA 4B2DA 1J4EA 4KRTA 3TFCA 3REQB 1FXQA 2VUYA 3SIMA 3GR4A 3TAKA 4ZQRA 2YCLB 1HJVA 3C0JA 3RXZA 4QE5A 5BXPA 3DAQA 1LBLA 5FI8A 6ALDA 3ONCA 3WDRA 3WUBA 2A3BA 4ASTA 5A8PA 1SFJA 3FS2A 2PDWA 5E93A 4C60A 3TN5A 1EJTC 2VX5A 1EJ7L 2OFJA 3N18A 1W2VA 1WP6A 1FWHC 4JN6A 3H21A 5FJTA 2ZQ0A 4S3KA 4GD0A 2ZUSA 3T0DA 1J18A 4PCPA 4OJYA 3F2BA 3DG3A 4I3GA 1PX4A 4P7NA 4UR9A 5HDRA 3VIHA 3JUGA 2ZE3A 5D8ZA 1MXGA 4WZHA 3GR8A 3B8UA 3VABA 3F5KA 4UTJA 5FCZA 3NQBA 4PMNA 1CPUA 5CPMA 1G1YA 5DMYA 2VELA 3NQ7A 3U4AA 1XWYA 3PG9A 1W8GA 4Q7IA 1JFHA 2RJHA 3G1SA 5D4YA 5CGQA 3EOSA 2HPMA 3ABQA 1NOWA 3NO5A 4PA8A 1JZ8A 2BXZA 1L6SA 3UWEA 4HJFA 4OIFA 2AMXA 3S2LA 1DKWA 5BU6A 1JIBA 1KFJA 4MMWA 3OLIA 4PBEA 3TP4A 3MV11 2XIJA 1QI0A 3HURA 4IUOA 1OG0A 1EJWC 3G0UA 3W53A 2YBUA 3VNJA 4RDVA 1E70M 1BGGA 5AC6A 2PD5A 3QY7A 4H9VA 5IXEA 1GZ1A 1Q65A 3LPOA 1R2TA 4MADA 1TPEA 3HU7A 3N4FA 1XG3A 4C6IA 1MW0A 4LGXA 3QQWA 4IIBA 3W25A 1MNZA 4A8RA 3GTNA 2PE4A 4X60A 1SZEA 2V5BA 3B06A 2X1RA 4V1XA 2VOTA 1GQNA 4JN7A 2OQHA 2WXDM 2WO5A 3MI3A 2WSPA 1S2CA 3U5UA 3RU6A 2BFGA 1H60A 1VQTA 4LBSA 3ZR5A 4JTRA 4B15A 1Q66A 2FB2A 2PDFA 3E0IA 3BSHA 3WLRA 1DJIA 4H8VA 1AZ1A 5A95A 1WBJA 2ISFA 3CHCA 4JTQA 2OYKA 2VEGA 3TWAA 1W31A 2ZRXA 1W8SA 2V63A 2PWUA 2X8RA 4MWAD 2QUTA 2E6FA 1S5TA 4YVPA 1AZ2A 3DEQA 3NUKA 3QYSA 3UJEA 3VMPA 2ACUA 4PMVA 1HN1A 4JYEA 3ARTA 3M7SA 4JN8A 4X0NA 5AZ1A 4DX3A 3CAKA 1MFUA 1JCJA 1DWIM 1HJWA 4S3EA 4B5SA 3BW4A 4JNMA 2QJGA 3IACA 1CWYA 2PLJA 1PDYA 3DYMA 2QR6A 1PZ2A 4ATWA 2A7RA 3UGVA 3Q2DA 3OVRA 1QOPA 3KDOA 1O95A 3I6RA 4PL1A 3WQEA 3C3NA 1SW3A 2VM8A 2OZ3A 1QHPA 4V27A 4GA8A 2CERA 4PFMA 4XAPA 5A6BD 5BOEA 5ECVA 2D20A 3K8KA 2Z1WA 2WLZA 1OFDA 3NZQA 4QJ1A 3AHYA 2PCEA 2F6KA 3V5CA 3EX2A 3WQGA 4RZ5A 3PPFA 5CZKA 1E6PA 2ZX5A 3SCRA 1DOSA 3R6IA 1KFWA 4LB4A 4XAYA 1IZKA 1KLZA 1IXOA 3WFZA 5BOFA 3GG7A 3W76A 1EA0A 2C0AA 2ZA3A 4A2RA 2WMIB 5AVHA 3W7KA 3W2JA 2ZRVA 3PR2A 2WCSA 1VYSX 2VYOA 3NPUA 2B4GA 3N14A 3S0CA 4AZBA 3W7IA 3WNNA 2ISVA 3A4AA 1IEVA 1NU5A 4WY0A 1DV7A 3TOYA 1EDQA 1FWTA 1KTCA 1DHKA 3W07A 1I4NA 4MOZA 3FYYA 2PDGA 4NHVA 2IQTA 2ZTKA 4Y9MA 5FEWA 3OG2A 1BG4A 1MUWA 3DBNA 4O8AA 4AYSA 3VNKA 4PSRA 2GUUA 4L4OA 5HMSA 3RLVA 4K39A 3V75A 2E0PA 2VO5A 1XUZA 3CL6A 2A3HA 3T2QA 1AL7A 1PKLA 3LTSA 3W87A 3WQ8A 4O1FA 2X1IA 2PC4A 1US2A 3DC0A 2VZOA 1H61A 4ZSTA 4E3VA 2J4GA 3TX9A 1KTBA 3TYAA 2AAMA 2IQDA 3KVKA 4JTHA 3FCPA 4HZ8A 2A1YA 3PZMA 5E0CA 4I5RA 2QGYA 4S2BA 4DNHA 4QROA 2YXOA 1Q6QA 2X0SA 2NV9A 3SSZA 1WAUA 2E25A 3EGJA 1U5VA 3L0KA 1FWWA 1FXPA 4PUEA 4JY8A 2VDGA 1ZGDA 3UJSA 2G5WA 3FK4A 4C1NB 2YL5A 3TQKA 1IT7A 3AMDA 4GLEA 3L4WA 5EGRA 1ONRA 1JCNA 3LI0A 3CQ0A 1GG1A 2PDNA 1QW7A 1WOAA 5D05A 4LANA 2CXGA 1K9EA 3FSUA 3PPGA 4F0SA 2VCBA 4RNFA 4X0VA 4FR6A 3ZT6A 3LLXA 4WSKA 4PMQA 1W1VA 7TIMA 5CG0A 3T4CA 1XL9A 4RNJA 4E2DA 2XFWA 3CUJA 3QM3A 7XIMA 3C8NA 3EA3A 1KNWA 4EWND 2EXOA 1OEPA 1KCXA 4WVXA 3LHYA 4HYVA 3DXIA 3VIMA 5I77A 1IQ8A 4HTBA 2C91A 1TYGA 2UZ9A 3NQ8A 2OWWA 4V28A 1L6FA 2HS6A 1FWCC 1LRNA 3CZEA 4AX7A 4LXFA 3GDRA 3N2BA 1YMYA 1JNEA 4O4VA 5CQ1A 3WQVA 4LAOA 2CYGA 3LCIA 4IGNA 1GVQA 1NDVA 1DJZA 1NJJA 4WSJA 4P7LA 3WZ0E 3W1QA 3EPNA 3N1AA 4RNIA 3EB2A 3WL1A 1H2JA 2Z6JA 3RGTA 4FOUA 4W7UA 4QJ5B 3GVVA 1LCOA 1YTEA 4UXDA 3W01A 1XIDA 4EF8A 3H22A 1TMHA 5A6BA 4MSSA 4LV9A 3R0DA 4B90A 2YXXA 2CLOA 4GI4A 1R8LA 3WQ4A 3N25A 1B30A 3H2MA 1K6AA 2WOQA 4DN1A 3H8AA 3VFLA 1IEIA 1VBUA 3SUSA 1P1XA 2GDUA 1R2RA 4UCFA 4MVAA 3AIRA 4NZ4A 3W7QA 4XZWA 3VIPA 2PDKA 3EB3A 1G7UA 4JTAA 1PV8A 3A3XA 1F3XA 2QUUA 3EKGA 4FX8A 2BSLA 3I3BA 1DJHA 3I4EA 2YOCA 1JCMP 5I3HA 4QSHA 4LBRA 1T7LA 5D37A 4MWAC 3UZZA 3BV7A 2YW3A 4GX9A 1LUCB 2ZADA 1JYNA 3V7PA 4MLRA 1MQRA 3LQLA 3STGA 3S9YA 4JQ3A 3UA3A 1NSJA 4WXZA 1KR0A 1XBYA 4UFHA 4GYPA 4BCEA 2BDQA 1XRFA 4GIRA 1XRTA 1OINA 1VR6A 4KH2A 4C6CA 3UZ5A 2FZBA 1KCKA 1O1HA 3RCNA 2VC7A 3OQEA 3BSGA 1OC5A 2CZDA 1H1YA 2E77A 1XDLA 2OR2A 3JZUA 2GFTA 5FJJA 3MWAA 4N7QA 1TPB1 4DZIA 4WJ8A 1AH4A 4JCLA 2QT3A 1B9BA 2VR4A 3CT7A 2VWTA 4NZ3A 5BU9A 1I75A 1OCJA 1XS2A 3W37A 4LVGA 4BWLC 4XTDA 3HGRA 1JCXA 2FQIA 4YLWA 3NZPA 4D6FA 4EF9A 1R47A 1I45A 4ONVA 2EG8A 4UMAA 1QNPA 5I5RA 4NZ5A 4ICCX 2CLFA 3KHDA 1W3KA 5K7JA 4GJJA 4PMJA 4XO7A 1K9DA 2HSAA 4US5A 3DIPA 1Q6EA 1CCWB 3SCQA 1ICQA 3ZWTA 1XFCA 4Q8NA 3QH2A 3PG8A 3W1AA 3SN1A 2NX3A 4UZUA 3ZM8A 4GBDA 2PTYA 4ORIA 5LA0A 3TNOA 3RMJA 2YX0A 3QQ0A 3EWZA 1OF8A 1EEPA 1UJPA 5E0FA 2UY2A 2G8ZA 4MKSA 1W9XA 4G9PA 1XYAA 3MC5A 1E5NA 4JNYA 1UG6A 3MUZ1 2WSQA 2WQPA 5FSDC 1CBGA 1FBAA 1CB7B 1A80A 3C61A 1JZ5A 1JL8A 4JOMA 4DF1A 1XJBA 1RY8A 5EBUA 5LNVA 2V38A 4AC7C 4BQ3A 4E6MA 4E2OA 1ZY9A 3TYEA 3CPGA 5FEPA 2J75A 2QCNA 3WQ6A 3ITCA 4MTVA 4HPXA 5AYXA 5I79A 4KWSA 1YX1A 1GTHA 4U5KA 2NQ9A 1I1WA 2D3NA 2WMGA 1BLIA 4ZGYA 1R86A 3ITYA 2OEJA 3TW7A 3F1QA 2QKFA 1XLJA 1Z9AA 3WF2A 3DKJA 2CHNA 1DHPA 3W7GA 1HKIA 5AN7A 4IH3A 1IEQA 2DEPA 3SEPA 3BARA 1OX4A 4IMEA 4OECA 4AZ5A 4XBKA 1W5PA 3NQAA 1M53A 4FR1A 1TPH1 3OTRA 2DY3A 1QUMA 2UY3A 3NZGA 3KDNA 3IGHX 1B3ZA 1HZYA 1E40A 3IAQA 2D22A 1EPVA 3CHDA 4OV4A 4DVOA 4XZIA 3UNTA 3E0LA 2RJGA 3BOFA 4NSBA 3W2LA 3GNNA 2OU4A 1JYWA 3B8IA 3TCSA 1RA0A 5GJMA 3EX4A 2KAUC 3UCCA 4R27A 3TJIA 3R12A 2FFCA 2CU0A 4EX4A 4GIEA 5D38A 2BGNE 2PTXA 4NJKA 1TWZA 4AZGA 1EC7A 1GVFA 3DYPA 3OLDA 3QC0A 4EOUA 4DBWA 5LIWX 1HL9A 4XBSA 1EYWA 3NSNA 2BOGX 5M1TA 3QTGA 1RQBA 1HJQA 3AISA 2VFFA 4DI8A 4W88A 2WMHA 3GXIA 4LWWA 2VD8A 3IIZA 4Z0JA 2E5DA 2IUZA 4DO7A 1AJ2A 1H1NA 2OZ8A 2WMKA 3DGRA 3MUXA 2QIWA 4DEFA 1I2NA 2AL2B 1QWKA 2DH2A 3ARPA 3WL0A 4A3QA 4LYQA 1E6NA 1WXZA 5LKYA 3LOTA 2ZCGA 4AHPA 1LTDA 3L21A 1E56A 5T8GA 1LL7A 3UEQA 1ODUA 3VX1A 3H7RA 1QJWA 2DDXA 4IPJA 1F3WA 3KOYA 5ECUA 5CKSA 4Q8VA 2D69A 4AZCA 4TVDA 1MRAA 1MSSA 3ME3A 3NQMA 2NQ5A 4J9JA 3WUGA 4U4MA 2XG9A 5HNRA 1B9ZA 1LQAA 2J24A 4PCNA 1K7XA 1UA7A 3ONBA 5C8BB 3ARWA 3LRLA 4JS3A 3WD3A 4EKJA 4BEQA 3IIVA 3F5LA 3BMXA 4XD4A 2AKZA 3SCVA 1LL4A 4V1YA 5D9OA 2WANA 4JTGA 3WELA 3PZVA 1VFOA 2HNHA 1L8PA 2X40A 2ZXAA 4XD6A 2C18A 1NDYA 3UCDA 3WNLA 4OFCA 1VENA 4RDZA 3E74A 1OG6A 1ZP4A 4QXIA 2ZX8A 2WNQA 3FJLA 3B97A 4DXXA 1QWGA 2E9BA 2QEZA 4JTLA 1EHNA 3AS2A 3GVRA 4JTCA 4X63A 1OF6A 1SPQA 4QS5A 4M80A 2RHGA 3L65A 3KTXA 3NPVA 3VPLA 4TU1A 5FJRA 1KA9F 3PSVA 3GB6A 3LX9A 1XH0A 4Y9AA 4H9TA 3UR2A 1FQ0A 3ARZA 2OX4A 1CLXA 5JIPA 1JRBA 3VXGA 3F4VA 3SY5A 3U8GA 1J0HA 2OPJA 1QOQA 1EC8A 4WY0B 3MT1A 4OTKA 2JF6A 4AD0A 1X7IA 5U7SA 4TQTA 1L6WA 3E2RA 3PPHA 2WJFA 1HVXA 4MAVA 1VS1A 2Z25A 3A3WA 4U33A 1JDFA 2WHMA 2QLYA 1UWTA 4GUFA 3QTPA 4M0XA 4I9MA 4PRWA 3RR1A 3A4XA 5AC8A 4AMCA 3CASA 5BXTA 2OCZA 4WLCA 3HQ1A 3W2UA 2RUSA 3CUIA 4DY1A 2UY5A 3M0IA 3NDZA 3L7RA 1A4MA 3PC0A 2QF7A 1AL8A 3ORWA 4HBKA 4H01A 4J3XA 1WZMA 3NGJA 3M9YA 4L56A 4V2XA 3U2EA 1WO2A 3AI0A 1C8QA 3MBDA 1GZJA 4RX0A 3APGA 3KOWA 4JEJA 3E96A 1OD8A 1YYAA 4I6KA 4JGDA 3CQKA 4R5EA 4Y7EA 3LI1A 1WDSA 3GS6A 1QRQA 3WQOA 4B9ZA 1F5ZA 4J3SA 1JEZA 3LZ5A 1O5XA 2JE8A 2NQLA 4NJJA 3P0XA 3NDYA 1ISWA 3WDIA 3GVWA 2WC3A 3MKVA 5CBBA 4IPLA 2FHBA 4CD5A 4O53A 7ODCA 1QVBA 4CD4A 1GKPA 2VFHA 1J0ZA 2XUCA 1N8FA 1J0KA 4NRRA 4GQGA 3ZFHA 4UTLA 3E9AA 5TF0A 1CGVA 2P1FA 3ALFA 4JTTA 3T0BA 3FW6A 3B0XA 4PTWA 1XSJA 3S46A 5AZ0A 1E4NA 1F8IA 2PDPA 1EJRC 4O1EA 4CD8A 1UCWA 3VNIA 4C7FA 1C8VA 3WQPA 2DVUA 1FDZA 3WK0A 3VGFA 3EYPA 4FNRA 5LIKX 2OGJA 4J3WA 4Q22A 2WSYA 1TV4A 3THQA 3W6YA 3H2OA 1PWMA 1JXJA 2ZRZA 2ZUVA 4AB4A 1WDQA 3VIIA 3BCJA 1JGMA 1X7FA 2NXHA 4JTDA 3DBPA 2QJNA 4ZODA 4MJ2A 2V3DA 3N3MA 2WNZA 3ERPA 3ZYZA 4E8GA 3TMQA 1V79A 2XIMA 4TMCA 2JGQA 3QSTA 2HDJA 2ALRA 4XD3A 5FOOA 1EBHA 1WKEA 2PGRA 4WHBA 2D0GA 1Z69A 1P6WA 4OKDA 3Q58A 1KXQA 2RH9A 4W87A 3TTEA 2FGBA 2CWXA 2Q02A 4DHGA 2W66A 2E9LA 4Y6GA 1XYMA 4C90A 4G7EA 3NQVA 3SQLA 3M0VA 4D6DA 4P8XA 3ANUA 4GY1A 1TV3A 5HNUA 4Z1AA 3VZYA 2PMQA 2INFA 3O6AA 3S9IA 3H4GA 1YE4A 4I7VA 3FIGA 3NR0A 4IL2A 2ZWZA 3LNMA 3TK7A 1ZALA 4Z1YA 3WF0A 5G1YA 1YNPA 3G8EA 3TYUA 3C0QA 5C54A 3CAQA 3VKDA 1EJXC 1SJBA 4W8AA 3ITOA 3JR2A 1XX1A 1XFBA 4XQ6A 5CEWA 3QSRA 2J62A 3UETA 3L23A 2QPUA 2W27A 2BOEX 2E67A 4UC5A 3GHRA 1UP2A 1IZCA 1O12A 1S2VA 4PMUA 2BY3A 3O6DA 3PFRA 3AXHA 5A8NA 1IEWA 2V69A 2ZVRA 2WQDA 4RE4A 1TR1A 2BX7A 2HVOA 4M5PA 1HVQA 4GYFA 3R8GA 1XCWA 3FOKA 3M0HA 1EWEA 1XYCA 2VCAA 4HIBA 1FWAC 5C0QA 5E6YA 1DJNA 4RE3A 3UXIA 3B3DA 2VFDA 1UZDA 1E6ZA 1DJYA 3R58A 2J74A 3ZSTA 2EKCA 2QCMA 1PJ9A 4KCVA 3NQEA 2VCCA 3AYRA 2NSOA 2Y8KA 3L4TA 3R94A 4AW7A 2QCDA 1JVNA 3VDAA 4F3HA 4MB5A 1O66A 4RXGA 4XAFA 4XIAA 1JZ3A 1E1CB 1GVIA 2DZPA 3LU2A 1WDWA 2ACSA 4GQRA 4FF7A 1BGAA 1CXFA 3QKEA 3PBYA 4MZYA 1CB2A 1UUQA 3CHVA 3OGRA 1F76A 3HTWA 1HP4A 3G6MA 4INFA 1R9ZA 3CZLA 4DJDC 2BHUA 3GZ3A 1OYBA 1QDSA 3VOJA 2EJAA 2C13A 2KZHA 2F7FA 3MMWA 2NQJA 2D1ZA 3CPRA 2DJLA 4YU1A 2XVKA 2WVVA 3AXKA 4S3BA 2QJJA 4DWSD 3URAA 3L67A 1EL3A 2PDBA 1SSDA 1VFSA 3R8HA 3FN9A 2YYUA 1N7KA 4GUHA 1QK2A 2BODX 5U4NA 2FLIA 3DESA 1QNOA 1A0EA 3C2EA 2ZZ2A 4TTUA 1TA3A 3BO9A 1X1NA 4F4RA 3LM7A 1DYSA 1QXLA 3PB2A 3CZJA 4JIEA 4QEHA 3OB8A 3OZYA 5HNTA 1RPXA 1UB3A 4M7TA 4N9DA 1Q4NX 1YIXA 1ZRQA 3ES7A 4GG9A 3VCRA 1PTAA 3LRMA 2VZTA 3TU9A 3WUEA 2BWGA 1G5AA 2EQDA 4E3TA 2QJHA 2VT0A 1E6QM 1FH8A 4QFUA 2GJXA 3VOHA 2QIIA 4JFTA 1RJQA 4MY8A 3VE9A 4C5ZA 2AMGA 4XAZA 5F4SA 3PS7A 1DXFA 4O12A 4A8NA 1T41A 2I56A 3A12A 4R88A 3TUUA 1FKXA 4M81A 5F2GA 1YPXA 1AD1A 5G4EA 1OX4B 2Q6ZA 3E2VA 3W1UA 1QO5A 1A5OC 4PRRA 1E3ZA 3GC2A 4W86A 1H7NA 2Y70A 3IJQA 3BLFA 4R7WA 1D8CA 2PTDA 3RO8A 4FNSA 3LSCA 3B4YA 1XYFA 4CQ8A 5D33A 2DU2A 4PUDA 1FWBC 4AVOA 3FNDA 4CNSA 1JR1A 4WDTA 3BCDA 4MYXA 1KQZA 4GH3A 5BNKA 4XIMA 4XTIA 1KXTA 1GEHA 3TWBA 1OIMA 2E4TA 3UR7A 3CB3A 1IXNA 3FYOA 1XG4A 2UY4A 5EMYA 4ZL1A 2SFPA 3RUBL 5AC4A 1XRSA 5C9WA 5AVNA 3TYZA 1RLDA 3VUSA 3PFMA 3TFXA 2P3EA 5C9RA 3WLLA 1TUFA 3CC1A 2ZDSA 3E0WA 1M6JA 2YL9A 4LVDA 4PMOA 3WLJA 5D2XA 4NZ1A 4UMBA 3DG6A 4I6VA 3I65A 1P6BA 3UFYA 3ITLA 3AMCA 4POCA 2X42A 3WLSA 3Q45A 1REQA 3QBUA 1E9IA 4RZBA 3VNZA 3G0XA 4MNJA 4MNLA 2FZMA 1HP5A 4HYWA 1OD0A 4JIRA 1V8EA 4S3DA 5EYWA 3P93A 2CFFA 4KIEA 4LYRA 1KV8A 1ZPTA 2INZA 1VH7A 2HVMA 1RHCA 4JAWA 3AMGA 2O9RA 3WLTA 4IISA 3ZIZA 5G4HC 3K4DA 4NG3A 3LD5A 1WUEA 4UFMA 1TJ1A 2OOGA 4IQLA 4XVEA 4IX2A 2A5HA 1LLZA 3A64A 2AQOA 3WDJA 1KKOA 3T08A 5LNSA 4PB5A 2PLMA 1KO0A 2PP1A 3VU2A 1BTMA 2X1SA 3HG4A 3NYDA 1TPUA 3WO8A 4GCAA 4XAGA 1LF1A 3ATYA 4YCPA 5A8OA 5J04A 4UTFA 5F4WA 4LEFA 1DORA 1N2VA 2XSXA 4W9TA 4R9XA 4CNOA 2OEMA 2DQXA 2QF8A 1MDLA 4PBGA 4WR3A 4Z1BA 3LGGA 2GYIA 1S2WA 3B9EA 3NZRA 1YXDA 4O4WA 3LPGA 4L9YA 3O05A 4ALDA 1E3XA 1CW2A 3M5ZA 3ARQA 3K1DA 2WZHA 4AVNA 1FA2A 4BWLA 4ZENA 2YXGA 1GJUA 1J01A 1GVYA 3P81A 4N0RA 4K7VA 4FNTA 2CBJA 3B8WA 3GVGA 2HMCA 1YDOA 4ZR8A 1A47A 4E38A 4EE9A 1UR2A 1SM9A 3WLQA 2UBPC 4DLFA 3ARXA 3CMFA 4BQ5A 1Z48A 5FIPA 2YFOA 4Q4OA 3SAZA 5K9CA 4C7GA 1YDYA 1NDZA 1UYQA 4LQ1A 3G22A 1H51A 1Q6DA 3LCXA 4E5TA 1OCNA 4S1FA 3ITXA 2R6OA 3MJMA 4JXCA 1GHRA 4AIBA 1RK6A 3A47A 4ZCWA 3GXFA 4PUJA 2RGMA 2Y61A 1QASA 4D1IA 4D6EA 4HA3A 1Y5VA 5EMJA 4J4KA 4F9DA 4Y9OA 3WD1A 1AK5A 2NVAA 3TTOA 1WYIA 2WMJA 3FX4A 5MKGB 4E4PA 1KGUA 3UG5A 4DAFA 3CZKA 3GYEA 4CN4A 3B0UX 2BHYA 1LG2A 1L6GA 4HZ7A 5B7ZA 5FEXA 5I00A 5AECA 3M0ZA 5EMLA 4DWSC 2XH2A 3P60A 3U2ZA 4WD0A 4MLJA 1JAKA 4DJEC 3S1VA 1QNQA 1VIZA 4D6HA 2ASHA 3A6OA 4MHBA 5AC5A 5I03A 1ISYA 1Z8AA 1EX5A 3L12A 4NF7A 4CU6A 3KCJA 4AH7A 4K8EA 3FEQA 3EKLA 3TSMA 2CNCA 5D2WA 1EP3A 4QLLA 4AWUA 4GJ1A 1FH7A 4E2BA 3BL3A 4EXBA 1JG9A 4FEZA 4Q4QA 1EHAA 2FMOA 1TPVA 2V5LA 4PTDA 4P8UA 5FF0A 1KQYA 1JFXA 1HGWA 5HR6A 1VJIA 1XHGA 4UR8A 3B8TA 3T0CA 4LAKA 4UNIA 2XGBA 1E9YB 3OQ8A 2Z7KA 3OBEA 1EUAA 3WH8A 4AFYA 1BTCA 3JW7A 4MF4A 1XPYA 3WLMA 2JK2A 2YCEA 4EANA 2CXEA 3CEPA 2VRJA 3HPZA 2OKOA 3BLLA 3EDKA 3PB0A 3W27A 1U5HA 3ABRA 3QR3A 1UR9A 4Z42C 1MYRA 3PTQA 4M3PA 4N42A 3U9IA 3V18A 4LFYA 2CHOA 3PZ9A 5I0DA 3MANA 2C3ZA 1XLKA 1GQJA 3BAKA 2O55A 3IK2A 1BPLB 2FB3A 3FDGA 2G97A 1XDMA 1H1ZA 4HPGA 3KBWA 1TMLA 4HMCA 3UXLA 3DX5A 1P0BA 4B91A 4DI9A 3WJXA 2I5IA 6ENLA 3N9KA 4TUFA 1XCXA 3DFQA 3THAA 3V36A 3H4XA 4H7CA 4PCSA 1EJSC 3GNOA 5BRBA 4WK9A 3P8JA 2IKJA 1P48A 2BY2A 2WK2A 3I6TA 5KZEA 4KGJA 3UA4A 4EVZA 1BVNP 4RUBA 2W9MA 4DYKA 1ZCOA 3D6NA 4GI8A 4PUKA 4UNKA 2I17A 1SJAA 2OYMA 3GH5A 4D8ZA 1E6XM 1GOOA 5E0KA 3T44A 4BA0A 1A5KC 3CZ8A 3EX3A 3W28A 4OOUA 4REQA 2EKGA 4NNAA 2PBOA 3O1NA 3WQCA 2G41A 3MHGA 2R9RA 4A05A 4AEFA 2ONEA 4GE8A 4GNVA 1X6NA 1G6CA 4U28A 3CL8A 1MQPA 4O50A 4R33A 2ZUMA 3WLHA 1J2BA 2OSWA 1SGJA 2X05A 2WVTA 1SO3A 4DXKA 1RALA 3OPSA 4JFSA 2QV4A 3AYTA 1Q85A 5K9XA 4PMYA 2Y5JA 2EPLX 1YQ2A 5H2ZA 1U1UA 3MCNA 4H41A 3CTTA 3UCQA 1OFOA 5BMWA 1EDTA 3PJUA 1EFZA 1SZFA 6REQA 3SRKA 5M3WA 3S5SA 4YL2A 2VOMA 8XIAA 1S39A 4N6EA 1VFHA 5T91A 3MUY1 5HWMA 3CUHA 1EC9A 1QPKA 5FSEC 3S2JA 3SW6A 4LU0A 1E55A 3CJPA 5BCAA 1PKYA 3GNDA 3TVAA 1S2TA 5JH1A 2A6NA 3W2MA 4S3JA 5GNXA 3ZR4A 3KL5A 3LK6A 3RX2A 1ISVA 4EPEC 3LYEA 5D9MA 1XP3A 1FVPA 1RJRA 1UD6A 1QU4A 1V0LA 2XM2A 5M2FX 5BWAA 1S46A 1KR1A 1SYTA 2P10A 1RXOB 3KHJA 4NT0A 4RE0A 1DIEA 1MW1A 1XLCA 1P1MA 4XZNX 2PZ0A 1ITCA 3IJ9A 2OLHA 1H7WA 2J9ZA 1SR0A 1X98A 3N29A 1BHGA 3FJNA 4CU7A 1XLGA 5C2CA 5A2AA 2NVDA 4D9PA 3PBUA 2BY1A 3BANA 2QQ6A 1BEUA 2ZDRA 4J27A 2OQLA 5DN1A 1VFUA 1Q2RA 2JIWA 1V02E 2CPUA 1SO6A 4P5UA 3T8QA 4MNMA 3BGGA 8A3HA 2XZ7A 3CMGA 4L65A 1VC4A 2WSKA 4LVBA 2VR2A 4RL3A 1DIDA 3THCA 1QOXA 1QAPA 2FYMA 3KVLA 4WIWA 3UG4A 4GINA 5FJPA 5KSWA 5AFDA 4GOAA 3HBLA 4GUJA 4Z2KA 1US3A 3ZJKA 1D3CA 3RLHA 3ARSA 4YS1A 1JZ7A 2DIKA 3NL3A 4Q4PA 5JXQA 1HL2A 1AUSL 1FCVA 3IS4A 5HQLA 1V77A 1Y5XA 1WKYA 3GAKA 3PJXA 3A5FA 3Q37A 3CWHA 1UC4A 2JKEA 4AHQA 1A3HA 1L2QA 4CVWA 2NVCA 3T40A 3M47A 4LC6A 2DFAA 2GVEA 1VPYA 3WBEA 5BYWA 3RNDA 1XGZA 1BXCA 1UWAA 3WLIA 1XYLA 2ZWYA 1KM5A 4CU8A 1YXCA 3BMWA 4YVXA 3ZJ7A 1VBHA 3T09A 1TCDA 2DQWA