3VPLA

Crystal structure of a 2-fluoroxylotriosyl complex of the vibrio sp. ax-4 beta-1,3-xylanase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-xylanase XYL4
publication title The crystal structure of a 2-fluoroxylotriosyl complex of the Vibrio sp. AX-4 beta-1,3-xylanase at 1.2 A resolution
rcsb
source organism Vibrio
molecule tags Hydrolase
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vplA00
2UY4A 1WZKA 3VMOA 1Q6CA 2GJXA 2WBGA 4U5KA 5KEZA 3WDRA 4TOQA 3CPUA 3VIKA 2W62A 5A95A 3RM4A 4EE9A 1E1EA 3A47A 1OWQA 4EKJA 4AY1A 1U30A 2WKLA 4HMDA 3AZRA 2Z1SA 1NM9A 3PTQA 1IZJA 1FHLA 1ZL1A 4AC1X 3EDDA 2IUZA 4W8LA 4H7VA 3BSHA 2PI6A 2QF8A 2DSWA 1H0IA 2J8FA 4OIFA 2XVPA 4ATLA 5A3HA 1A3HA 4GZJA 1H1NA 4BS0A 4D6HA 4TX6A 5JBFA 1KR0A 1BYBA 1R7OA 3SUWA 5I24A 1KR1A 4BQ4A 4HMEA 4ACZB 3ARXA 4ATDA 2VURA 2BY3A 1KXHA 2GJRA 1E9LA 1LL4A 3DECA 1TCMA 5I77A 1KWKA 2BXYA 1PX8A 1ZU8A 5IHRA 4N0RA 1K9DA 1WDPA 1QI3A 4J27A 4M8UA 1JFHA 3DYPA 3FNDA 2XGIA 3AIRA 3SCWA 3L4TA 3AHTA 2WHJA 5JBDA 1P6WA 1W1VA 3WD3A 2XFYA 1JDAA 2XSAA 5HXMA 1UD5A 4V2XA 1CXFA 1VAHA 4AZ6A 1EHAA 1H2JA 2J77A 1CGWA 3L4VA 3FW6A 1B1YA 2BVTA 2BHYA 3EBVA 3VVGA 3M7SA 4Z2IA 1M53A 2BY1A 2ZXBA 4W5ZA 4UNIA 5EFFA 2EPMX 4V27A 1HKKA 3WENA 2XM2A 2VX7A 1C93A 2VZSA 5I79A 1W9VA 3S6TA 2BY0A 3KE0A 3UEQA 2D22A 4M24A 1JGIA 2VL4A 3PHAA 5A8QA 4CD5A 3WNPA 1L0PA 2DSUA 1G1YA 1MWOA 4C7FA 3DYMA 4OZOA 3U5UA 5FIPA 4J28A 3AMGA 4Z2JA 1E6PA 1H4PA 4W7WA 2GUYA 2YIHA 1JYWA 2O9TA 3CZGA 2JF7A 2XTKA 1CXIA 2CBJA 2A3AA 2OYMA 3KL0A 3WSUA 5HDRA 3BMVA 1HJUA 3VIGA 2DSZA 1HP4A 3W82A 2ZUTA 3VD4A 3QOMA 3SUUA 5IHSA 2FH8A 5I2UA 4CN6A 4KRTA 3HN3A 3EMQA 3F4VA 2OSYA 4D6FA 3AIEA 4W8BA 3WF0A 1EOMA 3OB8A 1CGXA 3MKKA 3W25A 1BYDA 4A3HA 4JCMA 1XCXA 1GVIA 4W88A 3PZVA 3SCPA 1MW0A 1HKMA 2EPNA 1FHDA 1QPKA 2WYSA 1CGTA 2G3IA 5A94A 1QNSA 2CEQA 2YA0A 1C7SA 3OGVA 1UG6A 1UD8A 1UWIA 5BROA 3WNMA 4B9ZA 2ZX5A 1UA7A 2J25A 5A6BD 3DHPA 2UY5A 4JL2A 3PZNA 4E2OA 3VIJA 6TAAA 2YLAA 3M6DA 2VZVA 1CXKA 3K8KA 2W67A 2CHNA 3WL1A 1BQCA 5A8MA 2WNWA 2QLYA 3ARSA 4LPCA 3QR3A 4PRWA 1B31A 5DF0A 2DEPA 5FKYA 3ZR5A 1JYNA 1BPLB 1KCLA 5JBEA 5E6YA 2YL9A 3AFBA 1GOKA 1BLIA 4JFSA 4UFKA 4MAVA 3AS3A 4GQQA 1HL9A 1W3KA 3WEMA 2WZIA 4AZCB 3T2OA 1QHOA 4W7UA 2C0HA 5HPCA 3IAQA 1BVZA 3PN8A 3WH7A 1UWUA 1EXPA 1CBGA 1VF8A 2G41A 1HJSA 4NRSA 2DSVA 5C70A 5A2CA 4H04A 4UFIA 1UR0A 3T2QA 5CLWA 4MB3A 3VD9A 1GPFA 5JIPA 3M46A 1E4IA 2XIBA 3PZIA 4BQ5A 1SYTA 3WH5A 2WC3A 3PBGA 3U7VA 3BLPX 4CUCA 1W1TA 1UOKA 4JZ5A 1J11A 1GOQA 3IANA 1VEPA 3GNOA 4JFWA 1UR9A 1C8QA 2ZXDA 3F5KA 1PZ2A 1VFFA 2G4FA 4L4OA 4E4PA 2UWFA 3N11A 1FA2A 2WVVB 1UD2A 1Q6EA 2DH2A 1MXDA 5DEZA 3CUIA 1ISZA 3IK2A 1TUXA 3TTOA 5M03A 2QPSA 1H49A 2J7DA 2B31A 1TR1A 3VIPA 1W32A 1NWRA 1G94A 4J3TA 3W6MA 4ZEPA 2QV4A 2NW0A 3W81A 2XVNA 4C7GA 2PBOA 1QOXA 2V38A 4YHEA 2DIEA 3SIMA 4DWSB 2BXZA 4UQAA 4GI6A 3AICA 3E1F1 3CGTA 1GNXA 1GOIA 2IXVA 1UWSA 5BCAA 2PBGA 1C8YA 2Y5EA 3MO4A 2W66A 3MANA 3POCA 4X0VA 2XGBA 4ZXOA 1LG2A 1NOFA 4MB1A 4U5IA 2EJ1A 4H2CA 4DM2A 5I5RA 4XZBA 1E3XA 2CHOA 4CVWA 3WDIA 3WDPP 2ZX9A 4TXEA 3W37A 1DWIM 1QNQA 3ZJ8A 3ARYA 1WO2A 4AZ7A 4PMRA 1BG4A 3AIQA 3W38A 3FHAA 3ZJKA 2WHKA 2PWHA 4PMQA 2VC9A 8CGTA 3LPFA 3RDKA 3GDBA 4CU6A 3PTKA 3AIVA 5AY7A 2E4TA 1ITXA 3BGAA 1NOUA 1ZBWA 4AYSA 2GSJA 3RCNA 5E0FA 1MQQA 2ZUWA 4OJYA 4AZBA 2GK1B 5D8ZA 4UQ9A 4X9YA 1KGXA 3AHZA 4P7LA 1JI2A 1RP8A 1HKIA 1UKPA 1O6IA 3SUVA 5IDIA 1B0IA 2GDUA 2J8GA 1HP5A 3AQUA 3QHOA 2WWCA 1UWQA 1ISVA 2DDXA 2E9BA 1E0XA 3AZTA 5ABHA 5BXRA 2EPOA 3RIKA 4X0NA 1TA3B 2OLHA 3NYDA 2DIJA 1HT6A 5I23A 3RM8A 1J0ZA 2CERA 1YQ2A 3AOFA 4P7NA 4GKLA 2YDRA 2MANA 3PZ9A 5DT5A 3VD3A 1M04A 4UTFA 1LWHA 4RL3A 2D0HA 4HOWA 4K68A 3PZOA 5F7UA 2X8RA 3BSGA 4B3KA 1VFUA 4NF7A 2J7EA 4GIAA 4JCLA 2QMKA 4LQ1A 1NP2A 2WK2A 4ML4A 1E4LA 1ZS2A 4D71A 4BCEA 4CGTA 4D6GA 2VZTA 1PX4A 3AMKA 3ARUA 2XJ7A 1B3XA 1W9UA 4QCFA 1GOOA 3RJYA 7TAAA 2VTFA 4TX8A 2WVVA 2UY2A 2JFEX 2XSBA 4DUXA 3BAIA 4W7VA 1E55A 4GPNA 1MVYA 2BS9A 2O9RA 4FLSA 4WKAA 2CCRA 3QHMA 3CIVA 3IJ7A 1J0KA 3EDKA 1MW3A 3W29A 2WBKA 1D7FA 3AXXA 2W4XA 4HP5A 4CVUA 1JDDA 2ZOXA 2Y4SA 4J3UA 1XD1A 1BGGA 4PMZA 1JYXA 1U33A 1FH8A 3KZSA 2BHZA 4IPNB 2W91A 5EBAA 1GONA 5GPRA 5LA2A 2ZUVA 1JYVA 1SFSA 1PX3A 3L4UA 1IT0A 1OD0A 1HF6A 4WJXA 3WY1A 1CGVA 3WH9A 1EDGA 2XVLA 2YA1A 4B16A 1NWTA 4AIOA 4KH2A 3GM8A 1EH9A 3MUZ1 2WPGA 3WNLA 1UH3A 2VZOA 1KQZA 2BV9A 3WUBA 2AAAA 4JHZA 1XC6A 2ZXQA 2YJQA 3A6OA 1HXJA 2J79A 1QNPA 2CBUA 3ZMRA 2ZUUA 4TTUA 1GQIA 2E3ZA 1M03A 1UA3A 5A6KA 2G8ZA 3MUIA 4PTWA 4AXNA 3WBAA 3W24A 4GXPA 2BNJA 4UQBA 1BHGA 2OWXA 1UD3A 1V3JA 3GH5A 1W2PA 3AHYA 1DWJM 1CPUA 1XSKA 1E5NA 4GZEA 2WZEA 2XVGA 1GQKA 1BGAA 2E9LA 5ABEA 4W84A 3IJ9A 4QLLA 1MQPA 2E8YA 3N9KA 2A3EA 4RE2A 3T0DA 3LPOA 4YHGA 3BAKA 5A6LA 4IISA 3THDA 4AW7A 1K6AA 4E8CA 3WQ4A 4LGXA 1KFWA 4UQCA 3ZT7A 1UKSA 3WQVA 2WLYA 4MJ4A 3VD7A 1W9PA 3CHDA 4TVCA 5M5DA 3SCUA 1UHVA 2JEQA 1BAGA 4HA4A 1W9DM 4U31A 4ZE4A 1EA9C 3MMWA 3VIFA 2X2YA 4QDMA 2QMJA 2BVDA 3NSMA 4NRRA 3FXYA 1Q6FA 2JEPA 4JL1A 2E40A 3K4AA 1R87A 2EBNA 3UG3A 2DGAA 4PUEA 3CUJA 3TTYA 2J7HA 4U3CA 1JZ2A 4AD3A 2Y2WA 2VVSA 3AIWA 4NI3A 1H11A 3AIUA 2BFGA 3CHFA 1F4AA 4YN5A 1JF5A 1GZJA 3A4AA 1EDQA 1UZ1A 1KWGA 3T09A 4CU8A 3AIBA 5A6AA 3FAWA 3ZJ7A 3GBDA 1FOBA 3WL0A 4UR9A 1M7XA 1N82A 1KQYA 1W9BM 2GFTA 1JXJA 3ZOAA 4UFMA 1QHPA 2VCAA 3QGVA 4MB5A 1XSIA 4PYSA 1JNDA 4P8WA 3CTTA 4LYPA 4UFJA 3QHNA 1QBAA 1JF6A 1ZBKA 3OA5A 4J3VA 4XV0A 4CD7A 2AOSA 1WPCA 3VGFA 1C7TA 5HNNA 3CHCA 2PWDA 4D6JA 3NDZA 1JXKA 4UZUA 2WKGA 2YA2A 1MXGA 2E9MA 2V5CA 5HBFA 2DSKA 2X09A 2DH3A 1XSJA 4JAWA 2DQXA 3F5JA 1V3HA 5TD4A 1OGBA 4P8VA 2EO7A 2V3GA 2CKSA 3MMUA 1EDTA 4HZ7A 3WDJA 3JUGA 3KEHA 3ARRA 2D3LA 4KWUA 4D6DA 4DM1A 4P7QA 2WMFA 4FLOA 4BF7A 5FOOA 4D6EA 1NWSA 3TA9A 3I3BA 2CBIA 3ZT5A 4F8XA 2JALA 2JF6A 2XFFA 2YBTA 5A6JA 1MFVA 3EMCA 2D24A 1I75A 4L4PA 1E4MM 1JG9A 1UH2A 1E71M 4HTYA 2CETA 1ZB5A 1JL8A 2D23A 4PTMA 1QVBA 1OB0A 3VTRA 2VO5A 2E0PA 4BA0A 4WSKA 3N12A 3WF1A 2W63A 2YL5A 2XIIA 5LA1A 1J0JA 3B9DA 1BG9A 1G5AA 1Q4NX 1DP0A 1UWRA 3VNYA 2G3MA 1VJSA 1B9ZA 1OIMA 4PUDA 3T0BA 1DTUA 1GVYA 2J47A 4H8HA 5BWFA 2WAGA 3OLEA 1QI4A 3ARZA 2JE8A 2XFRA 4D72A 3G6LA 5M3WA 5A6BA 1H5VA 2VVNA 1IZKA 3VU2A 2O9OA 1V3IA 3TTQA 1VRXA 4EANA 2J4GA 1YHTA 1CENA 3WQWA 3VIIA 4PTXA 1V02A 4AD5A 5C8BB 4PEEA 4KMQA 5AC5A 2VZUA 1CYGA 1CXHA 1PJ9A 2Y24A 2WC4A 2WZHA 4AZIA 4FMVA 3AMLA 1GCYA 3I3DA 1TFVA 1NWUA 4ACZA 2GVYA 4P7RA 1QBBA 5GNYA 1EQCA 5E0CA 1XV8A 4B15A 3OZOA 5GNZA 1F4HA 4OKDA 5A8OA 4Q22A 5FD0A 3BAWA 1SMDA 3AMDA 4Q7NA 5CGTA 2NT0A 1FP8A 4IPLA 1NQ6A 1JZ8A 5HOSA 2WCAA 3SCOA 3VMNA 4M82A 4DUWA 5FL1A 5FCZA 1UWTA 5IFPA 4MPKA 3SCTA 1ISWA 1KXQA 3A4XA 2WMGA 1B3VA 5EFDA 1GOWA 2VT0A 1EHNA 4H41A 4V28A 4CCEA 1SMAA 1VENA 5A6MA 3AS2A 3WH6A 4KRUA 2ZUMA 4XZWA 4WLCA 2J62A 2VOTA 2JIEA 2YOCA 3GXFA 3SEPA 3HJEA 1CLXA 1VFMA 1JAEA 2A3BA 3OLDA 3SUTA 2D1ZA 2XHYA 3GH7A 3TTSA 4J3XA 3GXDA 5AC4A 3HU7A 3ZIZA 3I3EA 5JIWA 1VBRA 2X05A 5ABFB 3K1DA 1UYQA 4PTVA 3WFLA 1R85A 2WMIB 1E15A 3APGA 3UR7A 3VO0A 1PBGA 1C92A 2J7CA 4H8VA 1TG7A 5D9MA 3CO4A 3N1AA 5CSYA 2V3DA 4PBGA 3ZQ9A 2VUYA 1WDSA 3BAYA 4P7OA 3UETA 2YBUA 3WUGA 1US3A 2WXDM 4S3KA 4CU7A 4HZ8A 4AZ5A 5EB8A 1V6YA 3VGDA 5KZ6A 3AHXA 3ZSSA 2XUCA 2YDQA 1AVAA 1SR0A 2RGLA 1DWFM 1ZJBA 1UUQA 2XWDA 3WEOA 2XWEA 3UG5A 5BYWA 3W53A 4WF7A 1QW8A 3AISA 2FGZA 3T0AA 1MYRA 3N04A 1LJYA 1AQHA 2OSWA 1ISYA 2WSKA 3B9EA 4WKHA 2ZX6A 3N13A 3PZQA 1A47A 4LYQA 4UOQA 4AIUA 3J7HA 3A3HA 3WF2A 4AZGA 1G01A 4P8UA 1WDRA 1V08A 1E6SM 3WMSA 3CLWA 1QNRA 5E6ZA 4W85A 4J3WA 1TVPA 1BFNA 1AQ0A 2DT3A 4OBRA 5LYRA 5A1AA 2ZX8A 1E0VA 1E6QM 4LX4A 4M1RA 4XUYA 1OM0A 1MW2A 1PAMA 3WN6A 1OCQA 1OT1A 4ATWA 4AZCA 2AMGA 3SCQA 3GXIA 1V02E 3DC0A 4HA3A 1B30A 1UR8A 2HISA 4GO8A 4W86A 1VB9A 4AMCA 2VRJA 1JZ3A 4A3YA 4IM4A 3T08A 1XRVA 3GYCA 2ZUNA 4MAZA 1LL7A 2X1IA 1OD8A 1XYFA 1E6RA 1ESWA 3AJ7A 3WUFA 1V03A 1E70M 5M17A 4D1IA 7A3HA 4MTVA 1ECEA 1O7AA 1K9EA 1UKOA 4UFHA 2F8QA 1HJQA 4JIEA 4AD2A 3CZKA 1PPIA 1C91A 4AD1A 3EMZA 2Q8XA 1W91A 3AS1A 3CZ8A 3M07A 3N17A 3MSGA 2CYGA 1V0LA 2ZXAA 4AEEA 3NIYA 2WMIA 3CZLA 3K8LA 3K4DA 4F79A 5CPSA 2W5FA 3LPGA 3L4YA 2ZX7A 2VQTA 2OSXA 3NSXA 3KWXA 4DWSA 3VGGA 4DWSC 1E4NA 3VGHA 4AD0A 1ITCA 1J10A 1CWYA 1XH2A 6A3HA 1J12A 2TAAA 2WCGA 2VJXA 1BSIA 4MDPA 3F5LA 4HU0A 3VGEA 3L4XA 1J0HA 4S3JA 3VGBA 3VDAA 2FHFA 1MW1A 3EYPA 3VDBA 1LF1A 3W0KA 2VRKA 3WDHA 3VIMA 1WZAA 3CUHA 3OIHA 2CITA 1CDGA 1CZ1A 3RO8A 1B3YA 2O92A 1X6LA 1E1FA 1HL8A 1XGZA 3AHVA 4R5EA 3D5HA 3UESA 2J75A 4DUVA 3VDHA 3VMPA 3GZAA 4PMDA 1ODZA 1QI0A 2XYLA 2V5DA 2RGMA 3VX1A 2OWCA 3UG4A 3ARPA 4PMUA 1UH4A 1CGYA 2WM0A 3KL3A 5A2BA 1JZ5A 1G0CA 2D0FA 2GK1A 1JD9A 4W87A 4EAMA 2Z1KA 1DWGM 2VX4A 5BXTA 1KB3A 1JFXA 4PSPA 1HJWA 2WVSA 4YPJA 5GNXA 2EEXA 1QI5A 3WDQA 1AMYA 1E0WA 2C7FA 4CD4A 5DMYA 3WNNA 4B9YA 3LPPA 3BC9A 2WWDA 1R86A 1TA3A 4HA1A 2ZICA 3VOCA 5E9AA 2QHAA 3TP4A 1UR2A 1HJVA 1VJZA 3WQ6A 2YLLA 2WW5A 3O9NA 3MS8A 1LLOA 4FK9A 4JHOA 1K9TA 3FAXA 1E40A 3THCA 5LA0A 3W4RA 1D3CA 5CLTA 1TZ7A 3L4ZA 4PSRA 6CGTA 1QHZA 2CIPA 2FGLA 3B8SA 1V3MA 2UY3A 4HU8A 1GHSA 1ISXA 1HN1A 4U2YA 1X6NA 2D2OA 3MU7A 3PZGA 3ARVA 5ECUA 3N15A 5A8PA 3VPLA 2EPKX 1OIFA 2CPUA 3BCFA 3FN9A 4D6IA 1JI1A 1GHRA 2VX5A 1WZLA 1WKYA 3RILA 4RE3A 3RPMA 4FLQA 1HX0A 2CKRA 3VD5A 5A8NA 1K9FA 4CD8A 1E6NA 3VM7A 4ZENA 1JZ4A 3O6AA 4XX6A 3WD1A 2XPKA 3ZM8A 4IUGA 4GO9A 3CMGA 3ZJ6A 1D2KA 2OWWA 3T2PA 2YL8A 3WMBA 4PMYA 4Z2KA 2G3NA 1JZ6A 1KGWA 3NUKA 2E8ZA 4PN2A 5CGMA 4R27A 5A6SA 3MV01 1FH9A 4W89A 3WKZA 3WELA 3SUSA 5AYBA 1B90A 4C7DA 3S2CA 4CD6A 1FFRA 2X0HA 1HVXA 3IJ8A 4JFUA 1HKJA 1ODUA 2O9PA 4H8UA 2BY2A 4JKLA 5DFAA 3VKKA 1KXTA 2VMFA 4TUFA 4WIWA 3IAPA 1E5JA 4HOXA 1IV8A 3MUY1 3OGRA 4M56A 3SCRA 4CCCA 1QW9A 2ZWZA 3CUFA 1CLVA 1V3KA 4Z2LA 1MQRA 1NH6A 1XCWA 1I1WA 1C90A 2VR5A 4W5UA 2VNCA 2W61A 1I1XA 1EIBA 2FHCA 2Y8KA 7CGTA 3EDFA 4MNKA 2WLZA 1UR4A 1HNYA 4BQ2A 4HOZA 2YDSA 5C71A 3CBWA 2GDVA 1OT2A 3CHEA 4HPGA 1RP9A 4WK9A 4QLKA 1Y7VA 3GXMA 1C8XA 1EO7A 2NT1A 2V3EA 3MUAA 3L2MA 3OBAA 3VUPA 2WVUA 3PZTA 4ZFMA 9CGTA 1BVNP 1E43A 3SCVA 4GI9A 4CN1A 2ZWYA 3VX0A 4N42A 3BAJA 3VM5A 1VFOA 3GNPA 4URIA 1XD0A 3II1A 5EMYA 3RMEA 3UR8A 4Y7EA 3K46A 2OYKA 4PMVA 3AXIA 3VIOA 1KXVA 5FL0A 1KBKA 4MADA 4LXFA 4LYRA 1DEDA 3O2LA 3VILA 3NDYA 1NOWA 1LG1A 1M01A 3ARWA 2QPUA 3CH9A 3SCNA 4OBSA 1JDCA 2VCCA 4M29A 5JUVA 4U3AA 1VIWA 4Z2HA 3OGSA 8A3HA 1W3HA 1XYZA 5CZKA 3PZMA 1E73M 3KL5A 1H3GA 3WNOA 1UKQA 5BXPA 1OGGA 1CXEA 2WMJA 1AQMA 1E72M 3BCDA 2D0GA 2VR4A 3U5YA 4AISA 4J7RA 4HMCA 3PTMA 3OLIA 1VEOA 1RPKA 1TVNA 1LWJA 3LMYA 3ZR6A 1WZMA 4UCFA 1H0GA 1PIGA 2XVKA 1V0MA 4D6CA 4J3SA 1RH9A 3NSNA 4MNJA 1GJUA 2ZE0A 2PWFA 1V6UA 4NSBA 1H41A 2PC8A 3CZEA 1E3ZA 4OUEA 1GQLA 1W3LA 4UZSA 2F2HA 5I78A 4TVUA 3CUGA 4F66A 1W1YA 1QI2A 3WUEA 1CGUA 1WP6A 4F9JA 1TE1A 1FH7A 2F61A 4KGLA 5D9NA 3VNZA 2CBVA 3DHUA 4UQDA 3WD2A 1CNVA 4Z2GA 4MJ2A 4XB3A 5AYIA 1WNOA 1Q6GA 4FLRA 1WAWA 5CG0A 2YL6A 4PCSA 1LQ0A 1WB0A 1EQPA 2BVYA 3AS0A 4QLJA 1HIZA 3EDEA 1GUVA 3AYRA 4JKMA 3WFZA 2VQUA 1OBAA 1H09A 3PZUA 1C3FA 1NARA 3AXHA 3VIHA 1Z32X 1W9XA 3OG2A 3WH8A 4CCDA 4PMOA 2G3JA 3UCQA 1KBBA 1CIUA 2D20A 3U57A 4D1JA 3SURA 2PB1A 4PCTA 1WDQA 1B3ZA 2XG9A 3OLGA 1B2YA 4BQ3A 3QOKA 1UKTA 2ESCA 1J0IA 2WCSA 1BF2A 3L2LA 3WF3A 3GBEA 1E6XM 3B9AA 4WSJA 1JZ7A 2PWGA 1GJWA 3ZT6A 1E56A 4A4AA 3OZPA 1GW1A 4W8AA 3VDCA 1US2A 3GH4A 5IFTA 1RD6A 4EK7A 3BLKA 2PWEA 3RJXA 3HMCA 1U2YA 1E6ZA 1V3LA 3ALFA 3AMCA 3BH4A 3MSDA 3UERA 4AWEA 5BRPA 3BXWA 1PIFA 2BHUA 2V3FA 5GQBA 1CTNA 1LL6A 2EQDA 3BAXA 2A3CA 2YKKA 1EOKA 4FF5A 1NP0A 5A2AA 1UR1A 4OOZA 3WF4A 3TOPA 3RM9A 2XM1A 1TMQA 4GI8A 1EGZA 2DT1A 1ZBCA 4F9DA 5CXPA 2EPLX 2J7BA 3G6MA 4BZYA 4MDOA 2Y8VA 3ARQA 4QAWA 4UOJA 4QP0A 4U33A 1UZ4A 3FY1A 1V0KA 1B3WA 4CN4A 3WBEA 4ACYA 1V6VA 5D9PA 2W92A 3TONA 4JKKA 4RE4A 1CECA 5CQ1A 1JNEA 2WSPA 1VEMA 3CMJA 3NCOA 1JAKA 2WMKA 4HPHA 2PF0A 2D3NA 3WQ8A 3D3AA 4MB4A 5HPOA 1J01A 3BMWA 4HZ6A 5I3DA 2DT2A 2VX6A 1S46A 3WMCA 5DT7A 4GINA 5BRQA 4AD4A 4AZHA 1X1NA 1XH1A 2ZIDA 3AZSA 3EDJA 4M80A 2J74A 2GJXB 2J78A 4AIEA 4JFTA 4WKFA 2VRQA 5BXSA 2WB5A 4P8XA 2J7FA 2DPEA 4OOUA 1J9YA 5CPQA 4QCEA 4ZE5A 2FH6A 1WE5A 2DT0A 3POHA 1VBUA 1V0NA 1J0YA 4PMNA 1JIBA 3VINA 1OSEA 3ZSTA 1L8NA 3WQ5A 1CEOA 2C8NA 2FDMA 2GJPA 4AEFA 1GQJA 2HVMA 3WD4A 1UD6A 5ABFA 4JFVA 2WVTA 3GNRA 2A3HA 3MV11 2VCBA 1BYCA 3A4WA 1GOMA 5CJ5A 1PEZA 1BYAA 2J7GA 2NSXA 1MFUA 1DHKA 4GZIA 4UQEA 3ECQA 1R7AA 3W6LA 5A69A 2EXOA 1DWHM 4E8DA 1G9HA 2VI0A 1HJXA 3U7BA 4KGJA 2JIWA 5E09A 5D9OA 5ABGA 1ZJAA 2WHMA 3DYOA 3NJ3A 1FP9A 1V6XA 1BTCA 4QFUA 1OINA 2IXUA 3FHQA 4UOZA 3L4WA 4MNMA 2FHBA 4UFLA 1ZBVA 3N18A 4TTGA 3W26A 2X0YA 2WC7A 3CZJA 1UQZA 3AYSA 3W27A 4NZCA 3WIJA 4DWSD 2CNCA 1J18A 3ZO9A 5I6SA 4MNLA 1R8LA 3WD0A 1JD7A 1GORA 4U2ZA 3ALGA 1KCKA 2ZUSA 3AROA 5D8WA 1DWAM 3SCSA 5D4YA 1Q6DA 2CXGA 4M81A 4TVDA 1XHGA 4ZXLA 1V6WA 3GTNA 5I0DA 4PMXA 3ARTA 1CXLA 5E70A 1EO5A 1XH0A 3WNKA 2WANA 1HVQA 1OGSA 5CPTA 1W1PA 4B3LA 5IXEA 1QNOA 2WMHA 3W28A 1UQYA 2OYLA 4GQRA 2CESA 5DO8A 1WCGA 3MMDA 1FFQA 1PZ3A 4CKQA 1KGUA 2WHLA 3AI0A 1UD4A 1W2VA 4W93A 3WEZA 1W3JA 3K8MA 5CSUA
chains in the Genus database with same CATH superfamily
3HO8A 4U28A 2WBGA 3DFYA 4U5KA 2PP1A 3S1GA 3GU9A 4DO4A 4TOQA 3LHZA 4FB7A 3VIKA 1VS1A 4HKPA 1KRCC 4EE9A 5CAKA 3LXCA 4JHMA 4DUOA 3VOJA 4US5D 1L2UA 2HRWA 1NM9A 3GB6A 3PTQA 1JQVA 1L9WA 1JCMP 2ZADA 4LEQA 3LGGA 2QF8A 4H2HA 4OIFA 3A21A 3NXLA 3T7VA 3H2FA 3BJSA 4GGBA 4P5UA 1A3HA 2GL5A 3GIYA 3OYZA 1A4MA 4Q4OA 5JBFA 1EJVC 1KR0A 3RN6A 1KTNA 5I24A 4BQ4A 2CZ5A 4NIRA 1AG1O 3WO8A 3BCJA 4ATDA 2FQIA 2BY3A 1KXHA 4OUIA 2FTYA 3PG8A 2YFNA 3WK1A 3TOYA 1E9LA 4AB4A 1LL4A 1TCMA 3P81A 1PKLA 1KWKA 2BXYA 1PX8A 2V5BA 4YWSA 1W8GA 4J27A 4M8UA 5DY3A 3DYPA 3TCSA 4GWEA 1XYMA 2HVOA 3EWZA 2E6DA 1XLMA 3AHTA 2ATSA 1EC8A 4M6PA 1W1VA 1S2TA 4A3QA 2XSAA 3N4FA 3QBUA 3NGJA 3WFAA 1CXFA 3QTPA 1KBJA 1EHAA 3H2CA 3TYZA 1KTCA 4AYGA 5K9XA 1RY0A 2R94A 2BVTA 3EBVA 3VVGA 2ZXBA 4DYJA 3IWPA 1CB7B 5EA9A 5EFFA 8XIMA 4M51A 4QRNA 1JCTA 2VZSA 1J79A 3G3DA 4F2UA 3KE0A 4ICMA 4S3EA 3QV9A 1UPPA 3G1FA 4YXGA 1L0PA 1FWGC 4C7FA 3U5UA 2GGEA 4O1DA 5FIPA 3AMGA 4CNOA 2Z7KA 1H4PA 3G24A 1TZZA 2O9TA 2XTKA 3G8RA 4IFKA 2CBJA 2QCLA 4DXVA 1HJUA 1EKOA 2ZUTA 2XISA 3QOMA 3ES8A 3NQ6A 3N9RA 3B05A 4UC5A 4F0KA 1N8IA 1WQ5A 3G1SA 3LDVA 1T8QA 1A5UA 3S2JA 3G1XA 3OB8A 1M6JA 2BASA 3EA3A 3VAVA 3Q58A 3F2CA 1XCXA 2CU0A 5EMJA 1BWLA 3SCPA 2C0AA 2PDQA 1OZQA 1YXDA 1H63A 3TR2A 2NQ5A 4M6UA 5BROA 2RDWA 3W6YA 5A6BD 2UY5A 2E25A 3SAZA 4E2OA 2UBPC 1SUXA 3M6DA 3ITCA 4PL2A 1RZMA 3BGJA 4HB7A 2B81A 3K8KA 2W67A 3V1PA 3WL1A 1G4PA 2OTDA 4ALDA 3QPZA 3DXIA 3ARSA 4KWOA 4LPCA 3QR3A 3RX3A 3UZWA 2V68A 3S42A 4PRWA 1B31A 4PBFA 1JYNA 4IOTA 4FX6M 3VOHA 5F1UA 3AFBA 3WJYA 4TMBA 4M6VA 5GJMA 3AS3A 3N3MA 3TZFA 3LHWA 3B0VC 1QMLA 5HUOA 2VUNA 4E8GA 1I9CB 3PJWA 3UA3A 3OEXA 3KUMA 5DY2A 4H7ZA 5CC3A 1EXPA 1ZFJA 4XO7A 3TTEA 3CWOX 3FDKA 5C70A 3GXPA 4PODA 1FRBA 3CNYA 5HK4A 3W00A 1XYAA 4EF8A 2W9MA 1XW8A 1X39A 1GPFA 4AX7A 1EJXC 3HPSA 5AZ1A 2PDCA 3WH5A 5CPNA 4GISA 3BLPX 3ZFHA 2VFEA 1UOKA 4DJEC 4JYEA 1F74A 3GNOA 1UR9A 5E93A 3F5KA 1PZ2A 3ITOA 2ZVIA 2EF9A 3THAA 4E4PA 2UWFA 3SZ8A 2CFFA 4NJKA 3QZAA 1EP3A 1YBQA 1D7KA 2EHHA 3IK4A 4PH6A 2X1TA 5H8MA 4L56A 3IK2A 4I90A 5M03A 2QJIA 1TV3A 1H49A 4DPPA 3AUJA 3TN6A 1KRBC 4R3UA 4LUYA 3VIPA 2Y7DA 3HG4A 1ME9A 3BW2A 3TXZA 2XVNA 1DJNA 3IIXA 2YB4A 2V38A 5LSMA 1HL2A 4ZBCA 2BXZA 3MA8A 4UQAA 4X60A 1QO5A 5HATA 2IXVA 5BCAA 2PBGA 3U2OA 3EWWA 2Y5EA 1S2AA 3FJ6A 2W66A 2UZ9A 3CUZA 3QGAC 4J40A 1GT8A 1UIPA 4RK8A 5I5RA 3C61A 3GAYA 2QJHA 4DEFA 5AC6A 3SRDA 3TQKA 3W37A 3BLLA 3NQCA 4KEZA 1VP5A 4PMRA 1BG4A 3AIQA 3W38A 3ZJKA 4JGDA 1X7FA 4QS6A 3H2OA 3JVAA 1WBHA 2P1FA 3HGSA 8CGTA 2J6XA 3W84A 1H5YA 4CU6A 3O1NA 1RCXB 1ITXA 2XU2A 1BKHA 5D8ZA 1YNPA 1WOBA 3AHZA 1JI2A 1L6WA 4XIMA 3BV7A 4L1XA 1DPMA 5FJRA 1B0IA 2GDUA 3S1VA 4I9JA 3XIMA 2WWCA 1UWQA 2VGGA 1YPXA 1E0XA 2GSEA 3HQ1A 5BXRA 3UW6A 5CAHA 3M5YA 5LHFA 4G56A 4IX0A 2ZRZA 3RM8A 1J0ZA 4IF2A 2G3FA 4QTGA 4CNUA 3GD6A 3PZ9A 4GNJA 1M04A 3FKRA 4C65A 1LWHA 3R8HA 2QZRA 4WY0A 1R3QA 3LB0A 3PZOA 4N9DA 2X8RA 4NF7A 2J7EA 4GIAA 4A2SA 4JCLA 3UWQA 4ML4A 2I56A 1E4LA 5HMDA 4Q4KA 1XYBA 4BCEA 1PKNA 4CGTA 2O0TA 5C2XA 1IEVA 4GD0A 4MFDA 4M7TA 4QCFA 3OBKA 4EXAA 3RJYA 3NO5A 7TAAA 2NX1A 2WVVA 4PC8A 2FGBA 2UY2A 1TZ9A 2HEJA 4DUXA 1TV8A 2E6AA 4QJ3B 3ISIX 2XIQA 3QHMA 4NY2A 4RV3A 4RW5A 1FWWA 2NWSA 5FAGA 1MW3A 3W29A 3MHUA 2G4JA 2WBKA 2J9YA 2W4XA 3HFYA 4HP5A 1B9BA 1P0EA 2Y4SA 1H60A 1JEZA 3VYLA 2ZRVA 1W3IA 2HDJA 2YXGA 5D30A 1FH8A 3LY0A 4J2PA 2DU2A 1JYVA 2MUCA 1SFSA 1IT0A 3C5QA 4MPQA 1HF6A 1R2TA 3B97A 3G1RA 4WJXA 3WY1A 5C9RA 4CNNA 1EGMA 1EDGA 2XVLA 2QUNA 4C1NB 4AIOA 3GM8A 3ABRA 2NV2A 2WPGA 1S5MA 1RA0A 2PODA 1KQZA 2B7OA 3W07A 3P2VA 1JGMA 1QXLA 1XLLA 1AODA 3KRZA 1LRQA 1QNPA 2C13A 2ZUUA 4WEVX 3S5NA 5G4HC 1WBJA 1VYRA 4JYDA 4LVGA 2NQZA 4GACA 3PAOA 3QMSA 3IS4A 3DUGA 2OWXA 1V3JA 3GH5A 1W2PA 1ONXA 2E67A 4LAMA 1XSKA 4A8RA 5DN1A 4CNPA 2VWTA 4M7SA 5CBJA 3SJ3A 3CQJA 5A6TC 3DG6A 1GQKA 2E9LA 3ONCA 1FWCC 3IJ9A 4QLLA 1MQPA 4YCPA 3T0DA 1R30A 1ZTVA 4AW7A 4E8CA 2OMAA 3LMZA 5M5DA 3GDMA 3SCUA 1PXGA 1UHVA 4ZO9A 3KW3A 3KBVA 4O1AA 1EA9C 2PWVA 5CC5A 1TE6A 3NPXA 4G7FA 3FXYA 3NZGA 2E40A 3K4AA 3UPWA 4C91A 3TK7A 2IMRA 4K39A 3LOTA 4U3CA 1M3UA 1TPDA 4NVTA 2Y2WA 4WOZA 4HCHA 3AIWA 4NI3A 3CHFA 1F4AA 3CU2A 4B4FA 1GZJA 4JR5A 3QSRA 4UTTA 1ZLPA 4F0SA 4UR9A 1Q6LA 2ACRA 1N82A 1KQYA 1W9BM 2J66A 4BKNA 1NU5A 3OO2A 4QE1A 2AQOA 4MB5A 5CZ0A 4PYSA 1JNDA 2PE4A 3CQIA 5E5CA 4QDPA 1XQLA 3BWWA 3RO6A 3QHNA 1ZBKA 3OA5A 2E7FA 2R82A 4XV0A 1GQNA 5TIMA 4HPNA 3EOEA 4A8NA 3UD6A 3VKDA 4HNUA 5HNNA 3C3NA 1JXKA 5AYXA 5HBFA 1KRAC 2V5CA 2X09A 4JAWA 2DQXA 1OYBA 3VE9A 1V3HA 5TD4A 1F9CA 3MCNA 2OO0A 4B5NA 3TN3A 3M0IA 2W0UA 3UJEA 4BWLA 1EDTA 2C14A 5KSWA 2QCDA 2KZHA 1ZAHA 4DM1A 4XWUA 4P7QA 7REQB 2VHLA 2BDQA 4D6EA 3I3BA 1RJRA 4OU1A 3DERA 4GVHA 4F8XA 1V93A 1SJCA 1XP3A 2DIKA 2JF6A 2XFFA 3DU0A 5A6JA 3AJXA 1SO6A 2D24A 1I75A 1E4MM 2A4AA 1MEHA 4HTYA 3NQ7A 1JL8A 1K3UA 4JTAA 2D23A 1QVBA 4BA0A 4I9AA 1T7LA 3I65A 4IIGA 5T91A 3QQ1A 5BZAA 1OYCA 1Q4NX 3VNYA 1VJSA 1B9ZA 1OIMA 2DZUA 2J47A 2WZTA 5CCZA 2O55A 4NJJA 3ARZA 2R14A 4D72A 3G6LA 3B9OA 1EYWA 2O9OA 4IGSA 1QASA 4H6KA 4O50A 4DLFA 3P5ZA 5D33A 4GIEA 1YHTA 1CENA 1K4HA 3WQWA 3T05A 3W1NA 3WK2A 1ITQA 1V02A 4PTXA 1RVKA 1I2QA 3VK5A 3C2YA 4H6RA 4AZIA 2PMQA 5MF5A 1NWUA 5FF4A 3W76A 4F48A 4P7RA 3MKVA 1QBBA 3TJIA 3RRAA 1TVLA 4EX4A 4B15A 4A21A 1XGDA 5GNZA 3QRHA 1A49A 3E0WA 2VDIA 2YB1A 4CQ9A 5C2GA 2VEFA 3GHTA 3CM4A 2NUWA 1SZEA 5CGTA 2OELA 3WG6A 3HPXA 2Q6ZA 1PSCA 4WY0F 2WCAA 4DUWA 5HJYA 1S1PA 5FL1A 1KBIA 4RUBA 5FCZA 3TC3A 4MPKA 3UPMA 2WO5A 4MLRA 4AF0A 2WMGA 1B3VA 5CH9A 1DV7A 3T9PA 2FVMA 1EHNA 4V28A 2RDUA 1VENA 4HA0A 1X7IA 1UP0A 3WH6A 5B7YA 4IPPA 1XYLA 3NVTA 4D2JA 4WLCA 4NAEA 3RK8A 2YSWA 1BXBA 4HMNA 3NYZA 3SEPA 3DDMA 5AFDA 1YTDA 1CLXA 5CBIA 1GEQA 3OLDA 3TVAA 2D1ZA 3TTSA 2V8ZA 4J3XA 3GXDA 5AC4A 1AD1A 1XS2A 3ZIZA 3CMFA 1FVPA 1FWTA 5JIWA 3HM7A 4LVBA 1FWSA 4W9TA 1TV4A 3APGA 5FF3A 1G4SA 3EB2A 5D09A 1SJBA 3CQHA 4LAOA 1XICA 3PJUA 2H9AB 3PJXA 3H4XA 2NX3A 3ZQ9A 1GVQA 4KEVA 1Z89A 3UETA 4DO7A 4S3KA 4CU7A 1BRLA 2ZTKA 4ZSTA 1M68A 1XLAA 4YTUA 3BVJA 2RGLA 1DWFM 5C54A 3G1VA 3DEQA 1ZJBA 3PUDA 1UUQA 2XWDA 4L7ZA 1F05A 1XUZA 3W53A 1EZ2A 4Y8EA 3VXGA 3O16A 3U6WA 2FGZA 1NIUA 1XPGA 2WSKA 1YKWA 1EXBA 3NR0A 3TW7A 3ZXWA 3LRLA 3TEVA 3ITGA 3KHJA 1V08A 4X61A 1E6SM 4J3WA 5CZSA 2DT3A 4OBRA 4NZ1A 5A1AA 4IH3A 3M16A 1RJQA 5FEZA 3W7NA 2JQXA 4M1RA 4XUYA 2ABBA 2DZBA 1OM0A 5EYWA 4E3VA 3FYOA 3H6OA 3JZUA 1OCQA 4AZCA 4FXSA 3CPGA 1DTNA 1V02E 4Q33A 4V33A 5GJPA 1JUKA 1OVDA 3DC0A 1H7XA 3N19B 5LIKX 1B30A 1UR8A 3SY8A 4B4HA 4EF9A 1KM4A 3MZNA 4GO8A 2OZ3A 2RDXA 3ZVHA 3CHVA 3EEGA 5DANA 1ZP3A 4S3GA 1N8FA 4F0LA 2FFCA 3GYCA 3T1GA 3DH7A 3QSTA 3UVAA 4D1IA 5BU6A 5J5DA 4MTVA 1ECEA 1O7AA 4LYKA 3LQLA 3EXRA 4UFHA 1Z69A 1J93A 3LTSA 4J9JA 3H54A 4UWMA 2POZA 2ZXAA 4ICNA 4DELA 3NIYA 2WMIA 3K8LA 2Z00A 3MY9A 5CPSA 1IYXA 4FXRA 3LS9A 2A7RA 2QDDA 1ONEA 1BXCA 4S1FA 3KWXA 2F84A 4QQUA 1GYLA 1E4NA 2PFHA 3APTA 1KFCA 1ITCA 2ZDRA 1J12A 3UG8A 5JVLA 5DMLA 1VCVA 5JH2A 2CW6A 5EMUA 4BFAA 1U5JA 3F5LA 4WVXA 1NF0A 3VGEA 3BURA 2HQAA 1QU4A 3Q94A 3CL7A 4JX6A 4UMBA 4O53A 1Q13A 3LD5A 4XZHA 1SZFA 2AL2A 4NL1A 4MJMA 2VYOA 4KCWA 3OIHA 3H22A 4GZ7A 3D3FA 4ENLA 2O92A 2CLOA 1X6LA 5G2WA 4LS2A 4CEUC 3AHVA 3UESA 3D5HA 4DUVA 3VMPA 1AL8A 2XYLA 3VX1A 2Q02A 4C90A 3REQB 4ZOCA 2VC7A 1JD9A 1AW5A 4EAMA 2Z1KA 2VX4A 4HN8A 3TMLA 4HNTA 1IHIA 5GNXA 4GYPC 3UZJA 4L64A 3GHUA 3LCFA 5I7GA 3WNNA 3QMRA 4IFKB 1EP2A 1SO4A 1A50A 3BC9A 4HA1A 3VOCA 3NAVA 1FWNA 3TP4A 2IKHA 2OZTA 2NSOA 1W54A 4FK9A 4JHOA 2NQ9A 3FAXA 1E40A 1H7WA 2QUVA 1B57A 3QQ0A 4PUMA 3O05A 4PSRA 1ZENA 2FGLA 4V1YA 1V3MA 3NM1A 4DI9A 4FX8A 1M9HA 3L23A 1S2UA 3SN1A 1GHSA 4U2YA 3TC7A 3ARVA 4AWTA 4HYVA 4UTWA 3N15A 1VFHA 2FB2A 1EX1A 3R2GA 2CPUA 4AFYA 5CJMA 2V81A 2Y7FA 3IGHX 1GHRA 1V6TA 1O60A 1POJA 2XFWA 4GH1A 4WRHA 3RILA 4RE3A 1S5NA 1S2WA 2OOGA 1K9FA 3NL5A 1JZ4A 4XX6A 3OOQA 3ZM8A 1EBHA 1XLJA 3ABOA 3QQWA 1UC5A 2G3NA 1KGWA 3S3GA 3NUKA 3MTWA 1FH9A 5HNTA 3WKZA 1B90A 2YPIA 4C7DA 2WJDA 3IGSA 5JQ9A 3GTFA 3C2FA 1JDEA 3V7PA 5AHEA 1VCGA 1KFEA 1TTPA 1KXTA 4FXFA 3IAPA 4BWLC 4QG6A 4HOXA 4M56A 1NQKA 1F6KA 3CUFA 1CLVA 1XCWA 3ES7A 2I57A 3M5ZA 1GOXA 4LCQA 4ZQRA 1I1XA 1TMLA 2FHCA 1MO0A 4EPEC 7CGTA 3PR2A 3V1HA 2YDSA 2GDVA 2J27A 4HCLA 1P0BA 1KO0A 1C8XA 3DX5A 3EOUA 2WVUA 3PZTA 1YBQB 4K8GA 1BVNP 5HMEA 7ODCA 4CN1A 3VX0A 2AAMA 3I4EA 5M2FX 3OU8A 1XD0A 5DMNA 3GTIA 4TIMA 4PGLA 2YDAA 1RBAA 3TWAA 4RXGA 3VNJA 3O2LA 3PBYA 2YCIX 3E2RA 3JRKA 2JGQA 4HTBA 3SRHA 3HQNA 1KM1A 1OABA 1V79A 3KOZA 3CH9A 2HCVA 2VCCA 4Q8PA 4E3TA 3FK4A 4M29A 4HK7A 2RDTA 4RX0A 1RV8A 1W3HA 4FR1A 1E73M 2GPTA 4XK2A 3O63A 4IPJA 5BXPA 1CXEA 1AQMA 3HPZA 3PFRA 4JX5A 3HFTA 4AISA 1QWGA 3M9YA 3UXLA 3BL3A 4FNUA 3L2IA 9XIMA 3QM3A 4ORIA 2ALRA 1WZMA 4GA8A 1QDSA 3UY7A 1G7VA 2ZBTA 2XVKA 2O56A 1V0MA 4LY4A 1FWHC 3W75A 5H2ZA 3SB0A 3NSNA 1GKPA 3EWUA 4C6PA 1GJUA 2ZE0A 1V6UA 3GAKA 3GY1A 3FVMA 2YW3A 6TIMA 4OUEA 4K7VA 1GQLA 3C86A 4FXJA 4MUPA 2GQAA 2VELA 3NM3A 1W1YA 1QI2A 4X9SA 2F2KA 3WQGA 1GTEA 1Q8AA 3VNZA 4GNVA 2EPHA 2X40A 3DHUA 1KNWA 4UQDA 3WD2A 5FF0A 1EJRC 4FLRA 1WAWA 1JRCA 2YL6A 1X6UA 1EQPA 2BVYA 3CAVA 2GUBA 4OVXA 4NX0A 4WY0B 2YFOA 1K8ZA 3AYRA 1W0MA 1H09A 3GFXA 1NFPA 3GYEA 1AK5A 4EVZA 3OG2A 3WH8A 2NZLA 1DJWA 1I45A 3UCQA 4C5ZA 2D20A 3UR2A 2W79A 3KRBA 1ALDA 2VFIA 2XG9A 1ADOA 2PP3A 2I9EA 3KVMA 4Y6GA 1UKTA 2ESCA 4OTKA 2RJHA 2WCSA 1BF2A 2ZZ7A 3L2LA 3GBEA 4TR9A 3L9CA 4WZHA 1JZ7A 3RPTA 1GJWA 1E56A 4NT0A 1A3XA 2HJPA 1WOAA 3KS5A 3M0JA 4EK7A 2X1RA 1PDZA 1XISA 3RU6A 1Q6RA 1MMFA 1U2YA 3AMCA 3TSBA 3RLGA 1PIFA 1LL6A 3S8HA 4HNOA 4MJZA 3HPFA 3IGXA 2QAFA 1KTBA 3MW7A 3RM9A 3CQKA 1TMQA 4GI8A 4FOJA 3EPMA 1JUEA 1XG4A 3M43A 1GG1A 2ISSA 1A5KC 1TRDA 3PG9A 1IEQA 4U33A 1UZ4A 3FY1A 3Q4DA 4NASA 1OK4A 3MVIA 4ACYA 4NYUA 5D9PA 3TONA 2VEIA 4B5XA 2Q3OA 2WSPA 3NCOA 1JAKA 1TWIA 3WQFA 1LUCA 4ECLA 1E9IA 5HPOA 1J01A 4Q8VA 3NOYA 2PGRA 3BPWA 3WMCA 5K3VA 4GINA 3TLQA 4AD4A 3QY8A 1OK6A 5CSRA 4G6CA 3AZSA 2J74A 1VGAA 4KFOA 3ORWA 1W5OA 2QV5A 7ENLA 3V4BA 3TZNA 3MWAA 3TQVA 2VRQA 1ADSA 3D46A 2DPEA 4E2DA 4KPLA 2P5NA 1AH3A 2FH6A 4XZMX 1J0YA 3TCEA 4ZTYA 1CEOA 2C8NA 2FDMA 4AEFA 4ZZ9A 3QC0A 2Z7GA 1UD6A 1W1IE 5ABFA 1LOLA 3VABA 3MPGA 1SW7A 5H1WA 3MV11 1BYCA 1IEIA 2IPJA 1H61A 3MB9A 3QZ6A 1XBZA 4XD5A 4GCXA 3R8GA 2NSXA 4GCAA 3R5EA 5A69A 1O66A 1YXYA 4A8IA 4JICA 5E09A 5D9OA 3IACA 1ICQA 2WHMA 3B03A 3F4CA 3DYOA 4MOZA 3NJ3A 2OEKA 1I0BA 1BTCA 4A35A 1OINA 4N6FA 2E5BA 3F4WA 1IEXA 4YVVA 4H6QA 4IXXA 3UF9A 4Z1DA 3PBMA 4MWAC 1MUCA 3BQ6A 1XLDA 4NZCA 3SSZA 2CNCA 1N2VA 3EWDA 3WD0A 1R8LA 2ISDA 3ALGA 5AVNA 2RJGA 1YDVA 1XRSA 4IMDA 4C6EA 4IHCA 3KOXA 1Y8BA 5D4YA 1Q6DA 3DGRA 1OC6A 4ZXLA 3H55A 3GTNA 5I0DA 5HJLA 3ARTA 2QCDB 4G9PA 2OQYA 3GTXA 3VKCA 4HIBA 3TW9A 4MY1A 2PGEA 2EKGA 4KT2A 4AVFA 3KBNA 3GVQA 4GNKB 4MKNA 3W1QA 2OYLA 3P84A 1GG0A 2CESA 4AG0A 3B8TA 1WCGA 3GU1A 4PTDA 1NJJA 2VFHA 2WKJA 1KGUA 3AAMA 3SRKA 4B91A 4JBRA 3WEZA 4AZ5A 2UY4A 1O12A 1WZKA 2QIIA 1S5VA 3EX1A 3E49A 4LUSA 1Z8AA 3AO0A 5KEZA 3WDRA 3U9IA 3PS7A 1JPKA 3TKFA 4HNNA 3V36A 2ZA3A 1E1EA 3A47A 1OWQA 4DXKA 1G69A 4EKJA 1AJZA 1RCOB 1U30A 4YWIA 4AY1A 1R3RA 2WKLA 3LHYA 2Z1SA 3NQ2A 1FHLA 1N7KA 1ZL1A 2PDIA 3QF0A 3M0KA 1K8XA 1VCFA 3OYXA 1RPXA 4H7VA 4ROPA 1C9DA 4GXMA 3SADA 3EKGA 1A0DA 2Q8LA 1ICPA 5BRBA 1AH0A 3S6OA 2QULA 1R7OA 3QJAA 2NQLA 1KR1A 1OHLA 3ITVA 3R1ZA 3WLTA 3W7QA 3I7RA 4A8LA 2ZZ1A 3W7KA 3H70A 4GFSA 3Q67A 2NV1A 3UWZA 2CLFA 2ZZ6A 4C6DA 4AU0A 4LVDA 5IHRA 4N0RA 3IRDA 2QQ6A 4NZ5A 2R6OA 1K9DA 3W3OA 3QPYA 4NNBA 1JFHA 1YDNA 4PA8A 3SCWA 3L4TA 1RD5A 3UZYA 2P8CA 2WHJA 2VENA 5JBDA 1P6WA 4V15A 1FBAA 3WD3A 3LM7A 1JDAA 2XZ7A 3HQOA 1O5QA 1WKFA 4DJDC 1UD5A 4V2XA 2OKTA 4AZ6A 2J77A 2OR2A 5ECVA 2C15A 4O16A 4O0QA 3M7SA 4W5ZA 4Y96A 1HKKA 1PYMA 3WENA 2XM2A 2WV8A 3H23A 3N4EA 3GW3A 3FGCA 2VX7A 4H01A 5EMKA 3W73A 3VFLA 4E4FA 3LTPA 3UEQA 4QX4A 2EG7A 1JGIA 3Q2DA 2PDJA 4CD5A 2CLEA 4S3BA 3DYMA 4Q8TA 1DJIA 4J28A 3FDGA 4K37A 3UJ2A 4Q8NA 1NDVA 5AHIA 1RQBA 3CZGA 3MZ2A 4IICA 4C6IA 2A3AA 4XSLA 5HDRA 3IARA 3VIGA 1OX5A 2FH8A 3UXDA 2Z4GA 3DGBA 3F4VA 3OHMB 3OJGA 2OSYA 4LT9A 4R85A 3USBA 3AIEA 2XIMA 1KC7A 2ZC8A 4RKAA 1CGXA 3W25A 3E5PA 3G1HA 4JCMA 4EWND 1BRLB 3KCLA 3O8AA 2DY3A 3LV6A 5F4SA 4Z1CA 1PS9A 5FEPA 3TH6A 1WX0A 3DI0A 1IF2A 1QPKA 1UP2A 4PULA 3P0WA 2G3IA 2YZRA 3CAKA 1J2BA 5REQA 1C7SA 3OGVA 1UD8A 1UWIA 2QCEA 4B9ZA 2ZX5A 3DHPA 3RAOA 3PZNA 4M6QA 1TV5A 3M7WA 4UMAA 1W5MA 2YLAA 1AZ1A 1VBJA 3CV7A 2OPJA 2VZVA 1CXKA 4GABA 4NZ3A 1JDFA 2E09A 2QLYA 1Z3NA 3R0DA 3PWAA 3RMJA 5FKYA 6ENLA 5JBEA 5I00A 4GIYA 5E6YA 1NSJA 2YL9A 5HNUA 3AXMA 2ZQ0A 3NPUA 4HHPA 3EXSA 1W3KA 1UZDA 2CLPA 2WZIA 4AZCB 1BWKA 3EOOA 2QUTA 2NXHA 3A64A 3R8RA 4W7UA 5HPCA 1BVZA 5FSEC 3WH7A 1UWUA 1CBGA 4K36A 2G41A 4KCTA 4NRSA 4IP7A 2IQ0A 3ZVHB 3NEHA 1UR0A 3T2QA 4GY7A 5EL1A 3VD9A 3SQSA 4KEMA 1E4IA 3GC2A 3GX9A 5C2CA 1SYTA 4J5NA 2BP1A 3U7VA 1DE5A 3S5SA 1W1TA 1GOQA 4JXCA 4DXXA 4JFWA 1C8QA 2ZXDA 2G4FA 5T26A 4L4OA 1MXSA 1UC4A 2DJXA 1Q7MA 3CIXA 2D73A 3BW4A 3HURA 3EWBX 5CZTA 2Y62A 5DEZA 1KFJA 1XIHA 4OWGA 4MFEA 4WXYA 1TUXA 1LROA 3JR2A 3URAA 1TR1A 3W6MA 3WJZA 1D8CA 2PS2A 2PBOA 4FNSA 3T81A 4O17A 5AOUA 1XKYA 1IEWA 2DIEA 4WJ8A 3IRSA 1S3HA 1R5YA 2DUAA 4LCRA 3AICA 4MIMA 1XYCA 3E1F1 4H9MA 3CGTA 1GNXA 1D3GA 2A5HA 1UWSA 3TXVA 1TR9A 1C8YA 4R7WA 4Q8UA 3KFTA 2Y88A 3POCA 4QJ5B 1LG2A 4U5IA 1YEYA 3ZR4A 4H2CA 4DM2A 1WDDA 4Q8QA 3V5OA 1LT7A 1E3XA 3NL2A 3WDIA 3UQNA 4C1KA 1NY1A 4ZTXA 3ZJ8A 1HGWA 5KINA 4XAGA 1Y5WA 5B7ZA 4LS1A 4ZB2A 2PWHA 2E5CA 3VC5A 3PBWA 3DG7A 3OVQA 4EIVA 4DO6A 2FPYA 3RDKA 3PTKA 4M0XA 2E4TA 3BGAA 4ZA0A 1RXOB 1MQQA 2ZUWA 1A5LC 1KGXA 1O6IA 3QHOA 5KZDA 4AC7C 4F4RA 2CZFA 3UWEA 1V7YA 2DDXA 3HV9A 1P7TA 3AZTA 2IQDA 2TYSA 4W4QA 2EPOA 3RIKA 6XIMA 1KBLA 1YPIA 2OLHA 4P7NA 4GKLA 4N2YA 4QQ3A 1DJQA 4GX8A 4UTFA 3VD3A 5DT5A 4RL3A 2D0HA 4HOWA 5MHBA 3WQEA 4K68A 2B7PA 3N6JA 5F7UA 1FDYA 3FEMA 4C6CA 3RRXA 2Z2UA 4LUIA 4JTHA 1OFQA 2E5DA 3QFWA 2QMKA 4IIFA 4ILSA 4DBDA 1ZS2A 2PDYA 2GQ9A 2QJGA 3EAUA 1VD6A 2VZTA 3EZ4A 1PX4A 2OZ0A 3O7UA 3AMKA 3ARUA 5CG7A 1W9UA 2XDFA 2GVEA 3MCOA 2ZRYA 3TC6A 3USZA 1BWVA 4ZQNA 1KV8A 3CWNA 3K30A 4I3GA 2HBXA 2A21A 3NQFA 1E55A 3SGUA 3PF3A 4BY3A 2BS9A 1PHQA 4LAKA 1O68A 4GUIA 3CIVA 2C91A 1J0KA 5U4NA 2GVGA 5G4WA 3F4NA 4L6HA 4GXWA 4ZR8A 3PY2A 4NKCA 4J3UA 1XD1A 3GHRA 2QKFA 1BGGA 1XLKA 3U3HA 3R0KA 1LLWA 2DQWA 3KZSA 5DBTA 1KRMA 1TPVA 4GH3A 3OVRA 2ZUVA 4EXQA 1GVSA 2PURA 4JTDA 4BEQA 1OD0A 4MZYA 4IL0A 4B16A 4N9EA 1EH9A 4O8AA 4O54A 2BV9A 4H00A 3SDOA 1Z48A 4UTKA 1PCWA 1XC6A 4RDVA 3A6OA 1WUFA 4HHHA 4XKYA 3KCOA 2J9XA 2QDHA 3BV4A 4HNCA 2E3ZA 4G5DA 1E1CA 5A6KA 2HV5A 3MUIA 4AXNA 5XIAA 4LY8A 5EPDA 2DVXA 2P3ZA 1IT8A 4C60A 4GXPA 3QKEA 3TJLA 3SFKA 4GG9A 1UD3A 4RPPA 3E2QA 4JTTA 2QCCA 1PO9A 2OB3A 2JKPA 4O1CA 3SGGA 5LIXX 1TPFA 2E68A 1VFLA 4GZEA 4GBDA 4RPQA 4REQB 2NQHA 3LI1A 4W84A 4DZHA 3WLHA 2E8YA 3GR8A 3N9KA 4Z1BA 4BI5A 4US5A 4RE2A 3BAKA 3LYEA 4WD0A 3THDA 5H91A 4UQCA 3LSBA 4MLJA 1UR3M 3WQVA 2FLIA 2WLYA 4MJ4A 4DYKA 1W9PA 3CHDA 3E0LA 3WLNA 2W27A 1QCWA 3O15A 4U31A 3B0PA 3MMWA 3TFXA 2X2YA 3NQVA 3N6HA 4WDUA 3NSMA 4G7EB 4NRRA 2FTWA 1TJPA 1Q6FA 1R87A 3CUJA 4JPGA 3PNZA 4NX5A 4IJBA 1H11A 3TROA 3VCNA 4EPKA 1EDQA 1KWGA 4CU8A 3SFWA 4KWWA 4I9TA 5JXQA 3TWBA 2ASHA 3SECA 2BZNA 2H6RA 3GBDA 3R58A 1FOBA 2AQWA 1J5SA 5C0QA 3BK0A 3H2EA 5CC6A 1TV7A 2GFTA 5MKGA 5E9XA 3LLFA 2YX0A 3ZOAA 4C6FA 5C7HA 2VCAA 3UJRA 1TV2A 1P6BA 1ONWA 1QBAA 3QKZA 1IT7A 1UCWA 4L6OA 2EG6A 4UZUA 3WQOA 2WKGA 2HWGA 1MXGA 2DSKA 1QT1A 5D2XA 4N9BA 2DV0A 3A9IA 3UCCA 2A2IA 3G22A 5FJUA 2EO7A 2PPGA 2CKSA 5CC7A 4HZ7A 4F2BA 3JUGA 2D3LA 3KDNA 1TB3A 1SVDA 3H21A 1RAKA 2CBIA 1UUOA 3M0VA 1R3WA 1X96A 3ZT5A 2JALA 2PCEA 5FEXA 2YXOA 4LF2A 3FYYA 1LT8A 5F1VA 1MFVA 3VOIA 2AKMA 3BICA 2Z2BA 1JG9A 1E71M 6ALDA 4PE8A 4YMZA 3RX4A 3FLUA 3SGZA 2VO5A 2E0PA 3N12A 3WF1A 1FDZA 1FWJC 4US6A 2DZWA 3B9NA 4JTCA 5LA1A 4GIRA 4MY8A 1SJDA 1HKVA 1YTKA 1BG9A 1FCVA 1DP0A 2GOKA 1RK6A 3GVWA 5HWJA 2G3MA 4PUDA 1QWKA 1GVYA 3OLEA 5XIMA 1Q5MA 4MYAA 2JE8A 5A6BA 3TA6A 3WJWA 2NXIA 1VRXA 4EANA 3M64A 2Q71A 3M0YA 3QV8A 4LNCA 3VIIA 3KCJA 1O94A 5C8BB 4LFYA 1CT5A 3CB3A 4GVGA 1I2PA 2C79A 2VZUA 1CYGA 2Y24A 2WC4A 2HZGA 3O6CA 1OCNA 5H6HA 4DLMA 3I3DA 4JIQA 2ACSA 1ZZMA 1Q7QA 5U7SA 2RUSA 1EQCA 2NUYA 2FKPA 5E0CA 3TQPA 5FJTA 4WX2A 4FR6A 4ZFCA 4MKSA 3OP2A 2R8WA 2ZCGA 4KBXA 4XQ6A 4ZOAA 3E0IA 1LUCB 2OEJA 3MWCA 3KDOA 2GOUA 3C2VA 4H6EA 4IPLA 3SO7A 1NQ6A 4H1ZA 4PUWA 3VMNA 4M82A 4GQBA 3VDGA 1UWTA 3IUHA 1R0MA 5AVHA 3SCTA 3S9ZA 4MHBA 1H50A 1T6MA 5IBXA 4TO8A 4H9UA 4H9ZA 2Y7GA 3AS2A 3STCA 2Y63A 4FIQA 3W7RA 2J88A 2RAGA 3CAQA 2Z27A 3C0QA 5G2IA 2JIEA 2YOCA 3GXFA 2XH2A 5AN7A 5RUBA 2PC4A 2Z1VA 1I8JA 1VIZA 3HJEA 1K77A 1SZNA 1NDYA 2X1SA 3W1LA 2XHYA 3GH7A 2CZDA 5D32A 2VC5A 1F7BA 1XIGA 2TRSA 5ABFB 1UYQA 3WLOA 3F2DA 1O1ZA 3C2RA 2DZSA 3MC5A 2J7CA 4H8VA 3G1DA 1PTAA 5D9MA 3CO4A 3N1AA 5CSYA 3WQPA 1Q85A 2V3DA 2BTMA 4RDYA 1XXXA 1YTEA 1NAL1 1W17A 4K8HA 2NV9A 1G7UA 2YBUA 3BGGA 1DORA 4HZ8A 2OKOA 4ZB5A 5EB8A 1V6YA 2PLKA 5KZ6A 2OQLA 1PVNA 3AHXA 2YDQA 3R4IA 4Z42C 3DESA 3PAJA 3W1RA 2PTDA 2NUXA 3D0CA 3IIPA 5BYWA 3QW3A 3AISA 2EKCA 1QR7A 3N04A 3EWYA 1OC5A 1LJYA 5CKSA 3UJFA 4DF2A 3B9EA 4WKHA 3IGUA 5I09A 4JDBA 3TAKA 1A47A 4ERGA 4LYQA 5FEWA 3IV8A 4H3DA 4L4MA 4FNQA 2P0IA 3W87A 3WF2A 4AZGA 1G01A 4KIEA 4IG2B 4RE0A 1XLFA 5E6ZA 3BLOA 1GW9A 1P48A 1TJ0A 1BFNA 1AQ0A 4ZOBA 5LYRA 1VRDA 3MJYA 1Y5VA 2PU1A 3E2VA 3EEZA 4LC6A 3MI2A 2AMGA 3SCQA 3GXIA 4D8LA 3E9AA 3B8VA 5LZLA 1Y5XA 2NVCA 1QNVA 1WXYA 1PZ1A 5KMYA 3LERA 1JCLA 3T08A 4MAZA 4S3DA 1QRQA 1XYFA 4OV9A 8TIMA 1V03A 3STEA 1P43A 7A3HA 4PUUA 2FDSA 1EJUC 4RNFA 1UKOA 3NZQA 3VFCA 1SSGA 2ZKMX 1C91A 3EMZA 3SY5A 2Q8XA 1W91A 5L6UA 4JTRA 3M07A 4PFHA 5AC7A 1OX4A 1V0LA 4AEEA 5HINA 3FA3A 4YTSA 3P62A 3C56A 1PKYA 2ZX7A 1ZY9A 4ML9A 2WZMA 4YTTA 2OSXA 4DWSA 2BXVA 3O6YX 5LKYA 2ZDSA 3PULA 1FCQA 3LHTA 1QOPA 4DRSA 1KFBA 1J10A 5DBUA 5TF0A 1CWYA 1GVFA 2TAAA 2WCGA 2QR6A 1H1YA 3BO9A 1ZALA 1TKKA 3RU8X 3W9ZA 5K2ZA 1OJXA 3GHSA 4QDWA 1NFGA 1J0HA 3BW3A 4P2VA 3VDAA 1MW1A 2L5HA 3H24A 1LDCA 3GNXA 1LF1A 2PRHA 3UZ5A 4LOCA 3WDHA 1LRNA 3VIMA 3VNIA 3CUHA 5K7JA 4GUGA 3URQA 5LNRA 1CZ1A 4KRZA 1NTHA 1E1FA 1BTMA 1XBVA 4E2BA 3GDRA 4HQVA 1AFSA 1FCBA 2J75A 3VDHA 3GZAA 4XVEA 3FGCB 2V5DA 3UXAA 2Y5SA 3ARPA 2V2DA 4Y9PA 3WQCA 1CGYA 3T55A 2D0FA 3A23A 3UWYA 3BOFA 4ASTA 1FX6A 5BXTA 4H9XA 1RQHA 3CH0A 3E0VA 2WSQA 3WJSA 2QW5A 1MRAA 2NXGA 1E0WA 3GR4A 2C7FA 1ZNNA 1OCJA 1R86A 1TA3A 2ZICA 3BMXA 3NZ1A 2QHAA 2BVWA 3WLLA 1UR2A 1VJZA 4XISA 5IM51 2YLLA 2WW5A 4R7JA 5D04C 2ACQA 2B4GA 2XINA 3V18A 3W4RA 3LBMA 1X38A 3Q37A 1TZ7A 5D38A 3L4ZA 1SJAA 3PSWA 1R2RA 2CIPA 3AYVA 3OVGA 5BMXA 2H8ZA 1HN1A 1XL9A 1X6NA 2D2OA 3MU7A 1JPDX 1DQUA 5M1TA 2EPKX 4DX3A 4JTEA 4C5YA 1XLIA 3NDOA 3BCFA 3IV3A 3FN9A 2OX1A 5REQB 1R46A 1JI1A 2VX5A 3GXNA 4QE5A 3GKAA 4IJRA 3MJMA 2QJMA 2CKRA 4CD8A 1FHUA 3VM7A 4ZENA 2YCLA 1EF3A 2AGKA 1G67A 3N34A 5HQMA 4JNYA 3O6AA 2XPKA 4IUGA 4I6VA 3ANUA 3ZJ6A 3EXTA 2OWWA 1MZRA 3HMJG 4X2PA 1R2SA 5LXEA 1JZ6A 4DJFA 3OG3A 4JD4A 4O11A 3PVFA 5A6SA 4L1GA 3KRUA 4W89A 3LRMA 1FFRA 2V9DA 1HKJA 4KFNA 3WYZA 4H8UA 3VKKA 4NYYA 1E5JA 3PP7A 1IWAA 1XIBA 4EPBC 1LQ2A 3MUY1 2DW7A 2ZWZA 1V3KA 4Z2LA 1SR9A 3LU2A 1C90A 2VR5A 4W5UA 2VNCA 3ENLA 1R9XA 3VKJA 4NZFA 4GY1A 2HK1A 4GBUA 4AWUA 3REQA 5C71A 1OT2A 3NZRA 4HPGA 5CGQA 3VNKA 4QLKA 4L9XA 4ZFMA 1E43A 1P0KA 2D2JA 4GI9A 4HPJA 4N42A 3BAJA 3PANA 4URIA 3II1A 5EMYA 5K4ZA 3ICJA 2EGZA 4DB7A 1TMHA 3VOGA 1PE1A 4QS5A 4Y90A 2OYKA 1KXVA 4L9YA 2HROA 3VILA 1DEDA 1OFRA 5LIYX 2WJFA 2IPGA 3NQEA 3PTDA 2FMOA 2QPUA 1TRIA 3SCNA 3ERPA 4OBSA 1QUMA 3M44A 5JUVA 1PDYA 4U3AA 1J5TA 5CEWA 1O5RA 4O57A 2IPFA 3KL5A 1FKWA 1FWEC 1QPRA 3WNOA 2WMJA 1YE6A 4PL1A 2D0GA 2XN2A 2VR4A 3U5YA 1RLDA 4J7RA 4JDYA 3SSJA 3W7JA 2OOFA 4AVOA 3OLIA 4HPXA 1EWDA 3ZR6A 1H0GA 4IIHA 3CJPA 3LM3A 3WLQA 4Q32A 1XC4A 4D6CA 4J3SA 3P7YA 3CB8A 5AZ0A 4MNJA 4J35A 4S39A 2YCJA 2XSXA 3UT0A 5JMUA 1W3LA 2GJLA 4LUJA 4UZSA 3KBMA 3QV7A 4DQWA 3KTXA 3WUEA 4HHLA 3CC1A 2A79A 1FH7A 2C71A 3AYTA 1MZHA 1P7TB 3F1QA 4EACA 1OFBA 3NL3A 4MJ2A 8XIAA 1SGJA 1WA3A 3THUA 3L68A 5CG0A 5AECA 1LQ0A 2FTPA 4ERAA 4A3RA 4JKMA 3V16A 2VQUA 1OBAA 1K7XA 4GQ0A 3AXHA 2VEPA 3O06A 3L0NA 1SFTA 4PMOA 1P6CA 3VOFA 1KBBA 2PB1A 5I3FA 2BBFA 1AQFA 4O15A 3OLGA 1B2YA 1QW7A 3QOKA 3BTNA 4UBPC 4AHQA 4ADUA 1U83A 1E6XM 4WSJA 1N55A 1H7RA 5PTDA 2DW6A 3MYOA 5AHFA 4LCSA 3VDCA 3NTYA 3TJ4A 1X98A 1GVRA 5IFTA 6XIAA 5HULA 1X8FA 3BLKA 2PWEA 3RJXA 3PNUA 3WK0A 4O0KA 1V3LA 3W01A 3UERA 2E1WA 4AWEA 3V3WA 3BXWA 3WLRA 1CTNA 3BAXA 2A3CA 5AYZA 1EOKA 4FF5A 1NP0A 5A2AA 2FZBA 1UR1A 2QPXA 1R3TA 5G1YA 1GKRA 1ZRQA 1Q2SA 2EPLX 3N2CA 4BZYA 4MDOA 2X30A 1W5QA 2PDXA 4UOJA 4QP0A 1TPWA 3ZYZA 1V0KA 4GVFA 1B3WA 4CN4A 3WBEA 2Q8ZA 3TFCA 2W92A 4O14A 4XKYB 1DYSA 3EX2A 1JCYA 4RE4A 3AUOA 5CQ1A 1P0NA 1E1CB 4O13A 3HG2A 4AWSA 4MSSA 4JTUA 3WQ8A 2I1OA 1F07A 4MB4A 4GX9A 4AUBA 2DT2A 2VX6A 3AWOA 2DUZA 5BRQA 4HNLA 1UP3A 1X97A 2V69A 4M80A 1W37A 2GJXB 1Q3NA 1XJBA 2J78A 4AIEA 4JFTA 1ICSA 2WB5A 4P8XA 1ZGDA 2FZDA 1J9YA 4IXHA 4QCEA 2OGYA 3N3TA 3PFMA 1S2CA 1TPH1 2V2CA 1WXZA 4L80A 2A85A 3QPEA 5FESA 5KITA 1OC7A 4M1BA 4C6QA 4F40A 3DOPA 1V0NA 1R38A 1JIBA 3ZSTA 3ZLHA 1QTWA 1GQJA 2Z6JA 3AXKA 4DBWA 1A5BA 3EX3A 4GFIA 3RR4A 3A4WA 3BANA 3ELFA 2UV8G 3UZXA 5HA7A 1EA0A 1GOMA 4ERIA 1PEZA 2J7GA 1J8VA 4HU4A 4RNIA 1DE6A 3DFHA 2FJUB 2EXOA 1FWIC 1G9HA 4KGJA 1U5VA 2Y0FA 5MKGB 1F8IA 5CZJA 1FP9A 1V6XA 3E02A 2GYIA 2DP3A 1OX6A 1FKXA 2IXUA 3A4JA 1XCFA 3L4WA 4UFLA 1LP6A 3W22A 3CZJA 3W27A 1I60A 2BWGA 4DWSD 3GVRA 3A3XA 2VWSA 5I6SA 3EKZA 4MNLA 4U2ZA 2DZVA 4UUIA 1K6WA 2ZUSA 4F0MA 2WM1A 2FMNA 5HQEA 5KZEA 2CXGA 3BG5A 4TVDA 1CXLA 3P67A 5E70A 3RGTA 5FJIA 1HQTA 4YVXA 4XD4A 2YR1A 3WNKA 1HVQA 3PPFA 3KVLA 3WLPA 3RUBL 4YS1A 1LRTA 3OTRA 2A6NA 2WMHA 3PWGA 1K7EA 3MHGA 5HMSA 4Q8OA 4KIRA 3MMDA 1FFQA 1PZ3A 4S23A 4HN4A 1UD4A 5D2VA 3K4WA 3DHDA 4HYWA 1W31A 1KFLA 3VMOA 3TNBA 1U1UA 1OFAA 2OVLA 3RR1A 4JIPA 3WLJA 5A95A 2R1KA 1PYFA 3W1XA 2IKIA 3DN5A 2OLAA 1MI3A 2PUZA 4HMDA 3AZRA 1NELA 1B5TA 4GC4A 2V5KA 3UPBA 1P4CA 2IUZA 4UTUA 3AALA 2Z28A 3F4DA 2DSWA 1TREA 1EC9A 3W7EA 5CBBA 4ATLA 1SQ7A 5A3HA 4GZJA 1WDWA 2SFPA 1H1NA 4BS0A 4D6HA 1BYBA 1XLBA 4PFMA 3SUWA 5I3JA 2ISVA 1H51A 3ARXA 5IOBA 1W3TA 3V5FA 3TN5A 1EUNA 4MUZA 3ATYA 2GJRA 3SW6A 3S1XA 3H26A 4IQLA 3ABZA 5F2GA 2GWGA 1WDPA 1D3HA 1QI3A 3FNDA 1G4TA 1XINA 1LLZA 3U2ZA 3S2MA 3VNLA 1U5HA 5EBUA 2A6LA 2XFYA 1DQWA 4CCZA 5HXMA 1EL3A 4DZ5A 3UR5A 2FB3A 3QZEA 4IGHA 1K02A 1H2JA 2C1GA 1CGWA 3RLHA 3FW6A 1B1YA 4AVNA 3SI9A 2BHYA 3AU6A 2CLIA 1M53A 2BY1A 2EPMX 4HSOA 4V27A 3OZYA 1U22A 4DJFD 2QJJA 1C93A 1AW2A 5I79A 4OBTA 2BY0A 1THFD 2BGNE 4MVAA 4M24A 1L8PA 3UZZA 2HNEA 3TMQA 5A8QA 3CK5A 4HHMA 2DSUA 1MWOA 3CS2A 2NX9A 4Z2JA 4W7WA 2GUYA 2YIHA 4TU1A 3W71A 1JYWA 4AH7A 5LGXA 5C9UA 3LHVA 2JF7A 4G1KA 1GKQA 4A3UA 1GVEA 3LBCA 4B92A 3WSUA 1ZAIA 3BMVA 2DSZA 1HP4A 4UTJA 1UB3A 1DJHA 3W82A 3VD4A 5AHLA 3YPIA 3SUUA 5I2UA 4XZ9A 3FA5A 4O8RA 1LTDA 1AJ0A 2QCMA 2C3ZA 4D6FA 1M41A 4DBEA 2O7QA 3UYIA 3UFYA 3FX4A 3UGVA 1BYDA 4A3HA 3H8AA 4G2DA 4O18A 4L1WA 2GGJA 2DZXA 3LRKA 1XI3A 5EMLA 2X41A 1HKMA 2EPNA 1FHDA 2GGIA 3BUVA 3KS6A 1CGTA 1W6TA 4H83A 1XLGA 2FZ9A 4KF1A 4PCFA 1EZWA 2CEQA 2P8BA 3RLUA 3WNMA 1UA7A 4GLEA 4JL2A 2A0NA 4N6EA 4ZQPA 3VIJA 3RHGA 3KVJA 2CHNA 3VCRA 4XD6A 1VLIA 5A8MA 2INZA 2WNWA 5F2IA 4LVFA 1Z6KA 2DZAA 1K1DA 3ZR5A 1F73A 4ZL1A 4JFSA 4MAVA 1I2OA 2HE8A 1K4GA 4GQQA 4S3CA 1US0A 3R6IA 1H7OA 3WEMA 3QW4B 3T2OA 1VQTA 2JBMA 2REQB 1FWRA 1ZPTA 1VF8A 3B4YA 4CQAA 5A2CA 2Z2AA 3S2NA 1AL7A 5D2TA 4IUOA 4M19A 5CLWA 4MB3A 3R25A 3M46A 2XIBA 4BQ5A 4HSHA 5D05A 3BOLA 3H7VA 3PBGA 4DIAA 4CUCA 4DJEA 1J11A 3NQMA 1VEPA 1ELSA 1EEPA 1VFFA 1DJXA 4S3AA 1GYMA 3N11A 3T78A 1Q6EA 2DH2A 1MXDA 4AX6A 3TTOA 1OX4B 2J7DA 3JZEA 2B31A 2PA6A 1W32A 1NWRA 1G94A 3W02A 2ZZ5A 4ZEPA 1K03A 2QV4A 3N9SA 4C7GA 2H3DA 2C6QA 4HZMA 4YHEA 3IEBA 4DWSB 2OO6A 2QS8A 5JH1A 2VEKA 1OF8A 2INEA 4LANA 1FHVA 3FOKA 4I9MA 1VC4A 4R9XA 3E2SA 3KXQA 4ZCWA 2J6VA 2QEZA 3MANA 4X0VA 2XGBA 4ZXOA 2GZXA 4LBUA 1XLEA 2EJ1A 3W86A 4X3ZA 1A0CA 5AYYA 4OHQA 4X63A 3B0UX 2R1PA 5L9FA 1C9WA 1SFJA 1PV8A 1JCJA 2J8TA 3BJFA 3ARYA 1WO2A 2ZE3A 1A5CA 4NG3A 1RALA 3KX6A 2NLYA 3H53A 4PMQA 2VC9A 2Y61A 3LPFA 5FF2A 1AH4A 3GDBA 4Y2WA 3SY1A 4POCA 3AIVA 4CNSA 5AY7A 1NOUA 1ZBWA 7PTDA 2F7FA 2GSJA 3RCNA 3HZ3A 3C2OA 5E0FA 4J3ZA 4X9YA 1OFEA 1HKIA 2OT0A 4XZNX 4D8AA 3W72A 3TU9A 1BXNA 4MKVA 4YU1A 3CUXA 5D2YA 1F6PA 4R33A 3IJ6A 4BF5A 3TYDA 1G4EA 2CZVA 4X0NA 4Z0JA 1TA3B 4XAPA 3N2OA 3NYDA 2DIJA 5I23A 5C55A 2CERA 3AOFA 1MSSA 4DY1A 1H7PA 2MANA 2QF7A 4NXSA 5LNVA 2Q09A 2QGHA 4XBKA 1ZSXA 1VFUA 3FCPA 4JN6A 4JIRA 4LQ1A 1T96A 3GZ3A 4R53A 4D6GA 3W2JA 2XJ7A 3GK0A 1B3XA 3MSRA 1LM1A 4HD5A 3WX7A 3VUSA 4D9PA 2VTFA 1P1MA 1TTQA 3E74A 1MUWA 1JUBA 2JFEX 3BAIA 4W7VA 4FF7A 1MVYA 1A5NC 2O9RA 2RKXA 4FLSA 4JTQA 4WKAA 2PDGA 2CCRA 3LI0A 1Y0EA 3IJ7A 3EDKA 2ZRUA 3AXXA 1D7FA 3NWRA 2GDQA 2YCLB 3QC3A 4CVUA 3IIOA 1JDDA 1PTGA 2ZOXA 4LB4A 4IFOA 4PMZA 3RCYA 1U33A 1QK2A 4TX9A 4Q7IA 3U4FA 4IPNB 4FAMA 2D2GA 1F3WA 1GONA 4QJ1A 3IPWA 3KTSA 3QLLA 4ZVJA 1PX3A 1T40A 2X42A 3BG9A 3HOJA 3L67A 1CGVA 3WH9A 5SWUA 4NAFA 1REQA 4XAYA 1UH3A 2VZOA 1M7PA 1V4YA 4GI4A 3WUBA 1YPFA 2PLMA 4RW3A 2AGTA 4JHZA 2QDEA 2Y8UA 2V0TA 2ZXQA 2YJQA 4IL2A 3W2LA 4LNYA 2J79A 3ZMRA 1MNZA 5C7VA 4TTUA 1M03A 1UA3A 4WGXA 2G8ZA 3LCXA 4PTWA 4NI8A 4O1FA 4QGCA 3WBAA 2B0MA 3W24A 2BNJA 1R3YA 3HQPA 5DMMA 4UQBA 3DFTA 4KETA 1D9EA 3TYCA 3WJXA 1CPUA 1OFDA 4OV4A 2DJLA 4JNZA 1XRTA 3KRSA 5FA5A 2WZEA 6REQB 4H9TA 4O19A 5ABEA 3LCIA 2A3EA 1TQJA 3GG8A 3OA3A 1PCKA 4XG1A 4YHGA 1X1ZA 4UTHA 5A6LA 3QFEA 4BEUA 4IISA 2CWNA 1K6AA 3ZS4A 1KFWA 4RZ6A 1UKSA 3EWCA 4TV6A 3B8DA 3VD7A 3K1GA 4IWWA 2X16A 3VIFA 4QDMA 1M5WA 2BVDA 4NNAA 3CT2A 2EBNA 5K4XA 4MM1A 2NWRA 4IMAA 2J7HA 1JZ2A 4AD3A 2VVSA 3EKLA 3H2MA 4L6DA 2BOGX 1JF5A 3A4AA 4G1NA 1TYGA 2R91A 2PRMA 5A6AA 3FAWA 3M5VA 2PDMA 4UTTC 4ZB0A 3ZJ7A 4AY7A 2CLLA 1VKFA 3WL0A 4UTIA 1HG3A 1M7XA 3B0YA 4WHBA 4C6JA 2BMBA 4L9ZA 1GGOA 5BNKA 1RUSA 1Z41A 5DQPA 1QHPA 3QGVA 4B5TA 1XSIA 3TYAA 2OCZA 2OXNA 3DI1A 4UFJA 1JF6A 4J3VA 4CD7A 3VGFA 5AC8A 3E96A 1LBLA 3CHCA 2PWDA 4AMAA 2YA2A 2E9MA 3EGJA 2DH3A 1XSJA 3BOXA 3EPNA 3NEVA 3F5JA 1FDJA 3A12A 2HVNA 1OGBA 5DELA 3PPCA 4FX7A 2ADAA 2VDGA 2YYTA 3WDJA 5T8GA 1FUYA 1T99A 3KEHA 3ARRA 4KWUA 1VJIA 4HBKA 4HJFA 2WMFA 3N29A 4FLOA 2PGWA 4BF7A 5FOOA 3VNDA 3NVDA 4YL2A 3KBWA 3E0FA 2YBTA 4QHRA 1ONRA 4B5UA 4M5PA 3P61A 1EIXA 1L6FA 2Z1WA 1UH2A 4LSBA 4K2SA 4PTMA 5BMWA 3PSVA 1B4EA 3H2NA 4REQA 1OB0A 3VTRA 1POKA 4Q6XA 2OLSA 2CLHA 1CCWB 3B9DA 3LZ3A 3CV2A 1G5AA 3TLLA 4LF1A 1UWRA 4JQ3A 4FNTA 1TO3A 3T0BA 1DTUA 3L66A 5BWFA 3GVVA 2PTYA 1M1BA 3RITA 5BWAA 2XFRA 4ROQA 2VVNA 3VU2A 1V3IA 3TTQA 1T8XA 1W3NA 1Q63A 2J4GA 4G7EA 2POTA 4MZ8A 3T44A 2R1MA 4AD5A 4PEEA 3W7CA 4KMQA 2CXEA 4FMVA 1GCYA 4Y9OA 1TFVA 4NJIA 4ACZA 2HK0A 3BLEA 4A29A 1XV8A 3R43A 1DKWA 3OZOA 1A80A 3FVDA 1F3XA 1F4HA 4TV5A 4JTKA 4Z0SA 5CPMA 2H3BA 4Q22A 2PU0A 1SMDA 3AMDA 4IJCA 4Q7NA 3IJLA 3R12A 2BOFX 3NG3A 3W2MA 5HOSA 2VFGA 3GO2A 2Y89A 3MDUA 1EP1A 3E6EA 4RLIA 1FWBC 1GOWA 2VT0A 4H41A 3FIGA 1XIJA 4KRUA 4WDTA 2ZUMA 3QEZA 4FI4A 2KX9A 1OFOA 2VOTA 1OYAA 4XZLX 2ZA2A 1P1XA 4O28A 1VFMA 2A3BA 4DBUA 4XD3A 3QVQA 3SUTA 4XTIA 2PP0A 2P50A 3A9BA 3I3EA 1VBRA 2X05A 4IP5A 5AB3A 3K1DA 4DPQA 3GIPA 3OQEA 4PTVA 3L21A 3WFLA 1R85A 2PD5A 3EOLA 1E15A 3C6CA 1SFLA 2CWXA 1OG6A 4DJED 1TG7A 4R88A 4PBGA 4J2MA 2BOEX 2VUYA 2OZ8A 3BAYA 2V2HA 3WUGA 3EA1A 2WXDM 3SN4A 1EGVA 2WSYA 4E38A 3LBOA 3VCCA 5I3KA 1TJ2A 3ZSSA 2XUCA 3QTGA 3GTHA 4KCVA 1XQKA 3WEOA 1SW0A 2P10A 5KTLA 3M0MA 1AUSL 1QW8A 1IXOA 2PDNA 4NQ1A 1ISYA 1OG0A 2ZX6A 1ITUA 3PZQA 4UOQA 1C8VA 1DL3A 3J7HA 4WUIA 5JU6A 1WDRA 3LTYA 3M0LA 2G97A 5C5YA 3CLWA 1QNRA 2Y7EA 2HPIA 1V77A 1TVPA 5LIUX 4S3FA 4O1BA 3W7OA 1E6QM 7XIMA 4LX4A 3HGRA 5TAOA 3BQ5A 1B3OA 1PUDA 1P0DA 1GVOA 4ATWA 4QR6A 4UCGA 1IGWA 3S47A 1WV2A 5DRCA 3KHDA 2XH0A