3VPLA

Crystal structure of a 2-fluoroxylotriosyl complex of the vibrio sp. ax-4 beta-1,3-xylanase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-xylanase XYL4
publication title The crystal structure of a 2-fluoroxylotriosyl complex of the Vibrio sp. AX-4 beta-1,3-xylanase at 1.2 A resolution
rcsb
source organism Vibrio
molecule tags Hydrolase
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vplA00
1QVBA 4FLRA 3VO0A 4CN4A 3IJ7A 5HOSA 1CXIA 3ARYA 1QHZA 2D3LA 2DDXA 5HDRA 4J3TA 1KR0A 2EBNA 3BSHA 3WH7A 4XZWA 2QPSA 2UY4A 1PX8A 4GZJA 1KXTA 1VRXA 2XGIA 1CLXA 1ODZA 2BVTA 3QGVA 1C8XA 3M07A 3M46A 1W3KA 2EPLX 4QAWA 2WSKA 3GNRA 4AYSA 1OCQA 4YHEA 1RP9A 1KGWA 1CGVA 4QFUA 3WFZA 1P6WA 3WNMA 3MUZ1 4WF7A 1PZ2A 2DSKA 1H49A 2VRJA 4D72A 5JUVA 3AHYA 2DH3A 3T2OA 3WNKA 2VURA 2VRQA 3PZOA 2UY5A 4MB5A 1B2YA 1LL4A 4HOWA 1K9FA 3AFBA 4DWSD 1WZAA 4UCFA 3RIKA 3IK2A 2D1ZA 3W25A 3WMSA 1OINA 3CZEA 3WQ4A 1YQ2A 1V08A 1BSIA 2D22A 1QNRA 4BQ4A 3B9AA 3LPPA 4PBGA 3ZIZA 4AZCB 1Q6GA 2CPUA 2YLAA 3WD4A 1A47A 4CU8A 5A8QA 3GXMA 1GOIA 3W4RA 1KFWA 3VIMA 4R5EA 1BAGA 3VIJA 1H11A 3SCNA 4TOQA 2E3ZA 1MW2A 2DQXA 4H8VA 5C70A 2YL5A 2ZWZA 1BYDA 3K1DA 1B1YA 4M8UA 3EMCA 3VGDA 5HNNA 3VINA 3QHOA 4B3LA 5CLTA 5DT7A 3GBEA 4HP5A 4WSKA 3ZR5A 2PBOA 4U31A 1EOKA 1I1XA 1JI1A 1H41A 2RGMA 3VX0A 4UFIA 3BAJA 2GDUA 2XVLA 2W91A 1NQ6A 2EO7A 4C7GA 2J62A 2WBKA 2GK1B 1CEOA 3WD3A 3FAXA 5FIPA 1OSEA 1E71M 4CU6A 1E6SM 2WYSA 3EDEA 1UD6A 5A8OA 1PX3A 3OLEA 2W66A 2WM0A 1UKSA 3UG4A 5A95A 2NT1A 4UFKA 2J47A 4AD0A 1E15A 3PZ9A 2JALA 1HKJA 3BAYA 1YHTA 1E72M 4CCDA 1EIBA 1RP8A 4HU0A 4W86A 3HMCA 4ATWA 2QF8A 1JZ3A 3U5UA 7TAAA 1DP0A 2D3NA 4DUVA 1K9DA 4LYQA 1K6AA 3UG5A 2XIBA 4QCFA 4ACZB 5LA2A 2G3MA 5JIPA 2JEPA 3AZRA 1CPUA 1ZJAA 2PWGA 3K4AA 5A69A 5KZ6A 1VFOA 3WL1A 1V3JA 3LMYA 2OWWA 2WNWA 1HF6A 2IXVA 4AD3A 1E6ZA 1C8QA 3AZSA 4W7UA 3RO8A 4GIAA 2WVSA 4Z2KA 2IXUA 3RCNA 3O6AA 3MV01 1E3ZA 2WHJA 5BCAA 1UWRA 4HU8A 2QV4A 2WHMA 3BSGA 3B8SA 2WC3A 4PMUA 1GUVA 1ESWA 1KBKA 3AIUA 5M17A 4UTFA 4W89A 1JZ5A 5HBFA 4U3AA 2JIEA 4L4PA 1ISZA 3GXIA 4HZ8A 5CPQA 1JXJA 4GKLA 2V3GA 2V5DA 1AQMA 3MUAA 3SUWA 1HJSA 1V0MA 1XC6A 1FA2A 1D7FA 1UD5A 1FHDA 4X9YA 3DYPA 2CETA 2XJ7A 1B30A 1EGZA 1BG9A 1M01A 3BCFA 3VD3A 4U3CA 3ALFA 3CUFA 3WH9A 1NARA 3ECQA 2DIJA 2QLYA 2WK2A 4MAVA 4AIEA 1X6LA 5C8BB 1HX0A 1XD1A 1HKIA 1WCGA 4MAZA 3AISA 3QR3A 4D6GA 3VIKA 2GJXA 4B16A 1V02A 4GZIA 2W92A 4TVDA 5IXEA 3CMGA 3CUIA 3M7SA 4M80A 4JFWA 3WQWA 4JKLA 2VC9A 1AQHA 3ZJ8A 3A4XA 1B3VA 1E6RA 1G0CA 5BWFA 2GDVA 2NSXA 3BLKA 4UQEA 4AZBA 4PTVA 3WH6A 4UR9A 1DHKA 2VX5A 3L4UA 1TG7A 3AIQA 3T08A 4MB1A 3EDDA 2ZUNA 2J7HA 2DIEA 5I78A 2OYKA 3II1A 2C7FA 1ECEA 1QHOA 4GINA 4DM2A 4B9YA 1TVNA 3QHMA 1EH9A 3AIEA 4JFTA 2DT0A 4GI9A 3NSXA 4PMYA 3GXFA 1JIBA 4F8XA 1ZBKA 2A3CA 4MADA 5ABFB 4D6EA 3QHNA 1HL8A 1UKTA 5D8WA 1V3LA 1LQ0A 1QNOA 2WKLA 2CHNA 1EQPA 4RE4A 4KRUA 1TR1A 3WDIA 2WSPA 1VB9A 1Q6EA 2YL6A 2PWDA 2XHYA 4QLKA 1MVYA 5A94A 1WDPA 2YKKA 3AHVA 4PCSA 2YDSA 3PHAA 1UQYA 4MB4A 5ABGA 3NUKA 3D3AA 4AZHA 3WH8A 5ABHA 4Z2GA 4RE3A 4P8UA 1ISYA 5A6KA 1C92A 3WENA 5TD4A 4OZOA 1I1WA 1UH2A 1AMYA 3AYRA 5D9MA 5CSUA 1MQQA 1J12A 4D6JA 2WBGA 1B9ZA 2BV9A 2E40A 5CQ1A 4D6HA 1QW9A 1EO7A 1CXEA 1UWTA 3SUTA 1U30A 2VVNA 2OLHA 5IHSA 1QW8A 3K8MA 3O2LA 2DPEA 3VDCA 3L4TA 4AZCA 3AS2A 4A3YA 1Q6CA 1W9DM 4BZYA 3N12A 3BAWA 3AZTA 4GO8A 1E4NA 2WXDM 5EB8A 1L8NA 1XRVA 1JG9A 3AOFA 4MJ2A 4ZEPA 1NOUA 3T0DA 3F5LA 2V5CA 4WSJA 4EAMA 2VMFA 4CVUA 3RM9A 3OG2A 2VNCA 4D6FA 3W6MA 3ZQ9A 1TA3B 4U5KA 2XSAA 2J78A 3IJ8A 4W8AA 4Q7NA 1BGGA 2BY0A 3WDJA 4IISA 4LPCA 4F9JA 4KH2A 2QMKA 1LJYA 1UKQA 3CTTA 2DEPA 4MDOA 3ZT7A 3WSUA 4B3KA 1GOKA 3AMCA 4FF5A 3ZT5A 2G4FA 1W9VA 1ITXA 1BTCA 5I6SA 1E6PA 5HPCA 5GNZA 2VX6A 2DT2A 3VX1A 2IUZA 1MWOA 1JFXA 2GK1A 4RE2A 2VOTA 1XSJA 5A2CA 5A8NA 2OSWA 3WUGA 1UD4A 5GNYA 2VRKA 3WMBA 1S46A 1HJVA 4ZXOA 3RM4A 3FN9A 2E0PA 2AOSA 2XM1A 1W3HA 3ARSA 2RGLA 5CLWA 2WLYA 1BLIA 3VNYA 3AIWA 4JAWA 3B9EA 3VU2A 4GPNA 4Z2JA 4W88A 3W29A 4AD1A 2BY1A 2CIPA 1HL9A 3N18A 2Y5EA 3RPMA 1KXHA 1M03A 2WANA 1OBAA 3ZJ7A 1UD2A 3L4VA 1WZMA 5EFDA 2FH8A 4AC1X 3WBEA 5HXMA 4JHOA 1C93A 1O6IA 6TAAA 1CDGA 1TCMA 1XCXA 1H09A 3TA9A 3L4ZA 3N13A 3VIGA 2FDMA 3PZGA 5BXTA 1UA7A 4TUFA 3VD9A 2CNCA 4M56A 1G1YA 3F5KA 1HXJA 4HPGA 2J7GA 2D0HA 5FCZA 4V2XA 2YIHA 1GNXA 1WZLA 3G6LA 4AZ6A 2J75A 2YOCA 1IV8A 4XV0A 2YLLA 3MSDA 1E1FA 3W24A 4JFUA 2BHZA 3ALGA 1CTNA 1I75A 3GNOA 1CIUA 1MW1A 5FL0A 4B9ZA 1CENA 3T0AA 4IPNB 2EPKX 4AZGA 2CBJA 1DWJM 5CXPA 3ZJKA 3DHUA 1KWGA 4AEFA 4H8HA 3SCWA 3AYSA 5IDIA 1W9PA 4URIA 1E56A 1CXLA 3SUVA 1GW1A 4HTYA 3WDRA 3EDJA 1W91A 4Q22A 3N1AA 5M3WA 4Z2HA 2W62A 2ZXBA 5IFPA 4QP0A 3NYDA 1RH9A 3FY1A 4P7LA 1GOOA 2WWDA 3VM5A 1XCWA 4CUCA 5D8ZA 4ZE5A 2WCAA 3VD4A 4V28A 3VNZA 3VGBA 4ATDA 4D6DA 3L2MA 1A3HA 1GORA 1JXKA 1LG1A 4PSPA 2WMFA 4PTMA 4CD7A 4CGTA 3KL3A 4UQ9A 4UQBA 3GDBA 4CVWA 3ZOAA 2CITA 3SCVA 4KMQA 4CCCA 2D0FA 1UR1A 4M82A 1LLOA 1E4MM 1ZB5A 5EFFA 1XHGA 1DWFM 1PAMA 4PMOA 1U2YA 1B3XA 4F9DA 2BXYA 3GXDA 4PRWA 2J7EA 4MJ4A 1KGUA 2ZUSA 2E9MA 2WHLA 2X05A 5LA0A 1E43A 1E3XA 4PSRA 2HVMA 1VFUA 3PBGA 4UQAA 3I3BA 1KB3A 5A3HA 5CPSA 5I23A 3GH7A 3GM8A 5ABFA 3T09A 3VMOA 1QBBA 1XV8A 2FHFA 2WC7A 2YL8A 3U5YA 2OSYA 1CNVA 1HVQA 1BF2A 3WIJA 2W4XA 3CO4A 1HJUA 1CBGA 4NSBA 4V27A 1B3YA 1CYGA 1M04A 4EKJA 1MXGA 1V6VA 1UWUA 3EDFA 1SMDA 1E4LA 5DFAA 1Q4NX 1OD8A 3VGFA 5E9AA 4DWSC 2EQDA 2WMJA 1LG2A 3VMNA 1C8YA 3WF0A 2J8FA 4BF7A 2NW0A 3WEOA 2V38A 2WW5A 1CXHA 1V6YA 1WZKA 3N17A 1GHSA 4TTGA 3WF3A 2WCSA 4PMQA 4KWUA 1R7AA 2UWFA 1GQIA 1E0VA 2J7BA 2J4GA 1NM9A 3N15A 4J27A 1WKYA 3WNLA 4NRRA 2BXZA 3TOPA 2WMGA 4HPHA 4DM1A 4JHZA 3CZ8A 1RD6A 1MFVA 4UOZA 1W1TA 1SR0A 1GQKA 5GQBA 4IUGA 4KGLA 2DT1A 2E9BA 3S6TA 3WQ8A 2XUCA 4ZFMA 1BQCA 2ZWYA 3OIHA 3AJ7A 1M7XA 3VM7A 3AXXA 4ZE4A 1X1NA 1JI2A 1GZJA 2ESCA 2UY2A 1PEZA 1MW0A 3FW6A 3WELA 1UWQA 3FHQA 2BVDA 2ZE0A 2XTKA 1HP4A 3MSGA 4OKDA 1VFFA 1TA3A 3MMWA 4LGXA 4FLOA 5HPOA 2OYLA 1OGGA 1QI3A 1EDTA 1ZJBA 2O92A 4HA1A 3W53A 3WEZA 2CXGA 1DTUA 3CH9A 1MFUA 4UOJA 4W7WA 3SCUA 1V3HA 1UKOA 2C8NA 3T0BA 3BCDA 5E0CA 4ATLA 1Y7VA 2XVGA 3FNDA 4E8DA 1UZ1A 2WMIB 1SMAA 1VEMA 1EQCA 3VDAA 1EOMA 5CGMA 3DHPA 3BGAA 5A6LA 3RILA 1C7TA 3SUUA 1LWJA 1E0XA 2MANA 4A4AA 1QNPA 1CGTA 2Y8KA 4QDMA 4MB3A 3AS0A 1KGXA 1WNOA 3UR7A 1HT6A 3CBWA 1JZ2A 1UZ4A 1VIWA 3POHA 3E1F1 3VTRA 2O9PA 1NWUA 1GJWA 4U5IA 5F7UA 4CKQA 5M03A 3KE0A 4HOZA 3QOMA 3A3HA 1ODUA 4P8VA 5C71A 1VFMA 4U33A 1XSKA 2TAAA 4DWSA 1XSIA 3BLPX 1ITCA 2JF6A 5E6YA 1ZL1A 2XG9A 1BYCA 3NSMA 3NCOA 2VTFA 3BMWA 1GONA 1XYZA 5I0DA 2CYGA 1L0PA 1WDQA 4PMXA 1BGAA 1D2KA 1JGIA 8A3HA 1EDQA 1E0WA 3AXIA 1JF6A 5EMYA 3RMEA 3WFLA 1W9XA 4AZIA 3OLIA 1PIFA 1V0KA 1XH1A 5E6ZA 3RM8A 3AMGA 5E70A 2Y4SA 2G3JA 1BG4A 2YJQA 3W82A 1CGUA 3VMPA 2DSVA 3A4WA 3PZVA 4ML4A 1GQJA 1KR1A 1IT0A 5LA1A 3GH5A 2BHUA 3UETA 4JKKA 1CZ1A 1EHAA 5BXRA 2PWFA 1V03A 3F4VA 1JZ7A 2O9RA 5I2UA 2J8GA 3KL0A 2C0HA 2WPGA 4D1JA 1NOWA 2BY3A 2XSBA 3ZT6A 4AZ7A 4OJYA 1CXKA 3T2QA 4W8BA 2DSZA 4CN6A 1H2JA 4W87A 3VPLA 3WEMA 1Z32X 2PBGA 3TP4A 4M24A 1FFRA 1KCKA 1OD0A 2D24A 4X0NA 4W7VA 5CJ5A 3MU7A 2CERA 3KEHA 4WLCA 1UOKA 4FK9A 1C90A 3IJ9A 1H5VA 5GNXA 3WNNA 3SIMA 4C7DA 2D0GA 2EJ1A 3LPFA 4JFVA 4J7RA 2CKRA 1HKMA 3WD1A 4W93A 3CZGA 3O9NA 2Q8XA 5I5RA 4BQ2A 3ZSSA 1D3CA 3CPUA 1WDSA 3VIFA 2F8QA 1G01A 3CZKA 2JEQA 1JYNA 1WAWA 4PMDA 4H41A 3SCTA 1FOBA 3EBVA 4J3VA 5CPTA 1JDCA 1UWIA 1GPFA 1VF8A 4D6IA 1CLVA 4E4PA 4GQRA 2BVYA 3W28A 1HIZA 3AHTA 4OOUA 4UOQA 3PTKA 2W61A 1EXPA 1UR0A 1FP8A 4ACYA 4GI8A 1GHRA 1US2A 4CD8A 1E73M 4PYSA 4AD2A 1G94A 4OBSA 2BS9A 3WN6A 2JFEX 1GVYA 1X6NA 1R8LA 3WDPP 1E5NA 1DEDA 4MNMA 2DH2A 1U33A 2WMKA 4S3KA 3W38A 3MKKA 1MQRA 4MNLA 3BH4A 1E6QM 1QNQA 1NOFA 1TE1A 4AY1A 4TTUA 4Y7EA 1TMQA 5A6AA 4BCEA 4BQ5A 5D4YA 4Z2LA 3AI0A 4OIFA 4RL3A 1BYAA 1QPKA 2V3FA 3HU7A 2E9LA 2DGAA 2NT0A 1J0IA 2CEQA 4J3XA 2YDRA 3ARQA 1SYTA 3OA5A 1C91A 3G6MA 2VCBA 1BPLB 2YBTA 2FGLA 3AQUA 3GH4A 1BVZA 1KXVA 3WUFA 4AXNA 1CGXA 1W3JA 4D1IA 4N0RA 1E40A 2X0YA 1DWAM 1XH2A 3K8KA 4TVCA 3ZJ6A 1Q6DA 1V6XA 4WK9A 3OGRA 2VL4A 2DT3A 2VT0A 5IHRA 2WZEA 4WKFA 1HJQA 3VVGA 1ZS2A 1UH3A 5DT5A 2ZUVA 1HNYA 3PZIA 3UEQA 2QMJA 3NJ3A 3ARRA 3CHFA 4UQCA 3POCA 2WVTA 2GVYA 4U2YA 5A8PA 1ISWA 1QI4A 2VZUA 4ACZA 4BQ3A 8CGTA 4P7QA 3K4DA 3WNOA 5E0FA 3RDKA 4UFJA 1J0ZA 4UZSA 6A3HA 3AXHA 1MYRA 4GZEA 3VDBA 5FKYA 4JL2A 2XYLA 1W32A 1R85A 1G5AA 6CGTA 5A6BD 3CHEA 3W27A 4AISA 4CCEA 2ZXDA 1MQPA 1VJZA 1OIMA 5D9PA 4GQQA 5I24A 3OGVA 4H04A 1JZ8A 4AD4A 3WQVA 3WDQA 5JBEA 2WMIA 1R86A 2X8RA 4GO9A 2CBUA 3CZLA 1SFSA 3SCRA 3W6LA 2BY2A 2PB1A 1VBRA 3WNPA 3VILA 2WZIA 3BXWA 2VCAA 1NWSA 4HZ6A 2W67A 5I79A 3MMUA 2OWXA 5CG0A 2VI0A 2HISA 5A2AA 2VCCA 7CGTA 1V02E 1GVIA 4PUDA 3WF1A 5A6SA 2CHOA 3FHAA 1CXFA 3AS3A 4M81A 1V6UA 1UR2A 3WMCA 2XM2A 2ZUUA 4HZ7A 3W0KA 4J3SA 2G8ZA 3ARUA 3N9KA 3GTNA 4B15A 4PMVA 3LPOA 2WLZA 4CD4A 4JCLA 3WH5A 4J3UA 2O9TA 4IPLA 3N04A 3L4YA 1JNEA 4JCMA 5AC4A 2VR5A 3BMVA 1UR4A 1H0GA 3MUY1 1VAHA 4TX8A 3MO4A 2OYMA 1ISVA 1TUXA 2E8ZA 3B9DA 3AIBA 4FMVA 3ARZA 2W63A 3ARTA 4QLJA 1V3KA 3PN8A 3OLGA 1FH9A 2XVKA 1LF1A 3U7VA 4UFHA 4GI6A 4X0VA 3ZM8A 4LYRA 2GFTA 1F4AA 3WD0A 2CESA 2QPUA 4L4OA 4ZXLA 2CBIA 2YBUA 5M5DA 3DYOA 1HVXA 1FP9A 4LXFA 4P7OA 3SCOA 4P7NA 4AIUA 1TZ7A 1FHLA 4JL1A 1GOMA 2WB5A 2VQTA 3FAWA 2VZSA 1DWGM 4MNJA 2E8YA 3A6OA 1DWIM 5GPRA 5AY7A 3I3EA 4ZENA 1KQZA 3L2LA 5LYRA 4JZ5A 2V3DA 3BAIA 1HP5A 3GZAA 3HN3A 1UHVA 4JKMA 1R87A 2YA2A 1EO5A 3NDYA 1J0JA 1OB0A 4NF7A 4MPKA 3EYPA 3KL5A 2CBVA 2OSXA 1UR9A 3WF4A 3W81A 2WC4A 4HOXA 1LL6A 5JBDA 4OUEA 2WHKA 2A3HA 3AHXA 5AC5A 3MANA 4KRTA 3AMDA 5A6BA 5CSYA 3SCPA 5A8MA 4QLLA 3IANA 5DEZA 4NZCA 2Y8VA 1OT1A 4P8XA 3WY1A 4D71A 1OGBA 1UQZA 2PI6A 3VUPA 2BHYA 1JDDA 4TX6A 1CWYA 1RPKA 2WVVB 1N82A 1ZU8A 4BA0A 3UCQA 3JUGA 1CECA 2WZHA 4EE9A 4HMDA 5ABEA 4HMCA 1PIGA 4PCTA 3DECA 2J79A 1QOXA 1G9HA 4OOZA 4W5ZA 3IAQA 1Q6FA 4M29A 1VJSA 2GUYA 1XYFA 1VENA 2D23A 4F79A 4JIEA 3QOKA 1GOWA 3SCQA 1JZ4A 2XFYA 1J0HA 3EDKA 4H2CA 1XD0A 4F66A 3TTSA 4E2OA 3CIVA 3WUBA 3ZR6A 3F5JA 2ZX8A 4PMNA 1MXDA 1OM0A 1J0YA 4W5UA 4UNIA 1UWSA 4PUEA 2ZICA 1EDGA 1MW3A 2EXOA 1PJ9A 3A47A 1V3IA 2PWHA 4UQDA 3AROA 3DC0A 1ZBVA 1HJXA 4N42A 4XUYA 5AYBA 1V0NA 2YA0A 3SUSA 3VD7A 2ZX6A 1E6XM 1WB0A 2WCGA 1JYXA 2XWDA 1NWRA 4CN1A 1ZBCA 3CLWA 3NSNA 4LYPA 2DSWA 1F4HA 1FFQA 1UA3A 2G3NA 3ARXA 2X09A 4S3JA 1UH4A 4CD6A 5A2BA 2VR4A 1TVPA 1R7OA 3L4WA 4WKAA 3FXYA 1UD8A 2EEXA 1UKPA 2ZIDA 3KWXA 2GJRA 4AWEA 5BRPA 2XPKA 1EA9C 1GQLA 1VEPA 2VZVA 2X0HA 3ARVA 1NP0A 4EANA 3CUJA 3AMLA 5BXPA 1B31A 2OWCA 5CZKA 5FL1A 1W1YA 3LPGA 3U7BA 1W2PA 3L4XA 3VGGA 4P8WA 4D6CA 3PZUA 1VBUA 2ZX9A 3J7HA 3ARWA 1K9EA 4DUWA 2A3EA 4MTVA 3MV11 3EMQA 3OB8A 3UR8A 4EK7A 4AZ5A 4LQ1A 5EBAA 1W2VA 4AMCA 1FH7A 4AIOA 1LL7A 3PTMA 1E55A 2QHAA 3PTQA 7A3HA 3GNPA 1B0IA 2Y24A 5D9NA 1K9TA 2VX4A 1JYWA 3AICA 1UYQA 4QCEA 1V3MA 1JNDA 1J9YA 1QNSA 2JE8A 2VZOA 3S2CA 1JD7A 2VX7A 3SEPA 3WD2A 4AW7A 2XIIA 3W26A 1PZ3A 2J77A 2WVUA 5IFTA 2W5FA 3BC9A 1E5JA 1HKKA 2G3IA 1J01A 4K68A 3APGA 1UD3A 1QI0A 4PTWA 2FH6A 5DMYA 4YN5A 2AAAA 3M6DA 3OGSA 4PTXA 1IZJA 2JIWA 1E9LA 1HN1A 2J7DA 1QHPA 5A1AA 2J7FA 4PEEA 4R27A 5D9OA 2FGZA 3EMZA 1M53A 3SURA 3I3DA 1W9BM 1E4IA 5JIWA 3VDHA 3VKKA 2D20A 1B3WA 3WBAA 1W1VA 4BS0A 5I3DA 5A6JA 1W3LA 4CD5A 1J18A 4AD5A 4FLQA 3AIVA 3GBDA 3CZJA 4NRSA 1JF5A 1TFVA 3CHDA 4WJXA 3NIYA 3PZTA 3UG3A 1JL8A 1PX4A 1VEOA 2O9OA 1V0LA 4NI3A 2WWCA 1JD9A 1JFHA 3OLDA 2D2OA 2A3AA 1EHNA 3D5HA 1O7AA 3ZSTA 4TVUA 5BROA 3AMKA 1OWQA 1OT2A 1WP6A 4HA3A 3AS1A 3KZSA 4WKHA 3WQ5A 4JFSA 3U57A 4W85A 5DO8A 5ECUA 1JAEA 3N11A 1GCYA 1H3GA 2F61A 3TONA 3VGEA 5JBFA 3T2PA 1J10A 3CUHA 3WKZA 3PZQA 4DUXA 2ZOXA 2EPOA 1LWHA 1XH0A 2CKSA 5AYIA 1XGZA 5BRQA 1ISXA 1C7SA 1C3FA 2Z1KA 5KEZA 1UG6A 1WO2A 3GYCA 4Z2IA 1E1EA 2ZX5A 2FHBA 1H0IA 3UERA 2YDQA 2J74A 2ZX7A 4P7RA 1J0KA 4XZBA 3VIHA 1NWTA 3CMJA 1CGWA 2JF7A 1W1PA 2YL9A 3K46A 2F2HA 3MUIA 4MDPA 3VIOA 2VO5A 3AIRA 4FLSA 4UFMA 3NDZA 5BXSA 2UY3A 2YA1A 4J28A 3AHZA 3K8LA 3WUEA 3HJEA 1WPCA 1KWKA 3IAPA 3CHCA 3WQ6A 1PPIA 2WAGA 2WVVA 3ARPA 1KBBA 3PZNA 4W8LA 3CUGA 2XWEA 4HA4A 4A3HA 2ZUMA 4CU7A 1NH6A 3DYMA 2Z1SA 2PWEA 3VIIA 3W37A 2ZUTA 1JZ6A 3MMDA 1CGYA 2AMGA 1B90A 4C7FA 4H8UA 5CGTA 1J11A 5A6MA 1FH8A 1IZKA 4OBRA 3VD5A 2GJPA 3RJYA 1HJWA 1E70M 2PF0A 3OBAA 3PZMA 1BFNA 1GOQA 4M1RA 3TTQA 1PBGA 3BAXA 1JDAA 1BVNP 4E8CA 3MS8A 1DWHM 1US3A 2A3BA 1WE5A 3WL0A 1UUQA 5DF0A 2Y2WA 1B3ZA 3VOCA 4LX4A 1QI2A 2X2YA 3WF2A 1KXQA 1UR8A 5E09A 1ZBWA 2VVSA 4DWSB 4W84A 1QI5A 2XFFA 2FHCA 3OZOA 1GJUA 2VZTA 3OZPA 5FD0A 4YPJA 3VIPA 3BAKA 4PMZA 3UESA 2XVNA 2ZXQA 5I77A 3TTOA 2GJXB 4H7VA 4YHGA 3VGHA 3RJXA 3WDHA 1OGSA 1V6WA 4PN2A 1H4PA 1KQYA 1JAKA 4J3WA 1AQ0A 2VUYA 2XGBA 4IM4A 2XFRA 1JYVA 1OIFA 2BNJA 1W9UA 9CGTA 1WDRA 2EPMX 3CGTA 3ZMRA 2DSUA 4KGJA 2CCRA 3SCSA 2ZXAA 5FOOA 1BHGA 2G41A 2WMHA 2VJXA 4TXEA 3A4AA 1E6NA 2WKGA 3TTYA 1KCLA 4GXPA 2V3EA 2B31A 2ZUWA 2X1IA 2XVPA 1QBAA 1NP2A 4HMEA 3THCA 1BYBA 1AVAA 2BFGA 4MNKA 4U2ZA 2J7CA 3THDA 4UZUA 4AEEA 2VQUA 4XX6A 2EPNA 1H1NA 4XB3A 4UFLA 2E4TA 2PC8A 4WIWA 5BYWA 3ZO9A 2J25A 2GSJA 4PMRA
chains in the Genus database with same CATH superfamily
1DE6A 2B81A 4GQGA 3QPEA 4CN4A 1CXIA 2Y0FA 2D3LA 5FA5A 1H7RA 2DDXA 3A4JA 2ZRUA 5HDRA 5I03A 4ZL1A 1X38A 3MCOA 4QJ1A 1PX8A 1KXTA 1Y0EA 2RDWA 4RV3A 1QW7A 2XIJA 3QGVA 1W3KA 4Z0SA 2FYMA 1W17A 3TR2A 4YHEA 1ZAHA 3JS3A 2VEGA 1CGVA 1VHNA 4QFUA 3MUZ1 5BW6A 3U2ZA 5JUVA 2P50A 3NZ1A 2VURA 1J5TA 2VRQA 3PZOA 2UY5A 3DFHA 1AH0A 4MB5A 3NDOA 1EX5A 4IPIA 4ZO6A 2DY3A 4XWUA 3RIKA 3KLKA 3WMSA 4G7EA 1AD1A 3WQ4A 1BSIA 1SFJA 3KRBA 5LHEA 3L23A 4KIRA 1E0TA 3WD4A 5A8QA 4UTUA 3GXMA 2J9YA 3W4RA 1KFWA 1MXSA 3AU2A 4R5EA 1H11A 4TOQA 2O4QA 2J88A 2F84A 1MW2A 4H8VA 5HMEA 2PDHA 4PL2A 3TYUA 1EGMA 4H6RA 4Q8QA 1FWRA 4E2BA 5EGRA 5CLTA 3GBEA 4WSKA 4EIVA 3CS2A 4U31A 4RDVA 3S1GA 2QYGA 3IIZA 3QKEA 4S3GA 1H41A 1NELA 3O15A 1EEXA 3PR2A 2J62A 3I4KA 2WBKA 1CEOA 3OPSA 3O63A 2EKCA 5FIPA 5I09A 4MJZA 1PX3A 3IPWA 3OLEA 3UT0A 2NT1A 2J47A 3PZ9A 4I7VA 1YHTA 1E72M 1YLVA 3C2YA 1A5AA 1QNVA 5C9ZA 3QQ1A 2CLEA 4F0RA 4ROQA 1X8CA 3CAWA 4L1XA 4JDYA 4HU0A 4ZO8A 1UIOA 3R8GA 2RH9A 1DP0A 2D3NA 4PA8A 4LYKA 3SY5A 2ZRYA 1K6AA 2XIBA 3IJIA 5KZMA 4GKTA 1XIGA 3UXLA 1NJJA 2G3MA 2JEPA 3E0VA 1SZGA 2I9UA 1QMLA 3CQJA 1VFOA 4YCPA 3HG5A 1RSCA 1ADDA 1PKYA 2WNWA 4IPPA 2IXVA 4FNPA 1Q7ZA 3AZSA 3CJPA 2VC7A 5ECVA 1SU5A 1LOSA 2WSRA 1DQXA 3U2EA 1NFGA 1XBZA 2QV4A 3B8SA 4M7SA 4F3HA 1W5MA 2HSAA 1GUVA 3MC5A 4C6CA 3GIPA 2Z2UA 4UTFA 2A5HA 4L6DA 3FVDA 5HBFA 4U3AA 2DV0A 3GXIA 3G22A 3A9BA 2A85A 4IX0A 4KPLA 4DB7A 3CNYA 3W86A 2P88A 1FHDA 1XC4A 1B30A 5AZ0A 3KUMA 4F2TA 3ALFA 2NXHA 1NARA 3ECQA 1VYPX 3WLJA 2OELA 4H3DA 2WK2A 1OQFA 2PDUA 4H9YA 1HKIA 3KP1A 2YR1A 3PFMA 4ICNA 4MIMA 4D6GA 3VIKA 1OEPA 4B16A 3H70A 3GXPA 2OCZA 3MHGA 4JFWA 1R3TA 4JKLA 3STPA 3ZJ8A 1B3VA 1E6RA 5BWFA 2GDVA 2NSXA 2PU0A 3M0YA 4M7TA 3HPSA 1TG7A 1RK5A 3RRXA 4PUNA 3GW3A 3F4NA 4IFKA 5FF4A 3EDDA 4CQ8A 1L9WA 1BKHA 2WJDA 1ECEA 5AB3A 1H60A 3LS9A 2E1WA 5HQEA 4B9YA 1GVOA 4ENLA 1TVNA 1BD0A 2NQZA 4JFTA 4KETA 1UR3M 3ZR4A 1ZCCA 3USBA 1ZBKA 3B0VC 3VI2A 5HNRA 4KFNA 4C6JA 2FLIA 1S2CA 1O5KA 3G0SA 4YXGA 3S46A 2PFHA 2CHNA 3HM7A 4KCUA 3PSWA 1IGSA 1MMFA 1Q6EA 2YL6A 3W7KA 4MJMA 4L65A 4DO6A 1V5XA 1MVYA 3A13A 3MVIA 3AHVA 4PCSA 4KCTA 2YDSA 5FF2A 5ABGA 1F6YA 3QW3A 5LXXA 5ABHA 1B3OA 4NU7A 3U2OA 4QAIA 3BG3A 4D6JA 3PPGA 1EIXA 4B91A 1O4UA 2VVNA 2OLHA 1F7BA 3TH6A 3C5QA 4IG2B 4FIQA 5KTLA 3O2LA 1OABA 3L4TA 1EB3A 2G50A 3W7QA 4A3YA 4YYFA 1YBQA 3N12A 3AZTA 2G3FA 2V5LA 2X40A 3AUOA 3GDTA 1JG9A 2IKJA 3AOFA 1NOUA 4X22A 2RDUA 4NXSA 3BCJA 4EAMA 2H3BA 2VMFA 4CVUA 5BWAA 3OP2A 4DZIA 2VNCA 3ZQ9A 3HQNA 3IJ8A 4G6CA 1SUXA 4Q7NA 3WDJA 4LPCA 4KH2A 3KLLA 4K3ZA 2WSYA 4QITA 1LJYA 3W22A 3ZT7A 2TMDA 1D3GA 1B9BA 4FNRA 5C6MA 1RALA 2G4FA 3W1RA 5I6SA 1J2BA 5HPCA 3HMJG 2VX6A 2DT2A 1MWOA 3W07A 1XSJA 3M0MA 3RM4A 3PPFA 1FX6A 2E0PA 4DY1A 2XM1A 2VFDA 2RGLA 2WLYA 1BLIA 3FJLA 5M2FX 3EPMA 3VU2A 4GPNA 1FRBA 1W6TA 3GU9A 3ID7A 4AD1A 1P0BA 4IH3A 3LCHA 2Y5EA 4RKAA 3RPMA 1KXHA 3WO8A 4AB4A 2AKMA 2X7WA 5EFDA 1MZHA 2FH8A 5F1VA 1VLIA 3THQA 4JHOA 3C2FA 3N19B 1W8GA 1XCXA 3EOOA 1H09A 3MT1A 3E6EA 1RZMA 3VIGA 2FDMA 4TUFA 1VCFA 3VD9A 2ACRA 4DJEC 1TV8A 3GTIA 3VCRA 2D0HA 4V2XA 4H83A 1GNXA 4K2SA 3RF9A 4AZ6A 2YOCA 3ZLHA 3T9PA 3W24A 2QEZA 2OMAA 4JFUA 5HJXA 2BHZA 2YYUA 4D8ZA 1VFHA 1I75A 4UNLA 5LSMA 4IPNB 2EPKX 4RDZA 3ZJKA 3CB8A 4LUSB 2RHGA 2YPIA 5XIAA 3Q67A 1IIHA 4MHBA 4JICA 1KM5A 3I68A 3NO1A 4PB3A 3TA6A 3EDJA 1W91A 4QQUA 4KIEA 2W62A 2ZXBA 5F2MA 4LUJA 4REQB 3VM5A 5HMSA 2VHLA 2WCAA 4RR4A 4V28A 3VD4A 3WLNA 1H51A 1E51A 4HSNA 2WNZA 1A3HA 4HJWA 1GORA 1LG1A 1QK2A 4O15A 1XLDA 3EX4A 4CGTA 3KL3A 4Q8TA 2OODA 4FB7A 1SSDA 3P7YA 1DJWA 5CCZA 3WK1A 3SCVA 4MY1A 4LNYA 4DBUA 2FVKA 4IIEA 3CV2A 2PWVA 4RXFA 4WD0A 5D2YA 4QROA 1PVNA 2GJLA 4PRWA 4HPNA 4C6NA 2ZUSA 1JQVA 3TJ4A 3PBGA 1LDCA 4MF4A 1AD4A 3MWCA 2AKZA 3I3BA 1KB3A 5A3HA 4JTLA 4ZO7A 4S2BA 3VCNA 4HYWA 4J35A 3S1VA 2DUXA 1OYAA 2ZZ6A 2YL8A 3U5YA 3CO4A 1CBGA 1B3YA 3ANUA 2KZHA 3BW4A 1MXGA 2R24A 5EMLA 4K7VA 3EDFA 1KFCA 1NDYA 3VGFA 5E9AA 1VS1A 4FXSA 3VMNA 4H19A 3WF0A 4LV4A 5FJRA 4E3TA 1A0CA 3WEOA 1ME9A 3KZPA 4TIMA 1CXHA 1U5VA 4TTGA 3MDWA 3RX3A 4WGHA 3CV1A 2WCSA 1FKWA 4JTGA 4PMQA 4KWUA 5H8UA 5I3GA 1GQIA 1DV7A 3LMZA 1E0VA 2J7BA 3N15A 4J27A 2WMGA 4IPJA 4HPHA 4JHZA 4IL0A 2CW6A 3UYCA 3SRHA 4GCAA 5LXEA 1SR0A 2BGNE 5C5YA 3UY8A 4KGLA 4A8NA 3TCEA 4XQ6A 1A3XA 4XKYB 3LHUA 3W1TA 1X1NA 2ESCA 1UJPA 2ZRZA 1RHCA 2DQWA 3FW6A 2GVGA 2ZRXA 2BVDA 4Y8EA 1HP4A 5KMYA 4I8YA 4LGXA 3SFWA 3TE9A 3CWNA 1XQLA 2OZ3A 3QC3A 1EDTA 1ZJBA 4RZ6A 4HA1A 3W53A 4MG4A 3EGJA 3AC0A 2WSQA 4C65A 3LDVA 2QDEA 1UKOA 3T0BA 1GZ1A 3TIMA 5HUOA 2XVGA 1VEMA 5CGMA 2EF9A 2HS6A 4KERA 3SUUA 1F3EA 1QOPA 4A4AA 2Y8KA 3LNPA 5AYXA 4QDMA 3UR7A 3QMTA 1HT6A 2R6OA 1JDFA 1VIWA 3M0LA 1JCLA 1GJWA 1XLLA 2CZDA 3G0XA 4HYVA 4CKQA 3KE0A 2HPIA 1GYMA 4P8VA 1XWYA 4U33A 1XSIA 4H6KA 5E6YA 4NZ4A 1RY0A 2BODX 4Q4MA 3NCOA 2VTFA 3BMWA 1GONA 1L0PA 1WDQA 3FA5A 4DNMA 4J4KA 1E0WA 2FZDA 1JF6A 5EMYA 2HJPA 3OVQA 1XH1A 1B54A 1V0KA 1XICA 3MYOA 3AWOA 2HTMA 1KFJA 2YJQA 1XF0A 3I6EA 3VMPA 3A4WA 3MQTA 1GQJA 1KR1A 3LTPA 2QUNA 3PBMA 3GH5A 4PUMA 4G5DA 2G95A 1LUCA 1JZ7A 2O9RA 2CHRA 3KWSA 4D1JA 5CC7A 3T2QA 1E0UA 4W87A 3WEMA 3V5OA 4GXMA 3UGVA 4REQA 2CLPA 1XISA 2D24A 2YBVA 3S83A 2OOGA 4XSLA 1OG0A 3L67A 2I9EA 1WYIA 3DFOA 3SIMA 4C7DA 2D0GA 3LPFA 4JFVA 3W73A 1HKMA 1K7EA 4W93A 1F07A 4IX2A 3P0WA 1OJXA 3H2AA 3V7PA 4X63A 4INFA 4BQ2A 1YPFA 5AHLA 1RCXB 1IWAA 3LN3A 1UP0A 1G01A 4N6FA 2E6YA 3CZKA 1JYNA 4LB4A 1WAUA 4ZVJA 4H41A 4J5NA 1I60A 2FFCA 4E4PA 3QTGA 1M65A 1HIZA 3AHTA 2F6XA 4UOQA 1TCDA 1ZUAX 3LBCA 2V5BA 1KFEA 1GHRA 3QJAA 1P1XA 3R8HA 3W1AA 1S1RA 3EX3A 1E73M 5DX7A 5FJJA 3PJUA 4PYSA 2GGIA 2IQTA 4OBSA 4WHBA 3FK4A 1R8LA 3VK5A 5AC6A 3UWZA 4CNPA 3NAVA 1U33A 4FX6M 4S3KA 3UWYA 1KRBC 2GUBA 1KLYA 1GVRA 1KM3A 3I4EA 4AY1A 4RNJA 3Q65A 4C90A 5A6AA 1KM6A 4MGGA 4EX4A 3T8QA 3BGJA 4OIFA 1BYAA 5DXYA 4LCSA 1R9XA 1SJCA 1ZNNA 3QFWA 1J0IA 2CEQA 1LWIA 3ARQA 1K6WA 3OA5A 1OYBA 1Q7MA 5GJPA 1RQBA 5CPNA 4HHPA 2YBTA 2D73A 3QEZA 2FGLA 1AA1B 3AQUA 4AXNA 1BVZA 1KXVA 4ZQRA 3WUFA 4WR3A 1W3JA 5AC7A 4D1IA 4N0RA 1E40A 3KHDA 2X0YA 1XIJA 4BKNA 3BG9A 3W71A 1DWAM 1XH2A 4E8GA 3MYPA 3UD6A 3K8KA 1LRQA 1LOLA 4TVCA 2NX3A 3EXSA 4P61A 1RCOB 2VL4A 4YJ5A 3TTEA 3V18A 1NVMA 2WZEA 1IE7C 4WKFA 3M43A 1SO5A 1ZS2A 3WJSA 5DT5A 1Q7QA 3PZIA 3ARRA 3EXRA 3IRDA 1RBOB 3KCLA 4D8AA 3LGGA 2GVYA 4JQAA 4V1XA 5A8PA 1ISWA 4ACZA 5HAOA 4NASA 3T55A 5BOFA 2DJLA 3UVAA 3WNOA 5E0FA 4UZSA 6A3HA 2R1PA 4UMBA 3ITGA 4NAFA 1OG6A 3CHEA 3W27A 2I17A 3GTXA 4I6VA 3N73A 5I24A 3OGVA 3LLFA 2FFIA 3RN6A 2E28A 1LBMA 3W6LA 2YYTA 5K9CA 3KCJA 2PB1A 4LY4A 3T4CA 3VKJA 1VBRA 3WNPA 3VILA 3AUJA 4JYDA 1XI3A 5DY2A 4HZ6A 2W67A 1WBHA 5CG0A 1LLZA 3TYZA 4PC8A 3OOQA 1N8IA 3C8NA 1T6MA 5PTDA 1BRLB 4AUBA 2HQAA 1NU5A 3CAKA 5T9BG 3AYVA 2FPVA 1UR2A 2C1HA 3BG5A 1NAL1 4J3SA 2G8ZA 4JGDA 4IJBA 3ARUA 4DF2A 3N9KA 4IICA 3DFNA 1K4GA 5F2LA 3A9IA 2X1RA 2WLZA 3A3WA 3EA1A 5LNRA 3FDGA 3N04A 4S3FA 3L4YA 1XLMA 1S5WA 3BPWA 2Z27A 3IGSA 3SY8A 5AC4A 1GG0A 2VR5A 3SECA 1TZZA 3V36A 3MUY1 3SGZA 3WYZA 1VAHA 2P8CA 4KEMA 3TSMA 3W2UA 2QAFA 5J5RA 1XKJA 2Z6IA 3B8IA 1UB3A 2FDSA 4MKSA 2E8ZA 4B5XA 3MA8A 3ARZA 2W63A 3EPOA 4QLJA 3B06A 4DEFA 1LOQA 3H22A 2FMNA 3FOKA 1L2QA 3RLGA 1NTHA 4X0VA 3U9IA 2I5GA 4LYRA 2QPUA 4HMNA 2HE5A 3RX4A 4UTTC 5C55A 3SCOA 5FSDC 1M9HA 4X60A 2E6AA 2FKPA 2VQTA 4MNJA 3A6OA 5GPRA 3SQLA 4PBFA 2GGEA 4ZENA 4PCPA 3RXZA 3CM4A 1PTGA 1HP5A 1I2PA 4BWLA 1GTHA 3WLSA 2YFOA 4HHLA 4JKMA 2C1GA 5DXXA 5HNUA 1ZALA 2V82A 3LGDA 3WQGA 1BWKA 2RDXA 4QG6A 1XUZA 4YMZA 4Q4QA 4DBEA 2OSXA 4YS1A 3HV9A 3NOYA 3B0YA 1DJNA 3VXGA 2WC4A 1LORA 3OVPA 3O07A 5JBDA 3AHXA 4IIHA 2NX1A 4WOQA 4HTBA 3NG3A 3SCPA 3UWQA 4QLLA 2BLEA 5DEZA 4S39A 2Y8VA 1UQZA 3W7GA 2GPTA 4EXQA 3IIVA 3JUGA 4Y9AA 1CECA 4HMDA 1PCKA 1AL8A 4HMCA 4JTIA 3GU2A 3ONCA 3DIPA 4J3ZA 2V8ZA 4XVDA 1G9HA 2OEMA 4K37A 4N9DA 4S3CA 1W54A 3DKJA 2I1OA 1GOWA 2HVOA 2XIQA 1J5SA 3Q2DA 2IQDA 5F4SA 2OZ8A 1PUDA 3TTSA 1V51A 2TPSA 9XIMA 1GKRA 4UNIA 2ZKMX 4AH7A 2EXOA 3M0JA 2QXWA 2PGFA 1IXQA 4UQDA 1X7FA 2TYSA 2GUUA 2X0SA 1GVSA 2NZLA 4MUZA 2PRMA 3VD7A 2ZX6A 4O18A 3NQBA 3BWWA 1JYXA 4GZ7A 2POZA 1ZBCA 4NZ1A 5HQLA 1XYCA 2DSWA 4BF9A 3R11A 3VNKA 3IJQA 3PWIA 4B92A 4XUGA 4H7CA 3IVTA 3FXYA 2EEXA 3INPA 3LRKA 1FHUA 1R3VA 4OV4A 1KM2A 4Q4RA 3MBFA 4C6IA 3WQPA 4WCJA 2XPKA 1EA9C 1HW6A 2W79A 3QXBA 1GQLA 2VZVA 3ARVA 5AN7A 1K1DA 2PTDA 4QE4A 4JHMA 1J2WA 1B31A 1TIMA 1K8YA 4GIEA 1W1YA 1W2PA 2BDQA 4WDWA 3VGGA 1IIGA 1A53A 5KINA 2IPGA 2PSNA 5CJMA 2ZX9A 3SFKA 2A3EA 1K3UA 4AZ5A 4JX4A 4LQ1A 5EBAA 1W2VA 3W7PA 4DVOA 4CQ9A 4XVEA 1LL7A 3T4WA 4F0MA 4XZLX 7A3HA 4WY0B 3GNPA 2VEMA 1B0IA 1IWPA 1XIEA 2Y24A 1BRLA 4M1BA 2V2HA 5D9NA 4JTFA 2VX4A 1UYQA 2ACSA 4QCEA 2FVLA 1FWAC 2JE8A 4YCOA 3W23A 2VX7A 4GUFA 3WD2A 4AW7A 3E0FA 5CPLA 5K4ZA 2WVUA 2X30A 2W5FA 3BC9A 2QNEA 5K3VA 2VEFA 5DBTA 1P43A 4HKPA 1DJXA 1UUOA 2R9RA 3H12A 1Z3NA 4YN5A 3DX5A 4PULA 1IZJA 2JIWA 5A1AA 1QHPA 2PDLA 3OJGA 3ZS4A 4AC7C 1SM9A 4HIBA 2ZTJA 4PEEA 3W74A 1ENUA 3N6HA 1SZNA 4I90A 4R27A 3QH2A 5E93A 2PDFA 3EMZA 3NQFA 3SURA 4GNKB 4GFSA 3SGGA 3TSDA 4DJDA 3UXAA 3VDHA 1TRIA 1M1BA 2PGRA 3WBAA 1OF6A 1W1VA 4BS0A 3AYTA 3F2CA 1XBYA 5A6JA 1J18A 4C5ZA 4TV5A 3T6CA 4A3QA 1XLGA 3HG3A 1TFVA 3P82A 1EBGA 1V0LA 4NI3A 1DORA 1JFHA 5J04A 3OVGA 3OLDA 5T91A 3GRIA 5CJNA 2A3AA 1EHNA 1YXDA 1WXJA 3B8WA 1WP6A 4HA3A 3JRKA 4XTIA 4JFSA 4W85A 5DO8A 1YPXA 5ECUA 2ASHA 2W3ZA 5JBFA 1XYAA 3CUHA 3ZFHA 3OBEA 1XH0A 3NQGA 5BRQA 1ISXA 3EEZA 1C7SA 1C3FA 1I0BA 4S23A 3THAA 5KEZA 3VNDA 3KHJA 3V0UA 4HNOA 1E1EA 2A7PA 2VEPA 2J74A 4PBEA 3UYIA 2VEKA 2Q8ZA 3TAKA 2I14A 2VD9A 3H6OA 4O19A 4XKMA 3GUWA 2YL9A 2DP3A 2EAWA 5BXSA 1ZAIA 3ZZ1A 1EP2A 3DFQA 1KWKA 2AQOA 1WQ5A 2A4AA 1CCWB 3STGA 1UWAA 3B05A 4YVVA 3RYSA 3G1VA 4CU7A 1OFRA 2Z1SA 5AKQA 4JNYA 1O66A 1IT7A 3EOSA 3VIIA 2EPHA 1F9CA 4WEVX 1JCMP 1JZ6A 2AMGA 1U83A 3VOFA 1G4TA 2IMRA 4QHRA 2I7GA 3LZ3A 2QS8A 2E6FA 4WDUA 2XH4A 3LCGA 1GOQA 1L6YA 2PDQA 1ZY9A 1PBGA 2P10A 1YEYA 2LLEA 3MS8A 4AWSA 2NWRA 3WBXA 3PANA 4MMWA 5LZLA 1UUQA 2GGGA 1SZFA 2PTXA 3AXMA 4H9TA 2Y2WA 3G8EA 1OC7A 1QR7A 1A5OC 1B3ZA 2ABBA 2HE8A 1KXQA 5E09A 3I7QA 4DWSB 4W84A 2MNRA 1QI5A 3NL3A 2GQAA 3TW7A 3GY1A 2PEVA 3K1GA 3W2MA 1GJUA 2VZTA 4FOUA 1O1HA 3WBYA 3VIPA 1KTNA 5I77A 1R30A 4H7VA 4YHGA 3VGHA 3RJXA 4B2DD 3T7VA 4PN2A 1H4PA 3DFSA 1JAKA 4FAMA 1NIUA 4HU4A 1OF8A 3P80A 2XFRA 3HG4A 1MRAA 1ZTVA 1JYVA 1OIFA 1UOZA 2CZFA 1EJ7L 3F2BA 3CGTA 2DSUA 4KGJA 5JXQA 1ONWA 3XINA 4IT1A 2G41A 2WMHA 5G2IA 4ZSUA 3SN1A 1TWWA 2WKGA 3S3GA 3RCMA 3R79A 4GXPA 4NHVA 5LNVA 5G5IA 3NQ6A 4UXDA 1NP2A 4HMEA 2IQ0A 4ERAA 3S2JA 3OU8A 1ZLPA 4U2ZA 3PJTA 2J7CA 1R3SA 4UZUA 4ZB0A 4AEEA 3G2GA 2PC8A 3NEVA 1I2OA 1T8QA 1A50A 3HB9A 1LT8A 4WY0A 2GSJA 3MP3A 4PMRA 1UASA 5HANA 1G7UA 3IJ7A 3FJNA 2Q3RA 2A79A 4J3TA 2EBNA 3U48A 3WH7A 4QEHA 2QPSA 2UY4A 2GOKA 3F4WA 1AK5A 2G96A 4GABA 2BVTA 1C8XA 3M07A 3M46A 3DI1A 2EPLX 3DG6A 4MFDA 1ELSA 1TYGA 1WXZA 2WSKA 4AYSA 1OCQA 4ECLA 1RP9A 4OT7A 2PD5A 3F2DA 2DSKA 4D72A 4LS1A 1XJBA 3VUSA 3WNKA 3KOWA 4NNAA 1CB2A 1TQXA 1LL4A 3QMSA 4EWJA 4HOWA 2VM8A 3AFBA 1RY8A 4GA8A 5C2CA 4WJ8A 4L7ZA 1B4KA 4O4WA 1FVPA 4AZCB 3UJEA 5D05A 2CPUA 3A21A 3FEMA 2QCCA 2NVAA 3NWRA 1GOIA 1XFBA 3I6RA 3SCNA 5HR7A 3MKCA 1EF3A 1OK6A 3EA2A 3NVDA 3AXKA 3L0NA 2QDGA 1BYDA 2O4MA 2QCMA 3K1DA 3CH0A 1V6TA 1WUEA 5HNNA 3VINA 4NZJA 3GXTA 5DT7A 5TF0A 2PBOA 5JU6A 3EA3A 1U1UA 4B3ZA 2HCVA 5RUBA 2RGMA 4WJEA 2VWSA 1PKNA 1AW2A 4UFIA 1R3WA 3PFRA 2W91A 1SSGA 1NQ6A 1TV4A 1UP3A 1VHCA 1MNZA 1EJTC 3WD3A 4QISA 3UZJA 4R7WA 1OSEA 4O1FA 3K4WA 4ZQOA 4WOZA 4MKNA 2W66A 2AAMA 3RX2A 1W31A 4V1YA 5DQPA 5D02A 4CEXC 3A5FA 3GDLA 2PUZA 2E68A 3CYJA 1R3YA 1Z89A 2VDIA 4GNVA 3B0XA 4HPXA 1RP8A 2ZC8A 3RU6A 7TAAA 1TV3A 1FBAA 1K9DA 1EPXA 1POKA 4CLMA 1TKKA 5LA2A 2JQXA 5JIPA 5CPMA 5CC6A 1TPEA 1ZJAA 2YCEA 3KXQA 4CQDA 7REQA 4TR9A 5A69A 5KZ6A 1QPNA 4LH8A 2FPYA 4Y2WA 2NQ9A 2OWWA 3R8RA 1E6ZA 2J66A 6PTDA 1GTEA 4W7UA 3SZ8A 3PTDA 3MV01 3M44A 3W02A 1U1JA 1F8MA 4I5RA 2PP0A 4ZOEA 4G2DA 4Q8PA 2WC3A 3HG2A 1K70A 3G77A 3GE7A 3KOFA 4MKVA 4PMUA 3VFCA 1ESWA 3AIUA 4PUUA 3SRFA 4L4PA 1ISZA 4HZ8A 1BTMA 2OFJA 1JXJA 3W84A 4S38A 4PCFA 2V5DA 4E6MA 1NF7A 1V0MA 2TRSA 3VZYA 3VKDA 1XC6A 1WV2A 5DMLA 5BU6A 2CETA 3P61A 5FJUA 3BCFA 3VD3A 3LUTA 4U3CA 4UB9A 2NLYA 3OO2A 3WH9A 3ONBA 3UPBA 1Z44A 1ICPA 2DIJA 3UFYA 3B3DA 4AIEA 1X6LA 5KZDA 4NYUA 1HX0A 1PWMA 3QLLA 3GVVA 4FR1A 3H26A 2W92A 3MKVA 2AGKA 3M7SA 5GVJA 5HUPA 1K77A 3A4XA 3DERA 4RNHA 2OXNA 4C6QA 5LNUA 3V16A 2NV9A 1DHKA 5D2WA 2VX5A 3SQMA 3AALA 2ZZ5A 4Q8OA 4YTUA 3AIQA 4YL2A 3T08A 2C15A 2ZUNA 3PBYA 5G4WA 1FDZA 2PURA 2FZ8A 3IRSA 2Z29A 3W76A 2QCGA 4DM2A 3SN4A 4ZFCA 3AIEA 3GXFA 1JIBA 4F8XA 4YNGA 3KFTA 4PRRA 1ME8A 4A3RA 1VPYA 2WO5A 2P3EA 1J79A 1QPRA 5J5DA 3QHNA 1HL8A 2INZA 4UR8A 3LGEA 2IS7A 5D8WA 1V3LA 2WKLA 3FKKA 1UW9A 4RE4A 4KRUA 3TYBA 1YNYA 4GC4A 4L4LA 3G1SA 3QSTA 1TJ2A 4GYKA 4A2SA 3FEQA 4MWAB 3PHAA 1LRNA 5DN1A 3D3AA 2VGFA 2NV2A 2Y6ZA 3TQPA 2DU2A 4P8UA 1HUVA 4N6EA 3W9ZA 1ISYA 5A6KA 3WENA 1AMYA 2WOQA 3RK8A 3CV6A 3ISIX 1J12A 3NZRA 4WUIA 1LM1A 2YZ5A 3SUTA 3E2SA 1U30A 5IHSA 1QW8A 4C1NB 4F2UA 3K8MA 1S2VA 4HNNA 1UPMB 2P8BA 2DPEA 4GJIA 1ZRQA 4AZCA 5LKYA 1TWSA 2ZA1A 1DIOA 4TMBA 4Q4SA 5EBUA 4BZYA 2Y7EA 3BAWA 1L8NA 1BF6A 2DJXA 2O56A 4MJ2A 2NQJA 3T0DA 4XAGA 3F5LA 4B5VA 1WBJA 1V7AA 1TA3B 1HKVA 2XSAA 2X16A 3LYEA 3OA3A 2BY0A 4FO4A 4I7UA 3EWYA 1UKQA 2DEPA 4PMJA 3WSUA 1DXFA 4JEQA 4RUBA 3LHZA 2YCLA 4DBDA 2KAUC 1J93A 5LGXA 2V5JA 4AHOA 4RW3A 2X1TA 3EOUA 2PP3A 3BE7A 2IUZA 3VNJA 1JFXA 1TTPA 3VX1A 2VOTA 1DVJA 2ACQA 3WUGA 1UD4A 3SJ3A 3PNUA 4O16A 4CQBA 5CC5A 2BOGX 1W3HA 3H2OA 5A6TC 4AFYA 1EGVA 2BY1A 2EG8A 1HL9A 2NLIA 5HWJA 3W70A 1LQAA 1WZMA 2FQIA 2P1FA 2WZTA 4B90A 2B7QA 3NM1A 4P2VA 2WQPA 5CH9A 4Q7IA 2C79A 4C6MA 5CZTA 1CDGA 3L4ZA 3N13A 3IV3A 4IFRA 4GFIA 2PPGA 1FCQA 3O06A 3K30A 3L12A 2D2GA 5BOOA 2V6AA 4HPGA 3T42A 2J7GA 5FCZA 2CLIA 3CEPA 3QZ6A 3G6LA 2XDFA 1GJPA 1E1FA 2HWGA 2DZXA 3GNOA 1MW1A 5FL0A 4L5ZA 4LAKA 3IK4A 4UTWC 3T0AA 1YTEA 4AZGA 1KCXA 1TR9A 5CXPA 3DHUA 1MEWA 3RG6A 4H6QA 3SCWA 2NWSA 3MPGA 5I06A 3Q37A 1Q5MA 1YW1A 3A64A 2PMQA 4NZFA 3SDOA 3G1AA 4EVZA 5M3WA 4Z2HA 2J6XA 5IFPA 3NYDA 1RH9A 4P7LA 5CAKA 1ML1A 2DIKA 3W85A 4RXGA 5XIMA 1P6BA 1XCWA 3W1QA 1XG3A 3S42A 5D8ZA 4Y9PA 3VNZA 3W1NA 4QRNA 3VGBA 4B4FA 1HL2A 1A4LA 4I9JA 4US6A 3BLDA 2WMFA 4DQWA 4PTMA 4CD7A 4UQ9A 3GUGA 3M0ZA 3QKZA 5AHEA 3ZOAA 3GSMA 3NQDA 4JEJA 3BLLA 4HSOA 1UR1A 4PZVA 4M82A 1LLOA 4X3ZA 3ELFA 3ZLFA 2HZGA 1OK4A 5HWMA 1DWFM 3NQAA 1IR2A 3GG8A 1EJXC 2FGBA 1RA0A 2Z24A 3MI3A 2E5CA 2J7EA 4MJ4A 1THFD 4UCGA 5TAOA 4IP7A 1E3XA 4PSRA 2HVMA 3DI0A 1YXYA 4UQAA 2CZVA 4KRZA 1TB3A 3GH7A 3NL2A 3PC0A 3ZVHB 3T09A 1LT7A 3VMOA 2Z2BA 3F7JA 1QBBA 1XRSA 1XV8A 3ZWTA 1RXOB 1BF2A 1UJQA 1FXPA 4M6VA 5C0QA 3CL8A 2OLSA 1M04A 4GUJA 4EKJA 1V6VA 4DJEA 3EKZA 1E4LA 4MWAA 2IW0A 3UA4A 1WUFA 1LG2A 3ABOA 3O6DA 4LVDA 2XISA 2RAGA 3NYZA 4KT2A 2YCKX 3WLIA 4KEUA 3N17A 1GHSA 2D2JA 4ZOBA 1DYSA 4DELA 3EZ4A 1XG4A 3S5NA 3DBPA 3PP7A 1DXIA 1WKYA 2GSHA 1BWLA 3DOPA 3TOPA 4C1NA 2VR2A 3SY1A 1NEYA 3CZ8A 3FV9A 3W87A 3WQDA 4Y9MA 5JMUA 4UOZA 5FAGA 5LNSA 3VABA 2AL1A 1O68A 4IUGA 5D38A 3PJWA 3KTCA 4ZFMA 5DMMA 5FJOA 3OIHA 3GHRA 3QF0A 5K2ZA 1JI2A 1GZJA 4R7OA 4A2RA 1A5NC 1T99A 2E1DA 3U6WA 1UWQA 2YW4A 2HROA 2XTKA 3D47A 1E1CA 1VFFA 2PGEA 1TA3A 3LHTA 4IMAA 3ZXWA 5CPOA 2DFAA 5TIMA 4YU1A 1YMYA 2EJAA 2OYLA 5CZJA 3M4HA 1EFZA 1XGEA 1SJDA 4NZ3A 2H9AA 2GWNA 4FS9A 3WEZA 2QCLA 4UOJA 4LFYA 4W7WA 1HGWA 2C8NA 1KA9F 4FNQA 4ATLA 5E1QA 1UZ1A 1EQCA 1CX9A 3VDAA 3BOXA 1EOMA 3DHPA 3C2VA 1H50A 3RILA 1C7TA 1LWJA 4XAFA 3GHSA 5FF3A 1F2JA 1QNPA 3LXAA 2VDGA 4PTNA 1E9IA 1XYLA 1KGXA 2BOFX 3REQB 4XK2A 3POHA 3NQCA 4U5IA 3L21A 3QFEA 4G8TA 1M41A 3E74A 1OCBA 2VWTA 4JX5A 3A3HA 2PDXA 5C71A 3PK7A 4HBKA 2TAAA 4C1KA 1JUBA 1ITCA 2JF6A 1VIZA 3M0HA 3O1NA 2A7NA 4Q4KA 1LP6A 1A5CA 2QCFA 2OT0A 1E9ZB 2CYGA 1IR1A 2DVXA 1R5YA 2QGHA 2Y89A 4IP4A 4Z1CA 3S6OA 2C1IA 1GQNA 4XBSA 5KZEA 1D2KA 1JGIA 1M6JA 4NNCA 1XLEA 3SBFA 3WFLA 1W9XA 3G18A 3P3BA 3AMGA 3H2CA 2F9RA 1BG4A 4W9TA 2DSVA 1XP3A 3NTYA 5G4EA 2HBXA 3WQEA 2DZTA 1AJ2A 1R46A 2BHUA 1P5BA 4JKKA 3LOTA 2PWFA 1SW3A 1V03A 3W7NA 2FZMA 5I2UA 2WM1A 2J8GA 3R0UA 2WPGA 1KRMA 4DJFD 3M0IA 4JTKA 2BY3A 3N29A 3ZT6A 1K03A 5IBXC 3K5XA 3TWBA 5BRBA 1JQXA 3PS7A 3ABZA 2DSZA 2Y85A 3WX7A 1BQGA 1H2JA 2GQ8A 1LCOA 4R33A 2DZUA 1NFBA 1UBPC 1KCKA 4X0NA 4W7VA 2CERA 5EKYA 3KEHA 4Z1AA 3CO8A 1C90A 3IJ9A 1QOQA 5GNXA 2FB2A 4IOTA 1SPQA 3TKFA 3GC2A 4OGZA 2EJ1A 4J7RA 2QJGA 3UBPC 3MZ2A 3O9NA 4GJJA 5I5RA 3TC3A 4B4HA 4HNTA 4PEKA 1AW1A 1D3CA 4RE0A 1RJRA 1WDSA 2R14A 3VIFA 1FY6A 2QCEA 2CLKA 1SW7A 4I9MA 4XD5A 4E2DA 1WAWA 4ICMA 4PMDA 3SCTA 1DPMA 2OO0A 1FOBA 2EKGA 3EBVA 5CPTA 3V1PA 4GBDA 2NXGA 1VF8A 2BMBA 3W28A 3BJSA 5AHNA 4H01A 1EXPA 3N3TA 3NZGA 5F1UA 4UNKA 4BY3A 4E3VA 3ZVHA 1US2A 2C0AA 2OGYA 1XL9A 3RFAA 2G37A 4OFCA 2NUYA 1LROA 3QY7A 1VD6A 2BS9A 3TR9A 1O5XA 3WDPP 3GX9A 1E5NA 3RLUA 4GGHA 5D09A 1H5YA 2WMKA 2BGQA 2H90A 3N34A 1HFBA 3E0IA 1QNQA 2WKJA 1TE1A 1KBIA 1UP2A 5AC8A 3C61A 4LCRA 4TTUA 2PODA 2YCJA 3LERA 4BCEA 4IIDA 3UA3A 4XISA 3HFYA 5F4XA 2PD9A 2I5QA 3Q94A 4U28A 4F0LA 4AVFA 2XZ9A 2F6UA 2NT0A 3TEVA 4J3XA 1TPWA 4BI6A 2YDRA 1SYTA 1C91A 3G6MA 3NL6A 3RPTA 2VCBA 1I0DA 3GLCA 4QIUA 3EX2A 1ZCOA 4HHHA 4QJ3B 1KV5A 1K7FA 5KETA 4ZTYA 2FVMA 4EXAA 3BICA 3E2QA 3O7UA 3EWZA 1UH3A 3DXIA 4NZ5A 3C6CA 3CASA 1TV5A 3NJ3A 3CHFA 3TJXA 2QULA 4XAYA 4O57A 1UC5A 4U2YA 2J24A 3GDKA 4OE7A 3CC1A 3RDKA 3CWHA 1J0ZA 3H7UA 4AYGA 5FKYA 2W9MA 3HJZA 3NOEA 1W32A 1G5AA 3KOYA 4LT9A 4ZQMA 2ZXDA 4CCEA 3NNTA 1VJZA 4GQQA 4AD4A 1XFCA 2BG5A 5JBEA 2X8RA 1ZPTA 2CBUA 3LNMA 1SFSA 5EMKA 2BY2A 4MZYA 3PUDA 3LI1A 3HQPA 3S2LA 3LM3A 1JR1A 3V5CA 4DZ5A 1YKWA 5I79A 1GKPA 3LV6A 3GG7A 2Z1VA 2VI0A 1V02E 3REQA 1C29A 5EL1A 3WF1A 4JDBA 3HQOA 2CHOA 2Q02A 5CZ0A 5DRCA 1FKXA 2AGTA 4M81A 1V6UA 4A8LA 3SSJA 2X1UA 1A49A 3TW9A 3W2KA 4E38A 5CG7A 1YE4A 3QYSA 3W0KA 2VP8A 3B8VA 2PAJA 3GTNA 1P4CA 3O05A 4EF9A 1N8WA 3QPZA 3R4IA 1PKLA 3ATYA 5CBBA 1B4EA 3LPOA 4FI4A 4CD4A 1RQHA 3GR4A 5CSSA 3WH5A 3P8IA 4KWVA 3KBNA 3KRZA 4JCMA 2G0WA 1SR9A 3PF3A 1B57A 4FPSA 3S2MA 3PSVA 1IXPA 4DNHA 1NDVA 4TX8A 3MO4A 2OYMA 1F6PA 1ISVA 1Q85A 1TUXA 1U22A 2YXGA 3AIBA 4S3DA 4HQVA 4BJHA 3ARTA 4OU1A 4JTAA 2E77A 4AY8A 3TN3A 5I3JA 3U7VA 4UFHA 2PRHA 2A3LA 1TPH1 3V0SA 2GFTA 2WJEA 3WD0A 4DBWA 1SJBA 2CESA 3GD6A 4ZXLA 3GS6A 1H62A 3H53A 1W5QA 5M5DA 3PULA 4LY8A 4LBRA 3P60A 3DYOA 4ICCX 1GVEA 4P7OA 4P7NA 5DLCA 4AIUA 1DE5A 4RCXA 3H4GA 1GOMA 3FAWA 1EWEA 2E8YA 4GWEA 2WQDA 5AY7A 1V8EA 3QV9A 1XBVA 4FOKA 2YSWA 3GZAA 4QNEA 4LEQA 1G6CA 1MEIA 3BQ6A 2FJKA 1ZJIA 3EAUA 3NA8A 1KKOA 3LV5A 4DLFA 1J0JA 2P0OA 4MPKA 3EYPA 3KL5A 3R13A 3R12A 3FJ4A 1H7OA 3S5YA 1NY1A 3WK0A 2XU2A 3G1RA 4I9TA 2VUNA 1YBQB 2VELA 3M41A 2WHKA 2A3HA 3AMDA 5A6BA 2ZDSA 3OEXA 4ZQCA 1TTIA 5LIXX 3NO5A 4MLRA 1OX6A 4GNJA 1FWDC 4P8XA 2GLKA 2V2CA 3PB2A 4QM1A 5D2XA 1OGBA 3VUPA 5D03A 4IGMA 4ZSTA 1CWYA 1N82A 2BTMA 1ZU8A 2XN2A 4IWWA 4D8LA 2WZHA 3WCZA 4AX7A 4EE9A 5T26A 2C91A 4OOZA 3MZNA 2PDYA 1OHLA 4M29A 1XLHA 1W1B1 1K8XA 1XYFA 3SCQA 4GLEA 3IARA 4MPQA 2XFYA 1J0HA 5XINA 4O1CA 3TC7A 3F5JA 1EZ2A 1EJVC 2F7FA 4PMNA 4KCVA 1OM0A 2QVHA 3TC6A 1EDGA 1MW3A 3G24A 2RJHA 1JCTA 1BWVA 4WY0F 3UWWA 2PWHA 2VYOA 4PR4A 1QRQA 1ZBVA 4QBXA 4NL1A 4Z1YA 4B5SA 1V0NA 3SUSA 5HJLA 4DI8A 5JQ9A 4NT0A 4QNWA 2WCGA 4ERIA 2IPJA 3KS5A 2XWDA 4JTHA 4UTTA 3CLWA 1UMYA 4ERGA 3C4UA 4LYPA 3TQ0A 1JDEA 3KDOA 5E9XA 4C6EA 2AQWA 1Q8AA 4S3JA 3TLQA 1W8SA 2OEKA 4N2YA 2QJJA 1TVPA 4FP1A 5BU9A 1S2TA 1OCJA 5FACA 3NR0A 1PHQA 3E3HA 3KWXA 1L2UA 4IXHA 3T81A 1DHPA 1VFTA 5BRPA 1JPDX 4AEOA 4ORIA 5MKGB 5I00A 4EF8A 1TIWA 1S39A 2FTPA 3UZYA 1LQ2A 1P6CA 2VXNA 2QJMA 3VYLA 4OUIA 2OGJA 5CZSA 3GC5A 2IPWA 5FEWA 1JPIA 3NZQA 2OWCA 4LU0A 1Q65A 4HU3A 1IEXA 2H3DA 2NXIA 3M16A 3PZUA 5L9FA 4C6DA 1TTJA 3KVMA 5T8GA 4MTVA 8XIMA 2HRWA 3EMQA 3OB8A 1DQWA 4EK7A 4LF1A 4U10A 3NM3A 1FH7A 4AIOA 5HMFA 3PTQA 1VCGA 3BL3A 1Z69A 2JGYA 1TQJA 4H2HA 2P0IA 3S47A 4EPKA 5EMUA 8TIMA 1K9TA 3OHIA 4DN1A 2OLAA 1V3MA 1J9YA 1QU4A 4AWTA 4AXKA 3LSCA 4GGBA 3EWBX 4U4MA 3B97A 1EKOA 2G3IA 2PZNA 3TJLA 2IKGA 1J01A 4K68A 3VNMA 3APGA 4JIIX 1UD3A 4N4QA 2OU4A 2FH6A 1S5TA 2PDKA 3FX4A 1VLWA 3S2NA 3PG8A 2J7DA 3S0CA 5LIWX 4R53A 3TDFA 3MW7A 4OQVA 4LVBA 2ZC1A 4O11A 3S1XA 4Z17A 1O95A 3GTFA 4ZA0A 3I3DA 1O5RA 3H54A 3VKKA 2Q8LA 1H7XA 4A05A 3WMLA 2D20A 1B3WA 3FLUA 5I3DA 2XGZA 4XTDA 4CD5A 4AD5A 2CLHA 2OJPA 4QG9A 4LW7A 1F8IA 3KX6A 5G2WA 1JF5A 3CHDA 4HK5A 3NIYA 4FHAA 3N4EA 3DG3A 4LNCA 4Q7BA 3CIWA 3H8AA 1JD9A 4RNIA 4ADUA 1ZP4A 3RCYA 1WA3A 1O7AA 4TVUA 1GEQA 1OT2A 3WZ0E 3ITOA 3WQ5A 1S3TC 2ZE3A 3N11A 1H3GA 3VGEA 3SW6A 1J10A 3EWCA 1OX5A 2ZOXA 2ON3A 1KCZA 1ZP3A 1XGZA 2VEIA 2B4GA 4O0QA 4Z2IA 4LAUA 1H0IA 6XIMA 4C5YA 4P7RA 4B5TA 1NWTA 2JF7A 3HPAA 1W1PA 3OQEA 4DO7A 3MUIA 4MDPA 3VIOA 2AMXA 2VO5A 1C8VA 3NDZA 2UY3A 4M6UA 5IDZA 3K8LA 3HJEA 3WBWA 1S1PA 1AJZA 1RVGA 3EPNA 2BVWA 5HWNA 3TLLA 2ZUMA 3DYMA 3MO7A 1VKFA 2PWEA 1TTQA 3IIPA 3TYCA 5I3HA 2VENA 4GG9A 1FH8A 1G67A 1VZWA 1IZKA 3OVRA 2XFWA 1L6GA 1IQ8A 1E70M 2PF0A 1T96A 3N25A 3TTQA 5CGQA 3OYXA 4B5NA 1H7NA 1BXCA 4LUIA 3QY6A 1T8XA 1BVNP 3VDGA 4RZ4A 1US3A 5IM51 3WL0A 3OQ8A 2DW6A 5DF0A 1S2WA 3BOLA 3VOCA 5KSWA 4LX4A 1XIHA 1NDZA 5DANA 3TAOA 2E67A 3QR1A 3TZNA 2R1NA 1I2RA 4NJIA 2VVSA 2XSXA 3KOZA 4QDWA 2XFFA 2FHCA 1EP1A 4GUGA 3KTSA 3DEQA 3MJMA 3PPCA 3W1XA 4PFHA 2XVNA 2ZXQA 3TTOA 4JTJA 2RUSA 3WDHA 3G3MA 4N9CA 5MKGA 2XH0A 2BNJA 3CMFA 4Q4PA 9CGTA 3SCSA 2CWNA 4LANA 5FOOA 4NIRA 4CNUA 4BK9A 1ZENA 4TXEA 4QXIA 3A4AA 1JUKA 3TTYA 1KCLA 4MZ8A 1LUCB 3C2RA 2XVPA 3SQSA 3SADA 3W2LA 3MI6A 1BYBA 3N9SA 1IHIA 4MNKA 3TQVA 2REQB 2O7SA 2PDWA 1IXNA 2GOUA 3UU0A 2PCQA 2E4TA 3MSYA 1LBLA 2J25A 4FLRA 2QV5A 1TPVA 1D3HA 5HOSA 3ARYA 1QHZA 4NP7A 1Q3NA 1XLCA 2J27A 3BSHA 4GZJA 3FGCB 4GACA 3L66A 3ATZA 1O5QA 2PGWA 1RPXA 1KTBA 3QRHA 4MLJA 2A21A 4QAWA 5AVNA 3SN0A 4O12A 4Q8UA 1KGWA 3WFZA 2BASA 4R85A 3HPZA 1PZ2A 3TYDA 1FDJA 3AHYA 3KM8A 3V75A 2DH3A 4DI9A 5REQA 1IZCA 3GQYA 6REQB 1M7OA 1K9FA 1MUCA 3PAJA 2DW7A 4UCFA 3DHFA 3IK2A 2D1ZA 1OINA 3CZEA 2D22A 1QNRA 4JQ4A 3B9AA 3LPPA 4PBGA 3ZIZA 2C13A 3BUVA 2YLAA 1PTAA 1A47A 7TIMA 2Z1XA 1FCBA 4QQ3A 2E3ZA 1VFSA 2GVEA 2DQXA 2YL5A 3EWWA 1B1YA 1BXNA 4GYPC 4Q8WA 1FQ0A 3EMCA 3VGDA 3STEA 2P53A 2J6VA 4DUOA 4JN8A 4HP5A 5FAJA 1P0KA 3P67A 2BSLA 4R3UA 4YVXA 3OG3A 4X9SA 2BGSA 3D46A 1I1XA 4H9ZA 4F2BA 1JI1A 3BW3A 1EX1A 3VX0A 1RBAA 2VFGA 1TREA 2GDUA 2XVLA 2EO7A 2R1LA 2IKHA 3GFZA 4C7GA 3KBSA 1A5UA 2GK1B 3FAXA 2Z00A 1V77A 2O55A 2ONEA 2WYSA 3EDEA 3QVQA 1Y5VA 3TN4A 4HSHA 4HVXA 2WM0A 2XN0A 5A95A 4UFKA 3EX6A 4AD0A 4I7WA 3M5ZA 1A5KC 3BAYA 3CQ0A 3RR4A 4L1WA 4JQ1A 1WDDA 4KESA 3LSBA 1XQKA 4L4MA 3HMCA 3U5UA 4IMDA 4XSMA 2JGQA 4LYQA 5HJYA 4QCFA 4ACZB 3TXZA 4DJDC 1SO4A 1SFLA 1R9YA 1V3JA 3E96A 4NAFB 3LXBA 3LMYA 5B7ZA 4KBXA 2ATMA 4ADSA 2NX9A 2WVSA 4Z2KA 3F1QA 3RCNA 1E3ZA 3GR7A 2OQYA 3EX1A 2WHJA 4A35A 3NFUA 4US5D 4HU8A 1EBHA 2WHMA 3QZAA 4LVFA 3B40A 4AMAA 2GYIA 4JTSA 1MDLA 2ZQ0A 1KBKA 4JY8A 4W89A 2PLMA 2RDTA 4LC8A 4LSBA 1EYWA 3CL7A 5CPQA 1YRRA 3OODA 1AQMA 3SUWA 4NY2A 1HJSA 1MZRA 4ZGYA 3W01A 3TROA 1QFEA 3LCWA 1D7FA 3DYPA 2XJ7A 4O52A 3APTA 1BG9A 3C3UA 5I3FA 4K39A 4UBPC 3S1WA 4QE5A 1Q2RA 2Y1HA 1RBLA 4MAVA 3ABRA 3TCSA 4O1BA 2QGYA 4MAZA 3AISA 3QR3A 3WLKX 2PDBA 4GZIA 2VC5A 3W1MA 5IXEA 3CMGA 3N2OA 1PDYA 5D33A 1T40A 1Q6LA 3C8FA 2QDDA 2ANUA 1G0CA 7XIMA 5G1YA 3UQNA 3TN6A 4AZBA 1QDSA 4PTVA 2VFIA 3WH6A 4MYAA 4IMCA 5H1WA 4RLIA 3LM7A 3SRKA 4OV9A 1KO0A 2CLMA 3G5EA 3U4AA 2OYKA 3W3OA 4AY7A 4R9XA 1W3TA 2CZEA 3NPXA 1PB0A 3BJFA 4LS0A 2NQ5A 2YCIX 1AL7A 3G0UA 2DT0A 2REQA 4GI9A 5F2IA 1AZ1A 3I65A 3HGJA 3C2EA 5ABFB 4A8IA 4GVGA 4NAEB 5TQLA 4UMAA 4D6EA 4UTKA 4NJHA 2GQ3A 3L9CA 1QNOA 3GYEA 1A0EA 3XIMA 3UJRA 1EQPA 1VB9A 3TZFA 5HMDA 2SFPA 1CI1A 2PWDA 2XHYA 4QLKA 1KW1A 3FGCA 5EY5A 2ZYFA 4MWAE 1WDPA 1ZAJA 1UQYA 4MB4A 1J6OA 3FYOA 2R91A 1AH4A 1C92A 2QPXA 4TQTA 3E9AA 1I1WA 1W1IE 3AYRA 1X8FA 3BARA 5CSUA 3G1FA 4WRHA 4C6LA 2WBGA 3E2VA 1RV8A 2X42A 1YX1A 2BV9A 1NFPA 4O8RA 4RDYA 2E40A 6REQA 5DRIA 2OVLA 1XXXA 3VDCA 5M1TA 1Q6CA 1XIBA 2OKOA 3DFYA 1VCVA 4IMGA 4YVPA 4DZAA 4GO8A 1E4NA 3MB9A 3MVTA 4L6HA 4ZEPA 4XZHA 3N2MA 4QJ5B 1F6KA 4WSJA 1WX0A 4QS5A 3G1DA 1Z7AA 1JUEA 1A5SA 3KOXA 4U5KA 2DVUA 2J78A 4W8AA 1GT8A 3MUXA 4IUOA 4F9JA 2B7NA 3ITYA 4PL1A 3H2NA 1A5BA 3CTTA 4EP8C 3GK0A 2PDCA 4IIFA 4RW5A 3DFTA 4E0CA 4B3KA 3AMCA 3MDUA 1R6WA 2BOEX 4FF5A 3ZT5A 5E5CA 3XISA 1FWNA 2POTA 5GNZA 1ADSA 4E4UA 4K8HA 4IZGA 3B0PA 2GK1A 3KCOA 3UWEA 3WLOA 3M5YA 4I5XA 3MUCA 3HGOA 3S4TA 3MCMA 3C56A 3A12A 3WMBA 1S46A 2CZ5A 4ZXOA 3VKCA 5AFDA 1TMLA 4KQNA 3ITXA 1OY0A 3CQIA 2QCHA 3URQA 5CLWA 3VNYA 4LRTA 4JAWA 2C6QA 3NPWA 3P62A 4EAYA 1XLFA 5I3IA 1VGAA 3W29A 2CIPA 3M5XA 1W3NA 3RLHA 3N18A 3L5LA 1M03A 2DZVA 3ZJ7A 1UD2A 4BEQA 1Q13A 5HXMA 3P14A 2C16A 3S9IA 3U8GA 1C93A 1U5HA 4RPPA 2VFHA 3WJYA 3CYVA 3PZGA 5BXTA 1UA7A 3GIQA 2CXEA 2CNCA 4M56A 1G1YA 1W1ZA 3F5KA 1D8WA 5AOUA 1WZLA 3CPRA 5HINA 4XV0A 1X1OA 2CFFA 3MSDA 4L9XA 2YDAA 3QMRA 3ALGA 3SGUA 1CTNA 3UF9A 4B9ZA 2P3ZA 1CENA 1BVWA 1XX1A 3LB0A 4M3PA 1DWJM 2VDHA 1ZGDA 1KWGA 4AEFA 4O0KA 3BLEA 4H8HA 2VGGA 4IP5A 3W7OA 3TNBA 3AYSA 1GVFA 2HK0A 1XR2A 5FJIA 4URIA 1E56A 3QZEA 3SUVA 3LEPA 4HTYA 3ICJA 1UZDA 2YX0A 5D2VA 4Q22A 3N1AA 4KWWA 2AQVA 1D7KA 1V4YA 3W1UA 1RCQA 3KDNA 1KM4A 1VPXA 4IGHA 3R2GA 4ZE5A 4AX6A 3F4CA 2GGHA 3CT7A 4GY7A 4ATDA 4D6DA 4MZ1A 3L2MA 3PUEA 1B5TA 3UXDA 4Z1BA 1WOAA 3FCPA 4AVOA 4F40A 3IACA 3W6YA 4CVWA 4ZOCA 1DXEA 3CWOX 4CCCA 2D0FA 3HZ3A 1L6WA 1E4MM 3DCPA 4ZR8A 1ZB5A 4FSAA 1TWIA 1B3XA 3QC0A 2R1KA 3S9ZA 3GXDA 4H1ZA 1ZHAA 3UGRA 2OEJA 1KGUA 2E9MA 3GNXA 1UZHA 2X05A 1E43A 3PBWA 5LHFA 5CPSA 3LCIA 2ZVIA 5FSEC 4O0ZA 5I23A 5ABFA 4NAEA 3H2FA 1GK8A 5DELA 3KVKA 2FHFA 1R47A 4LWWA 1EJUC 1CNVA 4V27A 1YE6A 1LLWA 1CYGA 2W6RA 3TV8A 4D2JA 5FF7A 5F4WA 1QCWA 1Q4NX 3CIXA 1JCNA 4DWSC 1KM1A 4WDTA 1S2UA 2ZCGA 2NW0A 4TU1A 2V38A 3NQEA 3RUBL 1V6YA 1EYEA 3GR8A 1WZKA 3GU1A 2A6LA 1IEWA 4UTWA 2ISDA 3D6NA 2J4GA 6TIMA 2OZ0A 2OZTA 1NM9A 3LY0A 3B04A 3GG1A 3L0KA 3WNLA 4NRRA 2BXZA 4DM1A 4PFMA 4FXFA 1RD6A 1MFVA 4ILSA 1W1TA 5HQMA 2Z1BA 3QYQA 1I4NA 4PTDA 5D2TA 3FVMA 4JR5A 3WLPA 2E9BA 3S6TA 1QAPA 1H1YA 3WQ8A 1BQCA 5I07A 2ZWYA 3M0XA 3AJ7A 5EPDA 1AH3A 2CLLA 3CV7A 1M7XA 3VM7A 3AXXA 2UY2A 4A6GA 4NKCA 2NVDA 1MW0A 3WELA 2PDNA 2DUZA 2HNHA 1YYAA 1UPPA 3MMWA 2HDJA 3QM3A 5HPOA 1OGGA 1QI3A 2X2GA 1O1ZA 4C6BA 1XYMA 3WLHA 2CXGA 5AECA 1MFUA 3UZ5A 3SCUA 1V3HA 1XUUA 1PKMA 1EP3A 3BCDA 3WQOA 2HNEA 4WXYA 3UCDA 4E8DA 1DKWA 3IGUA 2Y7GA 1QATA 3BGAA 3CQHA 3WK3A 5A6LA 3TOYA 2MANA 2QAPA 3V4BA 1TUFA 3RGTA 1QPQA 4XD3A 2EHHA 3MI2A 4N4PA 1CGTA 1IEVA 3R6IA 5JH1A 1KV8A 1WNOA 1JZ2A 3CBWA 1UZ4A 4UR7A 2Z7KA 3E1F1 3VTRA 2O9PA 1NWUA 1O94A 4O13A 4HCHA 4I3GA 4ZQNA 5M03A 4HOZA 5CAHA 1VFMA 1XSKA 4O17A 3W2NA 1ZL1A 2XG9A 1BYCA 3A5VA 3T0CA 1A3WA 4JTTA 2FTWA 1QO2A 2P5NA 2YGYA 1F61A 5I0DA 9XIAA 2Y61A 3WLTA 1BGAA 8A3HA 1QPOA 3AXIA 4XZIA 3LTYA 3RMEA 3TVAA 3GTHA 3LQLA 3OLIA 1S3HA 1PIFA 1UROA 2Y4SA 1JPKA 4DZHA 2G3JA 4UMCA 4Y96A 3W7MA 1CGUA 4DWDA 4H8NA 3PZVA 4AU0A 4ML4A 4MVAA 4IQJA 1IT0A 2OPJA 4XZ9A 4YTQA 3UETA 1VC4A 1CZ1A 1EHAA 4KWSA 3VCCA 1MSSA 3KVJA 3F4VA 2V81A 1XLJA 4IXXA 3GKAA 3KL0A 2C0HA 2E5BA 2XSBA 4AZ7A 4OJYA 1CXKA 4CN6A 4W8BA 1QWKA 3C0SA 4JN7A 3PUGA 2A2IA 2PBGA 3GVGA 4M24A 3TP4A 3VKBA 1F05A 5CJ5A 4FXRA 3E2RA 4WLCA 1GZGA 4FK9A 3LA4A 1H5VA 3WNNA 1TO3A 4DJFC 3P8JA 1AUSL 3R5EA 3ANYA 5G1MA 3C86A 1FWWA 4NXKA 3WD1A 4JTQA 2OTDA 3BZGA 2J9XA 1LBFA 1PE1A 2Q8XA 3GNDA 3C52A 3PM6A 1TMHA 3ZSSA 2VC6A 2E09A 2F8QA 3C0QA 4IJCA 1YNQA 3QV8A 2Q09A 3NQMA 1OFQA 4X2PA 3BSMA 3I7SA 4D6IA 1W0MA 1CLVA 4MSSA 1Q8JA 2BVYA 1KKRA 3N4AA 2NQHA 4OOUA 4NI8A 3PTKA 4H4IA 2W61A 1UR0A 3UWUA 4US5A 4WDXA 4EPBC 5IRPA 4CD8A 2B0MA 3TUUA 2CWXA 2QF7A 4O1DA 3WN6A 1QO5A 4DYKA 3FDKA 1X6NA 3NO3A 4MNMA 2R8WA 1M5WA 1UUMA 4KFOA 1TPDA 3W38A 2ZRWA 3W00A 1MQRA 1FWCC 2ZZ4A 1E6QM 5T9CE