3VPLA

Crystal structure of a 2-fluoroxylotriosyl complex of the vibrio sp. ax-4 beta-1,3-xylanase
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
324
structure length
324
Chain Sequence
LDGVLVPESGILVSVGQDVDSVNDYASALGTIPAGVTNYVGIVNLDGLNSDADAGAGRNNIAELANAYPTSALVVGVSMNGEVDAVASGRYNANIDTLLNTLAGYDRPVYLRWAYEVDGPWNGHSPSGIVTSFQYVHDRIIALGHQAKISLVWQVASYCPTPGGQLDQWWPGSEYVDWVGLSYFAPQDCNWDRVNEAAQFARSKGKPLFLNESTPQRYQVADLTYSADPAKGTNRQSKTSQQLWDEWFAPYFQFMSDNSDIVKGFTYINADWDSQWRWAAPYNEGYWGDSRVQANALIKSNWQQEIAKGQYINHSETLFETLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-1,3-xylanase XYL4
publication title The crystal structure of a 2-fluoroxylotriosyl complex of the Vibrio sp. AX-4 beta-1,3-xylanase at 1.2 A resolution
rcsb
source organism Vibrio
total genus 135
structure length 324
sequence length 324
ec nomenclature ec 3.2.1.32: Endo-1,3-beta-xylanase.
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vplA00
1VIWA 3VTRA 4V27A 3D5HA 3WL0A 2GJPA 2WSPA 2IXVA 9CGTA 2WWDA 2WZEA 2OWWA 4HMEA 1LQ0A 1LL6A 2NSXA 3NIYA 3GNPA 1E6NA 4AIEA 3D3AA 1H1NA 1QI3A 5BRPA 3W82A 3AHVA 1BAGA 1UD6A 2WHJA 4D72A 1XHGA 3CO4A 2GK1B 1UWTA 3EMCA 3GTNA 3VGGA 2ZUUA 1LG1A 4CN1A 1I75A 2WCAA 2J47A 1CLVA 4W89A 2VX4A 1KBKA 4CCCA 3VMPA 2UY5A 5A2CA 3RDKA 5AC5A 2F2HA 3PZOA 5BXTA 4AIOA 2YA0A 1JZ6A 2CBIA 2VZTA 4V2XA 5A6BA 1DWGM 2BXZA 4CU7A 1HT6A 2J7CA 1TCMA 3BAIA 3WD0A 1PX3A 4MAZA 3WH9A 1QNPA 2O9RA 1GOWA 2W67A 1E40A 1OT1A 1UD3A 2XIBA 4E8CA 2CHNA 3NUKA 1KGWA 1UD4A 1R85A 4AD4A 2ZX6A 1FA2A 1CDGA 3WDRA 2WZIA 3SCTA 1HX0A 3WDQA 1MXGA 2YLLA 2YKKA 6A3HA 3PHAA 3SCOA 1C8YA 1OD0A 1TMQA 3OLIA 4AZGA 3VD9A 3O2LA 3IK2A 3WQVA 2YA2A 2WMIA 1FP8A 3AS2A 7A3HA 2V5DA 3VIPA 4F9JA 3BMWA 4W86A 4AZ7A 3SIMA 5KZ6A 4FMVA 1EGZA 5CZKA 4CGTA 2YL5A 1NOUA 5D9NA 3VOCA 1XH1A 1NP2A 4UZUA 2VVNA 2ZICA 3N17A 4TVCA 1NH6A 7CGTA 3ARRA 5F7UA 2Z1SA 3ZT6A 1CENA 1CGWA 2J7BA 2X0YA 2E40A 1WO2A 3ZOAA 4H7VA 3AHYA 3SURA 4MTVA 3W38A 3MANA 1EQCA 5A6LA 4HZ7A 3KL3A 5HBFA 1UH4A 2DT1A 3L4WA 3RIKA 3VDBA 4B3LA 4ACZA 3VIIA 3QHNA 1CPUA 3VGHA 3WQWA 2FH8A 3CLWA 2VZVA 3N13A 3AFBA 4WSJA 1VJSA 2CBUA 4JFUA 3AS0A 4AZCB 3PZIA 1VEMA 4ZENA 2WHMA 5E09A 4UFHA 5GPRA 1WDPA 1E6RA 2NT1A 3ZJ6A 3TONA 1NWTA 1B3VA 3N9KA 3VILA 4PTWA 1M53A 4PYSA 3EYPA 4MNLA 2CBJA 3GBEA 1SMAA 4UFKA 1HVQA 1UKQA 2ESCA 3TOPA 2CXGA 3WD3A 1J18A 4ATDA 4FF5A 5A1AA 5CSUA 6CGTA 4Q7NA 4TXEA 3VIFA 3GXFA 3PZGA 3SCRA 1HL9A 1RD6A 1E73M 1D7FA 3GDBA 4AYSA 1JDCA 1UKPA 1QNQA 4QFUA 5CGMA 1V6XA 1V03A 1VFMA 3ARTA 3BAJA 4FLQA 4NRSA 4AD2A 3CMGA 3ZO9A 1HNYA 2EPNA 3U7VA 1DWHM 4JAWA 1OWQA 2W61A 3S6TA 4ACYA 4AW7A 1N82A 2NW0A 2BY3A 2OYKA 4D6FA 2UY3A 1LWJA 1OB0A 2D23A 2DDXA 3WNKA 2CIPA 4AEEA 1LLOA 2WMHA 1UR9A 2D24A 2QMJA 1HKIA 4M29A 4M80A 5A6BD 3WF2A 1HL8A 7TAAA 4DWSC 3T2QA 3KEHA 1ISWA 1E3XA 1CTNA 1TG7A 2WXDM 5IHRA 3VUPA 1KGUA 3GZAA 2BFGA 1J12A 2DT3A 1K9TA 1P6WA 4R5EA 2Y24A 1B30A 1MXDA 2YDQA 1WDSA 2E9LA 3W27A 3WQ4A 1QI2A 3W53A 3I3BA 4LXFA 1J0JA 2YOCA 2EJ1A 3WFLA 3WDPP 3ZJ7A 1OINA 3E1F1 1UA3A 2BY1A 4ZFMA 3W4RA 1OD8A 1EOMA 4E4PA 1EOKA 1BLIA 3NSMA 1KWKA 3O9NA 2VX5A 4DUWA 2WLZA 4PTMA 3ZR5A 3WBAA 2PWHA 4H8VA 1HJSA 4EAMA 1KR1A 4YN5A 5A8MA 3T2PA 5A6JA 4UCFA 5JUVA 1QW8A 1OM0A 1Q4NX 4PRWA 1VRXA 2DSVA 1B1YA 4U5IA 4TX6A 1W1TA 2J4GA 3I3DA 1ISYA 2YIHA 3L4XA 3GXDA 1KWGA 1HP4A 1KB3A 1EIBA 1TVPA 2DSUA 4UQBA 2C8NA 2WVVB 3ZM8A 2BV9A 1W32A 3BLPX 5CPTA 1JXKA 5D4YA 1BVNP 4IISA 5LYRA 3ZMRA 1FH9A 1ECEA 2D1ZA 4P7LA 5EFDA 4LX4A 4MNKA 4HOWA 4EE9A 3VD5A 2VQUA 1LL7A 3PZNA 1W1YA 4M1RA 2XIIA 2VRJA 1E1EA 3VO0A 3W29A 4MB1A 5M03A 1R7AA 4ATWA 4EANA 2WBKA 4YHGA 4CVWA 3CZLA 1U30A 3WMCA 1CXIA 1UWRA 1K9DA 2D20A 1UKOA 3N11A 1XRVA 3TTYA 3KL0A 4FLOA 3M07A 3TTOA 2XWDA 4X0VA 1B3YA 1GOMA 2WMKA 3HU7A 4WIWA 5CSYA 1MQQA 1HN1A 1E15A 3LMYA 4PMQA 4CD4A 3KE0A 4KMQA 4D1JA 5BXPA 4LQ1A 1VFOA 5I77A 2JEQA 2X8RA 4PSPA 2X2YA 5FOOA 2VCAA 5CPSA 1UWSA 1C7TA 3VKKA 2VCCA 4W5ZA 5CXPA 2ZIDA 1OSEA 2AAAA 2CBVA 1C90A 2O9TA 3NSXA 4PCSA 1C91A 1RPKA 2WAGA 5M3WA 4CD6A 4HZ8A 2DSKA 3AZTA 5CPQA 5A2AA 5A95A 3VMOA 1CECA 4KRTA 1IZJA 1SYTA 3WMBA 3K1DA 3K46A 4CN4A 3T0BA 2WHLA 2J77A 4H8UA 2XM2A 1UOKA 1V0LA 3SUVA 3CZEA 1FFRA 5D9MA 3AMGA 1MW0A 5DFAA 1B90A 1WNOA 3G6LA 4HPHA 1H3GA 4ZXLA 1NWUA 2G3JA 1DWIM 1EHAA 3AISA 3CUIA 3ARZA 2WLYA 1VEOA 2WCGA 3B8SA 4IPNB 1Y7VA 1J0YA 2D0GA 1KQYA 4BF7A 1QNRA 1QHZA 3NCOA 3WH6A 3PTQA 4PTVA 2PWGA 4W8LA 3AIRA 3LPFA 1JFXA 5DF0A 4AZCA 3OZOA 1SFSA 3SCNA 2ZWZA 3OLEA 1DEDA 3VNZA 4A3YA 1BQCA 1FOBA 1Q6CA 1DWJM 3AOFA 1PIFA 3CPUA 2DSZA 1XCXA 2V3EA 3WF0A 1W2PA 1VF8A 2F61A 2XVNA 4H2CA 4WKHA 3ZSSA 2O9PA 1VENA 4M8UA 1UZ4A 1OBAA 3NYDA 4MJ2A 1W91A 4EK7A 1XGZA 1UUQA 1E55A 4XX6A 1HJVA 3CTTA 4UOJA 2PB1A 1A3HA 2QPUA 1F4HA 2WANA 2BXYA 1NQ6A 5HNNA 1UR8A 3K4AA 4U5KA 3QOMA 4AD0A 4WF7A 3UG5A 5FD0A 1W1PA 3L4VA 1R7OA 1W3HA 4BCEA 2PWDA 4CD7A 1EO5A 1BYCA 1VFUA 4Q22A 3OG2A 2XJ7A 3GH4A 4D6IA 1BTCA 4QLLA 1XV8A 1JDAA 2V3DA 1KGXA 4DUVA 2HVMA 1VAHA 1WKYA 3ZT5A 4YPJA 4ML4A 4BA0A 2GJXA 1FH8A 3AYRA 3DYOA 3LPGA 1DWAM 3A3HA 4GZEA 4XUYA 3A4XA 1HKMA 5E70A 1Z32X 3BGAA 5M17A 3CZGA 3TP4A 3BAYA 2CERA 2W91A 1E5NA 4Z2LA 3GYCA 5DEZA 5EB8A 2CITA 4CVUA 5ABHA 1ZJBA 1CGTA 2DGAA 1HKKA 1G94A 4R27A 4W85A 3QR3A 3U5UA 2YBUA 2ZX7A 1PZ3A 2W66A 1CGUA 4CCEA 3MSDA 4JZ5A 4HMCA 4NSBA 3IAQA 2IUZA 5A6SA 1GOOA 1UR2A 2W5FA 5DT7A 3EMZA 2VZSA 1SR0A 4OOUA 1GUVA 1V0KA 3PZMA 1TFVA 3VIGA 5A8QA 4UQEA 3POCA 4D6GA 1AQMA 1NWSA 5AY7A 5BRQA 3CIVA 3F5LA 3FAXA 3WD4A 3U5YA 4WJXA 4U3CA 1E0XA 1WAWA 2EBNA 4TOQA 5GQBA 1V0NA 3RMEA 3G6MA 1MW1A 3DHUA 3BCFA 2WVVA 5CLWA 2PBGA 4U33A 1ESWA 3ARPA 2W63A 3APGA 3WUBA 1W3JA 3WD1A 4UFJA 4QLJA 4BQ2A 5CQ1A 2XTKA 1PX8A 1WZKA 4GPNA 3GNRA 3VM5A 1JG9A 3ZT7A 3BSGA 2W92A 2EPLX 4FLRA 4UOQA 2DSWA 3WFZA 1LL4A 5BXSA 3MMUA 5D8WA 4AZBA 3EDDA 2DIJA 1QW9A 4HA1A 3T2OA 4IM4A 3GBDA 3A4AA 4ATLA 3WF1A 1H5VA 4QCFA 1WZAA 3CUFA 1PEZA 3AXIA 1ZBVA 3W0KA 5I6SA 4D6CA 4PMVA 4FK9A 1UQZA 1EQPA 4PN2A 2RGLA 3WH7A 3K8KA 3WF4A 4H04A 4WLCA 3THDA 2X1IA 3II1A 1E72M 1HVXA 2A3BA 1E4LA 4GKLA 2C7FA 5E0FA 2OWCA 5BWFA 3VPLA 1S46A 2XHYA 8A3HA 3BH4A 5ABFB 1V6WA 4P7OA 1RH9A 2V5CA 3WD2A 5FL0A 1I1WA 4CD5A 5AYBA 1E6ZA 1UZ1A 2CPUA 3BXWA 1GQKA 3UCQA 2FDMA 1E56A 1H0IA 4F66A 4B15A 4B16A 1DHKA 3M6DA 3AZRA 2DT0A 1J11A 4WKAA 4D6EA 2J7DA 3K4DA 2YL8A 2FHBA 4F8XA 1JYXA 3WQ8A 4PMZA 1YHTA 2G8ZA 3W26A 2YA1A 1MFVA 4LYQA 5E6ZA 3WH5A 2FHCA 4F9DA 2J8FA 1GCYA 4J3XA 2OLHA 3ALGA 3WNPA 3ARWA 2EO7A 2VL4A 3U7BA 1E0VA 4W7UA 1JD9A 1E5JA 4J3WA 2A3AA 3QOKA 3ZIZA 4CKQA 1KBBA 1B0IA 4NI3A 1TVNA 4UR9A 1BFNA 1BSIA 1FP9A 1M04A 2OWXA 2DH3A 3L2LA 4CU6A 4QLKA 1UA7A 3B9EA 3UR8A 1G9HA 1D2KA 2W62A 3EBVA 3WNLA 4JIEA 2JF6A 2GDVA 3OBAA 3GH5A 4JCMA 1QI0A 5ECUA 1AMYA 2E9MA 3UETA 2VO5A 1BYDA 4J27A 1M01A 3CHEA 3N15A 3K8LA 2PF0A 2VT0A 3SCSA 3WBEA 3CZ8A 1GJUA 1V6YA 4PUEA 1UR0A 1H4PA 1B9ZA 1G01A 2OSWA 1GVYA 2EPMX 3BSHA 3POHA 4OOZA 1BG9A 1NWRA 3AHXA 3GXIA 1BGGA 4AD5A 3VVGA 5DMYA 3CGTA 1DWFM 4M56A 2PWFA 1PPIA 3F5JA 1KCLA 5DO8A 1XC6A 2FGZA 3WNOA 3ZQ9A 1M7XA 1UYQA 5A6AA 1B3ZA 4LGXA 4Z2GA 4CCDA 4GI6A 5IFPA 5A2BA 2PBOA 1EDQA 3FN9A 3OLGA 3CHCA 1OT2A 3UERA 1CXLA 1ODZA 1NP0A 2XUCA 5JBDA 1UD5A 2CETA 2VI0A 1O7AA 2GJXB 3AZSA 2Y8VA 1DP0A 3THCA 1EDGA 4KH2A 1JZ2A 2W4XA 3L4TA 1JYWA 2VNCA 1R87A 4MNJA 1QVBA 4RE2A 3WH8A 1WE5A 1WCGA 4J3TA 1GHRA 1M03A 4AZ5A 1X1NA 1UKSA 2V3FA 3NDZA 4U31A 2UWFA 2FH6A 3VIJA 2CKRA 4P7QA 4DM2A 3UR7A 4LYRA 4M24A 5I78A 1AQ0A 3SUWA 1K9EA 4QP0A 4TX8A 4P8XA 1JI1A 1US2A 4HTYA 4KRUA 1SMDA 5IFTA 3MMDA 3WSUA 4H8HA 1E6QM 2CNCA 3WQ6A 1US3A 5GNXA 3AMKA 2ZUNA 3ARQA 4CU8A 1E4MM 4GINA 1UWQA 3ARVA 3PN8A 2VUYA 3AYSA 4JCLA 3ARXA 1UWUA 4JFTA 2AOSA 1GQLA 2JIEA 3AIQA 1FFQA 4P7NA 2EPKX 1NOFA 1WDRA 3T0AA 1CXFA 2XYLA 3DHPA 5I79A 4C7DA 3AIVA 5GNZA 2YDRA 3ECQA 4EKJA 4PMNA 1CIUA 3AI0A 2E3ZA 4JKKA 2CKSA 2OSXA 3PZ9A 3FHQA 3ZR6A 1GPFA 2B31A 3SCUA 1A47A 2ZUMA 1UKTA 1E0WA 2GFTA 2J7EA 2VC9A 3BAKA 3SUUA 4X0NA 5CGTA 2WCSA 1W9UA 3NJ3A 4A4AA 2BVTA 4GI8A 4W5UA 1W9DM 4PEEA 3AHTA 5E0CA 3VGEA 2VZUA 4QDMA 1JF5A 3VGFA 4HPGA 1OGGA 2QPSA 4HOXA 1ZBCA 1C3FA 1QI5A 2BHZA 4AZIA 5C71A 2J78A 2X05A 3UESA 1L0PA 4GQQA 5I23A 1V3HA 3ARUA 5JIPA 3CHDA 3N18A 3RO8A 1UHVA 2GVYA 4JKMA 1AQHA 1RP8A 3L4UA 3W6MA 2VMFA 2XGBA 5EMYA 2WW5A 4UTFA 3RM4A 4J7RA 4S3KA 4HMDA 2A3EA 1H2JA 1GORA 3EDJA 1ZBKA 8CGTA 2VJXA 2PWEA 4U3AA 3BAWA 3VX0A 3WL1A 2ZXBA 2YDSA 3RM8A 5ABFA 1MW2A 3AMDA 5I3DA 2QMKA 2ZUTA 4HA3A 1W2VA 2YJQA 4XB3A 5CLTA 3RCNA 4HU8A 3RJYA 2XPKA 3BMVA 3AIEA 4B9ZA 5CJ5A 4ZEPA 4TVDA 1V02E 1G5AA 1JGIA 4XV0A 2WYSA 1H49A 1W9VA 1QBBA 3A6OA 1V3IA 5ABEA 4D1IA 2TAAA 4JHZA 1UG6A 3DYPA 5HPOA 1QHOA 1XCWA 1MWOA 3AQUA 1UWIA 2WVUA 3EDFA 2X09A 3MS8A 2VCBA 2IXUA 2CESA 2XVLA 3HN3A 2J25A 1CGYA 1QPKA 1ZS2A 4PMOA 2Y2WA 1JZ3A 1VFFA 1LG2A 5I5RA 1PX4A 3J7HA 3ARSA 4TUFA 1VBUA 3QHMA 1G0CA 1E9LA 1GVIA 4ZE4A 1WB0A 5EFFA 2ZX9A 1EH9A 4JFVA 2UY2A 1GQIA 4KGJA 1OIMA 3KWXA 3AMLA 3PZTA 3GM8A 3AXHA 1Q6DA 2G3MA 3CUHA 1BPLB 1ZL1A 4MDPA 4JFWA 2GSJA 2A3CA 1E70M 3IJ7A 2E8ZA 3A47A 3MUZ1 3HMCA 4PBGA 5BCAA 1O6IA 2PC8A 3WEZA 1BGAA 4AY1A 2OYLA 4LPCA 4AEFA 3VNYA 3RPMA 5A6KA 1NM9A 1TA3A 2V3GA 1J0IA 1WZMA 3WN6A 2ZWYA 2GUYA 1YQ2A 1K6AA 4CUCA 1CGXA 1HJQA 2J79A 1X6NA 3VIHA 1K9FA 4KGLA 1QBAA 4WSKA 1LWHA 3QGVA 4Z2KA 2VOTA 4XZWA 4N42A 3VINA 1JYNA 4GO8A 2WKGA 1IV8A 2XG9A 2JE8A 3AXXA 5A69A 2GDUA 3FHAA 3SEPA 2VTFA 4MADA 3WMSA 2WM0A 3VU2A 5E6YA 3DYMA 2DQXA 3SUSA 1H11A 4TVUA 3VGBA 2XVGA 4HA4A 1LJYA 4V28A 1J0HA 1W3LA 4A3HA 2VRKA 2G3NA 1QNSA 3W24A 4JL1A 1W9XA 1QNOA 1V3MA 3F4VA 4M82A 3WDIA 1W3KA 4W7VA 3N12A 4AXNA 1FH7A 3ZJKA 2ZXAA 5BYWA 5I2UA 4MPKA 1E43A 4OKDA 1W9BM 2ZOXA 2WSKA 2VRQA 3WQ5A 2O92A 2WMJA 2WC4A 5A6MA 3L4YA 1PJ9A 3AROA 1HP5A 3RM9A 4PMXA 3AIUA 4PTXA 3TTQA 1OIFA 4IPLA 3N1AA 2UY4A 5D9PA 1E71M 4RE4A 2EQDA 5IDIA 3TA9A 4IUGA 4BQ5A 1ZJAA 2ZUVA 4AZHA 4MJ4A 1XSJA 4ZE5A 3ZJ8A 5C8BB 1MQRA 1V02A 1VJZA 1WZLA 2JIWA 3L4ZA 1EDTA 1AVAA 4WKFA 4MB5A 1KR0A 3FAWA 2G3IA 3T08A 1BF2A 3CH9A 1KXQA 1Q6EA 4OBSA 6TAAA 4W7WA 3VM7A 3DECA 2Q8XA 2XFFA 3AS1A 2ZUSA 2D22A 4HOZA 2J75A 5IXEA 4AD1A 2XM1A 3NSNA 2WVTA 4H41A 3VDAA 1E4NA 3BLKA 2OSYA 4W87A 3QHOA 4AZ6A 1JAEA 1GZJA 4DWSA 3K8MA 1UR4A 3FW6A 4B9YA 3OZPA 1DTUA 4B3KA 2G41A 3W28A 2E4TA 3UG4A 1HIZA 3WF3A 3W6LA 1OCQA 3ZSTA 4PMYA 3ALFA 5A8PA 2BS9A 1ZU8A 2VX6A 1C93A 2WMGA 1UD8A 3B9AA 3FNDA 1CGVA 3F5KA 3WDHA 3IJ8A 2Y8KA 4UQ9A 1MVYA 4PCTA 4UFMA 3UEQA 3VD7A 5A8OA 1CEOA 1F4AA 4GZJA 1XYZA 3PZVA 3T09A 5ABGA 2WNWA 2J7GA 5IHSA 3IAPA 1ISVA 4UNIA 1JD7A 5I0DA 3WNMA 1BYBA 4JFSA 1IZKA 4X9YA 2CHOA 2XFRA 1PAMA 3EDKA 3AHZA 1JFHA 1CXEA 1QI4A 4N0RA 1B3WA 1KXHA 4D6DA 4BS0A 3WIJA 1ISZA 2ZX5A 2WWCA 4Z2IA 2EEXA 1EXPA 2GJRA 5LA2A 1JI2A 2DIEA 3MV01 1KXVA 4AD3A 2BNJA 3NDYA 2WMFA 4QCEA 4UZSA 4AIUA 1QHPA 4DM1A 1C8XA 1J0KA 3L2MA 3SCQA 2QHAA 4GQRA 1GHSA 2PI6A 3LPPA 1V6UA 1PZ2A 5D8ZA 2J7HA 4S3JA 2VX7A 4W8BA 1GNXA 1H41A 1CYGA 3UG3A 3WUGA 1MQPA 3PTKA 5JBFA 1NOWA 4U2ZA 4W8AA 4P7RA 4UQAA 3FXYA 4KWUA 3GH7A 3OB8A 3VDCA 4JHOA 2JFEX 4AC1X 1GQJA 1TA3B 4TTUA 5A8NA 3WENA 2YLAA 1JZ5A 1JNEA 3N04A 1VBRA 1XD0A 5JIWA 1UH3A 4J3VA 2XSAA 3VMNA 1E6PA 2XGIA 5A94A 4FLSA 4UQDA 3VGDA 1E3ZA 2D0HA 2V38A 5HPCA 1JXJA 4ZXOA 1B2YA 2O9OA 1E6XM 3HJEA 3RILA 3MO4A 1D3CA 1KCKA 1PBGA 2ZX8A 1JL8A 1B31A 3GXMA 3JUGA 3GNOA 2Y5EA 2HISA 2J8GA 1GOQA 4P8UA 2BHYA 4PMDA 3MV11 5BXRA 4WK9A 1XSKA 4PUDA 1V6VA 2ZUWA 3MUAA 3WELA 3MSGA 3WUFA 3VIMA 5LA0A 3TTSA 2OYMA 4JL2A 1JNDA 3W25A 3B9DA 5D9OA 3OIHA 5AYIA 2EXOA 1HJXA 4DWSD 2YL9A 3WDJA 1R8LA 1JDDA 3EMQA 4OJYA 1L8NA 2CYGA 2WBGA 1KQZA 2BY0A 2J62A 4C7FA 2YBTA 3PTMA 2XWEA 3AS3A 1OGSA 2WPGA 1GW1A 4DUXA 4AISA 1V3LA 2XSBA 4M81A 4PMUA 3WEOA 4CD8A 1XH0A 1JZ8A 1W9PA 5M5DA 1EA9C 4PMRA 4W88A 4F79A 3M46A 1J0ZA 1EHNA 4E8DA 4E2OA 1BVZA 3MUY1 4Z2HA 5HOSA 4UOZA 2J74A 3ARYA 4AMCA 2GK1A 2WZHA 1OGBA 1HF6A 2WC3A 4C7GA 1IT0A 1J01A 1E6SM 2VQTA 1R86A 4NF7A 1LF1A 2EPOA 2E0PA 1GOIA 3DC0A 3WEMA 1V3KA 2F8QA 2XFYA 3IJ9A 3MU7A 3SCWA 3VX1A 4BQ3A 5A3HA 1B3XA 4OIFA 4DWSB 5KEZA 3AJ7A 3MMWA 1ITXA 2XVKA 3PBGA 5FL1A 2E8YA 5JBEA 3MUIA 4OBRA 2WKLA 3BAXA 1TZ7A 4P8WA 3BC9A 1C7SA 2VZOA 2JEPA 5FKYA 3OGVA 2DPEA 1E4IA 2CCRA 2E9BA 4J28A 1CBGA 1PIGA 5I24A 5LA1A 1H09A 1JAKA 2BVYA 3CHFA 3I3EA 4L4PA 4MB3A 2MANA 4JKLA 1ZB5A 4UFLA 3IANA 1TUXA 2WMIB 1JYVA 2BHUA 2WK2A 1RP9A 5FCZA 1EO7A 2D0FA 1VEPA 4AWEA 4GIAA 1ITCA 3WUEA 3PZUA 1C92A 1HKJA 1Q6FA 4Z2JA 1MW3A 1CWYA 1UQYA 4HU0A 2Y4SA 2QV4A 2QLYA 1BYAA 4D6HA 3LPOA 2JALA 4L4OA 1KXTA 3W37A 2WB5A 3EDEA 4D71A 1J10A 4QAWA 4BQ4A 3T0DA 5HXMA 3O6AA 3AMCA 1GOKA 1VB9A 4XZBA 3VD4A 1QOXA 2Z1KA 2FHFA 1ISXA 4LYPA 2FGLA 1WP6A 1JZ4A 3CBWA 4PSRA 2X0HA 1V0MA 4RL3A 1ZBWA 4HZ6A 4W93A 4TTGA 1V3JA 3VDHA 1NARA 2XVPA 4ACZB 2C0HA 3RJXA 3W81A 4K68A 2NT0A 4MB4A 5GNYA 1JF6A 3OLDA 3BCDA 2BY2A 4MNMA 3CUJA 1Q6GA 2ZE0A 4J3SA 4Y7EA 4J3UA 4W84A 4GI9A 3OGSA 1GONA 2VR5A 1C8QA 3OA5A 3CZJA 2WVSA 1W1VA 5DT5A 3CUGA 2VR4A 1MYRA 3A4WA 1U33A 1UD2A 3SCPA 5BROA 4URIA 4OZOA 1XD1A 2YL6A 5C70A 1E1FA 4UQCA 3SCVA 5AC4A 4UFIA 1TR1A 1GJWA 3PZQA 3M7SA 3VIOA 3CZKA 3VD3A 1WDQA 3WNNA 1XYFA 1HJUA 1JIBA 4D6JA 1UR1A 1BHGA 2D2OA 5CG0A 4GO9A 1BG4A 3WY1A 1CXKA 3CMJA 4RE3A 2ZXQA 4HP5A 3KL5A 2DEPA 3S2CA 1CNVA 1WPCA 4NZCA 1H0GA 1MFUA 2DH2A 1V08A 2WC7A 3KZSA 4MAVA 4U2YA 1TE1A 5HDRA 3AIBA 5FIPA 1XSIA 1HJWA 2ZXDA 4CN6A 1FHDA 4OUEA 1CXHA 2CEQA 1KFWA 4BZYA 2VVSA 1X6LA 4YHEA 3AIWA 4GZIA 2RGMA 4MDOA 1I1XA 3WKZA 4P8VA 2VURA 2QF8A 3VIKA 2WHKA 2JF7A 4NRRA 3FY1A 3SUTA 2DT2A 1CZ1A 1XH2A 2J7FA 5E9AA 3MKKA 2BVDA 1G1YA 2AMGA 3AICA 1JZ7A 1J9YA 1U2YA 3U57A 1UH2A 5EBAA 1CLXA 2G4FA 4GXPA 3OGRA 1ODUA 2D3LA 1HXJA 2A3HA 1FHLA 2D3NA 5TD4A
chains in the Genus database with same CATH superfamily
3BJFA 3VTRA 1GWJA 3D5HA 4V27A 1AW2A 2WSPA 2BX7A 2JKEA 3P7YA 2X7WA 1X7FA 2WWDA 4O1DA 3W7MA 1LQ0A 2NSXA 4U10A 2C0AA 5J8LA 3M0IA 4WY0F 3GNPA 5DMLA 3NM1A 2QQ6A 5HQEA 1QI3A 3AHVA 3D6NA 4TV6A 3WLIA 4A8IA 1RCXB 4D72A 2TMDA 2BWGA 4G9PA 3GTNA 4CN1A 2J47A 2OPJA 1WKEA 4J4KA 2VX4A 1KBKA 1GG1A 4CCCA 1KTNA 4NZ1A 1ALDA 5A2CA 3QQ1A 1W17A 3RDKA 3G1RA 2YA0A 3EWWA 3EX1A 3KRSA 1RJRA 4V2XA 5A6BA 1DWGM 2BXZA 1DXFA 1FHUA 2GYIA 2BB0A 3SW6A 3PUOA 1KM6A 1XIIA 2ALRA 4O8AA 2QF7A 4K3ZA 3BAIA 2PODA 2E5BA 2E5DA 4GVFA 4A8NA 2CHNA 3NUKA 5HANA 1R85A 3UJ2A 3W85A 4AD4A 1FVPA 4RK8A 7ODCA 5JH1A 4K36A 2V2DA 5I07A 3WDRA 4XTDA 4I9TA 3PHAA 1RQEA 4GIRA 1U5JA 4NYYA 2Z25A 4WRHA 2J6XA 4NX5A 3TYBA 3GVVA 3BV7A 1P7TA 3CWNA 3VD9A 4WOZA 3UGVA 2WMIA 4PC8A 7A3HA 3M5YA 2V5DA 2POTA 4AZ7A 5KTLA 5KZ6A 2FYMA 4FMVA 4Q8VA 2GGHA 2DVTA 4ZB0A 4RZBA 2YL5A 1NJJA 5D9NA 3FVMA 3TC7A 5LSMA 1TREA 4KPLA 3VNLA 4I8DA 1F9CA 3N17A 4TVCA 4Q8MA 4IG2A 3ARRA 3MVIA 1F3XA 5F7UA 4PULA 4GYKA 2X0YA 1A0CA 3ZOAA 2WKJA 3ZVHB 1M3UA 3AHYA 3R10A 1KBLA 2GUUA 3W1MA 2ZZ1A 2DT1A 3RGTA 3H4WA 3BOXA 2W3ZA 4C5ZA 3W7IA 2FH8A 3MT1A 3QRHA 4PA8A 3LEPA 4JD4A 4WSJA 4AF0B 3CAVA 4JY8A 4AZCB 4GOAA 2E68A 1U83A 5HMDA 3WJSA 4LUTA 4ZENA 5E09A 1AZ2A 2OKOA 1S3TC 4HJWA 3FA3A 2FFIA 4K1WA 1OYAA 3LQGA 4S3FA 1NWTA 1B3VA 4PTWA 1LBFA 3EYPA 2CBJA 4FI4A 1SMAA 1H50A 1XLEA 2CXGA 2OT0A 3QPEA 5LNVA 5DX7A 1JCTA 1J18A 1N8WA 3GZ3A 3NQBA 5A1AA 1BKSA 1L6GA 3IUDA 2DW6A 4Q7NA 4TXEA 3VIFA 3GXFA 3QZAA 1HL9A 3GU9A 3MC5A 3O05A 1UW9A 2YR1A 3CO8A 1RV8A 4GNKB 2ABBA 4HMNA 4HQVA 3NL3A 3GDBA 2I14A 3KDOA 1JDCA 2OOGA 2ZZ3A 3ARTA 4AD2A 4NZ3A 4LNCA 4H1ZA 4CNOA 1DWHM 1OWQA 3QXBA 1HG3A 4O16A 4QG9A 4O0QA 1LWJA 3WNKA 2DDXA 2WMHA 2BGNE 3T42A 2D24A 4O1EA 4V1XA 1HKIA 3MHFA 2PU1A 3KRUA 2E7FA 4M80A 5A6BD 4G7EB 7TAAA 3TN5A 5CBIA 3T2QA 1EGVA 4AWSA 3GXTA 1CTNA 1TG7A 4RUBA 3IK4A 4MWAC 3DERA 4OVXA 1P6WA 1XLCA 3JU2A 3I7SA 3WQ4A 3W27A 4K7VA 5LIXX 3DFQA 1GJPA 3WDPP 4JBRA 1IGSA 1TZ9A 2V67A 3JZUA 2ODOA 4W9TA 3GFZA 4FNQA 4E4PA 2JK2A 4JEJA 2WLZA 1FUYA 3F4DA 4PTMA 1VP5A 2VUNA 4NL1A 3QKEA 1KR1A 4YN5A 1WA3A 3T2PA 1GZ1A 1S2VA 4PRWA 4QNWA 2HNHA 1T7LA 1KM5A 2DSVA 4U5IA 4C6EA 4IX0A 1YXYA 2R91A 1W1TA 3VAVA 1XM3A 4KERA 2YIHA 3GXDA 3ITLA 3L4XA 1KB3A 1TVPA 4JYFA 3ABSA 3WCZA 1BF6A 1OYBA 3TXVA 4IISA 4HNNA 4H6KA 3ZR4A 4AB4A 1TUFA 3I10A 2P0IA 3CB8A 1LL7A 4IQEA 4NXSA 4R7OA 2EKGA 2JGYA 2BOGX 3TLLA 4MB1A 3FOKA 4ZFCA 5M03A 1R7AA 3KFTA 3WFAA 4MYAA 5EMMA 4N6EA 3CZLA 1U30A 2I17A 1TPB1 3PJTA 1IT8A 1UKOA 1XRVA 1SO4A 4GACA 1EJXC 4CNTA 3CB3A 1YRRA 1B3YA 3HU7A 4WIWA 4B5VA 5CSYA 3GU2A 1E15A 4REQA 5I77A 1UPMB 2X8RA 3NQEA 1HKVA 1TV4A 1WV2A 3Q65A 3LCWA 7TIMA 2VCCA 4EPKA 3DAQA 2P5NA 2QIWA 1DIKA 4PCSA 3K2GA 1GEHA 1NVMA 1W0MA 2DSKA 3AZTA 5A95A 1CECA 1EF3A 2FZDA 3CQIA 3O1NA 1H60A 3WMBA 2QYGA 4CN4A 2WHLA 1W56A 3EKLA 1KTBA 4HNCA 3ZYZA 4MZ1A 5I3JA 3LRLA 3CZEA 1FFRA 4L6DA 1SJBA 3LN3A 3LK6A 4E2BA 1MW0A 4XKMA 4HPHA 4LAKA 4ZXLA 3B3DA 3CUIA 3ARZA 2WLYA 4O54A 1KQYA 1NFPA 5DQPA 3PTQA 3RX4A 2PWGA 2ALDA 3VC5A 3HQNA 4H3DA 5DF0A 3OZOA 3HMJG 1BQCA 4GUHA 4JTTA 3LCLA 1FOBA 3AOFA 5D2YA 4GZ7A 3CPUA 2DSZA 3UCCA 3WF0A 1W2PA 4WKHA 4H2CA 1L8PA 1EWDA 2O9PA 3MDWA 3S2LA 3GRIA 4MJ2A 1W91A 3WG6A 1XGZA 2B81A 2HE8A 4DJFA 4XX6A 3CTTA 4OECA 1A3HA 1F4HA 4QG8A 1UC5A 2DY3A 3LLDA 3K4AA 4WXYA 3QOMA 1DJNA 4LOCA 4QS5A 3HV9A 1WUEA 3UG5A 3C0LA 2WM1A 2C91A 4ZQNA 5AC8A 1T41A 1W3HA 4O53A 2XH4A 2NLIA 1ITQA 1EXBA 1XV8A 1JDAA 1EX5A 1OZQA 1P0KA 3F2BA 1W6TA 4HGXA 1RR2A 2XN2A 4JNZA 4BA0A 4HU3A 3EA1A 3L65A 2GJXA 3LHYA 3BLOA 4E2VA 4US5A 1FH8A 3L0GA 4J5NA 3CYVA 3A3HA 5H8PA 5M17A 3CZGA 5FI8A 4RPQA 1XIHA 1E5NA 1Z44A 3GYCA 5DEZA 3BLFA 4CVUA 4ORIA 2VGFA 1YX1A 3AYTA 1X8FA 1HKKA 3LHVA 3W22A 2ZX7A 1PZ3A 2W66A 1CGUA 4JZ5A 4HMCA 2Z2BA 5MHBA 3IAQA 4Q7BA 2IUZA 1NEYA 2HS8A 3ABZA 4LVFA 3EMZA 1AH4A 5FF4A 3EA2A 2YBVA 3QGKC 1EFZA 4Q8NA 1TFVA 3TW6A 1IXQA 1R2SA 3L5AA 4PUJA 3TMQA 4UQEA 1Z8AA 4NZ4A 1NWSA 4O4VA 4LNYA 2QEZA 2IKIA 3BSMA 4H9ZA 5M1TA 2V82A 3CT7A 2EBNA 4IMEA 4TOQA 1JPDX 3G3MA 1QO2A 3GTIA 5CAKA 2REQB 3N2MA 1P6BA 3T0TA 2WVVA 5AHMA 4IL2A 5CLWA 2NQLA 1WDDA 1LQ2A 3WUBA 4UFJA 3RLUA 4BQ2A 4IIEA 3BW2A 2ATMA 3MTWA 1PX8A 5C2GA 3WO8A 3VM5A 3TJIA 4XZ9A 4LAUA 3IIZA 3DCPA 5DELA 4LUIA 3WFZA 3EOSA 1TMHA 3MMUA 3C2VA 3QSRA 1QW9A 3NQVA 4HA1A 4IM4A 2WNZA 4REQB 3WF1A 3W0KA 1VPYA 1TPH1 4FK9A 5D02A 1B9BA 3K8KA 3R0DA 1J79A 4NNBA 3I6TA 5E0FA 5BWFA 4S3CA 1S46A 2XHYA 3KTCA 5G5IA 4NZ5A 1XIJA 4DJFD 3PSWA 3ZFHA 3GLCA 4O52A 4CD5A 1UZ1A 3UCQA 5J5RA 4CLMA 1RQHA 4N02A 1H0IA 3F4NA 2PDWA 3KOXA 4OQVA 3W1LA 4B16A 3M6DA 2DJLA 2WO5A 1J11A 2P8CA 3R79A 4WKAA 4R9OA 2OLSA 1VKFA 2OZ3A 2YL8A 2FHBA 3RK8A 1A5KC 4PMZA 3SB0A 3G24A 5GJMA 4R3UA 3H7VA 1TMLA 2J8FA 1GCYA 3WNPA 4O1CA 4ZO8A 3RXZA 4W7UA 1QTWA 4OU1A 4CKQA 4NI3A 1TVNA 1BSIA 4QIUA 4US5D 2PDGA 5KETA 2VEFA 3IIVA 1Q65A 1SUXA 1TVLA 1XL9A 3B9EA 3UWZA 3UR8A 1D2KA 2C15A 4L6OA 4N9CA 4J1OA 1LCOA 3LZ5A 2JF6A 4IIBA 4JCMA 1QI0A 3UETA 1FWRA 1TCDA 3ZVIA 3V5OA 3K8LA 3UP8A 1X38A 4PUEA 3EGJA 3NL6A 5D37A 3OG3A 2EPMX 4DO6A 2PMQA 3H7UA 1T99A 3POHA 3QF0A 2NWRA 1PDYA 2IKJA 1BG9A 1XBXA 2ISSA 3H4GA 3HM7A 1KM1A 4S2BA 1TV3A 3IUHA 4M56A 1PL9A 5DO8A 3T9PA 3WNOA 2YZ5A 2H9AA 4ZBCA 3M16A 3WLRA 2VYOA 2ONEA 4S3DA 5LIUX 1EDQA 4IMGA 4WGHA 2B7PA 5RUBA 3H55A 1CXLA 3HURA 3IJIA 3O06A 3IIPA 1RQBA 2XUCA 1OYCA 3PBMA 4XSMA 3LLFA 4DBUA 1O7AA 2GJXB 3C8NA 4XIAA 1YDYA 3THCA 4KH2A 3M47A 4XWUA 2R6OA 4JNMA 2CZVA 4ZSUA 1JYWA 4S39A 2VNCA 4BEUA 1EL3A 2INFA 4RE2A 3W07A 5HUPA 3WH8A 1YPIA 4UMBA 1WE5A 1WCGA 3PUEA 1UIOA 1UKSA 3NDZA 2ADAA 4U31A 2FH6A 2W27A 3MSRA 4UXDA 4DM2A 4LYRA 5I78A 2HZGA 4QP0A 3PF3A 3MP3A 5AVNA 4RDYA 2GJNA 4L6HA 3MMDA 1E6QM 3M4HA 2CNCA 1KRMA 3B97A 3GR4A 4Q8UA 4L7ZA 4DWDA 2C13A 2HPMA 1E4MM 4Q4RA 2YCLB 3ARVA 3KCOA 4L1XA 4YCOA 3NVTA 1VBGA 2VC6A 3VNIA 3O7UA 4JFTA 5AYZA 4P7NA 3Q58A 2QULA 4RNFA 3V36A 4JQAA 4C7DA 1OX6A 2OO0A 1LUCA 3ECQA 1CIUA 3AI0A 4IT1A 5DBUA 2OSXA 4RXGA 1GPFA 3C4UA 3M64A 1EIXA 3QV8A 3GHUA 4JX5A 3TJ4A 2OZ8A 5HNUA 1S5TA 2X42A 3IGXA 2BOEX 2VC9A 4YMZA 3BAKA 1MSSA 4UTLA 1ZUAX 2R9RA 1W9UA 3NJ3A 2ZA2A 3VGEA 4ORMA 3VGFA 2Y61A 1UBSA 3EEZA 2QPSA 3UW6A 1ZBCA 1KBIA 4AZIA 2PDPA 1A5SA 5C71A 2J78A 1Z3NA 2AKMA 4KFPA 2YW3A 1PUDA 3W83A 1L0PA 4JTFA 1AQHA 5AHEA 1JDFA 4CNSA 3QW3A 2VMFA 2YCJA 5EMYA 4WVXA 2NX9A 2WW5A 4KRZA 1ME7A 3KOYA 1O68A 1GORA 5TIMA 5DMNA 3HQ1A 4KCWA 2GUBA 4U3AA 2OODA 1OZMA 4B5XA 5M2FX 1I9CB 4Q33A 1PHWA 2QMKA 2ZUTA 4HA3A 2DZSA 2WZTA 3MBDA 4XB3A 4HBKA 1NFGA 4AHQA 3BMVA 3LHUA 5CJ5A 3L7RA 1V02E 4R7JA 4LRTA 1H49A 1QBBA 2P0OA 1ZRQA 1XLIA 5FJRA 1V3IA 2PUZA 4JIRA 3MI6A 3DYPA 1QHOA 3AQUA 4YLWA 1KLYA 3MZNA 3OU8A 3P62A 3MS8A 3VCCA 1J4EA 2FKPA 2Z4GA 2PURA 2J25A 1CGYA 1QPKA 4PMOA 1TSIA 1YLVA 2Y2WA 1VFFA 2QCHA 1NSJA 3J7HA 4TUFA 1VBUA 1G0CA 1OEPA 1E9LA 4IMFA 1SJDA 2ANUA 4TMCA 2I56A 1IXPA 3NL2A 1US0A 3CTLA 2ZX9A 4MUZA 5EFFA 1EH9A 4M6VA 4L65A 5CJMA 1GQIA 1XRSA 1OIMA 1EUNA 1XIDA 3GM8A 1QOPA 2YDAA 5I7GA 3DUGA 2GSJA 3G0XA 3NOEA 3S9YA 2E8ZA 5HQLA 3ERPA 4GGHA 5I3KA 4PBGA 5BCAA 3EWBX 4AEOA 2GWNA 1VPXA 4QS6A 4JQ3A 1W5OA 4LPCA 5C9WA 4K8GA 4NUWA 5LIKX 4PZVA 5FJTA 1X1ZA 1V7AA 1NM9A 1U1HA 1P0BA 3HPFA 3RPTA 1VBJA 5TQLA 1YQ2A 4RW3A 5BOEA 1HJQA 3LHWA 1WOBA 5C0QA 5HINA 5JQ9A 2YPIA 3ATZA 1B5TA 5CZSA 3NAVA 3XISA 3YPIA 3C2YA 3B40A 2VOTA 4XZWA 2Y7EA 2ASHA 3S9IA 3NDOA 5CGQA 2WKGA 1EUAA 3BG3A 5A69A 2GDUA 1EJ7L 2JGQA 3PUGA 1O1HA 2D2HA 3BUVA 2XVGA 3N19B 5H91A 4NJGA 3TZFA 4JL1A 1W9XA 3DI0A 4FOKA 3F4VA 3WDIA 2CLIA 5T91A 1Q63A 1KD0A 2ZOXA 4F4RA 2IPFA 4PUMA 2VRQA 4PODA 3WQ5A 1UZHA 2PWVA 3TC3A 1S5MA 4JTHA 1B54A 5E9XA 2AMXA 3T05A 1OC5A 1OK6A 1HP5A 5K3VA 3GFXA 4JTEA 1OIFA 1FWJC 4WUIA 5IDIA 3TA9A 1LBMA 4LAZA 4BQ5A 4I7UA 3W00A 3P3BA 4AZHA 4FXRA 1K7XA 4XBJA 4ZE5A 2ZA3A 3ZJ8A 1DE5A 5C8BB 5FJOA 1XP3A 2QUVA 1AD4A 1AVAA 1V6TA 3FAWA 2G3IA 3QC3A 3S1UA 4N9BA 1JRBA 1KA9F 1VIZA 1XLAA 4US6A 3SO7A 3QVQA 4N7QA 2Q8XA 3AS1A 2D22A 3MMTA 1OFQA 2VDHA 2J75A 4AD1A 3MZ2A 2Z24A 5K9XA 3PJWA 3C3NA 4WD0A 3P84A 1E4NA 2OSYA 4W87A 3WJWA 2GQ8A 4WJ8A 1T0OA 1GZJA 1EPXA 4IFRA 1VC4A 1KRCC 4C6OA 1RA5A 1GT8A 3A3WA 1PTGA 4YTUA 3A3XA 1JRCA 1Q3NA 3KBNA 4JTUA 3SGZA 2E4TA 3UG4A 1HIZA 3TYDA 4DJFC 4PMYA 4IGSA 1QR7A 4ALDA 3VKCA 3B9AA 1G7UA 3F5KA 5C9RA 1MUWA 4UQ9A 1MVYA 4DRSA 4PCTA 1YE4A 1CEOA 1R6WA 4Q8TA 4X2RA 2ZVRA 4GHRA 5ABGA 4LU0A 4Q4KA 2OO6A 4GFSA 4LVAA 4CNPA 4D8LA 4DZ5A 1XKYA 3IAPA 3BVJA 2YXXA 3NQ2A 4OTKA 1JD7A 1KV5A 2PDLA 4IIFA 1PAMA 2FVMA 1VRDA 2HVNA 3UPWA 1JFHA 1QI4A 8XIMA 3TNOA 1KXHA 1BWVA 3AALA 1OFEA 3NNTA 2O4QA 4E5TA 2GJRA 1OFAA 5T26A 1XLKA 2CHRA 2CFFA 3G1HA 3USBA 3NDYA 1C8XA 3BCJA 1DL3A 1AH3A 2GWGA 3LPPA 4PRTA 1F8MA 1V6UA 3FJ6A 1DJWA 3OBEA 1VR6A 2H8XA 4W8BA 3FDKA 1CYGA 4K6AA 5JBFA 3SQLA 1EZWA 4W8AA 4P7RA 3EEGA 3PANA 3R4IA 1VGAA 2OU4A 1P1MA 5BOFA 3OB8A 1NDZA 2JFEX 4LV4A 2XN1A 1BWLA 2KZHA 1O4UA 1KC7A 2FTPA 3WENA 3LYEA 4GBDA 2CLKA 4Q8QA 3LY0A 1YNPA 1FWWA 3RHGA 2QAFA 3VGDA 2AGTA 2V38A 2D0HA 5HPCA 3FSTA 4ZB5A 4EACA 1PKYA 1E6XM 3HJEA 4WDUA 4LY4A 3H2NA 1D3CA 1KCKA 5HWNA 2ZX8A 1JL8A 1B31A 3G5EA 3GNOA 2Y5EA 1GOQA 4I7VA 2NQ5A 2QCDA 4PR4A 4C1LA 1R9YA 3T07A 4PMDA 4RKAA 3N6JA 1QASA 4ECLA 5DLCA 3IWPA 2Z1WA 1X39A 4XZIA 5DCEA 1HGYA 4FIRA 1KLZA 4DAIA 4ZCWA 3WELA 3HQPA 3O07A 3QYSA 4R7WA 1XBYA 1PV8A 4NNCA 3TN4A 4JS3A 4JL2A 3B9DA 1VH7A 3OIHA 2O7QA 3URBA 1VYPX 1HJXA 2YL9A 4HN4A 3U0HA 1YXDA 4S38A 3QR1A 2WBGA 4ENLA 3F7JA 4JTCA 2Q09A 1KFBA 4YVVA 2J8TA 1TRDA 1LOSA 1Q6LA 3PTMA 3GIQA 4JYDA 4X63A 4HYRA 4AISA 1V3LA 4Y9OA 3MKVA 1XH0A 1EGMA 4KEVA 4MPQA 1EA9C 4PMRA 4W88A 3UA4A 2YX0A 4F79A 1EJVC 1ICSA 4DJEA 1AMKA 3P60A 2HROA 3FSUA 1BVZA 2Y85A 5TF0A 5HOSA 4UOZA 1C9DA 2J74A 5K2ZA 5U7SA 1PYMA 1REQB 5D04C 2WZHA 2CLOA 1RD5A 2WC3A 1R38A 3SGGA 3E2VA 1J01A 2VQTA 1R86A 4C1KA 3R13A 2VM8A 3O8AA 1GOIA 3WEMA 1V3KA 1IZCA 2J27A 4BQ3A 4LUSA 4MZ8A 1CB7B 4OIFA 3NPXA 3EWZA 3EOUA 5HMSA 3F1QA 3LRKA 3EXSA 2E8YA 5FF0A 3MUIA 1TZ7A 1NTHA 3BC9A 3SY1A 1C7SA 3OGVA 2DPEA 3PP7A 3GG1A 2QR6A 5I24A 5LA1A 3L2IA 1H09A 4CQDA 4L4PA 5GVJA 1VZWA 4JKLA 1JYVA 1EJRC 2BHUA 3R94A 3HIJA 3QMSA 4LCSA 3IACA 3E6EA 2WSQA 3PZUA 3NEHA 4PUUA 4WX2A 4L56A 4HU0A 3TWAA 3RR1A 3B06A 2OQHA 1BYAA 4AUBA 4H8NA 3S5NA 2JALA 3TYZA 4L4OA 1KXTA 3W37A 1HL2A 1H61A 3T0DA 5HXMA 3GNXA 2Z1KA 1ISXA 3K13A 2FGLA 4RCXA 4NAEA 1M41A 3CBWA 4PSRA 1V0MA 5XIAA 5CZ0A 3U2CA 3V0SA 4HZ6A 4TTGA 4NKCA 4MB4A 3N4EA 3ZWTA 1JF6A 1E0TA 3TNBA 4FNPA 1G67A 1NY1A 1Q6GA 2JKPA 2ZE0A 4GX8A 2CU0A 3MI3A 2XISA 3VZZA 4OGZA 1VFLA 4WDXA 4Y9PA 3G1VA 5E1QA 4W84A 1TR9A 2YFOA 4GI9A 2VR5A 1C8QA 3SN4A 3HGOA 3E9AA 2WVSA 4IPIA 2W0UA 3CUGA 4NI8A 3QEZA 3A4WA 5CSSA 4AVNA 3SCPA 3I7QA 5HA7A 4URIA 4DZAA 2YL6A 3WLJA 4HSNA 1AW1A 4BI7A 3GU1A 1ME9A 1TR1A 4L9YA 3ONCA 4YJ5A 3PZQA 1P5BA 4LCRA 3C52A 3VIOA 4KBXA 4FHAA 3WNNA 3G8RA 1EP1A 3IGSA 4C6FA 4ADUA 1JIBA 1JCLA 1MDLA 4C6MA 1BHGA 4GO9A 1POJA 3WY1A 2B4GA 2W9MA 3VKAA 3W1UA 1UBPC 4NZCA 4DJED 4DJDA 4FNUA 3N29A 2VWTA 3AIBA 4ICNA 2BP1A 1HJWA 1SU5A 4A21A 1FHDA 1MDRA 1Z89A 1CXHA 2CEQA 1EA0A 3H2EA 3H6OA 4HNOA 2QJGA 4F40A 1QWKA 1ZALA 4GZIA 2QT3A 1DQXA 2ZCGA 2PDIA 4MDOA 3WKZA 2CZFA 4P8VA 2I1OA 1TO3A 3HB9A 1OF6A 4MOZA 4YTRA 1VHNA 2QF8A 2WHKA 4MY9A 4NRRA 3KOWA 1M9HA 4NG3A 2NX1A 1XH2A 1R5YA 2DU2A 2J7FA 1VD6A 1XLBA 2OB3A 5E9AA 2HEJA 3MKKA 3TH6A 1UMYA 2AMGA 3AICA 4ZQRA 3SFWA 3OGRA 5CPNA 2HJPA 2R14A 5C7HA 1VIWA 5G2WA 1XISA 3LCIA 4XAGA 4IWWA 9CGTA 1H62A 2PSNA 3SRHA 2AQWA 3R7MA 3TR9A 2QDHA 3NIYA 4Y8FA 3E0LA 2VEIA 4NASA 5I3GA 5BRPA 3QFEA 2C71A 3B9OA 3KP0A 3EMCA 3EWUA 5G1YA 3DESA 2ZUUA 1LG1A 5XINA 2JBMA 2WCAA 3A4JA 4XISA 1BQGA 4NIRA 4DUOA 4CQ9A 3PWAA 3IJ6A 4K39A 1QNVA 5EL1A 4LUSB 4H7ZA 3B0XA 2CBIA 1UJPA 4NP7A 4CU7A 1HT6A 3IS4A 3P61A 2J7CA 4EXQA 1TCMA 1FWNA 3S4TA 5IOBA 5LHFA 2JKAA 1K3UA 4MAZA 4QAIA 3WH9A 5IM51 2W67A 4JN6A 3W1QA 3Q37A 4HPXA 3CPRA 1UD4A 1I8JA 3C0SA 4UTJA 2RDXA 3FJ4A 1OX5A 1OK4A 4UTWA 3MPGA 3SCTA 4R33A 2E1WA 4X9SA 1XX1A 3VNKA 3LGGA 2G0WA 2ZE3A 3NO5A 3SCOA 6REQA 3C0JA 3DU0A 2Z0IA 5EA9A 4KF1A 4AZGA 1X6UA 4QNEA 3SGUA 3BLEA 1FP8A 1ZGDA 3AS2A 2ACSA 4B4HA 4ZGYA 1C9WA 3VIPA 3URNA 3BMWA 1IXNA 4EPDC 1PS9A 5I03A 3D3FA 1ICQA 2ZVIA 2GPTA 4L64A 1DJZA 2XINA 1NP2A 4UZUA 2VVNA 1TTPA 1OFOA 3GDLA 3LXBA 3W7DA 2Z1SA 2G95A 1CGWA 2J7BA 5D05A 1EJWC 3W84A 4A35A 1PXGA 2HQAA 4NX0A 5B7YA 4DJDD 4J9JA 3TMLA 5AHLA 3MANA 1CX9A 1EQCA 4HZ7A 3EOLA 2ISWA 3E02A 3NQFA 3VDBA 1HQTA 3QPYA 4ACZA 3T4CA 4BF9A 3INPA 3KOZA 3RFAA 4I5UA 1AJ2A 1TPFA 2VZVA 1XS2A 3N13A 1ZCOA 1XXXA 2PAJA 3W7QA 2GOUA 4JFUA 3AS0A 2DW7A 1O1ZA 3CM4A 3H2AA 1VEMA 3DKJA 4B90A 4UFHA 1WDPA 5K4XA 1E6RA 1YDOA 4ZOBA 3TONA 3CV6A 2NLYA 3N14A 4F2TA 4O10A 3H2CA 2WQPA 4PYSA 4MNLA 2J88A 1TWSA 1HVQA 1UKQA 2ESCA 2EF9A 2DVXA 4MJZA 3WD3A 2NQZA 3ATYA 4ATDA 4ES4A 3SM0A 3GC4A 2IQ0A 2R94A 3SCRA 3WX7A 1RD6A 1E73M 3CK5A 1D7FA 5CGMA 1V03A 2XFWA 4GYJA 1ZAHA 3NQ8A 5D38A 3CMGA 3GW3A 2C79A 3LSBA 4DYJA 5D2VA 4JAWA 3S6TA 5EU9A 3JRKA 2NW0A 2F6KA 2BY3A 3NGFA 2IMRA 2CIPA 3CV7A 4AEEA 1LLOA 4IXHA 1UR9A 4DB7A 4MLJA 3CQKA 1QJWA 3CIXA 3WF2A 1S2UA 1HL8A 4XAZA 1AFSA 3OA3A 4JDYA 3A23A 4XAPA 2PZNA 1ECQA 2BGSA 2PLMA 2V63A 2WXDM 1FWIC 5IHRA 3ITCA 3GC2A 1J12A 4JEQA 1K9TA 4R5EA 1BEUA 1B30A 1RBLA 3EPOA 2QGYA 3OPSA 1ZP3A 4Q4OA 2QPXA 2ZQ0A 1HO1A 4IJRA 1OINA 3GX9A 5F2IA 1UA3A 3URQA 2BY1A 4ZFMA 1OD8A 3L21A 5H1WA 2NV2A 2VX5A 2OEJA 5FJPA 4XVDA 3R0KA 2PWHA 4H8VA 1KO0A 1QW8A 1Q4NX 3UXDA 1MXSA 1VRXA 3WK1A 4QX4A 1DE6A 3BGGA 4TX6A 2AKZA 3KLLA 2PP3A 1WBJA 2DSUA 2QZRA 2C8NA 4O57A 3SN0A 1X1OA 4ZMGA 3BLPX 5LYRA 3ZMRA 1ECEA 2D1ZA 2PP1A 4P7LA 3RG6A 3VCRA 3OQEA 4LX4A 3EX2A 4LFYA 4ZR8A 3VD5A 4GUGA 4JX4A 2VQUA 3GFYA 2XIMA 4M1RA 2VRJA 4Z1BA 4EXBA 2AL2A 3OOQA 4IQDA 2GGJA 2HTMA 1GKPA 3CT2A 4WCJA 4EANA 3STPA 4YHGA 1P1XA 1DOSA 3VABA 3SRFA 3NZRA 3M07A 4HNUA 7ENLA 1GOMA 2ZRVA 2WMKA 4FX6M 4JQ1A 1NELA 1YPFA 4C6DA 4KMQA 4H9TA 1UB3A 3MCNA 3L5MA 3M5ZA 2VCAA 4O1FA 1UWSA 4A8LA 5HUOA 3VKKA 5FSDC 5CXPA 2ZIDA 1VCVA 1OSEA 1L2QA 2E6YA 2IQTA 3LENA 3B0YA 2O9TA 2RAGA 3NSXA 1SO3A 1C91A 4B3ZA 2QNEA 2WAGA 3B4UA 2G37A 5CPQA 3ZS4A 1V93A 2OXNA 3GG0A 1FDZA 3PBVA 1IZJA 3VUSA 3WQFA 4DBEA 3K46A 3T0BA 4HU4A 5HNTA 2J77A 2UZ9A 1UOKA 2G3FA 3SUVA 2X0SA 3ABOA 5LGZA 4Z1CA 3G6LA 9XIAA 2QCNA 1H3GA 3RNDA 2G3JA 1DWIM 3U4AA 3TYEA 2HXTA 1T5AA 4FXFA 2WCGA 4IPNB 3LB0A 1Y7VA 1J0YA 2LLEA 3SR7A 4R53A 4BF7A 1SSDA 1QHZA 3NCOA 3WH6A 4XK2A 1ZP4A 2A79A 3I4KA 3ITXA 4MIMA 4I5XA 1XYCA 1OG0A 3SCNA 2H90A 5HMFA 2ZWZA 1DEDA 3VNZA 1AZ1A 2P1FA 1DWJM 3EPNA 4K2SA 1RK5A 3OIXA 4GA8A 3H70A 3ZSSA 2PLCA 4M8UA 1UZ4A 5TBOA 3TN6A 4RJEA 3NYDA 4EK7A 5D2WA 3SFKA 4DJEC 1L6WA 3I6EA 4UOJA 2PB1A 2QPUA 1W3TA 3DH7A 2UBPC 2WANA 5HNNA 1UR8A 2J9XA 3KBJA 4U5KA 3MB9A 4ZO9A 2Q01A 4CEXC 1H7WA 4YTSA 4N6FA 1Z41A 4NHVA 5FD0A 4IFOA 4KEZA 2I5QA 4HPNA 4YXGA 4JQ4A 2PWDA 1BYCA 3WQCA 1VFUA 5EKYA 3GH4A 1YKWA 1FWCC 1BTCA 4GVHA 2CC0A 1GVQA 1VAHA 3ZT5A 4HCLA 3QSTA 4L1GA 4ML4A 3SQSA 1ONWA 2HV5A 1D8CA 5CZJA 3LPGA 1HKMA 4FP1A 3NL5A 3TP4A 3OYZA 4FNTA 2PFHA 1GW9A 4HSHA 4WHBA 2EJAA 2GQAA 2KAUC 3CXOA 4ZA0A 1PE1A 3A9BA 3VDGA 1UWAA 2X1TA 2Y89A 3QR3A 3U5UA 4CCEA 2C1GA 1I2OA 3WLQA 4AWTA 1JVNA 4M6QA 1V7YA 4EAYA 4YL2A 4TQTA 4D6GA 3M0YA 5AY7A 3F5LA 4JPGA 1TKKA 2EG8A 4WJXA 6XIAA 1XYMA 1WAWA 4JN7A 5GQBA 8RUCA 6XIMA 3LI0A 3Q4DA 1MW1A 4GCAA 1LLZA 3DHUA 3BCFA 3W6YA 5EPDA 4UCGA 1ESWA 3QJAA 3AYVA 5HWMA 3MWCA 5G1TA 2Q8LA 1H7XA 4AMAA 1YDVA 4HHPA 4GG9A 4GPNA 3KVLA 1JG9A 2Y5JA 3ZT7A 4A3UA 2EPLX 4JTKA 5HJXA 3IIXA 3U4FA 4ZVJA 5FSEC 4ML9A 1A50A 2VEPA 3EDDA 1TJ1A 1K03A 4DAFA 4MM1A 3G8EA 3T2OA 3A4AA 4ATLA 1WZAA 1ZBVA 3GXNA 3A24A 4PMVA 1EQPA 4FALA 3II1A 2A3BA 4X2PA 3SIZA 3T7VA 2GDQA 3TKFA 3LNPA 3VC6A 1EKOA 2X41A 5ABFB 1IIGA 1V6WA 3DKLA 2QJMA 4V15A 4DJDC 3WD2A 5FL0A 1I1WA 3SDOA 1GQKA 4UR7A 5CPMA 4O18A 1FWGC 3F2CA 4DF0A 5JU6A 1Q6OA 5L9FA 3CQHA 5AHNA 4UTHA 3W7OA 1LRNA 3FEMA 3W2JA 5F2GA 2O55A 1LOLA 2G8ZA 3W26A 2YA1A 4LUJA 2FHCA 4A2RA 1TV2A 3I6RA 4YIWA 4F9DA 4LF1A 4J3XA 1MEHA 4GVGA 2OLHA 3ALGA 2F9RA 2EO7A 2VL4A 3ARWA 2V2HA 4A6GA 1JD9A 1E5JA 4J3WA 2A3AA 1A49A 3QOKA 2QCFA 4UR9A 3QC0A 1M04A 3BJTA 2J9ZA 3W86A 5LIYX 3MY9A 7PTDA 1G9HA 3LCXA 3EBVA 4JIEA 1ONXA 2A3LA 1FKXA 4QM1A 1S38A 4BHYA 1EC8A 4DLFA 2PDFA 3OBAA 3GH5A 2E9MA 1BYDA 1P0NA 3CHEA 1KKOA 3N15A 3QBUA 1GTEA 1ZFJA 2VT0A 3WBEA 1H51A 1GJUA 4G1KA 3OVGA 3NR0A 1H4PA 3PBYA 1B9ZA 1XQKA 4JR5A 1GVYA 3BSHA 3PPFA 3H21A 3GTXA 3W7NA 3U6WA 5BMWA 3U2EA 3ZLGA 1S2WA 3CAQA 3VVGA 2QUUA 2PGFA 4F0KA 3MJMA 2PWFA 1PPIA 3ITYA 5HWJA 3F5JA 1XC6A 2FGZA 3T1GA 5A6AA 2WPBA 5C2XA 2F2KA 4CCDA 1IEVA 1JULA 3CHCA 3UERA 1LRTA 3NXFA 4G6CA 1Z7AA 1AD1A 5JBDA 4V1YA 5C7VA 4IP7A 4O1AA 4ERIA 1UD5A 3AZSA 3VI2A 1DP0A 4ZQMA 1EDGA 2E77A 3GXPA 2ZZ7A 4FX7A 3L4TA 1JJKA 3MP4A 3SY5A 4UTTC 3LBCA 4MHBA 1RLDA 1QVBA 2Y7DA 3N2BA 4LRSA 1U22A 3C8FA 3EA3A 4AZ5A 1ZJHA 1X1NA 2HNEA 3S3GA 2E6FA 2UWFA 4UNLA 4P7QA 3NZGA 1EJTC 5AVHA 1KBJA 1JI1A 2DQWA 1WXZA 1JR1A 1BKHA 3N2XA 1YE6A 3L5LA 1F74A 4KKXA 3UT0A 4C5YA 1R2TA 3N2CA 5LNUA 3MDUA 2QKFA 4AXKA 3WQ6A 3AMKA 2ZUNA 3KVKA 1UWQA 1RBAA 3PN8A 1D8WA 2Z26A 1I2RA 4LBSA 2EG7A 3C86A 2ISFA 2F84A 5HK4A 1MNSA 2AOSA 1DJYA 3WMLA 4INFA 3UQNA 3C3UA 1G4TA 4C91A 4C6PA 5CC5A 2QJHA 3GIYA 4PMNA 2PF8A 4IMCA 1A0EA 5HNRA 4JKKA 1TV7A 2CKSA 4NAFB 3B0PA 3PZ9A 1X97A 3ZR6A 1FXPA 1A47A 2ZUMA 1UKTA 4WDTA 4F0HA 4F3HA 4GH1A 1DORA 1HFBA 3SUUA 2WCSA 4DQWA 3M0KA 5E0CA 4IPJA 1SW3A 3NYZA 1JF5A 4HPGA 3S1XA 1OGGA 4HOXA 1W5MA 2X05A 5LNRA 1FDYA 4XD3A 4ZO6A 4D8AA 1TJ2A 5JIPA 4EOUA 3N18A 1XYAA 2DZVA 3L4UA 3UU0A 1RJPA 2ATSA 4IFKA 3UBPC 4XIMA 5KSWA 4UTFA 3P8IA 3RRAA 1YADA 2A3EA 1H2JA 4QJ1A 3UPBA 1UROA 1W3IA 2PWEA 3HF3A 1UUOA 3BAWA 3P82A 1QOQA 4MSSA 2OTDA 2YDSA 4JOMA 3STFA 1K4GA 3VOIA 1W2VA 5CLTA 3RCNA 1YDNA 1R3WA 4WGXA 3C0QA 5LNWA 2CWXA 4F2BA 4ZEPA 1QCWA 3LS9A 1RXOB 1JGIA 4XV0A 3VKDA 4J3ZA 2QAPA 3W02A 3PULA 3RUBL 4P2VA 2EG6A 5ABEA 4D1IA 3S5YA 4JHZA 5HPOA 2XGZA 1D7KA 2PLJA 2WVUA 3EDFA 4ZZ9A 2IXUA 3GO2A 1SFLA 1FWAC 3ANYA 2CESA 2VR2A 4LS1A 3I65A 1KTCA 3DG7A 5I5RA 1PX4A 1F61A 3TLQA 1K8CA 1GVIA 4XBSA 4ZE4A 1WXYA 1XUZA 3GW0A 1A80A 1XLDA 2VFDA 3BZGA 3DG6A 3GQYA 3UVAA 2UY2A 1F6KA 1PKNA 3FKRA 4KGJA 3KWXA 3PM6A 3IJDA 5AC6A 4IQLA 3AMLA 5AC7A 3PG8A 5A8GA 3B8UA 1Q6DA 2WJDA 4QISA 1BPLB 1ZL1A 5C2CA 4E3VA 1OC7A 5DRIA 1J6OA 3KTSA 4LBUA 3WLMA 4XVEA 1UP0A 4Q6XA 5F4WA 4AY1A 4H83A 3RPMA 1TA3A 1WZMA 3WN6A 4N4PA 1G4EA 4H4IA 1K6AA 2J79A 4QTGA 3V4BA 2AGKA 1R9XA 1K9FA 1VYRA 3KTXA 4KGLA 3QGVA 4Z2KA 3KX6A 4IPPA 4GO8A 4QDWA 2ZADA 3DOPA 3B8TA 2XG9A 3R89A 5LXEA 3WMSA 5E6YA 2PLKA 2DQXA 4TVUA 2DFAA 4HA4A 1LJYA 4V28A 4QDPA 1J0HA 3TR2A 8XIAA 1RZMA 4DZHA 1V3MA 1VS1A 3E2SA 4AXNA 3APYA 2ZZ6A 3LCHA 1J93A 3M1ZA 5LXXA 2ZXAA 3S46A 4O8RA 2DVUA 3R8GA 3SADA 3QPZA 4GIYA 2WMJA 3TUUA 1O60A 4JIIX 1DHPA 5EMKA 4HK5A 3RM9A 4PMXA 3AIUA 4PTXA 3TTQA 4TU1A 1K77A 5D9PA 2UY4A 4GNVA 1N2VA 3NG3A 2WOQA 3O3RA 3N3MA 2ZUVA 3FX4A 3DGBA 2A1YA 1MQRA 1V02A 1J2WA 2EHHA 4QQ3A 2GLKA 4GBUA 4MB5A 1UOZA 1KR0A 1Q6EA 3VM7A 7REQB 5HR7A 4LY8A 4M7SA 1KM3A 2HE5A 1Y8BA 1KM0A 4IJCA 1TWIA 1T96A 3N25A 2ZUSA 4HOZA 1H7PA 3QTPA 3TQKA 1GVEA 3W7PA 3BDKA 1A5LC 1DIEA 3NSNA 3T8QA 1TIMA 1NF7A 3BLKA 2I9UA 4AZ6A 4Z17A 2PTZA 3REQA 2FVKA 4DWSA 1UR4A 1BRLA 1DTUA 3WJXA 1S1RA 3LXCA 3M6YA 3T78A 3WF3A 4XO7A 3UZYA 1RY8A 2WSYA 2CLMA 4LWWA 5A8PA 2BS9A 4O19A 4IOTA 3TN3A 3WDHA 1TB3A 3GDMA 3IJ8A 1QPOA 1FY6A 2Y8KA 3EX3A 2OFJA 1E1CA 3S5ZA 2ZRYA 4YNGA 2PD9A 1AUSL 5A8OA 4IL0A 1XLHA 3BURA 2J7GA 4JYEA 5JMUA 1B4KA 3TU9A 3E2QA 4H6EA 3TEVA 4R88A 2W79A 3UWYA 1Q8AA 1BYBA 2XFRA 3CASA 3DBNA 2VOMA 3G0SA 3MYPA 5J5DA 1LT7A 4BS0A 2ZX5A 5BRBA 1JPIA 1FBAA 2WWCA 1OFPA 2YB4A 1EXPA 1S2AA 5C9XA 3MV01 1KXVA 2BNJA 3TQ0A 4DM1A 1QHPA 5KINA 4JHMA 3CMFA 2YCEA 1J0KA 5GJPA 3SCQA 3NQAA 2G4JA 4XAYA 5CC7A 2VX7A 1GNXA 5FF3A 4EP8C 3UG3A 2PDNA 4JTRA 3RO6A 4IIDA 2VEGA 4U2ZA 4ADSA 1GVRA 3DX5A 1EC9A 4UQAA 3HG2A 1RALA 4LVDA 3GH7A 4LBRA 3VDCA 3VE9A 3BL3A 4AC1X 5AFDA 3WQGA 1P48A 2PGRA 1X8CA 2ZC8A 3FIGA 1TA3B 5U4NA 3ABRA 5A8NA 3BLDA 2YLAA 1C29A 1JNEA 2G97A 4KIRA 4DF1A 3HJZA 3R6IA 3KHDA 4GJIA 1H1ZA 4UWMA 4E6MA 1E6PA 2XGIA 2FGBA 4FLSA 5B80A 3AUOA 1Q7MA 3TA6A 3LD5A 4GUJA 2BSLA 1W5PA 1PBGA 3P93A 3PBWA 3V18A 3GXMA 3GUGA 1YIXA 4P8UA 1YEYA 3AWOA 1IR1A 2PRMA 3W74A 4WK9A 1XSKA 3ES8A 5EMJA 4NJHA 1DJQA 3LV5A 4UNKA 2D2GA 2PDYA 3PJXA 3N2OA 4S3AA 2XN0A 2BMBA 3G1XA 1PWMA 3ABXA 5LA0A 3AAMA 4JICA 2EXOA 4DWSD 3PAOA 4B91A 4GRSA 2GGIA 4RE0A 4MKSA 3T40A 2Y63A 2PD5A 3OBKA 1F7BA 1OGSA 2WPGA 1QUMA 4DUXA 5D2TA 2DZBA 2XSBA 4M81A 1S1PA 4CD8A 2PDHA 1JZ8A 1QK2A 2AQVA 4CQBA 1W9PA 1QU4A 3P0WA 4U4MA 3KCJA 2Y62A 1J0ZA 2Z1XA 3S2JA 2P3EA 4E2OA 3MUY1 1TYGA 3GSMA 3ES7A 4C7GA 1XIFA 2GVLA 4NF7A 4DLMA 1A5BA 5I09A 2EPOA 2A0NA 1N55A 2E0PA 1IEWA 2F8QA 3IJ9A 5CZTA 3MU7A 3VX1A 5A3HA 1B3XA 1YNQA 4GUIA 4JN8A 3G1YA 3LI1A 3NPWA 4DWSB 3SSJA 1MO0A 3ITGA 2VENA 4KFOA 1ITXA 2XVKA 3PBGA 3FVDA 3KUMA 4IGHA 2WQDA 4O11A 5FL1A 2FPVA 4OBRA 4TR9A 5G4EA 1W1A1 2X40A 4TX9A 2E9BA 3VE7A 4FS9A 2BVYA 3CHFA 3ORWA 2Z29A 1P7TB 3A21A 4L9ZA 4MB3A 1TZZA 2MANA 3S9ZA 3C6CA 1G4PA 1DBTA 2WMIB 2ACRA 4ZTXA 5CG7A 4O12A 2WK2A 1RP9A 4JTQA 5H6HA 2HBXA 1PZ0A 1EO7A 3FLUA 3LTSA 4EPEC 4RR4A 4GIAA 1ITCA 1F6PA 3UFYA 4NXKA 5IBXA 4LUYA 3QV6A 1UQYA 2GJLA 1YMYA 2Y4SA 3A13A 2QLYA 1SQ7A 1A5NC 3LPOA 1SM9A 4IG2B 3M41A 3KS5A 4RZ5A 4IIGA 4BQ4A 1GKRA 3E0FA 1BWKA 2X0HA 4GISA 4AH7A 4E0CA 1ZBWA 2RDUA 1C8VA 2XVPA 3KWSA 2C0HA 4K68A 3OLDA 3GD6A 2HS6A 2ZC1A 2RDTA 1THFD 4LUTB 4J3SA 3OP2A 3LXAA 1Q5MA 1JCXA 3GY1A 2CWNA 1S39A 3CZJA 5CJNA 1TX2A 3BW4A 3S0CA 1U33A 3E49A 2PDBA 1SJCA 4LB4A 5BU9A 1KRAC 1SZEA 2C1IA 3MP5A 2TSYA 3H8AA 5AC4A 4UFIA 1GJWA 3IVTA 4QE4A 1W1IE 3M0JA 3VD3A 3OYXA 3NEVA 3NQ6A 1XYFA 3U3HA 2V2CA 1UR1A 1Z48A 1JCJA 2DIKA 2D2OA 5CG0A 1M7OA 4IZGA 2W6RA 4M1BA 1BG4A 4XAFA 1CXKA 2NXHA 3CMJA 1K8ZA 4H9YA 4RE3A 2ZXQA 2PZ0A 2GVEA 3QV7A 2BOFX 1CNVA 4IHCA 4ZQOA 3OVPA 2FJKA 1H0GA 3KZSA 4MAVA 3WLLA 4U2YA 3B8WA 1XSIA 3UXIA 2ZZ2A 1AL8A 4BZYA 5A6TC 3TFXA 4RDWA 1W8GA 1MMFA 1M5WA 1ZTVA 3GVRA 4NJIA 2RGMA 2PU0A 1IXOA 2VURA 4A2SA 3DC8A 4IUOA 3B4YA 3WBYA 4C65A 1GYLA 2JF7A 3FY1A 3ELFA 2DT2A 1DQWA 1CZ1A 2RKXA 3FGCA 1G1YA 1ZCCA 3EX6A 3U57A 2RJHA 1CLXA 2G4FA 2DZTA 2D3LA 3TAKA 1HXJA 3M5XA 4P61A 5D03A 2D3NA 4H9XA 1RK6A 2Y6ZA 1TV5A 1PB0A 2WZEA 3B9NA 4RPPA 4PFHA 4RW5A 1LL6A 3LQLA 4QHRA 3KP1A 4UR8A 5BOOA 1E6NA 4ROQA 4CCZA 5AECA 4AIEA 4UTUA 2QCMA 5MKGA 1H1NA 3W82A 3KZPA 1UD6A 3NQ7A 3VK5A 5BWAA 2WHJA 1EB3A 3CO4A 3TVAA 3IVUA 3VGGA 3P80A 3N34A 1TQJA 1CLVA 4W89A 3G22A 2NUYA 3VMPA 3NQMA 2UY5A 5F4SA 5AC5A 2F2HA 1RLCL 3PZOA 1WYIA 3WYZA 1R3TA 6TIMA 2NV9A 3BGJA 4FAMA 1JZ6A 3S6OA 2O7SA 4JTAA 1OVDA 3TSDA 3NPVA 3TV8A 3ANVA 1XBVA 4ZQPA 2FLIA 1DKWA 3GNDA 3CNYA 1PX3A 1VFSA 1KCZA 1GOWA 2O9RA 4ZOAA 1YBQA 1E40A 1OQFA 3OJGA 4B2DA 3T44A 1KGWA 4C90A 2VC7A 3D0CA 3R58A 3U8GA 2ZX6A 1FA2A 1XLMA 4MWAA 4MFEA 1HUVA 3WDQA 1MXGA 2YLLA 4MF4A 2YKKA 1AK5A 6A3HA 3KW3A 1C8YA 4XZMX 1OD0A 3TXZA 3CH0A 4GXMA 3H2OA 1R3RA 2Z00A 3O2LA 3WQVA 2BZNA 4F9JA 4W86A 3SIMA 4GQ0A 3IRDA 3UNTA 1EGZA 4B5NA 3GHRA 4CGTA 3VOCA 1XH1A 4AQLA 2ZICA 3LZ3A 3WK0A 4DO5A 2J24A 7CGTA 1LWIA 1XLJA 4I6VA 4LS2A 7XIMA 2V6AA 2E40A 3OZYA 4MTVA 4MJMA 5CSRA 3O6DA 3W38A 2OELA 5A6LA 2QV5A 3KL3A 2ZA1A 3A22A 3C61A 3L4WA 3RIKA 4B3LA 3VIIA 3QHNA 1CPUA 4DYKA 1JPKA 3VGHA 2AQOA 3QY7A 3ZLHA 5KITA 4UTIA 2DP3A 5FEWA 4NVTA 1VJSA 3G77A 3OODA 4EWJA 2NVDA 4BKNA 3UPMA 3VOHA 2XH2A 5SWUA 4I7WA 1B57A 2OGYA 2NT1A 4A29A 2R8WA 4ZOEA 1UP2A 1O5XA 2PDMA 4IMAA 3R1ZA 4Z08A 3S83A 5BMXA 4C1NA 3GAYA 2FZ8A 1GYNA 3CIWA 4UFKA 1QATA 3HG4A 1PDZA 2QUTA 1JEZA 3PFMA 3W71A 3BLIA 3VA8A 3GTFA 4FF5A 3MQTA 3N9SA 1DPMA 1Q7ZA 5CSUA 3PZGA 3DBPA 3EPMA 2EPHA 4XKYA 5KZEA 4QJ4B 5HJLA 1OF8A 4AYSA 2ZDSA 2R24A 1QNQA 4QFUA 3BMXA 1V6XA 1VFMA 3BAJA 4FLQA 3PWGA 3CWOX 4CQCA 3RN6A 3ZO9A 5G4WA 1HNYA 2EPNA 3U7VA 2W61A 2FZMA 4ACYA 4AW7A 1XG3A 2VEMA 1IIHA 4Y9AA 1H63A 1OB0A 2D23A 4H9VA 4JIQA 4WSHA 3ZWSA 3QFWA 1TPUA 3E0IA 1PZ1A 2YSWA 1LZOA 2HVOA 4DWSC 3FYYA 1ISWA 4AAJA 1E3XA 5DXYA 3VUPA 4IGMA 3N6HA 1KGUA 3PNZA 3S8HA 2BFGA 1Q8JA 2XH0A 2Y24A 3C5QA 4B2DD 1B3OA 1WDSA 5H8MA 1Q7QA 4FR1A 3DN5A 3W53A 4WR3A 1J0JA 2YOCA 3KOFA 3GS6A 3QM3A 3E1F1 3H2MA 3FDGA 3W4RA 2QCCA 4PRRA 3G1AA 3UGRA 1EOKA 1KWKA 3W7JA 2C14A 4GKTA 4PBEA 3WBXA 3NZ1A 3VFLA 4I5RA 4EAMA 1DVJA 5A8MA 4ZQCA 4L1WA 3BWWA 5JUVA 1OM0A 3TK7A 1QMLA 2P50A 1ZY9A 4XD4A 1B1YA 3GC5A 4AU0A 1P0EA 3CWHA 2WZMA 1IE7C 2NQHA 1ISYA 3I3DA 1EIBA 1FDJA 1S5NA 4MGGA 5TNVA 2WVVB 1FQ0A 1TRIA 2A4AA 1W32A 4ERGA 3LOTA 1Y0EA 5D4YA 1Q85A 5IRPA 4C6QA 3A5FA 4DN1A 2PTWA 2X1RA 3PTDA 2OQLA 1F07A 4MNKA 3KHJA 4S3BA 1EJUC 5A5WA 4RNJA 3PBUA 4EE9A 3NQGA 3PZNA 5JXQA 3LU2A 3KBMA 3VO0A 4ZSTA 3W29A 3UA3A 3EWYA 1YPXA 3DIPA 1OHLA 1O5KA 3QY6A 4QR6A 1LOQA 2WBKA 4KWVA 1KFCA 4AVFA 4CVWA 3GYEA 1MEIA 1CXIA 1UWRA 5EMUA 1K9DA 3P0XA 3N11A 3TTYA 4FLOA 3UZ5A 3L68A 3TTOA 1HKWA 4X0VA 1MQQA 1HN1A 1XF0A 4GC4A 4LVGA 3LMYA 4G56A 4PMQA 4D1JA 5BXPA 3NTYA 4PTNA 4PSPA 5CPSA 4AX7A 4D2JA 1C7TA 3WJYA 1JPHA 3P8JA 2AAAA 4JIPA 3ID7A 1OY0A 1RPKA 5TAOA 4HZ8A 3VMOA 1XDJA 3O0KA 1SYTA 3K1DA 4XSLA 4I3GA 3MCOA 3MUCA 3OW1A 3ANUA 3W7LA 1V0LA 1L6YA 4HVXA 5D9MA 3ZVHA 5DFAA 3FYPA 1B90A 1WNOA 4UIOA 5FAGA 1VLWA 3S1WA 4AIBA 1EHAA 3AISA 3BQ6A 1XUUA 3B8SA 4HJFA 3TYCA 1F6YA 2D0GA 1JUBA 1HZYA 1Q45A 2C3ZA 2VD9A 4W8LA 3AIRA 3EAUA 1JFXA 4AZCA 3HTWA 1YTKA 4C1NB 1Z9AA 4NJJA 4P5UA 2PTXA 1HW6A 1PCWA 2BASA 3GDTA 3CUXA 4HCHA 2NUXA 3PK7A 4B4FA 2WNNA 2PTDA 3T55A 1HJVA 4Z0JA 2H9AB 1R30A 2BXYA 4M51A 1A4LA 4H2HA 1V4YA 4QSFA 1AQFA 1G69A 4FO4A 3TCSA 4AD0A 5DRCA 3W7CA 3L0KA 1WOAA 4AG0A 1FCVA 3EWDA 2YFNA 3PSVA 3R25A 3BJSA 3P81A 4CD7A 3SRKA 3SN1A 4Q22A 2XJ7A 4D6IA 3I7RA 2Z28A 3LERA 1UP3A 2D69A 2V3DA 4GQGA 3GKAA 1KGXA 2HVMA 1TTQA 3FJNA 1F05A 4BY3A 3OHMB 3Q2DA 3AYRA 3DYOA 4GH3A 3PJUA 1K8YA 4G7EA 5E70A 4S3GA 5LGXA 5I3IA 4N4QA 2W91A 3GR8A 2ZFAA 2ZTKA 1QRQA 2VP8A 2CITA 3FKKA 5ABHA 2CLFA 1ZJBA 1XYBA 1MRQA 2XU2A 2DGAA 1LT8A 4R27A 4W85A 2IKHA 4XG1A 3M0HA 3W3OA 1BTMA 2V5JA 5IBXC 4PCPA 4NSBA 3WK2A 4KFNA 1IT7A 4PB4A 1PO9A 1ZJIA 3WLTA 4WDWA 1UR2A 4Y8EA 5DT7A 5KZDA 2J6VA 2VZSA 3TDFA 4EVZA 4OOUA 1ZLPA 1V0KA 2QUNA 4NT0A 5E0KA 3PZMA 1IEQA 3IUIA 5A8QA 3M0ZA 1LUCB 3ENLA 3P5YA 1SGJA 3FAXA 4KS0A 2V69A 4LSBA 3U5YA 2XIJA 1NU5A 1DXEA 1V0NA 3PC0A 4RV8A 3G6MA 3WLSA 5CCZA 1F76A 1TIWA 4DPPA 5IDZA 3V5FA 4U33A 3ARPA 3APGA 1W3JA 4AVOA 3TW7A 3T0CA 2PS2A 1T6MA 1UR3M 4M6PA 5CQ1A 4AFYA 2KX9A 2XTKA 3MWAA 3OVRA 2OOFA 2DZWA 1SJAA 1WZKA 2I5IA 3GNRA 4PUWA 3GK0A 3W1TA 3GUWA 1V8EA 4FLRA 1E9YB 4UOQA 2DSWA 3LM7A 3GHSA 4PE8A 2ZBTA 1KKRA 4FSAA 2DIJA 2E67A 3GG8A 5ECVA 3STCA 3ITOA 3LNMA 1DIDA 2EAWA 1XIGA 4LCQA 5I6SA 1Z42A 4PN2A 1MZHA 1UQZA 3GB6A 3T6CA 3WF4A 4MFDA 2NZLA 3IV8A 4CQ8A 5HAOA 4TV5A 4DYEA 1ADOA 4OV4A 1E4LA 2C7FA 2V0TA 3DEQA 1GVOA 3DDMA 4HHHA 1OG6A 3A64A 2RH9A 3WZ0E 3BH4A 4KCTA 4E3TA 1RH9A 1NAL1 2B7NA 2ZRUA 1OFDA 2I9EA 1NF0A 1NDWA 1OABA 2VEKA 4F66A 4B15A 1DHKA 2Q3RA 2INEA 4D8ZA 2RJGA 4D6EA 2J7DA 3AXKA 3K4DA 1JYXA 2H8ZA 3WQ8A 4DI8A 4KCUA 4KCVA 1YHTA 4DO4A 4LYQA 3WH5A 4RLIA 5B7ZA 3SJ3A 4DBWA 3U7BA 1ML1A 2ZRWA 1E0VA 5C9UA 3ZIZA 1Q13A 4ASTA 1GK8A 1BFNA 2XIOA 4CQAA 2NQJA 1W8SA 2DH3A 3L2LA 4CU6A 4F48A 5HR6A 1XRTA 2W62A 3WNLA 2H3BA 2GOKA 3HOJA 1CI1A 4KT2A 4FB7A 1AMYA 4J27A 1M01A 3RCMA 3SCSA 3CZ8A 5BU6A 1IF2A 1UR0A 1J5SA 1G01A 3NQDA 5CC3A 3RR4A 2YXGA 2I7GA 2YGYA 3NM3A 4M5PA 3W7KA 4OOZA 3AHXA 3GXIA 1BGGA 2PRHA 2HMCA 3MSYA 5DMYA 3CGTA 5DBTA 5FF2A 1KCLA 1M7XA 1KM4A 2NUWA 4LGXA 3KVMA 4Q4QA 5IFPA 1Q6RA 3M9YA 4KIEA 4DXXA 4EXAA 3HG5A 4CNNA 3URAA 2CETA 2NVAA 2VI0A 2ACUA 4LH8A 4GMEA 3R2GA 3LM3A 1SZFA 5DY2A 3KCLA 2VKZG 1JZ2A 1E9ZB 1J6PA 4JX6A 1XLFA 3JR2A 1GHRA 4O17A 4UTMA 1JUEA 3VIJA 2ICSA 2CKRA 1AL7A 1AQ0A 3SUWA 2QDGA 3W7EA 2O0TA 2CLPA 1M6JA 1FWHC 4KRUA 5IFTA 2V8ZA 4H8HA 3APTA 1W5NA 3VZXA 1US3A 2PDKA 4LANA 5GNXA 1I45A 3MYOA 4GINA 1Q2SA 3UXAA 2VUYA 1XYLA 1FX6A 4JCLA 3T81A 3ARXA 1GQLA 3AIQA 1LLWA 2EPKX 3OO2A 4G7FA <