3H23A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h23A00
3TYCA 4DJFC 4D8AA 4MWAC 2Y5JA 4DJDC 4DJFA 4DJEA 3H2NA 1TWSA 4S3FA 4S3DA 4S23A 2OGYA 1AD1A 3H22A 2VEFA 4NILA 1AJ2A 1TX0A 1Q8AA 1TWZA 2H9AA 3MCOA 2VEGA 4DJED 3H2MA 4DAFA 4S38A 1AJZA 4HB7A 4CCZA 2Y0FA 1TX2A 3TYDA 3H26A 2YCJA 1Q7ZA 4PZVA 1Q8JA 4S3BA 3BOLA 3BOFA 3H2FA 4DJDD 4MWAD 4S3CA 4DJFD 2DZBA 1AJ0A 3H21A 2YCIX 3V5OA 3H24A 4S3AA 4NIRA 1Q85A 1Q7QA 5JQ9A 1EYEA 1F6YA 3TYBA 4DAIA 2YCLB 2DQWA 4DB7A 4MWAA 4G9PA 3TZFA 2YCKX 3MCNA 3TYUA 3TYEA 1TWWA 2E7FA 3NOYA 2H9AB 2YCLA 4O1FA 3K13A 4C1NB 2VP8A 2BMBA 4S39A 1AD4A 3TYZA 4MWAE 2Y5SA 4D8ZA 3TR9A 3TZNA 4DJEC 4O1EA 3H23A 4NHVA 3H2OA 3H2EA 4DJDA 3MCMA 4C1NA 3H2AA 1Q7MA 4D9PA 4O0QA 4S3EA 3TYAA 3H2CA 2DZAA 4NL1A 4MWAB
chains in the Genus database with same CATH superfamily
1TMLA 3RU6A 3WNLA 1U1JA 1XIJA 2RDWA 3HTWA 5DT5A 2P0OA 1N82A 4M7SA 5IRPA 4ZCWA 2BODX 4NYYA 4C6LA 3NSNA 1R2TA 2VYOA 5CKSA 4HPJA 2A79A 3CIXA 4LU0A 4CNSA 3SR7A 4H4IA 3MP4A 2XVNA 1K1DA 2BDQA 2R8WA 3ARUA 1R7AA 4HNVA 3KEHA 4ATWA 4TQTA 1XLCA 4HNOA 2QJNA 2XDFA 1DXFA 1JAEA 1FFQA 4KIEA 1KM3A 3DU0A 5A3HA 3M07A 3MKKA 1EJWC 5AC4A 3EXRA 1ECQA 3KLKA 1V4YA 4ZBCA 3OVPA 4QX4A 1QRQA 3VNZA 2XVKA 4DVOA 2ZRYA 1HJVA 1P0DA 3N4FA 1JVNA 3HN3A 1EXBA 3CS2A 4ZODA 3DFTA 4I8DA 4YTTA 5A1AA 4ZL1A 1S5VA 1P4CA 3K1GA 4HQVA 4MNJA 2OQYA 2CESA 4JNYA 2D2GA 4J3SA 1J96A 4MNMA 1K7EA 3H2EA 1WUEA 1UROA 3N29A 3V16A 2CHRA 3CAVA 2GUUA 2OEMA 3MPGA 3L65A 1MEWA 4NXKA 3ZJ8A 1E9LA 1V3HA 3GE7A 2J7EA 2AKMA 2E4TA 4NAFA 4LV4A 2GJXB 2NQZA 3OGVA 1FP8A 4QG9A 5F2GA 4OKDA 3VXGA 1J2WA 5I5RA 2PDNA 2VJXA 3GDKA 3WMBA 2P3EA 1FBAA 3PHAA 4IJCA 3RJYA 3ES8A 1I2QA 4AHQA 3AIVA 2DY3A 5HNTA 4J2PA 3H54A 1E70M 3W2MA 3R10A 3QPZA 3A4XA 4Y9AA 1YTEA 1NELA 3ZJ6A 5J04A 4NSBA 2CU0A 1XCWA 4DBUA 3CV6A 4NI8A 4JR5A 4I8YA 1P6CA 3AXHA 1JGIA 2ZZ6A 2DIKA 2OEJA 3RIKA 3GIYA 1V7AA 3U9IA 2Q09A 3L67A 4LGXA 4UTTC 1V77A 5J5RA 4HVXA 3W71A 3HBLA 1H7NA 2YBTA 3AMDA 1WBHA 3TQ0A 1Q2SA 2YL5A 4KIRA 5RUBA 2WC3A 3PNUA 3UQNA 1A4LA 1R38A 5FESA 4DELA 4H04A 2GJXA 2EPOA 4I7UA 3KBWA 3KVMA 3W24A 3LLFA 4GI6A 3OTRA 2OSYA 4HPGA 3CHEA 3QOKA 2OQHA 1YRRA 3GU9A 3G1RA 1Y7VA 4WDWA 3GAKA 3LS9A 2QCDB 4KFOA 3VIKA 4PR4A 1KFLA 1EEPA 4JQ4A 3FY1A 5LIKX 5AB3A 5D02A 2FYMA 3W6MA 3AXIA 3B03A 3TLQA 7A3HA 2VC9A 3HU7A 4C6FA 3KFTA 3O3RA 4H6KA 2ATSA 4WK9A 4HHHA 3W86A 1K7FA 1O68A 4RV8A 3VOJA 2PLMA 4W93A 2YFOA 3WQ6A 2GWGA 3KW3A 4RNIA 3HPZA 4J40A 2VR5A 3ECQA 4QXIA 1TPUA 4J3UA 3LCFA 1R9YA 4S3BA 3LPPA 1A49A 1IIGA 3T42A 2DT2A 1JG9A 2Z25A 3RU8X 3SGGA 2ZRZA 3W7LA 1Q2RA 1WYIA 1UYQA 2UY5A 1P5BA 1O1HA 1TVNA 3RCNA 1ZBCA 3PF3A 2A3EA 3Q67A 4XBJA 4IG2B 2A6LA 3WQEA 3W7EA 1X97A 4UQBA 5EL1A 3DFNA 1SYTA 3N15A 5H8UA 4AG0A 2R24A 2ZX7A 1UZDA 1G1YA 1XC6A 4FHAA 4PODA 1BWKA 3RPMA 3G1HA 5C9WA 1EP3A 4H41A 4GNKB 1TR1A 2PPGA 3FYOA 3QGAC 1GYLA 5CJNA 4TV5A 3BH4A 3V7PA 4LTSA 1O60A 3GDLA 3OGSA 1DJHA 3BQ6A 4XZLX 5CG0A 2PDCA 4X0VA 3BW4A 1ZAIA 2WKGA 3UGVA 4FLSA 4DYJA 2ZUSA 3UY7A 2AMGA 4F2UA 1UIPA 5DY2A 1C7TA 4LYRA 2XGIA 1UZ4A 3LPGA 4PUEA 2CLPA 4NXSA 1RA5A 3MWCA 4Z42C 4M6QA 3TSBA 1QUMA 4J27A 2EJAA 2VGIA 1EGZA 4FXSA 2VEIA 3O16A 3R58A 1E4NA 2F8QA 1PEZA 3QV7A 2WCAA 3UXAA 4I3GA 1E5NA 1Z8AA 3IJDA 4QJ5B 2J8GA 3TMLA 4UMCA 3OZMA 5H91A 2WMFA 1IEVA 3GG8A 3GR4A 1F74A 5CC3A 3K30A 3KCOA 2E1DA 3OO2A 5CC6A 1ONWA 4MFEA 4FR1A 4J9JA 3KWXA 3VD4A 4J5NA 3VE7A 1JCTA 2X09A 1V0MA 4CQBA 1W5MA 2J7GA 2FHFA 4C1NA 4PMXA 4U10A 2IKIA 3ICJA 2VCAA 2PDXA 2J9YA 2Z7KA 2VL4A 4PUMA 3BG5A 1SSGA 4HCLA 3GG0A 4JX6A 3URQA 5BMXA 5EU9A 1E9YB 3TWBA 4LALA 4DPPA 3G18A 3ERPA 1H49A 2PDWA 2EKCA 3P8JA 3W00A 3S9IA 1N7KA 2TMDA 3WJXA 2WMJA 2XTKA 1PTDA 2Q8LA 4Q22A 4OOZA 1KO0A 5FEPA 5XIMA 3STEA 1FHLA 1OGSA 1P0EA 3UJFA 1FDJA 1CGWA 3O6CA 2GSJA 5CZSA 1LWHA 1MQRA 1E5JA 3WQDA 3CZGA 4WCJA 2VP8A 1VFHA 3CZJA 1H3GA 1T0OA 1O1ZA 5M2FX 4DM2A 3QBUA 3EX1A 3QEZA 3WNOA 2IKJA 4FP1A 8TIMA 3AYRA 3W4RA 1LLZA 5B80A 4MY9A 4O1DA 2BHUA 4Z1CA 4ZSTA 4X3ZA 2WPGA 4DJDA 4GIRA 3SW6A 4QEEA 4HYRA 3PBMA 2POTA 3S3GA 3WBWA 3H53A 2WWCA 2Z29A 3VKJA 1BRLA 3NQ6A 1AH3A 2AOSA 4TO8A 3HQ1A 4PTNA 3W1NA 2X40A 5GNXA 3L2LA 3POHA 3C4UA 1R87A 4I7WA 2HXUA 1H62A 3LD5A 3DGRA 3PZVA 5HR7A 3D47A 4TTGA 3V0SA 2CHOA 3P0XA 3E5BA 4DI9A 2XSAA 4NZJA 3V5CA 1JPHA 4I90A 5A6KA 2VEMA 5JBDA 2QUVA 4RZ5A 3KP1A 5CLTA 4RNHA 1FKXA 3G1VA 1PKNA 2VM8A 3ZFHA 2Z1SA 5IOBA 3PJUA 3U2OA 4H8UA 4Y2WA 3NZPA 4ICCX 2ZA3A 1KWGA 1SFLA 4I5UA 5A6LA 3W7HA 5CPQA 3BOXA 3LCHA 1R47A 3PJTA 2YL9A 1HL8A 3KL5A 3HG2A 1FWRA 1HUVA 3O05A 2P5NA 2V63A 4Z2IA 2Q8ZA 4C6EA 2E8ZA 3WLOA 5HMFA 3MHGA 3WQGA 1WO2A 4AEFA 2QV4A 4GFSA 4BI7A 1G4PA 3W2LA 2FB3A 3H12A 3DYOA 1GJUA 3LCLA 4JTCA 1GVOA 1K3UA 4QTGA 5FCZA 5BRPA 2YBVA 1QTWA 4LAUA 2QIWA 4GWEA 5K4ZA 3WBAA 1DTUA 1IV8A 3IARA 4WSHA 2JFEX 4GVGA 1QU4A 5TNVA 4AB4A 4UTJA 1NWSA 4I9AA 1FH9A 4J3ZA 3SN0A 4UTLA 3SECA 4UTTA 4EXBA 2KZHA 4S2CA 3MQTA 3ZYZA 1J4EA 4D2JA 1VRDA 4D1IA 3LHTA 4K68A 4E8DA 4K7YA 3PR2A 4R7WA 2NUXA 1X6NA 2WANA 2XH4A 2VFEA 3FGCB 1OBAA 4RW5A 5EYWA 4YJ5A 4S3AA 3ABZA 1ZFJA 1QW7A 1GOMA 1QOQA 1TELA 2OVLA 1W3LA 1VBRA 2Z27A 1HXJA 1O94A 4FNSA 2W0UA 4H1ZA 5AC5A 2D0GA 2WMHA 1BG9A 4MKNA 4YNGA 4C90A 4O1FA 3QW4B 1JQXA 2QVNA 1J6PA 3WF1A 4CU6A 3TR2A 2OTDA 1H11A 1MEIA 2DZXA 4Q4QA 4C6NA 3EWWA 2PF0A 1XFBA 3P80A 2PP0A 4Z2LA 1I2OA 4RDVA 4IQJA 1F4AA 4G7EA 3UCDA 1JUEA 3RLHA 1UKSA 2WC4A 3UA4A 1XLDA 3GIQA 3W85A 2QJIA 1EJVC 4YCPA 2E5CA 3EX2A 2XHYA 4QG6A 5DT7A 3VD9A 3GAYA 3TYAA 2FGLA 3C3UA 3M0ZA 2GVJA 4WD0A 3WH9A 2HPIA 2EEXA 2A3CA 1BGAA 3DZ1A 1R3TA 4UTKA 3UPBA 3GIPA 1VJZA 4Q7IA 3VM5A 1VFFA 1G7VA 3TYDA 2W5FA 5A8QA 1ONXA 1A3XA 2E3ZA 4GE8A 3VDHA 3ZVHA 2W27A 2W67A 1XLMA 4PUDA 1TCDA 1OFOA 4S1FA 4JQ1A 5T8GA 3C52A 2QMKA 1Q7QA 1AQ0A 1V6TA 1XIBA 2OODA 4GUIA 4AZBA 4G7EB 1IEWA 3YPIA 1CDGA 3ITLA 1WXZA 4NT0A 2CLFA 2BX7A 4F2TA 1Q6LA 5BOFA 3VMOA 5A8GA 3NO3A 1TV8A 4J35A 4OOUA 1WNOA 2OO0A 1F9CA 3WMLA 1PS9A 3HZ3A 4OHQA 2NXHA 1K8XA 2PDFA 4NZ3A 4M51A 4B9ZA 3DFPA 3H8AA 1VHCA 3B0YA 4XK2A 1H63A 2WZEA 3OODA 4O0QA 2V2DA 2A3LA 3SGZA 3TCSA 3MW7A 3ARXA 3VIGA 4XX6A 2R9RA 4N6EA 2NV9A 4E2DA 4LCQA 2DZVA 1UOKA 3WNNA 3P81A 1W9BM 3G1YA 4PRRA 4Y90A 3TNOA 3AYTA 3BMXA 1V3JA 4IXXA 4WR3A 4BFAA 5BRBA 3C2RA 3VNKA 1UZ1A 1DQWA 1FTXA 4Z08A 4Y7EA 4HNUA 2OZTA 3W7JA 3EAUA 3GXFA 4AD2A 3SGUA 5DN1A 3TJIA 3ZXWA 1BYCA 3CUGA 5A69A 4IIHA 2J8TA 2ISFA 1MQQA 3B8DA 3GTXA 4WIWA 5D38A 3C2EA 7XIMA 2MNRA 5C2XA 1SO5A 1E4LA 4OGZA 1EP2A 3QOMA 1XD1A 2GK1A 5LNSA 1CEOA 2WHKA 3PBVA 1EA9C 3F4NA 3WLMA 1IXPA 5HAOA 3V3WA 3W1QA 1B90A 1AH4A 4W8BA 1Z44A 2FZMA 3CPGA 1IGSA 1YLVA 3MB9A 3WH8A 5DEZA 1QI0A 3AAMA 2VDIA 4ICMA 2J66A 1S5TA 4AIEA 3GHUA 1MSSA 2WMIB 4HK6A 4DBEA 1YADA 1PX8A 2FDMA 4PUNA 3UPWA 3MHFA 1EIXA 4TVDA 4LYPA 1S2TA 1J0JA 4NUWA 3DH7A 4JHOA 4B5XA 1NP0A 2BWGA 2Y5EA 1J5TA 3OGRA 4HB7A 3UNDA 3EOOA 4GQGA 5A6AA 1K9EA 1EBGA 1JPIA 2P8BA 4GBUA 3SUWA 1JD7A 2ZZ1A 2YXOA 3IUHA 1TJ2A 2D23A 2B7QA 2QMJA 4IPPA 1DWIM 4NJHA 4JFSA 3HQNA 4KKXA 3DYMA 3VGDA 5HJXA 1WCGA 1DIEA 3UWWA 3WNKA 1DJZA 3M41A 5A6SA 4PMRA 2LLEA 3MY9A 3SQSA 3WUFA 2PWUA 3K1DA 4R85A 3ZWSA 1XGEA 2NWRA 4M3PA 4RKAA 4LJ3A 1OCJA 3NJ3A 1C7SA 1A5CA 3VGFA 3TR9A 2I5QA 4GIAA 1LWIA 3RRAA 5GVJA 2DJLA 5HMEA 2V67A 4J3TA 1ZJHA 1ZAHA 3N18A 5M03A 3SZ8A 3PUGA 4UOZA 3QVQA 3DFSA 3G6MA 2QCGA 2BY1A 2X42A 1TZZA 3BG9A 3VX1A 2D2OA 1CXHA 1JDDA 2J74A 1CPUA 1HVQA 1MO0A 4MYAA 3GG7A 3VCCA 2IQTA 1NFGA 3RCYA 3MBDA 4M7TA 1CLVA 4QCEA 3WUEA 4LB3A 3L0GA 3SBFA 3D3AA 1EQCA 5F4WA 5A2BA 1V6XA 4NZ5A 5BOEA 2A6NA 5A8MA 1EJTC 4ZGYA 2XVLA 3BOFA 2PWEA 1JF5A 3W7PA 4M80A 2YCEA 5E0CA 3WNMA 1HKWA 1OZQA 4TV6A 3G5EA 4A29A 4WLCA 3AU2A 2EPNA 4ZB5A 2J9ZA 3VKAA 3I3DA 4PCSA 3TC6A 4FNUA 4PMVA 3B9EA 3L4XA 4HZ6A 3P6LA 2C1IA 5CGQA 4Q32A 3KDOA 3KS6A 1FWHC 4GISA 4TVUA 3IJLA 2FLIA 2HDJA 3UR5A 3UJEA 3EOLA 4ML9A 4H9XA 2R14A 2DFAA 1GOKA 1PKMA 1F7BA 3QGVA 4HNNA 3FA4A 1CXFA 3PFRA 2VRJA 1VH7A 2DZUA 1WXYA 1YE6A 3QW3A 2DEPA 3S46A 4AWTA 3CUFA 1W9DM 4NYUA 2DZSA 1ZJIA 4PMJA 1WX0A 3VX0A 2GVYA 3N2OA 5HWNA 3SSZA 4UOQA 3ANUA 1PKLA 5H2ZA 5DO8A 2ZXAA 4IF2A 1YDOA 4C1LA 2ZYFA 3HJZA 1UWUA 4JIHA 3KTCA 4KT2A 4M6UA 4GY7A 3CHFA 3NPWA 4IICA 1MNZA 5D8ZA 1TRIA 1NARA 1UA3A 3QJAA 4AIBA 1MW1A 4WY0A 1J8VA 1VB9A 1SZEA 1V7YA 4F48A 4O28A 3NGFA 4QEHA 3VABA 4S3CA 2WM1A 2OT0A 2XISA 3NQ2A 3II1A 2INZA 3U4AA 2VZUA 3ELFA 3MCNA 3R25A 4QJ4B 1LJYA 4JTTA 4MNKA 2INFA 1JF6A 1KQYA 4XAPA 1S38A 2WWDA 3B8WA 3TN4A 3TWAA 5C8BB 1HO1A 1LBFA 3E6EA 2O7QA 3CZEA 3S1XA 9XIMA 1BWLA 3KZSA 2YFNA 2YA0A 2WMIA 1ITQA 2VZOA 4GQBA 4JDYA 3ZLFA 3G6LA 1ME8A 4HTBA 4M1RA 3APYA 1S2VA 4NY2A 3AMGA 2CERA 2VX7A 2DVTA 2PWFA 2QCMA 2CLIA 2O56A 4UR9A 3VIJA 4JS3A 1OCQA 1A53A 3DUGA 3PZUA 3NDZA 1KQZA 3RLUA 1CGVA 1O5XA 3HM7A 3G0SA 1A5SA 4G5DA 5LKYA 4K8HA 5LIWX 4QLJA 1UD3A 1TJ1A 4PFMA 3LLXA 4P8VA 1G4SA 1OFBA 1GJPA 3E2VA 1KFWA 4GMEA 1T40A 3OHMB 3IPWA 2JF7A 3UYIA 5LHEA 1W5NA 2G3FA 4N0RA 2QF7A 1VRXA 2F2HA 3C8NA 5IFPA 3AXMA 1KBJA 3NTYA 1NOWA 3UWZA 1EUAA 2V30A 4B4HA 4DXXA 4FB7A 4ZQPA 1JR1A 3TTYA 2VR2A 1AW5A 4Z1YA 4X0NA 4N6FA 4YTUA 5U4NA 3SN4A 1QXLA 1GHRA 1EPVA 4ZQMA 2E7FA 4POCA 1TIMA 3UPMA 2VI0A 4PMQA 2CLMA 5T26A 3OVQA 2CLEA 3O6YX 4AY7A 3EEZA 3S5OA 3ZOAA 1B4KA 4XVDA 4Q8QA 4PA8A 4ZVJA 3AWNA 4GKLA 2VGFA 2HNEA 3I7SA 4UZSA 4HJWA 5FJUA 4B16A 1V0KA 5D04C 1Z41A 4Q6XA 2GVEA 3UJ2A 4B3ZA 3LQGA 2X1IA 3CNYA 3GYCA 4AUBA 2E9LA 3A47A 4C65A 4C7GA 4PB3A 2PU1A 1C90A 3R5EA 4KEZA 1GG0A 1XSKA 5B7ZA 1DQUA 3AMLA 3MMDA 4N42A 2NWSA 4DO4A 4L9XA 4Q8VA 3ID7A 2VX4A 3KBNA 1HL2A 1AZ2A 4IX0A 3WO8A 2Y0FA 3QM3A 2BHZA 1TV7A 3RILA 3I4EA 4WGHA 4KGLA 3W75A 2CW6A 3NL2A 3QQ1A 4OJYA 4BF9A 4UFKA 2YJQA 3WD0A 1FUYA 4M0XA 1XLEA 3VI2A 3G3DA 3NO1A 4HMCA 4XZ9A 2GGEA 2VGBA 4FS9A 2C8NA 3MI3A 1KBLA 5D09A 4PCNA 3OJGA 2PD9A 3AO0A 2DH2A 2RDXA 5KZEA 3NUKA 1Q13A 4Q33A 3TN5A 1P7TA 3N04A 2Z1BA 2ZE3A 5CZKA 5ABEA 2E5DA 5FA5A 2RH9A 4UR8A 1JYWA 5LIXX 3UXIA 2P50A 3GR7A 4LEFA 2YZ5A 1AQFA 3N9RA 4WF7A 1LUCA 1E1CA 3E38A 4YWSA 3B8TA 3FN9A 3NQAA 2FZ8A 3A3XA 2EXOA 3A6OA 3A5VA 3WBYA 5A8PA 3AIWA 2X1UA 3ZT5A 4ZOBA 1RAKA 2C0HA 4JX5A 2A1YA 3W9ZA 3UCCA 1EWEA 2PTXA 5DBTA 4B9YA 2NVCA 3IJQA 2EKGA 3L5AA 4WZHA 2WB5A 2E25A 4UB9A 3LDVA 3B8VA 1HQTA 1GVRA 4CNTA 2Z7GA 2D2HA 5G2WA 3D5HA 1KC7A 1UR4A 3M4HA 3ZIZA 3EA1A 4JFUA 3EPNA 1VHNA 3H2MA 4O0ZA 1TTQA 3SADA 5FAJA 1LL4A 1PWMA 2V5KA 3WH7A 4YYCA 5I24A 4QBXA 3FLUA 2YCJA 4C6IA 5LSMA 3AZRA 5HUPA 4F3HA 1Q6OA 3FEMA 5IM51 1OX4A 1Z9AA 3VOHA 5JBEA 1M04A 1KXQA 1LYXA 2GWNA 1ONRA 3F4CA 3GUGA 1NTHA 4MVAA 4B3LA 4HKPA 2NUWA 3ZM8A 4DB7A 3AS0A 4PB5A 1Q6EA 4LAMA 1HNYA 2YCKX 1RR2A 1XC4A 1ADOA 1MRAA 5BMWA 2Y85A 4RDWA 3NDYA 2J47A 3WYZA 5DANA 4X9SA 3EKGA 4NNAA 3PB0A 1OFRA 3W2JA 2H8ZA 4DUWA 1E55A 3IVTA 4PL2A 3M9YA 1LP6A 3QPYA 4FF5A 2GGHA 4KFNA 4W7VA 4ZO6A 3BDKA 3WX7A 1SSDA 3B8SA 1EBHA 4HA3A 4ZQOA 3WLHA 1DV7A 5AHFA 4I6KA 1JZ6A 2YXXA 4ZFMA 4P8XA 4UQCA 4B90A 3K46A 3OA3A 1SFSA 1KWKA 3LI1A 3ZWTA 3WBXA 1UR8A 3P82A 4IL2A 3WMCA 1UBSA 2GUBA 5AC7A 2JALA 2Y8KA 1DQXA 3OPSA 4BQ2A 4L61A 4LUSB 3NYDA 1DHKA 3UR2A 3P60A 4REQA 3CUZA 4DNHA 1AMKA 4FI4A 3L23A 3N73A 3MMWA 1CX9A 3N12A 5H6HA 4ZQRA 3MV11 3CBWA 3DG7A 5AYIA 1GNXA 1PYMA 1ELSA 2H8XA 3UVIA 2BV9A 2PDYA 3VVGA 1UWAA 3UWVA 4PMUA 4FLQA 1IWPA 4K1GA 3KXQA 2ZX8A 3WENA 4EKJA 3GNNA 5ABGA 2PDHA 4MPQA 3EMQA 3NURA 4JIRA 4ORMA 4PBEA 1HIZA 4AHPA 3NIYA 2R91A 4UTFA 1WBJA 4G1KA 2HROA 3U2CA 1ZALA 3AXXA 4JHZA 1KM4A 4I6VA 3KVJA 3PJXA 1EEXA 4ZB0A 1H5VA 1PIFA 2C18A 1Q65A 1AZ1A 4R3UA 4YCOA 4B5VA 3DHDA 3GYEA 1M7OA 1NDWA 1UP3A 3HV9A 3T2QA 3T05A 1D3GA 2TYSA 3BE7A 4CCCA 1RBOB 2I16A 1R5YA 3LBCA 1KTCA 1OG6A 1JCYA 3NXFA 2XINA 4UNLA 4LNCA 3KOZA 3GTFA 1A0DA 3PULA 3BG3A 3FHQA 4UOJA 3W72A 3EWBX 4IOTA 2Z26A 4GO8A 2VC5A 1DWJM 3WEZA 4YHGA 1WZKA 3JU2A 1E6ZA 2IQDA 1GHSA 1VBGA 3W1MA 1E1EA 1FDYA 3NM3A 1RK6A 2WVVA 4P7OA 3E2SA 4AZIA 3CM4A 3S2NA 1ME7A 3T44A 1FP9A 2O4MA 1OSEA 4ZEPA 3BAWA 1XCXA 4LANA 4RE3A 5HUOA 4DBSA 4JYEA 4CCDA 3R0DA 4QLLA 3SUTA 5DMMA 1E9IA 3VNIA 4OE7A 5D9MA 4Z0SA 5A5WA 1RQBA 4RW3A 1OGBA 3C0JA 3BTNA 1TJ0A 3QF0A 4H3DA 4P7RA 3T8LA 3QLDA 1KBBA 1PSCA 4MAVA 5JVLA 5KSWA 3I7QA 2QJJA 4PMDA 3WDHA 3GNRA 1KRCC 3QQ0A 4IGSA 2J6XA 1D3CA 3NQVA 1PZ1A 1JI1A 3AQUA 4DO7A 1WA3A 4LVDA 1DWAM 4ORIA 5BW6A 3W25A 1JCLA 5D8WA 1QAPA 1PXGA 3ISIX 3GBDA 4UUIA 3ITYA 1Z89A 1DIDA 3EPOA 3AIQA 3CAQA 4W7UA 4F4RA 2R94A 4V33A 4DJFD 1HP4A 4B15A 4LVBA 4Z2KA 4F0KA 2PDJA 4IQDA 1JXKA 1SR0A 4EANA 2WSYA 2HK1A 3TC7A 1J0IA 5I77A 4EE9A 3EXTA 3MUAA 1DJGA 3C86A 3GXMA 5AZ0A 4PC8A 2C16A 4U28A 4YTQA 1AQMA 1XHGA 3ZVHB 4PUKA 4WUIA 4M6PA 1EGMA 3SRDA 3SCRA 1PHQA 5C7VA 1UD2A 4QAIA 5HWMA 1BSLA 3D3FA 5HNNA 1VENA 1VFTA 3Q4DA 3NSMA 1T41A 4NZ1A 3FEQA 1E4IA 2WNZA 3TIMA 4UNIA 1RH9A 1QI4A 3OP2A 4URIA 2OYKA 1ZTVA 1E0WA 1HO4A 3OG2A 3W88A 1SFJA 2POZA 2X7WA 4GUFA 2ZCGA 1RQEA 3AHZA 3VKCA 2V2CA 4CQCA 4DJDC 1OK6A 2G0WA 1E6QM 1XLKA 3EWUA 4QDWA 3BV4A 3PNZA 1FQ0A 2WNWA 2C0AA 1GZ1A 5BXSA 5BOOA 1FHVA 5DQPA 4EX4A 1UC5A 5CEWA 3WLPA 1DL3A 3WJSA 4Z2JA 3ITVA 4IMDA 4JGDA 1XKYA 2ISDA 4AZ6A 1MYRA 1QI5A 2WMGA 3KRBA 4GCXA 5HA7A 3WEMA 4GYKA 3GC5A 4AY1A 4XVEA 4JQ3A 1PYFA 1VBUA 1YNPA 3TTQA 4O11A 4EIVA 1NU5A 4DZHA 2FQIA 3WNPA 4F0MA 2OKTA 3WQ4A 5IBXA 1J18A 1X1ZA 4GH3A 2HSAA 1ADDA 5LA1A 1E0UA 2CBIA 4E4FA 2VELA 1QPRA 4R33A 3SCOA 3MSGA 4L1XA 4H9YA 1XBZA 4Q8UA 2V0TA 4OTKA 1YTDA 3OLGA 1ITUA 1E6PA 1HFBA 1UH3A 2CFFA 1PIIA 3T08A 4FOJA 1HN1A 3PPFA 1S46A 1LOLA 1A5MC 4AD0A 4B91A 3AC0A 4MJZA 1KXHA 3MYOA 4PRWA 4H01A 3FVDA 3T55A 4FALA 1KCXA 4QDMA 2QGHA 3TJLA 4XTDA 2PURA 4KWOA 5IDIA 1TWZA 3W29A 3APTA 2ZOXA 1MUCA 4YYFA 2X05A 3VDGA 4M82A 3ALFA 3T78A 3AIEA 3A23A 3MZ2A 2B7OA 1QOPA 1UWTA 2XVPA 3J7HA 3LNPA 3TN6A 1JI2A 2CBUA 4LNYA 3RLVA 3R2GA 2DP3A 3NL3A 4BY3A 4CU7A 3H4GA 1OINA 4D72A 4ZR8A 2ZADA 1WAUA 4IMFA 2GDQA 1PL9A 1FH8A 3GHSA 1J9YA 4XV0A 4C6CA 4H7CA 2OELA 2ODOA 3B8IA 2H9AB 5F4XA 3SCWA 2NXGA 2DUAA 1SMAA 1JULA 3UZ5A 5DMLA 3TDFA 3MUY1 1QK0A 4RUBA 1P0BA 4JTFA 3VE9A 4FXFA 3OIHA 4MZYA 3IJ6A 1S39A 1SU5A 1F6KA 1WUFA 3S5SA 5KEZA 4P2VA 1DJIA 4L4OA 2QUTA 4PUJA 6ALDA 2CITA 4MWAB 3W74A 1L6SA 4PE8A 4GYFA 1XIEA 5JH2A 1TQJA 3LA4A 3PZNA 4QFUA 1XG3A 4UIOA 2VR4A 1XKJA 3E0VA 3LI0A 4RZBA 4S23A 4A8IA 1XRFA 4HNLA 3UESA 1W3JA 7REQA 2WSKA 4KGJA 4D6EA 1UKTA 3S5NA 2VFHA 4QE5A 1OHLA 2RGLA 2VZTA 5F4SA 5FL0A 1SQ7A 3QN3A 5I3GA 2BG5A 2PD5A 1OG0A 4WDXA 1TX2A 2XYLA 5HBFA 4KF1A 2CBVA 3EX4A 4O1CA 4JL1A 4LW7A 5EPDA 5CPNA 2FTWA 3TW7A 1TUXA 2J77A 2D0FA 4INFA 3QY6A 2CC0A 2JE8A 1X98A 2HE8A 2FGBA 1Z69A 4XQ6A 2D3NA 4O17A 1BLIA 1VLIA 1Z3NA 1H1NA 4AXKA 3N2XA 4FOKA 3C0LA 3WJZA 4C6KA 3KE0A 1TMQA 4EWND 2XM1A 2JKEA 3RM9A 4O15A 1L6WA 1UIOA 1CTNA 1UR3M 4FEZA 1UKOA 3HURA 1XDLA 1P6WA 1DBTA 2HWGA 4GY1A 1UD5A 3BW2A 1S5NA 1V8EA 5F1VA 5E9XA 3BLFA 5CH9A 4WDTA 3NPXA 3TW9A 3EDKA 2YXGA 5FF0A 1JGMA 2ZZ7A 3ZJKA 4NZFA 4LUTA 3QRHA 2XWEA 4KWWA 2PTYA 4MLRA 2CLKA 2Y8UA 4B3KA 2BB0A 1LG2A 4PMZA 1PE1A 2Z24A 2WC7A 3WG6A 4UWMA 1H0GA 2MUCA 1F07A 1UWRA 2CETA 4RDYA 1XLHA 4GA8A 4JY8A 1LT8A 4NILA 1AJ2A 4JN8A 4JTIA 2GJLA 3WEOA 1B0IA 1B3YA 1OCNA 2V82A 3TMQA 3XISA 4JYFA 3UD6A 3ARYA 4AX6A 1LLOA 2UWFA 3N19B 1JYVA 3T4WA 3RF9A 2YBUA 1NF0A 3M5VA 1MXGA 3PWGA 2H90A 1RSCA 1NDYA 2A7PA 3ZR5A 5JQ9A 1KFCA 2XSXA 5LNUA 2QJHA 4MLJA 3A9IA 1JUBA 4GYPC 3WIJA 1R0MA 3W2KA 4ZE4A 3VUSA 3M0IA 4L9ZA 1SM9A 1OZMA 2QW5A 2JGQA 4WGXA 3R43A 4JD4A 5D2YA 3S2LA 2GQ9A 5HK4A 2I9UA 1EC7A 4DJEC 1CGTA 1B4EA 5KZDA 4W9TA 1FXQA 2NVDA 3MSRA 3EKLA 3MSDA 3WLLA 2QCFA 3LZ5A 1ADSA 1LQAA 1OF6A 2TODA 3FS2A 1I2NA 3W01A 3CMGA 4NP7A 1YEYA 1V6YA 3BLEA 3LSBA 3QXBA 2XFFA 3AIRA 3MBFA 1XYFA 1LTDA 2B31A 1S2AA 3POCA 1LBMA 3V75A 2HVMA 4U2YA 3OZOA 3RDKA 3IJ8A 3HPAA 5FJJA 2I17A 4FK9A 2GQ8A 1IEXA 3LHVA 4TXEA 3KRSA 5C70A 2PA6A 3VZXA 1XP3A 3W6YA 1B5TA 4LBSA 1RJRA 3Q45A 3VAVA 3MO4A 1KA9F 2PS2A 4ACZA 1TCMA 5JUVA 3GZ3A 5TIMA 5G1YA 3GVGA 4GVFA 3ABOA 2I1OA 5KITA 2CZ5A 4BI6A 4FZIA 1Q7ZA 2QT3A 1GQNA 2ZA1A 1C91A 2DZBA 1N8WA 3E12A 5A2CA 1FOBA 5AVNA 1CCWB 4MGGA 1RBLA 3PAOA 1ZJAA 2VZVA 1KGXA 3FAWA 4FO4A 2FZDA 2NZLA 4HPHA 3REQA 1J93A 4GUJA 3N4AA 2FH6A 2D69A 1W3KA 3WN6A 2QHAA 3UXLA 4E8CA 1HKVA 2PDIA 4IP5A 3S1WA 1CXEA 4P8UA 4GGBA 5HMSA 1ECEA 4FXJA 1W1A1 5J5DA 2WW5A 5F7UA 1DORA 4XIAA 3DGBA 1QPNA 3WK1A 1QPOA 1XR2A 4C6QA 5CSSA 3CWOX 1UWSA 3W02A 4LVFA 3GO2A 3DOPA 2BGSA 3FJLA 4TOQA 3BLLA 4S3KA 4PCTA 4IT1A 3EX3A 2HVOA 4W87A 4JFVA 2PWVA 3I4KA 4JTAA 5E0FA 3I6EA 3DHFA 3PFMA 2OB3A 4JOMA 4LUYA 1QO2A 1PPIA 3VFCA 2HQAA 4JL2A 3H2FA 2VURA 1Q6CA 1GQKA 5K3VA 4OV4A 4ZMGA 4AIOA 4HPXA 1E4MM 4GKTA 4LCSA 1KRAC 2VRKA 3L12A 4DLMA 1G4EA 3SM0A 4W89A 4HCDA 2CYGA 4O18A 4LUSA 1BYBA 1XYMA 1FA2A 3W7RA 4RPPA 2FZNA 4B92A 3N14A 3KWSA 4TVCA 2F7FA 1T6MA 2J25A 4NU7A 1U5JA 3W7QA 3HPSA 1R6WA 2XN0A 3WD3A 1XW8A 1V02E 4RZ4A 3V0TA 1GVYA 4HN8A 1IZJA 1B54A 5CAHA 4PTVA 6PTDA 3S42A 1FRBA 4Z1AA 4GUGA 4D6IA 3LHWA 3EB3A 3WQCA 4DNMA 1UKQA 3WLRA 1FWGC 2GK1B 3HIJA 1EB3A 1FXPA 4XISA 3U8GA 1XBVA 4S3FA 1WKEA 3AOFA 3VGHA 2J7HA 3C8FA 2VFDA 4XD5A 4RCXA 2A5HA 1EOKA 2E6DA 2FVKA 1S1RA 2P8CA 2QR6A 5IDZA 1Q5MA 2VCBA 4L80A 4CD4A 5D37A 4EPKA 3W26A 2YDRA 2GVGA 4CCZA 1VBHA 4K36A 3JW7A 5C5YA 1ITCA 3SRKA 4GZIA 3GC4A 2GLKA 4O50A 3RNDA 2EG8A 4EAMA 3ONBA 5FJPA 4LY8A 2IPWA 5I07A 2YCLB 1PVNA 3OQ8A 3UFYA 1XS2A 1J0YA 3AS2A 3GTIA 1TYGA 3OW1A 4NASA 1EC9A 3H7UA 1R9ZA 5XINA 1TJPA 4MDPA 3AIBA 1UPMB 2YSWA 2OOFA 1BFNA 5KZMA 3TVAA 3BUVA 4ZA0A 4GGHA 1OX4B 3L4ZA 3UG3A 2IKGA 3INPA 2ZXQA 1KR0A 3W7OA 1TTIA 2VMFA 5I79A 4J4KA 4AMAA 5IXEA 1GOQA 3PAJA 5J8LA 5L6UA 1V6UA 3WJYA 2YW4A 5BU6A 2SFPA 4Y9MA 1U33A 1QNOA 2Y7EA 1PJ9A 4LC6A 3TTEA 1FWDC 3E2QA 3T7VA 4H2CA 3BLOA 1X39A 2J7BA 4PTXA 5JU6A 4E3VA 1C9DA 5CQ1A 1TV5A 1NOUA 5AYYA 2Q71A 3W1XA 4AISA 2JEQA 1W5QA 1PBGA 4QE1A 4BHYA 4IUOA 4F40A 3CLMA 2WBKA 4Q3MA 1BEUA 4Q4MA 3FA3A 3ZZ1A 4YS1A 4Q8MA 1XBXA 1M7XA 4M29A 1ICPA 2XH7A 4LX4A 1RLCL 4W4QA 3EWCA 1VKFA 3GNPA 4LVAA 5T91A 1XLFA 1R8LA 1TE1A 3DAQA 3TH6A 3R11A 4C6OA 2PGFA 1GKPA 4ZOEA 1ICSA 1L6YA 5LIYX 3GDMA 2VC7A 3QV9A 1XLIA 4A05A 4DZAA 1G69A 1DE5A 3GTHA 4TR9A 3GG1A 5IHSA 2HTMA 2XIQA 3VNLA 3VINA 5JMUA 2VFFA 3FDGA 2WNQA 3EWDA 1GT8A 5ECVA 3GSMA 5K9CA 5LNVA 4XZMX 2FPTA 4OZOA 3CZ8A 2VEPA 3WD4A 4J28A 1CECA 4EP8C 9XIAA 3PANA 2X0YA 3LBMA 1IR1A 3HFTA 1XDMA 2C19A 1PWLA 4NL1A 4ZO7A 1REQB 1AFSA 4D6FA 5HQEA 1JRBA 2WVSA 4IP4A 3BQ5A 2TRSA 1GONA 2REQB 3FYPA 3TU9A 4LS1A 1W2PA 5EFFA 2HRWA 4V1XA 5DRCA 2A21A 3LGGA 3P61A 2HZGA 1TA3B 4IG2A 4BZYA 4L65A 4U3CA 3HFYA 2AL2B 3NQMA 2ON3A 1F2JA 2EBNA 3SUVA 4R7JA 3IJ9A 4ZENA 4W84A 4H6EA 3I7RA 1GWJA 1I4NA 2XH2A 3F7JA 2DDXA 4JQAA 4ROPA 2RUSA 4IGNA 1H60A 2OO6A 4X2PA 2FJKA 2ZC1A 5B7YA 5I3HA 1Z7AA 2DQWA 1TPC1 3VDAA 1TB3A 5EMJA 3VIMA 4CEUC 3O2LA 4E38A 1U2YA 3MVTA 6A3HA 1G5AA 4HU8A 2GDVA 1GOWA 4PMNA 5A8OA 3GX9A 1M01A 4HU3A 1W3HA 4WX2A 5CAKA 3KS5A 1ML1A 5CGTA 1T96A 3O6AA 1XF0A 4O52A 5HMDA 2ZE0A 3E0IA 2PDQA 3LQLA 1E6NA 2VVNA 4EPBC 1UHVA 2G97A 5FKYA 5EKYA 1FCUA 1Q6GA 2DIJA 3C5QA 1EF2A 1SUXA 1HX0A 1A5KC 4DJFA 2J8FA 3LRKA 4IP7A 3M0KA 3PSWA 2BVTA 2PSNA 2P10A 3FXGA 3BAYA 3E0LA 3M46A 1UUOA 3P3BA 2YPIA 1L2UA 3BSMA 1OFEA 3HMJG 1EA0A 1TQXA 2PU0A 5H8MA 1I1XA 1SJBA 2J4GA 2GUYA 3QGKC 4I5XA 1CXIA 3PN8A 4US5A 3O0FA 3H6OA 3U3HA 4AEEA 1A5OC 3UERA 1XSJA 5FI8A 2RJGA 1GQIA 3ARRA 3CV2A 3RM4A 1CXLA 3UWQA 3L68A 1J0ZA 3N1AA 3V1PA 3K8KA 4JY9A 4D6GA 1K4HA 5SWUA 3UZJA 4L4MA 1VJSA 4N9BA 2A85A 3A64A 4UTWC 4JTQA 4D8ZA 3LTSA 2YDAA 3FSUA 2V81A 3MI2A 1V02A 3PVFA 2OWCA 5CC5A 1YPIA 3MDUA 3BMVA 5TAOA 3PC0A 4TU1A 1LBLA 2OSXA 2XH0A 4JEQA 1OJXA 1CNVA 3KL3A 4XBKA 3WF0A 4TTUA 5TBOA 3CL8A 4HU4A 1FWWA 3A22A 5MF5A 3RX4A 3DG6A 4DPQA 3NL6A 2J88A 3WBEA 1VEOA 3FFSA 4KPLA 2E1WA 4Y8FA 2ISSA 4ROQA 5K7JA 3W7IA 2VEFA 3EBVA 1C9WA 3CU2A 4BQ3A 5G1TA 1ALDA 2R82A 3U7BA 4REQB 1ZHAA 4YWIA 4RXGA 3IACA 2DSUA 3WLIA 1J12A 2QCLA 3CASA 3LV5A 3SCVA 1R30A 2CZVA 1YE4A 4MB4A 3N6QA 1RV8A 3GDTA 5A6MA 1MUWA 1C93A 1B2YA 3GXPA 1W1B1 2CZFA 3L7RA 2W3ZA 3MC5A 4LUTB 1XINA 1VCGA 4HSOA 2QNEA 4QQUA 2AL1A 3PZ9A 4PEEA 2QDHA 4AC1X 3FKRA 2O7SA 2BMBA 1WDRA 2HK0A 3U7VA 1ZUAX 3IUDA 3MSYA 3URAA 1BD0A 4N9CA 4EXQA 2VGGA 3G0XA 2V38A 4FX6M 3RX2A 4B5UA 1W3TA 1KV5A 1JNDA 1B30A 2ZX5A 2R1PA 3SJNA 2IXUA 4F0LA 4LFYA 4KBXA 1XRVA 1XGDA 5DCEA 2B81A 2UZ9A 3F4WA 4J3WA 1EJ7L 5C2GA 3RRXA 2V2HA 1EHNA 4XUGA 3GWQA 3CQIA 1ISWA 1UCWA 3OOQA 3LSCA 1Y0EA 1VFUA 3ONCA 1NQKA 2ZZ5A 3LPOA 5CPMA 1E71M 2C13A 3BURA 3CUHA 4JIIX 2GFTA 4MJ2A 1NWUA 2VEGA 4DJED 3DX5A 4NNCA 1JYXA 4UZUA 4DAFA 2PDPA 2VX5A 3QZEA 3W0KA 3W23A 2QGYA 1E56A 2O0TA 1R3YA 4ADTA 1OIMA 5ABFA 3MP5A 2VUYA 1G7UA 3CT7A 2ACRA 4M5PA 1DHPA 4O16A 5REQA 2C79A 1F73A 2NV2A 1XLLA 1H0IA 2E09A 4AWUA 5G4EA 2ZQ0A 1Y8BA 3AMKA 2YKKA 5TF0A 3USBA 5BXRA 4Y9NA 4CD7A 4GIYA 2VWTA 5E1QA 2DZTA 3A4AA 3TQKA 1HF6A 4NHVA 4B2DD 1RVKA 1V6WA 1WZLA 2ZC8A 2GQ3A 3UCQA 3WDJA 4WJXA 2ADAA 3U57A 3T07A 4PFHA 3B97A 3R94A 3TAKA 3IIOA 2OLSA 3CYJA 4C7FA 4MMWA 3KVKA 2RFGA 1ZB5A 3D0CA 3KLLA 3IJ7A 2O9PA 5C9RA 2ZDRA 4KCVA 1LORA 1QVBA 3L5LA 4TMCA 3EDEA 1ISXA 1Y65A 3S83A 2V3EA 4ZTYA 1ICQA 1EJUC 4QS5A 1OYAA 4AZCA 4BQ5A 3SFKA 3W7CA 3EXSA 5CPOA 4DZIA 1SGJA 1KV8A 3DFYA 1K8CA 4RL3A 1O12A 1E6SM 1RY0A 3H26A 3QKZA 2HS6A 4TX6A 4TUFA 3VYLA 3UEQA 5BYWA 2E6YA 8RUCA 3SJ3A 5IBXC 4TIMA 1HG3A 3C2YA 3GH5A 4NJIA 1DE6A 1ZCOA 4JICA 4M19A 1BPLB 2DW6A 1TFVA 4OIFA 4AYSA 1FWCC 1T8XA 3CH0A 3DYPA 1YPFA 3ARSA 2Z6JA 1XD0A 4G9PA 3K5XA 4S3JA 4V1YA 4AC7C 3O7UA 2VEKA 1VJIA 4PTWA 3FNDA 2C3ZA 3E3HA 1KM2A 1A3WA 3TKFA 3M5ZA 3QV6A 3B0UX 1B3ZA 1FH7A 1J79A 3W1PA 1W5PA 2YL6A 2DJXA 3HPFA 3VIOA 4U4MA 2XIJA 4IPJA 1VIZA 4B4FA 2KAUC 4UTIA 5D9NA 4CN6A 2CZEA 3VKBA 1DJWA 4PTDA 4J1OA 2O9OA 1E1CB 2FMNA 3G22A 1OT2A 4W86A 4N9EA 5LHFA 4LUJA 3KM8A 2WV8A 1RPXA 3P2VA 1ZRQA 3E96A 4RJEA 4KWUA 1M53A 3M0XA 3STPA 3TC3A 3VOFA 1JCNA 3OEXA 4PBFA 4CNOA 1V6VA 1UH2A 3ORWA 2GZXA 1UW9A 1K9TA 4LOCA 4GQ0A 2QJMA 1OADA 2WCSA 2RJHA 4G7FA 3CUIA 2C71A 4DIAA 4ATDA 4NJJA 3CB3A 1RJQA 2Y88A 3F2CA 3WL1A 3QHMA 2E28A 1F76A 3UYCA 2V5LA 4Z2HA 4MNLA 5D33A 5DXXA 1BYDA 2Z1KA 4I7VA 3ITTA 3OYXA 4H8NA 2PDLA 1I0BA 3LMYA 4XZNX 3ME3A 2BGNE 3TYBA 4I9JA 1P7TB 4DF2A 2Z2BA 4HSNA 8CGTA 3T40A 3S47A 2X1TA 4JTEA 1WDSA 3QV8A 1MZHA 4GI4A 4Z0JA 1OCBA 4S39A 3LBOA 1EHAA 4YVXA 5CBBA 3KL0A 3G3MA 5I03A 4ZO8A 1U83A 1KLZA 2V8ZA 5HNUA 3L4VA 1PV8A 4JCMA 4IISA 5C0QA 3AI0A 2PRLA 2ACUA 4WOZA 3FSTA 4P61A 3A3HA 1SW0A 2X41A 2WVUA 1BF2A 3VD5A 4C60A 2X0SA 1TV3A 1ENUA 1M68A 3TSMA 1XLGA 3R8RA 1NVMA 2AQWA 2P0IA 4QSHA 2RAGA 4AWEA 2FPYA 1OT1A 1R85A 4KCUA 3W70A 3U0HA 3B9NA 1XI3A 2WXDM 2OXNA 1ZP3A 2ISWA 2IXVA 4YL2A 1KR1A 4NJKA 1FWJC 4FNTA 3G24A 2PLKA 3LK6A 1J2BA 1RQHA 2Y4SA 3SY5A 3WLSA 3H7RA 3PUEA 2HCVA 3LM7A 1XUUA 5AC8A 8XIAA 2VD8A 3TOYA 4HA4A 3M0VA 3W1RA 4HD5A 4HBKA 4H7VA 4PSPA 4Z1BA 5E0KA 2C15A 3VGGA 1GEHA 4CUCA 1XV8A 4LY4A 2OYLA 3TV8A 3N17A 1R7OA 4F0RA 3L4WA 2TAAA 2YYTA 1NFBA 2E40A 4PN2A 4QNEA 4ZE5A 4YLWA 3B9OA 2ZRXA 2XM2A 4A3HA 1EDGA 1W9XA 1XYLA 3EOEA 1KM5A 3U6WA 5HPCA 1TPWA 4C6BA 3UXKA 3A24A 4OV9A 4HMNA 4PUUA 4AWSA 2XN1A 2F2KA 4AD5A 3R8GA 4RXFA 3OVRA 4AH7A 1B31A 5FF3A 2D20A 1UR2A 4P7LA 1XIHA 4GIEA 3DI1A 2OQLA 3I6TA 2YR1A 3RPTA 3KDNA 2XFYA 4DJEA 4CD5A 3VD3A 1WXJA 5K4XA 5LXXA 2INEA 3U5YA 3WSUA 2F6XA 1CLXA 1E73M 1SJDA 4TX8A 7PTDA 1S3TC 4ZFCA 4W5UA 3WDPP 1R3RA 1I60A 3W6LA 5ENLA 1I8JA 5G1MA 1S3HA 4H83A 4KCTA 5BCAA 3TZFA 4GPNA 1IHIA 1MNSA 1UP2A 2DZWA 1KD0A 1JDAA 1HP5A 4BEUA 4JTGA 1BQGA 4RR4A 4MG4A 1E0VA 4NJGA 1RY8A 2WMKA 2YL8A 3WY1A 4KWSA 3ZT6A 1V0NA 1UMLA 2ICSA 2QQ6A 2IKHA 2ASHA 1XFCA 4QGCA 2PB1A 3NYZA 2Y8VA 4PMYA 4DY1A 3NO5A 3LGDA 2PBOA 2Q3OA 3USZA 4F9DA 3T2PA 1DTNA 3BAIA 5I09A 5EMUA 1R3SA 4AIUA 1NDZA 4C5YA 4E4UA 4JPGA 3STFA 4R27A 5M17A 4ZQNA 1E9ZB 2VOMA 1OFQA 3W7GA 3NVTA 3NSXA 1W1ZA 4X63A 2W61A 4GUHA 1GORA 3GDBA 3AHVA 2W4XA 1HT6A 4P8WA 4HN4A 3RG6A 1Z48A 3TFCA 4O53A 2VQTA 3WLJA 3CXOA 2BY2A 1I75A 1IR2A 1MXDA 1MWOA 2IW0A 3G1XA 3QR1A 1GPFA 3C6CA 2Y2WA 5AY7A 1XQLA 2YB4A 4GABA 2E8YA 2FTPA 2KX9A 3QTPA 3THDA 2BOEX 1D8WA 3P67A 1VBJA 3IIVA 1NM9A 3CHVA 1SJAA 4ONVA 3L4YA 3GUWA 2VO5A 3F5KA 4HMDA 3AXKA 3AJ7A 3S2MA 5AZ1A 1SO4A 1M1BA 3RXZA 5ABTA 3ABSA 4HZMA 4AW7A 3FCPA 3JRKA 1FWAC 4H9UA 4WJEA 1WE5A 1K4GA 2OSWA 3BC9A 3PBGA 4ZOAA 4D9PA 2XIOA 1W5OA 4BR1A 1K7XA 1EPXA 3VOCA 1HJUA 4CKQA 4K37A 3ABXA 3U48A 4MB1A 5H1WA 1VYSX 3P7YA 4QNWA 4CEXC 3Q94A 3ZVIA 3A3WA 3F2DA 1IXNA 4XO6A 4AVOA 2X1SA 3OBKA 1LOSA 2PDBA 4EWJA 1UR1A 4QHRA 4OVXA 3DKJA 3PUDA 1IYXA 3V0UA 5HWJA 2ACSA 4CN4A 3O8AA 3BCJA 5E9AA 4MZ8A 4UCGA 3KBMA 4KETA 1YNYA 2YB1A 5TD4A 3OLDA 3SIZA 3N2CA 1BYAA 4JZ5A 3TUUA 1G0CA 2J9XA 3REQB 4JIEA 4HZ7A 2XN2A 1V51A 1PZ2A 5EA9A 4CN1A 4HOXA 3C2OA 1U1HA 1NJJA 3TXZA 2YYUA 4YMZA 4NAEA 3VZZA 4GC4A 2VC6A 3NA8A 4TX9A 3Q37A 2PODA 3DFHA 2J24A 3TJ4A 5MKGB 4KRZA 5I3FA 4ZXLA 3THUA 2F38A 5BWAA 5DX7A 1OK4A 4L7ZA 2JGYA 6TAAA 2P53A 1XWYA 1WP6A 4FXRA 5EBUA 2J7DA 3QSTA 3IK4A 2G3MA 1JZ5A 3H7VA 1XICA 2F6UA 2QCEA 3UA3A 1VFMA 1QPQA 9RUBA 4H9MA 1XRSA 2OX1A 3ALGA 1WDPA 1X7FA 3HPXA 4UQ9A 1Y5WA 3ITGA 2WHMA 4Q4PA 5H8PA 4UFIA 4X2RA 5I02A 1DWHM 2AL2A 3K2GA 1VQTA 3C0SA 1EXPA 1KCLA 3T2OA 3K8MA 1K03A 1JJKA 1UUMA 5G2HA 1G4TA 4MJMA 2BGQA 2NV1A 2ZFAA 3PS7A 3BANA 1PX3A 4L9YA 5GJMA 1V3MA 4GHRA 3OLEA 4JTSA 1DJXA 4M1BA 1UD6A 3WK2A 4WSJA 1UR9A 3W1TA 4IPNB 4ES4A 1KB3A 4K7VA 1TPEA 3W3OA 4LS2A 5FF7A 2BVWA 3P84A 3VMPA 3KUMA 2GJPA 3AIUA 3SN1A 1LQ0A 1EKOA 2GSHA 1G67A 3BSHA 1I2PA 1K6WA 2XIBA 2G8ZA 2ZRUA 1Q63A 3M16A 2ZUNA 3EB4A 3DC8A 4GI9A 4QCFA 3UNTA 1BXBA 3SQLA 1GG1A 1X7IA 1H09A 3MANA 4CGTA 4DX3A 5CGMA 5GJNA 4HMEA 1TA3A 1Q7MA 4MKSA 4JAWA 4QRNA 1WZAA 4WXZA 1QHOA 4J3XA 2ZWZA 3S8HA 3KTXA 4EACA 1WDDA 4RK8A 5DMNA 4HNTA 2YLAA 4HGXA 2PRHA 3U4FA 2QYGA 1A80A 2PP1A 2BHYA 4JEJA 5MKGA 3T1GA 4IX2A 4U31A 5C9UA 3R12A 4ENLA 1FWSA 1F4HA 1WOAA 4TMBA 4X9YA 2Z2UA 4RE0A 1U1UA 1LL7A 2X1RA 2NT0A 3LV6A 1KXTA 3VFLA 4FR6A 3DBNA 5M3WA 2YDSA 3IIPA 2WSRA 2WLYA 1XPYA 5D2TA 5I7GA 1RD6A 2I57A 4MUPA 1RP8A 4QDPA 1HTIA 1XLAA 2WJZA 3G1SA 4FF7A 2UY2A 1IT8A 4DF1A 2DU2A 3O6DA 1FHDA 3W83A 3EKZA 3ANVA 4H00A 1PZ0A 8A3HA 5D30A 1VYPX 4Z1DA 1W3IA 2I56A 2PTZA 1M3UA 3H2OA 3LGEA 2IUZA 4R88A 2G3NA 2DUXA 3W22A 5FJOA 4UQEA 5FACA 2WVTA 2BVDA 1W9PA 1QR7A 2C1GA 4NF7A 4EOUA 4QP0A 1LWJA 2QF8A 3AHXA 4YTRA 3TP4A 4WHBA 1D2KA 3JVAA 3JUGA 2BOFX 2Q3RA 3UR7A 1CZ1A 1XYZA 1S2UA 3G0UA 2HNHA 1W9UA 2VWSA 4S3GA 3WD2A 1PHWA 2FJUB 4ZB2A 1B57A 3LTPA 1TJRA 4RLIA 2WK2A 1GOIA 5DXYA 1B9BA 3T6CA 4DM1A 4UTUA 4OFCA 1MUMA 5LGXA 3VGEA 2PZ0A 3ITXA 4HCHA 3HJEA 3BMWA 4RZ6A 2DV0A 1THFD 3THAA 4PZVA 4B5NA 3R13A 4JIPA 5AECA 5D03A 2Y1HA 3H21A 2L5HA 1R3QA 2PRMA 3D6NA 3GKFA 2PTDA 3LY0A 1IXQA 3KP0A 1AK5A 1UPPA 2OWWA 4WY0F 1V03A 3BCFA 1XLJA 3RITA 5AHEA 5A8NA 3WCZA 1YDYA 3GHTA 5EB8A 3ATZA 3CL7A 5LYRA 3S6DA 3VA8A 3N11A 3R0UA 2YCLA 1HJXA 1XQKA 1EJSC 2NQLA 2QV5A 1ZNNA 3CT2A 5I3KA 5FEWA 5JXQA 3L0NA 3S1VA 3B9DA 4O0KA 4L6HA 1GYNA 4AZCB 3NOEA 1ZENA 3MS8A 4IHCA 2XJ7A 3U2EA 5HQLA 3CAKA 2NVAA 4EF9A 3SAZA 4GBDA 4KRUA 4HJFA 4AYGA 3U2ZA 3W81A 3IGSA 2JBMA 4UMBA 2VHLA 1RCQA 4CD6A 5EMLA 1PCWA 2NLYA 4A8RA 1EFZA 3SO7A 4FOUA 2X16A 2QCHA 2R1LA 1P48A 3SUUA 3EWXA 4R5EA 4NAEB 3EWYA 1I9CB 2DPEA 1C92A 4JTDA 4DWSA 1E43A 5T9CE 3URNA 4G1NA 3QSRA 1LUCB 1BF6A 2QCCA 4GZJA 1ZY9A 4I9MA 4MM1A 1LL6A 2EGZA 2OMAA 2OFJA 2GSEA 3PPCA 1NFPA 3OHIA 1QNVA 1XM3A 1W3NA 1DWGM 1ME9A 3PPGA 1WAWA 2FVLA 3NQBA 2BFGA 4KERA 3PUOA 3V1HA 4EAYA 3W2NA 5G5IA 2XFRA 1AVAA 3B05A 1L6GA 1EGVA 2EG7A 5FSEC 1QFEA 5HANA 3CJPA 1JZ3A 5CSYA 4AMCA 1I45A 3NZ1A 4C1NB 1O4UA 3PTQA 3CQ0A 5AYBA 4F66A 1MVYA 4NNBA 1E15A 3GNDA 1P43A 2PDGA 1XH0A 3CWNA 4ZTXA 1YDNA 4AF0A 1G94A 2CBJA 2HS8A 4E4PA 2D22A 2OGJA 3RR4A 1VZWA 2I9EA 3DENA 3H23A 4IIEA 3CUJA 3WLTA 2DT3A 2DGAA 2FHCA 1EZ2A 5I0DA 5CPTA 2PDUA 1POJA 2FFIA 1EZWA 4FSAA 4AD1A 2NQJA 4ZO9A 2IMRA 3E49A 4DRSA 4LBRA 3N3MA 1UJPA 3GB6A 1I6NA 5E6ZA 4DXKA 3VK5A 1IIHA 3NQEA 1TPDA 2E67A 5CLWA 1DEDA 4MWAC 2ZIDA 3WDIA 3LX9A 4KESA 3E0WA 1UBPC 1YXDA 4GACA 2I5IA 4H6RA 2WM0A 4WEVX 2QDEA 4W7WA 4W85A 3ARVA 2OZ8A 1K9DA 4IXHA 3K8LA 3F4DA 4A3YA 5JH1A 3Q2DA 1O7AA 3DG3A 2WAGA 1ISYA 1JDEA 1XBYA 1CXKA 4Q4OA 1Q8JA 4L5ZA 1NY1A 2I14A 1WV2A 4GNVA 1MFVA 2A3AA 3BO9A 3B40A 4K2SA 3NQ8A 4A3UA 1EYEA 8XIMA 1UOZA 3HMCA 1EDTA 3DERA 3W73A 1H7XA 1TWIA 3W7NA 4XWUA 3LOTA 1XPGA 4GQRA 1AA1B 4U5IA 1T5AA 4EVZA 2ZUTA 3FJNA 1V08A 3DDMA 3IVSA 3CH9A 2FIQA 2ZZ4A 3TN3A 1GYMA 1DJQA 4V2XA 1AL8A 1AW1A 3JS3A 5CSRA 5I2UA 4FNQA 2BY0A 4DUVA 4K39A 1H7WA 4CNUA 1LZOA 3L2IA 3DC0A 4JFWA 5EBAA 1GUVA 2AGTA 3BZGA 1J11A 4CQDA 4JDBA 3M43A 4A3QA 1GQLA 1SO3A 3VNYA 3UG4A 4BCEA 4YU1A 2FMOA 3NQCA 1O6IA 1J6OA 1ZU8A 3N9SA 2EQDA 2IPJA 3TLLA 4GJIA 5LGZA 4F79A 3P74A 1UD4A 5LNRA 1Q8AA 3ABRA 4C6PA 3S0CA 3JR2A 5LNWA 4DWSC 1X6LA 3QHOA 3W82A 1XYBA 2QUMA 4IH3A 3UZYA 2DSKA 4GYJA 1J10A 3MT1A 2CIPA 4M81A 1EO5A 4IMGA 3G1AA 2BP1A 4QAWA 1V0LA 2NQ5A 3B04A 1R86A 1XYCA 3CZKA 4KH2A 3E74A 4I5RA 5FIPA 5F2LA 4DAIA 1GVIA 3MDWA 4EXAA 2X8RA 1TV4A 2QKFA 1JIBA 1W6TA 3TYEA 2YW3A 2DVUA 3BLIA 4PMOA 4JNZA 1SO6A 1TTJA 1EC8A 5C9XA 1VFSA 4Y8EA 5I3JA 4QM1A 1IZKA 1EUNA 3NR0A 1JZ8A 4WY0B 3M6DA 1VEPA 2BOGX 1E3XA 1VPXA 1OEPA 2QPXA 3TZNA 3OZPA 4Q6JA 3LEPA 3SSJA 4BWLC 1Q6DA 2VUNA 1RBAA 4YVPA 2CWXA 1KBKA 5HDRA 3SUSA 2AAAA 2ABBA 1H2JA 3A12A 5T9BG 3PPHA 1YBQA 2EHHA 3BV7A 1E1FA 3APGA 1XDJA 4MUZA 3UW6A 4IQLA 3FGCA 2OGYA 3FW6A 3EEGA 5E93A 4NQ1A 1AMYA 3TOPA 4O19A 1OYCA 3LN3A 1NQ6A 4V27A 4MPKA 2GQAA 2ATMA 3TW6A 4EF8A 1SPQA 1ZBWA 4FLRA 5ECUA 1D9EA 4IFRA 1SZRA 1UWQA 2V5CA 3GNOA 1OGGA 2EAWA 1ZLPA 1BHGA 1SZGA 1GQJA 1I0DA 4MWAA 1ZL1A 1AW2A 2VOTA 4HPNA 4GYPA 4M56A 2YGYA 3LM3A 3KBVA 3AISA 1Q45A 3RMEA 4U3AA 1VP5A 1QI2A 3I3EA 3LHUA 4QS6A 4EPEC 4WKFA 4PGLA 1Q66A 2JEPA 2PC4A 2NQ9A 3MTWA 3QH2A 3HG5A 2FKPA 3F2BA 3QY7A 3IVUA 1JRCA 4XKYA 3PTMA 4OECA 3AS3A 1MMFA 1FWIC 1REQA 4FAMA 1QW8A 4P7QA 3F5LA 3E2RA 1NOFA 4LPCA 3WQOA 2AAMA 3LHYA 4JTKA 4XD4A 3W84A 4WOQA 3ARWA 6CGTA 3BGAA 4F2BA 2FFCA 4UFHA 4JFTA 4PUWA 3K4DA 1BVNP 5FJIA 4L1WA 4LAZA 3WFAA 1RCXB 4A4AA 1U5HA 4YHEA 4DQWA 3HO8A 3AALA 1E6XM 3VCRA 5E70A 1GTEA 2PZNA 9CGTA 1HKIA 1HZYA 2XVGA 5CG7A 3ZMRA 3CB8A 3WDQA 3CO4A 3B8UA 4GH1A 4IGHA 4DI8A 2NLIA 4FA3A 1NAL1 2VNCA 3WKZA 3UBPC 3I10A 3TSDA 3QZAA 3KHDA 1DP0A 3IJIA 3T9PA 4MB3A 3AUOA 4GXWA 3A13A 5AYXA 1KFJA 1QNSA 4K8EA 3WF3A 4AY8A 4JNMA 4UC5A 1SW3A 3VD7A 3IWPA 4Q7BA 4AD3A 3B4YA 4LEQA 2GJNA 2RDTA 4IMCA 1OY0A 3SY1A 1ODUA 3TNBA 4O4VA 4GQQA 4B5SA 5G2IA 4XZWA 4MSSA 3WFLA 2GOKA 3RAOA 4GVIA 2XWDA 4XAFA 2DIEA 3VU2A 1CIUA 3MZNA 4IIBA 3A5FA 3QC0A 1JCJA 1N8IA 2G5WA 3MUXA 1RA0A 1YNQA 2VTFA 1U5VA 4ECLA 3WD1A 1SR9A 4JTRA 3A4WA 3O07A 2ZVIA 4LRSA 2NW0A 2RGMA 2C6QA 2JKAA 3PZOA 2EPLX 4ADUA 3AMCA 2Y5JA 1FKWA 4GX9A 4Z2GA 4EPDC 3T0CA 4Q8WA 2EPKX 1WB0A 3IAPA 4BI5A 1OC7A 4LUIA 2V6AA 1FVPA 1B3OA 3ZS4A 1XH1A 1KM1A 1TX0A 3LCWA 4RNFA 2D1ZA 1VC4A 4W5ZA 3QQWA 4PBGA 1H7OA 3PJWA 4S38A 4PEKA 4GFIA 4HU0A 2HBVA 3T0BA 3UWYA 3N13A 4LAOA 1FFRA 5EY5A 4A3RA 4O14A 3NAVA 1XYAA 1BKHA 3CLWA 3CL6A 4AZGA 3W28A 2OR2A 4XZBA 3RO6A 5KZ6A 4IIDA 2NSOA 2V3GA 1GCYA 3IGHX 2NT1A 3HGSA 4LAKA 4GZEA 4MYXA 3WQFA 1KTBA 4O57A 3I68A 4O8RA 1EOMA 2A7NA 5ABFB 1LRQA 1CI1A 3TAOA 2BNJA 3FV9A 1F3TA 6REQB 2A7RA 4GY0A 4KEUA 1KRBC 1YPXA 1TMHA 1POKA 1V5XA 2QXWA 2F61A 1HL9A 3T8QA 4D6DA 2ZTJA 3EDDA 3W1AA 3HOJA 1W1PA 3NDOA 3P5ZA 3ZO9A 2AGKA 3WF4A 1E40A 4MZ1A 4XD6A 5G4HC 3H4WA 2ZXBA 3ITOA 3R6IA 4OU1A 5I3IA 2E5BA 4Z17A 4J3VA 4YVVA 3SCQA 3FA5A 1YBQB 1UWIA 3EWZA 3VCNA 5LZLA 3HF3A 2A3HA 1MQPA 4AF0B 4IMAA 4YXGA 2ZRVA 4LBUA 3GM8A 2OX4A 1YMYA 1HKKA 5HNRA 2GYIA 3WQ5A 2C91A 3M0MA 1V3LA 2PGEA 1DPMA 2ALRA 2XZ7A 3QPEA 3KVLA 1EH9A 3C61A 5EMKA 2C7FA 1TREA 1T8QA 1AG1O 2YLLA 3VPLA 3A4JA 2XIMA 1M7PA 3B06A 4A22A 1XG4A 3BVJA 4IQEA 3AYVA 4AFYA 1GPWA 1LDCA 1JZ4A 1CGUA 5F2IA 4HK7A 4PB4A 2VT0A 3GXIA 1H4PA 1BRLB 1MZRA 3P62A 5DCBA 2PCQA 2XZ9A 4H9TA 1ZAJA 1BG4A 3SRFA 2HJPA 1R3VA 2PI6A 4J7RA 3VMNA 4XKYB 1DIOA 5FAGA 2Z6IA 5BXTA 4V28A 4DWSD 4DF0A 5LXEA 2F84A 2PWDA 1GKRA 4NRSA 3N2TA 5FF4A 3UXDA 3QC3A 4UFLA 4XD3A 1QK2A 3GD6A 4LYQA 4LF2A 2X2GA 2FB2A 1DVJA 3HGRA 3ITCA 3Q58A 2CLHA 3NQDA 3KOFA 4K6AA 2XPKA 1QPKA 3B4UA 4MJ4A 1EJXC 3WDRA 2J27A 4D8AA 4R53A 1A5AA 3M6YA 3KOYA 5I00A 1ZCCA 4LH8A 1VPYA 1WKYA 2B0MA 1L6FA 3CWHA 2YOCA 4IFKB 1XIIA 1O66A 3CPRA 1NIUA 1FCBA 2VFIA 3NM1A 3MMTA 4LT9A 4Y9OA 2QVHA 1GTHA 2XGBA 3LMZA 3LXBA 3CQJA 1F3EA 2D3LA 3LRLA 3UZXA 3WUGA 2CPUA 3VGBA 3PG9A 3VC5A 1TPFA 3C2VA 1C8YA 3COTA 1WPCA 3GR8A 1M03A 4Q8TA 3MV01 5C6MA 3M7SA 1EJRC 4QR6A 4HA1A 1VPQA 1IEQA 1QATA 1X1NA 5BXPA 3D46A 4AQLA 4GJJA 4M6VA 1YQ2A 3QFWA 2WBGA 2QULA 3FHAA 4QITA 2V5BA 1GVFA 1IZCA 4LQ1A 5E6YA 1R3WA 4IPIA 2ZXDA 4AU0A 4CD8A 3BPWA 1AL7A 4XTIA 4YIWA 1NEYA 2WZHA 2BLEA 1VS1A 2PTWA 1NDVA 4H6QA 4GOAA 3PZMA 1UZHA 2ZUUA 2GGJA 4AVFA 4RE2A 4AZ5A 2O9RA 5M5DA 3S6OA 3H2CA 1XXXA 1OIFA 3STCA 1WOBA 2O92A 1X96A 4NG3A 3W53A 1NH6A 1VGAA 2E9MA 3G1DA 1CW2A 3LCXA 3AS1A 3MHUA 2OYMA 4JKMA 1M7JA 3F03K 1D8CA 1LCOA 2WSPA 4Q8NA 2ZRWA 1OD8A 3GVQA 3AYSA 4FLOA 3O06A 3E0FA 4MTVA 1VCVA 1V3KA 4FPSA 1AJZA 1EYWA 1XIFA 3KCLA 4CNPA 1X38A 1HKJA 1JPDX 3CO8A 4JN7A 5FD0A 2X7VA 4ATLA 1G6CA 3M5XA 1MI3A 5K2ZA 3LENA 1XISA 3PZIA 4RX0A 4XSLA 1BVZA 2BZNA 3R89A 4DBWA 3RCMA 4P7NA 3W76A 2VQUA 2YX0A 2J6VA 1HJSA 3IEBA 3E5PA 1AD4A 1IWBA 3LUTA 3ZSSA 4D6HA 1BTMA 3BJSA 1OYBA 5FJRA 4ICNA 5KTLA 3M0HA 3W07A 3LXCA 4CLMA 1B3VA 2IPGA 1VEMA 2ZBTA 5FL1A 5FOOA 3NEVA 2IS7A 4DBDA 1OX6A 1N55A 3UGRA 2G95A 1Y5XA 3GXDA 3N2MA 3VIFA 5DCDA 2HV5A 3OVGA 4QE4A 2ANUA 1DKWA 3IK2A 4U2ZA 1ZSXA 4E2BA 3EA2A 6XIAA 1XUZA 3TEVA 1VAHA 4LVGA 4OUEA 4R9XA 3QMTA 1C3FA 3BL3A 2F9RA 2RDUA 4H9VA 1WDQA 3ARZA 4UXDA 3M0LA 1Q4WA 2D0HA 4OUIA 1CGXA 3LB0A 1ITXA 6REQA 3KBJA 3G1FA 5AOUA 3BJTA 1RK5A 1J0HA 4JN6A 3O15A 5C71A 3IV8A 3UU0A 2WOQA 3N25A 4E2VA 1XGZA 4C5ZA 3VOIA 1MW0A 5KINA 1FWFC 1P6BA 1WKDA 4LS0A 1E0TA 4NRRA 3RGTA 4ILSA 1HGWA 4MF4A 4B5TA 4ZSUA 1BGGA 2DSZA 1LT7A 1AUSL 1CT5A 2ZTKA 1F6YA 2PF8A 3B0VC 2ZKMX 4BJHA 3VTRA 1ZS2A 5D4YA 2MANA 3VIPA 3XIMA 1RVGA 1K8ZA 2C14A 3O0KA 1QT1A 1A5LC 3QYSA 2QLYA 2XGZA 4E0CA 4MWAE 3KBSA 1HVXA 3TA6A 1C8QA 1JD9A 1EP1A 1UMYA 1QI3A 5K9XA 1US3A 3KOWA 5DMYA 2OPJA 3B3DA 3GFZA 4QQ3A 1YHTA 3NGJA 4PRTA 5D05A 1F8IA 1DXEA 3JZEA 1R2SA 3SCTA 3AFBA 4FIRA 1MW2A 4NI3A 1K9FA 1LM1A 1JFXA 3NQGA 1WQ5A 4DJFC 4N02A 5CJMA 2Y61A 2DSVA 3IGXA 3H2NA 1UUQA 5DRIA 1OF8A 4DHGA 1LG1A 3VNMA 3NZGA 3AHYA 1R9XA 3MUZ1 3V4BA 4EK7A 5BZAA 4FX8A 1A5NC 4Q4RA 1CB7B 4N4PA 4CU8A 4L4PA 1M6JA 1BKSA 3CQKA 1A5BA 3TXVA 4BQ4A 3RK8A 1P1XA 3OIXA 2P3ZA 1F05A 4H2HA 1FCQA 5LA2A 4QLKA 3SEPA 1PTAA 3T09A 2ZX9A 2QPSA 4QJ1A 2G41A 1OD0A 2ZX6A 3CMFA 4O1BA 2BSLA 3V5FA 4IFOA 2OZ3A 4F8XA 1HGYA 4WVXA 3RJXA 3L9CA 5ABHA 5GNYA 2BASA 2O55A 2CKRA 3R79A 3DFOA 5CCZA 1A4MA 4CNNA 2J7CA 4HSHA 3HQPA 1K70A 3VNJA 4CQAA 3MUIA 3L2MA 3MA8A 5CZJA 3NG3A 3WLQA 3UG8A 3ZR4A 3CHCA 5I78A 3CEUA 4S2BA 4HYWA 3TK7A 4UTWA 3EMCA 4KCWA 3C3NA 4U33A 4MY1A 4OBSA 2OG9A 5L9FA 1KCZA 3ZLGA 5D2XA 4GG9A 1RP9A 3AROA 3PM6A 3SI9A 3IS4A 5A95A 3MYPA 2YZRA 5CPLA 2PGWA 1EX1A 5DBUA 3W1LA 4GX8A 3TE9A 1J0KA 1JL8A 3N34A 5C9ZA 4GD0A 7ODCA 2A4AA 1TV2A 1TPH1 2Q8XA 4UTMA 3SCPA 4WSKA 5AHMA 1KKRA 3EYPA 1O5KA 2JIWA 4BS0A 4MOZA 4XBSA 2GL5A 1F8MA 3W38A 3V36A 2BBFA 3WJWA 3BOLA 4HTYA 1EWDA 1KCKA 2E6FA 2JIEA 4V15A 3RYSA 5DELA 3CQHA 3TTSA 1IT7A 1L0PA 2UY3A 3LLDA 4GJ1A 2V5JA 1AQHA 4PTMA 4QIUA 3GH4A 5JBFA 2WHLA 3WZ0E 3B0XA 1RD5A 4E2OA 1QDSA 1B3XA 3QLLA 4LV9A 4ZOCA 2PDKA 2WYSA 2FZBA 3QR0A 1M9HA 3N6JA 4UFMA 1WZMA 3FYYA 5DLCA 2W91A 2Y24A 1EQPA 3TONA 1A3HA 1ZP4A 1ODZA 4KW2A 2AQVA 4XB3A 1OFDA 2W66A 3UETA 4D1JA 3WQVA 5I23A 1S1PA 4JTHA 4JTLA 4L6OA 3KCJA 1VD6A 1GKQA 1X6UA 4GNJA 5EMYA 3G8RA 4JHMA 5BNKA 3HG4A 4XO7A 2HBXA 4HA0A 1QHZA 1EX5A 3PP7A 2E77A 1YX1A 1QO5A 1LQ2A 4L56A 3PTKA 3S5ZA 5HXMA 5HJYA 3E9AA 1JDCA 1TIWA 1PCKA 2CNCA 4I9TA 3TFXA 3Q65A 4GINA 4HT3A 1P1MA 1RPKA 2QCDA 1LLWA 4H9ZA 3PWAA 1U22A 1X8FA 3AUJA 1XH2A 1E72M 4DWSB 4D71A 4R9OA 2NQHA 1MEHA 1H61A 2VZSA 4XZHA 2JK2A 3IRDA 4G56A 4AEOA 5EGRA 1XSIA 1XJBA 1PB0A 2HEJA 5AN7A 1GZGA 4M24A 4C6JA 2Y6ZA 3NPUA 1GJWA 1W1YA 3K13A 1GOXA 4AAJA 1DJNA 1TPB1 3ES7A 1JPMA 2XUCA 4WQ6A 1A47A 3GNXA 3UJRA 5AKQA 1BVWA 1W54A 4PCPA 3M1ZA 1UJQA 4HIBA 2X0HA 2B7PA 1B3WA 5GQBA 3UZZA 3GZAA 3HV8A 1QASA 2Z1XA 5F1UA 3E02A 2Z00A 4WXYA 4GXMA 1IT0A 5KMYA 3OBEA 3UT0A 1Q6QA 1QNRA 3CGTA 5CC7A 3A21A 4JTJA 2Y7DA 4BF5A 1O5RA 1NP2A 3W37A 2X2YA 1TWSA 5BWFA 3AHTA 5EFDA 3HQOA 3KTSA 2VVSA 3VO0A 2A3BA 4G6CA 4N2YA 2JF6A 1GGOA 1K77A 2CCRA 2DZPA 4O10A 1W1VA 3DCPA 4Y96A 4D6CA 1F6PA 4DJDD 5C54A 1H41A 2PLCA 1P0NA 3V5OA 2BXVA 4MADA 5AHNA 1H50A 1H51A 1ZJBA 2FZ9A 3TQPA 1KNWA 1HJWA 1A0CA 4RNJA 1PDZA 4W88A 4HP5A 4JCLA 2CXEA 1UH4A 2PC8A 3BZJA 3QFEA 1VFLA 1O5QA 5FJTA 3DEQA 7TAAA 2UV8G 1JCXA 4IFKA 3G8EA 1US2A 3SRHA 2DSWA 3TYZA 4ZZ9A 1OC5A 3HA1A 5CZ0A 3F1QA 2RKXA 3TJXA 3AJXA 1PO9A 3FK4A 3GXTA 3GDRA 2REQA 1DIKA 2J75A 2OOGA 3EPMA 1I1WA 1H5YA 1KLYA 1JQVA 1UASA 3H70A 4JX4A 2AQOA 4BKNA 2Q02A 3A9BA 1KKOA 4QROA 3VIIA 5HPOA 2H3BA 3PY2A 1UD8A 4FNPA 1PZ3A 4ASTA 3M7WA 2PAJA 3RUBL 4LB4A 1EF3A 1J01A 2WO5A 4H19A 1T7LA 3BLDA 3H22A 1HKMA 5AHLA 2H9AA 4FMVA 4AZ7A 2Z28A 3M0JA 3NWRA 2VRQA 1B9ZA 1D7FA 2PUZA 1AODA 4P5UA 5M1TA 1GEQA 3GFXA 1PDYA 3CUXA 2V68A 2OJPA 3ZSTA 5BRQA 2G4JA 4KWVA 2ZVRA 1L2QA 1FHUA 4JIQA 4O1AA 2NUYA 5I6SA 2QDGA 2NXIA 4DYKA 3DXIA 3KX6A 1Q85A 1Q3NA 3RLGA 1QNPA 3MUCA 4MY8A 3IV3A 4BK9A 5D9OA 2VENA 3CPUA 4W8LA 3IANA 4K38A 3NEHA 5CXPA 3NOYA 4LF1A 4OBRA 4XUYA 5E09A 1BTCA 3MP3A 2QUUA 3BICA 4D6JA 2DQXA 1JCMP 2CWNA 1RZMA 4XIMA 3ARTA 2CLLA 1ZQ5A 3GS6A 4PL1A 4O1EA 3QKEA 1GW9A 2H3DA 4JYDA 1NF7A 4K3ZA 2PE4A 1W1TA 3C0QA 2R1KA 3GVVA 1XX1A 4G8TA 4FX7A 4W8AA 3GW3A 3QMRA 3LHZA 3CTTA 4IWWA 2W63A 3P8IA 2XIIA 3WK3A 2CHNA 4BEQA 1FY6A 3VNDA 3EB2A 3T0DA 4NKCA 1U30A 3EZ4A 3OZYA 4MHBA 3DIPA 1Z6KA 1H7PA 4GZ7A 3L5MA 4UMAA 1YXCA 4UBPC 3F4VA 4MFDA 2WZIA 1OFPA 5F2MA 3UR8A 2X30A 3NQFA 2Y70A 4MWAD 2F6KA 2VX6A 4ERAA 2VKZG 4ACYA 3OYZA 5AC6A 3H24A 1BSIA 3QZ6A 1N2VA 1KFEA 3N9KA 3OBAA 4JQ2A 4RPQA 3GXNA 2PEVA 3LNMA 1BWVA 3VKKA 1BXNA 3WQWA 1TSIA 1OX5A 1IEIA 3DN5A 2NSXA 1CWYA 3C2FA 3QMSA 3T0AA 4L64A 3B0PA 5FEZA 2GJRA 2I7GA 2HVNA 2OKOA 1TWDA 1YTKA 4LSBA 3FOKA 4LXFA 1KTNA 3H2AA 1SMDA 4YN5A 1WKFA 5AHIA 2Y89A 3HB9A 3NFUA 2JKPA 3VDBA 4N4QA 4RDZA 3RM8A 4Q4SA 4C6DA 2J79A 1CGYA 4DO5A 4DO6A 3SQMA 3L21A 1UR0A 3KZPA 2V69A 3GC2A 1ZPTA 5HQMA 3ENLA 1M41A 4AXNA 1TO3A 2CEQA 3WH6A 4WKHA 1JZ7A 4GCAA 4WDUA 3NNTA 4GRSA 4AD4A 5CSUA 1ZBKA 5LA0A 1F61A 1WDWA 3STGA 1AJ0A 5AFDA 2WKJA 2CKSA 2DW7A 2YDQA 4NZCA 2E9BA 1TZ7A 4NAFB 2P1FA 3M5YA 1OB0A 4NVTA 1Y5VA 6ENLA 3TYUA 4DUXA 1EO7A 2EJ1A 5IFTA 5HULA 5CPSA 3PBWA 2ZUWA 3LU2A 4Q7NA 2Z2AA 3IUIA 3H4XA 3PBYA 2ZZ3A 3DI0A 3GU2A 2JQXA 3LRMA 2W79A 3M64A 2CXGA 3R4IA 3V18A 3KRUA 1QOXA 3U5UA 2WCGA 1Q6FA 4OBTA 4K8GA 2V5DA 1W56A 3SFWA 3C56A 4WRHA 1TRDA 3UF9A 2WVVB 2ZDSA 3BSGA 2ZUVA 3KOXA 3JZUA 2Y7FA 2NX3A 3WMSA 1D3HA 1R46A 4OQVA 3BAJA 2WZTA 2BXYA 2G4FA 2HE5A 7ENLA 3THQA 1LROA 4FIQA 2G50A 3VDCA 1JAKA 5AVHA 2W6RA 4DLFA 1X8CA 5LIUX 3MJMA 5CZTA 2GVLA 3S4TA 3SCNA 4IL0A 1UQZA 7CGTA 3ZJ7A 3W27A 1K02A 3VZYA 3P0WA 4JKLA 3WUBA 2CLOA 1TKKA 1SVDA 3OU8A 1VIWA 3ZR6A 1UA7A 3VOGA 1EDQA 3GHRA 1B1YA 4R7OA 1FWTA 1US0A 3DFQA 2UY4A 2C1HA 2W9MA 4NIRA 1PKYA 3L0KA 4H8VA 3BLPX 5JIPA 3ZT7A 4JBRA 2O9TA 1KFBA 4CQ8A 3GQYA 5MHBA 5DFAA 3R8HA 1JUKA 1CB2A 5A6BD 2IQ0A 3NXLA 4A6GA 1GOOA 5IHRA 1FWNA 2WLZA 1QBBA 3RHGA 1KM0A 1PTGA 3W2UA 3W7MA 2B7NA 2D73A 4H7ZA 2R1MA 4KEMA 1OQFA 3HG3A 2EF9A 3RPDA 4WJ8A 1HJQA 3GK0A 3SIMA 3QR3A 3PB2A 2QAPA 4X60A 3WLKX 4MDOA 1TVLA 5XIAA 3BLKA 4LCRA 3ZLHA 3P5YA 1KW1A 3WQ8A 1QMLA 1E3ZA 3V35A 1DYSA 1OABA 1VF8A 4XAZA 3IGUA 5C55A 3RN6A 1I2RA 5HATA 3L66A 4YPJA 1IE7C 3CV1A 2QJGA 2YA2A 4KQNA 5A6JA 1TPVA 1BQCA 1E6RA 1AH0A 1LF1A 1W1IE 2QCNA 3TROA 1ZZMA 2GGIA 2Q01A 3O63A 1ZBVA 3MO7A 3CK5A 2P76A 3UZWA 4BA0A 3TX9A 4NZ4A 2FGZA 2QDDA 1JZ2A 3GH7A 3I6RA 4ZXOA 1GK8A 3CZLA 3H55A 1F5ZA 3CV7A 1TWWA 4GO9A 3WL0A 3LERA 1V79A 2ACQA 1TG7A 4XG1A 4B2DA 4MIMA 2BS9A 1FWEC 4MAZA 4ACZB 3LTYA 2R1NA 3UY8A 1QWKA 5PTDA 1ZGDA 4IZGA 2FDSA 2ISVA 1IWAA 2QS8A 2G96A 1KM6A 4DXVA 3TCEA 2BVYA 3P93A 4NX0A 1CENA 2XG9A 1JFHA 4AZHA 1LOQA 3PZTA 3CIVA 3LCGA 4S3EA 4XAYA 3R1ZA 1KXVA 3EOSA 5TQLA 3I3BA 3TYCA 1RJPA 1ISZA 1H1YA 5CJ5A 1KGWA 1A50A 4IMEA 4PULA 4QJ3B 4CCEA 4E3TA 1RLDA 2OCZA 3OB8A 1MDRA 1SJCA 1AD1A 2WZMA 3PZQA 2Z1WA 4CQ9A 3NL5A 2OU4A 3WK0A 2WKLA 1F3XA 2VFGA 1VFOA 2GPTA 2ABAA 3UP8A 3XINA 1M5WA 1TZ9A 4UFJA 5A6BA 4IJBA 1RHCA 1XL9A 1TUFA 1XLBA 3DBPA 1QBAA 3IIXA 2J7FA 3G2GA 1QHPA 3ATYA 3CAWA 3QTGA 1BXCA 1NWRA 2FH8A 4U5KA 2W62A 3I65A 2YIHA 3BGJA 1GVQA 3S2JA 4GVHA 3S9YA 4N9DA 3M47A 4HHPA 2GGGA 1H7RA 2EO7A 4F9JA 2HXTA 3OQEA 2HMCA 4Q8PA 2AMXA 3L4TA 3GLCA 4AX7A 3BCDA 2J13A