3H23A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h23A00
4DJEC 3MCMA 3H23A 4S3EA 2VP8A 4DJDC 1Q8JA 2BMBA 1TWSA 3H2MA 4S3BA 4S3DA 2YCJA 3H2OA 3TZFA 3TR9A 4MWAC 3TYEA 1F6YA 4DJFC 4NHVA 1Q8AA 1Q7ZA 4MWAB 3MCNA 5JQ9A 2H9AB 2DZAA 4CCZA 4D9PA 2YCLB 4S3FA 3K13A 1AJ0A 2YCIX 4NIRA 3TYAA 4O0QA 4S3AA 3H2EA 3V5OA 4S39A 2VEGA 4NILA 1Q7QA 3H22A 2YCKX 3H24A 2OGYA 1TWWA 1Q7MA 3TYDA 1AJ2A 3H2CA 4S23A 4O1FA 2Y0FA 1TX0A 3H26A 4O1EA 1AD4A 3TYBA 1TX2A 4C1NA 4PZVA 4DJFA 1TWZA 3NOYA 2Y5JA 2DZBA 1EYEA 3H21A 4S3CA 3H2FA 4S38A 3TYUA 4DJEA 4DAIA 4G9PA 3MCOA 4DJDA 4DAFA 4MWAD 4D8AA 4DJFD 3BOFA 2VEFA 3TYZA 3H2AA 2Y5SA 3TYCA 4MWAA 4NL1A 4C1NB 4MWAE 4DB7A 1AD1A 2H9AA 2E7FA 1Q85A 4DJED 2DQWA 3BOLA 2YCLA 4HB7A 4DJDD 1AJZA 3H2NA 4D8ZA 3TZNA
chains in the Genus database with same CATH superfamily
1CGVA 3IJQA 2G4JA 2HRWA 4XZLX 4JNMA 2AQOA 2RJGA 3FKKA 3E2SA 4QG9A 2A7NA 4QROA 1ISWA 1KWGA 4M24A 1MZHA 3NSNA 2ZZ5A 1V6YA 3IGSA 1JYXA 3ZOAA 3W23A 2WMJA 1LJYA 4BY3A 1PL9A 2WM0A 1Q6LA 4FLQA 4IP4A 2X1RA 4OECA 2PFHA 3BG9A 1F07A 3OPSA 1XF0A 4MY9A 3VUSA 3NL2A 2QKFA 2EQDA 2A3EA 1TE6A 2NVDA 4FXFA 3MHGA 3BLOA 1OEPA 4PMOA 3B3DA 3WF2A 2WZHA 1PWMA 4F0KA 3M7WA 4UCFA 4WJXA 1W17A 4IUGA 3G2GA 1UKOA 1MMFA 2BXYA 4XVEA 3VOHA 1PKYA 1VBHA 4R33A 3HV9A 3VE7A 1ZB5A 2E9LA 3K1GA 2A21A 2VGGA 4DI9A 5J5RA 1WKEA 4JY8A 4LB4A 3RRXA 4XD4A 3GQYA 1ODUA 4NJIA 2ZZ1A 3HO8A 4DF2A 1V02E 1PX4A 2VOMA 4ZQCA 3ZLGA 1E5JA 1TELA 2J7CA 5A5WA 3NQ8A 2FB2A 5E70A 1IYXA 4GXWA 1PX8A 2NQJA 1J4EA 1X6LA 3KTSA 4ZTXA 1GVIA 2V5BA 4JYFA 3EBVA 3FVMA 3H4WA 3EB4A 1EOMA 3KCJA 2R82A 4KT2A 4GXPA 1UQZA 2YBTA 4K36A 1T8QA 4H19A 2H8XA 2XGBA 1DQUA 4S3FA 1WBJA 1V6XA 3CHCA 4K7VA 1O5QA 5ECUA 1WXZA 4HK5A 4RNIA 3EKZA 2IPFA 4M6VA 4LVGA 4X22A 4EPEC 4CNOA 1MFUA 4TVDA 3VDAA 1UCWA 5IDIA 1GOKA 3ZWSA 3PK7A 1ZLPA 4HTYA 2DEPA 3HGSA 1XPYA 4L9ZA 3HZ3A 1TVNA 3DESA 5KZMA 2B7PA 4N2YA 2QJJA 1UJPA 3M0YA 1EBHA 3AFBA 1KTNA 3P7YA 4PA8A 5TAOA 2OO6A 2QCMA 2WHMA 2PTDA 1E0UA 4ZA0A 1GUVA 2NQLA 1HFBA 3GDBA 1CGWA 3CQKA 3E0VA 3LY0A 3W22A 4B15A 3WH9A 2XVPA 1UC4A 4AISA 3C8FA 1Z48A 4U33A 4UTWC 1XIMA 2PEVA 1H41A 4ONVA 4W9TA 3NVDA 3VGGA 3U2ZA 1Q66A 4Q4KA 3LSCA 1TQJA 3N2XA 1I2NA 3W25A 1IEXA 2CHOA 4DHGA 3WUBA 2J24A 1Q6OA 1VFLA 5XIMA 1VIWA 1OC7A 2ZFAA 1RUSA 3C0LA 4KCWA 4AIOA 1WAUA 4Q4RA 3W70A 3PZNA 2WWDA 4CLMA 1H5VA 1SZFA 4AX7A 1I0BA 3WL1A 2OEKA 4CNTA 1EGZA 2CERA 1YNQA 4OUEA 2C15A 2VVSA 4Q8MA 3WLRA 2FB3A 1H7WA 1W3NA 2XHYA 4WF7A 5LNVA 4RZ6A 4U2ZA 3TN3A 3BPWA 1BWKA 1L6YA 5CCZA 1KBIA 1ZZMA 3DC0A 4ZSTA 4F40A 3PHAA 2SFPA 2HZGA 4M1BA 2P0IA 4JCLA 2AL2A 1QHOA 3WNLA 3GC5A 4GRSA 4J3TA 4N9DA 1PIFA 4QAWA 1Z8AA 2BTMA 4V1XA 2BVTA 3QF0A 3VO0A 1QBAA 5EB8A 2ZIDA 3SCSA 3M43A 4BF9A 3MZNA 4DF1A 3VDHA 4ADTA 3M64A 1P7TB 4LUSA 4EPBC 1AMYA 4ENLA 3DI0A 4OKDA 4HU3A 2CZFA 3ARZA 3N2MA 1JF6A 3FDGA 3DZ1A 5D8WA 3VD5A 3THDA 5DMYA 4LUTB 2JF7A 3GSMA 3NSMA 2HK1A 2NZLA 1H7RA 3GIYA 4Y6GA 1YXDA 3P2VA 1A80A 4MPKA 5GNXA 1WZAA 3SW6A 2Q6ZA 2CLFA 4XKYB 2DZVA 3GYCA 3ZYZA 3NNTA 3RPTA 1KXQA 3TK7A 1R86A 3PZOA 4UTLA 4LWWA 1JXJA 2WM1A 2QVHA 1L6WA 5FL1A 3I6TA 3A3HA 3WBYA 3B9EA 3ZR4A 1QK0A 2FVKA 5HNUA 1IWBA 4ZZ9A 3SUTA 3QKZA 1O68A 3CPGA 4PUUA 2W91A 1QO2A 1C93A 3H6OA 3UWEA 3NQGA 5E0CA 4PEKA 3M5YA 1B3YA 1XIBA 3GYEA 3MUCA 2V2HA 4GJIA 3TJIA 3GNXA 4A8RA 1EH9A 1WA3A 1VHCA 3ARSA 4CNPA 3PZUA 1LOQA 1LF1A 3LRLA 3GVWA 3PULA 3UVIA 1R2RA 5HPOA 2ZX6A 4DNHA 5DLCA 1N55A 3DG3A 1FWNA 3L4XA 1ALDA 7TIMA 1XSIA 1U5HA 3T07A 1GJWA 2YW3A 2E5DA 3VIPA 1UD3A 3MY9A 4US6A 4YTTA 1IEIA 1NOWA 2GJPA 4DXXA 3MQTA 4L4LA 2AL1A 4IOTA 1XKJA 2G3NA 1EEPA 1WB0A 2FQIA 4PB4A 4QNEA 4FZIA 2V82A 2YJQA 2NSXA 5I2UA 2J47A 3B4YA 4ZE5A 2PDPA 2VUYA 1BXNA 2GGJA 2OVLA 1QO5A 5BOFA 5D09A 5CQ1A 3AO0A 1AJ0A 1X1ZA 2YCIX 1GQLA 4PMVA 4GYJA 3EDEA 3GC4A 3UCQA 1XISA 4ZMGA 5BOEA 3F5LA 1UPMB 1JG9A 4LAOA 3PG9A 1EKOA 5B80A 3PTMA 3D5HA 3DU0A 3T6CA 4AHQA 1Y5XA 4DIAA 5F7UA 5FI8A 1WXYA 2W79A 3HV8A 4GACA 3AMGA 4LAZA 5H91A 2D0GA 3WH6A 3OZOA 1GVRA 1CDGA 5KZ6A 2Z1BA 1FFQA 5XIAA 4GYFA 3VGBA 2C14A 4HSHA 2WWCA 1WDQA 4U5KA 5IHSA 2PDUA 3SCTA 4LEFA 1XGEA 4JTFA 3A4XA 1BYDA 1ONEA 1F05A 4PMNA 3WZ0E 3G1SA 3ZZ1A 5EKYA 3NR0A 4P7RA 2QMKA 5FJTA 3WQEA 3T81A 4ZB2A 3PPFA 2QJGA 3G6LA 4Z42C 5IBXC 3WENA 2VD8A 4ADSA 4JTEA 3PJUA 1XIIA 2OTDA 3I3DA 1VEOA 4WY0F 3G6MA 3VGDA 3FAWA 1SO3A 4ZXLA 3FY1A 4E4PA 1W1YA 4PMDA 1VYSX 1E4NA 3R89A 4PRTA 3WDJA 2Z27A 3W82A 4LXFA 2J66A 4I90A 2ZYFA 3VDBA 4B90A 4XAYA 3MSDA 3UQNA 3ANYA 3IRSA 5DFAA 1RY8A 3GTFA 4XISA 4HHPA 2H3DA 5HUPA 3MKKA 3CAWA 3S2MA 2Y6ZA 1UMYA 3T0CA 2HVNA 3K4WA 3I3EA 3N6HA 3N6QA 1Q7MA 2C18A 3S9IA 3CGTA 1EJWC 3QSTA 2ZA2A 1VYPX 4QLKA 3OODA 4AWEA 5DCDA 3JUGA 5REQB 3GHSA 4URIA 5MKGB 1W32A 2VZUA 1PTGA 2EG6A 1IZKA 2AAAA 4ILSA 5HA7A 2BB0A 5I06A 1HJUA 3FSUA 1HKIA 3JS3A 2G8ZA 1V0LA 1L6GA 3W6YA 3IIZA 4JTCA 3OVPA 1BG4A 2ZQ0A 5HNRA 3SSJA 4JY9A 5FJRA 2QJIA 5LIXX 4K3ZA 1WO2A 1GQJA 4LANA 3BMVA 4B91A 1VHNA 1VRDA 3KVLA 4JEQA 1QJWA 4RZ5A 3DUGA 3W7KA 3WBWA 2WV8A 5D2YA 4JN7A 4A29A 3BSMA 1M01A 2O9OA 2XINA 4LYQA 1E6XM 2DP3A 1JNDA 3B4UA 3H54A 4AZIA 1NVMA 5I3FA 3CL7A 3AALA 2VQUA 3BLKA 2OFJA 1ZJHA 3IACA 5DCEA 2QCHA 6TAAA 3RILA 4JPGA 3FIGA 4KETA 3ARWA 4QLLA 3HQOA 1UB3A 3AISA 2XH7A 3MT1A 3I7QA 4QEHA 4PL1A 5D32A 4JKMA 4JEJA 3WDHA 3SFWA 3PWAA 3RM9A 1HO1A 4NZCA 4HJFA 3W7NA 5J5DA 4ZOEA 3LXBA 3VCCA 4QDMA 1DORA 1QBBA 4AU0A 1PBGA 4NG3A 1FX6A 2XU2A 2D22A 2CYGA 1HJXA 1FWCC 3LNMA 5GNYA 2WSQA 5H8MA 5A2BA 1BVZA 5L6UA 3TCEA 2FZNA 4QJ5B 1RBAA 3H2FA 3TLQA 3TOPA 2QIWA 1XSJA 2P3ZA 4XBJA 4L1WA 4O28A 5D2VA 1WDWA 1YBQA 2IQDA 3IVSA 1PUDA 4POCA 3C3UA 4N6FA 1JRBA 9CGTA 3EAUA 4CN4A 2Z6IA 4C91A 1UD4A 4QJ3B 3BSGA 1XPGA 2WC4A 3DERA 3MB9A 3R0UA 1W9PA 2FVMA 3LCFA 2PCEA 2PBGA 1Q5MA 3WLNA 5CPTA 2XGIA 3V0TA 4GJ1A 2QVNA 5LHFA 1N2VA 3T9PA 2QCNA 1AQMA 4MWAB 4LF1A 4NRSA 4RE4A 1SZEA 4YHEA 2P0OA 4HCHA 3HG2A 4GQBA 2REQA 4IM4A 4PTWA 5HQEA 1JPHA 1K1DA 1DJYA 1JZ7A 4M81A 1ZUAX 3B8IA 4OIFA 2WNQA 1SSDA 1L6FA 2Y7EA 1JYWA 1F2JA 4NZ3A 2X7VA 4KFOA 3WLOA 4RXGA 1I1WA 3DYMA 2E25A 4D72A 2X8RA 3KM8A 1PYMA 1T40A 1CGYA 2Y70A 3E9AA 4CGTA 4Q7BA 2IUZA 3VKJA 1PJ9A 2QDGA 3COTA 5AY7A 2I5IA 3LPOA 4K2SA 4GXMA 4JD4A 1RK5A 2IS7A 3NGFA 1DV7A 4RX0A 3F5KA 4TTGA 3PB0A 1D7KA 2R1NA 3W9ZA 1WOAA 2WJFA 1SZGA 3V0SA 3QYQA 4Z2HA 3MUAA 5G4EA 3T08A 4F4RA 1OFOA 5CAKA 1XBYA 1GYLA 4HBKA 4PYSA 2NWRA 4WOQA 5D2WA 3NQDA 1F8MA 3R0KA 3DFYA 4S3DA 5C0QA 3USZA 2PDBA 1V5XA 1W1ZA 3VX1A 1G7VA 5C9WA 1RSCA 1CB2A 3WQPA 4CCZA 2YCLB 1W9VA 2ZDRA 4QSFA 4GC4A 4WDTA 3WN6A 3V5OA 4GO9A 4PBFA 4DM1A 3QZEA 3IJLA 4GVHA 1VENA 4HZ7A 1E70M 1HF6A 1P6WA 3UEQA 3WYZA 1POJA 4B5WA 3HB9A 5I3HA 3SCNA 3GDTA 4HU8A 2GGIA 1VP5A 4CNNA 3II1A 4R53A 1RH9A 3CUFA 2P76A 3AMCA 3K4DA 2OGJA 2BS9A 1MRAA 1ZBCA 1E72M 1IGSA 1FWBC 4RV8A 1PE1A 3W83A 2PU1A 2RJHA 4CVUA 1GPFA 1O12A 3NXLA 2GUYA 2HISA 3ELFA 3FGCB 3KRUA 4JIPA 3S2CA 1JDDA 3BZGA 1TV8A 3HN3A 1M6JA 1E40A 1EC9A 3NQ2A 3P5ZA 2PWHA 2YYTA 5CG7A 2ZUMA 1RQHA 2Z1XA 3MKVA 3MTWA 4D6DA 3RAOA 2YW4A 3DX5A 5BCAA 1IE7C 2ZZ2A 4IIEA 1LT7A 2WPBA 3W81A 2EBNA 3VKBA 4A2SA 5HDRA 3VKCA 2YCJA 5A2AA 2YZ5A 2Y8UA 3NZGA 5LNRA 4F2TA 2UY5A 1XCXA 5HJXA 2CEQA 2XSXA 2HS8A 2OYKA 3D47A 2AKZA 3MWAA 5K4ZA 2XUCA 1OX5A 3ICJA 1LOLA 3Q67A 3SJNA 5I5RA 3SDOA 2PLKA 3CQ0A 5CPMA 1UP3A 3JR2A 1UZ1A 5C71A 1WX0A 3BW2A 1RCQA 3USBA 2NV1A 4UQBA 3O3RA 2CIPA 1OG0A 4G1KA 1XGDA 3P6LA 3AXKA 3P0XA 1KA9F 3CUHA 2R94A 4H6KA 5E5CA 4GVGA 1TZZA 3PFMA 2VOTA 1CYGA 4Q4OA 1VEPA 3TQPA 2Z26A 2CCRA 2VM8A 2XIIA 2ACSA 1W5NA 1XLBA 4CQDA 3B05A 1B4EA 5KSWA 4X63A 3NO3A 1E9IA 3P93A 4UUIA 5HXMA 1TVPA 4JQ1A 5M03A 1UC5A 4C6NA 3S0CA 3TN6A 1RAKA 2YB1A 4YWIA 3S1VA 1XINA 4AZCA 3W1PA 4PL2A 6A3HA 3FA3A 3H70A 4FNQA 3VIMA 2OX1A 3UF9A 3O1NA 1X1NA 3GR8A 1E9YB 1PHWA 2F6UA 1YMYA 5FIPA 5LGZA 4EK7A 3WNPA 3KBVA 3AYRA 3LUTA 1XH2A 3CAVA 6XIMA 4AZ6A 1DJQA 5ABHA 1EBGA 5C8BB 3NJ3A 1X6UA 3NL6A 1Q7QA 1S5VA 4M8UA 5JVLA 2AMXA 3KBNA 3QY8A 2DY3A 2V68A 4XV0A 4JTUA 5F2MA 2E40A 2WLYA 4O1FA 4Q3MA 3HPFA 4LY4A 4LVBA 1V0MA 2CBIA 4DN1A 1VBRA 3TYBA 1SO4A 1T0OA 1IEVA 1MFVA 3KX6A 4UTWA 3D3FA 1JDEA 2WNWA 3BXWA 2YXOA 3HMJG 3M1ZA 4CUCA 3M0KA 3ZS4A 3QMSA 3N4EA 3UR5A 4WDUA 3DFNA 2PZ0A 3WK1A 4BQ5A 3GFYA 1H7OA 4OOZA 1HGYA 3AWNA 5F4WA 2WCGA 2NUWA 1J2BA 3W7EA 2OB3A 1NAL1 1WOBA 3VZXA 5DELA 4H2CA 3EEGA 3SCWA 3LBOA 5F1VA 1XX1A 3WLTA 4ZO9A 4EKJA 3UT0A 1DE5A 3ISIX 1S5MA 1ZY9A 2W61A 3QJAA 3MI6A 3S83A 4L56A 4I5XA 4IJRA 4XZBA 5I3JA 1JZ3A 2E9BA 3IJIA 2FH6A 3PPGA 2A3HA 1C9WA 1HNYA 1EJVC 4XSLA 4E8DA 3EMQA 3CHEA 3AS0A 2PWDA 1J0ZA 1US3A 3RMJA 3AIUA 3BO9A 1ONXA 1BG9A 2WW5A 4MB5A 2QAFA 2OGYA 1Z44A 1NU5A 3LGEA 2IKJA 3WQCA 1XDJA 4KH2A 1T96A 2Z00A 1X8CA 1F8IA 1ZAHA 2BY0A 2ZUNA 2Y8VA 3LCXA 4XIMA 4A3HA 1GNXA 2WC3A 2ZRYA 1T41A 4BEUA 4PCSA 4NXSA 3GAKA 3QLLA 1JFHA 3IUHA 3QXBA 4J3UA 3OTRA 4ACYA 2J8TA 5BWFA 4M80A 4IICA 3O9NA 4HSNA 2BGSA 3MUXA 1S2WA 5HUOA 4B5VA 2PPGA 3BAYA 4F0LA 2V38A 3GXDA 1YDOA 2DUAA 3VPLA 3LG3A 2QIIA 3LERA 3GVVA 4B2DD 5DO8A 3PF3A 2EGZA 2B4GA 3GXNA 2WBGA 1UYQA 2Y7DA 4P8XA 3A12A 2J79A 3PAOA 5LSMA 4JIIX 1OADA 4UR7A 3W84A 1DE6A 1I60A 2PGEA 3OZPA 4HN8A 5A6JA 5FJPA 5TD4A 3WK3A 3SN1A 1M68A 1O95A 3WIJA 3CJPA 4E2DA 3WLJA 1B5TA 4FXSA 1QK2A 1GZGA 1KBBA 2WHKA 1XICA 4ZXOA 2WVVA 5JH2A 3GNOA 3OB8A 3UBPC 4D6JA 3W38A 2AQVA 2TPSA 4N42A 2DGAA 4C5ZA 1IF2A 4O1EA 2Y2WA 1B1YA 4F48A 2CLPA 3PWGA 2F38A 3IK2A 4H8VA 4OJYA 3VNDA 1DJIA 1W54A 4GO8A 1O7AA 1R8LA 2IPGA 1NDVA 3TW6A 5CZJA 3WD3A 1E1CB 3K8MA 1KRBC 1HN1A 3LXAA 3WFAA 5A8QA 4PTDA 3GDRA 2QMJA 1IWAA 4XZMX 5DBUA 3BV7A 1HL8A 4NNBA 5A6LA 4LUJA 5CGTA 1FH9A 3R25A 3BCFA 1YLVA 4QR6A 1M7PA 5FESA 3WK2A 2WZEA 2CZEA 3IARA 3IK4A 3O0KA 2UV8G 2GVEA 2QPXA 3EOEA 2GUBA 3E02A 3M0JA 3FFSA 4NJGA 2R1PA 4UQAA 1NM9A 4EWJA 3M0VA 5F1UA 5CZSA 5EGRA 1TG7A 3EDFA 4HU4A 2GJNA 3RGTA 3WF4A 4YCPA 3LOTA 1MWOA 3WJXA 1U22A 3RDKA 3CUXA 1AL7A 2I1OA 3CIVA 3RLUA 5AB3A 2FZBA 1KM6A 2Y5EA 1H61A 2QUUA 1VCVA 1BFNA 1EP1A 1LDCA 2YXXA 4JR5A 3CO4A 2DT0A 4BWLA 3WUGA 3MJYA 1WZLA 4Z08A 1S5WA 1S5NA 2O55A 5G5IA 3VFCA 5K9XA 1QOPA 1SU5A 3A5VA 2AGTA 4AZ7A 3NUKA 3B9NA 4O0KA 3MSGA 4JTRA 4MZ1A 2QZRA 5IBXA 3REQA 3MCOA 2PTZA 1KM4A 1E0XA 1VGAA 1MUCA 3UESA 3EWYA 1RJRA 2BSLA 5FAJA 1BTCA 3V4BA 1EZWA 3WX7A 3AHZA 1FFRA 2OSYA 1PWLA 2DQWA 3WO8A 1VJSA 3SRFA 1UWIA 3CS2A 1V6VA 2G3MA 1TA3A 2BXVA 3ZLHA 2VP8A 1G4EA 5E09A 3H7UA 4IPNB 4D6HA 3RLHA 1QOXA 1QHZA 3N2BA 5AHMA 3RIKA 1Q7ZA 3N1AA 3OLEA 3VABA 1PZ2A 4GZIA 4LS2A 2V5DA 4AD1A 5I09A 1QHPA 1RD6A 3WJYA 1VR6A 1PCKA 3CZEA 4IFKB 2ZRVA 1TZ7A 4P8WA 2Y61A 1FCUA 3VIIA 3IUDA 1HL9A 3LCGA 1ZP3A 2CETA 1EUNA 1OCQA 1YX1A 5CSYA 2V9DA 1K4GA 1R46A 2DU2A 1E4IA 4PMJA 2DFAA 4ZCWA 4PB3A 2I14A 4X2PA 3WBEA 3AZRA 5DCBA 3HGRA 1BXCA 1RA5A 4MNKA 5A6SA 4Y9MA 1JUKA 1RLCL 2E09A 3HJZA 3UPBA 3CYVA 1M9HA 3S2NA 4GMEA 3CWHA 8RUCA 2J88A 4DWDA 2O7SA 2ZRWA 1R9ZA 1K8ZA 4Q4SA 5KEZA 4AH7A 4F9JA 5DRCA 4XD6A 5C9UA 4GNVA 4IMCA 3QTPA 2O4QA 4UB9A 1A5CA 3NQ7A 5HNNA 4O4VA 4LAUA 2VRQA 4H7VA 2FGLA 3KOWA 3GKAA 1UH4A 3H23A 3R79A 1V3JA 2PGWA 2G96A 2FVLA 1JYVA 4QG6A 1ADOA 2J77A 1Z32X 5E1QA 3QN3A 4KCVA 4FIQA 1F4AA 2GJLA 2W63A 7XIMA 3MCNA 3GFZA 5EY5A 5TBOA 6TIMA 1LBMA 3C52A 3ZVIA 3ZT6A 5LNWA 1B9BA 4GI8A 2I9UA 4L9XA 2XISA 4ASTA 1P4CA 4IMAA 4QIUA 2RDWA 4OUIA 3A9BA 2UBPC 4ZFMA 3OOQA 3VDGA 4MKNA 4R85A 1TWWA 1EDGA 1B31A 2C0AA 4NNAA 4JIEA 4IGSA 1I8JA 3LQLA 1J0JA 3MUY1 2A6NA 4GGBA 4JHZA 4CVWA 3L67A 1KGUA 4I7UA 3NDZA 3TUUA 1OFAA 4C6QA 4N02A 1UMLA 2VWSA 4GISA 1OD8A 4CNUA 4U28A 3EPMA 4X0NA 2NUXA 3MP5A 2UY4A 1TB3A 4H6RA 1XYAA 1ZNNA 4W93A 2F9RA 5D9NA 2C19A 2F7FA 3OGSA 4Y7EA 1B3ZA 4V2XA 1VPYA 1W1TA 2F61A 3W71A 3VOJA 3NZRA 3LEPA 4UQ9A 4M7TA 3UWUA 8XIAA 3L2LA 1A3HA 3E3HA 2RDXA 4HCLA 4O1DA 3Q2DA 5JQ9A 4TX8A 1GYMA 2HWGA 3E2QA 4QISA 3EMCA 3TN4A 3V5CA 4OE7A 1GCYA 5F2GA 3PFRA 4Q4MA 4EWND 3G1RA 4KERA 5DMMA 1FWSA 3LCLA 3CT7A 3OBAA 1OK4A 4ICMA 1D8CA 2EXOA 4JX5A 4WJ8A 2PC4A 4AWSA 3LM3A 2VCBA 2R1LA 3UWYA 3VD4A 1RBOB 1K8CA 1R47A 3NZQA 1R38A 1YEYA 1UP2A 3C2VA 4GUFA 1FWEC 3SN0A 2DSWA 2GUUA 4DLMA 2QCCA 3T4CA 1YIXA 2A3AA 4FMVA 3EKGA 3LPPA 1CEOA 3FXGA 3ITVA 4P7LA 5FEZA 3WMLA 1OINA 1KKRA 3PWIA 3T0AA 3K8KA 3WLIA 1D3HA 3VD7A 5DT7A 3MV01 5AC6A 1DKWA 3GWQA 2CLKA 3MJMA 5E6ZA 1UR3M 4TV6A 3BMXA 4UTJA 4RLIA 2ZWZA 3TC3A 4D1JA 1Z42A 1EO5A 4FOUA 4W84A 3VE9A 1TV5A 1DJXA 3W02A 2VFIA 3NL3A 3TU9A 3OHMB 5AECA 4HQVA 2HS6A 1WBHA 4JDBA 4PBEA 1R7AA 4INFA 5KITA 1XH0A 4G2DA 1AH4A 1XR2A 3EWZA 1GVOA 5EFDA 2R1KA 5A94A 2E6AA 3CL8A 3MHUA 3AZSA 2X0SA 1G4SA 4WY0A 3PJTA 3AHTA 4ZOCA 1KXHA 4IPIA 1NQKA 3CQIA 3R0DA 4QG8A 1IZCA 4DBSA 3OGRA 1WUFA 3OU8A 5EL1A 1AZ1A 2CBVA 2PDIA 4X3ZA 3W2JA 5A6BD 1E56A 3UZYA 2XFRA 1UQYA 5E0KA 1TX2A 3HU7A 3VOFA 2X1SA 3BW3A 4PSPA 4JTHA 3WLQA 1OABA 1QPRA 4DWSB 1UR1A 3VMOA 1ML1A 3H7RA 4ZFCA 4I6VA 3LCIA 1A3WA 3KCLA 3WQ6A 4IFOA 5CPNA 2Z1KA 4H6EA 5K7JA 2ZXBA 5JUVA 1VH7A 2KZHA 3WQFA 1VC4A 3S1XA 4Y9OA 2WVUA 1DIOA 2Z29A 4OTKA 3EYPA 1XXXA 1BEUA 3QV7A 1RA0A 2HV5A 3WFLA 3BZJA 6REQA 2OOFA 3KAOA 4IHCA 2ZADA 1K8XA 4YHGA 1UG6A 3M0XA 3LM7A 3PN8A 4HK7A 4UTHA 1I9CB 4RW3A 1TCDA 2QV4A 3PM6A 3QMTA 2YFOA 1BF6A 4XKMA 3RR1A 4IGHA 3V5FA 2TSYA 4LPCA 5DY3A 3DHDA 1R30A 3QRHA 2J27A 5LYRA 4RE2A 2VXNA 2YA0A 4J3WA 3T2OA 1I6NA 1FY6A 2DSZA 2Q8XA 4LT9A 3CMFA 2VEKA 1E5NA 4HNOA 2VGBA 3UGVA 1VFFA 2F6XA 1V3HA 4KRTA 2V2DA 1IR1A 4HK6A 3TMLA 4NZ1A 1QMLA 3RO8A 3CV1A 4UTFA 1WAWA 3H4GA 3T05A 3J7HA 5FF3A 1QU4A 1SJCA 2PP0A 3WNNA 5A8GA 4G9PA 1GG1A 3PANA 1LLWA 1CXEA 1OWQA 4GJJA 2QR6A 4XAGA 3P67A 3BCDA 3G1XA 3KRSA 3A13A 3N14A 1XYCA 3SZ8A 5AHLA 5FEWA 1OIFA 3TW7A 2A1YA 2ZRZA 5HMSA 4IJCA 4O8RA 4CD6A 1CWYA 1E3XA 2CWXA 4IG2B 1ZBKA 2XVKA 1D7FA 3P61A 1IV8A 1CXKA 3SRHA 1F6YA 1DWAM 4Z2KA 1EJ7L 4JXCA 4IUOA 2WKGA 1KM1A 3TWAA 3ITTA 3UXDA 3IS4A 4NIRA 1E6SM 4TXEA 4PCPA 3S4TA 1XUUA 2ZXQA 1YYAA 1VZWA 3T2PA 2EO7A 2GJRA 1CXLA 3GNPA 3H2CA 1UH3A 1VF8A 1NF7A 2OLAA 5G2IA 4A22A 3TQ0A 3NQFA 2J9XA 4JTQA 2XFFA 3BJFA 1XG4A 2J62A 1VAHA 4YS1A 1JZ4A 4NX5A 1EQCA 1R3VA 2X1UA 1F5ZA 3MC5A 4FLOA 1QRQA 2C1GA 1G4PA 3NO5A 3R6IA 2OZ3A 3WD1A 5A2CA 2BX7A 3F03K 1H5YA 4NYYA 3M7SA 4LJ3A 4PUWA 3L12A 1ODZA 4DUXA 1PCWA 2CC0A 2PUZA 1VD6A 5I23A 3LRMA 1XIJA 3S1WA 4UFMA 4M51A 3RU8X 4HPGA 4A8IA 3H7VA 3BG3A 4G5DA 1V77A 2Y63A 1KR1A 2G5WA 3KL5A 4J28A 2D3NA 5BWAA 1C7SA 4KRZA 1DBTA 4O52A 1DYSA 3HPSA 4IJBA 5CPLA 2WZIA 4MY8A 1DQWA 3LENA 3ABZA 3TXVA 4ZVJA 3GK0A 2ZUUA 2ATSA 1QNPA 3R58A 3IGUA 1AH3A 3EX1A 2PP3A 4HPJA 1RD5A 3PC0A 3IJ9A 5I02A 3NURA 4IX2A 1Y7VA 1YTDA 1T8XA 4YXGA 4WRHA 3OLDA 4CD5A 4ZL1A 8CGTA 1YE4A 3W1UA 1MXDA 2EPNA 2PRHA 1SZNA 3WMSA 3QW3A 3W1LA 3FHQA 4E8GA 4Z2JA 3W00A 2E6DA 3S6DA 1R85A 3BQ5A 3DFPA 4ECLA 2BVDA 1GOWA 3M47A 4H9UA 3QZ6A 4QEEA 3UETA 1BF2A 2VFHA 4JTTA 2E1DA 1OQFA 1EYEA 2XGZA 3A3XA 3DN5A 1WDSA 4S38A 3STCA 1NSJA 5AC8A 2H90A 4E2VA 3QOKA 3IJDA 4KF1A 4K1WA 1GOXA 2VZVA 3QY7A 3QGVA 1Q63A 1W37A 3F4DA 3W7QA 4BCEA 2BFGA 1M1BA 4H8HA 4S2BA 1ME7A 1B4KA 1POKA 4QJ1A 2J7DA 4FNPA 4ZO8A 5BZAA 3B8UA 1W3JA 1MW3A 1JZ5A 3VC6A 5M5DA 1KGWA 2GWGA 3CIXA 3UA4A 4GCXA 2WNZA 3MSRA 1UA7A 1XC6A 1UR2A 3AIQA 4I7WA 4R7OA 2WMGA 5HOSA 1MW1A 2PLCA 3HQ1A 5EMUA 2CXGA 4MWAC 3P8JA 3THUA 1OVDA 2HE8A 3C5QA 4AYGA 1XLHA 4ZQOA 4FP1A 3OYXA 4PMYA 5D4YA 2P1FA 4HJWA 3GW0A 5C55A 4QS6A 3LA4A 3DBNA 3TQKA 3F2DA 4FOKA 1N8WA 4NILA 3SRKA 4B3LA 5KZDA 3PUDA 2YDQA 2O9TA 5EBUA 2QUVA 3DIPA 3L0NA 5JMUA 3RR4A 2Y7FA 1JPIA 3NPXA 3LV5A 4DO4A 2Q3RA 3APTA 1T5AA 1LL6A 2WAGA 4JN8A 3ARQA 2PD5A 3BANA 1X39A 3GKFA 4S3CA 4P7QA 2GLKA 4Q33A 1AG1O 3N29A 1UWTA 5HMFA 3QR1A 3FNDA 5M2FX 4L1XA 2YZRA 4H3DA 4B2DA 3BUVA 4GH1A 4QE5A 3TQVA 2IKIA 3W2LA 1S39A 5ABTA 2Q3OA 3TTYA 4TV5A 2CLLA 1QPOA 1E0TA 4MJMA 1KXTA 4HPHA 4Z17A 3WG6A 4IMGA 2VEPA 4WKAA 4H8NA 4KWSA 4KW2A 3TN5A 1S2TA 1Q4WA 2OR2A 3CYJA 4QCFA 3W01A 1FXQA 2AKMA 3QW4B 5M1TA 3ES8A 2C91A 4JGDA 2R6OA 3DG6A 2BHYA 4DXVA 4XZHA 1NDYA 3N3MA 3MI2A 1XGZA 4HIBA 4IGNA 2XN1A 3EPNA 1WYIA 4C60A 4O10A 3NTYA 4OV9A 1UPPA 1BSIA 4C6OA 3M5ZA 1KFBA 3VKDA 3SURA 2VGFA 1W9UA 3QHOA 4K68A 2ZZ7A 4HU0A 5GQBA 3TFXA 3LHUA 2OU4A 3EMZA 4P7NA 3T2QA 2IKGA 3CBWA 1V3IA 2OLSA 4K8GA 4HZMA 1V51A 4ACZB 4MTVA 4LH8A 3O16A 3U5UA 1XW8A 3WLPA 1FHLA 3LZ3A 1H50A 2UY2A 1K4HA 2WHJA 1EPVA 3GE7A 3VXGA 3LGDA 1D8WA 4W87A 5KINA 4UOQA 2NXIA 2HPIA 1FHUA 3W76A 3HA1A 1P0NA 2VDGA 4BA0A 5SWUA 3GFXA 2VR4A 4BF7A 1QT1A 3RU6A 4YVXA 5JIWA 3TE9A 3MUZ1 3C86A 1B30A 2Y5SA 3G1YA 4EF8A 1EA0A 3KUMA 3SIZA 3ARTA 3KBSA 1C3FA 4NVTA 1AMKA 3TP4A 2ZA1A 1IWPA 3TDFA 1GONA 1S2UA 2O0TA 2ACQA 3APYA 2OZTA 2YB4A 2PWVA 2ZRUA 4JQ2A 3TJXA 4DJFC 3CH0A 3A22A 4ROQA 2XZ7A 2VVNA 3PBWA 2RKXA 5AC5A 3JZEA 4PN2A 3KCOA 1TMHA 3UXIA 3SQLA 3VDCA 3MA8A 1MQPA 4P8UA 4J3VA 5E6YA 1VQTA 1M65A 3KOYA 4BEQA 3CQHA 3L5MA 4L4MA 3SB0A 3C0QA 3R7MA 1MEHA 3FDKA 2BASA 3M0MA 4IP7A 1SUXA 3TSBA 2C1HA 4K1GA 3UZXA 1JAKA 2E0PA 5B7ZA 5FSEC 4YTRA 3UWWA 4LB3A 3VCRA 3T8QA 2W6RA 4OQVA 4AY7A 3BGGA 3GM8A 1HX0A 3RITA 5LKYA 2QPUA 3H4XA 1JPMA 1WCGA 4C5YA 3WCZA 1KR0A 5FL0A 2DORA 5FAGA 3OLIA 1PXGA 3N25A 2QJMA 1E0WA 3HG5A 4A3UA 1TKKA 2AGKA 4XG1A 3LHZA 3SFKA 2GSHA 3MCMA 1OY0A 4QS5A 3FOKA 3L65A 4GG9A 3L66A 4IWWA 3WQ4A 3NAVA 3ZJ6A 2V5LA 2FJUB 2WHLA 3N13A 2JQXA 2VRKA 1RALA 5J04A 1BHGA 1EDTA 4KBXA 3NOEA 2VFFA 5AYIA 2E4TA 3S8HA 3O6DA 3ZJ8A 4CCDA 1EDQA 4TVCA 2XIOA 1Z69A 3MUIA 3I6RA 3BDKA 3WQVA 1A5NC 1NFGA 2VZSA 4B5NA 4E3VA 2ODOA 3VIKA 3W7LA 2C1IA 3ABSA 2IQ0A 3T8LA 3V1PA 2OT1A 3VOGA 3QYSA 4E2OA 5H2ZA 4QHRA 5FSDC 1P5BA 1PB0A 2RDTA 2JEPA 3B0VC 4HVXA 3WLHA 3KZPA 1YE6A 4ORIA 4R9OA 2ISDA 2X7WA 1OSEA 4M6UA 1HTIA 1HVQA 2VD9A 7REQA 2YFNA 1YNYA 3VM5A 4QE4A 3PAJA 1FXPA 2P8BA 2D2JA 3WQOA 3SBFA 4ADUA 3T78A 3SUSA 1SFSA 2QV5A 4W86A 3LN3A 3N4FA 5K4XA 1E1EA 4IQLA 3W7RA 2HROA 3W28A 1HKWA 2RAGA 3M0ZA 4RDWA 4AY1A 2QUNA 3N34A 3N2CA 3AROA 3M5XA 4I9TA 3FJLA 3T55A 1H1NA 4UMAA 1W3TA 2QCDB 2GL5A 5AHNA 1AZ2A 1LROA 1XQKA 3GHRA 1S2VA 2WJDA 5LIWX 4AY8A 5D9PA 5FA5A 5FKYA 4GLEA 1W3LA 1A4MA 3ATZA 1J5TA 3U2CA 4PCNA 3EWCA 3ME3A 2DT1A 2E5CA 4D6FA 2J74A 3MP3A 1LLOA 3SAZA 3WH8A 5I77A 3H12A 1HG3A 4JX6A 1QW8A 3FSTA 4Q8UA 4G1NA 4RXFA 4EX4A 3O15A 2E5BA 4IIFA 4P7OA 3M0LA 3GNRA 1RQEA 1S46A 3GXFA 3D0CA 4LUTA 3LB0A 4YYFA 2O92A 1QATA 2ZVIA 1XLGA 3G3DA 4H1ZA 3B40A 3MP4A 4ZENA 1JCTA 1V4YA 1TFVA 3NSXA 4W8LA 4XKYA 3Q45A 1JDFA 4D8ZA 3G18A 2CPUA 5LIYX 4GD0A 4F0MA 1J18A 1K7XA 2JEQA 3SRDA 1XIHA 2XSAA 3OGVA 1RP9A 3QR0A 5BNKA 2QW5A 4FXRA 1QPKA 3BLFA 1JEZA 2HE5A 3O0FA 3QKEA 2WZTA 3BGAA 4Q4PA 1UKTA 3GBDA 4D6EA 4I7VA 3XISA 2DV0A 1W5MA 1H09A 1B9ZA 2JBMA 3SUVA 4WKHA 3S5NA 2B31A 1CXHA 1R3YA 2Q02A 1G7UA 1SW0A 2NLYA 1FHVA 1CGUA 1LZOA 1M04A 1JD7A 1U1HA 1ZCCA 3UY8A 1TZ9A 4BHYA 4PTVA 1ECEA 2WCSA 3UERA 5JU6A 1VYRA 3HQNA 1M03A 1V93A 3CTTA 2PDGA 4I8YA 4L65A 2NQHA 3O8AA 1TJRA 3B8WA 4OZOA 5G2WA 3WQ8A 1XJBA 3AIBA 5C2CA 4A35A 5C6MA 5EA9A 1V03A 3AMKA 4C65A 2PDNA 9RUBA 3OO2A 1JI1A 1KNWA 4K7YA 2ATMA 3OLGA 1VBUA 1J0HA 4UCGA 1LT8A 3TTQA 3CNYA 3B8SA 1TE1A 5ABEA 1SVDA 2VC7A 1HP5A 1PZ1A 3EOUA 3MMTA 5DEZA 3U48A 4QGCA 3CL6A 4FB7A 4Z2GA 4Y90A 1DJWA 4AFYA 5IDZA 1KM5A 1A4LA 2A3BA 4L1GA 4E2BA 1OFBA 4U4MA 4LSBA 5I6SA 1J0IA 1DIEA 1HW6A 3S47A 3PZQA 1AODA 2XIQA 1E1FA 2CZVA 3AJ7A 4N4PA 5A6BA 2F2HA 2NV2A 5AFDA 2ONEA 5HQMA 1P48A 2GGHA 4DQWA 1UWUA 1FWTA 1W9BM 5XINA 3KDOA 3PUEA 1A5OC 1P0BA 4RNJA 3UJRA 1GZ1A 1JXKA 4N4QA 3WDPP 4ZB5A 4HA4A 3QV8A 4GCAA 3EX6A 1FA2A 1VRXA 1W5OA 2V5CA 1L8NA 3GH5A 3TSDA 3GVGA 2QCEA 5EMMA 4RDYA 3TYZA 1RJQA 2FIQA 4TX9A 3N2OA 3W1MA 4JBRA 5TQLA 2VFGA 3QZAA 1UKQA 4GI9A 2VX7A 4AIBA 4NAEA 1GW1A 1J12A 3GRIA 2V6AA 1U33A 1NP0A 4NY2A 1V8EA 3M07A 1ZQ5A 2DZWA 4N7QA 1JFXA 1VFSA 4M5PA 5LXEA 1XDMA 2ICSA 4RL3A 2YLAA 1GORA 5REQA 3MS8A 3TYAA 3VFLA 3BCJA 4QJ4B 4MLRA 2NQZA 3ECQA 5MKGA 1XCWA 4CN1A 1V0NA 3IWPA 5BROA 1O94A 5AZ1A 1VLWA 4YL2A 2Z25A 2IPJA 1FWWA 4ORMA 1UH2A 2XIBA 2PF0A 1IIHA 2WMKA 3CMGA 4QM1A 1FWIC 1QR7A 4K37A 4AZGA 3LHWA 3B03A 4B5XA 2VTFA 3EXRA 4AX6A 1E6NA 1J0KA 3S5YA 3BW4A 3A4WA 2QHAA 4BI6A 4QAIA 3W7HA 5LNUA 4ERGA 4JTIA 3V35A 3PG8A 1FWFC 4KESA 3P80A 3S6TA 1DXEA 5IRPA 3SQSA 2FFCA 3SIMA 1CLKA 1LRQA 3RHGA 2X05A 4B92A 1FBAA 2BVWA 4J1OA 4PBGA 3DENA 1ZJAA 5CBJA 1R2SA 1YTEA 4MZYA 3QLDA 1OJXA 1GKQA 3SCPA 4F8XA 4F9DA 4D71A 1YNPA 2WLZA 4WKFA 3GG8A 4XK2A 4HOWA 5F2LA 4S3KA 2BGNE 3LQGA 2DVTA 3FJ4A 2A3LA 3GTIA 3QBUA 4O13A 2VX6A 2ASHA 4RE0A 2L5HA 5AZ0A 3G1DA 4AIUA 4PB5A 5DXXA 3KL3A 4HT3A 2G50A 4R27A 3VOCA 3UCDA 4XVDA 4Q8TA 3CV2A 2R9RA 3VGHA 2BOEX 2BHUA 4K6AA 1AUSL 2YCKX 5C9XA 4CD4A 2TODA 2FZDA 3AYTA 2P8CA 1BQCA 1WQ5A 3IJ8A 4WCJA 4DELA 3MYPA 2OZ0A 4L80A 6CGTA 2VMFA 2OO0A 2DDXA 1PIIA 4DVOA 2EJ1A 3N4AA 3TV8A 2CESA 4Q8PA 2GVLA 2OLHA 1KKOA 1UZ4A 3M41A 1W1PA 1N82A 2W92A 3CLMA 2PWFA 1BLIA 3LLFA 3FJNA 1R3SA 2JALA 4B3KA 4IL0A 2PA6A 2PDHA 4WLCA 4AC7C 5FCZA 3FW6A 3GLCA 3L9CA 4J4KA 1PS9A 1V7AA 3W53A 1BQGA 4AHPA 4MWAA 4C1NB 3WDQA 3SUUA 4G8TA 2X0YA 3A5FA 2PDMA 4JL1A 2HVMA 2Z2UA 1PAMA 2VI0A 1J93A 1DWGM 1GQIA 5CZ0A 1RBLA 4AZ5A 1CLVA 1U5VA 1E6ZA 2GDQA 1ZS2A 4L7ZA 2BP1A 1Q2RA 4PTXA 3W0KA 3IIVA 1IXPA 4F0RA 2I5GA 2HMCA 3CLWA 4MOZA 4FNUA 3M9YA 1NP2A 3A6OA 2AOSA 2Y85A 3IRDA 4O18A 3R43A 4H83A 4CU7A 2VQTA 1W5PA 1UD2A 3CWOX 3SN4A 4K8HA 4U5IA 2AQWA 3BLPX 3CHVA 2GVGA 2WYSA 5T8GA 2OYLA 1OC6A 5I7GA 3DFOA 4JYDA 4M0XA 4HA1A 4LOCA 1EP3A 3QR3A 2QQ6A 1QWKA 3STFA 1H4PA 3OQ8A 3B8DA 5EYWA 2WQPA 3TSMA 3GTHA 4PTNA 3UXLA 2HQAA 1BKHA 1DVJA 5CPOA 2QLYA 4Q8QA 2HPMA 3W27A 3WY1A 4DAFA 4M82A 2FDSA 4AQLA 2EEXA 4Q8NA 2YR1A 2BNJA 2W4XA 3B0UX 3NPVA 3GXIA 3VNIA 2VR5A 3HIJA 1V79A 2YCLA 3W6MA 3W37A 4ZEPA 4GIRA 3PBGA 3AJXA 4WD0A 3E0FA 3KBJA 1IEQA 3D3AA 4R7JA 3RJXA 4AWTA 3S1UA 3A47A 4OHQA 3O2LA 2BZNA 3W7GA 1UOKA 2XVGA 1I2OA 1XRVA 5G1YA 3LBCA 4Y9AA 1ELSA 3DFSA 4WEVX 1EIXA 3G0XA 3QMRA 4AMCA 4H01A 5U7SA 2QUMA 4H7CA 2QCFA 1B3VA 1CBGA 4EVZA 2WMIB 2WK2A 1H1ZA 1LL4A 4CQAA 1QI5A 2ZDSA 1XUZA 3MO7A 1UBSA 1NF0A 3FYOA 2J25A 3SO7A 4NXKA 1P0KA 3BAXA 1PKLA 1OX4A 3NQAA 1MNZA 1OFPA 2PDCA 4Z1CA 3HFYA 1ZP4A 3PZMA 4C6IA 5DMLA 5MHBA 1PDYA 1L9WA 4WDXA 5BXTA 3NQVA 3GVQA 1Z6KA 4O57A 4UFIA 4MPQA 4LS0A 4DWSC 3N3TA 3T42A 1JUEA 2ESCA 1KGXA 3UYIA 4UQDA 3Q4DA 2G3FA 4AVFA 1PIGA 3B0YA 4O12A 2P10A 4XSMA 4BFAA 5D37A 2ABBA 2R8WA 3W29A 3KRBA 4X61A 5M17A 5K9DA 4GHRA 4GQQA 1HJQA 3IIPA 4I9MA 2VFEA 7PTDA 4AWUA 3BLEA 3TYCA 4MAVA 4O11A 3ABRA 3NXFA 1TO3A 2E1WA 3S5OA 3CUIA 4RNHA 5BRQA 2CU0A 2OSXA 4NX0A 4H6QA 5H1WA 1D9EA 3BGJA 1KM3A 4NQ1A 1EJUC 2EAWA 7CGTA 4TR9A 4DPPA 2ISSA 5CXPA 2RGMA 5CJMA 2BOGX 4ZODA 4E3TA 5T26A 3O6CA 3Q58A 1T99A 1B90A 1BWLA 2FHBA 2E8YA 1DJZA 1OM0A 4JFWA 2CBUA 2V2CA 5T91A 2VHLA 1Y5VA 1ITQA 3VA8A 1BVNP 1TJ2A 1X96A 1KCLA 4LYKA 1RR2A 4NJHA 2QPSA 4UQEA 2RFGA 3FK4A 3MW7A 1C92A 2NSOA 2E6YA 3LHTA 1PZ0A 2OWWA 4C1LA 3TMQA 8A3HA 2QF8A 5H8UA 5LA2A 3VM7A 2Z2AA 1GOMA 5HATA 4AVNA 1TSIA 4AD2A 1AFSA 3PPCA 1MI3A 4DI8A 2ZCGA 3CAKA 4LRTA 4PFMA 4JICA 2ZKMX 1UWQA 4D8LA 2EG8A 3DG7A 4LFYA 3HPZA 4YNGA 5I00A 3CWNA 3HJEA 1OK6A 1PO9A 4TIMA 2XFYA 4AG0A 4ZO6A 2INZA 2J7GA 3GZ3A 2X42A 2Y4SA 3FS2A 3MMWA 3UG3A 4E38A 4DZIA 2VDHA 3WL0A 1OZQA 2VURA 3OIXA 3WMCA 3W1XA 3FYPA 1U5JA 3BOXA 1EXBA 3OBKA 2YXGA 4PSRA 2PCQA 1W1IE 1VJIA 1JZ8A 4JCMA 3ARUA 3EKLA 4F2BA 2GWNA 1F7BA 4GX8A 4B4HA 4XTDA 4A2RA 3Q37A 4KEVA 3RX3A 1QNOA 2DZAA 3CU2A 2WXDM 5ABGA 3BV4A 4I5RA 1CCWB 3PZIA 3T40A 1KLZA 1MW0A 2Q8ZA 3WEMA 3BL3A 4JS3A 2OKTA 3CZJA 4IH3A 1X7IA 1QXLA 4JNYA 3RJYA 3I4KA 4QLJA 3OW1A 3QPEA 3KLKA 1QNRA 2ACRA 5HANA 5F4SA 1OCBA 3IJ6A 3NA8A 3CMJA 3EGJA 3FXYA 1F3TA 1NFPA 4IGMA 5I3GA 2CLEA 3F4NA 4DEFA 1M7XA 5FF7A 3GR4A 1P0DA 5AHIA 2V69A 4ERIA 3BARA 3G1FA 2NVCA 3GU9A 5C7HA 1G1YA 3KE0A 4CCCA 3KEHA 1BWVA 3VMNA 1KFCA 4GBUA 2OMAA 3EA2A 1ZU8A 1MSSA 1C7TA 1S1PA 3EZ4A 3MANA 3O06A 1AD1A 2DVXA 4HHLA 4C6EA 1IHIA 1ZBVA 2RUSA 5I24A 4IIDA 3E74A 3E2VA 4FNTA 1CT5A 4HNUA 4LV9A 3N19B 3N18A 1EIBA 2PWUA 2ZX9A 3L4ZA 3WJZA 2YLLA 2HBXA 3MMUA 4AD5A 4JOMA 1FH8A 4QNWA 4WSHA 2W9MA 1K3UA 1UIOA 2QGYA 3CV6A 4AD4A 2BVYA 3SJ3A 1GHSA 1A5MC 4H8UA 1PDZA 1UKSA 3W7JA 5L9FA 1V6TA 3ITCA 5GJNA 5D05A 4JAWA 4QDWA 3NGJA 4MFEA 5FJJA 4OBTA 3MDUA 4A8LA 2OYMA 4NI3A 1BTMA 4Q8OA 3T44A 1U2YA 3PJWA 1TRDA 3T4WA 1SPQA 4DM2A 1DQXA 5I0DA 1KV8A 4F66A 1TV4A 4YN5A 4FX8A 4JFVA 2ZBTA 3BAJA 1TTJA 1NDZA 1OF6A 2G3IA 4K39A 1O4UA 1V0KA 3RXZA 1JZ2A 4MJ2A 3MZ2A 4UFKA 2UZ9A 2NQ9A 3L68A 3URBA 3A4AA 2BY3A 2PSNA 4LALA 3VNZA 4JHOA 5DY2A 2YBVA 4IQEA 1YADA 1Q2SA 2P3EA 1Z3NA 4C6BA 3U2EA 1CX9A 4GPNA 4W7WA 1ME9A 4UMBA 2FKPA 4CU6A 1R3RA 1US2A 2ZX8A 4KPLA 4DBUA 3RPMA 4LCSA 2A2IA 2OXNA 2V81A 4EACA 4MF4A 2V5KA 1Q45A 1XL9A 2O7QA 5FF2A 3RM8A 1DJNA 4D9PA 1W2PA 5ABFB 1E51A 1QASA 3IGHX 4FNRA 4GQ0A 4C1KA 3T0DA 4XO6A 3WQGA 4DF0A 1MW2A 4PC8A 2V3DA 1KFEA 1KBLA 3UY7A 3IEBA 1E1CA 1K6WA 3ATYA 1EP2A 3L2IA 4PMRA 1H0IA 3ZT7A 3LTYA 4HNNA 1JULA 1O5XA 2GJXA 2JE8A 4QQUA 2EJAA 5CLWA 2GGGA 2BDQA 5HNTA 3H55A 1GOQA 1VB9A 3R11A 3V16A 3KTXA 1A49A 4HYRA 4MFDA 1HKJA 5K2ZA 1SM9A 4ZTYA 1UP0A 1MO0A 3DEQA 1OYBA 2Y7GA 1GJPA 2DT3A 4JTLA 4FIRA 3T09A 2FJKA 3VKKA 1AQFA 3GG0A 1OT2A 5A3HA 3CHDA 1JPDX 4QRNA 2PRLA 4M6PA 2VX5A 1G67A 2YKKA 2WVTA 2FYMA 4LTSA 1BGGA 3TEVA 4P2VA 3SEPA 3P5YA 4H9TA 3CUGA 2ZRXA 1UROA 4QP0A 4DRSA 1OX6A 1I45A 1BPLB 4TTUA 4F0HA 4TMBA 4WXYA 5CEWA 4GY0A 5AHFA 3T0BA 3IANA 1S2CA 4HMEA 3UD6A 2H9AB 4PUMA 4YVVA 3WDRA 7ENLA 3S5SA 3LK6A 3NM3A 4L64A 3ONCA 5A8MA 3A9IA 1H11A 3GNNA 5CAHA 3HF3A 3PNUA 1GHRA 3GG7A 4IPPA 3MHFA 2WMHA 1G0CA 3L2MA 1KM0A 5LZLA 5LA0A 1BRLA 3R10A 3L4TA 3NQ6A 3QGKC 4O17A 2YA2A 4GX9A 1WZMA 4GVFA 2BODX 4QFUA 3TWBA 3C2YA 3TFCA 2ADAA 3RRAA 1MXGA 1K7EA 3W2UA 5FF0A 3G1HA 2FZMA 3EX2A 4YU1A 1QFEA 3TH6A 3XINA 3W75A 4FI4A 3HFTA 2GSJA 3M16A 4X9YA 3ARPA 2JKAA 4M19A 4Z1YA 4LYRA 4JFSA 3E6EA 5AHEA 1EA9C 4BQ4A 3H2AA 3NPWA 3B0PA 3MU7A 3O6YX 3QV9A 3UJFA 1FOBA 1MUWA 1FDYA 4W5UA 4G7FA 4HB7A 1XLIA 2A6LA 3V36A 3G0UA 3ZWTA 1XLDA 1LUCA 4IFKA 3W7MA 1JI2A 1D3CA 3PTDA 2PU0A 2OELA 1MQQA 1GOIA 3W24A 3R13A 1SFTA 2C13A 5G4HC 5DBTA 1IIGA 2IMRA 3BE7A 1CB7B 3N6JA 1NY1A 4FAMA 2J7HA 1XH1A 3GIPA 2JGQA 3TKFA 1E71M 3WH7A 4REQA 3VK5A 4CQCA 1QI4A 3K13A 2I9EA 1XLKA 3TAKA 3V3WA 1E6RA 4E0CA 1P6CA 5JIPA 3FEQA 1Z89A 4CD8A 1M53A 2DH3A 4NSBA 3MYOA 4GKLA 1TX0A 5CC7A 1NTHA 3WFZA 4RDZA 2DUZA 3MVIA 1TPWA 4UR8A 5I3KA 1X7FA 1RK6A 3NFUA 1AW2A 2GZXA 4GUJA 3L5LA 4UTTC 5AYZA 5EBAA 1GGOA 1RVGA 2ZUTA 1CGXA 1FWGC 4UTIA 5CZTA 2PB1A 5EMLA 3W7IA 3KS5A 2VCAA 2YDRA 5G4WA 4CNSA 3STGA 4NRRA 5IOBA 4ICNA 3UG5A 2QJHA 1GKRA 3V18A 1GEHA 4NL1A 3MBFA 1QTWA 2D23A 4AIEA 3F5JA 4W88A 3I10A 3EWXA 4ES4A 1NH6A 4UZUA 4S3EA 1NJJA 2VC9A 3QY6A 4IISA 2WB5A 1O66A 1TWSA 3WMBA 1THFD 2JKEA 3KWXA 1QW9A 4AD3A 1CZ1A 1W31A 1C8QA 1GTHA 3AICA 4PTMA 4GH3A 5IFTA 1KTBA 1ZJIA 2OSWA 4DUWA 4PUNA 3R4IA 5AN7A 3IV8A 7ODCA 2E67A 4JTSA 4J3SA 1PPIA 1REQB 4AEOA 4Z0JA 1UR0A 2NXHA 2OJPA 4RPPA 5DT5A 2EPKX 1WP6A 2B7QA 3KP0A 5BMXA 1DHKA 3ZO9A 4NT0A 2HEJA 3TTEA 3KS6A 1XQLA 3IIXA 2WKLA 4S3JA 1TV2A 3DI1A 1JCYA 3CO8A 4BK9A 5FACA 3WLKX 2HNEA 2W3ZA 1S5TA 1H3GA 1XLJA 1VEMA 1KO0A 2PLJA 2QCGA 2VFDA 4EXBA 1F6PA 2VEFA 2FZ8A 2HDJA 3G1VA 1GVFA 2C3ZA 2PURA 4R9XA 2GVYA 2VNCA 5C5YA 3KP1A 3TTSA 4L6DA 2FH8A 3WQ5A 1JGMA 2HSAA 3C2FA 1H1YA 1KLYA 4R7WA 5FEPA 1I75A 1VKFA 4Y2WA 2GQ8A 4JDYA 3U2OA 4UFHA 1BYAA 4NKCA 4ML9A 1KC7A 4TOQA 2E28A 1K7FA 4R88A 5AVHA 2WANA 4FS9A 3NG3A 4MADA 4AXNA 1DJHA 1HIZA 1JIBA 1NDWA 3BLIA 1R2TA 3C8NA 3B06A 3S9YA 2TAAA 3VX0A 3CEUA 1LWJA 3DOPA 3ANUA 5J8LA 7REQB 3QPYA 4LBUA 4JYEA 5A1AA 1MDRA 3RLVA 3G24A 4I9JA 3MBDA 3PTQA 4R5EA 4O53A 2AMGA 3F4WA 3N15A 3LYEA 1I1XA 1K9EA 3CZ8A 4U10A 1A50A 2VR2A 2J8FA 4QX4A 4MG4A 1WDRA 3E0LA 4XD3A 2YA1A 1YRRA 2KX9A 5CGQA 2IPWA 3W1AA 1FCBA 1WDPA 4I8DA 4Z1BA 3ARYA 5DX7A 4NASA 3UJEA 1ENUA 3M0HA 5HINA 1M41A 5A69A 3WLLA 6ALDA 3I7SA 1XI3A 3WLMA 5LIKX 5HR6A 3KVMA 2ZXAA 3ZLFA 3RLGA 3DGBA 5PTDA 2RGLA 3ALGA 3AI0A 3L4UA 4HNLA 3PS7A 1L2UA 1JYNA 4H9VA 4BI5A 1EF2A 3OG2A 1LG1A 1KFLA 2E9MA 1YKWA 3AOFA 3E96A 2VEMA 3GHUA 1FKWA 1LLZA 3TA9A 3ZQ9A 3DDMA 3M0IA 1R7OA 4C6DA 4O0QA 3AIWA 4S3AA 3H2EA 1G5AA 3VIHA 4WJEA 1ITCA 2WVSA 3A3WA 4DWSA 2X30A 2GVJA 4W7VA 5HQLA 3WJWA 1KQZA 2C71A 4RV3A 4X0VA 9XIAA 4LAMA 2WMFA 3EWBX 2Y0FA 4L61A 1PEZA 4PCTA 1E6QM 1EGVA 1UUOA 1JUBA 4KS0A 3EXTA 4IIGA 3WBXA 4AEFA 3DYPA 4G7EB 3EDDA 1DIDA 4AD0A 4JNZA 3LXCA 2E3ZA 3IGXA 2OEMA 1W8SA 3VTRA 3DCPA 4OWGA 2XPKA 3OVRA 4J7RA 2XFWA 2X40A 4BQ2A 3P3BA 1J2WA 3TXZA 1XYLA 3DFQA 2YBUA 4MNLA 4ROPA 5K9CA 3OIHA 4NAFA 3LV6A 1DWJM 3M6DA 3BAKA 4XX6A 1FP9A 3KOXA 2DZSA 4MZ8A 3EA1A 4RJEA 2VEIA 2PWGA 1XLAA 3EXSA 3SSZA 2DJLA 2ZZ4A 3SECA 1V7YA 5AC7A 1A0CA 1C9DA 4YVPA 3U57A 4PMUA 3BVJA 2VGIA 3KHDA 4GK8A 3ALFA 3RCYA 2D20A 1ITXA 4X60A 3ZFHA 3BMWA 1RCOB 3WUEA 3P0WA 2Z24A 4Q4QA 1SO5A 4UNKA 3ARXA 2HTMA 3S1GA 1M5WA 2NX1A 1K9DA 1S38A 3THAA 4LNCA 4GQRA 3H24A 3GG1A 1E6PA 2WCAA 2GSEA 4YTQA 1VFOA 2BY2A 1OC5A 4EE9A 3EDKA 1W1VA 4MLJA 3QTGA 1ISYA 1R5YA 1WUEA 5ENLA 3DFTA 3R2GA 4KWUA 4Q8VA 5BOOA 4FX6M 2POZA 3TYUA 2FTWA 2VJXA 2PDXA 3DGRA 4A21A 1W3KA 3IVUA 3KVJA 4IG2A 3BOFA 3E12A 2CLIA 1PTDA 1TPC1 1OFEA 3C2EA 1GVQA 5DXYA 3OQEA 1VFTA 4H04A 4XAPA 1DWFM 1W0MA 4EXQA 4MM1A 1GEQA 1AL8A 4JKKA 2J9ZA 1HKMA 2ZWYA 1V3KA 2VCCA 4Q7NA 4L9YA 3UR2A 4GZEA 4BWLC 1XG3A 2I16A 1RJPA 4ICCX 4TVUA 3BURA 1JCJA 3UR8A 2D3LA 1EC7A 5C2GA 5C9ZA 4GIEA 3N9SA 4HNTA 3VNLA 3GH7A 1NWTA 2VKZG 3U3HA 2GQ9A 5E9XA 3SGUA 3VI2A 2CZDA 3CUJA 5DN1A 2HXUA 3TC6A 4S39A 1Y5WA 3AMDA 4UFLA 3BLDA 4C90A 2P50A 1Z41A 3VYLA 3CV7A 1F9CA 1F3XA 4LBSA 4DBWA 1KFKA 4IX0A 1F74A 3E49A 4FA3A 1QNQA 1J01A 1TMQA 3ABOA 4IL2A 1LG2A 4AMAA 1KBKA 2W5FA 4U3CA 4RZ4A 4NAEB 3GW3A 4LCRA 3H21A 3KHJA 1JCXA 3FLUA 2JF6A 3PBVA 4AYSA 1S2AA 3P8IA 4MUPA 3FAXA 3CUZA 2EF9A 1OGGA 5C9RA 4GYKA 1JDAA 3AIVA 3L0KA 2R24A 3S3GA 3GS6A 3IVTA 4HA0A 1EXPA 5H8PA 1K03A 4B9ZA 1KTCA 5C70A 2BHZA 4MWAE 3RMEA 4EPKA 1ZBWA 1R6WA 2A85A 5D02A 3MSYA 4CD7A 4JTGA 2X41A 3CT2A 4UZSA 2OEJA 3DHPA 4HSOA 4GYPC 3E2RA 3POHA 1TIWA 5D9MA 3UFYA 2F84A 2ZZ6A 1E4LA 4MNJA 4W8BA 1KCXA 5A8NA 3RCMA 2EPLX 3FCPA 1TPEA 3BQ6A 4PMQA 4ZO7A 4CU8A 3G5EA 3BC9A 4PEEA 3RN6A 3L0GA 1JCMP 4MUZA 3IAQA 4HMDA 5BXSA 2YL9A 2UWFA 3WEZA 3OJGA 4N6EA 3LPFA 3GTNA 3MO4A 3XIMA 1NOFA 3WUFA 1EHNA 4S1FA 4H41A 1CENA 2GGEA 2QGHA 4E6MA 3BJSA 1ONWA 1W56A 3LGGA 3SM0A 3ABQA 3B9AA 3TNBA 3VGFA 4DYJA 1FUYA 4IQJA 3VIOA 1EEXA 4HOXA 2J75A 2VYOA 3BWWA 1J6OA 1TWDA 1E15A 3RFAA 2QUTA 4ALDA 3YPIA 4LS1A 3V7PA 1SYTA 3PTKA 5LIUX 4ZOAA 4H4IA 2OQLA 3UW6A 4PH6A 3EOSA 2YL5A 3PSWA 4D6IA 2AL2B 1ZRQA 1NFBA 2W67A 1VCGA 1R3QA 1G01A 3TZNA 2DT2A 4S3GA 5JXQA 1C91A 3LLDA 1P1XA 5HMDA 1Q3NA 3VIJA 1C8VA 1SZRA 1SR9A 4Q7IA 4W89A 4CQ9A 4FR1A 3W7OA 2PDYA 1TJPA 1JAEA 3WF0A 4LGXA 4LUSB 3UR7A 2YPIA 1ZAJA 1ZAIA 3NDOA 1BSLA 4OV4A 4AF0A 3LCWA 1FH7A 3MPGA 4GUIA 4PMZA 4MJZA 1TTIA 3ZJ7A 1ICQA 4MDOA 4WGHA 4MKVA 1AJ2A 4PUDA 4UC5A 4TMCA 4OU1A 3UWQA 1N8FA 3GXPA 4XZWA 2MANA 2PDQA 2G37A 2KAUC 3LU2A 4Q8WA 2XZ9A 4RZBA 3QHNA 4MY1A 1SSGA 3DH7A 3LX9A 1QPQA 1KB3A 3I65A 3UWZA 3U8GA 4MKSA 1ZCOA 5DQPA 2Z7GA 4YYCA 2PDFA 3GB6A 2PC8A 3GY1A 4M1RA 4RK8A 1YXYA 1TPVA 1UASA 4FX7A 1PHQA 1VFHA 1C90A 3NEHA 5A95A 3ZIZA 1L0PA 1P0EA 2G3JA 3NPUA 1OGSA 5EPDA 5BRBA 1SFJA 1Q6RA 4JTKA 2V8ZA 2G41A 3W7PA 2BG5A 2NX3A 4C6PA 1XIGA 3TA6A 2VZTA 1JQVA 3EOOA 3BAIA 5E0FA 1TCMA 3A64A 4GZJA 3N73A 4D6CA 2GDVA 3WDIA 5BU9A 5BRPA 2XIMA 5TIMA 2B7OA 3PB2A 4DBEA 1P6BA 4ACZA 2GOKA 2CNCA 4HD5A 2OQYA 2J7BA 4FO4A 5F4XA 3WQWA 1GPWA 1MEIA 1A5AA 1G69A 4B5SA 1NQ6A 3S2LA 5GPRA 3DC8A 3L4VA 4JX4A 1HQTA 2WSPA 4BR1A 3U4FA 3AIRA 3QSRA 2A4AA 1KFWA 1M7OA 3OVGA 1SMDA 3BLLA 4IZGA 2VL4A 3NOYA 2YL8A 4ZGYA 1A5UA 4KEUA 1MZRA 5EMYA 3WNKA 2O56A 2TRSA 2ZC1A 1ISVA 2ON3A 8TIMA 2NWSA 4JTAA 4DYKA 3F7JA 1ESWA 4F2UA 3LD5A 1LYXA 3ZR5A 4DPQA 1LQ2A 4XUGA 4D6GA 1NWUA 3U4AA 4JTJA 1XIEA 2FHCA 4ZQPA 2E7FA 4UTKA 3K4AA 4V28A 1OIMA 1KRCC 3AXIA 2GQ3A 1OX4B 3H2NA 4JKLA 3NQCA 1S1RA 3SUWA 2RDUA 2I56A 4OGZA 2NV9A 3U5YA 2G97A 1H2JA 5A6MA 2XJ7A 5TNVA 3BSHA 2PODA 3LDVA 4GGHA 1VFUA 3QQ1A 3LTSA 1LM1A 3EEZA 1F3EA 3WJSA 3ID7A 4N9BA 5IM51 2VT0A 3CC1A 3DECA 2EHHA 2XYLA 2F8QA 3GC2A 4LCQA 1WV2A 4MNMA 4UTTA 1XD0A 2PZNA 1A5LC 3NEVA 3P84A 1XBXA 3I6EA 3CHFA 4JQ3A 3AUOA 4XBKA 4AVOA 3ZVHA 1TRIA 1FDJA 4EPDC 2TMDA 1XP3A 4YMZA 1DL3A 1CNVA 3ORWA 1S3HA 2WSRA 4AAJA 1ISZA 4D2JA 1TUFA 1OHLA 5K3VA 2BV9A 3AWOA 2DIJA 4LVAA 3LNPA 2E68A 5IHRA 4LRSA 2J8GA 1TWIA 1ZTVA 1UD5A 1EF3A 1GVSA 1F61A 4KGLA 4MWAD 4NF7A 4HMNA 1DEDA 4ZBCA 3W2NA 1LBFA 1A5KC 2OWXA 2YCEA 2CHNA 4LV4A 1TR9A 1J8VA 5JH1A 1VPXA 3OP2A 1U1UA 3I7RA 2E8ZA 2INEA 4GABA 3NCOA 3AQUA 5CZKA 5KMYA 1HKVA 5C2XA 5U4NA 3U7BA 5I07A 5E9AA 1EX5A 1X8FA 3P74A 1TPB1 1W6TA 4C7DA 3H2OA 3O07A 5AYBA 4AHOA 3JZUA 1DXFA 4FXJA 4LUIA 2CXEA 3A23A 4HCDA 1OB0A 4ZQNA 3HM7A 4YTUA 4H7ZA 5HK4A 4A6GA 4YIWA 2Q71A 1AW5A 4PCFA 2R91A 4DO5A 3EWDA 4H9ZA 4K8EA 5T9BG 2INFA 4ZE4A 1TREA 4IP5A 5I3IA 4WVXA 1KWKA 1B54A 2VX4A 3CQJA 3ENLA 3E5PA 1AD4A 3UPWA 3UPMA 3VGEA 1L8PA 3CTLA 3RX2A 5HR7A 1UUQA 1CECA 3URAA 1NEYA 2DZBA 4AB4A 4GNJA 3HG4A 1ICSA 3NZ1A 4C6JA 4MMWA 4HA3A 3OA3A 1TR1A 4A3RA 4F3HA 4Q22A 4CCEA 4NZ5A 3UZZA 3BICA 1RZMA 4PUJA 1DPMA 2EPMX 1GG0A 2WO5A 1RY0A 3POCA 2X0HA 1KD0A 2BOFX 4A3QA 4FPSA 2WPGA 6ENLA 1FQ0A 5A8PA 4LEQA 2QCDA 4LU0A 3HPXA 1UR8A 4UOZA 5CGMA 4H2HA 2WJEA 1OG6A 1YBQB 3HURA 1VFMA 1HJSA 2V3FA 4EAYA 5FJOA 3AS2A 3PUGA 1DTUA 3OYZA 3VMPA 4WX2A 2I7GA 3GU1A 1J10A 2PS2A 3WKZA 3STPA 3F1QA 3WQDA 4JTDA 3P62A 2XG9A 3N2TA 4J40A 1UZDA 2WSKA 5DF0A 3E5BA 3UNDA 3NYZA 3HG3A 3VOIA 1GK8A 7A3HA 3NQMA 1ZALA 3WBAA 2A79A 1TJ0A 3DFHA 2WSYA 1BGAA 1ICPA 2GK1A 1KQYA 2X2GA 1E4MM 1QOQA 3GIQA 3VU2A 4HNCA 3W7DA 4LUYA 1SQ7A 3C6CA 2REQB 5RUBA 1SJDA 3SY5A 1JD9A 2ZUSA 4HHHA 4AEEA 4MB1A 3C4UA 2X1TA 1RLDA 4B5UA 2Y88A 1UUMA 1TV3A 1FCVA 2D2HA 3CPRA 3VC5A 1MQRA 3BK0A 2CLOA 1IQ8A 4O19A 3WNMA 4LYPA 4J27A 3ZT5A 4X9SA 4DJFD 4Z2IA 4GINA 2WOQA 5CKSA 3PZGA 1KW1A 2YOCA 4ATLA 3CXOA 4FK9A 4MGGA 2A7RA 4MJ4A 1QAPA 2NT1A 3TROA 3W1QA 5D30A 3LHYA 1Q85A 1XIFA 3FKRA 3TONA 2FMNA 4DJDD 3TOYA 3UVAA 4XBSA 1G94A 3A4JA 1OF8A 2CW6A 1IZJA 1DOSA 3C0JA 4Y96A 2WZMA 1OBAA 3K2GA 3THCA 1WPCA 4OFCA 1CXFA 1RXOB 2DZPA 3E0WA 4JZ5A 3G77A 3H53A 4L6HA 1OFRA 4O1AA 1TYGA 1JJKA 3E0IA 2BBFA 2NXGA 2J7FA 1X38A 2PDJA 3OEXA 3PY2A 4TQTA 4US5D 4XTIA 4RNFA 2MUCA 2DSUA 4JFUA 3JU2A 1FCQA 1ZGDA 4PUKA 2DW6A 4IIHA 5HPCA 2BY1A 4JQ4A 1T7LA 4ATWA 4DUOA 5EMJA 1O1ZA 2QULA 4GUGA 3GDLA 3WSUA 1E0VA 3R12A 1H7PA 1E9ZB 3TYDA 3PR2A 3S2JA 2X1IA 2P88A 3B9OA 1ITUA 5CJNA 4KWOA 3AS3A 3OG3A 1EJXC 2RHGA 2CKRA 2D0FA 3W6LA 4GBDA 4NNCA 4Y8FA 2PAJA 3S9ZA 4DXKA 1YDYA 1SJBA 1LOSA 2JK2A 1GQNA 4FLRA 3SGZA 1GVEA 4KGJA 3URNA 3UXKA 4BF5A 5GJMA 2NW0A 3W74A 2VUNA 2DQXA 2D2OA 1JF5A 4CEUC 3RPDA 1RVKA 3K46A 2VZOA 1GVYA 4P8VA 5C7VA 1LWHA 4KFNA 4IF2A 4ZB0A 4A05A 4EXAA 2E77A 2FZ9A 2ZTKA 3W2KA 2X16A 4I9AA 2Y89A 1V3MA 3TNOA 2XSBA 3VNYA 1PV8A 1IT7A 2PLMA 4DJDC 1QUMA 3AIEA 3G8EA 1SW7A 4FR6A 1TIMA 4FALA 4S3BA 4ZQMA 4ZOBA 4UBPC 3CIWA 2Q01A 4UXDA 1UJQA 2GJXB 3FHAA 4PE8A 1CLXA 2IW0A 2A5HA 2ISVA 3EB3A 3PZTA 1NOUA 5CG0A 3WELA 3AU6A 4J2PA 4YWSA 3WH5A 2B7NA 2PF8A 1JL8A 2IQTA 5A6KA 1GJUA 4AXKA 1EO7A 1TPUA 4M29A 1A5SA 3GO2A 3THQA 1QI3A 1I2PA 4GE8A 4MB4A 5HULA 1FTXA 3R5EA 4GI4A 4UFJA 1O5KA 4XUYA 2OOGA 1W1B1 4UIOA 4O1BA 4IXHA 2PDLA 3TTOA 4RPQA 2VC5A 5G2HA 3RNDA 4AZBA 4WXZA 2EKGA 2QXWA 4HMCA 3G22A 1J79A 2DZTA 1ZPTA 1UWRA 2VDIA 3VNJA 4XIAA 1LQ0A 3RX4A 3CZGA 2XH2A 3U6WA 3PJXA 3ITLA 1HT6A 4B4FA 1YDNA 2P53A 2VELA 3QPZA 4KRUA 3LPGA 5AYYA 3UYCA 1LORA 3ITOA 2ZA3A 4LC6A 1AA1B 1YXCA 3VUPA 2FGBA 2V63A 4B9YA 4DZHA 4QCEA 2A3CA 3QQWA 3IJ7A 4DJED 1RPKA 3ZXWA 4LQ1A 1XLLA 4XQ6A 1F73A 4LBRA 1BRLB 1YTKA 1SR0A 3GHTA 2HXTA 2Z0IA 3UZ5A 1MYRA 2VENA 3CM4A 3I3BA 1EGMA 4F0SA 1HZYA 3TW9A 1KFJA 3K30A 1I2RA 3B8VA 2HCVA 3L4YA 1K9FA 1RQBA 3GTXA 1W1A1 4RR4A 4LVDA 3EWWA 1B3WA 2GYIA 3C2RA 2JIWA 1A5BA 2ZVRA 3U9IA 3W26A 1TPDA 2DIKA 4ML4A 4XZNX 3G8RA 1CI1A 3P14A 4C6CA 6PTDA 2FHFA 4WIWA 1FHDA 1PZ3A 2V5JA 4AZCB 4DO7A 1EOKA 4RDVA 1NIUA 1WKFA 5G1MA 1Z7AA 4UMCA 5IFPA 2V30A 2PI6A 4A4AA 3QH2A 3FN9A 4H9XA 1RP8A 1XLCA 2XN2A 1LUCB 1X98A 1D2KA 4W4QA 3DKLA 2PDKA 4WDWA 3ARRA 3NIYA 1DP0A 1TUXA 2DZXA 1MRQA 5FF4A 3UP8A 2ZUVA 2J13A 5KETA 1SGJA 3QHMA 2Y1HA 5EFFA 4XAFA 4GYPA 1O60A 4GFSA 3WD2A 2XTKA 2ALDA 4GI6A 5HMEA 4REQB 1UBPC 3C0SA 2XN0A 4G56A 1H63A 1UIPA 2CHRA 3VNKA 3DHFA 3LHVA 1V02A 4NUWA 5M3WA 1ZJBA 3ES7A 4DJEC 5DRIA 1OT1A 4QITA 3M5VA 3S42A 5FOOA 1C29A 2WKJA 5CSRA 1TTQA 1EWEA 4MYAA 1ISXA 1VJZA 4EP8C 3WEOA 3MV11 1WE5A 3VINA 1QWGA 1QI2A 2FPVA 2NLIA 3W2MA 5FJIA 3KOZA 2C8NA 4PUEA 4P61A 1MUMA 1P7TA 1JVNA 2WQDA 3GAYA 1W91A 1N7KA 1H51A 2C0HA 3CPUA 4YPJA 1BYBA 4GZ7A 4GFIA 2C16A 5HAOA 2ZTJA 4KIEA 1J6PA 3CEPA 3B8TA 3QFWA 2X09A 5DANA 1TTPA 4C1NA 4UQCA 8XIMA 3FA5A 3LSBA 1ECQA 1A0EA 2XVNA 1EJTC 3CZLA 4C6KA 2W62A 1AH0A 3VZZA 3CK5A 3M46A 1GKPA 3D46A 3GD6A 1W8GA 4PMXA 5D03A 1R3TA 2F2KA 4S2CA 4MAZA 1W3HA 3NZPA 5AC4A 1UA3A 1WNOA 3W1NA 2QJNA 1RHCA 3HMCA 1T6MA 4W8AA 3FYYA 5CLTA 4PFHA 2OCZA 2BMBA 1NELA 3BH4A 2I17A 2X2YA 1E3ZA 1FKXA 3HGOA 3G0SA 1TJ1A 4HPNA 3AYSA 4BZYA 2OT0A 4V33A 5TF0A 5T9CE 4QXIA 4TO8A 1K77A 4LVFA 3KZSA 3NDYA 1DJGA 3SCRA 1C8XA 1H7NA 3PZ9A 4HZ6A 5I78A 2WNNA 3TAOA 3MWCA 1QI0A 3K8LA 4PGLA 2ZZ3A 1XDLA 1XLFA 4CQ8A 1X1OA 1RCXB 1EC8A 1Q6DA 1I2QA 4W5ZA 4QTGA 3VD9A 3AXXA 4XO7A 1D3GA 3MKCA 3UWVA 4WSJA 2OPJA 3TVAA 4E5TA 3P82A 5HWMA 4HYWA 6XIAA 2QT3A 2WVVB 3UA3A 4E4UA 1U1JA 2DUXA 3UG4A 4O16A 3L21A 1VLIA 4WK9A 4FF7A 4NU7A 2YSWA 3ZMRA 3ARVA 3S5ZA 1Y8BA 2WMIA 3DXIA 1HXJA 1KV5A 5KZEA 1YDVA 1TPH1 4IQDA 1UOZA 2YX0A 2NX9A 3JW7A 2PGFA 1OZMA 2Z4GA 1AVAA 3AXHA 2QEZA 3KW3A 2NQ5A 4UTUA 4KWVA 2OKOA 4Q32A 2CITA 3SR7A 4PULA 3DYOA 4W85A 4C7GA 2BLEA 1G4TA 1LWIA 3TZFA 2DJXA 1XRTA 4HKPA 4DBDA 1OFQA 5BXPA 5JBEA 5AKQA 5BYWA 4XZIA 4ERAA 1VCFA 2GFTA 1S3TC 2XWEA 4FHAA 1E55A 3PUOA 1JCLA 1DTNA 1EYWA 1FRBA 1OYCA 2XWDA 1HO4A 2IKHA 1GOOA 1Q6GA 1O1HA 4JN6A 1XKYA 3W88A 1I4NA 3K1DA 3QVQA 3BTNA 3HOJA 1LP6A 3VD3A 1EFZA 2W27A 2FGZA 3UGRA 2WBKA 3UU0A 4L4PA 3T1GA 4AW7A 2Y5JA 5ECVA 2ZICA 3PVFA 4TUFA 3VCNA 1LRNA 4DAIA 3WLSA 1ZFJA 4EAMA 3R8RA 2HK0A 1XSKA 4GIAA 3W85A 2VWTA 2Z7KA 3EDJA 3KXQA 5BW6A 4E4FA 2H6RA 3GNDA 3VILA 4MIMA 3N9KA 2XH0A 3V1HA 1Q8JA 1AW1A 3PBYA 3REQB 3BJTA 4QQ3A 2IXUA 4JFTA 3KBWA 3RO6A 4KEMA 4UWMA 2Y62A 4QBXA 1KRMA 2YDAA 3INPA 2XIJA 4J5NA 1TA3B 1J5SA 5A6TC 3NWRA 5A8OA 4DLFA 3AUJA 3UXAA 2XDFA 1MDLA 1G9HA 1UW9A 2DH2A 5D38A 3MDWA 4AC1X 4JIRA 1EWDA 4NAFB 1XBVA 2ISFA 1V6WA 3GZAA 2C79A 1U30A 3NQEA 1US0A 3C56A 5CSSA 3UG8A 5IXEA 2P5NA 4KMQA 4PZVA 3WD4A 4OOUA 1ADSA 1UWSA 2ISWA 2W66A 1KRAC 3HPAA 3Q65A 3FV9A 3N04A 3GUGA 1JGIA 1F3WA 4CKQA 2HBVA 3UZWA 1UHVA 2DIEA 3GXMA 3QV6A 3K5XA 3LS9A 3W1RA 3B0XA 4ATDA 4FEZA 3R8HA 3AHXA 2O9PA 4GWEA 2QS8A 3TCSA 2PBOA 3W1TA 3SQMA 1KM2A 3ZM8A 2J9YA 3OHIA 4OVXA 1GT8A 1F4HA 1H49A 3T0TA 1PKNA 4HTBA 1W2VA 2W0UA 3OBEA 5D04C 2PD9A 5JBFA 3AYVA 1XFCA 4C6MA 1WXJA 2MNRA 4HNVA 2CWNA 4XAZA 1MNSA 4OT7A 3QC0A 2YIHA 4B5TA 3ITGA 2JFEX 4HZ8A 4XZ9A 4UTMA 1J9YA 4O8AA 1XRFA 4LF2A 3H22A 4IMDA 2QDEA 3PPHA 2Y24A 4S23A 1HP4A 4DY1A 1HL2A 4EIVA 5LGXA 1ME8A 2Z6JA 3FA4A 3MVTA 4HN4A 4N0RA 4EANA 4EF9A 3E38A 4CEXC 1W9XA 3LLXA 3O6AA 4EOUA 3CH9A 1I0DA 2VC6A 3L5AA 1PSCA 4DNMA 2GDUA 1R3WA 2CZ5A 4LW7A 2Z1VA 4HGXA 4IMEA 3V0UA 3V75A 2XM2A 2FTYA 1XYMA 3EB2A 4JL2A 4WHBA 2PP1A 3R94A 1R9XA 3AU2A 4I5UA 3QFEA 2R14A 1WZKA 5AVNA 3KBMA 4IXXA 1CGTA 1HKKA 3M4HA 2BWGA 1Q65A 2Y8KA 4Z1AA 3GBEA 5F2IA 4WUIA 3BG5A 1K9TA 1EUAA 1XM3A 2ALRA 4YLWA 5CH9A 4X2RA 1N8IA 1EZ2A 1TVLA 1QVBA 4ZQRA 2HVOA 4G6CA 1VBJA 3TR9A 5HBFA 4HOZA 1RPXA 2Z1WA 2G4FA 3WD0A 1DXIA 4DWSD 4FLSA 1P43A 4GY7A 1XFBA 4RW5A 1CPUA 1AK5A 3HQPA 5E93A 1C8YA 4C6FA 4PR4A 2PWEA 2I57A 1SW3A 5CC5A 1OYAA 4RUBA 9XIMA 1IXQA 4V1YA 4ZR8A 2ZE0A 2D0HA 1CTNA 1W5QA 2ZX7A 1JR1A 1UZHA 1Q6EA 2F6KA 1TWZA 2I5QA 5DMNA 1QW7A 1WKYA 3SGGA 1NARA 2E6FA 4JHMA 1OCNA 1ONRA 2PMQA 3VZYA 5FJUA 5D8ZA 1BKSA 3RK8A 1E43A 5CJ5A 2CBJA 4R3UA 2AAMA 3VNMA 2ABAA 4D1IA 3GDMA 1XLEA 1XRSA 1UD6A 1XHGA 1PYFA 2DVUA 2ZOXA 2V3GA 1X6NA 5AYXA 1XYFA 3AS1A 5LXXA 2A0NA 2FPYA 2HJPA 1L6SA 1QDSA 5CC6A 2PE4A 3GU2A 5BXRA 5ABFA 3QC3A 3U7VA 2J6XA 2Q09A 4O1CA 1KCZA 4PODA 1B2YA 4KCTA 5LNSA 1FDZA 4V27A 1HVXA 4NP7A 3VAVA 5I3DA 1SFLA 3F2CA 4Y9NA 2OG9A 3N17A 1X97A 2ZC8A 4IIBA 3S6OA 4PRWA 3FGCA 3C3NA 3W86A 3KTCA 2JIEA 4WR3A 1CW2A 4BS0A 2QNEA 3I68A 1JQXA 1IXOA 5I03A 1J11A 3GVRA 2NT0A 4BKNA 4A8NA 1PVNA 2Z1SA 1ZENA 1XWYA 4NI8A 5CC3A 4W7UA 4BQ3A 2IXVA 3KFTA 1YQ2A 3JRKA 3S46A 3W73A 3CAQA 1EJRC 2PTXA 1JNEA 3UNTA 4DZ5A 4I3GA 1LBLA 5D33A 3QEZA 3Q94A 4J2MA 1W3IA 4DJFA 3SY8A 2PTYA 3FEMA 3HTWA 1QNSA 1AQHA 3CZKA 7TAAA 4WY0B 1XS2A 1DIKA 4DZAA 4IT1A 4JIHA 4MB3A 4UOJA 4MYXA 4DX3A 2WC7A 1WKDA 5CBBA 4M3PA 4KQNA 1YW1A 4DJDA 1EQPA 3NQBA 4NZ4A 2J4GA 1GWJA 4Z1DA 2ZXDA