3H23A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h23A00
4PZVA 3TYCA 4CCZA 4S3AA 4DAFA 3BOLA 2H9AB 1Q85A 2YCJA 4S23A 1Q8AA 3H22A 2DZAA 2Y0FA 4S3CA 4MWAA 3TYDA 2VEGA 4DJDA 5JQ9A 4S3FA 4MWAE 3TZNA 1EYEA 4G9PA 4DB7A 4NILA 3TR9A 4DJFA 3TYZA 4S3BA 4DJEA 3H24A 4NHVA 3BOFA 1TX2A 4NL1A 3H21A 3H2FA 4O1FA 4D9PA 1AD1A 3TYAA 1AJ0A 3MCMA 2DQWA 2YCKX 3TYUA 2BMBA 3H2NA 4C1NA 3NOYA 1Q7QA 3V5OA 4O0QA 4S39A 3H26A 4O1EA 3H2CA 1TWWA 3TYEA 4MWAD 3H2AA 2YCLA 4MWAB 4DJDD 2VEFA 1Q7ZA 4D8ZA 2YCIX 3TYBA 4D8AA 2Y5SA 4HB7A 4DJFD 3TZFA 1Q7MA 2YCLB 4DJED 3MCOA 2OGYA 1AJ2A 4DAIA 1AD4A 1TWZA 3MCNA 4S3EA 3K13A 3H2OA 4MWAC 4DJDC 4C1NB 2DZBA 4S3DA 2Y5JA 1TWSA 3H2MA 1F6YA 4NIRA 4S38A 4DJFC 1Q8JA 1TX0A 2E7FA 2H9AA 4DJEC 3H23A 1AJZA 2VP8A 3H2EA
chains in the Genus database with same CATH superfamily
3GKAA 4IJCA 2QF8A 4NQ1A 4MJ4A 4JDBA 2E6FA 1J2BA 5FL0A 5TQLA 5DBTA 3L5AA 2SFPA 3WK0A 2W9MA 2DVXA 3SJ3A 4MOZA 4NZ3A 2KX9A 4Q8TA 3LLDA 4LYPA 5LIYX 1JXKA 3VIMA 4O1FA 3DGRA 4TV6A 3RX4A 4Z2IA 3BJSA 4B4FA 1AJ0A 2DQWA 4OVXA 3M0MA 4M51A 1XRFA 1AQHA 4E4UA 4PMVA 3BLFA 3LLFA 1N8WA 4YNGA 5J5DA 2B7OA 2PDMA 3MP4A 1S2AA 3NO1A 2OSWA 1WXJA 3GAKA 3O0FA 1AH0A 3THQA 5GNXA 1RUSA 2JKEA 2G41A 4XBJA 1W5OA 3WNMA 1LJYA 1XICA 2J77A 4YCPA 3OYXA 4OQVA 4HOXA 4L65A 2DQXA 4P7OA 2WJDA 1CPUA 1IR2A 2GJLA 3WQOA 4FXFA 5A6MA 1JJKA 4S38A 3N19B 2IKGA 1E9IA 1NARA 2OYKA 3JU2A 2BVYA 4PZVA 2NV2A 4FIRA 1DE6A 3H4WA 2E5DA 3SY5A 1EHAA 1TJ1A 3BGAA 3B8SA 4PMYA 3FKRA 1ZTVA 1I0DA 3AIRA 3VXGA 4YTRA 1RAKA 1LLOA 1QO2A 6TAAA 1EDGA 4DLMA 2FPTA 8TIMA 1CYGA 2G96A 3M5VA 4C7FA 3OTRA 4WD0A 3V5FA 1QVBA 4GZEA 1Y5XA 4KWSA 4LEQA 4HNTA 2VRJA 3A22A 3DG6A 3GIQA 3PAJA 3K2GA 3WEOA 4LBRA 2YL8A 4N4QA 5BXSA 4LX4A 3W23A 1YRRA 4MWAD 2VX4A 5FEWA 1VFMA 1XFBA 1J0JA 4HSOA 4QGCA 3CL6A 1XG4A 2ZZ6A 3MVIA 4EF8A 3SY1A 1E5JA 2ZZ5A 4J3TA 1D3HA 2QUTA 5LYRA 1TA3B 5GPRA 2YZRA 1BTCA 3BMVA 4DBUA 4G1KA 1VBRA 4QNWA 1SO4A 1D8WA 1W3JA 1R9XA 2FPYA 4CUCA 4K1WA 3ZR5A 4HPGA 4ZOEA 4TXEA 3H2MA 4LF2A 1Y8BA 4NNBA 4JTSA 1XYMA 3TEVA 3DFSA 5HAOA 3THAA 2V2HA 1B0IA 3QV7A 1H4PA 5JMUA 4I9JA 3LPPA 2IUZA 1WNOA 4RNJA 1AK5A 2PCQA 2D69A 1C3FA 2DT0A 1LOLA 4PSRA 2ZTJA 4QG8A 5CZKA 4UZSA 2WQDA 4FX6M 3CYJA 1MW3A 4WKHA 1HP4A 2XM1A 3SFKA 1L6FA 2VFGA 3ZSSA 3U8GA 1PCKA 2O4QA 3U48A 1E6SM 4J3SA 4XTIA 1KLZA 2ZIDA 1ZPTA 1UQYA 4ATWA 3E1F1 4UWMA 1LL7A 3M9YA 7A3HA 3RCNA 3TV8A 4KEZA 1IGWA 1TZZA 2FIQA 3EWZA 2AKMA 2AL2A 1JQVA 1FA2A 3NPWA 2PWFA 4J35A 4GQBA 4LS1A 2NX3A 4XSMA 3W6LA 1PX8A 3SRKA 3VNYA 4FNRA 3ATZA 2YCIX 3LX9A 4IX0A 3ARZA 1C92A 2VO5A 4QAWA 2WSQA 1JDEA 3G8RA 3WDHA 4C6MA 1RJRA 3UJFA 3EOSA 3NIYA 1F4AA 1TVNA 4C6OA 5JUVA 2WMJA 1PIFA 1XLBA 2YA2A 4DF0A 1L0PA 3IUHA 4EXBA 3VMOA 1A0CA 3WLOA 4YWSA 4MUZA 4DYEA 1M7OA 3FGCB 3C2FA 2XWEA 3WQDA 3S1XA 1U30A 3N6HA 2PDIA 4OU1A 1DWAM 2QDGA 3BLLA 3QMRA 3ABZA 3ZJ7A 1EJTC 4L9XA 1IIGA 1XKYA 1RPKA 1U1UA 1MNSA 1W8GA 3LRLA 1LRNA 1V51A 2NV9A 2WVVA 4WLCA 4D6DA 4FNUA 4IMAA 4AEOA 3REQB 2O9TA 1Q7QA 4M1BA 4UXDA 1E6NA 2PI6A 4WX2A 4JTTA 1LQAA 5AC4A 4MGGA 4Y8EA 2GDUA 4GNJA 3LCGA 7PTDA 1HFBA 3EBVA 4IZGA 4V28A 3DGBA 2ESCA 4ADUA 1QUMA 3ARSA 3HFYA 2V2DA 5JVLA 3CPRA 1J2WA 3TN3A 4FX7A 1JDAA 5CLWA 3UCCA 4Z2HA 3LTSA 3R10A 3NO3A 1C93A 3TC7A 5XIAA 2NQZA 3EB2A 1DKWA 4UUIA 2VD8A 8XIAA 2FB2A 1OZMA 4IFRA 3LN3A 2D2HA 3DH7A 4W8AA 1GT8A 4RE4A 1ZP4A 2V5LA 2PODA 2W79A 1UR3M 4NJIA 1B3YA 4H6QA 2QLYA 1YXCA 4QQUA 1ZJIA 2EG6A 3KS6A 1A4LA 3WNKA 4GQQA 3IV8A 2J25A 2NT0A 1UD6A 2QAPA 4PUDA 2CBJA 3NM3A 4W8LA 2CBUA 4PMDA 1ICQA 1MEWA 3PUDA 1X6NA 1V3JA 1VBJA 3W2MA 2YA0A 2YFNA 1G69A 2QIWA 2TAAA 5CC3A 3SCPA 5BWAA 3VIOA 4LH8A 2WBGA 4CQAA 1JPDX 4Z2GA 2PWUA 1QHPA 2UWFA 1IIHA 1S5NA 3QMSA 5I7GA 3L9CA 1RQHA 4GFIA 4CD8A 1QNPA 3UWEA 1FHLA 1QAPA 2W91A 3VNKA 4US5D 1TCMA 4B5UA 4HQVA 4R9OA 3L65A 5DXXA 4X2PA 4Q6XA 3PPFA 3IARA 3CL8A 3UR5A 4CVUA 3T8LA 1UBPC 1SZFA 2BGNE 3C3NA 4WJEA 1A50A 5D2VA 5U7SA 3UWZA 3PHAA 1F9CA 3GH4A 3QV8A 1QRQA 1XLGA 2VKZG 1SFTA 4G7FA 5LHEA 3M0JA 4H9ZA 3EWDA 2VEKA 1GTEA 1GHRA 3BANA 3NQBA 1PS9A 1XBXA 7REQA 3C3UA 3H12A 2IQDA 1RR2A 1KR1A 3B0UX 2G3NA 2H90A 4X61A 8CGTA 2C1GA 5H8UA 1LL6A 4GFSA 1GQNA 1UG6A 4HK7A 4GUFA 1VFLA 4HCHA 2PDPA 3LMYA 4D6JA 4M81A 5JBFA 3HZ3A 3QMTA 3DDMA 5I0DA 2CLLA 3WFAA 1OC7A 4ACYA 2RJHA 3CC1A 5HA7A 1XFCA 1AFSA 4JTFA 4MMWA 1OABA 2E3ZA 1FH7A 5CKSA 2YXGA 4MM1A 1N55A 4QROA 3W1PA 2XZ7A 2QJHA 4YTUA 2X7WA 4REQA 3RK8A 2CLEA 5C9UA 2R24A 4CLMA 5T91A 4NSBA 2DP3A 1U2YA 2VEMA 1YYAA 3UT0A 3L4UA 3UWUA 3TWAA 4DUXA 4RXFA 4W5UA 1XLAA 1CXKA 4MJMA 3N17A 2BS9A 3NQAA 1QPRA 4AZIA 3A23A 3WLTA 2INEA 3W1AA 3M0VA 3TDFA 3C2EA 3NQ6A 5AVNA 3OA3A 4ORIA 2E09A 4HHMA 2Y63A 4ZFMA 1RD5A 3R8GA 3V7PA 1A0DA 4AC1X 3HJZA 4C7GA 3LZ3A 5K4ZA 1G5AA 3R79A 4JPGA 4GX8A 1Z9AA 4W87A 2A3BA 5H91A 4AVOA 3CTLA 4MDPA 3EXTA 2ZUNA 3EDDA 1ZNNA 4M8UA 4DZIA 5LNVA 2J8GA 1TPDA 2CKRA 3E0WA 3ES7A 3G1DA 4RZ5A 1S2TA 2XH2A 1QI3A 2QKFA 1WUEA 1E6RA 3ARQA 4K39A 2FDMA 2PDFA 2WVUA 5AC6A 1C29A 4AF0B 3FVMA 4RK8A 2BV9A 3LBOA 1KBLA 2EJ1A 4NAFB 4AMCA 1JZ6A 1M65A 3NQVA 2XGZA 2OWCA 2Y7DA 2WVSA 4DJDD 1PKMA 5DMMA 1UWAA 3W84A 1ITXA 5ABFA 1VRXA 9RUBA 1XH0A 3G1YA 4PE8A 1UZHA 3GNXA 2NQLA 4QJ3B 3SSJA 3TZFA 4HZ8A 1P6BA 3UY8A 3G0SA 1SGJA 2I5IA 1XPGA 4JAWA 4DYKA 3VKBA 1MZRA 1XLHA 3RGTA 3K8KA 2W63A 3IGXA 3WNOA 1E40A 1B3XA 2OGJA 3EA3A 1OIMA 3UG4A 1GQJA 3G2GA 3EXRA 4I5RA 1XM3A 3U7BA 3WQWA 4QHRA 2X8RA 1L6WA 1GQLA 3OGSA 5CZJA 3FYYA 4JIIX 3BARA 4I9AA 2J47A 3TK7A 3TONA 1NP0A 3MB9A 3WQFA 1GYLA 3LCHA 3UZJA 1IWBA 2ZUMA 3N2MA 2OODA 4IPJA 4HK6A 3WZ0E 2HVNA 4Q8OA 2F9RA 2GVGA 2G8ZA 4C6CA 4Q7NA 4K36A 3WF0A 1NWUA 4NVTA 3IIXA 1XISA 1R2SA 3EAUA 4D6CA 3EX6A 3UPBA 1WKDA 1RALA 2WM0A 2VEFA 4BF7A 2CWXA 3A4AA 3HGOA 1TPUA 3OZPA 1VS1A 3Q67A 3CIXA 2FGLA 3MSYA 3Q2DA 3R0DA 3EWCA 5C2XA 1NQ6A 5I24A 4IJRA 1UH4A 3BMWA 4Y7EA 1LRQA 4GOAA 3WFLA 2Z2AA 4DAIA 2AMGA 1OM0A 4F3HA 4Q33A 3M5YA 5HQLA 3IK2A 4ILSA 1T5AA 5MKGB 4TUFA 3TXZA 4EP8C 3UVIA 1DWHM 3ZLGA 1C7SA 1W3TA 2CCRA 3C5QA 3P80A 4W93A 4I5UA 2I16A 5LGXA 1KLYA 2GUUA 1VBUA 3LPOA 3ZR6A 5XIMA 1AVAA 2VFFA 3ZYZA 3AU6A 2E8YA 3KL3A 4S3FA 1XXXA 4DQWA 1DJNA 2QGYA 2XN0A 2IPWA 1XL9A 1I60A 2J7HA 2H8ZA 3CLMA 4PRRA 4DY1A 4XK2A 3LCFA 2YL6A 1XH2A 2GDVA 1SZEA 2PDQA 3WDPP 1RV8A 3THUA 4AZHA 2CBIA 1MQRA 4YVPA 4D6IA 1B57A 2VGGA 3PZGA 4J3WA 5HNUA 1UWIA 3BQ5A 1BGGA 1XSIA 4AWSA 1H63A 1JCXA 2LLEA 3BE7A 1SMDA 4EACA 4Z1BA 4AXNA 2J9XA 3F2DA 1LCOA 4KWWA 1S1PA 4B5XA 2ODOA 2E1WA 2XIQA 3TJIA 1WV2A 2WB5A 2GVJA 1EP2A 2BSLA 3OHMB 4W84A 3EPOA 1H2JA 1E71M 3U3HA 3NAVA 3LU2A 5I78A 2NX1A 3W7EA 1F6YA 5AHEA 4ROPA 1CWYA 1RXOB 3PVFA 2NSOA 4A8RA 1XBYA 3GFYA 4L6DA 1CIUA 1JUBA 3HURA 3VKDA 3LYEA 3EPMA 3GXPA 3NDYA 3NQCA 2TODA 3CV2A 1EUAA 3MUIA 1PZ3A 4I90A 3NDZA 3UGVA 3E0LA 2IQTA 2D23A 3BWWA 2EKGA 2ALDA 2VEPA 2GQ9A 3VCNA 1XIGA 4AZCA 1FWCC 1MW1A 4LVBA 5AB3A 2HQAA 3EX3A 2Z00A 4NF7A 2HVOA 4YHEA 1OQFA 3UYIA 3BK0A 3CHFA 2ISSA 2WJZA 2WZTA 3QZ6A 4UR9A 4OECA 3DBPA 3TLLA 4IP4A 1AZ1A 4KGLA 4PMXA 4W7UA 3LV6A 3PSVA 3DFOA 1MYRA 5T9CE 1HJSA 2DJLA 2YYTA 3GKFA 4AYGA 2XSXA 3T2PA 2GLKA 3TJ4A 5K9XA 1I2RA 4DJFD 5ABEA 4XUYA 4L1WA 1GGOA 3QPYA 2A0NA 3SCTA 3UXIA 1VLWA 3NNTA 3OW1A 3TOPA 3WQ8A 1K8YA 1BSLA 4U28A 5A6KA 2O7QA 2VI0A 3FVDA 2DH2A 3TJLA 1UPMB 3TTSA 3BZJA 2PWVA 5AHNA 3QFEA 1KCKA 4WDUA 2P50A 3WJSA 3A3HA 5BRPA 4O19A 4EE9A 1OZQA 3WD0A 2WQPA 4S23A 1H3GA 1S39A 4V2XA 1PV8A 3HV8A 2RDWA 3FV9A 1JF6A 4MWAE 3EB4A 3WLRA 3GDTA 3LDVA 2OLHA 4H9MA 1PWLA 3BV4A 4IMCA 3FEQA 2Z28A 2V3FA 4I7WA 4HYVA 3CUFA 1FWAC 1HT6A 1ZBWA 3WDRA 4LF1A 1R5YA 4H7CA 4C1NA 3AHYA 3FSTA 3GR4A 4LW7A 4FOUA 4E2BA 1D7KA 3JW7A 4ZXLA 4AHQA 1FXQA 3OZOA 3C0SA 1NH6A 5TIMA 4DNHA 1J4EA 3A12A 2PS2A 4DJED 4ZCWA 2CKSA 3M4HA 1UMLA 4XKYA 3VM5A 1LT7A 1AH3A 2TMDA 5CJNA 1DJIA 1I45A 4IIEA 4JIPA 3NXFA 1CDGA 2VCBA 1S5MA 5JIWA 4D71A 5ECVA 1E0XA 3N6JA 3FKKA 5DCBA 1XX1A 3E49A 3WQ6A 4O1DA 3VKJA 3ZSTA 2WHJA 5RUBA 3MBFA 3ICJA 4GYJA 3LTPA 3Q58A 4H41A 1TQXA 3GU1A 1EOMA 3B9DA 1DJQA 1SMAA 3HMJG 3EXSA 3O06A 5AC7A 1HJUA 2L5HA 4W9TA 4PCFA 4GY0A 1FFRA 1ZBCA 5FESA 3DFHA 1E4IA 1B3OA 3KRUA 3RITA 2FHBA 3LXBA 2R14A 2ACQA 2WXDM 2FLIA 4UQAA 1Z8AA 2XIMA 4YXGA 1EGMA 4Z2KA 5H8PA 3ZMRA 1YW1A 5D38A 3TFCA 3W1UA 3G1VA 3TSMA 2A3AA 3VGGA 3NUKA 4QLLA 3LHTA 4DBDA 4AVNA 5ECUA 1Q6QA 1PHQA 1FWWA 4JQ1A 5FEPA 3QN3A 3POCA 2UY2A 2RGLA 1ZP3A 4PCNA 1G0CA 3PN8A 2YGYA 5E0KA 1F2JA 2WKJA 4YVVA 2BY2A 4EIVA 1E3ZA 1BAGA 3A6OA 1PVNA 3VZZA 1Y65A 1CLKA 3UERA 4YTTA 2VXNA 3EWYA 1VKFA 3UA3A 4CQBA 4UR8A 3KCLA 4RL3A 4J27A 3HGJA 3ABQA 4XO7A 5HWNA 1WPCA 4HP5A 1GVOA 4DWSA 2AAMA 3ABRA 4LY4A 3IIVA 3W1RA 2X05A 1BWKA 4ZXOA 2ZZ1A 5DO8A 3W7DA 3B4YA 3PBUA 1W2VA 2CLOA 1PUDA 5FF7A 3WD4A 2Y7EA 3MBDA 4Q4SA 4O4WA 3BJTA 4FXJA 3DECA 1JPHA 3PK7A 5DLCA 1TWIA 1SO5A 3GTFA 5I77A 1CGXA 4EAMA 2GSHA 1UA3A 2GQAA 1B4KA 3ZVHB 4Q4PA 1TPB1 2XWDA 3KBSA 4PBGA 4YL2A 2WWCA 4GXPA 4S39A 1IXQA 3MWCA 3KCOA 1IEWA 4QISA 4GBUA 2E8ZA 3E3HA 2GOUA 4AZ7A 3NM1A 5K2ZA 4DXXA 2GUYA 2FVKA 4Y6GA 2WMFA 3VIHA 3VX1A 4WCJA 3F4WA 3RJXA 4MUPA 1ZSXA 1TWZA 2QMJA 3VDAA 4AG0A 2DDXA 2EKCA 2QDEA 4MPKA 4GIAA 1K7EA 1TPH1 4FXSA 1AQ0A 1XS2A 3AYRA 4JL1A 5IDIA 1E72M 3M1ZA 3MMDA 2OEMA 4JXCA 3E12A 4N9CA 3GBEA 3HG2A 4HD5A 1W1TA 2C19A 4MPQA 4ZSTA 2DZXA 2ABBA 2PAJA 2DW7A 3SRDA 2NQHA 2YB1A 4ACZB 4B92A 1WZLA 3M7SA 1WZAA 3G77A 3MUZ1 2QR6A 1KCZA 1QOQA 1LG2A 2BDQA 2QAFA 1O94A 2ZX7A 1UHVA 2Y88A 5A8OA 5BXTA 2D3NA 4GUGA 3LA4A 4PCPA 4BEQA 3SCWA 4KS0A 4HNUA 2J13A 4ZB5A 1IEXA 4JNMA 1US0A 1XGEA 5I09A 2INFA 3G1SA 4LAKA 3R13A 1ME9A 4AZ5A 2TPSA 1TV5A 2F38A 1O68A 3T4WA 1JZ5A 3CHEA 2GL5A 1JIBA 3R11A 5IOBA 1JFXA 1UOKA 4HVXA 3A5FA 1LDCA 4JTIA 4GYKA 1E70M 1WXZA 4ZODA 4US6A 3BG5A 3VM7A 2XPKA 1JUEA 4MLRA 3BVJA 1E9YB 2HROA 3HF3A 5LIWX 4EPKA 3FJNA 4RW3A 2JBMA 4UOQA 4FR6A 3B05A 2P10A 2DZBA 2JGQA 4IP7A 3PTQA 1SPQA 3LCLA 5FF2A 3TROA 1IR1A 4M6QA 2ZRUA 1Q6EA 1E1CA 2OCZA 2XIJA 1S2UA 5LGZA 3N6QA 4A8LA 4PMJA 3SSZA 2J78A 2EXOA 5LKYA 1XIHA 3C52A 4G5DA 4NJGA 3VNZA 3H8AA 2V38A 4EPDC 1BEUA 1PHWA 3N18A 2OSXA 1B3ZA 3L0KA 2JE8A 4LTSA 3WQ4A 2NV1A 1HNYA 1N7KA 4NZ4A 1E73M 3QBUA 4GVFA 3GHRA 4UTTA 4Q4MA 3WLSA 3W9ZA 5I3FA 3YPIA 1HF6A 3T40A 1TFVA 4WGHA 1R7AA 3PPCA 3N4EA 4NHVA 3GC2A 5JBDA 4C1LA 1OG6A 1TR9A 2PP3A 3SIZA 3GTXA 4QG6A 3TNBA 3R58A 1P43A 4S2CA 2INZA 1BVZA 1RD6A 3LK6A 1TUFA 3S2CA 1FP9A 3W76A 1PBGA 1RCOB 3P8JA 2ZXBA 2WZMA 2OELA 4PRWA 2FGBA 3RN6A 3EOLA 1JNEA 4OBRA 4HGXA 1AODA 2ACSA 2X30A 4FLQA 1W9DM 5A3HA 3ZWTA 4GYFA 4IG2A 4PTWA 4J2MA 7TIMA 5A1AA 4H01A 4HU4A 3GXDA 3NL5A 3Q37A 3S3GA 3W0KA 2WHMA 5BZAA 3BDKA 1R85A 3UYCA 4R9XA 3I3DA 1C7TA 2Q6ZA 3E2SA 3S5SA 1LBFA 2XH4A 3VI2A 3WLKX 1FKWA 2HZGA 2JEQA 1IZJA 3AUOA 2AKZA 3PUGA 2G3JA 2XM2A 1OCBA 2FH6A 3UR2A 3A5VA 4KIEA 1AL8A 1UIPA 1R3WA 3H7VA 1UD8A 3DC0A 3GSMA 2GGGA 1WDQA 3QHNA 1XRVA 3UEQA 3C2RA 4H8UA 4K8EA 1W1VA 3FA4A 3AOFA 2HPIA 4K68A 4HN8A 2DIJA 4B5WA 2IS7A 2XU2A 3F5KA 3W86A 4EXQA 4O1BA 1Z3NA 1DTNA 4JNYA 4JX5A 1O5XA 2CZEA 5EGRA 3PG9A 3AXHA 4MIMA 2DH3A 1HG3A 3LQGA 2FTWA 4QEEA 2VYOA 2HWGA 3W1TA 1EQPA 2HISA 1G1YA 3UJRA 4KGJA 2D0HA 5F2MA 3H2OA 1UASA 3MHFA 1EBHA 3NQ2A 3MSGA 1HKKA 3TQ0A 2Y8KA 3PS7A 4OBTA 3U2EA 3VKCA 1EPXA 1EYWA 2NXIA 2JK2A 3W6MA 3WH5A 1ZY9A 1DIDA 2D73A 3PB2A 5I23A 1T99A 1CCWB 1VEMA 4A35A 5GNYA 4JICA 4A2RA 1BXCA 1ZENA 1EKOA 2PDXA 3TYDA 1OFRA 5CLTA 4AYSA 3GE7A 2QGHA 5BU9A 1W17A 1ML1A 2EJAA 4W88A 2CZ5A 1Q6DA 7REQB 2CZVA 3WLHA 4HYWA 3NYDA 4A05A 1JD9A 2CXGA 3IJ7A 1MRAA 4X9SA 4L9ZA 2E28A 3O63A 3IAPA 3FA3A 3L5LA 5KSWA 3CZKA 4ZOCA 1KCXA 4MWAB 3N34A 1C8VA 1S2CA 2DFAA 3IIZA 3DXIA 3E0IA 4R34A 2I5QA 1YBQB 1KBBA 3U6WA 5HJLA 2QPXA 1TTJA 3FX4A 3UR7A 1GVIA 2D0FA 3WMLA 2ZCGA 2GVLA 3ME3A 4HPJA 1RY0A 2G4FA 4NKCA 5XINA 4E0CA 3AS3A 4DWSC 3B3DA 5EYWA 4GCXA 4DBEA 4A3HA 1UKPA 3G18A 4FNSA 4IQLA 3S2JA 2HTMA 3GWQA 4ZL1A 1XIEA 4J1OA 4E6MA 4MYAA 3WH8A 1W3LA 3DIPA 3C86A 3N3TA 2V2CA 3LHWA 1MW0A 5CBIA 3W3OA 3GLCA 3LMZA 1GEHA 2TSYA 4MFDA 1G4TA 4O15A 3GNPA 5D03A 3CHDA 3J7HA 4IPNB 1PSCA 2CLPA 4FSAA 2QCFA 3AIWA 4JTEA 4LAZA 1KM2A 1E9LA 3KOYA 3NVDA 5I2UA 4X60A 3B8WA 2E40A 1XF0A 3GU2A 1IEQA 1K02A 1UH2A 4YS1A 5D4YA 1OX5A 3RMJA 5A8NA 3KL0A 1H60A 5BRQA 1HL8A 3VABA 3G1FA 1NSJA 4WSJA 3PZIA 3BUVA 2DSKA 2WC4A 3RR1A 1CW2A 4DM2A 4F2UA 1GOIA 4QSHA 4O57A 3FA5A 1RP9A 1WE5A 4AMAA 1ITCA 4JN7A 1B3VA 3WLMA 3FNDA 3MSRA 1BTMA 3E0FA 3VD4A 3SGUA 3QTPA 4BF5A 2BVWA 1R46A 3IANA 4XO6A 4ZO6A 4QJ4B 2CLKA 3L4VA 1IEIA 1UP0A 1JAEA 1LUCB 3RAOA 5C55A 5BXPA 1G4PA 3EX1A 3VDBA 2GGHA 1OY0A 1NJJA 1OFQA 5D2XA 3W37A 3RRXA 3WIJA 5DANA 1B4EA 3A47A 3KVJA 4H04A 1Q6OA 4LAMA 2XN2A 4LYQA 4GI9A 4A3UA 4P8WA 2E0PA 1BQCA 2WSYA 3H2EA 4UZUA 1WKEA 1Z7AA 3PWIA 2BG5A 1TVPA 1VYPX 5BYWA 1GOWA 1V6UA 4S3GA 4JTUA 3TOYA 4HSNA 1SZRA 1O4UA 3FSUA 4B5VA 1XCFA 1CB2A 1CLXA 1A5LC 3VGEA 4F40A 2E5BA 3MS8A 3ERPA 2XUCA 2NQJA 3KLLA 1L2UA 1WBHA 3AZSA 3RPDA 4ECLA 3AS2A 3GDKA 3IIOA 5AYBA 4C6LA 1HGWA 3KZSA 3NQDA 5J04A 5G1TA 1SO6A 4RZ6A 1WQ5A 4HPHA 3LHYA 1BXNA 5LA2A 1XUZA 4JTCA 1NDWA 3C2VA 1ISWA 1LLZA 4ALDA 2YJQA 4O0QA 1W1ZA 3AHZA 2QV5A 1Z32X 1UPPA 3WLQA 3AJXA 4FP1A 1W56A 2OWWA 4QCFA 3W7GA 2Y8UA 1J5SA 3A4XA 3OBAA 4ZBCA 1CGUA 3N9SA 1QTWA 2GQ3A 3OVQA 3AS0A 1KRCC 4BJHA 2DSUA 3PUOA 2VC7A 4ADSA 1J8VA 2PU0A 3N13A 4G2DA 3TNOA 1FCBA 3EA1A 2OEJA 2XFRA 3GG1A 4IPLA 3ENLA 5C54A 1I75A 3CQ0A 1FX6A 5FSDC 1KFLA 4UTTC 6TIMA 2ALRA 1XIFA 3WF2A 4DZAA 1W8SA 5KMYA 1V7AA 1E4LA 2VMFA 1K03A 2FMNA 3S1UA 3ITYA 4WK9A 3KP1A 1E51A 2R9RA 2G95A 4PULA 3WK1A 1DHPA 4H6RA 1P5BA 3G5EA 5A8MA 3REQA 4N9EA 1H0IA 3VNJA 1WAWA 3AIEA 4BWLA 2VFEA 2QPUA 3OIXA 4KFNA 3JZUA 3BG3A 4ZQNA 2BVDA 3K46A 2I7GA 1QU4A 3I3EA 1QW8A 3KOWA 5DT7A 2OQYA 3WQCA 3PZUA 5D05A 1OG0A 1D3GA 4I9MA 5H2ZA 2BZNA 3ZJ8A 4LWWA 1PIGA 1YADA 1TX2A 3UESA 1SUXA 3H2FA 2UY3A 4AY8A 4D9PA 3MMTA 9XIAA 3V5CA 1FKXA 5A8QA 4JIHA 2PMQA 4FHAA 1KKOA 3B9EA 2FKPA 3E2RA 4O14A 3U0HA 2PDHA 5DMLA 1YHTA 4HT3A 4X22A 3T1GA 3NFUA 1MDRA 2QJJA 1XYCA 4MSSA 6REQB 4QG9A 4KEMA 1OFBA 3GHUA 3KWXA 2UY5A 2VFDA 2DZWA 4UTFA 5AOUA 3NXLA 5HR7A 1YXDA 1XH1A 5LA1A 1W3HA 3W7LA 1I8JA 3ORWA 2XYLA 1E55A 4FNQA 4UTMA 4QJ5B 3WQVA 1EJSC 2FHCA 3DFTA 4YCOA 1QFEA 1DTUA 1GG0A 3PC0A 1L8NA 1BG4A 4XBSA 2F7FA 4CN4A 1ZFJA 1DJGA 2GYIA 3WK2A 1XGDA 5KZDA 4HNLA 3ATYA 3UCDA 1BYCA 4DXKA 3ITOA 1TZ7A 3W7RA 1UD2A 1F3TA 2IKJA 2ZRXA 4GLEA 4BQ2A 4XD3A 1ZAJA 3VDGA 1TQJA 1TRIA 1UB3A 1V3KA 2WBKA 2ZTKA 4M80A 4B3KA 3TIMA 5AECA 4GKTA 2NUXA 2QJGA 3URQA 4QLJA 3WX7A 3VKAA 1TVLA 1WUFA 4QSFA 4UFJA 1JYVA 8A3HA 1O95A 1KXVA 3ONBA 3L67A 2VVSA 3DG7A 4U5KA 2Y5SA 2HV5A 2F8QA 2R8WA 1KC7A 3RCMA 4PB5A 3H6OA 2VTFA 3MCOA 4AWEA 1BPLB 4E5TA 1L9WA 5D9NA 3QZAA 4W7WA 4AEEA 1RJPA 4GJJA 1EZ2A 1QO5A 4LCRA 1BLIA 2HS8A 3CH9A 3LV5A 1E56A 5F4SA 3CNYA 2VX6A 3LPFA 4LBUA 1ESWA 2J24A 3DHDA 4L1GA 4L9YA 1QWGA 1V0LA 2C13A 5AYIA 1LL4A 3CWOX 3FYPA 4LPCA 5HR6A 2NQ5A 1TELA 4POCA 1K8XA 3AXMA 2WK2A 2ATMA 1FHUA 4AD0A 1GOKA 1FDZA 1IF2A 3HM7A 5M03A 3EWWA 1RLDA 2OB3A 3H70A 4RDVA 1I4NA 3IJ9A 3QM3A 3KBMA 1OC5A 2ZKMX 4OTKA 2PDBA 3S5NA 4IUOA 1E43A 2CLFA 4QS6A 1J6OA 2X09A 3VIJA 1IGSA 4D6EA 1TG7A 4F2BA 1BYAA 4ZQOA 3K4WA 4PBFA 3T8QA 2C3ZA 3D3AA 1BQGA 3MUAA 2J7GA 5BRBA 3IPWA 4KWVA 2BODX 3TQKA 2XISA 3N1AA 2E68A 3ISIX 4E2VA 3OB8A 4L1XA 3NZRA 1UQZA 1VPYA 2E4TA 1SFSA 2RJGA 4C6NA 3P93A 4HMNA 1WKYA 5I03A 4JFUA 2PDUA 1MUWA 5K3VA 3IVTA 3W7IA 1EUNA 2QDHA 3T78A 2E9BA 1GPFA 3CAKA 4UFIA 4F0HA 1XBVA 4HA4A 2VWTA 2QNEA 1V03A 3VMNA 2WCSA 3D3FA 1MXDA 4MADA 1A4MA 4AF0A 2HDJA 4K8GA 1F05A 3W7OA 4Z0JA 1V3LA 3DZ1A 2A21A 4NAFA 1RHCA 2D3LA 3KVMA 6PTDA 1GJPA 3S6OA 1MVYA 1IZCA 3KX6A 3WH7A 2X41A 3EKZA 1K70A 4O28A 1YNYA 4DN1A 4UTHA 3T42A 4ZO7A 2C16A 3ITCA 3VNMA 1XIBA 4GI4A 1FWNA 1F74A 3UZYA 1PCWA 5I3KA 4MTVA 4XZNX 1MXSA 3NDOA 3WD1A 2OMAA 4NJKA 1UR0A 1O7AA 3SW6A 4ENLA 4IMFA 3S5YA 5BOOA 3M47A 2ONEA 5BU6A 3VX0A 4DI9A 3AROA 5DN1A 3EPNA 4JEJA 3B9AA 2YXXA 3N9RA 3W85A 3GRIA 2NXHA 2J7EA 2BHYA 3KVLA 4IT1A 4YLWA 4ICMA 5F2IA 4JX6A 4DI8A 3T4CA 3GUWA 4J3ZA 4JTJA 2DW6A 3SEPA 4S3DA 4CNSA 4U3AA 1CGWA 2VZTA 3OG3A 4QDPA 4BY3A 4IHCA 1UROA 2GGJA 4JTQA 1PPIA 1D3CA 4U10A 1B30A 3P67A 3PBWA 1NF0A 5D9MA 4LXFA 4ASTA 3W72A 4O16A 5JU6A 4F0KA 1UA7A 3ITGA 4HMEA 2WKLA 5LXEA 2XDFA 1A5MC 1EPVA 4LVDA 2QCCA 3WEZA 5LA0A 2UV8G 3UBPC 3GNNA 3UWQA 1F73A 3FCPA 4U5IA 3LGDA 4HSHA 3LCXA 3JRKA 3G0UA 3L7RA 3W7HA 3BOFA 2IMRA 4H8NA 1HX0A 3VE7A 1VBHA 4Q6JA 1F61A 3OLIA 4CNOA 5HMSA 1GZGA 3TSDA 2HRWA 1XIDA 2YDQA 5MKGA 1LZOA 1PTGA 3GU9A 1ME8A 4IIHA 2G3MA 1E0UA 1VR6A 1ONWA 4LEFA 1YNPA 1F8MA 3P7YA 3GVGA 4B3LA 3WEMA 4TTGA 3M0IA 1NQKA 3NQGA 3TC3A 1THFD 5DRIA 3N14A 4D1IA 4MKVA 3NO5A 2C71A 2I14A 3GXIA 3G1AA 3P3BA 1ISVA 3MKCA 4LAUA 1OD8A 1QPNA 4BWLC 2E77A 4Q4OA 3CHCA 4X9YA 4ZB2A 2O0TA 3STPA 3O6AA 1LYXA 4B2DA 2VHLA 5CPMA 1PWMA 1FWJC 4MB1A 3USZA 1JI2A 2A4AA 2WC7A 1FXPA 3W82A 4LV9A 4JFVA 4DX3A 4BFAA 3BLKA 1YIXA 4E2DA 3ARVA 3VGFA 1ECEA 3LERA 3UR8A 1WOBA 3KDNA 2GGEA 4CD6A 2VEIA 4G9PA 1TWDA 2V5KA 1ZJAA 3BW3A 3VILA 3C8NA 1L2QA 2I5GA 3PY2A 1YE4A 3TFXA 1QDSA 3M0LA 3OIHA 5D9OA 1KR0A 3LD5A 5CPLA 3MDUA 3MHUA 1VIWA 4MB3A 1Q13A 3BCDA 3SECA 3HA1A 2VZVA 3WBWA 1BF2A 3FS2A 1H49A 2FZ9A 4UTJA 2Q8ZA 3K5XA 3QQWA 3SADA 2W92A 4LFYA 4GO8A 4LU0A 1FWHC 4B4HA 3RO6A 1Z69A 1QW9A 2QEZA 3HG3A 3CS2A 1REQB 4J5NA 1DWIM 4QJ1A 2PFHA 2C15A 4BZYA 4ZEPA 2I1OA 4NNAA 1ZBKA 4AIEA 1C8XA 2DZTA 4DPQA 3W71A 3TN6A 4F48A 1AH4A 4RW5A 2WMKA 3DBNA 4P5UA 4OFCA 4HA0A 2YDRA 1VPQA 2PGEA 4WKAA 2FZ8A 1OYCA 1A0EA 3THDA 1LTDA 4MLJA 1SFJA 3P14A 3OA5A 4ZTXA 3QY8A 3DX5A 2VDGA 1XJBA 3CUHA 2WSKA 1W9XA 4M3PA 5IDZA 1J93A 3SQSA 3GK0A 2CBVA 4LCQA 1WZMA 2MUCA 1IE7C 3H55A 3PBVA 1H1NA 1X7FA 4AD2A 4H19A 4R5EA 3TAOA 2WMGA 3WMSA 3FJ6A 1XYAA 3WL0A 1CX9A 3AZRA 3NTYA 5I6SA 1QBAA 4LCSA 2DT1A 3HFTA 1LROA 4D8LA 1V8EA 3N2XA 2WPBA 4PYSA 4AB4A 3KTXA 3TYAA 4AVFA 4BKNA 2CHNA 1W9PA 5F1UA 5HBFA 3TTEA 3MUXA 1JULA 2C18A 3H2CA 1D9EA 1KD0A 3O6YX 4GG9A 3EB3A 3ZO9A 5HPCA 1JFHA 2YYUA 5KEZA 5E6YA 3OVPA 4JL2A 5JXQA 4L6OA 3W87A 3W70A 3K4DA 4H7ZA 2Q71A 3APTA 3R4IA 1VLIA 2BY0A 3SR7A 2ZFAA 1M5WA 3GDRA 3S0CA 4M19A 4ZENA 2PRHA 2X7VA 5I02A 1R87A 4YU1A 4CD4A 2I9UA 3TKFA 1NVMA 5GQBA 3KM8A 3SN1A 1JZ3A 1W9BM 3S83A 1OF8A 4CN1A 4Q7IA 2C0AA 1NWRA 4LUSB 4IPIA 4Z42C 3URAA 3WBXA 4F4RA 2OOGA 3W01A 2PF0A 5E0CA 3BQ6A 3VCCA 4ONVA 1CNVA 1XLFA 2OKTA 4LRSA 2ISFA 1Q5MA 3LM3A 4HA1A 1H5YA 1ME7A 3GXTA 2NVAA 2YBTA 3W26A 2DSVA 3RO8A 1FUYA 5A6BA 4XB3A 4GY1A 4ERIA 2PURA 3T07A 3GVWA 1Q4WA 1T0OA 3F2BA 1E0VA 3AMGA 4O50A 3PZNA 4UR7A 2J75A 4DBSA 4NL1A 4G6CA 1Q3NA 1NM9A 3TMQA 1EZWA 3JS3A 3L0NA 1F07A 1FRBA 3WL1A 3NCOA 4AX6A 4MVAA 1IT0A 2Z1VA 2YW4A 4A8NA 3BLIA 2J7FA 1HKJA 2C0HA 4Y90A 4FIQA 2YX0A 2QVNA 2Z29A 4WDWA 4BF9A 3ONCA 1JPKA 2Q3RA 3EMQA 2OLSA 3ZLHA 3MP5A 2J74A 1UIOA 4NT0A 7TAAA 3B0XA 1EX1A 3W2NA 2ZA1A 4ZE4A 4EKJA 1NDYA 3WLLA 2PWEA 1XDMA 1V6XA 1MQPA 2QPSA 1D2KA 1ELSA 2AL1A 2YBVA 5BCAA 2Z1WA 1PB0A 4HTBA 2G50A 3FXGA 3PZOA 3GW0A 4DNMA 5AVHA 2QCDB 3KFTA 1SZNA 2Q02A 3AMCA 2OZ8A 4GUJA 4OZOA 5AFDA 3FK4A 3QHMA 4Q4QA 5K7JA 1TO3A 3VD3A 3TCEA 1JYNA 2G97A 4XAYA 4KIRA 5C0QA 3TLQA 1CXEA 4HKPA 1JCJA 2GJPA 4UTIA 2XJ7A 4JD4A 2NVCA 2AOSA 4Q8PA 2ABAA 2VUNA 3GYEA 4Y2WA 2DZSA 4NZCA 5FSEC 3MVTA 4JEQA 1BVNP 3TAKA 5I06A 1QW7A 3I7QA 4PA8A 3C0JA 4GIYA 1VHNA 1W91A 1J6PA 3L12A 3IJ8A 3SY8A 3S42A 3QV6A 3N3MA 3EX4A 1P0EA 3HJEA 3WBAA 2Y89A 3CLWA 1ZAIA 1TPWA 3TN5A 4RXGA 1ZJBA 3R8HA 3LEPA 4Q7BA 2WCGA 5AHLA 2OYLA 3ARWA 3WO8A 3T0BA 1PDZA 4CNPA 2PDNA 3L2IA 1T41A 1GCYA 4XZWA 3R25A 4HHPA 3KLKA 4PUEA 4HOWA 1Q8JA 1MUMA 4R53A 5DQPA 4TX9A 1VEPA 3VIGA 5H6HA 1UC5A 1H62A 3PG8A 3ZVHA 1E4NA 3USBA 2ZRZA 4LUYA 1B90A 4JBRA 3WF3A 4MDOA 3W1NA 1H7WA 3BGGA 4GRSA 2ZC1A 1JCTA 1JGIA 5TD4A 1UUOA 3QR0A 2FQIA 1BKSA 2DVUA 4GNKB 2Z6IA 3M16A 2ZXDA 1R86A 3C61A 3N15A 1FVPA 2YFOA 1P0KA 4MZ8A 1WB0A 3IRSA 4K1GA 2W5FA 4WIWA 1KBJA 1RVKA 3VNLA 4V15A 4XVEA 3UXDA 3ABSA 3SRFA 1VYRA 1S5VA 2QV4A 3AIUA 3KHDA 5CBBA 1XLLA 4JKMA 2W67A 4HNCA 3T2OA 4OUEA 3GW3A 4O4VA 1VFFA 3GB6A 1G7UA 4IQDA 2PTYA 3EOOA 4M7TA 5DF0A 3LGGA 5DX7A 2XH7A 1BYBA 3W74A 1RA5A 3KTCA 4ACZA 1Y7VA 1QXLA 2A1YA 1MDLA 1PX3A 4GJ1A 1JF5A 4DIAA 3FDKA 2W61A 4Y9AA 3PF3A 5I3IA 3NGJA 5CZSA 3E6EA 3KAOA 3R94A 2X0HA 3VDHA 3Q45A 4W85A 4JGDA 5FAJA 5CAHA 4CQ8A 1E9ZB 2BWGA 3BV7A 4RKAA 5E09A 2WSRA 1OFPA 1ISZA 3G22A 1P4CA 3R6IA 4F8XA 4NI3A 5D8WA 2XFWA 4HJFA 1E3XA 1J0ZA 2VRKA 2Z1BA 1PZ2A 3PM6A 5LNWA 4JCMA 1TJ0A 1UR9A 4Z1DA 5T26A 3P82A 5AYXA 1UWUA 3WH6A 4IF2A 4IMGA 4CEUC 1JPMA 2PLCA 1KTBA 1S2WA 3PAOA 1OJXA 2ZRVA 2ZYFA 3GAYA 3MW7A 3BH4A 1ZUAX 1Z48A 4ES4A 4AZBA 3LI0A 3CPGA 4EOUA 4RPQA 1HKMA 3EKLA 4NG3A 4E8GA 1OFEA 1KGXA 1VENA 3WQGA 2VT0A 3U7VA 4MNMA 4PEEA 1YMYA 4DELA 3FLUA 1CGVA 4JQ3A 4RV3A 3QR1A 1DJXA 3NSNA 3LSCA 2P0OA 4KW2A 4UOJA 2ZDRA 3GVVA 3WLPA 1KTCA 2EG8A 3MDWA 4S3EA 1J0IA 3L4XA 5M5DA 1H5VA 4U2ZA 4EX4A 1LWIA 4DBWA 3CGTA 4XQ6A 3R43A 4PH6A 2QQ6A 1FCVA 4UFHA 3M64A 5CSUA 2OT1A 5A6LA 2EPOA 3NG3A 4FI4A 1U5JA 4FNPA 3LOTA 2V5JA 3O6CA 3OBKA 4FF5A 3I10A 1V08A 3WF1A 3G3MA 3SUVA 3MHGA 1XRSA 2BFGA 5IHSA 3TTOA 5G1MA 1FWEC 4YJ5A 1V79A 5A8GA 1C8YA 2AQWA 5HMFA 4TU1A 2QUMA 1PYMA 3V0UA 3TX9A 4XZ9A 3MT1A 2AGKA 4DO4A 2XIBA 1R3VA 2Z25A 2R1NA 3ITVA 3VINA 3N4AA 2DEPA 3T05A 3HPSA 3V35A 2VNCA 3PTDA 4WRHA 3H24A 3AHXA 3KBWA 3URNA 4H6KA 1F6PA 1AG1O 4W86A 4XBKA 1CZ1A 4HNNA 4CNTA 1GKRA 1MI3A 1TPFA 1VFHA 3NWRA 4NZFA 2GWGA 2H3DA 3G8EA 2Z27A 3K8LA 1PZ0A 4JYFA 1CXIA 4QFUA 3UJSA 1B5TA 3DG3A 4PUUA 1OYAA 1UH3A 2FVMA 4KFOA 5CXPA 3LCIA 3OOQA 4HYRA 1TSIA 2P1FA 3G3DA 1KTNA 3O05A 1AD4A 7ODCA 1K1DA 4I7VA 4AUBA 1XKJA 3DI0A 3RJYA 1ADSA 1I6NA 1UR1A 3HPZA 3NSMA 1TIMA 2QJMA 1OFAA 3N25A 3NPVA 3WYZA 1RP8A 4RZ4A 1AMKA 1TWSA 1LT8A 1TX0A 4UIOA 2GK1A 3D5HA 3DESA 3ITXA 4JTGA 5JBEA 3PJUA 3CZ8A 3DKJA 3AYTA 1TPC1 4IIGA 1OCNA 1UUMA 4DRSA 3V0SA 3MMWA 4M29A 2R82A 2W4XA 3W25A 4NUWA 4F2TA 4H7VA 3EKGA 3TZNA 3RU6A 1J0KA 3ITLA 3WENA 1X6UA 1JDCA 5BXRA 2Z1SA 3KP0A 4O8RA 4H9XA 2O92A 4QE5A 1OK6A 3ELFA 4H4IA 4PL2A 5I3DA 3H21A 2GVEA 3VOGA 1MUCA 1V3IA 1Y5VA 5IHRA 3RMEA 2XGIA 1JCYA 4LSBA 1VBGA 3PSWA 4HJWA 2X16A 4B5NA 3PNUA 1ZRQA 1OSEA 2F61A 3UWWA 3M7WA 4AQLA 1XLDA 5FJUA 3MI2A 3RYSA 1P7TB 1YE6A 4HB7A 2CXEA 2C7FA 1YTKA 3S5OA 2R6OA 2VFIA 5A95A 5F2LA 3A13A 5FJPA 3VCRA 4DXVA 4O17A 3QEZA 3MY9A 4XX6A 3OO2A 3AHTA 1ZJHA 2VC5A 5F2GA 1CT5A 3UZ5A 2DORA 4J28A 1CBGA 5FF4A 2CPUA 3CYVA 4Z1YA 4FOKA 1OYBA 3VNDA 1O12A 1O1ZA 3UETA 4F0MA 4C6BA 2PLMA 4GYPA 4Y9PA 1E6PA 1US3A 2GUBA 3THCA 4MWAA 3NL6A 4K7VA 4P2VA 1H11A 2VOTA 1DQUA 1EP1A 4UMAA 5EFDA 3RPMA 4A22A 3QXBA 1YBQA 4L4LA 4Q8MA 3PJTA 1W3IA 4K6AA 3L5MA 4FZIA 3PJXA 2ANUA 1W1A1 5IRPA 3CUZA 1Q6GA 4Y9OA 3HOJA 3SDOA 2XFFA 4U3CA 1XP3A 1UD4A 1M7PA 4CKQA 2V3DA 2HNHA 1GHSA 4H00A 2OG9A 1LWHA 4G8TA 4L80A 3LENA 2PF8A 4GCAA 3H4XA 4B16A 4IISA 3GG0A 2X0YA 1RPXA 3OODA 1VQTA 4QTGA 5IM51 4JTRA 2XGBA 3URBA 1XBZA 3EZ4A 1GJWA 3B9NA 3ES8A 4LB3A 3GNDA 3GZ3A 2ON3A 2VCAA 4JY8A 4L4MA 1SW3A 1TB3A 3BLEA 4MY9A 4Q8NA 5BW6A 1QNSA 4KETA 4K3ZA 4DF1A 2H9AA 1Q66A 5CG7A 4ZOBA 2J4GA 4IGMA 2HK1A 3A64A 1OADA 4AU0A 3KHJA 1P6WA 3R0UA 5EMKA 4ZQRA 2HE8A 1TV2A 2PD9A 3P5ZA 1XIIA 1K3UA 5TAOA 2RDUA 1VB9A 5HXMA 4BQ5A 4HU3A 4MYXA 5CGTA 1KW1A 4ZO8A 4S3JA 1QT1A 4GZ7A 1YDNA 1XLCA 2E6YA 2Q8XA 3WD3A 3W4RA 3GDBA 1G67A 2V63A 3HBLA 4FA3A 1S5TA 4R88A 4UFLA 3IACA 1LUCA 1M53A 1VEOA 3QYSA 1PL9A 3SCVA 4AIUA 2XN1A 2O9OA 3MSDA 3EMZA 3S5ZA 2D2JA 3PR2A 3H4GA 1WXYA 2OO6A 4RR4A 5FJIA 4TTUA 1W5NA 2PE4A 4MZYA 2PWDA 3BZGA 2FHFA 3AFBA 1WOAA 4ZFCA 4DVOA 1ZU8A 2WHKA 4D8ZA 2NW0A 2ASHA 3IJLA 1TKKA 3QYQA 4LUTB 3B8DA 1Q7MA 3ZT5A 1DXIA 3EOEA 3M43A 4Z0SA 3SQMA 2BOEX 3ARTA 3EWBX 1CTNA 3KTSA 4ICCX 1JI1A 4JKKA 1E0WA 4AHOA 1YLVA 5DY3A 1ZB5A 3UWVA 2EO7A 4O18A 3W1MA 4NU7A 4TQTA 3VMPA 3GH7A 2OX4A 1OX4B 3VFCA 2ZZ3A 5IFTA 3FXYA 1JCLA 2JF6A 4UMCA 4DEFA 4Y9MA 1R3RA 2KAUC 2PDKA 3IGHX 5EMJA 2ZXAA 5D37A 4NXSA 3UZXA 1ITUA 3O16A 1A5BA 3SUTA 1O66A 2WVTA 4MNLA 4OIFA 1ZZMA 2E25A 3KRBA 2Y4SA 2A6NA 2X1IA 5LSMA 1ECQA 4H9YA 2PU1A 4AIOA 3KDOA 4YMZA 2P8CA 2CZDA 5EMMA 3RCYA 5DRCA 1FWRA 3W07A 1XLMA 1IXPA 2PLJA 1GOOA 4H8VA 1T96A 4HMCA 3QW3A 2WJFA 3H2NA 4PUJA 1H1YA 3R5EA 3ANYA 1A3WA 3NQMA 2VC9A 3C6CA 2MNRA 2RKXA 1WA3A 5A94A 2RH9A 3CJPA 3VPLA 4N2YA 1TMLA 4ZOAA 2BB0A 2EBNA 2CHOA 4XUGA 1R3TA 1NDZA 2ZX8A 2YLAA 1XRTA 4HMDA 4AWTA 1ODUA 3LPGA 1ITQA 3PPHA 4H83A 3CIWA 3R7MA 3A3WA 4KKXA 2PD5A 3CXOA 3APGA 4DWDA 3TSBA 3P5YA 4J7RA 1EA9C 3UGRA 4IFOA 1NFBA 3B4UA 3BAIA 1Z89A 3SUWA 3QPZA 4GH1A 3O7UA 4NX5A 5EL1A 4U33A 5CG0A 5FF3A 5A5WA 4US5A 1TRDA 4JN6A 4L7ZA 1QI0A 4XISA 1KO0A 3UZWA 1MRQA 4NILA 3G0XA 4RZBA 2OQHA 2FZBA 4CQCA 4EPEC 6REQA 1A5CA 5LNRA 4KCVA 2PTWA 1SQ7A 4UQDA 1W5QA 1XI3A 1XSKA 3W7PA 3ZR4A 3MUCA 3WQ5A 3MI6A 4H9UA 4B15A 3RX2A 4LT9A 1P48A 3WY1A 3DU0A 1JCMP 1DXFA 2OPJA 4JYEA 1BRLA 3GXFA 1PKLA 1LG1A 3F4CA 4UTKA 1AMYA 5M3WA 1M7JA 4OOZA 1V6TA 3AYVA 5H1WA 2PDLA 1KFJA 2OLAA 4D1JA 4GD0A 3GVQA 1M68A 4GE8A 3SBFA 5CAKA 2AQVA 3BOXA 2GJXB 1EFZA 4AEFA 4FLSA 1ODZA 5HUOA 4AWUA 2VGFA 1V0KA 4HTYA 2F2KA 5I3HA 1XINA 1PZ1A 2GJNA 2CWNA 4IICA 1EJVC 4FOJA 3I4EA 1JG9A 2VD9A 3A9BA 4UC5A 3NZ1A 2DUAA 2VP8A 1UMYA 4A21A 1PXGA 5AZ0A 1JZ2A 5EPDA 4DM1A 3BGJA 2FMOA 4O0KA 3BAWA 3STEA 4E3VA 4ZQPA 2PDJA 3AWOA 1RSCA 5G2IA 2VUYA 3MTWA 1SU5A 4K2SA 2IXUA 3XINA 1NFGA 4E4FA 3B04A 3IV3A 3E2VA 3PULA 3BAXA 3QZEA 3M5XA 3D6NA 1CGTA 4R85A 1QCWA 2HBXA 3MUY1 1FWFC 1P6CA 4MKSA 1PTAA 1KFKA 1R3QA 4B9ZA 1R2RA 3VOIA 2IPGA 1BGAA 3QSTA 3VTRA 4W89A 1W1IE 2V5DA 4JX4A 4AZGA 4QQ3A 1DOSA 1NOWA 3UNDA 2YCLA 1IWPA 3KL5A 3LNPA 2YR1A 3PUEA 2ATSA 2O55A 3E74A 5TNVA 4XIAA 2REQB 2A3CA 3HO8A 3PNZA 2QHAA 4WXYA 5HQEA 3RLHA 5JH1A 4GY7A 4IXXA 3GG8A 4GYPC 4M82A 5EBUA 3W00A 3ALGA 5JH2A 3IJQA 2Z2BA 4IUGA 4MWAC 3C0LA 3G24A 1KQZA 3GY1A 2YB4A 4QS5A 4AD5A 3GH5A 2BXYA 4ZO9A 4UOZA 4AIBA 4AD3A 2PPGA 5C9ZA 4PC8A 3RDKA 3E96A 3VC5A 1V6WA 4LANA 1SJCA 5GVJA 3M0KA 2ACRA 4PFMA 1B9ZA 1JVNA 3CMJA 4RE3A 5F4XA 3W6YA 5C9RA 3BLOA 3O15A 1WDSA 2R1LA 3MWAA 1TTPA 3AO0A 4ML9A 3QF0A 4YTSA 3G1HA 4DJDA 1VIZA 1ALDA 1OF6A 4GZJA 5BOFA 4GI8A 3QLDA 1QNOA 2VQUA 1LBLA 4XZLX 2FZMA 1V93A 1NY1A 1XHGA 2YOCA 5FI8A 3KBVA 4BI5A 3QY6A 3NSXA 1D7FA 3W2KA 2ZX5A 5KTLA 4LYKA 2AGTA 5HPOA 1K8CA 1J01A 2QCHA 2YCKX 4GIRA 1L6YA 2B0MA 4L4OA 4DUOA 3KZPA 4WKFA 3H26A 3F7JA 2QYGA 1OX6A 2WLYA 1J10A 1K7FA 4K8HA 4O1CA 3M0HA 3TYBA 3CUXA 2VVNA 4H9TA 3TWBA 4CN6A 3GFXA 4CD5A 1FWTA 3IJDA 3GDLA 1POKA 4XV0A 1ONRA 2CETA 2YW3A 2IKIA 2DY3A 5F4WA 4LUIA 1ZL1A 2CC0A 4RDZA 1VC4A 3UVAA 2Y61A 2VL4A 2GFTA 1EJUC 3IRDA 3DFPA 3WQEA 2I9EA 3ZOAA 2GWNA 2VC6A 3AMDA 3M0XA 1GVSA 1XYBA 4WSKA 1LOQA 1GYNA 1BWLA 4ZQCA 2PTZA 1YDOA 4Q22A 2V30A 1VYSX 4G1NA 5MF5A 2VR2A 4D2JA 1YQ2A 2XHYA 4OT7A 4PFHA 2A3LA 2CLMA 2PBGA 3GZAA 4QP0A 1R3SA 2P53A 4WEVX 4MB4A 4P8VA 1RLCL 4JQ4A 3LRMA 4QNEA 3QOKA 3CHVA 4TOQA 1H41A 3LXAA 2A79A 4DHGA 2ZE3A 1AW5A 4WXZA 2R1MA 2YDSA 4DUVA 1W37A 3P62A 4ROQA 1X8CA 1NEYA 3W75A 5I5RA 6XIAA 4KEUA 3II1A 3SCUA 1JGMA 1TZ9A 3IIPA 4GO9A 5CPQA 4RDYA 3SJNA 1A80A 1KV5A 2WZEA 3HPXA 3CEPA 1SVDA 1TPEA 4E38A 3RRAA 5DCEA 1FFQA 2A7RA 2DSZA 1HJVA 3E38A 1LWJA 1FQ0A 1NIUA 2JGYA 4L5ZA 3P61A 3Q65A 3OBEA 5AHFA 1QR7A 3B8IA 1C9DA 2HEJA 3HGSA 2E7FA 2VZOA 2OEKA 3DC8A 3R1ZA 2OT0A 1ZS2A 3ZVIA 4EK7A 5KINA 1X7IA 2HNEA 3QLLA 4BQ4A 3BAJA 2H3BA 3SCSA 3WJWA 2ZVRA 2CZFA 1X97A 5LXXA 3RFAA 4FNTA 1LM1A 4LNCA 3STFA 3O1NA 4ERGA 5M2FX 5FCZA 2OYMA 2GVYA 1TR1A 1QPOA 3MC5A 2Z7GA 3DHPA 4TVUA 2A3EA 3V4BA 3WDIA 4BR1A 4Q4KA 3NVTA 5L6UA 3SUUA 3QJAA 4CEXC 3VGBA 3WUEA 1H1ZA 3U2OA 4GXWA 3OQ8A 4MFEA 4URIA 2D22A 1XYLA 6CGTA 1A47A 3WBEA 3GD6A 4DUWA 4KH2A 3R2GA 1OBAA 3VZYA 1R6WA 1GOQA 2TRSA 1MEIA 5AHIA 3P60A 1NWTA 1JXJA 3FJLA 1LQ2A 4P7NA 2YXOA 5T9BG 1HN1A 3LNMA 1JEZA 1FOBA 1V02E 3ARPA 3IJIA 3UF9A 5C7HA 1K4HA 2Z7KA 2FZDA 1G9HA 4FALA 1RY8A 2PSNA 3VUPA 2QMKA 3T7VA 1B3WA 4AFYA 3OZYA 4PMZA 1EXBA 3BL3A 1YDVA 2XSAA 1OEPA 3I4KA 1QNQA 1M01A 3BTNA 4L4PA 1HKWA 3R12A 1K7XA 3NOEA 5GJNA 1SJDA 4GWEA 1N8IA 3MP3A 5GJPA 3GQYA 3QPEA 4JN8A 5CJ5A 1OCQA 2VURA 4UTUA 3PZVA 1WZKA 4TX6A 1L6GA 3S6DA 1EP3A 3W1QA 3V3WA 1QJWA 1R38A 3N29A 1A5NC 1UP2A 2JKAA 3LXCA 4R3UA 3UJ2A 3HG4A 3AU2A 3I6TA 4K38A 1PO9A 5DBUA 4PTDA 1DEDA 1KXHA 3VK5A 2ZWYA 3GXNA 4C6PA 5JQ9A 4CQ9A 1DWFM 1AA1B 3CUGA 4ZTYA 1J0HA 4OKDA 1TV7A 3GHTA 3W2LA 3DUGA 1YEYA 1R3YA 4PMRA 4DJFA 1ZBVA 3DFNA 1REQA 3IUDA 2QXWA 3W2UA 2J62A 4UNIA 1AUSL 4PEKA 4EVZA 3P84A 3HGRA 1GVFA 3W7MA 3U5UA 1A5SA 2B7QA 4CCDA 2PUZA 1GEQA 1N82A 5G4HC 5G4EA 1LQ0A 1W5PA 3FDGA 5I07A 4QAIA 3INPA 2O9RA 4IJBA 5DELA 1UBSA 2DUZA 4FR1A 1NELA 4OJYA 1XYZA 1DPMA 3ZXWA 5REQB 3EDJA 4QX4A 3LQLA 4FMVA 2BXZA 5FF0A 4WR3A 3OP2A 1IZKA 1E15A 4DZHA 2G0WA 4BK9A 5B80A 2GSEA 1C8QA 4EWJA 3FFSA 3QV9A 3UP8A 3BSGA 1QPQA 1FTXA 2GJRA 1FY6A 4HZMA 3UG3A 3A4WA 3UU0A 2UZ9A 1Q65A 3B40A 3L4ZA 4Z1AA 4CD7A 2WLZA 3D0CA 2O56A 4R33A 4LVGA 4KPLA 3FOKA 1V3HA 5D2TA 1V6VA 5CCZA 2Z6JA 1EIXA 3MI3A 1U33A 4IMDA 4IMEA 1SO3A 1I1XA 4ZB0A 3UG5A 4FS9A 3CUJA 3HTWA 2NX9A 4BI7A 4DJEA 3WDQA 3SO7A 4DPPA 5EU9A 1RJQA 5IBXA 1FDYA 1W5MA 3MCMA 2QUUA 1XCWA 2FVLA 3I65A 1X1ZA 4LUSA 2EPNA 2X42A 2YL5A 3O3RA 1BF6A 1X1NA 1WDWA 1H61A 1JR1A 4HHLA 4IIBA 2PRLA 2BASA 4IM4A 1SZGA 4XZBA 1VF8A 1S38A 3ANVA 1A49A 4CNUA 3NPUA 3FAXA 4QE1A 3SCRA 4P8UA 1ZCOA 4GX9A 4PRTA 3W1XA 1Y5WA 4JOMA 5LZLA 4C6FA 4UQEA 4DJDC 5I3GA 2WMIB 1L6SA 3VIPA 2WV8A 4GGHA 2BX7A 3GDMA 3ARXA 3B97A 3CB3A 4Q8QA 4ICNA 1IWAA 1WP6A 1PEZA 3RLVA 4XAPA 1KGUA 1SR0A 2V68A 1XIMA 5EY5A 1AL7A 3N2TA 4E3TA 1CXLA 4C6KA 2GK1B 1Q8AA 3CPUA 1V3MA 2HJPA 4WOQA 1UJQA 4EWND 3OYZA 1BXBA 2O4MA 3BG9A 1EYEA 1QNVA 1DV7A 1DQXA 1RH9A 1G6CA 2R1KA 1BSIA 2CFFA 3LGEA 3ZWSA 1F5ZA 5FD0A 3S2MA 3VNIA 4Q8UA 2VJXA 4ZE5A 3GIYA 1H7RA 5HNRA 1XLKA 4Y96A 5BOEA 1KM6A 4JZ5A 4PUMA 9XIMA 1V0NA 1IT8A 1US2A 3JUGA 3S9YA 2PB1A 2ZUVA 2C1HA 2TYSA 2D20A 2JQXA 3SGGA 1E0TA 4FK9A 1RCXB 4Z08A 1FWSA 2QCDA 2J7CA 3AJ7A 2X1UA 1UKTA 4F9JA 1G94A 5IFPA 3OJGA 1MSSA 3UXKA 4M5PA 3QKEA 4MF4A 1XUUA 5D04C 3K1DA 4I6VA 2E1DA 3PFRA 1KRMA 1FWBC 1J79A 4DYJA 5PTDA 4QEHA 1AW2A 3MO7A 4PTNA 3EA2A 3PWAA 4XZMX 1XD0A 1O5KA 4FXRA 3W81A 1IXOA 2HCVA 3PTMA 3B8VA 3TTYA 1HL9A 1F7BA 5EMYA 3D46A 4HZ6A 1RQEA 4Z17A 4CCZA 1KRBC 3UG8A 4NRSA 3SCNA 2DIKA 3U2CA 4NAEB 1KNWA 1PIIA 2J79A 4I5XA 4IX2A 4I7UA 1FHVA 4IPPA 1V6YA 3BMXA 2P3EA 3F4DA 1W32A 2OKOA 2AAAA 3BCJA 4IFKB 2VM8A 2P88A 2OVLA 1EJ7L 2Z4GA 3MJMA 4XTDA 3CASA 3OQEA 3DHFA 2NXGA 1UD3A 3AXKA 2Y70A 5CSRA 2A5HA 3CZEA 3PP7A 3SM0A 2GOKA 3N73A 3CB8A 1EO7A 2ZX6A 1WYIA 4OGZA 3B0PA 2CHRA 3L2MA 3WLNA 3UY7A 3WNNA 5C2CA 1OINA 1EIBA 1GG1A 3XIMA 3NL3A 4Q8VA 2FDSA 1EX5A 3HQOA 4FEZA 2CLIA 4S2BA 2XG9A 3GVRA 3LSBA 1DQWA 1UC4A 5HDRA 1MW2A 4RCXA 1MFVA 3W02A 1UWTA 1GUVA 1GK8A 3U5YA 3W28A 1ONXA 2Y5JA 3FYOA 2RGMA 3F4VA 2WAGA 4NJJA 5BWFA 1LBMA 4X3ZA 1XD1A 2OFJA 1PTDA 3VIKA 1R2TA 1W2PA 4OUIA 1EOKA 3WUBA 2XIIA 2R94A 2X1SA 3T44A 1A5OC 2H9AB 1Q85A 2XVNA 3WK3A 2E6DA 1OHLA 2EPKX 1OK4A 4CU7A 3A21A 1GQIA 2VZUA 1M03A 4ZR8A 1OGBA 1XC6A 1A5KC 4BQ3A 1HZYA 2VFHA 1O5RA 2ZC8A 3LHUA 5K9DA 1HIZA 1XLJA 1TREA 1W9VA 4TVDA 5KZMA 4Y9NA 3ARRA 1QOPA 5HMEA 4WOZA 1OGSA 4OV4A 5E1QA 1XYFA 2WHLA 5FIPA 4UCFA 3TW7A 3UXAA 1V77A 1CXFA 1Z6KA 2YZ5A 4CNNA 1CGYA 4U31A 1XQKA 3MANA 2OQLA 2OX1A 2VCCA 3NZPA 4N7QA 1O60A 2BOFX 5HOSA 5FJJA 5TBOA 2VR5A 1RCQA 3NGFA 1BVWA 1X98A 1V7YA 4P8XA 1DJYA 5KITA 2F6KA 5D9PA 4AX7A 4UNLA 3SCQA 1YPXA 2PC8A 4DJFC 3VE9A 4UQBA 5CC5A 5ABTA 5EKYA 2ICSA 2MANA 3TTQA 1PAMA 1QATA 2PWHA 1CB7B 3QW4B 3POHA 1UCWA 2XZ9A 1W1YA 3SQLA 2WSPA 2Y0FA 2FFCA 3B06A 4HNOA 3WG6A 2W62A 3GC5A 4XD4A 3QHOA 4JFTA 1XSJA 4V1YA 2CEQA 3GTHA 3T0DA 2OWXA 4W8BA 1X96A 4EXAA 3IEBA 3SGZA 3M44A 4DLFA 1DE5A 1OT1A 4I9TA 1YXYA 3E0VA 4GQGA 4B91A 1T8QA 3NL2A 3KEHA 3PFMA 3S46A 1YTEA 5LNUA 3H7RA 4MB5A 5EMUA 3K1GA 1OFDA 2BTMA 5I00A 4DWSD 3GR8A 3UZZA 1Q45A 1V0MA 4LAOA 1EC7A 2G4JA 3EOUA 4XZIA 3DHUA 4NZ1A 2GZXA 4O11A 5AKQA 4IOTA 3AC0A 4PCTA 3VOJA 3HU7A 1PKYA 4KWUA 1VHCA 4IGHA 4M1RA 1W54A 1HKVA 1T6MA 3NJ3A 4C5YA 3OG2A 1DP0A 1H50A 1VPXA 4Z1CA 1WO2A 5AYYA 3DAQA 1VJSA 4DJEC 1K4GA 2WYSA 5C6MA 1V5XA 4O10A 5D09A 5IBXC 3S47A 3SUSA 4WQ6A 2CIPA 4RNIA 2A3HA 4GABA 1KWKA 1UR8A 2DT2A 4ML4A 1QWKA 2IPFA 1K9FA 1R7OA 3HQ1A 1W0MA 3EWUA 5GJMA 2WNNA 3VAVA 3S9IA 3VUSA 3W88A 1EEPA 3I7SA 3NQ8A 4G7EA 2HMCA 1CECA 4EPBC 3N11A 5KETA 4MNJA 1EHNA 1N8FA 1UZ4A 1VP5A 4D6FA 3O8AA 3MMUA 2PDWA 3QC0A 3G6LA 3RPTA 5DFAA 1QMLA 3PZ9A 1XDJA 1EGZA 1F3WA 4A2SA 3S6TA 1TWWA 3N12A 3W24A 1VRDA 1I2QA 5ABHA 4IP5A 1BRLB 3N2CA 2DV0A 1U83A 1IHIA 5CQ1A 1DWGM 3D47A 3H54A 1AJ2A 3TE9A 2Q8LA 3AXIA 5AC8A 2VOMA 4AW7A 1KA9F 1HL2A 4NI8A 2YSWA 1JYXA 1QASA 4JIRA 5FKYA 3MO4A 4DZ5A 3KOFA 4QDWA 2AQOA 2Q09A 4ORMA 1UZ1A 2QZRA 1AZ2A 2EGZA 1W1PA 1NF7A 3EEGA 3IVSA 4H6EA 3BLPX 5AZ1A 2YA1A 4LB4A 2X2YA 4WUIA 1PE1A 4L6HA 2XH0A 3IVUA 1EWDA 3TA6A 4N6FA 3FN9A 4J2PA 4O12A 1P7TA 1DJHA 1NTHA 4M56A 2BHZA 4C60A 3ITTA 1G7VA 4AD4A 1JCNA 1S2VA 5C70A 2W0UA 4M6VA 3Q4DA 2EPLX 3V1PA 3W22A 4J3VA 5LIKX 1XLIA 3KOZA 3RF9A 2WCAA 2EEXA 3BW2A 3ZJKA 2NLYA 2OTDA 4KCWA 1BFNA 2X1RA 4LRTA 3MPGA 1V4YA 3ZQ9A 1EF2A 1DIKA 4JHZA 5HUPA 4FAMA 3W73A 4BHYA 1AQFA 2VZSA 3TVAA 3HQPA 3HPAA 4MG4A 3ALFA 2VWSA 1OT2A 2B7NA 4L64A 2YCLB 1YKWA 4HCLA 1HGYA 1U22A 3DOPA 3NYZA 1A5UA 2C8NA 1EB3A 2EQDA 3E2QA 3WLJA 2AMXA 4B9YA 3HG5A 3P2VA 4FF7A 3LM7A 1HXJA 2IW0A 5LNSA 4TO8A 1KBIA 2HE5A 3KE0A 1TCDA 5BROA 4HPNA 1RZMA 2W66A 1X8FA 4GUHA 1EBGA 4JQAA 3KBNA 3TCSA 2QUNA 4C65A 2D24A 3PJWA 4M0XA 3IWPA 1HO4A 3ABXA 2YBUA 4JTKA 4GUIA 5FEZA 1VFTA 2V69A 1W3NA 2EG7A 2IXVA 4AD1A 5DEZA 4BI6A 2J7DA 3GO2A 3CK5A 3CO8A 3WKZA 1VCVA 5A6SA 3RG6A 3CT2A 4ZA0A 5CPSA 3CWHA 4ZVJA 3AIQA 1WCGA 4JHMA 2W3ZA 3P0XA 2VGIA 3PZQA 1U5VA 2OO0A 2Y6ZA 4OBSA 3GYCA 3W83A 4QITA 3C2OA 2XIOA 1T40A 2PP1A 2Y24A 4GC3A 4J3UA 2DGAA 3WMBA 1YX1A 4LUJA 4KCUA 4NYUA 1X1OA 4UB9A 2DU2A 3WCZA 1MWOA 3RILA 1JZ7A 4K7YA 3QR3A 4V1XA 1HTIA 1K9TA 1S3HA 4WZHA 3VO0A 3TA9A 3WNLA 3N04A 4N42A 3DYMA 4TIMA 2WANA 1H0GA 5HINA 5CEWA 3ZT7A 3UXLA 2C1IA 1PJ9A 4C6JA 1PX4A 1M9HA 2NUYA 3IAQA 1D8CA 1P1XA 2A7NA 1JUKA 3DERA 4WY0F 1JNDA 1T8XA 3BC9A 1M1BA 3V18A 2JFEX 3PPGA 4GI6A 1J12A 1DHKA 3UCQA 4LUTA 1M41A 4LNYA 1CEOA 2V5CA 5CZ0A 5KZEA 3GFZA 1RK6A 2GDQA 3C8FA 2QCLA 3NEVA 3MV11 1Q63A 1SSGA 4PTVA 5A69A 4JIQA 3B9OA 2NWRA 1JPIA 3DENA 2FB3A 4M7SA 4LYRA 1WAUA 2BMBA 1BYDA 2P76A 1NWSA 2WJEA 5E6ZA 1FH9A 1JL8A 2P8BA 3LHVA 1OX4A 1UWQA 3JR2A 3QOMA 4UQCA 2Z0IA 1XLEA 1G4EA 1TPVA 2ACUA 3V1HA 4OWGA 1OCJA 5CPNA 3AYSA 3BPWA 1GOMA 1H51A 3T81A 4JTHA 2DSWA 3AISA 1GWJA 4ATDA 2IQ0A 1R47A 1JD7A 4GISA 4B5SA 5BMWA 5C2GA 3A24A 4JTDA 2ZA3A 4MY1A 1KFBA 4QRNA 4G56A 3T0TA 1WKFA 4GPNA 2GPTA 3RUBL 3ABOA 5FACA 4JS3A 2ZQ0A 2E5CA 3CAWA 4QDMA 2ISDA 1QK2A 2R91A 2BP1A 3S1VA 1EXPA 3OLDA 3W29A 2QULA 1F76A 3M6YA 3W27A 1A5AA 5BMXA 4M24A 1QHZA 4PMNA 4V27A 3GM8A 3AUJA 4HBKA 3IUIA 4IXHA 1HJXA 4GC4A 4XD5A 3VGDA 2X1TA 3L23A 3QGVA 4KESA 3SCOA 2XVPA 1RA0A 2XTKA 4F0SA 4PMQA 4PTMA 2VELA 1LORA 3I6EA 4PB4A 3UW6A 5CBJA 4PN2A 2ZVIA 5E70A 1VCFA 1E6ZA 1GW9A 4UFKA 3EEZA 4QCEA 1NDVA 2Z1XA 3COTA 4F66A 1UUQA 2PA6A 3CUIA 3UQNA 3VIFA 3M41A 3NQFA 1ENUA 2QIIA 1I0BA 1S46A 1XW8A 3ZIZA 3MCNA 2D2OA 4UMBA 3CIVA 4O1AA 3S8HA 3RX3A 3G1RA 2W27A 1TUXA 4L56A 4KEVA 1VFUA 3MYOA 5DT5A 2AL2B 4CU8A 4AISA 4GBDA 2WMHA 1WX0A 3M6DA 1KV8A 3R0KA 3B8UA 2V81A 1QI5A 3VIIA 3P74A 3CT7A 4HPXA 3TP4A 1KQYA 1TMHA 3LHZA 3PANA 3M5ZA 3N2BA 4Z2LA 1YPFA 1WBJA 4A8IA 2XFYA 3O6DA 4GVGA 1EH9A 1XDLA 4GQRA 4LS2A 2NVDA 3HQNA 1MNZA 4XWUA 2XSBA 4FO4A 2QCEA 2YLLA 1OVDA 3OU8A 1EJRC 1KFCA 4LVFA 5AC5A 2GJXA 3WUFA 5B7YA 1EGVA 3CTTA 3P8IA 3LUTA 2ZX9A 4R7WA 1B2YA 4PUWA 4GQ0A 2ZRYA 3PBYA 2H8XA 1G4SA 3LB0A 4C6EA 2DJXA 2V67A 1DYSA 4IQJA 4BA0A 4PCSA 1Z42A 5C71A 3BSHA 4Q4RA 2VDHA 2PGWA 4N02A 1TE1A 5HNNA 3CAVA 2PC4A 3WJYA 4LY8A 4CQDA 3KOXA 3IS4A 3BURA 3RIKA 3CQKA 3CM4A 1BG9A 2QVHA 2QT3A 5LIUX 1KXTA 3AALA 1SJBA 1K77A 4OOUA 2WVVB 1TE6A 5FOOA 1HW6A 2DUXA 2UY4A 1B31A 4IQEA 1H7NA 3CWNA 2Y5EA 3NQEA 1KM3A 4V33A 3GBDA 2PGFA 4NIRA 3ZFHA 3T9PA 2J66A 1ZQ5A 1OD0A 4U2YA 2CU0A 2G37A 2Y2WA 4H1ZA 3AAMA 3TYCA 3O07A 4WY0A 2J88A 1VCGA 4JTLA 4F0LA 4X0VA 3BLDA 3TH6A 3OHIA 2J7BA 2VEGA 3CL7A 4QM1A 3W2JA 1OGGA 1GKQA 2WC3A 2REQA 7XIMA 1I2OA 3SN4A 2D1ZA 1OIFA 2ZZ4A 1W3KA 1J96A 4A3QA 5FEXA 2WOQA 4JNZA 1JYWA 1ISYA 3SI9A 3N9KA 4GHRA 3K4AA 3QSRA 4GINA 2P3ZA 3ZLFA 2I57A 4BS0A 4LGXA 4FB7A 5HWMA 5K4XA 2YDAA 3C56A 3VOHA 3BICA 3BSMA 1XPYA 3H2AA 2OZ3A 3FY1A 4W7VA 1XCXA 1VJIA 5CGQA 1M6JA 1O6IA 4W5ZA 1E1EA 4MHBA 5GNZA 5AHMA 4GVIA 3S9ZA 3LRKA 2DT3A 2QW5A 3T0AA 2Q01A 3OEXA 2Z24A 2FYMA 3EDKA 4YIWA 3K13A 5EMLA 4D72A 3LBMA 3SN0A 1W6TA 1AQMA 4N9BA 3GUGA 1M7XA 2WO5A 4RE2A 4PGLA 4I8DA 3PBMA 3MQTA 4TVCA 1EQCA 5D32A 3AWNA 4MY8A 3DEQA 3OGRA 2HXUA 3GTIA 5A2CA 2WNWA 3A9IA 1K8ZA 1FCUA 3QFWA 4IIDA 3TW6A 2QJIA 3DYPA 5CSYA 2GSJA 1W31A 4I3GA 3HPFA 2QJNA 2RUSA 2EAWA 2IKHA 3QVQA 4MAVA 1A3XA 4QLKA 1WDPA 1H7PA 1UKSA 2VR4A 1RBOB 4RNHA 4TMCA 3TR9A 3FJ4A 4XKMA 2BY1A 2J8TA 3VD7A 4NYYA 3KRZA 1KM0A 4MAZA 2CW6A 1U5HA 5G1YA 4WJXA 1FDJA 1GZJA 4B5TA 1GZ1A 2C14A 2ZUUA 3DI1A 3CZJA 3QQ1A 5MHBA 4C5ZA 1XIJA 1DWJM 1TYGA 4EAYA 2QUVA 2WNZA 3F2CA 5CPTA 1DJWA 1DJZA 2XVGA 1ADOA 2XINA 3VKKA 4WSHA 1VJZA 1P0NA 3WMCA 5EBAA 3QTGA 5BNKA 1I9CB 3OVGA 4AAJA 5D30A 4MKNA 5D33A 1EDQA 1WDDA 5AYZA 3S2NA 3QH2A 2HBVA 4ADTA 4LC6A 1C9WA 4RNFA 3UJEA 3WJZA 4GK8A 5ENLA 2A2IA 1OFOA 1EJWC 2BGQA 2IPJA 2Y7FA 3W7CA 5KZ6A 1PKNA 3KW3A 4REQB 2QCMA 1EEXA 4X2RA 1J5TA 3I7RA 3QC3A 3BXWA 4IGSA 4RDWA 2G3IA 1RBLA 3KUMA 4AXKA 3H7UA 4N9DA 3L4WA 4Q32A 3APYA 3RM9A 1UJPA 3TYZA 2QCGA 4GMEA 3AI0A 4O8AA 4S3BA 4X63A 3U9IA 3CQJA 2ZWZA 4UTWA 3DFQA 4JTAA 3RXZA 3E5BA 3OLEA 1E6XM 2J9ZA 1GQKA 1TMQA 2ZADA 3CO4A 1VH7A 2ZZ2A 5B7ZA 3SAZA 2ZICA 1LP6A 1H09A 1I2NA 4D8AA 1HVXA 4NP7A 1TA3A 5ABGA 3U4AA 3S1GA 1FWDC 3F03K 2G5WA 1KM5A 3IGSA 4YVXA 2C91A 4HK5A 4KF1A 3RLUA 1RBAA 1TV8A 4QR6A 4IH3A 5K9CA 1G01A 1C90A 1UOZA 2V6AA 4PUNA 3GC4A 5J8LA 2WNQA 2CLHA 1ICPA 2PTXA 3MJYA 5FJOA 5D2YA 4FPSA 4WGXA 5E0FA 2P5NA 5HNTA 5EFFA 1I1WA 3I68A 4GZIA 1YPIA 3VU2A 2E67A 2ZDSA 5ABFB 2Y8VA 1J0YA 4GIEA 2W6RA 4RJEA 5HMDA 3JZEA 4TMBA 3S4TA 1KGWA 4MJZA 4WDTA 4WHBA 1Q2SA 4RPPA 2C79A 2BHUA 1PDYA 1GTHA 3LY0A 4YN5A 2E9MA 6XIMA 1SSDA 4U4MA 2PZ0A 3ANUA 1XGZA 2V3GA 2JF7A 1O1HA 4UCGA 1E5NA 2DIEA 3T0CA 2CERA 4N4PA 3AS1A 2P0IA 1MEHA 4TX8A 4YPJA 3PZMA 1EF3A 1TIWA 1KFEA 1NFPA 3ZZ1A 3NOYA 1Z44A 2ZUWA 4D6HA 3V5OA 2JIWA 4O1EA 3GNRA 1R30A 3QRHA 2Y85A 3TYEA 2CITA 3G6MA 1LLWA 3AXXA 3PB0A 1GONA 5FJTA 1GOXA 1Q7ZA 1FCQA 3LLXA 2X2GA 5U4NA 4UQ9A 1ZHAA 4KMQA 3QKZA 2PCEA 3KVKA 3AZTA 3QGKC 3CZLA 4JFSA 4H2HA 1DL3A 2ISVA 4RX0A 7ENLA 1HJWA 3GG7A 4NZ5A 5FJRA 1R8LA 4MZ1A 4P7LA 2NWSA 2HXTA 2RHGA 3WSUA 1P0DA 2HK0A 3VOFA 2PRMA 2POZA 2NUWA 1H7OA 3GHSA 3GIPA 1OC6A 3FGCA 2PDCA 3GR7A 5G5IA 4ZMGA 5L9FA 1QHOA 1KFWA 3VA8A 1Q6CA 4NNCA 2ADAA 2FH8A 4NY2A 3HN3A 2F84A 2BBFA 1E1FA 3TW9A 1JZ4A 3B8TA 4X0NA 4HIBA 2DZAA 2QF7A 3VVGA 3TUUA 4KERA 4PSPA 1K9EA 5REQA 4MNKA 3T55A 4E2OA 2YKKA 2ISWA 4C91A 4DB7A 3SB0A 3W7QA 4J4KA 4BCEA 1I2PA 3NQ7A 4Q3MA 1UWRA 1EL3A 5T8GA 2Y7GA 5E93A 5G2HA 3BO9A 3RNDA 5DCDA 5CC6A 3MZNA 2J6VA 3MA8A 1KKRA 1Z41A 4WVXA 2EHHA 3VYLA 2F2HA 5DY2A 2B81A 2BOGX 4A6GA 1CXHA 4H3DA 3AICA 2ZRWA 1GVRA 4JIEA 5HATA 3T6CA 3A4JA 3PBGA 4R7JA 1TV4A 4YYCA 3N2OA 3FEMA 4IL0A 1RQBA 3VFLA 3HIJA 4PMOA 3HB9A 5A6TC 2Z2UA 4GGBA 4GXMA 2POTA 1KBKA 4LALA 1F6KA 1L8PA 4IL2A 4LOCA 2FZNA 3EGJA 1E4MM 1U1JA 3MU7A 4PODA 1U1HA 1VAHA 2ZE0A 4JDYA 4D6GA 5C5YA 4CCCA 5M1TA 2V82A 4DO7A 4GNVA 1ONEA 4KCTA 2ZXQA 2F6UA 3M07A 1Q2RA 3VC6A 4H2CA 1EA0A 4O53A 3TQPA 5CC7A 1KB3A 2E9LA 1J18A 3MZ2A 2OZ0A 2YCJA 2XVLA 3H22A 3OGVA 3DKLA 1UW9A 1GJUA 5A6JA 5IXEA 4XD6A 4DO6A 3Q94A 3W1LA 2ZZ7A 1TTQA 3EDFA 4LJ3A 1W9UA 1AW1A 4E8CA 4KFPA 1IEVA 4IIFA 1UWSA 2PDYA 1S3TC 4B2DD 2NT1A 2CYGA 2PWGA 4PB3A 2H6RA 4HN4A 2D0GA 4G7EB 1DIOA 3LBCA 3WLIA 1AD1A 4XZHA 2OJPA 4ATLA 4Z2JA 2RAGA 4HU0A 1YDYA 3EWXA 4ZQMA 2JKPA 4GH3A 2QS8A 2PBOA 3CV1A 2OXNA 2WMIA 3AIBA 4ERAA 3HMCA 3SURA 4YTQA 2FJUB 4EANA 3DFYA 1Q6RA 5SWUA 4FLOA 5HULA 3WJXA 3PWGA 1DIEA 1B54A 1KXQA 1ISXA 2Z1KA 4J9JA 3L21A 2OSYA 2V3EA 4H8HA 4RLIA 3KWSA 4AZCB 3LZ5A 1GW1A 3LTYA 3NZGA 3VD9A 3BAYA 1XV8A 3M46A 1BHGA 4WF7A 4QE4A 2YPIA 3WH9A 4GACA 3SZ8A 3CV6A 2OR2A 3XISA 1UP3A 1EWEA 4H9VA 4UTLA 3LG3A 1TJRA 3R89A 4JR5A 3T2QA 2DZVA 3AIVA 5F1VA 1DVJA 3NURA 3CAQA 1DBTA 1MFUA 3WDJA 1EC9A 1UR4A 3PZTA 4UNKA 1E6QM 2WM1A 4JQ2A 3OPSA 4ZGYA 1BKHA 2YL9A 1EO5A 2DVTA 4KRTA 1F8IA 1JDDA 3TJXA 3C0QA 4J3XA 1MQQA 5E9XA 4INFA 3GNOA 4C6IA 4HZ7A 2OU4A 3NA8A 4FX8A 5A2BA 2O9PA 1R9YA 4MJ2A 1DORA 4P7RA 2VRQA 3WQPA 2VDIA 2BNJA 3W53A 4AZ6A 4GKLA 4PR4A 2CESA 1X39A 2OZTA 3TYUA 4F9DA 6ENLA 4W4QA 2WWDA 3GTNA 1MMFA 3W7NA 4P7QA 1IV8A 5C8BB 1VD6A 3RHGA 3CQHA 4HCD