3H23A

Structural studies of pterin-based inhibitors of dihydropteroate synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of pterin-based inhibitors of dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis str. a2012
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 99
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2009-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3h23A00
3TYDA 3TZFA 4D8AA 1AJ2A 3H21A 3MCMA 1Q8AA 4DAIA 4MWAC 2DZBA 4S3DA 2YCIX 4MWAB 2E7FA 2Y5SA 2DZAA 3H2NA 3H2AA 4S3BA 3H22A 1Q8JA 4D9PA 3H2OA 3K13A 1F6YA 1AD4A 2YCKX 3MCOA 2Y5JA 4DB7A 1AD1A 3TR9A 3BOLA 4NL1A 1AJ0A 4S3FA 2DQWA 3TYUA 1EYEA 3H2CA 4C1NA 2YCLA 3H26A 4O0QA 4D8ZA 5JQ9A 1TWSA 4DJFC 1TWZA 4S23A 4MWAD 4S3CA 4DJFA 1Q7QA 4DJFD 4NIRA 4MWAA 4G9PA 4O1EA 4NHVA 2VP8A 4MWAE 4DJDA 3TYZA 3NOYA 3MCNA 2VEFA 3TYCA 3BOFA 3TZNA 4NILA 1TX2A 2H9AB 1Q7MA 4HB7A 3TYAA 4S3AA 4DAFA 4DJEC 1Q7ZA 4DJDD 4C1NB 2BMBA 2YCJA 4S3EA 3TYBA 1TWWA 2H9AA 1AJZA 2OGYA 3H23A 3H24A 1Q85A 3V5OA 4DJED 4DJDC 3TYEA 1TX0A 3H2FA 4S39A 3H2EA 4DJEA 4S38A 4CCZA 4PZVA 2Y0FA 3H2MA 2YCLB 2VEGA 4O1FA
chains in the Genus database with same CATH superfamily
3QKEA 4AFYA 4LUYA 4GZJA 1HX0A 3U6WA 2JEQA 2YL9A 1DPMA 3NQDA 3USZA 1QATA 2Y62A 3RM4A 4AZGA 4F40A 3E6EA 1G9HA 5C9ZA 2ACQA 4XVEA 1B3XA 1ZS2A 3NQCA 3LXCA 2TODA 1W91A 2P8CA 4QE5A 1ADDA 4UIOA 2Y24A 2SFPA 3B0VC 1EL3A 5T91A 4B92A 5LNUA 1CB7B 4UTIA 5DLCA 1UR3M 2OELA 2VT0A 4GFIA 4GACA 4TMBA 3JW7A 5EMJA 3RX4A 1OGSA 4JCMA 5KMYA 3UZXA 4L65A 3U7VA 4AWEA 2WNQA 3B8DA 2PDFA 3G8RA 4KCUA 2YDAA 1GQKA 1ZBCA 3LU2A 3TZNA 2GVEA 2X05A 4HA3A 1W1B1 3LBOA 1US3A 4C6FA 8TIMA 2WZIA 2OSWA 2Z25A 4KCTA 2CKSA 4P7NA 2X1RA 5K4ZA 4FXSA 2OGYA 4KEZA 4Q7BA 1U83A 4NNAA 3I7QA 1UWQA 3EX2A 2GSEA 4PFHA 2V2HA 2UV8G 4U10A 2UBPC 2QGHA 3P84A 1R38A 3P2VA 2PD9A 2D24A 5HR7A 1QBAA 4NUWA 2ZZ6A 3QFWA 4XUGA 4ONVA 2EG8A 1ZJHA 3KDOA 3FA3A 1M01A 4UTTA 1B4EA 1W5OA 1B3ZA 1CGYA 4DXXA 2ATMA 3B05A 3TIMA 3M47A 2CBJA 3IIZA 2OO0A 1P7TB 3EYPA 1MDRA 3MI2A 1GHSA 2AOSA 2IKHA 4G5DA 1MDLA 3ABOA 2CLFA 3P82A 3PZUA 2XTKA 2Q6ZA 5D37A 3FSTA 2G50A 1KXHA 1G0CA 2XYLA 1JDFA 3BUVA 1KKOA 3E0VA 3N2TA 4QQ3A 4OHQA 3OB8A 3G1HA 3VIGA 3STEA 2PWUA 1TKKA 3BARA 4I7UA 1TX2A 4LF2A 3QOMA 3LSBA 5A6TC 4KETA 5C70A 2WYSA 1DQXA 4KCWA 1K7XA 4EWJA 2WLYA 4M82A 1MMFA 1XIIA 3G1VA 4YU1A 3OP2A 4J7RA 3W24A 2ESCA 2RDWA 4ZA0A 3ZIZA 2WC7A 1UQYA 4XIAA 1ZLPA 3BMXA 3VX1A 1KQYA 2ZXQA 1TJRA 3NQ8A 3JVAA 3W1QA 4D1JA 3CTTA 1XD0A 1VP5A 2IQDA 3PZQA 4A3HA 4XX6A 3GU1A 4JTEA 4TMCA 3KBSA 2ZKMX 3WQOA 2ZTJA 1BYCA 1SJAA 1EIXA 4TOQA 4EACA 3B0XA 1Q6DA 4CNNA 4MUPA 4EPEC 4G2DA 2EQDA 1A3WA 3A12A 1QHZA 5LGXA 2A3CA 2A3HA 1DJIA 1AD4A 3SEPA 3I6RA 4Y9OA 5BZAA 4JR5A 1XJBA 2UY5A 3OLEA 4GC3A 4IMCA 4J28A 4W93A 1NOWA 3S0CA 2P8BA 1L6SA 4JL1A 3WD3A 3W2LA 2WVVA 3B03A 2PTDA 4NJKA 2XUCA 5HJLA 4PMNA 5EMUA 1EZWA 1JCJA 4L6HA 3UNDA 1UWAA 4WUIA 3TC3A 2ZUWA 1HW6A 1JDAA 2WVVB 3LCLA 4UFMA 1NM9A 5AYBA 5CKSA 4IMDA 1LL6A 3GXNA 1Q7MA 1GEQA 4TO8A 2GGIA 3CAKA 1NQKA 1C90A 1E4MM 3UWZA 4O52A 1EOKA 2PDMA 4AQLA 1KFCA 1TQJA 3H24A 2YW4A 5EBAA 4GYPC 1ITUA 4DELA 3WNKA 4IL0A 1I1XA 2BBFA 2DSKA 2OOFA 3MY9A 5K9XA 3C8NA 1Y0EA 4C7FA 1RQBA 5CBBA 2WZMA 4BHYA 4XIMA 2QLYA 4ZOCA 3CXOA 3B0PA 2JGQA 1JZ6A 1RBOB 1BSIA 1WDWA 4LS2A 4A8IA 1EDGA 3QV6A 1HO1A 3VZZA 3B9OA 3NPVA 1FH8A 1U1JA 3E2RA 3HV8A 2GDUA 5CBIA 4LXFA 1PCKA 2ZYFA 1KTBA 3QQ0A 5KEZA 4HSHA 1HVQA 1B90A 5C55A 1RBLA 3L67A 2DW6A 2Z7KA 4MHBA 2DZSA 4TU1A 4B2DD 3EX6A 4Q8TA 4AXKA 4GBDA 4QLLA 1MW0A 2ZA1A 3HGJA 3HZ3A 2YZ5A 5DMLA 2VI0A 4KESA 3C3NA 2IXVA 4ZCWA 1R9ZA 2BVWA 1JYVA 4GKTA 2J8FA 1FWGC 4P2VA 2CU0A 2WNNA 1QNRA 4ERAA 1PYFA 3CQHA 3LSCA 2PMQA 3R4IA 3M5VA 1XH0A 3AXKA 2G0WA 1TO3A 5LXEA 2KZHA 5D38A 3KZPA 4I5RA 5CEWA 2XM1A 2CWXA 3W6MA 4J4KA 1VFOA 1K8CA 4H9VA 1HNYA 5AHEA 3ARSA 1EHAA 5C6MA 1K6AA 1SU5A 1BWVA 2EPMX 3R10A 3VNDA 1KXTA 5E0FA 3WMSA 2XIMA 1MWOA 4O1BA 1V7YA 2J7HA 2ASHA 3DGBA 2C1GA 4Z17A 3AC0A 1B5TA 1ZPTA 2WSRA 3M0ZA 3ARRA 5BMXA 3EB4A 1DYSA 3DFNA 1DXFA 5DMYA 4CCEA 1QOPA 1KR1A 3GNRA 3MV01 3E0FA 3W7EA 4IHCA 1JZ8A 3PJWA 1OCQA 1PZ1A 2VFGA 2IKIA 3O2LA 4B5NA 5HXMA 1Q65A 2QXWA 4KT2A 2CETA 3C2EA 4NHVA 3IARA 4XZMX 2OKOA 2VEFA 2Z2UA 3IV3A 3DC0A 4YVVA 2H9AB 3F4CA 4WDTA 2P0OA 4LAZA 3KTSA 4RX0A 1E73M 1W5QA 4CGTA 2OWWA 3W71A 1T6MA 3NXFA 3WKZA 4FX7A 1K9TA 1TVLA 5FEXA 2GL5A 3VTRA 3BV4A 3QSRA 4S39A 2DSUA 2VX6A 3DG3A 2HZGA 1FWNA 3CUJA 3NURA 4KMQA 4C6EA 4DXKA 4KWOA 1XP3A 4YMZA 1RAKA 4YVPA 3W1AA 5H1WA 1VFFA 1VCFA 1YDYA 5CGQA 1VLWA 4CLMA 1N8WA 2OSXA 3CC1A 3KX6A 2PDIA 1LBFA 1YYAA 1Q6RA 2C14A 2CLPA 5AN7A 2OJPA 4AX7A 4AEOA 5BYWA 5LIUX 2GQAA 1JEZA 3DI1A 1E0VA 3NYDA 4HMNA 1ALDA 3WLLA 1FH9A 2GWGA 2BG5A 4HPNA 1TPVA 3WJSA 2QS8A 3BLFA 3CV6A 4CQ9A 2ACSA 2VTFA 2QCEA 2CHNA 4P8WA 1XWYA 2DU2A 1J93A 4PCFA 2PDUA 1O5XA 4PL2A 1A3XA 2PWHA 3MDWA 4RKAA 4KWWA 4INFA 3CAQA 4AD5A 1XIEA 3H7VA 1Y5WA 2GUBA 2Q8ZA 1M1BA 3A3WA 1E4LA 1QW8A 4E5TA 5TAOA 1FWSA 4MVAA 1QOQA 2HJPA 3ARUA 1IT8A 1XF0A 3WLRA 2YB1A 3CV7A 2PLCA 2D2OA 5AYIA 2DIEA 4XO6A 3AXHA 3EDJA 1R3RA 1AL7A 4UFHA 2YDSA 6REQB 4RNHA 3CEUA 2C6QA 4ES4A 2ACRA 4RR4A 1V0LA 1QU4A 3NL2A 3A9IA 4MJ2A 2ISWA 1BPLB 3T0BA 1OINA 2V0TA 4Q22A 4GUIA 3MB9A 4P8UA 1I0DA 3DFSA 2E77A 2ZRWA 4QITA 3BO9A 3S83A 1S5VA 2VR2A 3R13A 4AZCB 3LHUA 1THFD 3M0VA 4AYGA 2YCEA 3NZRA 1NARA 2WOQA 4H2CA 5FJJA 2VFEA 5KITA 2FH6A 2ZRXA 4JQAA 4PMOA 2EPNA 1F6PA 5CZ0A 1OFDA 4Q6JA 5M3WA 4NAEA 3G6LA 5GPRA 3SRFA 3TNBA 4DF1A 3DU0A 1R46A 1TE6A 1H2JA 3I4EA 3HGSA 3FDKA 3AIQA 1L6FA 3UJRA 3FAWA 3BWWA 3ZJ6A 1UMYA 4HA1A 3PBMA 2ATSA 2I5IA 1B9BA 3SR7A 2YCJA 1Z9AA 4IX2A 4M6UA 1CBGA 2GOKA 3BW2A 5CJ5A 2XFWA 4LBUA 3UR8A 4O1CA 4J3XA 4H3DA 1E43A 3C2RA 3ECQA 5EL1A 2DIKA 4HHLA 3L0NA 5FF4A 4D6JA 3U9IA 3GH4A 4LQ1A 3CIWA 3LMZA 4F0HA 3W26A 3T0CA 3HJEA 1DORA 1G67A 2Y8KA 3PB2A 2VURA 3QXBA 1BXBA 1I2NA 3KBNA 2CZ5A 4D71A 2FIQA 5FOOA 2CNCA 4F9JA 1TVPA 4N4PA 3H4GA 2HRWA 3DERA 4MAZA 1D8WA 2GWNA 4WSHA 1A5BA 3KL0A 3NDZA 1XBXA 3E0WA 1J9YA 3CYJA 4UOZA 3OYZA 2WSKA 4MKVA 4LVFA 3FJ4A 4AZCA 1VZWA 1EA0A 1U5VA 2V5BA 5FSEC 2NT0A 3PZ9A 1JGIA 2YSWA 3HTWA 4A8RA 7PTDA 4QRNA 3M9YA 2PF8A 4Q4MA 3NO3A 4GJJA 4ZXOA 3TQ0A 5C54A 3NOYA 3CNYA 3IRSA 3GQYA 3QQWA 4NAEB 5LIKX 4GVHA 2PDPA 3PJUA 4S3AA 4UZUA 5D05A 4GX8A 3GTNA 2Q3OA 4H8NA 4LJ3A 4CD4A 4RDYA 4UC5A 4OBRA 4AF0A 3C4UA 1ZJAA 3GAKA 2OLSA 2QULA 3WZ0E 4LTSA 4C90A 1JZ4A 1GG0A 1MXGA 3FEMA 2E5CA 3TH6A 2I9EA 1GQJA 3TZFA 1R6WA 5AYYA 4IF2A 4KS0A 3WBYA 3FFSA 5IFTA 4Y8EA 1NVMA 2X1UA 3V18A 1R7AA 3KOZA 3QV9A 4J2PA 4FNSA 2QKFA 4LVBA 1D2KA 4J5NA 3MI3A 1TSIA 4B4FA 1XIGA 2J9YA 3KEHA 4S1FA 4GFSA 3WK0A 3B3DA 3FN9A 1MI3A 2J9ZA 4AD0A 3ARPA 3IJ7A 2J66A 4W8BA 2XN0A 4LAOA 2GQ9A 2B4GA 3GHSA 3LCIA 1IGWA 4XAFA 5EMKA 4UFKA 1QPNA 3EMZA 1EYEA 1SZEA 4KQNA 3M64A 5I07A 1K9EA 2DT0A 3SDOA 1P0EA 3PWIA 4NG3A 3HFYA 1EXBA 2DUAA 3CH9A 2ZRYA 3VZXA 1HTIA 3PTKA 3G1SA 3KBMA 3LRLA 1XLAA 3T09A 2ZRUA 1QI0A 2W0UA 3GXMA 4GQ0A 3IVSA 3CZGA 1GOKA 3NWRA 4PUJA 4LCQA 3AIWA 3U5UA 3EMQA 1GVSA 3ARXA 1UKSA 4WY0F 3QR1A 4DRSA 3W2MA 2MNRA 3T9PA 3W1NA 2R1LA 4GNVA 3IUHA 1M03A 4PTXA 2E1WA 1TJ2A 3W7JA 1OT1A 3AS2A 1E40A 1KTCA 1YMYA 3S3GA 1LLZA 1TZ9A 3HQPA 3ITGA 1BGGA 5A6BA 1WZAA 1XICA 1QHOA 4AZBA 2Y5SA 5U4NA 2G96A 4GZIA 3TWAA 3ARZA 1X1OA 4XZHA 1K7EA 3W73A 1UA3A 1R9YA 7XIMA 4UTTC 2ABBA 4WXYA 5E9XA 2PLMA 3F03K 3QHMA 5EBUA 2HROA 1OX5A 1QK2A 2ZADA 2REQA 3CT7A 4F4RA 1V4YA 3EX4A 3FCPA 1GJPA 2WWDA 3FV9A 4F3HA 3W27A 1X6NA 2IQ0A 3CPUA 3SN4A 4AD1A 3BCDA 3THDA 2V5JA 4ADSA 4JTTA 1Z32X 4BR1A 1PIGA 4MWAE 3HOJA 2EPLX 2KX9A 2YLLA 3BH4A 3BPWA 3ZFHA 3T0AA 2DZPA 1KM4A 2V81A 3PPFA 1H63A 3AAMA 1ZZMA 2G41A 4Z2KA 1OJXA 4Y6GA 2VZUA 5AHMA 4LYPA 3O1NA 4MY9A 4X22A 2H9AA 3N2OA 1K4GA 4CQBA 4HK6A 1V7AA 1E6SM 4GIEA 2BVYA 3UR7A 1H5YA 3PPCA 3PUEA 4UTWC 1JFXA 4MOZA 3H2EA 3ME3A 3NZGA 3GNOA 4CVWA 3F4VA 3C61A 5HWJA 5JIPA 3CT2A 4RNJA 3C0JA 2F6KA 3VC5A 3ZSSA 3PPGA 2QVHA 3WF3A 4URIA 4MWAC 2DEPA 2XH0A 3VIKA 3GC2A 4DZHA 4LANA 5BXSA 3L4YA 1QO2A 3UVIA 4A4AA 4ZQRA 4B9ZA 1VIZA 4OU1A 2D0FA 4HTYA 3L23A 4UTUA 2PDQA 3T0DA 2CW6A 2WMJA 4CQDA 2JK2A 1EH9A 2CZEA 2O7QA 4A05A 3CBWA 4RDWA 4JIPA 1BTMA 4WVXA 4MNKA 3WIJA 4RXGA 5AYZA 5FEZA 5EFFA 4U33A 1IZJA 2BVDA 3SGGA 4JFVA 3MDUA 1BVZA 3TE9A 2CHRA 1WXJA 3IACA 4FOUA 3GZAA 1KFEA 2BGQA 5E1QA 1XLIA 2QPSA 5K3VA 1TB3A 4GKLA 1XYZA 2A79A 2ZX8A 5ABEA 2WJEA 1XCWA 3UXLA 2Y70A 3NL5A 2YBTA 4HPXA 4I5UA 3U2CA 5CC7A 1XYFA 1G69A 4NZ5A 4I90A 4EF9A 2UZ9A 1QUMA 1A5KC 3OQ8A 3EWCA 4RPQA 2XHYA 4JTAA 4MDPA 4MADA 1H7XA 5AFDA 1DBTA 2VNCA 2R14A 3MWAA 1J6PA 3MKCA 3EEZA 3MUY1 4GUHA 2D23A 4DYJA 2NV1A 1V0MA 4F48A 5A95A 1FWFC 5L6UA 4HNNA 4H8UA 2YXOA 3F4NA 1WP6A 1XQLA 4NY2A 4MYAA 3TP4A 5EB8A 4UFLA 1AQFA 1JUKA 1BRLA 4C6OA 1V02E 4QLJA 4PUMA 3O3RA 3UJSA 2YDQA 1SFTA 1CECA 3HF3A 3O6YX 3O63A 2E5DA 3DN5A 5D04C 5A8MA 2FMNA 3VM7A 3D46A 4MY8A 3PB0A 3COTA 3DGRA 3SUWA 3SUUA 3Q2DA 2BHZA 2AQWA 1WE5A 4HHHA 3EKZA 4Y7EA 5PTDA 1DIOA 1Z44A 4DUXA 2E0PA 3TR2A 4LNCA 3MSGA 4S3FA 5F1UA 2XJ7A 1UUMA 1ODUA 3PNZA 3IAQA 4IG2B 3M6YA 2AAMA 1NP0A 3EWBX 3WFAA 4S3CA 3THAA 4PUKA 5ECUA 1H7RA 5F2IA 1UR8A 2QCLA 4GH3A 3WQEA 3QTPA 3LPOA 1G4PA 4GZ7A 4N9DA 3I68A 3PUGA 4G7FA 2RDXA 5BRBA 1OX4A 3GDMA 3GBDA 3TW6A 2J88A 4HT3A 1PXGA 4KPLA 3GHTA 5FJTA 3M41A 3GFYA 4HPJA 5I79A 1ISVA 4Q8OA 4JKKA 4AZIA 3EA1A 1AMKA 3T0TA 3O7UA 4D6IA 3UGRA 4XZWA 2AMXA 5AYXA 4H04A 4QDMA 3KM8A 1BVWA 3R0DA 1E4NA 2Z7GA 6CGTA 5AC7A 4C6JA 2G3FA 3BV7A 3BZGA 3BLKA 3QY7A 4TXEA 1WUFA 3TN6A 4V27A 4CD5A 1M9HA 2PDGA 4E2OA 2O55A 3GBEA 4S3BA 3PZTA 3S6OA 4EANA 4X9YA 3R1ZA 1LOSA 3LPFA 1B2YA 5HJXA 4IG2A 1E56A 3CWHA 2FDMA 4H6EA 4NI3A 8CGTA 2XFYA 1YTEA 4LY8A 1IGSA 1O4UA 2OEMA 3MUIA 2HMCA 4DBUA 4I9JA 3NXLA 3W88A 3R94A 1FHVA 2BXZA 3ZMRA 1XLJA 3ABQA 4B3KA 4HYRA 2VFFA 2Y7GA 4S23A 3TV8A 4GHRA 4LC8A 4B5VA 3DG6A 3J7HA 3SUSA 1UZ4A 4GCXA 2D22A 3S8HA 3W1MA 3LI1A 3TMLA 3WMCA 2OFJA 3GG8A 3AFBA 4HOZA 4W5UA 1EDTA 4ATLA 4B3LA 1IQ8A 4B9YA 4GBUA 3MUCA 4NZ4A 4E3VA 3RXZA 5HUOA 4F0KA 1DV7A 1UD2A 4ZB5A 4MNJA 4DI8A 3GH5A 4TX6A 3KW3A 3GSMA 3MT1A 4GVFA 4JKMA 1BG9A 1TX0A 1C91A 1Q2SA 1NH6A 4EPBC 4I7WA 4XBKA 1JCLA 3W2KA 1OFPA 3H21A 3LZ5A 4A3QA 2NQZA 4GNJA 2PA6A 1WXZA 1V6UA 1F3WA 3QFEA 4WZHA 4HP5A 1CNVA 9XIMA 3SCNA 3W2NA 1UWTA 1VBHA 2GUUA 4DM2A 1P7TA 3W4RA 5FL1A 2WCAA 2G3IA 1B3OA 1S2VA 1OGGA 3LERA 4YYFA 2I14A 1YHTA 4GWEA 3QMRA 3N6HA 1TPWA 2DH2A 3S42A 3EB2A 3GXDA 2EO7A 2XGBA 6ENLA 4MZ1A 3VIIA 2A1YA 1O5QA 3OJGA 1YKWA 1R9XA 4QE4A 3T1GA 1SO3A 2V8ZA 4LYKA 3MTWA 1PO9A 3RM9A 3VDBA 4LUSB 3GYEA 3C0SA 1G1YA 1QPQA 3LYEA 4HMCA 5IDIA 1B1YA 2E9BA 2D73A 1QRQA 1JL8A 3ABRA 4UTLA 1ZUAX 2WPBA 3WLQA 3RCMA 1J96A 3S2NA 3GVQA 1VFLA 5HWMA 3MW7A 4HBKA 2BY0A 3B4YA 4TVDA 1CGXA 5AY7A 3ARVA 4Y9MA 3R58A 1ECEA 1T41A 3AYRA 1PTAA 4I5XA 1ESWA 3MP3A 1WOAA 3MHGA 3SB0A 1L2UA 1L8PA 3H2CA 3BE7A 4YWIA 1L0PA 5CAKA 3KCLA 1LQ0A 1NWUA 4BQ5A 1O1ZA 3BMVA 3R6IA 4B3ZA 1PTDA 1G7UA 3WQ5A 1AG1O 5J5RA 2CXEA 3RLGA 4AUBA 3RU6A 3RN6A 4JTKA 4C5YA 3SECA 3IK4A 2B31A 1KFBA 3LRMA 1TG7A 2X2YA 3DUGA 3VGGA 1E1CB 4D6CA 3PBGA 3N3MA 1ME9A 2PGWA 1C8XA 3HG4A 1R5YA 4LALA 4YN5A 4GYFA 1H11A 5BWFA 3SCTA 4REQB 3THCA 3WQ4A 1QO5A 4Y8FA 2VC6A 2QDHA 5XINA 2CIPA 1K8YA 2Z29A 4NT0A 2J47A 1ZB5A 2GZXA 2NX3A 3ALFA 3UJ2A 3CTLA 2V2CA 1IXPA 4NRSA 4IH3A 3PR2A 3G1XA 1HZYA 4WDUA 3WEOA 3NGFA 3VUPA 1OC7A 2QMJA 1YDVA 5XIAA 3E02A 3LLXA 4LS0A 2JIWA 1ISZA 4LC6A 4REQA 2QUNA 2VCCA 4X60A 4MNMA 2X7WA 2I5GA 5FA5A 3ZQ9A 3SGZA 1K03A 1JDEA 1H60A 3HQOA 2BX7A 2CLHA 2A2IA 4WJEA 4DPPA 3T40A 1GW9A 5HNNA 2FFIA 3VVGA 2DGAA 3OPSA 1X7IA 3LEPA 1JPMA 1TRDA 1U30A 2YYUA 3URBA 3NNTA 2TYSA 4BK9A 2AQVA 1YPIA 2TSYA 4HZ8A 1Y5VA 5I7GA 3G1FA 2NV9A 4NJJA 4HOWA 1Q5MA 2EAWA 1QNOA 2P0IA 4EWND 1NDWA 4MWAA 3GD6A 3OVQA 4H2HA 4HJWA 4JNYA 2XGIA 4H6QA 2IPGA 5LA1A 4HU8A 3UR2A 5AOUA 3N9RA 1M68A 4Z1CA 4LW7A 1Q6GA 1XSKA 2GK1B 2J13A 1GKPA 5A6BD 3BAKA 3ZR5A 2CBUA 3OBAA 4O0ZA 4B2DA 4ENLA 1HXJA 2ZUMA 4PR4A 5K9CA 4PUDA 3CQKA 4LUSA 3VDHA 1R3TA 3PC0A 2XH7A 5HMSA 2W92A 1DJNA 5D9PA 1FKXA 1UD6A 1W5MA 4QSFA 3OZMA 3K5XA 3CLMA 1CXFA 3UZZA 1KBKA 3GKFA 3HU7A 4I9AA 3E38A 3EOLA 2J62A 4PMZA 2HS6A 1O95A 4RW5A 4C5ZA 4KWVA 2W6RA 4HA4A 3LHZA 3WELA 4HCDA 3LOTA 1AQMA 5JIWA 4L9XA 4AHPA 3H54A 1HVXA 3RPMA 1KM5A 2I17A 5A6LA 4ZEPA 3DOPA 1F3EA 3BOXA 2QT3A 3GVGA 4R85A 4W7UA 3TVAA 2DP3A 4GO9A 1GORA 4IT1A 3R5EA 1GOOA 4KGJA 4O1EA 1XFBA 1B30A 1KCXA 5M17A 4GUGA 3UZWA 2F8QA 3DC8A 1LQAA 1MW3A 2VHLA 1AFSA 3PBWA 3AUOA 4AMAA 2TAAA 4IFRA 3BTNA 5I0DA 3G8EA 3EBVA 3BW4A 3VGEA 3CZKA 4NASA 4F0RA 3TN5A 4DLFA 4OECA 4GXMA 3V5OA 1BSLA 1O6IA 4IL2A 2CITA 1CZ1A 4IJBA 3WEMA 5F2LA 3T2PA 4RJEA 1N82A 2YYTA 4H9TA 4IJRA 3LBCA 3B04A 1LLOA 2CEQA 3CIXA 4JOMA 4H7VA 3MCMA 5G1TA 5A3HA 2VDIA 3NYZA 1P43A 1UC5A 3MKKA 3ES8A 5CG7A 5DMMA 3QH2A 3TK7A 5A1AA 5CGTA 3FYPA 3C2VA 2ZOXA 4XV0A 1SQ7A 3G5EA 4LB4A 5A8OA 4GIRA 3CHCA 2OYKA 2DT3A 1P0DA 3C56A 1GVRA 3QRHA 3G0XA 2NX1A 5D03A 4DY1A 4XAGA 3QGKC 4JDYA 2DUXA 3RU8X 1UWRA 3R25A 4PA8A 3AIRA 3MBDA 3RITA 3W74A 4YCPA 4UQ9A 4WD0A 1GCYA 2PC8A 3FXGA 5BROA 3T8QA 3KFTA 3BAYA 1UMLA 4US5D 1P6BA 1JI1A 3EOUA 2ZUVA 3GXTA 1KA9F 4PE8A 5KZMA 4UCGA 1LWJA 4UTKA 5E70A 1J0ZA 3RDKA 3L4ZA 2QJIA 4F79A 1SM9A 1ZU8A 2IQTA 1GJWA 2FB2A 1TPEA 2NQ9A 1JF6A 3GU2A 1YBQA 3QKZA 1WUEA 1ZFJA 5I23A 3UFYA 1XPYA 5DF0A 2O0TA 1EP2A 1W9UA 1E0UA 2VEGA 2EJ1A 1KKRA 4HHPA 2ZVIA 2Z1KA 4DAIA 5HMDA 4GY7A 1F61A 5FF2A 1AODA 1H51A 4LV9A 2W3ZA 1BKHA 4JQ2A 1F2JA 3JRKA 1HKJA 1JPKA 3RM8A 3K4AA 2XH2A 3W53A 2ZA3A 3LGGA 1UH4A 1J12A 2H8XA 3BL3A 3GIYA 2WXDM 5DCDA 4D2JA 2DQWA 3VM5A 4H19A 3ZLFA 1KR0A 1HJXA 2PDWA 2O56A 1XUZA 1QK0A 3U7BA 5T26A 4K39A 4WIWA 5BOFA 1R7OA 4C1KA 3B9DA 1S5TA 3DG7A 1XUUA 2HBVA 3KS6A 5U7SA 2IW0A 3M5XA 1Q2RA 2EKGA 2BVTA 2Q3RA 1UH3A 3BG5A 3IUDA 4JX5A 4ZOEA 3IJQA 2XSAA 3L65A 1H7WA 1X7FA 2XWEA 5E0CA 1E5JA 4UR9A 1FCVA 3W7NA 4HCHA 4YTQA 4CKQA 4HMDA 4XKYB 3UVAA 1A5CA 3GLCA 4QDPA 3IAPA 3CGTA 4ERIA 3OHMB 1E6RA 3B8SA 2YA1A 2QW5A 3VGHA 3EPMA 2VZTA 4AEFA 1WV2A 4AMCA 3GDKA 2NXGA 2XIJA 3NM1A 3SCQA 1J11A 2WVSA 3TQVA 4AIUA 3A9BA 3BXWA 1N7KA 3K30A 2PFHA 4OV4A 1JD7A 1ZNNA 4H7ZA 3W7HA 5BXTA 1BEUA 2POTA 1TV7A 1UR0A 1D3CA 3B9NA 2JFEX 3H2AA 4XG1A 5G5IA 1P4CA 1UG6A 6PTDA 5IFPA 2RUSA 2WZEA 1JZ5A 4K7VA 1PVNA 4QS5A 4B5TA 1XYAA 4JXCA 2F7FA 5J5DA 1FWAC 4C1NA 5HQLA 1B9ZA 1XS2A 3I3EA 1SSGA 4C6KA 4B16A 4JQ1A 4IIEA 4BEUA 1K70A 2B7OA 5G1MA 4A6GA 3URQA 1S46A 1TPFA 4GMEA 3MPGA 2EF9A 4S3KA 4DBDA 1QNQA 1EC8A 2Z1XA 1J0HA 4K3ZA 5ENLA 4GY1A 1UBPC 3LCXA 1TR1A 3RUBL 5DT5A 3V7PA 4N9CA 4ZOAA 1IR1A 1VYPX 3NTYA 3HIJA 2PI6A 5HWNA 3PTMA 3FGCA 4JTCA 3W07A 1E4IA 1FWTA 5IRPA 2Q71A 4BI5A 1KLZA 3UBPC 4DWSA 3MBFA 3P14A 4JN7A 3GWQA 2FPTA 2CPUA 3OZPA 3RLHA 2XVPA 4JGDA 1RQEA 4XTIA 4NJIA 1TTQA 3VOGA 1PBGA 1A3HA 2DORA 2E8ZA 3Q4DA 4ZOBA 5LGZA 3E2VA 3W86A 4W5ZA 4QP0A 1TVNA 3W0KA 1VD6A 3MMTA 3AZSA 1D7FA 3P61A 4H6KA 3S46A 1IXQA 4TTGA 3ENLA 1QDSA 3AMLA 3GO2A 1FQ0A 2WQPA 2QCCA 4UQCA 3VU2A 1R2TA 3DZ1A 1L6YA 1FCBA 4CU7A 3T42A 4K68A 2GJXB 4HNVA 1DWFM 1TZ7A 2XFFA 1BD0A 4ZGYA 2VFIA 4A22A 2J7DA 1DJWA 4G9PA 1FH7A 4YVXA 1XH1A 2XVGA 3E5BA 2QUTA 2PDNA 3M0KA 1IV8A 2FZBA 1M53A 3VDGA 1BXCA 2VRJA 1GZ1A 2PBOA 3CL8A 4DAFA 2GUYA 4RXFA 4ADUA 1TCDA 2PGFA 3OGRA 3IJ8A 3PNUA 3BSGA 1A49A 3O05A 3PULA 1REQA 4Q7NA 4BKNA 3A3HA 1V3MA 2QV4A 3AHYA 2HPMA 2IKGA 4AC1X 2QAFA 3MVTA 5CC3A 3BDKA 3CUXA 1S39A 1XLBA 2GVGA 3GM8A 1SJCA 2A3LA 1LBLA 4LNYA 5M03A 1H3GA 4GLEA 1Q6QA 3CS2A 4QJ1A 2R8WA 2Y89A 4YL2A 1HIZA 4ZMGA 1VPYA 2TPSA 3E2QA 1JCMP 3CK5A 1MEHA 3BLOA 3WBWA 3CUHA 5CPLA 1BYDA 4A8LA 2W63A 3N3TA 1JAKA 4UXDA 3DHUA 3LY0A 4TQTA 3P6LA 4AHOA 3V16A 4NXKA 2C0HA 2HVMA 4WJ8A 2RGMA 3RIKA 3AJ7A 3GTIA 5HBFA 3F4WA 2OXNA 4D8ZA 5F2GA 1BAGA 5HAOA 4PODA 1HT6A 3VMOA 1OY0A 2XH4A 4ATDA 8A3HA 2POZA 2WNZA 2NX9A 1MNSA 2VX4A 3FKKA 1T8QA 3W7KA 4KCVA 3S9ZA 3FEQA 1X1NA 2PP1A 4LU0A 3EB3A 1XG4A 1R2RA 1A5AA 4MY1A 4F2BA 4WEVX 5TF0A 4J40A 1HL8A 5MKGA 1C29A 4IP4A 3EDFA 3KXQA 4E8DA 1XYMA 2J4GA 5CZSA 1SJBA 4R33A 1ZY9A 4RZ5A 5KSWA 1UPMB 1HKMA 3MWCA 3S5NA 1QI4A 2BB0A 4GGHA 1QMLA 3MQTA 5I2UA 2YCLB 1TJPA 3O06A 4X9SA 4JZ5A 1M3UA 3V75A 5I5RA 2R1MA 1GHRA 3DESA 2DY3A 3CUFA 3HPSA 4CUCA 1ML1A 2Y1HA 5CC5A 2QCGA 2XZ7A 4Q8QA 4NJHA 1PB0A 3BJSA 5I03A 5EMMA 4HJFA 4QCFA 2PS2A 2O9PA 4KWUA 4GABA 4ZO9A 1DXEA 1MUMA 3CPRA 3ZT7A 1FFQA 1R87A 1HP4A 3UG8A 5FAGA 1JNDA 2ZA2A 2HS8A 3PZVA 3E49A 5HMFA 1E51A 2R24A 2UY4A 4Z1YA 1L8NA 4Y9PA 1TIMA 4UQAA 3H6OA 7ENLA 1WO2A 1TPB1 4BWLC 1K8ZA 1YTKA 3LLFA 5I77A 1E6ZA 2ZX6A 3KBWA 1QNVA 2BSLA 2WMIA 1ZAIA 9RUBA 2VC5A 4GY0A 1QJWA 4JAWA 1JZ3A 4H00A 3SO7A 2E9MA 1LWIA 1XLCA 3FA4A 1WDSA 3BSMA 4IIBA 3NUKA 3EXRA 5IXEA 1E6QM 3WJZA 4ALDA 3G1YA 1QASA 1YDOA 1ICPA 4WKHA 3TTOA 3LCHA 3H12A 1CGVA 3VIPA 5TIMA 2VVSA 1KWGA 4J3ZA 3ZLGA 2YX0A 2Y5EA 2Z4GA 1BF2A 1M7XA 1QNSA 5A6JA 2X0HA 4S38A 2ZZ5A 1X97A 1S5WA 4GVGA 4O14A 3TYDA 4XKMA 5D9OA 4XZBA 2XIIA 3GW0A 4LEFA 1TWDA 1XM3A 3TUUA 4WDWA 4RE3A 1VFTA 3HPZA 2XIQA 1G4EA 3UCDA 3W02A 3GU9A 3VX0A 2PZNA 2YXXA 5DMNA 1V93A 3KRSA 1K7FA 3TTYA 2XDFA 2HBXA 2YA0A 4Q4PA 3UERA 3FGCB 4Q4SA 4B5XA 1RA5A 2FKPA 5DT7A 3A23A 2CWNA 2BS9A 4HA0A 5CZTA 1JCNA 3FJ6A 4MKNA 4JFSA 1CTNA 3W1UA 1EC9A 1OG0A 3VD5A 5HATA 3GG1A 4O10A 2HVNA 1A5UA 5CPMA 3V36A 4IZGA 4M3PA 4CD7A 1ZSXA 3F5KA 3NVDA 3ICJA 2CZDA 3W7RA 3B8VA 2NVCA 4IMGA 2GDVA 3DCPA 3L4WA 3T05A 2YKKA 1UIOA 4MPQA 1X8CA 3VGDA 3E2SA 3LENA 4TIMA 1RBAA 2OT1A 1PIIA 4Q8UA 3CHDA 1DJQA 3MS8A 4FA3A 1SMAA 1XIHA 4HTBA 4O8RA 2OZ0A 4RCXA 1WAUA 5KZ6A 2E09A 4M8UA 1M7OA 4IGNA 3UPMA 4C65A 2VC7A 5CAHA 2P1FA 1YDNA 2FPVA 2CZFA 3GFXA 4TR9A 3GR7A 1OC6A 2LLEA 4MWAB 4ZTYA 8XIMA 3ANUA 1KCZA 1X39A 4PMXA 5DEZA 3SIMA 3TSBA 5TNVA 1OYAA 4RZBA 1LROA 3LMYA 5GNXA 3K13A 3AYSA 3CQJA 3SN0A 2AMGA 1PWMA 1DJXA 1QR7A 4IPIA 1KM0A 1MFVA 5EU9A 4ZFMA 4U31A 1U33A 4MDOA 2D0GA 2EPKX 1GNXA 3TFXA 4TVUA 4KKXA 3MKVA 4NQ1A 2DH3A 4P61A 3PTQA 2NQ5A 3BJTA 2DZXA 3CUIA 4E4PA 3WQCA 4PUUA 3RMEA 1NDYA 4B5UA 1LL7A 4XUYA 2HWGA 4ZB0A 5CG0A 2IPFA 4WKAA 2EXOA 4R88A 3SY5A 3G1AA 2INZA 3L9CA 2PPGA 1UJQA 1U5JA 5CCZA 4K8GA 2NLYA 3N4FA 5A8PA 5CZJA 3CZEA 4DEFA 1XLEA 3W25A 1GONA 1VBJA 1KBLA 1XLDA 5A8QA 4BEQA 4RNFA 1OADA 2I9UA 3LLDA 4M29A 4P5UA 3NL3A 3OLDA 4QGCA 4MG4A 2YXGA 3PZMA 3H7UA 3WJWA 2WMHA 1HG3A 1KBBA 5EGRA 4QHRA 2Y4SA 3L12A 3FOKA 2V2DA 3G18A 1TPH1 1DL3A 2WPGA 4WDXA 3IEBA 2O9TA 4JN8A 4UQEA 2VFHA 1K77A 2BXVA 2R82A 3A21A 4LX4A 3UEQA 3QLDA 4CEXC 3FIGA 4A2RA 4JY8A 3W7OA 3XINA 3CHEA 3ONBA 4C6LA 4U2YA 3EWWA 3NAVA 1HF6A 4D9PA 3SSJA 2WVTA 1VC4A 1V5XA 4R7JA 2PDYA 3VOFA 3POHA 2C3ZA 4L9ZA 3EPOA 1AD1A 4AWTA 1DE6A 4NL1A 3WF4A 5FF0A 3QZAA 1V3JA 1ICQA 4X2PA 3PF3A 3SCSA 1WB0A 2V3FA 1IWAA 2X30A 3VKDA 2VEMA 4RV8A 3MYOA 2B7PA 2ZZ3A 3P8IA 2R1NA 4FF5A 3NEVA 4MSSA 4R9XA 4AG0A 2VP8A 3GNDA 5TBOA 4K1WA 5HA7A 4AZ7A 2ZX9A 4JYFA 1SVDA 1GVEA 3EWUA 2Y88A 3VPLA 1XG3A 1U1HA 1MUCA 4QTGA 4KGLA 1GG1A 1K9FA 3O6DA 4LV4A 4CEUC 2D2GA 5E9AA 4PMQA 4AC7C 4BF7A 2RKXA 1GVQA 3APYA 4U2ZA 1WQ5A 1LM1A 3TA6A 4M6VA 1WAWA 1Q4NX 3KP0A 1UKOA 1NOFA 4U3CA 1E70M 2HV5A 4IPPA 2GJRA 5BCAA 4QS6A 1TPUA 5T8GA 2OWXA 3OYXA 4UR8A 4V33A 3W28A 3UG3A 3P60A 3WUFA 1XCFA 4UFIA 1XBYA 4IQLA 2I7GA 5A2CA 2PWDA 3PZIA 2ZXDA 1JDDA 2HEJA 1A0CA 4XD4A 3ZT5A 3VDAA 1E0XA 5D32A 4NSBA 2PUZA 3FW6A 2BY1A 3QBUA 2ISVA 4FXFA 1CXLA 4I9MA 2D69A 4F2TA 4W7VA 4FO4A 3KBVA 1S2CA 4I8DA 4BFAA 4LBSA 3ERPA 3TONA 1G4SA 2FGBA 3N04A 1FOBA 7REQA 1SMDA 4JTLA 2G3JA 3L7RA 3PPHA 3NQFA 4IFKA 3M16A 3GS6A 1AUSL 4I7VA 4HSNA 2AGKA 4HIBA 3W81A 1ZJIA 1PE1A 3EDDA 3PZNA 2ZUNA 3H4XA 1W9XA 5LXXA 3UD6A 3L68A 4TX9A 5GNYA 2H90A 2NZLA 5MKGB 2FPYA 1OWQA 1PTGA 3WNOA 1Q8AA 2W4XA 1KGXA 4S3DA 1R47A 1PDYA 3FX4A 5CXPA 7REQB 2E6AA 2WSQA 4RE4A 3GDLA 1V77A 3OGVA 5IBXC 4HHMA 4A8NA 1IXNA 5C7HA 3W6LA 5I3FA 3S1VA 3QEZA 2GVJA 4KRUA 4A3UA 1VGAA 4IMAA 4YLWA 4IXHA 5DXYA 1DWIM 5CSSA 3BLLA 3VFLA 3MSRA 2V5LA 3DECA 2NVAA 3VXGA 3AYVA 5GVJA 3T8LA 6A3HA 1VENA 1OZQA 5CLTA 1KLYA 1QW7A 4QLKA 5FCZA 4CNOA 2VRKA 3LUTA 4PEEA 5FF7A 1PKLA 4HZ6A 1XSJA 4E4UA 1W9BM 2W67A 2PDCA 2PTYA 3MCNA 4MTVA 1GQIA 4L4PA 3O9NA 2BWGA 1EJUC 1BF6A 1AH3A 1YNPA 2ZE3A 2WLZA 2UWFA 3D3AA 2V3DA 1IR2A 1TA3A 3T2QA 3WG6A 2QJGA 3UCQA 2WKLA 4DJED 3EWXA 4GH1A 2GPTA 3SCPA 3UYCA 3RG6A 3F2CA 3SI9A 3M0MA 4OVXA 1BYAA 1EFZA 1JDCA 4D8AA 4IICA 3QSTA 2A3AA 1JIBA 1JG9A 1F4HA 2QZRA 3CHVA 4MJ4A 6XIMA 1M6JA 4JFTA 4AD4A 3OVRA 3H2NA 1EQCA 1JJKA 1T0OA 3DENA 1PHWA 1UOZA 1XRTA 1RCXB 3ES7A 2RJHA 1SO4A 2ZQ0A 1ZP4A 3BG3A 4GNKB 4JTJA 2PP3A 4L64A 3SJ3A 3B8WA 4QNEA 4RV3A 2W62A 3P67A 2X8RA 1RUSA 4IP5A 2VZVA 3AIUA 2AKZA 3M07A 1SPQA 2XIOA 3MUAA 3KCJA 3LS9A 1KRCC 2EGZA 4MZYA 5E09A 1E1EA 3GY1A 3VABA 1W1IE 1W9PA 3TN4A 1CX9A 2JKEA 3UA4A 2ADAA 4DIAA 3RLUA 1TTJA 5KZDA 3O6AA 4PBEA 1J5TA 4O13A 2J6XA 1E1CA 3N73A 3AICA 4LWWA 3TC6A 3VD3A 4Q8VA 3WMBA 3H23A 2QJMA 3BVJA 1DQWA 1K4HA 1BRLB 2IMRA 3RF9A 5FEWA 3ABZA 5KZEA 2VUNA 2Q09A 1VFMA 3HGRA 1QI3A 3WD4A 3HPXA 4W4QA 3NQVA 4O4VA 2FDSA 3EXTA 4ACZA 1OFRA 3RYSA 4PSPA 4GCAA 1AZ1A 1MXSA 3A24A 3UWUA 2VVNA 1ADSA 3DFTA 3AIEA 4IQJA 2YBUA 1MSSA 4OWGA 3SAZA 3EOOA 1I0BA 2BZNA 3TA9A 1XRSA 2GQ3A 5T9CE 2B7NA 3F1QA 1OQFA 2WCSA 2Y63A 3TTSA 3QW3A 4JIQA 4PTVA 4L6OA 4O0QA 5HNRA 3SGUA 4EXQA 3GRIA 4FLRA 1RP8A 4M6PA 3RPDA 3UCCA 3U5YA 2VC9A 4NZ1A 4H9UA 3R7MA 1IWBA 2JGYA 4JTIA 2F2HA 3HB9A 1I2PA 1SGJA 3U48A 4GPNA 1C3FA 4DJDD 1K3UA 4QR6A 4HU0A 1OCJA 4HU3A 1KFJA 1F7BA 3THQA 1OF8A 5BNKA 4MB5A 1H0GA 3M6DA 1O12A 3K8MA 2VGIA 1GPFA 4L56A 1OGBA 3MVIA 1FRBA 4PZVA 3WNNA 3REQA 3N6JA 2V3GA 4ZR8A 1E0TA 5LNSA 5LA2A 1ZENA 1AJ2A 1GK8A 2NT1A 5C0QA 1W9DM 5BRPA 4O18A 4Z0SA 3GG7A 5LNWA 3NEHA 5G2IA 3LXAA 2WK2A 4ZQMA 3WNLA 1Q8JA 4DYKA 3GHRA 4DO6A 4L1WA 3BICA 4FF7A 4DO7A 2X41A 4UZSA 2Y7FA 2YL5A 2FVKA 4F0LA 1EHNA 4CD6A 4E2DA 4JNMA 3CHFA 1H5VA 5BU6A 2Y7DA 3GVWA 4AF0B 1GUVA 1GOXA 4A35A 2VENA 2EBNA 1XDLA 1NFGA 1M65A 1B4KA 2V5CA 3CZLA 4MWAD 1QHPA 5D30A 1KGUA 4FAMA 2DSZA 5A5WA 3WNMA 2X1IA 1LDCA 2AKMA 2O92A 4K36A 3D3FA 4HYWA 3CUZA 4MYXA 1PJ9A 1XLMA 3ITOA 1E71M 4FXJA 3L4VA 4ZSTA 1J8VA 2X2GA 1RD6A 4F8XA 5AHNA 2J75A 1NSJA 1CPUA 4CN6A 1QI5A 1UR4A 1H49A 3ZR6A 2WBKA 1W37A 4Q8PA 3E9AA 3GTHA 3S1WA 3KVKA 4YIWA 3UA3A 4US5A 4I6KA 5BXPA 3SRHA 5LKYA 3C2OA 3GX9A 5HJYA 1E6PA 1P1XA 3DYPA 3HA1A 4G56A 1BQCA 1XYLA 4HVXA 4PUEA 4DQWA 2ZFAA 1YE6A 3PBUA 1FP9A 4FI4A 1H7OA 2QCDA 1O1HA 3VD9A 1IIHA 1EJSC 1EGMA 4F2UA 1H50A 2ZTKA 4EKJA 2ZUUA 3Q65A 3VCRA 1U1UA 3W37A 4BF9A 3TAOA 1EJTC 2A4AA 3WLMA 2PTWA 3PJTA 1UIPA 1XIDA 2A21A 4GX9A 1TWZA 1N2VA 1IT7A 1HQTA 2DJXA 4GE8A 2NW0A 3R89A 5C9UA 3E3HA 2EKCA 2BGNE 4FSAA 3QOKA 1FXPA 4WHBA 5D02A 4MB1A 1GVYA 1SO5A 5AECA 4ACYA 5KINA 3AWNA 3QC3A 4M24A 2Z28A 4Q4RA 3FA5A 3M0HA 1XGZA 3MYPA 6XIAA 5C2GA 1I2RA 2QF7A 3WLOA 3RILA 4JBRA 1XYCA 2P3ZA 4IQEA 4OGZA 4F0MA 2Y61A 2VRQA 1IIGA 3V0TA 4UNKA 2QCFA 4JTUA 3O07A 4AVNA 4BJHA 4GQQA 4GXPA 3QF0A 4A29A 1EWDA 4QX4A 2HCVA 3EDKA 4I9TA 3H53A 3BAWA 3O0FA 3A4WA 2J7EA 2AL1A 1CGTA 4HYVA 1Z48A 2P53A 4O1AA 4F66A 4OTKA 2J8GA 1OBAA 3MUZ1 1RQHA 4QM1A 1UZDA 2QAPA 3BLPX 2J7BA 4R9OA 3Q58A 1I2QA 3UWQA 2P3EA 4CU8A 3W9ZA 3GUGA 4J2MA 4H83A 1QCWA 5REQA 3SN1A 3OLIA 2BGSA 3PM6A 3MP5A 2ZUSA 3W3OA 2ZIDA 4OIFA 2Y8VA 2QYGA 5D8ZA 3UG5A 3W70A 3LCGA 4ZB2A 4RUBA 3E1F1 4JYEA 4UB9A 2DVXA 5CPNA 1B3WA 1C9WA 2A7NA 3NGJA 1UYQA 3RMJA 2AGTA 3NQMA 2XGZA 3SM0A 4B90A 2FHCA 1CLXA 4BI6A 3ALGA 3ONCA 2V6AA 3WL0A 3CO4A 1DOSA 4Z2IA 3QVQA 1YLVA 3EXSA 3QGVA 3IJDA 3OEXA 3AXMA 2HNEA 2BHYA 5B7YA 3TW9A 1E9ZB 3W23A 2KAUC 3PUDA 2PDLA 1VEPA 2OEJA 4KW2A 4HNUA 3R0UA 2UY2A 1GOIA 4HKPA 2OZTA 1JVNA 3LQGA 2BNJA 2D3LA 3AISA 3LGEA 4IGMA 1XISA 4PCTA 5D4YA 3WUBA 5I78A 2DZAA 3SUTA 3ORWA 2JKPA 4PC8A 3NPUA 1JZ7A 3TROA 4J35A 4TV5A 3GKAA 3UYIA 1GOQA 1FHDA 2YCKX 2ZCGA 4H41A 3A4JA 1FWJC 5D2YA 1Q63A 3TAKA 3ZJKA 2EPOA 3AJXA 2WJFA 3P80A 3GXFA 3VNIA 1AJ0A 1EO7A 1A5MC 4GYPA 2QHAA 1XDJA 2OQYA 1WYIA 3U3HA 5E6ZA 1A4LA 5G1YA 4XSLA 1H09A 1OM0A 4ZO8A 3L4XA 4DJFC 1HL9A 1OC5A 4XWUA 1UD4A 3QZ6A 3VMPA 1MZHA 3IGSA 4XQ6A 4LAMA 5RUBA 2OTDA 5F1VA 3ITXA 3RRAA 4DJDA 1HJUA 1YADA 5AHLA 4X2RA 3F5JA 2QJHA 4YCOA 1EGVA 1EX1A 3JZUA 2WMFA 3UY8A 3TJLA 1UWUA 5LSMA 3KBJA 3W7PA 2F38A 3C3UA 3MJMA 1IYXA 2ZDSA 1S1RA 1NY1A 4CCCA 2G5WA 4Z1AA 4FNRA 1LRQA 3RLVA 3NQBA 4ILSA 3K1GA 3EX1A 4O1DA 1TV4A 1XIJA 4YXGA 2ONEA 1EF2A 3PG8A 5GQBA 3WL1A 4F9DA 1BVNP 3MMUA 3PP7A 4CCZA 4P7OA 1ZBVA 3GAYA 3LZ3A 3Q45A 3MANA 1OK6A 4QJ5B 4E8GA 4AU0A 4CN1A 4O12A 3RGTA 1PEZA 4K38A 4QDWA 6TAAA 2Y85A 4LUTB 5DY3A 1WNOA 2BTMA 2QUMA 4IISA 4JEJA 3CV1A 4KRTA 4M1BA 3RO6A 1IZCA 5JBEA 1F6YA 2GDQA 7ODCA 3L4TA 3G3MA 4ICMA 4Z42C 1GWJA 4KF1A 1TIWA 1M7JA 4LOCA 4N7QA 2VD9A 3UP8A 3ZVHB 3T07A 3VIHA 1UCWA 5A6MA 2NVDA 3S1UA 3GE7A 4UTHA 2CLEA 1S5NA 4N6EA 3SY1A 4E4FA 3FY1A 3NG3A 1W56A 1V3IA 1XDMA 3WLPA 3N6QA 4GQBA 2D1ZA 5I3HA 3CV2A 1FHUA 3HG2A 3SUVA 1HL2A 5MF5A 1TWWA 1VHCA 4WSKA 1BXNA 5DN1A 3BLDA 3W7IA 1XXXA 2BOFX 4WGHA 1T5AA 3M5YA 3QR0A 1DQUA 4GC4A 1TWIA 3B97A 1LORA 1JYNA 4H9ZA 2PU0A 4QJ3B 3PZOA 4MFDA 3B9EA 1XGDA 2W27A 2Z1BA 4A21A 3UT0A 2PURA 1QNPA 4Y9NA 3KZSA 3HQNA 4F0SA 2RGLA 1A4MA 1XPGA 3S5OA 3TCEA 1EUNA 4NZCA 3W1RA 1TPC1 2PF0A 3T55A 4RE0A 5I09A 3N2CA 1PIFA 1IWPA 4BQ4A 5JXQA 2QDGA 4NZJA 3S6DA 3AS3A 3VAVA 3KVLA 1TPDA 3W00A 2QCHA 3VGFA 1EEPA 4UMAA 1XIMA 3VILA 1T7LA 1KW1A 3VO0A 3T44A 2VGFA 3SFKA 4M56A 1LUCB 4KIEA 1DWJM 1V6WA 4ACZB 3HQ1A 2WJZA 4RW3A 4UTMA 2VUYA 2NUXA 3R8GA 2PU1A 1AW1A 9XIAA 4GQGA 5HANA 3FSUA 3TXZA 1AVAA 4JIRA 4H7CA 1OCNA 3CUGA 3W2JA 1DTUA 4PYSA 2V63A 2Q01A 4Q4KA 5FJRA 3HJZA 4KFNA 4IGSA 4A3YA 2Z1VA 3K8LA 1ME7A 1WX0A 3IGXA 1E9LA 1M7PA 2JF6A 3IGHX 1SZRA 3S2JA 1JCTA 2F61A 5J8LA 1C9DA 4C6BA 4DBSA 4ZO6A 1I6NA 1VPXA 3LHVA 2YR1A 1E0WA 3GNXA 4JL2A 4IMEA 2OEKA 4FK9A 3S5YA 2R6OA 1UZHA 3HO8A 2HDJA 1LYXA 5BOOA 2I1OA 3BOLA 5C2XA 1NWRA 2GSJA 4GINA 3A64A 3A47A 1W5NA 3OBKA 3H26A 2DT1A 1CT5A 3OIHA 5AHIA 1PCWA 1VCVA 1W1TA 3SQLA 3P93A 1V79A 3ZYZA 3VKAA 4DJFD 3MJYA 3NO1A 2WSPA 3BQ6A 5G4WA 2VFDA 5HINA 4WY0B 3VC6A 3ZXWA 4BZYA 1EYWA 4AISA 2HNHA 4EPKA 2QCDB 2Y6ZA 1V6VA 1OX4B 2V5DA 4MPKA 1YE4A 1LT7A 1Q45A 2OMAA 4ZE4A 1C7SA 3PSVA 1PKNA 3U2EA 4RZ6A 1DP0A 3TU9A 5KETA 5AVNA 2JF7A 2GGGA 1D3GA 4PTNA 4QEHA 3EX3A 4MB4A 3WDQA 3L21A 5ABHA 3WK3A 4UNLA 3U2OA 4BWLA 1ZAHA 3VKKA 4QXIA 5BXRA 4OUIA 3G1RA 1NJJA 3XIMA 2B0MA 2OZ3A 3EWZA 2Z27A 1RPXA 5LA0A 2BODX 1OFOA 3IK2A 2VELA 2D2HA 2HXTA 3WUGA 3GH7A 2YZRA 3BCFA 2PZ0A 1RZMA 4PMRA 1ELSA 1EEXA 1IEXA 2OT0A 1DJZA 1WKYA 3VIFA 1WOBA 1S2TA 3HPAA 1PX3A 1W6TA 3L5LA 1BQGA 4J27A 3NIYA 1MQQA 2PGRA 4M51A 3DKJA 3ZZ1A 3PJXA 4XTDA 1DE5A 4YJ5A 1MW2A 4ZSUA 1B3YA 3NFUA 1HGWA 4PL1A 5I02A 4AZ5A 3D0CA 3RPTA 5JH1A 3PFMA 1XYBA 4NP7A 1YXCA 3V3WA 1TE1A 4W86A 1MFUA 5TD4A 1RJRA 1VFSA 1T99A 3ELFA 5FF3A 4WKFA 1DJYA 3O16A 2E25A 3OA5A 4Y2WA 5AC6A 3WQWA 3NQAA 3FJNA 3KL3A 4EOUA 3JUGA 4IIHA 3OZYA 4YTRA 1XBZA 4X63A 5I3KA 3CLWA 1TR9A 2ZXAA 2WV8A 4IOTA 3II1A 2JIEA 4KEUA 3ITVA 4W7WA 1O60A 3ISIX 3L66A 1US0A 4HU4A 2ANUA 3S2LA 4W87A 1GYMA 4ASTA 4ZE5A 2NSOA 2DSVA 2Y2WA 2W61A 3R12A 2PTZA 1NEYA 4NF7A 3H2FA 3OW1A 1CXEA 3KVMA 1LLWA 3GDRA 3S2CA 3H55A 3KRZA 2E6FA 3M43A 4YHGA 1E1FA 2XM2A 1HKWA 2OLAA 3F7JA 4MZ8A 2YDRA 4BY3A 4AWUA 5CJNA 3RO8A 4HK7A 2A3EA 2WWCA 5H8PA 1V6YA 3BGAA 3AU2A 4H8HA 3W6YA 2G4FA 3TDFA 4V28A 3WDPP 3SQSA 3UZJA 3VKBA 4QSHA 3MUXA 3VNYA 2FTYA 4HMEA 1GEHA 4C6CA 3GDBA 1E3XA 3PWGA 2AQOA 1JYXA 5FIPA 1NP2A 4CQCA 4QAWA 4PMDA 4WLCA 4IJCA 4AW7A 5D9NA 3KVJA 4Q6XA 4M1RA 1A50A 2HQAA 4ZENA 3LPPA 4UMCA 3VIJA 3A4AA 4QEEA 3WEZA 1HUVA 3I7SA 1W3LA 2GYIA 1DVJA 1XSIA 3JZEA 3UXAA 4FLQA 3MSYA 1RVGA 5ABTA 3NJ3A 4CD8A 3PANA 4GA8A 5I3GA 4HCLA 1UR1A 1JQXA 1KV8A 2Q8XA 4HD5A 1YXYA 3T2OA 5CPTA 3AYTA 3M46A 4W88A 1HJVA 4LSBA 2WANA 3MC5A 4AYSA 3DHDA 2DT2A 2FZMA 3MMWA 3EOEA 3VNKA 2XPKA 1VYSX 5C9WA 3PTDA 4I8YA 3SCOA 2NXHA 1NIUA 1JQVA 3HMCA 3S5ZA 1EP3A 2E6YA 1XRVA 1FWIC 1RY8A 5A6KA 1QTWA 1XKYA 1VIWA 3BK0A 1FWCC 3K46A 1UP3A 1O7AA 3QQ1A 4XISA 1N8FA 1UP2A 1FTXA 5FAJA 1CCWB 5C7VA 1YX1A 1G01A 1ONWA 2GGHA 3CYVA 1YXDA 4CN4A 3IVTA 1GVFA 1KFLA 3QJAA 1EQPA 1GQLA 1LG2A 3M0JA 3QV8A 4DZIA 3P5ZA 3BANA 2FGLA 1MW1A 3BC9A 2FVMA 1XX1A 1S38A 4QG9A 3VOHA 4LVAA 3PUOA 1EGZA 3W85A 1EWEA 2QR6A 3LI0A 2VX7A 1ITQA 2IS7A 4PN2A 4M81A 1BFNA 2VR5A 1MYRA 3W84A 3F2DA 2D3NA 4NI8A 3MSDA 1AW5A 1FDYA 3WD0A 1A5LC 1N55A 4LUIA 3QW4B 3VD4A 2E40A 2ZUTA 4JQ3A 4ML9A 3PWAA 2GSHA 3W76A 3MZ2A 3EWYA 2BOGX 3RR1A 1S5MA 2PC4A 1RPKA 4O15A 4G7EB 4GUJA 3N4EA 4JIHA 2QEZA 1CGWA 4MUZA 4E6MA 7TAAA 3CAWA 1FUYA 4Z2GA 3JR2A 1A47A 2FQIA 3HG5A 4FPSA 1T96A 1PWLA 2ZC8A 4OBSA 1GOWA 3DFPA 3RCYA 3N11A 1JFHA 1MZRA 4NYYA 3N2MA 4PUWA 3CQ0A 2EG6A 2ZRVA 3DEQA 3KLLA 1HP5A 3EAUA 1JUBA 4ADTA 3GIQA 3IWPA 3VE9A 2DFAA 4NRRA 3H2OA 3B0UX 4OQVA 3I4KA 1XI3A 4DN1A 4XB3A 5D2WA 4R7WA 3ZS4A 1U5HA 4M5PA 4LEQA 1JF5A 4WCJA 4RPPA 2VCAA 4IPJA 3K8KA 2W66A 3W87A 3ZOAA 4X0NA 1TREA 4GGBA 1VJIA 1L6GA 3NO5A 4L7ZA 3M0LA 1SW3A 3FXYA 5LZLA 4FNTA 3UWYA 3G1DA 4HPHA 4EE9A 2QUVA 4MKSA 4A2SA 3LNMA 3PZGA 2WMKA 1W5PA 3VDCA 4TVCA 3AALA 3ZM8A 1SW7A 3BGGA 4DI9A 4FS9A 1FCQA 3AU6A 1OIMA 2GJLA 2C0AA 2CKRA 3QMTA 4I3GA 1JXJA 4DJDC 5LYRA 1EBGA 5I3JA 3C2FA 5FKYA 2ZZ7A 3C0QA 3FHQA 4O0KA 5A2AA 3EKLA 1IEVA 1TUXA 3KTCA 1Y7VA 4J3TA 4WQ6A 5I24A 1A5NC 3GC4A 1F3TA 2XZ9A 4YTTA 1HJSA 2J74A 2QVNA 1R3WA 4DNMA 1W9VA 5I3DA 4GISA 1FXQA 3HN3A 1K9DA 1VYRA 5HPOA 3AWOA 3O15A 3P0XA 3GC5A 1FWRA 4NVTA 4LYQA 4C91A 3TOPA 5K7JA 3PG9A 4J3WA 1GZJA 3RX2A 3GYCA 3BAXA 3WBXA 1AW2A 5FJPA 5LHFA 2OG9A 2QCNA 1BG4A 3C6CA 2NSXA 4OV9A 4FLOA 3QY6A 3F4DA 1C7TA 5M1TA 4HK5A 4ECLA 1XH2A 2Z24A 1VHNA 4ATWA 1REQB 1R3YA 3SBFA 4Y9AA 4MF4A 4NILA 3BCJA 1V6TA 1YW1A 1SR0A 2YIHA 4KBXA 4V1XA 4XZIA 3R43A 3B06A 3CU2A 3W2UA 1K6WA 3AO0A 3TEVA 2XN1A 3B8IA 3WK1A 3W7QA 2QJJA 4ICCX 2F6UA 5D33A 1M41A 5HUPA 3N17A 3TOYA 3RR4A 2OCZA 1TFVA 3L0KA 5J04A 4UQDA 4C6IA 3P5YA 3CMGA 4M7TA 3AZRA 3FYYA 4AD3A 2BDQA 4JQ4A 5GJMA 4LYRA 2BOEX 1M5WA 3CPGA 2QIWA 1H61A 3WH9A 2YGYA 1JNEA 4DLMA 3V4BA 2NUWA 4EAMA 3K4DA 1TTIA 3CL7A 1EO5A 4WOQA 4LS1A 4FB7A 3POCA 1L6WA 1U22A 4JTHA 3QYSA 1OD0A 2VOMA 2ZBTA 3JS3A 2YCLA 2F2KA 3CJPA 1RH9A 1Q6EA 4O28A 5EKYA 1J2BA 1DIEA 2YOCA 3SIZA 5IOBA 5FEPA 3LB0A 2O7SA 2ZX7A 3BURA 4HZ7A 2TRSA 2QCMA 3B8UA 2CERA 2DV0A 4KEVA 5D2VA 4Z2HA 1C93A 2VYOA 3QLLA 3V5FA 2VO5A 4AY8A 4Z08A 5A8GA 1ISWA 1NDZA 2JQXA 5B7ZA 5GJNA 3V0UA 1FVPA 3RHGA 4DJEC 3IIXA 2W79A 1OB0A 2GVLA 4L80A 1TV3A 3TYBA 4OJYA 3U4FA 5A94A 2X1SA 4HN8A 4ZODA 4E2VA 2A5HA 4JD4A 5FACA 4W8AA 1VRXA 5SWUA 4Q8NA 3IIOA 3RNDA 3PN8A 3CIVA 1FWDC 1DIKA 4PMVA 3G2GA 3P81A 4JIIX 3M44A 4N9BA 2BASA 4JY9A 1YNQA 3FLUA 3INPA 3DFQA 3R8RA 3IGUA 4K2SA 4HNCA 3WLJA 3BLIA 1KCKA 4O1FA 3LBMA 3GNPA 1DKWA 4YTUA 3KP1A 4QJ4B 3HFTA 4AY1A 2HTMA 1SR9A 1CLKA 3V1PA 3ATYA 3V1HA 1SUXA 1R3VA 3AQUA 2CCRA 4DWDA 2PRMA 3ITCA 2JBMA 1HJQA 1Z3NA 5M2FX 4PMJA 2WM1A 1GVIA 5A6AA 1OFBA 1J0IA 1AMYA 3B0YA 2EEXA 3UWWA 2MUCA 2C91A 3HMJG 4M6QA 1Q66A 3WDJA 5LIWX 5BWAA 4B4HA 3OVPA 4PB4A 2WC3A 1X6UA 5DCBA 4WGXA 1ZALA 3VNLA 1XGEA 1KXVA 1MO0A 1W2PA 1D3HA 1BYBA 1MNZA 4B5WA 5F2MA 1DIDA 1GTEA 3PFRA 4FX6M 1V08A 3OIXA 4ZQOA 2OPJA 4MGGA 3APTA 4PRTA 1IXOA 2WO5A 5BU9A 3P3BA 4H1ZA 3TYEA 1PX4A 2BP1A 2GJXA 3ATZA 1R2SA 1XHGA 5EYWA 2DW7A 2OODA 3FYOA 3UQNA 2J7GA 3CZ8A 3UJEA 1A53A 1NAL1 3EKGA 3DYOA 3GFZA 2R1KA 3ZJ8A 3IANA 3BGJA 3N9KA 4C6MA 3LRKA 1X38A 1NFBA 4GI6A 2FB3A 1XL9A 5DXXA 2C13A 3KHDA 1LWHA 5AB3A 2V82A 3T08A 2J8TA 3HURA 1EZ2A 4PMUA 3G22A 3KOWA 2WSYA 1EB3A 1Q13A 2NQHA 3MU7A 4FXRA 1J0KA 3MO4A 4L4OA 2DJLA 2G37A 3WH7A 4NNBA 1OYBA 2ACUA 4W8LA 4DZ5A 1IT0A 1MEIA 3KOXA 3CB8A 4HZMA 4D6GA 1XQKA 1MEWA 2E1DA 3CM4A 2UY3A 2RFGA 5IBXA 3W22A 2WMIB 5FJIA 2QV5A 4GO8A 2HVOA 2OYLA 4DO5A 7A3HA 1R3SA 1E15A 5EPDA 1Q3NA 1V03A 2IPWA 5H2ZA 4P7QA 3NQ7A 2REQB 5AHFA 4NX5A 3T81A 4PRWA 1NF7A 3P7YA 1J79A 1ZTVA 5LNVA 1JR1A 1B57A 2J79A 5CQ1A 1US2A 2IUZA 4R27A 1BLIA 3ZWSA 4AIOA 2OO6A 4JTFA 1TV8A 4E3TA 1JZ2A 3CEPA 1CYGA 4FX8A 2QNEA 3SQMA 3L2LA 2J7CA 2YCIX 4U4MA 1NWTA 4EP8C 2F84A 4AVOA 4HSOA 4R5EA 2FJKA 2FZDA 4PCPA 2FVLA 5HNTA 2H3DA 1TMHA 3PVFA 4GK8A 1Q4WA 4NKCA 4PGLA 2C79A 4YYCA 3N13A 4QFUA 3STPA 1KBJA 3BG9A 4GVIA 1W8SA 4EXAA 3D5HA 2EJAA 5JH2A 4GQRA 4LAUA 2OX1A 2HISA 3U8GA 4J3SA 2FZ8A 5CPSA 2PDHA 1GQNA 3OG2A 3ABXA 4S2BA 4KRZA 5FJOA 1LBMA 3NVTA 4BA0A 4XKYA 2R1PA 4O53A 3ID7A 1HKVA 4OOZA 4HB7A 4J3VA 3CB3A 3U4AA 1OD8A 1PHQA 1C8QA 1DEDA 1R0MA 2ZICA 4PBGA 3IJ9A 3SFWA 4UCFA 1J5SA 4Q33A 1CENA 1VR6A 4B5SA 4S3EA 1VH7A 3W1PA 1UASA 5I06A 3WO8A 3WX7A 3B40A 3LDVA 2TMDA 4QNWA 5C5YA 2RAGA 1B0IA 2QPUA 2CESA 3WK2A 1RVKA 4L6DA 4W84A 1FWBC 1OVDA 2ZX5A 2FMOA 2J7FA 2P10A 1IEWA 1Y65A 4G6CA 1S2WA 5HQMA 4CNTA 1N8IA 2PTXA 2DQXA 1FY6A 1ZCOA 3QMSA 5MHBA 2C19A 4MM1A 1ECQA 1P48A 1CW2A 5G2HA 1RCOB 2E4TA 3WBEA 1D8CA 3NQEA 5EMYA 1VF8A 3AHTA 2OYMA 1ONRA 2VD8A 3TCSA 3PSWA 4XK2A 3WLTA 1PDZA 3UPWA 2E67A 1WKEA 4JHMA 2GLKA 1EJWC 2YBVA 4ZBCA 3LM3A 3WFLA 2DZVA 3N25A 2BHUA 3UXDA 3VOIA 4R3UA 1EP1A 1VEOA 4AX6A 4O16A 4PRRA 1H7NA 2V67A 1G4TA 5JQ9A 4DZAA 3NQGA 1DHPA 3M7SA 3OZOA 2J27A 5D09A 2D2JA 2WKJA 4RK8A 2GVYA 1AQHA 2PRLA 4Q4OA 3GK0A 4O57A 3VNZA 3HG3A 1GOMA 4H01A 1A0DA 3WJYA 4U28A 4DBWA 3SW6A 4JTGA 1GPWA 4FNQA 2C71A 1F6KA 1U2YA 3WLHA 3E12A 3U0HA 1Z41A 2RHGA 1Q85A 4KFOA 2A6LA 1WA3A 5JBDA 1OABA 1AA1B 3BSHA 5A2BA 1OEPA 4YS1A 2YFNA 4D1IA 3DDMA 1EJXC 4TX8A 4P8VA 4MNLA 3W82A 2PP0A 4DVOA 3IJ6A 5DX7A 2BFGA 1JYWA 1UC4A 1P6WA 5L9FA 3H22A 1RK5A 1FDZA 1I45A 4WSJA 3W7GA 4WK9A 1JPIA 2DIJA 5DRCA 4HNTA 3AMDA 3FAXA 2GOUA 5CPOA 3AI0A 3KUMA 1QPRA 1WPCA 1W1A1 3QZEA 4ROPA 2VXNA 1DWGM 1VKFA 1VS1A 1W3JA 4FP1A 4GZEA 2QQ6A 4QAIA 4PTMA 3T7VA 2C1IA 1OCBA 2WHKA 1Z69A 1TWSA 4PB5A 3IJLA 4K8EA 2E6DA 3W1TA 1RJPA 4EXBA 3MA8A 1UKTA 4Q7IA 1V3KA 4IXXA 1AZ2A 1JAEA 1UWSA 4ZTXA 5C9XA 4U5IA 2FTPA 3ABSA 2ISFA 1UROA 3OO2A 1EOMA 2Z6JA 1PSCA 1VB9A 1EF3A 2GGJA 4NZ3A 4C1NB 4UOJA 3BJFA 1QXLA 4FOJA 1TRIA 4N2YA 5EMLA 1F74A 3T78A 3VMNA 4MB3A 2QF8A 4KWSA 4JPGA 1F4AA 3B4UA 2VKZG 1RK6A 1R8LA 4EVZA 1XLKA 1YIXA 3AS0A 3JU2A 2PWVA 3G3DA 4D72A 1ZCCA 1LZOA 1LP6A 5AC8A 4ZXLA 1W31A 2H6RA 1LF1A 4MJMA 5AC4A 1OX6A 3KDNA 5CLWA 2ZDRA 3W01A 5JBFA 5HQEA 1TJ1A 3LHTA 3QR3A 4ORIA 4IGHA 4B91A 1KQZA 1O68A 2C7FA 2D20A 4Y96A 3DBNA 2E5BA 2GK1A 1VQTA 1W3TA 1TTPA 3VE7A 4N0RA 1F9CA 3G0UA 3NL6A 2E8YA 3RFAA 1IE7C 4LVGA 1H62A 2YB4A 1W32A 1LRTA 4IMFA 2VOTA 4XZNX 2BY3A 3RAOA 3I7RA 4FEZA 1YRRA 4H4IA 3C86A 3DI0A 3G0SA 5DELA 4NU7A 1Q6CA 1M04A 4OKDA 1RSCA 1ONXA 4XVDA 1QI2A 5B80A 1K8XA 3OU8A 3GB6A 1F3XA 3PBVA 2FZNA 4ZQNA 4MFEA 1Q7ZA 3F2BA 5I6SA 3EDEA 3WYZA 3C52A 3UGVA 1XLHA 1J6OA 5GNZA 1KB3A 1CWYA 2PSNA 4GD0A 1RR2A 4FHAA 1WCGA 4ERGA 4YHEA 2NQJA 1MRAA 3K1DA 4UTJA 2Z1WA 1P1MA 1VJZA 3DX5A 3W1XA 1J0YA 3H2MA 1XLFA 4DBEA 2GFTA 5IHSA 3SCUA 2P88A 1NDVA 1ZL1A 2P50A 1D9EA 5A69A 3P0WA 5E93A 1IEQA 2C8NA 3GW3A 4MJZA 3K4WA 3I6TA 3N19B 4US6A 1FA2A 4PBFA 3ITLA 3USBA 1S1PA 3MCOA 1L9WA 1RHCA 1E3ZA 3PAJA 1UD8A 2AAAA 1HJWA 3TQKA 1KC7A 1PPIA 2CFFA 4CNSA 3AS1A 4H9YA 3Q67A 3QM3A 3E74A 1O66A 1Q7QA 2VEIA 4FLSA 4WR3A 4H9XA 3WCZA 2GJPA 1MQPA 3VGBA 3ANVA 3BQ5A 2ALRA 1NF0A 2X7VA 5DO8A 3LV5A 1EJVC 4JX4A 2CZVA 5EFDA 2H8ZA 4S2CA 5EA9A 1ZP3A 3D6NA 3SZ8A 2X16A 2OLHA 5DY2A 2HXUA 5JUVA 3C0LA 3SSZA 3SRDA 5XIMA 2XSBA 3TLLA 3KWSA 4N9EA 3GG0A 2XU2A 1ENUA 4XAZA 1KBIA 3UJFA 4JNZA 1I60A 5GJPA 4ZFCA 3WSUA 2X1TA 2VZOA 1YQ2A 3VCNA 4NYUA 1TJ0A 4I6VA 3HM7A 4IIDA 3OODA 4N6FA 5IDZA 3CAVA 3SCWA 1C92A 1GTHA 3RRXA 2XVKA 1J4EA 3V35A 1LCOA 1SJDA 1VFUA 3DXIA 4CQAA 2WHMA 4JN6A 2DVTA 5FL0A 4ZL1A 5CJMA 3LN3A 1LTDA 2Z2BA 1QW9A 4H6RA 3N2XA 3TFCA 2OQHA 1RJQA 1RA0A 2QJNA 3AXIA 1KD0A 1BHGA 1QPKA 1J0JA 3SY8A 2Q02A 3WD2A 1OFAA 3MP4A 1MVYA 1VBGA 1K02A 1LQ2A 3W7LA 4FR6A 1J2WA 1OFQA 7TIMA 3ANYA 2AL2A 1P0KA 1VEMA 1ZGDA 2VWTA 3STGA 2VR4A 4MIMA 5DFAA 4UTFA 1YBQB 1UJPA 1MRQA 3NZPA 1W3KA 2V38A 3FVMA 1PZ3A 4C7DA 1POJA 4K6AA 1QVBA 2VCBA 1GGOA 3LXBA 4D6EA 4JX6A 1NU5A 3AMCA 1FWHC 2ISSA 5F4SA 4O4WA 3OVGA 4EIVA 3K2GA 1PL9A 1FKWA 4QISA 4PTDA 4IQDA 4WY0A 4DYEA 1MUWA 1YEYA 4XD6A 3NOEA 4N4QA 2ZWYA 4PULA 4DUOA 1HFBA 1VFHA 3WY1A 4PMYA 4OBTA 4K7YA 2PE4A 3CMFA 3I3BA 3SADA 1S2AA 3VINA 3GTXA 4JTDA 4LGXA 6ALDA 2DUZA 5C71A 1JXKA 1XD1A 1H1NA 3GR4A 3ARQA 4KIRA 2WB5A 6TIMA 1Y8BA 3WF2A 4YPJA 4XSMA 3LNPA 1E5NA 3LHWA 8XIAA 3P74A 4JKLA 1UH2A 4LVDA 2NXIA 4M0XA 4IIGA 2HK1A 4G8TA 3URNA 4WXZA 2NUYA 2PDBA 5DANA 1OHLA 3M0YA 1ISXA 1SSDA 3IVUA 3SJNA 1G7VA 1WZLA 3TC7A 3W72A 2ZXBA 1F07A 4ZVJA 4EX4A 2GQ8A 1J01A 5CSUA 2XN2A 3WDHA 3FNDA 3IPWA 2W91A 4LY4A 3CL6A 3VYLA 4ZQCA 1UKQA 3WH8A 3H4WA 1XINA 3WQVA 2WJDA 4LBRA 2F9RA 1X96A 3VK5A 3WLIA 1O5RA 4QIUA 4G1KA 4DWSC 3W38A 3KLKA 1E6XM 4M7SA 3VIOA 2FFCA 2V3EA 2OB3A 2DZBA 1HGYA 3VA8A 1SFSA 1OG6A 4PSRA 1E9YB 1Q6OA 1P5BA 1WKFA 4JICA 1X98A 3VI2A 2YL8A 3HPFA 4W85A 5DCEA 3LTYA 3WBAA 3A22A 3WJXA 4QQUA 4W9TA 4JFUA 3G24A 4OFCA 3EWDA 2V5KA 3TNOA 3WFZA 1KM2A 2DZWA 2NQLA 1IF2A 3R8HA 3WQDA 1GZGA 1ZQ5A 1KTNA 3NDOA 2ALDA 1LJYA 1VBUA 4AZ6A 4DWSD 4DPQA 3TYCA 3WQ8A 3QHOA 3S5SA 3W83A 1NELA 1CDGA 2V30A 1F8MA 1UB3A 3KRBA 5E5CA 4Z2LA 4DNHA 1KM1A 5F4XA 4ICNA 1ZRQA 3ZT6A 3VKCA 4G7EA 3CASA 5H8MA 2G3MA 2CBIA 1OYCA 5TQLA 1QFEA 3S2MA 4CNUA 4FZIA 4LRSA 3AXXA 5BOEA 1X1ZA 1CI1A 4IX0A 2JEPA 4UWMA 3YPIA 2VJXA 3C5QA 2ICSA 2RJGA 1ZHAA 3NSXA 2G97A 3FVDA 2AL2B 4LAKA 2H3BA 1PV8A 3ZJ7A 3S4TA 3I6EA 1Q6FA 4DUVA 2R91A 2O4QA 5CZKA 4EPDC 1MQRA 5DQPA 3MMDA 3MI6A 3L2IA 4Y90A 3OOQA 4RDVA 1W3NA 3WN6A 2WZTA 1XRFA 3E96A 3QN3A 4Q3MA 4TTUA 2IKJA 4BQ3A 4DB7A 1JCXA 3T6CA 5C9RA 1XBVA 1I8JA 5ABGA 1EIBA 3LV6A 3TW7A 2Z1SA 4GXWA 1VJSA 5FI8A 4DJFA 4O54A 3OBEA 1UR9A 4TUFA 4GRSA 1EJRC 4JTQA 4ZZ9A 1V6XA 4X61A 1PS9A 4UFJA 1B54A 1H7PA 1I75A 5D2XA 1EBHA 5E6YA 1HN1A 3RK8A 1FFRA 3GIPA 4PFMA 1UQZA 4CCDA 1TMQA 4BF5A 2R94A 5CBJA 1Z42A 2PWGA 2O4MA 1RY0A 1DWHM 3LD5A 1BWKA 2XISA 3UZ5A 2PRHA 1H0IA 4NZFA 4HNLA 2OSYA 4J9JA 3THUA 2O9RA 5I00A 3ZLHA 4GIYA 3REQB 1JGMA 4UTWA 2F6XA 1DHKA 3WLNA 2Y0FA 2Z6IA 2X40A 1VBRA 3GNNA 5D8WA 1HKIA 3NPXA 1P0BA 3TQPA 1GT8A 2E7FA 1G6CA 1R3QA 3PS7A 3UXIA 1H1YA 4WX2A 4DX3A 2YJQA 3CMJA 1ISYA 2IPJA 3NA8A 2QMKA 5I3IA 4HN4A 1Z8AA 2XWDA 2Y5JA 1RD5A 4LUTA 1W3IA 3APGA 4HPGA 1V3LA 2P76A 3A6OA 2Y8UA 3SRKA 2BXYA 4JIEA 3GDTA 3KE0A 3NDYA 3P62A 4GJIA 4C6QA 7CGTA 4IWWA 4KH2A 1E72M 1FP8A 5FD0A 4WRHA 2I5QA 1BKSA 3U2ZA 4LB3A 4C1LA 4IP7A 1S3HA 2W9MA 3IRDA 3L2MA 5AVHA 1VAHA 1UD3A 1Z89A 1KRBC 3AZTA 3WNPA 3IJIA 4S3GA 2Z0IA 1ICSA 4UBPC 5LNRA 1R86A 3MZNA 1WDPA 3DYMA 3M7WA 3WH6A 2FTWA 4AWSA 1EDQA 1LRNA 4FIQA 3ZVIA 3LCWA 3VKJA 2J78A 4J1OA 1ZBWA 4FNUA 1KXQA 4L1GA 2OU4A 3BAJA 2BY2A 1Z6KA 4V2XA 3VCCA 4AD2A 4AIEA 3U57A 1YNYA 2CLKA 1SYTA 4K37A 2FHBA 3C8FA 5E0KA 1ME8A 4UUIA 4C7GA 1V0KA 1ITCA 1PX8A 3QTGA 2V68A 3A3XA 2YFOA 3HBLA 3VOCA 1I4NA 2WM0A 1EXPA 2I16A 4RL3A 5JMUA 4K8HA 4NJGA 4LFYA 3F5LA 3ZO9A 5DBTA 1DJGA 5D9MA 2C1HA 3WF0A 1JPDX 2EG7A 3CWOX 4CQ8A 2GJNA 5HDRA 4Q8MA 4YWSA 4IUGA 3L5AA 3BAIA 4R34A 4D6HA 2I57A 1EKOA 3IIPA 4LCSA 3AMGA 3PAOA 2PB1A 4NAFA 2E9LA 4JDBA 4KEMA 5A6SA 3H8AA 2X0SA 4DO4A 3HV9A 5H91A 1WDDA 3S9IA 1SW0A 1W1PA 1KRAC 4WF7A 4GJ1A 3NM3A 2YLAA 3B8TA 3OA3A 1FCUA 4FMVA 2VM8A 2A3BA 3EOSA 3LQLA 3WQPA 4JS3A 2WVUA 3E0IA 1F5ZA 1XR2A 4PB3A 1UA7A 5AC5A 4IFOA 4N02A 2NV2A 3TSMA 3EMCA 2XG9A 2FHFA 5JVLA 4E8CA 3TXVA 1NTHA 1X8FA 3NZ1A 2PDXA 4XZ9A 3OG3A 4L4LA 4UNIA 2PLJA 2DZUA 2P5NA 4LUJA 4FIRA 4XAYA 2ZZ4A 2IXUA 2R9RA 3W29A 1GYLA 1SZGA 3ARWA 3AMKA 4CNPA 1FDJA 2NWSA 2PDKA 3V0SA 3GR8A 5KTLA 1EX5A 4DUWA 4D6FA 1TELA 3KWXA 1AH0A 1H41A 2ZC1A 3DHPA 3IS4A 1FX6A 4N42A 3SCVA 3C2YA 3UNTA 3LX9A 3NZQA 4PCSA 1KV5A 3S6TA 3LCFA 3ARTA 4L5ZA 1KGWA 2WKGA 1GKQA 1SZNA 5REQB 1F05A 1JRCA 2PGEA 4CVUA 3E0LA 2ZE0A 2DPEA 2CC0A 3UR5A 4RE2A 1VLIA 2HE5A 1XKJA 4LRTA 4X3ZA 3NQ6A 1AL8A 4IPNB 2C16A 4GIAA 5ABFA 5K2ZA 1QAPA 1F73A 4V1YA 1QBBA 1UW9A 4DF2A 1MXDA 1E6NA 1UWIA 2O9OA 4JEQA 4O50A 5HULA 3H70A 4K1GA 3NCOA 2VX5A 5M5DA 2YW3A 1JUEA 1GJUA 3UESA 4EF8A 3TYAA 1JPHA 3VNMA 1UKPA 1V0NA 1LOLA 1TZZA 3GXIA 8RUCA 2Z26A 3QHNA 4LCRA 1GYNA 3FKRA 3Q37A 3WQGA 3NR0A 2VEPA 4BI7A 2FZ9A 4POCA 4QROA 3VOJA 2G95A 4GI9A 1PYMA 1KFKA 2WHJA 4EK7A 1SZFA 4AVFA 1G94A 4C6DA 1OIFA 2WBGA 1ADOA 2A7RA 3GHUA 3O6CA 2DZTA 2BLEA 4O8AA 3MO7A 2VQTA 3TJ4A 1XFCA 3GVVA 3B9AA 1LG1A 1ODZA 1OK4A 3NPWA 4LT9A 5HPCA 3CQIA 2DVUA 6REQA 2XVLA 4PUNA 1CXIA 3TWBA 4G1NA 3STFA 1DXIA 4L61A 4QCEA 5HK4A 1OT2A 4O11A 2CXGA 3DFYA 2J77A 4X0VA 1X6LA 2VGBA 5K4XA 4IM4A 1B31A 1H1ZA 1S3TC 4YNGA 2INEA 4NIRA 2G3NA 4Q4QA 4AHQA 1J10A 3WQ6A 1WDRA 1FWEC 5JU6A 5CSYA 2VZSA 1JD9A 2V9DA 2WHLA 1PUDA 1NOUA 1BWLA 3AOFA 3T4WA 1SFLA 4JCLA 2A0NA 1R85A 4M80A 1TV2A 3WDRA 3ITTA 3DAQA 5LHEA 2ON3A 3SURA 5H8UA 1W0MA 4Q8WA 5F7UA 1I2OA 1YTDA 4P7RA 4FALA 1C8VA 3M4HA 4GYJA 2FGZA 3RJYA 4JHZA 4GG9A 1GVOA 4U5KA 2CLIA 2YA2A 3KS5A 1LL4A 5FJUA 3W7CA 3WLKX 3N1AA 2PEVA 2QPXA 2PAJA 4AZHA 2VL4A 2C18A 2PCEA 2B7QA 4QG6A 1VCGA 1UPPA 1JCYA 1IHIA 2VEKA 3O8AA 4RZ4A 3RCNA 4FNPA 4AH7A 2NLIA 3AHXA 3DFOA 2X42A 3OLGA 3IIVA 4B15A 1WBJA 2PBGA 1XLLA 2J9XA 3DHFA 3H7RA 2YPIA 3GZ3A 2WMGA 4GI4A 2NWRA 1P0NA 1B3VA 3W7MA 2XFRA 3IV8A 2QUUA 3GTFA 1SO6A 1RLCL 1WZMA