1JQXA

The r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPAYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 113
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqxA01
2GOUA 3NQDA 3N9SA 4DO5A 3C61A 3S5OA 3MYOA 1H60A 3O07A 3GIYA 2QUVA 1H61A 2ZBTA 4PH6A 3RLVA 2ATMA 3MI3A 3P5YA 1QPQA 4OQVA 1DOSA 1ICQA 4FNTA 3C0JA 3DKLA 3QMSA 4KKXA 2Q3OA 2AGKA 4WY0F 2J9ZA 1P4CA 4UFKA 4HSOA 3TQ0A 4HT3A 4UMAA 4POCA 1LRTA 3M0ZA 1EP2A 3QF0A 1ML1A 1FCVA 3MYPA 3O6YX 2NZLA 3DFSA 1TREA 1TO3A 1W0MA 3LOTA 3QQ0A 3WJWA 2Y6ZA 3ELFA 3TQVA 2OZ0A 4MZYA 1W5NA 5E93A 2CZ5A 3PBYA 3T4CA 1A5CA 3EX2A 1BTMA 1R46A 3CQ0A 4PTNA 3CHVA 3L0GA 4XZ9A 2A6NA 1LBMA 1FWSA 1RQHA 4CQAA 1TJRA 3BG5A 1FDYA 3TC7A 1FDZA 1LBLA 3ZFHA 4PL2A 4PC8A 2CLEA 4DQWA 1BEUA 4OE7A 3L5MA 1PS9A 2GVLA 4S2CA 5HWMA 1B57A 4IJBA 3LRKA 4WZHA 4Y6GA 3THQA 2E5BA 2XN0A 5G2IA 1X8FA 1G69A 1FWWA 4O11A 1LLWA 4LWWA 4LS2A 2Q8LA 1SO4A 1KM3A 2Y62A 1Z44A 3LLDA 3HIJA 5D38A 1AL8A 4QSHA 2CLMA 3B04A 3N2MA 2NWRA 4DO4A 1JQVA 1MEWA 2CW6A 2EAWA 2NX1A 3GDTA 2YYUA 1WBJA 4JEQA 1QFEA 2BXVA 2YFNA 4Z0JA 4OV4A 3M7WA 1AW2A 1LLZA 2A5HA 5FF3A 2V5LA 4O4VA 4RV8A 1ADOA 4UTWC 1KFLA 2I9EA 3M16A 4O54A 1Z42A 4KWWA 2H3BA 1L6WA 4A29A 3UNDA 2EKCA 2WSQA 2A2IA 1FWRA 3NQ7A 3CLMA 4C1KA 3P62A 4MJZA 1GG0A 3MUXA 3PB2A 4FO4A 4HKPA 2BWGA 2YDAA 3UY8A 4AMAA 5LZLA 3W86A 1KTCA 4BWLA 4ADSA 5D30A 3KAOA 3P84A 4XTIA 4K37A 2QCLA 1XC4A 1G4SA 4RXFA 3FYPA 3I7RA 3LTYA 1M7PA 4XKYB 3E96A 3TXVA 2Y61A 1GTHA 1XDLA 1I45A 3GNDA 1K03A 4NVTA 2V0TA 4FB7A 2E5CA 1MXSA 3STCA 5D2TA 3LERA 3LI1A 4X22A 3P74A 3C2OA 1K7XA 2QF7A 3P8JA 2A7NA 1D3GA 2BSLA 2JGQA 3HGOA 4YL2A 4QIUA 4H6KA 3DFNA 2O7QA 4RXGA 3H55A 4A2SA 1SPQA 1TPWA 4RCXA 3RU6A 2AQWA 5D37A 1C29A 3UYCA 5D2WA 3M47A 4BFAA 4M5PA 4A3UA 3VE7A 1TPB1 2DZTA 4TMBA 1JJKA 1FXQA 5FF4A 1HO1A 2NXGA 5MHBA 3M5ZA 1GVQA 1KLZA 3DKJA 1FBAA 1YTEA 4TX9A 3VCRA 5FEZA 2KZHA 1KBJA 3FOKA 4M7SA 4MY9A 3LB0A 4JTHA 1B9BA 2CLKA 4AF0A 3L0NA 4PA8A 1X1OA 5L9FA 3F03K 1I2RA 1S5TA 5EPDA 1XL9A 1ONRA 4LT9A 2ZQ0A 1DQWA 1FUYA 1QOPA 3RMJA 1IXPA 3W7LA 1GJPA 5DBUA 3TUUA 4O17A 1THFD 1PV8A 2DZWA 1TPUA 1XBZA 3CEPA 2NV1A 2GQ8A 3IIVA 1ZY9A 5FEPA 3ZWSA 1GQNA 2OX1A 1KM5A 3PUEA 1K3UA 2WSRA 4U4MA 5BMXA 2ZRYA 3W73A 4O0ZA 1A53A 4DF0A 4BI5A 4YWIA 4U28A 1L9WA 1B4KA 1NEYA 2Y89A 1ZCOA 3QW4B 2YFOA 2C15A 3W2UA 3LHVA 4AWTA 1LROA 1TQJA 4ADUA 1Q3NA 4MFEA 2RDWA 2NUXA 1QDSA 1G7UA 3LDVA 1H5YA 4Q33A 3W1UA 2FPVA 2BTMA 1R2TA 3W7RA 1QNVA 1G67A 1MSSA 4K8HA 3HG4A 4IMGA 3S9YA 5AHNA 4S1FA 5K2ZA 3DFTA 3S1VA 2NWSA 3W2MA 3DFPA 1GVRA 7TIMA 4AAJA 4LTSA 2H6RA 3W70A 1KLYA 2GVJA 1H51A 1F05A 2G5WA 2X1RA 3PVFA 5TBOA 3U2OA 4Z0SA 1OFPA 5AHEA 3O15A 4FHAA 4NX0A 1W31A 3W2JA 5CG7A 1SO3A 4EWND 1OFBA 3NQAA 2Y70A 3PM6A 4LVGA 4RX0A 5D32A 1OX6A 3PY2A 2J88A 3N14A 4DF2A 2DJLA 4IPIA 5CPMA 3P67A 5DY3A 4O1AA 3L68A 1DKWA 4LVBA 1VGAA 1WQ5A 1Z48A 5DCBA 3LXBA 1H7RA 6TIMA 4WXZA 2XN1A 3W74A 2VEMA 4XBKA 5FF2A 1GPWA 3GNNA 4M7TA 3GK0A 4OHQA 4QAIA 3ZWTA 2DU2A 4O1DA 5K7JA 1G6CA 3CIXA 2ZDRA 5D2VA 5HR7A 2I1OA 4UUIA 2HTMA 3E0IA 5C55A 4CCCA 5HNRA 5CZSA 4RZ4A 1D9EA 1XCFA 3TSMA 3LX9A 3WJYA 1JRBA 3G1XA 4JIQA 2FLIA 3MO7A 4XBSA 1NVMA 3AO0A 4FIRA 3LLFA 5LGXA 3IEBA 1SR9A 5K4ZA 2Z6IA 3HGRA 1W3NA 5HULA 4GE8A 2FJKA 5DXYA 1C8VA 1UUOA 3LXCA 4N6FA 3TIMA 2BZNA 4WX2A 2QCHA 3NQCA 3TROA 4UTIA 1CW2A 1SZFA 3M1ZA 4DO6A 2VFEA 4GBUA 2QDHA 3U6WA 1ZFJA 1SW0A 3UD6A 3LCGA 5A5WA 2CLIA 2QCCA 1N55A 3SZ8A 3DFOA 2ATSA 1MO0A 2QCNA 3P7YA 3M6YA 4UTKA 1F76A 4DPPA 1J2WA 1ZJIA 1N7KA 1VS1A 4UTUA 1OX4B 1X1ZA 3OEXA 2FB3A 2A6LA 3OG3A 3QMRA 1E51A 1P1XA 1YTKA 3TSBA 4YCPA 5FF0A 2ZZ2A 4NJKA 3G22A 1SU5A 2H3DA 2ABAA 4K39A 1W1ZA 4LNYA 4O19A 2VKZG 1AW1A 2VC6A 4UFLA 2J9YA 2O7SA 3LRMA 1OYBA 2WNNA 2P0OA 4X2RA 4TU1A 4FNQA 3BPWA 3Q94A 1W5QA 3A5FA 2CFFA 3M43A 5F2MA 5KITA 4HN4A 4J9JA 3EWUA 1KFCA 5G4EA 2NX3A 4Q4KA 1FY6A 4IMDA 3EWYA 3OVPA 2A85A 4N2YA 1WAUA 3W1RA 1SZEA 3IGSA 2VFIA 5CZ0A 4BWLC 1T96A 4JX4A 3LM7A 2WSYA 1TMHA 4Q32A 1PIIA 4ZL1A 1EEPA 4ML9A 4A2RA 3W7HA 3QH2A 3HBLA 3NYZA 3STFA 4D2JA 1W5PA 3T78A 3NEVA 1DVJA 2WOQA 4RJEA 1IIHA 4LVFA 3LBMA 2Y85A 1KFKA 1Z41A 1IGSA 4NNAA 4ZZ9A 1FCUA 3FKRA 2HMCA 2YCEA 2RDTA 3EXSA 2YSWA 3NNTA 5HQEA 1NF7A 3RFAA 5AFDA 3NPWA 1WX0A 3N3MA 2CZFA 4LVDA 2CLOA 3TE9A 4UTJA 5DY2A 1OF6A 3S8HA 3E12A 4BF9A 1T8XA 1WDWA 1KFBA 4I7WA 4HSNA 1UBSA 2WQPA 4GNJA 3LXAA 1MEIA 1KTNA 4Y8FA 1H7XA 2VELA 3CEUA 3CM4A 4AHPA 3DU0A 2V5BA 4GWEA 1K8ZA 3P81A 3QW3A 5F1UA 3LBCA 2QCFA 3B4UA 1NSJA 1WV2A 2I14A 3ABSA 4NU7A 2DP3A 3KVKA 5G2WA 4UFHA 4GC4A 4K7YA 2IQTA 2V30A 3P8IA 1KM4A 1OABA 4TO8A 3VE9A 1JQXA 3DAQA 3BLFA 2V2CA 4PEKA 4EVZA 1JUKA 1UUMA 3QJAA 5I3GA 1J4EA 2NV2A 1F6KA 5D02A 2DZXA 1SO6A 4O50A 5CPLA 2ISWA 5AHFA 1SW3A 4HHPA 1MZHA 4WQ6A 1RPXA 1KM6A 4AEOA 4E0CA 3W75A 2Z1BA 2GVGA 4CQ8A 1RR2A 2FIQA 2A7RA 2WNZA 4AXKA 4UTTA 5G5IA 4N9CA 1EB3A 3MI2A 4Z1DA 4K8EA 3W72A 1TPC1 1GYLA 4AB4A 3E49A 3EXRA 2DJXA 3C52A 3LHYA 5DELA 1MEHA 3A5VA 5D2YA 3PC0A 1LBFA 3LTPA 2A4AA 3LV6A 3W07A 3W7OA 3O05A 2NXIA 4XKYA 1VZWA 4BR1A 2R14A 1YYAA 4JTTA 3W88A 4CNPA 5BW6A 2YZRA 4AWSA 5C54A 2V2DA 1OG0A 2DZVA 5HWJA 3A9IA 4O4WA 1WXJA 4O52A 1L2UA 3NL5A 1TRIA 1PCKA 4LC6A 4NJJA 3UWYA 3TCEA 3PUOA 1SUXA 4HNTA 1UASA 1K02A 4GUIA 4GRSA 3QQ1A 3B03A 3JS3A 3WK3A 4JTLA 3UZJA 4K38A 3G24A 2WNQA 4ALDA 2CU0A 5AHLA 2ZRZA 4XQ6A 1DJQA 4O53A 2GJLA 3TKFA 4NNBA 2E68A 5FEXA 1FCQA 1PHQA 3P5ZA 4NXSA 2EGZA 5DBTA 1JRCA 2WJZA 2VFFA 1G7VA 4WD0A 1TTQA 2E6AA 1VYPX 3W22A 4OWGA 4ZQMA 4FXSA 4JX5A 3N34A 3TX9A 1OJXA 3NQVA 3ANYA 1W54A 3GB6A 4YXGA 4FX6M 4NT0A 1T99A 3GXNA 1ICSA 4NQ1A 2RKXA 5CZJA 2A21A 4Y96A 3TW6A 2B7OA 4UXDA 5CPNA 5K4XA 5AHMA 3M5YA 3NZ1A 3W7PA 3STGA 3QSTA 3MWAA 1GEQA 3G0UA 1L6YA 2QJGA 3G1DA 5I3JA 3TJXA 3GYEA 4JXCA 4MZ8A 4MYAA 2V9DA 3R8RA 3LV5A 4JTJA 4JGDA 3LHWA 1OHLA 3AJXA 4JNMA 1A5AA 5LNUA 1H63A 4FXRA 3JRKA 3SIZA 1XUUA 4XTDA 4ZQCA 4CNNA 1AG1O 4O15A 2E6YA 3I7QA 1TPFA 4LW7A 1W37A 2Y7FA 4DPQA 3W7DA 3ABRA 3L65A 1ZNNA 5U4NA 2GUUA 1NAL1 1TV7A 1FXPA 3G1FA 3TJLA 3TK7A 5AYZA 2YPIA 4UNLA 1EX5A 4JTIA 3BGJA 3EWZA 3C2RA 4Z1BA 5EYWA 2H90A 5F2IA 1N8FA 1W5MA 3B0PA 2V81A 3KRZA 3U8GA 1O95A 2J6XA 2XFWA 3V75A 3UQNA 2TRSA 4HNVA 1TV8A 1VCFA 5D03A 1JUBA 2E09A 4DEFA 4GUGA 4WUIA 3SW6A 3HOJA 3HPZA 3OVRA 3HB9A 5C6MA 1FCBA 3B8DA 4IX2A 3M9YA 3QPYA 2VFGA 1F74A 4LV4A 4HPJA 2FFCA 1KFEA 2X1UA 4UC5A 1L6SA 5AN7A 1FDJA 1TSIA 1OFDA 3W2NA 3BG9A 1OYAA 3GKAA 5H91A 3BLIA 3BW3A 3TV8A 4M6PA 4UFMA 4JYDA 1KBIA 2WV8A 4N6EA 4HNNA 3TA6A 4AHQA 2HSAA 4QNWA 3W7MA 3EB2A 1ME8A 2Y7EA 2JKPA 4JTEA 1GVSA 2QDGA 3S6DA 1P0NA 6ALDA 2VENA 3B05A 4JYFA 4NZJA 3L5LA 3TFCA 1RD5A 4JYEA 2OJPA 4LVAA 1YPFA 1Y0EA 5LHFA 1VYRA 1OFQA 4M6QA 4OBTA 5U7SA 4OV9A 1GWJA 2V82A 3GDLA 2FPYA 5GVJA 3SFKA 3T40A 3VFLA 1ZAIA 3OVQA 1TPVA 3GLCA 4MIMA 2E6DA 3W85A 1VRDA 1JCYA 1IIGA 3N9RA 4O28A 5LNVA 3M44A 3W83A 1LOSA 3IVUA 4KFOA 2ZRUA 4CNOA 1TTPA 3W7EA 1OFEA 3QZEA 5DXXA 2ABBA 3TMLA 3I7SA 3W7IA 1J5TA 2QUUA 3CT7A 3I6RA 1Q6QA 3LCXA 3SECA 3T55A 4KFPA 5A8GA 1OYCA 4R53A 3EXTA 4IMEA 5EY5A 4MLRA 5SWUA 3PSWA 3GXTA 1VYSX 3QMTA 3R12A 2OCZA 4N9DA 2QCDA 5CGQA 1GTEA 2X1SA 1B4EA 3B0VC 2YGYA 1I2QA 5G2HA 3LCFA 4FNUA 3FIGA 4CCEA 3HG5A 3M5VA 4LRSA 3RF9A 3SSJA 2B0MA 3HJZA 4UMCA 4AF0B 4NX5A 2Y7GA 1XBVA 1PHWA 1PVNA 4UFJA 1BWLA 4P61A 4FNRA 3UWUA 1FWNA 2V8ZA 1WBHA 3QPZA 3LHZA 1QWGA 1TB3A 3HQ1A 3NVTA 5K3VA 3R13A 2ZTKA 2QJHA 3TAKA 3W6YA 5EA9A 3L67A 3G1SA 3L2IA 1OX4A 1S5VA 3K30A 1JCMP 2QKFA 3TMQA 3DGRA 3O63A 4UFIA 3VKJA 4O14A 3DI0A 2ZZ6A 2ZRXA 3OA3A 4DXVA 3S5NA 3W7NA 5F2LA 1GYNA 4AH7A 2EHHA 1ME7A 2W0UA 1T0OA 3DENA 1F73A 1OFAA 1R2RA 1AL7A 3MI6A 3GR8A 2QCMA 3QFEA 2PCQA 3W7CA 2VEPA 3TC6A 3GKFA 5HWNA 5F4WA 4UTTC 3R5EA 5K9DA 3O6DA 3NQMA 3T7VA 5KZMA 2B7QA 1HUVA 1K7FA 1D3HA 4Z1CA 2QJIA 4IUOA 2ZA2A 4UIOA 3P61A 2ZA3A 1EWEA 2ZCGA 1VC4A 1O60A 1W5OA 4PL1A 1AK5A 2XN2A 2Z2UA 3SGZA 2QAPA 3BARA 1TPDA 3S42A 1H50A 4JY8A 4WY0B 3G1AA 2X30A 4B5NA 3NOEA 3SR7A 2G95A 4IPJA 1JR1A 2VFDA 2NXHA 1LOQA 3BV4A 4IWWA 2J9XA 4NJGA 2RHGA 2CLLA 5LGZA 4OGZA 2C16A 3EWXA 4FX8A 1LORA 1SQ7A 4ZQRA 1XXXA 4CLMA 3BW2A 4ZVJA 4KFNA 3NQ8A 3UY7A 3W9ZA 3C2VA 1GT8A 1TTIA 4FX7A 2Y7DA 4YCOA 3NQFA 2ISVA 4IMCA 4HNUA 4C1LA 2VOMA 4LU0A 3Q2DA 5HJLA 4P2VA 1G4EA 3PR2A 5AC6A 3S1XA 1HL2A 4PODA 3PULA 1Q6RA 1Q45A 4JS3A 4FEZA 1VCGA 2BX7A 1EP1A 3NQGA 3CPRA 4MY1A 3PF3A 5L6UA 4JY9A 5FESA 5I3IA 3NA8A 3PWAA 1PE1A 1O4UA 4DELA 1WYIA 5LHEA 1VHCA 2TSYA 2RFGA 4FIQA 1H62A 4O10A 3A21A 2FB2A 2NLIA 4L4LA 5HINA 3L0KA 3MJYA 2YXGA 5EBUA 4QQ3A 5AOUA 4TMCA 1XBXA 5E1QA 5EKYA 3C3NA 1EUAA 1EUNA 1ZAJA 3KOFA 3KRSA 4ONVA 4WOZA 4UNKA 3WK0A 3D0CA 1KW1A 4R33A 3B0UX 3FYOA 4MZ1A 3QRHA 2X1TA 2CZDA 3FS2A 1YXYA 1QPNA 1BKSA 1QO5A 2QCEA 3GR7A 3NDOA 1YDVA 3R89A 5G4WA 3PG8A 3L9CA 1KA9F 3P82A 4O1CA 2ZZ1A 3CU2A 1EA0A 5IBXC 2G97A 3Q58A 2C6QA 1FWTA 5AHIA 4O16A 1KTBA 3LCIA 4O57A 3VNDA 1VQTA 4MLJA 3W7JA 3TXZA 3KX6A 3NL2A 4Z08A 1QPOA 1EWDA 4MPQA 1YADA 3W1NA 3W87A 3EX3A 3O8AA 1XFBA 2GQAA 3W1LA 3W1TA 1EP3A 3MMTA 4ADTA 4UTLA 3CWNA 3NPUA 4MYXA 2ZFAA 1LTDA 2CLFA 3UWQA 1LRNA 3YPIA 3DBPA 2P1FA 3W76A 1YXDA 3UPBA 3UXDA 3NGJA 1VHNA 4JTUA 4TR9A 5I3FA 3MHUA 4GUHA 1SFLA 4O8RA 4FNPA 1X6UA 4BK9A 3CTLA 5HMSA 3NM3A 1GOXA 1YDOA 2FPTA 1SFJA 1H7NA 3BVJA 1S5WA 3GXPA 2VEIA 3W2LA 3JR2A 2H8XA 1LP6A 3H54A 4WJEA 1QPRA 4AWUA 2DZSA 1QOQA 2HS6A 1H7PA 5IM51 3HMJG 5BOOA 4LV9A 3PBWA 5KINA 2NX9A 3THAA 4FNSA 5FI8A 4CQ9A 2F84A 3TW7A 3ZR4A 4YMZA 4N02A 5CPOA 5AC8A 3HG2A 4NZFA 5D2XA 1DORA 2ZZ4A 1M6JA 1JVNA 3M41A 3IRDA 4M19A 4IMFA 4LC8A 3LTSA 1SO5A 3N73A 3G1VA 4JDYA 3W1AA 1TV5A 1QAPA 4X9SA 2JGYA 4IQLA 3A24A 5F4SA 5DN1A 3Q37A 4RKAA 4EOUA 4LS1A 4GFSA 3P80A 2PRLA 3QC3A 4K6AA 4A22A 4YLWA 1QCWA 3O1NA 1KM0A 4KWVA 1ZENA 3LI0A 4LRTA 4RZ5A 3A23A 2F7FA 3NO5A 3S5ZA 1VPXA 5HR6A 4QJ1A 4HPXA 5D04C 1ZALA 3UPWA 3TSDA 5LNRA 1YXCA 3KRUA 5D33A 3FJLA 1BWKA 4MY8A 1RQEA 1W3IA 4EF8A 1OK6A 1OK4A 3KVLA 3NPVA 3TAOA 3LCLA 3DFQA 3IVSA 2VFHA 1IXQA 3B06A 3KFTA 1QO2A 4ZQOA 3UZ5A 1FQ0A 2OT1A 4W9TA 3GAYA 1IF2A 2GPTA 4N4PA 4NXKA 4X3ZA 3CC1A 4I9AA 5CKSA 1EIXA 1WA3A 4MKNA 4R7JA 2C19A 2A0NA 1M7OA 5TQLA 3NQ6A 3DZ1A 1H1ZA 1OX5A 3PUDA 2PRMA 1O94A 4L4MA 2QUTA 1W56A 1X7FA 4ICNA 1O5XA 5CSRA 1UB3A 1O5KA 3MHFA 4A21A 2CWNA 4Z1AA 4JD4A 4JX6A 3TQKA 3W7KA 3HO8A 2JKAA 1VCVA 3QSRA 1H1YA 4RLIA 5J5RA 3EX1A 3GDKA 3C6CA 4N9EA 4ORIA 1DHPA 3MP5A 1A5BA 5T26A 5AC7A 3I65A 4DBDA 3ATYA 1JCNA 1RQBA 3MHGA 3EWBX 8TIMA 2TYSA 1TTJA 1XKYA 3W7GA 1YPIA 3VI2A 3S0CA 3G1HA 3NPXA 2EPHA 1RVGA 1F6PA 4RZ6A 1XBYA 1I8JA 1M5WA 3HF3A 1WOAA 3NL6A 3HPXA 3HGSA 4RR4A 2OMAA 2B7PA 4XWUA 1JCJA 2ALDA 4E2DA 2C1HA 5E0KA 3IIOA 1KFJA 1KV8A 1HTIA 3GZ3A 2J24A 5TIMA 2GQ9A 4K36A 5IBXA 2TPSA 1AW5A 3DXIA 4JTFA 4JTKA 3KVJA 4IX0A 1QMLA 2QEZA 1W8SA 4ZMGA 2ZRWA 4O1BA 3G18A 1SZGA 2R91A 1IXNA 3PAJA 3OHIA 3GX9A 2Q8ZA 1VJIA 1W3TA 1JULA 2P10A 2ZZ3A 3HPSA 3WJSA 4E38A 1F2JA 3W3OA 4GJ1A 3O06A 2C14A 3NXFA 4UMBA 3GDMA 2Z0IA 2PURA 2QR6A 3ABOA 2NUWA 2VEKA 1JCLA 2B7NA 2LLEA 3TR2A 3BLEA 4PCFA 5KSWA 1YDNA 3EX4A 2YW3A 4EIVA 1PCWA 1LOLA 4AVFA 4Y9AA 5F4XA 1LYXA 3ABQA 5KZDA 1HFBA 3PB0A 2OT0A 3FEMA 3MW7A 3DH7A 3C2FA 3R2GA 1R47A 1I2OA 3PSVA 2ZZ5A 3CIWA 1V5XA 3LHUA 4JIPA 1H7OA 4K7VA 3BGGA 1V7YA 3RLUA 3FA5A 1TQXA 2QAFA 4M6VA 1OF8A 3WJZA 4EF9A 3BK0A 1CX9A 3G3MA 1XDMA 3H53A 1LM1A 3G1YA 2WO5A 2FTPA 1LRQA 1TPEA 1KV5A 2UV8G 1SSGA 1LCOA 4LS0A 4CCDA 2NUYA 4N9BA 5HUOA 1VLIA 4FF7A 4Y90A 2JKEA 2Y63A 2A7PA 4NNCA 3KXQA 3SJ3A 1AMKA 2ZZ7A 2J27A 2WKJA 1DJNA 4O0KA 1A50A 2EF9A 4DF1A 1XI3A 3LGEA 4UTMA 3C2EA 3NM1A 3NZRA 4MFDA 3BO9A 1LDCA 3LHTA 1IXOA 3SY5A 3W2KA 2CZEA 3IVTA 4PFMA 4GUJA 1NF0A 1P5BA 3NQEA 4WXYA 5D09A 1GVFA 2H8ZA 3TNOA 3G8EA 3W23A 2RDUA 2JK2A 1C9DA 1DV7A 3E02A 3LCHA 1HO4A 1ALDA 4WY0A 1G4PA 5J5DA 3L5AA 4QM1A 3FFSA 3N19B 3USBA 1I4NA 1OVDA 3TFXA 3O6CA 1TPH1 1DL3A 3DHDA 3ATZA 1OFRA 3IGXA 4QISA 1I2NA 2C0AA 3IGUA 1U5JA 2W6RA 1KM1A 1K7EA 2HS8A 5LNWA 1H7WA 3QM3A 3C56A 3CWOX 1B3OA 3IIPA 5DCDA 4BI7A 4UTWA 3IIZA 3W71A 4XUGA 1S3HA 4QNEA 3T44A 1UCWA 3NAVA 1HG3A 5C5YA 3G0SA 1JCXA 2C13A 1K8XA 3S1UA 3WK2A 5K9XA 3KHJA 3W7QA 4QITA 4JTSA 2C3ZA 1RV8A 5BRBA 5F1VA 1P0KA 3LRLA 3RNDA 1YLVA 2VXNA 3KVMA 3N2XA 3EKZA 4UR7A 1LZOA 4LUJA 3G3DA 2Q3RA 3LCWA 3UWZA 3MBFA 1ZAHA 1R30A 3W1PA 2R94A 1VR6A 5EMUA 4ORMA 1KM2A 3QEZA 3W1MA 5DCEA 1Q6OA 2JBMA 3MP4A 5K9CA 1VLWA 1FX6A 1GG1A 2W79A 2X2GA 4DBEA 1YTDA 4G1KA 3STEA 5LNSA 2QCDB 2TMDA 5DLCA 1VH7A 2D73A 4O12A 5KZEA 1OFOA 4UCGA 1A5SA 1QR7A 1TRDA 3C8FA 5ABTA 3F4WA 2V2HA 5AB3A 3BW4A 3UWWA 3F4NA 2R8WA 1I2PA 4GXMA 5I3HA 5BNKA 3OIXA 4ZQPA 1JUEA 2GJNA 4MVAA 3HGJA 4JICA 1PL9A 2YW4A 1TYGA 3FLUA 3NQ2A 4NJIA 4TIMA 1ICPA 4LUIA 3W1XA 4H4IA 1ZHAA 4MUZA 2A1YA 3V1PA 2YR1A 4O18A 1F5ZA 4O13A 5FF7A 5KTLA 5AYYA 1SW7A 2YX0A 4LY8A 5CZTA 2E6FA 2ZA1A 4NUWA 3SI9A 3TU9A 3NL3A 5F2GA 4S2BA 4JTGA 5LSMA 4NJHA 4IOTA 3PG9A 3INPA 1XM3A 1K8YA 2DZUA 1CI1A 3WJXA 3EWWA 4H3DA 5D05A 4MOZA 3O16A 4UR8A 5G1YA 4UTHA 2E77A 2ZYFA 1DQXA 3A22A 1GVOA 3G8RA 3DHFA 1U83A 3ZS4A 4IXXA 4ZQNA 2CLHA 4AHOA 1WOBA 2G96A 3HG3A 2ISSA 4WOQA 3GAKA 2PRHA 3W1QA 3S1WA 2YYTA 3L21A 3E9AA 5LKYA 1UJPA 3QYQA 4N4QA 3IV3A 1SZNA 3MP3A 3I68A 1SSDA 5FEWA 1Q6LA 5KMYA 1G4TA 4RK8A 5CSSA 3TDFA 2PE4A 2DORA 2AAMA 5HUPA 2RH9A 2Y88A 3GDRA 3C4UA 3G0XA 1TJPA 2PC4A 3M5XA 1GZGA 4GUFA 3F1QA 2ZRVA 4JDBA 3P60A 3MBDA 3FKKA 5BMWA 2C18A 4I7UA 2WPBA 4HIBA 1RZMA 2DZPA 4JR5A 3NR0A 3RK8A 1NFBA 3L66A 3W84A 5H2ZA 5AYXA 3FJ6A 2BLEA 3PBVA 2E5DA 1DBTA 1TIMA 3WK1A 2B4GA 3PS7A 3BG3A 3UWVA 3CB8A 4MJMA 2FQIA 3UXAA 3NG3A 3OBKA 4E2BA 2E1DA 1F7BA 3S5YA 5G1TA 2QCGA 3TH6A 1EPXA 3EKLA 3IIXA 4R34A 3GVGA 4JN6A 4BI6A 1XUZA 2ZTJA 4OU1A 3PBUA 3SGUA 1R2SA 5I3KA 1ME9A 2Z6JA 4IGHA 4IXHA 4LOCA 2FDSA 3WFAA 3EEGA 3DI1A 5C2XA 1TCDA 3EX6A 4OT7A 5EL1A 2X16A 4I7VA
chains in the Genus database with same CATH superfamily
1F3WA 1BXCA 2PU1A 4EXBA 1QW8A 1WZAA 3EAUA 3NEHA 1MVYA 2FVLA 3TN6A 2PTDA 3AICA 2FH8A 1QWKA 3RLVA 3TYZA 2HVNA 3MI3A 4M29A 6A3HA 3RCNA 3VC5A 2A79A 4GQBA 2HZGA 3QMSA 1J8VA 2Q3OA 4WY0F 2GJRA 2X09A 4HP5A 4QLKA 4XD3A 4HSOA 4RL3A 3O6AA 1VBUA 5AC5A 4US5A 4UMAA 1EDQA 3U3HA 1MUCA 4C6EA 1UR4A 3SQMA 1FCVA 1YPXA 3N3TA 3SDOA 2WWCA 1TO3A 2PTYA 1W0MA 4QR6A 3QQ0A 2DDXA 3SN1A 4AIUA 3TQVA 2POTA 4MZYA 3W29A 2CZ5A 2BVWA 3CO4A 3T4CA 1BTMA 4DM1A 1W1B1 4JPGA 2CC0A 2FZMA 3CHVA 3L0GA 2A6NA 4OIFA 4CQAA 3BG5A 4I6KA 2ZADA 3G1RA 3PAOA 4BCEA 4DZHA 3T2QA 2GVLA 4S2CA 1KD0A 2J7BA 1U2YA 4Y6GA 5G2IA 1O1HA 1X8FA 3UXKA 1G69A 1FWWA 4O11A 4F0RA 3MJMA 2PCEA 4HK5A 4DRSA 2CLMA 4X63A 2NWRA 1MEWA 2C7FA 3HMCA 3ERPA 2YYUA 4JEQA 1QFEA 2BXVA 4PB3A 5FA5A 4KF1A 1AW2A 4DWSC 5I09A 4B16A 1XH1A 1A0EA 1Z42A 3K1GA 4PMDA 1AZ1A 4KWWA 1HVQA 3EA2A 1L6WA 1TUFA 3UNDA 3GY1A 3AJ7A 4AG0A 1XS2A 3N6JA 2CITA 3AMLA 3B8VA 2V5JA 1FWRA 3OLDA 1G01A 1R85A 4A3RA 4MJZA 2ZIDA 3MUXA 3N25A 5TAOA 2YDAA 1TZZA 4P7NA 5LZLA 4BWLA 2HK1A 1G4SA 4FLQA 4ZE5A 4RXFA 1OGSA 3MA8A 1UYQA 3FYPA 4Y8EA 2YXOA 4QEHA 4EX4A 1S1PA 1QUMA 1GTHA 4FALA 1I45A 4S3BA 4NVTA 1DWAM 5H8MA 1PIFA 4XUYA 2XWDA 4YTRA 2WCGA 3LI1A 2XVPA 3C2OA 1K7XA 3BJSA 1CLXA 2A7NA 1Z8AA 4JQ4A 3POHA 4MB1A 1SJCA 2BXYA 2O7QA 1LQ0A 3CB3A 2AQWA 5D37A 3H7UA 1ELSA 3WH8A 1JZ4A 3CJPA 3EMCA 4UOQA 4BFAA 1TPB1 4MUPA 1HP5A 1JJKA 2HPMA 2FGLA 2HK0A 3CUGA 4QJ3B 1EOKA 2QLYA 4Z2GA 3DKJA 2DUAA 5M3WA 3EEZA 4MY9A 3LB0A 3GRIA 3ES8A 1PX3A 2CLKA 1XQLA 5L9FA 2YB4A 1ZU8A 2C8NA 5GQBA 2XDFA 4GK8A 4IG2B 3AIQA 3B9EA 3R0UA 3QOKA 1GJPA 5D8ZA 5DBUA 4O17A 1TPUA 2ZWZA 2CWXA 3CEPA 1XIDA 3IIVA 4LQ1A 3ARYA 3T05A 3WNLA 2YL6A 3ALFA 5GJPA 4U28A 2XHYA 3QW4B 2ACSA 1HN1A 5IHRA 2C15A 5H8PA 2GSJA 3LQLA 3LHVA 3WLKX 3ZT7A 2Y1HA 2AQVA 1ISYA 4G7EB 2YCLA 4PMOA 4Q33A 3RMEA 3W1UA 2BTMA 4BJHA 1QNVA 1ISWA 4K8HA 2V3EA 5IFPA 2VR5A 3UG4A 4CNUA 3T8LA 1HXJA 2ASHA 2FYMA 1IEIA 7TIMA 1GVRA 1FP8A 1UD2A 3VMPA 5EB8A 5E70A 3CQHA 2GVEA 1PTDA 1H51A 1Q63A 3UF9A 4CCZA 3UJSA 1A0CA 5AHEA 1XH2A 4HBKA 1W31A 5CG7A 1DWHM 3PM6A 1S1RA 3R79A 4LVGA 4RX0A 5CAKA 2P8BA 4DVOA 1X8CA 4IPIA 2A3AA 3A64A 3QHMA 1S38A 1VGAA 2VX7A 1E15A 2PWUA 4YU1A 4XBKA 3HU7A 5M17A 3T2OA 3R0DA 2DU2A 4RNHA 4W87A 4MWAC 5C55A 3AWNA 2JE8A 3VMNA 5HNRA 3BSGA 2EG8A 4RZ4A 1XCFA 3TSMA 3QFWA 4JIQA 1EJSC 2F38A 4HZ8A 4XBSA 1N8WA 3LLFA 3ITGA 3STPA 5BOFA 1W3NA 1CXLA 1ZUAX 5DXYA 2E9MA 3MZNA 5GNXA 4K1GA 1OINA 3WD2A 4N6FA 1Z7AA 1J96A 3KDNA 3S2CA 2PF8A 2UY2A 1EBHA 1CXEA 2QCHA 1VEOA 3TROA 5CBIA 1SZFA 3M1ZA 3W01A 3EYPA 4GBUA 2QDHA 5CZKA 1SW0A 4HMEA 3LCGA 5A5WA 2CLIA 1S5NA 4PRWA 2VUNA 1MQRA 3SZ8A 3DFOA 4S3KA 5JXQA 2V5CA 4UWMA 5DT5A 2VVNA 1J2WA 4GYKA 1PXGA 2DQXA 1N7KA 4AD3A 4KGLA 2OYMA 4F79A 4Z2IA 3OG3A 3ARZA 3OZYA 1P1XA 1YTKA 2DIKA 2Q8XA 1O12A 4NJKA 1SU5A 4I9MA 3WO8A 2ABAA 4K39A 2PC8A 4K8GA 2D0FA 1ITXA 2BASA 4KWOA 4O19A 2PGEA 1JZ8A 3THUA 2J9YA 1I1WA 2PLCA 3LRMA 4HHHA 2XSBA 3IACA 4TU1A 3N2BA 1OSEA 2OWXA 5HBFA 5HQMA 3CUJA 2CFFA 3GHRA 3R43A 5KITA 3EWUA 4B2DD 5DMYA 4I8DA 4IMDA 4BY3A 2PF0A 3EWYA 3K4WA 2A85A 2DH2A 4EPDC 3B97A 3UERA 4LJ3A 2G3MA 1LF1A 4Q32A 4ZL1A 3CUXA 3W7HA 1TMLA 2O4QA 3NYZA 5BWAA 3STFA 3UA4A 3T78A 2YB1A 1XQKA 1EGVA 2YXXA 2VX6A 3OZMA 3APTA 4EAYA 2DFAA 1WZKA 1JD7A 3LBMA 5I3DA 4D1IA 4GQQA 4ZZ9A 1CECA 3WMLA 2HMCA 2RDTA 5C7VA 3ORWA 4L9XA 3H2CA 3RFAA 2ZUSA 2H9AB 1EO5A 1A3WA 5I02A 4GISA 2EPOA 5HNTA 2GGGA 2CZFA 2IKJA 3F7JA 3TE9A 4U33A 5A6JA 1T41A 2JALA 3E12A 1OD0A 1A47A 4I7WA 1D8CA 2NQZA 1PJ9A 2OQYA 2WQPA 2ZX9A 1MEIA 1KTNA 3GXIA 4Y8FA 4BF5A 4MDOA 4D8ZA 4JHZA 2WM1A 1RBOB 3CEUA 3KDOA 4PBGA 1L8NA 1XICA 3SCUA 2WHMA 4MNLA 1P0EA 5C9ZA 1YBQB 4GC4A 4ZE4A 2IQTA 2QJMA 4DO7A 3EB3A 4DN1A 2OTDA 4LH8A 5DMMA 2V2CA 4EVZA 1V3HA 1SO6A 2ISWA 4M51A 1VEMA 4HHPA 1MZHA 2CHOA 4WQ6A 1RPXA 3W75A 1K6AA 2Z1BA 1OCNA 1AD4A 4AXKA 4D6FA 1T8QA 4F0SA 4P8VA 3NTYA 3EA3A 3MI2A 3CTTA 4Z1DA 4K8EA 4MJ2A 3W72A 4GIRA 3EXRA 1JPHA 3CHFA 1V6WA 3A5VA 5D2YA 4YTQA 4AEFA 4PSPA 3E2VA 1XYLA 4Z2HA 3O05A 5CH9A 4XKYA 1VZWA 2CBUA 3MSGA 2VWTA 4YTSA 2QPXA 2WC3A 1YYAA 2YZRA 4IFOA 4AWSA 1HQTA 5HMFA 1TA3A 2XZ9A 5HWJA 3A9IA 4O4WA 4ZSTA 4YWSA 3TONA 4JFWA 4Q6JA 4LGXA 5ABGA 3UETA 3JS3A 3SUUA 4YPJA 4JTLA 3UZJA 1W9UA 4ALDA 1Z69A 2CU0A 1XLCA 4LEQA 1F3TA 3KTSA 4O53A 4NNBA 1PHQA 4NXSA 2A3HA 3WQWA 1JRCA 1FH8A 3MTWA 1EF3A 4DXXA 4PTXA 1WKDA 3WBXA 4JX5A 1J6PA 2QIIA 3LN3A 3Q65A 3D47A 4NQ1A 3HQPA 4Y96A 3QLLA 5K4XA 3M5YA 3NZ1A 1VKFA 3K13A 5C9XA 1U30A 3E0FA 2HE5A 1DJZA 4OKDA 3WUGA 4ZCWA 1GOIA 3TJXA 1V6YA 1TE6A 1GOOA 2UY5A 3EKGA 4ZXOA 4JNMA 3UESA 3SIZA 4O1FA 1XUUA 4LF2A 2C79A 1TZ9A 4S39A 1JZ6A 4O15A 1BXBA 2E6YA 1TPFA 4LSBA 4DPQA 2G4FA 2BY0A 1RJQA 1FKXA 1QT1A 1HJVA 1NAL1 2D24A 4S3CA 5AYZA 1EX5A 3GC2A 4PMUA 5A6TC 1N8FA 2V81A 2QJJA 4XD4A 2CXEA 2XFWA 2QV5A 3UQNA 3ISIX 2OO6A 1TV8A 4HOWA 2F61A 4GJIA 2J7CA 2XIOA 3HOJA 1UHVA 1Y8BA 3OVRA 3HB9A 3ZT5A 2RAGA 2X1UA 1L6SA 2PWGA 1QI2A 5AN7A 4E8DA 1FDJA 1OFDA 2OZTA 2D2HA 3FVDA 5HPCA 2EXOA 1D7KA 2HISA 3GKAA 2YJQA 4FI4A 5H91A 1R87A 3TV8A 4U31A 2XFYA 2WANA 3VZXA 1DWIM 3DBNA 2WV8A 4E4FA 2E40A 4JTDA 5GNYA 3LMZA 4ATDA 4IMAA 1UP2A 1E72M 2QMKA 1BQGA 1RPKA 2JKPA 2R9RA 3F4DA 4JTEA 4Q7BA 4WHBA 3XISA 2PLKA 3TEVA 3NYDA 2OJPA 2VCCA 3T1GA 4F40A 3B9AA 1Y0EA 4DJEA 4A8IA 2YDSA 4M6QA 4OBTA 3R58A 4RE4A 3K46A 1K4HA 2FPYA 5GVJA 3SFKA 3VFLA 4PR4A 3GLCA 4MIMA 4J3VA 3W85A 4O28A 4H8HA 2I5QA 3M44A 3W83A 3OP2A 5CPTA 4CNOA 3ZJ7A 1WZMA 2Q6ZA 2BB0A 2O55A 3QZEA 2XSXA 2VGIA 3DGBA 1TV2A 3PJUA 4DUXA 5A8GA 1ZJHA 4IMEA 3TWBA 4J40A 3GXTA 1VYSX 1M9HA 4PMZA 3WX7A 5CGQA 4ZA0A 3B0VC 2PLJA 2VRKA 3FIGA 1E0WA 3M5VA 2OLSA 3SSJA 2B0MA 5CGTA 3CWHA 4DB7A 4WVXA 1RXOB 4L80A 2I9UA 3H2NA 1BWLA 4GG9A 1US0A 4A8NA 3KW3A 3DG7A 3W6YA 3VOHA 4YJ5A 4IZGA 3OPSA 2AKMA 5A95A 3L2IA 3K30A 2CIPA 2P53A 2XIJA 4DYJA 1JCMP 1W1IE 3CUFA 3SM0A 3DYMA 4DYEA 4UFIA 1Q85A 3VKJA 3DI0A 3WMSA 2ZXAA 1KRCC 2ZRXA 3W7NA 3GYCA 2QS8A 3OZOA 4AH7A 3B8WA 5JIWA 4JZ5A 1OFAA 1W3LA 5XIAA 2V63A 5KZ6A 1MRQA 3T9PA 4BS0A 1E9YB 4LUTA 3GM8A 3W7CA 3TC6A 3BAJA 1UZDA 3GKFA 2SFPA 5F4WA 4UTTC 1DTNA 1NOUA 5A6AA 4KEMA 9RUBA 3WN6A 2ZC8A 2G50A 4ZOBA 4DYKA 4Z1CA 1E9ZB 1XLAA 4UOJA 4MNMA 2ZA3A 1JZ3A 4L64A 2ZCGA 1VC4A 3JZEA 2XN2A 4M6UA 4G2DA 1EKOA 3NOEA 3ITTA 3SR7A 4AY1A 4IPJA 4L56A 2Y5SA 1E6XM 2A3EA 2DQWA 2WXDM 4TUFA 4FLOA 4LAKA 1OG6A 4HA0A 1LORA 4HPGA 4XIMA 1JF5A 1TX0A 3BW2A 4ZVJA 4DWSB 4KFNA 3UG5A 1ZLPA 1QBBA 1TWIA 1KRAC 3W9ZA 3C2VA 3PZUA 2DW6A 2PODA 4DJFA 2DZBA 2NQ9A 3RO6A 4IMCA 2VOMA 4D6GA 4GXPA 3ZLFA 4W8AA 1G4EA 3AYVA 5AC6A 3AHVA 4GINA 2WJEA 1LL7A 3PF3A 5L6UA 3ARRA 2Z7GA 1W1PA 4F2TA 5DX7A 5FESA 2OEJA 3LNPA 1PE1A 3POCA 3QGKC 4I5XA 4HZ6A 1JI2A 1P6WA 2OR2A 3OQ8A 5LHEA 4N42A 1UUQA 1NWUA 1V4YA 2RFGA 3ARUA 3GTFA 3MSDA 2FB2A 2NLIA 5TD4A 4QDPA 3MJYA 2YXGA 2GOKA 5EBUA 2GSEA 4EACA 2AMGA 1TWWA 2AQOA 1BXNA 4CD6A 1ZAJA 3FY1A 4WOZA 4UNKA 3WK0A 4R33A 4GIAA 3SEPA 1E43A 3C2YA 3QRHA 4TVDA 2X1TA 2G0WA 3FS2A 1KBLA 1K8CA 4XVEA 2CLPA 2VRQA 1RJRA 4O1CA 1XC6A 3PANA 3Q58A 4Z1YA 2XVGA 2XIBA 3CNYA 1E71M 4ZR8A 3SUSA 2OQHA 2WZTA 4KGJA 1QPOA 1TR1A 1UWQA 4MG4A 4JHMA 3PP7A 3W1NA 2I5GA 3W87A 1EC9A 3VYLA 1XFBA 5CLWA 2GQAA 1AQHA 1AH3A 5CSYA 4ADTA 4B9YA 3E0WA 2ZWYA 2VD8A 1OIFA 1UKQA 2CLFA 9XIAA 3PN8A 3YPIA 4ZB0A 3DBPA 3RM8A 4IGNA 2ACRA 3AIVA 3MV11 1CLKA 3UXDA 1BF2A 3SBFA 1FP9A 4TR9A 2PDBA 1VFHA 4EP8C 2AKZA 3L2MA 1YDOA 1SFJA 3WMCA 3GXPA 2VEIA 2DSWA 3W2LA 1FWIC 4IGSA 4J7RA 2FH6A 4AWUA 2WMKA 3WNPA 2WPGA 1H7PA 5IM51 2J47A 5C8BB 3THAA 3GU1A 3R4IA 4FNSA 5FJOA 3BOLA 3TW7A 2INFA 1DHKA 2REQB 1U33A 4GYJA 3OA5A 3GH4A 3CQIA 3OO2A 4BA0A 2YDRA 3PPCA 3PNZA 4JDYA 4AIEA 3P93A 2JGYA 5DN1A 4LS1A 4H9ZA 2VX4A 2PBOA 4HK6A 5PTDA 1ZENA 3EMQA 3A23A 3U2ZA 2VR2A 5XIMA 1P6CA 5HR6A 1DEDA 4QJ1A 3E1F1 2QPSA 3BGAA 4BQ5A 2ICSA 1YXCA 3KRUA 4MY8A 4PMVA 4EF8A 3EDFA 3HM7A 1OK4A 3KVLA 1W1YA 3LCLA 1RLDA 3M0VA 3DFQA 3GS6A 1PEZA 4URIA 1F8MA 3B06A 1QO2A 1B3VA 3UZ5A 3HV8A 2OT1A 2WBGA 2PAJA 3GAYA 4NXKA 5FJRA 4C90A 4ZB2A 4JAWA 1IEQA 2A0NA 1BRLA 2TODA 2IPGA 2VOTA 4HPHA 1KGXA 3DC8A 1B3XA 1BGGA 4L4MA 4IICA 3AXXA 3M0JA 3UGRA 1X7FA 4XD6A 1W6TA 4ICNA 1O5XA 3GSMA 4A21A 5HATA 4Z1AA 4MWAB 2QVNA 3W7KA 3GHUA 3HO8A 2JKAA 4D6EA 3QZ6A 2YCKX 4RLIA 3EX1A 3GDKA 1DHPA 1A5BA 4NP7A 3P2VA 3CAQA 3EWBX 4CD7A 4ATLA 1YHTA 3GHSA 4HYWA 2O9RA 1KO0A 1TTJA 1XKYA 3W7GA 3VI2A 2F2HA 3S0CA 3PJWA 1VD6A 3G2GA 3QKEA 5DMLA 1W91A 3E2RA 3KOZA 3PZGA 2G3NA 4Q8MA 5HJYA 2OMAA 2B7PA 3ZZ1A 4AD1A 5E0KA 4F48A 1KFJA 1VFSA 1J01A 1S39A 4B9ZA 4XISA 1Q6FA 2VCBA 5EMJA 2TPSA 2P88A 2P76A 4G7EA 3HA1A 5AC4A 1QMLA 1ESWA 2QEZA 2D3LA 4ZMGA 1OT1A 4HQVA 4E6MA 2YBVA 3HZ3A 1QI3A 3GX9A 1VJIA 4YTUA 2P10A 4M82A 2G41A 1IR2A 2BGQA 2ZZ3A 4J28A 3UZWA 1GOKA 2E25A 4XZLX 2WZHA 3ARTA 1KNWA 3O06A 2D2OA 1M3UA 2Z0IA 4PN2A 2LLEA 3SFWA 2YLLA 2R1LA 1I0BA 2X0HA 1LOLA 4PZVA 3G6LA 4Y9AA 1LWJA 4AVFA 5KZDA 1XD0A 2OT0A 3UFYA 3MW7A 3C2FA 3R2GA 1PDYA 1R47A 2YA0A 2BXZA 2PDMA 3LHUA 5RUBA 1FWFC 2DVUA 1V7YA 4M6VA 4EF9A 3BK0A 7TAAA 3G3MA 1KR1A 1PTGA 5DMNA 2WO5A 1GORA 2FTPA 3MMDA 4JHOA 1L0PA 3WLTA 1V0MA 1JNEA 2J6VA 3SUTA 5CPQA 3AIBA 4LS0A 4UNIA 1V3MA 1JIBA 5FL0A 4XV0A 2OVLA 2NUYA 1JZ2A 3MCOA 4G1NA 4FF7A 3S83A 1AMKA 1H0IA 2ZZ7A 1OGBA 3MMUA 1SFSA 3J7HA 1A50A 2DIJA 3D6NA 3MVIA 3RPMA 3V0SA 4UTMA 3C2EA 3MB9A 4DIAA 4W8BA 1IXOA 1D7FA 3SY5A 1MWOA 3IVTA 3ARPA 1E6PA 1JCTA 4ICMA 2GK1A 1NF0A 1P5BA 2RDUA 4I5UA 3E02A 3S1GA 1HO4A 1E4MM 4QROA 4WY0A 3N19B 1PZ2A 4R27A 3O6CA 4XG1A 4HMCA 1EF2A 1OFRA 1Z32X 2GGJA 3IGXA 2FHCA 1I0DA 5J04A 4QISA 2MANA 3KM8A 3WNMA 4US5D 5EMYA 4C7DA 1H7WA 3B0XA 3CWOX 1NWRA 5DCDA 4BI7A 2V3GA 3IIZA 4DXKA 3CMFA 2FZ8A 3F5KA 3BMWA 3T44A 3NAVA 1HG3A 5LIKX 1XLIA 5C5YA 4JIIX 2G37A 1E1FA 3UPMA 4ZFMA 4NAEB 4W84A 3WK2A 2JIWA 5LIWX 3WQDA 5BCAA 4JTSA 4BKNA 1NWSA 2C3ZA 3TW9A 4CVUA 1V77A 4H9TA 5F1VA 3EA1A 4KRZA 1PB0A 1XSJA 4Q4SA 1UWUA 3GUWA 4YHGA 4LUJA 4JKMA 4GVIA 3T0TA 3UWZA 4GY1A 3MBFA 2G3JA 1YNYA 3H2MA 5EMUA 1CTNA 3ID7A 1KM2A 3D46A 1Q6OA 3MP4A 4NSBA 5A6SA 3VCNA 3AS3A 2X2GA 1YTDA 5I24A 2PWDA 5T9CE 3U5UA 3AYTA 2TMDA 1J18A 1BFNA 2D73A 3U4AA 1UR9A 3LPFA 1QR7A 2PD5A 1TRDA 3C8FA 5ABTA 1SVDA 1F6YA 4GXMA 3OIXA 3N4EA 4MVAA 1KFWA 1ICPA 4LUIA 3EGJA 3W24A 2VX5A 2OKTA 1OCQA 3CAWA 4PTVA 3MT1A 3CZJA 1H11A 1SW7A 2VDIA 5CZTA 4FXJA 3AIUA 2NQJA 1IWPA 3O0FA 4X60A 4A8RA 4NJHA 3IJ7A 3ME3A 2YA2A 3EWWA 5M03A 5REQA 2XGZA 3U0HA 3WD1A 2E77A 1GVOA 3BV7A 4IXXA 4ZQNA 4ACZA 1WOBA 1Q2RA 1K4GA 2WMIB 4WOQA 3E9AA 3L21A 5LKYA 2J8TA 1EC8A 3QYQA 4N4QA 3IV3A 1AD1A 3MP3A 1SFTA 4AVOA 8XIAA 1Q6LA 1J10A 4GIYA 4RK8A 4QQUA 5CSSA 2PE4A 2HBXA 4Q8WA 3UCDA 3BSHA 2VWSA 2EO7A 1W9BM 3GDRA 3C4UA 4HA3A 4HOZA 4GUFA 1N8IA 2J13A 4GQGA 4H9UA 5BMWA 3S2LA 1ITUA 4J27A 3NR0A 3RK8A 3BMVA 3CQKA 2WVSA 1XLGA 4B92A 1TIMA 2E9LA 1HGWA 3PS7A 2J7DA 3UWVA 5M1TA 1WUEA 3ZSTA 1AVAA 3BDKA 3GW3A 2ZVIA 3PTKA 4R7OA 2Z26A 1LG2A 2VURA 4V28A 2POZA 3B3DA 1EPXA 3EKLA 3VKBA 4R34A 4GYPA 4LX4A 3WDPP 4OU1A 1W1A1 3SGUA 1R2SA 3TN4A 2Z6JA 4LOCA 2Z25A 1C7TA 3VNLA 3GTIA 3OJGA 1TCDA 3EX6A 4I7VA 3B9OA 3NQDA 1WKYA 4XZWA 3C61A 3S5OA 1H60A 3M0MA 3O07A 4LCSA 5I03A 4ZENA 3AMCA 3TYAA 3VOGA 4GZJA 2NVAA 1DIOA 1QPQA 2GWGA 1DOSA 4OQVA 3FGCA 3DKLA 1OQFA 3ABZA 3LGGA 1P4CA 4LUSA 3H2FA 4NASA 1JZ5A 3O6YX 3NDYA 2DUZA 3DFSA 3LOTA 3WJWA 1FVPA 2R6OA 3ELFA 3VPLA 4RUBA 3LPGA 1W5NA 3PBYA 4WGXA 3EX2A 3CQ0A 1MUMA 1IWAA 4XZ9A 1FWSA 1RQHA 1TJRA 3AROA 3TC7A 1FDZA 4PC8A 1G94A 3L5MA 3KCLA 1PS9A 4Y9OA 1B3YA 5HWMA 3VD5A 1B57A 3HJEA 4C7FA 3THQA 2XN0A 3OGVA 2PZ0A 1G1YA 3ZVHB 1VFMA 2BVDA 4DUWA 1LLWA 2PDUA 4LWWA 1CB7B 3AHTA 3ZYZA 2Y62A 3QHOA 3RX2A 5D38A 1AL8A 4QSHA 3B04A 2WJDA 3N2MA 3VGGA 2XU2A 3GDTA 4DAIA 2YFNA 4NAFA 4AFYA 4Z0JA 4OV4A 3OW1A 1NWTA 3TLLA 2V5LA 4RV8A 3TTEA 1ADOA 2QXWA 3GVRA 3VKDA 1SMAA 5G1MA 1AH4A 7ODCA 4H7VA 1PKYA 4Y2WA 2A2IA 2BS9A 4PCPA 1E3XA 4TQTA 2OODA 1PDZA 4ASTA 4WF7A 4IPPA 3NQ7A 3P62A 1OT2A 3ZO9A 3PB2A 3UJEA 2BWGA 1OC5A 3UY8A 3VABA 1M03A 4AMAA 2PBGA 1YIXA 4MB5A 5D30A 3KAOA 3V5CA 2O9OA 2QCLA 1HX0A 5A6KA 1M7PA 1RBLA 3P14A 1XDLA 3K8LA 3H7VA 4WK9A 3VO0A 3STCA 3WBWA 3LERA 1QTWA 3GG8A 4X22A 3P74A 1FFQA 3P8JA 3GNXA 3PZQA 1D3GA 2BSLA 2JGQA 4E3TA 3DFNA 4GX9A 2WMHA 5LXXA 2ON3A 4RXGA 3H55A 4IQJA 1SPQA 2E8ZA 4HMNA 4RCXA 3RU6A 4CU8A 3GIPA 4D8AA 4IT1A 3UYCA 3M47A 4M5PA 1XLJA 1E3ZA 2DZTA 3N2TA 4A35A 1W1TA 3OHMB 3BQ5A 3AYRA 5MHBA 3VNMA 2CBJA 1KLZA 2BVYA 4TX9A 5FEZA 3FOKA 1MDRA 2XM1A 3L0NA 1ZP3A 1X1OA 3CYJA 3R7MA 1I2RA 1LLOA 2RDXA 1S5TA 1UA3A 1ONRA 2PSNA 5FJPA 1SJBA 3RMJA 3W7LA 3DFHA 4LNCA 1B3ZA 3SUVA 4HHMA 1GNXA 1XRTA 1V0LA 1RCXB 1BYCA 4C6NA 5IFTA 1ZY9A 5LA1A 1GQNA 3PUEA 4U4MA 3Q67A 2ZRYA 3QBUA 2IS7A 3WZ0E 5HMEA 3AU6A 5CJNA 4ATWA 2Y89A 3FDKA 2VZTA 1LROA 2ACQA 1TQJA 1EHNA 4ADUA 1CEOA 3NSNA 4MFEA 3VIPA 2RDWA 5C71A 1H5YA 3ICJA 3LA4A 1DE5A 3R94A 2FPVA 3GG0A 4EXQA 4PB5A 5AHNA 4PUKA 4R5EA 3VZZA 3PWGA 2OLAA 3S1VA 5BYWA 1JL8A 3I3BA 3W2MA 3IJDA 1YRRA 3DFPA 4LTSA 4AEEA 2H6RA 3W70A 1IGWA 3E0LA 2VGFA 1UIPA 1F05A 4KW2A 2X1RA 3U2OA 4Z0SA 2GSHA 1QPKA 3W2JA 4EWND 4MAVA 3TN5A 4AISA 2HBVA 3N14A 4WSJA 4DF2A 3BSMA 2DJLA 3BL3A 3MSRA 4O1AA 3L68A 4W7VA 2PGWA 1DKWA 4LVBA 4KWSA 5BXSA 1XG4A 3TR9A 1LL4A 1AMYA 4WXZA 3W74A 1GPWA 4ENLA 4M7TA 4OHQA 4QAIA 1W2PA 2O4MA 2ZX7A 1QNQA 3WNKA 1IE7C 3HFYA 1FWGC 2ZDRA 1GVYA 2ZVRA 1L2QA 5D2VA 1EOMA 3TZFA 2DV0A 2I1OA 2HTMA 3WDIA 1YMYA 3TYDA 3ZIZA 4CCCA 3JU2A 3TTSA 2DW7A 3LX9A 3NDZA 1W3HA 4LANA 2FLIA 3MO7A 1NDZA 1J0HA 2CESA 1NVMA 2B31A 4FIRA 1QNSA 1SR9A 1AQMA 3QGVA 2Z6IA 3HGRA 2DEPA 4GE8A 2FJKA 3BURA 1C8VA 4AYGA 1ISZA 2J8GA 1V0NA 4OOZA 1CW2A 1YNPA 3U6WA 1ZFJA 1OADA 3UZYA 4FP1A 2J7EA 1F76A 2YLAA 1TIWA 1NM9A 1ZJIA 4KCUA 1C90A 1EDTA 1BG9A 1OX4B 4GI4A 5E09A 3TTOA 2FB3A 1E51A 3TSBA 3VKKA 2HV5A 2WCSA 3DDMA 4AD2A 4GD0A 2H3DA 1AJ2A 2O9PA 1O68A 1W1ZA 1VP5A 4ES4A 3RGTA 3UG3A 4BEQA 1J6OA 2VC6A 3HPFA 2IMRA 2XJ7A 3WCZA 4P7OA 4HCHA 3BPWA 3QR0A 3LNMA 3A5FA 4FA3A 3TCSA 2OYKA 4CN4A 1VBGA 3IRSA 1B1YA 3OVPA 3V0UA 1ZPTA 1YE4A 1WAUA 4L6OA 3W1RA 3CZEA 1HKVA 5HNNA 4O1EA 4BWLC 2VVSA 1TMHA 5AZ1A 1V6XA 3WQCA 1V6VA 1PIIA 4DY1A 4ZTYA 1ZJAA 4A2RA 2ZOXA 3B40A 5XINA 3FAXA 1ZTVA 3W38A 3MV01 1XINA 4RJEA 1X98A 4LVFA 1B54A 2VGGA 4C91A 1Z41A 1JXJA 3P0XA 4WGHA 4REQB 2YCEA 3PTQA 3EXSA 3NNTA 5HQEA 5C9WA 3BLLA 4PMRA 1B5TA 4LUYA 5AFDA 1WX0A 2YL9A 4QS6A 1UR0A 4LVDA 4UTJA 1IQ8A 4BF9A 1WDWA 4JQAA 3WBAA 4HSNA 3UCQA 3LXAA 1J11A 3CV2A 4DJED 1H7XA 4DZAA 4F0HA 3DU0A 4S3JA 2V5BA 1K8ZA 3SSZA 3LEPA 3FN9A 4Q7IA 5ABFA 1NSJA 1WV2A 2I14A 3ABSA 3KVKA 4EXAA 2FZBA 1K1DA 5G2WA 4UFHA 5A8PA 3PZMA 2CHNA 1CXHA 1EL3A 1US3A 2J7FA 3VE9A 1JQXA 2MUCA 3DAQA 4O0QA 4NI8A 1TWDA 2GGHA 4MWAA 1VFTA 4PMNA 1UUMA 1SMDA 3QJAA 2NV2A 1F6KA 3V4BA 3B0YA 1SW3A 3BANA 3K8KA 1XG3A 1P0DA 3OBEA 4CQ8A 2FIQA 2A7RA 4QRNA 2WNZA 4IUGA 4U2YA 3WH7A 4V2XA 4N9CA 4QGCA 4Y9PA 1UBPC 1EB3A 1R3VA 3BJFA 1TPC1 4AB4A 3E49A 2DJXA 3LHYA 3R10A 4HJFA 4AZCA 1MEHA 2C0HA 3PC0A 3BMXA 2VZSA 1Q66A 2ZICA 1ZBKA 4BR1A 3WEMA 3ABXA 5BW6A 2UZ9A 1UH2A 5FKYA 5C54A 1UH3A 1OG0A 3WQ8A 4O52A 2YKKA 4GO8A 1TRIA 1WAWA 3FW6A 4NJJA 4LB3A 3PK7A 2WMJA 1K02A 3QQ1A 3B03A 1U5VA 3WK3A 1WNOA 3KL0A 1UKOA 2WNQA 4GMEA 4TX8A 4CUCA 4U2ZA 1XYMA 1DJQA 4FOUA 2GJLA 2XINA 5FEXA 2EGZA 3GO2A 4GNKB 3GWQA 2VEGA 2PDLA 2VFFA 4WD0A 3IK4A 4HGXA 4QE4A 2YOCA 1K70A 3NVDA 1PYFA 4OWGA 4FXSA 3N34A 3TX9A 3K4DA 4U5IA 3NQVA 3ANYA 3W6LA 1W54A 1UROA 4YXGA 3WLIA 1M1BA 1T99A 3NZGA 2RKXA 3H26A 4IIEA 4UXDA 1X7IA 3STGA 2W9MA 1GEQA 3G0UA 3MWAA 3N11A 1QNOA 3WF1A 4TXEA 3RXZA 3ARVA 4ILSA 4CNTA 4PUEA 2C1GA 4JXCA 1Y5XA 4MZ8A 2V9DA 4MKSA 4JTJA 1W3JA 3LHWA 3AJXA 2PTXA 5LNUA 1W32A 9XIMA 3JRKA 3VOCA 3WQVA 4XTDA 4ZQCA 3HQNA 3I7QA 4AD0A 2ACUA 3W7DA 1NELA 4UB9A 1LL6A 4DJFD 1Q2SA 5U4NA 4B91A 1TV7A 1FXPA 2Z27A 3DHPA 2QMJA 1QHOA 3TK7A 3T81A 1R38A 4JTIA 3BGJA 5EYWA 2H90A 1Q7ZA 1ZSXA 2J79A 1W5MA 3CBWA 3B0PA 1RCOB 1O95A 4UBPC 1XYCA 2E67A 4B3KA 5HK4A 1PSCA 3V75A 2R1NA 3BXWA 1JYWA 4HNVA 3QR1A 5D03A 3UYIA 4DEFA 4GIEA 3TP4A 3N04A 3TYBA 1E0XA 3IARA 4MJ4A 3HPZA 5C6MA 4UQAA 1E1EA 3AC0A 2FFCA 4F0LA 4HOXA 4MAZA 3BG9A 1AJ0A 1GKRA 1OYAA 1P1MA 3BW3A 1UWSA 4QNWA 3GG1A 1VB9A 1B2YA 2Y7EA 1KWKA 4DHGA 2QDGA 4LBRA 5BROA 4ZFCA 4NZJA 4LAUA 1ITCA 3VGEA 1YPFA 2OYLA 4MGGA 1ZRQA 1UA7A 4W86A 3QR3A 4WDXA 3GDLA 2AL2B 1RD6A 1ZAIA 2INZA 1TPVA 4BQ2A 2E6DA 1VRDA 4PE8A 1RCQA 3TNBA 3A3XA 3IVUA 3W7EA 4PUNA 1OFEA 1UOZA 3TMLA 1M7JA 3I7SA 3OIHA 4ACYA 2QUUA 1Q6DA 3CT7A 1Q6QA 3VNZA 4V1XA 4CN6A 4DNHA 3AALA 1OY0A 1TVNA 2VJXA 3PSWA 4JTQA 4XB3A 3PZVA 3NURA 3H21A 2P5NA 3KS5A 5DRCA 1GTEA 1M7XA 1B4EA 4E3VA 3A3HA 1I2QA 3CMGA 4FR6A 4QX4A 4CCEA 3HG5A 4ZGYA 3HJZA 1XBVA 1PHWA 1QI4A 3XIMA 4G9PA 1GZ1A 1RHCA 3QPZA 4FLSA 1BLIA 1TB3A 3SRFA 5K3VA 3R13A 1HNYA 4N7QA 4WSHA 3TAKA 5EA9A 3WD4A 3L67A 2I57A 3G1SA 5CSUA 3IJIA 3VAVA 2PDYA 1PBGA 3N4AA 3O63A 2OWCA 4O14A 3PJXA 4AZ7A 5BU6A 3WQ6A 4DXVA 4D6IA 1E4NA 5F2LA 1T0OA 3DENA 3KWXA 5IDZA 4W8LA 3QY7A 1R2RA 3E5PA 4IJCA 3S2NA 2QCMA 1R9ZA 3A4AA 1KQYA 1JDFA 2VQUA 4AU0A 3W81A 3KBVA 1NFPA 5HWNA 3R5EA 3T7VA 4C6DA 2EPNA 2B7QA 2OEMA 4A3YA 2QJIA 2I16A 4L7ZA 4JNZA 4CGTA 1W5OA 4PL1A 2Z2UA 4QG8A 4MTVA 3C86A 2VO5A 3PZ9A 1XJBA 3S42A 4F0KA 2X30A 1UWTA 5HAOA 5D9PA 1TVPA 3TZNA 1LQAA 3A47A 1A5LC 2D0GA 4RW5A 2INEA 3BV4A 3K5XA 4IWWA 1H5VA 4NJGA 4ZO6A 2OSYA 2RHGA 2VHLA 3WIJA 5LGZA 4M3PA 2C16A 1S2UA 5LIUX 4FX8A 3KE0A 1SQ7A 5HNUA 4IL0A 3M0KA 4CLMA 1EZ2A 1ZJBA 3NQ8A 3S4TA 4J3TA 1GT8A 4FX7A 3URQA 2F6XA 1R7AA 1UG6A 2ISVA 1PAMA 4HNUA 4TVUA 4U3CA 3PJTA 3OLIA 3VNJA 8XIMA 1Y5VA 1HL2A 2VMFA 4PBEA 3PULA 4PODA 1U22A 4JS3A 4MPKA 5E6YA 3TJIA 3NQGA 4JTRA 3CPRA 3B8SA 3DCPA 4JY9A 2PU0A 1LWIA 5I3IA 3VK5A 3PZIA 4HNLA 4S3FA 1J5SA 2DVXA 4FIQA 3A21A 4L4LA 5HINA 3AAMA 1W9DM 3H23A 4QQ3A 5AOUA 1EJ7L 4M1RA 2WLZA 2XYLA 2P3ZA 3C3NA 1EUNA 3TWAA 1PZ1A 3JUGA 4NZ1A 4MZ1A 4W7WA 1YXYA 5IHSA 1VPQA 1TFVA 4H1ZA 3R89A 1IT0A 3V1HA 1KA9F 3CU2A 5IBXC 3TTQA 2G97A 2C6QA 5AHIA 1EQPA 4ZEPA 4O16A 2DGAA 1KTBA 3VNDA 4MLJA 3W7JA 1EPVA 3KX6A 4Z08A 2OGYA 1EGZA 4WSKA 3RR1A 4AW7A 3O8AA 3AS1A 3MUIA 3IJ8A 4ERIA 3MMTA 4C6FA 4IQDA 4UTLA 3EDDA 3NPUA 4JIRA 2BHUA 4MYXA 3NSXA 5E5CA 2ZFAA 4C1NB 1DE6A 1LTDA 3AQUA 3MUAA 2P1FA 3W76A 1EJUC 4GUHA 1WXYA 4O8RA 3W28A 4OUEA 5HMSA 3NM3A 4RNIA 3N2CA 1H7NA 3BVJA 3JR2A 2H8XA 2E4TA 4Y7EA 3NUKA 2FHBA 1TJ2A 5A94A 4MADA 4YIWA 4GI8A 2W61A 3W26A 3MWCA 3PBWA 5KINA 1J0KA 5FI8A 4DJEC 4YMZA 1VAHA 4N02A 4MWAE 5AC8A 4NZFA 1T5AA 3GNRA 3BTNA 3MSYA 2WZMA 4H9XA 2D69A 3QZAA 4M19A 4IMFA 2BDQA 2X40A 3W1AA 1TV5A 1QAPA 1TV4A 3BJTA 4X9SA 3A24A 2BMBA 3GZAA 1FWCC 1F9CA 2UY3A 4KWVA 4LRTA 3LI0A 3KOXA 3NO5A 3S5ZA 3W4RA 2PLMA 1ZALA 1MW3A 3U48A 3E6EA 1NDWA 5D33A 4LALA 1RQEA 1B9ZA 1OK6A 3F4VA 4L9YA 3WDQA 4IFRA 3WLOA 1IXQA 3KFTA 3SAZA 1HJUA 1PX8A 2ZUWA 1PUDA 1IF2A 2GPTA 5DQPA 1EIXA 2HWGA 1F3EA 2EEXA 4DBUA 3M4HA 7REQA 1M7OA 3NQ6A 1FH9A 2CPUA 2XSAA 2PRMA 1REQA 2P50A 4JKKA 1U1HA 4GVGA 2ISFA 5CSRA 2OX4A 2CWNA 3GNPA 1BHGA 3ZJ6A 4JD4A 3WNOA 4PUMA 3FA3A 1VCVA 4ZODA 1UJQA 1C92A 1NY1A 4DBDA 4C5ZA 2DZAA 1JCNA 1F8IA 3MHGA 4WKAA 3M6DA 3KZSA 4JQ3A 1M01A 1BKHA 5IXEA 2WQDA 3MMWA 1F6PA 2HNEA 4RZ6A 1I8JA 5BXTA 2Z7KA 1JFXA 3VU2A 4NRRA 4XWUA 1JCJA 1X6LA 3H4GA 4E2DA 2Y5EA 3EOOA 1M41A 2PDIA 1HTIA 4I90A 2GQ9A 4GHRA 4K36A 5HJXA 4X61A 2UWFA 1UR8A 2VI0A 1AODA 6XIAA 3VKAA 1F4AA 1W8SA 3SIMA 1KBBA 2FDMA 2J75A 1SZGA 2R91A 3LMYA 4CN1A 4FAMA 1TCMA 1U5HA 1MYRA 3OHIA 1LT8A 4EPEC 3AI0A 4RDYA 3THDA 4FOKA 4XO6A 1E5JA 4QLLA 3C0LA 1ZS2A 3DOPA 1DJWA 2ADAA 2V68A 3ABOA 4R9XA 1RLCL 4XAFA 2NUWA 2IXVA 1JCLA 2B7NA 1A3HA 1PWMA 3BLEA 4PCFA 4EIVA 3HFTA 1B30A 2Q01A 1NH6A 1HFBA 1TKKA 3KEHA 1WE5A 3FEMA 4QCFA 3VA8A 5CG0A 3ONCA 3G6MA 1V5XA 2WMFA 1CENA 4EK7A 2X7VA 4CVWA 3FA5A 2QAFA 3C0QA 3H53A 1LM1A 3FDGA 2PDFA 3BAIA 1LRQA 3PHAA 1P0BA 1LCOA 4CCDA 3F5LA 5A8NA 3WG6A 4W7UA 2WJFA 4Y90A 1UH4A 4C60A 2PP0A 4NNCA 2VDHA 3KXQA 4CU6A 4IQEA 1DJNA 4O0KA 4DF1A 1CLVA 1XWYA 1FWBC 3EWCA 3NM1A 3NZRA 1KKOA 2CZEA 4PFMA 3BH4A 2V5DA 3AZSA 2FHFA 1UC4A 3C8NA 6ENLA 3G8EA 4IM4A 3AZTA 3VDCA 2Y8VA 1C9DA 3LCHA 1ALDA 1EYEA 1G4PA 2V38A 3FFSA 3N18A 3NQBA 2PP1A 1NP2A 4GBDA 4B90A 1OVDA 2NSOA 1TPH1 3DHDA 3ATZA 1JZ7A 3CIVA 1GW9A 4FLRA 2RUSA 3IGUA 4A3QA 5LNWA 2GDVA 3APGA 4PMQA 3C56A 1GVEA 1US2A 1Y65A 3WF0A 2O0TA 1RA5A 4UTWA 3W71A 4QNEA 4GPNA 3FCPA 4JOMA 1OZQA 4PBFA 1NARA 3G0SA 3LU2A 1K8XA 4GCAA 4NY2A 2Z1KA 4DI9A 3KHJA 3H12A 5BRBA 1V3LA 8RUCA 2BP1A 3LRLA 3IJ9A 2VXNA 3KVMA 3EKZA 4UR7A 4ZBCA 3G3DA 5HXMA 3GBEA 3SB0A 2NT0A 1ZAHA 1VR6A 2E1WA 2XZ7A 2A3LA 1Y5WA 4E8GA 2OB3A 3QEZA 2GUBA 5K9CA 2JBMA 1DXIA 1GG1A 3JW7A 3TVAA 2VDGA 4DBEA 3AHYA 5T9BG 3MUZ1 3WQ5A 4HTBA 2Z1WA 2PDQA 5DLCA 1VH7A 1EX1A 2PZNA 5KZEA 1XLBA 4I9JA 4ZB5A 3AU2A 4NZ5A 2V2HA 3ITCA 4EWJA 4AZGA 3F4NA 1XR2A 2JF6A 1V08A 4B5WA 4B5SA 5I3HA 2WSPA 1IEVA 1Q8JA 1JUEA 4EANA 3HGJA 5TNVA 4JICA 5E9AA 3F5JA 2YW4A 3CO8A 5C9RA 3KWSA 1IWBA 4H4IA 3V1PA 2GZXA 2YR1A 3KP0A 4O13A 1F5ZA 4HU3A 4J3WA 5KTLA 3RM9A 4B5UA 3AISA 2YX0A 1VEPA 5ENLA 1P7TA 2ZA1A 4XVDA 2OPJA 4EPKA 3SI9A 5I23A 3LENA 4S2BA 4JTGA 3E2QA 4L5ZA 2WAGA 2DZUA 1CI1A 5AYBA 4JFSA 3OVGA 4H3DA 3GNOA 4MOZA 2WHJA 3O16A 3S47A 2ZYFA 1DQXA 1U83A 5F7UA 1EJVC 1NQ6A 3HG3A 2ISSA 4S3AA 3GAKA 3W1QA 1UJPA 3TN3A 2FZDA 3I68A 3VGDA 1JYXA 1MZRA 1QHPA 5KMYA 1G4TA 2V3DA 3TDFA 2DORA 1VIWA 4GKLA 2AAMA 1XP3A 1TELA 5LXEA 1XIFA 3WUEA 2RH9A 4FMVA 3G0XA 1TJPA 1GZGA 3F1QA 3P60A 3MBDA 3N6HA 3ZMRA 3FKKA 2WBKA 1I75A 4HIBA 3ARQA 2DZPA 3T08A 1PO9A 1NFBA 4ZOEA 5H2ZA 5AYXA 3FJ6A 2BLEA 3PBVA 1DBTA 3T2PA 3WK1A 4K68A 4GACA 4ZSUA 3CB8A 2EG6A 4H2HA 1KWGA 3NGFA 2FQIA 3RG6A 3BLKA 3S5YA 5G1TA 1XIGA 3VUPA 1GONA 4IL2A 4JCLA 4JN6A 2QV4A 5CC7A 1LUCA 4LBUA 5A6LA 4KBXA 1MDLA 5JBEA 1NTHA 2G3IA 2X42A 5EL1A 2GOUA 3N9SA 3OZPA 3MYOA 1OWQA 3R25A 2QUVA 1H61A 1GYMA 4Z2LA 4PH6A 3CV1A 1PKNA 1Z3NA 3BZJA 4DI8A 2ATMA 2VZUA 3EMZA 3VXGA 5IDIA 3IS4A 4KKXA 2AGKA 3WLQA 3RITA 2PB1A 4UFKA 2WNWA 3WY1A 4HT3A 1XGEA 4POCA 3M0ZA 1EP2A 1OEPA 2YIHA 1ML1A 2J77A 1L6GA 3E38A 2BOFX 4A6GA 2B81A 2Y6ZA 1XFCA 4KCWA 4LAOA 2OZ0A 3B8UA 2TAAA 2BGNE 3V7PA 5I78A 3QGAC 1A5CA 4PTMA 1DJGA 3LGDA 3AS0A 4DWSD 1CB2A 4B15A 3ZFHA 2JQXA 2CLEA 4DQWA 1BEUA 3V0TA 4CQDA 3MQTA 2J78A 4IJBA 3WEZA 5B80A 3LRKA 3PFMA 2PTZA 2HXUA 3HV9A 4GA8A 3L7RA 2Z1SA 1KQZA 3QY8A 4LS2A 1SO4A 1KM3A 1IEXA 1Z44A 3LLDA 3HIJA 3VX1A 1EZWA 5LIXX 1GQKA 4LYRA 2NX1A 1S2CA 1WBJA 3QY6A 3WLHA 2EBNA 4GABA 3A4WA 4JTAA 2J7HA 3M7WA 1LLZA 2A5HA 3DFYA 5H6HA 4O4VA 3H4XA 3WD0A 3LG3A 1B3WA 2I9EA 4DM2A 4EE9A 3DYOA 4H6RA 3M16A 5A1AA 4YVPA 3RO8A 5JU6A 5BU9A 1ODZA 4A29A 2GJXA 4JL1A 3XINA 1GHRA 3PPFA 1XCXA 4J3XA 3CLMA 2CERA 1V7AA 2IPFA 3HURA 3IUDA 5C7HA 1GG0A 5LIYX 4MSSA 4HKPA 4AD4A 2VP8A 2GGIA 4ADSA 2O92A 3P84A 1XC4A 3E5BA 4XKYB 4YVVA 3E96A 3TXVA 4UR9A 2Y61A 2F6UA 5I00A 3GNDA 1K03A 3CPUA 4FB7A 1TA3B 3OGSA 5I06A 3WH5A 4GZIA 1XYZA 2QF7A 3VFCA 4YNGA 4YL2A 1KR0A 3CQJA 2QNEA 4HU0A 3DEQA 1DPMA 4I9TA 4UTFA 2OOFA 4DUOA 4PYSA 1WUFA 1C29A 4WDUA 4X0VA 5D2WA 5B7ZA 2IPJA 4ZO8A 5ABEA 1MW2A 2HXTA 3VE7A 5FF4A 4P7LA 2XISA 2D23A 3VKCA 1GVQA 2AL1A 1PPIA 3VIFA 3VCRA 2KZHA 4JIEA 3II1A 1KBJA 4M7SA 4WCJA 3FSUA 4MB4A 1ODUA 2XFFA 4W5ZA 4Q6XA 5A69A 5CC5A 3U9IA 3GTXA 2QIWA 3F03K 5EPDA 4F4RA 4LT9A 2ZQ0A 4UQEA 6REQA 2I17A 3TUUA 1E1CA 2J25A 3VDAA 1AUSL 1UWAA 4J3SA 3PZTA 3G77A 1XBZA 5FJJA 2NV1A 1T6MA 1JFHA 3M0HA 1ZL1A 5FEPA 3ZWSA 4Z2JA 1EXPA 4UQCA 3WKZA 1BVZA 3CMJA 1KM5A 2IQ0A 4LAMA 4K3ZA 3W73A 1A53A 1Q5MA 2MNRA 2VR4A 1ZCOA 1AQ0A 3OG2A 4AWTA 1RP9A 4K1WA 3PZNA 3VVGA 1NFGA 3V18A 4HU8A 1QDSA 1G7UA 3LDVA 4XZNX 3DUGA 3AUOA 1UD3A 4NYUA 1G67A 1MSSA 3CXOA 4KQNA 4AIBA 3JVAA 4UZSA 1UQZA 2D2GA 3K4AA 1GHSA 1E40A 1PIGA 3S9YA 4S3DA 5K2ZA 5FOOA 4UOZA 3DFTA 1OCJA 3WNNA 1Q6EA 4MNJA 1VBHA 5E0FA 4D6CA 1EFZA 2ZX6A 4JFUA 2NWSA 4J1OA 4A05A 4R9OA 1KLYA 3B8IA 4AMCA 2GVJA 4FOJA 4MWAD 2G5WA 3PVFA 5TBOA 1OFPA 3O15A 4FHAA 3GH7A 4GYPC 1OFBA 2AMXA 2Y70A 1BYAA 4MKVA 3PY2A 2J88A 2OWWA 5CPMA 1A0DA 3P67A 1JPMA 3AIEA 1WPCA 2DSZA 1WQ5A 1Z48A 3MANA 5DCBA 3LXBA 3OYZA 3DG3A 3HTWA 1H7RA 2XN1A 2VEMA 5FF2A 4AX6A 3UZXA 5K7JA 3BLDA 1MW0A 3QV9A 1WXZA 4HNOA 5HR7A 4UUIA 4KRTA 3L4WA 1KXHA 3THCA 2QGHA 3AIRA 1D9EA 1JRBA 3G1XA 1EA9C 3WLJA 1CCWB 3MO4A 4MB3A 4TVCA 3LBOA 1KBKA 3IEBA 3VINA 5K4ZA 1K9FA 3PTDA 2EJ1A 1GW1A 4DLMA 3LXCA 3FJNA 3TIMA 1H49A 2BZNA 3R0KA 2PWEA 1ISXA 3NQCA 4KEZA 2Y0FA 3L2LA 3REQB 1XLEA 3BUVA 4GNVA 3UD6A 4RE2A 1N55A 1W3KA 3T4WA 1H4PA 3P7YA 1DJHA 1HIZA 2XPKA 3VD7A 4DPPA 2YA1A 1VS1A 5HPOA 4NZ4A 1X1ZA 1GOWA 3R6IA 2CXGA 3G22A 4KRUA 4QBXA 3CL8A 2X05A 3AOFA 4LNYA 2J74A 3QN3A 1AW1A 5FACA 4UFLA 2PDXA 4ECLA 1ECQA 1BPLB 3RX3A 4X2RA 1XYAA 3Q94A 3DECA 3WBYA 3M43A 2V69A 2WCAA 2VL4A 4GXWA 4XAPA 1JG9A 5DEZA 4J9JA 3WF3A 2G4JA 2NX3A 1FY6A 1M68A 2QT3A 1PKMA 3HN3A 4N2YA 2VFIA 1CGVA 1GVIA 1NOWA 2OU4A 5HA7A 3LM7A 3NZQA 2WSYA 1YX1A 4LEFA 1RH9A 1CDGA 1EEPA 1XD1A 2D1ZA 1E0VA 5I2UA 1FH7A 1ADSA 2ANUA 3HBLA 1W5PA 3VTRA 1TJ1A 1S3TC 1VFUA 4S3GA 2WOQA 3BAKA 4KCVA 1KFKA 5BWFA 2XVKA 2PDCA 1IGSA 4NNAA 4GYFA 4C6MA 2ZXQA 3FKRA 3GXDA 5A2BA 2WC4A 3SURA 2IKHA 2W4XA 4H9VA 5D9MA 4C7GA 1GCYA 3FSTA 2UY4A 3N3MA 4HA4A 3FX4A 2CLOA 2WHKA 1OF6A 3SCTA 5A8MA 5MKGB 1T8XA 3LK6A 1I6NA 1QBAA 1XIHA 3MS8A 3FA4A 4H8NA 4DJDA 4GI9A 3CM4A 3M07A 1GJUA 5DRIA 5F1UA 2QCFA 4NU7A 3QQWA 2DP3A 4IF2A 1R3YA 2V30A 3P8IA 1DXFA 1IYXA 2ZXDA 3VDGA 3BLFA 3W02A 4KETA 1P6BA 4PEKA 2BY3A 3EPOA 1JUKA 1J4EA 4CD8A 3URNA 1UZ1A 1E70M 5AHFA 2J66A 4AEOA 4E0CA 1H0GA 1AFSA 3AMGA 5GNZA 1RR2A 4KERA 3WQFA 1UWIA 3VNYA 4AZHA 4E4UA 1UKTA 4RNJA 1Q4NX 3S9ZA 2PDJA 2JEQA 4F2BA 5FJTA 4WKHA 5D4YA 4H6EA 4JN8A 4PB4A 1R7OA 3VD9A 3EDKA 3ZJ8A 3C52A 5DELA 4Q8NA 4QG6A 1PYMA 3KBSA 3D3AA 1TE1A 2V67A 1LBFA 3LTPA 5C2GA 2XH4A 3W7OA 3CS2A 2NXIA 2OGJA 3PFRA 4L65A 4CNPA 6XIMA 1UP3A 1HT6A 1VIZA 2DZVA 1W9VA 4XZIA 1L2UA 3NL5A 4LC6A 3V35A 3WSUA 3UWYA 1VENA 3TCEA 3GU9A 3A4XA 4DZIA 4HNTA 1UASA 4GUIA 1Q6GA 3QC0A 3TOPA 3KTXA 4J3ZA 5KETA 3G24A 1UC5A 5AHLA 2ZRZA 3KCOA 3ITOA 4XQ6A 2E68A 3P5ZA 4L1WA 3WFLA 2WJZA 1XYFA 1G7VA 1R6WA 3OYXA 3SCNA 2E6AA 1VYPX 1XHGA 3W22A 3CZKA 1LG1A 4ZQMA 5FCZA 3VOIA 3AUJA 4W4QA 3BOFA 3UJRA 3IWPA 5MF5A 4FX6M 3SCQA 3GXNA 1S46A 5CZJA 1HP4A 3MDWA 4PMYA 1HKIA 5CPNA 5AHMA 3W7PA 4IG2A 1L6YA 1LJYA 4LYQA 3G1DA 4V15A 1U1JA 5IOBA 1OHLA 1A5AA 4E2VA 4TOQA 2OKOA 4GJJA 3DX5A 4CNNA 3DHUA 4AIOA 3RLGA 3AZRA 4LW7A 3Q45A 5BOEA 3ABRA 1UD6A 2P8CA 1OD8A 1OM0A 1ZNNA 2GUUA 4G8TA 1MNSA 4CD4A 4JBRA 3CUZA 2XVNA 3P0WA 4OZOA 3QV7A 5CJMA 4NILA 2J7GA 3VIKA 3EOUA 4A4AA 2YCIX 5F2IA 1GOQA 3T07A 1BRLB 3DG6A 3GU2A 1YE6A 3CV7A 3G5EA 3FK4A 1BGAA 3KRZA 4GO9A 2QUNA 4QP0A 3W82A 4U10A 2PWVA 1CWYA 1JUBA 2E09A 4GQ0A 3CAKA 3B8DA 6PTDA 4IX2A 4C6QA 4LV4A 1F74A 1KFEA 4UC5A 3NXLA 2HEJA 1V93A 4IP4A 3W2NA 1C8XA 2EPKX 3U57A 4R7WA 1O6IA 4BZYA 1W8GA 3SCRA 1M04A 1VBJA 3A9BA 4JYDA 3TA6A 1XIMA 1HKWA 3W53A 3EB2A 4S3EA 3IJ6A 1ME8A 3FJ4A 4PMJA 3RAOA 2VENA 3B05A 2CETA 2AAAA 3L5LA 4BEUA 4LVAA 4FSAA 1E6ZA 5I0DA 2FVMA 1IR1A 1VYRA 1OFQA 2IQDA 5U7SA 4OV9A 2V82A 3WLNA 2G3FA 1E4IA 4C6PA <