1JQXA

The r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPAYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase A
total genus 113
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqxA01
3QQ0A 2YGYA 1IXPA 3JR2A 4TIMA 3TROA 1JRCA 1SFLA 3ZWSA 1YPFA 3P8JA 3C2OA 1X8FA 2CLKA 3FFSA 2H6RA 3S5YA 4TU1A 5G1YA 4RV8A 3M5XA 3B8DA 3F4WA 4GNJA 2NV2A 4ZMGA 1OX5A 3NQFA 3MHGA 1TPB1 1KFLA 1J5TA 1KTBA 1H1ZA 3HO8A 5G2WA 3WJZA 2CLOA 3PF3A 3ZWTA 1JJKA 1LOLA 2O7SA 3UXAA 3EB2A 1KFEA 3GDRA 1ZNNA 4M6QA 4W9TA 3BLFA 3VFLA 2A6LA 2Y89A 3IIOA 1XBVA 3S42A 1F7BA 5HWJA 3W1QA 5DBUA 2ZRWA 3HG3A 2Y63A 1RZMA 2JGYA 4QJ1A 2H3DA 1TV7A 4ORMA 3NL3A 4LVGA 4AXKA 4MYAA 4LU0A 1FXQA 3PSVA 3TC6A 1Z42A 3B0PA 1NVMA 1LRQA 5DBTA 2B7OA 1P4CA 5HUOA 3G18A 4XQ6A 3BW4A 1B3OA 3L0KA 1FX6A 2OZ0A 5D2VA 2J88A 3GLCA 2PURA 2C13A 3CB8A 4Y90A 4MJMA 3G1HA 3M16A 1KM4A 3DHFA 1SQ7A 3IIVA 3MBFA 3VI2A 3MW7A 2NUWA 1EP3A 1GYNA 2Q3OA 1F76A 3DFNA 4QNEA 2GVLA 3JRKA 2WNQA 3TX9A 3PULA 2YFNA 3ATZA 4OV4A 3STFA 5CGQA 3WJYA 2RDTA 3G22A 2FTPA 1IXNA 1AMKA 5LNRA 1GVFA 2QJGA 1U5JA 4UMAA 4RCXA 2WPBA 2R91A 1SZEA 3NYZA 1LDCA 3EKLA 1F74A 4JR5A 2VFHA 3TCEA 3P8IA 5D33A 3VCRA 1SZNA 2X1TA 4O4VA 5DY2A 4NJHA 1LBLA 2CZDA 4AF0B 1AK5A 3G0UA 1WBJA 4L4MA 3M5YA 2P1FA 4BR1A 4JTJA 4UTTA 3NQ2A 1LLZA 3LCHA 5BMWA 2QCGA 4HKPA 3LI0A 3SIZA 1PS9A 1TQXA 1F6KA 1JCNA 4R53A 3Q2DA 3UPWA 5F2IA 4NVTA 4X22A 3C56A 3CWNA 1AL8A 3HG5A 4LVAA 1W0MA 4O11A 5FF7A 4EF9A 2QCCA 2B4GA 1VLIA 2QUTA 3O06A 3W1NA 2A21A 1H7OA 1X6UA 4LNYA 3RK8A 2EGZA 4DEFA 2DORA 1TPH1 1C9DA 2DJXA 3GX9A 1FXPA 3EX2A 2W79A 3BV4A 2AAMA 3UWVA 1GQNA 2UV8G 4X9SA 3TC7A 1DQXA 1RR2A 2FPTA 3TNOA 4Q33A 3NG3A 4FXRA 2AGKA 1OFPA 4DPQA 3W1XA 2DZWA 3IGUA 3NEVA 5G4WA 2ISVA 4K36A 1SO5A 5HR6A 4FNTA 1KTNA 4JIQA 5E0KA 4BI6A 1K03A 3N73A 2E68A 3MUXA 5DXYA 4ML9A 1KBJA 5C2XA 3LBCA 3QC3A 3E0IA 5I3KA 1DQWA 3I7RA 3VE7A 2Y7EA 2G95A 2J24A 1EEPA 2CU0A 3QEZA 4WZHA 3FJLA 1LYXA 1W54A 1TTPA 2OCZA 3B4UA 3LOTA 4TO8A 3W7RA 3F03K 1GVSA 1WOBA 4PA8A 3R13A 2GJNA 1D3HA 2NV1A 1FDZA 2TRSA 4MY8A 1VLWA 2TYSA 4UXDA 4Q4KA 3S1VA 1DHPA 4UMCA 3W75A 4IPJA 3MHFA 2NWRA 3EWWA 3QMSA 3NM1A 4KFOA 3ZS4A 4JTIA 4NNCA 1V5XA 2E77A 1K7XA 5G2HA 3CHVA 1VCGA 1QAPA 4E2DA 1TTIA 1CI1A 3QFEA 4XKYB 1DOSA 2A7NA 4PFMA 2ZZ3A 3M6YA 3O6YX 4O18A 3BGGA 4PEKA 5U4NA 1PV8A 3W7DA 3Q37A 3W76A 3PAJA 3LRKA 2Q8ZA 1O4UA 1O60A 3RLVA 2C19A 4GBUA 2V0TA 2ZZ6A 4YCOA 3U2OA 1R2TA 2VKZG 1L9WA 1KTCA 5D09A 5HULA 1W5PA 5DY3A 1T99A 2C1HA 4MY9A 3TR2A 3W74A 3IVTA 4P2VA 2V5LA 4O12A 4GUIA 1XI3A 3NQCA 1SR9A 5D2TA 1OF8A 5MHBA 2CLEA 5DLCA 3PBUA 5EYWA 1YTEA 4IXXA 3TW7A 1FCBA 2BTMA 3L21A 4E2BA 4WJEA 1TTQA 2EPHA 2QCMA 3GK0A 5F2GA 2DZTA 3NQ6A 5C54A 5FEPA 3I68A 3SJ3A 2Y62A 1QO2A 2X30A 4JTEA 3C2EA 2WNNA 3UZ5A 1FDJA 4DO6A 1VGAA 3TFCA 1OVDA 2GPTA 5DN1A 1S5TA 1BTMA 3C61A 1H51A 4AEOA 2ZA2A 3M1ZA 4NUWA 1ICQA 3W2KA 2ZDRA 2QKFA 3R89A 2QJHA 1VQTA 3CEUA 3A23A 3W7QA 4QM1A 3P80A 4Z0SA 1R30A 1W37A 4XBSA 3LCWA 2CZFA 3PG9A 1K3UA 3IIPA 3UWYA 3EXSA 3W83A 1K8XA 1I2NA 5CSSA 3EWUA 1YDNA 5K4ZA 2FB2A 3IGSA 2ATSA 2G96A 2B7QA 5BW6A 2YW3A 3W85A 1H62A 2Z1BA 4AWUA 3VE9A 1OK6A 2NLIA 3CWOX 3HJZA 4NT0A 2EAWA 4DF0A 1SUXA 2V2HA 3IVUA 4UTUA 1L2UA 4LTSA 3HGSA 5I3JA 2H90A 2OX1A 1TPFA 2R8WA 2GQ8A 3GDMA 1MXSA 1NF0A 1LP6A 4AHOA 3NQDA 5AYZA 3TQVA 1OJXA 4AMAA 1RPXA 4H3DA 4NJKA 3PUDA 4OWGA 1KM0A 4Z08A 3L67A 3W6YA 5AC7A 2PRMA 7TIMA 6ALDA 1EWEA 2QDGA 3DFTA 4LRTA 3R5EA 4FNRA 3STCA 4ZL1A 3S0CA 2D73A 3EWYA 1LM1A 2B7PA 3TQ0A 4DELA 3KXQA 1SPQA 3T40A 3O07A 2A5HA 3G8EA 3WJSA 2PRHA 1WYIA 4UTJA 3S5NA 3P60A 2CWNA 3CLMA 4G1KA 1Q3NA 1MEHA 8TIMA 3P5YA 3DFOA 1FDYA 4FF7A 2BZNA 5BNKA 4E0CA 2P10A 1VPXA 1IIHA 1MZHA 4M19A 3P67A 1SSGA 1X1OA 3P61A 4UR8A 4PC8A 3NQAA 3KRUA 4ZQOA 2QUUA 2NXIA 1P0KA 3NGJA 1KFJA 1YXCA 3CT7A 1OHLA 1A5CA 4RX0A 3T55A 4MJZA 4GC4A 4BWLC 3NQEA 5K9DA 3W84A 3IRDA 1UASA 3OHIA 1L6SA 1H7RA 1FBAA 1HL2A 1TTJA 2X2GA 1PIIA 1IF2A 2QCFA 3KVJA 1KLZA 4JIPA 3L65A 4IMGA 1D3GA 3ABOA 3ABRA 3CU2A 3P81A 4UCGA 4FHAA 3KRSA 3PSWA 1PCKA 4BWLA 1EUNA 1C29A 3MP3A 1M5WA 3HGOA 4LV9A 1T96A 1KFCA 1UB3A 2QCHA 5G2IA 2FIQA 2PC4A 2CLIA 3BVJA 3EX4A 1KA9F 1H63A 2ZZ2A 2YX0A 4IX0A 4KKXA 4AWSA 2O7QA 4DBDA 3STGA 3OBKA 3M5ZA 4O16A 3LX9A 1ZAHA 3DBPA 2GQAA 1H1YA 5FEXA 3TA6A 2E5BA 4Z1AA 1RD5A 4NU7A 1H7NA 3DGRA 1N55A 1XKYA 2I14A 5AHEA 1FUYA 1DKWA 5FF4A 4O1CA 4UIOA 5K3VA 3L66A 2C16A 1X1ZA 3F4NA 3FIGA 3C2RA 4GRSA 1W1ZA 3GNDA 4HSNA 2VFIA 4NXSA 1WDWA 4MZ1A 3RF9A 2I1OA 5CZ0A 5LNVA 5HWNA 1A50A 3NZ1A 2TPSA 3HB9A 5EKYA 2RKXA 4CQ8A 4Z1BA 2BSLA 1DVJA 2WSRA 1Y0EA 1HTIA 5CZJA 3LHUA 3DZ1A 3TJLA 3A9IA 2EF9A 3W2JA 3GXNA 5A5WA 3HMJG 1OX4A 1LLWA 3UWWA 3C3NA 4N2YA 3GXPA 4WY0F 1EX5A 1VJIA 3W23A 3OEXA 5LHFA 1KM5A 1KV5A 3LCXA 1OYAA 2VC6A 1M7PA 5EL1A 3HOJA 3TXZA 3UNDA 1HFBA 4O28A 2DZXA 4NXKA 3GZ3A 1F5ZA 1XBXA 2W6RA 4CCCA 1GWJA 3FS2A 1QCWA 4M7SA 4UR7A 2GVJA 4CNNA 4GXMA 4DBEA 2VEPA 5FF2A 1FWNA 3PBVA 4YWIA 4J9JA 1OG0A 3QRHA 3E12A 2BX7A 2GJLA 3P84A 5LGXA 1TB3A 3A5FA 5D04C 3TMQA 5D32A 4JY8A 4N6EA 4EWND 4GJ1A 3W7OA 1T0OA 3NQGA 3I7QA 4XUGA 5I3HA 1B9BA 3L5LA 2DZUA 5EPDA 4UMBA 1XDLA 2A2IA 1TIMA 5TQLA 5D38A 1UJPA 1GEQA 1UBSA 1FCVA 1YXDA 4LUIA 3W7CA 3G1XA 3S9YA 3W1PA 1GOXA 4HNNA 1QPOA 1FWRA 1IGSA 2QR6A 3CIWA 4LWWA 1ZJIA 2C3ZA 1XM3A 2NX1A 3PUOA 3W1UA 3EX6A 4LT9A 1PHWA 2Y88A 2QCDA 2QCNA 1CX9A 2ZZ7A 4FNQA 3PM6A 3NPXA 4DQWA 3CQ0A 3OVRA 3P82A 2NXHA 4IMDA 5AN7A 4UTWC 2Z6IA 3SY5A 3R12A 3GKFA 2WSQA 2EKCA 1Z48A 4OE7A 2ZA1A 5K7JA 1ICPA 3PR2A 1N8FA 4ZQPA 3O8AA 4O1DA 1G6CA 3ZFHA 4AHQA 4O53A 3GB6A 2C18A 4GWEA 3OIXA 4OU1A 3W1LA 4BF9A 5IBXA 4HT3A 3LERA 2GOUA 3IV3A 4O1AA 4EF8A 3I7SA 4CLMA 3NQ7A 1KBIA 4S1FA 4C1LA 4UC5A 4UTLA 4UNKA 4LV4A 4M5PA 4D2JA 1SO4A 3O1NA 4E38A 1MSSA 4ZQCA 2NZLA 1Q45A 1QMLA 4Y8FA 1H7XA 2VELA 4JXCA 2FLIA 3KVLA 1ZY9A 4EOUA 5F4SA 2PCQA 4LS0A 4LS1A 4MY1A 2ZRVA 3M7WA 4UFMA 3NPUA 1SZGA 4JTLA 2Y7DA 3W7GA 3S1XA 3UY7A 1RV8A 4OHQA 4ZQRA 3T78A 3KRZA 3E9AA 4WXZA 5H91A 3QZEA 1JCYA 1XXXA 3PB0A 4MZ8A 3M43A 3O63A 5DCBA 3UY8A 1W5MA 1R2SA 1K8ZA 3LV5A 4K37A 1FWSA 2FJKA 4IMFA 3TDFA 5AHIA 1GTEA 5EA9A 4ORIA 3T44A 2G97A 1OX6A 1YDOA 1XCFA 1EP1A 4PH6A 3M9YA 4XWUA 4ZQNA 4YLWA 2ISSA 3P7YA 4LVFA 4LVBA 2Q8LA 1TV5A 3PUEA 3W1AA 4M6VA 3QW4B 4WOZA 1EIXA 3WJXA 3NDOA 3MWAA 1GYLA 5C6MA 5L9FA 4UTHA 3RLUA 1SU5A 3BARA 1W8SA 4FX6M 1OFRA 3DKLA 5LGZA 3BLEA 4RZ5A 3NL2A 5AYYA 1QR7A 1WBHA 4LY8A 4I9AA 2ISWA 3TH6A 4ICNA 3N34A 1XBZA 3LRMA 3C2VA 3MYPA 2YYUA 1WA3A 2Y7FA 2ATMA 3W2LA 3QPZA 3CEPA 1FWWA 2H8XA 2Z2UA 4O1BA 3BG5A 1QO5A 1QPNA 3W7MA 3PWAA 3NQMA 2WQPA 1TRIA 1YADA 4XZ9A 1R47A 3M5VA 4UTTC 1VCFA 1FWTA 2VEIA 3UWUA 5GVJA 1DJQA 1JCXA 3MI6A 2V2DA 2ZZ5A 3E02A 4UFLA 5HINA 2GVGA 4DF1A 3T4CA 3TMLA 1H7WA 1BWKA 1G4PA 5SWUA 3ABSA 2WOQA 3FA5A 4ADSA 4JYFA 5AOUA 4P61A 1FY6A 3FKRA 3P74A 2ZCGA 3WJWA 2RHGA 4QIUA 3RNDA 3SW6A 3FOKA 3LXAA 1VRDA 5D30A 4H6KA 4HNVA 3W2UA 3GYEA 4IWWA 3NAVA 1EB3A 1G7UA 1ME8A 3OA3A 4K38A 5DXXA 5FF3A 3N2XA 2GUUA 4ADUA 1NFBA 2CLHA 3W2MA 2DU2A 3NQ8A 5G5IA 5KTLA 5KMYA 2RDUA 4FNUA 4JTGA 1NSJA 4OV9A 2YZRA 3G24A 3LHTA 3N2MA 4BK9A 3EEGA 5AFDA 2VXNA 4KFPA 2QAPA 2KZHA 4N9BA 5AHMA 1PHQA 1OFDA 4GUHA 4WOQA 3S6DA 4JX5A 3L2IA 4R7JA 2PE4A 5KZEA 3N9SA 3PB2A 1ZENA 2E09A 3QM3A 1RQEA 2VEMA 4DPPA 5D2WA 4EVZA 1WAUA 4O52A 4JYDA 1W5NA 3CTLA 3NR0A 4K39A 3B05A 4DXVA 1IIGA 1LORA 4DF2A 1HG3A 4C1KA 5FESA 2ZZ4A 2QF7A 3THQA 1FQ0A 3ATYA 1W5QA 2JKPA 4IMEA 3SI9A 3QW3A 3QJAA 1JQVA 1LBMA 3W73A 1ML1A 2X1RA 5AHLA 3TSDA 1F6PA 2LLEA 1HUVA 2A1YA 1I4NA 5F4WA 3QQ1A 4R34A 3W87A 1O95A 3HGJA 1B4KA 3W2NA 5E1QA 5K2ZA 4JTFA 3IVSA 4PCFA 5HQEA 3SZ8A 4HIBA 2QUVA 3O16A 2E6FA 3AJXA 2OT1A 2C0AA 4MOZA 4RXFA 3EX1A 1I2RA 3NM3A 5H2ZA 1TO3A 3I65A 4AF0A 1LROA 3NL6A 1EWDA 2HTMA 1F05A 2JKEA 2NUXA 4XBKA 4M6PA 2ZYFA 3MMTA 1Q6RA 4O4WA 3S1WA 1L6YA 1OYCA 1QDSA 3FJ6A 4DO5A 2WV8A 4XTDA 1DBTA 3GDLA 3TSBA 1YYAA 5C5YA 1TPVA 5D02A 4JYEA 1AW2A 2Z0IA 5KINA 4K8HA 3FEMA 2ZA3A 3KVMA 5AB3A 5CSRA 5K9XA 2RFGA 4RXGA 1DV7A 3NPVA 4UFIA 2OT0A 3F1QA 1QOQA 5K9CA 4Q32A 1QPQA 4AWTA 2FQIA 1BWLA 4UTMA 3LV6A 2GQ9A 4MIMA 5TIMA 3WK0A 1KM3A 1GT8A 2RH9A 3GAYA 4EIVA 2BLEA 3KAOA 3MJYA 1J4EA 1SSDA 5D03A 5BRBA 2Y61A 1VH7A 3BO9A 2XFWA 2B7NA 3G8RA 4UTWA 1XL9A 4MLJA 4U4MA 4HNTA 3NVTA 1S5VA 1SO3A 4LUJA 1ONRA 1U83A 5LKYA 4YMZA 1JCLA 2YPIA 1B4EA 2YCEA 4FX7A 2ABAA 1X7FA 2J6XA 1XDMA 1SW7A 1NF7A 5A8GA 4Z1DA 1PVNA 1W31A 3M41A 3EX3A 1SW0A 4NZFA 3ANYA 3BG9A 4OBTA 3IIZA 1DORA 1GJPA 4IQLA 5CPMA 4JTSA 2WO5A 1H61A 5HUPA 1I2QA 2E6AA 2CW6A 1F2JA 1UUOA 3BGJA 3E96A 4IXHA 3HGRA 3N14A 3SECA 1M7OA 4TMBA 3GAKA 4MZYA 4CCDA 2FPYA 1FCQA 4POCA 4UFKA 3B0UX 1A5AA 1HO1A 3W71A 3BLIA 3V1PA 1TPEA 3OVPA 4MFDA 4JDBA 3UQNA 2A4AA 5AHNA 3CIXA 5CKSA 4JTKA 3S8HA 1Z41A 3NZRA 1LRNA 2V30A 3R8RA 3W7HA 3LBMA 4FEZA 3W88A 1PE1A 3M47A 5KZDA 3UPBA 1JR1A 3GNNA 3PBWA 4AVFA 5BOOA 1ADOA 1N7KA 4JTUA 1JQXA 1QWGA 2J9XA 3QH2A 3HPSA 1JCMP 1YTDA 3LCIA 4X2RA 2CLMA 3M44A 4GFSA 1TPUA 4LC8A 5EBUA 2YDAA 2W0UA 3H55A 4I7WA 4WX2A 3TUUA 1R2RA 3MO7A 1GTHA 1LCOA 4QNWA 1C8VA 3UZJA 2NWSA 4IX2A 5CPNA 3OG3A 5EMUA 5FF0A 3FLUA 1D9EA 3LCLA 2DJLA 2V82A 3LHYA 4WY0A 2VFGA 4QQ3A 4TMCA 4YCPA 3GIYA 3A21A 2RDWA 4RKAA 3HIJA 1YPIA 1TCDA 4QAIA 4TX9A 1TSIA 3W7JA 5AC8A 3HG2A 3I6RA 3RU6A 5I3IA 4JEQA 4RJEA 3EWXA 1OABA 2J9YA 5CPOA 2Y6ZA 4NNAA 3DH7A 3TAOA 2YFOA 1W56A 3MI3A 4WY0B 5LHEA 3DXIA 2R94A 3V75A 2X16A 4U28A 3S5OA 1SZFA 3ABQA 4IUOA 1LTDA 4ZVJA 2CLLA 1LRTA 4UFHA 2NUYA 4OGZA 3EWBX 3W1RA 3L5MA 4FX8A 5KSWA 4BFAA 1LZOA 2ZQ0A 5CZTA 3G1DA 3N19B 1S3HA 1TMHA 4QITA 3GR8A 1W3NA 5EY5A 2TMDA 3E49A 3TQKA 5LNSA 1H50A 1AG1O 3B04A 1KM6A 5CG7A 1GVQA 2JKAA 4JS3A 3LDVA 1ME9A 2YR1A 1OYBA 4N9DA 4O54A 1ZHAA 5C55A 1YDVA 1KFKA 4A2SA 3W1TA 2F7FA 1ZAJA 4LC6A 1WOAA 1QOPA 3PC0A 2HS6A 4N02A 3LLFA 1P1XA 3L0GA 5KITA 2NXGA 4JTTA 4JICA 4KWVA 1OF6A 5CZSA 5I3FA 2DP3A 3UYCA 3LHZA 3TFXA 4LRSA 3W7PA 4IJBA 2CZEA 4NJJA 2WJZA 1DL3A 4NX5A 1ME7A 3BG3A 1RVGA 1OFQA 4AHPA 3C8FA 2V9DA 5LNUA 5HWMA 5E93A 5LSMA 5T26A 3W3OA 1VR6A 3P62A 3LB0A 5LZLA 3Q58A 2ALDA 4H4IA 4RLIA 1BKSA 1S5WA 4WQ6A 3H54A 2A7PA 2E1DA 4S2CA 4Y6GA 3MP5A 3CC1A 5AHFA 4K6AA 1KLYA 2VFDA 1G7VA 3KFTA 5D05A 4JNMA 3QSRA 4O14A 1G4EA 3FKKA 1E51A 3AO0A 3LCGA 3EWZA 1TQJA 2YYTA 1H7PA 2BWGA 3NPWA 2NX9A 4GUFA 1O5XA 3KHJA 3SR7A 4N6FA 2A6NA 2YXGA 1IXQA 1ZCOA 1A5BA 3G3DA 4B5NA 2H3BA 1GZGA 1THFD 5HMSA 3UXDA 3TU9A 3WK2A 5DCEA 2ZZ1A 4O0ZA 1OFBA 3LTYA 1OFEA 5F4XA 4QISA 5I3GA 1K7EA 3G1AA 4CCEA 3H53A 4UUIA 1WXJA 1JCJA 2YSWA 1NEYA 1QPRA 1XUUA 3EXRA 2VFFA 4A22A 4BI7A 3C2FA 3LHVA 2ABBA 5DCDA 2VENA 3NL5A 2J27A 3N9RA 3EXTA 1PCWA 2V5BA 2C14A 4O0KA 1GG1A 3CPRA 2AQWA 4JD4A 1R46A 3C6CA 1H60A 3YPIA 4PTNA 3GDKA 5J5DA 4LS2A 1Z44A 1F73A 3NNTA 2JK2A 4HPJA 2VEKA 2A85A 4N9CA 4ZQMA 2DZSA 4O13A 4NX0A 1W3TA 2FDSA 3HQ1A 1JRBA 3LTSA 3DHDA 4NNBA 2QCLA 1NAL1 1G4TA 4A2RA 3MBDA 1KM1A 4R33A 2EHHA 5AYXA 2F84A 3GKAA 1B57A 1G4SA 1VHCA 4JX4A 4OQVA 4KWWA 3DI0A 4RZ4A 3U8GA 1LOSA 4I7VA 1PL9A 2BXVA 1KM2A 1T8XA 3O15A 1RQBA 3WFAA 1WQ5A 3GDTA 1VYSX 1Q6QA 2QJIA 2XN1A 4Y96A 1BEUA 4JTHA 1EUAA 5FEZA 4GUJA 4O17A 2Z6JA 1W3IA 1H5YA 1VS1A 1AW5A 3W1MA 1YLVA 3ZR4A 2I9EA 3HBLA 3MI2A 4LW7A 3B06A 4N4QA 4MVAA 1O94A 4JDYA 1EA0A 1WX0A 1L6WA 3WK3A 1I2OA 2X1SA 3LLDA 5F2LA 4XTIA 1DJNA 1RQHA 4Z1CA 3B0VC 3USBA 5FI8A 3PBYA 3QPYA 3CM4A 2QCDB 4AH7A 4MYXA 3NXFA 1JUKA 2JBMA 1TV8A 4FNSA 1JUEA 1FCUA 1M6JA 4MKNA 3KX6A 4DO4A 3NO5A 4OT7A 1O5KA 2ZTKA 4S2BA 4RZ6A 3IEBA 1EP2A 3SGZA 1G67A 4UNLA 2FB3A 2TSYA 4O15A 5ABTA 3W7LA 2WNZA 5D2XA 1I2PA 3L68A 1JVNA 2DZVA 3FYOA 5DELA 2FFCA 1TPWA 4K7VA 2R14A 3A22A 4NJIA 3PG8A 3L9CA 1TPC1 5LNWA 3PY2A 3LI1A 4WXYA 3QMTA 2H8ZA 3TAKA 1AW1A 3QYQA 2ZRXA 4L4LA 3PVFA 4IGHA 4GE8A 3G0XA 4LVDA 4TR9A 2A0NA 1GPWA 5IBXC 3P5ZA 1EPXA 1AL7A 4JN6A 1I8JA 4UTIA 3SSJA 1HO4A 1QFEA 4XKYA 2X1UA 4HHPA 4IPIA 5HNRA 3BW2A 3DENA 4NZJA 4JX6A 4O57A 2V2CA 3ELFA 3TE9A 4CQ9A 5CPLA 3HPXA 2ZRYA 3EKZA 3QSTA 3IGXA 3GR7A 3UD6A 4WD0A 1WV2A 5K4XA 2C6QA 3W7EA 1QNVA 2VOMA 4N4PA 5D2YA 5BMXA 3VKJA 4YL2A 4FB7A 3SFKA 4BI5A 4FIQA 3G1SA 3LGEA 1K8YA 5F2MA 3W72A 3W86A 3RMJA 2DZPA 2ZTJA 4RK8A 3O6DA 4HSOA 1XFBA 3SGUA 3TJXA 1YXYA 2P0OA 5G4EA 1K7FA 1XBYA 4KFNA 1MEWA 3G1YA 5FEWA 2CLFA 5F1VA 1TRDA 3TXVA 3HF3A 4PL1A 2Y70A 4CQAA 3TV8A 3QMRA 1VHNA 4HPXA 1A53A 3JS3A 3WK1A 2CFFA 3G3MA 5AC6A 4M7TA 1A5SA 2A7RA 4K8EA 4O10A 3THAA 3HPZA 2YW4A 1P0NA 3BK0A 4O8RA 1TREA 3GXTA 3W7NA 1MEIA 2HS8A 3L0NA 3C52A 1TJPA 5G1TA 2FPVA 2QDHA 4ADTA 3S1UA 2B0MA 4UTKA 5F1UA 1W5OA 2ZBTA 3BPWA 5U7SA 1ZAIA 4YXGA 4MLRA 5L6UA 5J5RA 3W7KA 1G69A 1J2WA 1KFBA 5KZMA 3G1VA 4HN4A 3KOFA 2Y85A 3INPA 1Q6OA 4NQ1A 2E5CA 1TYGA 4AAJA 3LM7A 3G1FA 3B03A 4O50A 2E6DA 1XUZA 4FNPA 1JULA 4FXSA 2J9ZA 4CNOA 4A29A 1VC4A 4X3ZA 3STEA 3DI1A 3T7VA 1K02A 4JY9A 3D0CA 2NX3A 2G5WA 3TW6A 1Q6LA 1ZALA 1CW2A 2V8ZA 3LRLA 3O05A 1YTKA 3HG4A 3Q94A 4Z0JA 4Y9AA 3TIMA 3TKFA 4RR4A 3G0SA 4FO4A 5HJLA 3W07A 5HR7A 3UWZA 2CZ5A 2VFEA 4IMCA 1GG0A 2V81A 3LTPA 3W22A 3DKJA 4JGDA 2E6YA 3TK7A 4A21A 2IQTA 2QCEA 4ALDA 3C0JA 4PL2A 1OFOA 4ZZ9A 3DFQA 1KV8A 2Q3RA 2HMCA 3U6WA 4MFEA 1SO6A 3RFAA 4ONVA 2WKJA 1V7YA 3LHWA 2XN0A 3R2GA 1JUBA 2Y7GA 1LOQA 3TSMA 1I45A 2XN2A 1VYPX 1TJRA 2HSAA 4N9EA 5D37A 4O19A 1TPDA 4NJGA 1XC4A 3VNDA 1ICSA 2ZRUA 3GVGA 1GVOA 3LXCA 1UUMA 1SFJA 2QEZA 3MYOA 3NA8A 1SW3A 4CNPA 4HNUA 6TIMA 4FIRA 3W9ZA 1VZWA 3DU0A 1OFAA 3W7IA 1VYRA 3LCFA 3LXBA 3A24A 1P5BA 4I7UA 1VCVA 3K30A 1UCWA 1KW1A 1OK4A 2ZFAA 4UFJA 3L5AA 5IM51 5TBOA 1LBFA 4AB4A 3UWQA 2OMAA 2JGQA 3N3MA 3A5VA 3PS7A 3NOEA 2QAFA 1ALDA 2WSYA 4GUGA 2E5DA 3MP4A 3NQVA 3S5ZA 4LOCA 4WUIA 1ZFJA 4MPQA 1GVRA 3MHUA 3W70A 3KVKA 3O6CA 2C15A 3OVQA 2PRLA 1OX4B 3FYPA 1MO0A 2OJPA 3DFPA 1IXOA 4QSHA 4IOTA 4A3UA 3DAQA 3DFSA 4PODA 2ZRZA 4K7YA 4MUZA 3M0ZA 3QF0A 3C4UA 3BW3A 3IIXA
chains in the Genus database with same CATH superfamily
5ABEA 1VPQA 3KTSA 2R9RA 3C8NA 1JZ4A 3TROA 1JRCA 1A5NC 5I24A 3ZWSA 4DBWA 3C2OA 4V33A 2XIJA 4PB3A 4RV8A 3F4WA 1JZ7A 4FSAA 1OX5A 4DHGA 3NQFA 4JPGA 3MHGA 1GEHA 1J5TA 1KTBA 1A47A 2Q01A 1UUQA 3PF3A 1R3VA 2VGGA 4L56A 3GDRA 1ZNNA 4W9TA 3VFLA 1XF0A 2A6LA 2YIHA 3S42A 2V3GA 4US5A 1JZ2A 2OYLA 3W1QA 1JAKA 5DBUA 2JGYA 4QJ1A 3QV7A 3HV9A 4UOJA 1KRAC 1J96A 3TC6A 1Z42A 3MMWA 3B0PA 3WCZA 5HUOA 1EBHA 3RYSA 3WF0A 4XQ6A 1P1MA 2YCIX 1FX6A 1S2VA 4M51A 1TV2A 2J88A 1QK0A 3CB8A 3WMSA 3WYZA 3WQPA 3TOYA 3R0KA 3IWPA 4WKHA 3MW7A 3IJ7A 4A6GA 1XYFA 4A05A 4PTWA 1F76A 4QNEA 4UQBA 1HJSA 4YJ5A 3PULA 2YFNA 4L7ZA 4EE9A 4OV4A 2PBOA 1Q5MA 2REQA 5CGQA 2WC3A 3PPGA 3AMLA 1TJ2A 3BZGA 3CB3A 1QHPA 1BSLA 3XIMA 1AMKA 1E43A 3T09A 1GNXA 2QJGA 2DFAA 4H6RA 4DXKA 4WDXA 4A3RA 3OHMB 2R91A 1P48A 4W5UA 1SZEA 1PTDA 3VNIA 3NYZA 1F74A 3TCEA 1SZNA 1ZQ5A 3WFZA 3V18A 4O4VA 3IJ9A 4GI4A 4X9YA 1XSKA 1LBLA 2CZDA 2V63A 3M0XA 4GZ7A 3WMCA 4L4MA 2P1FA 1YNYA 5CJMA 1EC7A 1MQRA 1GQJA 4JTJA 4UBPC 3UFYA 1M41A 4D6JA 4AQLA 1PS9A 4EP8C 4RZBA 1JCNA 2UZ9A 3PFRA 4R53A 2REQB 5C0QA 4O11A 1XLGA 4EF9A 3K4DA 3BSMA 2QUTA 2R6OA 1UPPA 4UB9A 3RK8A 2EGZA 3S1GA 3BH4A 1J0JA 1KQZA 3WQ6A 3UGRA 1OSEA 4KS0A 1U1HA 3WDJA 3IK4A 1WUFA 1XG3A 1ZP3A 4LSBA 2VRJA 4XVEA 1H0IA 3UWVA 2UV8G 4X9SA 3NWRA 4X0NA 2WMGA 4PUUA 1XRTA 3NG3A 1UKTA 4WDTA 1UD5A 1E4IA 4DPQA 2FTWA 3W1XA 4KWOA 5G4WA 4YYFA 1IT7A 1SO5A 4ENLA 3GD6A 4RUBA 4MSSA 1KWKA 5C2XA 3MCNA 1DQWA 2Y7EA 2G95A 3WNPA 1J5SA 3GWQA 3SUVA 1VKFA 4C6QA 4CEXC 5E0FA 1TTPA 2OCZA 3CH9A 3IJLA 4TO8A 1JNDA 4HU8A 2NV1A 2GVYA 4QP0A 1FDZA 3ITGA 2TRSA 2TYSA 4UXDA 1DHPA 1SZRA 3OG2A 3ITLA 1OT1A 3MHFA 4XBJA 3R8GA 2ZXAA 5CC5A 3ZS4A 2GGHA 4NNCA 4B16A 3U2EA 4OZOA 3ZIZA 3CHVA 2XUCA 4E2DA 4MWAB 3NXLA 3HPFA 1PUDA 1QUMA 2Z7GA 1X6LA 5BXTA 3L4ZA 2A7NA 3TLQA 3A3WA 3W7DA 2IKHA 1Z8AA 3KZSA 1O4UA 1DXIA 2C19A 1L6FA 2IQDA 2ZZ6A 1D7KA 5HULA 3UJEA 3DHPA 1J6OA 5DY3A 4AX6A 4GO9A 3VXGA 3A4JA 1WDPA 3FHAA 3IVTA 2V5LA 1XI3A 2IS7A 4WSKA 1GQLA 5BZAA 5TF0A 1BXBA 3ZQ9A 2CLEA 3LYEA 1EQPA 4RPQA 4MAVA 2YB4A 3M46A 2YLAA 2QPSA 4MPKA 2EXOA 2BTMA 4NAFA 4YU1A 4MF4A 1H2JA 2PDYA 2EPHA 3GK0A 5F2GA 2DZTA 5D9PA 1M53A 1PYFA 2QDEA 3ZR6A 2DSZA 3KBJA 5AKQA 4JTEA 3C2EA 5EFDA 1FDJA 4DO6A 5DN1A 1JXJA 3B9AA 1H51A 2ZA2A 4OBSA 1C7TA 4PEEA 1Q6CA 3N4FA 3W7QA 4DJFD 4GBDA 4PRRA 3P93A 3AIUA 2FDMA 1V79A 1K3UA 3UWYA 3EXSA 5CSSA 3EWUA 4CVWA 4INFA 4UOQA 2W63A 5M17A 1TE1A 2F6UA 3FJ4A 1QTWA 3VE9A 3VK5A 3OQ8A 4DUWA 9XIAA 3IVUA 1L2UA 3OOQA 2PLKA 3HGSA 5H6HA 3RDKA 3OP2A 2R8WA 3KDOA 4IGNA 3VKKA 3GY1A 1MXSA 1NF0A 4AHOA 3TQVA 3SO7A 4H3DA 4LUTB 4F0SA 2P88A 3W6YA 5C2CA 3WQFA 2PRMA 3AHVA 3RU8X 3S0CA 3EWYA 4LF2A 3IJ6A 2B7PA 4C6NA 5LXXA 3HN3A 1H41A 3O07A 3ZSTA 2XZ9A 4QG6A 3IJIA 3RJXA 6XIMA 3LENA 5I78A 1MNSA 2CWNA 3OYZA 2CHNA 8TIMA 4H19A 3GC4A 5BNKA 2NLYA 1BKHA 2DDXA 5I3DA 2EG6A 3PNUA 3WDQA 3NGJA 1YXCA 4HCLA 1JF5A 3GTNA 2WHJA 5JIPA 1HW6A 5K9DA 2CHOA 3SN1A 3W53A 1CGUA 1OQFA 3EOLA 1CECA 2X2GA 1XLBA 1IF2A 3PTQA 3KVJA 4JIPA 4AEFA 5CPTA 3L65A 4LUSB 2DH2A 4IGSA 3CV6A 1D3GA 2O56A 1Z69A 3CU2A 4UCGA 3ALGA 4FHAA 1PCKA 4WJXA 3NIYA 3MP3A 1M5WA 3AU2A 1TWDA 2CLIA 3BVJA 1KA9F 1RA0A 4QCEA 2ZZ2A 1F8MA 3BLDA 4KRTA 1BRLB 3UG8A 3BAXA 4MB3A 3N15A 3STGA 3WUBA 3BCDA 3A12A 2V3DA 4PMOA 1ZPTA 1ZAHA 3CLWA 2GQAA 3DN5A 4Z1AA 2W4XA 5M1TA 3DGRA 3PTKA 1XKYA 1FUYA 4D6HA 5K3VA 4GINA 2C16A 4MNJA 3DHUA 2PAJA 1W1ZA 2VFIA 1WDWA 2ZX5A 3RF9A 2OGYA 2I1OA 5CZ0A 5LNVA 2OQLA 4ZO9A 5HWNA 3WF3A 4E3TA 1XX1A 3CXOA 4NRRA 1EXPA 2PUZA 2VZSA 1Y0EA 3ARTA 2BNJA 1UW9A 3LHUA 2FZBA 3DZ1A 3SY8A 3A9IA 2EF9A 1KCKA 2PZNA 3ZJKA 2J8FA 1LLWA 3UCDA 3UVIA 4GH1A 3UWWA 1RSCA 4WY0F 2D1ZA 3MSYA 3W23A 4HD5A 1EJUC 1VB9A 3MUY1 4D6DA 3FCPA 1DIOA 1J0HA 3PP7A 4O28A 4O8AA 2DZXA 4FI4A 2JALA 3MQTA 4PB4A 3H4XA 4HZ8A 4W7VA 1GWJA 9RUBA 3FAXA 1IHIA 3UG5A 5FF2A 2WLYA 1FWNA 2G3FA 5T8GA 3REQB 3VIOA 1T40A 1TB3A 5D04C 3SCWA 3TMQA 3FW6A 4N6EA 2OQHA 2VWSA 4IGMA 3W7OA 4NYUA 4RW3A 1D2KA 1NDZA 4F2TA 1B9BA 5EPDA 1OINA 4LCRA 4E4PA 5D38A 3CZKA 3ARZA 1N8IA 1EH9A 4FK9A 3S9YA 3W1PA 4P5UA 4R88A 1V4YA 1IGSA 2QR6A 3GXDA 4RDVA 2ADAA 3BTNA 4PMVA 3POHA 1CWYA 1NOUA 1W1B1 3W1UA 1XC6A 2ZIDA 2QCDA 3WLJA 2ZZ7A 4HB7A 3PM6A 3H6OA 3CQ0A 3TN5A 3H7UA 2NXHA 3R11A 1BG4A 3V3WA 4K3ZA 2EKCA 4OE7A 1ICPA 1NM9A 1N8FA 4ZQPA 3O8AA 3AHZA 4M1BA 4O53A 4YHGA 4AHQA 3D47A 3GB6A 2C18A 3TTEA 4OU1A 3W1LA 3CZLA 5DMMA 5CBBA 1E9LA 5IBXA 4IM4A 1OD8A 4S1FA 2G4JA 3BAKA 1SO4A 2PGFA 1M7JA 5A6JA 2WZTA 1DWIM 4DAIA 1EJVC 1SFSA 2XFYA 2FLIA 4ATDA 4EOUA 2X0YA 2XG9A 2V5CA 1DWJM 1HXJA 1SZGA 4RE3A 1FVPA 3H8AA 3CASA 1BXCA 2Y7DA 1JPMA 2Y8VA 3WNOA 3GR4A 3UY7A 3VX1A 1RV8A 3KRZA 3E9AA 4GH3A 1VEMA 3PN8A 1IEXA 4YN5A 2E8ZA 4ERAA 4H2HA 4CGTA 1W5MA 1R2SA 3LV5A 4DN1A 4K37A 2FJKA 3TZNA 3N29A 5AHIA 5EA9A 2PP0A 2G97A 3T44A 7XIMA 1OX6A 4J3UA 1OEPA 3CJPA 5BROA 1VJZA 4M3PA 2J8TA 2PP1A 4LVFA 2Q8LA 4R7OA 4ZFCA 1XHGA 1K9TA 1ZBWA 3W1AA 1EIXA 1JGMA 3MWAA 3NDOA 3TCSA 4UTHA 4OECA 1GGOA 1SU5A 5HQMA 4Y9PA 3VNZA 1R7OA 3BLEA 4RZ5A 3TQPA 4Z1YA 2DIJA 4LY8A 4IHCA 1WA3A 2Y7FA 4WSHA 3DIPA 3CEPA 3B8TA 4HJWA 4WKFA 4IISA 3BG5A 3M0VA 3EAUA 1QO5A 1RJPA 4HBKA 4CNTA 7ODCA 2GZXA 2Z29A 3PWAA 4LALA 2YBVA 3UVAA 4XZ9A 1R47A 4HOZA 1V3KA 3SAZA 5BXPA 2D22A 1YKWA 2EPNA 2VEIA 3UWUA 2EJ1A 1DJQA 2ZZ5A 3E02A 4UFLA 4FS9A 3T4CA 1H7WA 4JYFA 3CAWA 4DJEC 3KTCA 1Y7VA 5REQA 2YL5A 1TWSA 4QIUA 3SW6A 1CXLA 1KCZA 2ACSA 3NAVA 1JF6A 4K38A 5DXXA 2VEFA 5FF3A 3N2XA 1NFBA 4CUCA 2HPIA 2I5IA 2HE8A 4H41A 4REQA 3H12A 5GQBA 1GQIA 1RK5A 3KOYA 4U33A 2D23A 4KFPA 2KZHA 4G56A 3C3UA 4B5XA 3UCCA 1KRCC 3N9SA 5JU6A 2DUZA 3E1F1 4AVNA 5LIXX 2QGYA 4FR6A 4MTVA 3EEZA 1MDRA 1IEQA 4L65A 1LL4A 4W84A 2PGEA 4B15A 4DF2A 1Q6EA 3ZM8A 4C1NB 4ZE5A 2R1PA 2WJDA 3OGSA 4C1KA 5FESA 3WH9A 2E28A 3K4AA 3L4YA 1FQ0A 3ATYA 5JQ9A 3DESA 4V15A 3RITA 3WDPP 3DYPA 5AHLA 3POCA 3OW1A 2NVCA 4B5TA 4B5SA 5AVNA 2A1YA 1O7AA 1I4NA 2I5QA 3ZOAA 3QQ1A 4R34A 1O95A 3HGJA 1WUEA 3W2NA 5E1QA 1QI0A 4KCTA 4DYKA 1CXHA 3U5YA 3ZO9A 3NYDA 1NJJA 4MOZA 4YPJA 2C71A 1HKWA 1I2RA 4BQ3A 2ZDSA 3PWGA 1DTNA 5EFFA 3L4XA 3NL6A 1EWDA 2OVLA 1T5AA 2HTMA 1F05A 2BY2A 2JKEA 2QPXA 2GGIA 5A6MA 4I9TA 1ZJAA 5FSEC 1Q6RA 1XIJA 4NSBA 2GSEA 1VFSA 1LUCA 2WV8A 4QDPA 1YYAA 5C5YA 5D02A 1AW2A 4PBFA 3UJSA 3V0SA 2Z0IA 4UR9A 4QS6A 2BS9A 5A8MA 3UNTA 5AB3A 2CLPA 3FA4A 2XISA 5E0CA 3BE7A 2OT0A 3PBMA 4Q6JA 4Q32A 1W1TA 1BWLA 3N04A 4JTAA 3WK0A 4KEMA 1KM3A 5A95A 3QQWA 3VOCA 3URAA 3K46A 4JTCA 1V0MA 3KAOA 4FXFA 5I03A 3MJYA 1SSDA 3FGCA 2ZWYA 3LK6A 5BRBA 3E0WA 2QPUA 1B5TA 2KX9A 2ZX8A 4MLJA 4A3HA 4LUJA 3UA3A 2HXTA 3QKEA 5REQB 1B90A 1US3A 1B4EA 2YL8A 4FX7A 3M7SA 3VDGA 1SW7A 5A8GA 4Z1DA 1PXGA 1GW1A 1SW0A 3BG9A 4NZFA 3SSZA 4XZBA 4ICCX 2PC8A 1PBGA 4IQLA 3ZVHA 1EX1A 4GYPA 1XSIA 1F2JA 3UP8A 1Q85A 3BJFA 3BGJA 3BWWA 3E96A 4QE5A 3MKKA 3SECA 4Q8QA 4TMBA 3GAKA 4MJ2A 5CZKA 1YBQA 4CCDA 1UQYA 3AC0A 3N17A 3QV9A 3E2RA 4H7ZA 3B0UX 3W71A 1BSIA 1TPEA 1IZCA 4NZ4A 1NQKA 3SCRA 2D0FA 4HHLA 3C2YA 3GHUA 3S8HA 1R0MA 1LRNA 2V30A 1AD4A 1HN1A 3BMWA 5CSUA 3GHRA 2J66A 2XHYA 3FDGA 3W7HA 2D0HA 1PE1A 3UPBA 1JR1A 1HKJA 3A4WA 2OYKA 1ADOA 3WNLA 1QWGA 3KWSA 1UKPA 1JCMP 1HT6A 4ZB2A 4LAOA 1UWUA 3M44A 2V5KA 4HNCA 3B40A 4L9XA 4UNIA 1TPUA 3AS2A 2W0UA 3H55A 3TOPA 3AZRA 3TUUA 1R2RA 1BGAA 1Q2RA 1LCOA 4R9XA 4QNWA 2UY4A 3PPHA 4J3TA 2GJPA 5FJOA 1C8VA 2HE5A 2NWSA 2P0IA 1UIOA 4LXFA 2TAAA 1MDLA 1K1DA 3PZ9A 3W82A 4DM2A 4LAZA 1UWIA 3OBAA 1Q13A 4RKAA 1Y65A 3HQPA 1RY8A 1GJUA 1TCDA 1YPIA 1TSIA 3HG2A 3RU6A 1UH4A 5A69A 3EWXA 2Y6ZA 4AD5A 4J3WA 3TAOA 2PWUA 3MI3A 5CAKA 1UR1A 1XR2A 3APYA 2HJPA 3H2FA 3V75A 5A2AA 3WZ0E 2Q09A 3I6TA 4OGZA 2PI6A 1O12A 4FX8A 5KSWA 4BFAA 5CBIA 3VUPA 2ZQ0A 5FL0A 1ZUAX 3N19B 1TMHA 2TODA 4CNUA 2A3HA 1NWTA 2J78A 3TN4A 5EY5A 2TMDA 2IXVA 2QZRA 1H50A 5LNSA 4A8NA 3PNZA 3LZ3A 1GVQA 4IT1A 4JS3A 1NWSA 3LDVA 1ME9A 3WQ5A 1OYBA 4O54A 4Q8VA 5C55A 4N42A 1AODA 4Z2LA 4OUEA 1W2PA 5FD0A 2GWNA 3AXMA 2HS6A 2XIBA 2PDGA 2BY3A 1W9XA 1P1XA 4LB4A 2GK1A 3GU1A 1GYMA 2DP3A 4D8ZA 2X7WA 4JBRA 3LHZA 4Q8OA 1XKJA 4XIMA 3WQ8A 4B9ZA 1RVGA 4MKVA 3WEOA 4H8UA 4HU3A 2V9DA 3S2LA 3CWHA 2YXOA 4B9YA 5MKGA 4DZAA 1VR6A 1XWYA 2ALDA 4H4IA 2QLYA 1S5WA 3WMBA 4QDMA 5ENLA 3H54A 5FACA 1NOFA 3RHGA 3AMKA 5C70A 5E9XA 4GKTA 1HX0A 2VFDA 3QSRA 1G4EA 3C0SA 1US0A 1E51A 3LCGA 3EWZA 4I3GA 1H7PA 2OGJA 2XH0A 1CXEA 1GK8A 3CMJA 3TN3A 4BQ2A 3RX3A 4IJRA 3B8WA 2A6NA 2YXGA 1GOWA 3ARVA 1A5BA 1TA3A 3G3DA 3FK4A 3NQBA 2Z4GA 5TNVA 3PK7A 5ABFA 3VKAA 3KLLA 3UZXA 2V6AA 3WK2A 5DCEA 3OJGA 3LPFA 3VGFA 4DJDD 2Z26A 3SCOA 3LTYA 1OFEA 5F4XA 4Q8UA 3IJ8A 4BF5A 1M01A 3F2CA 4LUSA 5D8ZA 2BASA 1J10A 3H53A 1E6QM 1CB2A 4BI7A 2VQUA 2A3CA 2YDSA 3EXTA 1PCWA 4NAFB 4HMCA 4LCSA 3ARYA 2ONEA 4X61A 2VC5A 4B3LA 4W8BA 3CPRA 1V3MA 3GDKA 1IYXA 3NNTA 2JK2A 4I8YA 2VEKA 2A85A 4PCNA 1U1JA 1FA2A 4O13A 2X0HA 4NX0A 1OB0A 3LTSA 1BF6A 1XLCA 2WVTA 2FHBA 2IMRA 4BEUA 4NNBA 3S9IA 2QCLA 3MBDA 3FGCB 2EHHA 3ITCA 2F84A 3GKAA 2XVLA 4RL3A 3U8GA 3RLGA 2AKZA 3F2DA 2WSPA 1KM2A 4E4UA 3O15A 1WQ5A 3URNA 1VYSX 1VP5A 1EDTA 4L61A 2D0GA 1XW8A 4REQB 5CBJA 4Y96A 3GQYA 2CC0A 1EUAA 2Z6JA 3GDBA 1Y5WA 2X41A 2I9EA 2V38A 3JZEA 2X2YA 4N4QA 3RCMA 1MRQA 1EA0A 4GQ0A 1I0BA 2AAAA 1RQHA 1JD7A 1IR2A 3UR8A 4JKMA 5H8MA 1YW1A 3PBYA 1T7LA 3ZZ1A 3CL6A 4J3SA 3W27A 1JUKA 2JBMA 3WH8A 1M6JA 1E1CA 4R3UA 2RGLA 3VGBA 4ZOEA 3NO5A 4OT7A 1EP2A 1EPVA 5JBEA 3SGZA 1G67A 4UNLA 3GNRA 4E3VA 3T8LA 2FB3A 2I17A 3PJUA 1I2PA 1W17A 4DWSA 2YBTA 1SYTA 2VEGA 3RM8A 2Y5EA 4NJIA 3L9CA 3VDAA 4MWAC 3APTA 1E0VA 1MXDA 4S38A 4WXYA 3QMTA 1AW1A 1H3GA 1BXNA 2VMFA 2E67A 3G0XA 2J7FA 4D1JA 1SM9A 1EPXA 1AL7A 2UY2A 4PCSA 2XH2A 5H8UA 1UA7A 1QFEA 4XKYA 5HNNA 2Z1SA 5DMNA 4XKMA 3ES7A 1F3EA 2NQHA 4BCEA 1WO2A 4QEHA 4NZJA 3ANUA 2V2CA 2WHLA 3TE9A 4CQ9A 5CPLA 3SQSA 3QSTA 3IGXA 3MMUA 4C6DA 2GVEA 5XINA 1IR1A 3N12A 2VOMA 1QNVA 5A2BA 4OIFA 5BMXA 4YTQA 1V02A 3CHEA 4BI5A 4FIQA 1PKNA 1K8YA 5F2MA 1R3TA 2WHMA 4JTQA 1E73M 1WXYA 4HSOA 2P0OA 1O5RA 1WKDA 3G1YA 4MM1A 4CQCA 4XX6A 1EXBA 4ZBCA 1UH2A 3E2SA 1YE4A 2IPGA 4PL1A 1L0PA 4S3EA 5FJPA 3QMRA 1VHNA 2ISFA 4TVCA 4HPXA 3ZLGA 2CFFA 1TELA 3CHDA 5AC6A 2OG9A 2A7RA 2YW4A 1GKQA 4E8GA 3W7NA 1MEIA 3O7UA 1QI2A 3ABXA 1W5OA 4PMZA 1KXVA 1TVPA 5EBAA 1C8QA 3CT2A 4J7RA 1GVIA 3ARXA 3EB4A 2ZADA 3E0LA 5KZMA 3G1VA 4HN4A 3RPMA 3VYLA 2Y85A 4QJ4B 3QPEA 4NQ1A 4U3AA 2F6XA 1AQMA 3LM7A 3H70A 4ACZB 1JZ8A 4FXSA 1JULA 1J0YA 4QJ3B 1PKYA 4CNOA 4CN1A 2BHZA 1PZ2A 8A3HA 2NX3A 3LRLA 2V8ZA 4WR3A 2MUCA 4QJ5B 3O05A 3HG4A 3TKFA 4E8DA 4GNKB 4NF7A 3LBOA 2CZ5A 2ACQA 3SUSA 1GG0A 2V81A 4S3FA 3LTPA 3W22A 4ZGYA 1UD8A 1TWWA 1XRSA 1IEWA 4HN8A 4ALDA 3UBPC 3C0JA 5IXEA 1KV8A 2AL2B 1SO6A 3MA8A 3LHWA 3UJFA 3AICA 1ISYA 4TOQA 1E6PA 1RLCL 1UOZA 2HBXA 2PF0A 2Y7GA 3WLPA 1A0EA 2WM0A 3UXKA 1JPDX 1EGMA 1Q6FA 1TPDA 2CWXA 2ZRUA 3GVGA 1DXEA 1IWBA 2D24A 1SFJA 3NA8A 2QGHA 6TIMA 1V3LA 3W9ZA 1VFOA 1VZWA 1OFAA 1VYRA 3LCFA 3LXBA 1VCVA 2ZFAA 1UWAA 8XIAA 5TBOA 3CZGA 1D8WA 1LBFA 4C6KA 3UWQA 2ZE3A 4I6KA 4LANA 3NSMA 3NOEA 3ZJ6A 3JU2A 2ZUVA 4GUGA 4LOCA 4WUIA 2J75A 3KBMA 2GK1B 1W1PA 3MHUA 3MUCA 3BAYA 1E40A 4Q8NA 3OVQA 4MKSA 2EPKX 2OJPA 3CYJA 1IXOA 1TVNA 4QSHA 4IOTA 3DAQA 1XGZA 5DF0A 3MY9A 1XLHA 3VGGA 4Z2JA 4TV6A 3QY8A 4L1GA 3EWCA 3C4UA 4MB5A 3BW3A 1FFRA 1YIXA 2PDHA 4AU0A 1IE7C 3CQIA 3DUGA 2YCJA 4Q4PA 4P7NA 1PPIA 3LQLA 3VM5A 1SFLA 3WLIA 3CNYA 1X8CA 3UERA 4GGHA 2CLKA 3FFSA 2W3ZA 4LYRA 2H6RA 3S5YA 4GNJA 4ZMGA 3LPPA 3AZSA 1KXTA 3OGRA 2V3FA 4Q8PA 2BGNE 8RUCA 2OSYA 1KBLA 1H1ZA 3AOFA 1JJKA 3AXXA 3TONA 4UWMA 2O7SA 1DWFM 1KFEA 4M6QA 4B90A 3FEQA 2Y89A 2XINA 5HWJA 1HNYA 3HG3A 2Z1WA 1RZMA 3QV8A 1JYVA 2H3DA 1TV7A 3AIWA 4ORMA 5A6BD 4LU0A 1LT7A 3O0FA 1FXQA 3PSVA 3NZQA 1IWAA 4Y2WA 5DBTA 1M9HA 4IPPA 1P4CA 4L6OA 2CBVA 3WELA 2Q6ZA 3WQ4A 3HQNA 1B3OA 3L0KA 1TWZA 2OZ0A 5D2VA 3N9KA 3H2AA 1QW9A 3GLCA 3T08A 2J62A 3SGGA 3S47A 5C71A 1Q8JA 3MBFA 5A8OA 3VI2A 1MRAA 5I0DA 2NUWA 1FHUA 4AUBA 4F79A 3KP1A 4GACA 1YDYA 2FH8A 3CAVA 3KS6A 1AH4A 5DT7A 1J79A 3EDJA 1AQ0A 1TWIA 1XFCA 3STFA 4DRSA 3WJYA 2PP3A 2RDTA 2ZKMX 2FTPA 1S2WA 5LNRA 5IDIA 2BY0A 1NH6A 1Q65A 2HISA 3B8SA 3A4XA 4UMAA 1QRQA 2WMIA 1LDCA 3AXKA 3MC5A 3P8IA 3VCRA 2FGBA 4W5ZA 2X1TA 1XH0A 3QC0A 2NW0A 5CH9A 1E4LA 2E0PA 3ZYZA 1XLKA 2X40A 3QR3A 2OSWA 3ITOA 2A3EA 4H9TA 3K1GA 4UTTA 3FN9A 3NQ2A 1PZ3A 3VO0A 2QCGA 2V5DA 4HKPA 3SIZA 4AYGA 1F6KA 1J93A 1BTCA 4R85A 3UPWA 4DM1A 4X22A 2DW7A 3GTHA 4LVAA 3CZ8A 3H24A 3RJYA 2A21A 1H7OA 3HMCA 4FALA 2CEQA 1UPMB 2EO7A 4AC7C 4MWAA 2DJXA 2CKRA 5HK4A 2QF8A 3EX2A 2GGJA 2O9RA 1MUWA 3BV4A 2AAMA 3MCOA 2OOFA 1DQXA 2F61A 1RR2A 4P8UA 2FPTA 2XIIA 3TNOA 4LEFA 5DRIA 1OFPA 3PTDA 3SY1A 4AXNA 1R3WA 4ZTYA 3WNKA 1UJQA 1E6RA 4BI6A 2VC9A 3N73A 2E68A 2XZ7A 3MUXA 1KBJA 4DI9A 2XH7A 3E0IA 2PTWA 2J24A 3L23A 1EEPA 1E6NA 2CU0A 4X60A 4H00A 2BGQA 3T2PA 3CL8A 3NO1A 1TFVA 1LYXA 4XIAA 3B4UA 3UR2A 3LOTA 4H83A 2XYLA 1DIEA 3MB9A 3F03K 1GVSA 3ES8A 1VFFA 1KBKA 4F4RA 2WMIB 4GA8A 1LQ2A 4H01A 1RD6A 3S1VA 4UMCA 1GVYA 2GL5A 2INFA 1FWFC 1E55A 1N2VA 3O3RA 1A5UA 4N0RA 4ERIA 1RAKA 3QMSA 1ELSA 5A94A 3OVGA 1K7XA 2ZUTA 1QAPA 4D6IA 3SQMA 3QFEA 1PSCA 3CUXA 1ISZA 3AYSA 4XKYB 5DX7A 1W9BM 5HANA 1QXLA 4PFMA 3LU2A 2J77A 3AMCA 3Q37A 2XIQA 3P3BA 3W76A 2W67A 2Q8ZA 1O60A 5HMFA 2V0TA 4Q4MA 1FWHC 1KTCA 5D09A 4C7FA 3H2MA 4DB7A 1HP5A 2C1HA 2P5NA 3TR2A 1EC8A 1GONA 4LCQA 4IICA 4TTGA 4PUMA 4PYSA 5DLCA 2PEVA 1ZL1A 3WDRA 3PBUA 5EYWA 3UR7A 4IXXA 1XGEA 3DEQA 4E2BA 5A8NA 1UMLA 2G3NA 1P0EA 2FMOA 4J4KA 3SJ3A 3TVAA 2Y62A 1QO2A 3R58A 2J7GA 3WBEA 2WNNA 1NFGA 3UZ5A 1GHSA 1VGAA 1JEZA 3TNBA 2WB5A 2GPTA 1BTMA 1W1A1 3C61A 1KXHA 3M1ZA 1ICQA 5CC3A 3W2KA 2QKFA 1OIFA 4L80A 1VQTA 3HTWA 4QM1A 2XGZA 3E3HA 4V1YA 4Z0SA 1XYBA 2VR5A 3LCWA 2CZFA 3PG9A 3E2QA 5EMKA 1I2NA 4GX8A 2ATSA 2B7QA 1GPFA 5BW6A 3BANA 4PGLA 1GQKA 3DC0A 3W85A 1B9ZA 3HJZA 4NT0A 1AZ2A 4DF0A 1SUXA 2V2HA 3UZWA 1CLXA 2AQVA 3ONBA 1ECQA 5I3JA 2H90A 1JL8A 1RXOB 1TPFA 2DVTA 4EX4A 2GQ8A 3GVVA 5T91A 1OJXA 3VILA 5ABHA 1TR1A 3NEHA 1ZBCA 1KM0A 4Z08A 3WENA 3L67A 4XZMX 5AC7A 2PU1A 2PPGA 7TIMA 2P3EA 2QDGA 3DFTA 4FNRA 3GG8A 1YNPA 3RG6A 2D73A 1LM1A 3T81A 2E4TA 4RDYA 1SPQA 3NCOA 3EKGA 1UG6A 2A5HA 2OLAA 4QLKA 2PRHA 1WYIA 1DTUA 3P60A 1HKKA 1Z3NA 1MMFA 1UD3A 3SUUA 1FHLA 1EFZA 1SJBA 3C0QA 3LNPA 3CQHA 1W9VA 1FDYA 4ZO8A 2BZNA 2P10A 1RCOB 1VPXA 1IIHA 3T0AA 3UGVA 4OOUA 4ZQOA 2NXIA 3BUVA 4W7WA 1A5CA 4RX0A 3VMNA 2VURA 1K77A 1VJSA 3NQEA 3W84A 1XRFA 1L6SA 1H7RA 1FBAA 1W3HA 1HL2A 1TTJA 2GUYA 4LYPA 3WBWA 1OC7A 4CU6A 2QCFA 3LSCA 1KLZA 4GQGA 2WM1A 4F66A 4JL2A 1QK2A 1EJSC 1V0KA 4A8IA 3ABRA 3L12A 3P81A 1QJWA 3HM7A 5DMLA 1C29A 4UQ9A 1GORA 2XDFA 4LV9A 1T96A 1KFCA 1UB3A 3SRFA 2PC4A 4WGXA 5RUBA 2YXXA 2AOSA 2YX0A 4IX0A 4KKXA 4AWSA 4O1EA 2O7QA 3VX0A 4R9OA 3QV6A 1RBOB 1SMAA 4QGCA 4O16A 4Y8EA 4NL1A 1GHRA 1IEIA 1X96A 3R0DA 3WIJA 1VD6A 3DBPA 7REQB 1H1YA 2E5BA 1EYWA 2IXUA 3UEQA 2J74A 4NU7A 4HA0A 3VD9A 3CTTA 3AU6A 4RNIA 1DKWA 2OELA 2X09A 4O1CA 5FF4A 2DPEA 3GVQA 3FIGA 1ADSA 1JPKA 1HVQA 2W27A 2A3BA 3B9OA 1RK6A 4DJED 1KC7A 3CV1A 2F2KA 4UZSA 3QLLA 1A50A 2TPSA 2Z25A 4H8NA 2RKXA 4F8XA 1BHGA 4KH2A 2WSRA 4HP5A 5CZJA 3UU0A 1CXKA 2I57A 3N6HA 3ISIX 3W4RA 2D2GA 2OX4A 3TJLA 3VAVA 4A3YA 3SJNA 4M24A 3VOIA 3C3NA 1EX5A 1VJIA 5JBFA 2G4FA 4M80A 2VZVA 3GTIA 4IIHA 2VC6A 2CETA 3HOJA 2QVHA 4XD4A 4NY2A 2J25A 1XBXA 4EPEC 1QCWA 4M7SA 4UR7A 2GVJA 2J47A 4CNNA 5D4YA 4G7FA 4GXMA 4YNGA 1WDSA 2VEPA 3PBVA 1EQCA 1W9PA 2JIEA 4D6EA 5CQ1A 4ROPA 3N18A 4UTFA 3NQGA 1XG4A 3HURA 3ZSSA 4JQ4A 1YNQA 5LIKX 1RBAA 1XDLA 4D9PA 3E5PA 3GO2A 1UJPA 3WKZA 1GEQA 1UBSA 4OJYA 4MGGA 3OLDA 5M03A 1GOXA 4HNNA 4KIEA 2F2HA 1QPOA 4MDPA 2WMKA 4LWWA 1ZJIA 5H8PA 1VAHA 2WXDM 1XM3A 2NX1A 3N4EA 4JHZA 4LT9A 4Q8MA 2BVTA 3GNXA 2NT1A 3V5FA 1CX9A 1OT2A 4DQWA 4GLEA 3OVRA 4IMDA 4K8GA 5ABGA 4UTWC 2Z6IA 5B80A 3GKFA 4AIUA 5AZ0A 4C1NA 3S6OA 5K7JA 3W38A 3U2ZA 4O1DA 1G6CA 3ZFHA 5CLTA 1K9DA 3DC8A 3WY1A 3EA1A 4BF9A 3LERA 4EF8A 3H4GA 4L9ZA 1BFNA 4PUJA 4IZGA 3CV2A 4UC5A 2HK1A 4UNKA 4LV4A 4M5PA 3O1NA 1JCTA 3FAWA 1WZMA 1X97A 2OEJA 4ZQCA 3F5JA 1Q45A 1HL8A 1TUXA 1H7XA 4AFYA 1SR0A 3KVLA 5F4SA 3SRDA 4GY7A 4RE0A 4AISA 4LS1A 2WJFA 2ZRVA 4LBSA 4UFMA 3NPUA 3MUZ1 2E7FA 2ACRA 3CMFA 3LQGA 4ZCWA 1EZ2A 2RAGA 1DEDA 3WF4A 1Z6KA 1U5HA 3T78A 1XDJA 1BYCA 1ONXA 3PB0A 5FSDC 4AYSA 3RXZA 3HQOA 1K8ZA 1ZCCA 3N3TA 4GOAA 6PTDA 1YDOA 2HEJA 1HJXA 3QKZA 3W01A 3RO8A 4XWUA 3VD4A 4YLWA 2W92A 3P7YA 5DO8A 2NV9A 2BP1A 2INZA 4WOZA 1OBAA 4AD0A 1KR0A 1J18A 3MCMA 3BARA 6A3HA 2VC7A 1W8SA 4FX6M 3I3EA 5AYYA 1QR7A 1I1XA 1UWTA 3MYPA 4PUWA 2H8XA 4IP4A 1E0XA 1QPNA 3NQMA 4QFUA 3DFYA 1EGZA 3BLOA 1P6BA 1KWGA 3UG3A 1RALA 2GVGA 4JHOA 1BWKA 1G4PA 1W3KA 2IPWA 3ABSA 1F9CA 1R7AA 3KS5A 1KGUA 4UCFA 1VBUA 1MNZA 3T8QA 3G77A 1A4LA 1VRDA 5D30A 2R24A 4H6KA 4PRTA 3WLQA 1Q8AA 4PE8A 4O1FA 3GYEA 1G7UA 1ME8A 1UD2A 5G5IA 3W2MA 5KMYA 5D9MA 4UQAA 2WKGA 4A4AA 3N2MA 2FTYA 2W66A 2DSUA 3VMPA 1GOIA 4NKCA 1DIDA 3NDYA 1LWIA 3XINA 3MSDA 2PE4A 2E09A 2G3MA 1TJ0A 4CKQA 3IJQA 1UP2A 4AC1X 1VIWA 4KMQA 6XIAA 4O52A 1V3IA 4CQDA 2CITA 3CTLA 4K39A 2C1IA 1LORA 3G5EA 4UQEA 1HG3A 4RNJA 2ZZ4A 5HAOA 3RN6A 4DUVA 2G3JA 2XIOA 2J7EA 2JKPA 4IMEA 3SI9A 3QW3A 4H8VA 4PUNA 1ML1A 3EPNA 2GJXA 4PMRA 1OCJA 2QT3A 4JFSA 5I77A 2LLEA 1OC6A 4PRWA 4RW5A 1W32A 2VO5A 5MKGB 5F4WA 1C93A 3W87A 3M0LA 1RVKA 5K2ZA 3KCLA 4DZ5A 4JTFA 4GVIA 1YPXA 1YX1A 3SZ8A 3Q65A 2QUVA 1E5JA 2HVNA 3O16A 2E6FA 3AJXA 4PMDA 4FXJA 5I23A 1Q7ZA 3VA8A 2QUMA 3CMGA 3I65A 1LROA 4IPLA 1XQLA 4XD3A 2NUXA 5I09A 3ABZA 4HA4A 1E70M 1AUSL 1PKMA 1B31A 3QZ6A 1L6YA 3PZGA 4XTDA 1DBTA 3GBEA 4JYEA 3R6IA 3MKVA 4DBUA 3UT0A 4GJJA 2VQTA 4K8HA 5C9XA 2O4MA 2RFGA 1P43A 1NQ6A 1W9DM 2PDUA 3F1QA 1YEYA 2D3LA 3CH0A 4M0XA 4AWTA 5TIMA 5PTDA 2RH9A 3GAYA 3N6QA 2ZWZA 4L9YA 1HKVA 2QJNA 4US5D 1SJDA 5LIYX 4GYFA 2XFWA 3G8RA 1POJA 1XL9A 3V0TA 3R79A 3WF2A 4U4MA 2RJGA 2AL2A 3NVTA 1S5VA 4Q8WA 2NVAA 5EMYA 1BVWA 2FYMA 1Z89A 4RNFA 2HBVA 2G41A 2YCEA 2ABAA 4CU7A 2Z1XA 4DNHA 3D5HA 5T9BG 5AVHA 3M41A 1K6AA 1DORA 4JTDA 4JTSA 2WO5A 3NFUA 3TJ4A 2VVSA 1EHNA 1D3CA 1UUOA 3GHTA 3HZ3A 3HGRA 3N14A 4F2BA 1M7OA 4RNHA 2DZAA 4ZTXA 2VD9A 3QHOA 2FPYA 4H2CA 4POCA 5AC5A 4JQ1A 3BMXA 3C5QA 3V1PA 2WCSA 9XIMA 4MFDA 4JDBA 1S38A 2A4AA 1UHVA 1Z41A 2BXZA 3NZRA 5XIMA 1B3ZA 4IUGA 2FHFA 1LT8A 3MO4A 1LG2A 4E2VA 1DJXA 4V1XA 3WBAA 4AVFA 5AECA 4QROA 1N7KA 4ZSUA 2AMGA 4JTUA 4ROQA 3QH2A 4JQ3A 3EZ4A 3HPSA 3LCIA 4AW7A 2CLMA 1K4HA 1XLAA 4WX2A 3MO7A 2OKOA 4TQTA 4PCTA 3OIHA 2P76A 5CPNA 3OG3A 1MFUA 3D3AA 5CLWA 2GYIA 3BAWA 4LPCA 2DJLA 2VFGA 4QQ3A 5CC6A 4ES4A 3GIYA 4YCPA 3G6LA 4TX9A 2DGAA 5AC8A 4JEQA 4QQUA 2PTXA 4GC3A 3BQ5A 1MW3A 3I6EA 3O6AA 2JIWA 4AWEA 4XK2A 5LHEA 1P7TA 1M65A 2X16A 4U28A 3ABQA 4IUOA 4ZVJA 2O9PA 1ZP4A 2Y1HA 3W1RA 5BOFA 1LZOA 4ZO6A 5CZTA 3GW3A 4JQAA 4OTKA 4GI9A 4H7CA 3KM8A 2DH3A 1S3HA 3PZNA 4HZ6A 4QITA 1F07A 1QVBA 3E49A 3VMOA 1VF8A 3B04A 3OBEA 3BCJA 3SCSA 2GFTA 2JKAA 3S2JA 4DYEA 1YDVA 1KFKA 4A2SA 3VD5A 4LYQA 4S39A 5E6YA 4LC6A 5M5DA 1WOAA 4NZ3A 3PZTA 1TV3A 1CGWA 2NXGA 2PFHA 2YL9A 5I3FA 3LD5A 4GIAA 3UYCA 3TFXA 2ODOA 2CZEA 2OLHA 2WJZA 3E38A 3HV8A 2Y0FA 2PWGA 4D72A 1OGGA 3L4WA 2PDNA 3MMDA 5LSMA 5E93A 3WLKX 2DSWA 2QNEA 4RLIA 4WQ6A 2A7PA 2E1DA 4LGXA 4Y6GA 1GKPA 3MP5A 4C7DA 4V28A 4K6AA 1KLYA 3B8UA 3KFTA 5D05A 4JNMA 3Q4DA 4O14A 3OZPA 4AD3A 3BSGA 4ML4A 4L1WA 2V5JA 2GDUA 3M0YA 3LG3A 4GUFA 1VIZA 2WMFA 1O5XA 1CLKA 3QGAC 5FOOA 3SR7A 1ZCOA 3H2OA 1S1PA 4GI8A 2PDPA 2E3ZA 1THFD 5HMSA 2ZUMA 4GIRA 2PGRA 2IPFA 1ZJHA 1E9IA 3SCVA 4IF2A 1CLVA 4QISA 3F4CA 2FVLA 1K7EA 3G1AA 1C90A 1NEYA 1QPRA 1XUUA 1NFPA 4ZOBA 1ZZMA 2ABBA 4ZR8A 2VENA 3NL5A 3C0LA 4HMNA 4DJFA 3KL3A 2C14A 4EPKA 4IFKA 1OADA 4X63A 1M3UA 3QHMA 1H60A 3YPIA 1OCNA 1Z44A 4EKJA 1X6NA 4N9CA 3A64A 2QXWA 4ZQMA 3PJWA 5A2CA 1XRVA 1IT0A 1W3TA 4LAUA 1GOOA 2FDSA 4GFIA 2XWDA 1WZKA 2UY3A 3S2MA 3DHDA 1EKOA 1NAL1 4GGBA 4QXIA 2ZX9A 4G6CA 4R33A 1VHCA 3EMCA 4KWWA 3WD3A 4RZ4A 4NHVA 3WLHA 5EB8A 2O0TA 2Z24A 3B97A 1XQKA 1XH2A 4AIBA 1J8VA 3MZNA 2XN1A 3CS2A 4Z2HA 1BEUA 4I6VA 3ZT7A 4JTHA 5FEZA 3BOLA 1VS1A 1YLVA 4AX7A 3MPGA 4LW7A 3ITVA 3B06A 1O94A 3MVTA 5G4HC 2P8CA 4IIEA 3OTRA 2X1SA 4XTIA 1DJNA 1XYLA 5FI8A 3EGJA 1XD0A 3V7PA 5B7ZA 3QPYA 3H21A 2PD9A 4JZ5A 1WDRA 2QCDB 1MW1A 3R4IA 3NXFA 1TV8A 1DYSA 4MKNA 3ARPA 1XLIA 2ZTKA 3WLLA 1EOKA 3RX2A 2Q71A 4NI8A 3EDDA 2NQZA 3FYOA 5I02A 1QHZA 2FFCA 1UA3A 1TPWA 4PBGA 2R14A 1X1NA 1KFWA 1NY1A 1XIEA 1VPYA 4CD8A 4GJIA 3TAKA 3QYQA 4L4LA 3T9PA 2OU4A 4KW2A 5IFPA 1NP2A 4LVDA 2A0NA 3DG7A 3P5ZA 5IBXC 1MQQA 7TAAA 1JYNA 4D8LA 4GIEA 4G7EB 1X39A 1FWGC 1S2CA 3EOEA 3SSJA 4G1NA 1G1YA 4Z42C 2X1UA 4F0RA 3TTQA 3DENA 4KEVA 4P8VA 4RV3A 4JX6A 4GVGA 4JKLA 1JG9A 2FH6A 3CO4A 3MU7A 2ZRYA 4FOKA 3GR7A 3FXYA 4W89A 4WD0A 3OODA 3WUEA 1WV2A 1QI5A 3W6MA 3LGGA 3W00A 1EJRC 2IKJA 2C6QA 2NQLA 3W7EA 4F0LA 3KCJA 1WKYA 1L2QA 3VKJA 1YQ2A 4YL2A 4FB7A 3G1SA 3W72A 4DBSA 3W86A 1BQCA 3PJXA 4FR1A 2JF6A 4RK8A 3PPCA 3TJXA 1CGXA 3OA5A 1FWBC 9CGTA 2A3AA 1TRDA 3TXVA 3PTMA 4QR6A 1XIHA 4CQAA 3WBYA 3J7HA 3TV8A 4M29A 2WK2A 2VUYA 3WK1A 2J7CA 4R7WA 3G3MA 4M7TA 3THAA 2WBGA 4BHYA 3VKCA 3S83A 2FPVA 2QDHA 4ADTA 2B0MA 5F1UA 2ZBTA 3VCCA 4YXGA 1ZB5A 5L6UA 5A1AA 1Q7QA 1S5NA 3GG7A 1I6NA 3K1DA 1J2WA 4S3JA 3INPA 3KBNA 2OFJA 1TYGA 3TN6A 3OLEA 2E6DA 3NOYA 4PULA 4C6PA 4A29A 4X3ZA 3WMLA 5BXRA 3F4VA 3STEA 3T7VA 3LEPA 4DVOA 3K8MA 1HL9A 1TZZA 2G5WA 3TW6A 5DMYA 1Q6LA 4WLCA 1JPHA 4TX8A 6TAAA 4I5RA 1U30A 4Q7BA 4FO4A 3NSNA 4GYKA 5HR7A 3RCYA 4AY1A 5C2GA 1L8NA 4IMCA 1AH0A 2VCBA 3PZIA 3JVAA 5HQLA 3KL0A 2CBJA 2E6YA 3ZXWA 2EJAA 1OFOA 4ZZ9A 4WRHA 2HMCA 4MFEA 3AJ7A 1A5OC 2ZVRA 1E0TA 3ERPA 3RFAA 3RIKA 3GVRA 5MF5A 1R9YA 3V36A 1P0BA 1FH7A 3T6CA 2VZUA 3K5XA 2WHKA 3S2NA 3R2GA 1HQTA 3AS3A 4TVDA 4HJFA 3MVIA 3OZOA 4RE2A 1NWRA 4O19A 2XSXA 2YCLA 4JIIX 4NJGA 1XC4A 2ZVIA 2WW5A 3QFWA 3LXCA 3MYOA 1SW3A 4HNOA 4CNPA 1ITXA 3GYCA 2GJXB 3W7IA 1QPKA 4F40A 3MJMA 3A24A 1P5BA 1DJZA 2XTKA 5IM51 3L5AA 4AB4A 3QZAA 3IRSA 4JL1A 2OMAA 5I6SA 3SBFA 5IHSA 1KCLA 5FCZA 2QAFA 1VFHA 1LUCB 1QW7A 3S5ZA 4MPQA 3O2LA 2ANUA 4AZ5A 3KVKA 2Y24A 4W87A 1A49A 3O6CA 2Z1KA 4GQBA 1QT1A 2C91A 1EJ7L 4IJCA 3BAJA 2JF7A 3DFSA 1R38A 4K7YA 4A8LA 3M0ZA 4WGHA 3RPTA 3IK2A 3IIXA 4CD6A 3UR5A 1L6GA 2FZ9A 4RDWA 3JR2A 2ZUUA 3ZLFA 4TIMA 3IUIA 2Y5JA 3LY0A 1DPMA 1LWHA 4Z17A 3PFMA 7PTDA 1PYMA 4EK7A 1YPFA 1K9FA 1Q66A 3P8JA 4YTSA 1X8FA 3P14A 5G1YA 4E6MA 3M5XA 3B8DA 2NV2A 2WNWA 1RP8A 3EDFA 2IKGA 4H9UA 1TPB1 4YWSA 1W9UA 1KFLA 1EEXA 1DWAM 1R87A 3HO8A 3WJZA 1LF1A 2VL4A 3ALFA 3VIIA 2FVMA 1LOLA 2BOEX 3UXAA 1B3VA 3UA4A 4GK8A 1XBVA 3IS4A 3VIMA 1PX8A 3AIBA 2ZRWA 2Y63A 1KQYA 2MNRA 4Q3MA 3NL3A 4AXKA 3MV11 3R1ZA 1S46A 3DG6A 2B7OA 2VX5A 5HA7A 3G18A 4GMEA 3BW4A 3PBGA 4KQNA 3UW6A 3FYYA 4JN7A 4DY1A 2Y2WA 4OKDA 3IV8A 4MJMA 3M16A 1KD0A 1KM4A 4Y9OA 3DHFA 2XGBA 4IP5A 1SQ7A 3WUFA 4PTVA 2F38A 3DDMA 1J0KA 1PAMA 4JIHA 2BDQA 5C9WA 4F9JA 1EP3A 1GYNA 4MB1A 5A6KA 3DFNA 3TX9A 1BYDA 1G0CA 4WKAA 3ATZA 3GNOA 3H2EA 3DFHA 1HJVA 3KOXA 3G22A 1E6ZA 1IXNA 5E09A 3M0IA 3S2CA 1B1YA 3T0CA 5KETA 4RCXA 1YMYA 4PZVA 3SN4A 2VCAA 4FF5A 2G3IA 4B3ZA 4MG4A 2VFHA 4BA0A 4NJHA 3GIPA 3G0UA 1V03A 3M5YA 3XISA 2GGEA 4AD4A 1TQXA 2J8GA 1QNQA 3AFBA 4E2OA 3URBA 1W0MA 5FF7A 4L4OA 2QCCA 2B4GA 1VLIA 3QTPA 3O06A 5LIUX 3CAKA 4LNYA 3MWCA 3K8LA 2XIMA 3AIQA 2DW6A 4DEFA 1TPH1 1C9DA 3GX9A 2W79A 1LQAA 2GGGA 1GQNA 3TC7A 5FJRA 1GVEA 1RLDA 4Q33A 2VYOA 4FXRA 1PDZA 4JKKA 1UP0A 2G50A 5C9UA 2DZWA 3IGUA 5I5RA 2NSOA 1V51A 5HR6A 3VFCA 1KTNA 1VEOA 4TUFA 1E3XA 5E0KA 3ICJA 1K03A 5DXYA 1E15A 3VOHA 3QC3A 3I7RA 2ASHA 3PWIA 4DWDA 3QEZA 3VNMA 4WZHA 2CKSA 1TZ7A 2X7VA 4LF1A 3W7RA 4CD7A 1WOBA 4PA8A 4JCMA 3WD2A 2GJNA 2YBUA 3U7BA 4MY8A 2EPMX 2YOCA 3BURA 1T8QA 1FKWA 2POZA 1FOBA 4DJDC 2NQ5A 3EWWA 1JDEA 3NM1A 3MTWA 4KFOA 1XCXA 4JTIA 2J6VA 2E77A 4JTRA 5G2HA 2WBKA 4UQCA 2VCCA 2Z00A 3VD3A 3GC5A 3ZR5A 4LX4A 1CI1A 4HQVA 4Y9NA 2Y5SA 2W5FA 1A5MC 1DOSA 3M6YA 5FKYA 2GSJA 3F5LA 5U4NA 4PEKA 3VABA 1B3WA 2H9AB 3AYTA 3A13A 3PAJA 3CV7A 1G5AA 3RLVA 3VDBA 3CO8A 1MW2A 2DT2A 4GBUA 5XIAA 2ACUA 3U2OA 2VKZG 1L9WA 2DEPA 3D3FA 1W5PA 5BWFA 3IUDA 3MV01 3PHAA 4ZO7A 5AYIA 3W74A 2V3EA 4O12A 4GUIA 3NQCA 1DIKA 2V69A 5BRPA 1OF8A 1BVNP 2PWEA 5MHBA 3D6NA 3TW7A 1FCBA 4HPNA 3RR4A 4GQQA 1TTQA 2ICSA 2QCMA 4ICMA 3TLLA 1R3RA 3GM8A 1LL7A 3KOZA 5C54A 1BWVA 3I68A 1E4NA 2QULA 1OVDA 3EDKA 4AEOA 5ABFB 4XD5A 4C7GA 4AZIA 2QJHA 4HMDA 1FKXA 2WZMA 3LZ5A 3ANVA 1EDGA 4HNLA 2DZBA 4CVUA 1R30A 1Q4NX 4XBSA 3GE7A 2AKMA 1HF6A 1QHOA 4LY4A 5JH1A 3IIPA 3W83A 1K8XA 4I9MA 3A4AA 2Z7KA 1YDNA 5K4ZA 4ZFMA 3UETA 2FB2A 5FJJA 3IGSA 1UKOA 2G96A 1A5KC 4L1XA 2YW3A 2Z1BA 2YKKA 4AWUA 4UTUA 3Q45A 3UJ2A 3KDNA 3W81A 2I9UA 2VP8A 2QMJA 3E0FA 3SM0A 5A8PA 4UZUA 2OOGA 4HCDA 1Q63A 1LP6A 2X0SA 3QY6A 3V5CA 4HU4A 3UESA 4NJKA 3PUDA 3PUGA 4OWGA 2YZ5A 3VGDA 3TYCA 4I5UA 1X98A 6ALDA 1RH9A 1EWEA 4AIEA 4LRTA 1XIDA 2EPOA 3N11A 1YHTA 4WCJA 4AZCA 3KXQA 3T40A 2WZIA 5CJNA 1QI4A 3G8EA 2L5HA 2VX6A 4B4HA 4WVXA 4E4FA 4W7UA 2ZC8A 1MWOA 1MEHA 1CZ1A 3GSMA 1WPCA 5E5CA 3P5YA 4JNYA 4GZIA 2FGZA 3DFOA 4FF7A 2PSNA 3GXFA 4M19A 3W6LA 4CQBA 3BZJA 3P61A 4PC8A 3NQAA 3KRUA 2QUUA 2VR2A 1KFJA 4C6JA 3CT7A 1OHLA 1BQGA 3T0TA 1ZBVA 1CXIA 4GC4A 4BWLC 1QBBA 4IMAA 1RBLA 3IRDA 1UASA 4HYVA 3VNYA 1NELA 3HJEA 3OPSA 2YA1A 3V16A 3BLLA 1PTGA 1V6UA 2QV4A 3M4HA 3ZJ7A 4HU0A 1Y5XA 4IMGA 4NRSA 3ABOA 3BLPX 3GH7A 2QJJA 3KRSA 4BWLA 3GH5A 4BQ4A 2XVKA 4WF7A 2OXNA 3HGOA 2QCHA 3GG0A 1H0GA 2QDDA 3EX4A 3GIQA 1FWJC 5ECUA 4GXPA 1ISXA 2OZ8A 2VGFA 3QBUA 4DBDA 4TXEA 3OBKA 1ZS2A 1XLEA 4TTUA 1I1WA 3M5ZA 3QYSA 1RP9A 1HP4A 2IW0A 3TA6A 4ERGA 1RD5A 2DT0A 3WD1A 1N55A 3AIVA 2I14A 2FZMA 1I75A 1UYQA 3L66A 4IFOA 1Y8BA 5HJXA 1X1ZA 2QS8A 3W24A 1U5VA 4HK5A 3C2RA 1C8YA 2BOGX 4GRSA 3JZUA 4BY3A 2PWVA 4ZOAA 2PDJA 1PDYA 1GOMA 5DFAA 5HNTA 3FA3A 2XGIA 1VEPA 4CQ8A 4Z1BA 2BSLA 1DVJA 3WH5A 3U9IA 1UBPC 4K1GA 4IFKB 1KRBC 3HMJG 4EACA 5E6ZA 3B9NA 1OX4A 5DEZA 5KZ6A 1G94A 1V0LA 4N2YA 3N25A 3OEXA 2AL1A 1FP9A 3LCXA 1UZ1A 1M7PA 3VNJA 1H09A 1Z32X 5A6SA 1HFBA 4KRUA 1F5ZA 2W6RA 4DX3A 3FS2A 1K6WA 1UR4A 2DQXA 4NG3A 1VBRA 3QR1A 4YWIA 4I8DA 4J9JA 4BQ5A 4LQ1A 3QOMA 2BX7A 2GJLA 1S2TA 5LGXA 5D32A 1J12A 4JY8A 4GD0A 1IQ8A 1T0OA 4KGLA 5JH2A 4L6DA 3LUTA 1FWDC 1VFLA 3KRBA 3E0VA 5JXQA 1TIMA 3EYPA 4DUOA 1WKFA 4LUIA 3W7CA 5CG0A 2OO0A 4HMEA 1PIGA 3PZQA 2WC7A 4LJ3A 3UXLA 2VRQA 3CIWA 4F2UA 2OLSA 1R9ZA 2C3ZA 4WK9A 1JDDA 4GQRA 2Y88A 2QCNA 3QTGA 3THDA 4GHRA 3KE0A 3GFZA 4HZMA 1NOWA 5JIWA 2OEKA 3NPXA 3P82A 2BGSA 4HOWA 3R12A 1V0NA 2WSQA 1Z48A 3SQLA 4BZYA 2ZA1A 1TKKA 4GWEA 3VUSA 1F61A 2GOUA 4O1AA 2PWDA 3I7SA 3E5BA 4AG0A 3VIHA 2WCGA 3C86A 1P7TB 4C1LA 2ZUNA 1FFQA 1IV8A 2Y8UA 2ZXBA 2VUNA 3VCNA 4E38A 1MSSA 2NZLA 1QASA 1AA1B 2VELA 1IWPA 3WNNA 1ZY9A 3KW3A 3AHXA 2PCQA 1XPYA 1H4PA 1L8PA 5HDRA 1A0CA 4XZLX 2INEA 1EHAA 4WXZA 1FHDA 1JCYA 5I06A 4H9XA 3KTXA 4MZ8A 2EPLX 5LIWX 3H23A 4ASTA 1K70A 5IFTA 3CGTA 3DCPA 3RGTA 3TYDA 3T0BA 5C7HA 3M9YA 1QOXA 2ISSA 5T9CE 1TV5A 3PUEA 3P2VA 2BV9A 4M6VA 5C6MA 5L9FA 1GYLA 3IUHA 1J9YA 3P0XA 1PX3A 2ISDA 1OFRA 3DKLA 5LGZA 2WWCA