1JQXA

The r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPAYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 113
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqxA01
4N4QA 4EOUA 3C6CA 5E0KA 2QCHA 3T7VA 1SZFA 4TU1A 6ALDA 3LTPA 2QCNA 4AXKA 3C2FA 2E6AA 3QEZA 4L4MA 3UWWA 1VJIA 1G69A 4UTJA 4XUGA 2QDGA 4KKXA 3DFQA 4BI6A 3AO0A 2X1SA 4JN6A 3L0NA 1R47A 4UUIA 3TKFA 3W7IA 7TIMA 1VR6A 2HSAA 5AOUA 1A5BA 2VFDA 4AH7A 4ONVA 1TPB1 4LS2A 3LM7A 3E12A 4E2BA 3TQVA 1EWDA 4UTLA 2GVLA 2W79A 4RX0A 2RKXA 2E5BA 1I4NA 1K3UA 1KBJA 2NXIA 3KX6A 3NQ8A 5HR7A 3QMSA 3GVGA 3W9ZA 4PFMA 3HG2A 1XM3A 4EF8A 1YXDA 1SZGA 3LCWA 2C0AA 1LRTA 2A7RA 4ZZ9A 1JJKA 2HS8A 1VCVA 4O54A 2Y61A 2WNZA 1U5JA 4R34A 4AHQA 3N2XA 3LLFA 4TMBA 3FFSA 1P0KA 2YPIA 4UFJA 1ME7A 1LM1A 1B3OA 1YXYA 3TNOA 1FCQA 1HG3A 4MOZA 1I2RA 3N3MA 2RHGA 3R89A 4AAJA 3P62A 2V2CA 3SFKA 2UV8G 1QOQA 3C4UA 5F2MA 2YFOA 3C3NA 4UFMA 4QISA 3S1VA 1TTPA 3CPRA 2F7FA 4XKYB 2Z1BA 1I2OA 2JKPA 4FNUA 1OG0A 2QDHA 3EX1A 3PBWA 2PCQA 2Q8LA 3M5YA 1IXOA 3TQ0A 2A5HA 1KM4A 3LBCA 2WKJA 1GVOA 5U4NA 2FLIA 4O10A 4NJGA 5HR6A 1LOLA 2X1UA 3PY2A 5AYYA 3W7LA 3B06A 2PURA 4A3UA 2DP3A 4NVTA 3TMLA 3MMTA 5FEPA 2Z2UA 2CLFA 1P4CA 1GVSA 3IEBA 3DFTA 4WY0A 4N6FA 1FBAA 5K2ZA 3N9RA 2CLEA 3L68A 5LGXA 3GKAA 3A21A 1ZY9A 1KW1A 3PUOA 3CM4A 3TFCA 2TYSA 4FEZA 4NUWA 3M1ZA 1PCKA 1MEHA 4O4WA 3QJAA 3D0CA 4BF9A 2YGYA 2NXGA 3AJXA 3KRZA 3BLFA 3W2LA 4IMDA 5KMYA 2YX0A 2JBMA 5DN1A 1VHCA 2R91A 2GOUA 5F2IA 5DCBA 5E93A 3S6DA 2QAPA 5I3HA 3NL5A 2ZZ3A 2ZRYA 1WA3A 3MUXA 5G5IA 2NUWA 4PCFA 3CB8A 2B7QA 1W37A 1H7NA 2D73A 1MSSA 3IIVA 4IXXA 1JCMP 1TPC1 1Q3NA 5E1QA 3Q2DA 4NU7A 4Q4KA 3DAQA 1B4KA 3O63A 3O8AA 1R2SA 4LVGA 1M7OA 4FNRA 3G3MA 4B5NA 1W0MA 5G2WA 4LTSA 4NX5A 1G67A 1MZHA 2Z0IA 5HWNA 3B4UA 2H90A 1ICQA 1UASA 3W84A 1EA0A 4LV4A 4FF7A 4JTUA 1WX0A 1OF6A 2EAWA 1UBSA 4JTJA 1FWRA 1G4TA 4MLJA 1QDSA 2A6NA 3BLEA 5CSSA 1W5PA 2A7PA 3STFA 5D2VA 5HINA 2J9ZA 4MZYA 4ICNA 4JDYA 3A9IA 4O57A 2BZNA 3QW4B 3G24A 3KAOA 4JXCA 3HGSA 1IIHA 3P84A 3TU9A 1VZWA 3W74A 3NQFA 3P5ZA 4FNPA 2ATMA 2OT0A 4S2CA 3W7QA 3IIXA 3IGSA 3DFSA 1YTEA 1KV5A 4O14A 3PR2A 3TW6A 4UR7A 3LXCA 3R5EA 4UFKA 4QSHA 1JCJA 3LTYA 2E6YA 4E2DA 4JR5A 4ZMGA 3LHUA 3NEVA 3BPWA 2NUYA 3RLUA 4O0ZA 4IX0A 2NZLA 3CU2A 3T40A 2F84A 4JTSA 3OVPA 4A22A 4H3DA 4FNSA 2JKAA 1JVNA 2YR1A 4HSOA 4RK8A 2OJPA 1Z41A 3ELFA 5G2HA 5C6MA 3VI2A 1K8YA 3EXSA 5KSWA 1OFQA 3P61A 5K4ZA 1XKYA 3Q58A 1A5SA 3CTLA 4Z1DA 3EWXA 3P8IA 5D2WA 3S1UA 3HF3A 3SJ3A 1QNVA 3OVRA 5AC8A 3PC0A 3OVQA 5D2TA 3GDMA 3LBMA 4MUZA 2B4GA 2G97A 3EWBX 1LDCA 3VE9A 3FLUA 1L9WA 1LCOA 3LHWA 4JD4A 3IGXA 4LC6A 1LOSA 1KA9F 1VQTA 3PAJA 1EUNA 1YDVA 2A21A 2AAMA 4KFPA 1JQVA 3VCRA 2A85A 2DZUA 3H53A 4O13A 4UTWC 4Y9AA 4WUIA 4LC8A 3W7PA 1HUVA 5D32A 3CEPA 4UTUA 1RV8A 1I8JA 2ZZ7A 3DBPA 1N7KA 3HJZA 3PWAA 1HO4A 1F76A 1FDJA 3GK0A 4AB4A 1AW5A 5I3FA 4Y90A 3FKRA 3PF3A 2V5LA 3L2IA 4DF2A 4Q33A 2QCDA 2TPSA 3MP3A 1TJRA 4DEFA 2WNNA 5DELA 3PM6A 3M5ZA 3W85A 4KWWA 3NG3A 4UTKA 1L6YA 3BVJA 1DOSA 5HWMA 1T8XA 1J2WA 2DJLA 5DXYA 1X1OA 1NFBA 1Z42A 1CI1A 1DVJA 3R13A 4IJBA 2QUTA 1ME9A 4N9CA 1TREA 1KFCA 2ZDRA 1GQNA 4O28A 1H61A 3K30A 1KM5A 2KZHA 3WJSA 1GYNA 3MP5A 2Q3OA 3BGJA 5F1VA 1EEPA 5A5WA 3S1WA 1LORA 4ZQNA 1SFJA 4NJJA 3NZRA 2Y63A 2GUUA 4FNTA 2X30A 3E49A 1KM2A 4N2YA 3L0GA 3LGEA 3TK7A 3QH2A 1SO3A 3W7OA 3FA5A 3S5YA 3PB2A 3TJLA 1R46A 3W1AA 3DFNA 2XN0A 1A50A 4C1KA 1TIMA 2G95A 3G0UA 4TR9A 3KVMA 4N9BA 2PC4A 2E1DA 1EPXA 4Z0SA 1GVRA 1VCFA 1EP3A 5IBXC 4YXGA 4IMFA 2RDUA 1TTJA 4I9AA 5F1UA 1MXSA 1T96A 1O4UA 3EKZA 2P0OA 3ABSA 1HTIA 5AB3A 3NR0A 1I2NA 1VYRA 2CLMA 3TA6A 3UWQA 3L0KA 4MZ8A 5K4XA 4PC8A 2WSQA 2PE4A 4AEOA 3DHFA 1VRDA 3UPWA 3LCHA 4IUOA 3T78A 3EX2A 3MI2A 1R2RA 1QCWA 1OFBA 1O94A 1WAUA 2VEIA 3NM1A 3EB2A 1KLYA 3LRKA 4DQWA 4UMBA 1YPIA 3LRMA 5AHEA 1EP2A 4O15A 3RF9A 4HNTA 4X22A 1E51A 4GWEA 4NJIA 3Q37A 5L6UA 2WV8A 4LY8A 3L21A 4K6AA 2QUVA 2YDAA 4W9TA 1FCBA 5KZEA 1W5OA 3W71A 1W5MA 4IQLA 2WSRA 3L9CA 3O06A 4QQ3A 3SZ8A 4N02A 2BXVA 3W83A 5G2IA 3BV4A 1O60A 3G8RA 1PVNA 1TQXA 4TMCA 5AHIA 1C8VA 3W1MA 5BMWA 1WXJA 3DGRA 2W0UA 3NPWA 3EXRA 1YDOA 4UFHA 4Z1CA 2NX9A 3PULA 3TSBA 4D2JA 4UTHA 1M7PA 1RZMA 3WK3A 1H7XA 1LZOA 1TRIA 3WJZA 3WK2A 3PUEA 5AHFA 3B0VC 2V2DA 4FIRA 3GIYA 3LCFA 1LROA 4OHQA 3TCEA 3KOFA 2Y88A 4JYFA 4WX2A 3HG5A 2FPTA 1TV5A 3TSMA 3M43A 3GX9A 1LBFA 5F4WA 3H55A 5TIMA 5FESA 4R33A 3ABQA 1JQXA 4QNEA 2I9EA 4L4LA 4UTTA 4DBDA 3UXAA 4O16A 4QAIA 3SSJA 5TQLA 2GPTA 5FF7A 1QMLA 2ZRVA 2E77A 4ORIA 5FF3A 1F6KA 4N6EA 1JRCA 1FDYA 1PV8A 2ZA2A 1M6JA 2NLIA 1IGSA 2WJZA 2QJHA 4RXGA 2WSYA 3QZEA 5D02A 1GTEA 3IVTA 1KM1A 5AFDA 4WQ6A 3QM3A 3LV6A 4IX2A 2H3BA 4IXHA 4AVFA 2Y7DA 5G1TA 4JTLA 3TH6A 1W3IA 3GR7A 1F5ZA 5FEWA 3NDOA 3G3DA 4O17A 5EPDA 2ISVA 3F4WA 4YCOA 3O6CA 5FEZA 5D03A 5U7SA 3I7SA 2H6RA 2W6RA 5H2ZA 1JR1A 1PHWA 1XBZA 5KINA 1TPVA 5FI8A 1ONRA 1AL7A 3GAYA 3NOEA 1EB3A 4AHPA 3PSWA 4X9SA 2VFIA 3EEGA 3V75A 4NZJA 1ICSA 1QPNA 2YSWA 4PTNA 3NAVA 5ABTA 1YYAA 4EF9A 4K37A 3U2OA 3LCLA 3UY7A 4FO4A 2I1OA 2GVJA 1KM0A 3LXBA 1OVDA 5AHLA 1F6PA 1FWNA 3T44A 3G1FA 3L5LA 1KFKA 1RVGA 1H51A 1W54A 5D09A 1B4EA 4HNNA 3DKLA 3KRSA 3LI1A 4IMCA 1N55A 3N19B 2VFHA 2J88A 2G5WA 3W7KA 4UTIA 3W23A 1QO5A 4TO8A 5LNVA 3W73A 1YDNA 5T26A 1Q6OA 3L5AA 3TSDA 1KFJA 1BEUA 3LRLA 5D30A 2VKZG 1SU5A 4O1AA 1NAL1 4Z1BA 5KZMA 1I45A 4QIUA 3GDRA 3LHVA 1ME8A 3QW3A 3GXPA 3P82A 4YCPA 1X6UA 3EWZA 1D9EA 1OABA 1SSDA 1OX4B 3LV5A 4A29A 1DQWA 2Y7EA 4HHPA 1TPEA 4XBSA 1SPQA 3N14A 2FIQA 5HQEA 2V82A 5DBTA 4CCCA 2FB2A 3VNDA 1OYCA 4JNMA 4H6KA 5A8GA 4FHAA 4LOCA 3PUDA 1XBXA 1XBVA 2BSLA 3OBKA 4FX8A 4NT0A 3NQGA 3B05A 2WNQA 5EBUA 5AC7A 3IRDA 3O05A 3F4NA 1JCXA 1JUEA 3E96A 3NQ7A 3FOKA 4MZ1A 3UWUA 3W75A 4BWLA 4LW7A 4R7JA 3LLDA 2HTMA 5I3GA 3S8HA 3P67A 3DH7A 4HT3A 1SO6A 3C2OA 3C2RA 1ZJIA 1OF8A 2B7NA 1S5WA 3STEA 3STGA 3L5MA 4DPPA 5C54A 3W2NA 4DELA 2FTPA 1VC4A 1FWTA 3W2JA 1SW0A 1BWKA 3CWNA 1AG1O 3W7NA 2ZZ1A 4O19A 4OV4A 1PIIA 1S3HA 2V8ZA 4JX6A 3W6YA 2ZA3A 3O6DA 2RDWA 3RU6A 2ZYFA 4IWWA 4ZQRA 4FB7A 4FNQA 2C6QA 2GQAA 2J27A 2C14A 2V81A 1VS1A 3STCA 5BRBA 3U8GA 2CLIA 3QYQA 1KLZA 5J5RA 4K38A 5AYZA 3NQEA 3C56A 2DZWA 1OJXA 1O5KA 2ZFAA 3NQCA 2G96A 4LUJA 4CQ8A 5EYWA 1VYPX 1T99A 4Y6GA 3W86A 3VE7A 3DI1A 4JY8A 4O0KA 4NNCA 4ALDA 2NWRA 3CLMA 1V5XA 5BMXA 4ZQOA 2OT1A 5LNUA 5DY2A 4IMEA 1GZGA 4BK9A 3BW2A 2RH9A 2ZCGA 2VC6A 1TB3A 3M47A 3HGJA 3ZWTA 8TIMA 3M5XA 4ZL1A 2E68A 4XKYA 5FF4A 2B0MA 1DKWA 1GG1A 3E02A 3ATYA 1FXPA 2NX1A 3I65A 1YTKA 1OK6A 3W7EA 1OX4A 3KVLA 5K9DA 1UUMA 2Y7GA 3SECA 3NQAA 3FJ6A 3F1QA 4NQ1A 3W22A 3W3OA 4Z0JA 1NVMA 1Q6RA 3G1SA 4O8RA 3WFAA 5CPLA 5KTLA 3QQ1A 3ANYA 4POCA 1W5NA 2ZRUA 3CT7A 2C13A 1ZHAA 3P81A 4O12A 4O18A 3W1TA 3LCXA 1K8XA 4P61A 2YYUA 3NQ2A 3NPXA 1W1ZA 2V9DA 2EF9A 3NPUA 3LXAA 3HGRA 3S5NA 4DO6A 4WOZA 4MVAA 2JGQA 1XDMA 4JX4A 2ZZ5A 1GOXA 4PODA 1DV7A 1TV8A 4LRTA 3BARA 1VCGA 3BG5A 1CX9A 2PRMA 1RQBA 4U28A 3IIOA 1PE1A 2VENA 5DBUA 1WQ5A 4LS1A 1PCWA 5IM51 1VH7A 4O1DA 5CPNA 2HMCA 3UPBA 1LYXA 1AMKA 4GUHA 1L6WA 3I7RA 2Q8ZA 1IXNA 3G18A 3VKJA 3OG3A 3CEUA 3ZFHA 3TJXA 1H62A 3DZ1A 3TMQA 3A5FA 3NM3A 3MBDA 1VLIA 2ZRZA 1G4PA 4WXZA 1JUBA 4JIQA 3UXDA 1VYSX 3HPXA 3MWAA 5CZSA 3T4CA 4J9JA 4GUFA 1GTHA 3FS2A 2R94A 1RQEA 2Y7FA 1M5WA 1P5BA 4MJMA 2VOMA 3M0ZA 3GNDA 2VELA 2Q3RA 1DORA 2X1RA 4DF0A 3O16A 3W7GA 4XWUA 4CNOA 3NXFA 2DZTA 5AHNA 4JICA 3IIPA 1YPFA 1JCLA 1SO4A 4AHOA 1ICPA 4P2VA 3EWUA 1SW7A 3TXVA 2Y62A 1GEQA 4O4VA 5C55A 2XFWA 3GAKA 3L65A 4JS3A 5CZ0A 4HIBA 1FWWA 5TBOA 4A2RA 3NNTA 1AL8A 4M6VA 4HNUA 1TCDA 5AC6A 1THFD 4S1FA 1TO3A 3N34A 1ZAJA 4IPJA 2NUXA 2VFFA 2RFGA 3RK8A 2A6LA 3QC3A 1FCVA 3E0IA 4OT7A 1ZALA 4TIMA 3G1HA 4ZQCA 4UMAA 1Q6QA 3P8JA 1H1YA 1H63A 4OE7A 4LWWA 3W7RA 2ZTKA 1KBIA 2BX7A 4DO4A 4NJHA 5C5YA 4MJZA 5CPOA 2NV1A 1B57A 1BKSA 3ATZA 1LLWA 2YW4A 5DCEA 3CIXA 4HPJA 4X3ZA 4MY9A 1V7YA 4YMZA 3EX3A 3GDLA 3C8FA 1W56A 2GVGA 2C18A 3W2KA 5SWUA 2Y85A 1W5QA 1K7EA 4UFIA 3S1XA 3IVSA 2JK2A 4XQ6A 1P1XA 3NZ1A 4ORMA 3C0JA 4JIPA 2CLLA 4RJEA 3W1PA 2FB3A 1ADOA 5LGZA 2CLKA 4N9DA 3TDFA 5KZDA 1LLZA 3HGOA 5AHMA 3QSTA 1G4SA 3OEXA 4WY0F 3B04A 3TV8A 4O53A 3MBFA 4MIMA 2NXHA 3Q94A 2QAFA 3M44A 3T55A 4Y96A 1LBLA 1GWJA 5HWJA 1DBTA 5D2XA 4M6QA 3TC7A 3LHZA 2ZA1A 3OA3A 1L2UA 1TTIA 4MY8A 1XL9A 5LZLA 2E6FA 3W88A 2J24A 4MKNA 3UWZA 3WJXA 3W1QA 2QCFA 1H7RA 3M41A 4ADTA 4DF1A 3G1XA 4AWUA 2Z6IA 1W31A 2GQ8A 5LHEA 3I6RA 1K7FA 3HO8A 3FYPA 3W1UA 4HKPA 1WYIA 2J9XA 4RXFA 1K7XA 4LUIA 1EX5A 2FPYA 3BGGA 4NXKA 1TSIA 1C29A 4K7YA 1OFEA 2A1YA 5HULA 4CNPA 3HIJA 2AQWA 4YWIA 2JGYA 2H8XA 1EIXA 3W76A 2QEZA 3C52A 2CZDA 1GT8A 3ABRA 1K02A 2X16A 3MHUA 2ISSA 1OX6A 3B0PA 2QF7A 3SR7A 1NEYA 5D04C 3A5VA 1MEIA 3U6WA 4N4PA 1ZNNA 4HSNA 3O15A 4HN4A 1KM3A 1TPDA 4X2RA 3DXIA 3R2GA 3G1VA 1WOBA 1IIGA 3F03K 2OMAA 4EVZA 2CZ5A 1F73A 3QQ0A 5J5DA 2O7QA 3G0SA 1IF2A 2H8ZA 1KM6A 3HMJG 3RLVA 1SQ7A 2FFCA 4FXRA 4KWVA 4O11A 4NX0A 2H3DA 1TQJA 1CW2A 1ZAIA 1OFDA 4K8HA 1XUUA 2WQPA 3PS7A 1R2TA 4DO5A 4ADUA 4JDBA 3C2VA 1LP6A 3ABOA 3UQNA 1JCYA 5K7JA 1O5XA 3JS3A 3BK0A 4UR8A 3NQ6A 1OYBA 1FQ0A 2GQ9A 3A22A 4XBKA 4O1CA 3O1NA 3S42A 4WY0B 3NL6A 3KXQA 3B0UX 4RV8A 4LV9A 1Q45A 3MYPA 3HG4A 4WZHA 1D3HA 1PHQA 4NZFA 3TE9A 4QM1A 3MO7A 4LVFA 3ZR4A 4QITA 2YXGA 4K8EA 1WV2A 2C16A 2YZRA 1FUYA 2CZFA 3W1NA 2TSYA 4M7SA 4I7WA 3LHYA 2Y89A 3M16A 5HUOA 3QMRA 3BG3A 1I2QA 1R30A 2P1FA 4KFNA 4C1LA 2ZRXA 4DBEA 1LRQA 3WJYA 3LDVA 4RLIA 5GVJA 4UFLA 2VFGA 4PEKA 4TX9A 3LI0A 3KFTA 3C2EA 4OV9A 4M5PA 4JTHA 4M6PA 3RFAA 5BOOA 4AWTA 1G7UA 3DENA 4Q32A 4XTIA 1OK4A 3EWYA 3LTSA 1UCWA 4O1BA 2I14A 3SW6A 3C61A 3G8EA 4IGHA 1TYGA 2B7PA 3GDKA 1KTCA 1OX5A 3W7DA 1Y0EA 3HQ1A 3GYEA 4LU0A 2HS6A 1G6CA 2FDSA 1YXCA 1QWGA 1OFPA 4FX6M 2R14A 3V1PA 1VHNA 3BW4A 1W8SA 2FJKA 4AWSA 2ABAA 1ZAHA 1DJNA 3O6YX 1H5YA 3GXNA 2ZZ2A 3UYCA 1S5TA 3GR8A 5KITA 4E0CA 5C2XA 2NX3A 5LNRA 2CFFA 3M5VA 1RD5A 6TIMA 1N8FA 4UTTC 3CWOX 3W7CA 2DZVA 4WOQA 4BI7A 2C3ZA 2Y6ZA 3R8RA 4UMCA 2V30A 3MYOA 5G1YA 1VLWA 2DZXA 3CHVA 5LHFA 2DJXA 1GYLA 1O95A 2YFNA 3CIWA 1QO2A 1XI3A 3UZ5A 4GBUA 2ZZ6A 1QPRA 3BG9A 3SI9A 5EL1A 3HG3A 3W2UA 1GJPA 4JYDA 4K7VA 1H1ZA 1UJPA 2EKCA 1SFLA 1DJQA 1U83A 3FYOA 4GFSA 3QF0A 3PG8A 4FXSA 3PBYA 1S5VA 1WBHA 5D33A 4RCXA 3GZ3A 3UWYA 2XN2A 1FY6A 1WDWA 1SW3A 3EX6A 4RR4A 2TMDA 1H7PA 1SR9A 3LCGA 3PG9A 4JTTA 2O7SA 3TAOA 1GVQA 1MEWA 3OIXA 4RKAA 4JTKA 3S9YA 5MHBA 1QOPA 3MP4A 2IQTA 5FF2A 3BW3A 3LX9A 1A53A 4CNNA 5HMSA 3NO5A 4K36A 5K3VA 2TRSA 4FX7A 3H54A 3A24A 3NGJA 3WJWA 4DPQA 1VPXA 1VGAA 3L67A 3OHIA 3GXTA 3P60A 3P80A 1HFBA 2E6DA 4XTDA 4G1KA 4UTWA 3TW7A 5FEXA 2AGKA 4YL2A 3GNNA 2ZBTA 4LRSA 4LVBA 3HOJA 1UUOA 3QMTA 2PRHA 1FXQA 1IXQA 5LNWA 3IV3A 3TIMA 5BNKA 5LNSA 1F7BA 3TQKA 4GRSA 1J4EA 1K03A 3HPSA 3HPZA 3S5ZA 3TX9A 1XC4A 3W07A 1J5TA 1NF7A 3W1RA 3G1YA 4OQVA 4Z1AA 2QCMA 1QPQA 4JX5A 1Z48A 2QCDB 4GUGA 3S0CA 1I2PA 3TAKA 2XN1A 4JYEA 2C15A 4WXYA 3UD6A 3S5OA 3M9YA 1L6SA 3EWWA 4NNAA 1X7FA 2QJGA 3BLIA 3E9AA 3B8DA 4NJKA 3FKKA 2DZSA 5CSRA 5DXXA 4HNVA 1W3NA 4JTIA 1XFBA 4WJEA 4UTMA 3TFXA 1K8ZA 4JTGA 4ZQMA 1DHPA 1TV7A 4GNJA 5HJLA 5EA9A 1D3GA 3NYZA 1FDZA 4MFEA 1TPH1 3P74A 1W3TA 3CC1A 3PBUA 3L66A 3UY8A 3DU0A 2LLEA 1DL3A 3PVFA 3ZS4A 4RZ4A 4Z08A 1TMHA 1ZFJA 5D38A 1GG0A 2VFEA 4CCEA 3LERA 1H60A 2QCLA 3DKJA 3LHTA 2E5DA 2WPBA 1RPXA 3PBVA 5CZTA 1SO5A 5IBXA 1WOAA 2NV2A 4NNBA 2Z6JA 3SY5A 2EGZA 1OHLA 1TJPA 4Y8FA 4MY1A 4BWLC 1T0OA 4UXDA 4RZ5A 1EP1A 4ZVJA 3G1AA 4CQAA 3P5YA 1PS9A 2FPVA 4JTFA 5F2LA 2BWGA 3KHJA 1TPUA 3UNDA 1OFAA 3DI0A 2CLHA 1QAPA 4GC4A 2B7OA 1SUXA 1QFEA 3RMJA 2QCCA 4HPXA 4ML9A 3N73A 2CZEA 4M7TA 1TPFA 4GJ1A 3MI3A 2QCGA 4M19A 4EIVA 5AN7A 3G1DA 4UIOA 2BLEA 4NXSA 1H7OA 1JULA 3R12A 3W87A 3DHDA 5CG7A 3LOTA 3N9SA 3FJLA 2QJIA 4CQ9A 4LVDA 4UNKA 1HL2A 2C19A 3W1XA 1BWLA 3KVKA 1C9DA 3ZWSA 3W7MA 4QNWA 5G4EA 1KFEA 5D2YA 2VEPA 4A21A 4PL2A 4CCDA 1XXXA 1F05A 3TXZA 3TR2A 1NF0A 2A0NA 2CU0A 3QPYA 5LKYA 3MJYA 2GJNA 3SGZA 1XBYA 4AF0B 2CW6A 4IMGA 3B03A 1JCNA 4GXMA 1FX6A 2RDTA 3W7JA 1YADA 1H7WA 4I7UA 3HBLA 1ALDA 1H50A 4PH6A 1G4EA 3TC6A 5F2GA 1PL9A 1QR7A 2BTMA 1WBJA 2ZTJA 3IGUA 3JR2A 4DXVA 5EY5A 1LRNA 5I3KA 4LNYA 5L9FA 3IIZA 3KRUA 3SIZA 1FCUA 1X1ZA 3NL2A 4MLRA 2WO5A 2OX1A 1RR2A 1UB3A 4JY9A 4EWND 2YYTA 1A5CA 4I7VA 2EPHA 4R53A 4YLWA 3MI6A 3TROA 2ISWA 1ML1A 4UC5A 3W2MA 2A4AA 2DU2A 2QCEA 3NQMA 3EKLA 5DCDA 1KFBA 3A23A 4S2BA 2X1TA 1LBMA 2J6XA 4PA8A 5F4SA 5D05A 1OFOA 1AW1A 4IOTA 1KFLA 2E09A 3WK0A 3TUUA 2FQIA 2ZRWA 2YCEA 4CLMA 2DORA 3W72A 5AYXA 2E5CA 3EXTA 3MW7A 3QRHA 5EMUA 2A7NA 2CWNA 3YPIA 1MO0A 3NL3A 1KV8A 1JUKA 2J9YA 4K39A 3CQ0A 5EKYA 3FEMA 3KVJA 2P10A 1KTBA 3W7HA 3MHGA 3PSVA 1P0NA 5CZJA 2EHHA 5I3JA 1LTDA 4LVAA 5CGQA 1TRDA 4QJ1A 2V5BA 1YLVA 3PB0A 4GUIA 4H4IA 4JTEA 1ZENA 5I3IA 3N2MA 3FIGA 4UNLA 1HO1A 2PRLA 4OBTA 1F2JA 3JRKA 3I68A 5DLCA 4OU1A 3RNDA 2VEKA 2C1HA 3W70A 3P7YA 3SGUA 2QR6A 1YTDA 3NQDA 4BFAA 1XDLA 3NQVA 3THAA 2Y70A 4ZQPA 2ZQ0A 4OWGA 3WK1A 4MYAA 2CLOA 1GPWA 4PL1A 3LB0A 4GUJA 5FF0A 2ATSA 4A2SA 3MHFA 4E38A 1DQXA 5BW6A 3DFOA 3HB9A 1SZNA 3GB6A 2X2GA 2OCZA 4ADSA 4BI5A 4JGDA 1OFRA 3I7QA 3NVTA 1B9BA 1G7VA 1BTMA 1A5AA 4O50A 5HNRA 4AF0A 4RZ6A 1QPOA 1SSGA 1X8FA 1SZEA 1TTQA 2JKEA 4FIQA 1AW2A 4AMAA 1ZCOA 5H91A 4MYXA 1XCFA 3USBA 5D37A 1AK5A 1KTNA 2V0TA 4UCGA 2VXNA 5K9XA 1OYAA 3LCIA 5DY3A 4MPQA 2QUUA 4XZ9A 5LSMA 3QPZA 3G22A 4WD0A 1Q6LA 1NSJA 2V2HA 4JEQA 3THQA 3M7WA 2ABBA 2NWSA 1XUZA 2OZ0A 2R8WA 4LS0A 3QFEA 2YW3A 3M6YA 3GDTA 2WOQA 2A2IA 4GE8A 4IPIA 4OGZA 3BO9A 4BR1A 5G4WA 3VFLA 1JRBA 3DFPA 1GVFA 5F4XA 2ZZ4A 4O52A 3O07A 2QKFA 5K9CA 3EX4A 2VEMA 4N9EA 1EWEA 4MFDA 1F74A 5CKSA 3QSRA 1RQHA 3W1LA 1LOQA 3INPA 2ALDA 1TPWA 3GKFA 2DZPA 3GLCA 3NPVA 4LT9A 4U4MA 3UZJA 3NA8A 3UWVA 3G0XA 3IVUA 1IXPA 5HUPA 1Z44A 4KFOA 2GJLA 5CPMA 1FWSA 1EUAA
chains in the Genus database with same CATH superfamily
2QLYA 4ZTYA 4ZE5A 4JFWA 1A3XA 2O55A 6ALDA 3U2CA 3P2VA 1G69A 2CHNA 3F5LA 4IP5A 4OOUA 3PNUA 4GVFA 4JN6A 4F0LA 3H2MA 2HSAA 5AOUA 1IT8A 4AH7A 1TPB1 4PSPA 3LM7A 3ZVHA 3E12A 3SRKA 4DZ5A 1EWDA 4UTLA 1KXTA 4RX0A 4H8VA 3KRBA 2CBUA 2NXIA 3CK5A 2CKSA 1UP0A 1WKDA 3THUA 2PBGA 2ZADA 3GG0A 4EF8A 1SZGA 4MB3A 3CV1A 5CPQA 1OD0A 1U5JA 4Z2IA 3WLOA 3N2XA 2HZGA 1XIDA 1P0KA 4Q8TA 4L4PA 1ME7A 3UVIA 1LM1A 4YHGA 1YXYA 1FCQA 1HG3A 3SUTA 2X09A 3WMLA 1K8CA 3SFKA 3SQLA 2YFOA 4LH8A 4UFMA 4I6VA 3PFRA 2YXXA 1BGGA 1I2OA 2JKPA 4FNUA 3RG6A 2QDHA 3CMGA 3PBWA 1IEQA 1UH3A 3CHFA 1ZRQA 2A5HA 1KM4A 1FWFC 1KXHA 1PXGA 1KC7A 3DG3A 5GQBA 1HKVA 2PURA 1UC4A 2DP3A 3IARA 2GGJA 3GXMA 3VIGA 9CGTA 2PBOA 5K2ZA 3UA4A 2E0PA 3N9RA 4AD1A 1ZGDA 4F2BA 3HMCA 1DYSA 3A21A 1ZY9A 1KW1A 4Q3MA 3PUOA 4FEZA 2HK0A 2A3EA 2OQYA 1PCKA 3GNXA 3D0CA 2WM1A 1C7TA 1JPKA 3K4DA 1V79A 3COTA 2JBMA 2PDFA 2WMHA 3BCDA 1VHCA 3WLIA 1M3UA 5DCBA 1L6GA 5E93A 3RIKA 3ISIX 3T0AA 2INFA 3BZGA 2ZZ3A 1WA3A 3MUXA 2PLJA 3UG8A 3BURA 1UZHA 4INFA 3K4AA 3WNLA 4ATDA 5EMMA 1TPC1 1Q3NA 3KCLA 4DRSA 3Q2DA 3PJUA 4Q4KA 4WGHA 2PU1A 4KCUA 4GYPA 3DAQA 4W7WA 3RLHA 4LVGA 3O8AA 1M7OA 4FNRA 1S2WA 1A3HA 4L65A 3DOPA 4HNLA 1MZHA 3JUGA 1Y5VA 4KEUA 2H90A 1UASA 3OHMB 3S2MA 2A3AA 1GOOA 2VEFA 4HD5A 3WBXA 1OT2A 5JBDA 1QDSA 2BHZA 2ZUWA 2YA0A 3OG2A 4DJDA 3CZLA 4JKKA 3STFA 4EKJA 2J9ZA 1ZLPA 3U2ZA 2BZNA 4JXCA 2HVOA 3HGSA 1S5MA 3HFYA 2ATMA 3VNYA 3IIXA 2PLCA 3DFSA 1GNXA 2PD9A 3V18A 4O14A 3PR2A 2YA1A 3A9BA 4M3PA 1JCJA 1A0EA 3OLDA 4AEFA 3LTYA 2B31A 3O7UA 1UH2A 2OELA 3AXHA 3EDEA 4D6GA 4Y7EA 3BPWA 4O0ZA 4IX0A 4JL2A 5DRIA 1RH9A 5E9XA 4OJYA 3KOWA 2F6KA 4R88A 3Q4DA 2YR1A 5G2HA 4D72A 1K8YA 5KSWA 1OFQA 2IPFA 3Q58A 1PKLA 2D24A 4Z1DA 4AZHA 3EWXA 4C6BA 1IEIA 4CU8A 1UZ4A 3OVRA 4GG9A 1E1CB 3GDMA 4NG3A 1L9WA 3LHWA 1V0LA 1WZAA 3DIPA 4UCFA 1K9TA 1VQTA 1EUNA 2PDXA 4Q7NA 2A21A 2AAMA 3KOYA 1JQVA 1JD9A 1RLCL 4O13A 4DNHA 1XPGA 1PWLA 3OTRA 1R85A 1RK6A 2YLAA 1EYWA 2OO0A 4UTUA 3SCOA 3PWAA 4U2YA 3BSGA 3O2LA 1JDEA 3LZ5A 1AW5A 4XZLX 4A8NA 1XH2A 3BC9A 4I8DA 1P48A 3QQWA 2DQWA 2QCDA 5AY7A 4C6LA 1G0CA 4HZMA 4PR4A 1REQB 3W85A 3M5ZA 3AHTA 5C71A 1L6YA 1DOSA 1UWRA 5HWMA 4PMUA 1CXKA 1XIFA 1ZQ5A 5HOSA 1TREA 1KFCA 3VAVA 1Q4WA 1KM5A 1XH0A 4X61A 4D9PA 2I56A 2YLLA 3L4ZA 1XIMA 4ZQNA 1SFJA 3GSMA 5C9WA 3M0YA 3LGEA 4LANA 3BTNA 1SO3A 4ICCX 4EP8C 3S5YA 4HPNA 3TJLA 1UUQA 3W1AA 3KCOA 3DG7A 1FWCC 4XX6A 3KVMA 5IBXC 3V0UA 4RE3A 1T96A 4B5XA 3EKZA 3GVQA 3ABSA 1VF8A 3NR0A 5AB3A 1VYRA 3H2NA 2CLMA 4MZ8A 1IEXA 2PMQA 3T9PA 5A8PA 4M24A 3T78A 3SQSA 4F3HA 3VD9A 1R2RA 3CQIA 5ENLA 5GNYA 1WAUA 3SIMA 3UESA 5G4HC 1KLYA 2C7FA 3LD5A 4ZB2A 3SCVA 3Q37A 3L7RA 5KETA 1DE5A 3KWXA 1QASA 5ABEA 3P6LA 4DYKA 1UWTA 3WLNA 4W9TA 2XISA 3MU7A 4LUYA 1W5MA 3L9CA 2I5QA 4N02A 2BXVA 2HJPA 3G8RA 5A6AA 1H41A 1TZ9A 2AMGA 1TQXA 2PTZA 1REQA 3GVVA 5BMWA 4A4AA 6XIMA 2GQ3A 2W0UA 2D22A 1PTDA 3QLLA 3CH0A 4Z1CA 3PULA 1RZMA 4FXJA 2GOKA 2XDFA 2WJEA 1LZOA 1TRIA 3IUIA 4YTSA 3GIYA 1IHIA 2YZ5A 1XHGA 4OHQA 3PAOA 1HGYA 1D8CA 2GSHA 4JYFA 4WX2A 8A3HA 1ZBCA 1TV5A 3M43A 3HM7A 1L6FA 2WMKA 2PDWA 3H55A 5FESA 1NU5A 1H11A 4QNEA 2I9EA 4DBDA 3KTXA 4IJCA 4O16A 4QAIA 1XYMA 3GG1A 3WQWA 1QMLA 4ORIA 1EFZA 4KIEA 4DXKA 1JRCA 2OEJA 3FDKA 4L56A 3AWNA 2NLIA 1IGSA 3SY1A 4L6OA 1AH3A 4RXGA 1ZJAA 4B91A 2EEXA 3MVTA 3PPGA 4QLKA 4NHVA 2Q8XA 4HN8A 5LXEA 4IX2A 3K13A 3BOFA 4H41A 3FW6A 1W9VA 1Y65A 2WZTA 5G1TA 4A6GA 3EA1A 1HQTA 4MWAE 1RPKA 4G1NA 4DO7A 3WD0A 3CB3A 4YCOA 3O6CA 3ENLA 4C6JA 5U7SA 1XSJA 2DUZA 1TPVA 5FI8A 3VOHA 3GAYA 3NOEA 4U3AA 1E3XA 4A3RA 4AHPA 3VIFA 1GVEA 1Z3NA 3SJNA 3EEGA 3V75A 3O9NA 5HQMA 4PTNA 3NAVA 5ABTA 4U31A 5I7GA 3LCLA 3WEOA 2I1OA 1KM0A 2G3MA 1JI1A 2IKJA 5AC4A 1F6PA 4GKLA 4DWSC 1M41A 3PHAA 2V69A 2VFHA 5BYWA 5GNXA 2XIOA 3VIOA 2G5WA 3W53A 4UTIA 1OGGA 5LNVA 5A2CA 3SCRA 1YDNA 1WUFA 4JFTA 3LRLA 1IR2A 3VC6A 5D30A 1US2A 4U2ZA 1NAL1 2GWNA 1I45A 3GDRA 5HMEA 4J7RA 1JIBA 3GHUA 3QW3A 4YCPA 3B8TA 4OTKA 1SSDA 4FLOA 1VFTA 2Y7EA 1TPEA 1JZ8A 1SPQA 4ZOEA 2VO5A 2P5NA 4ERAA 1BRLB 4MNJA 4RPQA 3WIJA 4HPHA 1AVAA 3PUDA 3OBKA 2BSLA 1V3MA 2W66A 3GD6A 1Q66A 4HMCA 5EBUA 3IRDA 3WQFA 2MUCA 3O05A 3ARSA 1CWYA 1JUEA 1QI2A 5CGTA 5A95A 3UWUA 3VDBA 1V6WA 1V02E 4C6PA 4R7JA 2CZVA 4X9YA 2HTMA 3P67A 1H3GA 4HT3A 3GU2A 2FH8A 3AIVA 4J35A 1O6IA 3C2RA 3MDWA 4I9TA 1CB7B 3AMGA 4QJ5B 3FY1A 1EKOA 4ERGA 1VC4A 1SW0A 4F0KA 1BVZA 1AG1O 2ZZ1A 4BF7A 4WKFA 3VNZA 4MSSA 6A3HA 2J7HA 1VFFA 2ZYFA 4IL2A 4IWWA 3URBA 4FB7A 3AICA 4XAFA 1LWJA 1E0XA 1MNSA 4A3QA 3STCA 3U8GA 4JZ5A 3KP1A 3CPGA 4K38A 5AYZA 2J13A 2DZWA 4BJHA 2ZKMX 5EYWA 3QZ6A 4O0QA 4GFIA 2WPGA 2EJ1A 4JY8A 4ALDA 1J11A 1ZTVA 2OT1A 3QXBA 4G5DA 2X41A 4HOXA 1TWWA 1GZGA 1C7SA 2ZCGA 3UCQA 1TB3A 2OB3A 4E2VA 3C8NA 3HGJA 1EC8A 2E68A 1IWPA 3OLEA 4ROPA 1BSLA 3GR4A 1OK6A 4IGSA 1VENA 3SECA 2WVSA 4NQ1A 3NUKA 4HHHA 4MNLA 4IPNB 1Q6RA 3WFAA 1CYGA 3DGBA 1ECEA 1NOFA 3WD1A 1JAKA 1IV8A 2ZRUA 1Y7VA 3CHCA 4O18A 3W1TA 4NI8A 1KRAC 3S5NA 4WOZA 4E4FA 1DIDA 4GOAA 2JGQA 5F7UA 5GNZA 2OWCA 4LRTA 1KGXA 1LF1A 2NLYA 3BG5A 1CX9A 2PRMA 1RQBA 5HXMA 4U28A 1PE1A 3NIYA 5DBUA 1WQ5A 1PCWA 1ZUAX 2OTDA 4O1DA 1EC7A 3C3UA 2AKMA 2HMCA 4CVUA 4IIBA 4GUHA 4IG2B 5M3WA 3I7RA 3ZT5A 3CYJA 5AYBA 3LENA 3ZFHA 1XLLA 4G56A 3A5FA 2VTFA 4QX4A 1VLIA 4BF5A 1G4PA 3BJTA 3VDHA 4IIDA 2R94A 3HQPA 2VOMA 4GYPC 1Q6CA 3GNDA 1DORA 4LAOA 3WBEA 3CUZA 2X1RA 2DZTA 1EZWA 2ZWZA 4HA3A 3IIPA 4B4FA 3APGA 3H23A 2O9OA 1YPFA 2ZICA 4JCLA 4AHOA 5CSYA 1X6NA 2XH7A 3E2VA 4P2VA 2CEQA 4CKQA 4XAYA 2XIMA 4YNGA 3ABXA 3TXVA 2Y62A 1XLKA 2WZHA 4UQDA 2XFWA 3L65A 1DE6A 4DJDC 4HIBA 3WH5A 1FWEC 3A3HA 1DIEA 3M0HA 4HZ8A 1XG3A 4XIAA 1TCDA 1FHLA 4S1FA 3MT1A 4IIFA 4JL1A 3RK8A 4C90A 2ZXAA 4XZWA 3VDCA 3E0IA 3N11A 3UF9A 4TIMA 3G1HA 1Q65A 4ZQCA 1H1YA 1H63A 3B9EA 4OE7A 4EXQA 5E0CA 1A4MA 5MKGB 4LGXA 5CPOA 1BKSA 3ATZA 2WZMA 4F0RA 4HPJA 5TF0A 1R0MA 3BAJA 2W27A 2VUNA 3VMNA 3C8FA 1W56A 4IIEA 2A79A 1F9CA 5SWUA 5BWAA 1TV2A 1W5QA 4KGJA 1JZ4A 2D69A 3IVSA 1WCGA 4XQ6A 2QS8A 1P1XA 3H70A 3U4AA 1KCLA 1UMYA 4HZ6A 4I5UA 4UQEA 1WPCA 4JNYA 4R85A 2VX7A 3EB4A 5AHMA 1GUVA 3W6MA 1JAEA 4C5YA 3MBFA 3MQTA 4PMOA 3MSRA 3Q94A 2UY4A 4GABA 2CNCA 5I02A 3SCQA 5D2XA 1D3CA 3VFCA 1DP0A 3C2YA 3RO8A 3LHZA 4HNOA 3MPGA 1TWSA 1TTIA 3H2EA 2X8RA 2OR2A 2E6FA 3BAIA 2TAAA 3QYSA 4MKNA 3WJXA 3W1QA 1H7RA 3M41A 4BQ2A 4EK7A 1R3SA 2GQ8A 1CGXA 3FYPA 2HK1A 3IJQA 4GVHA 2WHMA 4NXKA 4Q6XA 1OFEA 2A1YA 2AQWA 4AZCB 2ZWYA 4YWIA 2HVMA 3W76A 3HJEA 1P6CA 4H7ZA 4XD5A 1J12A 1OX6A 4GX8A 3B0PA 1E3ZA 2QF7A 5CC3A 3SR7A 3SCUA 4RPPA 2PDQA 2Q09A 3U6WA 1V6TA 2YCLB 4U3CA 1J0HA 1KM3A 4X2RA 2Y8KA 3DXIA 3G1VA 1RALA 3U7BA 1W1IE 3DCPA 1IIGA 1S46A 2UY5A 1WDPA 2OMAA 3F03K 4EVZA 2XM2A 4NZ4A 2O7QA 1J6PA 3BICA 4PMYA 3G0SA 3MMWA 2E1WA 3EA2A 2H8ZA 3EOEA 1SQ7A 2ANUA 2WK2A 4P8UA 2YBVA 4LAKA 4KS0A 1RY0A 2XH0A 4K8HA 1XUUA 2XZ9A 1S38A 3EOUA 4DAIA 4JDBA 1KGUA 1LP6A 3C2VA 5AKQA 1QJWA 2DEPA 1OYBA 4JKLA 4XBKA 3R8GA 3U7VA 3S42A 4FR6A 2VP8A 4DM1A 3MYPA 3OB8A 3HG4A 4HU0A 1UP2A 1XDJA 1UG6A 3E0LA 3TE9A 2PDIA 1EJUC 3MO7A 3NSNA 2YXGA 2YZRA 2NSOA 1BYCA 1BYBA 1X97A 3LHYA 2UY2A 3J7HA 4PCTA 3NZPA 1U22A 1MYRA 5CEWA 4DBEA 3N4EA 3MSDA 3WJYA 1EPVA 1V0MA 4YTQA 3H4WA 2VFGA 2ZOXA 4OV9A 1TWDA 2DH3A 1ZZMA 4AWTA 2YA2A 3DENA 4Q32A 2WYSA 4XTIA 2PD5A 3SQMA 4O1BA 4H7VA 4TVUA 3IAQA 4OUIA 4D6EA 1YQ2A 1H5VA 4E4PA 4Q8VA 1KTCA 3W7DA 1NTHA 1ITCA 3KS5A 2NQLA 4W86A 4G7FA 1QU4A 4TV5A 3CBWA 4NZ3A 1OFPA 4L1WA 3S9IA 4J3ZA 2R14A 2DW7A 3V1PA 1VHNA 4KCTA 2ABAA 3PZGA 1J0IA 3AQUA 2QGYA 1LQ2A 2RJGA 4QDMA 2NX3A 2XH2A 6TIMA 1N8FA 4KWOA 3DECA 3WD3A 4HMNA 3ZT7A 2E9BA 2DZXA 3WQVA 4KPLA 4NZ5A 4FI4A 4DUVA 4LCRA 4PBFA 2FHCA 2QV5A 2CIPA 3TYBA 4G7EB 3KUMA 1RP9A 2PTXA 3FSUA 4L9YA 1R3YA 2F8QA 3UZ5A 1V77A 1X39A 3EAUA 4XZBA 3HG3A 4JYDA 1DJQA 1U83A 4M1BA 3PBYA 4IQJA 2HEJA 5D33A 4C1NA 3UW6A 3GZ3A 2ZE0A 4M0XA 3WN6A 4AIUA 2XN2A 3WF1A 1WDWA 1BHGA 3N1AA 1SW3A 4RR4A 3LCGA 2QULA 1IT0A 4H6RA 1V0NA 2WKLA 3ARVA 4JTKA 3S9YA 4B5VA 3BW3A 2YBUA 3LX9A 2NQJA 2Y4SA 1K6AA 4U33A 1XINA 4CD4A 3WJWA 1VPXA 3PPCA 4H8NA 2VR4A 4NASA 5IFTA 1W9BM 3UJRA 3R8HA 4AC7C 3P80A 4G1KA 4UTWA 3TW7A 3VNMA 2W9MA 3IUDA 4YL2A 2OQHA 2ZBTA 3ECQA 1RA5A 3FA4A 1FXQA 2VDHA 1J4EA 1K03A 4DHGA 3HPZA 3RX3A 3W38A 1J5TA 4MTVA 4Z1AA 1Z48A 1K4GA 1I2PA 3VIIA 1NFGA 1BQGA 2XN1A 3UD6A 4TVDA 4B9ZA 1L6SA 3EWWA 4NNAA 5XIMA 1ADSA 3E9AA 1UKPA 5CSRA 1B0IA 2Z2AA 3B97A 1F8IA 4WJEA 2KX9A 3TFXA 3W0KA 5GJMA 1DHPA 1U1UA 1K9EA 2WCGA 3S4TA 3GRIA 3P74A 3VM7A 1W3TA 5HANA 4C6IA 5E9AA 3GM8A 2WMIB 2X0HA 5D38A 1IEWA 2GWGA 3RDKA 2GSEA 1H60A 2QCLA 4KBXA 2YCIX 3N2CA 3V1HA 3P0XA 1UPPA 1J96A 3SY5A 4Y8FA 4D8AA 4RZ5A 1EP1A 1UJQA 4ZVJA 4MB4A 4Q4MA 1UIOA 2FPVA 3P5YA 3BMWA 1OFAA 2CLHA 1MDRA 3L4UA 1QAPA 3WH9A 3VMPA 1LL4A 3KDOA 4GD0A 4C7FA 3A4XA 1TVLA 1DWHM 3THCA 3VIMA 3N73A 2XIJA 3DYMA 5IDZA 3GC2A 1A5OC 1H2JA 1ZP4A 4M19A 4TX8A 3G1DA 4UIOA 2BLEA 1KCKA 2J78A 1SR0A 3W87A 5HPCA 3DHDA 1O68A 3QV9A 1OZMA 1ADDA 1EEXA 3ITTA 4LVDA 2C19A 3T42A 3W1XA 1BWLA 3BJSA 1EO7A 2ACSA 3EGJA 4QNWA 4LAZA 1QHPA 1YNPA 1J18A 5D2YA 3DFYA 1TG7A 1XLAA 3MCOA 4A21A 3LQLA 4MUPA 2VURA 1OQFA 3QPYA 5LKYA 5M2FX 3SGZA 2XGIA 2EO7A 3FX4A 5JIWA 3B03A 5GJNA 4AC1X 1FX6A 3I3BA 1ZP3A 1JF6A 4GX9A 2IKGA 3UZZA 1JZ5A 1R9YA 1R3RA 2G41A 1WBJA 1VIWA 1KFWA 5EY5A 5B7YA 1EA9C 1TV3A 1FCUA 4AG0A 2ZX5A 3MKKA 4IFKB 1POKA 4LCQA 3NL2A 5H6HA 1RAKA 1RR2A 2VGGA 3U3HA 3VOCA 3GXDA 3CPUA 3RPTA 2ISWA 2A4AA 2DU2A 1QI4A 2WMIA 2YB4A 1XF0A 4DVOA 4DYJA 4AXNA 1KXVA 3AWOA 1A5KC 1X98A 1KFLA 1MDLA 3AIWA 2GGGA 2QZRA 3WLJA 3W72A 2JEPA 3B9AA 4PCSA 1PX3A 4ZENA 1MW1A 3QRHA 2CWNA 4NAFA 4PB5A 4IFOA 1MO0A 1P7TB 4WJXA 4A35A 2CHRA 4DJEA 5EKYA 3FEMA 2P10A 1EXBA 4MDOA 3UGVA 3W7HA 1TELA 1T41A 5CZJA 5HNNA 1UKQA 1XYZA 3H7UA 3FK4A 1LTDA 2QDDA 1MW2A 4QJ1A 1YLVA 4GUIA 4H4IA 1FHVA 2FGBA 4UNLA 3LPFA 2Y5SA 1AD1A 4FLRA 2PRLA 1EJ7L 3I68A 3QLDA 3DYPA 4OU1A 2C1HA 2QR6A 5BRPA 4BFAA 1R9ZA 4KCVA 3UWEA 3NQVA 5A6JA 3THAA 3S2LA 3WK1A 4MYAA 2PP3A 4GUJA 1RHCA 5C9ZA 2IMRA 4E8CA 4A2SA 1W9UA 3IAPA 4K8GA 1SZNA 4IISA 1GZJA 2X2GA 4JGDA 1JPMA 4B5WA 3R6IA 3RLGA 4EPEC 2F9RA 3NVTA 3UR5A 1BF6A 4O50A 3TTOA 1DHKA 2P3EA 3VZXA 3IV8A 1UKSA 3MSYA 4JFVA 2QIWA 3NYDA 1N2VA 3UR2A 1AW2A 3VD7A 3K1GA 3NTYA 2VQTA 1E55A 5B7ZA 2VXNA 4AFYA 2GDQA 1E5NA 5FSDC 2CC0A 4LUSB 1UC5A 2V2HA 2BXYA 1AQFA 3THQA 3M7WA 3S6OA 1XUZA 3FJNA 4NZ1A 4LS0A 4GPNA 2YW3A 3M6YA 4A3HA 3MMDA 4H9UA 2A2IA 4UZUA 3WFLA 3PNZA 4IPIA 3WZ0E 1PJ9A 1CENA 1UD6A 2CHOA 2PDNA 8RUCA 3LUTA 2R82A 3O07A 1N8WA 4W93A 3G2GA 4US5D 5E5CA 1EWEA 3L4WA 3QSRA 1C93A 4W8LA 3INPA 3GLCA 4LT9A 3UZJA 4U4MA 2FGLA 2Z7GA 1FHUA 4QCFA 1IXPA 3NOYA 1XQLA 2QJJA 1W5OA 1FWSA 1EUAA 2ZIDA 2C1GA 3PTQA 4EOUA 1UQZA 5E0KA 4ACZA 2D2HA 4AIOA 3VGHA 2CETA 4ES4A 1U30A 3C2FA 2E6AA 4L4MA 1E73M 1PPIA 3GH4A 4J3UA 3R43A 2CBJA 5A8MA 3L0NA 4R27A 1TZ7A 3TKFA 3VABA 5BCAA 1XLGA 1A5BA 3GU1A 4NRRA 4PE8A 1MI3A 4LS2A 4FPSA 3ICJA 4E2BA 4PCNA 1JL8A 3RUBL 1PAMA 2GVLA 3WF0A 1P6BA 2RKXA 2E5BA 1I4NA 2PGWA 2J75A 3B3DA 1KBJA 4IPPA 3KX6A 1UR0A 3NQ8A 3BV7A 2J8GA 1K9DA 3W9ZA 2C91A 2GJXA 4JIHA 1BPLB 2A7RA 3WDPP 1JJKA 2HS8A 4H8UA 4J27A 4QAWA 1TUXA 4KW2A 1CGVA 1NIUA 3WKZA 4O54A 2Y61A 2WNZA 1LT8A 4IIHA 4R34A 3GTNA 4PUUA 4M29A 3WFZA 3FFSA 4OUEA 1IZJA 1KO0A 1TKKA 1XLEA 4S3FA 3LPGA 1LJYA 3SSZA 4XZMX 4MOZA 1I2RA 4LUSA 2FVLA 1X8CA 2V2CA 2UV8G 3CL7A 4HVXA 1QOQA 1G94A 1GOKA 1QBBA 1R3QA 3CWHA 1GHSA 1TJ1A 1WXZA 4A8LA 1TTPA 3FA3A 3CPRA 1PZ2A 1UH4A 5AZ0A 1TX2A 1OG0A 4Z2JA 3BZJA 3EX1A 4GLEA 2JF6A 4Q8UA 1T7LA 3WG6A 1Z6KA 3BLOA 2FLIA 4O10A 5HR6A 4DLMA 3MUZ1 1K1DA 4A3UA 1GVSA 3ARYA 3FAWA 4JIEA 3CZKA 2BASA 3CTTA 4WY0A 4J3WA 3I10A 4HU4A 3SY8A 4DUXA 1E40A 5JMUA 3CM4A 3WD2A 3TFCA 3A3WA 4GHRA 4NUWA 1K9FA 5BU9A 2NXGA 3AJXA 4ASTA 2GGEA 4WDWA 5EFDA 5BWFA 1WKFA 4ZR8A 5A6TC 1SMDA 5I3HA 2GFTA 4C6CA 5G5IA 2NUWA 4JOMA 4PCFA 1PYFA 1UWSA 3CB8A 1H0GA 2ON3A 4XISA 1H7NA 2D73A 5A6SA 1MSSA 1GEHA 5E1QA 2HNHA 4BCEA 1JNEA 2ZVRA 1B4KA 3NWRA 3O63A 3AXXA 4B5NA 1W0MA 1WDDA 1NDVA 4H00A 4LTSA 4NX5A 3ZIZA 3N29A 2WBKA 5HWNA 3U5YA 3W84A 3HURA 4FF7A 4S3DA 4TXEA 3EEZA 4JTUA 3NDZA 2WM0A 1W9DM 4PTWA 2YOCA 1OF6A 2QNEA 4JTJA 1FWRA 3EPNA 2A6NA 4AW7A 1W5PA 2A7PA 2ZUNA 3AS2A 4MZYA 4HJWA 9RUBA 4DBUA 4QE4A 3VU2A 3P84A 1CLXA 3TU9A 1LWHA 3RILA 1E6NA 3EA3A 1YTEA 3PZVA 2C71A 1HP4A 3A12A 3FJ4A 3VGFA 3UJEA 4UR7A 3R5EA 1K70A 4GQBA 4ACYA 3AHXA 4QSHA 2NQZA 4ZBCA 4E2DA 3AUJA 3LHUA 2VC9A 1A0DA 2NUYA 3EOOA 1BLIA 3RLUA 3ZYZA 4RW5A 1NQ6A 1HT6A 2F84A 3ARZA 1V3HA 4JTSA 3ALFA 5FIPA 2JKAA 5FJTA 1JVNA 4PB3A 3OGSA 5KZEA 1AQHA 3EXSA 4CQCA 3VNIA 3QR3A 1XKYA 4S38A 1DWGM 3MO4A 2Y8UA 2FHBA 1QNVA 3PC0A 3R58A 3U48A 3CUXA 5D2TA 1LL7A 3LBMA 4Q6JA 1LQAA 2G97A 3EWBX 1LDCA 3VE9A 2HBVA 3FLUA 4HSHA 3TTSA 1KA9F 1E71M 4GY1A 1O66A 4TVCA 1LLOA 1K77A 2DT2A 2QYGA 3RX4A 4US5A 3CZEA 3W81A 3EZ4A 4UTWC 4CGTA 4Y9AA 7REQB 1HUVA 1I8JA 2PB1A 1N7KA 1XC6A 2G4JA 5I3FA 4Y90A 1FTXA 2IPWA 1S2AA 4Q33A 4TTUA 4E2OA 3MP3A 4DEFA 2H9AA 3MCNA 3KZPA 4KWWA 3NG3A 4UTKA 3BVJA 1JZ3A 5DXYA 3NDYA 4L61A 2WXDM 1Z42A 1DVJA 3R13A 3H7RA 3CZ8A 2VC7A 2QUTA 3B8UA 4DAFA 4N9CA 2WANA 2ZDRA 3OYXA 4O28A 1H61A 2KZHA 3K30A 3DERA 1GYNA 4HK6A 3MP5A 3VUSA 2GDVA 1EEPA 3S1WA 3GZAA 4LUTB 2JALA 3NZRA 2VMFA 2Y63A 2X30A 1NELA 1KM2A 3H2FA 3P3BA 4N2YA 1YPXA 2XGZA 3FA5A 3PJTA 1V4YA 1R46A 1H49A 1IE7C 1UWAA 6REQB 1JFHA 3USZA 3SRHA 1UPMB 2DW6A 1A50A 5ECUA 4C1KA 1TIMA 2E9LA 4CQBA 2E1DA 1ZL1A 4IMFA 1TTJA 2NVDA 5F1UA 3G1RA 1O4UA 3TA6A 2DUXA 2WVTA 1NM9A 1US0A 4Q7IA 1AQMA 2PE4A 3ME3A 2WSPA 4DZIA 3DHFA 4QHRA 4GXPA 4PZVA 2WZIA 4V1YA 5ECVA 4M51A 4CNTA 3WNPA 1QNSA 3SCSA 4HYWA 3T4WA 3EX2A 2WHLA 1O94A 1Q2SA 5CJNA 1BF2A 2L5HA 4F2TA 4UMBA 1DJXA 3LRMA 9XIMA 1XYAA 2W67A 1IZKA 3RF9A 4HNTA 4GWEA 1V08A 3KP0A 2I9UA 2WV8A 3L21A 5EGRA 1WZLA 1OGBA 1MNZA 1FCBA 3O0KA 2PWGA 5AC5A 1KBLA 5T91A 4IQLA 1P0DA 3O06A 2CLPA 3NQBA 4QQ3A 3SZ8A 1CIUA 3TTEA 1PO9A 5G2IA 4CU6A 3N15A 3VYLA 2XVPA 4TMCA 3H2AA 2VD9A 5A6MA 2R1KA 4E3VA 3EXRA 4CVWA 1B3YA 4F0SA 3AU2A 5FJUA 3TSBA 5BOFA 3M46A 5JH2A 1HX0A 2DIJA 2Q71A 3WJZA 5IXEA 5AHFA 3BQ5A 3N2OA 3CV2A 3KOFA 5CBBA 2FPTA 3TSMA 4CQDA 1LBFA 2VCAA 1MQRA 5EMKA 2ZUSA 6REQA 3ABQA 1E9LA 4L4LA 1MVYA 2HXUA 5TQLA 2OEMA 4M6UA 4BQ4A 2GPTA 1U2YA 5FF7A 2QDEA 3D46A 2E77A 4OBSA 5FF3A 1Q4NX 1PV8A 3XIMA 7XIMA 2X05A 2ZA2A 2WCSA 3E5PA 4DJEC 2WSYA 3QZEA 3OO2A 4HYRA 3IVTA 1KM1A 4WQ6A 3WDRA 3LV6A 3GVWA 3GC5A 4P8VA 3W01A 4PB4A 3TH6A 4LYRA 1F5ZA 1ECQA 4PMDA 2POTA 5EPDA 3TEVA 2H6RA 3AMCA 1XBZA 1UD8A 5BZAA 2QPSA 4DUWA 5LA2A 1RLDA 1EB3A 4H9XA 1ONXA 1JZ2A 1A5NC 4X9SA 3EWCA 3VIKA 1VFHA 1QPNA 1FRBA 4PMQA 3QV7A 2PAJA 3ZOAA 4FO4A 3LXBA 1OVDA 2VM8A 2WC4A 1RVGA 1H51A 1PKMA 3V3WA 1B4EA 4HNNA 1J6OA 1UR2A 3DKLA 3KRSA 4H83A 4Z17A 3LI1A 6TAAA 1QNOA 2C8NA 1VFUA 1NDZA 3CZJA 4TO8A 4UQCA 4F48A 2BY0A 4KF1A 1RXOB 1VPQA 3L5AA 3TSDA 3S46A 4S39A 1KFJA 5FA5A 1BEUA 3CMFA 3AMKA 1Z9AA 5A69A 5JU6A 4P7RA 4DLFA 3LHVA 1ME8A 1EJVC 4BEQA 3B8IA 3LV5A 4A29A 1DQWA 3QGKC 3UR7A 4HHPA 4XBSA 4FS9A 5DMYA 3QR1A 2FIQA 5HQEA 3VNDA 4JNMA 4H6KA 4FHAA 3N25A 3R25A 1GVYA 1E4LA 1JCXA 3NQ7A 3UR8A 3AHZA 2GSJA 1EJXC 4BWLA 2J79A 3LLDA 1KR1A 3S8HA 3VGBA 2BGQA 2JQXA 1V3JA 4DWSD 1ZJIA 1OF8A 1X96A 1S5WA 3STEA 1NWRA 4DPPA 5C54A 4IM4A 4N7QA 3C0SA 3MVIA 4Z1YA 1KXQA 1M9HA 1BWKA 2IXUA 3W7NA 4ZFMA 1UZ1A 4M81A 3OGVA 3CMJA 3MY9A 3W6YA 1JG9A 4JTQA 7ODCA 9XIAA 4ZQRA 1QUMA 1TUFA 4FNQA 3U57A 2C6QA 1OCNA 2GQAA 4AD5A 5BRBA 3SM0A 3AFBA 3VDAA 4CD5A 1KLZA 3LY0A 3RR4A 2IKHA 5J5RA 3PTKA 2FYMA 3CL6A 3NQEA 3C56A 3RMEA 5I2UA 1O5KA 3TVAA 4LUJA 3IANA 3ZSTA 5D8ZA 3VE7A 1VEPA 5BMXA 4HBKA 3TYAA 4IMEA 3BW2A 2RH9A 4IGNA 2VC6A 1ELSA 3M47A 3B4YA 2VUYA 1XIGA 3M5XA 4XKYA 4J2PA 3FYYA 2X0YA 5HK4A 5FF4A 1DKWA 3E02A 3MUIA 3ATYA 3I65A 3VKAA 1A80A 2ZX6A 1Q7ZA 2PZ0A 5K9DA 1ISYA 1UUMA 2AL1A 2Y7GA 3TN4A 3FJ6A 3F1QA 2DV0A 3W22A 1H1NA 1NVMA 3ERPA 3C0QA 1KKRA 2GJPA 5KTLA 3L4XA 3QQ1A 4POCA 3KZSA 4KIRA 3MDUA 1K8XA 3WLMA 4NYYA 3NPXA 1W1ZA 2V9DA 4GZ7A 3PTMA 4PBEA 3AZRA 1XIIA 1DV7A 4YVXA 2QJMA 2RDXA 3AXKA 2OGJA 3IIOA 4Y9NA 4IGMA 2VENA 2PI6A 4LS1A 4GGBA 1VH7A 3OZMA 5CPNA 3RCYA 1LYXA 1AMKA 4H6QA 1L6WA 1IXNA 4JQ4A 2DSVA 4DUOA 1XQKA 1GOIA 5HNUA 2GL5A 3NM3A 5REQA 3GC4A 3LYEA 4WXZA 4DB7A 1CXFA 3O0FA 1JUBA 1VYSX 3HPXA 3A47A 1XLHA 3T4CA 4GUFA 3FS2A 4ECLA 1P5BA 1GKRA 4O8AA 3E5BA 8XIMA 1E0VA 4QE1A 3FEQA 1EOKA 1DXEA 3VGEA 4GCAA 1V93A 3S3GA 1DTUA 4JICA 1JCLA 4MAZA 1J8VA 4C7GA 1ICPA 3EWUA 2G0WA 3KW3A 2OWXA 1GEQA 3WCZA 3GAKA 1I0DA 4DWSB 3N4AA 4J40A 4UBPC 2WWDA 3GVRA 3PWGA 1E4IA 3M0KA 3NO1A 3WY1A 1E4MM 5J8LA 2RFGA 3QC3A 4Q4SA 4V33A 4GK8A 1RJPA 3APYA 3WDJA 3IPWA 2GK1B 1WE5A 3W7RA 4EANA 3PP7A 2WVVA 1KBIA 2YIHA 4NJHA 5C5YA 4JQ3A 3CAKA 1B57A 3DG6A 5DMMA 2XWDA 4PRTA 1GONA 1KNWA 1XYCA 4KEZA 1W2VA 4M82A 4X3ZA 4MY9A 1V7YA 2IQ0A 3OU8A 5BRQA 2GVYA 4UOQA 4O1FA 1LG2A 3GUWA 3V36A 3EX3A 4YU1A 3GDLA 4PUDA 2VHLA 2C18A 3W2KA 1ZJHA 1RK5A 3GXIA 2J4GA 4KCWA 1CGTA 3I4EA 3ES7A 3S1XA 3NZ1A 3E2RA 1I9CB 4DX3A 5I00A 3C0JA 1VEMA 1Q6DA 3AYTA 2Z1WA 5LGZA 3TDFA 4N9DA 5KZDA 1TZZA 8CGTA 2EG8A 4G9PA 3OEXA 3B04A 4MNKA 5DEZA 4AD3A 1MMFA 3M44A 2R6OA 4REQA 3CUGA 2WJFA 1MXDA 3RAOA 3TC7A 2NQHA 1L2UA 2OZTA 3BOLA 3FV9A 4BY3A 3GTFA 4A3YA 1CT5A 3ZVHB 1XPYA 3W88A 2J24A 3SFWA 5H1WA 2Z6IA 1W31A 3I6RA 1E5JA 1DWAM 2D0HA 2O4MA 1WYIA 4WDTA 2HBXA 3NJ3A 3POHA 4XSMA 1K7XA 2XFRA 2FPYA 3GYCA 1R8LA 2EBNA 4P7NA 3N04A 4CNPA 4XAGA 3LSCA 5TNVA 2X0SA 3QHMA 5FL0A 2QEZA 3VILA 4EAYA 4EPDC 3ONCA 1K02A 2X16A 4LJ3A 2ISSA 3APTA 1XH1A 2VRKA 4URIA 1NEYA 5D04C 1HW6A 5CBIA 3DDMA 4JTDA 4N4PA 4B5UA 1QT1A 1I0BA 1YE4A 1TPDA 3HPFA 4C6FA 2PWFA 3RCMA 3W82A 1N8IA 4AY1A 1XG4A 3QQ0A 2IXVA 4DNMA 2DZBA 3G6LA 2OVLA 4A8RA 3ARQA 3CV6A 3BH4A 2FZ8A 1VFLA 2FFCA 4FXRA 4O11A 1TQJA 4V2XA 1ZAIA 1OFDA 4GI8A 4E4UA 4HP5A 4DO5A 3GBDA 5CC5A 3LQGA 4DXXA 3ABOA 2BY2A 3VK5A 3BK0A 4UR8A 3W25A 4L5ZA 2BVDA 2DDXA 4XAPA 3P14A 3A22A 2E7FA 3TYDA 2XINA 1BD0A 3NL6A 3D5HA 2Y1HA 2DVUA 1Q45A 2DPEA 1P6WA 1X7IA 1JGIA 2W4XA 4QM1A 4F79A 4LVFA 2EPLX 2CZFA 3W1NA 2OWWA 2ESCA 1CCWB 4M7SA 1UZDA 4YS1A 5BOEA 2WBGA 3M16A 5HUOA 1R30A 4C1LA 3SCWA 4C6MA 2FMOA 1OCQA 3LDVA 3B9DA 4L9ZA 3WMSA 4LYKA 3LGDA 5H8UA 3ZR6A 3KFTA 3C2EA 4M5PA 4JTHA 4M6PA 3RFAA 3SN4A 4JQAA 3R0UA 4WK9A 3EWYA 3T2OA 3IJLA 4H04A 2I14A 3SW6A 3QGVA 1VFOA 2B7PA 3ALGA 3KBWA 4W7UA 1Y0EA 3HQ1A 3GYEA 1UD4A 4Z2GA 3ZLGA 3VIJA 5MF5A 3GFXA 4PMXA 1QWGA 2OXNA 2X2YA 3CV7A 2FJKA 4QR6A 3VGDA 1JFXA 3FHAA 3IJ7A 2I57A 3TC3A 1JDFA 4MG4A 3VKDA 4F9JA 4WF7A 2ZZ2A 2W61A 3VM5A 4ZFCA 3ARRA 3M5VA 3W28A 4BI7A 1LT7A 2DZVA 3TQPA 5H8MA 1JDAA 2C3ZA 3R8RA 2AMXA 4LYQA 3CHVA 1LUCA 3T0TA 5LHFA 2DJXA 1A0CA 1GYLA 3GNOA 1XLIA 5IHRA 1M01A 1QO2A 1AZ2A 2DT0A 4GBUA 4GNVA 4RE2A 3SI9A 4H9TA 2J8FA 5EL1A 4K7VA 2EKCA 3CHEA 1SFLA 4GFSA 4FXSA 3UZYA 3GY1A 3N2BA 4Q8WA 3WX7A 5CGMA 4B5SA 5CAHA 1AJ2A 3UWYA 1OSEA 1QI0A 2O7SA 1MRAA 1GVQA 3RGTA 3OIXA 3DEQA 4PBGA 2XIQA 4B5TA 2CBVA 1PIGA 3NO5A 1YMYA 1HKIA 2TRSA 3URAA 3W26A 1HF6A 5I3DA 3KE0A 1EJSC 3NGJA 3VUPA 1UR4A 3OHIA 3P60A 4K2SA 2E6DA 3FXGA 2INZA 1B3WA 2AGKA 2PF8A 5C7HA 4LVBA 1VBJA 3OZYA 4LRSA 3RPMA 1NP0A 1UUOA 3QMTA 3STPA 3IV3A 1QNQA 5LNSA 3TQKA 2W91A 4GRSA 4GY7A 4U10A 4IF2A 4W8BA 1JZ6A 2WLYA 4QG6A 4TV6A 3W1RA 3WQ6A 4TQTA 1NDYA 2QCDB 1XGDA 4Z42C 1AFSA 1U5VA 4GUGA 4MADA 1OIMA 3VNJA 2C15A 3FGCB 4AD4A 1X7FA 1MUMA 4K3ZA 4LPCA 1LG1A 3VA8A 4MJ4A 5EFFA 3UJ2A 4JTIA 2V38A 2DY3A 4ZQMA 2XSBA 5HJLA 3V35A 4CUCA 4MFEA 4CD7A 3ITVA 4GH3A 1QI3A 5D8WA 1X6LA 1Y5XA 3PBUA 3L66A 1X1NA 3DU0A 2LLEA 3ZS4A 2DZAA 1TMHA 4RDWA 1ZFJA 1GG0A 2DGAA 3VCCA 2V67A 2WWCA 5JH1A 2D20A 4QCEA 3V5CA 2WPBA 3PBVA 5CZTA 1SO5A 1P0BA 3G77A 5CQ1A 2NV2A 2EGZA 1GOQA 3S2CA 2X7WA 2VX6A 4LYPA 2VNCA 4BWLC 1T0OA 4UXDA 3GUGA 4CQAA 5HNTA 4F0HA 1TPUA 4L4OA 1E1EA 3H21A 1M68A 4GC4A 4F66A 3N6QA 1QFEA 3RMJA 4S3KA 4P5UA 3WNKA 2QCCA 4V1XA 4ML9A 2CZEA 2QCGA 2BFGA 2ASHA 4R9OA 3KDNA 3PZ9A 4FAMA 3K46A 3WH8A 4NXSA 1H7OA 4QRNA 4WEVX 1JULA 3R12A 4X60A 3LOTA 3N9SA 4J1OA 1IWAA 4Q4RA 1HL2A 1GZ1A 1C9DA 3ZWSA 3GW3A 4GY0A 4RUBA 1XLCA 1KFEA 2RGLA 3VOFA 2VYOA 4YYCA 1XXXA 1F05A 2R1NA 4HK7A 1U33A 1NF0A 3B8VA 5LIYX 3OLGA 2JF7A 4LEQA 2Z29A 2PTDA 1NDWA 3NSXA 3BGAA 1EGZA 4BEUA 3EB3A 4DM2A 2XVGA 3W7JA 5D9NA 1H09A 3HBLA 2E9MA 3T08A 5EMLA 3FGCA 3ZJ7A 1ALDA 1H50A 1G4EA 3TC6A 2A3HA 2ZTJA 4DXVA 5I3KA 1GOWA 1CXIA 3TR9A 4LNYA 5FJJA 3MKCA 3UYIA 3D47A 1X1ZA 2P3ZA 2O0TA 3WLHA 4MLRA 3SRDA 2OX1A 3M0JA 3U9IA 4CCZA 2YYTA 2YDRA 4I7VA 1O12A 2G3IA 4DZHA 3MI6A 2DUAA 3U4FA 2PCEA 3RHGA 3EKLA 5DCDA 1KFBA 3IJIA 1E4NA 3HQOA 1W91A 2YDSA 4DI9A 2J6XA 3I6TA 1XYLA 3BSHA 4OECA 5D05A 2GZXA 2PGRA 2FTYA 1UKTA 4MB5A 4D6HA 2YCEA 3UEQA 1Q2RA 3N3TA 1PZ1A 1GJUA 2E5CA 4B3KA 5EMUA 3LNPA 3NL3A 1QK2A 2J9YA 4K39A 2BXZA 4GZIA 3KVJA 3GIQA 3P0WA 3N4FA 3MHGA 1P0NA 2Z26A 5I3JA 3CIVA 4JHZA 3BAYA 5CGQA 2ZXQA 4JTEA 1RUSA 3QR0A 2AQOA 2WMGA 3FIGA 3WELA 1NWUA 4OBTA 1F2JA 1C8QA 1HVQA 2FGZA 1XDLA 4L7ZA 2Y70A 4ZQPA 1LL6A 1K6WA 3LB0A 5FF0A 1OADA 3T0BA 2PSNA 1DQXA 3DFOA 3HB9A 1GOMA 1DWJM 1SYTA 1GK8A 3I7QA 2OU4A 2HWGA 2BB0A 3RPDA 5HNRA 4HYVA 4H19A 1SSGA 1KGWA 2JKEA 1V6VA 4FIQA 3ORWA 3PZNA 1XCFA 5D37A 4C7DA 1KTNA 2V0TA 5KEZA 4UCGA 3V5OA 3HU7A 2HROA 4C91A 3LCIA 3BAWA 2QUUA 5LSMA 3UZWA 2XVNA 1C92A 1Q6LA 3H7VA 5I09A 1NSJA 3TP4A 2NWSA 2OZ0A 1UR9A 2A3CA 2R8WA 4CNSA 3QFEA 2HE8A 4B2DD 3OVGA 3VVGA 3GDTA 4GE8A 2Y2WA 2REQA 3QKZA 3TYEA 2GLKA 4BR1A 4N42A 5G4WA 2UY3A 2F61A 1V3IA 1JRBA 3WDHA 1GVFA 2I17A 1TA3A 1Z8AA 2ZZ4A 4MWAD 2QKFA 4X2PA 1BWVA 3EX4A 2VEMA 1DJZA 4MFDA 1WKYA 3R94A 4PULA 1XD1A 3W1LA 5I23A 2ALDA 3NPVA 2VR2A 5FJIA 1B9ZA 3IVUA 2DIKA 2OSYA 3CQJA 4XB3A 4KFOA 2QMKA 3PPFA 4H8HA 3PWIA 3BLKA 3P7YA 5CPMA 3C6CA 1KWGA 2I5IA 5E6ZA 3VD5A 3T7VA 4D6JA 1SZFA 4GIRA 3CUIA 4TU1A 1Q8JA 3T1GA 3B9NA 3B9OA 2QCNA 4AXKA 4MF4A 4JPGA 3UWWA 2WJDA 3NVDA 3WLTA 4UTJA 3F4CA 1ZBKA 4KKXA 2VZVA 3DFQA 3ITYA 5CC7A 4BI6A 1R86A 2X1SA 1J9YA 3CJPA 5CLTA 1FWJC 1JXKA 3W7IA 4GJIA 7TIMA 2PDPA 4KQNA 1KWKA 2VFDA 2VWSA 2PTWA 4YYFA 3TQVA 1QW8A 2J66A 3E38A 5A3HA 1WP6A 1TE6A 2IQDA 2W79A 3E3HA 4HU3A 1TWZA 1K3UA 3T2PA 4I3GA 1AJZA 4ZOCA 4PFMA 3HG2A 3PBGA 3EOSA 1XM3A 1YXDA 2WMJA 4XV0A 1XCWA 4CEXC 4RNHA 1QWKA 3BXWA 4AHQA 3F4VA 3LLFA 3QVQA 4WSKA 1KRCC 1V6YA 4FSAA 2CWXA 4DJFD 1NQKA 4J4KA 1BG9A 1IR1A 2WVUA 3BQ6A 4QISA 3S1VA 1XRTA 4QROA 2F7FA 1M7XA 1QPKA 2ONEA 2Q8LA 4IZGA 3II1A 2FMNA 3TQ0A 1ISWA 3ZJ6A 4P8XA 2WKJA 3RYSA 3DBNA 3AC0A 4AX7A 7TAAA 4NJGA 4AMCA 3FNDA 4ZXOA 2VEGA 2HPIA 1FHDA 3VGGA 3W7LA 4AZGA 1M53A 3ZLHA 5FEPA 3IEBA 3CNYA 1FBAA 2CLEA 1JCTA 2Q02A 5LGXA 1VBGA 5HPOA 6XIAA 5LA0A 1B31A 2TYSA 3M1ZA 1MEHA 5JXQA 1S39A 1XYFA 2YGYA 3BLFA 2YB1A 2YX0A 4MAVA 4NP7A 1QHZA 2R91A 5F2IA 1SGJA 3S6DA 3SRFA 3KTCA 4IFRA 1XIEA 2XSAA 4MWAB 1J79A 3UBPC 1FKWA 1AA1B 3KTSA 2B7QA 1W37A 3I3EA 3N6JA 3IIVA 3KLLA 2ZC1A 2PTYA 2E67A 1P43A 3WQPA 1YNQA 3DYOA 1G67A 2Z0IA 2YL8A 3PZQA 1EA0A 4LV4A 1V6XA 1U1JA 2X1IA 1XFCA 1QNRA 5KZ6A 4H01A 3GO2A 4OZOA 1G4TA 1MUWA 4KWSA 3BLEA 3WQEA 1Q6FA 3UXKA 4ROQA 1BGAA 4ICNA 4GC3A 4JIIX 4M80A 3A9IA 3S2NA 1Y8BA 2Z1SA 3LS9A 3QW4B 3KAOA 3NQFA 2PU0A 3P5ZA 3VNLA 2OT0A 1HP5A 4S2CA 3N13A 4WGXA 2O9TA 4HA0A 3IGSA 2W92A 2P50A 1KV5A 3LXCA 2BGNE 4UFKA 1VB9A 4X0NA 5C9UA 4XSLA 1OWQA 3ANVA 4I9JA 1N82A 3NEVA 1CEOA 3T40A 3ZMRA 3CAVA 4A22A 4HMDA 1F4HA 4GIAA 4S23A 3HZ3A 1BYDA 4JTAA 5C2GA 4RK8A 4HSOA 5C6MA 2OJPA 1Z41A 5FOOA 3VI2A 4M8UA 5K4ZA 3P61A 1T6MA 1VEOA 4B2DA 5AC8A 1B3VA 1WKEA 3OVQA 4MUZA 2Z7KA 4D1IA 1LCOA 3QY7A 4JD4A 4LC6A 1YKWA 4R7WA 4JHMA 2Z27A 3EDDA 3PAJA 1YDVA 1AMYA 1UW9A 3KL3A 2VGFA 4MWAA 4KFPA 3RM8A 1FH8A 2A85A 2J74A 1TVNA 2DZUA 3H53A 2NSXA 2E28A 3TOPA 4KEMA 4LC8A 3W7PA 4WUIA 5D32A 1RV8A 1UD3A 3DBPA 1HO4A 1F76A 1FDJA 4ZB5A 1OCBA 3ITCA 4AB4A 1PTGA 2PWHA 3HA1A 2IS7A 3L2IA 4DF2A 2DQXA 1OC5A 2BOFX 2TPSA 3IJDA 1TJRA 2WNNA 5DELA 3PM6A 2WW5A 2BV9A 1PZ3A 1PBGA 2ZXDA 1ZU8A 1T8XA 2DJLA 2FVMA 3TNBA 2V68A 4IJBA 4W5UA 3FN9A 1B30A 1G9HA 1WO2A 3JVAA 4NAEA 5XINA 4LY4A 3WJSA 3OOQA 3MA8A 2BMBA 2Q3OA 3UNTA 5A5WA 3HTWA 3FHQA 1LORA 2JIWA 3VD3A 2P0IA 2BOGX 4GYFA 2GUUA 1BQCA 3TK7A 3PUGA 3W7OA 3PB2A 5I03A 1EDQA 4XZNX 1RY8A 1Q85A 5EMJA 2XN0A 3V0TA 4XUYA 4QEHA 4TR9A 3R0KA 3VPLA 1BTCA 1EPXA 1VCFA 3CHDA 1EP3A 1XD0A 1XS2A 3HV8A 4I9AA 1MXSA 4YVVA 1AODA 2P0OA 4PSRA 3BAXA 1DEDA 1I2NA 3K1DA 2Y5EA 3UWQA 3DUGA 3L0KA 3WUEA 5CH9A 3T07A 4PC8A 2WSQA 4W4QA 5LYRA 1VRDA 4KWUA 3VIPA 3TLLA 4DJFA 2F6UA 2AL2A 4A05A 3ITOA 3BWWA 4IUOA 3PZTA 3MI2A 1QCWA 2VEIA 3EB2A 1V02A 3LRKA 1V3LA 1DJYA 1PB0A 1FH7A 4X22A 1E51A 1ISZA 5L6UA 1HJSA 3SUSA 2RAGA 4Y8EA 3QV6A 3W71A 2WSRA 1OM0A 3R79A 1XSKA 3PZUA 4IMAA 3BV4A 1O60A 1RBAA 3V4BA 1PVNA 2PDGA 3CYVA 3VZZA 3W1MA 2G37A 4LF1A 1F3XA 1ITUA 4HNCA 2WNWA 5M1TA 2NX9A 1O1ZA 3WD4A 2J6VA 4D2JA 4AY8A 2YCJA 4CNUA 3ARWA 5ABGA 3WK3A 3QFWA 3GH5A 1BXCA 3PUEA 4EAMA 3B0VC 4Q4OA 2V2DA 3LCFA 4RDYA 2POZA 1GQJA 4Q8OA 3GX9A 6ENLA 4Y9OA 4C6KA 3A3XA 1B2YA 4PUJA 4R33A 4AX6A 4JQ1A 3MMUA 1JQXA 1L0PA 4E6MA 3UXAA 1KB3A 3TYUA 1BXNA 2Y5JA 1E9ZB 1YHTA 4AZBA 4HPGA 2VGIA 2ZRVA 5DMLA 1BAGA 1J0ZA 1F6KA 4N6EA 3KOXA 1ISVA 4IIGA 4GI4A 1M6JA 2QJHA 3W00A 5HA7A 3HN3A 3OJGA 1DWFM 1EXPA 2R1PA 2Z1VA 4AU0A 3S47A 5AYIA 2ZX9A 1B3ZA 5BROA 3GNPA 1JYWA 4C1NB 2Z4GA 3AU6A 4XO6A 1GORA 5CG0A 3NDOA 4H9MA 3AIEA 2ISVA 5FEZA 2ADAA 2OG9A 2P76A 1XYBA 5D03A 3I7SA 3MZ2A 5H2ZA 1PHWA 5KINA 3W02A 1XIJA 3SCPA 4B90A 1ONRA 3GBEA 1E43A 4ZODA 4GZEA 3PSWA 5D4YA 2RJHA 3MUY1 2PP1A 4NZJA 1ICSA 1UA3A 2VOTA 5ABFB 1VFSA 1JEZA 3U2OA 2GVJA 2VQUA 3B40A 3KLKA 1L2QA 2FZ9A 3S5SA 1FWNA 3T44A 2G3NA 3G1FA 1I75A 1KFKA 3ZM8A 5HMFA 5FJRA 1MXGA 1WB0A 2PWDA 2ACQA 1Q63A 2DSUA 5EMYA 1N55A 3N19B 4JIRA 3LEPA 5AECA 3H26A 3R11A 3W29A 1QO5A 3KL5A 1EZ2A 4GZJA 3ABZA 2VCCA 4DJED 3OBAA 4PUNA 2OYLA 1I60A 1A5MC 3LG3A 2VKZG 5CBJA 1IWBA 2PDLA 4ZOAA 4QIUA 4LB4A 3GHTA 4W89A 4QP0A 4YTTA 4DBWA 3E0VA 2QQ6A 1GQKA 1X6UA 3G6MA 4RNIA 1D9EA 1OX4B 3LA4A 1V03A 2P8CA 2D0GA 3F5KA 1EH9A 2V82A 2QVNA 2FB2A 1S1RA 1OYCA 1ZBWA 1SJCA 4NI3A 1XBXA 1XBVA 4FX8A 5CSUA 3B05A 2WNQA 2I16A 3AS0A 1KQZA 1BXBA 3AMLA 5DRCA 2VVNA 2J47A 2XUCA 4LW7A 1JF5A 1EHNA 5IRPA 1SO6A 3C2OA 3SN1A 1HKWA 2B7NA 3L5MA 4GQRA 4PUKA 3L4YA 3KM8A 1GJWA 3AUOA 2PS2A 4R3UA 1S3HA 1VAHA 4D8ZA 3EDFA 3AXIA 2PEVA 3O6DA 4J3VA 1X38A 3OA5A 3VD4A 2HRWA 5ABFA 4YN5A 3SUVA 2C14A 3OGRA 1VS1A 4PN2A 4QBXA 2CLIA 1OZQA 2E4TA 3QYQA 3TOYA 1BVNP 4KRZA 4MMWA 2J7BA 1W1TA 1KQYA 1UMLA 3V7PA 3NQCA 3V0SA 4CQ8A 1VYPX 1T99A 3T2QA 3W86A 3DI1A 1EDTA 4FOKA 3UFYA 3CLMA 3KCJA 2EPNA 3QC0A 1YRRA 1L8PA 3UCDA 5I06A 5DY2A 2D3LA 4US6A 4ICMA 8TIMA 2GJRA 3G5EA 5D9OA 3UXLA 3N12A 5FJPA 1R7AA 2B0MA 4HMEA 2VX4A 1WUEA 1FXPA 2NX1A 3AROA 3W7EA 3Q45A 1OX4A 3KVLA 2OOGA 2WKGA 3NQAA 4Q22A 4NIRA 4Q7BA 4O8RA 3WQDA 3FSTA 3UZXA 5CPLA 3VCNA 1F3TA 3ANYA 4WJ8A 3VZYA 3CT7A 4HQVA 1HKMA 4P61A 4EE9A 1KCZA 2VDIA 3HGRA 4DO6A 4RDZA 4MVAA 1ITQA 3AYVA 5A6KA 4GI6A 4JX4A 1GOXA 4PODA 3N2TA 4NAFB 1TV8A 3LBOA 3BARA 4L80A 1NJJA 1U1HA 1VCGA 3MB9A 3NSMA 1EF2A 4I5XA 2BOEX 1E9YB 4KGLA 4BS0A 2QW5A 1JXJA 2Q8ZA <