1JQXA

The r57a mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPAYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 113
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqxA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqxA01
1O4UA 4OHQA 4W9TA 1DKWA 3SZ8A 5K2ZA 5D38A 3N3MA 2E5DA 1ICPA 3L2IA 1Q6RA 1EX5A 2A85A 4LW7A 2QEZA 1LORA 3SGUA 1UUOA 3TXZA 3N9RA 3NL3A 3P81A 3KX6A 2BX7A 1SQ7A 3S5ZA 3R12A 3NQ7A 4O16A 4JDBA 3R8RA 1ME8A 1A5AA 2WPBA 3PUDA 3TK7A 3B05A 2TYSA 1ZAIA 1OX5A 3UWYA 5FEWA 4NNBA 4BK9A 1KM1A 3IIXA 4MY9A 3HG5A 4RK8A 4ZL1A 5DXYA 4AHQA 3SR7A 3LHVA 1G4TA 4FNSA 4KFOA 4QITA 3MBFA 3MHGA 2H3BA 4IMGA 1P5BA 2QCGA 1TPWA 4WX2A 4RXFA 1SSDA 3O16A 2YFOA 4RZ5A 2FFCA 2QCEA 1SFLA 4XKYA 2B7PA 4JXCA 3CB8A 1LLZA 2YYTA 3NQEA 5EPDA 4MFEA 3W7PA 3UYCA 4XTIA 4LVDA 1JCMP 1FXPA 5HUOA 4JTHA 4HN4A 2QJHA 1LTDA 4YL2A 1SUXA 1TQXA 2CLKA 3LCWA 4DELA 3CEUA 5TIMA 3RLVA 4UTTA 2V82A 3IIOA 1VS1A 1GVQA 3NVTA 1YXYA 5G2IA 4HT3A 3PC0A 3R2GA 3NQGA 2W0UA 3LTPA 3FKKA 2CLLA 1RVGA 3EXRA 3AO0A 4JTEA 5J5DA 3CLMA 1EUNA 1U83A 3A23A 1V7YA 3QMRA 3PS7A 1LM1A 2NV1A 3L5LA 4NJIA 4CQ9A 5FF7A 1AW1A 1WBJA 2VEPA 3DFQA 2JBMA 3QFEA 2GQ8A 2QUTA 2VFHA 4JNMA 4N9DA 4A2SA 5TBOA 1DOSA 4MFDA 1W37A 1TRIA 3S5YA 1FDYA 4WY0F 4XKYB 3EKZA 1RZMA 3NL6A 5LNWA 1S5WA 1C8VA 5LGXA 4QJ1A 3RU6A 1IXOA 3UZ5A 2ATSA 4X9SA 3NO5A 3CC1A 3PUEA 1RR2A 4GC4A 3QRHA 3L68A 5DLCA 1OFQA 5K4ZA 4BWLA 3HPZA 5CZTA 3P61A 2CW6A 4B5NA 5FEZA 3SJ3A 3G1FA 3STFA 1GT8A 3GXTA 4MJZA 3BVJA 4N2YA 4JD4A 4GUJA 2C19A 1MZHA 4UR7A 2OT0A 5D2TA 2AQWA 1FWWA 5LHEA 1X7FA 4Z08A 4FNRA 4ONVA 1XUZA 5CZSA 4EVZA 1O94A 1HUVA 1OVDA 3HF3A 2OMAA 3DI0A 1TPFA 1OYBA 1QDSA 3IV3A 3HO8A 3N9SA 2ZZ1A 5AN7A 1SO6A 3ANYA 3BLFA 1R47A 4LVFA 4O4WA 2BXVA 1LBLA 3W7LA 3CHVA 4PEKA 1EUAA 2A5HA 2UV8G 3TQVA 5F2LA 5C54A 4A29A 3N73A 3CU2A 1DHPA 1TRDA 5G5IA 2YW4A 3FJ6A 5F1UA 2GVGA 5F4WA 1XKYA 1H1ZA 1ML1A 2ZBTA 2FB3A 1T8XA 3C2OA 3EWYA 1F76A 1SW0A 3IIVA 5A8GA 5HWMA 3L66A 5BOOA 4QSHA 1YTEA 1TPVA 3HMJG 3RNDA 3UY7A 5U7SA 3DFSA 4UC5A 3I68A 2Z2UA 4AVFA 3C2VA 4UTIA 3RK8A 1WBHA 5LZLA 1I8JA 3KVKA 1TPH1 1EWEA 5CGQA 4LY8A 2CZ5A 4Y96A 3W7CA 1L6WA 1QPOA 3TW6A 4JX6A 2YZRA 3P80A 4O1DA 4O1BA 4ZQCA 4QM1A 1K7EA 2YYUA 4O0KA 4A21A 3P8IA 3UWQA 4WUIA 4UIOA 3B8DA 4S2CA 3LLFA 2YX0A 3CIXA 3HGOA 2JGQA 3LM7A 3TR2A 2H3DA 2V81A 2H8XA 4PH6A 2NX1A 4PL1A 3GXPA 3ZWSA 4L4MA 3EX2A 3THQA 2CZFA 4AH7A 3PSVA 3O6YX 3DFOA 2Y70A 1SSGA 3DGRA 1X1OA 3NPXA 2EAWA 2NUYA 3LDVA 5H91A 2A0NA 3CWOX 3OG3A 3F1QA 3GZ3A 2EPHA 4WY0A 4Y90A 1FWTA 1K7XA 5DN1A 4FX8A 2E09A 3GXNA 3W7QA 1H50A 3BW2A 1LRTA 2X1RA 3DXIA 3G1SA 3KOFA 2OJPA 3PSWA 1XDLA 3NQFA 1G4PA 1W3IA 1JJKA 3PBVA 2CLOA 1QO5A 3VFLA 1P0NA 1TPUA 3IEBA 2VFEA 2J27A 3T7VA 2CLIA 1MEIA 1ICQA 2O7SA 4LS2A 4POCA 5KSWA 3V1PA 3C8FA 3O07A 3P84A 3W7KA 4GNJA 1EEPA 2I1OA 2ZA2A 1X1ZA 1GVFA 2V2HA 2R94A 4ICNA 3A9IA 4JDYA 1VCGA 1L6SA 3W84A 2E5BA 4IXHA 3KVLA 3SECA 1G69A 3FYPA 2C16A 1JCNA 3G1AA 1NF0A 3WJSA 4NVTA 1LP6A 3FEMA 5AC6A 4ORMA 2HSAA 3QMSA 1JCXA 3EXTA 1R2RA 3NOEA 5AHIA 4MLJA 3TAKA 3B0UX 2ISWA 3MO7A 2P10A 2CZEA 4GXMA 5C2XA 2NXGA 1VR6A 3P5YA 3KVJA 3PF3A 2I14A 1YTDA 4GUFA 3W72A 3LOTA 4LRTA 3MMTA 5HULA 3PB2A 2F7FA 3O8AA 3P82A 4AXKA 3CT7A 1WX0A 1ZJIA 4EWND 3HGSA 1SO4A 3FOKA 3BGJA 1XM3A 3M5VA 1VH7A 3LTSA 3QM3A 2B7NA 2YR1A 2FPTA 1X8FA 3VCRA 1XL9A 1I2NA 4QNWA 3S0CA 4HNUA 2DZPA 4K8EA 3KRZA 2PCQA 3EWZA 2QF7A 4HNTA 2WNNA 3W07A 3H55A 3L0GA 3NQAA 3QSRA 4AHOA 1KLYA 2QR6A 1FWRA 3QF0A 1F5ZA 5AHNA 4TIMA 4JR5A 1OFPA 2OCZA 3G8EA 3VE7A 1UBSA 3W7MA 3R89A 4X22A 4K39A 4E2DA 3L9CA 1QPQA 2GQAA 4O14A 1LOSA 4NX5A 3T4CA 2X2GA 2X1SA 5LNRA 1KBJA 4UUIA 1JUBA 5KZDA 4A2RA 1HG3A 2Z1BA 5KZEA 4FX7A 3LHUA 1DL3A 1L9WA 4UFHA 3OEXA 3M41A 3E49A 1GVRA 4BF9A 3U2OA 3NPVA 2B0MA 1OK6A 3MYOA 4FO4A 1F6PA 2A6NA 4UMCA 3MW7A 3SI9A 3W70A 3NR0A 1SZFA 4TMBA 4H4IA 4UXDA 5D32A 2DU2A 1GTEA 4JTTA 3OA3A 4E38A 5G4WA 1TB3A 4PL2A 1KM3A 1B4EA 3HJZA 3W1LA 4OBTA 1TTQA 3D0CA 3W83A 1UUMA 2AGKA 4GUIA 1F6KA 2A7PA 1VHCA 4OQVA 3P74A 3KVMA 3M1ZA 1ZHAA 5ABTA 4IMDA 3W74A 4MYAA 3N2MA 1IGSA 3F4NA 3FFSA 4LC8A 4JYFA 4Q4KA 2DJLA 3FIGA 4RX0A 1F2JA 2ZRYA 5DCEA 4JX4A 3UZJA 1W3NA 5AC7A 2E68A 1DV7A 1KV5A 1KLZA 3LV6A 5I3JA 4I9AA 2PE4A 3O15A 2Q8LA 1ZFJA 4JGDA 3MUXA 4KFPA 1YTKA 3ABRA 3BLIA 3Q2DA 3M47A 3GDRA 4MKNA 5AFDA 2B4GA 3THAA 3TC6A 2QAPA 4AEOA 5EBUA 1OF8A 2CLHA 3E12A 1RQHA 4LV4A 4XUGA 3S8HA 5CPOA 3TSBA 3C4UA 1B9BA 8TIMA 1GG0A 5D2WA 2P1FA 1K3UA 1XBZA 3NEVA 1PS9A 2JKEA 3S1VA 2Y7DA 3B06A 3JR2A 3C52A 2VENA 2PURA 3PG8A 3NGJA 4UFMA 5DBTA 5BMXA 1QPRA 2WQPA 3DKLA 5IM51 1ZALA 4IMCA 3EKLA 1IIHA 1GEQA 4NQ1A 2JK2A 1VPXA 1KFCA 1WA3A 3CPRA 3KRSA 3G3DA 3ELFA 4IMEA 4AAJA 3NQ8A 2W6RA 3KAOA 4HNNA 4S1FA 1OABA 1JCYA 3S1WA 2DZSA 2NXIA 1Q6LA 3A5VA 1Q3NA 1YYAA 3BO9A 4XQ6A 2Y7EA 4NT0A 5EL1A 1QO2A 1QWGA 4UTWA 5HUPA 1KM4A 4Z1AA 1K03A 4C1LA 2YFNA 3N19B 2H8ZA 4N4PA 4O18A 3LXCA 1VYSX 4O4VA 3S1XA 5L9FA 3ABOA 3O06A 2PRLA 5KMYA 3DENA 4OWGA 3VNDA 4YMZA 2Y85A 1N7KA 1Q6OA 1W0MA 4PODA 2RDUA 1EPXA 5AYYA 1TQJA 3P62A 4DO4A 1H60A 5D2XA 3PUOA 1I2QA 3I65A 3W1NA 2QCFA 3LCHA 4G1KA 1T99A 2GJNA 7TIMA 3W23A 5CPLA 4KWWA 2GVJA 2YSWA 3UWVA 1WOBA 4HSOA 4ZQMA 1SW3A 1GJPA 4HPJA 4JIPA 3S42A 3G0UA 3L0KA 1XDMA 4CCDA 4XBSA 4DBEA 1SW7A 3IVUA 3ZWTA 3DBPA 3C56A 3NL5A 3M9YA 1MXSA 4JY9A 5D33A 4JS3A 5AHMA 1U5JA 2QUVA 1TPDA 4ZQNA 4O19A 4OE7A 5LSMA 1GG1A 2ZRVA 1HFBA 2ALDA 1WYIA 2J9XA 4CCEA 2ATMA 3DFTA 2ZZ4A 3WJWA 4PA8A 1KM6A 5G2WA 1B57A 3KFTA 3BLEA 3NZRA 2C6QA 3MWAA 5EA9A 1TPEA 4K37A 3NA8A 4IMFA 2VEKA 3PBUA 4O13A 1OFEA 4UTUA 1AK5A 4M7SA 1TREA 1ALDA 2VELA 2R91A 3IRDA 3LHWA 3CWNA 3TA6A 4LVGA 1H7XA 4NJHA 3OBKA 3WK1A 4AWSA 4O52A 2ZRUA 4X3ZA 3UXAA 2A6LA 4P2VA 2VFDA 1TSIA 4FB7A 1TTJA 3W22A 3QQ0A 3E96A 2OT1A 1MO0A 2J24A 3QJAA 2G96A 4RXGA 3PVFA 5K9CA 3EWUA 1L2UA 4MUZA 3TFCA 6ALDA 2PC4A 1DJNA 3IGSA 3FYOA 5I3IA 3M16A 1VGAA 5IBXC 3MJYA 3PM6A 1DORA 4K7YA 2WJZA 5F1VA 4Z1BA 1H7OA 5CPNA 1FWSA 4ORIA 5K9XA 1O5KA 1SR9A 1DVJA 5CG7A 1CI1A 3EWWA 1AMKA 5TQLA 3TE9A 1D9EA 1ZNNA 4UCGA 4L4LA 1OHLA 3STEA 2E77A 3W87A 2TSYA 4UNKA 1W5MA 3TQKA 3O6DA 1D3GA 4O53A 3EWBX 3PB0A 1IIGA 5BNKA 3LCFA 3LHYA 4A22A 4O12A 3TV8A 2VC6A 1Y0EA 2BTMA 4UFIA 1P1XA 1W54A 1H61A 2Z6IA 1VLWA 3GR7A 4IX0A 4CLMA 4M6PA 3A22A 3RMJA 4DF0A 1L6YA 4JX5A 3BW4A 4HSNA 2ZTKA 2ZRWA 4QISA 1KM0A 4LS1A 4O11A 2YXGA 3MP3A 1XBVA 3WFAA 5D37A 4YXGA 2CZDA 1R2TA 4M7TA 3S1UA 2H90A 2QCHA 3NNTA 1W1ZA 1KW1A 1DQWA 1YLVA 1KFJA 1NFBA 3FS2A 4JN6A 3DAQA 5HQEA 3LV5A 4JTLA 1IXQA 2Y62A 1LDCA 4CQ8A 4E2BA 3DKJA 3G24A 1W5OA 5DY2A 2JGYA 2A4AA 1OYAA 3LBCA 3IIZA 3IGXA 2G5WA 3OVPA 3LLDA 2XFWA 2DJXA 4YCPA 3L5MA 3HB9A 5FF0A 3T55A 1LBFA 3U8GA 1OFOA 4UNLA 3NAVA 2QCNA 2YDAA 5HWNA 4NJGA 4K7VA 5EKYA 3WJZA 4AB4A 3TIMA 1QNVA 5KZMA 5FF2A 1R2SA 5HJLA 4ADUA 1SO5A 3I7QA 4M6VA 3NQCA 3ZFHA 3O63A 3UQNA 1KBIA 4TO8A 1LCOA 3I6RA 5D03A 2B7QA 3TH6A 5AHLA 4N02A 2ZQ0A 1M7PA 2E6AA 3W1MA 4UTMA 3PBWA 1Z41A 2QDGA 2GUUA 4RZ4A 1OFAA 3A5FA 2FIQA 3ZS4A 1WOAA 4HNVA 2QJIA 2CLEA 3TC7A 5FF3A 2C0AA 1OK4A 4JYEA 3NQVA 4NXKA 3LHTA 2NXHA 2IQTA 3BV4A 1YDOA 4OV4A 4IUOA 2RKXA 4UMAA 3NQ2A 1XFBA 4CNNA 3P5ZA 1TPB1 1BWLA 3Q37A 4K8HA 3G1DA 3QPZA 1W31A 3W7EA 3E9AA 4DEFA 5F4SA 4CCCA 2I9EA 4GRSA 3TCEA 1ADOA 1G67A 5F2IA 1KFBA 4A3UA 1FBAA 2ZA1A 4EF9A 3NPUA 3TAOA 4LOCA 1OG0A 1ICSA 2QUUA 5J5RA 4UTKA 4IQLA 1GYLA 3YPIA 1GTHA 2JKAA 1KFLA 2FTPA 1PV8A 2TMDA 1WAUA 3KRUA 4WY0B 3HOJA 3BG9A 3W1PA 1VQTA 5DELA 5E93A 3I7RA 3TMQA 1R30A 4AWUA 3SIZA 2NWRA 1QPNA 3FLUA 5F4XA 3DFNA 3B4UA 1TMHA 1UB3A 3Q94A 3HG4A 3C2FA 5DCDA 2VOMA 3EX4A 4C1KA 4DPQA 4IPJA 1A5SA 2Y7GA 2EHHA 5F2GA 1CW2A 3MHUA 6TIMA 3TJXA 4LU0A 2V30A 1KTBA 3UWZA 1UCWA 4IPIA 4X2RA 3NPWA 5DCBA 5I3KA 4DO5A 1P0KA 5D30A 3QW3A 2LLEA 5D2YA 5DBUA 3L65A 3LB0A 1HL2A 1SO3A 2Y61A 3GVGA 5EMUA 3IVTA 4D2JA 4LUIA 5K4XA 2H6RA 3GKAA 1W5NA 2QDHA 4IJBA 1JRCA 4CNPA 2DZVA 2VFGA 4JTGA 3W1XA 1VYPX 1IXPA 3GKFA 2HS8A 2QCLA 4TU1A 1RQBA 3VKJA 2A1YA 2WSQA 3NDOA 3BG5A 5U4NA 4OU1A 2G95A 3H53A 1ME7A 3G1XA 1XI3A 3W7HA 3RFAA 3JS3A 2HTMA 3ABSA 4RKAA 5IBXA 2RDTA 3ATZA 5BW6A 2Z0IA 3L21A 2E1DA 2ZCGA 3B04A 1I2RA 1H7WA 4N6FA 4FIQA 3UWWA 1NAL1 1AL7A 1G4EA 4HIBA 1FXQA 1YADA 3TX9A 1VCVA 1OF6A 3UXDA 1J4EA 3G8RA 4ALDA 1M5WA 1LOLA 4BWLC 1PHWA 2J9ZA 3PG9A 5BMWA 2F84A 2Q3RA 3IVSA 3NQDA 3R13A 4IOTA 1JCLA 1K8YA 5T26A 5KITA 1G7VA 3WJYA 4MIMA 3G1YA 1TJPA 1KTNA 4GBUA 4XZ9A 2GPTA 1Q45A 2V5BA 3IIPA 3MI2A 3T78A 3RLUA 2X30A 4RLIA 4BI7A 1OFRA 4BI6A 3W75A 4RZ6A 4GE8A 3M5XA 3UD6A 2WKJA 4UTJA 2V9DA 1TV5A 4GJ1A 4EF8A 3O05A 1ZY9A 1XBYA 1JULA 4ADTA 4BI5A 3M5YA 3TKFA 4LWWA 1FCUA 4JTKA 4R33A 1FX6A 5D2VA 4K6AA 4BFAA 2X16A 1VHNA 5EYWA 2E6YA 1HO4A 5AC8A 2Y88A 3O1NA 3C3NA 1G6CA 1JVNA 2ZZ5A 5HR7A 1EP2A 1XUUA 2ZZ3A 4JTSA 2NUXA 2VEMA 3E0IA 4Y6GA 3P67A 4WD0A 3NQMA 2WO5A 3EX1A 2E5CA 5FF4A 2BSLA 3QW4B 3GYEA 3VI2A 1H7PA 3GAKA 5AHEA 1M7OA 3W86A 4YCOA 1W8SA 3GNNA 1YPFA 4N9CA 2V8ZA 2NV2A 1YDNA 2DORA 3G0SA 4ML9A 2YPIA 4WJEA 1P4CA 3EX6A 1TPC1 3KXQA 4WXZA 1E51A 5CZJA 1D3HA 1SZNA 1LOQA 1ONRA 5E1QA 4I7WA 1F74A 1A5BA 1WV2A 2BLEA 3W2JA 3LGEA 4FNTA 4QAIA 5HR6A 5DY3A 2C13A 3S6DA 4ZQOA 3M0ZA 3R5EA 1KV8A 3P7YA 3HGRA 4OGZA 4TX9A 3L5AA 4NNCA 2HS6A 1PIIA 4WXYA 3TSMA 3STGA 4UFLA 1K7FA 1KFKA 3PWAA 3DHDA 3HG2A 2YW3A 4K38A 3MP5A 2V2CA 3L67A 1EB3A 1K02A 1A5CA 1LZOA 1O5XA 2QCDA 3F03K 3N2XA 4FNPA 1M6JA 4O0ZA 4M19A 3NM3A 5FEPA 4NJKA 2V2DA 3G1VA 5LNSA 3MI6A 4UFJA 1V5XA 2EKCA 3HPXA 2C1HA 3MHFA 3LRLA 1C29A 2GVLA 1PL9A 3CEPA 1OJXA 3W73A 5CSSA 2RH9A 3B0PA 4RR4A 4H6KA 1I4NA 1VJIA 5H2ZA 5C5YA 3I7SA 4WOQA 3M43A 4Q33A 1SU5A 5FI8A 4TR9A 1PVNA 3DU0A 4MY8A 2VXNA 1LBMA 3N34A 1GVOA 4H3DA 4QIUA 4MOZA 1GOXA 5K7JA 1JCJA 2ABBA 2HMCA 4DXVA 4JTUA 4LTSA 2Y6ZA 4EIVA 2Y63A 1JUEA 1GZGA 3DHFA 5CKSA 2ISSA 3BW3A 2X1UA 3CQ0A 3G3MA 1H7RA 2ZRZA 2QCDB 3STCA 3W1RA 5G4EA 4GFSA 1RQEA 2ISVA 3MYPA 3QYQA 4RV8A 3B0VC 4KKXA 1WDWA 2XN0A 4NZJA 3TROA 3UNDA 4TMCA 3TJLA 4HHPA 3S9YA 2Z6JA 3GLCA 3K30A 2NLIA 3W3OA 1WXJA 4XTDA 3W6YA 2R14A 3BK0A 3FA5A 1DJQA 3DZ1A 3QMTA 2FQIA 2PRHA 4O17A 2ZRXA 1B3OA 4Q32A 2J88A 5AYZA 1RPXA 1VC4A 1EA0A 3M7WA 4XWUA 3USBA 5C55A 4LT9A 3W88A 2NWSA 5GVJA 4AMAA 2A7NA 4MVAA 1OFBA 3TNOA 1HO1A 3BGGA 4MY1A 1TYGA 1EP3A 1OYCA 1K8XA 4O54A 4RJEA 4O1CA 3LXAA 4LC6A 3OVQA 2NZLA 1GQNA 2FB2A 2VEIA 2QKFA 2AAMA 2TPSA 2GOUA 3GIYA 4LS0A 4MZ8A 2TRSA 4I7VA 1ZAJA 3NZ1A 2QCMA 3LCLA 1KM5A 2Q8ZA 4EOUA 2C14A 4CQAA 3G22A 2JKPA 4Y9AA 4Z1CA 2ABAA 4KFNA 2DP3A 1T96A 2OX1A 3PR2A 4JYDA 1EIXA 4FX6M 4MZYA 3W7DA 1F05A 4PTNA 3C61A 1QOPA 3UPWA 3TQ0A 5SWUA 3TMLA 5D02A 3W7NA 1KA9F 1W5PA 4FNQA 3NL2A 2D73A 3GNDA 1ZAHA 2FDSA 1TCDA 1BKSA 3E02A 5KTLA 1Z48A 1O95A 4P61A 4N9EA 3TSDA 3LCGA 4FEZA 2Y7FA 1SZEA 1GVSA 3UY8A 5LNVA 1I45A 2WNZA 1R46A 3DFPA 1FCVA 5I3GA 1T0OA 3FJLA 1PCKA 3LBMA 4IX2A 3CTLA 3W2MA 1SPQA 2XN2A 2CLFA 4ZMGA 3HQ1A 2VFIA 1JQXA 3ATYA 2P0OA 1N55A 1XC4A 5A5WA 3GR8A 5AOUA 4JTFA 3SW6A 3N14A 4DQWA 2C15A 1RV8A 3LERA 5HMSA 1C9DA 2BZNA 3EXSA 4O8RA 3S5NA 3LXBA 1IF2A 2QCCA 1QCWA 3BARA 4Z0SA 3CM4A 4U4MA 3SSJA 4QQ3A 4WQ6A 3W71A 3GB6A 3C0JA 4IXXA 4NXSA 1I2OA 1S5VA 1IXNA 1UJPA 2WNQA 5I3HA 3QZEA 5K3VA 1W5QA 4MJMA 3OIXA 3QQ1A 4R34A 3NG3A 1FCBA 4O1AA 3SFKA 2FPVA 3T44A 4O28A 4LVAA 1AW5A 1PCWA 3M44A 3HBLA 4GUHA 5HWJA 4GWEA 5AHFA 2YGYA 4NUWA 1TIMA 1S3HA 5AYXA 2DZUA 4RCXA 1XBXA 1FUYA 1G4SA 2NX3A 1LRNA 4N9BA 3W2UA 3A24A 3DH7A 4R7JA 2CFFA 3SY5A 4MYXA 4NJJA 3KHJA 1H63A 3F4WA 4R53A 2O7QA 1DBTA 3A21A 3GX9A 1NSJA 4I7UA 2DZTA 3ABQA 2WOQA 3LTYA 5D09A 3Q58A 3QPYA 4BR1A 3P60A 4UFKA 1OX6A 5LHFA 1QMLA 2CU0A 1Z42A 3W85A 5I3FA 2DZXA 3EWXA 1MEWA 1GWJA 3GDLA 1JR1A 5LGZA 4OV9A 3HG3A 4S2BA 4QNEA 3PBYA 4FXRA 1SZGA 1MEHA 1SFJA 1TTIA 3M5ZA 4NX0A 2ZTJA 5C6MA 4JICA 3W7OA 3HIJA 4UTWC 3W7JA 2GJLA 1X6UA 4N6EA 1NF7A 2E6FA 1LYXA 2RHGA 1TV7A 4DPPA 1J2WA 1CX9A 3GK0A 4ADSA 1N8FA 5DXXA 2QJGA 4MZ1A 2ZZ2A 2YCEA 4O57A 2E6DA 4FF7A 4YLWA 1HTIA 4N4QA 1TO3A 4JTJA 4DF2A 4UTHA 3TXVA 4ZVJA 3EX3A 3HPSA 3LRKA 4LRSA 1F7BA 1UASA 3LI1A 3W2LA 3UWUA 2J9YA 3W7IA 4JEQA 1OX4A 2OZ0A 1S5TA 2V5LA 3DI1A 1FQ0A 2C3ZA 1PE1A 3FKRA 3TFXA 2R8WA 4FXSA 1VZWA 1MSSA 3LCIA 3O6CA 1JQVA 1QFEA 3H54A 1DQXA 4JY8A 4M5PA 4ZZ9A 1YXCA 2ZYFA 1YPIA 2RFGA 4O50A 1ME9A 4NU7A 5CZ0A 4NNAA 4HKPA 5CPMA 1EWDA 3NXFA 3U6WA 5LNUA 3TW7A 4U28A 4IGHA 3MBDA 4JTIA 1FDZA 3C2EA 1QOQA 4UTTC 2A2IA 1QAPA 4K36A 1G7UA 3W1UA 1TTPA 4J9JA 3BPWA 1XXXA 2WV8A 5L6UA 2GQ9A 1TJRA 1BWKA 1YDVA 4OT7A 3LRMA 3P8JA 2G97A 1OX4B 2FJKA 2NX9A 4FNUA 3OHIA 1VRDA 5HNRA 4PC8A 4YWIA 4MPQA 4GUGA 2RDWA 2W79A 2WSYA 1THFD 4WOZA 3BG3A 5KINA 3G1HA 3AJXA 4ZQRA 1LRQA 3MI3A 3W7GA 4MLRA 2Q3OA 3GDKA 1W3TA 3TU9A 2A7RA 3W2NA 4UR8A 2J6XA 2EGZA 4O15A 1Z44A 3WK3A 1KTCA 1AL8A 3EB2A 4Y8FA 3PY2A 4JIQA 2ZFAA 1FY6A 1VYRA 3W7RA 1LLWA 5MHBA 1VCFA 5G1YA 1QR7A 2BWGA 2KZHA 3ZR4A 3W1QA 3WJXA 4FHAA 3V75A 3NM1A 5HINA 2PRMA 1ZCOA 3M6YA 1K8ZA 5LKYA 3L0NA 4CNOA 1GPWA 4Z1DA 1J5TA 4XBKA 1XCFA 4DF1A 1KFEA 1OFDA 5CSRA 3PULA 4IWWA 4LV9A 1KM2A 1LROA 3NYZA 3PAJA 4WZHA 1H1YA 4DO6A 4Z0JA 3VE9A 3C6CA 4PCFA 4UTLA 2C18A 3GDTA 4NZFA 3SGZA 1NVMA 3W2KA 3EEGA 2CWNA 1A53A 4ZQPA 4DBDA 5E0KA 5FEXA 3T40A 3TUUA 3RF9A 1B4KA 3W1TA 4LNYA 3QH2A 3GDMA 5K9DA 4O10A 1AW2A 4AWTA 2FPYA 1VLIA 2X1TA 3C2RA 5G1TA 3G0XA 3S5OA 1F73A 1H62A 3LX9A 3GAYA 5D04C 1W56A 1WQ5A 1GYNA 1AG1O 2V0TA 5FESA 4FIRA 4AF0A 4PFMA 3IGUA 2ZA3A 3JRKA 1I2PA 4KWVA 1H5YA 1YXDA 1A50A 3B03A 2WSRA 3WK0A 1O60A 5G2HA 5BRBA 5AB3A 4HPXA 1H51A 1FCQA 4LVBA 3W1AA 3WK2A 3OVRA 4AHPA 2ZDRA 3CIWA 3LCXA 3LI0A 3HGJA 3QC3A 5F2MA 1BEUA 1JUKA 3INPA 3TDFA 3MP4A 2CLMA 2VKZG 3QEZA 1Q6QA 2EF9A 3LHZA 1FWNA 5D05A 2DZWA 1RD5A 3G18A 2Y89A 1H7NA 2VFFA 1JRBA 5EY5A 1NEYA 1EP1A 4UMBA 3NQ6A 1FDJA 3QSTA 1PHQA 2ZZ6A 2FLIA 3W9ZA 1BTMA 4M6QA 2ZZ7A 4LUJA 4E0CA 4AF0B 1ZENA 2A21A 2QAFA 2XN1A 1TV8A 2NUWA 2B7OA 3UPBA 3W76A
chains in the Genus database with same CATH superfamily
3HMCA 3SUWA 1R9XA 4C91A 3TJIA 3LQLA 2E5DA 3S9ZA 2XWEA 2IS7A 3L2IA 3AI0A 3FJNA 3BDKA 1DWGM 1UQZA 1UUQA 1NIUA 1UA3A 2IPGA 2A3BA 4GH1A 3SGUA 4J2PA 4H83A 3TXZA 1OCQA 4J3WA 2D2OA 3KS5A 1JDAA 2YB1A 4O16A 1EHNA 1ME8A 1A5AA 3PUDA 3TK7A 3TYEA 1ZAIA 3CS2A 4IGNA 5FEWA 4NNBA 1CXLA 5HQLA 4JKLA 4BK9A 3KOYA 3IIXA 4MY9A 4RK8A 2CKSA 4AZCA 5DXYA 1ZP3A 3IPWA 5JBEA 3LHVA 2GJXB 3SJNA 1P5BA 4RXFA 1JL8A 4WGXA 1Q7ZA 3M64A 2FFCA 2QCEA 3QY6A 4KCVA 4KCWA 4BKNA 1GOIA 5EPDA 3W7PA 3EDDA 4LSBA 1HJXA 1FXPA 4PBFA 2HXTA 5I3DA 5HUOA 1K4GA 3VC5A 3AAMA 1LTDA 5LYRA 1MW0A 1TQXA 4UTTA 3M0JA 1VS1A 1GVQA 1EDGA 2FVLA 3K1GA 4HBKA 1WE5A 3PPFA 3UBPC 4LPCA 2W0UA 1B3VA 1Z89A 5CJMA 4GK8A 3ZMRA 3AO0A 3UXKA 1EUNA 3EGJA 4AZCB 2EO7A 2WJFA 3PTKA 2GSJA 1OT1A 3L5LA 4CQ9A 5A6AA 1AW1A 3DFQA 2JBMA 3P93A 3R43A 3GHTA 1CWYA 4A2SA 4N9DA 5TBOA 2OB3A 2VURA 1TRIA 4WY0F 4ZB2A 2DVTA 5LNWA 1C8VA 5LGXA 3DN5A 4QJ1A 1FWBC 4LQ1A 1IXOA 3UZ5A 2ATSA 1V0NA 3CC1A 1PZ2A 1RALA 1RR2A 4GC4A 3ITGA 2D0GA 2KX9A 3L68A 2VD9A 4HK6A 4NZ4A 5DLCA 4N7QA 1QVBA 4C6FA 4ZO7A 3AZTA 2VZOA 2E9MA 3GXTA 3WQEA 4F79A 3ABXA 4R27A 3ALGA 4JD4A 1GHSA 1W1TA 4UR7A 4NP7A 3EOEA 2QGYA 5LHEA 4LEQA 5CZSA 3BMVA 2RGLA 2WBGA 4GBDA 2X05A 1SZRA 1ISVA 2OMAA 3DI0A 4LBSA 3RPTA 1QDSA 3HO8A 2GYIA 4KEMA 4W7WA 4A8NA 3ANYA 3KLLA 3OLGA 4GCAA 3CHVA 2A5HA 3TQVA 5C54A 4A29A 3C86A 4LAKA 1DHPA 3FSUA 1TRDA 5G5IA 2YW4A 5F4WA 3AYVA 2ZBTA 1T8XA 1EIBA 1NTHA 5JBDA 3LD5A 5HWMA 1YTEA 6A3HA 1V02A 3UVAA 3RX2A 1EHAA 4P8WA 3WDHA 1LL7A 4KIRA 3BOXA 1TPH1 2QDDA 5CGQA 4LY8A 1CEOA 4Y96A 3W7CA 1L6WA 1GOWA 2QIIA 3MUIA 4JX6A 2YZRA 4O1DA 2VX4A 4O1BA 4ZQCA 4C7FA 3H4GA 2ICSA 1CXIA 4KWSA 4WUIA 3B8DA 2YX0A 3CIXA 2JGQA 1EL3A 1JD7A 2VDIA 4OZOA 2H3DA 2H8XA 3VNZA 4HCDA 3D46A 2CZFA 5CLTA 1NOFA 3W26A 4CNTA 2DT0A 3DGRA 2GSHA 3VNLA 1LWHA 3LDVA 2PDUA 3AIWA 2YJQA 3F1QA 4PEEA 1SJBA 1UZDA 3NTYA 4KH2A 1OC5A 3FSTA 4Y90A 3T8LA 1FWTA 4CEUC 2AQVA 2Z2AA 2E09A 3VM5A 2FHBA 3GXNA 5CXPA 5G4HC 1TJ1A 3B8TA 3OA5A 1PSCA 3BW2A 3ARWA 3T81A 1LRTA 3KOFA 1EF3A 1XDLA 3GHUA 5AZ1A 1G4PA 1W3IA 1JJKA 2V5JA 2GFTA 4G7FA 4PMRA 2VFEA 5KZ6A 1MEIA 1XD0A 2O7SA 4LS2A 1E1CA 4POCA 5KSWA 1PWLA 3V1PA 2PDPA 3D6NA 3G1RA 2ZA2A 4IQEA 1BAGA 2DW6A 2V2HA 1PKMA 4FOJA 4B16A 4GKTA 3QOMA 4KCTA 2E5BA 1F9CA 4IXHA 5AVHA 4DO7A 1GOQA 2C16A 1AMYA 3M0XA 4NVTA 3WJSA 1LP6A 2GDVA 1CGYA 3OW1A 3EXTA 2PDGA 1R2RA 3NOEA 2Q01A 4YNGA 2ISWA 3K8LA 1PKNA 2I17A 1QK0A 2P10A 2FTYA 2NXGA 1PPIA 5E70A 3QBUA 5HMDA 3PF3A 5IHRA 2OU4A 1B9ZA 4GUFA 3W72A 1T8QA 2DSWA 4HVXA 4I3GA 3VKDA 4GIRA 5HULA 2GK1B 1OCNA 2WMIA 3EOSA 5C70A 1WX0A 4EWND 1JZ5A 3BGJA 3H6OA 1TMQA 3MANA 4FALA 1XM3A 3M5VA 2XIMA 1RCOB 3QM3A 1W91A 3VCRA 1UKSA 4Z17A 2BOEX 2R1PA 1I2NA 1MDRA 4QNWA 4HNUA 3PPHA 3NFUA 4JFVA 3EWZA 2CBJA 2QF7A 4IIFA 3LN3A 4S3KA 4LF1A 1UKTA 1VJZA 3DERA 2WYSA 5FJJA 3VC6A 3QSRA 4AHOA 2F2HA 1XYZA 4EXAA 3E5PA 4TIMA 1CDGA 1XYFA 3G8EA 5FJPA 5A8MA 1UBSA 3ARTA 4O14A 1AH4A 5DX7A 2X2GA 2X1SA 2WMIB 1KBJA 2ZC1A 2PDYA 3LHUA 1DL3A 3M41A 3E49A 3WQ4A 3RAOA 3B4YA 2B0MA 3NPVA 4KMQA 2A6NA 2ZUSA 3MW7A 2V63A 4TMBA 1YPXA 4H4IA 3KM8A 1KXVA 3BAXA 2VUNA 4E38A 5HXMA 3VD5A 1V02E 1KM3A 1RCXB 1B4EA 3W1LA 2RJGA 1M01A 2EG6A 1UUMA 4OQVA 3P74A 3WMLA 4ZA0A 3UJSA 4GABA 3B0YA 1JYVA 4IMDA 3N2MA 2INEA 1IGSA 3F4NA 1D7FA 1E3ZA 4Q4KA 1MXDA 1W3NA 2UY2A 1BRLB 1KLZA 2V69A 4I9AA 2PUZA 4KFPA 1YTKA 3ABRA 1ZUAX 4JTQA 3Q2DA 2ZE0A 1NFPA 2QAPA 5GPRA 1EFZA 1Z69A 4AEOA 4UBPC 4FLOA 1RQHA 2HRWA 4PMZA 1GG0A 1K3UA 1WZLA 2JKEA 2I56A 4F0MA 3OGVA 3PG8A 2X8RA 5I06A 4ENLA 1JEZA 3DKLA 5IM51 4URIA 3EKLA 1GOOA 4NQ1A 1VPXA 4C7DA 1WA3A 3CPRA 3ELFA 3CWHA 2VL4A 3EBVA 3DOPA 3N4AA 1K77A 1UD4A 1HP5A 1O7AA 4I9MA 1YBQA 2NLYA 2W6RA 3QC0A 3RR4A 1QHOA 4S1FA 1TWSA 5REQA 1XC6A 2CC0A 3WNOA 3RGTA 4AD4A 2Y7EA 2DSUA 5I6SA 1QO2A 2BOFX 2H8ZA 1E9YB 2REQA 4Y9OA 5L9FA 4O4VA 3O06A 3DENA 4OWGA 1SR0A 2R82A 4YMZA 2Y85A 4K3ZA 2XGIA 1FWAC 1Q6DA 4GVIA 4PUEA 4A8IA 3ITXA 3KL5A 5TD4A 3UA4A 2YCKX 1A5MC 1FWGC 1MUWA 4GA8A 3TYBA 4ZQMA 3GC5A 5GQBA 3VZZA 1FWJC 1YBQB 1RH9A 3FEQA 2OLSA 1O6IA 5IDZA 4XBSA 4KETA 1LLOA 2FGZA 3IVUA 1LWIA 1OC6A 2VT0A 4JY9A 3M9YA 3T08A 1HT6A 2YXXA 1F8MA 4FP1A 4ZQNA 5A6MA 3WQ6A 1CBGA 1EJWC 5LSMA 3GNPA 3GVVA 2ATMA 3WKZA 4C6EA 1VF8A 1KM6A 1B57A 3BLEA 3CYVA 1IV8A 2C6QA 3RLGA 4K37A 3SN0A 4PMQA 3PBUA 1A3HA 3LPOA 4AD5A 4DI9A 4XD4A 1ALDA 3N2BA 1LT7A 4UOQA 1E15A 4LVGA 1FKWA 1MUMA 4AWSA 5MKGA 2Y5SA 2CHOA 1RP8A 4X3ZA 3UXAA 2VFDA 1Q4WA 1TTJA 1GOKA 4GVFA 1RBAA 2OT1A 3H4XA 4HNLA 2X09A 3D3AA 4QJ3B 3VIGA 1NY1A 4MUZA 7REQA 3SRFA 3HURA 2PC4A 1DJNA 3MSDA 3M16A 1OD8A 5IBXC 3MJYA 2VGIA 1MW3A 1OIFA 1DORA 5A8QA 1CPUA 4ORIA 5K9XA 3A47A 3FX4A 3OZYA 3R10A 1DVJA 2YL5A 1S38A 1CI1A 2EG7A 2PF0A 1ZNNA 4KW2A 2V3DA 3PZGA 1B5TA 2VQTA 5MKGB 2G3FA 4GI6A 3U5YA 2NSOA 1GW1A 3JUGA 1GK8A 3LPGA 2J74A 3UJ2A 1JPKA 3IJIA 3CQKA 1W5MA 2QQ6A 4HK5A 3V4BA 3CAVA 1E0TA 7REQB 4IFKA 3S2JA 3LHYA 4A22A 1R8LA 3EMQA 2BTMA 2HVMA 2VWTA 5A69A 1D8WA 3FDKA 3GR7A 4FR1A 4QDMA 4ZTYA 2Z26A 3BSGA 4WHBA 3BTNA 3VD7A 1FWCC 4BJHA 1KM0A 2YXGA 1XBVA 3W38A 3PJUA 1M7XA 1QI0A 4JQ2A 1AFSA 2QCHA 4G56A 4Q8VA 2HPIA 1W1ZA 1NWSA 1NFBA 3TYUA 3F4VA 3LV5A 1IXQA 2ZUVA 2PWDA 1LDCA 3VIKA 1W9UA 3HA1A 2JGYA 2A4AA 5GJMA 3LBCA 5CC6A 3C5QA 5HNNA 4X61A 3LLDA 3OB8A 3T55A 1LBFA 3U8GA 2XIIA 2PTXA 4UNLA 2OFJA 2QCNA 4HU0A 4YPJA 4OTKA 3WNKA 3R11A 3UG3A 3BAWA 1Z7AA 4M82A 3TIMA 3BMWA 5KZMA 1R2SA 1DTNA 4GO9A 1YEYA 3TEVA 2VRKA 3ZFHA 1WDPA 3MTWA 3O63A 5LXEA 3KTSA 1QW7A 1UKPA 1EXBA 2OXNA 3L4YA 1OCBA 2PTDA 4WLCA 2GUUA 1OFAA 3A5FA 1LT8A 2G50A 2FIQA 3ZS4A 1E70M 3SCSA 3CUXA 2FHCA 2NXHA 3IUHA 5H8MA 3BV4A 4KEUA 2W9MA 4YYCA 4LYRA 4UMAA 1TWWA 3LZ5A 3COTA 3GHRA 5E9XA 4UB9A 1TPB1 4CNUA 2OLHA 4K8HA 3RXZA 5C2CA 3MB9A 3GZAA 3QPZA 5T8GA 3BLDA 3QZ6A 3TCEA 5F2IA 1UPMB 1KFBA 3U48A 4DJDA 3TAOA 1ICSA 1C7SA 6REQB 4PYSA 4AX6A 4S23A 2VR5A 3CMJA 1ZLPA 1GVYA 3SY1A 5B7YA 2ALRA 2Z4GA 3PZMA 2CITA 4WY0B 1GGOA 1VQTA 2VCAA 5DELA 2HK0A 1R30A 4AWUA 6TAAA 2J77A 1QPNA 3FLUA 2GVEA 1QNPA 3B4UA 1TMHA 1EGVA 3MU7A 3C2FA 3QHOA 2VOMA 4DPQA 1Q6EA 3V18A 4Y8EA 4FZIA 2Y7GA 3CT2A 3MDUA 1Q66A 1J0HA 3UWZA 4IPIA 1L6FA 1L8PA 2V5KA 5D30A 3WLPA 3B40A 2HNHA 3UR5A 5EMUA 5K4XA 3M4HA 2QDHA 4C5YA 2VI0A 2A79A 2YZ5A 1A5OC 4DM2A 1F61A 1IE7C 3VD9A 4JTGA 1XPYA 4W7VA 2J8GA 1VYPX 4OFCA 5DMYA 2QPSA 4HNOA 2QCLA 4TU1A 4ZFMA 2WSQA 4INFA 4HD5A 1HP4A 1Y7VA 6ENLA 5BROA 3R0UA 4WDUA 4HP5A 4D6EA 4OU1A 2G95A 3GYCA 1TG7A 2A3HA 1NWUA 1XI3A 3K1DA 5JQ9A 3GC2A 3CIVA 2CNCA 3ONBA 4YHEA 4HYVA 5B7ZA 4A3RA 3HV9A 5M17A 4V15A 2ZCGA 2X7WA 1V93A 1I2RA 1H7WA 4N6FA 1MMFA 4HIBA 1RK6A 2PPGA 1J4EA 4ERAA 2ACSA 1XGEA 3QHNA 1LOLA 2VEGA 3O0KA 3W53A 2J9ZA 1U33A 3KL3A 4E5TA 3IVSA 1QI5A 1AZ2A 2OGYA 3G1YA 1BYAA 1TJPA 3BZJA 3WLJA 3EB3A 2ZXBA 3MI2A 1KGXA 3RLUA 2AL2A 4B3ZA 4YVVA 1JZ8A 4BI7A 1E9LA 3FXYA 4PTXA 2BODX 4BI6A 3W75A 4GE8A 2QLYA 5BXPA 4WF7A 2Q6ZA 1XINA 2GDUA 3W27A 4BI5A 4UCFA 1G9HA 3VUSA 4OIFA 1FCUA 3PUGA 4PB5A 3DYOA 4ROPA 4TX8A 4MWAE 1E72M 3FCPA 5EYWA 2E6YA 3VINA 2XSBA 3G2GA 1XUUA 2VEMA 3E0IA 3QLDA 2NT1A 2E5CA 1NFGA 2PGEA 3VABA 2BSLA 3UGVA 3VI2A 3R4IA 2IXVA 3PZIA 2VX7A 1QI2A 1DJWA 1E3XA 2BDQA 2V8ZA 3MCOA 3AIBA 1YDNA 2DORA 1YMYA 2YPIA 3VOJA 3CHCA 4GH3A 3KXQA 4WXZA 1E51A 1SZNA 2CKRA 2PGWA 5DY3A 1E4LA 3M0ZA 3B9OA 1V77A 4NNCA 4WXYA 2UZ9A 3WMSA 1PDYA 4B9ZA 1MZRA 4PFHA 2BGQA 3DHDA 5I03A 1LZOA 1O5XA 3N2XA 4FNPA 1M6JA 3QV8A 3QGVA 4JKMA 4M19A 4BQ5A 2YBVA 4MB3A 5FEPA 2C1HA 3IUDA 2DEPA 3E38A 3LRLA 1KKRA 1FFRA 3ARUA 4FAMA 4PULA 5CSSA 2RH9A 5C5YA 4WOQA 3CUFA 3DU0A 4BY3A 4J3TA 3N34A 4NILA 1GVOA 3JW7A 1REQB 2EJ1A 4WKFA 3KL0A 1GOXA 4AQLA 2RGMA 1C7TA 1AJ0A 2ABBA 2HMCA 4D8ZA 4JTUA 3UG4A 2NVAA 4LAOA 3BW3A 1ECQA 2ZDSA 3W1RA 1RJQA 5G4EA 4JHMA 2Z2BA 1DWHM 1YX1A 2NVCA 2YB4A 2BY1A 2D69A 3TJLA 4GI8A 3MA8A 4JN8A 5BXSA 2SFPA 1R7AA 4XTDA 3BK0A 3FA5A 5EMKA 5HJYA 2FQIA 4R9OA 2PRHA 2ZRXA 2AKZA 3E2RA 4BQ3A 4IG2A 1VC4A 4C6OA 3M7WA 1EA0A 5C55A 4IIDA 4E8GA 2HVNA 1HIZA 1OFBA 3ZIZA 3NVDA 1EH9A 3BGGA 4MY1A 4AZ7A 1TYGA 1I6NA 1OT2A 2XWDA 1OYCA 4O54A 5AY7A 1GQNA 4ZE5A 4JCMA 1Q4NX 1ZAJA 3NZ1A 4B5WA 1V51A 1KM5A 4L1WA 2Q8ZA 1UR9A 4EOUA 2C14A 4KFNA 2DP3A 1P43A 2VO5A 4JQ1A 5CBJA 2OX1A 2YA2A 1EIXA 4FX6M 4MZYA 1F05A 1VB9A 4AY7A 4IG2B 2F61A 3TQ0A 2ZC8A 5D02A 4DBSA 1KA9F 1W5PA 2PAJA 2WCSA 1TCDA 3JZUA 5JUVA 3E02A 4A4AA 2E1WA 2OYMA 4DWSD 4FEZA 4QE1A 1K6AA 2XJ7A 1GVSA 2QMJA 2XUCA 3DFHA 4DWSB 3CTLA 3FXGA 3PK7A 2XN2A 1TA3A 2W61A 4J40A 4ZMGA 1YRRA 4FSAA 2VFIA 4WEVX 2VR2A 4KGLA 5ABFB 1VPQA 5A6TC 3N14A 1P6BA 4D71A 3SB0A 3RMEA 1VFTA 2PDKA 5HMSA 1C9DA 3EXSA 3SUTA 3SN4A 5HATA 3S5NA 1S1RA 1TZ9A 3WLTA 1IF2A 3P0WA 1Z6KA 4ZGYA 1HQTA 3BARA 3THUA 3B8UA 3ARVA 3WCZA 1AQFA 3HU7A 4JFWA 1M04A 4L7ZA 3GB6A 3URQA 2DPEA 2C79A 1GQKA 1S5VA 1JYXA 1BYBA 1W5QA 3OIXA 3Q65A 4A3QA 1CGWA 3CBWA 4PMNA 3AS1A 1FCBA 3ZT6A 4O28A 2C8NA 1CXKA 4L6OA 8XIMA 2CPUA 1EDQA 2DZUA 4LFYA 4DNHA 3M46A 5TF0A 1HNYA 4N9BA 3W2UA 3A24A 3SY5A 4MYXA 1W1A1 2C1GA 3F4WA 2O7QA 1DBTA 3OO2A 2VX5A 3A21A 3GX9A 3WLRA 4FXFA 3QPYA 4NRRA 4BR1A 3P60A 2PD5A 1VIWA 1JPIA 3N15A 1V7AA 5I3FA 4GIAA 3WQGA 4YTTA 1K70A 2ZVIA 2WVVA 3IJDA 1MEWA 3IAQA 3WD0A 3HG3A 1XDJA 1TTIA 4NX0A 3URNA 5C6MA 3W7OA 4NAFA 1NF7A 3WBAA 4JBRA 1Q6FA 3H2MA 3JU2A 3GK0A 1N8FA 1UP3A 1OY0A 1UKOA 2E6DA 3WEZA 3EYPA 3EPMA 3VFCA 2PDIA 3VD4A 4DF2A 4JN7A 4UTHA 3TXVA 4ZVJA 3HPSA 2CETA 4LRSA 3CJPA 3LI1A 3MY9A 2J9YA 1RXOB 3TA9A 2OZ0A 2C3ZA 4H8VA 3FKRA 3DEQA 2QHAA 2XPKA 2OODA 3BICA 4QCEA 1VZWA 1M7JA 4S3EA 1JQVA 3H54A 4JY8A 1W1PA 2G0WA 3DFYA 4GQQA 4IICA 4ZZ9A 2PTZA 4O50A 1ITXA 3AWNA 4W85A 4HKPA 4DUXA 5CZKA 4U28A 3AICA 4NYUA 4JTIA 5M3WA 3H7VA 3C2EA 4UTTC 2A2IA 1QAPA 1G7UA 3IRSA 3W1UA 4AD2A 5I5RA 4XZNX 4J9JA 2WV8A 1DWJM 1XLAA 1YDVA 4H8UA 3FGCB 2NT0A 4PR4A 1J0JA 4I6KA 3TYCA 4D1JA 2B81A 1UPPA 1VRDA 2QF8A 3GH7A 2IPJA 5HNRA 4QE5A 3LGDA 1I75A 4WOZA 5I23A 3BG3A 5DEZA 2VZVA 3G1HA 3WF2A 5EMYA 3UGRA 3MI3A 2VDHA 4GISA 1B3WA 2Q3OA 1W3TA 3QTPA 1L0PA 1QW8A 5HOSA 3W2NA 1W2PA 2PDQA 3N04A 2BXYA 3ZVHB 4WR3A 1WDSA 1FY6A 4GZEA 1LLWA 2WSPA 4A6GA 5ENLA 1HGYA 3QGAC 2BWGA 3WH5A 2KZHA 1NH6A 4B2DA 1AD1A 3W1QA 3P2VA 3G6LA 3HPFA 4XBKA 1DWAM 1OFDA 1KCLA 1R0MA 4IWWA 1KM2A 4WZHA 1BSLA 5BRQA 4PCFA 2YIHA 1XH2A 3UF9A 3SGZA 4NZFA 1NVMA 2FGLA 2EBNA 2DT2A 5FEXA 3T40A 3W1TA 1AW2A 2GGHA 2FPYA 3C2RA 2O9OA 5G1TA 4IP7A 4TV6A 4W88A 1H62A 4X2PA 1FWEC 4DJFA 1EA9C 4B2DD 7ENLA 2NQ5A 1CGVA 1EX1A 1W1YA 4YWSA 3CZ8A 4OOZA 2ZA3A 3IWPA 1RPKA 3SUVA 1TWZA 3GIPA 3W1AA 2F2KA 1Q5MA 5FJOA 1P0EA 3GM8A 3CL8A 3QC3A 1X8CA 1BEUA 1A47A 2GL5A 3TDFA 2CLMA 1UWIA 4Z2GA 3AHXA 3R6IA 3UEQA 2PA6A 5D05A 1EBHA 2GDQA 1PX4A 3DC0A 1P6CA 2OVLA 2Y89A 4DJFD 5DO8A 3SADA 8CGTA 3NQ6A 5I7GA 3VXGA 3VNIA 4KERA 3A4XA 2ZZ7A 1ZENA 2OOFA 2FVMA 1HN1A 2OWXA 3LLXA 5FJTA 1E6XM 4PRWA 4P7LA 2OTDA 5I3IA 4W9TA 3SZ8A 3N18A 5K2ZA 3BJSA 1C93A 4LB4A 5CAKA 1W8GA 4LUTA 1EX5A 1V0MA 3UVIA 4FXJA 3TN4A 4C6PA 3BAJA 1C8XA 1L8NA 1V6YA 1SQ7A 4U2YA 3R12A 1ODUA 3GUGA 3R8RA 2XGBA 2FJUB 2O56A 3KZPA 2VEFA 3B05A 2TYSA 2EXOA 1OX5A 3UWYA 9XIAA 1KM1A 4QDWA 1P48A 4QLJA 2YA1A 4PCSA 1G01A 3WY1A 4AHQA 4CN1A 1OQFA 4FNSA 4C60A 3W00A 3TC3A 3MBFA 2EPLX 3F4DA 1TPWA 4WX2A 4RZ5A 1SFLA 3ITTA 2W66A 3LM3A 1W9BM 3CHEA 2PC8A 4LUTB 4JXCA 3CB8A 1LLZA 3DESA 3P3BA 4LUSA 1A5KC 4JTHA 4HN4A 1DYSA 3I4EA 3B0XA 1SUXA 4IQDA 1JYWA 1H2JA 4TOQA 4DAIA 2G8ZA 3ZVIA 3RX3A 4NAEA 3PC0A 1W9DM 4XIMA 3T0CA 2QPUA 4IQJA 4CUCA 4JTEA 1RA0A 5A2CA 2J7GA 3PS7A 1GORA 4UOZA 1EYEA 4RE4A 4IHCA 2GQ8A 2QUTA 4JNMA 4P7QA 1C90A 4RW5A 1FDYA 2OG9A 1RZMA 1U22A 4JIHA 1S5WA 4AY8A 3RU6A 3N13A 3WBYA 1J0IA 4LUSB 1EQCA 4X9SA 5IDIA 2Z24A 4HPHA 3V5CA 2XISA 2H9AB 1UG6A 2ZXDA 1BTCA 3QGKC 5K4ZA 4BWLA 4DYKA 3HPZA 4IPLA 4NAEB 3P61A 2CW6A 2VJXA 5E6ZA 4DY1A 3SDOA 4DJED 2PGRA 3SIMA 7TAAA 1JPMA 3STFA 3G77A 3KP0A 3SCQA 3TTOA 4DVOA 4GUJA 1WNOA 2OT0A 4FI4A 1FWWA 1X7FA 4Z08A 1J96A 3TVAA 1B3YA 4QP0A 4FNRA 1XUZA 4FLRA 2RJHA 4NY2A 1J6OA 3M6DA 4H9XA 1OVDA 1JAEA 3JVAA 5XIMA 3WLQA 2QYGA 1IT7A 1ZU8A 4JQ3A 3B9AA 1IHIA 4O4WA 2BXVA 3W7LA 1EUAA 1HKIA 1U5VA 5F1UA 3FJ6A 4BS0A 1XKYA 1ML1A 3WQ8A 3C2OA 2BMBA 3EWYA 1SW0A 3IIVA 5A8GA 5BOOA 4FK9A 3CAWA 3WSUA 3AHTA 3RNDA 2DIJA 5U7SA 3AALA 5I2UA 3V5FA 4AVFA 5CPQA 4HYWA 2V3EA 1I8JA 3GS6A 1FP8A 5FKYA 3WD2A 4GMEA 5HANA 3E2QA 2ON3A 1YKWA 2V5CA 3P80A 4U5IA 4AYGA 4QM1A 4A21A 3UCCA 4HA1A 1YIXA 1EOKA 4QBXA 3HGOA 4K1GA 3LM7A 1BVZA 3TR2A 2PDXA 3SCPA 1XLIA 1XCWA 2V81A 5I00A 3FA3A 1BHGA 3GXPA 3OYXA 3WQFA 3VDBA 2G37A 3ZWSA 4Z2IA 4L4MA 3KW3A 3PSVA 2JIWA 2VNCA 4C6NA 1XF0A 2WZTA 1IWBA 2NV9A 1IEIA 1X1OA 1MUCA 3N6JA 4G9PA 2A0NA 1R85A 3OG3A 1GEHA 1GKPA 1ECEA 3NDZA 2XFYA 3MV11 4J3XA 3T0TA 1GPFA 4NG3A 4Z2KA 1K7XA 3WELA 5DN1A 1S2TA 4FX8A 1GUVA 3GNOA 4XUYA 1H4PA 3GDBA 3ECQA 3W7QA 3M0VA 1XLBA 2X1RA 3G1SA 3TYZA 2OJPA 1KQYA 1PIGA 2QVNA 3PBVA 2CLOA 2D22A 1TPUA 1YNPA 1DWFM 3N17A 1F4AA 1JF6A 4MUPA 1ICQA 4F48A 1PJ9A 3ICJA 3O07A 4H41A 3PTDA 4GNJA 2WWCA 2I1OA 2Y4SA 3E6EA 1HKVA 2GJRA 4HA3A 3A9IA 4JDYA 4LGXA 1L6SA 3TNBA 2E0PA 3EDFA 1MQRA 3KVLA 3Q4DA 1G69A 3G1AA 1FVPA 1J0KA 1KCZA 3CB3A 3C0LA 1KRCC 1JCXA 1PZ3A 3FY1A 4MLJA 1RBLA 4HU3A 1GQLA 3B0UX 2VGFA 4RPPA 3MO7A 4RDWA 1KCXA 4CD8A 5CBBA 3T2QA 6PTDA 1US0A 4LYQA 3AS2A 3PB2A 3O8AA 4L65A 1PBGA 1U1HA 3P82A 1SMAA 3WUBA 3HGSA 1SO4A 2WQDA 3T07A 3RPMA 5BYWA 3URBA 2YR1A 1U1UA 5E6YA 1XL9A 4QROA 3NZPA 1T7LA 2DZPA 4WIWA 3K2GA 1U1JA 2IKIA 2PCQA 2BHYA 1K9TA 1DTUA 3F7JA 2EPMX 1JXKA 2V68A 1UWUA 3L0GA 4ZEPA 1FWRA 3QF0A 1F5ZA 5AHNA 4HMDA 1X6NA 2OCZA 1EJTC 3R89A 4E2DA 1DJYA 3FDGA 1LOSA 1RLCL 4LYKA 4EX4A 1V3JA 2Y5JA 1ITUA 3OG2A 2G3NA 5KZEA 3AYRA 1XIIA 2I5QA 1QHPA 2VC7A 1GVRA 3PNUA 4HHLA 1I1XA 4Z42C 1OK6A 4MNKA 3SI9A 1SZFA 1R3VA 2J47A 2W91A 1XLJA 2HNEA 3H4WA 5IFTA 1TB3A 1TVPA 3D0CA 2AGKA 2HK1A 4ZENA 3TONA 3WDIA 3GSMA 3KRBA 5CC3A 4LC8A 4JYFA 3PFRA 1W6TA 4RX0A 3QVQA 1IWAA 3ZT7A 1ITCA 1DV7A 3RRAA 2BY3A 4PUKA 4HTBA 1L2QA 3GD6A 2Q8LA 1J93A 5E09A 2HBVA 4BA0A 1HJVA 4E3TA 2J66A 4LEFA 3TYDA 4CD7A 3CUZA 3BLIA 4MJ2A 4B3KA 5AFDA 3ALFA 1NARA 1GJWA 3TC6A 3CH9A 2XVPA 1OF8A 1ISZA 4AD0A 1HKWA 3S8HA 3C4UA 1B9BA 8TIMA 4NZCA 1VFMA 1XBZA 3NEVA 4JL2A 5IRPA 2Y7DA 4LCQA 3JR2A 3C52A 3OLIA 2WMHA 2VENA 2PURA 4MWAC 4NIRA 1QPRA 2WQPA 1ZALA 1SMDA 1IIHA 3NJ3A 3WFLA 4BF5A 3WG6A 1KFCA 4F40A 1OWQA 4DAFA 4HN8A 1DJHA 3MSGA 3IV8A 4AAJA 3KAOA 4H8NA 4JTCA 5ABHA 4UTFA 1OABA 2YCLA 2ZICA 3GNXA 2NXIA 3OBAA 1KM4A 3FNDA 3KTXA 3N19B 1BLIA 4BQ2A 3LXCA 1CB7B 3S3GA 3S1XA 1W9VA 2PRLA 5KMYA 3FYYA 4ZXOA 1N7KA 1W0MA 2Z7GA 4PODA 1A5LC 5AYYA 3WH6A 1OM0A 2FH8A 4H19A 3P62A 3K4WA 3WF3A 4ZO9A 1I2QA 4DJDC 3QR3A 4HZ6A 3W1NA 2OZTA 3LCHA 3V3WA 3W23A 4KWWA 1BXBA 3BE7A 4EKJA 3UWVA 1ZTVA 5EMMA 1GJPA 4HPJA 3OU8A 5C8BB 5HBFA 4GGBA 4AD1A 3IACA 5I0DA 3ARZA 3L0KA 5I02A 2YCLB 3ABZA 4QQUA 3UJRA 1TVNA 4CCDA 4D9PA 4UQEA 1K9EA 1XLGA 1VKFA 2UY3A 5KEZA 5AHMA 2AKMA 2XTKA 1GQIA 2JQXA 4CQCA 2XH4A 1HFBA 3REQA 1WYIA 2J9XA 1BXCA 1J0ZA 2HV5A 4EPKA 3S83A 2YL9A 1UH3A 1TPEA 1KBLA 4F0LA 3K5XA 2EPNA 3RG6A 4MSSA 5D8ZA 3W01A 1AK5A 1VP5A 1XISA 1W3KA 2R91A 2WPGA 3IRDA 1NDWA 3LHWA 2VCCA 2CERA 1B3XA 1O68A 2EKGA 4YHGA 3GH4A 2ZRUA 2A6LA 3MDWA 4NZ1A 2QUNA 3QQ0A 1KXQA 3PZNA 3QJAA 2G96A 5I79A 4AVNA 4Y9NA 3EWUA 4CVUA 1L2UA 3TFCA 3IGSA 1BVWA 3NIYA 3ZJ7A 1NJJA 3B3DA 3MKKA 2C91A 1JZ6A 1RA5A 3VD3A 2CWXA 4DZAA 3WMCA 4K7YA 1K8CA 4V1XA 4B92A 5F1VA 4Z1BA 4D72A 1H7OA 3BQ5A 5J04A 4JHOA 3TTQA 4S38A 4Q4RA 3TZFA 5HMEA 1QWKA 5TQLA 4AZBA 1XFCA 1E71M 3TE9A 1D9EA 3L2LA 3UESA 4PBEA 4UCGA 4L4LA 1OHLA 4Q4OA 2CBIA 4MDPA 3AXMA 1F4HA 4FOKA 4FLQA 3GFXA 2TSYA 4J3SA 2ZADA 1QOXA 4O53A 1OSEA 3EWBX 3SEPA 3PB0A 1DPMA 3CH0A 4OBSA 4Q4QA 2VC6A 1B1YA 4ECLA 1CECA 1E4IA 1L6GA 2ZX5A 1JZ2A 2J7BA 1PTGA 3T0DA 2GGGA 2Z6IA 5LA2A 3GU2A 1MNSA 3ARSA 3A22A 4DF0A 4HJWA 5CSYA 1L6YA 4HSNA 1V3MA 2ZTKA 3EDEA 1MFUA 3PPCA 1V3IA 3WFAA 5D37A 3VOFA 1S2AA 4YXGA 3CV2A 1R2TA 2O0TA 1X38A 4IP4A 1KW1A 1DQWA 5HQEA 3UCDA 3L2MA 4AG0A 4DHGA 3V7PA 3APTA 2Y62A 1XHGA 2O4QA 4CQ8A 2QNEA 1OYAA 1B0IA 3N12A 1G5AA 3OVPA 2PDWA 1BF6A 3A3XA 4I8DA 3HB9A 5FF0A 4YTQA 5HWNA 4NJGA 2PCEA 4AB4A 1C3FA 5FF2A 2MANA 1H1NA 1SO5A 3BWWA 3VDGA 3UQNA 2XG9A 1LUCB 3SUUA 5JH1A 3PFMA 1Q2SA 2ZQ0A 3NQBA 1BPLB 2E6AA 1R9ZA 3PBMA 3PBWA 1Z41A 3KCJA 1NP0A 3QKEA 3SCVA 5JBFA 2JEPA 4Q4SA 1T6MA 1XRVA 2CLEA 3GVQA 3SBFA 3TC7A 4UQCA 2PB1A 5FF3A 3C3UA 1OK4A 4JYEA 1ZJHA 4F9JA 3NQ2A 4A3HA 3VIJA 4J2MA 1U2YA 1FHDA 1W31A 3E9AA 4CCCA 1UD8A 2I9EA 2QT3A 1ADOA 1G67A 4KPLA 2J62A 1FBAA 4EF9A 2INZA 3R8HA 2W63A 2Y8UA 1OG0A 4Q22A 4PSRA 3H7RA 2O9PA 4UTKA 4IQLA 1GYLA 3YPIA 1KFLA 2XH0A 3W0KA 1PV8A 2TMDA 5A6SA 1TX2A 3BG9A 3TN5A 3TN3A 5E93A 3GG7A 4OVXA 1CGXA 3PPGA 2ZUNA 2NWRA 3EA1A 3N1AA 3EX4A 4C1KA 4IPJA 2D0HA 3A4JA 3PBGA 5CC5A 1CW2A 3MHUA 4AW7A 2V30A 1KTBA 3TQPA 1UCWA 4X2RA 3NPWA 5DCBA 4DYJA 1UC4A 4ZOEA 3RCNA 2OPJA 5M2FX 2Z1WA 3A64A 3CNYA 3D5HA 4KWOA 5JH2A 2Y61A 3GVGA 4U5KA 4PMVA 4D2JA 2A3EA 2H6RA 4CGTA 3OZPA 2C71A 4IJBA 1JRCA 3PANA 4UZUA 5MF5A 4EPBC 1IXPA 4JZ5A 2HS8A 3U7BA 1WPCA 1AODA 1R87A 3NDOA 1XKJA 4YIWA 3EMCA 3H22A 4B4HA 5U4NA 3V0TA 3QTGA 3VGGA 3T1GA 3BLOA 1HJQA 3JS3A 2HTMA 3ABSA 3EPNA 1SYTA 4L56A 2RDTA 2DGAA 3SN1A 4C1NA 4JNYA 2V38A 4FIQA 1XG4A 3UWWA 4GPNA 1NAL1 1I1WA 3TX9A 1VCVA 1T41A 4N0RA 3UXDA 2XVLA 3KDOA 4ALDA 1M5WA 3QQWA 1XGDA 1PHWA 2DSKA 3LY0A 4ZODA 2DSVA 4IOTA 3LYEA 4F0KA 1XIBA 4GBUA 1KTNA 3U7VA 4XZ9A 3GU9A 2ODOA 2V5BA 3RPDA 2QIWA 1UIOA 1ISXA 5T91A 1DIDA 4ZTXA 4YVPA 1OC7A 4P5UA 3FV9A 1TX0A 3QLLA 2WKJA 1MFVA 1CIUA 2V9DA 1F8IA 4MNLA 3GU1A 3R94A 4C1NB 2J7HA 4ZXLA 3O05A 1ZY9A 1NDZA 4NL1A 1JULA 3U2CA 3M5YA 1PTAA 1UWSA 4NKCA 1Q63A 4R33A 2X16A 1J5SA 4F9DA 3TTEA 4JL1A 3W24A 4H8HA 4PE8A 1G6CA 2ZZ5A 3SQMA 2NUXA 4Y6GA 3P67A 4L5ZA 4DI8A 2DY3A 3CMFA 3EX1A 4KF1A 4DLMA 3GR4A 4Z2JA 3QV7A 3N3TA 4GZJA 5FJUA 3L7RA 1Z3NA 3GAKA 1LG2A 1OEPA 3PTQA 5AHEA 1M7OA 5H8UA 4DUWA 3AXKA 1RVKA 3GIQA 3GNNA 2GZXA 3KP1A 4ML9A 2ZKMX 5DANA 4WJEA 1P4CA 3EX6A 1XLDA 1Q85A 3LSBA 1D3HA 4HNCA 2BNJA 4EANA 3E0VA 3ITVA 4FNTA 4QAIA 3LGEA 5HR6A 2DZAA 2W27A 2PU0A 3UNTA 3HGRA 1HKKA 2NSXA 1Y65A 2WKGA 2HS6A 5G1MA 1VBRA 3STGA 4UQDA 4KT2A 1KFKA 3PWAA 4K38A 4Q8PA 5FL1A 3MP5A 4CD6A 2V2CA 3L67A 1K02A 1A5NC 1CT5A 3F03K 3M0YA 2C1IA 2MUCA 3Q67A 2XVNA 1HVQA 4NJKA 2V2DA 3G1VA 5LNSA 3U2EA 4IGSA 1OINA 1V5XA 3HPXA 4IF2A 4E3VA 4JEJA 4NASA 5D8WA 1OJXA 3W73A 6XIAA 2GGJA 2GWGA 1I4NA 1VJIA 3PZVA 1CTNA 3I7SA 1C8YA 2MNRA 1MW1A 2VP8A 3M43A 4Q33A 1SU5A 3B8IA 4TR9A 1KO0A 1Z8AA 1EOMA 1LBMA 5BU6A 4E2VA 4H3DA 5CQ1A 4QIUA 3U2ZA 3K4AA 4QHRA 3LG3A 4HCLA 1DE6A 1GZ1A 4MOZA 5K7JA 4XAYA 2ACQA 1IR2A 4DXVA 3AIUA 4EIVA 2Y63A 3CZJA 9XIMA 5CAHA 2NQLA 3N6HA 1H7RA 3TP4A 3UW6A 3ITYA 1MI3A 4TVDA 4NZJA 4Q8TA 5M03A 1EDTA 3SCWA 4HHPA 5JIPA 2Z6JA 3K30A 2D2HA 5D9MA 2NLIA 1JCTA 3ORWA 2IPWA 3W6YA 1V79A 2R14A 4HU4A 3IAPA 2Z1KA 4DBUA 3DZ1A 4GOAA 4HOXA 4FMVA 4MNMA 3LNMA 3SY8A 3USBA 3NO3A 1XG3A 3W88A 5GVJA 4AMAA 3WDPP 1Q13A 3TNOA 5M1TA 4MNJA 2DVUA 1X7IA 2PBOA 5HNUA 3MCNA 1B31A 3ITOA 1K8XA 4O1CA 3MMDA 1E4NA 4LC6A 3OVQA 2ZWZA 2FB2A 2QKFA 3ANUA 3U5UA 2TPSA 2GOUA 3T2OA 4LS0A 1E6NA 3AQUA 5BZAA 5A2AA 1XSJA 3DYMA 1Y5WA 4Z2HA 4CQAA 1Y5VA 4X0NA 2ABAA 4WSHA 1YE6A 3PR2A 3K13A 1XSKA 1R5YA 5A94A 3SCOA 4Q7BA 3W7DA 4PTNA 3CQIA 5D4YA 1R6WA 3UPWA 1TELA 5SWUA 3W7NA 4FNQA 1ZBVA 1TKKA 3NL2A 4G7EB 5KTLA 3VIPA 4IIGA 4W89A 3B8SA 4P61A 4N9EA 2R9RA 1LQ0A 1D8CA 5LNVA 3FJLA 4WSJA 3LBMA 4RNFA 3LBOA 5D9PA 2YCJA 2CLFA 3HQ1A 1GCYA 3ATYA 3MKVA 4XAGA 5A5WA 3GR8A 1JDCA 2EPKX 3D3FA 2C15A 1VIZA 1WUFA 3LERA 1MVYA 3GTHA 2PF8A 4GQRA 4O8RA 2HQAA 2UWFA 3AZSA 2VZTA 3CM4A 4U4MA 3SSJA 1XICA 1W2VA 1LQ2A 4WQ6A 2J7FA 4LF2A 3WIJA 3C0JA 2OEMA 4NYYA 4IXXA 1CYGA 4XVEA 4ACZA 1IXNA 3QQ1A 4AZ6A 3NG3A 1UOKA 3GFZA 5EMJA 3WENA 3RILA 1PCWA 5PTDA 3EA3A 2F9RA 3GG1A 1GONA 2YGYA 4NUWA 1TIMA 2CEQA 1N8WA 3ISIX 1XBXA 1KRAC 1FUYA 1XPGA 4PTVA 2OLAA 2NX3A 2BVYA 2OQHA 1XRSA 1NELA 4R7JA 2DUXA 3MUZ1 5AECA 4M81A 1DXIA 5CPTA 4I8YA 4CU6A 4I7UA 4RV3A 2F8QA 1QMLA 2CU0A 1Z42A 3W85A 4HB7A 4U10A 1BVNP 4AC1X 4JIRA 3EWXA 3VZXA 3GDLA 4XD5A 2TAAA 1PYFA 4QNEA 4NHVA 4FXRA 3II1A 1SZGA 2ISFA 3M5ZA 4ACZB 4K1WA 4JAWA 2Z00A 1QUMA 3HIJA 3PZUA 4UTWC 2HZGA 2BS9A 3W7JA 2GJLA 1V6TA 1ZBKA 1LYXA 1TV7A 1W1B1 2QJNA 3V16A 4D1IA 1PYMA 2D3LA 1CX9A 2O92A 3SCTA 2QJGA 3ZR6A 2GK1A 4YLWA 3PTMA 1A0EA 3B9NA 4AFYA 3VVGA 4DN1A 1O66A 1F7BA 1UASA 4EPEC 3W2LA 4GY0A 3FN9A 4E2OA 1WZMA 4JEQA 4F0RA 2WM1A 3AUJA 4IH3A 1OX4A 4GVGA 3DI1A 4GQGA 1PE1A 3ONCA 1TMLA 1MSSA 3LCIA 3O6CA 4XK2A 1ADSA 5RUBA 1HZYA 1MDLA 3WBWA 4GIYA 1JGMA 2ZYFA 1XS2A 2WZIA 1P1MA 4AZ5A 4NU7A 4TXEA 1O1HA 3LNPA 3NXFA 3U6WA 5LNUA 4QG9A 3M0IA 5GJNA 1KRMA 2ZUWA 1M9HA 3RITA 3BPWA 5L6UA 2VDGA 3OGSA 2GQ9A 1WDDA 3BV7A 4TVUA 3W4RA 1BWKA 3MCMA 3MPGA 3P8JA 1OX4B 4FNUA 1QT1A 4PC8A 4L9ZA 4YWIA 4MPQA 3R0DA 3AIVA 2W79A 3WX7A 3BJTA 2WSYA 3MVTA 2QVHA 1A3WA 1QBAA 2D2JA 3QR1A 1C92A 3U0HA 4OUEA 5B80A 2VWSA 4Z1YA 1UOZA 3WUEA 3WK3A 2ESCA 1AL8A 4Y8FA 4JIQA 2ZFAA 1VCFA 2BHZA 4Q8QA 1J6PA 1C9WA 1YW1A 1BRLA 1QI3A 3BJFA 4FHAA 4CEXC 2PRMA 1ZCOA 3M6YA 1K8ZA 4IIHA 3ANVA 4DB7A 4DF1A 1KFEA 3NYZA 3O2LA 1H1YA 4M0XA 3C6CA 3VE9A 3U4AA 2C18A 3GDTA 3W2KA 2CWNA 4L1GA 1VFFA 5E0KA 3NSXA 3RU8X 2WM0A 5EMLA 1J0YA 1KWGA 3TUUA 4S3JA 4LNYA 1VPYA 1RJPA 4O10A 3GXFA 2X1TA 4GYKA 3S5OA 2WLYA 2CBUA 3EWCA 3GAYA 4HU8A 1E40A 2XGZA 2CBVA 5AKQA 3AMDA 3AXIA 1ZZMA 3AMLA 2WANA 4PFMA 4MTVA 1EJSC 1H5YA 4KWVA 6CGTA 3WK0A 1PKYA 3DECA 3T6CA 2NQHA 4PBGA 4A8RA 3CIWA 5CC7A 3FW6A 3LCXA 1JIBA 5F2MA 3PZ9A 1V6UA 5AYIA 3ITCA 2VRJA 1JUKA 1WCGA 3INPA 3MP4A 5CH9A 1Q6QA 1N2VA 2EF9A 1EYWA 1UR8A 2VOTA 1H7NA 4HOWA 2ZUMA 3K8MA 1EP1A 4H9MA 3QSTA 5FSDC 2ZX9A 1Q8JA 1FHVA 1TVLA 3HFYA 1NWRA 4LUJA 3HM7A 4E0CA 3I6EA 2E28A 2QAFA 3WQ5A 1VD6A 3SCUA 1TV8A 2B7OA 4S3DA 3UPBA 3W76A 1O4UA 1G0CA 4OHQA 1DKWA 1UWQA 4MF4A 3WH8A 3CZLA 2R1NA 4LW7A 2QEZA 4TQTA 1PZ0A 2A3AA 1MRQA 1LORA 3CPGA 4C5ZA 2WWDA 2P3EA 1E6RA 4L9XA 3N9RA 4US6A 3NL3A 3STPA 2YA0A 3KX6A 2BX7A 2ANUA 1NM9A 3LUTA 4PGLA 3N4EA 4JDBA 2WPBA 4RZBA 3C2YA 4I5UA 4UQBA 3WF4A 4ILSA 2WK2A 4X0VA 3A4WA 1ESWA 3S5SA 3HG5A 1W9XA 3AHYA 2ZWYA 2BVDA 3KBWA 3SR7A 2J4GA 3HJEA 1G4TA 2WHKA 4KFOA 2BP1A 2H3BA 4IMGA 1RD6A 2QCGA 1SSDA 4TX6A 3O16A 2YFOA 2HISA 5CEWA 4XKYA 3A3WA 3MMUA 3U3HA 4XD6A 4YTRA 3GVWA 3NQEA 4J3UA 4XTIA 4LVDA 1HXJA 1U30A 1D3CA 5BOFA 2CLKA 1A49A 3CEUA 3VIFA 3RLVA 3CYJA 4F4RA 3WQOA 3IIOA 4L80A 1YXYA 4PMOA 4HT3A 4XSLA 4J27A 3FKKA 2I5GA 4JOMA 1WP6A 3KZSA 3NUKA 1VFSA 1U83A 4Q6JA 5C9ZA 3KTCA 3GG8A 3QMRA 1Q2RA 1LM1A 2NV1A 4HMCA 5AC4A 2VEPA 4QRNA 5AZ0A 4GY7A 3SQLA 3H24A 2HBXA 2VFHA 3QKZA 2CIPA 1DOSA 4X60A 5AC5A 3S5YA 4XKYB 5EGRA 1X6LA 3ZM8A 5C71A 3AHZA 3BCFA 1U5HA 4RNJA 3NO5A 2PWGA 3PUEA 1PX3A 4ZFCA 3OZOA 3SGGA 3ZQ9A 4HMEA 3NZGA 4R7OA 1OFQA 5CZTA 1B2YA 2UBPC 3O0FA 2O9TA 1DXEA 1GT8A 2YBTA 4MJZA 3TR9A 3BVJA 4N2YA 2C19A 1MZHA 2HXUA 4MDOA 3EA2A 2AQWA 7PTDA 3WN6A 1R7OA 3ZOAA 4EVZA 5FCZA 3ZR5A 3A4AA 1TFVA 1HUVA 2UY4A 4AC7C 3HF3A 5LA1A 4HYRA 4EAMA 1ZCCA 3N9SA 4XBJA 5AN7A 4K2SA 3IK4A 3BLFA 3WNMA 1EBGA 1EO7A 1LBLA 2CYGA 3POCA 3KBVA 4PEKA 4G8TA 3GXDA 5LIYX 1UROA 4U3CA 3TLQA 3E74A 2GVGA 4ZO6A 2DUZA 3DHUA 1F6YA 4GYPC 1F76A 5J8LA 3W37A 2HWGA 4QSHA 4ROQA 3GTIA 1TPVA 4GQ0A 5HA7A 1I9CB 3DFSA 4UC5A 1MQPA 3I68A 2Z2UA 3GBDA 4XZHA 2J7CA 4O1FA 4UTIA 3RK8A 1WBHA 2D2GA 5LZLA 5A6KA 3EOLA 1EWEA 1R3RA 2CZ5A 3WUGA 3ZLFA 2PU1A 3TW6A 1J2BA 2OZ8A 1UA7A 3P8IA 4UIOA 4M8UA 4S2CA 4QG8A 1UWTA 3LLFA 1BYCA 3ARQA 3HPAA 3CXOA 1VJSA 4V27A 4PL1A 3EX2A 3THQA 1ZSXA 4B15A 1YE4A 3O6YX 3F2CA 3DFOA 5CJNA 3O6AA 3EOUA 2Y70A 4IISA 2QV4A 2EAWA 6REQA 2NUYA 4QGCA 4BF7A 2OSXA 3H12A 4EXBA 2WB5A 3ZXWA 4WY0A 1CENA 5FA5A 1F3TA 4GQBA 3SQSA 2RUSA 4H9ZA 1H5VA 2YOCA 3PSWA 3NQFA 3ES8A 3VK5A 3CUHA 3VFLA 1P0NA 3IEBA 5C7HA 1J9YA 2GUYA 3T7VA 2CLIA 4Q7NA 2R1KA 2OKTA 4S3CA 3C8FA 3P84A 1EEPA 1QNOA 5C9XA 1XIHA 1GVFA 2ACRA 2R94A 2KAUC 3J7HA 4LBUA 4LB3A 4ICNA 4CVWA 3W84A 3M0KA 2PDHA 2W4XA 3I10A 1PUDA 3FYPA 4WDWA 1NF0A 3GW3A 1XH0A 3V36A 2HSAA 3V0SA 4PUDA 3THCA 4AZHA 5AHIA 3FVMA 3FJ4A 1E1FA 2Y1HA 4GXMA 1VR6A 5FJIA 3KVJA 4B5TA 1UC5A 1YTDA 2PBGA 3LOTA 4LRTA 5XIAA 1POJA 2OYLA 3MMTA 2E3ZA 2F7FA 4AXKA 1ZJIA 5EB8A 5ECUA 3H8AA 4G1NA 3FOKA 4H7ZA 3LQGA 3N2CA 1VH7A 3NEHA 2FPTA 1X8FA 1JZ3A 2HROA 3E3HA 3PWGA 3CMGA 4PCNA 3L4ZA 1JG9A 1EKOA 2E40A 3VDAA 4F2UA 3D47A 4IJRA 4EWJA 2P8BA 1S2WA 3H55A 1V3HA 1IWPA 4YVXA 2QR6A 1H09A 1EQPA 2CESA 1Q7QA 3RUBL 4DX3A 1IEXA 4F2TA 1KGUA 2AQOA 2AOSA 2DW7A 3VE7A 1VBGA 1MW2A 2FZ9A 1SVDA 3W7MA 1UWRA 2BVTA 3L9CA 1F3EA 3UG5A 4M1RA 2QPXA 4UUIA 5KZDA 1HG3A 3LZ3A 2Z1BA 4FX7A 3CPUA 4UFHA 3VO0A 3ITLA 4B9YA 2PDLA 2ZOXA 3BMXA 1XYAA 4BF9A 3LS9A 1EZWA 3L4UA 1V0LA 3MYOA 4FO4A 2D3NA 4UMCA 4AISA 4M24A 3W70A 1K4HA 2DU2A 1XIEA 2JEQA 5BOEA 1GTEA 5D9OA 3BSMA 4AZIA 3OA3A 3OOQA 4GINA 5HJXA 4WKAA 3GHSA 4YN5A 4OBTA 3WD3A 3AJ7A 3W83A 4GUIA 3QPEA 1X1NA 1F6KA 1R3QA 2A7PA 3VM7A 3RM8A 3GQYA 1ZHAA 4AEEA 1WKFA 5ABTA 3WQVA 1IYXA 4XZWA 3FFSA 2AMXA 2DJLA 2QMKA 3FIGA 1F2JA 5DCEA 3S2CA 4JX4A 5FOOA 3UZJA 1QNQA 2W3ZA 1ZBWA 4HOZA 2E68A 5CPSA 5I3JA 1YNYA 2PE4A 3DHPA 3O15A 5A6LA 3NSNA 3F5LA 4JGDA 3WH9A 4C65A 4MKNA 1VFHA 2B4GA 3AHVA 2FGBA 2AL1A 4BEQA 1M03A 5EBUA 3E12A 4LV4A 3WEMA 5CPOA 3TSBA 2QS8A 1W3JA 1H3GA 4D6DA 3DBNA 3UETA 1KBBA 1EC8A 5BMXA 1FWDC 4H6RA 4IMCA 3ZLGA 3W6LA 2JK2A 4I5XA 3KOWA 3KRSA 1EJRC 2X1IA 2Z27A 4IMEA 1AA1B 1J10A 3NQ8A 2Z25A 4FOUA 4HNNA 1Q8AA 3BANA 1KC7A 2HEJA 4RDVA 1REQA 1JCYA 3S1WA 2DZSA 1Q6LA 1RP9A 3A5VA 1Q3NA 1YYAA 3BO9A 4NT0A 1QWGA 4Z1AA 4C1LA 1AQMA 2PODA 1OCJA 2GJPA 1DXFA 2PLJA 2FZNA 2IKHA 2WVTA 1E6QM 1PWMA 1M53A 1Q6OA 2RDUA 1EPXA 4DO4A 5IHSA 1H60A 3XIMA 3PUOA 1OZQA 4QAWA 2F6KA 4G1KA 1T99A 2GJNA 5CPLA 1O5QA 2GVJA 2YSWA 1WOBA 4HSOA 1IQ8A 1FWIC 4JIPA 3LA4A 5LIKX 4QG6A 3G0UA 2NVDA 2OWCA 4MMWA 4S3AA 1XDMA 3IJ9A 1RHCA 4DBEA 3DG6A 5BWAA 1OGGA 1KR1A 1SW7A 1V6WA 2OKOA 1R3YA 1HJUA 2Q09A 4CKQA 4DUOA 1MXSA 5F7UA 4JS3A 1ZS2A 3USZA 3WLKX 4O19A 4QCFA 4AIEA 4F0HA 4RNHA 5E0FA 2ZRVA 4H9UA 3VZYA 4CCEA 5BCAA 3DFTA 2ZZ4A 3WJWA 3AC0A 2PP1A 3NA8A 4IMFA 2VEKA 2Z1VA 4O13A 1OFEA 4UTUA 3PZOA 4M7SA 4F8XA 1DJZA 2VELA 1EPVA 1A80A 3TA6A 3TJ4A 5HQMA 4S3FA 3WK1A 4NJHA 3OBKA 1BQGA 4P2VA 2VYOA 4JQ4A 1TSIA 4XKMA 4FB7A 3W22A 1A3XA 2PDJA 2J24A 4G2DA 4RXGA 3KUMA 3PVFA 2PS2A 5K9CA 1E9IA 4IT1A 3R8GA 1R3TA 2YBUA 6ALDA 1W3LA 2E8YA 4XAPA 4DWSA 1E5JA 1PO9A 1EJVC 3F5JA 1CB2A 5ABFA 5CPNA 4PMJA 1RY8A 4NI8A 3MUAA 5CG7A 1T40A 3EWWA 1AMKA 1HGWA 4OUIA 5DQPA 2PLMA 1CZ1A 4Q8MA 2E77A 4PB3A 3ES7A 2QW5A 2DSZA 4QLKA 3Q45A 3VNMA 1BG4A 3TQKA 2FFIA 5CGMA 3PP7A 3O6DA 2P0IA 3I3DA 1D7KA 5BNKA 3LCFA 4JIEA 4O12A 3TV8A 1DIOA 3T4WA 3BURA 1TE6A 4GIEA 4UFIA 3R25A 1P1XA 1ONEA 1QJWA 3EDKA 4GX9A 1H61A 1VLWA 1PIFA 2FZBA 1OIMA 3CASA 3RMJA 3BW4A 2B31A 4HTYA 2GQ3A 3UP8A 3OTRA 4LS1A 7XIMA 3MP3A 1UZ4A 3S6TA 5LIUX 1KWKA 2PI6A 2CZDA 4M7TA 4MGGA 2H90A 3NNTA 2VZUA 4H04A 4DWDA 1J8VA 1WXYA 3DAQA 4JN6A 5HAOA 3S4TA 3VGDA 4JTLA 3BL3A 3S47A 3TOYA 3DKJA 3G24A 1XX1A 3WQCA 3QFWA 3IGXA 1VBHA 2G5WA</