2PRHA

The structures of apo- and inhibitor bound human dihydroorotate dehydrogenase reveal conformational flexibility within the inhibitor binding site
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
367
structure length
358
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title The structures of human dihydroorotate dehydrogenase with and without inhibitor reveal conformational flexibility in the inhibitor and substrate binding sites
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 135
structure length 358
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2prhA00
4GE8A 1NF7A 1LBLA 5E93A 3EX6A 1XBXA 1WAUA 4MZ1A 2E5CA 2B7QA 4NJJA 4JY8A 1LBMA 3W71A 1W5OA 2QUVA 1QO5A 4PL1A 1DORA 1IF2A 2W79A 3HJZA 3OIXA 4OE7A 2TRSA 3GDRA 4ZQCA 2ZZ3A 3TSDA 4NJHA 3TUUA 6ALDA 3W7JA 3P80A 2TMDA 4QJ1A 5D32A 5HUPA 2J9XA 5KINA 4UTTC 2Y7GA 3UZ5A 4FB7A 5AHLA 5F4XA 3TROA 2Z1BA 3N73A 3P8IA 1W54A 2ZA3A 4NJGA 3P5ZA 3KVMA 4M7TA 1QO2A 2V5LA 4PFMA 1TQJA 4UTKA 2GPTA 3CQ0A 2J88A 4O28A 3CEPA 3L21A 5K9DA 3IGXA 3I7RA 5G2IA 1OJXA 1IIHA 1PE1A 4NQ1A 3W1QA 3FEMA 1X1ZA 3PR2A 3SI9A 1ZJIA 1BWKA 1F73A 3W2NA 4YCPA 3QSTA 5LSMA 3DFTA 3QEZA 3W7GA 2VFIA 1I2QA 3P84A 4UTTA 1Q3NA 2I1OA 3Q94A 3O15A 4DO4A 4NJKA 1AL8A 1F74A 4OBTA 5K4ZA 1QFEA 1SW7A 4RZ6A 4BK9A 3EXTA 3DI1A 1F2JA 3M0ZA 1H51A 3BW3A 3W7NA 1YDOA 3W87A 4O16A 1KFEA 4TMCA 4DBDA 2GVLA 1NAL1 4N9DA 4JX5A 3PULA 1YTEA 2DZXA 3VKJA 4LVDA 3CTLA 3W86A 2Z6JA 4WQ6A 5DCEA 2ZRYA 3BO9A 1EWDA 1TCDA 3WFAA 4LC6A 4NT0A 3T4CA 3N2MA 1F6PA 3NM1A 2V9DA 3GDKA 3NEVA 4UFIA 1P0NA 3HIJA 1VJIA 3LCIA 3U2OA 3MI3A 2ZCGA 1ZENA 2NXIA 1Q45A 5HINA 3LTSA 3C56A 3L5LA 2X1RA 4OWGA 4JGDA 4FO4A 2ISSA 1ZAJA 3FLUA 3WK3A 4UFMA 2C1HA 2B7NA 5HUOA 5L6UA 4XKYB 4JYDA 4MYAA 4JTLA 4WXZA 5D2VA 3DXIA 5BRBA 3LERA 1TPC1 3IVTA 4ZZ9A 4AF0B 3ABRA 1O5KA 4I9AA 4ZQRA 4QNEA 3NQ7A 3LCGA 1DL3A 2V81A 1OFDA 3C8FA 4Z1BA 2YYUA 2WO5A 1GTEA 4E2BA 3C2EA 4UFKA 3SSJA 2VELA 4GUFA 2A4AA 3G18A 1Q6OA 1QDSA 2Z0IA 3G1XA 4PEKA 1YYAA 1UUMA 3PSVA 2WQPA 3TFCA 3W73A 4LUIA 3MI6A 2RDWA 1YPFA 4HSOA 4XKYA 1OYCA 3MJYA 1W8SA 2B7PA 1V5XA 1GVFA 2YSWA 1X7FA 4JIPA 4QITA 1G7VA 4AF0A 2J6XA 2E6FA 1WQ5A 3UWYA 5AFDA 2XN0A 3P81A 4FNRA 1BTMA 1TTQA 3HG5A 1TTPA 4FXSA 4MPQA 2YCEA 3C2FA 1QPRA 2QCFA 1G4PA 1TPDA 3UXAA 3W72A 1EP1A 1X6UA 4MZYA 3W2MA 3BG3A 3G24A 4UMAA 1JCMP 3B0VC 1K8XA 3N9RA 2FQIA 3QFEA 3W22A 1XDMA 1G4EA 5EL1A 5EA9A 1TPH1 1UUOA 4BI7A 1OK6A 3PUDA 2H6RA 1G69A 1A5AA 2ZZ1A 1LOSA 3TXZA 5HWMA 3NPWA 2E6AA 2FPTA 1BKSA 2UV8G 3G1SA 5DCDA 4AEOA 1DJQA 2PC4A 3S5YA 2QJHA 3M5ZA 2PRMA 4IMEA 4YCOA 2CZFA 4A3UA 3LTPA 2NX9A 4MFEA 3S5OA 3L65A 4JTSA 3W88A 1KTBA 3RF9A 4UMBA 3P8JA 4XBSA 5LNRA 1DBTA 1WBJA 2R8WA 1QR7A 2WNQA 3W74A 2G97A 1MSSA 3GKFA 3B04A 4I7WA 1FQ0A 1XXXA 3C3NA 3CU2A 3ABQA 5AHEA 1PV8A 1W1ZA 3A21A 4L4LA 1VR6A 1KFJA 1YPIA 1B4KA 3G0UA 3L66A 3BGJA 3L67A 4JYFA 5FESA 1GJPA 3USBA 1H7PA 3M16A 2NX3A 5DBUA 4IQLA 2E77A 5BNKA 3W7QA 3W1TA 4M6PA 3MO7A 4OU1A 4IX2A 4GC4A 5CSRA 1VH7A 1ZAHA 4Y6GA 2ISWA 4K8HA 3KRZA 4UFLA 1L6SA 5AYXA 1W5PA 1A50A 3LRMA 4LS2A 4AHOA 2TSYA 4GBUA 3W83A 5CSSA 1B3OA 4WY0A 2X16A 2X1TA 1FCVA 3W1LA 1SUXA 3GVGA 3CM4A 4H3DA 3TQ0A 2FB3A 1A5BA 4LS1A 4DQWA 3LOTA 1M6JA 5LGXA 3IIZA 3H53A 3B05A 3O8AA 4RCXA 4WJEA 3LCXA 4MLJA 4O57A 2WPBA 5H2ZA 3ZFHA 1KFLA 4UR7A 3UY8A 1NEYA 1GEQA 1K7FA 4CNPA 4LS0A 3ATYA 3GNNA 3NQFA 2WSYA 1DOSA 1ICPA 2A6LA 4AAJA 4LNYA 2A5HA 3SGZA 4MY8A 4IGHA 3EXSA 3P60A 2YR1A 5C6MA 3HPXA 4MVAA 5FI8A 3MBDA 1ICQA 3E96A 3UPWA 5LNUA 2F84A 3RK8A 3W7DA 1JRBA 1WA3A 3KAOA 4RR4A 2DORA 1TPFA 1RVGA 5DBTA 3PUEA 3EX4A 3TC7A 1JCLA 3UWZA 4ORMA 2A0NA 2D73A 3PS7A 5IM51 3TA6A 1SO4A 3KVKA 3EXRA 2QJIA 2OZ0A 4C1KA 4MOZA 3GYEA 5U7SA 2H3DA 1HL2A 1L6YA 3LHYA 1HO1A 2ZRUA 3O07A 3EB2A 1TV8A 2NUWA 3TQVA 3UNDA 3DFOA 1VGAA 4Z1AA 1KW1A 3C61A 2GQ9A 1WDWA 3G1AA 3FIGA 4HT3A 4MZ8A 1Q6QA 4XUGA 2A7PA 5J5DA 3S8HA 3NQAA 1FDZA 1R30A 2WSQA 1U83A 1U5JA 3W7KA 2JKEA 4AWSA 4K7YA 1NF0A 4RKAA 4N02A 4UTLA 1O95A 1LDCA 1FXQA 2WNZA 1XFBA 2Y89A 1QPNA 4O52A 1R47A 1KLZA 1TTJA 2QCMA 2WSRA 5AC6A 2CW6A 3LCHA 1ML1A 2RH9A 2IQTA 3TAOA 3GDTA 4XWUA 3A5VA 1H7XA 3OHIA 5DXXA 1Q6LA 1EEPA 1XC4A 4O53A 4TR9A 3O1NA 1G67A 1XBVA 2BZNA 1P0KA 3ELFA 2A7NA 1IXPA 1WV2A 4NNBA 2FB2A 2X2GA 4LY8A 4J9JA 3CEUA 3M5YA 1EPXA 1F7BA 4FIQA 4Z0SA 3TIMA 3T40A 3OBKA 3M9YA 3CB8A 4JY9A 1SFJA 4ZQOA 5HR6A 3EEGA 4KWVA 1ICSA 5H91A 4Q32A 2FDSA 3LHUA 3NQ6A 1HFBA 3MUXA 5BMXA 1B57A 1GYLA 4H4IA 4PL2A 4M19A 3SW6A 1ALDA 4GUJA 4NXSA 4EF8A 4IOTA 3LLFA 1JUEA 1LYXA 4CQAA 3H54A 3EKZA 4NVTA 1GVRA 2QCHA 2VFEA 4WXYA 2QJGA 1SSDA 1ZCOA 2V2DA 1W56A 1MEIA 4DBEA 4IPJA 1I2PA 4UFJA 5G1YA 1EWEA 5LZLA 1LRTA 4ZQMA 4RZ4A 5KMYA 1UB3A 1EB3A 4MY9A 4IMGA 3UWUA 1PIIA 1TTIA 4RXFA 4UNLA 5HQEA 3ABSA 4DF1A 4LVAA 5GVJA 1TMHA 3GZ3A 4ADTA 5F4SA 3QQ1A 3DI0A 5HWJA 3GXPA 3PB0A 3SJ3A 3FYPA 3T44A 1SW3A 3HGRA 4HNTA 1LROA 2HS8A 4M6QA 3NPUA 2C6QA 1VRDA 4X3ZA 2ZZ7A 2Y62A 1VLWA 1GTHA 3M47A 1DV7A 3EX2A 2EHHA 1H50A 3GX9A 3QW3A 2ZTJA 1XBYA 2A7RA 4TO8A 5AC7A 4A22A 3P7YA 3PG9A 1OG0A 1T8XA 4TX9A 4N6EA 1TPVA 5D37A 2AGKA 2BWGA 1SZGA 2DZUA 2GVGA 3N9SA 1H7RA 5FF4A 1RQHA 4EVZA 4DO6A 2VXNA 1PVNA 3B03A 1K7EA 3UXDA 5D04C 4BF9A 1T99A 1PHQA 2ATMA 5AN7A 3L2IA 3V1PA 2PE4A 3HPZA 2QUUA 1FCQA 3LRLA 2CLFA 3W7RA 3AO0A 3S1XA 2EF9A 2OJPA 2CLHA 1MEHA 4AHQA 3NM3A 2Y70A 1R2TA 2C15A 3HGOA 4H6KA 4D2JA 3YPIA 3P5YA 3PBYA 1I8JA 4FX6M 2OMAA 3SZ8A 4BWLC 3HG2A 1J5TA 5AOUA 2QCEA 2Y7FA 1F6KA 5HJLA 5K9CA 2NWRA 4QQ3A 3PVFA 5EKYA 4U28A 2V2CA 3G1VA 3BV4A 2WKJA 1SZFA 3W1AA 3LX9A 1EA0A 1P1XA 3TQKA 1QPOA 3LV6A 3LM7A 5LNSA 3NVTA 3KHJA 2DJLA 1R2RA 2E6DA 3KVLA 4OHQA 3I7QA 2ZRXA 4LVFA 3OEXA 5D33A 5CPNA 3L5MA 1KM4A 2V2HA 3L0KA 1FY6A 3NQMA 4HIBA 2A85A 4LOCA 1RZMA 2X1SA 4K7VA 2B0MA 3G1HA 5FEXA 5KITA 1LBFA 2B7OA 3NYZA 2NX1A 3THQA 1K02A 3S1UA 5IBXC 1W5MA 2OT0A 3HF3A 4WY0F 4C1LA 3OVQA 3A24A 3HB9A 1PL9A 3W3OA 4FX7A 1KTNA 4QM1A 5G4WA 4NXKA 1VHNA 3TDFA 3HO8A 5AB3A 2BLEA 1W5QA 1OFEA 1T0OA 4Q4KA 3UWWA 5CZTA 8TIMA 3TXVA 2R91A 3B8DA 3DU0A 3NQGA 4O17A 3LXAA 1K8YA 3LBCA 1S5TA 2V5BA 4WOQA 2QCDB 5BMWA 4B5NA 3S5NA 4JX4A 1ZHAA 5IBXA 4IWWA 2R94A 2XFWA 3LDVA 2JBMA 3IGUA 4HKPA 1Z48A 2NXGA 2VFDA 2BXVA 3MBFA 2FPYA 2YDAA 1H62A 2J9YA 3B06A 1MO0A 2H8ZA 3E12A 3FKKA 2DZVA 1GVOA 2ABBA 5I3GA 2VEIA 3BK0A 3NQ8A 4N4QA 1R2SA 4UUIA 4UTHA 3SFKA 3S6DA 1OK4A 5HMSA 4EWND 3BVJA 1TPUA 1EUNA 4WX2A 2VKZG 3O63A 4YMZA 4UTIA 4RX0A 3W7CA 2QCDA 3A5FA 1VYSX 1VHCA 2J9ZA 3W85A 3W7HA 1OFRA 3UPBA 1XCFA 2OT1A 5G1TA 1W3IA 3E02A 3S5ZA 1H7OA 1XBZA 4Z08A 2C13A 1H61A 3DH7A 3DFSA 4LRTA 4FNPA 1S5VA 4K6AA 1C9DA 3W2LA 5C55A 3LXCA 1K03A 2ZA1A 1XI3A 3W84A 5F4WA 2Q3OA 2E5BA 2QDGA 4Y90A 4PA8A 1VCGA 3W1RA 4DPPA 2Q8ZA 1AMKA 2GOUA 7TIMA 4OV9A 1OF6A 1TV5A 2DZSA 3NL3A 4UIOA 2QR6A 3W75A 5HWNA 4GRSA 1O5XA 4K37A 4LT9A 1P4CA 2C3ZA 4DELA 1L6WA 4R7JA 2OCZA 4LU0A 3A22A 2NV1A 1WX0A 4N4PA 4OT7A 4JDBA 3KX6A 4BR1A 3G1YA 1FCBA 3IIPA 2I9EA 3MHFA 5LNWA 2WOQA 1SSGA 2PCQA 1BWLA 3UWVA 4N2YA 5TQLA 1YADA 4O0ZA 4O18A 1TB3A 2A21A 3NA8A 1XM3A 1I45A 2FPVA 4HHPA 4K8EA 3HG4A 2Y85A 3PBWA 2HSAA 1B4EA 1Z41A 4HPJA 1OFBA 3TC6A 2X1UA 3P74A 4O50A 1HG3A 3L0NA 5DN1A 1DKWA 1LTDA 4ADUA 2FTPA 5K3VA 4NJIA 4R33A 5DXYA 2VC6A 5J5RA 1QCWA 4OV4A 2NV2A 1FXPA 1ADOA 1M5WA 4PTNA 3R89A 3BG5A 1A5CA 4X9SA 2VEMA 3L0GA 5CZJA 3R13A 5D2YA 4JTHA 1QWGA 1KV5A 4O11A 4ORIA 4UCGA 1SO6A 2HS6A 2YXGA 3TSMA 4DPQA 5FF0A 4LW7A 2P0OA 2JK2A 4BI6A 4JIQA 4N6FA 3OG3A 3R8RA 4DF2A 1UCWA 5D02A 2JGYA 3NAVA 2FFCA 2G5WA 2NUXA 1DHPA 2W6RA 4JTEA 3Q37A 4XBKA 2E5DA 3M44A 3UY7A 2ZBTA 3MHUA 3P67A 4LV4A 3NQCA 4GFSA 4RK8A 3IEBA 3NPVA 1KM0A 1TREA 4I7UA 4YL2A 3NQVA 1VQTA 4JR5A 4O14A 4UR8A 1KM2A 3DFPA 4X2RA 3R2GA 4CCDA 3QJAA 5ABTA 1LZOA 4NZJA 5MHBA 2BX7A 3M43A 3NOEA 4ZMGA 3FJ6A 5I3FA 4O4WA 1KM1A 3G1DA 3IIXA 1W31A 3BW2A 4Z1CA 3LB0A 4IUOA 3RLUA 1T96A 3C2RA 3W6YA 4A21A 2Z6IA 3BG9A 3W1XA 4UTUA 4JX6A 3W7OA 3S1VA 4LVGA 1H60A 2Q8LA 4JTUA 5LNVA 2J24A 1ZFJA 1TPB1 3T78A 3O06A 1N7KA 4O15A 4Y8FA 4DXVA 2QF7A 4KWWA 5FEWA 1JVNA 3C52A 3TJXA 3LI1A 5FF3A 3NQDA 3F03K 2DJXA 1OFQA 4NX0A 5CPMA 3VCRA 3SIZA 5BW6A 3GR8A 4O19A 4HNUA 3GXTA 1X1OA 3O6YX 5CZ0A 1LP6A 5CG7A 3TW7A 4QAIA 3VE9A 1S3HA 4O1AA 1RR2A 4UXDA 3W76A 4JNMA 1YXCA 1Z44A 1R46A 4EOUA 4ICNA 4Y9AA 5D2TA 2V82A 3NQEA 1TQXA 1JCJA 3LCLA 3DENA 2CLOA 1FDJA 5A8GA 1G7UA 2A1YA 4HNNA 2VOMA 1OYAA 3W9ZA 3BGGA 1M7PA 1D3GA 4RV8A 3VI2A 2EPHA 4WZHA 4WUIA 4JTFA 1BEUA 4QISA 3W1PA 5C54A 4NNCA 4ZL1A 2G95A 2C0AA 3ATZA 2ABAA 3KOFA 3TSBA 3INPA 2PRHA 4FNSA 5LHFA 2H90A 5DLCA 4O0KA 3L68A 4KKXA 5G2HA 1FDYA 2QAPA 3M6YA 3M41A 3BW4A 1F5ZA 2KZHA 1RPXA 3IV3A 2WNNA 2A6NA 1UJPA 2C19A 1LRQA 1Y0EA 3BLFA 5F1UA 3W7PA 3W7MA 3QPYA 5I3JA 3VE7A 4Y96A 1K3UA 2Q3RA 4MJMA 3OVRA 2EKCA 4MJZA 3IIVA 5KZEA 3DKJA 5DY2A 3TMQA 3LHWA 2YPIA 2JKPA 1C8VA 2OX1A 4ZQNA 3SY5A 4UC5A 2NUYA 1FX6A 1PS9A 2HTMA 2HMCA 1PHWA 3IGSA 3WJWA 4FNQA 2RFGA 4AB4A 4L4MA 3MP5A 5FEPA 1JCXA 1F76A 4JEQA 1Q6RA 3PF3A 4CNOA 5KSWA 1LRNA 3UD6A 3JRKA 4GJ1A 4LV9A 1YDNA 4QNWA 2QCGA 4M7SA 2I14A 3NZRA 5LGZA 3LHTA 2GQ8A 1FWWA 5K7JA 2XN1A 4AWUA 4CQ9A 4JTIA 4ZQPA 4WD0A 4IXXA 4QIUA 3GAKA 3SR7A 1OFAA 3MYOA 1OX6A 2ATSA 4N9EA 2ZA2A 3B4UA 3QC3A 3T7VA 3NL5A 2AQWA 3QMSA 3EKLA 2ZRVA 4ALDA 4EIVA 3LGEA 4O1CA 4O1BA 3G8RA 3WJYA 3C6CA 3CLMA 2X30A 2YW4A 4Z0JA 1FBAA 2ALDA 2ZZ4A 3HGJA 2XN2A 2DZPA 1JUBA 2Z2UA 1K8ZA 4XTDA 3U8GA 2DP3A 1ME7A 4S1FA 2P10A 3H55A 4NUWA 1TRIA 3B0UX 4XQ6A 3TJLA 1YXYA 2E09A 4RXGA 3QYQA 4LUJA 3S0CA 2WV8A 3OA3A 1W37A 1H7WA 3PG8A 2C18A 3GDLA 1EIXA 3TNOA 5F2LA 1I2OA 1KFCA 1H7NA 2H3BA 3M5VA 4JN6A 3TE9A 1QOPA 2TPSA 2O7SA 1MXSA 4CNNA 3CWOX 4M5PA 1DQXA 3DHFA 1H5YA 3GIYA 5I3HA 1CX9A 3GAYA 4DF0A 3PC0A 4UTMA 4GUHA 1YDVA 5D03A 1W3NA 3RFAA 1P5BA 1TO3A 1YLVA 1AL7A 5LKYA 2O7QA 1VYPX 3QQ0A 4NU7A 4A2RA 4FIRA 1AG1O 4JICA 3NL6A 2WJZA 3HOJA 1G4TA 3P82A 3ZWTA 1CW2A 3G8EA 3FFSA 4IJBA 3QM3A 4JS3A 4DEFA 1OFOA 4PC8A 2DZWA 1VCFA 5T26A 3VNDA 3T55A 2V0TA 3F4NA 4P2VA 5TIMA 3C0JA 1NFBA 2CLMA 1HUVA 2QUTA 1NVMA 3F1QA 3NR0A 3PWAA 1HO4A 3GKAA 1H1YA 1NSJA 4CQ8A 2QCCA 2YW3A 4UTJA 2ISVA 5E1QA 1J2WA 3ZWSA 4JXCA 1JUKA 3NDOA 4GXMA 4A2SA 4LWWA 1JR1A 5A5WA 1LORA 4WOZA 2QKFA 2BSLA 2VEKA 4AMAA 1LOLA 3MP4A 3LV5A 2VFFA 1A53A 4IMDA 5E0KA 3S1WA 4BWLA 5F2MA 1AK5A 2FJKA 3WK1A 5CGQA 4O12A 1GG1A 3QMRA 3TR2A 1DVJA 1ONRA 3RLVA 2QCNA 4OGZA 1JQXA 5CZSA 3QW4B 4O4VA 3MI2A 2VFHA 2V8ZA 1VYRA 5D30A 1G6CA 1X8FA 2TYSA 5F2GA 5AHMA 1EP2A 4FXRA 4NZFA 1N8FA 2Y88A 3G3DA 3NXFA 3FKRA 1KFKA 1J4EA 1E51A 3WJXA 3A23A 1I2NA 3VFLA 3MMTA 1GT8A 1TRDA 4ZVJA 3ZR4A 3NG3A 3NNTA 4AH7A 3SECA 3LCFA 1RD5A 3EX3A 2YX0A 3TH6A 3F4WA 3D0CA 3GB6A 1SFLA 1XUUA 5C2XA 3ANYA 3GDMA 1W5NA 4GUGA 3HGSA 3FA5A 3DBPA 4UNKA 1DJNA 1JCNA 2A2IA 2AAMA 3LCWA 3NPXA 1TJRA 3W2KA 1KBIA 4N9CA 3QZEA 3CIWA 3GR7A 2Y63A 3GXNA 3KVJA 4Q33A 1TPWA 3C4UA 3BLEA 3IVSA 3RMJA 2ZRWA 4FX8A 3HG3A 2CZDA 2VFGA 1XL9A 2GQAA 5G2WA 3DGRA 5KZDA 3UQNA 4O1DA 3WK2A 4MFDA 3BLIA 2ZTKA 3DKLA 3LI0A 3LRKA 3EWYA 1XKYA 3WK0A 3E0IA 4M6VA 3M5XA 4S2BA 2CLKA 1VPXA 4RJEA 2LLEA 2V30A 3QF0A 4MUZA 4I7VA 3ZS4A 1TSIA 3G0SA 4JTGA 5HULA 3QSRA 2QCLA 4XTIA 3W7EA 1FWNA 1KFBA 3UZJA 3STEA 4JTTA 3IVUA 1AW1A 3TFXA 4NNAA 1IXNA 3KRSA 5DY3A 4LC8A 5AYYA 4CLMA 6TIMA 2NXHA 2J27A 5D05A 5G4EA 5F2IA 1EP3A 1I4NA 5D2WA 3UWQA 2GVJA 2CLIA 4ADSA 3QMTA 3S9YA 1WOBA 5FF7A 1ZY9A 4LRSA 3I68A 3RU6A 1QPQA 1SO3A 1VC4A 4YXGA 3PY2A 5FEZA 4JDYA 4GNJA 5KZMA 3EWUA 5EYWA 1JCYA 4TMBA 3A9IA 3BPWA 2CWNA 3IRDA 3DAQA 3MWAA 4O8RA 1KLYA 4PH6A 3CPRA 3FJLA 1CI1A 4TU1A 5I3IA 4UTWC 4HSNA 4IX0A 5KTLA 2YZRA 1SQ7A 1A5SA 4N9BA 2RDUA 1VLIA 2R14A 3PAJA 2CLLA 3TAKA 3JR2A 1SR9A 1OABA 3WJZA 4BFAA 3EWWA 2RDTA 1IXQA 4FNTA 3N2XA 5C5YA 4IMFA 3EWBX 1GYNA 4U4MA 1GVQA 2G96A 3O6CA 1SU5A 4LTSA 3HMJG 3W7LA 1L9WA 1OX5A 1UASA 1VCVA 4IMCA 5LHEA 1IXOA 1SO5A 4DO5A 4UTWA 5EBUA 2ZZ5A 3U6WA 4E2DA 3KFTA 3STCA 3NO5A 3EX1A 3FYOA 2ZZ2A 1FWSA 4E38A 1LCOA 5AHIA 2ZRZA 4O54A 3V75A 1GG0A 3EWZA 2ZQ0A 3AJXA 3LTYA 3O05A 3W1MA 3CC1A 2YFNA 4G1KA 4AHPA 5DCBA 1O94A 3JS3A 3N34A 5EMUA 3N19B 4WY0B 5F1VA 1WOAA 3G0XA 4ML9A 4IXHA 1V7YA 1PCWA 2Y7DA 4K36A 1JQVA 3EWXA 3PSWA 2NZLA 3NQ2A 1WYIA 3DZ1A 4KFPA 4K39A 5AYZA 1ZAIA 1LM1A 4O10A 1ME9A 1PCKA 2JGQA 3PBVA 5K4XA 2NWSA 1OF8A 1KV8A 3W2JA 4HN4A 1OVDA 4E0CA 2F7FA 3K30A 1TYGA 3W23A 1MEWA 1KBJA 3OVPA 4A29A 2BTMA 2FIQA 2B4GA 1ZALA 1KM3A 1IGSA 2YFOA 2CLEA 1YTDA 4R53A 1TIMA 4RZ5A 1O60A 3W2UA 4GUIA 1LOQA 2YYTA 3LLDA 3Q58A 5BOOA 1MZHA 1WXJA 3UYCA 1H63A 1FWRA 3HBLA 1FCUA 3S42A 1JRCA 1GQNA 2EAWA 1FWTA 1F05A 2ZFAA 3HQ1A 4FF7A 3QRHA 2DU2A 1RV8A 4JTJA 1XUZA 2W0UA 4FEZA 3O6DA 4ONVA 5TBOA 3GLCA 4AWTA 2ZDRA 3MP3A 1GPWA 1AW5A 3W1NA 3LXBA 4CCCA 1M7OA 1UBSA 1AW2A 3GNDA 4CCEA 3E49A 2Y7EA 2RHGA 5CPOA 3STFA 4PCFA 3STGA 2PURA 4O13A 2ZZ6A 2C14A 4MY1A 4AXKA 5AC8A 4OQVA 1S5WA 2QDHA 3I7SA 5K9XA 4EF9A 3G1FA 2VENA 1O4UA 2QEZA 2H8XA 1W0MA 4R34A 4JTKA 5U4NA 1RQBA 3LBMA 3M1ZA 1IIGA 2C16A 2YGYA 3P62A 3LHZA 4YWIA 4FNUA 3NGJA 2CZEA 1K7XA 1G4SA 3W1UA 2ZYFA 3KXQA 1B9BA 5I3KA 3CT7A 3IIOA 1TPEA 1THFD 5DELA 1QNVA 3PBUA 1KTCA 2QAFA 4PODA 5G5IA 3FOKA 1OFPA 4TIMA 1GOXA 3B0PA 2VEPA 3DHDA 3PB2A 1YTKA 2JKAA 3W07A 3QH2A 1HTIA 3C2OA 3KRUA 1SZEA 3TMLA 3PUOA 4QSHA 1GWJA 1OX4B 5AHFA 3TK7A 3CIXA 4AVFA 4UFHA 5FF2A 1ME8A 5AHNA 4BI5A 4MLRA 1TJPA 3WJSA 3CHVA 2CFFA 1FUYA 1W3TA 3I6RA 4NX5A 3W7IA 1DQWA 2E1DA 4MYXA 4KFOA 4S2CA 2FLIA 1JULA 3C2VA 2GJNA 3TW6A 3GK0A 2CU0A 2RKXA 4XZ9A 3MW7A 3G22A 1YXDA 1SZNA 1VZWA 3NL2A 1ZNNA 1I2RA 1SW0A 1OX4A 2CZ5A 2Y6ZA 3TU9A 3P61A 2EGZA 2DZTA 5EPDA 5CKSA 4POCA 1KA9F 3PM6A 4HPXA 4JYEA 4GWEA 1L2UA 3G3MA 1H1ZA 3N14A 3DFNA 3I65A 4X22A 1QAPA 3MYPA 4KFNA 4HNVA 3RNDA 5K2ZA 2PRLA 1D3HA 3O16A 1KM6A 1KM5A 2GUUA 2E68A 4MIMA 4W9TA 5D09A 5D2XA 3M7WA 1C29A 1D9EA 4Z1DA 1OHLA 5D38A 4LVBA 3BARA 5CPLA 3HPSA 1JJKA 4IPIA 3TV8A 1WBHA 1TV7A 1Z42A 2P1FA 3THAA 3L9CA 1LLZA 3Q2DA 5HNRA 3DFQA 5EY5A 3TKFA 2Y61A 3ABOA 5HR7A 3L5AA 4FHAA 3R5EA 1LLWA 1GVSA 3QPZA 5L9FA 1N55A 3TX9A 1QMLA 1EX5A 1OYBA 4YLWA 3W70A 3N3MA 3NZ1A 3SGUA 4JD4A 3MHGA 1QOQA 1VS1A 1XDLA 2GJLA 4UMCA 1EUAA 1SPQA 2E6YA 4MKNA 5SWUA 3LHVA 1RQEA 3CWNA 2NLIA 4K38A 3R12A 4RLIA 4P61A 1GZGA 3FS2A 3TCEA 3E9AA
chains in the Genus database with same CATH superfamily
3WELA 4X0VA 2PP3A 1NF7A 2GSHA 1LBLA 1ADDA 1QI2A 3B8VA 4HK6A 2OOGA 4MZ1A 2CLPA 4E4FA 2B7QA 4NZ5A 1BFNA 4QLKA 1B3WA 2BFGA 3AMCA 4I9MA 1QO5A 2W79A 1CIUA 3HJZA 3OIXA 4ZQCA 4FAMA 4NJHA 5EMJA 3TUUA 4HD5A 2TMDA 5D32A 4CD6A 4UTTC 1O68A 4D8ZA 4FB7A 1Q4WA 2BP1A 5AHLA 1HIZA 1TZ9A 2Z1BA 3SUVA 1W54A 1LF1A 2P50A 4M7TA 2V5LA 1D8CA 4JNZA 3CQ0A 1PX8A 3W29A 1VFTA 3L21A 5K9DA 1XLFA 1OJXA 3VX1A 4CUCA 1X1ZA 3PR2A 3FK4A 4E3TA 1BWKA 5LSMA 1OINA 1UKTA 3TWBA 4PGLA 3W7GA 2CHRA 4WKAA 3V5CA 1W1VA 2D0GA 1EJ7L 4UTTA 2I1OA 1XRVA 3Q94A 3O15A 3WQDA 1I60A 4NJKA 1F74A 2E1WA 3MV11 5C9ZA 1SW7A 5CPSA 3MV01 3DI1A 2WSKA 3B9NA 4ZB2A 4B16A 2OB3A 3PTQA 1WUEA 3W7NA 3WEOA 1ZBCA 4TMCA 2FVKA 4N9DA 2DZXA 2WC4A 2FGZA 1UZHA 4Y2WA 2JFEX 3WD1A 1EWDA 3VPLA 4E3VA 1RD6A 5CSUA 3WL0A 4XZIA 2C1IA 5I24A 3T4CA 1HN1A 3QYSA 3N2MA 1F6PA 1WCGA 4IQDA 2QULA 1MQRA 2X7VA 3LU2A 1C8YA 2XSXA 5CGMA 1B3VA 1ZENA 2D2JA 1K70A 3KDNA 3QBUA 5HINA 4F3HA 2X1RA 4J3SA 4FO4A 3UG4A 1ZAJA 5HAOA 1O12A 2B7NA 3V3WA 5LXXA 1OZMA 1TPC1 2PTZA 1UZDA 4ZQRA 1KQYA 3AXHA 4IISA 4DUOA 1DL3A 3MB9A 3W37A 4HHHA 4W7WA 2WO5A 1NIUA 3TYBA 2EPKX 2PDUA 2WPGA 3OZYA 3BOLA 4PEKA 4B3ZA 3QTGA 1VJZA 3A3XA 1XG3A 1JZ3A 3KL5A 1NP2A 2B7PA 2YB1A 4MB5A 1X7FA 4KIRA 4DAFA 3GRIA 1G7VA 2J6XA 2QF8A 1WQ5A 4KRUA 2XN0A 4WSHA 1OG6A 2NSXA 1BTMA 3HG5A 1TTPA 4QEEA 1G4PA 2UY5A 3UXAA 1LG2A 3L4YA 1X6UA 2DY3A 4LYPA 2XIIA 1TX2A 1W1TA 3C3UA 2FQIA 1XDMA 1ITQA 3GH5A 3ABXA 2WVVB 4W7VA 1X1NA 3VMNA 1R9YA 4DHGA 3VD4A 4AD2A 3H4GA 4TQTA 3H70A 1G69A 1P0DA 1KXTA 3NPWA 3VM5A 5DCDA 4PR4A 1DJQA 1UWUA 2PRMA 4IMEA 4YCOA 3LTPA 3S5OA 5I79A 5E70A 3N3TA 3F2CA 1KTBA 4ROPA 3P8JA 3N2TA 4AZHA 5LA0A 4XBSA 4B90A 3QV9A 1DBTA 4GMEA 3N1AA 2W61A 1GVIA 2VM8A 1XCXA 3B04A 4I7WA 1FQ0A 2QS8A 1XXXA 3C3NA 5GJPA 1JPKA 3IJ9A 1PV8A 3TC3A 4GH1A 1W1ZA 1VR6A 1YPIA 4S3BA 4RNIA 4E8CA 4MWAD 3L66A 2A3HA 4JYFA 4JL1A 1O1ZA 2E77A 3ARYA 5KZ6A 4CEUC 2DPEA 2WKLA 4LX4A 2ISWA 1RBOB 2VMFA 4UFLA 5AYXA 3CZ8A 3T0TA 3LRMA 4LS2A 3E0WA 2HVOA 5CAKA 3CZEA 4WY0A 2X16A 2X1TA 4C65A 3W1LA 1SUXA 3TQ0A 1JL8A 5E6ZA 4H9MA 4LS1A 1P7TB 4D6DA 5LGXA 3IIZA 1E1FA 4W88A 4O57A 1YEYA 2F61A 5H2ZA 3VKBA 1FWFC 1RP9A 3UY8A 1GEQA 5CJNA 4PUJA 4ATDA 3ATYA 4IL2A 1LL6A 1E3XA 3SGZA 5CC7A 4IGHA 1BAGA 3EXSA 4V15A 5C6MA 2XGBA 3EAUA 3HPXA 3RXZA 4EPKA 1E4IA 4GI4A 4YVPA 5PTDA 3UPWA 4GVHA 3QQWA 2O4QA 1LUCB 1AFSA 1I9CB 3EKGA 1TPFA 1FKXA 1BYBA 5DBTA 1NFGA 3PUEA 2HQAA 3TC7A 4H8NA 1QI5A 1TFVA 2YDSA 4J2PA 3TA6A 2WCAA 3WENA 3KVKA 4W93A 3EXRA 2QJIA 5LIUX 4MOZA 3GYEA 2X2YA 1L6YA 1HO1A 4O1EA 5BWAA 2ANUA 3O07A 4RV3A 1TE6A 2GQ9A 4MKSA 1WDWA 3G1AA 1WXZA 3T81A 2XVLA 1WB0A 3FVDA 3NGFA 1Y8BA 4HNOA 4ZBCA 5J5DA 2F6UA 3M64A 3NQAA 1FDZA 1R30A 2BGQA 2WSQA 3CWHA 1ZJBA 3VKKA 4K7YA 3APYA 4RKAA 1IZCA 4XKMA 4Z2GA 5IRPA 2EPNA 2WNZA 4G7EA 4AX6A 1XFBA 4PE8A 2BS9A 1C91A 1E3ZA 3SEPA 1TTJA 3BMVA 2WSRA 3VOGA 2CW6A 2ZC8A 3LCHA 1E40A 3AYSA 1OZQA 1FHUA 3GDTA 2IKGA 3A5VA 2VT0A 5C2CA 1F8MA 3K8LA 4FR1A 1W8GA 4W7UA 4JFWA 2W91A 3IAPA 3WQ5A 2PLKA 1SJBA 1LWIA 1WV2A 3EWDA 3GHUA 4JQ3A 1AH0A 4J9JA 1F7BA 4J3XA 4B5VA 3BURA 2BB0A 3M9YA 4ZQOA 2HEJA 1GVYA 2PWGA 3MCMA 3BICA 2FDSA 1B57A 3CMJA 4M19A 4GUJA 3LLFA 1JUEA 3REQB 3UJRA 5EMLA 4QJ5B 1AD1A 1SSDA 1ZCOA 3PWIA 1W56A 1MEIA 1I2PA 2V6AA 4MJ4A 3AZSA 5LZLA 1WZKA 4ZQMA 1FVPA 3LD5A 4RZ4A 5KMYA 1UB3A 4MY9A 3UWUA 1TTIA 4RXFA 3B0XA 2PB1A 4MTVA 5GVJA 4DF1A 2VRJA 3O0FA 1CLKA 4ADTA 5MKGA 3QQ1A 4L9XA 1HKJA 5HWJA 3GXPA 4NHVA 4HNTA 2CWXA 4M6QA 3NPUA 1RPKA 2C6QA 3VX0A 4YS1A 3ZMRA 2ZZ7A 2Y62A 2J62A 1H4PA 1DV7A 3KOXA 4ICMA 4KRZA 4ZE5A 2WLZA 6REQA 3QW3A 2XIBA 2ZTJA 2A7RA 1LL7A 5AC7A 4A22A 1W1IE 1MUCA 4O1FA 3C0QA 1OG0A 3VXGA 2FZBA 2V5KA 2KAUC 3SFWA 3ZT6A 4MB1A 2AGKA 2WHLA 2R9RA 3WFZA 3GC4A 5CC6A 1SZGA 4FR6A 3C0LA 3N2CA 4GKLA 4PUUA 4Z2HA 1X98A 3NDZA 5CSYA 1RQHA 1TUFA 3MANA 1LT8A 3B03A 6ENLA 1M53A 4B5XA 4BF9A 2ATMA 1PHQA 4HPHA 3TW9A 3WQWA 2FTWA 4XAZA 1PTAA 1P6CA 3HPZA 2QIIA 3LRLA 4PMRA 1HXJA 3S1XA 2CLHA 1W3HA 3NM3A 3ZLHA 1IEXA 3ALGA 3GBEA 4ZFCA 1SMDA 1H09A 2E8YA 3ONCA 1OT2A 1W2PA 2P3EA 5FJUA 4GVGA 4TV5A 2GWNA 3HPFA 2OPJA 2QCEA 3PVFA 1UBPC 2V2CA 2DH3A 4U2ZA 1UR0A 3LX9A 1L8PA 2OGYA 4KS0A 1M41A 4HCHA 5LNSA 3V0TA 1XRFA 3P14A 2E6DA 3CQKA 4H01A 3I7QA 4LVFA 5CPNA 2BY0A 3WLMA 1BYDA 4LAUA 5IDZA 3L0KA 2VEGA 4HIBA 5BXTA 3SRHA 4JTQA 5ENLA 5KITA 5IFPA 4KPLA 4DX3A 1W5MA 3SBFA 3B9OA 3ES7A 3HB9A 3CMFA 1B1YA 4NXKA 2ACQA 3TDFA 4LQ1A 5AB3A 2PTDA 1W5QA 1OFEA 4YTSA 3CJPA 3UWWA 2QIWA 4XK2A 4JOMA 3DU0A 1EZ2A 4FPSA 4NRRA 1ONEA 3LBCA 1S5TA 1HJUA 3THDA 3GHTA 1XLJA 4B5NA 3VGHA 1ZHAA 3LDVA 4ZENA 4L9ZA 2NXGA 3GXMA 2YDAA 4LGXA 3B06A 4DZHA 1J0IA 4I5XA 4GBDA 2WHMA 1NWRA 3DUGA 3FKKA 1MNZA 2ABBA 4IF2A 4S3CA 3NQ8A 4H04A 4IT1A 1WPCA 1F3EA 3GD6A 5HMSA 3BVJA 3KW3A 5FAJA 2ISFA 4YMZA 5FJIA 1A0DA 2QCDA 1JI2A 1R3SA 1VYSX 2FTYA 5HJXA 1R7OA 3BAJA 3W85A 3CS2A 4KEUA 3BQ6A 1NWTA 3UPBA 4CGTA 2VC7A 1H7OA 1XBZA 4C6DA 1H61A 3DH7A 4FNPA 1BGGA 3W2LA 3AIBA 4C6IA 3LXCA 5CZKA 1XI3A 2X09A 1AMKA 2PDGA 4EPBC 1OF6A 3NL3A 2DUAA 1DIOA 3AHYA 1XIMA 2FMOA 3BTNA 1IZJA 4IH3A 4I3GA 4PCTA 4H7ZA 2XH2A 4LT9A 3NSXA 2BXYA 4ZFMA 2OCZA 3B40A 4X60A 4GQ0A 4N4PA 3WDJA 4BR1A 1JDDA 1FCBA 4DJDC 2FYMA 4AQLA 2NQHA 1SSGA 2PCQA 1H41A 3VDHA 1UR3M 2YL8A 1OCBA 3ARUA 4F2UA 1QJWA 3XIMA 3NA8A 4HPGA 4L5ZA 4HHPA 4K8EA 3ORWA 1CNVA 3HG4A 1Y5WA 1I6NA 3PBWA 3S9IA 2HSAA 1Z41A 1MDRA 1OFBA 3TC6A 2X1UA 3R10A 1UP3A 1QI0A 3KRBA 3TYCA 5DN1A 4K1GA 2OFJA 4ADUA 3RM9A 2QLYA 3RU8X 4NJIA 3U3HA 5DXYA 1J5SA 2YL5A 3ARRA 1GKRA 2W62A 3WH8A 4PTNA 5H8MA 1R3QA 3BG5A 4FZIA 4REQA 1EFZA 4PMJA 3OO2A 3TSMA 4DPQA 5FF0A 2P0OA 4BI6A 2YOCA 4N6FA 3WMSA 4OFCA 1AH4A 4HTBA 3A6OA 3GHSA 2G5WA 2VYOA 5DEZA 2B81A 4I90A 5IXEA 2ZBTA 2FFIA 1FKWA 4JN8A 3DEQA 4GFSA 5CG0A 4J3WA 3IEBA 2EKGA 4PMXA 1VQTA 1KM2A 1NDWA 2AL2A 1I1WA 2VR2A 1RCQA 2QQ6A 5MHBA 3NOEA 4MWAE 5I3FA 1JZ7A 3UG8A 3UR8A 4IUOA 5JIWA 1B5TA 3SUUA 1T96A 1NOWA 2OOFA 3AXMA 3W1XA 4AD5A 3MZNA 2Y5SA 1JPIA 1T41A 4K2SA 1RXOB 3AICA 2PC8A 3KLKA 2Q8LA 1TZ7A 1R3VA 3VFCA 3JVAA 1TPB1 3T78A 1N7KA 2OZ3A 2PFHA 3SQLA 4DXVA 5AZ0A 1YBQA 2WHJA 4KWWA 1JVNA 3VD9A 3LI1A 1EQPA 2DJXA 4KEVA 1OFQA 3G6LA 4EACA 4XZWA 4PRRA 1TWDA 1R87A 3TN4A 2V5CA 4QEHA 3VDCA 1RR2A 3M0MA 4C7GA 4RNHA 4JNMA 1YXCA 2ZUSA 6XIMA 5D2TA 2V82A 1TQXA 2OELA 2EQDA 1EJSC 1EOKA 3GTFA 3BSGA 3E74A 4HNNA 1FFQA 1XPYA 3I4KA 1M3UA 2OYLA 2P88A 4PRTA 1UP2A 2HXUA 2V3FA 2WK2A 4H83A 1BYAA 4RV8A 4AYSA 1EX1A 4WZHA 3CT2A 4JTFA 4MG4A 4QISA 1AZ1A 2KX9A 3W1PA 4J35A 1DWFM 2G95A 1GQLA 4J3VA 1EXBA 1TV3A 4QTGA 4FNSA 5LHFA 5DLCA 1EL3A 1VFHA 1FWDC 3UXLA 2J8TA 2O9OA 3E38A 4KKXA 3T4WA 4QE5A 4GOAA 1KCKA 4J3ZA 2KZHA 1RPXA 3CYJA 5F1UA 3CHFA 1VBRA 1GPFA 4Y96A 1K3UA 2Q3RA 2YLLA 3HPAA 3T2QA 5KZEA 3DKJA 3QLLA 2XZ7A 1Q63A 1GZ1A 2YPIA 4OKDA 4XZBA 3LA4A 2NUYA 3IGSA 2GGGA 1EJVC 2IUZA 3AHXA 4V27A 1BRLB 4LYRA 4AY8A 4DY1A 1T8QA 3WQVA 1DJGA 1M1BA 1ZP4A 1TIWA 2I14A 1J96A 1XD0A 3LHTA 2GQ8A 4PMVA 1LJYA 1I75A 2XN1A 4CQ9A 1V0LA 3TA9A 2WZEA 3SR7A 6A3HA 1XLEA 3B4UA 3T7VA 3MVIA 2Z2BA 2VGIA 3GTXA 2QNEA 1K9TA 3JW7A 3A64A 4HMNA 5CJMA 1OC6A 2ZIDA 3HGJA 2O56A 3KBJA 1OY0A 1E0UA 4IFRA 2WHKA 1EGVA 2DP3A 4S1FA 1CEOA 4W8BA 2WMKA 1FTXA 3NOYA 3BMWA 3BZGA 3B0UX 5D9NA 5T91A 5T9CE 1H7WA 2C18A 1TVLA 4CNUA 2OEMA 1EIXA 2ACUA 4NAFA 2WWCA 5F2LA 1CLVA 1DHKA 1GJUA 2QMJA 3TE9A 2O7SA 3AAMA 1IE7C 1MXSA 2IPFA 3NJ3A 2PBGA 1DQXA 3DHFA 4DF0A 6XIAA 4UTMA 3PC0A 1GOQA 4PTWA 4JFUA 4EAYA 3RFAA 2ZX8A 4TV6A 1SGJA 5LKYA 3LK6A 4WGHA 4UQCA 1ESWA 1VYPX 2Z27A 4NU7A 4FSAA 4A2RA 2I5QA 2JE8A 2WWDA 2BOEX 3TJIA 1T5AA 3SCVA 2OQLA 2OVLA 3TONA 4IJBA 1EDGA 3PUGA 4HJWA 3VNDA 3U4FA 1BYCA 4YN5A 4Q7NA 2NQLA 4DBWA 5ABFB 1XICA 1XLDA 1HUVA 3RRXA 4DBUA 3C2YA 3VDGA 2QCCA 2YW3A 2ZKMX 4WLCA 4XAFA 1JXJA 3ZWSA 2WBGA 4GINA 1UD6A 4LWWA 4WOZA 4AMAA 3VZXA 3CLWA 1UC4A 4ZO6A 3S2NA 1U2YA 3CXOA 3SM0A 5CGQA 4AUBA 4MWAC 1DVJA 1ONRA 3IACA 5HPOA 4F9JA 1QW9A 3MI2A 3FSTA 1G6CA 1XRTA 3U7VA 1EP2A 4NZFA 1IWPA 3UYIA 2F9RA 2Y88A 5F7UA 1E51A 4LCSA 1GT8A 3IV8A 3VD7A 3NG3A 3APGA 3M0LA 3H7UA 3NIYA 4HOZA 1R9ZA 3GB6A 1JYWA 2WXDM 1H11A 3ANYA 5BROA 3GDMA 4GUGA 3IJ7A 1DJNA 4LYKA 2A2IA 4OBSA 1M7XA 4L1XA 1W1A1 3GU1A 3QZEA 4C90A 4J3UA 4A3QA 3GXNA 3KVJA 1TPWA 5KETA 4AZBA 3IAQA 3UF9A 3RMJA 9CGTA 2EJAA 2PBOA 4LUSA 2GQAA 3GC5A 1QW7A 5G2WA 3WK2A 5I00A 1HKMA 3BLIA 2BNJA 4IQJA 4Q8TA 1W32A 1XKYA 1F6YA 4M6VA 5GJMA 4BQ2A 4R9XA 2UY4A 2QDEA 3CTTA 4M1RA 5HATA 4IIEA 4MUZA 1MUMA 3ZS4A 1TSIA 2QCLA 4XTIA 3V36A 4ZTXA 4PMQA 3W7EA 2HNHA 1KFBA 3CAVA 2QW5A 4S3GA 1XG4A 4NNAA 3O0KA 3KRSA 3DFHA 3F5LA 4LC8A 4HA4A 2J27A 1EOMA 1L6GA 1H5VA 5D2WA 3UWQA 3VIOA 3S9YA 3PBGA 3VOCA 3LNMA 4AY1A 1SO3A 4DXKA 2D20A 3BDKA 3PY2A 3RCMA 1CZ1A 2O9PA 3VD3A 4GNJA 4QFUA 2O92A 5KZMA 3AIWA 1JCYA 4WHBA 2CWNA 3IRDA 1IZKA 4PH6A 3MVTA 4WEVX 2UY2A 2NQ5A 2PD9A 2YZ5A 4PYSA 2RDUA 5DANA 2R14A 4GQGA 5JXQA 4BFAA 3EWWA 4MB4A 5CCZA 1MXDA 3E2RA 3ARSA 1R38A 8XIMA 1GYNA 1XINA 1BGAA 1AQMA 1UASA 1RLDA 4UOQA 4IMCA 5DMYA 5CC3A 1IXOA 1SO5A 4E2DA 3KFTA 3CGTA 4Z17A 3IANA 1QNPA 2BMBA 3CQIA 3SCOA 3EX1A 3FYOA 3ARXA 5CQ1A 4LSBA 4QG9A 4JAWA 3KUMA 3V75A 1R3RA 5FL1A 2ZQ0A 3LTYA 1YPXA 3W1MA 5HOSA 3N19B 1AQFA 1VBHA 5F1VA 1V7YA 5IHSA 1JQVA 3EWXA 1WYIA 4KFPA 2PDMA 1LM1A 4JFVA 1OEPA 5K4XA 3EA3A 4JL2A 1OF8A 1XLHA 1S2AA 4CQCA 2F7FA 3KTXA 1TYGA 4K1WA 1FP8A 1J0HA 5D9MA 4PMOA 4HGXA 3ES8A 3AXIA 1EF2A 4GX8A 3E0VA 1KM3A 1IGSA 1HL9A 5M03A 1SJAA 5BRPA 3VD5A 4GY7A 3H2FA 1REQA 4GUIA 3SDOA 3WYZA 3UR2A 1W6TA 1MZHA 1FWRA 1CGTA 1JRCA 1GQNA 2EAWA 4RUBA 2ZFAA 3QRHA 2OEKA 3D6NA 4TX6A 1RV8A 4JTJA 1XUZA 1WZAA 4FEZA 3BSMA 2VZSA 4ONVA 3GLCA 2VDIA 2ZDRA 1WP6A 1GPWA 1AW5A 3N12A 1RJPA 1M7OA 5HXMA 1S46A 4DI8A 4IGNA 1O1HA 4CCEA 4DWDA 3H8AA 4ZTYA 2QVNA 4EP8C 3STGA 1SJCA 5JUVA 3FGCA 4IFOA 2ZZ6A 4AXKA 7XIMA 3ICJA 3G1FA 4ACZA 1W0MA 5U4NA 2V3DA 5E5CA 1UD4A 1B54A 1XH0A 4B5WA 3AFBA 5BYWA 3W1UA 3KXQA 2C91A 1THFD 5DELA 3PBUA 3W26A 3WQEA 2QAFA 2XIMA 7TAAA 2BV9A 3AIVA 1UH4A 1GOXA 4G5DA 3B8SA 2XINA 1HVXA 4ZOAA 3W07A 3PTMA 5FIPA 1HTIA 3TMLA 7ODCA 3PUOA 1GWJA 5AHFA 3OU8A 1P6WA 3WLNA 3CIXA 2Q71A 4LUTB 4OVXA 1VBGA 3DDMA 5FJOA 4BI5A 4MLRA 4B3LA 3AQUA 2CBIA 4UCFA 3K8MA 1VEMA 1DQWA 4S2CA 4L65A 3FJ4A 3GK0A 2CU0A 4XZ9A 2ONEA 3MW7A 3G22A 2VZOA 3BOFA 4IL0A 1KFWA 4WDUA 3QVQA 1ZNNA 1SW0A 2FVMA 2Y6ZA 5I0DA 2WYSA 3P61A 1LQAA 2ZXBA 4GD0A 1KA9F 2ZX5A 4JYEA 3N4FA 1ZP3A 4JIEA 1H1ZA 2X0HA 3DFNA 1QAPA 1M68A 3GVQA 1FFRA 3ZJ6A 4FLRA 4Y9OA 2PRLA 1D3HA 4US5D 4C7FA 1V6VA 1XYCA 3O16A 3RX2A 2GUUA 4Z1DA 1D8WA 1EXPA 4LVBA 1VEPA 4KBXA 2GZXA 1GOOA 5CPLA 4AZIA 1CGYA 1JJKA 5FSDC 2JALA 3E5BA 5EMMA 1EEXA 4R88A 4IUGA 3DFQA 3S4TA 3JU2A 3QV8A 4GQBA 3R5EA 1ZBVA 4AD3A 3O6AA 2WC7A 4IIFA 4YLWA 3W70A 3SGUA 3CV1A 5XIMA 2JEPA 4UMCA 1EUAA 5SWUA 4AFYA 1RQEA 3CWNA 1UWAA 5CH9A 2HJPA 1UWQA 3FS2A 4DAIA 3RR1A 1DWAM 3LYEA 4NAEB 5DF0A 1XBXA 4Q8PA 4PMNA 2PWEA 4NJJA 5BXSA 9XIAA 2GUYA 3EOLA 2ZZ3A 3H2AA 3P80A 4F0HA 1CGXA 4QJ1A 3BCFA 2PTWA 4WDTA 5HUPA 3XISA 1R5YA 3MWCA 2Y7GA 3UZ5A 3M0HA 3R8GA 3TROA 3P8IA 4B4FA 3UFYA 2PWFA 3H21A 3P5ZA 4ACYA 3EMQA 2GPTA 3R6IA 3KBNA 4GXWA 3W6MA 3CEPA 3R58A 2A79A 3I7RA 1UKPA 5G2IA 1IIHA 2VEFA 3VILA 4M56A 3DFTA 3QEZA 3B9EA 4F9DA 3ITLA 2HE5A 4DO4A 3EMCA 2X40A 1QFEA 3LSCA 4RZ6A 4XD3A 3LZ5A 1GKQA 1H51A 4PBGA 3BW3A 1YDOA 1BVNP 1KFEA 4ECLA 3S6OA 3MMDA 3R4IA 2GVLA 4HA1A 3CTLA 3DYOA 4DM1A 1WDQA 5DCEA 4F40A 4NILA 3BO9A 1TCDA 2J7GA 2J7FA 3EOOA 3H26A 2VDHA 3HURA 4DWSA 4I9TA 1E9IA 3UW6A 2A3CA 2GOKA 3HIJA 1VJIA 1P43A 3LCIA 3U2OA 1HKIA 1J12A 2FZNA 1Q45A 4JIIX 3Q45A 4ZB0A 3T9PA 2XFFA 1JPHA 2RDXA 4AEEA 2YL6A 1Z7AA 1XLMA 1SR0A 2VVSA 3RMEA 1VAHA 1V7AA 3DN5A 4UFMA 3ZJKA 2C1HA 4GHRA 5HUOA 1XF0A 3BWWA 4MYAA 4JTLA 1OT1A 4XSMA 1EGMA 5BRBA 3DXIA 5HBFA 3ZIZA 1BSLA 4I9AA 1RY0A 1TJ0A 3LCGA 3GM8A 1OFDA 2YYUA 1KBLA 4E2BA 3SSJA 2VELA 4GUFA 4LYQA 1CWYA 1Q6OA 1YYAA 1MUWA 1UUMA 3WH9A 2CNCA 2DT0A 2VOTA 2WQPA 3WD3A 2ACSA 2NSOA 2VWTA 4AZCB 3TFCA 4F8XA 2RDWA 1YPFA 1JGMA 4HSOA 3MJYA 1W8SA 4FA3A 4LF1A 1V5XA 2FH6A 4LB4A 3EDEA 4XO6A 4JIPA 1US3A 3T0AA 4AF0A 4P7RA 2E6FA 3UWYA 1UW9A 4DYEA 5AFDA 3P81A 1RALA 2VX5A 4E4PA 4FXSA 2QCFA 1RA0A 5AY7A 3CZLA 4H6RA 1XIDA 3WQCA 3W53A 3W2MA 3I6TA 2OSYA 3L2LA 4UMAA 5FD0A 3K1GA 3W22A 3HA1A 1G4EA 5EA9A 1TPH1 1UUOA 2FZ8A 4BI7A 3AC0A 1HJSA 3R1ZA 2WMGA 3B3DA 1J0JA 5DX7A 3RX3A 1R86A 1WUFA 2WNWA 1LOSA 4PMZA 3TXZA 2FPTA 2WJEA 1BKSA 3CL8A 2UV8G 5CBJA 3G1SA 4AEOA 2PC4A 2QJHA 1W1B1 3L7RA 1MRAA 4GH3A 5FA5A 2CZFA 1V0MA 4Y9NA 4JTSA 3RF9A 3WDIA 1TKKA 1HT6A 2QGHA 1WDSA 3GG0A 2CEQA 1WBJA 3W74A 1MSSA 2R1LA 3V35A 3GKFA 3ABQA 2Z00A 4Q8QA 1JG9A 1K9EA 1TVNA 1BD0A 2WMFA 1B4KA 5H8PA 1C7TA 1UPMB 1MI3A 2GJXA 3USBA 2G3IA 2NX3A 5BNKA 4D71A 3W7QA 3W1TA 4AD4A 4EKJA 1F3WA 3MO7A 2PTXA 5CSRA 1ZAHA 3F7JA 4Y6GA 4C6KA 1CGVA 4K8HA 3KRZA 1L6SA 2D1ZA 2OQYA 5EMYA 4AHOA 2TSYA 5HNNA 3NWRA 2X05A 3IJ8A 3W83A 1E1EA 3WD2A 2IQDA 3UJSA 3THCA 3GVGA 3IWPA 5JQ9A 1W91A 3MSGA 4GXPA 2XGIA 4EX4A 2FJUB 4IFKB 3H53A 4QAWA 4RCXA 3LCXA 3HN3A 1W9UA 4S3DA 1NY1A 1VIZA 3CPGA 4RDZA 1XGEA 3I6EA 1K7FA 3CAWA 4LS0A 2XPKA 2ZADA 2ZUWA 2WSYA 1ICPA 4LNYA 5FAGA 4MY8A 3TTSA 3P60A 3MBDA 3RILA 4XAGA 4EXBA 5LNUA 3W7DA 1N8WA 1Z69A 2XFYA 1WA3A 4RR4A 3GNRA 3FJNA 1JCLA 2HE8A 3GDBA 1KCXA 4Q4PA 1OSEA 1GQIA 1DWIM 4K3ZA 3WEMA 4BZYA 4PZVA 1TV8A 2NUWA 2DT3A 3UNDA 3QV6A 1V3KA 2NLYA 2OZ8A 4Z1AA 1DJHA 2OLHA 2R1PA 3BLPX 1Q6QA 3KS5A 3S8HA 1JD9A 3IARA 4PEEA 4XZLX 2JKEA 4AWSA 3H6OA 1B9ZA 4FOJA 3WLKX 4WDWA 5HANA 4DZ5A 1UYQA 1ZGDA 3VINA 5EGRA 2Y89A 3GNPA 4C6NA 4O52A 1R47A 1UJQA 1N2VA 1PIFA 1C92A 4GZEA 2IQTA 2PDHA 3TAOA 4WGXA 4E2OA 2DQWA 1NARA 1BXBA 2I57A 1A5UA 3T05A 3OHIA 3SO7A 4TR9A 2Z7GA 4JFTA 5JBDA 2BY3A 2BZNA 3OLIA 3PPHA 4Q4OA 5DMMA 1GVEA 2FB2A 2X2GA 5GNZA 5LYRA 4LY8A 4AXNA 2R6OA 4GNVA 3URAA 3CB8A 4JY9A 5MKGB 1SFJA 3GIQA 5HR6A 4KWVA 4MNMA 1ICSA 1NWUA 5A8OA 5H91A 1ALDA 4ENLA 1UMLA 3I3BA 4NXSA 4EF8A 1LYXA 5A6BD 2I5GA 1Q6FA 2EPMX 3EKZA 4NVTA 2EBNA 1GVRA 2QCHA 1V3LA 4B3KA 2DVXA 2Q01A 3WF4A 1CXEA 1GOMA 6REQB 4ZO8A 2P8CA 5G1YA 1EWEA 2TAAA 1HVQA 4IMGA 1ITXA 1PIIA 3OYZA 3ABSA 2BHUA 3WUBA 1Y65A 1DWGM 5F4SA 1XKJA 3DI0A 3FYPA 1BLIA 2DSZA 2WM0A 3EMZA 1VRDA 1VLWA 1XIHA 3ZJ7A 1XWYA 7PTDA 4BCEA 3GX9A 1XBYA 3U7BA 4TO8A 1ADSA 5JH1A 3P7YA 1OGSA 3EEZA 4N6EA 5JIPA 2HXTA 3W00A 5D37A 2BWGA 1ISVA 2DZUA 1H0IA 3GY1A 5JMUA 5LIKX 2C71A 2DIEA 4EVZA 3WQOA 3WQ8A 2VXNA 1CXKA 1SVDA 5FCZA 4GCAA 1PSCA 2J79A 1UIOA 2ZX7A 2OSWA 4LANA 2INZA 4NASA 3WQPA 3UNTA 2P76A 3UVAA 2CLFA 1JZ2A 3WDRA 1CB2A 5A95A 2Y70A 1I0BA 3QGAC 2C15A 3HGOA 3OG2A 2ALRA 1FHVA 3YPIA 3UG3A 2VR5A 3FW6A 4L6OA 1Q65A 4A8LA 3MSRA 3PBYA 2D0HA 3M6DA 1UHVA 3KWSA 3B8IA 3HG2A 3BAWA 3PPCA 5HJLA 5K9CA 1JZ6A 2NWRA 4QQ3A 4V33A 5EKYA 3G1VA 1SZFA 5A6JA 1V0KA 2J6VA 4C1NB 4BEQA 1DWHM 3WQFA 1E0VA 1EQCA 1Q5MA 3EDKA 1P1XA 2O55A 3TP4A 1W3KA 3LV6A 5M1TA 3LM7A 5I77A 3KHJA 1EO5A 1J6OA 3VNKA 2YDRA 2ZRXA 1QNSA 5D33A 3V5OA 1TVPA 2PDBA 4XIAA 1OIFA 3CZKA 3KTSA 2FH8A 2X1SA 4NF7A 4K7VA 4GZIA 5E9XA 3G1HA 1LBFA 1ISZA 3VCCA 2NVAA 1K02A 3S1UA 2OT0A 4S39A 1YHTA 1V6XA 3HF3A 4FI4A 4NL1A 3AROA 1QHZA 4GACA 4AZ7A 5ABHA 1E5NA 1PX3A 3VIJA 3W3OA 4FX7A 3QOKA 4QM1A 4E8GA 1VHNA 5EFDA 4WDXA 3WMCA 2DIJA 1VB9A 1RJRA 2R91A 3B8DA 3JUGA 4I6VA 5CJ5A 2V5BA 2E3ZA 2QCDB 1XISA 4EPDC 1FWIC 2MUCA 2R94A 3RM4A 2FZDA 4UZUA 4UOJA 1Z48A 4H2HA 1YKWA 1IHIA 3EDJA 3E12A 2FGBA 5I3GA 4JZ5A 2VEIA 3BK0A 1EC9A 3MZ2A 3ZZ1A 3OP2A 3S6DA 1OK4A 5H6HA 3MQTA 2VKZG 1KD0A 3RO6A 2UZ9A 1CT5A 3NEHA 1D7KA 4UBPC 3PZQA 2C8NA 1VHCA 3AI0A 2J9ZA 4EE9A 2R1KA 1ZU8A 1JNEA 1OFRA 3N25A 4MNLA 3WLTA 2OT1A 4QP0A 5DRIA 1YNYA 3E02A 4HU4A 1VFSA 3T0DA 4Z08A 2C13A 1UD5A 4OECA 1ISYA 3WLHA 1PEZA 3LQGA 4K6AA 2VJXA 2PEVA 3W84A 1YNQA 2Q3OA 3JZUA 4HHLA 3RO8A 2PA6A 4Y90A 3AS0A 3PNUA 1EIBA 4PUKA 7TIMA 4GLEA 4OV9A 3AU6A 3SCRA 1FWGC 2VZTA 1S2VA 1C3FA 5HK4A 3QHNA 3ENLA 1V08A 2IPWA 3WDQA 3A22A 3PNZA 1Z6KA 4JDBA 1J01A 1NDYA 3G1YA 5LNWA 3VGBA 4W8AA 4AIBA 2PTYA 3VIKA 2A21A 4GC3A 1I45A 3OZOA 1ZQ5A 4LEFA 3SQMA 2Y85A 4F48A 3T8LA 1JF5A 4JHOA 2ODOA 4KRTA 4W5UA 2OKOA 2VX6A 3R0UA 4O8AA 4O50A 1GHRA 2ADAA 1G5AA 1LTDA 1BF2A 4R33A 5J5RA 1QCWA 4OV4A 3V1HA 4AIUA 3SUWA 4QDMA 2NV2A 1FXPA 2WVVA 4M82A 1ADOA 1PB0A 7A3HA 4R27A 3TZNA 3ZM8A 1A5CA 2JQXA 1XQKA 3V7PA 5D2YA 2OU4A 1QWGA 3TLQA 3N13A 4H00A 4UCGA 3TWAA 3IJQA 4LW7A 1WKDA 4F0RA 3R8RA 4EWJA 1XYAA 3N11A 2FFCA 1QNOA 3L12A 1U1UA 4WJXA 2DSKA 3SRFA 3GR4A 1X7IA 3Q37A 2E5DA 3UY7A 1QXLA 3N6HA 3P67A 3NQCA 3NZGA 4YL2A 2D2OA 3R2GA 1TA3B 3LPOA 4TUFA 2MANA 4NZJA 2BX7A 2W9MA 3TR9A 1KM1A 1S5MA 3TTEA 4Z1CA 3BW2A 3LB0A 3RLUA 2YB4A 3ALFA 3C2RA 5JU6A 2CKRA 4A35A 5T9BG 4GY0A 3C8NA 2Y1HA 5C8BB 3WMBA 5TNVA 5I07A 1DQUA 5DMNA 1IWAA 2J24A 5D4YA 1A3XA 5I5RA 4W89A 4BEUA 4NG3A 3GSMA 1J10A 4Y8FA 2QF7A 1BQGA 3C52A 1XW8A 2PGWA 1J0ZA 2F6XA 4LJ3A 1GNXA 3IJ6A 3EZ4A 5AECA 3GR8A 4OZOA 4HNUA 3O6YX 1KGWA 4NI8A 3TW7A 3VE9A 1S3HA 4UXDA 3D47A 4PUWA 1R46A 4Y9AA 4ZXLA 3UPMA 1KCZA 2DZAA 2DQXA 1X97A 5A8GA 1G7UA 3I4EA 3VZYA 2VOMA 3BGGA 5A8PA 1LUCA 1M7PA 4HMDA 3V0UA 1VBUA 2J25A 1E5JA 2EPHA 3QC0A 3UJFA 1DWJM 4G9PA 2XJ7A 3WLSA 4NNCA 4MADA 3RJYA 5GPRA 3ATZA 1XSKA 2EG6A 2YA0A 3KOFA 3INPA 2W27A 4I5RA 2H90A 4O0KA 4BA0A 2E4TA 4IHCA 2CYGA 5G2HA 4YU1A 2PWUA 1TCMA 3M41A 3BW4A 1EBGA 2VQUA 1TG7A 2OLSA 3IV3A 4LAOA 1Q8AA 1LRQA 3BLFA 4PN2A 3W7PA 3W7MA 4GGHA 5HJYA 4JKKA 4KCUA 3F2DA 1AVAA 1VD6A 2PDIA 3TN3A 5MF5A 4G56A 1ZL1A 3T1GA 1PS9A 3GIPA 1V93A 4FMVA 2XHYA 1BSIA 3ZOAA 4L4MA 3W81A 3MP5A 5FEPA 3A3HA 3PF3A 3D5HA 5KSWA 2YDQA 4GJ1A 4DLMA 2W92A 1IWBA 1QNQA 2G4FA 1B3YA 3UJEA 1FWWA 3KBWA 4AWUA 1XS2A 4JTIA 3NZPA 3PZIA 4ZO7A 2VRQA 4QIUA 1R9XA 1OX6A 4GPNA 3QC3A 1PTGA 3NL5A 3KHDA 4NAFB 4EIVA 4JHMA 2Y24A 3WCZA 3BLKA 3WUGA 2X30A 2YW4A 2ZZ4A 4F0MA 3NZQA 3REQA 4P8XA 1OB0A 3WLRA 3VUPA 1IYXA 2ZXAA 4X2PA 3U8GA 3UR7A 1ME7A 4D6GA 3GG8A 2P10A 3EPNA 2ZWZA 1TRIA 3EOUA 2PZNA 4LUJA 3S0CA 2Q09A 3EDDA 2J78A 4TXEA 4NZ3A 3FCPA 1TZZA 1WNOA 4C6JA 3LLXA 4YTRA 1KFCA 3H24A 1H7NA 1OCJA 1QOPA 2TPSA 1VF8A 2YLAA 4CNNA 3CWOX 2XVPA 4Z1YA 1CX9A 3FHQA 4GUHA 4D1JA 4PTVA 1W3NA 1GORA 3KTCA 3OIHA 1AL7A 5C9XA 4F2TA 4AW7A 3PZTA 1OCQA 4J4KA 5EBAA 3QOMA 4JICA 2WJZA 1KB3A 4UQ9A 4HB7A 1KXQA 8A3HA 1CW2A 2QDDA 3AWOA 3GG1A 1KRCC 3FFSA 2GSJA 3F2BA 1K1DA 2POZA 4PC8A 2DZWA 1VCFA 5T26A 3A13A 2VX4A 3IS4A 3T55A 2V0TA 1NFBA 3CMGA 1OGGA 3SGGA 2CLMA 3F1QA 4RDYA 4KCTA 3NR0A 1S1RA 3PWAA 3FY1A 3WL1A 3GKAA 2RGLA 3VOJA 3ZR5A 2WLYA 4JXCA 3CZJA 3E0LA 2ESCA 3DHUA 1JR1A 2VCBA 2HV5A 4EXAA 1TV4A 3SRKA 3GBDA 1LOLA 3PZUA 3K5XA 4C6QA 3S1WA 5DFAA 4BWLA 1DIEA 2PLJA 1XC6A 1S2CA 5CAHA 3NUKA 2GVEA 4MWAB 4ROQA 3TR2A 2WMIB 4MMWA 1U5VA 3UXIA 4JTDA 4JIRA 3CO8A 3BJFA 4GG9A 2V8ZA 1VYRA 1X8FA 1CXLA 4FXRA 1K6AA 4V28A 3DX5A 4XIMA 1XGZA 1JIBA 5A6KA 3FKRA 1J4EA 5ECUA 2XH0A 4P7LA 3VFLA 1V6UA 4ZVJA 2REQB 2DGAA 4LUSB 3VNIA 3LCFA 3EX3A 5FL0A 4DNHA 2YX0A 4GQRA 4DJFA 3SAZA 2YKKA 1W5NA 3DBPA 4UNKA 4NP7A 4PBFA 2DW6A 3LCWA 4I6KA 1TJRA 4N9CA 1W9BM 3GR7A 3O7UA 5A2AA 2D2HA 1US2A 4Q33A 1PKNA 3C4UA 2G41A 3BLEA 1FWJC 1XGDA 4FX8A 3PTKA 2CZDA 2OTDA 1Q7MA 1TX0A 5I03A 2JIWA 3DGRA 3MCOA 4KCVA 3UQNA 4MFDA 2YL9A 1ZTVA 1KKRA 3LRKA 1UROA 1A47A 1PAMA 3G5EA 1EC7A 3N04A 5I02A 2V30A 1POKA 3BQ5A 3QF0A 4OBRA 3DG7A 4I7VA 2XVKA 4JTGA 1Z32X 5HULA 2BVWA 1FWNA 1W3JA 1V3IA 4R85A 1MW0A 3TFXA 3VNZA 1U22A 3VC6A 1IXNA 4CLMA 6TIMA 2XIQA 5BCAA 4DVOA 2E25A 2NT1A 5F2IA 4K68A 2GVJA 3BCJA 1HJVA 4RW5A 3NO3A 3OTRA 3MJMA 1QPQA 3QR3A 1BVWA 1XYLA 4YXGA 5FEZA 2CZVA 5BXRA 4H8HA 5BU6A 4LY4A 5EYWA 4TMBA 1K8CA 2BVDA 1B31A 4MPKA 1NDZA 4ML4A 1S2WA 2FHCA 3GNXA 4WSJA 2WCSA 2BODX 3FJLA 1PKYA 5REQB 3TZFA 4C6LA 1A5SA 4N9BA 3A4JA 3GU9A 1UQYA 2NW0A 3WJZA 3M4HA 4FXFA 2RDTA 1ZCCA 2CITA 3CZGA 4FNTA 1ZUAX 3T07A 3FDGA 1ELSA 4ZB5A 1L9WA 1OX5A 3A4XA 1IEIA 1VCVA 3BV7A 5LHEA 5E9AA 4HHMA 4E2VA 3GFYA 3VOHA 3U6WA 2ZUVA 3PZMA 1EJXC 3LUTA 1ZB5A 3TYUA 1FWSA 4E38A 1LCOA 3SN0A 3EWZA 4TTUA 3TN6A 4AHPA 1O94A 1UKQA 1UKOA 5EMUA 3WH5A 3G0XA 3MA8A 4ML9A 2Y7DA 5HPCA 2WW5A 3PSWA 4YPJA 3NQ2A 2CBVA 3TLLA 3DYPA 3NO1A 4K39A 1ZAIA 4JTRA 4O10A 1PCKA 4OUIA 1MRQA 2NWSA 5A6BA 4JFSA 1PIGA 4AVOA 4QJ3B 1XRSA 1Q6GA 1KRMA 5LIYX 4E0CA 2E67A 3D46A 3K30A 3W23A 1MEWA 1LT7A 5B7ZA 3VCNA 2WBKA 2G3MA 3EA2A 4IP7A 5DMLA 4PCPA 2VZUA 3NCOA 1B30A 3H4WA 4A29A 3E2SA 3ARZA 2FIQA 3UCQA 4R53A 2NQJA 1SM9A 1F8IA 3AMLA 2X0YA 1O60A 2F2HA 1LOQA 3H7RA 3PZOA 1D3CA 4UTFA 4MHBA 3UYCA 1H63A 4A3HA 3HBLA 3S42A 5C9UA 3VIFA 3HQ1A 1FWTA 4FF7A 1I0DA 2DU2A 3AMDA 4ACZB 2VX7A 3AWNA 2PP0A 4HBKA 1MWOA 3MP3A 1FHDA 5I09A 3W1NA 2VTFA 3AJ7A 1YMYA 1UBSA 4QCEA 1M9HA 5A2BA 3GNDA 1MZRA 4CVWA 3E49A 2Y7EA 2XIOA 5CPOA 2DUZA 4Y8EA 3ITXA 2GFTA 2C14A 3QTPA 1JDCA 1QW8A 5CC5A 4OQVA 3DOPA 4EF9A 1VENA 2VENA 2H8XA 2QJMA 3AHVA 3LENA 4R34A 2H9AB 1RH9A 1RQBA 1IIGA 5A6MA 4N42A 3P62A 3LHZA 3S2LA 3KCOA 1XP3A 1WZLA 4A4AA 1E6QM 3L4UA 1BG4A 1HKKA 3TJ4A 1VBJA 2OWCA 3ZSTA 2AL1A 4PODA 3L4XA 3VMOA 1LWHA 2GWGA 3FOKA 1OFPA 4TIMA 3B0PA 2G50A 1JFHA 2JKAA 4L9YA 3KZPA 2L5HA 3C2OA 3M0IA 3WF3A 3TK7A 2CXEA 4CN4A 1NP0A 1O5RA 1JAKA 1ME8A 1AMYA 4E4UA 1TJPA 4IG2A 5ABEA 1JNDA 2CFFA 1FUYA 2J13A 1HKWA 1W3TA 3I6RA 4NX5A 3W7IA 4G8TA 3VGDA 1QRQA 1JULA 3OYXA 4NIRA 3CUXA 3P2VA 4I5UA 1K9DA 4MNKA 4QG6A 2A3EA 3PFRA 5GQBA 1U1JA 1GOKA 1PZ3A 3TU9A 3LPPA 2DH2A 5EPDA 2XVNA 4OOUA 1VRXA 4H6EA 2VR4A 3GNOA 4H8VA 1QASA 4GWEA 3TTYA 3LMZA 3N14A 3FSUA 3I65A 2OLAA 1H49A 1E6RA 4HNVA 4XVEA 5B7YA 1Q2RA 4S3AA 3RM8A 2XVGA 4RDWA 2DIKA 1FWEC 4MIMA 3ZVHB 5D2XA 5C7HA 1C29A 1YIXA 2QHAA 5BWFA 3WLLA 3WFLA 4JCMA 3BARA 4B5TA 2ZDSA 1OQFA 4IPIA 1Y7VA 1WBHA 1TV7A 1Z42A 3L9CA 5HNRA 2DVUA 2OKTA 5EY5A 2Y61A 3ABOA 3G6MA 3LG3A 4Q6JA 4UQEA 2I16A 4WR3A 1GVSA 2GGJA 4C6BA 1EA9C 2D24A 3GH4A 1XLBA 4RE4A 3AUJA 1QMLA 2Y2WA 2I5IA 4EK7A 3CYVA 3R79A 4US6A 2GGHA 4G7FA 1QOQA 4D9PA 3ITTA 4NI3A 1SPQA 3LHVA 3V5FA 4K38A 3R12A 4J2MA 1V3HA 1YW1A 3TCEA 1V02E 4PMDA 4DO5A 1DE6A 4GE8A 3BE7A 4KW2A 4W4QA 1NFPA 4W8LA 3EX6A 3K13A 1C93A 2E40A 2WAGA 2E5CA 4QR6A 2PDPA 1AQ0A 4JY8A 1LBMA 1W5OA 2QUVA 1DORA 5E6YA 1E6SM 3KWXA 2TRSA 4OE7A 3VNLA 3GUGA 1MW3A 3TSDA 3OVGA 4K8GA 2PGEA 4PCSA 2QJNA 4XISA 2RJGA 2XFRA 2JF7A 2WVSA 3QY8A 1OWQA 5KINA 3R8HA 3WNPA 2D22A 5F4XA 3N73A 4NJGA 2Z1VA 1UH3A 2C79A 4Q8UA 1QO2A 4RPPA 4D8LA 1TQJA 4UTKA 2QV4A 2J88A 4O28A 3ZVIA 3B0YA 4D6CA 3H2MA 3NXLA 1GYMA 3IGXA 1PE1A 3FEMA 5E0FA 4F0SA 1XFCA 3ABZA 1CXIA 3SCQA 1F73A 1Z89A 4YCPA 2QPUA 4GIYA 4LAKA 1VJSA 3AISA 3TYAA 2VFIA 1I2QA 3P84A 1Q3NA 4Q6XA 5FKYA 1AL8A 4JNYA 3BANA 1B90A 4ZA0A 3EXTA 2VUYA 4M24A 3KEHA 1F2JA 5LA2A 3AMGA 4XX6A 4CU6A 3AU2A 3W87A 3UESA 3WNLA 5XIAA 4QLJA 3OJGA 3PZ9A 4CN6A 4DBDA 4L6HA 3VKJA 5DT5A 4LVDA 3SUSA 2Z6JA 4HP5A 4INFA 2BHYA 4S3JA 3J7HA 1XCWA 2IQ0A 4NT0A 4EXQA 4J27A 4C5YA 1ISWA 3GDKA 4EAMA 3POHA 3HM7A 3T2PA 3MI3A 3ITCA 4TX8A 2ZCGA 4CNTA 2NXIA 4J28A 2HWGA 3DCPA 4ERIA 2GK1A 2ISSA 1BHGA 2X42A 1QT1A 3WK3A 4JQ4A 4BHYA 2BDQA 3VGEA 4H9VA 1V4YA 4WXZA 2OYMA 4ZZ9A 3IVTA 4AF0B 2IKJA 4KWOA 3ABRA 1O5KA 2EJ1A 1KRBC 4QNEA 4ZR8A 3VTRA 4TVUA 3NQ7A 1UD2A 3MUY1 3C8FA 1G94A 4UFKA 4X63A 3VVGA 1NOFA 4AC7C 3VO0A 1QDSA 4ZOCA 2Z0IA 3G1XA 1GCYA 2GJPA 3AYTA 3PSVA 2HRWA 4NZ1A 4ASTA 3MKKA 3RAOA 3W73A 3GTIA 3BCDA 4D1IA 4XKYA 1JF6A 1GVFA 2Y8UA 2YSWA 4M29A 2PWHA 1E15A 1UD3A 3ANVA 1TTQA 4FLSA 4MPQA 3C2FA 3MDWA 3O2LA 3V18A 3VMPA 3B8TA 1TPDA 4C6FA 3W72A 1EP1A 1JDFA 3BG3A 3CHCA 3G24A 1JCMP 3CQJA 1K8XA 2WVUA 3B0VC 1A5OC 3N9RA 2NV9A 3QFEA 1G0CA 2XZ9A 3ARPA 1XLLA 1PKMA 1OK6A 1OD8A 4IJCA 4A8IA 1O6IA 2YCJA 2H6RA 3SY1A 1A5AA 3GQYA 2ZZ1A 3DBNA 4XD4A 5FJRA 2E6AA 1B3ZA 4QJ4B 3A4WA 1XLKA 2GGIA 1Q7QA 3S5YA 3M5ZA 3MS8A 3T0CA 2Z1SA 4A3UA 4MFEA 3L65A 4E8DA 1MNSA 1DTUA 4I8DA 3W88A 3OOQA 4UMBA 1MQQA 3CUZA 2XM2A 1E72M 1GOWA 2O4MA 5LNRA 4H8UA 3OZMA 4Y7EA 4A8NA 2HBXA 1QR7A 2WNQA 3DGBA 2G97A 3WN6A 3RPTA 3BOXA 1IR1A 5A2CA 4GI8A 3CU2A 2VGFA 4OOZA 3URQA 3A21A 4L4LA 1FP9A 5JBFA 2J7BA 1U5HA 4IPPA 2FZMA 3G0UA 2XTKA 3BGJA 3L67A 4KMQA 4YTUA 3ITVA 3MO4A 3M16A 5DBUA 3B9DA 1EC8A 2CC0A 4WIWA 3V16A 1VH7A 1G9HA 4DWSD 1W5PA 1V79A 3SCNA 1A50A 4XAPA 4C6EA 4GBUA 2C7FA 3WDPP 1B3OA 3KDOA 3QHOA 3VIMA 1Z9AA 1EJUC 5GJNA 3CM4A 1PJ9A 4H3DA 3WSUA 4DQWA 3LOTA 1M6JA 1WXYA 4GK8A 4GI9A 4DLFA 3O8AA 3B05A 3PAOA 1JYXA 4Q7IA 1NJJA 3VKDA 4FXJA 3M07A 1KFLA 4W85A 2VVNA 2Z25A 1AD4A 4GYPA 4CNPA 4MB3A 1NM9A 4DB7A 2YBVA 3TYZA 3GNNA 2ZX9A 3NQFA 1DOSA 2A6LA 4AAJA 2A5HA 1TMQA 2YR1A 3AALA 3ARVA 3T09A 1PKLA 4S3FA 2F84A 3TQPA 3LNPA 1JRBA 2DORA 4L80A 1XLGA 4ORMA 3PS7A 3LGGA 5IM51 4KGJA 2WVTA 2OZ0A 4C1KA 3AIUA 1V02A 3QXBA 2H3DA 2E28A 3PP7A 4JIHA 4DBSA 1HL2A 3LHYA 3H2CA 2E7FA 2ZRUA 3EB2A 3C86A 1S2TA 2V38A 3TQVA 1S39A 4C6MA 2Y8KA 4MZ8A 1JDAA 4ERGA 3AS1A 3OLGA 1DJZA 4Q4SA 1U1HA 3HTWA 3W7KA 2YCLB 1AH3A 4QG8A 2XH7A 1F3TA 4N02A 3EWCA 1LDCA 1EJWC 2WM1A 4UQDA 1QPNA 3PJWA 1KLZA 3S83A 4CEXC 5AC6A 3WX7A 4GGBA 3DIPA 2XGZA 1M65A 1H1NA 1HJWA 2RH9A 3MKCA 4XWUA 2WZHA 1H7XA 5DXXA 1Q6LA 1EEPA 4O53A 1F9CA 1H2JA 2PDXA 4PB3A 4E6MA 4Q3MA 5FACA 3G2GA 4GKTA 3ZR6A 2NVCA 4NNBA 1YQ2A 4BF7A 4W5ZA 4F2BA 3TIMA 3TOYA 1OGBA 3T40A 3E3HA 3OBKA 3FXYA 1ZRQA 4Q32A 4B9ZA 1BVZA 3RR4A 1A0CA 4IOTA 4CQAA 3CASA 1TR9A 4WXYA 2QJGA 2V2DA 2PDYA 4I9JA 4DBEA 4IPJA 3N18A 1F61A 4UFJA 4JQ1A 1UWRA 2VCAA 1FWBC 3NSNA 2EPOA 1EB3A 5HQEA 4YYFA 1JCTA 4LVAA 1TMHA 3A4AA 4Q4MA 5CGTA 4Q8MA 3LM3A 3SJ3A 3GUWA 3T44A 4PSRA 3HGRA 1M01A 3S2JA 2HS8A 4R7OA 5CPTA 1E1CB 4X3ZA 3M47A 4ICCX 2PLCA 1WKEA 1Q6EA 2O0TA 2EG7A 4BQ5A 1H50A 3CHEA 3K2GA 2HVNA 5BXPA 4J1OA 1T8XA 3CV6A 3WBEA 4C6OA 3UZWA 1TPVA 1LQ0A 3VM7A 4DYJA 1KGUA 2GVGA 1ZJHA 4FP1A 3ZSSA 5FF4A 4DO6A 3M0VA 3R43A 2INEA 3ZLFA 3QGVA 1K7EA 1TJ1A 1XX1A 5AN7A 2ACRA 1GEHA 1K4HA 1A3HA 2PDJA 5GNYA 3IJDA 1OC7A 3QKEA 3W7RA 3AO0A 3CIVA 1US0A 2OJPA 2Z28A 1MEHA 4BQ4A 3W02A 3AXKA 1YDYA 3UP8A 1XDJA 2J4GA 3PFMA 3MU7A 3VKAA 5BOEA 2WJDA 3P5YA 4GX9A 4FX6M 1I8JA 3SZ8A 1AJ2A 3VAVA 1RCXB 1LWJA 1QK2A 3S47A 1F6KA 2WKJA 1NU5A 1ISXA 4RNFA 2ZUTA 3STPA 2GDQA 3TQKA 4HMEA 2XH4A 1QPOA 2DV0A 4NAEA 2E9BA 3NVTA 4X9YA 1ZLPA 1R2RA 1LL4A 3BMXA 3OEXA 1ONXA 1X6LA 3L5MA 4KEMA 1KM4A 2OZTA 4MDPA 1FY6A 3NQMA 1ITUA 4B2DA 2DT2A 3K8KA 2B0MA 1E4LA 3NYZA 2B7OA 5I2UA 4B5SA 4C7DA 5IBXC 3DHPA 3L4VA 4NZ4A 3KE0A 3KL0A 4WY0F 4A6GA 4C1LA 3OVQA 1KRAC 3NFUA 1PL9A 3ERPA 1HJQA 1KTNA 2E9LA 2AQOA 2PDNA 3HO8A 4RZBA 3UG5A 2BLEA 4OTKA 5CBBA 5CZTA 4L4PA 4L7ZA 3TXVA 3N4EA 2BGNE 4ZSUA 1GQKA 1RY8A 4O17A 3LXAA 1K8YA 1PDYA 4WOQA 3H2OA 3UJ2A 4LCRA 3S5NA 4JX4A 4QS5A 5IBXA 4P5UA 4HZ6A 4IWWA 3HZ3A 1N8IA 1VFFA 4Q22A 3OGSA 3UZYA 3MBFA 1HP5A 2HZGA 2WMHA 1H62A 2J9YA 2Z1KA 1A4LA 2H8ZA 4ERAA 4AC1X 4N4QA 4UUIA 3SFKA 3VA8A 3QR1A 2AKMA 1EUNA 4WX2A 2Z7KA 3O63A 3UZZA 2PGFA 4G1NA 1Q4NX 4L6DA 4RX0A 3BUVA 1V3MA 4KWSA 4Z42C 3QZAA 1ZZMA 1XCFA 5G1TA 1W3IA 2E9MA 3FAWA 3S5ZA 1QVBA 1HGWA 5AYBA 5C55A 1JZ8A 1UOKA 2ZA1A 2VZVA 3GXIA 5F4WA 3KOZA 3ZLGA 1NELA 2GUBA 2E5BA 1E9LA 4LEQA 2QDGA 1MYRA 1VCGA 2AMXA 3HU7A 4AIOA 4DPPA 2Q8ZA 2PDLA 2GOUA 2Q6ZA 2CETA 1TV5A 4UIOA 3URNA 2PP1A 2VGGA 2YIHA 4C60A 4K37A 1O5XA 1ECQA 2BASA 2DUXA 1P4CA 4DELA 4R7JA