2PRHA

The structures of apo- and inhibitor bound human dihydroorotate dehydrogenase reveal conformational flexibility within the inhibitor binding site
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
367
structure length
358
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title The structures of human dihydroorotate dehydrogenase with and without inhibitor reveal conformational flexibility in the inhibitor and substrate binding sites
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 135
structure length 358
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2prhA00
1YYAA 3LDVA 5BNKA 2OX1A 4RXFA 5CSSA 5HUOA 1XBZA 4JTGA 4HIBA 3S0CA 3INPA 4K8EA 3PSVA 1OVDA 1W3NA 1KV5A 3G3MA 3Q2DA 2QJIA 1VS1A 2Z1BA 2FPYA 2VXNA 4BI5A 3W2MA 1YDOA 3LBMA 2NX3A 1RV8A 3SY5A 1FWSA 1ONRA 5EKYA 1MZHA 4CQAA 1NAL1 1R2TA 3W85A 5IBXA 4WZHA 1JCNA 3L67A 5AYYA 3GVGA 2ZRUA 1CX9A 5HWJA 3W1RA 2GQAA 1FWWA 1H1ZA 4O50A 1F76A 3P62A 1GVQA 4PA8A 4ZQNA 3W75A 3EX6A 3DI1A 3S9YA 2PRMA 4XQ6A 1GTHA 3A5VA 3GZ3A 3WJSA 4HNVA 1OFRA 3SR7A 4PH6A 1VYRA 4UTTA 2A5HA 1LP6A 2QKFA 3DHFA 2V5LA 2FFCA 2WOQA 4EOUA 1MSSA 3UWQA 4IMCA 4UMCA 3P60A 4IX2A 3KVKA 2ZRWA 3VCRA 5AHLA 2QAPA 3EKZA 1FCUA 5CPNA 4AAJA 1OF6A 8TIMA 3GDLA 1TO3A 1KTBA 4UTWA 2TPSA 3M7WA 3RLVA 2A0NA 1KFCA 2E6DA 3P5YA 1AK5A 4OT7A 2ZZ7A 3CEPA 4E0CA 3ATZA 3TAKA 3BLFA 3LHVA 2CLLA 2V30A 3I65A 2VEPA 2TYSA 6TIMA 4O19A 3IGXA 3GAKA 3VE9A 3W7KA 1KFKA 1FCQA 2A6NA 4GUIA 3G1XA 1OYBA 4HSOA 3KRUA 3BARA 4NZJA 4E2BA 4FX7A 3EWUA 1OFBA 1FX6A 3W88A 1Q6RA 1ZFJA 2BWGA 1GWJA 3L5MA 3UY7A 3BV4A 4H4IA 4R33A 5LNUA 1OHLA 5E0KA 4X9SA 3M5YA 3G1FA 3DZ1A 3R2GA 4UTJA 3RFAA 3FYOA 1OYCA 2R14A 2VFDA 4O11A 2F84A 1Q45A 2KZHA 1KM6A 2QCNA 3MP5A 1MEHA 2QCEA 4JXCA 1W31A 1N55A 1EWDA 3EWBX 4MPQA 1A5AA 2JGQA 2NXGA 4FNTA 5E93A 4K36A 2VFEA 2HS8A 1PS9A 3O07A 1SW0A 1BWLA 4XTIA 3NPXA 3M5VA 3S1UA 1YADA 4O17A 1G4SA 5FF7A 2Y88A 3STFA 1W3TA 4IXHA 3LCGA 1TPH1 2FIQA 5D2WA 1H7RA 3MWAA 2E6AA 3N2MA 4FO4A 3C0JA 1LBMA 1RZMA 2DZXA 1GZGA 1ZJIA 3HQ1A 3FYPA 1L2UA 4N4QA 1F7BA 2YX0A 3BW4A 2H8XA 3W1MA 1YDVA 3U8GA 3FOKA 1S3HA 4TO8A 1W54A 3TKFA 3NQVA 3PB2A 1B3OA 2YCEA 3UWZA 4AEOA 1ICQA 4GUFA 3QEZA 3MJYA 3IGSA 2DZSA 3CB8A 6ALDA 4MZ8A 3IRDA 4LV9A 1K03A 2RH9A 4O1DA 1VPXA 1UCWA 1A50A 3GXNA 5D2TA 5G4WA 2QR6A 3NL3A 1VH7A 4A22A 1QCWA 2NUWA 1SZFA 2ZYFA 1OK6A 3KVMA 1S5WA 3QMTA 5F2IA 4YWIA 1I45A 3ELFA 5KSWA 2EHHA 3BPWA 3PAJA 1HO1A 2NUYA 2BZNA 4E38A 5DN1A 3NQDA 1SFLA 2CWNA 1XDMA 1XKYA 3EWWA 3FFSA 3WJWA 1W3IA 3N9SA 2EPHA 2YPIA 2I14A 1JUEA 1QR7A 5CZ0A 3TQ0A 1MO0A 3GIYA 1I2OA 5H91A 1DBTA 5F1UA 1VCVA 3TU9A 4WUIA 5KMYA 1K7EA 3N19B 1VC4A 3P81A 4QJ1A 3W7HA 4NJIA 3FA5A 4QNWA 4R7JA 1WXJA 4UFKA 3MO7A 4AVFA 4M7SA 3TH6A 2ZQ0A 5F2LA 1GG0A 3BGJA 1WAUA 3DU0A 1UJPA 2NLIA 3AJXA 3VE7A 1VYSX 2WNQA 3RK8A 3T44A 2RFGA 2UV8G 1GQNA 3CM4A 4PTNA 1DJQA 1V5XA 4CQ8A 1TQXA 3TW6A 4ALDA 5C2XA 1GPWA 4CNNA 1DJNA 1FCVA 3HF3A 5D03A 4YXGA 3M6YA 1LLZA 3R12A 1EUAA 4NJHA 3LCXA 5D33A 5D2VA 2ABAA 2LLEA 2ZZ1A 1KLZA 2NX9A 3ANYA 3GDKA 3IIVA 4A2SA 3P8IA 2A21A 3BGGA 1EX5A 5FEWA 3MI6A 3V1PA 2A4AA 1WDWA 2QCHA 2QCCA 3A21A 4TMBA 2ISSA 4BWLC 1XUZA 4DF1A 3MYPA 3TX9A 2CZFA 1FBAA 2J88A 3U6WA 1H50A 3NZ1A 4IJBA 3NQAA 5K4XA 3E0IA 5AC8A 2C19A 2XFWA 1I8JA 3GAYA 4M6PA 4P2VA 1SU5A 5G2WA 1YPIA 2FB2A 1XBVA 1D9EA 1YTDA 5A8GA 2NXIA 1JJKA 1IXOA 3FKRA 2W0UA 1A5BA 5DBUA 3TMLA 3QPYA 2J6XA 4AB4A 3B0PA 5GVJA 4CCDA 2TSYA 1LZOA 1RVGA 5TQLA 1ICPA 2C15A 5CGQA 1TRIA 3TC6A 5I3FA 2X1UA 4CQ9A 1J4EA 3JRKA 4PEKA 4BI6A 1JQVA 4KFNA 1K7FA 3W7DA 3LLFA 4JY9A 4B5NA 2WV8A 2D73A 1ZAHA 4MY8A 4GUHA 3Q94A 3S5OA 2NV1A 3CU2A 3MP3A 3CLMA 3M5ZA 4IOTA 4NX0A 2RDUA 3W84A 2NWRA 1AL8A 4JTLA 3UZJA 3C6CA 4GC4A 3TMQA 2ZZ4A 4WY0F 3LB0A 3TC7A 1OFDA 3H55A 3DXIA 3P7YA 3U2OA 3QMRA 4PC8A 4RV8A 3G1HA 5AC6A 5KINA 3PVFA 2OT1A 2VEKA 3PS7A 4NUWA 1GEQA 1GOXA 1GT8A 4YCPA 4O16A 4UFHA 1XBYA 2ZTKA 1TPVA 4AF0A 4BK9A 1DHPA 3W2NA 4IMDA 3O1NA 5HINA 3DHDA 3W1LA 4WD0A 3C2FA 1O5KA 3OA3A 3DBPA 3NNTA 3UWWA 1FDYA 3M1ZA 4Z1CA 4MIMA 3FS2A 4IGHA 2CLEA 3V75A 4LVAA 5D2YA 1VYPX 4FXSA 2YYUA 3MHGA 3PM6A 3HGSA 5AFDA 4XBSA 3OVRA 3C3NA 1B4EA 1SZGA 3NGJA 2C0AA 5I3IA 3NQGA 1R30A 1JULA 4LWWA 3EX4A 1OFOA 1DVJA 1NF7A 4LU0A 3GXTA 3KRSA 1H51A 4U4MA 3P61A 4Z1BA 2Y63A 2DU2A 1VGAA 5LKYA 1XBXA 3PUEA 3TSMA 2CZEA 5U4NA 2RHGA 1XM3A 2X1SA 3LCWA 1H7WA 1LM1A 2E5BA 3BW3A 3UWVA 3W7JA 4JS3A 3LTSA 3S1VA 4X22A 4A29A 4OBTA 5BMXA 1KFJA 2NV2A 3QSTA 3W76A 3MBDA 4JIPA 3M44A 1RQEA 1ME7A 4N9DA 3MW7A 2ZTJA 5LNVA 4GUJA 3B4UA 3C56A 5CZSA 3DFNA 3TJXA 5K9CA 4DO6A 5EY5A 3EWYA 5HWMA 5LGZA 4DF0A 5FEZA 3EXTA 4A3UA 1OK4A 2PRLA 3TV8A 1H7PA 4RLIA 4PL2A 1ZY9A 1DKWA 2C16A 1THFD 3W1XA 3NZRA 2W79A 3I6RA 5LNSA 1LOLA 4HNTA 1FCBA 3QC3A 5C6MA 2Y62A 2ZA1A 1KM3A 3W73A 4QISA 2QUVA 2G5WA 3G1YA 4GFSA 5AHIA 2PE4A 3CTLA 4NX5A 2ABBA 1TREA 1H5YA 4IXXA 1O94A 3L9CA 2YGYA 3CEUA 5C5YA 1H63A 1F2JA 3BG5A 2DZVA 4AWTA 1S5VA 2PC4A 4O13A 3TROA 1AW5A 1AL7A 1W56A 3W7QA 3C2RA 2C1HA 3HPZA 4HSNA 3NQ2A 4RKAA 2E1DA 4ML9A 3M47A 1AW1A 1D3GA 4DPPA 1YLVA 2V8ZA 4Z08A 1ZAJA 2CLHA 4JN6A 3BW2A 3RNDA 3W7NA 2ZBTA 4L4LA 1GYNA 5ABTA 1TRDA 5DBTA 2QJGA 4Z0SA 3KXQA 4G1KA 2X1TA 5CG7A 1PIIA 3W1AA 3B8DA 3JS3A 3T7VA 2AGKA 1BKSA 1Q6OA 3TXVA 4IX0A 4O1AA 3TSBA 1VJIA 1YDNA 5C54A 3M0ZA 4N6EA 1Z42A 3HG4A 1VLWA 4IUOA 4RR4A 1SW7A 1SFJA 2V81A 1VCFA 4MLRA 3L66A 4HNNA 4HN4A 2WQPA 3PG8A 4LNYA 1JUBA 4ZQPA 2C18A 4AF0B 4UTLA 5CPMA 4MOZA 2OZ0A 5H2ZA 2PURA 2FPVA 3UPWA 1PHWA 3UQNA 1L6SA 1M5WA 5BOOA 4JTUA 2DZWA 3W86A 1K8XA 2E5DA 4GXMA 1VHCA 2YSWA 1PE1A 3NVTA 2DJLA 3NPUA 3GYEA 4QITA 2Z6IA 3WK0A 4NNAA 4IMFA 2FTPA 3SGUA 3UXAA 1VQTA 1JR1A 4O28A 3W2KA 4FNRA 1SW3A 2DZTA 2WKJA 2QDGA 4I7VA 1WBJA 1TTPA 1ADOA 3ATYA 3L68A 2IQTA 4DEFA 3C2OA 2Z0IA 5SWUA 3A23A 2QEZA 2A7PA 3KHJA 3BK0A 5AYZA 5LZLA 3CPRA 2GPTA 1KM5A 1ALDA 4NJJA 3W7RA 3HGRA 3I68A 1KM4A 1JUKA 5J5DA 1SO5A 3LRMA 1YPFA 1A5SA 3MHFA 4JYDA 2W6RA 3M43A 2FB3A 3W2LA 1IXPA 3S1WA 1HG3A 3THAA 1N8FA 3QSRA 2VFGA 2ZCGA 4NXKA 4TR9A 2QCGA 4OU1A 2GQ9A 3ABRA 1VHNA 2XN2A 5K2ZA 5HNRA 4AHQA 1EUNA 3I7RA 3KFTA 5KITA 2G95A 1SR9A 3C8FA 2JGYA 4WXZA 2YR1A 3KVJA 3EB2A 2XN0A 1SO3A 4PODA 1LCOA 3W1TA 1FXPA 5G4EA 1JCMP 3DFQA 1H7XA 4XKYA 1GG1A 2VEMA 1PCKA 4ADTA 3PF3A 4MVAA 3LTPA 4FIQA 1VLIA 5EPDA 2YFOA 3WFAA 4TIMA 1BTMA 3BO9A 5DCBA 5BW6A 3B06A 2AQWA 3EKLA 1LYXA 3IIXA 1UB3A 2R8WA 3W7OA 1W5MA 3WJZA 3EWZA 4JTHA 4GWEA 1W5PA 5EMUA 4JX4A 1G4PA 3EXRA 2ZRZA 2A85A 2WNNA 3O6CA 3KAOA 4K39A 2A2IA 2QCLA 3LV5A 1DV7A 5K3VA 3IGUA 3G1DA 4WOZA 2R91A 1TSIA 5D30A 2G96A 3CC1A 2BXVA 1N7KA 3VFLA 3TQVA 4LVGA 4FNUA 1RPXA 2ZZ6A 3IV3A 4H3DA 5J5RA 5K4ZA 4WQ6A 1MEIA 3DH7A 3LOTA 3B0VC 4WJEA 3E02A 4PFMA 1Q6QA 1DL3A 4M19A 4EF8A 4UR7A 2GVJA 2QCDA 2EKCA 1G6CA 3MMTA 4Q32A 2I1OA 2JBMA 3N2XA 4YMZA 4LVFA 1K8YA 1A53A 4CCEA 4WY0A 4UFMA 3R8RA 1JRCA 2QUUA 3C61A 2ATMA 4TX9A 1LOSA 3LI0A 4Z0JA 3T40A 4LS1A 4RK8A 3G3DA 3NDOA 4EWND 3VI2A 1LRTA 3QYQA 1Q6LA 4JYEA 4NVTA 4HPXA 4YL2A 1LRQA 3D0CA 3L0GA 4KFOA 4JDBA 4UFIA 1QFEA 1PL9A 4O1CA 3UXDA 3W6YA 2Y7DA 2R94A 3PBVA 4X3ZA 1TTQA 1ZNNA 2YW4A 1H1YA 1XXXA 3G24A 1WBHA 1OX4A 4DXVA 1TJPA 5DLCA 4IPJA 4HT3A 4EIVA 4UTHA 2XN1A 3S6DA 5F2MA 5FEXA 1TPEA 3R13A 1SPQA 1JCLA 3W7IA 5HULA 1HUVA 4K6AA 4CNOA 3LXCA 2GQ8A 4MFDA 3HMJG 3F1QA 1IIGA 1ICSA 1O95A 4DO4A 3L2IA 2P1FA 4JICA 2WPBA 3OIXA 3HPSA 2QAFA 1GJPA 4QNEA 3M5XA 4FXRA 3AO0A 3C52A 1F74A 3UD6A 3M9YA 4JTEA 4KKXA 2HSAA 3DAQA 5AC7A 5AHEA 1UUMA 2AAMA 2YYTA 3O06A 4RCXA 5I3GA 1P0KA 1B9BA 4TMCA 3LXAA 3JR2A 2ZDRA 4UCGA 3O6DA 4LVDA 3DFOA 1OG0A 1IXNA 5K9XA 3C2VA 1LORA 4LVBA 1VZWA 4ADSA 1JCYA 3R89A 4UFJA 4LRSA 5KZMA 1TPWA 2ZRYA 1IF2A 1E51A 3GB6A 3GDMA 5I3HA 5AOUA 4IPIA 4XKYB 3LHUA 4OV9A 5HR7A 4UIOA 3QW4B 3YPIA 2HMCA 4N9CA 3TA6A 1KBJA 3TR2A 1ZCOA 5K7JA 2NXHA 3S5YA 3TDFA 3LERA 5AN7A 4UTUA 1LDCA 4N4PA 1FY6A 1I2NA 3BLEA 4JTSA 4L4MA 1TYGA 3GR7A 3HGOA 5T26A 1H60A 3G1VA 4DO5A 4O53A 3RF9A 5DY3A 1ZHAA 1QPRA 1XUUA 1QOPA 4N6FA 3NQMA 1EPXA 2GUUA 1SZNA 1M6JA 3F4NA 5DCDA 2YZRA 3W7CA 3G18A 4O1BA 3TNOA 5MHBA 1SQ7A 1R2SA 2HS6A 2O7QA 3LBCA 5CKSA 3E12A 4KWVA 1MXSA 4OV4A 3LHYA 1AMKA 4UTMA 1I2RA 2VELA 1WOBA 2YDAA 1FWTA 3DENA 4MFEA 3B0UX 2WO5A 3G1SA 3PUOA 3E96A 3SIZA 3G1AA 3W71A 5D05A 3W2UA 3IIOA 4C1KA 1O4UA 4HKPA 2Y7FA 4JTKA 1L9WA 4GUGA 4HPJA 3NQFA 2NZLA 1KTCA 5HMSA 1EB3A 4EF9A 3A24A 2QCDB 1TV5A 3O63A 4NQ1A 4EVZA 1OFAA 4AXKA 3W22A 1K8ZA 3SFKA 1X7FA 1EIXA 3QJAA 4WY0B 1OFEA 1HL2A 4FX8A 3LRLA 3W1PA 1X1OA 4WXYA 1KFEA 1P0NA 3UWYA 5L6UA 3HB9A 3PG9A 4K8HA 5AYXA 2HTMA 1QO2A 4NJKA 3EXSA 5FF4A 3LHZA 3NG3A 1G7UA 3O6YX 5FESA 3S1XA 3NXFA 4BFAA 3UY8A 1QPQA 1H62A 3FEMA 1S5TA 1OX4B 3IEBA 1PHQA 3SJ3A 4LS2A 5G2IA 4S2BA 1G7VA 3SI9A 3QM3A 2CLIA 3L65A 2J9ZA 5DXXA 4MYAA 3N9RA 2JK2A 4RX0A 2Y70A 3GLCA 3RU6A 3NL2A 5G2HA 3Q37A 2GVGA 4O52A 5D04C 3S8HA 2ZRVA 2VOMA 1OFQA 1TPUA 1V7YA 3CHVA 3MI3A 3W70A 1OJXA 3QPZA 2GJNA 2VFIA 4DBEA 2E77A 3NR0A 5D02A 1IIHA 1T96A 1TTIA 1B57A 2ZZ3A 3H54A 1TCDA 4A21A 2F7FA 3L0KA 5LGXA 3CQ0A 2VFFA 4GE8A 1BEUA 3W3OA 3UNDA 1FUYA 1EP3A 3TK7A 1PVNA 1J2WA 4UTKA 2E6FA 2Z6JA 4XTDA 4DELA 4NJGA 3G0SA 1VRDA 1DQWA 3PBUA 4QIUA 2P10A 5HUPA 4BI7A 2X30A 1IGSA 4QM1A 2CZDA 3SGZA 1JQXA 3BVJA 2FQIA 2RDWA 3QQ0A 1EP2A 1Q3NA 5HWNA 5EL1A 3LTYA 5FF0A 3W83A 1R46A 2VENA 1QOQA 2B0MA 4N9BA 2V2DA 2WNZA 4Y90A 1SO4A 3RLUA 4OHQA 4XBKA 4BF9A 3EX2A 4IQLA 4MLJA 4LUIA 2CLOA 1YXYA 4OQVA 3TSDA 4RZ4A 4BR1A 3G22A 4WOQA 3ZWTA 4AWUA 3HPXA 4ZL1A 2CU0A 5AB3A 4GJ1A 3W87A 5TBOA 2ZA3A 3PC0A 2Q3OA 3NM3A 2Y7EA 1RD5A 1L6YA 2V2HA 3OHIA 3F03K 1LTDA 3L5AA 1F6KA 3LX9A 3LHTA 1NVMA 2H3DA 2V82A 2BLEA 3DFPA 2EF9A 3O15A 1LOQA 3OVQA 3P80A 4H6KA 1X6UA 4POCA 2PRHA 3STEA 4RJEA 1K7XA 3QFEA 1MEWA 4O15A 1FWNA 3ABSA 4NU7A 4AHPA 4NNBA 2FPTA 4OGZA 2O7SA 3T78A 3USBA 3PSWA 3W7MA 1T8XA 2H6RA 3N3MA 4ZQRA 4FX6M 4N02A 3NPWA 4K37A 1VCGA 3NQEA 1IXQA 1H7OA 2E5CA 3QH2A 1TIMA 4LC8A 4O12A 4MKNA 3LGEA 2FJKA 4GBUA 5AHMA 4UMAA 2YFNA 1GVOA 3GK0A 3MHUA 4QSHA 4Z1DA 1GVFA 4J9JA 2VC6A 3O16A 2OJPA 3O05A 4KFPA 2QDHA 3P8JA 5D09A 2H90A 3G8RA 3TFCA 1TPB1 5F2GA 4GNJA 3GKFA 2YW3A 3E9AA 3W9ZA 2CLMA 2GOUA 4UR8A 3HJZA 1RQBA 1EP1A 3Q58A 2JKEA 4S1FA 4O54A 4IWWA 1YTKA 5LNWA 1XFBA 3TQKA 2DORA 4P61A 3I7SA 2X16A 4PL1A 1NEYA 3G0UA 2A7NA 3W2JA 1T0OA 1G67A 1WQ5A 3A5FA 2A6LA 2B7NA 3IVSA 2ISWA 2E68A 4LUJA 4R34A 1EWEA 3VNDA 3LCLA 3F4WA 4IMGA 3W7EA 4DF2A 3A22A 5DELA 1I2PA 3WK3A 1LBLA 5CPLA 2OT0A 3KRZA 1SO6A 2ISVA 5F4WA 3B03A 1PV8A 1K02A 5DY2A 4JD4A 2J27A 2NX1A 1GVRA 3LCFA 1FWRA 3GDRA 2Z2UA 4O0ZA 1YTEA 2ZRXA 4DBDA 3W1QA 2C13A 4DQWA 4JTTA 1JCXA 1OABA 5LNRA 5BMWA 3WK2A 2V0TA 3WK1A 3CIXA 2VKZG 1EEPA 3LHWA 1W8SA 1Z48A 3FLUA 3RMJA 1GVSA 3W23A 1P4CA 3BG9A 3GKAA 3OVPA 4AMAA 2ZA2A 5KZDA 1FXQA 2VEIA 4XZ9A 4JX5A 3M41A 3PBYA 5KTLA 3VKJA 1UASA 3W72A 3ZR4A 4MUZA 4FF7A 3THQA 5EYWA 4ZVJA 2BX7A 3HG2A 3GNNA 4NNCA 7TIMA 2E6YA 3KOFA 3QRHA 3FJLA 1ME8A 1TB3A 4MYXA 4K7YA 3UZ5A 4BWLA 4JDYA 2QCMA 1TJRA 1X8FA 3NM1A 4S2CA 5D32A 4JR5A 5D2XA 5D38A 1BWKA 1FQ0A 3GDTA 3DGRA 1F73A 1RR2A 4FB7A 1AG1O 3QW3A 4N9EA 4I7WA 5CZJA 2CLKA 3STCA 4FHAA 1QMLA 3MP4A 1LROA 4NT0A 5IBXC 4MZ1A 2GVLA 4O4WA 1RQHA 2YXGA 3P74A 3N34A 1GTEA 4LV4A 4ORIA 5I3KA 3N73A 1WV2A 3S5ZA 1DORA 1W1ZA 5E1QA 3W7PA 4ICNA 4XWUA 3EX1A 3R5EA 1OX5A 3NO5A 5CZTA 3TJLA 4JTFA 3OEXA 3HIJA 1HTIA 4AH7A 3NA8A 4ZQOA 1QPOA 1KA9F 3DFTA 4WX2A 1EA0A 1QDSA 1OYAA 2JKAA 3HGJA 3CIWA 1UBSA 4YLWA 4O18A 4UTTC 1WX0A 1LBFA 1CW2A 4LT9A 5AHFA 3TE9A 2Y85A 1M7PA 2WSYA 1G69A 3PB0A 4PCFA 4Q33A 3FKKA 3BG3A 1Z41A 3PUDA 3SW6A 3DFSA 2E09A 1A5CA 3B05A 4JX6A 4UTWC 3NAVA 4W9TA 4UXDA 3TW7A 3FIGA 3C4UA 2V9DA 1FDZA 3EWXA 5LSMA 2WSQA 3CWNA 5EBUA 1G4TA 3E49A 5D37A 1TPFA 2X1RA 4ZQCA 3ZFHA 2C14A 4K38A 3EEGA 1SSDA 3P84A 3SECA 1VR6A 3HO8A 1W5QA 5G1YA 2Q8ZA 4LOCA 3NQ7A 2Q3RA 5HJLA 1TMHA 5C55A 4I7UA 1SUXA 3WJXA 1ZAIA 1OFPA 2QJHA 2WSRA 1KV8A 1NF0A 2OMAA 2B7PA 2C3ZA 4LRTA 1YXDA 1LRNA 1KM1A 4LC6A 4LTSA 4RZ6A 3LI1A 4UFLA 4N2YA 1L6WA 2H3BA 3MBFA 4LS0A 2JKPA 1KM0A 4JNMA 5CSRA 3QF0A 3LXBA 4O10A 3LRKA 1WYIA 3P5ZA 3GNDA 1T99A 2QCFA 4UUIA 2NUXA 5FI8A 3S42A 1XCFA 1TQJA 4RXGA 4TU1A 3EX3A 1HFBA 3N14A 1AW2A 5HQEA 2B7QA 3LM7A 3W1UA 5LHEA 3GXPA 5CPOA 1OX6A 2Y61A 4NZFA 2PCQA 2ATSA 2B4GA 3HG3A 5F4XA 4CCCA 3O8AA 3HOJA 3P82A 1PCWA 3B04A 5U7SA 2X2GA 1P5BA 2QUTA 3LV6A 4K7VA 3SZ8A 4Q4KA 3ZWSA 4Y6GA 4QAIA 4M7TA 2A1YA 3IVTA 1OF8A 4M5PA 3TXZA 2CLFA 4U28A 4AWSA 3CWOX 3K30A 1SZEA 1O5XA 3S5NA 5IM51 1W0MA 1I2QA 3MUXA 1NFBA 1HO4A 2TMDA 4A2RA 1KFBA 1P1XA 1X1ZA 3G8EA 4O14A 5FF3A 2J24A 2BSLA 2ALDA 3DI0A 5HR6A 1ML1A 4Z1AA 4X2RA 1CI1A 1I4NA 4JTIA 1XL9A 1QNVA 2BTMA 2NWSA 1W37A 1QWGA 3DKJA 4Y8FA 4RZ5A 1KM2A 4GRSA 4C1LA 1H7NA 4O4VA 2CW6A 3TUUA 2DZUA 3L21A 3IIPA 1XC4A 3A9IA 1O60A 3GX9A 2EGZA 4LY8A 4AHOA 1ZENA 4JY8A 3PR2A 1WOAA 2CFFA 3ABQA 1NSJA 2Y89A 4D2JA 2A7RA 3W74A 1C9DA 1M7OA 1R2RA 3I7QA 1Y0EA 1F5ZA 3ZS4A 2GJLA 4O57A 5FF2A 3G0XA 1GYLA 2C6QA 5FEPA 4NXSA 3W1NA 1F6PA 2QF7A 5AHNA 1C29A 1C8VA 2WJZA 4MJMA 1JRBA 3LLDA 3KX6A 4O8RA 4UMBA 1JVNA 4UNKA 3QMSA 5F4SA 4XUGA 3W7LA 4ADUA 1TV7A 4R53A 4QQ3A 5DCEA 5EA9A 3T4CA 3UPBA 3W7GA 4CLMA 4UC5A 1WA3A 2I9EA 2CZ5A 4UTIA 1Z44A 1B4KA 4I9AA 3L5LA 1TTJA 1XI3A 2DJXA 2ZZ5A 3STGA 1FDJA 4JYFA 4KWWA 4MJZA 1W5NA 1U83A 1KFLA 2G97A 5DXYA 3NPVA 2H8ZA 4FNQA 3HBLA 3IVUA 4DPQA 3NOEA 5KZEA 4JTJA 3QQ1A 4OWGA 2J9XA 5BRBA 3ABOA 3MI2A 3KVLA 3NQ8A 3NYZA 3BLIA 4FNSA 4E2DA 4O0KA 3CT7A 1JCJA 1XDLA 4ZMGA 2DZPA 1U5JA 2RKXA 4JGDA 1ME9A 4ORMA 5I3JA 3C2EA 3NEVA 4IMEA 3TAOA 2ZFAA 5K9DA 3PWAA 5LHFA 2Y6ZA 1LLWA 1J5TA 4M6QA 2P0OA 5G1TA 4OE7A 4ZQMA 5G5IA 3UYCA 3NQCA 2J9YA 2ZZ2A 3LCIA 4FEZA 3P67A 4FNPA 1D3HA 1QPNA 4JIQA 3L0NA 3FJ6A 1H61A 3QZEA 3IIZA 4JEQA 3TCEA 2RDTA 2TRSA 3NL5A 1SSGA 3DKLA 3GR8A 2V5BA 1YXCA 1DQXA 2OCZA 3SSJA 1UUOA 5F1VA 3OBKA 2EAWA 3LCHA 1KW1A 1TPDA 2V2CA 1G4EA 3PBWA 1KLYA 4HHPA 3W07A 4LW7A 2Q8LA 1W5OA 3HG5A 4Y96A 1QAPA 4MY1A 2FDSA 3TFXA 4CNPA 3OG3A 1R47A 3H53A 4YCOA 5TIMA 3M16A 1KBIA 3WJYA 3NQ6A 4HNUA 4FIRA 1KTNA 3PY2A 5L9FA 3MYOA 1TV8A 2Y7GA 1F05A 2FLIA 3PULA 1QO5A 3TIMA 1TPC1 4UNLA 4ZZ9A 4M6VA 5A5WA 2DP3A 4MY9A 3UWUA 2B7OA 1DOSA 1K3UA 3T55A 2VFHA 4ONVA 4MZYA 3NL6A 4Y9AA 1ZALA
chains in the Genus database with same CATH superfamily
5CSSA 4RXFA 3CT2A 1GJUA 1BHGA 2BDQA 1W3NA 1IZKA 1KV5A 4LAKA 5MKGA 1UYQA 2QJIA 2Z1BA 4P7OA 2FPYA 2VXNA 5REQA 1YDOA 3LBMA 2NX3A 1E4NA 3RRXA 4QLLA 4MJ2A 1ONRA 1QNPA 5EKYA 1MZHA 4GBDA 1FP8A 1JCNA 3L67A 5AYYA 2QPUA 1GQLA 1W2PA 2OSYA 3AMLA 3GVGA 4IP7A 4U31A 3RM8A 3OBEA 5TF0A 5HWJA 3W1RA 3VDGA 1AD1A 1H1ZA 2NW0A 3KOYA 4PBGA 2PDQA 1GVQA 4L64A 1BXNA 4PA8A 4ZQNA 1FRBA 1TJ1A 2PDLA 5TNVA 1GTHA 3A5VA 3SR7A 1V6WA 1XJBA 1VYRA 4L1XA 1LP6A 2QKFA 3HV9A 2V5LA 1JPDX 3MV11 4UQ9A 4LNCA 5CEWA 2P53A 4EOUA 2D0GA 2UY4A 2ZRWA 5AHLA 4HU4A 2QAPA 4MDPA 1XP3A 1AJ0A 3VD4A 1OF6A 1Z6KA 4DIAA 3W6MA 3CUFA 1TO3A 1KTBA 1RBAA 2TPSA 4IGSA 1YNPA 3RLVA 3P5YA 1X6NA 3BC9A 4GY7A 1OQFA 1EX1A 3PJUA 2CLLA 3G5EA 1FWGC 3PANA 2TYSA 3LPOA 4TVUA 3VE9A 2ONEA 4F9JA 4H01A 1KFKA 2A6NA 3DIPA 3GU2A 2QDEA 4HSOA 3MC5A 1AUSL 4NZJA 4PN2A 4FX7A 1FX6A 2VO5A 2C71A 1R3RA 3L5MA 3BV4A 3FGCB 4BY3A 4D6FA 3ZVIA 1EEXA 2WSPA 3RFAA 4YPJA 2F84A 4HA3A 4O0QA 2J79A 1XIBA 2OQLA 1Z8AA 2QCEA 4JXCA 5D9PA 1C93A 2HK1A 4CD5A 2I16A 1IEXA 4MPQA 2NXGA 4FNTA 2Y5EA 3CK5A 1OIMA 3NPXA 3OP2A 4D72A 1G4SA 5FF7A 1M7XA 1JZ2A 3UEQA 2ZXQA 4IXHA 4REQB 3BMXA 4GYPA 4YYFA 2JIWA 3SRHA 3OZPA 3FA4A 5I2UA 3CUGA 4N4QA 3VKAA 5AC5A 1F7BA 2PC8A 2YCIX 2XH0A 3KHDA 4Y9PA 4QROA 1S3HA 2VWTA 1W54A 3TKFA 3ZR6A 3PB2A 1FP9A 2I5GA 1MW2A 1EBGA 4AEOA 4D6HA 3USZA 3VIPA 5REQB 6ALDA 4MZ8A 3HQOA 5E5CA 4B2DA 1TR1A 3SRFA 3IV8A 2NVCA 1Q66A 3UNTA 3GNXA 2BFGA 4DNMA 2QVNA 4S3CA 3NL3A 2GLKA 3L2MA 4A22A 4RUBA 1GHRA 2NUWA 1SZFA 2HE8A 1OK6A 3KVMA 1S5WA 2XWDA 2ZVIA 2WC3A 5KSWA 3ELFA 3O0KA 1E72M 2OOGA 3TN4A 1HO1A 1XKYA 4RNHA 3EWWA 1C92A 1FH7A 1QRQA 2I14A 1JUEA 1NDVA 4D6JA 4US6A 1OCQA 3TQ0A 3UESA 1MO0A 3OLDA 1PBGA 1DBTA 1Q8AA 1V3KA 3TU9A 3N19B 3P81A 3TA9A 2P50A 3L4YA 4M7SA 1P7TA 1SJBA 3CPUA 1GG0A 3H23A 4YTTA 1WAUA 3LZ3A 3ZYZA 4KH2A 1VYSX 1W32A 3RK8A 2D24A 2PD5A 4PUDA 4A35A 4EPEC 4H9ZA 4GPNA 3TW6A 4ALDA 5C2XA 3IAPA 2HVNA 1FCVA 5D03A 4YXGA 3SJNA 1CZ1A 4NJHA 3ES7A 1UR9A 1XIGA 3B8UA 4PUMA 5B7YA 4R5EA 4A2SA 3A64A 2XVPA 3SQLA 3PZUA 3UR2A 1BPLB 3BV7A 4LAOA 1WDWA 2ZKMX 5BXTA 3OQEA 4TMBA 2P3EA 2BS9A 3CL8A 2OGYA 4J1OA 2O0TA 2V5CA 1FFRA 1U5HA 3SSZA 3E0IA 1JGMA 1WDSA 4GNKB 1I8JA 3GAYA 4M6PA 1YPIA 1XBVA 1CXFA 1D9EA 4C91A 8A3HA 1RCQA 4G1NA 1I6NA 1EA9C 1TJ2A 1GKRA 3W81A 1A5BA 2PGEA 1MFUA 3MMUA 3GH4A 1OC5A 3AYVA 5GVJA 2BOEX 1RVGA 1JQVA 1UA7A 1P6BA 1K7FA 3BJFA 1ISWA 1ZAHA 3VOIA 2XVKA 2CCRA 1TCMA 1OWQA 3WD0A 3DCPA 4GCAA 1VFTA 1YEYA 1AL8A 3CMJA 1JAEA 3UZJA 1U2YA 2YJQA 4XSMA 3IPWA 3N1AA 3N9KA 3BOXA 1H4PA 4TX6A 4XX6A 1E40A 1R8LA 1XLJA 1PZ2A 5A8NA 1QW8A 2Y5JA 1DXEA 5KINA 3PVFA 2QXWA 4NUWA 1GEQA 3O6AA 4ECLA 4YCPA 4Q8QA 4JFTA 1F3WA 4O1FA 2GGJA 1NWRA 3DHDA 3UG5A 3W1LA 4QE5A 3OA3A 3DBPA 4P7QA 3JZUA 4IGHA 3V75A 5AC4A 1CIUA 2YYUA 3MHGA 5CBIA 3OVRA 3NGJA 2C0AA 1XW8A 4WDTA 4BS0A 1NF7A 4LU0A 4ZB2A 3GXTA 1UMYA 3KRSA 1P7TB 4RDZA 4U4MA 2J7EA 3P61A 4DVOA 1ITCA 3UG8A 1W3HA 4Q4RA 1JZ7A 4KF1A 3BCJA 3LTSA 3DG3A 2WHLA 5BMXA 3G1RA 2BY2A 4JIPA 1RQEA 2FGZA 3RIKA 3ZT5A 5CZSA 3DFNA 4RPQA 5K9CA 3UJEA 3ZSTA 3T2QA 5HWMA 2GDVA 1T8QA 1DJGA 5A6SA 2D69A 3F4VA 3TV8A 5CJ5A 4PL2A 1I0DA 3HMCA 2WHMA 3W1XA 1IT0A 4H2HA 3GFYA 5IFPA 2OYKA 4B2DD 5A6MA 4L1WA 1EJUC 2Y62A 3W73A 2O55A 2CC0A 2MANA 3BAXA 1VFMA 3VNKA 1J6OA 3PTKA 2PE4A 2ABBA 3I10A 1OCNA 2OX4A 4DUWA 4IXXA 3UG3A 2YGYA 3VIFA 5C5YA 4D6GA 1H63A 4RE2A 4C6MA 1TWDA 3ARXA 3A47A 4IQJA 1W56A 3C2RA 3AS0A 4AD3A 2OZ3A 3EOSA 4XO7A 2E1DA 1XIJA 1YLVA 3BOFA 1GCYA 1J12A 3RNDA 3RGTA 2ZBTA 2BHUA 4B5XA 3CV6A 3K46A 2CHRA 1E1CA 5I06A 4HCLA 4R27A 3JS3A 4PRTA 3T8QA 3TXVA 4IICA 1FVPA 3RILA 1PKMA 4N6EA 2V69A 1UPPA 4G2DA 2YCJA 3B97A 2ZADA 1J0JA 3E2VA 4D6IA 3ISIX 1GPFA 3IJLA 4A6GA 2DSVA 1VCFA 1AQHA 2WQPA 1JUBA 5E6YA 2J62A 3A4JA 1NDYA 4MOZA 2OZ0A 3M6DA 5H2ZA 1E56A 3QR0A 2PURA 1G0CA 1PHWA 3UQNA 5I07A 7A3HA 1VHCA 3NVTA 1Q2SA 1BKHA 4ZODA 3WK0A 4H8HA 2VZUA 3SGUA 3RITA 1CBGA 1VQTA 3W2KA 1A4LA 1V0LA 3QLDA 1AQ0A 3WNKA 2J8GA 2P88A 5HOSA 1KRAC 4WKHA 3CASA 3WZ0E 3BK0A 5AYZA 4R7WA 3CUZA 3CPRA 3FHQA 1KM5A 1ALDA 3AXIA 4NJJA 4AEFA 3AROA 1VBHA 1KBBA 1JUKA 4M51A 1B54A 4JYDA 3M07A 4TOQA 1IXPA 1CGVA 2XWEA 2XG9A 2VFGA 3WD1A 4TR9A 2GQ9A 4IFRA 3EB4A 4AHQA 4PUEA 1HKWA 3FDKA 3CAKA 1ITUA 2JGYA 4WXZA 3EB2A 3KVJA 4B4HA 1V4YA 3CMGA 2X0YA 1SO3A 4PCTA 1FXPA 3URAA 1Y7VA 4JCMA 2PDUA 2VEMA 1V6VA 3AIVA 3SCVA 1CLKA 4ADTA 3LTPA 4L7ZA 2V3GA 2W67A 1CWYA 1IGWA 2OFJA 4UB9A 5EPDA 3WFAA 1BTMA 5BW6A 3EKLA 1UB3A 1PKNA 3MANA 1XD1A 3SUUA 5LXXA 3EWZA 3DERA 4GWEA 1XFCA 2AL2A 2ZRZA 4JQ1A 2QCLA 3A3WA 1DV7A 1TX0A 2DQWA 3IGUA 1D7KA 3G1DA 3N4AA 5D30A 2X7VA 3A4AA 1RJRA 4CD7A 1E1CB 3KS5A 4H9TA 1PDYA 1N7KA 1V02A 2POZA 4Y9NA 5C2CA 1BVZA 1E5JA 2ZZ6A 5CC7A 2R1LA 4FLSA 1S2CA 5LYRA 3QOMA 3WLOA 3MUCA 4YTUA 4WQ6A 3DH7A 3LOTA 4WJEA 3P6LA 1EDTA 3AXKA 4GK8A 1Q6QA 1DL3A 4EF8A 3Q67A 1Z7AA 2GVJA 1LLOA 4FXFA 2EKCA 3LENA 3SFWA 2D2GA 5LIWX 4GX9A 4YMZA 4CCEA 2ZX6A 2ATMA 4LS1A 2OU4A 3G3DA 4EWND 3VI2A 2EPNA 3IJQA 4NYUA 3QYQA 4HPGA 3FK4A 4JYEA 5CQ1A 3WLSA 3W27A 4YL2A 1LRQA 1GORA 4JDBA 1QFEA 3SQSA 3W6YA 1W1IE 2BV9A 1XLEA 1ZNNA 3AMCA 1M9HA 2J13A 3SBFA 2F6UA 1QBBA 3ZLGA 4C7FA 5DLCA 4HT3A 3LNPA 1BD0A 5E9XA 3WEZA 2XN1A 4U3AA 4C6PA 2NQLA 3R13A 2GVEA 5HULA 4CNOA 3ZR5A 3LXCA 2VTFA 3SUTA 3S9ZA 2GQ8A 3HMJG 4X2PA 3F1QA 1ZJHA 1Q65A 1C3FA 4GVHA 1E9IA 4QEEA 3OIXA 3DHPA 3UD6A 3AHVA 2X42A 4JTEA 3QV6A 1TWWA 4LEQA 1JIBA 4GY1A 2YYTA 4RCXA 3A3HA 4TMCA 2J7FA 4HNCA 4UCGA 1RA0A 3TTQA 5EMKA 2Z26A 1MXDA 2OELA 5C9ZA 3DYOA 1Z9AA 2PLMA 3OBAA 1JCYA 3BANA 3MB9A 4PMNA 1TPWA 3KLKA 2ZRYA 4KQNA 3SCSA 3AXHA 3GB6A 3UG4A 3DDMA 2EKGA 3KOWA 5I3HA 2WCAA 3URQA 3VIGA 4INFA 1DJYA 1UWRA 1OADA 2G4FA 2WBKA 1E43A 2A3EA 1JPMA 3TA6A 4S38A 5I00A 1KBJA 3K4WA 2EJ1A 3WQPA 5EMJA 4HVXA 1I2NA 3PZVA 1TYGA 1IEIA 5T26A 1H60A 3G1VA 3OGSA 3RF9A 2QNEA 1Q5MA 3PBGA 1M7JA 2YA2A 4UZUA 1SZNA 2AL2B 1IEVA 3W7CA 1UOZA 2INZA 3ARYA 1XRFA 2I5QA 1R2SA 4Z2IA 3T0BA 1CDGA 1AMKA 2PSNA 4UTMA 2YDAA 1IR2A 1WOBA 5A8PA 3PUOA 3E96A 3SIZA 3W71A 3IIOA 1M68A 1U1HA 1O4UA 2XFYA 2E9BA 1L9WA 4W5ZA 2E7FA 5HDRA 1B3YA 3A24A 3CHCA 5TAOA 1OFAA 1KCZA 1ZPTA 2TAAA 4ERIA 4Q7BA 3SCQA 4K68A 3TN6A 5DRIA 3DN5A 3HB9A 3PG9A 3H7VA 2AKZA 4J3UA 4UR9A 1ITXA 2HTMA 5FF4A 3NG3A 1AFSA 1G7UA 3ZLFA 3S1XA 3UY8A 3BLOA 1QPQA 3R4IA 3VXGA 3ARZA 5DX7A 3IEBA 3UR5A 1DTUA 1QNSA 4CU7A 1BQCA 1ZSXA 3R1ZA 3VNMA 2YLLA 4GIRA 1WZAA 4ZOEA 1RVKA 3O7UA 1XPGA 3N9RA 5HJXA 3RDKA 3WYZA 3N11A 3GLCA 2VMFA 3RU6A 4DJFC 3B40A 3Q37A 4EKJA 2Y2WA 4MNKA 2VOMA 2Y8VA 1V7YA 3MY9A 3CHVA 1H49A 1IYXA 2GVYA 4DBEA 1Q6FA 2E77A 1NDZA 1YIXA 1P6WA 1RJPA 2J47A 3AAMA 2ALRA 2ZZ3A 5C0QA 1TCDA 2OEKA 2F7FA 3L0KA 2ADAA 4HOXA 4V15A 3UNDA 2E8YA 1EP3A 2ZUSA 4UTKA 4J3WA 3T0AA 3H7RA 4XTDA 1HN1A 3M4HA 1RCXB 1VRDA 4PMOA 5HUPA 2OLSA 5CXPA 4AX6A 2CZDA 2E3ZA 4Q4MA 3ANVA 1FWDC 3NXLA 4AFYA 1D8WA 3B9AA 3CYJA 1HKMA 3AU2A 3Q65A 1UKSA 1D3CA 4N9BA 3BGAA 4AZGA 3K8MA 3TJ4A 3FAWA 1MQPA 1LWHA 4LUIA 5I02A 3C0LA 4XO6A 4ZL1A 4GJ1A 5TBOA 5IRPA 1JPHA 3PC0A 3NM3A 2J7HA 2Y7EA 4FZIA 1DIEA 1M41A 3LPFA 4ZGYA 3R0DA 5M5DA 3L5AA 5JIPA 2BLEA 3BCFA 3VFCA 2VUNA 2Z1VA 3P80A 1HKKA 1LG2A 1Z69A 3NOYA 3L12A 2XHYA 2E9LA 3QHNA 3QFEA 4O15A 1S1PA 4D8ZA 3WLQA 3B8SA 3RYSA 3BLPX 3M0VA 3RLGA 2CNCA 5IXEA 1HVXA 3R8GA 3B8WA 2XIOA 4FX6M 4FS9A 4JQ3A 1B0IA 3NQEA 4NAEB 5A6TC 1H7OA 3N6JA 1SJAA 1TIMA 4O12A 4CQCA 1E71M 3LGEA 2FJKA 4GBUA 5AHMA 3BE7A 2FZNA 2EPKX 4Q7NA 2YFNA 4Z1DA 3WQEA 3O16A 3BMWA 2OJPA 3BSHA 3O05A 2CEQA 4D8AA 3UVIA 3TFCA 3SUSA 4DYKA 4Q8OA 3LUTA 3S3GA 1TPB1 1MQRA 3GKFA 3ME3A 3E9AA 1VFOA 3WUEA 3MJMA 3BAJA 1HP5A 3HJZA 3KRBA 1W3JA 2VGIA 2DT0A 2DORA 4P61A 1X8CA 5B80A 3G0UA 4QDMA 4MAVA 1W6TA 3IVSA 3TYBA 4YU1A 4LUJA 3V0TA 1EWEA 4OUIA 4DF2A 4I9MA 1EGVA 5CPLA 2OT0A 3DBNA 1SO6A 1O5QA 4JIIX 1M3UA 5F4WA 3LCFA 3UW6A 1FWRA 4JQ2A 1YTEA 4CU8A 5HANA 4DBDA 2C13A 4DQWA 4JTTA 1JCXA 4P8UA 3OGVA 4Y8EA 2V0TA 3WNOA 1EEPA 3LHWA 1Z48A 4Q4PA 3RMJA 2PDHA 4JTRA 2XH2A 1XIDA 4AMAA 2ZA2A 4OVXA 4J3SA 1FXQA 4XZ9A 3M41A 3PBYA 4XZBA 1R7OA 3ZR4A 4MUZA 2A3LA 1GK8A 2VGFA 2R1NA 5I77A 3GO2A 2NSXA 3POCA 1EJWC 3TEVA 2P3ZA 1XCWA 3T81A 2FH6A 3GFZA 3UZ5A 9RUBA 4JR5A 1ODUA 3C86A 3BQ6A 1TWZA 1GW1A 3R43A 5B7ZA 4FB7A 1AG1O 4B15A 3SADA 2AMGA 2DGAA 3VU2A 4I7WA 2CLKA 1W9UA 3HTWA 3UXLA 1QMLA 2AOSA 4MZ1A 3N34A 1GKPA 1WV2A 4WF7A 1W1ZA 2QIIA 5E1QA 4HMNA 3W7PA 1XG3A 4IJCA 3EX1A 2KAUC 1OX5A 1UR3M 2E67A 1UH3A 1UZ4A 3LN3A 4A8IA 3U7BA 5I03A 2DZBA 4KT2A 4EE9A 1UROA 4AIUA 1QI4A 2ZDSA 3G77A 3NA8A 4ZQOA 1QPOA 4C6DA 3U0HA 3M0HA 4LGXA 4QX4A 3BSGA 3ONBA 4KEZA 1I0BA 4YLWA 3TJIA 4KBXA 1V51A 4GJJA 4IIGA 1XH2A 1WZMA 3VNIA 2OEMA 4PFHA 1POKA 4L4OA 3FKKA 2PGFA 4IQEA 3PUDA 2E09A 5DMLA 3B05A 1W91A 1XLLA 4XZNX 3NAVA 1XDJA 4UXDA 3C4UA 1SJDA 1FDZA 2V9DA 4NZ4A 1XLAA 1I60A 5EBUA 4GYFA 5XIAA 2OO0A 3E49A 2X1RA 3SY8A 4S3KA 3VYLA 1YQ2A 1E0TA 1VAHA 5G1YA 2Q3RA 3HQPA 3AXXA 5C55A 4MWAD 3HN3A 2QJHA 2DY3A 1NF0A 2OMAA 2B7PA 2C3ZA 3WLPA 4QHRA 4HMDA 3WFZA 4N2YA 5RUBA 3F5JA 3CQJA 5CSRA 5BWFA 5HATA 3AU6A 4GISA 3UF9A 3VAVA 1ZJBA 1S2VA 2NUXA 3CBWA 3N17A 1W1VA 1XCFA 3EYPA 1UD2A 1HFBA 2WANA 4PB3A 5CH9A 1XLGA 1AW2A 4NAFA 5BU6A 3ORWA 1OX6A 1BG4A 1FOBA 4KRUA 3CL6A 2PCQA 4AZCA 2ATSA 3HG3A 3HOJA 3B04A 1K9DA 1A5KC 4F2TA 3LV6A 1GONA 3UA3A 4GYPC 3GY1A 2BVDA 1QOXA 4QAIA 4US5A 2A1YA 1JZ4A 2CLFA 3QYSA 2G4JA 4PTVA 3W0KA 4CUCA 1I2QA 3S9IA 1RBOB 2Q01A 1ODZA 3WBYA 1DWHM 2GL5A 3VGEA 1LL6A 1X1ZA 3G8EA 1MDRA 4NI8A 2BSLA 4ACZA 2F61A 4UQEA 1G5AA 2WWCA 3BWWA 5I0DA 1CI1A 1PJ9A 1YMYA 1E6NA 3NWRA 3HA1A 1UD4A 1V77A 1JNEA 1QHOA 1JGIA 1R3YA 3NUKA 1KM2A 3WQWA 4O4VA 2QJNA 1GZ1A 3GX9A 2EGZA 4HNOA 4LY8A 4QP0A 4AHOA 1EKOA 1OY0A 5EMLA 4D2JA 2A7RA 2DPEA 3W74A 4IQDA 2GJLA 1A3WA 3SGGA 3TWAA 4HBKA 4NXSA 4NP7A 4IPPA 4QQUA 1C8VA 4LB3A 1Q4NX 3BH4A 3KX6A 1E6XM 1UKQA 4UMBA 3AFBA 4UNKA 5F4SA 4XUGA 2NV9A 3UPMA 4UC5A 2I9EA 2PWUA 4RW3A 1HGYA 1Z44A 4I9AA 1C91A 3L5LA 1D2KA 4JYFA 2PTZA 4MJZA 1W5NA 3UR8A 1GOIA 1EJXC 3HBLA 2BASA 4GQBA 4OWGA 2VDIA 3BAWA 1Y5VA 3F4CA 4FA3A 5HNNA 3NYZA 4GXPA 4I6VA 3BLIA 4FNSA 1LQ2A 2J8FA 3C3UA 1WDRA 3CT7A 4ZMGA 4HP5A 4L9ZA 1U5JA 5HXMA 1MNSA 3C2EA 2OSWA 4G6CA 2ZFAA 3BDKA 3KM8A 2QGHA 4MHBA 5AY7A 1FFQA 2VDHA 4H9YA 3WF1A 5G5IA 2GJRA 2ZX9A 3NQCA 3LCIA 4NAFB 3P67A 4FNPA 1NP0A 3L0NA 3FJ6A 3QZEA 4AZCB 2QDDA 4GKLA 2TRSA 3NL5A 1SSGA 4JOMA 1A3XA 2ISDA 5M17A 3NQBA 3SN1A 3SSJA 5IHRA 2DT2A 5F1VA 3IARA 3OBKA 2OTDA 2V2CA 3W07A 4R9XA 1FWAC 5ABGA 2NVDA 1W5OA 5E09A 4I9JA 3ARVA 5CZKA 1JDCA 4MY1A 1K4GA 1MNZA 3CS2A 4XKMA 4B3LA 3WLRA 2XVGA 3OG3A 3H53A 1OZMA 3QY6A 4ACZB 3WJYA 4QJ5B 1REQA 3ABXA 3NVDA 5IOBA 4ZZ9A 2INEA 1JZ8A 5A5WA 4MY9A 1X6LA 1QHPA 3M0KA 3DYMA 4U2ZA 3K2GA 4DZIA 3NEHA 2POTA 2NQ5A 3I3EA 4X0NA 2YLAA 1SGJA 4CNSA 2J66A 4JTGA 4HIBA 3CV7A 3S0CA 4MB3A 4K8EA 3G3MA 3Q2DA 1HL8A 1AH3A 4JQAA 4BI5A 3W2MA 1X1NA 2UY5A 4AIEA 2QJMA 1ZRQA 3NURA 2PPGA 4UWMA 1H2JA 2W62A 1QWKA 2ZRUA 4F48A 2Z25A 4TXEA 3AMKA 3G2GA 1FWWA 4O50A 1F76A 4AY8A 1ISYA 8XIAA 4EAYA 3CZ8A 3EX6A 2VNCA 2PRMA 2EBNA 4XQ6A 1OFRA 4US5D 2XM2A 3TC3A 5A8MA 1V93A 2VZSA 3DHFA 2IS7A 2F2HA 4F3HA 1U33A 5BXPA 2VD9A 1XSKA 2WOQA 1MSSA 4LYQA 1RUSA 1B3ZA 1PDZA 4PMYA 3L4WA 4GI6A 1BLIA 2GOKA 3MS8A 5CPNA 4XZIA 1C90A 3K8KA 3CZEA 4UTWA 3M7WA 4QCFA 5GPRA 3CQKA 2PDXA 2ZZ7A 4CD4A 4E0CA 3ATZA 3THUA 3W37A 3KBJA 3LHVA 3SCUA 4WRHA 3DC8A 1S5MA 2V30A 3I65A 3TYEA 2VVNA 3AUOA 5ABEA 3GAKA 3W7KA 1FCQA 4WSJA 2WCSA 1OYBA 4HCHA 4C6BA 4J40A 3MZNA 1N2VA 1QI2A 1Q6RA 1ZFJA 3DX5A 4CVWA 4LCQA 2C7FA 3PN8A 2CBUA 1EO7A 2WVUA 4H4IA 1VB9A 3M5YA 4PUJA 3MKCA 4J7RA 3VK5A 4AZBA 2AMXA 4QDPA 1F8MA 4UTJA 1J96A 3ZQ9A 4FOUA 2VFDA 5BCAA 2QCNA 2WZTA 4A3YA 4HJWA 1UC5A 4AX7A 1W31A 1GQIA 1P1MA 1DHKA 4MKVA 4K36A 2VFEA 4M3PA 1MRAA 1PS9A 5CCZA 2R6OA 1SW0A 4XTIA 3S1UA 4O17A 2XZ7A 3FYYA 1R3SA 3CGTA 3ALGA 1W3TA 2ZUMA 1REQB 3D6NA 3TQPA 1F61A 2QT3A 2E6AA 5JU6A 4R88A 2D3NA 4JQ4A 3BZJA 1L2UA 1GVEA 3MVTA 3GUWA 4H2CA 3K4AA 1X96A 3BZGA 2Z28A 1JFHA 5BROA 1EC9A 4JKMA 3UWZA 2IXVA 4CU6A 3PWGA 1R3WA 1RP8A 4GUFA 3EA3A 3GTHA 2DZSA 2X0HA 4ZB5A 3IRDA 1KGWA 4OTKA 1NQKA 1GZJA 4GO8A 1UW9A 4O1DA 2FFIA 1VPXA 3AICA 2O4QA 1UCWA 4EPDC 3ZJ6A 4PB4A 1DJXA 5G4WA 4UOQA 1VIZA 1VH7A 1KR0A 2FGBA 4LUSA 1QCWA 3PWIA 2BG5A 5F2IA 4FALA 1I45A 1QW9A 3V7PA 4JFSA 4CQBA 3GH7A 1Q63A 3WELA 5DN1A 3NQDA 4HYWA 2Q09A 3FFSA 4RDVA 3CAQA 3GHUA 1W3IA 4P8WA 2EPHA 2YPIA 1B3XA 1QR7A 4V28A 5BRQA 5LXEA 5CZ0A 4C6LA 4C5ZA 3ZIZA 3PK7A 3DFYA 4R3UA 4DXKA 5KMYA 5BWAA 1T6MA 3WBXA 2WXDM 3H70A 3RX2A 2WCGA 1OGSA 4PMDA 1XLBA 4L9XA 5F2LA 1ELSA 3AJXA 1S2WA 4XUYA 1ZBWA 3T44A 1J93A 1GQNA 3CM4A 1YBQA 2F6KA 1V5XA 2JIEA 3UZYA 4TTGA 3CUIA 2Z1XA 2V3DA 1GGOA 3SQMA 1BF2A 4PULA 3LCXA 2ABAA 2LLEA 2NX9A 3DGBA 3IIVA 2WB5A 1MMFA 1E9LA 3P8IA 1EX5A 5FEWA 4ZXLA 2FVKA 5C9UA 3V1PA 2A4AA 2QCHA 3L4VA 2PD9A 4DLFA 1K9FA 3URBA 2E28A 1XUZA 2VRQA 3TX9A 1AD4A 1FBAA 3AXMA 1L8NA 4IJBA 1VJSA 5K4XA 1NTHA 3LGGA 1S3TC 5G2WA 2PMQA 5CBBA 1YTDA 5A8GA 2W27A 5A6BD 3FKRA 1RCOB 2W0UA 2ISFA 5DBUA 3TMLA 3QPYA 1B1YA 4BQ2A 3S46A 4Q3MA 1VFFA 4J3ZA 3KTSA 1J6PA 2QULA 2VYOA 1KXQA 5TQLA 2C15A 1TRIA 2X1UA 1GUVA 1J4EA 2WZMA 2XGZA 2WMFA 3JRKA 4I5RA 4KFNA 3PTMA 5M1TA 1UP2A 3LLFA 4D6DA 4B5NA 1L2QA 2W66A 1CXEA 2D73A 4MY8A 4KPLA 3S5OA 1POJA 3URNA 5FL0A 1W1YA 1RA5A 1AH4A 3M5ZA 1IT8A 4NX0A 5C9XA 3PJXA 3MTWA 2RDUA 3W84A 1E15A 2VUYA 2V3FA 4D71A 1KFWA 1OFDA 3H55A 3P7YA 1E6ZA 1BTCA 3GTFA 3F5LA 2YB4A 4U10A 3EPOA 3U5YA 3WENA 3N25A 2YZ5A 3JVAA 2OT1A 2X0SA 3LA4A 2A3BA 1PPIA 4E4PA 1JDAA 1GOXA 4LUSB 4CVUA 3ALFA 2GGEA 3CHEA 3ZT6A 1XBYA 1TPVA 1UUQA 2WC7A 1DHPA 2AL1A 4XK2A 4QR6A 3V5CA 4WD0A 3C2FA 1O5KA 3NNTA 3UWWA 4DJDA 4UQCA 1FDYA 2I57A 1FKWA 4MIMA 1WE5A 2CLEA 2JEPA 2A3HA 1VYPX 1XYMA 4FPSA 2D23A 4FLOA 1KWGA 4XBSA 4M6UA 5I3IA 3NQGA 2YDRA 3ZMRA 3F5KA 1OFOA 2HK0A 3PZ9A 3VMPA 3RN6A 3FVMA 2Y63A 2DU2A 3U5UA 1XBXA 3TSMA 2CZEA 3AIRA 2RHGA 3WH6A 1QBAA 4ZB0A 4GJIA 1YBQB 3FX4A 1DE6A 4A29A 3J7HA 3BL3A 5TD4A 1KFJA 3MBDA 3CV1A 3WL1A 1SMAA 1UKPA 5LNVA 4GUJA 3C56A 3ZZ1A 1ZB5A 3B0YA 5EY5A 3EWYA 3M0MA 5LGZA 4HD5A 1NP2A 2OWXA 4I90A 2Q6ZA 1EZWA 4X0VA 2C16A 2CYGA 4BF7A 1THFD 2W79A 3I6RA 3R10A 3UCQA 3ARUA 2AKMA 1LOLA 4YIWA 3H22A 5C6MA 3HV8A 2HE5A 3WCZA 1ZUAX 1KM3A 6REQA 3DHUA 2G5WA 4XD4A 3KW3A 3M64A 3ENLA 3H2FA 4NX5A 3VCNA 2QS8A 3BCDA 2J78A 4GA8A 2DZVA 1NOUA 2XDFA 1OBAA 2HVOA 1S5VA 3VM5A 1AW5A 1AL7A 3T9PA 2C1HA 1AA1B 1IHIA 1FTXA 4RKAA 4H6QA 1M03A 3BAIA 2CLHA 3A12A 4AXNA 4L4LA 2QV4A 5DBTA 4TUFA 2X1TA 3CV2A 1PIIA 1VFHA 3W1AA 3B8DA 4AEEA 2AGKA 2PS2A 1BKSA 4O1AA 2C1IA 2CXEA 5A8OA 1XH0A 3VUSA 5C54A 2DUZA 3WSUA 4YN5A 2I56A 1O12A 2RAGA 2HVMA 2W4XA 2BGNE 1ZBVA 4RR4A 1SW7A 1SFJA 3REQA 5FJRA 3P0WA 3NSMA 4HNNA 3EA1A 4LNYA 4ZQPA 3G6LA 4HNLA 2BY3A 3KCOA 4UTLA 5CPMA 1NH6A 4ZR8A 2JFEX 4ZBCA 2J8TA 2I17A 1A0EA 3L4TA 1M5WA 3HURA 4JTUA 5CLWA 1NELA 2DZWA 4PMRA 1K8XA 3S2CA 1PE1A 4I5UA 1MRQA 1XRVA 5AZ1A 3LYEA 3NPUA 2J7BA 3WLIA 3GYEA 2Z6IA 2Y8UA 4HK6A 4PUUA 4H8VA 3UXAA 1XYFA 2PGWA 1W9PA 1OCJA 1SW3A 3KUMA 2DZTA 1EJVC 1WBJA 1ISVA 1HKJA 1ADOA 3ATYA 2IQTA 4QCEA 4DEFA 3C2OA 5D9OA 4W8LA 5SWUA 3A23A 1UZ1A 1KGXA 4MNJA 4Q8PA 5LZLA 4PRRA 5EGRA 3MKVA 3W7RA 4DWDA 5J5DA 4QXIA 2FJUB 1YPFA 1A5SA 2FB3A 2ZUVA 4JTCA 2PZNA 4WDXA 3THAA 1N8FA 4LAZA 3H12A 2QCGA 4QE1A 3ABRA 1JDFA 5HNRA 1W2VA 3I7RA 2AAAA 4NHVA 5KITA 5FL1A 3RO8A 2DIKA 1SR9A 4IIHA 1UJQA 2W61A 2XN0A 4PODA 1LCOA 2VCAA 3T05A 5G4EA 3E1F1 2PU1A 4ZTYA 1QVBA 3PF3A 4X63A 5GJPA 4FIQA 1VLIA 2YFOA 4TV6A 2WVVA 3N6QA 3GE7A 1FKXA 2P76A 3EB3A 2ASHA 2WWDA 3W7OA 1NJJA 1RP9A 4DJDD 1UQZA 2XIIA 1W5PA 2PDPA 4BZYA 1G4PA 3EXRA 1VEPA 2WNNA 3KAOA 4ZEPA 2A2IA 3LV5A 5K3VA 1XLFA 2D0FA 3VIKA 4KMQA 4GINA 2VM8A 8RUCA 3N4FA 4LVGA 2YKKA 4GY0A 3IV3A 4KCTA 5J5RA 3UJ2A 4YHEA 1MEIA 1A5MC 1TWSA 2OR2A 4AUBA 4OOUA 1EGZA 3GM8A 1TMLA 2FZ9A 4B16A 3REQB 2QCDA 1FH9A 2MUCA 3O9NA 1PTDA 4LF2A 1A3HA 3KTCA 3FV9A 3N2XA 4LVFA 1K8YA 3FXGA 4TV5A 4UFMA 1JRCA 3U3HA 4TX9A 3T40A 3FVDA 1G94A 4RK8A 3WQCA 1Q6LA 3AYRA 1Q6DA 3LLXA 1JZ3A 4HPXA 2PF0A 3R0KA 4IG2A 3D0CA 2PBGA 4KFOA 3HU7A 3RJYA 4KIEA 2R94A 4X3ZA 1TTQA 3Q45A 1WBHA 5FCZA 1TJPA 3ONCA 4EXBA 4EIVA 4UTHA 5D8WA 3APGA 2ZVRA 3S6DA 3ARPA 4E6MA 1BGAA 4J4KA 5FEXA 3TNBA 1SPQA 1RH9A 4K6AA 3H2AA 3OJGA 2QUMA 3OGRA 4PRWA 1EF2A 2X09A 1DWGM 5GQBA 3GVWA 2J77A 5CJMA 2MNRA 4ZOCA 1IWAA 3M5XA 3NJ3A 4FXRA 4YTRA 3C52A 5JUVA 4K3ZA 3QGVA 1EL3A 3M9YA 4KKXA 4W8BA 4NZ5A 4PUKA 1UHVA 3UXKA 1E0WA 4JL2A 2ZDRA 4DJEA 1V3IA 4F8XA 1IXNA 2QLYA 1LORA 1I9CB 1TZ7A 3XISA 5A94A 4LRSA 1YPXA 3WBWA 3DUGA 1XGZA 4Q6XA 3GDMA 3R25A 4Q8WA 4IPIA 5BXRA 1PTGA 1SR0A 4UIOA 1B5TA 1XIEA 2HMCA 2WZEA 3WMCA 1AZ1A 1ZCOA 3U57A 3VM7A 2NXHA 3S5YA 2WVVB 3KEHA 4UTUA 1IV8A 3MKKA 1RBLA 4L4MA 2D0HA 1UR1A 3MV01 5KEZA 4OBRA 5DY3A 2VX5A 1QPRA 3NQMA 3QY7A 2GUUA 5CGMA 1M6JA 2VR5A 4PMXA 2QIWA 4W5UA 3WLMA 5DCDA 3G18A 2XINA 4WGXA 2XIBA 3DG6A 3TNOA 2WJDA 3H2OA 3O0FA 4NIRA 2GSHA 1WO2A 2O7QA 3LBCA 3U48A 3E12A 4KWVA 4OV4A 3LHYA 3RPDA 1I2RA 2VELA 4FLRA 4DLMA 1O68A 3DENA 1PZ1A 1JNDA 4MFEA 4HOZA 2ZX8A 1J0IA 2QJJA 3G1AA 5D05A 1EJRC 3AJ7A 4HKPA 1OCBA 4GUGA 3NQFA 4ATWA 1YE6A 2NZLA 1KTCA 5HMSA 1EB3A 1WNOA 4EF9A 4EACA 4HOWA 1H0IA 2QCDB 3O63A 1UWQA 3VOGA 2G3NA 2WMJA 1KKOA 3QJAA 1OFEA 4Z2GA 1HL2A 3LGDA 3WY1A 3LRLA 3MSDA 3T6CA 3VOJA 1X1OA 4Q4QA 1P0NA 1V6UA 2X8RA 2Z24A 5AYXA 4K8HA 1QO2A 3IANA 4GZJA 3EXSA 3OZMA 1B90A 2DV0A 3GG8A 1XPYA 1VP5A 4AWEA 1RJQA 1H62A 1DXFA 3T08A 1JD9A 3B0XA 1PHQA 4LS2A 4QTGA 3GR4A 4S2BA 1G7VA 3SI9A 3G6MA 3L65A 2J9ZA 5DXXA 5CC3A 4RX0A 1GQKA 2Y70A 4FK9A 3WF0A 4B5UA 1TPUA 5H8UA 3W70A 4ERAA 3NR0A 3KTXA 1TTIA 2EO7A 5J04A 1C7TA 1GW9A 4URIA 5JIWA 3H54A 4FXJA 4A21A 3KL3A 4W85A 5EB8A 1BEUA 3DESA 3W3OA 1FUYA 1DIKA 4M56A 1CEOA 3OO2A 2VX7A 3QTPA 2E6FA 2ZWZA 2OPJA 1H0GA 1DQWA 4QIUA 1MZRA 2DSZA 1T7LA 1IGSA 4IGNA 3V4BA 2PDGA 3SGZA 3BVJA 2RDWA 1T41A 1Q3NA 1E9ZB 1XYBA 3A9BA 2CKSA 2XU2A 2OZ8A 4GQQA 1R46A 1QOQA 2B0MA 2G3JA 2YBUA 3RLUA 1NOWA 1G1YA 2ZC8A 2CLOA 1PAMA 1YXYA 2HPMA 3RG6A 1FH8A 3HPXA 3OYZA 2OLHA 1WKFA 4FI4A 1WAWA 4MMWA 1FWBC 5LA1A 2YDSA 5IHSA 5LA2A 1L6YA 2V2HA 5DF0A 4B5WA 3V16A 3WQ4A 1LTDA 3EGJA 1TUXA 1IEWA 3LHTA 2H3DA 1TELA 4J3VA 2EF9A 3KCLA 3OVQA 2J25A 4DI9A 3A6OA 3STEA 3RCMA 1MEWA 4TVCA 3KP1A 5D9MA 4AHPA 3CAWA 2FTWA 4NNBA 1UIOA 3USBA 3WD2A 3W7MA 1T8XA 3VILA 3CNYA 4IZGA 1X39A 3V18A 2Z29A 1VCGA 2VEFA 1XHGA 1IXQA 4W8AA 2E5CA 3QH2A 4E2VA 3A4WA 5DFAA 1GNXA 1S2AA 4DJED 3GK0A 4GVIA 1GVFA 1I1XA 2P5NA 1XCXA 2QDHA 2IKGA 1UZHA 5CAHA 5D09A 3G8RA 3N4EA 1UKOA 4H1ZA 1CGWA 2X1IA 4JIEA 2CLMA 5A8QA 1V02E 2WVSA 1US2A 3WG6A 4JZ5A 2VC5A 4O54A 4H19A 3ZM8A 4C6NA 4QRNA 4GC3A 3TQKA 3I7SA 2X16A 1NEYA 3W2JA 3VDCA 3A5FA 2A6LA 4R34A 5XIMA 3VNDA 4KEMA 4J27A 3LCLA 4IMGA 3W7EA 3A22A 3WK3A 1RY8A 4GHRA 1LBLA 1V03A 1UD5A 4Q8MA 4B9YA 5CSYA 3NSXA 1PV8A 1ZU8A 2VP8A 4JD4A 1OM0A 2NX1A 3GDRA 3ARQA 1UD8A 4IIDA 4DO7A 3ITVA 2GGHA 2P0IA 1OABA 4FOJA 2BXZA 5LNRA 4L80A 3IJ7A 4XAGA 1S5NA 4ZXOA 3VUPA 3CYVA 1U22A 2IQDA 1EYWA 1W8SA 3FLUA 4HHMA 3VTRA 2J7DA 4HZ6A 5HAOA 1GVSA 3BJTA 2ZICA 4M1BA 3W23A 3GKAA 3OVPA 5KZDA 1ITQA 2VEIA 3Q4DA 2PP1A 3LEPA 3MCOA 1UASA 4IISA 2BXYA 4FF7A 2BX7A 3GU9A 3GNNA 4NNCA 7TIMA 3KOFA 4JNZA 3QRHA 1KXVA 3FJLA 2IPFA 1Q6CA 2PF8A 4JDYA 2QCMA 3B9OA 3U2EA 1NIUA 3TCSA 3TYAA 1XSIA 4S3GA 5D32A 4XD5A 4HYRA 3DGRA 1F73A 1PIFA 3BXWA 4N9EA 1W17A 5CZJA 2E0PA 3STCA 3MP4A 2GVLA 1RQHA 4QJ4B 1TA3A 3T0CA 2BHYA 3CIVA 7TAAA 1IWBA 2XSBA 4HTBA 2XGBA 2C91A 4GQ0A 1EDGA 2OB3A 4ICNA 4IP4A 3TJLA 1HTIA 1OD0A 4A4AA 5MKGB 3M0XA 4YHGA 1US0A 3WL0A 3ZSSA 3BUVA 3HGJA 3CIWA 4HSHA 1E3XA 1QK0A 1CW2A 2W3ZA 3FNDA 2FHFA 2O9TA 2VCCA 2Y85A 2WPGA 4W4QA 2WSYA 3BLKA 1G69A 4Q33A 1PKYA 3LPPA 2D2OA 2JF6A 1EDQA 7XIMA 2PAJA 2PDWA 3NZGA 4H7VA 4V27A 3VZZA 1A5CA 4JX6A 4UTWC 3VA8A 2Y4SA 4NASA 4W9TA 2YXOA 1L6GA 4F79A 1RLDA 4YJ5A 2GDQA 2C14A 3ITOA 3IWPA 4MJ4A 1E73M 3HO8A 1OC6A 1HGWA 2Q8ZA 5HJLA 2PDBA 3WJXA 4MAZA 1KV8A 2WMGA 4AW7A 1YXDA 1LRNA 1W9VA 1LJYA 1MFVA 3T4WA 1H09A 2YL5A 3GG7A 4UFLA 1L6WA 1PXGA 3MBFA 2D2HA 1KM0A 4JNMA 3QF0A 4O10A 3W24A 5CBJA 1Z89A 5JH2A 1T99A 2QCFA 4UUIA 2EG8A 1C7SA 4OBSA 1XWYA 1V3JA 3EX3A 2EPMX 3K13A 3RPMA 5HQEA 4C6CA 5LHEA 3W1UA 3UZWA 4AG0A 2YCKX 3CLWA 3P82A 5AVHA 2QUTA 5CC5A 1LL4A 3SZ8A 4Q4KA 2CITA 4Y6GA 3O2LA 4ILSA 4LALA 1OF8A 3TXZA 2OEJA 1E6RA 2JF7A 4AYSA 1UBPC 4AWSA 3CWOX 3K30A 1SZEA 3CTTA 3UZZA 5IM51 3R79A 3OW1A 3RLHA 4BA0A 3MUXA 3T2PA 1R5YA 3VOCA 3I3DA 5DT5A 4A2RA 4GZ7A 1P1XA 5HNTA 4PCNA 1S38A 3DI0A 1F3EA 3DEQA 3JZEA 1LUCA 2VGBA 2WJEA 1DWIM 1I4NA 1QNVA 3CWHA 3DKJA 3PPHA 4A05A 4EXQA 3I4KA 1TA3B 4DX3A 3UCDA 4ERGA 4ZFMA 1VBJA 1NQ6A 4S3JA 4C1LA 1UC4A 1CNVA 1H7NA 1UWSA 2CW6A 4RE3A 4R9OA 3IIPA 2C79A 1XC4A 3A9IA 1O60A 1XH1A 3FJ4A 2Y5SA 3GXFA 3WH5A 1ECQA 1FHLA 3DC0A 1ZENA 3PR2A 1WOAA 2CFFA 4HYVA 2Y89A 3FJNA 2XVNA 1HX0A 2PDKA 3R8HA 1ADDA 2H9AA 1M7OA 3CZKA 1BF6A 4XZLX 1ONEA 2IUZA 3SRKA 3CMFA 1HT6A 3G0XA 1GYLA 4JL1A 2QF7A 2VR4A 3TLQA 1ONWA 3H21A 2G41A 2WJZA 3SIMA 2NT1A 4GI9A 2ZUUA 1JVNA 3QMSA 2DH3A 4KW2A 1QI0A 4S3AA 5GNYA 2IPJA 1W1A1 4KCVA 1XLDA 1UR2A 4R53A 4QQ3A 5EA9A 4K1WA 3UPBA 3WH8A 4CLMA 1WA3A 4RW5A 4C60A 4UTIA 1KCLA 1UQYA 1TTJA 2DJXA 3STGA 4G5DA 4Y9MA 4AVNA 4IH3A 4KWWA 5EMYA 5G1MA 1KFLA 5C7HA 3NPVA 3WDPP 2CHNA 4ACYA 4DPQA 5D8ZA 3VIIA 4JTJA 3WX7A 2J9XA 1HKVA 3ABOA 2E40A 3NQ8A 3R94A 1CCWB 3WO8A 1ENUA 4E2DA 4O0KA 1JCJA 1XDLA 4I9TA 1ZGDA 3IS4A 5A1AA 4RNFA 3EDDA 3CXOA 5I3JA 2PTDA 3FEQA 4IMEA 4C6JA 2RGLA 4QG6A 3MWCA 4XISA 3M0LA 3KBVA 4E2OA 3RAOA 2E9MA 4OE7A 1D3HA 1Q13A 4U33A 4LSBA 3IIZA 3TVAA 4AZ6A 3UZXA 4W7VA 3FY1A 4QLKA 4XIAA 1DQXA 4JBRA 1UUOA 4WK9A 2EAWA 3LCHA 3PBWA 1TPDA 3B8VA 3TTYA 2Q8LA 4HTYA 1X97A 4DZ5A 2NQJA 1QAPA 3L7RA 3TFXA 3H2MA 1RY0A 2VL4A 4CNPA 4X61A 1R47A 2Q02A 2HCVA 2V6AA 3QFWA 3M16A 4DWSC 1LUCB 3JU2A 2HXUA 3PY2A 3WFLA 3MYOA 1TV8A 1GOOA 1F05A 1J10A 4UNLA 2VI0A 2YA0A 3W82A 2B7OA 1K3UA 2VFHA 4GD0A 4MZYA 4Y9AA 4GVGA 3MMDA 3RR1A 4RNIA 2OX1A 3PAOA 5HUOA 3GBDA 1XBZA 4LFYA 3INPA 4S3BA 3T0TA 3PSVA 1OVDA 4HQVA 4BJHA 5FSEC 1DEDA 3WMLA 3WQGA 4JAWA 2H9AB 1HKIA 3E5PA 1A4MA 1FWEC 2ACUA 4NSBA 4WZHA 2OYMA 1Y5WA 5E0FA 1LF1A 4GO9A 3VPLA 3VKBA 1CX9A 2GQAA 4J35A 1W1PA 4CCZA 4J2PA 4FR1A 1VKFA 3P62A 5LA0A 4B4FA 4A8LA 1FHVA 2Y0FA 1HJUA 4BQ4A 5FSDC 2BVTA 1TV3A 1VBGA 4HZ7A 4C6IA 4HNVA 4NL1A 4PH6A 4C90A 3MUAA 4AYGA 2DH2A 4OUEA 5E9AA 4NRRA 3UWQA 4UMCA 3P60A 3WF3A 4IX2A 3VCRA 3EKZA 4AAJA 1Q6GA 2R1MA 3PPCA 4M82A 2Y8KA 3B8IA 1XV8A 2E6DA 1AK5A 1HW6A 1L0PA 3E5BA 4IM4A 3GVQA 4C6EA 2BMBA 3RHGA 3PP7A 3TAKA 3BLFA 3SCNA 3S83A 2PDMA 3ZOAA 3PZIA 1CXKA 1EZ2A 1OB0A 4PCPA 4GUIA 3G1XA 4JIRA 4OJYA 3KRUA 3BARA 3EWUA 1OFBA 2I7GA 1EFZA 3W88A 5DMYA 2BWGA 3K1DA 3WLLA 2RGMA 8CGTA 4R33A 5E0KA 4X9SA 2B31A 3G1FA 3LQGA 1Z3NA 4HZMA 4JN7A 1OINA 1FWFC 3EWCA 3ABZA 3FYOA 4IPLA 1OYCA 2NQHA 2PLCA 2R14A 3NCOA 4O11A 5JBEA 1Q45A 2KZHA 3APTA 3MP5A 1MEHA 1DJZA 1SYTA 2ACQA 1L8PA 3AUJA 3MT1A 2FZDA 1XYZA 2WHKA 3EWBX 1A5AA 1OD8A 2HS8A 3O07A 1KO0A 1BWLA 3TZFA 1EYEA 2CBVA 1B2YA 1YADA 4AC1X 4F9DA 2FGLA 2Y88A 3STFA 4HB7A 3LCGA 1TPH1 4MNMA 5D2WA 4DB7A 3GHRA 3KOXA 2VOTA 1H7RA 3MWAA 3N2MA 4FO4A 3C0JA 4QAWA 1LBMA 1RZMA 2DZXA 5A3HA 4B5TA 4YNGA 3EOEA 5M03A 3EMQA 2YX0A 4XSLA 2ZUWA 3VKKA 1M01A 1IEQA 1YDVA 3U8GA 4DM2A 3KZSA 1UWIA 1KB3A 5CG0A 3NQVA 2WM1A 2YCEA 1JG9A 1ICQA 3PPFA 3OLIA 4KEVA 3IGSA 3KBWA 5HQMA 2A3CA 3CB8A 4LV9A 2RH9A 2WSKA 3VNLA 1A50A 3GXNA 3SCPA 3SEPA 3OZYA 3VABA 3KL5A 2ZYFA 4LXFA 3QMTA 3S4TA 1TVNA 4LEFA 2EQDA 3QGKC 3BPWA 2W5FA 4E38A 1ZTVA 3LMZA 1ZJAA 1XLCA 3CAVA 4RE4A 3AWOA 4RL3A 2DW6A 3L23A 3GIYA 1I2OA 5H91A 4CGTA 2BY0A 3CZGA 2R1KA 4WUIA 1K7EA 3VZXA 1VBRA 1VC4A 4QJ1A 4QNWA 1E1EA 4R7JA 1WXJA 4EAMA 4UFKA 1CTNA 3MO7A 4AVFA 4DXXA 4XAPA 2ZQ0A 3H2CA 1UJPA 3DU0A 2NLIA 1J01A 3TP4A 4DI8A 2WNQA 4CD6A 2UV8G 3OZOA 4PTNA 3R58A 2VX6A 1CXIA 1DJQA 3AZTA 3PZNA 3BLLA 2FYMA 1TQXA 2HXTA 1GPWA 3IUIA 3KLLA 4XZWA 3EZ4A 3HF3A 3D5HA 3GFXA 3M6YA 1LLZA 4BEUA 3W26A 4DJFA 2WLYA 4H6EA 2ZZ1A 1KLZA 4FLQA 3GDKA 4I3GA 1V79A 4WCJA 3UFYA 5JBFA 7PTDA 3A21A 2ISSA 4BWLC 1KNWA 1IWPA 4F0LA 3BJSA 3EEZA 2XH7A 3ES8A 1FWIC 1ZCCA 3MYPA 4PE8A 2CZFA 3AYSA 2J88A 1EQPA 3U6WA 1A80A 1H50A 2FZMA 3NZ1A 3WD4A 3NQAA 2WKGA 1AODA 3FHAA 3F4DA 5AC8A 4B5VA 4P2VA 1HJWA 1R86A 4JEJA 3B8TA 2NXIA 2PWEA 4NZCA 1PX3A 1XISA 1XIHA 3WDQA 1X98A 4XIMA 1UKTA 2J6XA 4AB4A 1XYLA 3IJIA 4F0RA 2TSYA 1LZOA 4E8DA 6XIMA 5CGQA 1J0ZA 4ZO6A 1IQ8A 4PEKA 3ITXA 1BWVA 1NU5A 4JY9A 1XGEA 5HMEA 1EH9A 3Q94A 2NV1A 1PEZA 3R7MA 3CU2A 4MNLA 4B9ZA 3MP3A 3WMSA 1RHCA 2PCEA 4PGLA 1M1BA 1ZP4A 3QBUA 1KBLA 3S2MA 4JTLA 3QY8A 2PTYA 3WUGA 4CKQA 4WY0F 3LB0A 3TC7A 4MB1A 3U2OA 3HPAA 1B3VA 3QMRA 3AISA 1UOKA 3BLDA 1YNYA 1VEMA 1A5NC 4PC8A 4RV8A 5AC6A 3EOOA 4L56A 1R85A 3PS7A 4U5IA 3QZ6A 4GIAA 1O5RA 1GT8A 1E1FA 4RV3A 1XYAA 5FAGA 4AD0A 4DYJA 4UFHA 1CENA 5EU9A 3SAZA 4BK9A 3VDAA 3W2NA 3WUFA 1KQYA 2CIPA 4CEUC 2O92A 1SM9A 4AC7C 4LCSA 3PJWA 5FJPA 4PMJA 2DVUA 5D2YA 4F0KA 4ZE5A 4BQ5A 1VPQA 3HGSA 3HM7A 4DYEA 3C3NA 1SZGA 1JYXA 4G56A 1ESWA 4MADA 1XS2A 1R30A 3GTNA 4QGCA 3EX4A 4LUTA 3WQ8A 1H51A 2R9RA 2Q71A 1RXOB 2EPOA 1VGAA 5LKYA 3PUEA 4X9YA 3MA8A 3TTEA 1H7WA 2E5BA 3UWVA 3QLLA 2ZC1A 4NKCA 1O66A 3OODA 2FMNA 3W38A 1ME7A 3MCMA 4N9DA 3MW7A 2ZTJA 3PZOA 4AZIA 3W01A 1UZDA 4Z42C 4DF0A 1E5NA 2YOCA 4A3UA 4F40A 1H7PA 4RLIA 1CYGA 1ZY9A 4HA4A 1DKWA 3NZRA 4MG4A 1YE4A 3SO7A 5GNZA 2X40A 5LNSA 4HNTA 2OOFA 3TW9A 4DBSA 1BYAA 1ZL1A 3SN4A 3OQ8A 3B9NA 2OWWA 1WZKA 1RALA 1O94A 3L9CA 2BGQA 3BG5A 1OEPA 1BVWA 1BXBA 3R11A 4MWAA 4AWTA 2CXGA 4HA1A 3W7QA 3HPZA 3NQ2A 4IP5A 1NWSA 2GDUA 4ML9A 4GFIA 3M47A 1AW1A 4H7CA 4DPPA 4Z08A 3UJFA 2DVTA 1UMLA 1ZAJA 1K6AA 5JBDA 1C9WA 5ABTA 3N12A 1TRDA 1A5OC 4Z0SA 3KXQA 4G1KA 3OIHA 5CG7A 3T7VA 4UBPC 1Q6OA 2GYIA 4IUGA 1ZS2A 1VJIA 1Q85A 1PKLA 3ITCA 3M0ZA 1KRBC 1HNYA 3HG4A 2R1PA 4WSHA 3UGVA 1W9XA 3GG0A 1JPKA 2V81A 2WVTA 1BAGA 1MXGA 1PWMA 4MLRA 4K2SA 4DJFD 2Y1HA 1TJ0A 2VEGA 3KZPA 4MM1A 3MU7A 2WZHA 1RPKA 4PMZA 4GMEA 2FPVA 3QPEA 4IF2A 2G3MA 3UPWA 4KWUA 1L6SA 5BOOA 3KS6A 2PI6A 4LH8A 4JHZA 3VIJA 2E5DA 4V33A 2PP3A 2YSWA 5FAJA 4IIEA 4QITA 1Q4WA 4NNAA 3S2LA 4IMFA 1NWTA 2FTPA 3D47A 4JHMA 5EMMA 3HZ3A 3ITYA 4O28A 1JR1A 1Q8JA 4FNRA 4RDYA 1XQLA 4LUTB 1FWCC 2QDGA 4I7VA 2OODA 1PUDA 3OOQA 1XX1A 2O4MA 1XC6A 2QEZA 1A5UA 2A7PA 3AI0A 1ECEA 1RK5A 1YKWA 4MB5A 4YVVA 2G3IA 2HDJA 3QV9A 4H8NA 3KCJA 4LBUA 2VT0A 1A0CA 4F4RA 3HGRA 3I68A 1SO5A 3LRMA 3WLHA 1WP6A 2GUYA 1ZLPA 3MHFA 4AD4A 2DEPA 2W6RA 3M43A 1DWFM 4GYKA 4E5TA 1BSLA 2XIJA 3QSRA 3ZJ7A 2ZCGA 4NXKA 6XIAA 2XN2A 1G9HA 5K2ZA 3E0VA 2JE8A 4C6FA 3KFTA 5T91A 5EFFA 2G95A 3H4WA 3GXMA 4U3CA 2HRWA 3C8FA 3UERA 1R6WA 3WF4A 3IAQA 3W1TA 4A8NA 1U5VA 1GQJA 3ZXWA 3K4DA 4KGJA 2IMRA 1DP0A 2ON3A 3EWDA 4S3FA 4XV0A 3SM0A 5DCBA 1OZQA 4HN8A 4MWAB 2BVWA 3IIXA 4S3DA 2R8WA 1W5MA 4NZ1A 3WJZA 4JTHA 1WDDA 5EMUA 1QHZA 4HU0A 3P2VA 4V2XA 4K39A 2QQ6A 4YVPA 4GQRA 1EGMA 4WOZA 4TTUA 2R91A 2G96A 3HJEA 4NYYA 2F38A 2BXVA 4R7OA 3WQ5A 2XTKA 4Q7IA 4FNUA 1RPXA 1EC8A 4CN1A 2BODX 3ZLHA 4KS0A 3ITGA 4YWSA 4FF5A 3B0VC 3E02A 3W4RA 4K1GA 5JXQA