2PRHA

The structures of apo- and inhibitor bound human dihydroorotate dehydrogenase reveal conformational flexibility within the inhibitor binding site
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
367
structure length
358
Chain Sequence
b'MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title The structures of human dihydroorotate dehydrogenase with and without inhibitor reveal conformational flexibility in the inhibitor and substrate binding sites
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 135
structure length 358
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2prhA00
3P74A 3I7QA 2ZRVA 3W85A 2GUUA 4L4MA 1AK5A 3BW4A 1H51A 3NR0A 3OIXA 1B3OA 3W2JA 2DJLA 3UZ5A 4JEQA 3CM4A 1QCWA 4E0CA 5DY3A 1H7WA 1S5TA 3H54A 3KRUA 3QJAA 5IBXA 1XL9A 4UTTC 3W83A 3LBCA 4ZQOA 5CSRA 5K9DA 3C56A 5K9CA 3CEUA 3TJXA 1UJPA 3W75A 3W2UA 3N34A 1W3TA 4GBUA 2W0UA 4N9DA 4NXSA 1UCWA 3GKFA 3WJXA 2BX7A 2C19A 3VFLA 1KFLA 4IXXA 2ZTKA 1TTJA 3S8HA 4JYEA 3PM6A 3T7VA 2HMCA 3GR7A 4AMAA 1OABA 1LTDA 3EWBX 5HWJA 3IVSA 1J2WA 1YLVA 4NNCA 2JGYA 3IIVA 2ZRXA 3DFNA 2VEKA 4AHPA 3OG3A 1K7FA 2ZZ6A 4DF0A 3DI0A 3ABOA 3S5ZA 3W84A 5HINA 3DFSA 2JKAA 5K4ZA 4LTSA 3G24A 3ZWTA 1F74A 4I7VA 3NGJA 4W9TA 3FA5A 1P1XA 2YX0A 3NL2A 3NG3A 5K9XA 1SZNA 7TIMA 1S5VA 1VR6A 3A9IA 3TFCA 2ALDA 3L9CA 3I65A 3I7RA 3TV8A 3HPZA 3TMLA 3P81A 3LDVA 1G7UA 1D9EA 3G3MA 4Y96A 5FF7A 8TIMA 4UTTA 1FCVA 1IXPA 3LTSA 2X16A 1XC4A 2NXHA 3HGOA 5DLCA 3B8DA 4LV4A 3FIGA 3QSRA 5DCBA 3FJLA 3O6CA 3P80A 2ZA1A 3DFOA 3MBDA 5HQEA 3P7YA 1OF8A 4OV4A 2YCEA 4AH7A 2I9EA 4O52A 1D3HA 4GUIA 1KLYA 5U4NA 3ATZA 2Y6ZA 3MI6A 4MIMA 1WXJA 1G4SA 4YL2A 4XTIA 3TH6A 1R46A 3L68A 4UTMA 1LYXA 3HMJG 1AL8A 2QCCA 2ISSA 4Y90A 5CPLA 3T4CA 1GYLA 4KFNA 3GB6A 3G1SA 2E6YA 3LHWA 4IPIA 3LI0A 3A5FA 1TPEA 4R34A 5MHBA 4TR9A 4N9EA 4N2YA 4XWUA 3W72A 1ML1A 3LCIA 5CPOA 4JN6A 1QNVA 3MUXA 4A21A 5AOUA 4N4PA 1I2OA 1QDSA 3W7IA 4TU1A 3B4UA 3DKLA 1Z42A 4FEZA 3UZJA 4JTTA 4M6PA 4X3ZA 5KZMA 3DKJA 4AWSA 1KV8A 4ZZ9A 3WJWA 4JIQA 1GVOA 4DEFA 3D0CA 3TA6A 2E5BA 3TXZA 3W1TA 1O60A 5DCEA 1XXXA 3NQ6A 1LCOA 2NUYA 3NQ2A 2E68A 4UFIA 2H3DA 2D73A 1EIXA 3OVPA 5FEWA 2J24A 3KHJA 3DENA 3MHUA 3GXNA 1DORA 3GNNA 2QCEA 1V7YA 4JYFA 4JTIA 1W5OA 1SQ7A 5D03A 4EVZA 2FIQA 1YYAA 2ZZ3A 1IXQA 1G4EA 5C6MA 1YDVA 2G5WA 3QW4B 3WK1A 2EF9A 2J9ZA 4Q33A 4YMZA 1DVJA 1L6WA 5HWNA 1OHLA 3HB9A 4WQ6A 3EXRA 4GWEA 3CU2A 4DO5A 2ZDRA 5HJLA 5LNVA 3TR2A 3W3OA 3PWAA 4I7UA 4CCDA 2RDTA 3W70A 4AHQA 3BLIA 4MFEA 2PC4A 3HO8A 4JD4A 4OBTA 1YPIA 4ZQNA 3P84A 4DO6A 4LVAA 2E6AA 3TNOA 2GVGA 3BO9A 3C6CA 4H3DA 2X1RA 2NZLA 1PS9A 3LHZA 2DZWA 2QF7A 1FDJA 2GJLA 3CB8A 1I4NA 1GVRA 2XN1A 2PURA 3GDMA 3NQMA 4ICNA 4MKNA 4NJIA 4EIVA 2VELA 1A53A 1R2SA 1A50A 4FNUA 3UY7A 4C1KA 3VI2A 1OYAA 3KXQA 5EYWA 1DQXA 5CZSA 3G0XA 1A5BA 4O18A 2NV2A 3E02A 1KA9F 1TPFA 3G8EA 2QCDB 3PBYA 3Q58A 4AXKA 3L67A 2QAPA 3W7PA 5BRBA 2NX3A 2R8WA 1VGAA 2GPTA 5DBTA 5T26A 3OVQA 3S5YA 3RLUA 5FF3A 1KTCA 1QOQA 5K2ZA 4O4VA 2ZRUA 2Q3OA 3C61A 4HIBA 3W6YA 3G1YA 2J88A 1GZGA 1C29A 2YW3A 4O14A 2ZRWA 4FNQA 4OU1A 3A5VA 3PR2A 1H5YA 2CLIA 1T0OA 4HNNA 3KRZA 4QM1A 1KM3A 3NQAA 4GRSA 1UB3A 4WXYA 2NV1A 4DO4A 3N73A 1DKWA 2VFGA 3P62A 4BWLA 4BF9A 3UQNA 1TPUA 2HTMA 1EP3A 4UR8A 1QPNA 1NF7A 5DCDA 5AHMA 3TSBA 3QSTA 2CZ5A 1FXQA 3IGUA 3O16A 1M7OA 3GZ3A 3MJYA 2FPYA 4OGZA 2E5DA 2FPVA 3PB0A 1OFBA 2A21A 2XN2A 2J6XA 4UTIA 5DN1A 3E96A 1ME7A 5D33A 1Z44A 1IGSA 3B06A 5I3GA 1PHQA 1JULA 1Q6LA 5AHLA 1UBSA 1TB3A 2B7PA 4M6VA 2YPIA 5DELA 3MO7A 5KZDA 3EXTA 4N9BA 3SI9A 2ZA2A 4QAIA 4UTLA 3O6YX 2E1DA 3K30A 2CLHA 2OCZA 5HR6A 4O0KA 1JCMP 3A23A 2DZPA 4FB7A 2HS8A 1JCYA 1KFKA 2Y70A 4FNTA 3TC6A 4UNKA 5LZLA 3SFKA 3BGJA 1GWJA 4TX9A 1XBYA 2ZA3A 1GYNA 2PRLA 4AF0B 3NPUA 2KZHA 3IV3A 3W2LA 3NPVA 3C2VA 1TMHA 2A0NA 5AB3A 2RDWA 4UR7A 5FEZA 4PC8A 1GVQA 3VE7A 2NUXA 1R2RA 1SFJA 1JVNA 3DAQA 1NFBA 2BZNA 1XDLA 3GDLA 5F4XA 1ZENA 2G96A 3EX6A 1GQNA 4LNYA 4JGDA 3STCA 3W1RA 3CIXA 4ZQCA 3HJZA 1I2NA 3HG2A 3CEPA 4MOZA 4GXMA 1H1ZA 4JTKA 1KM0A 3WJZA 3PULA 3S6DA 1OJXA 4D2JA 5F2IA 2RKXA 2JKPA 1LZOA 1VCFA 5DXXA 1PCKA 1SO5A 5F2LA 4LS1A 3OBKA 2FPTA 2JKEA 4OQVA 3W7GA 4R33A 4PA8A 3R5EA 3W22A 2PRHA 2ISVA 3F03K 1QPQA 3IIPA 2TYSA 3BLFA 5D32A 1JCXA 1OFQA 3W1NA 3DZ1A 2E6DA 3NQ7A 3FKKA 1A5CA 2Y7DA 4IMEA 3UWQA 3DFPA 2CLLA 2H6RA 3KOFA 2OX1A 3TW6A 3WK3A 3S1WA 5CPNA 4MZ8A 3U8GA 1PVNA 1FWNA 4ALDA 1H61A 3SECA 2J9XA 2V8ZA 3LI1A 4JR5A 1Q45A 3E9AA 1AW1A 2RFGA 2VFIA 5IM51 3LCHA 1GVSA 4IJBA 3IGSA 1VYRA 5AYXA 2H8XA 3IVTA 3OEXA 3HQ1A 3T78A 1KBJA 1EWDA 3L2IA 1EUAA 1SFLA 4E2DA 1JUEA 3EXSA 4O28A 2A1YA 1A5AA 1TPB1 5HMSA 2Z6JA 3V1PA 3LGEA 1GTEA 5DXYA 5LHEA 2A7PA 4O1BA 4XKYB 5D2XA 3TDFA 1KW1A 4ADTA 3FFSA 3L0KA 5HWMA 3O1NA 4LRSA 5BMXA 3BG5A 4ZQMA 1SZGA 3MYOA 2OT1A 3P67A 3LRMA 4QITA 3W1UA 4RV8A 1IIHA 4KWWA 2YZRA 4LS2A 2QR6A 3LTYA 2E5CA 3UY8A 1TTIA 4IUOA 3G18A 3GVGA 2J27A 1LRTA 1RVGA 3LXBA 1I2RA 3LCGA 4IQLA 2VFHA 3NL3A 5I3IA 3TQ0A 2ISWA 1YTKA 3ZR4A 5EA9A 4CQ8A 1K02A 3CC1A 5E93A 1I45A 1KFBA 4M5PA 4QNEA 1FCUA 3M5XA 3FYOA 2CLEA 1TO3A 3G1XA 2J9YA 5IBXC 2B7QA 1AMKA 4NUWA 1P0NA 2ATSA 5HULA 5LGZA 1LRQA 4NJJA 1KFEA 3G1FA 1L6SA 4GUGA 4RCXA 3DH7A 3R2GA 1HFBA 1S3HA 5FF0A 4QISA 4OV9A 3S1VA 2P10A 4EWND 2ABAA 3HBLA 4O19A 1TPVA 1ICPA 1GTHA 4NJHA 3RLVA 2ZZ7A 1TRDA 2BXVA 2FTPA 3QYQA 3P5ZA 4UTKA 1KV5A 4FX6M 1ZFJA 4LS0A 5C2XA 3BK0A 1EEPA 1P0KA 3QQ0A 4AF0A 4EOUA 1FWTA 3MI3A 3C8FA 4YXGA 1O95A 1H50A 1KM2A 3M1ZA 1TTPA 5D37A 2UV8G 1XFBA 3HG4A 4M6QA 2E09A 3G0SA 4MUZA 1Z48A 4S2BA 1LORA 1R2TA 3GKAA 2FDSA 1FWRA 1U5JA 2DZTA 3VNDA 3RF9A 2X30A 1IF2A 4JDBA 1UASA 2TSYA 1NVMA 4RZ4A 5TQLA 3IGXA 2WO5A 4GUHA 1M7PA 3W2KA 1OX5A 2V2DA 4UFJA 1KM6A 4NVTA 1X8FA 5AC6A 1QR7A 2RDUA 1M5WA 1G4TA 2NLIA 3R13A 1WQ5A 1ZAHA 2ZZ5A 5G2HA 1W54A 4DPQA 3W9ZA 4HT3A 3NNTA 1KTNA 1OYBA 2C6QA 2B0MA 5C5YA 1GPWA 1W3NA 3TC7A 4ADSA 2F7FA 3THAA 3N9RA 1H60A 3STFA 3GK0A 3W88A 2X1SA 5LSMA 3W7RA 1TREA 1CX9A 5CSSA 3HG3A 1SUXA 1VH7A 4NNAA 1M6JA 3BG3A 3M6YA 4NQ1A 3M5YA 2PE4A 4PTNA 4JY8A 3S9YA 3NA8A 3OVRA 1LOSA 1K3UA 5CKSA 2YDAA 2VFDA 4LV9A 5KZEA 1YXDA 4GC4A 1AL7A 4FXSA 3QEZA 4XKYA 3W07A 3H55A 2A4AA 3W7LA 4WXZA 4O17A 3HOJA 1TJRA 2DZUA 1SZFA 4O1CA 3S1XA 3EWXA 4MYAA 1JCNA 3TSMA 1E51A 2XN0A 5LNUA 4O10A 3QMRA 3LBMA 4PL1A 4X9SA 4MJZA 1SW7A 1AG1O 1O4UA 3EWYA 1VLIA 1LLWA 5C55A 3SR7A 4DBDA 3NQCA 4IMFA 3QPZA 2Y7EA 3IVUA 2EPHA 1RD5A 2I14A 4RZ6A 4RKAA 2VC6A 5U7SA 4ORIA 1Q6RA 1W5MA 1XCFA 3RFAA 3QMTA 5KITA 1DL3A 1FWSA 1YXYA 1LOQA 3NQ8A 4QQ3A 2V30A 4K7YA 4L4LA 3TK7A 1YTDA 1G67A 4OHQA 3Q94A 2P0OA 3C2FA 1TSIA 3PUEA 2ZZ2A 5BNKA 3MWAA 1SZEA 3OA3A 1K8ZA 3M5ZA 1JCJA 1EP1A 2NXIA 3ANYA 3UWVA 5HR7A 3M7WA 5DBUA 2VKZG 3G1VA 1FX6A 2WSQA 1V5XA 4HHPA 3FLUA 5G2WA 4C1LA 4A22A 5L9FA 5E0KA 2FB3A 1C8VA 2YYUA 5F4SA 1NSJA 1NEYA 4XZ9A 3LCXA 4O50A 4UC5A 4AWUA 2Z1BA 3BGGA 3QFEA 4M7TA 3C52A 6TIMA 1ZAJA 1F2JA 3MBFA 5G1YA 3BG9A 3HG5A 3QPYA 2A7NA 1G6CA 2OT0A 4S2CA 3THQA 4G1KA 3HPSA 3W1XA 1GVFA 4CNPA 1L6YA 4K39A 4RR4A 1HTIA 2B4GA 4KKXA 3LHUA 3FYPA 1QO2A 4RLIA 4WY0F 3LHVA 4KFPA 4JX5A 3IIZA 2B7OA 2EHHA 2C3ZA 1QFEA 3GYEA 5AHEA 2WSYA 3VKJA 1W37A 3M41A 2QCNA 1ZJIA 3G1HA 1O94A 1H7NA 1ICQA 3WK0A 1F5ZA 1SSDA 2YFNA 4N6EA 1BWKA 3R8RA 3R12A 1F6KA 4U28A 4YCOA 3W2NA 4BWLC 3U2OA 4JX4A 1GG0A 1Z41A 2Y7FA 5AHNA 4IXHA 1XDMA 3HPXA 2Y89A 4LC6A 3W1AA 2ATMA 1WX0A 4GNJA 4XBKA 3TIMA 4LU0A 5I3FA 4LRTA 4FIQA 3TJLA 1DJQA 1H7RA 3EWZA 4HPXA 4UTHA 3IIXA 4PL2A 3GAKA 2GJNA 1X6UA 4K7VA 3TX9A 3E12A 3TKFA 5G5IA 3SGUA 1W5NA 4IWWA 3S1UA 3W1MA 5HUOA 1OFDA 3W7MA 2Z0IA 3SY5A 4NU7A 1EA0A 3CWNA 1SW0A 4J9JA 4ORMA 3KVKA 3KRSA 1WOAA 2DZXA 3W7NA 3NL5A 1UUOA 4Z1AA 1I2PA 2Y63A 4KFOA 4FNSA 4N6FA 2V0TA 4FX7A 4GJ1A 5K7JA 1ZHAA 2FJKA 2WQPA 4JXCA 3TSDA 5LNSA 2A2IA 1TTQA 2QJIA 2QCFA 4JTSA 1F6PA 3DFTA 1TRIA 1LBFA 3LCFA 3PG8A 5KTLA 3L5MA 2AGKA 1VJIA 1OFAA 3SZ8A 3CLMA 3TW7A 5H2ZA 4JTUA 1XI3A 1H7XA 3TCEA 2HS6A 3W23A 4P2VA 2JK2A 3C2RA 3UWZA 4Y6GA 3G8RA 4E2BA 2CLFA 4KWVA 4EF9A 1QMLA 2FFCA 3KVJA 3W7DA 1SO4A 1G4PA 3E49A 2V81A 5TBOA 3S5NA 1LRNA 1N7KA 3FJ6A 3GAYA 4XBSA 4MZYA 3LV5A 1X1OA 2VFFA 3LTPA 3LLDA 1EPXA 4B5NA 3IIOA 3LHTA 1VS1A 4P61A 3CHVA 2C14A 3NO5A 4LY8A 1VHNA 2YR1A 1C9DA 3TE9A 4Y9AA 1OFPA 3T55A 2FLIA 4HNTA 3M43A 3TUUA 5LNRA 3SGZA 1OX4B 3O63A 5EKYA 4GUFA 5EL1A 1OK4A 3MP3A 3GXTA 4NT0A 3DI1A 2IQTA 3EB2A 1OFRA 1LOLA 3YPIA 1PCWA 1KBIA 1SSGA 3BARA 1XBZA 4LVFA 1H62A 2V82A 5CPMA 5D09A 4XUGA 4LOCA 2R14A 1B4KA 2QCGA 4JTFA 4O16A 3NPWA 3LRLA 3JRKA 2ZRZA 4UTJA 3W7KA 3B0VC 2PRMA 1JQXA 4PCFA 1YDOA 1RR2A 1L2UA 1T96A 2O7SA 4UMCA 1OX6A 3GXPA 3HF3A 5LNWA 5D04C 4PEKA 3MI2A 2TPSA 1SO6A 6ALDA 3PG9A 3MW7A 2DP3A 4Q4KA 2QUVA 1VCGA 4XTDA 3F1QA 4NXKA 1MEWA 3M16A 5BW6A 2V2CA 3U6WA 2WV8A 2DORA 1RZMA 4ZQPA 1VLWA 3NYZA 3MHGA 1Q3NA 2X1UA 1U83A 1W31A 4AB4A 3FKRA 3NDOA 3IRDA 3S5OA 2EGZA 2EAWA 2C15A 4FNPA 1B9BA 2FQIA 4K6AA 2TRSA 3STGA 3P8JA 4UXDA 3Q37A 5F1VA 4ADUA 1HUVA 4O0ZA 2Q8ZA 1IIGA 3EX4A 1MXSA 4O11A 2BSLA 1TV8A 3NAVA 3NVTA 1NAL1 2QCDA 3PUOA 2CU0A 5D02A 3TMQA 2YFOA 3KVLA 1QAPA 5AHIA 3PF3A 2OJPA 4YWIA 4UCGA 3L0GA 1ZCOA 3TAKA 3LLFA 1ALDA 2GQ9A 2Y61A 2ZCGA 4K37A 4BI6A 3W7EA 3TU9A 5H91A 3O06A 2GQAA 4RZ5A 1JQVA 1R47A 3UXDA 4NZFA 4O13A 1N8FA 4LVBA 1UUMA 3N9SA 1FCQA 4IMDA 1LLZA 4IMCA 3UYCA 1G69A 2E77A 5FF4A 4IOTA 3WFAA 5D2YA 4BR1A 1AW5A 3LXCA 1GG1A 3L0NA 4CCCA 2A6NA 1F73A 1WYIA 1O5KA 1T99A 2WKJA 1NF0A 4X22A 3KFTA 1DJNA 1QOPA 5HNRA 2H90A 1P4CA 3MYPA 3VE9A 3NOEA 5A5WA 4PODA 4LC8A 3WJSA 1TV5A 2CW6A 3F4NA 5J5RA 3LV6A 3LCWA 4OE7A 2DZSA 2NXGA 3PSVA 3W87A 4N02A 1QPOA 2V5BA 5EY5A 3WJYA 1R30A 1WBJA 3FOKA 4E38A 4R7JA 1SO3A 4U4MA 3L66A 3EX2A 2VEMA 1DOSA 4LT9A 5BMWA 4AHOA 3TXVA 3PBUA 4EF8A 1Q6QA 4DPPA 1YPFA 4CNNA 1TPC1 1JRBA 4HNUA 2WNQA 1IXOA 4LWWA 3GIYA 3GR8A 1ZAIA 3QM3A 4UFMA 1VYPX 2E6FA 4IX2A 2A7RA 1WOBA 4NZJA 4HNVA 4MLJA 2Q3RA 4MJMA 1MEHA 3LERA 4FIRA 4TO8A 1S5WA 1EUNA 2X2GA 1PL9A 4X2RA 3NL6A 2PCQA 1XBXA 5GVJA 3CTLA 4JTEA 3ZFHA 4HKPA 1BWLA 3DHDA 4LUJA 5D2VA 4FNRA 1OX4A 3G3DA 5CZJA 1FXPA 1CW2A 4Q32A 4WUIA 2NWSA 1TQXA 2NUWA 3NXFA 1RV8A 4O54A 1H7PA 2BLEA 1F05A 3LRKA 2Z2UA 5LHFA 3O05A 3C0JA 3OHIA 1RQBA 1XBVA 2QKFA 4DBEA 3GNDA 3M44A 3NM1A 4O1DA 3TQKA 1TIMA 1WA3A 3TQVA 1W0MA 4OT7A 2VFEA 1OG0A 2Y85A 4O4WA 5G2IA 1H1YA 1B57A 1TPDA 3CT7A 4IPJA 3N2MA 1FBAA 5EPDA 3RK8A 4IGHA 2CWNA 2CZDA 4LVDA 3DXIA 3C2OA 2RH9A 1PIIA 2YSWA 2YW4A 1FY6A 4AVFA 1W56A 3AJXA 3STEA 1YTEA 2VOMA 4CQAA 1ZNNA 5AC7A 2GVLA 4AEOA 3N14A 3L65A 2C1HA 3GLCA 1L9WA 4Z08A 3S0CA 1FWWA 4DF2A 1ZALA 4WX2A 3JS3A 5HUPA 1Q6OA 3W71A 4I7WA 3ATYA 3L21A 4M19A 2OMAA 3ZWSA 4WJEA 3ELFA 3UWYA 5EBUA 4DXVA 3B0UX 1VC4A 3M9YA 2WOQA 3PAJA 2NX9A 4Z0SA 1MEIA 4FHAA 1ONRA 3PC0A 1LROA 3B05A 4Z0JA 4BK9A 3DFQA 3O07A 5AN7A 2AQWA 3UD6A 5AHFA 3SJ3A 2QUTA 5CZ0A 4BI5A 4BFAA 4XQ6A 3B03A 3UPWA 3W1QA 1TPH1 5DY2A 1KLZA 2YYTA 3W7OA 3H53A 3LHYA 4RJEA 4WOQA 3INPA 2VENA 1GEQA 1CI1A 1DV7A 1K7XA 1BEUA 5FI8A 1W3IA 4LW7A 3O6DA 3C2EA 4ZL1A 3NPXA 3EWUA 3C3NA 3NEVA 3P8IA 3L5AA 5ABTA 4QJ1A 5G4WA 3I7SA 1VYSX 2AAMA 2ZBTA 3I6RA 1LDCA 5G4EA 2Q8LA 1W8SA 2QDGA 3ZS4A 4ZVJA 2LLEA 1SU5A 1OYCA 4O57A 2C16A 1J5TA 4UFHA 4S1FA 3W7HA 3M47A 4N9CA 4UFKA 4Y8FA 1KFJA 2R94A 4HSOA 5FESA 3A24A 3QW3A 4NX5A 5CGQA 4NNBA 4POCA 5AC8A 1VPXA 1YDNA 3T40A 3P5YA 4O1AA 2H3BA 3M0ZA 3KVMA 2DZVA 4QSHA 4IX0A 1ME9A 5F4WA 1TCDA 1FDZA 3BV4A 4NX0A 2YGYA 3CIWA 3W1LA 1HG3A 4UTWC 3EWWA 4ZQRA 1FDYA 4A2RA 2HSAA 2C18A 3B0PA 4ONVA 1KM5A 2G97A 5G1TA 2VEPA 2GQ8A 5F2MA 1N55A 5E1QA 3QH2A 1FQ0A 3PB2A 1BTMA 3KAOA 3QRHA 5AYYA 1KFCA 3UWUA 1P5BA 2QCMA 2QAFA 3W74A 4R53A 2ZZ1A 4UMBA 2TMDA 5I3JA 2A5HA 1OF6A 4TMBA 4BI7A 4FX8A 4NJKA 2WNZA 4WZHA 3BPWA 4CCEA 3M5VA 4CNOA 3N3MA 1OFOA 1XUZA 2Y7GA 3G22A 4ML9A 5C54A 4I9AA 5J5DA 5AYZA 5LGXA 1K8YA 1XM3A 4UTWA 5D2WA 1VCVA 4UIOA 1MO0A 1VHCA 3QMSA 3BW3A 2JBMA 3IEBA 4JDYA 1ICSA 4JIPA 1GJPA 1WDWA 1XKYA 1SR9A 1VZWA 2BTMA 1JJKA 2QCLA 1RQEA 4MFDA 1JCLA 4RXGA 3UNDA 3Q2DA 1H7OA 1O5XA 1OVDA 2CZEA 4HSNA 4MVAA 5AFDA 2VEIA 5D05A 3JR2A 3MP4A 1X7FA 3NZRA 2ZRYA 3VCRA 1LP6A 2C13A 5L6UA 4AAJA 4AWTA 1WV2A 2ZFAA 3ABSA 4Z1DA 3BVJA 3UXAA 3P61A 1RQHA 3EKLA 2V5LA 4RXFA 4MYXA 2CFFA 2W6RA 3QF0A 3WK2A 1H63A 4MZ1A 4PH6A 4WY0B 3SIZA 4ZMGA 1OFEA 2ABBA 1K8XA 3A22A 2H8ZA 4A2SA 3HGSA 1DHPA 4UFLA 5EMUA 4K36A 4Z1CA 1KM4A 5K4XA 3RU6A 3A21A 3PY2A 2NX1A 1YXCA 4DELA 2GOUA 4UUIA 3W73A 4MPQA 4HN4A 3MP5A 4HPJA 4TIMA 1MSSA 1TJPA 1GT8A 4YLWA 2W79A 1J4EA 3R89A 5SWUA 2CLMA 5CG7A 2WJZA 1W1ZA 4K8EA 3PVFA 4DQWA 1XUUA 2B7NA 1PV8A 2C0AA 2A6LA 2XFWA 3PBVA 4A3UA 4Z1BA 4RK8A 4FO4A 4GFSA 3DGRA 2FB2A 3TAOA 2I1OA 2Y88A 2X1TA 3ABRA 3CQ0A 4MLRA 4FXRA 1TQJA 2WNNA 4RX0A 3TROA 3N19B 4JNMA 1D3GA 5KSWA 4A29A 1OK6A 1VQTA 1QWGA 4JTGA 1TYGA 2R91A 1ME8A 3CPRA 3PSWA 1LM1A 3P82A 5KMYA 1JR1A 1RPXA 4JY9A 1IXNA 2WSRA 4NJGA 3W7CA 3G0UA 1WBHA 4OWGA 1I8JA 3W7JA 5FEXA 2BWGA 1LBLA 3DHFA 3GX9A 3KX6A 3NM3A 4O53A 1TV7A 5D30A 4MY1A 4O12A 5FF2A 1EP2A 3G1AA 2QJHA 1YADA 2V2HA 3SSJA 3HGJA 3EX1A 1HL2A 4CLMA 3T44A 2Y62A 3FEMA 5TIMA 3N2XA 1LBMA 1F76A 1I2QA 1EB3A 2CLKA 2OZ0A 3O15A 3USBA 3DU0A 1EWEA 4WOZA 1SW3A 4DF1A 3QZEA 1THFD 1JRCA 4N4QA 3O8AA 1T8XA 4QNWA 4K38A 3NZ1A 4M7SA 1K03A 4CQ9A 5F2GA 3W1PA 3L5LA 4JTJA 4O15A 3MHFA 4JX6A 3GDRA 4PFMA 2P1FA 1A5SA 3P60A 3E0IA 2NWRA 3NQFA 3SW6A 1W5PA 4WD0A 3V75A 4GE8A 3QC3A 2DJXA 1G7VA 5A8GA 4MY9A 3GDTA 2QUUA 3RNDA 1HO4A 3ABQA 3NQEA 2QDHA 4JTHA 3EEGA 1QPRA 1PHWA 3NQDA 4GUJA 2A85A 3C4UA 2DU2A 5BOOA 3RMJA 5F1UA 1MZHA 3PBWA 1TPWA 4JICA 4JS3A 1GOXA 3LXAA 2V9DA 3LCLA 3GDKA 1EX5A 3MMTA 3EKZA 5D2TA 1QO5A 3W76A 1ZY9A 4UNLA 5FEPA 2ZZ4A 4IMGA 4LUIA 3NQGA 1Y0EA 3AO0A 3HGRA 4JYDA 4LVGA 4H4IA 5K3VA 2GVJA 3FS2A 2QEZA 4K8HA 5I3KA 1DQWA 3NQVA 5I3HA 3PUDA 4JTLA 1F7BA 2YXGA 2O7QA 1FUYA 1FCBA 3I68A 3UPBA 2QCHA 5KINA 4UTUA 1X1ZA 1W5QA 2CZFA 4YCPA 2G95A 4H6KA 2ZTJA 2Z6IA 3BLEA 4WY0A 3W86A 3EX3A 2QJGA 1SPQA 1KM1A 1AW2A 5LKYA 4TMCA 3QQ1A 1VRDA 2CLOA 3HIJA 2VXNA 2ZQ0A 2WPBA 4FF7A 1JUKA 3W7QA 5CZTA 1K7EA 3UWWA 3BW2A 5D38A 1WAUA 2F84A 3B04A 4QIUA 4O8RA 1DBTA 3PS7A 3DBPA 3LM7A 1JUBA 3S42A 3F4WA 1ADOA 2JGQA 3LX9A 4UMAA 1PE1A 3CWOX 1B4EA 1HO1A 3LB0A 3LOTA 3W2MA 2RHGA 1BKSA 2ZYFA 3G1DA 4MY8A 2EKCA 1KTBA 3TFXA
chains in the Genus database with same CATH superfamily
3DUGA 1O1ZA 3MT1A 4IL0A 3NR0A 3CO4A 3VGFA 2PF0A 2PD5A 1J9YA 5FJIA 4JEQA 3CM4A 1W8GA 1XS2A 3CBWA 1XL9A 4UTTC 3W83A 2J8GA 3LBCA 1NDVA 5CSRA 3TJXA 3W75A 1MW1A 1B1YA 4GBUA 3GBDA 3GDBA 1EO7A 4NXSA 1UCWA 1EC8A 2HK1A 2J7DA 4FLQA 1KFLA 3JZEA 2CBIA 3F4VA 1TTJA 4JYEA 2Y2WA 4RNIA 2PDGA 1OABA 1LTDA 4C7FA 3IVSA 4B9YA 2CKRA 3IIVA 4L6DA 2V3FA 8CGTA 3OG3A 2ZZ6A 3TTOA 1F8IA 2PDNA 4DHGA 3S5ZA 3W84A 5HINA 2JKAA 3GIPA 4J3XA 3ZWTA 1F74A 4R5EA 3NGJA 3N4AA 4G1NA 1P1XA 5I06A 3C0SA 1YBQA 3NG3A 7TIMA 4H01A 1IEWA 5ABFB 3BJTA 3ARVA 2ALDA 5A6LA 3GE7A 2WHKA 2XIIA 3HPZA 3TMLA 2WZMA 3G3MA 3MKVA 4UTTA 2A79A 3IUDA 3LTSA 3VKCA 4LV4A 3LMYA 3FJLA 3O6CA 2OEMA 3MBDA 5AVHA 3VIIA 3U4FA 3GY1A 4GUIA 3ATZA 1AD4A 4AISA 2WCGA 3N6HA 4HSHA 5JVLA 4XTIA 3EA2A 4UTMA 2ZUMA 5IHSA 2QCCA 4Y90A 3RPMA 1FWJC 1K1DA 3BV7A 2E6YA 3LHWA 4KEZA 4R34A 4N9EA 4XWUA 3W72A 1Y8BA 3LCIA 3U3HA 1QNVA 3AYRA 4QSFA 4N4PA 4TU1A 3B4UA 1ITUA 1Z42A 2GGEA 4FEZA 1IZKA 3HPFA 1PWMA 4M6PA 4X3ZA 1XRFA 1ISXA 5DO8A 4ZZ9A 1WKDA 4TX8A 1QHZA 1F6YA 2I5IA 1GVOA 2Q71A 5I02A 4HNCA 1AH3A 1IV8A 2E5BA 3TXZA 2Y0FA 3I3BA 1XXXA 2NUYA 3D47A 1IZJA 3LBOA 2VD8A 2H3DA 1NP2A 1EIXA 1HF6A 3WUBA 2OB3A 3VKBA 3CAVA 1AJZA 3MHUA 1VBHA 2QCEA 3L4UA 4JTIA 1S5MA 2FIQA 2BB0A 2ASHA 1G4EA 3RG6A 2G5WA 4MPKA 5FD0A 3QW4B 4TX6A 2J9ZA 2W3ZA 1DVJA 3MUAA 3WDIA 3DYMA 2CPUA 1CXKA 3EXRA 4GWEA 3ZSTA 4DO5A 4DIAA 5LNVA 3CL6A 3PWAA 4I7UA 2RDTA 4NY2A 1YPIA 3P84A 4DWSD 7A3HA 4Q3MA 2GVGA 4HZMA 2ZE3A 2EKGA 1M1BA 1PDYA 1UA3A 1MNZA 4D8ZA 2R1PA 1FDJA 2A3BA 1JDFA 4UQDA 3W01A 2PURA 4ICNA 4MKNA 3VOJA 5I3DA 3ITGA 1K9TA 1UR0A 4C1KA 2UWFA 3VI2A 1E43A 1OYAA 5CZSA 4F2UA 3H2NA 1A5BA 1E6SM 4GMEA 2WCAA 2ALRA 3W7PA 3VZZA 5BRBA 3TYCA 2WM0A 1RK5A 2PLJA 3SURA 4REQA 2QHAA 5K2ZA 2AOSA 2F2KA 3B8WA 3W6YA 5JU6A 4LYKA 1Z6KA 1I0DA 1S46A 5CSUA 1C29A 2J7EA 4OU1A 3PR2A 3RX4A 5ABFA 3KRZA 1OZMA 4HCHA 3QFWA 1KCXA 4GRSA 1CXLA 4DO4A 1FWHC 2W61A 3PWGA 6CGTA 1EP3A 1EJWC 3ZR6A 3TSBA 4BF5A 3O16A 2FH6A 3VM5A 2EQDA 4UTIA 3OIHA 5BRPA 3N6QA 2ZUNA 5D33A 3AOFA 4ATDA 3B06A 5I3GA 3CLWA 1VPQA 1Q6LA 1FWIC 1TB3A 2B7PA 4LQ1A 3QV7A 3SI9A 4IFRA 3EXTA 3U2CA 2ZA2A 1HP4A 5E6ZA 3O6YX 3HJEA 3K30A 2CLHA 1RJPA 1UZ1A 3UR5A 2DZPA 1U1HA 1A3HA 1WP6A 4FB7A 2HS8A 1RSCA 1XYLA 1KFKA 3K1DA 2Y70A 5A8NA 3QR3A 2HCVA 3KBNA 2J75A 3SFKA 2ZUSA 4N0RA 5GJMA 4TX9A 4LBUA 3DYPA 1E9LA 1XG4A 3BWWA 2ZA3A 3AMGA 1TV2A 1WXYA 1HJUA 1XC6A 2PRLA 3WENA 1DQUA 2PWUA 5AB3A 2HK0A 4HK5A 1X6LA 1J5SA 3VE7A 3QY6A 1R2RA 1WKFA 1SFJA 4IP7A 1JVNA 3BGAA 1NFBA 2VGIA 2BZNA 2GUYA 1XDLA 4AIOA 1UD3A 2G96A 3PAOA 4N7QA 3W1RA 4EXQA 4D6CA 3HJZA 3CUFA 3APGA 4L1XA 1I2NA 3CEPA 4JTKA 3ONCA 3KS6A 1LZOA 5CPTA 2GVYA 3WF0A 2ISVA 2EG6A 1UH4A 2TYSA 5A6SA 4B5XA 3PZTA 1AQFA 1HN1A 2E6DA 3DZ1A 1GQKA 3FKKA 2Y7DA 4CVWA 4IMEA 3DFPA 4GIEA 4XX6A 3KOFA 3WK3A 2HNEA 4MZ8A 3B0XA 3H4GA 3SECA 1F3WA 3ZZ1A 1Y5XA 4IPPA 3E9AA 1PYFA 3WUFA 2GK1A 4C60A 3R94A 2WSPA 3T78A 4UQEA 3L2IA 2QPXA 1EUAA 1SFLA 1JUEA 1FOBA 3EXSA 1A5AA 4CNUA 4UBPC 4GGBA 5DT7A 5HMSA 3V1PA 1SYTA 5DXYA 4OTKA 4KS0A 2V6AA 4PBGA 4O1BA 3N3TA 5D2XA 2IPFA 2G3IA 4MNKA 1D7KA 3W26A 1JZ2A 5BMXA 4ZQMA 1SZGA 1EL3A 2XTKA 3VKKA 3VM7A 4LS2A 3UY8A 1AJ0A 3TTEA 3A47A 3GRIA 4IUOA 3VVGA 4JN7A 2J27A 3U2EA 3PZQA 4M81A 2NQJA 5I2UA 3ARWA 5A2CA 2ISWA 5EU9A 1K77A 3ANVA 2GYIA 1K02A 3OZPA 4M5PA 1B3XA 1JIBA 3CZLA 4QNEA 1FCUA 4UZUA 4V33A 3WNLA 1TO3A 2INZA 3G1XA 5IBXC 1AMKA 1P0NA 3M0LA 3CS2A 2OLSA 2R1NA 3KCJA 2F6KA 3ISIX 2HVMA 4GUGA 3GG8A 4RCXA 3AS3A 3DOPA 4F79A 4LSBA 4QISA 3K8LA 3EOOA 3XINA 4WSKA 5DQPA 1BQCA 2ABAA 2IW0A 3OHMB 2XH4A 4KRUA 4AD2A 1NIUA 1UP2A 4NJHA 3RLVA 2BODX 2A3AA 1WZKA 1TRDA 2BXVA 2OR2A 3KBSA 1T40A 4IQDA 3U0HA 4FX6M 1E6XM 2GGHA 1OD0A 2UZ9A 3DFHA 2PWFA 3IUIA 1XLFA 1KM2A 1LL6A 3VIGA 4A6GA 1Q65A 2ZKMX 2FVLA 3S6TA 4G7EB 4RUBA 5D37A 5HANA 3PN8A 3HG4A 3G0SA 4MUZA 1Z48A 4I5RA 3MKCA 1RHCA 3WH6A 1VPYA 1R2TA 3WL0A 1CENA 2X30A 5TQLA 3IGHX 4LCRA 1WKEA 3AALA 2WMIB 1OX5A 2V2DA 1KM6A 4NVTA 5AC6A 1QR7A 1M5WA 3W6MA 1Q7MA 3R13A 1UMYA 3W9ZA 4HJWA 5IXEA 3HURA 7CGTA 1KTNA 1DTUA 5C5YA 1PTGA 4S3EA 2QW5A 3MSDA 4HTYA 4ADSA 3EMQA 2XVLA 4UQAA 1E6QM 5E6YA 2ZADA 2OLHA 1TREA 4LAZA 3WQ8A 3AWOA 5GNYA 3LM3A 4XISA 4L4PA 1EQCA 3BG3A 3M5YA 1NWUA 4PTNA 2PTYA 3OVRA 1K3UA 2HNHA 2R1KA 2VFDA 4LV9A 1J0KA 1YXDA 4GC4A 1UUQA 3XIMA 3MUY1 1AL7A 5B7YA 4D6DA 2CESA 2WAGA 3W7LA 3HOJA 2DZUA 4O1CA 4O1EA 3S1XA 4MYAA 1E51A 3BZGA 2XN0A 2YL8A 4LCSA 3T81A 3VNJA 3OLDA 3B8VA 3ONBA 1CNVA 3ZM8A 3KM8A 3CUIA 1O4UA 3EWYA 4Q8UA 1UR9A 2VP8A 5C55A 3N12A 3G6LA 1EYEA 4X60A 4IMFA 4AC7C 4LAOA 1B30A 3MKKA 1PKYA 4RKAA 1IEVA 4IM4A 1XGDA 3DFYA 5HMEA 3WLIA 3EDEA 3PZMA 2NQZA 4QQ3A 3NO1A 4BKNA 3OYZA 1TZZA 4IP5A 4K7YA 4QQUA 3TK7A 1NFGA 3V36A 2QJMA 3C2FA 2DT1A 1SZEA 1K8ZA 3M5ZA 1CDGA 4LUSB 1BPLB 1V5XA 4HHPA 5G2WA 3KBVA 1X1NA 4L4OA 2D2OA 4A22A 5DMYA 5L9FA 1TMQA 4XZ9A 3KL0A 1J0IA 4M7TA 1T8QA 1DXEA 1ZAJA 2QPUA 1UHVA 3QPYA 1K4GA 4HHHA 4JFTA 5M5DA 4ACYA 3W1XA 2YDSA 3WG6A 4CNPA 2C71A 3CPGA 3FYPA 2PDBA 3GIQA 2B7OA 1ZCCA 2VR2A 1M7JA 2EHHA 2XWEA 4IH3A 2C3ZA 2O56A 1QFEA 2CHOA 5AHEA 4GZJA 1GQIA 2QCNA 4BCEA 1ZJIA 3G1HA 1R87A 4QTGA 1SSDA 4D8LA 5I24A 3AWNA 4W5ZA 4QE5A 4O0QA 4GH1A 4GY7A 2F2HA 3U2OA 4JX4A 4IZGA 1GG0A 3PFRA 5AHNA 1XIHA 1A5KC 4F2TA 3E74A 3B0YA 4R27A 2AQOA 3MCNA 1YMYA 4LRTA 3V16A 3W28A 1H7RA 3EWZA 1R6WA 4UTHA 1QNQA 4DJEC 2B31A 2WMIA 4K7VA 3TX9A 4DUXA 5E9AA 3SGUA 1W5NA 3R0KA 3BICA 2YCLA 4HA3A 2VX7A 3SY5A 3R0DA 3UU0A 4XZHA 3U5YA 3WH5A 1SW0A 1JPIA 4AX6A 3KVKA 3KRSA 3W7NA 1UUOA 2GGIA 4KFOA 4N6FA 3WQPA 4FX7A 5AYIA 1VRXA 2FJKA 2J62A 1GKRA 2V69A 3BLOA 4JTSA 3DFTA 3M6DA 1DIOA 4WGHA 3I3EA 1TCMA 4QEEA 1CLKA 1XH1A 3UG5A 3KLLA 3WBAA 4CGTA 3U4AA 4JTUA 3BLDA 3VOHA 1UZ4A 3E0VA 4PCNA 1QBBA 4LAKA 3C2RA 3M4HA 4Y6GA 1WB0A 4E2BA 2CLFA 1HJQA 3C5QA 1XPGA 2W27A 3BAJA 4C6JA 3AIEA 3E49A 5TBOA 1RALA 4A3YA 4KRTA 1GYMA 1LRNA 1N7KA 4XBSA 1E71M 4GACA 5T9CE 1XIFA 4EK7A 3LTPA 1EPXA 3JZUA 5A6KA 3IIOA 1VS1A 4GVIA 2E3ZA 1Q2SA 2OLAA 2VRQA 4N42A 4LY8A 2I7GA 1DIEA 4I9JA 5MF5A 3T55A 1AQ0A 2FLIA 3CYVA 3NUKA 1DTNA 5LNRA 1MDLA 4RDZA 4YTTA 5CQ1A 3O63A 3GXTA 4NT0A 2NQ9A 2JEPA 3GW3A 4V2XA 3VGHA 2HXUA 3II1A 4LUSA 5CBIA 2BVWA 2Z7KA 4FXFA 3BARA 1PDZA 1JYWA 5HNNA 1H62A 2E28A 1WZAA 4PUMA 4XUGA 1GOWA 3TEVA 1Z69A 3LRLA 3JRKA 2ZRZA 3IARA 1V3JA 4PCFA 4AIEA 1T96A 3CB3A 4UMCA 1OX6A 4C6KA 1XJBA 5D04C 4PEKA 4F0HA 3MI2A 1JZ7A 1SO6A 2XPKA 1UWIA 3B9DA 3WQ5A 3TOPA 2Z2AA 1OCJA 4XTDA 4NXKA 1G94A 3M16A 2IXVA 2V2CA 5REQB 2WV8A 3P0XA 1DXIA 3MB9A 2DORA 1DJGA 4KPLA 4M3PA 1GW1A 3NYZA 3WF4A 1Q3NA 2FZBA 4NG3A 5MKGB 3NDOA 3TJIA 1BGAA 3IRDA 2EGZA 2EAWA 4FNPA 3Q37A 4ADUA 2ODOA 2PTXA 4MWAE 1IIGA 3EX4A 1MXSA 3NVTA 1NAL1 4ZO6A 3PUOA 3WLRA 2CU0A 1OCNA 4MUPA 3TMQA 2F8QA 2PGRA 3KVLA 4E8GA 3WBWA 1FWAC 1UA7A 1AVAA 3K4WA 3WLMA 3THCA 3EOLA 1ZCOA 3PJWA 5E0CA 2Z00A 2XZ7A 3LLFA 2GQ9A 2Y61A 1EF3A 2ZCGA 4D6EA 3VOIA 5H91A 3ZT5A 3LQGA 1R47A 4D6JA 5A6JA 3GUGA 4LVBA 1UUMA 3GO2A 5LIKX 1TE1A 4K1GA 4YTRA 5FF4A 4BR1A 2G8ZA 1AW5A 3L0NA 4CCCA 4MMWA 3B9NA 4PZVA 4PGLA 2WKJA 1FKWA 4H8VA 4B3ZA 2H90A 1Y65A 4ZFMA 4EANA 2MANA 2REQA 1SJDA 3NOEA 3TONA 5A5WA 5EFFA 4MNJA 3NWRA 1TV5A 2PWGA 2VZTA 5ABGA 3PSVA 1V6TA 2PLMA 3COTA 3EPOA 3QLLA 1AH4A 2DQWA 3WJYA 3RCNA 3VYLA 1QT1A 3FOKA 2WMHA 5A1AA 3AUOA 2L5HA 3ORWA 4C90A 4HOWA 4AHOA 2O4MA 4WLCA 4EF8A 1YPFA 4CNNA 1TPC1 4WHBA 4HNUA 4C6EA 4Y9MA 1XD0A 1VYPX 2XIQA 5E9XA 1WOBA 3DHUA 1QNPA 1E1CA 3LERA 3ZSSA 1S5WA 2GSHA 4DLMA 1UP3A 1XBXA 3R0UA 1KWGA 3CTLA 1VIZA 4JTEA 4D1IA 3EOEA 3F4CA 3IK4A 5H6HA 3G3DA 3PBMA 4IQJA 1BWVA 3AXXA 4CN1A 3U7BA 1FXPA 4PUDA 4WUIA 1PEZA 3AYSA 2FZ8A 3B40A 1PX4A 1RV8A 4I5UA 2Z2UA 4W5UA 5LHFA 2POTA 3C0JA 1RQBA 2QKFA 4J2MA 2R1MA 1CIUA 3C3UA 1V93A 1TIMA 4OT7A 3N17A 5CZKA 3N04A 7TAAA 2Y85A 2ZOXA 2VYOA 1DWIM 1H1YA 1TPDA 2PDYA 2VCBA 4FR1A 3VK5A 4IPJA 3UJRA 1RA0A 1UWSA 2FTWA 1J96A 5REQA 1JAKA 4UOJA 2YW4A 4PTMA 4PUJA 2BOFX 3C0QA 4D6GA 5MKGA 3AJXA 3GC2A 1YTEA 1OT1A 1GOOA 4TUFA 3N14A 3L65A 3OA5A 4IPLA 2C1HA 2NT1A 3GLCA 5LXEA 1IHIA 4CU7A 1A0EA 3KOXA 3ATYA 3L21A 1VBJA 3F4DA 1H09A 5EFDA 3M9YA 1V02E 1OGBA 2WOQA 2NX9A 4Z0SA 1A5NC 3T09A 3GH7A 1ONRA 5D9NA 3MSYA 3U57A 3EMZA 4RE0A 4JHOA 3DFQA 2BVDA 5AY7A 2AQWA 3UD6A 5AHFA 2PSNA 4L9ZA 4GH3A 3VXGA 2QUTA 4Z1YA 3N29A 4C6CA 3B03A 3SSZA 3UPWA 1UKOA 1KLZA 2YYTA 1ZRQA 3W7OA 3AHYA 3LHYA 4WOQA 4D6FA 3INPA 3VIFA 2F6XA 2Z4GA 3UVAA 4DWSB 2G41A 3WFLA 4LW7A 5I07A 4QXIA 3U2ZA 3P8IA 5G4WA 3WUGA 5C9UA 3L4YA 3MUCA 1V51A 2E9BA 5HATA 3VIMA 1TR9A 1A5OC 3VU2A 1JNDA 2QDGA 3VX0A 4ZVJA 1SU5A 2W9MA 1JPDX 2YBVA 1H5VA 7REQA 1V0NA 3L4ZA 2C16A 2W66A 1M01A 4UFHA 4N9CA 4ZO7A 4GOAA 4R88A 3A24A 3QW3A 4NX5A 5CGQA 1QK0A 2W4XA 3SO7A 4ROPA 3M0ZA 3KVMA 3D6NA 3R4IA 1HP5A 3AYTA 5JIWA 1QRQA 3BOLA 3THDA 1Q4WA 1M03A 5HDRA 4NX0A 1HG3A 4UTWC 3EWWA 3G2GA 9XIMA 4AX7A 3QHNA 1P0DA 4V28A 2ZX8A 2DVTA 1FQ0A 3KAOA 1V6VA 1XDJA 3QRHA 3H4XA 4Q6JA 1EC9A 2OODA 4GVHA 1QI0A 1P5BA 1UPPA 1A47A 2HVNA 3OLGA 3RDKA 1F9CA 2MUCA 4R53A 2RDXA 3ZOAA 3K13A 3WCZA 3U48A 2A5HA 4MJ4A 4BI7A 2VX5A 1IT0A 4F0SA 1V8EA 1FH9A 1A5MC 2ACQA 3RAOA 2WNZA 4MADA 2J7CA 3BPWA 3N3MA 3ARZA 1XUZA 2YJQA 3UZXA 1JYXA 2XVGA 5AYZA 2P3EA 4UTWA 3PHAA 3FW6A 2NSXA 1MO0A 2DW7A 3N15A 3BSMA 3BW3A 5GQBA 2HE5A 5CPSA 3GFXA 2X05A 4JIPA 1GJPA 1TWDA 2BTMA 3AISA 3SAZA 4DAFA 1RQEA 1EJ7L 4MF4A 3A3WA 4RXGA 1KXVA 1KB3A 4H9YA 2X1IA 1S1RA 3JR2A 3BCJA 1P6WA 1X7FA 3FX4A 3GHTA 1NOWA 1JF6A 2QGHA 4JZ5A 1V0KA 2CLPA 1WV2A 1RLCL 3GC5A 4XAFA 3UXAA 1XICA 2V5LA 4J1OA 4HU3A 2CFFA 3PP7A 3WK2A 1H63A 4MZ1A 3BH4A 1V08A 2JIEA 3TR9A 3MC5A 3CQKA 5M17A 4OUEA 1R5YA 5A8QA 4ZFCA 2VRKA 2PC8A 3HGSA 3OOQA 2WVUA 4W7VA 3EMCA 4D72A 3WZ0E 3FK4A 4F9DA 4DELA 3RO8A 2AKMA 4ERAA 4HPJA 2D2HA 4EXAA 4FMVA 4H1ZA 4DWSA 1M53A 2CLMA 2WJZA 4K8EA 4LXFA 4R85A 3I4EA 4HA0A 4H00A 1MRQA 3CAKA 4RK8A 3DGRA 4M80A 3WQCA 1ZP4A 2Y88A 4HB7A 3I10A 1S2UA 2Z25A 2J25A 1EOMA 1TQJA 6A3HA 4HOZA 4RX0A 1J0YA 3N19B 3PFMA 1W9PA 1D3GA 4ZA0A 1SFTA 1OK6A 2PWVA 1VQTA 4C6BA 1XYMA 3GHSA 1LG1A 2Q01A 1RPXA 4JY9A 1ISWA 3A6OA 1WBHA 4OWGA 4XZMX 1I8JA 1E4IA 1B3VA 1E4NA 3ALFA 1LBLA 3KX6A 5D30A 4MY1A 3KRBA 2BY0A 2QJHA 4JHZA 2ZDSA 1K6AA 1EEXA 4Q4PA 3EX1A 4CLMA 3QHOA 4Q8MA 3IJ7A 5TIMA 1LT7A 1LJYA 5H8PA 1HT6A 2YBUA 1VIWA 2PFHA 3DU0A 1QW8A 1EWEA 1P0BA 3QZEA 1D3CA 1SM9A 5CG0A 1UOKA 1OCQA 2PS2A 1T8XA 3WLNA 4KWOA 3NZ1A 4M7SA 5LIWX 3MDWA 3L5LA 3HM7A 5FSDC 3PZGA 1NWRA 2NWRA 4ATLA 2ICSA 1F4AA 3V75A 3WQOA 4JKMA 4F66A 2BVTA 2FVKA 4HNOA 4J3TA 3WH8A 2QDHA 4CD7A 1XR2A 3EEGA 3NQDA 4GUJA 3QR0A 2D2GA 5TNVA 3RCMA 1U5HA 4JS3A 2YCKX 2JALA 3LCLA 4HMCA 4PRTA 3M0HA 1TA3B 4LUIA 3NQGA 4R7WA 1KGXA 2QVNA 2VCAA 2PDUA 5D8WA 2OYLA 4KCTA 1GORA 1W1PA 1DQWA 2WM1A 1E4LA 3E2RA 4JTLA 1TWZA 4LPCA 2WKGA 1LUCB 3LS9A 2HISA 1A49A 2O7QA 3KP1A 8XIAA 3I68A 4LNCA 2DT3A 3U9IA 5A94A 4L1GA 4UTUA 4FSAA 3HZ3A 3NSNA 1OZQA 4DM2A 3EX3A 2QJGA 1Q63A 4Q8WA 3MMDA 4MDOA 3QQ1A 5AVNA 2QJJA 4C6QA 2ZQ0A 5FJJA 2FZDA 4PRWA 3W7QA 1BVNP 3FNDA 5CZTA 1K7EA 2XIBA 2CCRA 3W37A 1JUBA 1S2VA 3A4XA 4IIHA 4PTWA 3SUUA 5FAJA 1A4LA 3ITCA 1C91A 4MY8A 1KTBA 3P74A 3I7QA 2ZRVA 4C6OA 1AK5A 3KBJA 2VVSA 1H51A 3OIXA 4P7NA 3WF2A 5BU6A 4M8UA 2CYGA 4XZLX 1H7WA 3WBEA 4C6PA 1RJRA 4D1JA 3KRUA 3QJAA 1OC5A 4GVGA 3URQA 4JIRA 3C56A 2J7GA 2W67A 5K9CA 3K8KA 1V4YA 1W3TA 2W0UA 3R8HA 4F2BA 3GKFA 4LYQA 1G0CA 4KERA 2DIJA 2ZTKA 1R3SA 3S8HA 3BQ6A 3GR7A 3EWBX 5HWJA 1J2WA 4NNCA 1HGYA 3WH9A 2JGYA 2ZRXA 3DFNA 4AHPA 1K7FA 3VFCA 3D3FA 4ICCX 3DI0A 3IJDA 4J3SA 3DFSA 3BMXA 3SB0A 5K4ZA 4LTSA 3OZMA 2R9RA 3BMWA 1XD1A 2P5NA 5K9XA 1KWKA 2EEXA 1VR6A 3A9IA 5IOBA 4IMAA 3CHCA 2QUMA 4XZIA 2Y5SA 4B3LA 1XISA 3BAIA 3P81A 4AMCA 4ZGYA 1FCVA 4DI9A 2X16A 3RRAA 2P8CA 3QSRA 5DCBA 3P80A 3ES8A 1D8CA 3P7YA 1X6NA 1PX3A 5CLWA 1D3HA 1W1B1 3EA1A 4GXWA 3MI6A 4YL2A 1XLJA 1HL8A 4C5ZA 3JW7A 2BOEX 3WDQA 1EGMA 3V1HA 4GISA 3HMJG 3AFBA 3RYSA 3T4CA 1FWCC 5BXSA 1TA3A 4B5TA 3G1SA 3LGDA 3LI0A 3A5FA 5MHBA 4N2YA 3W81A 5CPOA 4JN6A 3WQ4A 3W7IA 4ZO9A 4GFIA 4ILSA 5EMLA 3UZJA 1UPMB 4JTTA 3Q67A 1TE6A 4PCSA 2NSOA 5KZMA 4AWSA 3T2QA 4LGXA 4QLLA 1VJZA 2DV0A 4JIQA 4DEFA 3D0CA 3REQA 3KW3A 3P93A 2PMQA 3H23A 1O60A 4MNLA 5A8MA 1LCOA 3NQ2A 2DH3A 2E9MA 4TVDA 3PTDA 1HXJA 2PGWA 4XO7A 3GNNA 1W5OA 1I9CB 1SQ7A 4KQNA 2VHLA 2POZA 2PD9A 1UWAA 1BF6A 1QUMA 2ZZ3A 3KUMA 1KKOA 2OWXA 2PAJA 5C6MA 5D9MA 1E70M 4B16A 4Q33A 4YMZA 2DSUA 2WJFA 4JTQA 4KETA 3HB9A 1NWTA 2WC4A 5HJLA 1W9VA 1XYFA 2FMNA 3GG0A 4H6QA 1PKLA 3FXYA 1DJIA 4NILA 2I17A 4AHQA 4MFEA 4JD4A 1WDDA 3RPDA 4DO6A 4K8GA 2RAGA 1PS9A 5C7VA 4CN6A 3AXHA 5A8OA 3T9PA 1EZWA 3A3XA 3RLGA 3QGKC 4FNUA 3UY7A 3SCWA 1PX8A 1UIOA 3RM8A 1A5UA 5EYWA 1R86A 3NZQA 1EGVA 3TN6A 2NV2A 3ITYA 1OD8A 1UH2A 2QCDB 3PBYA 2EG8A 3WEZA 2QAPA 1VF8A 4HA1A 3OO2A 1I1XA 2NX3A 4CEUC 3R43A 5DBTA 5T26A 4E6MA 3S5YA 4M0XA 4WKHA 4WDXA 1KFWA 3LPFA 2MNRA 2JE8A 3C61A 2CHRA 3RR4A 1F07A 3GVQA 1GZGA 3LSBA 4O14A 2ZRWA 1H5YA 2CLIA 3VIHA 4FF5A 1KM3A 3NQAA 3VO0A 3QY7A 1UB3A 1S2TA 4YVVA 1PBGA 3N73A 1Y5WA 3FA4A 5AKQA 2GFTA 4BF9A 3UQNA 2HTMA 5A95A 3T6CA 2Q09A 1NF7A 5DCDA 3CK5A 3QSTA 2XIMA 1M7OA 4UOQA 3MJYA 5EGRA 1HKMA 4OGZA 4LAUA 1OFBA 2DEPA 4JTAA 3WMSA 4AZGA 1ELSA 1JFHA 1IGSA 4XV0A 1JULA 2PODA 5IDIA 1Q5MA 3CV1A 2P8BA 3E2QA 4GC3A 2ZX9A 2YPIA 2ZIDA 4QAIA 3WLLA 1Y5VA 4FOJA 1UWUA 1ZU8A 1MWOA 3PJTA 3A23A 3K4AA 1E5JA 1W3JA 1TJ1A 3NDYA 1XBYA 1GYNA 3AMKA 1KBLA 4QE4A 4AF0B 4E8DA 3C2VA 2A0NA 3DG6A 4KMQA 4X61A 4X2PA 2WVTA 2WVVB 1POKA 5F4XA 2E4TA 5C9RA 3EX6A 4JGDA 3STCA 2BXYA 3MTWA 1VBRA 1PIFA 1WCGA 1KM0A 2WWCA 3PULA 3S6DA 1OJXA 3VPLA 5F2IA 5FACA 3NSXA 3V0TA 3RX3A 4LS1A 2FPTA 2JKEA 3LK6A 1QTWA 3KCLA 2ZX5A 3W22A 2E7FA 1DWJM 4FA3A 3F03K 3NXLA 1QPQA 3TYUA 1KCKA 2QXWA 4BF7A 5D32A 1FFRA 1OFQA 3NQ7A 4X9YA 1A5CA 2PDMA 4CQCA 2CLLA 4ZEPA 2H6RA 5CPNA 1E5NA 2BG5A 1FWNA 3QR1A 4XD4A 2HQAA 2J9XA 5JIPA 3T2OA 1GVSA 4IJBA 3IGSA 3ZJ8A 1VYRA 2J78A 3OEXA 2WVSA 1KBJA 2WXDM 1EWDA 3LPOA 4E2DA 4RZBA 5HMFA 1UD5A 2NVDA 3T07A 2Z6JA 3LGEA 3SCVA 4IIFA 3V4BA 4YJ5A 4S3CA 3QKEA 5HWMA 5C8BB 3O1NA 3BG5A 4H8NA 1W9UA 3MYOA 4W86A 2HJPA 1YDYA 4QITA 4RV8A 3QLDA 1EJTC 2QR6A 3LTYA 1UWTA 1PSCA 3KDOA 3GVGA 3VNZA 1RVGA 2E9LA 3OVGA 1I2RA 3MQTA 2VFHA 1BYCA 5I3IA 2ZICA 2AL2A 4U10A 3ZR4A 2XISA 2WWDA 2PWEA 4AIUA 4E2OA 1ZQ5A 3FYOA 3L2LA 1SGJA 2CLEA 5JBEA 5IFTA 1P7TA 2J9YA 4M1BA 2AL1A 4UR9A 3E0LA 1JZ3A 1L8PA 1BLIA 5I77A 4NJJA 1KFEA 4Q4QA 5KZ6A 3DH7A 3R2GA 5AYBA 1HFBA 2DQXA 1A0DA 3S1VA 2P10A 3B3DA 4GCAA 4PMVA 4H6EA 1W3KA 2OQHA 1LWHA 3URNA 1ICPA 1GTHA 4DJFC 1X96A 3UR8A 4PMDA 4ZSTA 1IT7A 1O12A 4QFUA 3P5ZA 4LY4A 1KV5A 2PBOA 4LS0A 1BXNA 2J6VA 3E38A 2OGYA 1W9DM 3GZAA 3M0KA 1EEPA 3URAA 1RH9A 3QQ0A 4AF0A 1UKPA 2WK2A 2X09A 4NI8A 1KBBA 4V15A 1H50A 2VWSA 2Y8UA 3ZT6A 4PFHA 4HZ8A 2FGZA 3AMLA 5M3WA 2WVVA 4B2DD 1XFBA 1PZ3A 1R3QA 2E09A 4PUKA 4S2BA 2PGEA 1LORA 5HJXA 1VFHA 1FWRA 4XAPA 3W82A 4RPPA 1IF2A 1UASA 4MWAC 3IGXA 4I5XA 3GUWA 1M7PA 4DUVA 1EO5A 4F48A 1CXHA 3B9OA 3ARRA 1X8FA 1IR1A 2WHMA 1LF1A 3VTRA 3GTIA 1UH3A 1WQ5A 2ZZ5A 1HX0A 3TOYA 1W54A 4DPQA 2PDWA 4HT3A 3NNTA 3MDUA 1W3NA 4AC1X 2F7FA 5I00A 4IICA 1H60A 3STFA 3GK0A 3P2VA 2X1SA 4Z2JA 2VM8A 1CWYA 1CX9A 2P0IA 5B7ZA 4DBWA 2R24A 4TVCA 2ZUVA 5CSSA 3IPWA 2VDGA 3TYEA 1VH7A 4NNAA 2OO0A 1M6JA 3UA3A 3ZLGA 4ZE4A 2VD9A 3NO3A 4U2ZA 3QGAC 3S9YA 3NA8A 4G5DA 2HRWA 1CZ1A 1Q4NX 3QEZA 3VD5A 1DXFA 3LLXA 3W07A 3H55A 4G6CA 4Y9NA 5GNXA 1B54A 3H8AA 1AH0A 4PMZA 4H9VA 3EWXA 4IIDA 3TSMA 1SJAA 1YPXA 4EPBC 3QMRA 4PL1A 4X9SA 1UIPA 1SW7A 4MJZA 4QG8A 3M0MA 2WW5A 4ZENA 1LLWA 1V77A 2FHFA 5E70A 2Y7EA 2ZC8A 2WSKA 2YA0A 4RZ6A 4DBSA 4CKQA 1W5MA 3EB4A 3GW0A 1XCFA 1WPCA 5KITA 1FWDC 1LOQA 4IP4A 4S3BA 1JEZA 1YTDA 1OCBA 1E6ZA 3PUEA 5BNKA 3V5CA 2XSXA 4C6LA 1JCJA 3SUSA 4PMJA 2OGJA 3M7WA 2VKZG 3WMLA 3AHZA 2OG9A 2Y24A 3OODA 4IJRA 3FLUA 4GY1A 1NQKA 3GSMA 1C8VA 3NOYA 1NEYA 1FA2A 4O50A 2ACSA 3BGGA 1J01A 3UGVA 6TIMA 3C52A 1G9HA 1EJUC 5G1YA 3BG9A 3B4YA 3HG5A 2A7NA 4J2PA 3TLLA 3MVTA 3THQA 4IIBA 1EF2A 5HK4A 2Z26A 1GVFA 4IGNA 1L6YA 4DJED 1HTIA 2B4GA 2HBVA 3LHUA 1QO2A 1EOKA 3W24A 3LHVA 4KFPA 4JX5A 3IIZA 2X41A 4L80A 2WSYA 3VKJA 4BJHA 3M41A 3KWXA 4GA8A 1U2YA 1O94A 1H7NA 1ZBCA 3NEHA 2D24A 4MDPA 4BWLC 3ABXA 2QNEA 1Z41A 2Y7FA 3T08A 2XHYA 4GBDA 2QPSA 1UD6A 3PJXA 4WR3A 2ATMA 1SMDA 3VOCA 3TVAA 3CHDA 1W1A1 2NLYA 1TIWA 3TJLA 4KBXA 1VENA 2A3EA 3IIXA 1V3MA 3O3RA 3GAKA 3N4FA 2GJNA 1X6UA 4I8YA 2OZ8A 3TKFA 4WEVX 5HPCA 2QZRA 1HJWA 4IWWA 3S1UA 2AGTA 4A8RA 2Z0IA 2J66A 1WUFA 4ZE5A 4W85A 1WOAA 2DZXA 3ARSA 3NL5A 1LL4A 4HMEA 1I2PA 1EYWA 2CBVA 1EJRC 2A3LA 3FAWA 5EBAA 3S83A 4JIEA 1ZHAA 4HU4A 4A8IA 5CC5A 4PTVA 4IGSA 3EB3A 2A2IA 5CLTA 5BOFA 1TTQA 2QJIA 3DC8A 4LEFA 2QCFA 4EE9A 3BSGA 4YVXA 1E15A 3G77A 1U1JA 1LBFA 3LCFA 1DP0A 1OFAA 3SZ8A 3CLMA 1BYAA 1YIXA 1H7XA 1F3TA 2HS6A 2XSBA 3LD5A 4AEFA 2BVYA 2JK2A 3RIKA 2PPGA 2PU1A 5RUBA 3QPEA 2P53A 4GCXA 2C91A 3VILA 1UG6A 4MB5A 1C7TA 3VX1A 3SUTA 3KVJA 4HYWA 3WYZA 2GQ3A 2V81A 2OFJA 4AZCB 3FJ6A 2VFFA 3AIWA 5CGTA 3POCA 4QRNA 1CEOA 3SCRA 4CNTA 3GNOA 3NGFA 3LLDA 1FKXA 1TVLA 3QTGA 3O6AA 4ACZB 2C14A 4L64A 4XD3A 3NO5A 3NIYA 1VHNA 4CD8A 4PE8A 2PA6A 3TE9A 1JDDA 3TYAA 4E3TA 5E0FA 1VFLA 3S47A 3TUUA 2VOTA 1B2YA 4UB9A 3UZWA 5EKYA 1OK4A 2HZGA 3MP3A 2VWTA 2V68A 4F0RA 1IWPA 3YPIA 5XIAA 4DJDD 2EJAA 1XBZA 3SQMA 3EGJA 4GQBA 2QMJA 1GJWA 5D09A 4LOCA 3CZJA 2R14A 4MB3A 1B4KA 4QJ5B 4JTFA 3NPWA 2D69A 3W7KA 3B0VC 1H0IA 1RR2A 4A35A 5LNWA 2TPSA 2ZWYA 4OBSA 3PG9A 4B91A 5JBFA 1QOXA 1RP9A 3CUHA 4BEUA 3EDJA 3U6WA 4ES4A 1YQ2A 4ZQPA 5JXQA 3I6TA 4UQBA 1EA9C 1RP8A 3E6EA 4R3UA 2X1UA 1U83A 1Q2RA 1W31A 4J27A 3FKRA 2WMKA 1JD9A 2C15A 3GFZA 3A9BA 2E25A 1B9BA 4XAZA 2FQIA 3STGA 3P8JA 3WH7A 2DZBA 5XINA 2O55A 4DYEA 1YBQB 4XSMA 1HUVA 2O92A 2Q8ZA 1BG9A 3HFYA 4O11A 4H9MA 4PMRA 2IKIA 2X7WA 1QAPA 4RNJA 3JUGA 3CZEA 3PF3A 1R7AA 1JL8A 1IEQA 1L6FA 2G4FA 1NDYA 4UCGA 3UP8A 3TAKA 4TVUA 1UC5A 3FJNA 1ALDA 3SCUA 4BI6A 4PMUA 4H9XA 1XLBA 4RE2A 3O06A 2GQAA 4RZ5A 3H21A 3ARXA 3DESA 3B97A 3GR4A 3DEQA 3WELA 4O13A 4YTSA 4B3KA 1XV8A 3RCYA 3N9SA 3GG1A 1XIDA 3EOUA 3LY0A 3UYCA 3CAQA 3E2SA 2E77A 4E4FA 1JZ8A 1ZBKA 3WFAA 4RE3A 5LIUX 4AUBA 3LXCA 1GG1A 3WD1A 4X22A 1US3A 1DJNA 1QOPA 4ZTXA 1JDCA 3SY8A 4XAYA 4L1WA 3WJSA 2CW6A 5J5RA 4UWMA 4OE7A 1QPOA 2V5BA 1YX1A 3LG3A 3SADA 1WBJA 1V03A 4B4FA 4E38A 4U4MA 3L66A 5CBJA 2VEMA 1DOSA 3T42A 1C92A 4AZCA 1FHUA 1XQLA 4U3CA 3S6OA 4B5VA 3N2BA 2WNQA 3GIYA 2OELA 3GR8A 4O8AA 4B92A 5EMKA 1RA5A 5TF0A 4NZJA 3BZJA 4HNVA 2BDQA 1MEHA 3UEQA 4ACZA 2X2GA 4MNMA 3B9EA 3N6JA 1XRTA 4X2RA 3NL6A 5BROA 4KGJA 2YXOA 5GVJA 5DMLA 4IIEA 1JDAA 3CZGA 4LUJA 4FNRA 5BRQA 3GC4A 5CZJA 4Q32A 1TQXA 1TWWA 3NVDA 4O54A 4W4QA 2BLEA 2J8FA 1DJWA 4I90A 1ZJAA 3OHIA 4L6OA 4UOZA 2IKHA 2Z24A 4YIWA 1E6NA 3GNDA 1K9EA 5CAHA 4QP0A 3GH4A 1WA3A 3TQVA 1W0MA 2VFEA 1OG0A 2VI0A 4LUTA 1FWGC 1XGZA 4O4WA 2GDUA 1B57A 2PTDA 2EBNA 2YA2A 2YXXA 4GZIA 4F0MA 1Y7VA 5EPDA 3RK8A 4IGHA 2CWNA 2PTWA 3C2OA 2EPNA 1MZRA 1PIIA 2ZXQA 3LU2A 8XIMA 4IGMA 1FY6A 1QXLA 3HPAA 5CJMA 4REQB 2F9RA 3AS2A 2DVUA 2TAAA 1E0VA 4RDVA 3VKAA 2VOMA 3EDKA 4CQAA 1ZNNA 3B8UA 4AEOA 1H1NA 1OGGA 3ALGA 1L9WA 1XGEA 2GDQA 3FDGA 1PTAA 2IQ0A 4DF2A 1N2VA 4WX2A 1EJVC 4PMXA 1XIIA 1FWFC 3IUHA 1XLMA 2VNCA 3B0UX 1VC4A 1Z89A 4Q8QA 4GY0A 9XIAA 7ODCA 3DG7A 3KTSA 3MMUA 4PR4A 3VINA 3D46A 4KCWA 4ROQA 2PB1A 1MNSA 3BJFA 3U5UA 4HVXA 3SJ3A 3WLQA 2PDHA 1TV4A 3IJ9A 4FXJA 1RCQA 3CZ8A 3W1QA 1V6UA 1UZDA 2O9RA 4FPSA 1TJ0A 3H53A 4IUGA 1K9FA 4JNZA 4INFA 2VENA 1GEQA 1EZ2A 3VMNA 1XIGA 2GOKA 1BEUA 2PLCA 4HZ7A 1W3IA 2J79A 4ZL1A 3C2EA 3BCFA 4DBUA 1A4MA 3EWUA 3C3NA 1V0MA 5LYRA 3UG3A 1ZPTA 3NSMA 4GHRA 3H7RA 1ITCA 4JAWA 5C2CA 4GKTA 1ZTVA 4WIWA 4AZ5A 4AY1A 3ZS4A 2PEVA 3K46A 4GKLA 5IHRA 3RRXA 4S1FA 4Y8FA 3PTKA 1KFJA 5FESA 4GJJA 3CMJA 4POCA 5AC8A 3T2PA 1YHTA 3CUXA 3P5YA 1E1FA 1ISYA 5F4WA 2YGYA 6ENLA 3A64A 1RLDA 4UZSA 1NQ6A 4JNYA 4WJ8A 4DB7A 3CV7A 4GIYA 1W1IE 1KXTA 1KM5A 3S5SA 2VEPA 4ML4A 2XWDA 2GQ8A 3QH2A 1IT8A 5DRCA 1UKTA 2XGIA 3UWUA 4HHMA 3EKGA 4GLEA 3BJSA 2I16A 3O9NA 1VFFA 3BOFA 2CITA 2UY5A 4UMBA 4YTUA 5I3JA 2C1IA 4US5D 3CNYA 4AWEA 1OF6A 4TMBA 3PPHA 2WANA 1H41A 3IAQA 2C79A 1JPMA 1V3LA 2BY1A 2GK1B 5JBDA 4ZXOA 5H1WA 3MZNA 3IJLA 4CNOA 4PN2A 3ABZA 1YNQA 2FZ9A 2Y7GA 5C54A 5LGXA 2WC3A 5HJYA 2Z27A 4FK9A 3NURA 3ANUA 4B4HA 4KRZA 3VAVA 1JI1A 1VHCA 3QMSA 3EWDA 2JBMA 4GG9A 2BP1A 1ICSA 4WF7A 4S3JA 1XKYA 2QCLA 1OGSA 3OQEA 1N8IA 3ZJ6A 1JCLA 2G0WA 3Q2DA 2PZ0A 2D1ZA 1H7OA 1OVDA 2V3GA 4MVAA 3MP4A 4IL2A 3NZRA 1GZJA 2ZRYA 2J47A 3VCRA 1LP6A 3T05A 2ZFAA 4QLJA 4XB3A 1PUDA 3P61A 1RQHA 3URBA 3CUGA 4RXFA 1XPYA 3QZAA 3S46A 2W6RA 3QF0A 3TN4A 4JL2A 4PH6A 1Q8JA 1PB0A 1ODUA 1P1MA 4ZMGA 2JQXA 3A22A 4YHEA 5HPOA 3WQVA 2OSYA 2H8ZA 3TTYA 1E55A 5EMUA 4K36A 3RU6A 4F9JA 3A21A 3PY2A 1BXBA 1B90A 3QKZA 1YXCA 5CEWA 2X42A 2GOUA 3QXBA 4AFYA 1W1YA 1TJPA 4O1FA 2WBGA 3DHPA 4YLWA 3T0CA 2Z1WA 4KEMA 1E40A 3S2NA 3PVFA 4DQWA 3UA4A 3PBVA 3D5HA 4W8BA 4A3UA 4K1WA 4FO4A 1QNSA 4HA4A 2I1OA 3M0IA 3AMDA 2RGMA 3KE0A 3F2DA 3BSHA 2XZ9A 2CBUA 2WNNA 3B9AA 2NVCA 4QLKA 1EDTA 2PP0A 3VIKA 5KSWA 3PZ9A 3OP2A 4PMOA 4JFUA 2J13A 4JTGA 1TYGA 1P6BA 2QYGA 3A3HA 2DFAA 2I5GA 4KGLA 1M65A 2ZXAA 1LM1A 6PTDA 1BHGA 4H8HA 1BKHA 2VR5A 1XHGA 3H12A 4EXBA 1IXNA 2WMFA 3VCCA 3R58A 4F8XA 2ZUWA 1W2PA 3W7JA 2BWGA 3CXOA 4TTUA 4AY7A 3TP4A 2PI6A 3CASA 3SSJA 1B31A 3VDBA 3ZIZA 3N4EA 1I2QA 1EB3A 1KO0A 3RMEA 3T4WA 2OZ0A 1VP5A 2GWNA 1SW3A 4EPKA 1H2JA 4LALA 4A8NA 3O0KA 2ZVIA 3WN6A 2WHJA 4CQ9A 4JTJA 3MHFA 4MGGA 3GDRA 4PFMA 2P1FA 3P60A 2HV5A 3VD3A 3NQFA 2WZEA 3QC3A 1G7VA 3SJNA 5A8GA 4XIMA 5CAKA 2QUUA 3RNDA 3NQEA 4MB1A 1CXFA 1UC4A 1PHWA 3APTA 1Q6DA 4JIIX 1OQFA 5F1UA 3VZXA 1MZHA 3PBWA 1GGOA 1XLAA 1KGUA 4OIFA 2OPJA 5AC4A 3U7VA 1KRMA 1NOFA 1QO5A 1ISVA 3LN3A 1ZY9A 4IMGA 5T8GA 2D0GA 1Y0EA 4D6IA 8A3HA 3PK7A 4UQ9A 4LVGA 4GYPC 4JYDA 2INEA 4M29A 4G8TA 3O7UA 3NQVA 1VB9A 1FHDA 5I7GA 4ZB0A 2YXGA 5KEZA 5BXRA 1JYNA 1J6PA 4V27A 5KINA 3QY8A 3UJ2A 1YEYA 2G95A 1Z32X 1NARA 4H6KA 4QEHA 1RXOB 3DCPA 3W86A 1RY0A 5AC5A 1TFVA 1NOUA 1SPQA 3VGGA 3HU7A 2RGLA 1VRDA 1RD6A 2VXNA 4L56A 1XSJA 2WPBA 1JUKA 4IJCA 5TD4A 3UWWA 2F84A 1DBTA 1HJXA 3DBPA 3ZXWA 5CXPA 2XU2A 4FR6A 2Z1VA 2CXEA 4GYPA 1LQ0A 3HA1A 2WKLA 1HO1A 3S2LA 1E9ZB 1WDRA 3W2MA 1XF0A 4JQ2A 1BKSA 4Q4MA 1BYDA 3VOGA 4O1DA 2EKCA 3TFXA 2R1LA 2VEGA 3W85A 2GUUA 4AZHA 3GTHA 1TVPA 1P6CA 2NQLA 3BW4A 2XDFA 3BL3A 4QCEA 5EMJA 4XZWA 3W2JA 2DJLA 3UZ5A 4B5WA 4OOZA 1QCWA 4E0CA 5DY3A 1S5TA 2QDEA 5IBXA 2AAAA 4EAYA 3GNRA 3MUIA 3VGDA 3I6EA 2PF8A 5AZ1A 5CC3A 3W2UA 3N34A 3BANA 4I3GA 2BX7A 3GTFA 2C19A 4IXXA 1R9XA 1XINA 3R6IA 3W25A 3PM6A 4Z2KA 4GJIA 4OFCA 2PDJA 4Q8NA 1AMYA 1FWBC 1YLVA 3TCSA 1SVDA 2B81A 3ABOA 4ICMA 2YCLB 3ZJKA 4ZODA 1GQJA 1ZJBA 2ZE0A 3UJSA 2D20A 4W9TA 3FA5A 2YX0A 1SZNA 1JDEA 1S5VA 4J35A 4E3VA 4AYSA 1UYQA 3AXMA 2XGZA 2HXTA 3I65A 1F61A 4JN8A 4Z2GA 3TV8A 4EPEC 4CVUA 5BXPA 3NQBA 1D9EA 4Y96A 5FF7A 4A3HA 4IF2A 2NXHA 3HGOA 4HU0A 5DLCA 3FIGA 3GH5A 3FHQA 3GWQA 3DFOA 4QDWA 1OF8A 4OV4A 2I9UA 4O52A 3SBFA 2DIEA 3ZO9A 3KBWA 1WXJA 2DSWA 3UYIA 3P0WA 1DWGM 3Q45A 3L68A 1M9HA 1KRBC 3ZYZA 2VC5A 1AL8A 1X97A 4AYGA 5CPLA 1GYLA 1XIEA 4XUYA 5BOEA 1TPEA 2E0PA 3VABA 1VBUA 1CGVA 3MUXA 4A21A 4Z2HA 2QT3A 5AOUA 2BS9A 6XIAA 2GJRA 3S3GA 1QDSA 3DKLA 1W32A 1D8WA 2Z1XA 1DJYA 1PPIA 3Q4DA 2XGBA 2DUAA 4GZEA 3DKJA 4B2DA 1KV8A 2DT0A 2PGFA 2H9AA 3WJWA 4JQ3A 3TA6A 3IJ6A 3W1TA 1J10A 3KHDA 4NYUA 4Q7BA 2GVEA 2E68A 2BGQA 3LENA 4PUNA 1H0GA 1G01A 2BXZA 5FEWA 2J24A 3DENA 3R79A 3E2VA 1DORA 3GXNA 4JYFA 5D03A 1UR3M 4EVZA 1YYAA 4BQ2A 2Y8KA 3AIQA 1GZ1A 1IXQA 3M0XA 2G3FA 3N9KA 1RCOB 1UD2A 2IQDA 1KGWA 3WK1A 5J04A 2EF9A 3LSCA 3NFUA 3OW1A 5HWNA 1GOKA 4NAEA 3TC3A 3HTWA 4WQ6A 2ISDA 4MJ2A 3CV6A 3CU2A 2I57A 2ZDRA 3W3OA 4D8AA 3WNNA 2WLYA 2PC4A 4NRRA 4Q8VA 4OBTA 4GZ7A 3C6CA 1R9YA 2X1RA 2NZLA 4YWSA 3SN4A 2DZWA 1J18A 3EAUA 4WKFA 3PNUA 1J2BA 3CB8A 2PDIA 4DI8A 5CBBA 1GVRA 3MVIA 3GDMA 3NQMA 1BVZA 4NJIA 4EIVA 2VELA 5ENLA 3WNPA 1X38A 3A12A 3SRKA 2XVKA 3G0XA 4PTXA 4O18A 3MWCA 5C9WA 3GYCA 5G1MA 3E02A 3G8EA 2ZUTA 3Q58A 3WLKX 5C9ZA 3L67A 1LLOA 4GYFA 2R8WA 4L7ZA 4M6UA 2WNWA 2GPTA 4I9MA 2W91A 3RLUA 4NZ3A 4O4VA 2VZSA 2YW3A 1DEDA 4FNQA 3A5VA 2VO5A 1T0OA 4HNNA 4QM1A 3KOYA 5GPRA 4WJXA 1UROA 1IEXA 3BAKA 4WXYA 1DKWA 1L8NA 3P62A 1TPUA 4HZ6A 4P7RA 1QPNA 4K3ZA 2EG7A 5AHMA 1WDPA 1GJUA 2HBXA 3E0WA 3GXMA 2XM1A 3W38A 2XN2A 2IUZA 1NP0A 5DN1A 2GJPA 3E96A 1ME7A 2DUZA 2REQB 1Z44A 2YLLA 4DJEA 1PHQA 5EMYA 1UBSA 3OU8A 4F3HA 3S2JA 4M6VA 4MKVA 3H2OA 5DELA 3MO7A 5KZDA 4N9BA 4UTLA 2E1DA 4EP8C 3UESA 5HR6A 2DIKA 1P0EA 4O0KA 4MAZA 4NP7A 3SN0A 1JCYA 3IWPA 3VDHA 2CERA 3TC6A 5LZLA 1E1CB 2OEJA 3MMWA 1GWJA 3OGRA 1BVWA 3Q65A 5KETA 4ZB2A 2KZHA 3NPVA 2RDWA 4UR7A 5I5RA 3VDAA 1REQA 2NUXA 2GL5A 3H24A 3ZMRA 3DAQA 3GDLA 2VRJA 3N2CA 2BMBA 4H8UA 4DYKA 1GQNA 1Q13A 3CIXA 4ZQCA 4LFYA 4I9TA 2XVNA 2ZXBA 5GJNA 3ARUA 3CH0A 3WJZA 2I56A 2RKXA 2JKPA 1B0IA 1W9XA 1SO5A 5F2LA 3TNBA 4DXXA 3W7GA 3N2OA 2FTYA 2PDFA 1J0JA 2PRHA 2QUNA 3USZA 3IIPA 2G4JA 2G50A 4XVDA 3BLFA 4YN5A 1MUWA 3UJEA 1JCXA 5E5CA 3HFTA 2OX1A 3TW6A 3S2CA 3NJ3A 3WBYA 3AXKA 1H61A 1MVYA 4S38A 5I23A 4DJDC 3LI1A 1Q45A 1AD1A 4H7VA 1L0PA 2VTFA 3LCHA 2OEKA 1TKKA 3MUZ1 2ESCA 3HQ1A 3W0KA 5JMUA 1TPB1 3L4XA 4TV5A 3L4TA 1GTEA 1B3YA 5LHEA 2A7PA 4XK2A 3TDFA 4ADTA 3FFSA 3KTCA 2XYLA 1E9IA 4LRSA 3ZQ9A 1LQAA 3LRMA 3W1UA 2FGLA 1HVXA 3AIUA 3H22A 2E5CA 1DE6A 2NT0A 1TTIA 3KWSA 3LGGA 3G18A 5DT5A 4DJFD 1LRTA 3H2CA 4NSBA 4LUYA 1Q6GA 4KH2A 4IQLA 3LCGA 4A8LA 2VL4A 3TQ0A 1JZ5A 3MANA 4ZOEA 1ONEA 1YTKA 4DJDA 3BE7A 5EA9A 4CQ8A 3CC1A 2J7HA 3AUJA 4GINA 4S23A 4URIA 3GBEA 1NFPA 2VUNA 4NUWA 2WB5A 3ARQA 4L65A 5LGZA 2YKKA 4H9UA 3WF1A 3G1FA 1L6SA 1V3KA 3LMZA 1E0XA 5ABHA 4ASTA 7REQB 1EQPA 4GYJA 3P3BA 2GWGA 4ERIA 1BQGA 1WZMA 4US6A 1KQYA 3HBLA 4O19A 5CCZA 1TPVA 1W1VA 4MWAD 1V6XA 1A5LC 3ZJ7A 4BA0A 3FXGA 3T1GA 1WAWA 1UR2A 3QYQA 4UTKA 1ZFJA 4NZ5A 3BK0A 1TX2A 2EJ1A 3V18A 4GD0A 4D71A 4MM1A 1FWTA 3MI3A 4GABA 4QGCA 4C5YA 4IFKB 4EKJA 2CNCA 3XISA 2UV8G 3PTQA 4QG6A 2FDSA 2OO6A 1U5JA 2DZTA 1TZ7A 4JDBA 2TSYA 1NVMA 2OYKA 3GXFA 3IK2A 2WO5A 4GUHA 3RGTA 3W2KA 4UFJA 4L9XA 2RDUA 4E2VA 1S2AA 1ZAHA 2V67A 3VGBA 5G2HA 3KZSA 4PB4A 3PZUA 3A4WA 3ITLA 2WMJA 1OYBA 3UG8A 2C6QA 2B0MA 1GPWA 2BHYA 4ZBCA 4X0VA 5M2FX 3TC7A 5A2AA 1ENUA 4TQTA 3THAA 3DYOA 3OG2A 4PBFA 1XLCA 1V6YA 3W88A 5LSMA 3W7RA 1NDWA 4JFVA 3HG3A 1SUXA 3HQOA 2PE4A 4J4KA 2Y1HA 4XIAA 2EPOA 3BDKA 5CKSA 1GONA 2YDAA 5KZEA 4UTFA 2XH7A 2F38A 4IIGA 4FXSA 1W2VA 2Q8XA 1MFVA 1O66A 4JQ4A 1IWAA 4DWDA 4WXZA 4O17A 1SZFA 3GVRA 1JCNA 4W89A 1TVNA 1GK8A 2NQHA 4O10A 2C7FA 1AG1O 1KRAC 2X40A 4S39A 4ZOAA 1E9YB 2Z29A 1NWSA 2R6OA 3NQCA 3IVUA 3V5OA 4BQ5A 1RD5A 2D23A 5JH1A 3WBXA 1Q6RA 2QV5A 3FAXA 4ECLA 3RFAA 3QMTA 1DL3A 2QS8A 2Z2BA 1FWSA 2F6UA 4IG2B 2INFA 5IFPA 4L4LA 4QDPA 3N11A 1G67A 1J6OA 4OHQA 2P0OA 1TSIA 2D22A 1PJ9A 3MWAA 3OA3A 2BBFA 1EP1A 2C8NA 2NXIA 3UWVA 5HR7A 1LWIA 4OBRA 3QV8A 3GM8A 3UERA 4C1LA 5C7HA 2FB3A 2YYUA 3LCXA 1QASA 2Z1BA 3QFEA 1KBKA 3WLJA 1B5TA 1PKNA 4M56A 2OT0A 4DNHA 5JQ9A 2WZIA 3DN5A 4LX4A 2CWXA