2PRHA

The structures of apo- and inhibitor bound human dihydroorotate dehydrogenase reveal conformational flexibility within the inhibitor binding site
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
367
structure length
358
Chain Sequence
MATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title The structures of human dihydroorotate dehydrogenase with and without inhibitor reveal conformational flexibility in the inhibitor and substrate binding sites
pubmed doi rcsb
source organism Homo sapiens
total genus 135
structure length 358
sequence length 367
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2prhA00
1L6YA 3M6YA 1KM0A 3Q2DA 1ME9A 5C54A 2QF7A 1SZGA 3NA8A 1SO3A 1Z44A 3G8RA 3K30A 1A5BA 5AHMA 4DO6A 5K2ZA 1OF8A 1FWTA 4JNMA 3M43A 4QNEA 3RF9A 3BW4A 4WJEA 5LNVA 4LOCA 4WY0B 4LRTA 3S9YA 3EB2A 3W75A 2VEIA 3HPXA 4J9JA 1TRIA 3UNDA 4H3DA 1LCOA 2ZRXA 4UNKA 5F4SA 1GVFA 4LRSA 2ZDRA 2YZRA 1UJPA 1ZCOA 2QCGA 1TCDA 4BFAA 3C6CA 4CQ9A 3S6DA 1CW2A 4RZ4A 2OCZA 1Q6RA 1KLZA 1Q6OA 3B8DA 5DXXA 3PSVA 3MP5A 1C29A 1DV7A 2V0TA 3BGGA 2B7PA 4O12A 4Z1DA 3NPUA 4Z0JA 1LYXA 2NWRA 3DFNA 2ABBA 2Y6ZA 4NU7A 3W1PA 1X7FA 4HKPA 3QMTA 4HPXA 4O14A 3LCHA 5CPOA 5KTLA 1WOBA 1MZHA 4O17A 1OVDA 4UMBA 1W3NA 2E5BA 3M41A 1FCQA 1VJIA 2QUVA 3S0CA 2CFFA 1SU5A 3T44A 4AB4A 2EHHA 3DZ1A 4IMGA 4R34A 1LOSA 2C18A 3A5VA 5I3GA 5CSSA 1OX4B 3CIWA 4WY0A 1MSSA 1P0KA 4O53A 3W6YA 2CWNA 3PUEA 1ZHAA 3GB6A 3PAJA 6TIMA 2ZZ4A 1LOQA 3O05A 2C13A 3HMJG 4JTIA 4I7VA 1S5VA 1YTEA 1LRQA 2EGZA 4M5PA 1O4UA 2EPHA 4OHQA 3KRUA 5AC8A 3AJXA 3NDOA 1RQEA 3QSTA 3PUDA 3UWWA 1H63A 2H6RA 3LHWA 1OG0A 4QSHA 3QSRA 3TAOA 1V5XA 1P1XA 1YADA 4MFDA 3TK7A 1VLWA 1ME8A 3SZ8A 3FS2A 3VE7A 3QC3A 1TQXA 4X3ZA 2DU2A 3GAKA 4R7JA 3EWBX 4JY9A 1TMHA 1XUUA 1WBJA 2Y70A 4JX4A 1X6UA 1LZOA 3T40A 2YXGA 4OBTA 1K7EA 2E1DA 2ZQ0A 4JTSA 3W1UA 1Y0EA 3IVUA 2GJLA 1YDNA 3MHUA 4NJKA 3O07A 3CU2A 3DGRA 5AHIA 1DL3A 3IGXA 3QMRA 3FA5A 3W1MA 3TX9A 4NNCA 2WJZA 4GUHA 1KLYA 1SW0A 1TB3A 4I7WA 1Q45A 3HG3A 1SR9A 2JKEA 2NX9A 3W3OA 4NUWA 3TE9A 1O94A 3QH2A 3PB0A 1T0OA 2WOQA 3EWXA 4FF7A 4NNBA 3THAA 3W83A 4I7UA 1XM3A 1ZNNA 2EF9A 2F7FA 3NG3A 3G1DA 1L2UA 4PL2A 5E93A 3DHDA 1VC4A 2V8ZA 3NM3A 4JD4A 1FCUA 3W7PA 3PF3A 4OV4A 1OYAA 4JDYA 2NUYA 1AMKA 3C3NA 3KVLA 1PL9A 5LGXA 1ME7A 4UFMA 1I2QA 3W76A 1P0NA 4HSNA 4UFIA 3LHUA 2J6XA 3TMQA 4DXVA 1WV2A 4JTKA 5G4EA 3GR8A 1TJPA 3H55A 1G69A 5D04C 4E2BA 3G24A 1Z41A 3TNOA 3EXSA 1BTMA 3PUOA 3RU6A 3MWAA 4UTWC 3DI1A 3MUXA 2YW3A 4UUIA 2AGKA 4HIBA 4O10A 4MY9A 5DLCA 5D2TA 2JKPA 3G0SA 4LW7A 3B04A 4QIUA 3BG5A 3FJLA 3MBFA 4ZQRA 2V2CA 2DZXA 5LSMA 3NQEA 3LCXA 5G2WA 5L6UA 2ISVA 1OYCA 5I3HA 5CZJA 3N19B 5AOUA 1AK5A 3W2UA 2QR6A 3ZWSA 1T99A 4RZ5A 1QO5A 4GJ1A 4JX5A 2A0NA 3EX2A 1AW1A 3QRHA 2OMAA 1SFLA 3C52A 1TPDA 1NSJA 4AHOA 2Z0IA 3B4UA 3JRKA 2E6FA 2VELA 1VGAA 5C6MA 4O57A 5E1QA 1XDLA 5G5IA 1YXYA 4O1BA 3SR7A 4U4MA 4O15A 4FNPA 1SZFA 4R53A 3C2VA 2XFWA 3SI9A 3NAVA 1YDOA 3S1UA 5IBXC 5CZTA 1GWJA 5DY3A 1O60A 1I4NA 3G18A 4K8HA 4RZ6A 3W70A 2C3ZA 3P82A 1GVSA 1HL2A 3NQGA 4UXDA 5KMYA 3LDVA 1I2OA 5HUOA 5BNKA 4JYEA 5DXYA 2WV8A 5G4WA 4R33A 3E02A 1ML1A 2BWGA 4FNQA 1FQ0A 1ZAJA 2ZA2A 4A3UA 5DELA 3UWZA 3PR2A 1JJKA 5BMWA 4FNSA 2W79A 4PC8A 3DI0A 4N6EA 1YYAA 3MW7A 2QDGA 4BI5A 2QCMA 1W5OA 3W7DA 3GDKA 1KV8A 2YSWA 1M7OA 3GNDA 3M44A 1TTPA 4UMCA 3W2MA 3P5ZA 3I6RA 7TIMA 1SFJA 3W23A 2XN2A 2ATSA 3PB2A 3QFEA 3MO7A 5HWJA 2GQ8A 4XWUA 2CLEA 4N9CA 1VQTA 3EX4A 4LUIA 1A50A 4JICA 4OU1A 3W74A 5CGQA 1TV8A 1ICPA 1S5WA 1YTKA 4Q33A 2RDUA 4NX5A 4DEFA 1TV5A 5DCBA 5K7JA 1VYPX 3I7QA 3NQ2A 1LP6A 3CIXA 2E6AA 1J4EA 3H54A 4NJIA 3Q58A 1XFBA 3PS7A 3NGJA 5TBOA 5EMUA 2E5CA 4FO4A 1WXJA 3BW2A 3RLUA 3W7OA 2ZZ7A 3UPBA 1FDYA 3SY5A 2I1OA 1PV8A 2B7NA 1L9WA 4O0KA 3M5XA 4EIVA 2ZRWA 1GPWA 1LLWA 4ZQOA 3LRMA 3LBMA 2LLEA 5KZEA 2H8ZA 4QAIA 3W7MA 3EWYA 3L0NA 3ABRA 1YTDA 1B57A 4DF2A 4LUJA 3IVTA 4TMBA 3HPSA 3UZ5A 3ZS4A 1KBIA 3HGJA 2J9XA 4UTTC 4Y90A 4JX6A 3W84A 3Q37A 4QQ3A 4DPQA 2ZA3A 4TR9A 4A22A 1W3TA 2O7QA 6ALDA 4MYAA 2H3DA 3H53A 4NXSA 1JQXA 1MEWA 2QJHA 1QPRA 3FLUA 1XXXA 1N8FA 1WX0A 5FF4A 3SSJA 2A1YA 3E12A 5AYZA 3DKJA 3NL5A 1MEHA 2A7PA 4NJGA 3BG3A 1TJRA 1VCGA 4MY8A 4DBEA 2A7RA 4A29A 3BLEA 2DP3A 1XBXA 1XI3A 1QR7A 3DAQA 4JIPA 2A6NA 4Y6GA 2EAWA 3ABSA 1H61A 2QCDB 2Z2UA 4IOTA 2X2GA 2OT1A 4JTGA 1L6SA 3PVFA 5F2LA 3EKZA 1H7OA 4UFKA 4K7YA 4AHPA 1W54A 1NFBA 3F4WA 3CC1A 1IIHA 3N14A 4LC6A 1DKWA 3DFQA 3NQ7A 5TIMA 1JVNA 4LS2A 5FEZA 1JUBA 3RNDA 2Y7EA 2NX1A 1H51A 3EWWA 4O52A 2W0UA 3LTYA 1G4TA 4C1KA 1XBZA 4NZFA 3S5YA 3LHTA 3W2LA 4JTLA 3N2XA 1KFEA 3DFOA 5U4NA 3UYCA 4DF1A 1G67A 3N34A 4TU1A 2ABAA 5CSRA 4O54A 1F6KA 1VH7A 2HS6A 4Z08A 2A7NA 1VYSX 3SECA 1K7XA 3IGSA 1EPXA 1I8JA 3OBKA 1EWEA 1LBFA 3WJYA 2Q8ZA 3M5YA 2FLIA 2YCEA 3LRKA 3TROA 3WK0A 2NXGA 3N2MA 3WJZA 2JGQA 2QCDA 5AFDA 1ZJIA 4A21A 1DBTA 3NR0A 1G7VA 2ZFAA 1SO5A 3P8IA 5D02A 3W7RA 1RR2A 4CCCA 3LCLA 1C9DA 4QM1A 2V2DA 3OVRA 3A22A 3UY7A 2FJKA 5AYYA 2NXIA 3LCGA 5C55A 3TFXA 4DELA 3YPIA 1GOXA 3LCIA 4ZQPA 2WNQA 4LNYA 3M5VA 2QDHA 3O6YX 5F2IA 4KKXA 4BK9A 5A8GA 2A2IA 3STCA 3MYOA 4O4VA 1D3GA 2J27A 3QF0A 3C2FA 4RK8A 1GYNA 3W1TA 1DQXA 4XBSA 3LV6A 1H7PA 4N2YA 1HO1A 3W07A 4EF9A 2B0MA 1K02A 1DORA 4DO4A 4KFPA 4AWUA 5D2VA 5C5YA 4ZZ9A 3TMLA 1Q6QA 1EEPA 4AVFA 2ZRVA 2VFIA 5LNSA 4YWIA 3O6CA 1U5JA 3A23A 2GOUA 5K4XA 3IEBA 4UFLA 3VNDA 3P5YA 3HB9A 2A4AA 3NNTA 3DKLA 4JTHA 1EB3A 3TW6A 2VFFA 4CNPA 2CLLA 3SJ3A 3L67A 3GDMA 4H4IA 5D05A 4CQAA 3FJ6A 1LDCA 3PG9A 4JTTA 4K6AA 1VZWA 1X8FA 4E38A 2DZWA 2QJIA 3U8GA 3OHIA 3LI1A 5D2YA 4JTJA 1GZGA 4O13A 1FWNA 3LCWA 3LTSA 3GAYA 3TR2A 3GKFA 4LC8A 2A85A 2Y63A 2A21A 4KFNA 2ISSA 5FEWA 1KFKA 2V81A 3ZWTA 4Y9AA 3E0IA 4IX2A 1NVMA 3E9AA 3W7CA 2OZ0A 3W22A 3LOTA 5HWNA 1TPVA 3UZJA 4LS0A 3A21A 4UTJA 2E77A 1VRDA 3IGUA 1LROA 4GUFA 3EEGA 4Y8FA 5A5WA 3GZ3A 4AH7A 1OYBA 2GQAA 3OIXA 3W7HA 3NPVA 3T55A 2WNNA 3MHGA 4LS1A 4MZ1A 3P61A 2GVGA 2TRSA 1JUEA 3IIVA 2FIQA 1WYIA 4FIRA 5FESA 5KINA 3KRSA 1UUOA 4NX0A 2CZ5A 4K37A 1DJNA 4BWLC 3IIXA 5K3VA 2YW4A 3DH7A 2FB2A 1A5CA 1KM6A 3THQA 4XTIA 3P7YA 4N9BA 3PBYA 2NV1A 4HNTA 4HNVA 1A53A 1ICSA 1WA3A 3ATZA 3NPXA 3MMTA 2BXVA 5FF2A 3OA3A 3LERA 1OX4A 1IGSA 2FPYA 4K7VA 4XZ9A 5AHEA 3A9IA 4PODA 1TPH1 3EXRA 5BRBA 3WK2A 3HG4A 2YX0A 4AEOA 4M6QA 3LBCA 1FX6A 3TC7A 3GDTA 2OX1A 4MPQA 2C6QA 1F05A 3HG5A 1GVOA 4OWGA 4M6PA 1W3IA 5I3FA 2R94A 3O8AA 2YYUA 2YR1A 2D73A 3TQVA 4M19A 4AMAA 3UWYA 2DZUA 2C0AA 4ORMA 1I2NA 1XL9A 3BARA 4K8EA 5G2HA 4ONVA 1DVJA 4NT0A 3TA6A 3LTPA 4WQ6A 2VKZG 1X1ZA 3GDRA 4XBKA 4FB7A 1TTJA 2C19A 2ZTJA 3NQVA 3JR2A 3GKAA 4LT9A 1SPQA 1WAUA 1QO2A 1SSDA 3QPZA 3CT7A 3KVKA 4UNLA 5LHFA 1KM4A 1Z48A 5K4ZA 1X1OA 2Y88A 3U2OA 1GG1A 1SZNA 3NZRA 1IXOA 1R2SA 3L5LA 2ZRYA 4B5NA 1JCNA 4JYFA 1YPFA 5G1TA 2QAFA 3BG9A 1OHLA 4QJ1A 2UV8G 4X9SA 3BO9A 1EP2A 4JN6A 4Z1AA 1XUZA 4PA8A 4JEQA 3PBUA 4N6FA 4FX8A 3A24A 3HOJA 3SW6A 2V5LA 4CLMA 1QPQA 2CZEA 5EL1A 1BKSA 1R2TA 1HFBA 1F74A 3IIZA 4L4MA 4IUOA 3W88A 3I7SA 3NL3A 4RXFA 1YXCA 3ANYA 1G7UA 3BW3A 1JCXA 3KXQA 2Y85A 1OFOA 3TXZA 1FDZA 5HUPA 4IMEA 1LRNA 5HQEA 1SSGA 2NV2A 3WJWA 1M6JA 4FEZA 1YLVA 1OF6A 2WSQA 4NJHA 4LVBA 1H7RA 3U6WA 1I2RA 1K8YA 3RFAA 1TPB1 5HMSA 1TO3A 4UMAA 3KX6A 2F84A 1KFLA 3HBLA 1SW7A 1XBYA 4OGZA 4C1LA 3O06A 2IQTA 1OK6A 3M1ZA 3IIPA 2NUXA 3LHVA 3P81A 4NNAA 1QWGA 4ZQMA 4N02A 1RPXA 2J9YA 1A5SA 4IMCA 1SZEA 3CEUA 2NUWA 3VKJA 3EX3A 2X1RA 4AHQA 2CLIA 4ZQCA 3MP4A 2RFGA 3GDLA 4WZHA 3OG3A 3W1QA 4FIQA 2P10A 5K9DA 1ADOA 4JXCA 4GUJA 1Z42A 3TKFA 5FEPA 2NX3A 4JTEA 4OQVA 3N9RA 1MXSA 3S1VA 3DENA 2A6LA 2JK2A 1G4SA 1TYGA 4O19A 2BX7A 5KITA 3W73A 4IPJA 3W85A 2Y89A 3PG8A 3NQDA 3CWNA 3P80A 2PURA 2YGYA 4IXHA 3QEZA 3UWQA 5K9XA 1QPOA 4FXSA 2BSLA 3EWUA 3PY2A 4YMZA 1FWWA 4CNNA 1AL8A 5CPNA 4LY8A 2I9EA 4S2BA 3DBPA 1NF0A 1TRDA 1TPC1 3IV3A 4MVAA 3LRLA 1JCYA 4NJJA 3VFLA 3R13A 1R30A 3LXBA 3FOKA 5DBTA 2RH9A 1EA0A 3B06A 2O7SA 4KWVA 4UTWA 1XKYA 1VHCA 2WSYA 3N3MA 2V2HA 3T4CA 3EX1A 4JGDA 4MLRA 4UFHA 3CHVA 5I3JA 3CEPA 1H1YA 2ZTKA 4Z1BA 3CWOX 3TCEA 4OE7A 1W37A 2YDAA 5KSWA 4GE8A 4QISA 1VCFA 5K9CA 5G2IA 1GVQA 5EPDA 2AAMA 1THFD 5D30A 2ALDA 2NWSA 3GXTA 4NQ1A 4DF0A 3R89A 4X2RA 5HNRA 2WQPA 2HS8A 5D2WA 1PS9A 3QZEA 4M6VA 5AHFA 1E51A 3SGUA 3S8HA 1QDSA 4O11A 1AL7A 3NQAA 4O0ZA 5SWUA 1TPWA 1DOSA 2NXHA 4K36A 2PRLA 1SO4A 3NQMA 4ZL1A 2EKCA 4JDBA 1TPFA 2BLEA 1GQNA 2C16A 3R2GA 3STFA 4RR4A 3EXTA 4HNUA 2YFNA 4AXKA 4HPJA 3R8RA 3ABQA 3P74A 1KTBA 4PFMA 5IBXA 2C14A 2DZVA 4HNNA 4M7SA 2Y61A 5D2XA 2X1UA 1R47A 4MKNA 2VFGA 1TV7A 2FPTA 3W2KA 3P60A 5HJLA 3HGSA 4O50A 3E49A 4YL2A 1D3HA 3USBA 1KBJA 3L68A 5LGZA 3INPA 5I3KA 4Q4KA 3NO5A 3KVJA 1F2JA 3BK0A 3LLFA 5LHEA 4GC4A 3STGA 2R8WA 1I2PA 2E6DA 5HULA 4N4QA 1G4EA 2E6YA 2BZNA 4UTHA 5CPLA 8TIMA 2CLMA 1KFCA 5D37A 3NQ6A 3TV8A 1T8XA 4PL1A 3UD6A 2YYTA 2Y62A 3W87A 3NQFA 3CB8A 4ADUA 4FX7A 3C2OA 2VOMA 5AC6A 3UXDA 1K8ZA 4LVAA 1H50A 3EX6A 2B4GA 1FXPA 4QNWA 3G0XA 4MY1A 1OJXA 3V1PA 1N55A 3W7EA 1HO4A 1H7NA 3EWZA 3P62A 1O5XA 4OT7A 1J5TA 2X16A 3I7RA 3M9YA 1JR1A 4IJBA 4O1AA 1B4KA 3B0PA 4POCA 2QUTA 2ZZ3A 1XCFA 3BV4A 3F4NA 3PULA 1W5PA 3M47A 2H90A 5EA9A 1UUMA 3P84A 2HMCA 4AWSA 4UTLA 4PH6A 4UR8A 3IIOA 1MEIA 2GQ9A 4CCDA 2QCEA 4BF9A 2Y7FA 3G3DA 4NVTA 2G95A 2CU0A 4JY8A 1KFBA 1QFEA 4MLJA 4NXKA 1LORA 1BWKA 5KZDA 3CLMA 4TMCA 2FQIA 3F03K 3SIZA 2QCHA 5U7SA 4YCOA 4DQWA 5LZLA 4RX0A 2J88A 3QQ0A 3UXAA 3LV5A 3I65A 3BLIA 3A5FA 5F1VA 3LCFA 1GG0A 4UTUA 4I9AA 3TJXA 2WSRA 5AHLA 3W72A 1W0MA 2GVLA 4K39A 4MOZA 4IXXA 4UTTA 4O1DA 3WJSA 1NEYA 4LV9A 2CW6A 4LVDA 1ZY9A 1JULA 1W56A 2C15A 2QCCA 1H7XA 3HF3A 2VEMA 5LKYA 4Z0SA 3BPWA 4Z1CA 5H2ZA 2GUUA 1OFDA 2J9ZA 1PE1A 1RZMA 3QJAA 1LTDA 4JIQA 3UWVA 4GNJA 4ADTA 1OK4A 2VENA 1OFAA 1AG1O 4G1KA 1LM1A 3LI0A 1FXQA 3HGOA 4LTSA 3EKLA 4GXMA 1UBSA 5EKYA 3QMSA 3MJYA 3T7VA 5G1YA 2Z6JA 4XTDA 1H60A 3C8FA 2VXNA 4O28A 3QM3A 2WNZA 1K7FA 3T78A 3KFTA 4HN4A 3D0CA 3P67A 3C4UA 5FF3A 4BI7A 2OJPA 5D33A 1FUYA 1OFQA 3NVTA 4LWWA 3O15A 3W2JA 3MHFA 4HT3A 1PCKA 1PVNA 3OEXA 2Q3OA 4YXGA 5D03A 5F2GA 1ALDA 2VEPA 5HR7A 1LRTA 3TSBA 1EWDA 5AB3A 3W1LA 3B03A 5BOOA 3MI2A 1QMLA 5HINA 3CQ0A 2HSAA 5KZMA 2G5WA 2TSYA 2G96A 3B0UX 2X1TA 2X1SA 1F6PA 1TSIA 3W1AA 1FDJA 4Q32A 1RVGA 5L9FA 3W1NA 4JTUA 3S5OA 1VYRA 2C1HA 4KFOA 4IMFA 5AC7A 4O1CA 1ICQA 3GNNA 5LNUA 1TQJA 3G1AA 4O16A 1WOAA 3S42A 4FNRA 4JTFA 3W2NA 1AW2A 3N9SA 2DZPA 4AF0B 4DPPA 4RCXA 2P1FA 4WUIA 1OFEA 3HIJA 5J5RA 2VC6A 1TTQA 3MBDA 3C0JA 5LNRA 5F2MA 4WY0F 3NQCA 3O63A 1OFBA 2NLIA 1GTHA 2QKFA 3G8EA 3L0GA 2QCFA 3NXFA 2B7QA 2QJGA 3PBVA 1MO0A 4IPIA 2YPIA 1SUXA 3FFSA 5BMXA 3KVMA 1LLZA 5F4XA 3KOFA 1K03A 3HPZA 3G1YA 2B7OA 2H8XA 2GVJA 1KM1A 3P8JA 4MUZA 5DY2A 1U83A 2CZFA 2Z1BA 3UPWA 1IIGA 3DFPA 3MP3A 1KV5A 5HR6A 1GYLA 2V82A 1IXPA 3W1XA 4O4WA 4WX2A 2FB3A 2GJNA 3V75A 5I3IA 3W1RA 5CKSA 1S5TA 1VS1A 4D2JA 4AF0A 3QW4B 1W8SA 1G4PA 2P0OA 1O5KA 1M5WA 3SGZA 3QYQA 1P5BA 3G3MA 3LHZA 3ZFHA 3W71A 2A5HA 5H91A 5EYWA 2ZZ5A 4UIOA 3GK0A 5CG7A 3IVSA 3PWAA 1XBVA 4N9DA 3W7LA 1YXDA 4U28A 2ZZ2A 1C8VA 3MI6A 1GJPA 4XQ6A 3TFCA 3G22A 3W9ZA 3CTLA 4ALDA 1W1ZA 1RD5A 1VLIA 1LBLA 3HQ1A 5C2XA 3MI3A 4GUGA 1JUKA 3C56A 5AN7A 1BEUA 2E09A 4RLIA 4FX6M 3O1NA 5EY5A 2ZRZA 5DCDA 1RQBA 4MZ8A 3FIGA 4WOQA 1QNVA 3TSMA 3TXVA 1GT8A 4DBDA 1RQHA 1EUAA 1F76A 3WK3A 2Y7GA 1UASA 2FTPA 1QOQA 2ZZ1A 5E0KA 5AYXA 3IRDA 1VHNA 1JRBA 1WBHA 1JQVA 4KWWA 3FKRA 5CPMA 4AWTA 3UY8A 2ISWA 3DHFA 2ZRUA 3UQNA 3GLCA 3WFAA 5FF7A 2JBMA 1K3UA 3L66A 2CLHA 4RV8A 1W5NA 1QCWA 1PCWA 2FDSA 1DHPA 1R2RA 1EP3A 1A5AA 2FFCA 2NZLA 4JYDA 1JCLA 1H62A 2RDWA 3LLDA 1TREA 4BWLA 4XKYB 3N73A 4BR1A 1G6CA 2DZTA 3G1VA 1FY6A 1TPEA 2W6RA 3RK8A 4X22A 3MYPA 2RKXA 2TYSA 4JR5A 3TC6A 4P2VA 2VFDA 3STEA 1EP1A 3GXPA 3W7KA 1GVRA 1ZALA 1XC4A 2BTMA 5MHBA 1SO6A 4EVZA 1H7WA 1LBMA 2PE4A 3NEVA 5AHNA 1NAL1 3GVGA 1RV8A 4H6KA 3TU9A 3G1FA 1KM3A 1EUNA 2CLOA 1CI1A 3PM6A 4FNUA 4UTKA 4A2SA 5DN1A 1R46A 2R91A 4FNTA 1F73A 2HTMA 4O18A 2RHGA 2Z6IA 1UB3A 2GPTA 3LXCA 3G1SA 4Y96A 4PCFA 3O6DA 3TQKA 1KTNA 4GBUA 3RMJA 2YFOA 2TPSA 4S1FA 3TDFA 3S5NA 5LNWA 5BW6A 3C2RA 3R12A 1Q3NA 3ELFA 2ZA1A 2J24A 3L2IA 2ZCGA 5CZ0A 5D09A 3G1XA 3VE9A 4P61A 1W31A 1PIIA 3FEMA 4XKYA 3M16A 1KTCA 4L4LA 3HJZA 4UFJA 3W7GA 1SW3A 1ZFJA 4FXRA 3LGEA 4FHAA 2XN0A 1S3HA 3HO8A 4YCPA 3L9CA 4N9EA 4TX9A 2ATMA 2JGYA 3LM7A 1GTEA 1HUVA 5IM51 3E96A 3LX9A 4M7TA 2V30A 4ZMGA 4IGHA 4RKAA 2QCLA 3B0VC 1IXNA 4CNOA 4BI6A 3KRZA 2QAPA 4LVGA 4WXYA 4N4PA 1YDVA 3DFSA 3OVPA 1KFJA 2FPVA 2VEKA 5FI8A 4LV4A 4ADSA 1XDMA 1I45A 3CM4A 1B3OA 4W9TA 1DJQA 1J2WA 4IX0A 4LVFA 4MZYA 3G1HA 4HSOA 1FWSA 1JCJA 4WXZA 3W7JA 3KHJA 1M7PA 1ZAHA 1T96A 4LU0A 3JS3A 3KAOA 4S2CA 2KZHA 3NZ1A 3WJXA 2E5DA 2AQWA 2CLFA 2PRMA 4ML9A 1KM5A 1SQ7A 1TPUA 1Q6LA 3QQ1A 3W7IA 1L6WA 3OVQA 1DQWA 1H5YA 2VFEA 1P4CA 1TIMA 3AO0A 2V9DA 4ICNA 1W5MA 1EX5A 1FCBA 3M5ZA 3GR7A 3L21A 3R5EA 4A2RA 5DCEA 1W5QA 4WD0A 2X30A 4MJZA 5EBUA 1F7BA 2XN1A 3M0ZA 3L0KA 1HG3A 1WQ5A 2PCQA 3NOEA 3PBWA 1AW5A 4CCEA 4NZJA 3DU0A 5GVJA 4RXGA 1O95A 4RJEA 3I68A 1ZAIA 2JKAA 1VPXA 1LOLA 1KM2A 4DO5A 1ZENA 2DJXA 2TMDA 5F1UA 1IXQA 1VCVA 1EIXA 3NYZA 3ZR4A 4AAJA 4E0CA 2DJLA 4K38A 5T26A 1FWRA 3NQ8A 3W86A 4OV9A 3QW3A 5F4WA 1JCMP 4IMDA 2WPBA 1WDWA 1YPIA 1CX9A 5D32A 3S1WA 2OT0A 2ZBTA 3TSDA 4ORIA 5HWMA 1B9BA 1FCVA 3PSWA 4MIMA 2QEZA 3W7NA 1B4EA 3G0UA 5J5DA 3C2EA 3NL2A 2Q3RA 1OFPA 2ZZ6A 3M7WA 3BLFA 4EOUA 3NPWA 2I14A 2E68A 3S1XA 3Q94A 4TIMA 1OX6A 1VR6A 1BWLA 3ABOA 1QPNA 1QOPA 3PC0A 4JS3A 4EWND 5ABTA 3FYOA 1KA9F 3DXIA 4UR7A 3LB0A 1D9EA 4YLWA 1FBAA 2QCNA 1UCWA 4ZVJA 3RLVA 2H3BA 1QAPA 4QITA 4O8RA 4TO8A 2R14A 1JRCA 1IF2A 3HG2A 3TQ0A 3L65A 1TTIA 1NF7A 2CLKA 1OABA 2PC4A 4MYXA 3VI2A 4GWEA 3DFTA 1PHQA 3S5ZA 2WO5A 5TQLA 4PEKA 5CZSA 3TJLA 1H1ZA 4UCGA 3LHYA 4EF8A 2CZDA 5FEXA 5DBUA 5FF0A 1KW1A 3BGJA 3QPYA 3NM1A 3CPRA 3C61A 4GFSA 3TH6A 2WKJA 4IQLA 3TW7A 4E2DA 3BVJA 1GEQA 1ONRA 3VCRA 3GIYA 1HTIA 3SFKA 1F5ZA 3GYEA 5D38A 2RDTA 4XUGA 3L5MA 3F1QA 1PHWA 3LXAA 2Q8LA 4WOZA 3L5AA 2VFHA 4HHPA 4UTMA 2QUUA 1N7KA 3WK1A 4MJMA 4IWWA 3O16A 1OFRA 3FYPA 4UC5A 2V5BA 3ATYA 3UWUA 2DZSA 3NL6A 3TUUA 4ZQNA 3GX9A 1V7YA 4GUIA 3HGRA 4GRSA 2G97A 4UTIA 3TIMA 4MFEA 1OX5A 3B05A 2PRHA 4PTNA 3TAKA 3W7QA 3FKKA 4CQ8A 3GXNA 2ZYFA 2DORA 1K8XA 2Y7DA
chains in the Genus database with same CATH superfamily
3Q2DA 1KXQA 1ME9A 5C54A 5D8ZA 3NA8A 5IXEA 3WBYA 3W6MA 1Z44A 4HD5A 3RF9A 1VRXA 3SCVA 4LOCA 3AMGA 2VZUA 4IMAA 2HRWA 4LRTA 1FH7A 3AALA 4DJFD 2PD5A 3W75A 2VEIA 2XVNA 3MCMA 1FWBC 3RPDA 2J7HA 4UNKA 4ZFCA 3P0XA 1ISWA 1BF2A 5DANA 4IH3A 4V2XA 2VUNA 1NH6A 1TELA 1A47A 4CQ9A 1M53A 1PB0A 3T09A 3B8DA 3H23A 3PSVA 2Y1HA 1SFSA 3TYBA 5CLWA 1LL7A 3BGGA 2PDNA 4LYQA 3NPUA 2ABBA 2Y6ZA 4D6HA 1GJUA 3W1PA 4HKPA 4QG9A 3UGVA 1EYEA 3C5QA 5E9XA 5KTLA 1U33A 5I78A 1CGTA 1WOBA 1MZHA 2X2YA 3QFWA 1Y65A 4X0NA 1IYXA 1VJIA 2QUVA 3S0CA 4HA1A 1GQIA 4AB4A 1V79A 2EHHA 1E1EA 4NRRA 4R34A 1LOSA 4IGNA 3RMEA 3CIVA 5I3GA 4QG8A 1HGWA 1ZBCA 3QR3A 4A8RA 1P0KA 5CSUA 2J8FA 1ZHAA 2ZZ4A 1OIFA 5LA1A 1XLGA 3HMJG 1LRQA 3N04A 1UR2A 1QI5A 1O4UA 1AQ0A 3KRUA 4H8UA 3MT1A 3NDOA 3PUDA 4XZIA 5M03A 2ZUSA 4QSHA 2PDUA 2PGFA 1P1XA 1ME8A 3FS2A 4WGHA 4X3ZA 3BAWA 3GAKA 4R7JA 2JIEA 3EWBX 3RX2A 1TMHA 3T0CA 1X6UA 3M7SA 1H49A 2YXGA 4HN8A 4OBTA 1JZ8A 1JL8A 2ZQ0A 2PC8A 3IVUA 1IQ8A 4NJKA 2B31A 3CU2A 3KL0A 3AHYA 1DL3A 1TMQA 1XQLA 4KCTA 4DYKA 3QMRA 1TVLA 3DYPA 4RDWA 3QC0A 3FA5A 3W1MA 2YXXA 3V1HA 4C6EA 1XLDA 5EB8A 2WJZA 1QRQA 1SW0A 2O4MA 4L4OA 1XRVA 2FZ8A 1SR9A 2FH8A 2G8ZA 2OYMA 5M1TA 3TE9A 3BXWA 4PUJA 2VGGA 3ITYA 2C8NA 3CTTA 3PB0A 4IJRA 3EWXA 2VL4A 3GQYA 2PWFA 3W83A 4I7UA 4UQDA 3N18A 1W9UA 3M4HA 3G1DA 1H11A 3DHDA 1VC4A 5A8MA 3PF3A 2OXNA 2XSBA 2WZMA 4JDYA 2NUYA 3KVLA 1IEIA 1ONXA 4UFIA 4CN4A 1V6YA 4Q3MA 1UWSA 2DUXA 3GR8A 1MW0A 4JCLA 1CGWA 3OG2A 1NP0A 1PZ3A 4E2BA 3G24A 3AXMA 3PUOA 3GU2A 4UUIA 3IJ9A 1NDZA 4MY9A 3I3DA 5D2TA 1QW8A 3B40A 4US6A 1SJCA 3H24A 1BHGA 2L5HA 2FTYA 3MBFA 2Z1WA 4W85A 2V2CA 2DVXA 2DZXA 2BBFA 4DX3A 1K77A 2GZXA 3MPGA 5I3HA 4PTWA 1VJSA 2YL6A 4DVOA 1DJWA 5AOUA 4EPDC 1QBBA 3W2UA 3WNLA 3SUSA 5C9ZA 3AWOA 4JX5A 4HVXA 1PTDA 3AICA 4O1FA 1PDYA 1J79A 1IE7C 3ZXWA 2O9OA 1VGAA 5G5IA 3SR7A 4O1BA 1FWFC 4QJ4B 4O15A 3P3BA 2BOFX 2XFWA 3SI9A 1VPQA 1YDOA 2G4FA 3D3AA 5CZTA 4U3CA 2W5FA 1O60A 3PZNA 1AH4A 2AAAA 1EGVA 1KB3A 3P82A 1SJAA 3WYZA 3NQGA 5CBIA 3H26A 5BNKA 4JYEA 1YIXA 2YDSA 1RP8A 2ZXQA 2XTKA 1KWGA 3WH9A 2F6KA 3PR2A 5C9RA 1JJKA 3AZTA 2D0HA 3GC5A 3A12A 3ZQ9A 4FNSA 5FJPA 3H21A 1BYBA 1JD9A 2VX4A 2YIHA 1K70A 2OX4A 4BI5A 3IWPA 5AYIA 2VMFA 2PGEA 1PTAA 1BSLA 1TTPA 2WB5A 4UMCA 1GVIA 3CUHA 1DTUA 4G7FA 3MO7A 5HWJA 4DM1A 1VEOA 3TN3A 3OYXA 4IPNB 1RLCL 2DUZA 3AS2A 3EX4A 1EC8A 4JICA 4OU1A 1LQAA 3KBJA 3WO8A 1S5WA 2RDUA 4DEFA 1TV5A 3UESA 1E43A 3I7QA 3WELA 4P8UA 1SGJA 2V5CA 5EMUA 3BW2A 3W7OA 4I5UA 4C6OA 4C7GA 3W25A 3EMZA 2I1OA 1L9WA 4O0KA 4E3VA 3TN4A 3N4FA 5JH2A 1GPWA 2J77A 3RO8A 2WVTA 3BCFA 5A1AA 2LLEA 4XZHA 3U5UA 2WZIA 1QASA 1YTDA 3SJNA 4YYFA 3REQB 2JF7A 2Q8XA 1KGWA 3UPMA 4TMBA 3HPSA 3ZS4A 3HGJA 2FJUB 4KMQA 2WMIA 2J9XA 1FRBA 4QQUA 3W84A 4DPQA 2ZA3A 5AVNA 4UZUA 5T91A 1TWZA 2G3FA 3ARYA 2VUYA 3LZ3A 1F9CA 2UBPC 1AJ0A 1XXXA 3PZOA 5E5CA 1RK5A 5BOEA 2J47A 3SSJA 3OOQA 5AYZA 1YE4A 3FHQA 3H2NA 1XPGA 2A7PA 4NJGA 4QS6A 4HYWA 1TJRA 3WLJA 1VCGA 3GW3A 2ZXDA 1MVYA 4K68A 4LUTB 2NQ9A 2BY1A 4HZ7A 2QCDB 2R1NA 4QDMA 2X1IA 4H1ZA 3G6MA 4W5UA 4GHRA 5F2LA 1H7OA 4DLMA 1O1HA 4UFKA 4AHPA 2X8RA 3WQWA 1J12A 4OECA 1PIFA 3CC1A 3NXLA 6ENLA 3S6OA 4QX4A 1OIMA 5TIMA 3URQA 3TYUA 4LS2A 5FEZA 1JDEA 5D9MA 1JUBA 3RNDA 3E5PA 2NX1A 4H9YA 1H51A 3EWWA 3EWCA 1X6LA 3LTYA 1G4TA 1E6SM 3W2LA 3DFOA 5U4NA 4DF1A 3UG8A 3N34A 1XV8A 5H8UA 5CSRA 3ZJKA 2HS6A 2A7NA 1K7XA 3IUHA 4P8VA 4OBSA 4Q4RA 3WJYA 3M5YA 1V0KA 3OGVA 2YCEA 3RJYA 3WK0A 2NXGA 1ZB5A 4GY1A 3NR0A 1G7VA 2ZFAA 3BL3A 5D02A 4QLKA 3W7RA 5C2CA 3LCLA 5HMEA 4D71A 2IKJA 2V2DA 3A22A 3UY7A 2VC9A 3BCJA 5AYYA 4AZHA 2NXIA 5CG0A 4BA0A 3GZAA 2GSHA 5JQ9A 5GJMA 1XJBA 4HZ8A 4LNYA 1Z8AA 2QDHA 2DSZA 5DRCA 1B0IA 4KKXA 2BS9A 3NWRA 2E9MA 3MMDA 1E70M 1PUDA 4J3UA 3STCA 4O4VA 1ITCA 4Q4OA 2VP8A 2WCGA 1QNOA 2FH6A 3C2FA 1CB2A 2F9RA 1GYNA 1W8GA 1DQXA 3KWSA 4Y2WA 2B0MA 1PTGA 1Q6DA 1Q8JA 4PBFA 3N2OA 4CU8A 3S4TA 4ZZ9A 3OBEA 4IPLA 1F3EA 1WP6A 4D1JA 4YWIA 5K4XA 1MI3A 2VVSA 3P5YA 3UU0A 4JTHA 2VM8A 3NNTA 4PMYA 3TW6A 3UG4A 4CNPA 3B9DA 2FGLA 1LDCA 3OLEA 4LAKA 3U48A 2C79A 4Q8TA 1Z69A 3LTSA 3W53A 3TR2A 4LC8A 1UIPA 2Y63A 2A21A 3IUDA 4YTSA 3GD6A 4Y9AA 3D3FA 3E0IA 3F2CA 3URAA 3W22A 5HWNA 4MWAB 3UZJA 3LSCA 3VILA 5EMKA 5IFPA 4Y8FA 5A5WA 4RNIA 3K4AA 4AH7A 3TYEA 1YQ2A 4HBKA 4LUSA 3MHGA 2CESA 1KGXA 2TRSA 4I5XA 2FIQA 2X0SA 1WYIA 5FESA 1DIOA 2CZ5A 2OWCA 3ENLA 1KM6A 4AIOA 3SQMA 2RDXA 1IWAA 2NV1A 4EANA 3NPXA 4F66A 3OA3A 1E40A 3TYAA 1OX4A 2FPYA 1QHOA 3WF3A 3A9IA 4PODA 3TCSA 1TPH1 3EXRA 4ZEPA 5BRBA 3VUPA 4AEOA 1XLLA 4H6RA 4M6QA 1V02E 1JZ6A 4TV6A 1VBHA 4M6PA 5I3FA 2W61A 4FALA 1M03A 3L2MA 2YYUA 1HL8A 4FR1A 4PRTA 4XIAA 3GNXA 4ORMA 2WVUA 5G2HA 3CHEA 4RDZA 1DVJA 3VGEA 4TTGA 4XBKA 1ZRQA 4FB7A 1TTJA 2C19A 2I16A 4DI9A 3GKAA 1TR9A 1SPQA 3CV1A 1E56A 1SSDA 3VC6A 3KZSA 1KRBC 4UNLA 2VI0A 2QPUA 1SZNA 4GYFA 1R2SA 1NWUA 3MKVA 2XIOA 2RJGA 4JN6A 4HU0A 4MNJA 4U2YA 2PP0A 2E40A 4N6FA 2X09A 5I07A 2YL9A 1R3QA 3HOJA 3SW6A 1XD0A 3GXMA 2PP3A 5EL1A 5PTDA 4W89A 1W9VA 1NIUA 1R85A 3IIZA 1W2PA 1KQZA 2HBXA 3I7SA 3NL3A 4RXFA 1YXCA 2FDMA 1JCXA 4L1GA 1OFOA 3TXZA 2WANA 4H2CA 4IMEA 2PTZA 3RRAA 1UH4A 1C3FA 2NV2A 2DSKA 1YLVA 2Y5JA 2WSQA 2C1GA 1H7RA 3LGGA 4LVBA 1K8YA 3HQPA 3CZJA 4NF7A 3CZGA 3URBA 1JI1A 3KX6A 3WY1A 3NZGA 1SW7A 3OP2A 1TWWA 4OGZA 3O06A 1OK6A 2EBNA 3M1ZA 2Z1XA 3UG3A 3VCCA 3STPA 1A5SA 3VYLA 1RK6A 2D69A 2REQB 3BAYA 2RFGA 1LWJA 3GDLA 4WZHA 3W1QA 3CO8A 3GIQA 4WEVX 4JQ1A 3VZYA 3DG6A 5D9OA 1QATA 5FEPA 3S2LA 4OQVA 3S1VA 2WHLA 3A3HA 3L4WA 3F4CA 1E3ZA 5KITA 4ZFMA 4H8VA 3U2ZA 1TWSA 3D47A 1R3TA 4L9YA 2Z00A 4B2DA 4ZTYA 3QHOA 3QV9A 4IXHA 3UWQA 5K9XA 2BSLA 4JKMA 2C7FA 2I9EA 3M07A 4RDVA 4AU0A 2VD8A 3UR8A 3AHVA 1K4HA 3LRLA 3N6QA 3VFLA 3OGRA 5BU6A 3MC5A 3LXBA 4KT2A 4AZGA 3B06A 3TOYA 3W6LA 1XKYA 1CXLA 1P6CA 3GSMA 1EFZA 3VDBA 3CHVA 1OINA 4DWSD 3CEPA 2PTDA 3DC0A 2AMGA 3TCEA 2OU4A 2WHJA 1BVWA 4DNHA 1U2YA 3N13A 2CHOA 2Y8UA 3TVAA 1VCFA 4CU6A 4PCSA 1F4HA 3GDBA 1GVQA 1SJDA 5EPDA 2J62A 1THFD 1EJ7L 4INFA 1NQKA 2WSPA 3R89A 4YTTA 3AHZA 1BPLB 1WDQA 3KBWA 5D2WA 1DWHM 4HSHA 4M6VA 4DUWA 1DYSA 1KR1A 4QE5A 1EX1A 2XSAA 1ONWA 3VM7A 1UA7A 4IP4A 1TPWA 2DT2A 2PRLA 1SO4A 4ZL1A 3BV7A 3APTA 2GGHA 3AHXA 3R43A 1JI2A 4RR4A 3N17A 3V5FA 4D9PA 4HPJA 2Y5EA 1KTBA 5IBXA 2C14A 2BVWA 1XINA 1G5AA 4XD3A 1BWVA 4KH2A 3SO7A 2W9MA 1TV7A 2FPTA 3LEPA 3HGSA 2PBOA 3E49A 3D5HA 4O50A 4YL2A 4B4FA 2ZXAA 3ABXA 3INPA 3D6NA 3E0VA 4F0KA 3U4AA 2E0PA 1VBGA 3ZT7A 1PX8A 4Q4KA 4A3YA 3KVJA 5A6AA 1F2JA 4H7CA 1RY0A 2BG5A 2R8WA 1P6WA 4ZO6A 1TG7A 2E6DA 1E55A 2E6YA 5CPLA 5FL1A 8TIMA 1KBKA 2CLMA 3MCNA 3KM8A 2Y62A 3NQFA 3CJPA 4ATDA 4ADUA 1UZ1A 3MV01 3BZJA 2B4GA 3VKKA 1OJXA 1B3XA 3FGCB 3P2VA 3EWZA 4W4QA 4OT7A 3PJWA 2ZX5A 1J5TA 4FK9A 3I7RA 4O1AA 1UC5A 2PLMA 3R1ZA 1WB0A 4IFKA 2WKLA 3KZPA 1W5PA 1KCKA 1Q85A 3MVIA 4AWSA 2GSEA 4LCSA 2GQ9A 4CCDA 4D6FA 2G95A 1JGMA 1ENUA 2GSJA 2VRQA 5KZDA 3CLMA 4TMCA 3SIZA 4QBXA 2EPMX 5LZLA 3M46A 4LFYA 1MNZA 3KBNA 3QQ0A 3WBXA 3T05A 3LV5A 5FIPA 4GG9A 4H9MA 4Z2HA 4UTUA 2PDGA 3W72A 4WKFA 2GVLA 4K39A 3VX0A 3FCPA 3KS5A 2CW6A 1EC7A 4LF1A 3TONA 5DMMA 1ZY9A 2C15A 2NT0A 3DN5A 3GC4A 2AOSA 2JIWA 1M01A 1EJRC 4LXFA 3EA3A 1BXCA 3UWVA 2VENA 2X05A 4J40A 1C93A 1DWGM 2ZUUA 5A6SA 3WLQA 5EKYA 1UG6A 4GVIA 1FWJC 1LG1A 2Z6JA 1PWLA 3QM3A 3ITTA 1EZ2A 2NVAA 1US0A 3KFTA 2BXYA 3P67A 3C4UA 4IISA 4B5TA 3EOUA 4G7EB 4GACA 4DYEA 2PWHA 3ZT5A 2J7GA 2YCJA 3XISA 4HNLA 4FI4A 4HT3A 2R1KA 1ZU8A 1MMFA 4K1WA 2XM2A 4KBXA 5D03A 5F2GA 1ALDA 2VEPA 2XVKA 3ZJ8A 3TSBA 3S47A 1IV8A 1B3YA 3AS0A 1QMLA 5B7YA 3CQ0A 3WLHA 3VNYA 4B3LA 2AKMA 1C8XA 4J2MA 2ACQA 2X1SA 1XG3A 3W1AA 3GO2A 1FDJA 4PMUA 4Q32A 3TN6A 5TD4A 4ZB0A 4AUBA 5HMDA 3M0LA 2QJMA 2WW5A 5CPSA 5A8OA 4IMFA 2QPSA 3GC2A 4GI4A 3G1AA 3S42A 1OWQA 4FNRA 3N9SA 4RCXA 1XR2A 1FP9A 4TOQA 5DT7A 2VC6A 1TTQA 2YZ5A 3MBDA 1BXNA 3QV6A 3O63A 1O1ZA 2JE8A 4U5IA 3SRDA 2QKFA 3G8EA 4Y7EA 2QCFA 5KEZA 1WCGA 3QY8A 2YPIA 3ERPA 3PK7A 2G0WA 3KVMA 1RP9A 1K03A 3GVVA 4GKLA 4I5RA 1EKOA 3HPZA 3V16A 4KRTA 2CWXA 3WH7A 2H8XA 1E1CB 2GVJA 4HTYA 3P8JA 4MUZA 3SEPA 4HU8A 1MW3A 4R7WA 2Z1BA 1UKQA 1IXPA 3DC8A 4O4WA 3RM8A 3UP8A 2GJNA 3VM5A 9XIAA 1S5TA 3BC9A 1ITUA 3MUIA 1M5WA 3VABA 1P5BA 1T7LA 3LHZA 4G6CA 4RZBA 5EYWA 4UIOA 5M5DA 1XLEA 1ECEA 1RH9A 5CG7A 4DZ5A 1H2JA 1E6PA 5ABHA 1C8VA 3MI6A 1GJPA 3F7JA 4IL2A 1EJVC 5LXEA 1LBLA 5AN7A 1A3WA 4TX6A 1NOFA 5EY5A 1POKA 2ZRZA 1F61A 4MB5A 4QSFA 3TSMA 1GT8A 3ICJA 2HE5A 1F76A 1AZ2A 1NY1A 1UASA 2ZZ1A 3UR2A 3U4FA 2OKOA 3IRDA 1VHNA 2NSOA 4I3GA 5CPMA 1KXVA 2ISWA 4HK6A 1J93A 2ZRUA 2CBIA 2JBMA 4IICA 3B8WA 1QCWA 2ZUVA 1XS2A 1DHPA 5BXPA 1FTXA 2FFCA 3G77A 3LLDA 2W92A 2RUSA 2D3LA 3G1VA 3BSMA 4GIEA 4DYJA 3WNMA 1OT2A 3UJEA 4R85A 2VFDA 2GUYA 3AC0A 4Q8WA 3LD5A 1GVRA 1ZJAA 4AY1A 2BTMA 5MHBA 4JL2A 4EVZA 3CO4A 5A6KA 1LBMA 2PE4A 5FJJA 3TU9A 4NAFA 3W00A 1WXZA 4YVXA 5G1MA 4A2SA 1PZ1A 3PFRA 3ANUA 3I10A 2GPTA 2WM1A 4MAVA 2IKGA 3G6LA 1SYTA 3O6DA 3IK2A 4S1FA 3TDFA 3S5NA 4YHGA 4WDXA 1WKYA 3EPOA 1QOXA 3G1XA 4QDWA 1W31A 5MKGB 4XKYA 3M16A 3GU1A 4LB3A 3W7GA 1MW2A 2WZHA 4FP1A 2WAGA 4C6PA 3MDWA 3Q45A 3LPGA 2BXZA 3MMUA 4KCUA 3EDKA 1LL6A 4FHAA 8CGTA 2XN0A 5A2CA 2X41A 2XZ9A 3L9CA 3H7VA 1GTEA 5AVHA 3E96A 3LX9A 1Q4NX 3W29A 1EZWA 2DSVA 1DJHA 2QCLA 3RHGA 2ZADA 1X96A 3KRZA 3VGDA 3T2PA 4ZCWA 2QAPA 4LVGA 2AKZA 2YBUA 2XIJA 2VQUA 1YDVA 3DFSA 1LL4A 1RD6A 4HPGA 3ZZ1A 1R6WA 2VEKA 5FI8A 4HHLA 3WKZA 4CU7A 3TTYA 4IX0A 3ABZA 4HZMA 4UOJA 1XLKA 1XYBA 4FMVA 4B5WA 3G1RA 3W7JA 3KHJA 1M7PA 4LU0A 1HGYA 2MNRA 3KAOA 4S2CA 4HTBA 4IHCA 7ENLA 4PULA 5FJRA 1EGMA 1NWTA 2E5DA 4S3AA 4GIYA 2CLFA 1WDDA 2PRMA 3EOOA 1BVZA 2NQZA 1E71M 3EDFA 1ZBVA 4C6IA 4RE0A 3W7IA 4AD1A 2VFEA 1DJXA 3WLLA 4JQAA 4GO8A 1NTHA 3IAPA 5FOOA 4ICNA 1XYZA 3C0LA 3M5ZA 3GR7A 4C65A 5DCEA 1G01A 3IJLA 2X30A 4MJZA 3UVIA 1ZCCA 3L0KA 1HG3A 3C8NA 2PSNA 1T40A 1HJQA 3DU0A 3PWIA 1TWIA 3ARUA 4I6VA 1J0ZA 4LBSA 1CB7B 3B8SA 3I68A 3UXLA 2V5KA 2VD9A 1LOLA 4AY8A 4DIAA 4RPPA 3P93A 1J18A 2PLJA 1ZENA 2TMDA 5F1UA 1IXQA 1B90A 3KHDA 1VCVA 2C0HA 1CGUA 1D3CA 3VKDA 3ZSSA 4TVUA 3ZR4A 1P7TB 4W8BA 3VU2A 3PZ9A 5T26A 4ZOAA 1Q65A 4ACZA 4AWEA 4DLFA 4YHEA 4JIHA 2WK2A 4YWSA 1JCMP 1AVAA 3VNKA 4V15A 1PX3A 1VFTA 1SMAA 3SRFA 2EPKX 1B4EA 2A3EA 3C2EA 3NL2A 3DECA 2Q3RA 1OFPA 3F5JA 3BLFA 3QGKC 3NPWA 4B3KA 3VIOA 3OGSA 3CYVA 1Z9AA 3ABOA 5ABTA 3FYOA 4UR7A 3DERA 2PWDA 3PJTA 4WDTA 3B3DA 1R9XA 4O8RA 3VMOA 2R14A 1R9ZA 3QGAC 1S46A 3WUGA 2FHCA 4DXXA 1HKIA 1FWGC 5CZKA 2Q02A 2Y8VA 3DFTA 3S5ZA 1XH0A 3CL8A 4JHMA 4XVDA 3TJLA 2WVSA 1H1ZA 4UCGA 5CSYA 4AEFA 4H9XA 3KTCA 2D0FA 3N15A 4XKMA 5A2AA 3QPYA 3NM1A 1J2BA 3CPRA 4GFSA 4MWAE 4IQLA 4E2DA 3GH7A 3BMWA 1HTIA 3SFKA 5CC3A 2EKGA 2WJFA 3GYEA 2CETA 5D38A 2CZVA 3VO0A 3GXDA 2Q8LA 4WOZA 4NYUA 2QUUA 4UTMA 1N7KA 3PTKA 1GJWA 4MJMA 2NVDA 3O16A 4GO9A 3FYPA 3E6EA 2O56A 3NYDA 1FVPA 3AYVA 3NL6A 1EBGA 1X39A 3LG3A 3GX9A 1EQPA 4MWAD 3IS4A 1M7JA 1OC6A 5KZ6A 1R87A 1UH3A 2QPXA 2OWWA 2WVVA 1E4NA 2WMFA 2DSWA 5HBFA 1QI2A 3M0IA 2Y7DA 3OO2A 2QUMA 5AHMA 1A5BA 4XV0A 3CQHA 5LNVA 3QVQA 4CEUC 3B8VA 1A5OC 2DZAA 3GFYA 3R8HA 1TRIA 3UNDA 4H3DA 1LCOA 4RL3A 5F4SA 4KW2A 5JMUA 1GVFA 4KETA 3T4WA 4LRSA 2ZDRA 2YZRA 1UJPA 4HNOA 2QCGA 1OB0A 2DT0A 3C6CA 5HQLA 5E9AA 2YL8A 5IHRA 1Q6RA 1KLZA 1Q6OA 5DXXA 1UOKA 2ACRA 2E8YA 4Z1DA 1D2KA 3JZEA 4Z0JA 3USZA 2DQWA 2NQHA 5TNVA 3SY8A 1WUEA 1RPKA 3QN3A 3T0DA 4HPXA 5CPOA 3ZLFA 1ELSA 3WEMA 1FCQA 1LUCA 1PDZA 2GFTA 3EMCA 4JKKA 2CFFA 2QT3A 1CT5A 3DZ1A 2PODA 4DJFC 5HJYA 2C18A 3VKCA 4C6QA 3A5VA 3CIWA 4WY0A 1MSSA 4IGSA 2WC3A 3SFWA 2OVLA 2QULA 3V5OA 1HF6A 1QWKA 3LGDA 1I1XA 3AXIA 4ERIA 2QDEA 3LLXA 2EGZA 1UC4A 4CQCA 4MSSA 5GJPA 1A5UA 4JN8A 4YJ5A 5BXRA 2OWXA 1RQEA 4Y9OA 2OO6A 3VDAA 1V5XA 4F8XA 2VTFA 3TK7A 1HN1A 4LH8A 5FAGA 4H8HA 4JHOA 4Q8VA 1WBJA 1V3KA 4GY7A 1L8NA 3WQFA 1V0NA 2QUNA 1S38A 3T40A 1K7EA 3CS2A 4LALA 5H8MA 4RPQA 4H9UA 1QNRA 3O07A 1Z6KA 1IT7A 4UR9A 4G9PA 2P5NA 3V36A 4LAUA 4Z17A 1TR1A 1H09A 2PDBA 5M2FX 5FJIA 4C90A 2QV4A 3CAQA 1Q45A 2R6OA 3RPMA 1YNYA 3W3OA 4NUWA 1UD5A 4KIRA 4BZYA 1R3YA 3HU7A 2J7BA 4GZ7A 2FFIA 1FP8A 3VIPA 4NNBA 1RALA 1X97A 4EPEC 4R5EA 3F2BA 2UWFA 1AD1A 1E9IA 4B9ZA 4C6CA 3AMCA 1B1YA 4PL2A 5E93A 4LYPA 1VFUA 3SUTA 1W9XA 4UWMA 3C3NA 3T2OA 2PGRA 4Q7IA 3GFZA 4YTRA 4LSBA 2R82A 3W76A 1P0NA 3E38A 3WLKX 4QEHA 4DXVA 5G4EA 2P3ZA 4J3XA 1XP3A 5D04C 1IEXA 1Z41A 3TNOA 5HMFA 2V3GA 3BTNA 3UZYA 3RU6A 4UTWC 1HP4A 3DI1A 3SUVA 1YRRA 3RM4A 2O9PA 1XFCA 3G0SA 3TYDA 1VENA 4FSAA 3FJLA 1S5MA 2E25A 1PJ9A 5BOFA 2WCSA 2R1PA 1YEYA 1XLAA 2IQDA 3LCXA 1QT1A 3EDEA 2J6VA 3PZVA 3V0TA 2ISVA 1REQB 2ICSA 3GRIA 3DDMA 1B3WA 4A8LA 3I4KA 2IW0A 1UD3A 2QR6A 4P7QA 1R3VA 3V18A 4GJ1A 1I9CB 3UEQA 4AVOA 3QY6A 3EX2A 1CPUA 3WQ4A 1G9HA 3ISIX 2VELA 3JRKA 5C6MA 4O57A 3TYCA 3XIMA 1RSCA 4U4MA 3AIEA 4JEJA 1SZFA 3U7VA 4R53A 3C2VA 4C7FA 2XINA 5BZAA 3NAVA 3S1UA 4UQEA 1GWJA 1I4NA 4RZ6A 2IKHA 1RCQA 1HL2A 5EMLA 2PPGA 2NSXA 3VA8A 4KF1A 2VWTA 2BWGA 4FNQA 2PB1A 2ZA2A 2D20A 4WSKA 4R9OA 4IIFA 2W79A 4N6EA 3FJNA 3MW7A 3BQ5A 4F2BA 1QNSA 2QCMA 1W5OA 1V0LA 3W7DA 3GDKA 2YSWA 1M7XA 5FKYA 3GNDA 2GDVA 1VKFA 3W2MA 3WCZA 1H41A 3P5ZA 1SFJA 2XN2A 2WMIB 2H9AA 1OT1A 3RG6A 2FHFA 2CLEA 4EWJA 1ESWA 1RCXB 1VQTA 4WKAA 4N42A 1CBGA 5CGQA 1TV8A 1ICPA 2NW0A 1YTKA 4NX5A 5DCBA 4ZOEA 1BAGA 3NEHA 1LP6A 3CIXA 4ML4A 4WJXA 3TLQA 4NJIA 3Q58A 1XFBA 2IUZA 2VR5A 5TBOA 2AQVA 3RLUA 4OIFA 5FA5A 4QTGA 3TWBA 4OUIA 4UCFA 1W91A 4QHRA 3UPBA 1PV8A 2B7NA 3IK4A 5HXMA 4PMNA 4EIVA 2F38A 1LLWA 3W27A 2PU0A 1KXTA 3LBMA 3ID7A 3GXIA 1V6UA 3A4XA 3W7MA 1EOKA 4CNSA 3ABRA 3G5EA 1B57A 5FACA 3S9ZA 4S3EA 3T9PA 3AZSA 1Y5VA 1JGIA 3UZ5A 4J7RA 1DTNA 4UTTC 4JX6A 4QQ3A 1E4LA 2NQLA 3WENA 1UD8A 3RLHA 3WLPA 5ECVA 4H83A 1CGVA 1ADDA 1XIBA 1KWKA 4MYAA 3UJSA 2H3DA 4NXSA 3LM3A 4QG6A 1ZTVA 3DEQA 4IIGA 4EXBA 3FLUA 4H01A 3T08A 2PUZA 3AISA 2A1YA 3E12A 4NL1A 4G1NA 3NL5A 3A64A 2G3MA 5HA7A 4MY8A 4DBEA 3NQBA 2A7RA 3LPPA 3NFUA 2DP3A 3UERA 1XBXA 1XI3A 1KBBA 4JIPA 2A6NA 1LJYA 4GCAA 4IOTA 1EXBA 2OT1A 1AFSA 5C8BB 1W54A 1NFBA 1EPVA 3PTQA 2J8GA 5A6TC 2V68A 1IIHA 1B30A 4LC6A 2Z1KA 1DKWA 4C6KA 3T07A 3APYA 4XB3A 2XU2A 4NILA 2VJXA 4O52A 4KEMA 1MQQA 2WLZA 1RVKA 3U0HA 3GNRA 3S5YA 6PTDA 3II1A 9XIMA 4JTLA 1KFEA 3UYCA 2CKSA 3K46A 1VJZA 4O54A 4FOKA 1VH7A 2XDFA 3SIMA 4MPKA 1VF8A 4LAMA 2WHMA 3FEQA 3W02A 5BWAA 3OBKA 4UOZA 1EWEA 2BASA 2Q8ZA 3CV2A 4V27A 3WJZA 3N2MA 2JGQA 4LBRA 1FKWA 2TODA 4KIEA 4A21A 1DBTA 1SO5A 3SADA 2DY3A 4CCCA 3WLNA 1FWCC 1C9DA 3FV9A 3AHTA 7A3HA 1US2A 1XSKA 1PPIA 3VD4A 4OKDA 3VMNA 3IRSA 3SBFA 2XM1A 5C55A 2PDQA 1EGZA 3MKKA 3VPLA 3S83A 1M1BA 1NP2A 4XZWA 4GH3A 7REQA 4P7RA 3KUMA 5A8GA 2A2IA 1VFMA 1QI0A 1D3GA 4E2OA 3EZ4A 4IUGA 2SFPA 3N12A 2YB4A 2BVTA 1E73M 4N2YA 3W07A 4EF9A 4Z2KA 1DORA 1OM0A 4JTQA 4KFPA 4F2UA 1E15A 1Q13A 5C5YA 4MTVA 3PZMA 4ATWA 4GZJA 2HZGA 3WF0A 3UZWA 4LBUA 4QCEA 1GPFA 1U5JA 1IWPA 4UFLA 5HJXA 3SUUA 2A4AA 4DJDD 3FYYA 3BAXA 1EB3A 2CLLA 2YCLA 4XAGA 4LY4A 2TAAA 3FJ6A 4JKLA 4K6AA 2QJNA 1VZWA 3WUEA 4E38A 5GQBA 2DZWA 1IZCA 1ZUAX 2NV9A 2QJIA 3LI1A 4LEFA 1GZGA 3MWCA 3LCWA 1EHNA 1BVNP 3N6JA 2VX5A 3GKFA 4P7NA 4KFNA 2CBUA 4PFHA 5FEWA 3KDOA 1MUMA 2J7EA 3ZWTA 1CXKA 1NVMA 2UZ9A 3E9AA 4Q7NA 3W7CA 1TPVA 4A05A 5BCAA 3D46A 4UTJA 3OZPA 4MUPA 3VDCA 2HISA 3IGUA 2A3AA 1F3XA 3AMLA 4GUFA 1GQKA 4B5UA 1OYBA 3OIXA 4D8LA 4REQA 4EPKA 3QZ6A 3W7HA 3N2TA 2PMQA 4DBUA 1EEXA 3HM7A 1CENA 4HCDA 1V6TA 4LS1A 1TVNA 3FXYA 1UUOA 1UD6A 1UKSA 1DJNA 5GNZA 2YW4A 3DH7A 1PYFA 1V6WA 1BYAA 4HOZA 3P7YA 1ZZMA 3O0KA 1R3RA 4FLQA 5IFTA 4HNTA 3MMTA 5FF2A 2V3DA 1IGSA 2PDXA 2ZUWA 3CUIA 4QE1A 4XZ9A 5AHEA 1R5YA 3CQKA 4IIEA 3HG4A 4AX6A 3ITXA 1MXGA 3WLIA 1TJ2A 2J7CA 1S2UA 3TC7A 1Q7MA 3OIHA 4MPQA 3M0MA 2C6QA 5AZ1A 1N8IA 3HG5A 1GVOA 3QLDA 1W3IA 1EXPA 2OLSA 2R94A 1EC9A 4B90A 4BEQA 2V6AA 3B8UA 2D73A 1C8QA 4M19A 1Q6GA 3UWYA 2DZUA 2Q09A 1G1YA 3BARA 2ZC8A 4NT0A 3ZOAA 2BOEX 4AMCA 3AUJA 3SCPA 2HEJA 1EYWA 4JL1A 2QLYA 3BJFA 3JR2A 1NWSA 3WZ0E 1JYVA 3W26A 2FVLA 4ZO9A 3KVKA 5LHFA 4V1XA 1KM4A 1LWHA 2Y88A 2C71A 4KEVA 2CKRA 1XKJA 3L5LA 4JYFA 5G1TA 3F5LA 2QAFA 1OHLA 2R1LA 3FSTA 4PA8A 1JPMA 4G2DA 3PBUA 1YNQA 1JDDA 1E1FA 5C9XA 3QKZA 1QPQA 1KR0A 2CZEA 4H7VA 3VKAA 1BKSA 1WDRA 1IWBA 1F74A 4Q6XA 3W88A 1J5SA 3TWAA 1YW1A 5ENLA 3PNUA 2Y85A 1FDZA 5HUPA 1TJ0A 1LRNA 5HQEA 1SSGA 3WH6A 1M6JA 3L4XA 5FJUA 3EPNA 1OF6A 4NJHA 3U6WA 3RFAA 1TPB1 4RUBA 1BLIA 2XHYA 2F84A 2ASHA 4Z42C 2ZDSA 3LYEA 3E5BA 7TAAA 1OSEA 3SRHA 1O5RA 3FAXA 1QI3A 2NUXA 1QWGA 4ZQMA 4N02A 1FHLA 2J9YA 4IMCA 3CEUA 3VKJA 3EX3A 1U5VA 2CLIA 3L23A 3SCNA 1K9DA 4FIQA 2P10A 5K9DA 2PZNA 2BFGA 4Q8PA 3WQ6A 3E2RA 1Z89A 4US5A 4PUNA 3UA3A 1ADOA 4JXCA 3H2CA 4GUJA 3N4EA 3VZZA 1TE1A 3TKFA 4PMDA 5TF0A 1JAKA 4TXEA 4S39A 4HCLA 1XIMA 4L7ZA 2A6LA 1TYGA 4XSMA 4F48A 2OG9A 2BHZA 2BX7A 3R25A 4Q8MA 4IPJA 1BXBA 3PG8A 3P80A 1U30A 3BAKA 1QPOA 3PY2A 4CNNA 1AL8A 5CPNA 1RXOB 1TV4A 5HANA 4OTKA 1GHSA 3GHTA 1NF0A 1TRDA 1TPC1 4MVAA 1M68A 1JCYA 3OLIA 5DMNA 5EGRA 5DBTA 2RH9A 4NY2A 5AY7A 5D9NA 1VHCA 1XH1A 4DUOA 4MB1A 1FHUA 3F4VA 4J27A 1F4AA 5I3JA 1H1YA 1XRFA 4YTQA 4Z1BA 3CAVA 1Q7ZA 3KOWA 5CLTA 3QPEA 2F2HA 4V33A 3IPWA 3RAOA 4Q4PA 4Q4QA 4QISA 1GKPA 5K9CA 3KCOA 3KTSA 2Z4GA 3GE7A 4GISA 1TUXA 3IV8A 5HOSA 4WR3A 1VFFA 2EPLX 5CC6A 3ARRA 3TEVA 1J96A 3PFMA 1PS9A 3QZEA 4E8DA 1YKWA 4U31A 3O0FA 3SGUA 1E51A 2J79A 1QDSA 4I8YA 3WLMA 5SWUA 1JIBA 4AY7A 2NXHA 1JZ2A 3NQMA 1TPFA 4DWSC 3UJFA 2WMHA 2QS8A 4BS0A 2BLEA 3R2GA 3STFA 2DH3A 3EXTA 3U3HA 2DSUA 3KCLA 4L80A 2OFJA 3V3WA 4M7SA 3VIHA 1XIEA 3L2LA 5D2XA 3WLSA 4W88A 1R47A 4MKNA 2OKTA 3W2KA 3P60A 5HJLA 5FSDC 1D3HA 1LT8A 4IFKB 3MTWA 5LGZA 2Y4SA 3VIKA 3PUGA 2E9BA 4Z2LA 1ECQA 5I3KA 4AG0A 4C1NA 3OW1A 1EJTC 4RNHA 3HV8A 4CVWA 4XAFA 3O9NA 1I2PA 4JQ2A 3QHMA 3WDIA 1XHGA 3IARA 3NQ6A 3TV8A 4PL1A 3UD6A 3TLLA 2VDHA 1FOBA 2EG7A 2ISFA 1S2AA 3CB8A 4GIAA 4IIBA 1UR0A 2VOMA 3UXDA 1K8ZA 5BRQA 2F61A 1DIKA 2VZVA 3G0XA 2F8QA 5FSEC 2ZUMA 3V1PA 1N55A 4XZBA 4GH1A 2HK0A 1H7NA 4DY1A 3BCDA 4JOMA 4M8UA 1MYRA 3B0PA 3EB3A 4JIIX 3ALGA 3F4NA 4C6FA 1JF5A 3RDKA 1R86A 4QAWA 3P84A 4PH6A 4DN1A 2O0TA 2Y7FA 1R38A 1VBUA 1KFBA 1LORA 2FQIA 4W93A 4YCOA 4LB4A 4RX0A 2J88A 1PYMA 4GI9A 3I65A 3A5FA 2IS7A 5F1VA 3LCFA 1GG0A 4FOJA 3TJXA 5AHLA 1W0MA 4IXXA 1NEYA 3E74A 4LV9A 5DX7A 3FA4A 2I5GA 1DXIA 2ACSA 1M9HA 2OLHA 4XO6A 4RW3A 4XAZA 5BU9A 5LKYA 5H2ZA 2EJ1A 4BQ2A 2GUUA 1OFDA 2J9ZA 3AU6A 8XIMA 3VOHA 3VKBA 1E0UA 1RZMA 3QJAA 4ADTA 2ZC1A 1UIOA 1OFAA 1FHVA 2OGYA 1MRAA 4G1KA 4IGMA 3QMSA 3ITOA 3ORWA 4CEXC 4F0LA 1B2YA 5CH9A 1WZLA 3ARWA 3H22A 1X38A 4HN4A 4MKSA 2CEQA 4BI7A 1FUYA 1RY8A 1OFQA 1I60A 1JZ5A 3NVTA 3W2JA 1I75A 4W84A 1J10A 2VCCA 2J4GA 1PCKA 1WUFA 4Y9NA 1CXEA 5H1WA 1RBOB 1MUWA 1V77A 1FA2A 1KC7A 3CHDA 1ZSXA 3HQOA 4WKHA 2WMJA 5HINA 5KZMA 3PTMA 1IR2A 1W3HA 3BICA 3B0UX 1QBAA 3EOSA 2IMRA 3OZYA 1TSIA 4N0RA 3VINA 4L4PA 4WK9A 5L9FA 3W1NA 1VYRA 2C1HA 4KFOA 5AC7A 4O1CA 1XIIA 3GNNA 4QJ3B 3TR9A 4O16A 4XZNX 1TKKA 5JVLA 2ZX6A 3N3TA 4WY0F 3NQCA 1OFBA 2I9UA 2C1IA 4CQBA 4GI6A 2B7QA 3PBVA 1X8CA 1CTNA 5BMXA 5F4XA 3KOFA 1OY0A 3BJSA 4DWDA 1GCYA 1ITXA 3KCJA 1L6GA 1E6NA 3BLOA 3VNMA 2OEJA 1WKDA 3LPFA 1CNVA 3PPCA 4PMVA 4AIBA 3W28A 3LU2A 1MNSA 1OCJA 2YL5A 2Z26A 4HMEA 5HR6A 1EIBA 2VX6A 1XLIA 1EHAA 2DT1A 4WX2A 3IJQA 3BOXA 3BLLA 1VS1A 4C6BA 4D2JA 4AF0A 7ODCA 1O5KA 1PAMA 3SGZA 2KAUC 3CMFA 4GGBA 4ATLA 2ZZ5A 1JDAA 2OB3A 3E2SA 1PKLA 2P50A 3VIGA 1YMYA 2AL2B 3PBMA 4C6MA 2AL1A 2XGZA 2QMJA 4R88A 3L4UA 5C2GA 3QOKA 1JUKA 4GGHA 5I3DA 3MY9A 2DH2A 5I77A 3LN3A 4XD6A 5DCDA 1SZRA 2D2JA 4D6EA 4MZ8A 3FIGA 1QNVA 4HPNA 2DUAA 1RQHA 5EFDA 5B7ZA 5AKQA 1EL3A 2Y7GA 3A4JA 4KWUA 1QOQA 3AIUA 1J11A 4KWWA 5G4HC 4B3ZA 3FKRA 3DHFA 1FWEC 3L66A 4GINA 4DHGA 2CLHA 7CGTA 3LQGA 4GQQA 1X6NA 4D1IA 1W5NA 3UZXA 3QLLA 1PCWA 1EP3A 1A5AA 1R3WA 4GNKB 2NZLA 1JCLA 2RDWA 2VR4A 4IL0A 1AA1B 2HWGA 4XKYB 2D23A 4J4KA 4F4RA 3RK8A 1F3TA 3CT2A 3DIPA 2BB0A 2WWCA 4JR5A 3UCCA 3STEA 5CCZA 1KKOA 1XC4A 1XH2A 3DGBA 4OVXA 4H6KA 1ISYA 4RE2A 3G1FA 1V8EA 4GX9A 5A6LA 1V3IA 3NIYA 1W3LA 3WSUA 5AYBA 4ZO7A 4FNTA 3CWHA 2OODA 1UB3A 3I3EA 4EXQA 1CZ1A 3G1SA 4Y96A 3J7HA 4PCFA 2D2HA 3UF9A 4DRSA 4GBUA 2YFOA 4Q7BA 3R12A 4AD4A 1Q3NA 4QXIA 3ELFA 2I57A 5H8PA 2J24A 3EOEA 4YNGA 4HQVA 5DQPA 4P61A 2HVOA 1PIIA 2YXOA 1E0TA 1KTCA 3HJZA 1KRCC 2G50A 1MDLA 4PN2A 1MQPA 1VBRA 4GYKA 3WLTA 2GOKA 4M3PA 2VRJA 3FDGA 4L65A 3RM9A 3JZUA 4FR6A 4PMOA 1JXJA 1TX2A 4TX9A 2JGYA 3WEZA 4HB7A 4M7TA 1TVPA 4LX4A 3AS1A 1O66A 1IXNA 4CNTA 4S3GA 1S3TC 2XPKA 3QV8A 1Q63A 4L6HA 4L1WA 2FPVA 1D8CA 4Z2IA 1XDMA 2OR2A 1HP5A 4W9TA 4HSOA 3WLOA 3QOMA 2O55A 1YPXA 3CHFA 3WJXA 1GGOA 3OZOA 1PKMA 4L6OA 4ML9A 1KM5A 3V35A 1TPUA 1Q6LA 3NZPA 5BRPA 4GXPA 1H5YA 1D7KA 2WMKA 4ACZB 1TIMA 3AO0A 3WEOA 2E1WA 1W5MA 2OZ3A 1EX5A 3GG7A 4W5ZA 3MANA 3L21A 3R5EA 4A2RA 1XRTA 3VOJA 2XJ7A 1XISA 1CGXA 4YVVA 4V1YA 2P0IA 4WD0A 2IXVA 4ZA0A 5A6BA 1PKYA 1K9EA 5T8GA 3M0ZA 5LA2A 2WZEA 4XBJA 4BKNA 1AW5A 5E0CA 5GVJA 1MFUA 2PI6A 4DI8A 3H2MA 1ODUA 3ZT6A 4D72A 1DWIM 4LCQA 2ZVIA 1D7FA 1TFVA 1EIXA 3NYZA 1NARA 1V6XA 2DJLA 1FWRA 4OOZA 3W86A 4OV9A 3QW3A 1PKNA 3AWNA 5BXSA 1CDGA 2WPBA 4BQ4A 1YPIA 1YE6A 3SUWA 4GJIA 2ZBTA 3W4RA 6A3HA 5HWMA 2ALRA 3JUGA 3AROA 3ARQA 3VD5A 3W7NA 2XH0A 5JBFA 4FPSA 2ZX8A 1DHKA 3PAOA 2I14A 2E68A 3MCOA 1OX6A 1J0HA 1BWLA 1QPNA 4JS3A 4EWND 4F79A 3DXIA 4L64A 3UJRA 4X60A 3WNPA 3RLVA 2H3BA 1QAPA 2D3NA 3DUGA 3EA1A 2HXTA 4QITA 3M0KA 3CZLA 5E6YA 3HG2A 2PAJA 1OABA 1RBLA 3VI2A 1RHCA 4C5YA 2VT0A 1VIWA 5I0DA 1P0BA 1KKRA 3EDDA 3QTGA 5TQLA 4Y9MA 1FWHC 4GYPC 2CERA 1S1PA 2WVVB 5FEXA 5FF0A 4PEEA 3MMWA 1KW1A 2DV0A 1V3HA 3TH6A 4UTFA 1SR0A 4PB4A 1ONRA 3VCRA 1UZHA 1WE5A 6CGTA 1F5ZA 1Y5WA 2BHUA 4H8NA 3VDHA 1QVBA 1PHWA 3LXAA 4IP5A 2DVUA 4YPJA 1DIEA 2DZSA 5HQMA 9RUBA 3TUUA 2D24A 2NT1A 4TUFA 1BF6A 3I4EA 1V7YA 4GJJA 1W9DM 1A5LC 3ONBA 4TTUA 1N2VA 4HA4A 3ITGA 4P5UA 4UTIA 1E0VA 5CC7A 1HNYA 3OODA 4PTNA 3W7QA 1UP0A 1ZS2A 3IJDA 4LEQA 2OOGA 2ZICA 5JBDA 1K8XA 3V4BA 1LUCB 2OEMA 5HDRA 3ZYZA 1NQ6A 3G8RA 4DO6A 3AIQA 1OF8A 4JNMA 3OYZA 3M43A 4L5ZA 4QNEA 1P0EA 3BW4A 4WJEA 1E6RA 3BAJA 3IJIA 4WY0B 1NJJA 3S9YA 3EB2A 1X7IA 4J9JA 2YKKA 2ZRXA 4DM2A 2XG9A 3IUIA 4Y9PA 1ZCOA 4MWAC 4WGXA 4BFAA 3S6DA 4W8LA 1CW2A 4RE4A 2OCZA 4NI8A 3B9AA 3MP5A 1C29A 3AYSA 1DV7A 4O12A 2QVNA 1LYXA 2NWRA 3DFNA 4NU7A 3WQGA 2OELA 2XYLA 3A6OA 1X7FA 3OA5A 3LSBA 2IPFA 4HHHA 3BOFA 2EXOA 4M1RA 2PDKA 4UMBA 1WZMA 3VOCA 2E5BA 2R24A 3M41A 3GBDA 1SU5A 2XGIA 3IACA 4MNLA 4RNJA 1DJZA 3TC3A 1MXDA 3W6YA 2CWNA 4NHVA 4P8WA 3PAJA 6TIMA 5ABEA 2V67A 1TJ1A 2RGMA 3O05A 3VXGA 4JTIA 4XD4A 1S5VA 1YTEA 5CXPA 2FVKA 1E0WA 4GQGA 4I9MA 4ZODA 4M5PA 4HYRA 3EA2A 4EX4A 5EMJA 1BSIA 4CD4A 4PYSA 1AMYA 3AJXA 3QSTA 3E0WA 4BJHA 3UWWA 1KRAC 2H6RA 4PMRA 1OG0A 3QSRA 1TV2A 1YADA 4JN7A 1XX1A 4RNFA 1VLWA 5TAOA 1TQXA 4W87A 2AQOA 1WDPA 2Y70A 1IEWA 3WG6A 4JX4A 1BYCA 3SDOA 1Y0EA 3LBOA 3M0JA 3K4DA 5AHIA 3IGXA 3T42A 3M0VA 4URIA 2QQ6A 1CYGA 2XIQA 3PTDA 4PSRA 4PUWA 3AXXA 3QHNA 2OOFA 4I7WA 3NO1A 3HG3A 2JKEA 2NX9A 3GFXA 2ONEA 1IEQA 4PUUA 1UQYA 1UKTA 1L8PA 3PPFA 3THAA 1EOMA 4QP0A 2E9LA 1ZNNA 1LQ0A 3BSGA 3H4XA 2EF9A 3NG3A 4ZGYA 2XVPA 4NZ4A 3R0UA 2V8ZA 4JD4A 3W7PA 1TIWA 5A69A 3F2DA 4MB4A 1LLOA 4UB9A 4QGCA 1QU4A 3HTWA 2V38A 3ZJ6A 2ZUTA 2GQ3A 2GWNA 2QIIA 1PL9A 4KCVA 1ME7A 1RBAA 3NGFA 3SAZA 1I2QA 4HSNA 1E4MM 4ECLA 3LHUA 5I24A 2VZSA 3BH4A 1TJPA 2WWDA 4PRWA 3AFBA 1G69A 3RRXA 3VD9A 1PEZA 3EXSA 1BTMA 2ZIDA 3MWAA 3A3WA 1XLHA 5AC4A 2AGKA 3WDPP 4O10A 3R79A 2JKPA 1XIGA 2BDQA 3HN3A 5LIYX 3CV6A 3B04A 4QIUA 3WBAA 3BG5A 3GHRA 3CK5A 3AIVA 3VNZA 1JXKA 5GNXA 4W86A 2Y5SA 3S5SA 5LSMA 3NQEA 3UVAA 1P48A 5G2WA 5L6UA 1OYCA 3LZ5A 4NZ1A 5CZJA 5BROA 2FGBA 3QTPA 4ERAA 3WBWA 4PR4A 4BCEA 1QO5A 2OMAA 1SFLA 3C52A 1TPDA 1OCQA 3KL5A 2PTYA 4X0VA 2Z0IA 1PZ2A 2E6FA 5E1QA 3NZQA 2XWEA 3TTOA 3BGAA 3GBEA 3A4AA 3WD0A 2H9AB 2PDYA 1KGUA 4HGXA 3IGHX 1S2VA 3RIKA 4B9YA 2R1MA 4K8HA 3W70A 2C3ZA 3ITCA 4UXDA 1I2OA 4LNCA 1B3ZA 5G4WA 4R33A 4EXAA 5CBJA 1ML1A 1G94A 5JIPA 3SCQA 1FQ0A 4MHBA 3WUFA 3KBVA 2IXUA 4XO7A 3E0LA 5BMWA 1T6MA 1GQLA 1JG9A 4PC8A 2XIMA 4DAIA 1YYAA 4BY3A 2QDGA 4DJEC 1KV8A 2CBJA 4JBRA 1M7OA 3CQJA 3M44A 4DXKA 4KQNA 5CPQA 3K8MA 3U2CA 3I6RA 3W23A 4MDOA 2ATSA 3CAKA 1A3HA 2P88A 5IRPA 2G3IA 4AD3A 4XWUA 2PDHA 2JEPA 3FSUA 3GNOA 3H6OA 3W74A 4J3ZA 5K7JA 3NQ2A 3ES8A 1QTWA 3BZGA 3SCRA 1MQRA 2GGIA 1P43A 4I8DA 3NGJA 1B5TA 5I09A 4FO4A 3OPSA 3ARSA 5J04A 2WC4A 1UQZA 3CH9A 2ZZ7A 1FDYA 4QLLA 4M6UA 4ZQOA 1NU5A 3LRMA 4C6LA 1XF0A 2FZ9A 3K8LA 3GH4A 3L0NA 4D8AA 1XGZA 2PWVA 3OVGA 4XD5A 3WMBA 5LIXX 1KBIA 5AZ0A 1NFGA 4M51A 3Q37A 3WFZA 5REQA 4TR9A 1EQCA 4JQ4A 1XIHA 3WDJA 3H53A 3BURA 1JQXA 1MEWA 2QJHA 3M0XA 2I5QA 1N8FA 1ONEA 3WQ8A 4D6GA 4WDWA 3BUVA 1HT6A 2O9RA 3COTA 2WC7A 3DKJA 1TCMA 7XIMA 3BLEA 3PANA 3VNJA 1QR7A 4Y6GA 3ABSA 1H61A 2X2GA 3PVFA 2O9TA 4IIDA 2B81A 2W62A 5I6SA 2WBGA 2ZWYA 2AMXA 3N14A 4PCPA 5LA0A 2INEA 3NQ7A 1Q6EA 2XZ7A 1O5QA 1Z3NA 2Y7EA 5DRIA 1S2WA 4C1KA 4NZFA 2HPIA 1H4PA 3LHTA 5CPTA 3N2XA 7REQB 4ICCX 1G67A 4TU1A 4A4AA 2ABAA 1CGYA 1F6KA 3IGSA 1EPXA 3AYRA 5JXQA 4ZXLA 1LBFA 3RILA 1RAKA 2C91A 3LRKA 3TROA 3R4IA 1OD8A 4AEEA 3AYTA 3BAIA 1S1RA 4LUYA 2QMKA 2VWSA 3U5YA 2WKGA 1RR2A 3MUCA 3ZMRA 1W1TA 5I79A 3A9BA 3V0SA 3CBWA 3AI0A 3OVRA 3E2QA 2FJKA 3IJ7A 4E4FA 3SQSA 3CZ8A 2ZWZA 2YCLB 3LCIA 1I6NA 1EJSC 2WNQA 1GOKA 1Y8BA 3R58A 1KRMA 4GK8A 4OJYA 5F2IA 2ZVRA 1XIFA 1JDCA 3BJTA 4JTAA 1DWJM 3NJ3A 2G3NA 3B8IA 2BVYA 1ZP4A 3DYOA 3LQLA 4Q6JA 4UZSA 4YYCA 2FTWA 4RK8A 3W1TA 4XAYA 1HO1A 4F0MA 3POCA 5I03A 1K02A 2QJJA 1EH9A 5D2VA 3EDJA 3CZKA 1Q6QA 1EEPA 1VEPA 4REQB 2VFIA 3RCMA 1UZDA 5LNSA 4TX8A 4GC3A 1WAWA 4FLSA 4J5NA 3A23A 2GOUA 2Z25A 3HB9A 3DKLA 1U5HA 3VMPA 2BVDA 3UCQA 3L67A 4KRUA 3GDMA 4H4IA 5D05A 4CQAA 1CECA 3TP4A 1H0GA 5C71A 3K2GA 4JTTA 3W0KA 1X8FA 4F2TA 4A3QA 2YOCA 4OOUA 4GVHA 4JTJA 1FWNA 3NSNA 4XVEA 3U2EA 4QFUA 2RGLA 5JU6A 1KFKA 1OCNA 3GYCA 2V81A 3LOTA 1C90A 4LS0A 2E77A 3PZTA 1VRDA 3TYZA 3GZ3A 3UJ2A 2GQAA 4WIWA 4DJDC 3NPVA 1J8VA 3H8AA 3VIMA 2WNNA 4MZ1A 2BV9A 3P61A 4I90A 4J3VA 2GVGA 1JUEA 5CC5A 4FIRA 2Z2AA 3GTXA 3PZQA 1IR1A 4BWLC 3ANVA 1A5CA 4A3HA 3V5CA 4HNVA 1ICSA 3ATZA 1E3XA 3RU8X 2EJAA 3ZIZA 4S3KA 4NAEA 3VK5A 1Z7AA 3N9KA 5A8PA 1CIUA 3WK2A 4EACA 3LBCA 4HU3A 3VGFA 3GDTA 1GW1A 2OX1A 1XYMA 1F05A 2DT3A 2XH4A 1R7OA 1F8MA 4IT1A 1CXHA 4J3WA 3BMVA 2IPJA 1L6FA 4K8EA 5LIUX 4ONVA 3TA6A 3AS3A 1OG6A 3P14A 4WQ6A 1ZGDA 4HNCA 2OZ8A 3R6IA 2INZA 2ZTJA 2A3LA 4DJFA 4LT9A 2YCKX 3QPZA 3CAWA 1GYMA 4M1BA 1Z48A 9CGTA 3U2OA 1GG1A 4C7DA 5EMYA 1IXOA 4ZXOA 2ZRYA 4B5NA 3EBVA 3UXIA 1YPFA 3TZNA 4PB5A 3BO9A 1XUZA 1W3KA 4G56A 1TWDA 4R9XA 3A24A 3L4VA 4CLMA 1LQ2A 2W66A 6REQB 1HXJA 1HFBA 2KX9A 2XUCA 2XIIA 3OQEA 5I06A 1UBPC 3ANYA 3RITA 1XYCA 1G0CA 2VDIA 4B5XA 1EDTA 3WJWA 1DJYA 2HJPA 1I2RA 3ZVIA 4CD8A 5HMSA 4UMAA 4CKQA 3OZMA 3SN4A 1W9BM 4AZCB 1GOMA 4C1LA 3LENA 1E5JA 3LHVA 3P81A 2WM0A 4NNAA 1FKXA 2R9RA 1RPXA 4FOUA 3CUFA 1GOWA 1SZEA 4AHQA 2HK1A 1TX0A 5DEZA 2Q01A 1RCOB 1NELA 1SMDA 1OGGA 4MAZA 3K13A 1FWIC 2QYGA 3IAQA 2NX3A 3N9RA 1BYDA 4H9TA 4QEEA 4AQLA 3DENA 1G4SA 3FAWA 4S3CA <