1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclodextrin glycosyltransferase
publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
1WISA 3FT2A 3TCLB 2ZG2A 4KFZC 1OL0A 2O5YH 3OQ3B 2F54D 3K2UH 2DQEL 1A4JA 1E72M 2E9BA 4HS3B 3TH2T 3WHXA 3HZ3A 2PTTB 2WAGA 4U1IA 3QR2A 4WO4C 3OGOE 1MCPH 1UWGL 1U8PA 3C8KB 4P5TC 3C60B 4F9PC 1OD9A 5IGXH 1BQLL 4N1CA 5MEND 4WSJA 3VA2C 1UM4L 2FLBT 4FQHA 1KBKA 2ZCKL 1ES0A 4JFFA 3FFCB 4O2CB 4L8CA 2XUCA 1NGZA 3QI9B 1FH8A 1T21B 1OCWH 5C0CE 2H3NA 2FX7H 5I8CB 1NFIA 2YR3A 2A3BA 4PGBB 3BMVA 3VNZA 2AJZB 2NPLX 1M4KA 5BMFL 3SE9H 3EYSL 3FOMB 3DUSA 3HE7C 2R2CA 3CZLA 4PJHA 3WLBA 5DD6B 1FORH 5C08E 1K4CB 5HI4C 1MQRA 1KEML 15C8L 4UT7H 2W38A 3RWCB 3W2DL 2Q7NA 1DUZA 1LDPH 5KAQG 3BN9C 4O00A 4RMUA 2EDLA 4UFMA 4PJDA 3DMMD 3C5ZB 3VFVB 2H9GB 4LKXB 3CTTA 5HHMD 4OT1H 1KB9J 1MHCB 4Q9RH 5BZWA 1C93A 1JE6A 2VQ1B 4KQ3H 1OHQA 1BJ8A 1FC1A 2VMFA 2VOTA 4I5BB 3KLHD 4LCYA 1FA2A 2XGBA 3QJFA 3N1QC 1BQSA 1A02N 1EAPB 3U79A 1O5DT 4JQVA 3FFCE 3FO2A 4XHJD 4NQTA 5LKNA 2A6IA 1SEQL 4XRCB 4IRJD 5IB1B 3N1MC 4KMTL 2NQCA 1VEOA 2EDTA 4QHNA 2DQHH 2OTUB 5LQBH 1UWQA 1T0MA 1HP5A 3FQRB 5HGBA 3D2UD 4JIEA 2G5BA 1R3IL 2OZ4H 1J1OL 1T0PB 1XCWA 1V6VA 1KPRA 5I18L 5FUCE 4J3UA 3WELA 1A5FL 4YHLH 3TBVA 5C0GA 3PZNA 4ZTOH 4P8WA 1KCRH 1A7PL 3RTQC 4LHUD 2EE2A 1CZ8H 2A9NH 3DX8B 5GSRA 1QX1A 2BVQB 1UQZA 2P4AB 2IC2A 2UZXB 3DHUA 3EOAA 1IVLA 3UP1A 1KIPA 2CCRA 5F9JB 2VXQL 1BFVH 3DSFH 2APXA 3CIQA 2PF6A 3AICA 4KROC 1G7LA 3C6LB 3NIDE 3U7WH 3IAPA 3JZ7A 1KCUL 3JWOL 1HJVA 3ZQ9A 2X0YA 4P2OC 2IAMA 3MREB 4Z0XB 4JFQA 1IAIM 5FO9A 3GNPA 3VD9A 1QI4A 4DEPB 2AOSA 1WIOA 2EH8L 1EV2E 4I77L 1WCBA 4ZSOB 1CGUA 1I1CA 4LBEB 5T3ZD 2G4FA 4L4VD 3I9GH 2ZUQC 2FWOA 3SQBA 1I9IH 2ZIDA 1B0GA 3TBYA 4JFDB 4G8GB 3LMJH 1QSEA 1NDGB 4U1JA 2QKIA 4Z7WB 1F02I 3LS5L 3VDHA 1NGWA 5KSAA 2VDRH 3GB7B 3W28A 3DRQA 1H3VA 3QA3A 5EIVA 4XX1G 2B1HL 4NP4L 4AY0A 2J5LC 3R1GL 5DTFB 2Q8AL 5I71C 5F9DC 4PJXF 1KYOK 4ZD3L 4M62H 2V7HB 4XPFL 3D50A 2YPKB 5HHOD 3VCLB 4OIIL 1GPFA 3L9RA 3JV4B 5FO8A 3EBAA 2IMNA 5MERA 2AJ3A 1UKPA 2ADJA 4D1IA 1C5DA 5DLMH 1J11A 2CGRH 2DD8H 1HNYA 1TZIB 4JFFD 5F88B 1RUKL 2XXCB 3OSKA 4TUKH 3VXMB 3BC9A 5TD4A 1HJQA 5SWQA 5L2JA 3QH3B 4HK0A 3UESA 1J0IA 3FNDA 3BJLA 3MZGB 4JFDE 3BRGC 5JO5A 1EMTH 4MA8H 4OTXH 1UD2A 5J57B 1WEJL 2EPMX 1HHJA 4Z7WE 3VXOA 4ZAKB 4B15A 1DR9A 4LVHB 4DQOH 1WDPA 3F6LA 1RHHB 1GOGA 4G9FA 1HF6A 5DJ6A 4D3CL 3PDOA 4XP5H 5FKPA 4K55A 2GJRA 1W2VA 4TUJB 3HG1A 2BNUB 3D87B 4OD3H 4UQ9A 3HS0B 3QUXB 4MLSA 4M61A 4MXVF 4G6KH 4JAMB 1S5IH 2Z93A 2ZG3A 2ESVB 3AAZB 2Y06L 4ZMAT 5DK3A 3BFOA 4V1DA 5JBEA 1ETZB 3M8OH 1RK0B 3W25A 3WL1A 2D22A 4XBEL 1RJLB 5KVEL 2OWCA 2FNBA 2WZHA 3AY4A 1I3VA 3P73B 1A22B 4EBQH 2Q86B 1VRXA 4KRLB 1NMBH 2A83A 2FGWL 4K8RC 4Q22A 3ZT6A 4HH9B 1YN7B 4GSDH 2G75B 5F89B 3VXME 4R96A 1JZ2A 4M6OL 1R3JA 2BSED 3MUHL 1A6TB 3TYGL 5E2UL 1E1FA 4P46C 1EOKA 2GSGA 5T33H 4ONHB 3BVXA 4XCEB 3PWJB 4XCFH 1IQDA 4YHPA 4AWEA 1UG9A 2BSTA 4ZXBA 1TVHB 2YJQA 3AISA 3FO1B 2QBWA 5D93C 5C9JB 3CX2A 5DEZA 2OSXA 1VEMA 3LB6D 1UWUA 2E3ZA 4U7KA 1K8IB 4KKAC 3RM8A 4F8XA 2ZP0T 3OKKA 1UZ8B 1IC5L 4LGXA 3MGAA 1X3DA 4OLZL 4XPBL 3RY6A 5SWZE 5HOSA 5EUOA 3ILPB 3OX8B 3BW9A 2KUTA 3N85H 4UILL 3VFRA 3KR3H 1RI8A 1OTSD 3BPOC 2OL3A 1EO7A 4HKZA 4HHAA 3AS1A 3RNQA 4P9MH 5INDB 5DT5A 4JB9H 4O4YH 3QIWA 1RUAH 1GGCL 1KULA 1T1XA 1YYLL 1B9ZA 4FRWA 5ICYB 1UEMA 2EDXA 5T1DH 3OF6A 4JKKA 4OI7A 2ZKHH 1UXWB 2DKUA 3CHCA 5CBAA 3BRFA 3H8NA 4L8SA 2R2EB 4AEEA 5JPMB 4OUUA 3VG9C 5TH2B 1QSED 5CJ5A 5HD8D 5KSAD 3OLGA 3VRJB 3PQYA 5IR1B 1AJ7H 1DWFM 4H25A 3BH9A 3IFPB 4ODVL 4G8FA 4J4PA 3NMEA 5TE7H 2RCSL 3ZO0A 1EOMA 3MOBH 4AQ1B 2ARJB 3GYCA 4JREC 2WM0A 1AGEA 2R29H 4ZUSA 4ETQA 5IHLB 4CBPA 3H54A 3SKUD 4QRRA 1YQ2A 1TQBC 3BZDA 1ZGLA 4UU9A 5EOCH 4AENA 1DBML 3EYFA 1NCDH 5CEXA 4HUWB 3R0MA 3V5KA 1KG0B 4ZUVB 2WW5A 1S5HA 5T5NF 4GAFB 4NQXA 1MCEA 2BDNL 4PLJC 1KGCD 3QEGH 1KN4L 5KSBF 3RM9A 1OIMA 1BGAA 1N6QH 3TIEA 3ESVF 5DFVD 4F8QA 4WGVB 1UWIA 1KELH 1NC2B 1HYRC 4LVOC 3VNYA 3MLWL 3RWJA 2LU4A 4OM1H 4NC1C 5I2UA 1U42A 4CJ0A 4YC2C 1MLBB 3IDYC 4NRZB 4HTYA 4G9FD 5ELIA 3QHMA 1ZHBA 3ARGA 3GJFB 4JDZB 3ARBA 4X5XB 2DTSA 4UAOC 3AHYA 5GXBB 3HG1D 4WO4B 3GSQA 5L2KE 4LLUB 1ZA6A 1RVFL 4UV7L 1F6AA 1I1YB 2ICWJ 2WMHA 4AZBA 1P1ZB 4P5TB 1N26A 4RISH 4PRNB 4KDTC 4ZFMA 2R39A 4V1DD 3FQWA 5B8CA 2UY4A 1YUHA 2E0PA 2PYEA 3QEUB 2DAVA 1WBZB 4D71A 5ID0A 1T6VN 2IH1B 3Q5YA 5CJQL 4DN3L 5JW3H 2YD3A 4ZFOB 2E4TA 1Q6EA 1LEGB 4UQCA 4KKCC 3STZA 3ZYJA 3RWFA 1U0QA 1WZAA 3PGDB 3RL2A 2B8OT 5DGRA 2VLKD 1FO0B 3SDAA 4MB1A 3HE7B 4XAKD 2V17H 1HVXA 1KXVC 4PMQA 3W5MA 4ZXBD 1ISWA 5IKCA 5M03A 2JB5H 1RZKC 3CFJB 3RUGA 3NSXA 5A6MA 3N9GH 4LLMA 4PJEB 1PEZA 4G8EA 3F58L 1FYTA 2CDGA 2COQA 3QUKA 5DMYA 2QPSA 4LIQH 4OZIF 1U8IA 3VWKA 2EDQA 3MQIA 3VW3L 3V5DB 3TVMA 3DX3A 5J06A 2NNAB 4KI5C 5CD3A 2OR7A 1JNNL 2ADGB 2HYMA 3HPLB 2AK4A 2YXFA 3KEHA 3MRDB 5C0RH 3ARFA 4ELME 3HPJB 5CEZL 3V5HB 3X3GL 3ARWA 2V3DA 3GK8H 2EIZB 2CH8A 2G5RA 1LO3L 4S1QH 5DRZA 3JBG7 2BVPB 3BAJA 2XVLA 3OF6D 1W91A 1AGDB 5E8NB 5F1OB 3MLYH 4ACZA 2VDQH 2F53E 1RZJH 4A3YA 3S8WA 1AGCA 5ITFB 1BVKA 3F62A 5EC2B 3RTQB 4JN2A 5E9DB 3W6MA 4E2OA 1FNSL 4P2RA 4OCMC 4P2YA 4CVZB 4XCYB 4JFPB 3B2VL 1JF1A 3CFCH 3U7YL 3PQYD 2Z8RA 5HGDB 5DMGD 1KOAA 2CLRB 1MUJA 3E3QC 4OF0A 3QDAA 5D7SH 1L9NA 3TIDB 1AGFB 4K2UL 3BCFA 4BUHA 3ARZA 1M6OA 2D23A 1HQ4B 2GTWA 1T0OA 4JO1L 3BVTA 4KROB 1FCGA 3QUZA 2J74A 3S4SG 2J7LA 4FK9A 1DQQA 1U3HA 5CSUA 1IKFH 2E3VA 4GRLA 4P2OB 4OZGA 1L7TH 3BSHA 4GQ9L 2ZUVA 4YFEA 2DQXA 1F3JA 4DZ8B 2BJMH 5C07E 4X4YB 1RZIA 4QXUH 1HHGB 3OL2A 3RO8A 3Q2CA 4PJFB 2OMNA 2WPGA 2ZUQB 5AAWA 1A4KB 1OGTA 2IPTH 3A6BL 1R86A 2XKUA 1I8KA 1F8TH 1NBVL 2G2RA 3P3YA 1UA6H 4TVSa 2WINA 4RMWA 1ORSB 1AHWC 3DLQR 4N8VA 5E9DE 4GAYA 3DIFB 5CP3A 5J7CC 3H7LA 4FQIL 2Q7YB 3P4NA 2YD6A 4RGND 4KI1A 1U95A 4LSSL 4HXAH 3VI4F 1PKOA 1U8NB 1CPUA 3GSRA 2ILLA 1XD0A 2J5LB 5CP7A 1IQWH 3QXDB 1P9MA 4TOYH 1ZE3C 3ARGD 5I71B 3CUIA 1W3JA 2J47A 1OT2A 3ARBD 3EIFA 4KK6C 1UYQA 7FABL 4L8BB 1JPSH 2A74B 1CR9H 1QVBA 1WAAF 4GLRI 1GXEA 4HUUA 3K1DA 5GJTL 3H55A 2YN3A 2JCCA 3EO9H 4TNVK 1FZJB 2F19H 2QSCL 2PYED 4M00A 4JQIL 2H1PL 4L3AA 3VFNB 2BNJA 1D9KD 4PJFE 1XGTA 2DBJA 1GQKA 4MA7L 4B0MM 5F44A 3SDYL 2DTML 4PTTA 3D4YA 1FLRL 3VE0A 4OZHA 2OBGA 3SDAD 1DSFL 3BMWA 2VDLL 2BMKA 5HI5D 2BNRA 2BVYA 3Q6FA 4Q97A 3MRGB 4R0LA 4YBHA 1HHIA 3CDFA 4JRXB 2VR5A 2DQDL 1A21A 2VWEE 3EOBB 4LRNH 1X5LA 1FYTD 2BCKB 4MZ2A 4HDIB 4LHUG 1OAYH 2PI6A 1F42A 1GZJA 5A8QA 6FABH 3LEXA 3TVMD 2NY2D 5GGVH 4H8WH 5CBEA 2C8NA 3QEHA 1JGVL 4PY7B 5FDWA 4ZFFA 3GJFK 2AK4D 5FOJA 3IRPX 2EZ0D 3D1MC 3ARFD 1J10A 4KUCD 4NQVA 3BSZL 1QNOA 4KVNL 3RPIA 3DX9B 3WV0A 5BQ7A 1UXSB 3LY6A 3PE9A 1W2PA 1NBZB 1QEWA 4P46B 1CXHA 1YEIH 4FQLH 4O58L 3GXFA 3ULVH 3SCTA 1M01A 1OQXA 2EIEA 2C1OB 4NZRL 2R56L 3P4MB 1C1EL 3UTSE 4QRTA 5D93B 4PR5B 1DBBL 5ID1B 3OJVC 5FIPA 4JFXB 4UTBH 3D3VB 5IVXE 3WNOA 2FEDD 5FYJU 4JRXE 1HZHH 4FZ8H 4HH8A 2OSLA 4PLOB 4IS6A 4LGPB 5IFPA 1Y7VA 3QULA 2BFGA 4M82A 5IMKB 1Y18A 5CJXA 3KPPA 3KLHC 3MO1A 1J05B 2OWWA 3MRKB 1OAUH 4X0KA 2WWDA 5IJKA 2MKLC 5KVMC 1Z32X 2QQQA 3OMZA 3P11H 4FMVA 3D6GA 5HDBE 2DKMA 4XHJC 3BGMB 3BPOB 1F2QA 4HS6A 4TNWF 4Z2LA 1HI6A 1U92A 1CGVA 1XGQB 4IRJC 1NANH 2C4XA 2P5WB 4LCUB 3QUZD 2KKQA 4JGMA 2PWFA 2WIIB 4J8RB 4X6EB 3EZ8A 4G6MH 4L8DA 1U3HD 3LSOA 3DV4B 3KPMB 3MBEA 4AIZA 4L9DA 4TULH 4JJ5B 1S3KH 3VFOA 5E08H 2GK0B 1FHDA 2EABA 5A16A 4XP1L 3F7RA 5C0FA 2R0WH 1LP9E 4J1UA 1E4KC 3MCG1 1CECA 3L3IB 1S9WA 3WN6A 4NWUL 3HR6A 1K4DA 1E6PA 2W4XA 1F58H 4AMCA 2HJFB 4JFHE 1DLFH 5CINH 3VG9B 2DL2A 2XWJA 1ZBVA 4XPTL 1KACB 3D3VE 5GGQL 3JTTB 3TNNB 5DEFA 1JD9A 5C71A 4Q6IA 2JJTA 1KPUB 2J88H 1ZS8B 1GOWA 4DVBB 5E8OB 2VDML 2ZUWA 4TOQA 5A2AA 3F5WB 5EIIB 4H5SA 1H8NA 4JREB 3GH5A 4FQ2L 5T1KA 2P5EB 5C0JA 2OSWA 5CLWA 5BO1H 2P5WE 5ACLA 1T89C 1S7TA 3U9PL 5ADOL 1BMGA 1HINH 1R3HB 5GGSB 1RJYB 3RZCA 3X12A 2D7TL 3D0VA 3HMXL 5HI3D 3D25A 5GGRY 4BQ5A 4FABL 4IPNB 2IALB 4OLYL 1UKTA 1QR4A 4PGEB 5E5RB 4I0PA 4LDEB 2OK0L 1MJ8L 4LVOB 3LN9A 1O7VA 2CRYA 2UWEF 3EW3B 5A2JH 1VFAA 5MP6L 1B3YA 4E5XB 2BNRD 3HUJF 4AEHL 4DGYL 4YC2B 3BAEH 3FN9A 3IDYB 4AIXA 4ALAL 1IL1A 3WD4A 3FONA 3QIBC 1FE8H 5D1QA 3AIRA 2NY5H 3L3OA 4OBSA 4QGYA 4UAOB 3ROLB 4YJZL 5C7XL 4WFFE 5J9PA 3T0EA 4NRXA 1OW0A 5FOOA 1FYHB 2P5EE 4PPTA 2NYYD 3WEZA 2UZIL 1G7HB 4J28A 1QLRB 2H32B 1KSRA 3CZ8A 3IB4A 4HKJB 3VXSA 1F00I 1FNLA 1YEFL 4W4OC 5AYBA 5DJZA 1RIHL 2J4WH 3LKNB 1C5BL 3NCYP 4HC1L 2LAAA 1QLEL 4ZO8A 5FA4B 2HRPL 1PZ3A 4RNRB 5FKAB 3WDIA 4JPIB 1WQVT 5KS9B 3F65A 3WN5A 1GGBL 1JYVA 1UA3A 3D52A 4Q74A 2I9LA 2X4SB 3GSNB 2WC3A 5EUKB 2YLLA 5AC4A 3APGA 2DSZA 4TVCA 4NC1E 1JNJA 2EE3A 1DP0A 1T0NA 1LO5B 4IOFC 3O3DA 3WO4C 3AJ7A 4HWBL 3ZTJH 3W5NA 1KT2B 1PW3A 2AABH 3MFFB 4ZUTB 3FAXA 5C0IA 4LLDA 4ODTL 3T3ME 3MODL 1OM3H 3NN8A 5DK2B 3BZFB 1NAMH 1GOFA 2AXJA 1ZLVH 1RJZA 1W72L 1KGXA 2VI0A 3GSXA 4JQVC 2P42B 1EDQA 2D7OA 3KAAA 2DIEA 5D8JL 1OB1A 1G01A 3IJSA 2JIWA 3WD5H 1LK3H 4PRAA 1V5JA 5BVPH 1NH6A 3MRMB 3MBED 1NUNB 3MLPA 4LQFH 2XZZA 3EJZD 2VLLB 3HB3D 5EZIL 5KS9E 3SCWA 5DI8B 1UCBL 3NSMA 3BP4B 4GG8A 3LB6C 1INQA 1I4FB 5TF0A 4YE4H 3ULUH 4HIEB 1RU9L 2V2XB 4MDIB 5I1KL 5GSVA 4PB9H 3DX6B 1NOFA 1BYBA 5KEZA 1YC7A 1JPGA 3T04D 1F90H 2GSIB 2K7QA 3RU8L 4AZHA 1OTSC 1YY8B 3ALWA 4JHWH 2DIJA 5BCAA 2L7UA 1RZFH 3D3AA 2AJSL 3O2DL 4KI5E 1NFDA 3QNXB 2X2IA 2VKXA 4POYA 5AY7A 1GZPB 2WWKO 5T1KD 4QTHB 4ZNEE 1U8KA 4YO0B 1G7MB 1JK8B 1LE5A 4AW7A 5TDPB 2FLRT 1QNSA 1KLFA 3DROA 1ISZA 4ZXOA 1VFUA 1I9JH 2HTKD 1MF2H 3RZCD 3ZM8A 3ARDC 4HF5L 4RAVA 1L7IL 1ITCA 3SKNA 3SCPA 4UNUA 3PHQB 3P9LB 5HD8C 1U58A 3CFBA 4LSUL 1VPOL 4I0PD 3EYOB 3CZFA 1AHWB 2K3TA 4OGXL 5IB2A 5IW1A 3VGGA 1RZGA 1QWUA 2E6PA 3GO1H 5T3XL 3VFTB 1NL0L 5I17B 5D1QD 5D9SA 2FO1A 3AS0A 3E3QE 3S36H 4MAYA 5C0BB 4Z2JA 2XNAB 5HGHA 1HQRB 3T0ED 1XYFA 1VHPA 3N0PB 3GHEH 3MRQB 3I75B 1ZT7A 4WJ5B 3VJ6B 2PWGA 5EC1A 3B9VA 1I1AD 1HL9A 1B6UA 5K9QI 3PXHA 2OSYA 4BH7B 4P2CG 1PQZA 4Z7QE 3VXSD 4DWHA 1SHMA 4I4WB 3ARUA 1A9EA 3VG0H 1C92A 1JDCA 4QP0A 1NWRA 5J4MA 1ED3B 3HKFA 3MXVH 5IVZA 1AXSB 1CWVA 2BSSB 1X5XA 2YKKA 5DFVC 4D8PA 1UEYA 3GGWA 2E7CA 4UB0L 2F54B 1TCRA 2X6MA 2P49B 3EOTL 1NBYA 5EOCJ 3BVNA 3V6ZB 5D7KD 1CGSL 5DUPH 3RIAK 1V0NA 5MEPB 4Q58C 3S4SB 2Y7QB 2IEPA 2MNUA 3RL1A 5IMOB 2W60B 1XH3A 1BVLA 3H7BA 3RX8A 4G43B 5MENB 5E03A 1MNUH 1NUGA 5HVHC 2R0ZL 2XSBA 4D6DA 4NN5C 5KSBA 4JFUA 3O11A 2DGAA 3WE6B 5JW4N 4MPKA 4ONGL 1T83A 4QGTA 3OR6B 5ETUA 4WENB 1JZ3A 3WUEA 3HCVB 3BCDA 2X4QA 4D1JA 5IHSA 2VCBA 5LYRA 4LDLB 3UTPE 3E0GA 3CO4A 4BKLB 4R3SB 3NABH 1LEIA 4ZO6A 2F54E 1KB5B 1EEZA 4YDLC 3BEVB 3B3IA 3WH8A 1V7NH 1Q9OB 1MIMH 4U1MA 1GOKA 3O8XA 3HC4L 4JL1A 5DQJA 3PWLB 4O02L 3HNSH 3BKYH 2CBUA 3GXMA 1E5NA 2EDJA 1ZEAH 1E70M 4LSRL 3RY6C 4AZCB 3BXNB 1H5VA 5FUOH 4Q7DA 4OLVL 3W9EA 1CXEA 2GUOA 5CCKH 3EJPA 2CBJA 1UH4A 3ZR5A 5LGKA 1ODAA 2YBRB 3MRIA 5KN5B 1ODUA 1S7WA 2G41A 4GG6B 1OQOA 3IU3A 3TV3L 1KXTA 2BP3A 3PV6B 4IRJB 4ZUUB 1P7QA 2XI9A 5E09A 4XWOD 1AP2A 5JZ7D 3D2UB 4BSVB 5FYJD 1AY1H 3MRRB 4LCIH 3OB0H 4XHQA 4GKSA 2WNWA 1CFVH 1BSIA 2F1BA 1FZKA 4MDJA 4L8SC 2FR4B 1I1FA 3U0PB 4NM4H 1E4JA 3QSKB 3BUPA 2EECA 2WP3O 4PBGA 3FT4B 1IGFL 1WC7B 4LHUB 5AZ2H 4PG9A 1HXJA 1TTFA 1NDMB 2CLZA 2DIAA 1OINA 5J1TC 2XVGA 5IMMB 2R69L 1CFSA 1F4YL 1A1NA 3VIJA 3G6JA 5ITBL 2OR9H 4PS4H 5DDHA 5DMGC 2PKDA 2QQKH 4U3CA 3HC0B 3HZYA 5EOQH 3MFGB 1TQSA 5FCSH 4PGCB 5CSZB 5ALBL 5FCUL 3FKUS 3MOQA 4MAYD 5I79A 4GG6E 5A6SA 4MCZB 5E5MA 1CE6A 5F93C 1TA3A 2GIYA 2EYSA 3ULSB 3PTKA 2UYLB 4L4VB 1CXFA 4F15C 3WD1A 5CEZD 2WBWB 5L7XH 2HKHH 4Y8DC 3A21A 4TSBL 3FT2B 1ZAGA 3GBLA 3MV8D 2WMGA 1FAKT 3QHTC 3WFEL 3VDBA 4YHKL 1DE4A 2R1XB 4RGNC 3T65A 1H4PA 3ZTNH 1SYSA 1G7PB 1OP3K 4Q0XL 2PUQT 3WHXB 3DGGA 4H26A 2X4UA 4A6YA 3ARGC 2O92A 2QR0A 3CUJA 4PJAF 1VIWA 3ARBC 4GAGH 4U6VH 5DRWB 4U1IB 4LX4A 5HHOB 3QIBB 4HPYL 4MA1C 5TQ0L 4F2MA 1RUML 4OGYH 1AC6A 2VDPL 1S9VA 3CIVA 1U8PB 3BP6A 4I3SH 2MTPA 1KJ3L 3V6OA 3T2PA 3C2AL 2XIBA 4PTUA 5ISZE 1XF1A 3BZEB 3RJXA 5GIRB 4JZ5A 2D4FA 3QZWA 4HK3N 1AD9B 4EI5A 1HKKA 4W87A 4DGVL 4JFSA 1KXQE 4WWKC 1ES0B 2BXZA 4FP8L 1NGZB 3BPLC 5TJWK 5T3ZE 1D9KC 4JN1H 5LGJA 4L4VE 1NFIB 4AZ8A 3PZUA 3DX1A 5CZXD 2UUDH 5C2BH 1FAIH 3G9AB 3SDAC 1Z5LA 4YNYA 5DZOA 2R8SL 4PJHB 5HI5C 3B8YA 4XVSH 3TA3A 3RI5K 3O6LL 1OAZL 3HN3A 4O5LL 3LQAL 2CIIB 5GZOD 4C7GA 2XVNA 1EXUA 2ZXQA 3W0KA 1DUZB 3O8XD 5D7LA 3VXUA 1M7IA 4OAWB 1MWAL 1VENA 3FY1A 1DANU 3O3AB 1UACH 5GNYA 4PJDB 2MCPL 3WO4B 3O45B 3BH8B 3FFDA 2VRAA 5HHOE 1ZOXA 5DWUL 1VESA 5BZWB 3P0VH 1HNGA 3TVMC 2NY2C 3QXVA 2XG5A 3TN0C 4LSTH 4N8VG 4P4KA 4H0IA 5DJYB 3V4PH 1XF3A 4LCYB 2FHCA 1OWWA 4MD5B 5I1CL 2VH5L 3QJFB 2EZ0C 1JPFA 3MXWL 5JW4R 2HFEA 2E9MA 2V38A 5MEOA 1ODZA 2F5BL 1P7QD 1CG9A 1Y6NR 4K3HA 4F7TB 1XH2A 1T0MB 5HGBB 1A0QH 1BFNA 1R0AL 3HI1A 1BQUA 3AFBA 2G5BB 5JHLL 4TYUA 5TPWH 3V0VA 4WF7A 1KPRB 1QVOA 2X1IA 5IFJB 4MVBD 4GXUN 4PJHE 2MOVA 1NWTA 1MCLA 3HNTL 3TBVB 3OKOB 4WW2C 4GO8A 4GKZA 4M6NL 3EYUL 2FEDC 3NPZB 5D9MA 5AWNH 5GSRB 1OLLA 1NMCC 3EHBD 1OGBA 1DQTA 1WZLA 3BUBA 5CD5D 3QHNA 3MJ7B 2UZYB 3AREA 2WC4A 1UJTA 2R0LH 4EXKA 3BUDA 1CL7L 2G9HA 4FF5A 3WSQH 2HKFL 1XF4B 5IB3A 1BFOB 3QUZC 3BKML 1U3HC 3EFFA 4CD6A 3WDJA 5FO9B 1U30A 1SJEA 2X7LA 2NW0A 3M17B 4P5MA 1E4XL 1YNTA 4AIEA 3BE1L 4M03A 1G6RH 1OPGH 4HC1A 5H35A 3AMGA 2BFVL 5HBFA 4LF3B 1X44A 3OPZH 1DQLL 3UCRA 1BJMA 5CXPA 4ORZC 1B0GB 3TBYB 3ARDB 4XZWA 5FYKL 3LXCA 4W6YB 2Y6SD 1QSEB 4U1JB 2QKIB 3UYRL 4KVCL 3F6IA 2H45A 1MEXL 1NGWB 5M94B 3DVNB 4MNHA 3DRQB 1U8LB 3QA3B 5ESQA 3GMNA 4DAGH 12E8L 4PJCA 3VDAA 1OD7A 1A3QA 3CLFH 4LFHG 2BVOA 5F1KC 2VC2L 3GKWH 3QO1A 5TE6L 1YY9D 4RIRA 5E99L 1CIDA 5L9DL 1E3ZA 4GT7A 3MRNA 3L9RB 4AZ7A 1GZQA 4X7SH 1KEGL 5DK0A 2AI0L 3PABA 5DMIL 2ADJB 4EI5D 4N0FB 2VVSA 3QQ3A 1C5DB 2FE0A 3U1SL 5ILTL 1P5VA 4YZFE 5DQ9A 3ARSA 5HI3C 5D8ZA 1ADQL 3QHZL 5L2JB 5FYLH 1SJVA 1CXLA 3G08A 4PRPE 3EGSA 4Y88A 3WNPA 4XB8A 5JO5B 1LWRA 4MJ5A 4RZCA 3H6JA 5HDQL 1OSPH 3L4YA 2J25A 1QSEE 4LSPH 1HHJB 3TA3D 4NJ9L 3OXRB 4R0LC 3W24A 3CFEA 2F8XC 4G9FB 2W9EH 1UB5A 3PDOB 2I07B 1G1CA 3VXUD 3HG1B 4TVPL 4S1RH 4YDIH 4K9EH 4AL8H 5BV7C 1G0XA 1XR8A 3VSTA 4KZEH 2NYYC 4V1DB 2VZOA 1JN6B 2DQCH 1R87A 3WF3A 1F4WL 4YHIA 3RX5A 3CXHJ 3NVQA 5HVHB 3GSOA 1B31A 4NN5B 4QAWA 2X4PA 4RX4A 5FA3A 4DO5A 2EPKX 1OGSA 2VZ1A 3OAZH 1TCMA 4R96B 1R3JB 2VLKB 3KYKL 3O9WA 5KW9L 5A6LA 1UOKA 4PJBA 2DQGL 2GSGB 3AYRA 4HBQA 1B4JH 5IW3A 4CJ1A 2BSTB 4HCRH 4YDLB 4FQXA 3GBMH 3GH4A 1S7RA 4P9HC 1EFXA 2GT9A 3NZHH 4G9FE 4IMLB 4HBCH 1VADB 3RWHA 1EJ6A 1DVFA 3OKKB 3RWDA 5ABFB 3HG1E 4K3EL 4Y4KD 4W7WA 3KJ4C 3ARED 2OI9C 2EBNA 1FZOB 4K7PX 5EUOB 5C1MB 1QO3A 4CKQA 3BW9B 1YMMA 1UM6L 1BYDA 2Q76B 4Y0GA 3MGOA 4KTEL 1CXKA 2Z35A 1F3RB 2OL3B 4KRPD 5GISL 3RKPA 1N8ZA 1ZV5A 4HKZB 4HHAB 1PX4A 5BS0A 3RNQB 3A4XA 2XTKA 4HZ6A 3B5GA 4R4FL 4HOXA 1KV3A 5EZOL 3MBEC 2R4RH 4RFOH 1T1XB 3DTXA 1ZS2A 2OW7A 4ML4A 3EJZC 4QT5A 1KIRB 3HB3C 2VLKE 2BRRL 4MD0A 5DUMH 1FH9A 3FMGH 5JOFA 5A6AA 4X4ME 3GSVA 1E4WH 5HHXL 1QI5A 4L8SB 5IJVA 3BDBA 2PB1A 2WANA 3KPNB 5IEKA 3CMJA 1BGXH 3H9SA 2NY7H 1E3XA 4C56E 2RFXB 4I3GA 4G3YL 4NKMA 5IHUH 3PQYB 3NIDF 1QR1B 4H25B 3MRCA 4Q6IC 2JJTC 2OQJA 1QKZH 3QCVL 5EBWB 5I77A 4Z2KA 4KV5E 1GGYA 1DL7H 4JM4L 1S7SB 3LS4H 4L4TA 4LYPA 3TV8A 2XZCH 1P2CB 3BVUA 4GINA 1IGML 5BYWA 3UBXI 2VITA 3P30H 5SX4H 4U4BA 1XSIA 3HAEA 4XVJH 1ZGLB 4AENB 3EYFB 5CEXB 4ZFZA 2HG5A 3PIQA 2HTKC 4F15B 1S5HB 3RZCC 2C4FT 4NQXB 4AH2A 2YL9A 2WZIA 1G7IB 4PV9B 5JMRA 3TIEB 3R06A 4W8BA 3IJHA 4WW1A 2NT1A 4ZOBA 1GC1H 1PD6A 5DT1L 2V5DA 3RWJB 2XQYK 2V3GA 3MNVB 2XQBH 3WXWH 4RGNB 1T7YA 5DSCB 4BQ2A 1HDMB 2Y1VA 1N5YH 5E2JA 3ARGB 3EJSA 1WP6A 5JLZA 3VFPA 3ARBB 5F72S 2I60H 3GSQB 5D7IE 4MA1B 3T0EC 1ZA6B 4OLUH 1GCYA 4ODSH 4XP6H 1FGNH 1ROWA 1I1AC 5K9JL 1OW0C 2VX4A 4GAJH 2PF0A 1CDIA 3SE3A 1LO4L 1HTYA 4OGZA 1YEHL 2EH7H 4WWKB 1YUHB 2PYEB 1L0PA 5ID0B 4W5ZA 3BPLB 3QQ9D 4RX4D 1D9KB 3F12B 4Z7WF 3MMUA 4RL3A 3QFJA 3RWFB 1W9XA 2JEPA 3GIVA 1IAIL 3RL2B 4QRPA 3BEWA 1IEAA 3O9WD 4G7YH 4UV4H 1IC7L 3MLRL 4S2SB 1GQLA 2PN5A 4N5UA 4OZFA 3LV3A 1Z2KA 3SDAB 3WN5C 3RY5A 1YYMH 2DQUH 5F96H 4NDMA 3OKDA 4K7FB 4H88H 2FZ3A 3LXBA 1UWSA 2R23A 3L4TA 3MYZA 1OGAA 4FQXD 4RGNE 3RUGB 4LLMB 4TSAL 2OYLA 1EFXD 4N1HB 4M93C 4YHYC 1OP5H 4PY8I 4G8EB 2ZX9A 4YQXL 1FYTB 2CDGB 3QUKB 5D1ZA 3S34H 5BROA 3QQ4A 1TMQA 3TVMB 2NY2B 2E6QA 2NY5C 1YMMD 1CI5A 4QXTA 3G5YA 4ONFH 4JFOA 3VIIA 3ALGA 2AK4B 4IIQA 32C2A 5EU7E 4R4BA 4KPHH 3CZGA 3TESA 3VILA 1YHTA 4X99B 2F58L 5BS0D 1KFWA 5I1LB 1DFBL 3VRIA 4PJ8A 1ECEA 1H3GA 1G9MH 2XM2A 2XN9D 1IGYB 5H94B 3FN3A 3MJ9A 5C92A 2TAAA 1KBBA 1U3JA 1QBBA 4MMZC 5E5UB 1ZGLM 2WBGA 5LCVL 1RIUL 3D5OF 2KH2B 1VERA 2DS4A 4ACZB 5ENWB 2QQNL 3NH7H 1BVKB 1MI5A 1H3PH 4WW2B 1IEBA 4NWTL 3CSGA 5E0FA 1NMCB 4DW2L 1JF1B 4UT6L 2RQ8A 3FRUB 1ZBCA 4PRDA 2DWEA 4IOSD 4NF7A 1GJIA 3SGEI 4NIKB 5GGTA 4JO3L 2ZJSH 1VBUA 2GTWB 3L2MA 4L4TD 1FP9A 3QUZB 4EI6A 4XWOC 1NEZA 1N64H 3ZL4H 4WKHA 2DQJL 1DQQB 1IFHL 1U3HB 2DDQH 2FX9L 2PR4L 5KG9A 5J6HA 1F3JB 2HA1A 4M7LH 4JCMA 1VGKA 4JFYB 3O6ML 3GMPA 1OGTB 1P6AB 2DQEH 4ZE5A 1SJHA 1I8KB 1TETL 4PD4J 1Q9WB 1BHGA 3I50L 3SKMA 4W8LA 4OFDA 3TO4A 1XGRA 4GAYB 3L4XA 4NO2A 4Z7UF 5GPRA 4UDUB 3P4NB 5IW6A 4CADA 4FN0A 2DI7A 3N11A 1BQLH 3L7EA 5EZLA 1WSST 1HIML 4GI9A 5CJBA 4YHOL 4LIQE 2EO1A 5C8JA 4KUZL 4H04A 4PRBA 4XC1L 5GRWA 4MJIB 1KCVL 5BMFH 2JCCB 4U1LA 3IFLL 2E7HA 3EYSH 3SCUA 1HXYA 4J27A 1MAKA 4UQDA 3TEUA 2WMJA 1RFDL 4Q6YA 3S88L 3KPTA 4DO4A 5CPQA 1XGTB 1IAOA 1BOGA 1KEMH 2PCPB 3LOWA 2CKRA 15C8H 3EZJB 4PTTB 4QRPD 4TNVF 4OZHB 1N0LA 3IF1A 2Z91B 1CBVL 2BNRB 5T1LB 2WBKA 3SGDI 2DSWA 3RPMA 4R0LB 1XCQB 4DKFL 5C0EA 1OGAD 1C3FA 3T3PE 1CS6A 1TQVA 1MREH 1DWGM 5J13C 2EDWA 3WMBA 1BD2A 2Z1KA 3WXVL 5BV7B 3UBXA 1JL8A 1ZK9A 4AM0A 4KTDH 5D1ZD 3S7GA 2ATPA 3IRZA 2AXGA 5KSVA 1SEQH 2HVKA 3LEXB 1TFHA 2IBGA 4KMTH 2ZUMA 3DX0A 1IBGH 4RDQF 4MJIE 2JCCE 4WY7L 5FDWB 4D9QE 1BQHA 2R4SH 5CZXC 4GRWF 4NQSA 3WKML 4NQVB 4HUVA 5I18H 5JXEC 3L5WA 4YX2L 4I0CC 1A5FH 5AZEH 5BQ7B 1PIGA 1XHGA 2MHAA 4JHAH 4PJ8D 4U6HA 1A7PH 4OZ4A 4F57H 1G6VK 2K1MA 1E1EA 4XPGL 3GRWA 1EBPA 1H5BA 1JF6A 5GZOC 4OZHE 1S8DA 2YDQA 3O8XC 1QSFD 4QRTB 5D5MA 1LK2B 1D6EA 3FB5A 5LWYL 4IRZL 4QXGL 5F97E 4P4RA 4PBWD 1MI5D 1QZ1A 1W3HA 3L7FA 3ZDXE 3G5ZB 4WFHE 4AD0A 2RJMA 3UEZA 5H37H 3KJ4B 2JELL 1Y18B 3KPPB 4OFYA 2OI9B 3MO1B 3PF2A 3JWOH 5LA1A 2DWDA 3VXRA 4X0KB 4P59L 1J18A 4AD3A 1EEYB 3IS1X 4HS6B 2XN1A 1U92B 1IARB 4IM8A 3EDEA 3WQ4A 3SDXA 4OZOA 2DM2A 2GQHA 4L8DB 1IT0A 4FMFA 5CWSA 3BISA 3MBEB 2BSRA 4AIZB 3D39A 3EJYD 5DFAA 3HMWL 3IGAA 4MVBC 2YK1L 5A16B 1CVSC 3MPCA 3QZWG 3LS5H 5C0FB 4PJEF 3RBSA 3F7PC 4PG2A 3W82A 4X83A 5LBSL 2YPLA 1RZ7L 2D4DA 3AMCA 1GGTA 1S9WB 1K4DB 4NP4H 4AT6A 3R1GH 2Q8AH 1S7QA 4U6TA 3FQTA 4ZD3H 2X42A 4KAQL 4XPFH 5I73C 3MI6A 3AHZA 1YNKH 3O0RH 4DO6A 1NARA 4CCEA 1P4LA 1R3KA 2VAAA 4NRSA 2YD1A 4OIIH 4Q6IB 2ED9A 3VFUA 2ORBL 2F1AA 3CMGA 2D31A 1KC5L 1YDPB 4UZUA 3VIFA 4NUJA 5T1KB 1RUKH 5C0JB 4LASL 1FVDB 1S7TB 1W0YT 3U57A 5FOBB 2HJKA 4OLXL 1VFFA 5K9QG 4M8UA 1R46A 2ZNXA 5TDNB 4DVRH 3SY0A 3RZCB 1WEJH 3X12B 1MELA 1G5AA 3D0VB 3PHOA 3D25B 5KBNC 1PG7X 2Y6SC 1XV8A 5IT2L 4PJIA 4D3CH 4F7EA 1XFPA 5FECA 5B38B 2F74A 1QNQA 3SKJL 2DQFA 3FB6A 3HZMA 1PX8A 4YXHL 3RGVA 2B2XL 1T80A 1NCAL 1IV8A 1IL1B 1F11A 1GOHA 4XBEH 3FONB 5KVEH 1YY9C 4Z76B 2X5PA 5DC9B 3L3OB 1KTLB 5SWSA 1JFQL 4LGRB 5ACMA 5B39A 2VE6A 4PRIA 3CZSA 2FGWH 1BD2D 3T0EB 2FECL 3V6OC 4TX8A 4NRXB 3I6LD 4EI5C 1GOMA 4RSVA 4LLVB 1I1AB 3CGTA 4QXWA 4PJFF 4WV1A 4M6OH 1NC4A 1QFWI 4KJQD 3TYGH 2VQTA 5L88L 3R8QA 3OGVA 2D9CA 3UXFA 5HHQA 3TO2A 2BY1A 5DA0B 4QYOB 1C5CL 5DJCA 2EACA 2ZX7A 3ZOAA 3SCVA 5IESH 4RMSA 4CMHC 3TA3C 3WN5B 4V27A 3WIHL 1MJUL 2I9LB 4M1RA 1IC5H 2A0LD 2I27N 3AQUA 4OLZH 4XPBH 4ZFOL 4XGZA 1T7XA 2X4NB 5A8NA 2IH3A 4GW5A 4UILH 4M93B 4YHYB 2VL5A 4GBXA 2KQNA 4TRPL 3FO9B 1FO0L 4UOW0 3WEOA 3LPOA 3T0EE 3AHTA 4LLDB 1W8OA 4OFYD 1B30A 3NN8B 1OD8A 3VXRD 1GGCH 4DKEL 1RJZB 1YYLH 2C7FA 1A6WL 4UIMA 3GSXB 4FNRA 2DM3A 1BIHA 1QI0A 3B2UC 3W4RA 1NBQA 2Q3AA 1OB1B 2QHAA 3P0YL 2LFGA 1E4IA 2F8OA 1A7OL 5A40E 3N13A 4PGZA 5F1SA 1YEKL 5TGBA 3ALFA 3BWAA 4GMSL 3MACL 2AVGA 3D39D 1UVQB 1H11A 5IFHL 2PO6A 4LVNC 3WH5A 1KTDA 3SCMA 2YFOA 1CLCA 3QGVA 2YPLD 1INQB 5C0CA 4FNLL 4RRPA 5DT7A 2I5YL 4ODVH 3MO4A 4Y4KC 2RCSH 3KS0H 3AREC 5HDBF 4KY1L 1AXIB 3TCLA 1JPGB 2EC8A 2EE6A 4UCFA 1UB6A 2PWEA 2VRJA 4KRPC 4HUNB 5C08A 3I3EA 4JANA 4N90E 4OD1L 3LXAA 4LPWA 1OWRM 1DBMH 3WFDL 3HZKB 1NFDB 3LEVL 4R8WH 3FW6A 5E7FA 4YHEA 3HI6H 1U8KB 2BDNH 4KC3B 2PYFB 4P8VA 3IU4L 4JDTL 3D18B 1LE5B 1LVEA 3CVHL 2DLFH 3DYOA 1VACA 2V9RA 3DO7B 2BY2A 3BGAA 4Q7NA 5T1MB 3C8KA 3DROB 3CHDA 3MSGA 2AGJH 1SY6L 2X10A 3C60A 4PLKD 2QHRH 1HKFA 3MLWH 3TBSA 5JW5A 1E6NA 1A1OB 2XGIA 4WHYG 1MCQA 4K7PL 3GFUA 3V7AG 3FFCA 4O2CA 3QI9A 1T21A 4ISVB 1HT6A 2VO5A 3CZFB 3CPLA 1YEEH 3UTTD 2Q3ZA 3RGVD 2AJZA 1RVFH 5IB2B 1HKLL 4X7DC 5IW1B 1EJOL 1RZGB 4XB3A 1LILA 1PBYA 4DWSD 1C8XA 1MY7A 1FC2D 1WFOA 1BLIA 4OUEA 1FBIL 2BK8A 5DD6A 1K4CA 5SWSD 4PRID 5CIPH 5CJQH 4V2BA 5HGHB 4DN3H 3C08L 4GQRA 3V6BR 4RGOL 1NFDE 5F7MC 1ZT7B 1CN4A 2WZEA 3C6SA 4XNZC 3T0AA 5H8DA 4Y7EA 2GJXB 5CPTA 5IUSA 1NC4D 1PQZB 4LKXA 2P7TA 3U36A 1VJZA 1MHCA 4F7CB 2OLDA 2WYSA 4JPWL 1TNMA 2VXTL 4EIZC 1QG3A 3MV8B 4I5BA 3ZE2E 2FJGB 2DSVA 3BH4A 1MCCA 1NBYB 4NBYB 3F58H 1QD0A 4PMXA 2HVJA 2HP4A 3J7HA 2D20A 3F5LA 4P7RA 3VW3H 1AE6H 5EU5A 3OAUL 1JNNH 3ULUE 3PZ9A 3U46A 1H3UA 3RL1B 3V52L 3U4EB 5J13B 4GBXD 1HN1A 1XH3B 2NX5E 3Q1SL 1KENH 3H7BB 1KQZA 5J12C 1T1ZB 3RIAF 2DMKA 2QADD 1QFUL 4HD9A 3DX8A 3X3GH 3QQ9C 4NJAL 1LO3H 4DK6A 5ETUB 2XIDA 3EMZA 1I7TA 5SX5K 4N8PA 3O9WC 2OJEB 1CICA 3MV8E 1EO8L 5ACZA 3C6LA 4KXZI 3GNML 1LEIB 1FNSH 2DF3A 4LMQE 1EEZB 2F15A 1CENA 3UPAA 1QQDA 3HAEG 4U1MB 3SCMD 4K8RL 3O8XB 3U7YH 5C0CD 5DC0A 4LBEA 5E2VL 3KPLB 5DQJB 3RHWK 5EBGA 1FDLL 1D6VH 1C7TA 5KVGH 2RAMA 5JIWA 1L9MA 2VDNL 4HKBB 1HJSA 3LKSB 5DMKA 1M53A 3V4UL 4JL2A 2ZE0A 1WWBX 4K9EC 4Z7WA 4PMOA 2UY5A 5I23A 5C08D 3MRIB 3UAJC 5A2KH 2J77A 3GB7A 4D0CB 1KXTB 2XZAL 1UUQA 1UWRA 1JMZA 1P7QB 5DTFA 3F8UB 4P2QA 3A6BH 3CXHK 4N68A 4F79A 3PGFL 1NBVH 3GXDA 3VCLA 5I76B 4GKSB 1ZSDB 4NC2B 1MW1A 4PRWA 3CSYB 1FZKB 3C60D 4ZS7L 1I1FB 1BYAA 4YEEA 5I78A 3P0GB 2XPKA 2XFFA 4LSSH 2D7QA 1Q6FA 4PG9B 2BHYA 3FFCD 1B3WA 5F88A 3VXMA 1FL6A 4X9GA 3G6JB 1KFAL 2WQ8A 3QH3A 4KI5F 3VXNB 2YKLH 5DDHB 7FABH 3OXSA 5I73B 4OZFG 1ORQA 5DVLA 3U0TB 2HAZA 1GJWA 4M43L 4GKLA 5GJTH 4G7VL 1EHXA 5GS0D 4C7DA 3GXTA 2IF7A 4JQIH 3MJ8B 2H1PH 2D0FA 4N9OB 5E5MB 2CPUA 1CE6B 3W0WD 3WFCH 2BNUA 2NTFA 4JRYA 3SDYH 4ODHL 4JAMA 3AAZA 5F9WC 4OQTH 5SWZA 4GJTB 1K5NB 4APQA 5I1JL 1FLRH 5IXEA 3FN0L 2KQMA 4Z0BL 4LLWB 3WFBL 1ETZA 5JORA 4LPCA 2VDLH 1W32A 1UA7A 2AJVL 3P73A 2R1WB 1VGEL 1DE4B 1YN7A 1T2XA 4JY5L 2DQDH 3T65B 3VSUA 1SYSB 1X5YA 3G6JE 3MU7A 1KLGB 3DGGB 4A6YB 2X4UB 4CVWA 2QR0B 2IPUK 3EAKA 4DKDC 2FYVA 3PZIA 4LHQB 5CGYD 3W81A 4ONHA 4UTFA 4XCEA 4F2MB 5C70A 4FNQA 5IB4B 1KNOA 1S9VB 3DARA 1TVHA 1YZZA 4Z7QF 4YHML 4KGJA 3NDYA 2IAND 1KWGA 3RKDD 3SE3C 3QZWB 4EI5B 3BSZH 3SE8L 4K7PY 4KVNH 4YDKL 3LHPL 1A9BB 4PB0H 5KANG 5HDLA 1JJUA 3MRFA 3MZTA 1V6UA 2J8HA 5IM7A 5IVNA 2J4GA 5FL0A 4O58H 4XPHL 3BP5A 3IDMA 3K0WA 4TUOB 5KVDL 2R56H 5KJRH 1C1EH 2X09A 1CICD 1PAMA 1Z5LB 1UM5L 2VZ3A 2YUZA 4GOSA 1RAMA 3T8XA 3OB8A 4BQ9A 3TA3B 3JXAA 4CMHB 4CN1A 3QO0A 2D3VA 1ZBWA 2J6EL 3VVGA 4D6FA 3VXUB 2EQDA 1RQ5A 5ICYA 3LPGA 1GC1C 1U8HB 2ED7A 3U4BL 4HZ7A 4NSKB 4XNMB 1DUYA 3RI5F 3AIBA 2DT0A 3HNVL 2HT3D 4R27A 3GSNL 1XF3B 5TH2A 4D9RD 1JPTL 3K4ZA 4DUWA 1JPFB 4HIHA 1E4NA 2HFEB 2APWA 4XP1H 1NPUA 4PJ8C 6CGTA 1CG9B 4WUKH 5L2KA 4XNXL 1AVAA 4P2QD 2WMIB 2ARJA 4QLKA 3HI1B 2GUYA 1HJUA 3TT1H 5F6HJ 2D0GA 1OTTD 3H3KA 3MKKA 4FZEL 1QVOB 4LVNB 1X1NA 4QHKJ 4ZTPL 3QJHA 4XPTH 1H0DA 5DJDA 4HJGA 4GKZB 3TLRA 4EDWL 4RWYL 5E70A 1WO2A 3GMRB 3K3QA 4ZUVA 4Y4KB 1PY9A 4PP1D 4O9HH 1MCIA 3AREB 4OCRL 1E9LA 4CU8A 4J23A 1ACYH 2G9HB 2IPKA 2P8PA 1HWGB 1NC2A 1I1RA 4KRPB 1OAKL 3U9PH 4IHOB 5IB3B 5ADOH 3UG5A 5IHZA 1DQJA 3L3HB 3N17A 3GJFA 3EFFB 3HMXH 1SJEB 2NY4C 2X7LB 3UBXG 1YNTB 3BYTA 4WO4A 1X6NA 1OSZA 4OLYH 4JRYD 3MX0A 5SWZD 3DETD 3BZ4A 1P1ZA 4APQD 3HHRB 2OK0H 3X13A 1XCXA 5JIIA 1CU4H 2F8VA 4AEHH 1BQHG 4DGYH 5L8JB 3DX4A 1G9EA 4ALAH 4ELMA 2JK5A 2IH1A 4QY8A 1JZ7A 5C7XH 1A64A 4MNHB 3S6TA 4U3AA 5JDJA 1AI1L 5ESQB 5H2BA 3UZEA 2VABB 3PGDA 1NGQH 3FHAA 5FHBL 4PJCB 1OAXL 1K6AA 3V95A 1FO0A 5JOPD 1EGJA 2UZIH 2BVOB 2YD8A 3QO1B 4UDTB 4Q9QH 2F53A 4PMNA 5CILL 3PG2A 3VFWA 1YEFH 3PNWB 3CFJA 1CGTA 1RIHH 4WJXA 1C5BH 2OYKA 4XNZB 1QLEH 3QQ3B 1E6QM 1K9TA 3O6KL 4NQCA 1E6OL 2HRPH 1MCFA 3WNLA 5EU3A 5DQ9B 2EYRA 4JZNA 3BUTA 2A1WL 3ZYOA 1GGBH 3KLLA 2X9XA 3V5DA 3WQ6A 3G08B 4NNXA 3LKRA 3UTQA 1QLFA 4H20H 3HPLA 1SBSL 1G6RB 4WIWA 3DUHA 3WHE0 4RZCB 2AJXL 3MUY1 3QFDA 1YEJL 1MQKL 5L0QC 2BNQE 4HWBH 5C07A 3CUPA 2EIZA 1WKYA 1E43A 3P4LA 3WUFA 2J7DA 4PD4K 1YQVL 4PJCE 4P7NA 1DEDA 1V3IA 4F8TA 1AGDA 1W72H 2EEXA 5E8NA 3GDBA 2DT3A 4PMUA 3WS6A 3CXDL 4RE3A 4F7PB 4EZMA 2ZSVA 5D8JH 5J12B 4KJQC 5E9DA 1PG7L 1CK0L 2Q8XA 1KTCA 3D5HA 4XCYA 1NLDL 1HKJA 2WCGA 4R26L 5DEGA 1QBML 2CK2A 3WCYA 2V5TA 3GXPA 5EZIH 5HGDA 3T4AB 2CLRA 4HPGA 5GGSY 1UCBH 4EN3A 1SY6A 2DOCA 3TIDA 3O9WB 1KCLA 4CNIA 1QPPA 2NCMA 4XWGL 4PJBB 5L2KD 4HOZA 1X7QA 3NYDA 3WQVA 1CDCA 1HQ4A 4L3EE 2E8ZA 4W6XB 4CMMB 3Q48A 3NCOA 5I1GH 1RU9H 2A0LC 2CLVB 1G0CA 5E2WL 5I1KH 1AGBB 5HJ3B 1A7RL 5JA8B 3CVIL 4J3SA 1K3IA 4NCC2 1EFXB 4WFGD 2GT9B 3RU8H 5TE4H 3VI3F 3GBEA 3H0TA 1HHGA 2ZOKA 3K46A 3OAYH 3RWDB 5F9OH 2AJSH 3QUMH 3O2DH 4HWEL 2F2HA 3U6RB 3HE6A 1KB5L 3DI3B 1FJ1A 3MBXL 1YMMB 3BDYH 4QTIL 3ZKQD 5A8MA 1ORSA 1YNLH 3HU7A 1ZLWK 3IAQA 1U2CA 3T0VA 1BGGA 1J9YA 5B3JF 3DIFA 2FDMA 2DSKA 5BS0B 1XIWD 5A3ID 4YFDB 4OSUL 1UWXK 4PJHF 1H1NA 1CNVA 3WQWA 3QXDA 5B39G 2XN9B 1DWJM 2E9IA 1L7IH 3KPQA 1CLVA 2VVNA 4JGUA 3L5IA 4MD0B 4WSKA 4WO4D 5JOFB 3U7VA 2NXYD 35C8H 4LSUH 1QWNA 3PZTA 1VPOH 3GSVB 5TQ2H 1ZBKA 4I48A 5EORL 3AXHA 3UG3A 4Z18A 4PJDF 4NN7C 5FYLE 1QTYT 1E6ZA 3MMWA 1F4XH 1MRDL 5IEKB 1CDHA 5T3XH 3W26A 3KGRA 1GUVA 4E42A 1NL0H 3NFNA 5F6IC 3T0XA 3TFKC 4LRIC 2J8OA 1FG2A 3MRCB 4MX7B 4KHXL 2EKSB 2UUDK 2BOBA 1EUUA 4NM8L 4EUPA 3OG2A 2YUVA 1PX3A 4L4TB 1KR1A 3S6CA 3UTSA 2J2ZA 3PDDA 2F53D 2XWEA 3JWOC 1U36A 5DMJB 5HI4D 2GK2A 3KS0J 5IVXA 4QLRA 3U5YA 4DGIL 4JRXA 4WFEE 2VR9A 3NTCL 3V0AC 4PLKC 1P4IH 2XN9E 4NQCD 2HG5B 4UB0H 5F9WB 4YHGA 2YPVL 1AQDA 3EOTH 4AH2B 3VUPA 2XOTA 1HYSC 4AK1A 4B7LA 4LARH 1AR1D 1JVKA 3ZKXC 3R06B 1XF2A 3IJHB 4WW1B 2GCYA 4PY7A 2AXHA 4BZ1L 3TOPA 4NKOA 5T3ZL 3RGVC 1HVQA 4WEMB 5GS3A 3BDXA 2Z92B 2CERA 4DWSC 4PJ7B 4NCDA 1UXSA 3TZVA 5C07D 3CX5K 4WEBH 4M9OA 1T03L 1TITA 1LP9A 3VFPB 2OYPA 5JLZB 2R0ZH 2J75A 4J3VA 1YJDC 4M6ML 4RRPG 2C1OA 4ONGH 4YZFF 3P4MA 4L4TE 4YHNB 3HAEH 2HLAA 3L5XH 4HLZH 1C7SA 5AD0A 4PR5A 4WV1C 4YGVA 4XP4H 3LZFL 3D3VA 3K80A 4L4PA 2DKSA 3L95A 2VRKA 1AXTL 2FX8L 3WMCA 3WUGA 1X4ZA 3BP7A 4O51A 4QRPB 4EN3D 3SUVA 3BEWB 3HC4H 5ABDE 3BGMA 4OZFB 3BWUC 4ZQKA 3UCQA 3BX7C 4PYGA 5FV1L 4NDMB 4LCUA 2WIIA 4J8RA 4X6EA 2R23B 3RIFK 1OGAB 1T6WA 4AZIA 2YEZA 3DV4A 5E94B 3KPMA 5DJ8A 2W63A 1MAML 4NO3A 4JJ5A 1GHFH 4PJ7E 2XWDA 2GK0A 4GBXC 4QKXB 1HOCA 5A6BA 1TVDA 2MQCA 1VF8A 2QADC 3MUGB 4UFLA 3L3IA 3KL5A 4V2CB 4HFWA 1GOIA 1Q8MA 3HE6D 4ODUA 3BAKA 3TT3L 2QEJA 3G5YB 2CIPA 4JFOB 3W53A 3IFOB 1T66D 3JTTA 2J79A 3OKNA 4JLRA 3TNNA 4RBPH 4AZGA 3JV6A 3M7SA 2VYRE 4PJ8B 2E5EA 1ZS8A 3WD0A 5E8OA 1IGFH 4NRRA 3F5WA 5EIIA 4QRPE 2ICWI 1UR0A 4D0DB 2QV2A 3SCMC 3WH6A 3G9VA 2N56A 2R69H 1IKNA 1F4YH 1QSFB 3PDGA 1GCFA 3AXLA 5ITBH 1GGUA 4F3FB 2CKBB 3QG6A 4P48A 1MI5B 4UZSA 1N3NA 1IEBB 2XT1B 2EAEA 1R3HA 1M04A 4KQ4L 1RJYA 2QSTA 1OCWL 1JRHI 5ALBH 5FCUH 2APTA 1T2JA 2YD9A 4H1LA 4PRDB 2DWEB 4OKDA 2IALA 1CBGA 1MFDL 4PGEA 1U6AL 3SE9L 1ZLSL 5IIEA 2FGLA 2XG4A 4XMKL 3UTSD 4E5XA 4OF3A 1NEZB 4P7OA 1DBJL 1RMFH 4TSBH 4UT7L 1Z0NA 2NY4B 4JRXD 5HPMA 1CD1B 1BJ1H 3WFEH 3BESR 4YHKH 5HYJB 4L29A 3BAYA 1BVZA 3GMPB 3K4DA 4KDTA 1XZ0A 8FABA 2W07A 1G7HA 1KJ2H 1TPXC 1QSFE 2EIDA 2H32A 4BH8B 4Q0XH 5FL1A 4RWHA 1VB9A 5M5DA 1BX2A 4QCFA 5I8KL 3C5JA 1OAQH 5EUOF 1PSKL 3T1WA 2J6EA 1RUMH 4NO2B 3OIHA 2VDPH 5IW6B 3SOBL 3L7EB 5EZLB 3C2AH 5FA4A 4CDHA 3OAZK 4G6AD 3TZVD 3BPNC 3L1OL 4Q9BA 4HG4J 4JPIA 5KS9A 4TVDA 4DGVH 1FCCA 2Y36H 3CNKA 3ALPA 2X4SA 3B83A 4FP8H 3S37H 5ABEA 4F7MB 4OKVA 5C8JB 3WIJA 2YHGA 5F7DA 4PRBB 5BWFA 2DJUA 4JFHD 1KCRL 4LPVA 4U1LB 1MAJA 3D3VD 3AI0A 2C3WA 4EK7A 1ZT4B 2R8SH 4BK5A 1C8YA 2WKLA 2AV7A 5HYJE 3O6LH 1OAZH 4O5LH 3LH2L 3LQAH 5DK2A 4EVNB 1NUFA 3MJ6A 5D6DC 4ZNEA 1MWAH 5D1XA 2WVSA 3BVVA 1FNGA 2NW3B 5ICZB 2BV9A 2A9ML 3DSFL 2MCPH 5L0QB 5DWUH 4Z7VE 5CGYC 5C0EB 5DJ0B 1TTGA 2NY0D 1JGLL 1LO2L 1BD2B 4OLEA 4Y2DD 4MXQC 5I1CH 3UBXB 5DI8A 4AM0B 1E4MM 3RKDC 3TH3T 3I9GL 2WCAA 1JWUB 4KKLC 3UROR 3W29A 2AXGB 3OZ9L 3UTOA 3CUGA 5KSVB 1RZ8B 1IGTB 2F5BH 5LXGH 2HVKB 1H49A 3EJQA 4HIEA 3OKMB 4MDIA 1OBAA 1HH6B 4TSCL 1RULL 3NIFE 5JHLH 4NQSB 2ICES 5C6TH 5A3HA 3QEQD 3IJ9A 3D0LB 1CICC 3HNTH 2MHAB 2QV4A 1UYWH 2MQ3A 4U6HB 1MFCH 4IOIB 4OZ4B 4M6NH 5FGCB 3GI9L 2AMGA 2IG2L 1GZPA 5FGBA 5F1NB 1S8DB 4C54A 1FNHA 1G7MA 5GS2H 4YH6A 3VD4A 5D5MB 4GH7B 2JF1A 4EANA 4TX6A 5D70L 1CL7H 1FQ9C 3L7FB 2J8FA 2I9TB 3B43A 5FIEA 5CS7A 1KWKA 3BKMH 3KPOA 3I6LE 5HYQB 3CDGB 3VXRB 2BVTA 4AJ0A 1F4HA 4JO2L 2AEPL 1KIQA 1E4XH 1EMTL 4MA8L 3NIYA 3BE1H 1AQKL 3SDXB 2ZCLL 1DQLH 3C8DA 3VFTA 4X6FA 5CWSB 3G6LA 4QRQA 1OTTC 1OB0A 4LVEA 5FYKH 3IGAB 2H2PC 3RUGF 1AMYA 3UYRH 4V2XA 1HQRA 1K6QL 3SN6N 2ZXBA 4G6KL 1MEXH 3L4WA 2WMPA 3MRQA 1SZNA 2OL3L 2IUZA 2YPLB 2EYTA 5IMLA 3OKLB 2CHOA 4LEXL 1FIGL 4CDGC 3FZUD 2DIBA 4NN7B 2XVKA 4HP5A 3M8OL 1NOWA 4BH7A 3NJ3A 3PBGA 12E8H 4AT6B 5D5ME 1MVUB 3KXFE 2IQAA 4G9DA 4I4WA 5ANMB 5I15L 3VA6A 3FQTB 1YPZA 1NMBL 3QDHA 2VC2H 4QNPF 1AXSA 4JPKL 5TE6H 5F6IB 2WCSA 4KK9D 5E99H 3MLVL 1P4LB 2A6KA 5L9DH 4HZAA 5A95A 3WD3A 5LAXA 3BPCB 4S11A 2F54A 4KUCF 3VFUB 1KEGH 1A3LL 2GVYA 2AI0H 5DMIH 4DJMA 2ADIB 3V6ZA 4M1GH 4S3KA 3OV6A 1NLBL 4HGKC 1V03A 5ILTH 3OJDB 4XCFL 1ADQH 3QHZH 5MEPA 1T7ZA 5ICXB 5K93A 3CZKA 3DETC 5IBTL 4APQC 5IMOA 2W60A 5DS8A 3EDKA 2VAJA 1RP9A 3RDKA 2R15A 2DYPB 5HDQH 1EAJA 5CEYA 4G43A 3WF4A 4NJ9H 3KWXA 3HMCA 2O5ZL 3ZKXB 3KG5A 4CUCA 3N85L 3KR3L 3V4VL 5D1XD 3OR7A 3UTTB 2HMID 3HZMB 2PW2B 3FB6B 5ANME 3RGVB 2IJ0C 1UQSA 1UD5A 2CITA 4Y1AA 4MJ6B 3N04A 4P9ML 4E0RB 3ZJ7A 4DWSB 4AMXA 1F4WH 4BKLA 3CJJA 1HSAA 4R3SA 5SWSB 1QSZA 2VE6B 4PRIB 4ZYKB 2P46B 4QO1A 1Q9OA 4Z2HA 3RPKA 5EO0B 2WUBL 3WBAA 4UNIA 2V2TA 4WV1B 3GUTA 3PP3H 2PNDA 2WWMC 1NC4B 3KYKH 1SFSA 5LGHL 4RDQG 3BD3A 5KW9H 1JUFB 4R90L 2DQGH 1V3HA 1P7KA 4NKIL 1VKXB 2BX5A 5DJCB 2YBRA 1SJXA 5KN5A 3T3PF 1C90A 4GG6A 1N4XL 2CKNA 5TE7L 3MOBL 2V5CA 4E9LA 2EDRA 5C0DA 2E8YA 7CGTA 3SEPA 4K3EH 3DDGA 3UTTE 3SCNA 4PEEA 4BSVA 2EC9T 4MA3A 4YBLC 3S5YA 1FPTH 1UM6H 3TNMB 4LL9A 1PKQB 4HEME 2VL5B 3AUVA 4GBXB 4M7JL 3T0WA 4YEFA 3MA9L 4KTEH 5GISH 2JCCF 1XCTB 2QADB 5F1IB 4M6AA 4JVUA 2P24A 4R4FH 5EZOH 4IPLA 5IMMA 4AD4A 4UIMB 3RVTD 2P8LB 3KNBB 4B9YA 2BRRH 4HAFA 4OM1L 5C09E 3HC0A 4OZHF 1A6UL 3ZYZA 3IDNA 4X9BA 1QFHA 2M26A 4LAJH 5TGBB 3BWAB 2XRAL 4MYWB 5ISZA 2GY7B 3CBWA 3ZDXF 1KXQA 1RH9A 3SCMB 3IVKA 4G3YH 4N0YH 4RISL 4X0NA 5FD0A 3OGCA 5JUVA 1ACZA 1ZLUH 4L4VA 5IFAH 4ZOAA 1DQML 3QCVH 1H9VA 3MLUL 4JM4H 1UJ3A 1LL6A 2LABA 5JW3L 1PKQE 2C1PA 4U6XB 5F7UA 2YXMA 3GMLA 4XCCH 3UTPD 1IGMH 1UB6B 1XR9B 5C08B 4ZFGH 3U9UA 2GJPA 2R1XA 4JANB 1XIWC 1G7PA 4U1KB 5A3IC 1KR0A 1XYZA 3GXNA 4F9LA 4D6CA 2V17L 1XGPA 4MNJA 4OCWL 5DRWA 5HHOA 1EFQA 3QIBA 5IG7B 1VACB 5CPSA 3IFNH 2NXYC 3GJEA 3GMQA 1BBDL 4XXDA 2DLHA 4CU6A 3BZEA 5DT1H 2EIBA 4LIQL 5GIRA 3TBSB 5JW5B 1AD9A 1V08A 1TPXB 4NQEE 1G9NC 2PC8A 3L3DA 4W4OA 3CPLB 3H3PH 1A6ZB 4FQJL 5C0RL 1JWMB 5JQ6L 4HZ8A 4Y1AD 2DEPA 5K9JH 3NDZA 3R0NA 1CGXA 3BPNB 3GK8L 1LO4H 1REIA 1YEHH 1TDQA 5F7WC 3MUZ1 4MQXC 5KZCB 3MMDA 1ZHNA 1JNLL 2CIIA 4XVUD 3W0WB 1ZJAA 3C6SB 4OAWA 3RCNA 3O3AA 1IAIH 3UTZB 4QFUA 1CWYA 3O45A 3U36B 2P7TB 3BH8A 5E95B 3MLRH 1R5VA 1B4RA 4ESKA 3DOSA 3CFCL 1AR1C 2W62A 2FD6L 5DJYA 2F61A 3RM4A 4MD5A 3BGFC 4L5FH 2GKIA 4TSAH 4PJXE 1IC4L 3FTGB 1EA9C 1Q6DA 2HVJB 4F7TA 1SYVA 4LPXA 5EU5B 4JFED 4DM2A 5LJYH 2DJSA 2ZOLA 1BPVA 2BJML 3U46B 1FP8A 5IFJA 1LD9A 1J0ZA 2XYLA 2IANB 3WS6C 4WGWB 3IETB 1DWAM 2DM4A 2ZICA 4MAUH 4TTDD 5EU6A 3OKOA 2X41A 2LVCA 3CPUA 2F58H 3W0WE 3EYQD 1PVHA 1KF9B 1A6AA 1UKOA 4WTZA 4M8VA 1UA6L 3AM8A 3MJ7A 1ZL1A 3CK0H 1I7TB 4FLSA 1PLGL 4FNSA 4EUPG 2BERA 4ERSH 4EN3C 5LCVH 5BV7L 1RIUH 2ZUXA 1CICB 2RB8A 1NQ6A 3U4AA 3WKNA 2QQNH 5ACZB 2ATKB 1XF4A 4TOYL 1BFOA 2X89A 4EEEA 5ISZD 1JDAA 1E6SM 1QQDB 4P0DA 1CR9L 1D5XB 1WWAX 2EDFA 4UT6H 4K3DL 1X5KA 4QRUB 3M17A 1L6XA 4HJJL 2V2WB 5ESAB 3AHVA 4LF3A 2NZ9D 4NZTL 4HOWA 2F19L 4PRPA 4JO3H 3T09A 1YMHA 5A6KA 3HE6C 2DB8A 4WHTB 5DMKB 3ARDA 3GBNL 5IBUB 2IANE 4JY4A 4Y19B 2DQJH 1IFHH 2MKWA 2C9AA 1FOBA 4HIJA 1T1WA 1T66C 2FX9H 2I26N 2PR4H 5KTEH 3RHWF 3DVNA 2WXDM 4P9HL 2AEWA 1U8LA 1NJ9A 3O6MH 2LE9A 4FFZL 3BAIA 3SO5A 2VWEC 2Y25A 4IMKA 3PWNA 3G5VA 4P2QB 2QHLA 3IDXL 4X8JB 3ZHLA 1XD1A 3PZMA 3MV9D 1I9EA 1TETH 3QIBD 1MWOA 1O7SA 2UY6A 2G60H 5KZ6A 2YMXH 3I50H 1UR1A 3ZE0F 4H8HA 4XC3H 1OAYL 1UR8A 3IYLW 4N0FA 1MCJA 3UC0L 5DR5L 3KE0A 2JF7A 1W9DM 5GGVL 3UJTL 2B31A 1FL6B 2HJLA 4PMVA 3VFGH 1HIMH 3OXSB 3WF2A 5FK9B 3ZJ8A 4YHOH 3Q5OA 3ABZA 3MRPA 3QR3A 1ORQB 3PWPA 4KUZH 4QLLA 2OXHA 2QJDA 3NFSH 4Y19E 1JAKA 2BXYA 4D9RE 3BKJL 3IFLH 3OXRA 3CMOH 2JB6A 3QYCA 4ZG1A 2J3SA 3DGCR 3ALXA 1RFDH 3S88H 1LMKA 2I07A 4HSQA 1W3KA 1J86A 3OLIA 2NTFB 3C09C 4JRYB 4P2QE 4K71B 1WFNA 5SWZB 2QMJA 4IOFD 4XT1C 3I85A 3BIKB 3LAFA 4APQB 4UTBL 4F33B 3P9MA 4ENEC 1JN6A 4O2EA 5JORB 3TM6A 1CBVH 1UQYA 4DFHA 4M48H 5I30H 1B3ZA 2HISA 4DKFH 3HR5B 3A22A 4I1NB 2HT2C 3P11L 4OM0L 3T1FA 1BJ1J 2VJXA 2XA8L 4MCYA 1OOAA 4JO4L 3WXVH 4FQQA 2ZSWA 4G6AC 5GRYA 2VLKA 3TZVC 3Q6GH 2RGLA 3LN4A 4YDJA 2X0HA 1NFDF 5C6PB 4NKDB 4X4MA 4X6DA 1GIGL 1KNOB 5MI0C 2ENSA 4XI5D 4WY7H 1YN6B 3RWGB 3SKOB 2QLYA 5I2IA 1LHZA 2Z4QB 5DVOA 4C56A 5EU6D 5L8LB 4IMLA 1CT8A 3VD5A 4YX2H 5AG8A 1VADA 1QFWM 3IAGC 1R5WB 4U7MA 5ABFA 4W81A 3TJEL 1K2DB 1MQ8A 1ZXQA 4H1LG 3EJRA 3UO1L 4JRYE 3MRFB 4WWID 2HLFD 1DLFL 1QRKA 1FZOA 5IM7B 4XPGH 2B1AL 4ZEPA 3OBAA 3BP5B 4XP9H 3IDMB 5A43C 2DQIL 2Q76A 4QOKE 5CZVH 1VFOA 5DJAB 3GM0A 4AYSA 1RPQA 5CZKA 4P99A 4IRZH 5LWYH 2EEDA 3T8XB 4DTGL 5GRVK 4A2LA 2X89D 4OZIB 1HXKA 1V3JA 3QO0B 3EBVA 5HY9A 3DVGA 3QNZB 3HG4A 3CC5A 2JELH 2NY0C 1KIRA 2E7LA 3M1BA 2FL5A 4CN6A 4Y2DC 4YBLB 4P59H 5JOPE 2YWYA 1JTOA 3LD8C 1DUYB 1SR0A 4PRPD 2VLRE 3CU7A 3THML 2B4CL 5KVFL 2IFFL 1JFXA 3ARDD 2P47B 1V02E 5JNYA 3KPNA 3MROA 1Q6CA 1CVRA 1WTGT 2FATL 4Z77A 1WJ3A 5LVEA 1PBGA 2RFXA 5I1DB 4HIHB 3HMWH 4KWUA 4GW4B 3NAAL 1QR1A 2YK1H 1YA5A 2XWBA 1PZUB 3QNYB 1E4LA 5EO9A 4F37K 3QPQD 5EBWA 5D7IA 5LBSH 2IBZX 5L2KB 3BAEL 1S7SA 3KLSA 2A6JB 1T1YB 2ARWA 3TYFB 2NY5L 1EK3A 3ZT7A 1IKNC 1P2CA 4OZIE 3KLKA 3CHFA 3QJHB 1A47A 5I0DA 1H0DB 4MSWA 5DJDB 4HJGB 2DMCA 4BQCA 1D5BB 3MRJA 3EDDA 2FYYB 2ORBH 3DSNA 1G7IA 4H7VA 1KC5H 2J4WL 4PV9A 2IPKB 3PWPD 2P8PB 1CZ1A 3MNVA 4OLXH 1U8MA 5IHZB 3FO0H 1DQJB 3CAFA 1XIWB 5DSCA 1HDMA 3TA9A 1MFAL 2EADA 1UFUA 1KPVA 2J12B 2BOCA 1R24A 4MJ4A 1WBXA 1OSZB 1EO5A 5IT2H 4JZJC 1HNFA 2NXYB 1ZWIA 4XAWL 1XSKA 3BZ4B 2OP4L 4D2NA 1DBAL 2HRLA 2EO9A 3FZUC 3SKJH 4ODXA 3X13B 4YXHH 2DRUA 2B2XH 2WUCL 4WWKA 1NCAH 5F70A 4OOUA 4ZE4A 4WFGE 4ELMB 3VD7A 2ITCB 2JK5B 4LAQL 1HSBA 4QY8B 5FYJL 1D9KA 3F12A 4KK9C 1JFQH 1D5MB 4GRWH 1R33A 4WKFA 5H2BB 4S0SD 2IXUA 3RA7L 1NCCL 4S2SA 1MJ7L 5BVPL 5AG9A 5JQHC 5D72L 5HHNA 5J1AA 3V9FA 4W85A 3GNOA 2AJYH 2F53B 1LEKA 5ECUA 5FFLA 1I8LC 4K7FA 3VFWB 5L88H 3SUUA 1RP8A 1VBRA 3OTTA 3K8MA 3H9HB 4I9WD 3FB7A 1U9KA 4BQ6A 4H8UA 1MSPA 4C56D 2CJUL 2Q6WB 4NQCB 1C5CH 5DHVB 4YE4L 5EU3B 2X1XR 2EYRB 4JZNB 4BSJA 3V0WL 2G3NA 3S5ZA 3WIHH 1MJUH 2M8XA 3TN0A 3WKZA 4NNXB 3LKRB 3UTQB 1QLFB 4U3XA 3G6JF 3WJJA 2WSPA 3IJ8A 2JLLA 4YR6A 5D1XC 4YHZL 2HMIC 3BGFB 3NCFB 2YBTA 3QFDB 3EO0A 3MR9A 4ZS6D 4FFYL 1E0OB 5DVKA 4X8XA 1JZ8A 3QDJE 1JXJA 3PTMA 4X99A 1M05B 1CLYH 5I1LA 4TRPH 5C07B 3CUPB 5E8PB 4PY8J 3GI8H 2WHMA 1JHTA 2XICA 1IGYA 5H94A 1WAAE 2LU3A 1I7ZB 2OYMA 3U2SB 1J8KA 4DKEH 2A77L 4M7KL 1A6WH 2VIRA 3PHAA 2DPEA 1SMAA 1NANI 5GRZA 5ENWA 1DDHB 2ZSVB 1U3YA 3P0YH 1N82A 4POZC 4WW2A 1GNXA 1YEKH 4GMSH 3SBWC 1EGZA 4NQCE 3WDPP 2RHEA 3FRUA 5DEGB 1JZ4A 5DJ2A 3REWB 2FHFA 43CAA 2FBJL 4HZLA 4EN3B 4M4PA 4CNIB 1X7QB 1DANT 2I5YH 3QBTB 4JVPA 2YUWA 5FGBC 1XGUA 4KY1H 3WQ5A 1QW9A 3ES6B 4UQ2B 1H3TA 2DI9A 3B9KA 1Y0LA 3H0TB 3GM8A 4M4RA 2ZOKB 4JFYA 4M3JA 4OD1H 4MAZA 4JM2A 2YFNA 1MRCL 1Q0YL 3MUJA 3WFDH 4WRLA 5ESVB 3LEVH 3VG0L 3HE6B 5IP4A 1YEGH 1FL5B 1FJ1B 1OY3B 5EFIA 1G94A 1Q9WA 3RVTC 3SDDD 3SJVA 5FV2A 4EJ1C 2EICA 4JDTH 2WK2A 3CVHH 2CK0L 4UDUA 4XMLL 5HGAA 3ME0A 3H9YA 1EEQA 1X5GA 3KPQB 3V8CA 4KKBD 3VINA 4XZUA 1MCOH 4X4XA 3VIMA 3PN8A 3DVIA 4RMVA 2PBOA 3CSPA 4I48B 1QHZA 1HL8A 4MJIA 3BIBX 4MTVA 1HKLH 1EJOH 4N0RA 4WWKD 3ARTA 3PWUB 3AYSA 4E42B 2VSCA 1WIPA 3NFNB 3ZIZA 1UZ1A 1FBIH 2AS5M 2PCPA 4PLNC 1FG2B 1MCWW 3C08H 2Q8BL 4RGOH 3MUAA 2BOBB 4EUPB 5AYQA 4XBGB 2Z91A 4YK4C 3QUMB 3UTSB 1R3LB 5T1LA 1KYOJ 3KL0A 2DQTL 1XCQA 2JIXB 4IRSA 2D73A 1A14H 3AMLA 1V7NL 2XFXB 4JPWH 5IVXB 1MIML 2VXTH 2FO4A 3GEWB 3BLKA 2X8RA 3BT2L 1PZ5A 3C09B 3LRLA 1NWUA 3HNSL 5A94A 3S98A 2UWEB 1AQDB 4KRNA 2X2JA 3HUJB 3MOAH 3S35X 4BCEA 3TN0D 1XF2B 1R8LA 2GCYB 5MHSD 2F7PA 5CCKL 5I8OH 3W37A 3H42H 1ONQB 3O4OC 4NKOB 4BFIB 2YA1A 4HT1H 5HXMA 3V52H 1LL4A 3C9NA 3INUH 2OM5A 3WNMA 3TZVB 4X9FA 4ZODA 2MANA 1LP9B 3VM7A 3RJYA 4NZUH 1RPKA 4XVUC 5GRUH 5DFWH 5MI0B 4FLQA 3C87A 1LK2A 2HLAB 5AD0B 2LQRA 4K23L 4DN4L 1E0VA 3AXXA 4YGVB 1A3HA 5MEQB 1CDYA 4LCCA 4A6YL 2WNGA 3G5ZA 5FM4A 3VRLF 4F80A 3CFDB 3L95B 4LPYA 3VXPB 3GNMH 4CKVX 3KDMA 2UWEE 4PS4L 3BP7B 3N15A 1BIIB 3HUJE 4O51B 2VDOH 3PJSB 4K8RH 5DQDL 4MNGE 1QYGL 1EEYA 2GFTA 2WLZA 4ZQKB 5E2VH 3EYVA 4PJCF 4NXKA 1KUMA 2APVA 2VDNH 4JY6A 3KJ6L 5DZLA 4D6HA 2YEZB 5DJ8B 3V4UH 2NY0B 4NO3B 4HUKB 3B9KD 5GRJL 3UZQA 4Y2DB 1HOCB 1KB3A 3LD8B 3MYJA 4TTDC 5EBAA 1GQIA 1AKJA 4JM2D 4AG4H 5L7XL 1HIZA 4HFWB 2XZAH 3RIFF 4ODUB 3EYQC 1KJMB 3O3BA 4OI9A 2OCFD 4ZPTA 1FV1A 3ZKSD 1X4XA 3SJVD 1X6LA 1W2KT 4NUGH 5J6GB 4LMQI 3OKNB 4OJYA 4JLRB 2FHBA 3QEQB 1ZVYA 3JV6B 3CFIC 1EHNA 1N6UA 4XH2B 2GTZB 3QP3A 4HEPG 3WUWB 4EQ2A 4GAGL 1YDPA 4U6VL 5DYOA 2YA2A 5HHPB 1MH5A 2WBJC 5IBLD 3AU1A 1HE7A 3MSPA 4OGYL 5K9KB 5CUSH 3Q0HA 2YRZA 4W7UA 1FVDA 3AXLB 3DECA 2EEAA 2O9TA 1TQBB 4BFGA 1J0JA 5JIKA 5FOBA 3QG6B 1SBBA 4MJID 2NZ9C 1N3NB 1PGRB 4D9QD 2DDXA 4UOZA 1UJ3C 4M43H 5TDNA 1P69B 1M71A 1P6FA 4H1LB 4OCYH 3RIKA 4MNQB 4AXNA 5C2BL 1IM9D 4C7FA 3SURA 5I1AA 4A2MA 5BOPA 5IIEB 1S7XB 5B38A 3KLAA 1QUNA 5LG1A 2NTSP 2BVEA 4F9LC 3F7YA 4PJBF 5I1JH 5T1LD 2R9HD 5DD1L 3WUBA 3FN0H 4Z0BH 1B2YA 4P3WA 3NOIA 4MAVA 4IRSD 1UG6A 4Z76A 3QEQE 3N50A 5A8OA 2AJVH 4WFHD 5HPMB 1KTLA 4HIIB 1WIUA 4JZJB 1UACL 2VURA 4ZPVB 4L29B 3O2WL 4JY5H 2QSQA 4LLVA 1I1AA 1H0GA 1XZ0B 4WTZG 8FABB 1ZHKB 2MPAH 2PBGA 4W6WB 2QQLL 3QRGH 4KJPC 1BX2B 3V4PL 3C5JB 5F7EL 3T4YA 3WBEA 3RAJL 4ORGB 4N8CL 3A4AA 4YHMH 4QYOA 5ADPL 1JD7A 1EDTA 3LQZA 2CHNA 4YPGB 1WF5A 4I2XA 1B90A 4MNQE 3KHOA 1QA9B 4YDKH 4M81A 3LHPH 1CLOH 5F3BA 2XQYG 4LHJB 4W70A 2HH0L 4OKVB 3U30C 1FFPA 2P48B 5F7DB 3DRTB 2Y07L 4UT9L 1U2HA 1QBLL 4XPHH 2X4NA 4XNQA 5KVDH 3FO9A 1UM5H 3QWQB 5AWNL 5E56A 4NZDA 2DT1A 5D7JA 3RZWA 2AV7B 3WH9A 4PRHB 2EKJA 5CFHA 5L6YL 2J6EH 1ZA3B 4JKLA 4TPRL 5D1XB 1FNGB 4J7RA 1OP9A 5M17A 3U4BH 2CBVA 1WDQA 2IXVA 5JW4Q 1KJ2B 4RFEB 3HNVH 3L4VA 1UVQA 3GSNH 3JUYA 2V3FA 4OB5L 1E15A 4URTB 4XI5C 1ZVHA 1G1YA 1T7WA 1U2YA 1G6RL 1B0IA 4LK4A 2WVTA 1AKJD 1LDSA 4XCNA 4M24A 5CMAA 1JGUL 1A3RL 1HJXA 3AM8C 1LNUA 2HLFC 3WD2A 3ULVD 3PL6A 1Z9MA 4X80L 1UR4A 4RAUA 4AY1A 1PJ9A 1QNZL 1A6PA 4DAGL 4PRHE 4QEGA 1V05A 3IDJA 1BFTA 2WVVB 3CLFL 3HZKA 1EEUA 4PJ7F 4EDWH 4Z78A 4HIXH 4RWYH 1KB9K 1INDL 1FH7A 1HHHB 3ZDZE 5B21A 2PYFA 1RUQH 2VXVH 5TDOB 1NAMA 3D18A 5J3HD 3N9KA 3DO7A 5EZJA 1E6JH 3O6FA 4PGDA 5T1MA 1BQCA 3MRLA 5D2NC 1XGZA 1OAKH 1A1OA 1CQKA 4FFVD 1J1PH 3P2TA 3FXYA 3QHFL 3IDIA 3KPOB 4ONOA 4ISVA 3TCXA 3TP4A 1KIQB 1CE1L 4FNTA 1CYGA 2V7NB 2Y4SA 3E8UH 4LSPL 3QPQC 4LSQH 4IMKC 1IAKB 3NACH 5BZDB 4X6FB 3L4UA 2NX5A 4QRQB 1JV5B 5E0CA 4ZENA 4S1RL 1E5JA 4K9EL 1IGCL 5EH1A 1C91A 3LEYL 2O9OA 2EYTB 5IMLB 1OP3H 4KZEL 1AI1H 2GJXA 1J1XL 25C8H 4GQQA 5FHBH 3O6AA 2IQAB 4G9DB 1FNEA 4F7CA 1HEZB 1YPZB 4IDJH 2OLHA 5JIPA 3MV8A 5CILH 2XY2A 2A6KB 2BY3A 2BZDA 2FJGA 5AC5A 4XVTH 5LAXB 4NGHL 1A7QL 4N0UB 2C7UA 1KLUA 5C0ND 3ELAT 3O6KH 1J01A 4YK4B 1E6OH 2DSUA 3VTRA 1P53A 4V28A 2XZQL 2A1WH 1MW3A 2BVUA 1GAFH 1D3CA 1XMWA 2ICWB 1I9RL 3NFPB 3OJMB 2W0LA 1LE9A 1IGJB 2OS7A 4NRYA 4PV8B 2ZUNA 1NKRA 3U4EA 1F97A 1SBSH 5DS8B 4C58B 2CYGA 1B3JA 1C16A 1T1ZA 5CEYB 1YEJH 1MOEA