1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclodextrin glycosyltransferase
publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
4WHDA 1FNGA 4W4OA 1I7UB 1FZJB 3BCDA 4RL3A 2FSEB 2AQ3A 4X7DC 2QHLA 1IM9B 1WF5A 4YHIB 4QLKA 4JZ5A 4PJIE 3V4VH 5EC2B 3GSNA 3OQ3B 3ARGB 2JJTC 1K8DB 4IM8A 1DJSA 3DSFH 2XWDA 4ZPTB 3QJHB 4M6NH 4OZHE 2D7NA 4PEEA 3SCTA 3SIMA 2NXYC 1JGEA 2ZUSA 3H53A 1UKQA 2CDFA 3ZL4H 4HIXL 1SYTA 5DQDL 3N18A 1JPGB 4U2YA 3T4YB 2CUHA 4ODTL 4ISVB 3RL1B 5JXEA 4XX6A 3BEWA 4LCYB 1CXFA 3MA7A 5CP3A 5I78A 3TV8A 1JL8A 3MJ6A 5D1ZC 3FFDB 1BBDL 3MBEA 4G80B 3GMRA 4MMXC 4RZCA 5IFAL 2VRQA 3MSGA 4LYPA 4YH6A 4K94L 3UTOA 1JD9A 3OF6A 1EXUB 3OLDA 3U36A 3UBXB 2WSPA 2AJSH 1XSIA 4TN9A 2G2RA 4RIRB 5IIEB 3EJPA 1UD4A 3GMOA 2WLZA 4JKPL 4LYQA 5K9KA 1PZ5A 3RZCD 1NWSA 2OXHA 2ICEB 2H6PB 4KZDH 1XHGA 5I1EH 3AIUA 4PUBL 2WUBL 2GITB 3KHOA 3RKDD 5F7FA 2J8UF 3OMZA 4KWUA 1OGAA 1WDQA 5BXRA 1ADQH 1UKPA 3UJJL 4TVDA 3V6ZA 1UJ3B 4OZFG 3WD0A 3A21A 2PR4H 5DURB 1G6RB 1GIGL 5J9PA 1KCSL 1ZL1A 2HG5B 1MEXL 4N9GB 4YEEA 5C0BA 3TO4C 3LQAC 4KUZH 3WH7A 2BXYA 1YNKH 5CGTA 1NFIA 2XTJD 5EU5A 3RGVB 3D1MC 1BFVH 3VINA 5DO2D 1CE1L 1YPZB 2WBWB 3T2NH 3RWGA 3U0TB 1YNLL 4OCXL 3BKJH 3BQUC 5D6CB 3T2QA 3MLUL 3HMWH 3QUZD 4O51A 1PPIA 4WLCA 3VRJA 4O9HL 1AGCB 3P3YA 4AT6A 4TVCA 3QEHB 3TJEH 5DI8B 5FA3A 3WY1A 1CGVA 4MDJB 4Z6AT 3ULUF 5F7LB 5TPWH 3PDDA 4KPHL 4GINA 3AXLB 2P5WE 1HSAA 3BUYB 3KPRA 1S78D 5FUZH 2VAAB 1MFDL 4X5WB 4P2YA 3VFOA 1QLFB 5I1GL 2PW1B 4N0CC 1KIQA 1V3JA 2RBLA 3R4DA 3VMPA 4QWWD 2LABA 4JZJA 4ZXOA 3GI9H 2V3EA 1XGQA 4HC1A 4FQHB 2OM5A 4DO5A 1LVEA 5TFSH 3GBML 5C0JA 5BS0B 5HYEA 4E0RB 2OSYA 3D5HA 1NWTA 3P73B 1QQDB 2QQLL 3TBSB 1PLGL 5DK0A 5C0CE 1Q6FA 5A94A 4FTVA 4F7CA 3Q6FA 3M6DA 3MBED 4NN6C 3LS4L 4NC1C 4PJHF 2BNQA 1QLRB 1FFPB 3O9WA 3AM8A 5TH2B 4MCZA 3ZO0A 4JE4B 4AH2A 4MB5A 4CU8A 5J0BA 3ALFA 1ZS2A 3BXWA 4FQ2L 4XGZA 2Q7YB 5AWNL 3LQAH 4PJIA 4PJGA 1K3ZA 1FZMB 3TVMC 3C5JB 2BVQB 2A1WL 3BZFA 4IS6A 2FHFA 3MOAL 4L4VE 2D7QA 1E55A 4ENEC 2CLRB 3ZKSD 2B31A 5GNZA 4XB8A 2J79A 2IAMA 2X70A 3GHBH 4RISH 4R8WL 3FFCD 4Y4FC 2HN7B 4YHYC 3L7EA 1YNTA 1G9EA 3SDCC 2QL1A 2R1XA 2B8OT 3BXNA 1FC1A 1QSFA 5C08E 1KR1A 1BFOA 1KJ2H 3GSXB 4JLRA 3DX1A 1E6SM 1QFWI 1OWQA 1KT2B 12E8H 2FGWL 3DURA 4JFXB 1J7VR 3UBXG 2ZE0A 3PN8A 4PBVC 4HULB 3QUXA 3HTLX 3QJFA 3W81A 3BVWA 4KKAD 4PD4J 1JPFA 3AREB 5J4MA 1JD7A 1FZKB 3CFBA 3QXWA 4Z76A 3ARVA 3QXTA 1XC6A 2D3LA 1ETZA 1PYWB 3PABA 4F7PB 4HXAH 1NL0L 3AISA 4NXSA 4JDVB 4PRIB 5CBEA 5KN5B 4I9WE 4G43A 2Z35A 3NIYA 1GGCL 1HZHH 4GKNB 1RURL 3SCOA 3U57A 2FWOA 2VDLL 3H9ZA 4E42A 2XPGB 2YK1H 5ESVA 5C2BH 4POYA 1YDPA 1JYNA 4LSUL 1AQHA 1MH5A 3KXFA 2WUCH 2G75A 5C70A 5M3WA 3NVQA 5FKYA 1KLUA 4YR6B 1M7IB 3DUUB 3EJQA 2ED9A 5E5MA 2FB4L 3RA7L 5L2KB 4XPGH 5C9KA 4NQEB 2FGLA 1EFXD 1T20A 3L3JB 1NCNA 3VXME 2ARJA 1S7VB 4MX7B 3RILA 1B31A 2EYTB 2EO9A 4KJWD 4RE2A 3MCG1 2AV1B 4W5ZA 1NUFA 3WEMA 5CFHA 1C92A 4P2RB 2XZQL 1U8HB 4FTVD 1NEZB 2XNAB 4U1IB 3PGCA 3WSQL 3PIQA 1LO2L 4DM2A 1HHJA 4P3CL 1JWMB 1FFQA 4NC2B 4DUVA 3DVGB 1FE8L 2BNQD 2O5XL 4X9YA 2GUOA 2OX5A 3WLBA 4FLQA 2YR3A 5F7KC 1OF2A 3CVHA 1C08B 1R3IH 4WI2A 2ILLA 4R5EA 3TH4T 4FXLA 5F96H 4IRSC 3CD4A 2XT1B 4WHTA 4P5TA 1JN6A 1WITA 3QEQB 4TSCH 4XNXH 5FV1L 4J4PC 1JHTB 1UACL 3N1QC 2EYSB 4M8VA 1RZ8B 3QIBA 2J5LC 4IIQB 4R4BB 4FNPA 3OAZH 5IHBA 5GGUB 3RPKA 2ZUUA 1LD9A 3ARBA 5IUSA 4UILH 2R4SL 2NY2D 3TEUA 5D7IE 2B4CL 3GXDA 3L4ZA 4RFNC 3P30H 3G5XB 2E4TA 2XKNB 2B2XL 2I26N 2ZPKL 3CNKA 1A1MA 4PJDF 4ML4A 2KUTA 2Y5TA 3TYFA 4XUYA 4K9EL 2CIKA 4IOFD 4UAOB 2Q8XA 3LKNB 3QRGH 4K2UL 1JWSB 3OR7B 1TCMA 3G08A 3L95B 4L4VA 1CIDA 4NQCB 3GMPB 3RVUD 4G9FB 2DDXA 3VIKA 4HGWA 2WBJB 4Z7VE 4UQ3B 3RNQB 3PL6A 5FD0A 3GGWB 3T3ME 4AISA 3FB5A 1WDSA 4CMMB 1GW1A 1FVCB 5C08A 1PJ9A 1ZE3C 4X5XB 1CK0H 4ORGA 4R90L 2MQ0A 4ZXBA 5D93C 1MCEA 3FQRB 1C8QA 3VXUB 1JDDA 5MEOB 4W7WA 3LV3A 5T3ZH 4N0UB 5BOPA 2CO6B 5I75C 4C7DA 3ZT5A 1NCDH 1E6JL 2VDPH 3FT2B 3GJEB 4L4TE 5ISZB 5J06A 2CXGA 2NY7L 3DRQB 5D7LE 4UBDD 3U48A 4PB9L 3VGAB 1AIFA 5F6IB 1ROWA 1GGIH 1ZS8A 1NMBL 1YPZF 4KKCC 1WAAF 1JAEA 1ACZA 3AHVA 4P5KB 3H3PH 3U7WH 2F53E 4U2ZA 4M1RA 1QNZL 2NY1B 4LAQH 2FO4B 4QRPE 5EU6E 2V17L 2P5WD 3D4ZA 4YHML 7TAAA 4K7PY 1B0RA 3ZLQC 2BVYA 1UVQA 5E2JA 4XHQA 1S9XA 3EFDL 4LEOB 2Y06L 3KJ4C 1G9MC 5EZLB 4KQ4L 2ID5A 2XXCB 3VXMA 2BJMH 1K9EA 2GT9B 1A3LH 3MCKA 2JIEA 2W4XA 2OXGA 3UG4A 2J7GA 4Y5VC 4ERSH 1CFVH 3I02B 2A0LD 3RDTA 4L4PA 5GS2H 5C0CD 3ZKQD 2ICWI 1OTSC 1YEHL 2PO6A 5L88L 2X9XA 1GYAA 4HUKB 3DXAE 4JFPB 2CHNA 5JDSB 5HHMB 1DBAH 2FDBP 1U8PB 5KSUA 3BVNA 2XSAA 4JO1H 3EZJB 4HA4A 1CLOL 4PMQA 2CLZA 5GGRB 1HP4A 1PD6A 4TSBH 1I1WA 4XXCA 5ACZB 1UCBL 5JORB 3G5YA 1DVFB 4HG4J 3JZ7A 4OUEA 4FOMA 2ZWLT 3OG4B 3SE8H 3EYFA 4LSVH 1IGTA 4OJFL 5D6DC 3MJ8B 2XTKA 4IOSD 1MI5E 3BUDA 4U4BA 1DWAM 1F3JA 2VZ1A 5C08D 1F42A 4Z7QF 3S35H 5IB3A 3UTZA 2EDHA 1YEEH 4R4FH 1QACA 4KMTH 3AYSA 1DUYB 2FIKB 1NKRA 3OKEB 4PLJC 4R96A 1Z6JT 1MVFA 3O3UN 5FK9A 1V7MH 4S1QH 5ENWA 1FP9A 2MPAL 1G9MH 4Y4HC 5DDHB 3VWJB 5D5MB 3VD4A 4Y19E 3WKMH 1T03L 4M93C 2XYCA 5KEZA 3MV8E 3G04A 1E27A 1U8QA 2IG2L 5ADPL 5IF0B 2F8XC 2D03L 1Q72H 4NJ9L 1B1YA 4Z7VA 4I9WD 5JOFA 2FEDC 2QKIB 3CC1A 2CRMA 2DH2A 4HIIB 4QHLB 2NX5B 1SFSA 3MRHB 2W65B 4LSQL 3AIQA 2D24A 3UTSE 1AD0B 3IGUA 4H04A 4Z77B 1LNUA 1CLYL 2XQYG 4ZYKA 4Q0XL 3MGOA 2A38A 3OKNA 4LHUA 4JQIL 2C4FT 3MLYL 4XX1E 1KXVA 1UC6A 1J1XL 3I3EA 2UV3A 4WI4A 1RV6X 3T0XA 2R69H 3QNZB 3GH5A 3V5KB 1Q8MA 4LBEA 2B7DT 4G6FD 2ITCB 3O2WL 3D18B 4HS3B 1P4BL 1U0QA 5IQ9A 5J6GA 1CI5A 4P4KC 1FHGA 2VR9A 1P84J 3E2HB 5CJOH 3RDTD 3HUJA 3I2CL 4PTMA 3FXYA 2HT3C 4MA8L 3NH7H 1CR9L 5D7LA 4ELME 1QFUH 3QCVH 1CWYA 4JM2C 4LVEA 3MODL 5BCAA 5L8KB 5E95B 2F53A 4ZOAA 3U7YL 4YO0A 5JBEA 3VVGA 3VFVA 3P2TA 35C8H 3BO8A 5EU6A 3QDME 4NQUA 5FO9B 2JTDA 2O93L 4M7LH 2G9HA 2Q86A 4LMQE 1SMDA 4LVNC 1BFNA 3CHEA 1E28B 5DEGB 2CKBH 1ZWIA 1V08A 3X3FL 4NZDA 4JANB 4Z9KB 2IGFL 4GW4B 4J3OC 1I1FB 5AD0A 4WU5B 1YY8A 4RAVA 3C87A 3V52L 4D0BB 3QPXH 3BSHA 3EO9L 4JM4L 3WUEA 4WTZG 4LU5L 3P4OB 1HVQA 2QEJA 1H3VA 2D4DA 1JTTA 5B4MD 3I50L 4KTEH 4HH9A 3DXAA 2E27H 1FRGL 4OLUH 1R3LB 1XH3B 5F3BB 4P9HL 1RHHB 1B88A 3IETB 1K2DB 2YSSA 3AIEA 4NRXB 4JY4B 4PRPE 1WBZA 3MRMA 2MOVA 3L5IA 3ZIZA 2AGJL 2OTUB 5K33A 1MHEB 3MBXH 4FQJH 4HGMA 4XWGH 2G3MA 3LPFA 1TJHL 1LL6A 3UPRA 4MSWA 1VHPA 1M05A 4JO2H 4J2XA 3AMDA 4ATWA 4UFHA 1KPUA 1MPAL 2F9BT 5EIIA 4D3CH 2P8LA 4I48A 4WCYH 1ZHLA 2O5YH 5D1QC 2OR7A 2IH1B 1ORSA 3LEYL 4JFHE 2AJYH 4LCUA 1FYTB 2HKFL 2VISB 4APQC 5DYOB 5IMOA 1T66C 1MHCB 2DM7A 2J4WH 3LMJH 3CFKB 2OTWB 5DD3L 4M3JA 1VFOA 1OHQA 1OB0A 1VEMA 3SQBA 2WWDA 5T1LA 1F6FB 3IDMB 2ALWA 2ZX9A 4JN2B 4YHGA 4OZOA 1B30A 4YX2L 2ADGB 2VLKE 1CWVA 1J5OH 1F6AA 2A77L 3T77A 1JNLH 1QUNA 3MMUA 1ZGLM 4RAHA 4L4TD 2R2EA 3UJTH 4LSPH 5HVWA 1N3NA 5I1IL 3S88H 3FL7A 1D5XB 2AEWA 2DIJA 4O58H 5HD8C 1L0XA 3ZDZF 3P40A 3UTSA 3W11C 3VNYA 1LE9B 5TE7L 1P4LA 4ZUVA 3KGRA 1HE7A 5BVJB 2YUWA 3KYNB 4PGBB 4QRPD 5DZNA 2AXFB 5E9DB 5EU6D 3GRWH 4KFZC 5LQBL 2OSWA 3GBNL 4PMDA 3PF2A 4JRYE 5BZWB 4KHTH 5DRXA 3F62A 5BVPL 2ZWZA 2ZJSL 1W91A 1L0QA 2WW8A 3BKMH 3GMQB 1R7OA 4PLKD 4XP4H 2ESCA 4DZBA 2EE9A 3CH1B 3JV6B 2H3NA 4UV7H 1X5IA 3CTTA 1C5DA 3F8UB 3OKYA 3V4UH 1CL7I 1AKJB 1TA3B 5CIPA 2WZPD 5JUEH 4JDTL 3UYRH 4GO8A 1F8TL 4UINL 1UB5B 3ZR6A 4ELMA 3BH8A 1RUKH 1XIWB 4NN5C 3V9FA 2IBZX 3DXAD 4XPTL 4GRLB 4GKZA 3NCFB 4PRDB 4ZUUB 3SE9L 1W8OA 4EDWL 5A43C 2X4PB 3N04A 2E40A 4ZFFA 3IFLL 2QQQA 4H41A 3D9AH 1FH5L 4FFVD 4H26B 3A67L 1XF2A 3QDMA 2E7HA 2O5ZL 3MA9H 1Z0NA 3F7RA 4YBLC 1CFTA 3GSQA 3PDOA 4AD5A 1Y7VA 2VC2H 2A6IA 3GNMH 4G6ML 3CDCA 1AC6A 5H35B 5LGJA 2HRLA 1VCAA 1CBVL 2HVJB 3A6CH 1G7PB 5KTEH 3HE6A 1IEBB 4OGXL 5JO5B 4LSTH 4YK4C 1NCWL 2NQCA 4X6CA 1CNVA 5KVGL 1A6ZB 2AERT 3RTQA 3T0DA 4KK9D 2IANB 1MI5D 3ZSSA 5E56A 1ZGLB 1MIMH 1MQQA 2H45A 2WK2A 5I1JL 3UETA 2RQ8A 4JKMA 2DM3A 2XM1A 3N85L 5KOMC 1S3KH 4TRPH 4YDIH 3NTCH 4X4ME 2ENSA 3VE0A 4HIXH 1RJZB 4PRPA 1IZJA 1OWWA 1E6ZA 3WNLA 5DQDH 3U82B 2A9ML 3LRGA 5DJYB 2JJVA 3QFJE 2VDNL 2K9UA 4Y19D 1Q6EA 2JIXD 3MV8D 5JPMA 2AEPH 2XA8L 1BD2B 2JB5L 4AIZA 3RWHB 3ISWA 4G6KL 3HRZA 4PY7B 4TSAH 5FM5M 1WZAA 2MHAA 4QGYA 3UTSD 4J3WA 4Z8FL 1R87A 3PHAA 2GJJA 2CJUL 4QHKJ 4JKPH 2DN7A 3SBWA 1GUVA 1VDGA 4GLRI 3BKYL 1HEZA 4ZG1A 4JHWL 1UM6H 5EORH 5GS3A 2GAZA 2EXYD 5DHYB 1T7YA 1DQJB 4HK0A 3RKDC 2V5SA 2VLKA 2BERA 1TG7A 1LO5B 3PWLB 5FYJH 5CHNA 2C5DC 3V4PH 3OAUL 3PP4L 3UJJH 4ODXB 3PWJB 5HHVH 2LTQC 4E9LA 5I18H 1SY6A 3LEXB 1GIGH 2C7UB 5MENB 4AIEA 3FNDA 2H41A 1F97A 1E6OH 3WIHA 3NAAH 2ZG3A 5C6PB 4BH8B 1YQVL 5I8CB 2FLRT 5FGSA 2XTJC 4ZUSA 3IDUA 3QIWB 4GW1A 3V6OC 3QDMD 2V2XA 5F89A 1CE1H 2VABA 3A0OA 2WQRA 5HYJB 3NCJL 4JRYA 1UQSA 3MLUH 3WFCL 2ATKB 4A6YA 3UCQA 4W8BA 3W28A 4GS7C 3WH5A 4O9HH 1T6WA 2RHEA 2GTZB 4C57C 3GJFA 1K9DA 4KI5F 1DEDA 1LO0L 3IJSA 3I75A 4Z2KA 4I0CC 2E6QA 3ZKND 1H09A 3MREB 4W4OC 1ZA3A 4HKBB 2R29H 5SWSA 3QCTL 3RTQD 4POZD 3IU3A 4HA1A 4HZAA 1WP6A 1S78C 5DRWA 1MFDH 1RZ7L 4F7EA 1JZ3A 5A16B 4PJAE 2C3VA 4AEEA 4GW5B 4ZD3H 3DTXA 4QY8A 1W3JA 4QRTB 4UQDA 1PG7W 2ZIDA 1UG6A 5BRZE 1HKIA 2Y07L 5IBTL 2CYGA 4EUPH 4KVNL 1A6WH 1Z3GH 5J12B 5HY9A 2ZX7A 2EACA 1O7SA 2VLJA 5JXEC 2PBOA 1L0PA 2P44B 4L8BB 1IC5L 1MELA 1UYQA 3MBEC 1KSRA 4I0KA 2YFOA 2D2OA 3ESVF 4PMOA 4GH7B 5HI5D 4X99A 2HFGH 2M8XA 4OZIA 1Q9OB 1TIUA 3O41A 2ZUMA 2CUMA 2NYYD 4G7YH 1GVYA 2J78A 3HMXA 4JFHD 4PJ5A 5A2IH 4FQ2H 5C0FA 1NFDB 4YXHH 3QHMA 3JWDH 4F15C 2DIAA 4XPBL 5F9OL 3PV7A 3BMWA 5FKAA 4KROB 4MLSA 3H7BA 3DO7B 2DT2A 4X4MA 3O0RL 4RCAA 5I66B 2YC1A 3UO1L 1A02N 2IPUK 1JNHA 3QFJA 4NKQB 3VNZA 3QG6A 2VLKD 3PHQA 1ZHNB 4V2XA 4BZ1H 3TBTB 1I7TB 3FRUA 3AIRA 1MCKA 4X98B 3I3DA 1QRNA 4OSUL 3LS5H 5JQHC 3S6TA 3PZOA 1X5FA 3OBAA 3IYLW 1AY1L 2FGWH 4DVBB 1JK8A 4P49A 2L4OA 5CGMA 2JF1A 1KJVA 3GI8L 3AOFA 4B0MM 5MEQB 4NWTL 1J9CT 3ZOAA 3GSNH 1ES0B 3S34H 1IEAA 3T3PF 4KKAC 5I23A 3Q6GL 1CE6A 3SCPA 4EJ1C 3CU7A 5FGBA 4JRYD 1NL0H 4U0QB 1E4WH 1NBVH 2NXYB 4L3CA 1PS3A 5E8EA 3FHQA 3CCHB 5A8PA 5ILTH 2WNGA 4UB0L 2ADFL 2V2WB 5DJ6A 5C0EB 1DDHA 5CP3H 2GJZB 3BJ91 5B39A 3CZJA 1SEQL 5D2NE 4A2LA 5CCKH 1CDCA 4O5LH 2GTWA 1TVPA 5D1ZB 2NY0D 1D5IL 3LPPA 1KBGL 4S2SB 4CADA 1TE1A 4YLQT 3Q5OA 1YHTA 1FVDB 3GTNA 2X89D 1T1YB 4OB5L 1RUML 4Z5RB 2VXQH 5C09E 1BG4A 1ITCA 4MNQD 2IPTL 1JPSH 2HWZL 4JZJC 2EEBA 5JIIA 4G6JL 2IQ9H 2IH3B 4ONHA 2P24B 1W1PA 5E6IA 4HPYH 4M03A 2P8PB 2WMIB 5KVFL 3UTTD 5DUMH 2OSLB 5I1LA 1I7RB 1H0DB 1JZ4A 1DBJL 3X12A 1M03A 5JIWA 2F1BA 2BSSA 3ZSTA 5JOPD 5DRZA 5I16B 3U5UA 3JUGA 5F8QC 2XG9A 5JHDE 1NAMA 3D25B 4H8WL 1C5CL 5L7XL 3JUYA 5GS1A 3SUVA 2QSQA 3O8XA 4HBQA 5DHXB 2C1OB 3AS2A 3D3VB 2ZG1A 1E4NA 1CU4L 3K8KA 4PJ7B 4QOKB 5J13C 3MRJB 5DFWH 1DANU 4LLMB 4PJAA 1J1OH 3TO4B 4Z2HA 4ZXLA 5I24A 2HFFA 5I0DA 1E71M 3S5LG 1GJWA 3WJJA 1UXWA 5BRZA 4QP0A 3C2AH 1BYAA 4NPYA 2VR5A 3C6SB 1UR0A 3QFJD 4WJ5A 2NNAA 4MVBC 1S9YA 2EH8L 3WMBA 4EI6A 2W60A 3B43A 1RQ5A 4JCLA 2NY2C 2EADA 1W3LA 3FCTA 1Q1JH 3MRBB 5D9NA 4JRXA 4U6YB 4XMPL 2AI0L 4X6EA 1KJ2B 1VESA 1QR4A 3QUXC 5FECA 1U8LB 2DYPB 4UOW1 2OR9H 4YHLL 5E6YA 2IALB 5SX5H 5T5NG 5IMLA 2GJRA 5ECJE 2BVPB 5FF6A 1KB5A 1KPVB 2BSRB 3ARFA 2IQAA 1U30A 4HC1H 1AXTH 1YN7A 4QT5B 1HVXA 5CQ1A 1FDLH 2ADIB 3MLRH 4PD4K 1HT6A 5B8CA 3AIWA 2PW2A 4XBPB 2YPVL 3KR3H 4PLNC 4K7PL 2X4OA 1E70M 5MI0B 3F7VB 2Q6WB 1NGQH 1D5BB 4HD9A 2I07B 3EDDA 3IGAB 1OARL 3VFTA 4OLYL 1NFKA 1YMHA 5L9DH 1ZT7A 3WF4A 5GS0C 1H3UA 1JTOA 1CXKA 5EOCH 4D6CA 4JN1L 4OFDA 4YUEH 4QHUB 4B53A 3LPGA 1HXYB 4FG6D 4TUKH 5EU4A 3HLAA 3ZT7A 3TVMB 2WCGA 1ZKAA 5HXMA 2CLVB 1JZ5A 4XC1L 4UBDC 5D70H 5EO1A 2QV2A 3ZE1F 1RZKC 4WHYG 3MUGB 4HCRL 3QI9A 1JUFB 4N0YL 4NKDA 2QPSA 3QNYA 4LHJB 1EPFA 1TETL 1QNZH 3RY4A 3CIQA 3C9NA 2EDRA 4FNQA 3OLIA 3QWRA 3MMEA 1NGYA 4BUHA 1A7OL 3JXAA 3O8XD 1T7ZA 4YHMH 3CMJA 3U4AA 4XV0A 3VXRB 3QQ9D 5FCUH 2EE6A 5ABFA 2Y7QA 2YPLA 1LHZA 3SCNA 1OAQL 4P5TC 4ACPA 3VFNB 4KZEH 1UWEL 5BRZD 1EOKA 3QIBC 3H3KA 1U8JA 4FQQB 4HXBL 5FGCB 2P7TA 3CV5A 5HI4D 2UYLA 1HNGA 1AH1A 3ARBC 1R3HA 4G8GA 2EABA 3JV0A 1T21A 3B9AA 3MGTA 2XWBB 2N7BA 3LRHA 3O3BB 2HVKB 3HNVH 4BZYA 4XMLL 3B3IA 1BYBA 3B9KA 1UKSA 2DQUL 1SBSL 1OSZB 4IRZL 1NMCC 5GS0H 3QOKA 2WMPA 4NNXB 4UCFA 5CBAB 4JL2A 3HE7A 4PYSA 5GNYA 3EYPA 4M8QA 4ODVH 3SKNA 2CPUA 4LP4A 1MCQA 1NFDF 4IOIA 3IDGB 1MNUL 4JFSA 3AMLA 3VD3A 5LGKA 2R8SL 3F6LA 3ULSB 4NQVB 3AAZB 2DBJA 3QFDB 1OB1A 1WT5A 3PL6C 5D2LA 1S7RA 4BF7A 4UOJA 4DTGH 1RZKH 4RQQA 3DX2A 4HWNA 1GGBL 4ONFH 5I30H 1JNNH 1A9EA 4GQQA 3BAIA 3VIIA 4YDJA 4NO0A 1UG9A 4XAKD 4I2XE 4NJAH 2FDMA 5DFVD 4ZXBC 3BP4A 4TQEL 1EEUA 5A8NA 3C08L 3CVHH 5D8JH 1R5VA 2VXVH 4ZS6D 1WK0A 4EKXA 1GH7A 5F1KC 4YIQA 1KFAH 4FXKB 1QHPA 4NOBA 4NUGH 4IRSB 2AJZA 1N26A 4Q9RL 4AG4H 3WSUA 1D5ZA 2D03H 1A14H 3QPQD 3T0WA 4Y16A 4G42A 1TJIL 4KJQC 4R7DB 4CRPA 5ABHA 5HTSA 3BN9D 2J5LB 2YDQA 1RK1B 1NWRA 4WKHA 4JFZL 5HGHA 4P9HC 4FP8H 1XF1A 4AEIH 1NBZA 5ERWA 3RBGA 1ZLSL 4OQTA 4BQ8A 5EBAA 2V3DA 5B22A 2P5EB 4XNUH 4LX4A 4ZO9A 2XZCL 5DJCA 5C09D 3X11B 1PZUB 4K3DL 4W81A 5M03A 1BQHB 1RUAL 4LFHD 1U8KA 4KQ3H 5EUKB 4NT6B 4PJBB 2JIXB 1QW9A 3RDTC 2EJ1A 2Q8AL 5T5FL 5EBLB 5KVEL 2D20A 3WDPP 4FZ8L 1I9RH 3W6LA 1MW2A 4MD5A 2Y36H 5JHDD 4BS0A 4H20H 3Q48A 3RVXD 3RL2B 2DD8H 1A6PA 2OL3A 2XIDA 3B9KD 4G8FA 4MD4B 3MSDA 5LBSL 3O45A 5EIQA 1XR8B 4NQDE 3MNVA 3FN0H 1R34A 3U4EB 5DD6B 4B3KA 4YHNB 5I75B 5IKCB 3WF3A 4PJ7F 4UOW0 5BO1L 5CAYB 4U1HB 3W29A 1TITA 4JM4H 1CF8L 1MLBA 1RZJC 2CEQA 4RAUA 4GXUN 4HG4K 4LRNL 5A6KA 3MRLA 4ZFZA 2ZXQA 5ITBH 1AO7E 3NSMA 2ADJB 2GCYB 3LIZL 4P9HH 4XNZC 3VGGA 3WBDA 4WW1A 1SBBA 3WHXB 4ACZB 1DE4B 4PMVA 3UESA 5EWIH 2GJ6E 3PG2A 1NDGA 4FQCH 3QNXA 4KY1H 3K4AA 2YD1A 2XN0A 1TJHH 2YBRA 3BIBX 3KJ4B 2UVFA 3KJ6L 3P9MA 1A21A 2EDNA 3BP5B 5IP4A 1RIVL 3CZFA 4Y16D 5DRNB 1M71B 3OPZL 2Y6SD 1QHZA 3QQ4B 3WFHA 1DLFH 3L2LA 1PKOA 3TBYB 2Y1VA 4HMDA 4HUVA 1XD0A 4HKJA 1KXVC 5AZEL 3TBWB 4RWYL 5HGDB 4OGAD 5E5UB 1EQPA 4I2XA 4HKXB 3POCA 1IGYB 5IB4A 4JDZB 1FJ1B 1E4XL 3UZQA 1C5BL 1CS6A 5DT7A 4ZO6A 5IFJA 4CNIA 2EEDA 5DJ8B 1IQDB 4KK8D 2CNCA 1WGOA 3MLZH 4PRNA 1CYGA 2H9GB 4OIIH 4EVNA 4HW6A 2Z93A 3C60D 1AGBB 3S37H 3RWCB 1UCTA 1SYVB 4MZ2A 1RZJH 5A1AA 1SYSA 4P4RB 3F5JA 1T04A 5BV7C 3STZB 3KL5A 5JA8B 4IM4A 4ALAL 2BSED 4C83B 1FZOB 2KL6A 2YIHA 1T5XB 4B3LA 1VAHA 2Y9RT 4I0PA 3D52A 2GVYA 2ED7A 3U0PB 4LYRA 3ZJ8A 5HYQA 3L3GB 3RUGB 3T0EE 1ISZA 1NP2A 1AHWA 3W6MA 1JGUL 5EUOA 2G3JA 3ZJ6A 3LPWA 1OQXA 1BQHG 2B1AL 3F7YA 1FORH 5E8DH 4BSWB 4LEXL 5L2JA 1QPKA 2ZCLL 3ARUA 5KSVB 4JDTH 3SDXE 2QF8A 4UINH 3BZDA 3MV7E 1NDMA 3V5DB 1P1ZB 1VFUA 1AR1C 3KPSA 4TTUA 1ZV5A 5HYSA 1R5IB 4PTTA 5BXFB 4GG6E 5CJXC 5FOOA 1Q9KA 5CEYA 3B8SA 3FQWB 1KBKA 1FH5H 1JCKA 4L8CA 3A67H 4OQTL 3RBSA 3BH9B 2F61A 2VL4A 3L4XA 4KJPC 1G1YA 2R2BB 3GMMB 3L3KB 4NQDA 4PY8J 3RWIA 1ISYA 3BCFA 3MOQA 5INCB 3HHRB 3MYZA 3REWB 4HAGA 4DWHA 3H0TB 1NM9A 1Q38A 2NTFB 4WEBH 1UH4A 2H8PB 4KDTA 5IHUL 1IGIL 5TDNB 5FEBA 4KK9C 3DX9B 1MRCH 5BV7H 2WVSA 2GK0B 5I1JH 4X9FA 1IGML 3N85H 5GZNC 3D85A 1EJOH 2LU3A 4PRBA 1V05A 1G01A 2OL3L 1GQIA 5E7FA 1J8HE 2ZX6A 3E8UL 1K8IA 4JFTA 4Z2GA 4HDIA 5F9JA 3NCEB 5CGYD 5K9OB 5C0GB 2GJ6A 3NFSL 4QRSB 4UTBH 2AJ3B 2F54E 4NKMB 1CDGA 3KYMB 2ZSWB 5JXAH 2XJ7A 2CITA 3UTTB 5HGAA 4AZ7A 3WFEH 1E6QM 1UJTA 4LVNB 4G8EA 1P6FA 3O2VL 3IS1X 5H37H 3LH2H 1OAYL 2JB5H 4F8TA 3F5LA 3OAYH 4MDIA 2MMXA 4HLZG 2I60L 4WWKD 3TIEB 1ZU8A 2FX9H 1RAMA 2DWDA 5KSAA 1WIUA 5E03A 4BK4A 1KC5L 2H1PH 2DLFL 2DJSA 4H8UA 4OUUA 1B4JH 4M7ZC 3BKYH 4L4OA 3C8DA 4JFWA 2HJLA 4LVHB 3QGVA 4UZSA 3PQYB 1CDIA 4UOZA 1IKFL 2EYRB 4I77L 3SCRA 4JHWH 4TTDD 1PKQA 1GQLA 3WF1A 3BGMA 2N56A 4XWOD 3VFUA 1FFOA 3DWTA 1JNEA 4CJ0A 3SDYL 2EE2A 3KEHA 5GGSY 1CFSB 5FM4A 3AHZA 4NQSA 3Q3GB 1CGWA 4DW2L 1D5MA 4P99A 2AQ2A 4PREB 2X05A 3K2UL 1Z0MA 5F8RC 2V5TA 2X2HA 4WUUA 5F71A 3B2VH 3C6LA 1RVFH 1WTGT 3KLAB 1DSFL 3GK8L 4NHUA 5D1QB 1WZKA 2F58L 4JR9L 3SY0A 1FNSL 1KLGB 1T4KA 4HUNB 1NCAH 5TE6L 3WS3A 1HF6A 1KENL 2L7UA 4FNRA 2EDOA 5D71H 1RJLA 2Q76A 3WDHA 5KS9F 2AXGA 2KDGA 5CS7A 2R9HD 3T0EA 3VJ6A 4BKLA 5A8QA 4NQDD 1K4DA 1XGPB 3VXTB 1UB6A 3EO0B 1AXSB 5C3TA 3TESA 4NZTH 5CINL 5JMRA 5CD5D 4PBWD 5D4QA 4FQXA 4RWHA 5JW4Q 4MAUH 4ZMAT 1FLRL 1B3YA 1FSKC 3ZKNC 3DBXB 4O2EB 3RWFA 3RTQC 5GRJH 1AFVL 1GZPB 3EIFA 4WV1C 2D31B 2GSJA 1QI3A 1AO7D 2BCKB 4GXVL 1KUMA 2X4RB 3AS3A 5IDIA 1UH2A 1X5HA 4DKAA 3PWPA 1L7TL 1MJUL 4GG6A 3WN5A 1Y0LA 1V3KA 4MJ6A 3QUMA 4N0RA 4F66A 2CIIB 5D1XA 4XP5L 3P11L 5IBTH 2GJ6D 5GSRA 3UC0H 1HJXA 4UV4H 1IRAY 1BGXL 3G5ZA 3VKKA 5DMKA 3TP4A 4XCFL 4OLZL 4X6DB 1E73M 1OCWL 2F18A 1ZLVK 2WW5A 3RWDA 5CIPH 5CSZB 5HHNB 4RRPA 2NYYC 3FB6A 5KSAD 1UKTA 1V6UA 4K3JL 2ZSVB 4MD0A 3V0WH 5DJDA 3EOAB 4LGSB 5TDOB 3SBWC 3ARDA 4HZ7A 1X4XA 4LLWA 5SWZE 1QSEE 4DUXA 1EO8L 3VXNB 1FL6A 5EO0A 2R23A 1J8HA 2J25A 1MFUA 2JEPA 3KPOA 3G6AB 1FCGA 3O6FD 3MX0A 3STLB 4PJFB 2ORBL 2YJQA 4IPNB 5A3ID 1BVLA 3MUIA 3OJ2C 1S7UB 4YBLB 3A24A 2F54A 4POUB 3BGFB 1X5GA 2F19L 4PB0L 1U41A 4IMLB 3PHOA 4WW2B 4D8PA 3SPVA 3WDQA 1F90H 1EX0A 2XZAL 2VSDA 5JW3H 3VI3F 2DQTH 2OWWA 2EDBA 2PXYB 1ESWA 2OJZH 4YK4B 1DLHA 3IDXL 3GI8H 4F7MB 1LWJA 1J0KA 3OLEA 1U93B 3G6DL 1I9IL 1A2YA 2OJEB 3KPNA 4NKIL 3IXAB 2DI9A 1JGLH 4C56D 4H8HA 2FJFB 3M17A 4M7JL 4U1JA 3F7QA 1Q6CA 3GJFK 4OT1L 4JZNB 1KELH 2DL2A 5DQJB 3K3QA 32C2B 2BVOA 4WFGE 3RUGF 1F4XL 1QVOA 2HTLD 3MQIA 1J18A 4JZOA 1T0NA 1MWAL 2X4QB 4MXWH 3DDFA 1D5IH 2Q8BH 2NY0C 1ZLVH 3MV7D 1KXQE 1GONA 1XGUA 4UMGA 3DV4B 3KL3A 3J7HA 4Y88A 2JIWA 5HNNA 4IHOA 4M8UA 3MGAA 3VIPA 1ONQA 2HWZH 1F4YH 4HJJH 5EOTA 4U31A 3OLGA 1RZIA 2IBZY 5FYLE 1DWGM 5AAMA 3DRTB 4C4KO 4BSVA 5FXCH 4BFIB 1GZJA 4EUPB 1U3HA 3VRLE 1G7HB 1BF2A 1DQLH 1XCQB 4HTYA 1CG9A 1MF2L 3MROA 5KANI 1T1WB 2X4SB 3QDGB 2VH5L 3BWAB 3VD7A 1W2PA 3M8OL 1SY6H 1OSPL 1YA5A 1A6UH 1J05B 2A6JA 5H2BA 3WIHH 2UUDK 5A8OA 3VW3L 4N8CL 4GO9A 3GUTA 2AK4A 2SEBA 4D0DA 4DM1A 3KLKA 3MO1A 2Z31D 5I2IA 5T33H 1J8HD 4TNVF 1V8HA 1FNEA 5FIEA 3WD5H 4Z7WA 43CAB 4NRSA 2A6DA 4M29A 4JM2F 4A6YH 2X5PA 1VERA 2QSCH 2F54D 1S9VA 2EH8H 5MEPA 5IT2H 2UWEB 3GJFH 4DQOL 4OKVA 2J88L 5AYBA 1FV1B 3NZ8A 2HJFA 3FB7A 4LIQE 5KG9A 4OFPA 1RIUH 3IFPA 3HZYA 3GXFA 4Z0XB 2G8ZA 4ZFOA 1OAZL 5GPRA 2R2CA 2E9LA 2I5YH 5I8KL 3NFPB 3MUY1 1OM3H 3MACH 1T0PB 4Z0BL 3GIVA 5DJXB 2AKRB 3CFDA 2LAAA 3BP7A 4RMTA 1W32A 5TF0A 3QUML 4M5YL 5FGBC 2JF6A 4PP2A 1T3FB 3FN9A 4J3UA 4HJGA 2CDFB 3VFMA 1QHOA 3TPUA 1R5WB 1K5NA 3MRKA 4J1UA 4I13B 1KTLA 1XV8A 5A2CA 4Y7EA 3W26A 1EAPB 4N8VA 4N5UA 4JPIB 1OARH 2J74A 1TQBB 4JEGB 2O61A 4JQXA 3BDYL 2W91A 3AMKA 4XP1H 3IFNL 4G6AC 3HMXH 1U95A 2BRQA 2HMID 3WQ6A 4E8DA 2Z9TA 4WFEE 4JFDE 4JN1H 3CO4A 1AQMA 2LVEA 5CEXA 3U36B 4J6RL 5DWUL 4XNQA 1OAKL 3BAKA 4NWUH 2G2RB 2ZOLB 4F15B 5JW5A 3HC0B 3K1DA 2PWEA 2ZKHL 3OZOA 1ZANH 3B9EA 4ZQKB 3MRNA 3UZEA 5E6IC 3QG7H 1BX2A 1EUTA 4UNIA 2J8FA 1ZEAL 4XRCA 3VH8B 2WV3A 2YEZA 2FD6H 1U3JA 3HC4L 4N0YH 5TJWK 5DK2A 1FGNL 1K9TA 4NQXA 3VGEA 5GS1C 5JDJA 3H9HA 4LSRH 1A7OH 5C2UB 3O8XC 4LMQI 5FO8A 2VDOL 4HMEA 1M6OA 4Y2DD 9CGTA 5DT1H 3F58H 3NCOA 4UQ2A 3QQ9C 3HI5H 2CBIA 3LKOA 4HUUA 3LD8C 2VDML 3U9UA 4I3SL 4JY5L 3L3HB 1E56A 1V7NL 2HAZA 1NLBH 2NR6D 3DHPA 2XGIA 5E2VH 3WJJC 4JPWL 4OLVH 5EU5B 1GHFH 4Q6IC 4ELKA 3BX7C 2BY0A 3OKKA 5DR5H 4HPHA 3H9SE 4TULH 4OCSL 4HXBH 1SEBB 3C60B 3EAKA 4G9DB 1JE6A 1CD1A 2VC9A 3GSOA 3EO1A 3IJ7A 1T1XA 4U1SA 1GSMA 4X7CC 3DVNA 5FUCC 4AD4A 3BP6A 4MAVA 3ZE2E 4AT6B 4UT6H 4CBPA 4HWBA 5KZCD 4IRZH 1QYGH 1MQRA 2IFFL 2ZOKA 5C6TL 5TQ0L 4LLAA 1HSAB 3KPRB 1HK6A 3B4NA 2Z91A 5I8EB 5SWZD 1HP5A 1QSED 2XICA 3TJHD 3CHDA 3EJJX 3ARFC 1OT2A 3VFOB 3ZHDA 1EHNA 1MNUH 5HDRA 1KPRA 2BC4A 1V6VA 1A7PH 5TQ2L 1NMAH 5B8CC 2GY5A 4Q22A 1XGQB 3GXTA 4U3HA 2MCG1 1EDTA 1GGBH 1KIRA 1QO3A 4PJEA 4OV6F 4UQEA 5IMMB 5AYIA 1K3IA 1Q0XL 5DK0B 4R0LA 3V0VA 1QOKA 3WDJA 1JXKA 1QX1A 2XQBL 4PG9A 3Q6FB 4Q7NA 1NAMH 3LKSA 1I3UA 4XZUB 4DAGL 3L4YA 3RIKA 2O92A 4YHPA 3HPJB 4S11A 5FB8A 3VI4F 3BYYA 5DFVC 3UR7A 3O9WB 4TQEH 4S1DD 2KQNA 5IR1A 1OM0A 3O4LB 4W6WB 4WW2F 1S7QA 2VL5A 4DOHE 2FBJH 4XGZB 5D7JB 4ZS6C 2GIYA 2Z4QB 2C1PA 4PV9B 4XHJC 5F7DA 1XCTB 3JV4A 4ZUTB 1HSBB 1XMWA 4P2OB 3PZGA 4PJGB 5DJ0B 2FH8A 3NFNB 1RP8A 1GC1L 4Q9RH 4IS6B 1UOKA 4DWSA 3BHBA 1G5AA 1FHLA 5A6JA 2I9LB 4MXVE 3QHFH 2QTEA 1I8MA 2IAMB 2X70B 3QT2A 1I3RA 3DHMA 4LPXA 3NACH 3UYPA 2NXZB 3LQZA 3KDMB 1AGFB 3HAEA 2WP3O 2FNBA 4AQOA 1INDL 2J8UE 4V1DE 4NFBA 3ELAT 5D2NC 1ODAA 1QSFB 2RCSH 2W9DL 3QEGL 4YPGB 5I19H 5CP7A 1N7ML 3MMDA 2CK0L 1ZLSH 2IJ0C 5IB2B 1BFOB 1KCRH 2Y8KA 4JLRB 5IW1A 3VFPB 3LKRA 5AUMA 3K80A 3QZWA 1X5JA 5CSUA 2XZCH 3RKPA 2NCMA 1N6QH 2DMKA 1KB5H 2ZUTA 4RSVA 2PYFB 3OJVC 2DKMA 1CDBA 4YBHA 3D3AA 3CFBB 4PGZA 2PTUA 4YDKH 1GGYA 5TGBB 3VH8G 4XMKH 4F57H 4XI5D 2PTTA 2BVTA 4U0RB 3KPQA 5EU3A 5HDQH 2Z35B 4U6XA 4Q9QH 1MXDA 1MIEL 2FWOB 2IPUG 1KTCA 1Q94A 5ESVB 2Z1KA 2X10A 1KEML 3GEWB 5MP6H 3S96A 3T4AB 3ULUE 2BVEA 2VZTA 3B9KC 3TZVD 1I1RA 3KXFB 1OAUH 3OX8B 4LPYA 5LBSH 4YDVA 5GGSA 3UPAA 1ZGLP 3NDYA 5TE4H 5F21B 1KLUB 4CCDA 1B4RA 3HE7C 2WMHA 5E5MB 2VXUL 4MQ7A 2W9EL 3CSGA 3EFFB 4GPNA 3AVEA 4MNLA 3C5ZA 3ECQA 3SCSA 5KVMC 2ARJB 5SWQA 2NY3D 1G7IB 3W5NA 3SCMB 1WT5C 2NY6B 4P48A 4FFWD 5JIPA 3MO4A 1RU9L 4CUCA 3AZRA 4XP6H 3MRIB 1CGXA 1MRFL 1CXEA 4LRNH 2CPCA 1ACYL 4MB4A 5FUOH 4YXLL 3PGCB 5E00B 3PIQB 4KMLB 1HHJB 1XGYH 3VD9A 2D9QB 4OQ1A 3W0WE 4CU7A 2VITA 4PJHE 4RMSA 1D6VH 2UWEF 4KK5D 3NSNA 2GUOB 3UCRA 2Z8RA 1BQLH 1OAXL 1I1YB 2X41A 1C16B 4WTWA 1R33A 2UVEA 1NC2D 3CVHB 2NLJA 3G6JA 5TD4A 3KJ6H 4PJXB 4A3YA 3ARWA 3MLTA 1L7IL 1JN6B 2DTSA 4Y16C 2IMMA 2D7MA 5EO9B 5D72H 4IPLA 1CXHA 4JPKH 3MJ7A 3OPZH 3QIBB 4QRRB 1YYLL 2YWYA 2FL5A 2X2IA 1XH1A 4FQPA 1UWGH 2XXMB 1OTTD 2EIZB 2WWKT 4LQFL 4YZFF 4FFZL 3ARBB 3CLEL 1ITXA 1S8DA 4PYGA 3PWVB 4DGVH 4DK3A 3MLVL 5AZEH 2EXOA 2CGRH 3MRDB 1FFRA 3LCYA 5AZ2L 4UNVA 3TOPA 1NPUA 5IJVB 4WFED 4JFDD 3VXPA 2W63A 4D9LL 2ATPA 3HPLB 3TT1L 4YN5A 3QCUH 3ZZ1A 5E09A 1EEZA 2D7TH 4EI5D 4C54A 1IFHH 4L4VB 5ABDE 5KAQF 3BKCL 5F88A 3MRFB 5DEFB 3GSRB 4HGWB 4P5MA 4M61A 3PL6B 1GQJA 4MJIA 4GXPA 3GMLB 1QFHA 3BVUA 4U1KA 4U1NB 3WFLA 4LIQL 4V1DA 3RHWF 1LILA 4HT1L 3MXWL 1YZZA 4YE4H 5I1DA 1E40A 1VKXA 5I73C 4XTRC 4OV5B 2ICCA 4X4XA 1JGUH 4ZXBB 1BSIA 1V3HA 4UFKA 1EGJH 4IRJD 5A6SA 1WCQA 1G9NL 3QUYB 2JE8A 4P2CG 2B1AH 3BAXA 3LV3B 3ZKXC 1PVHA 5F1IA 1G94A 1KCVL 3PZUA 5CEZE 3L1OL 3IJ9A 3L2MA 3AIBA 1BJ1H 5IQ7H 3U2SA 3H9SD 2MCPL 1OTUD 4DUWA 1B0IA 4H2CA 1KCLA 2F5AL 2JCCA 3WL0A 1DBBH 4HUWA 4DKDC 3IJHA 4QRUA 1D9KD 5I15H 4M7KL 3VSVA 1AIFB 4IDLA 3S35X 4HPOH 2AVGA 1KB3A 3ZYZA 1IC1A 4H25A 4XBGA 4X9BA 3HFMH 1W9PA 5C0DB 4AD2A 1U6AH 1I1AA 4OQTH 1YJDL 3THCA 3B8YA 2DF3A 4HIJA 4QO1A 2GK1A 4GXUM 1UVQB 1IC4H 4LASL 1S9XB 2GY7B 1JWUB 1N59B 3RJDA 3VRIB 1I8IA 3IB4A 4X8JA 3KLHD 4XB3A 1MJJB 3VXMB 1HKLH 5DMGC 1HDMB 3VIGA 2VERN 4HU0A 4AENB 4WEUD 3RQ3A 3O81A 4YHKH 2PO6B 1IGMH 4GSDL 5ACLA 4I3RL 1NJ9A 1MUJA 2OL3H 4H88L 3IVKB 1NCCL 2H32A 2C26A 4N0FA 4XAWH 3L7FA 4M9PA 4NM8L 3BVNB 5I1AB 5LJYH 4EK7A 4H1LB 5CGYC 4LDOB 4NO2B 2ICWJ 5IBLD 3LEVL 1TVHB 4LKCA 4JAMA 4BA0A 3GO1H 1UZ8A 1MCCA 3VFSA 3G5YB 5HPCA 1MQKL 3MLWL 5H94A 3GNOA 4ZE4A 3WO4C 4X6BA 2FX7L 2I60H 4FQLL 4PJIF 3E3QE 4PJGF 3CZGA 4HWUA 1IL1B 2XY2A 4Q74A 3D69B 4C7GA 2ICWA 5BQ7A 4C4KT 4Y0GA 1LL7A 1NC4D 5LGHL 4V1DD 4YWGL 4I0PC 1C8YA 3TCLA 1XGTA 4MS8D 1F3JB 3VXQA 4L1DA 5GISL 2OMNA 2JKXA 4XCYA 4I77H 3UTZB 2AABL 1AHWC 4UQ9A 3IF1A 4PV8B 4FXGA 2DKUA 3CSBA 2AJUL 3TV3H 2J47A 2XN9D 5FK9B 4I5BA 1NGXB 4QAWA 1HKFA 4OZFA 3V6FA 3KVQA 2E3ZA 2YRPA 4P8WA 3BDXA 4NYLB 2OR8A 5GRVK 1E27B 1S5IL 1U8QB 4P23A 4YFLF 3A5VA 5I17A 3WIIH 1BOGB 1DWJM 3WCYA 5GRYA 3MNWB 4J8RA 2R2HA 3MYJA 4P46D 3SKJH 1FO0B 3WYRA 3ZDYF 2F58H 4HIHA 1YPZE 2W1NA 3ZTNL 1BVNP 1Q6GA 4GAGH 1EO5A 3UROR 1AJ7L 4W68A 1I1AD 4ZYKB 5IEKA 3ULUD 2IPKB 3MGOB 1MW0A 2OLHA 1ZT1B 3OKNB 5DMYA 5L6YH 3LRSA 4LHUB 2FJHB 5M5DA 4UDUA 5J11C 3Q1SL 3WL1A 4QNPE 2R9HC 4U49A 2F74A 1T5WB 3R8QA 3SDCA 4R26L 5C0RH 1N0LA 3PV6A 4HX1B 4UIKH 5GGRY 2IUZA 3LN4A 4LBEB 2HA1A 4LCWB 5E2TL 3VM5A 1QP1A 4B9ZA 3IJYB 3GDBA 1TJGL 4GUPB 2EC9T 4ZNCD 2WBKA 4DN3H 3DIFB 5JPNA 1TTFA 2MWCA 1LEGA 5IQ9B 2GJPA 3LXAA 5J6GB 3V5HA 4KDTC 1MFBH 3HUJB 3OB8A 1J1PH 1UD3A 1VJZA 4DN4H 5JHLL 1YC7A 5D7LB 4D0CA 1JFHA 1WFOA 5T1MA 1EQCA 1OQOA 2ERJC 3CXDL 3W0WD 5FYKU 1VJSA 5BS0E 1L7TH 3ALWA 4LKXB 4U5IA 2OZ4H 1GVIA 4XCCL 3MCLL 3VFVB 3BO8B 1H3PL 3NIFF 3ZO9A 1NCBH 3CSYA 3OKMB 4ZFGL 4QXGH 3DVIA 4Q2ZA 2G9HB 4C55A 3QUKA 2Q86B 1FN4A 4HPGA 1DFBH 1I7UA 1T7XA 4FABL 4ZPVA 3IDJA 4AY0A 2Y23A 4YHIA 3PGDB 5KSBE 3HU7A 1NAKH 4UIMA 4D6JA 3BUTA 4NZRL 4QXUL 3ZTJG 4BYHA 1YY8B 5AD0B 4RAVB 3ARGA 3FB8A 1K8DA 1KJ3H 2EIBA 4F37K 5KSAC 5TDPA 4CKVX 8CGTA 4PTWA 2FGZA 4D6HA 4ZPTA 3TN0D 1CICD 1VPOL 2WMJA 1FQ9C 5DVKA 4HH9B 2DQIH 2BHYA 1MCOH 4O02H 3ULUL 4Z7QE 1KEGH 2HH0L 4NRZA 3T4YA 4ISVA 1JJUA 4H1LG 1XH0A 4LCYA 2WAGA 3MRMB 1OY3B 3BE1L 4G80A 5EPMA 3FHAA 3WXVL 2ZICA 3N1MC 3LHPL 1YEFH 1FGVH 3ABZA 3HR5A 3UPRB 1HXJA 1EXUA 4EBQL 2BOBB 4MSWB 3UBXA 5IIEA 4RIRA 1IGJA 1KPUB 5EIIB 3C6LC 2EDYA 2P8LB 3L5XH 4JREC 5HI3C 1J0YA 4FFYH 5IG7B 2WXDM 2ICEA 2H6PA 2YDRA 3Q0HA 4LCUB 3DX3A 2VRJA 2WMGA 4RFOH 3IANA 4PRIE 4J4PA 3TA9A 3ZQ9A 1PBGA 2GITA 4K8RD 3T0EC 5JZ7D 2YXMA 3CUHA 3FTGA 4AXNA 2JALA 2FH6A 4JKWA 5KVDH 1QI5A 3CZKA 1CVSC 5E0FA 3LX9A 1UJ3A 5CEZD 2DQCL 4FQXC 1JYVA 5L2KE 3D0LA 1J01A 1G6RA 1S9KC 1TLKA 1F6AB 4NQEE 2D7PA 1W0VB 4MCYB 4N9GA 2CKSA 1MVUA 3C8HA 4JRWA 3TT3L 5HPMB 1EERB 1N3NB 3RGVA 3JV5A 5IHZA 2ZOXA 5C9JB 1CFQB 4OM0H 2R1YB 5LYRA 5K93A 1AGEA 3JVGA 4MAYB 5DZOA 3U0TA 2DDQH 2G5BB 4P2RE 4YXKH 3WUWG 5D6CA 1F11A 1P4LB 3G9AB 3WN5C 2V5CA 1A3QA 3DC0A 5D1XC 1WIOA 1XSKA 1HKJA 3GM8A 1AGCA 4D2NA 1S7TA 2N7AA 1NGWA 3QEHA 4DGYH 2DBLH 2VDRH 3QHTC 3G6LA 5DRXB 4MNMA 1UASA 4N5ED 3FO2B 1WLHA 1IM9D 1RULH 3AXLA 3BUYA 3U0WL 2NT1A 4XNMB 4NP4L 1J9YA 4JFFA 2H3NB 2AEQL 3ARGD 4X9HA 3RVTC 4WU7A 5AG8A 1QLFA 2PW1A 1ZOXA 1BEYL 4U1MB 3QEQE 2BZDA 3TA3A 3O3DB 3WH9A 3QWOB 4HBCH 2J6EL 1A22B 1MJ8L 5IFTA 3VCLA 1QBML 2B20A 1U8OB 4ZTPL 4FQHA 2UY7A 3VG0H 1JYWA 5BS0A 3F7PC 3W53A 1QQDA 5EULV 4UI2A 4CN6A 4ZFFB 2VURA 4K8RL 4XVUC 4X7SL 4R97B 3BI9X 4Z7UB 2CKNA 4LNVA 5E5RB 5F1NB 1OP5H 4Y5YB 1GORA 1QLRA 4Y1AB 3GSQB 5TH2A 3PDOB 4N1EA 4JFOA 5CEZL 2ZCHL 5D7KE 1OP3H 2DPEA 2Q7YA 1N64L 3GB7A 3HE6B 5KSBA 1E4LA 4M48L 1W72L 3QHOA 1BM3L 1FZMA 1OAZH 4B15A 3C5JA 2BVQA 3UJIL 1C7TA 4KVCL 4X6CB 4XP9L 1A7NH 5I8KH 3SCQA 4NQCE 4G9FE 1F4HA 3IDYC 2A9NH 3ZE0E 3VWKA 1P7HL 4BH7A 3NUKA 4Y5VA 3QUMH 1P2CA 3HG5A 1C1EL 5I1KH 3FRPG 4YNYB 5MERB 3GSXA 5DURD 1KT2A 1CFNB 1WV7T 2X4UA 3WELA 4YHOL 3CFJB 3RU8H 3VXUE 5KJRL 5FIPA 1JTPA 3LKQA 1NP0A 3OXSA 4N0UE 4JG1H 1A4JA 2ZP0T 5C07E 2LV4A 3HRZB 4OZGA 1GOHA 1GXEA 1GRWA 3EUUA 2MHAB 1NH6A 2OI9C 3A6BH 1P4IL 2FLBT 1CD8A 5DWUH 5ISZE 2AK1L 4GZJA 5C0IB 4GQPH 4LPTA 4JDVA 4Z7VF 1NC2B 4PRIA 5KN5A 3GYCA 3OKDA 1HEZB 1GCFA 2CK2A 3U5YA 1ZEAH 1EIBA 1U3HC 1ED3B 2DAVA 3U6RB 1M7IA 4R4ND 4HK0B 4KKLC 5L2KA 1OT1A 1YEDA 1W3KA 4QDMA 1FGNH 4ZENA 4EXPX 4NQEA 1ZLWK 5EZOL 4ONGH 2A83A 3VXSA 4GI9A 2ZUQC 3L3JA 3QDJB 4TUJA 3BVVA 1S7VA 1CZ8H 4MX7A 2EYTA 2PCPB 2FATL 1RZFH 2BRRH 1QPPA 4JHAL 1C3FA 3RY6A 2JB6A 3L3DA 3P4LA 1F4WH 4AYSA 3HUJF 2NR6C 4ZAKA 4RA3A 3K2MC 1U8HA 3PZQA 3MJ9A 1A3RL 2XNAA 2CMRH 2D9CA 4U1IA 4PJ9B 3SKUD 3O4OC 2PWDA 4AQ1B 5F89B 4X0VA 4PY8I 5HHME 3P0VL 5CWSB 2VABB 3DVGA 4JFEA 3CZ8A 4GRWH 1IT9L 2EIDA 4A6YB 1LK3H 1N5AB 2VXTL 1G6RL 4YQXH 4NO3A 2DQDL 1ISXA 3P0YL 3GJFB 1D6EB 2A3EA 3KPPB 3I75B 3VPLA 1LWRA 4M62H 3RY5A 1GJUA 3VX0A 1ZA3B 4CW1A 1TQSA 2DS4A 5SWSB 1I9EA 3WQWA 3II1A 3IU3B 1ZT4B 5DRWB 5HBFA 1TPXC 2EYSA 1RZ8A 3TJHC 1A5FL 5JUVA 4XPHL 4R4BA 4YDLC 2BP3A 1HINL 4QY8B 3QHZL 5EB8A 4RFEA 3W82A 5E94B 3DMMA 4L8SB 5CJQH 4L3EB 5J6HA 4NNPH 3BZ4A 2XKNA 4X83A 2VLJB 3THMH 1S7XA 1FOBA 5F9WC 4DAGH 3RPMA 3BEVB 3IU4H 4JQXC 1HWGB 1LG1A 3ZHKA 5E1HB 3ME0A 2K3TA 3LDBB 4X99B 4XH2B 3TNMB 3ARED 4OZIB 5D5ME 4W8LA 1UT9A 3S4SB 1J12A 1ZLWH 2RGSA 3NZHH 3B5HA 4WO4B 1ODUA 3OR7A 3L95A 4PJ5B 1DBML 4AM0B 4RDQF 1WSST 4NQCA 4G9FA 3O6ML 4NSKA 5F93C 4PRID 2WYSA 2WBJA 1DEEB 2PETA 4UQ3A 3RNQA 4E41B 2ARJQ 5CUSL 2NX5E 5DD5L 2X2YA 5FKAB 2MJWA 3X3GH 3UTPE 5FHBL 1CGUA 4CMMA 1HYSD 1H2JA 4MQSB 4W93A 5T1KA 1JGIA 4OD3L 5T1DL 1JNHB 5D7SL 2FYYA 1UUQA 4IEFB 3QG6B 1UENA 2QMJA 1KBBA 1T2QH 3FQRA 1YY9D 4UQAA 2W9DH 4P57A 3FRUB 1FIEA 3VXUA 3RX5A 3FMGL 1QRNB 3BPLC 3CX5J 2BMKA 2E7BA 5C07A 4CMHB 5BJTB 1NUDA 1JK8B 4PBXA 4AL8L 3AMCA 3L5WB 5ISZA 4P2RD 4XPAH 2YKLH 5A6AA 2F1AA 5FA4B 5ANMB 1GPFA 4M1GL 3BUBA 1CE6B 4HWEH 4P5KA 4KV5F 4QFUA 4O4YH 2FJGA 1ODZA 5DUBA 4RMQA 4XI5C 4L3CB 4ZS7L 1UR9A 2R0KH 1MIEH 1M4KA 1CLZH 2NPLX 2UWFA 1RUQL 3B2UD 3NABH 3M7SA 3O2LA 1BVKB 3WD3A 5DJ6B 4KI5E 1DDHB 2EH7H 2V9QA 3GIZL 2A3HA 1NC4B 4IISA 5B39B 2VZVA 2YA1A 2XVPA 4DKFH 4M3KB 5F7YC 4HF5L 3QEQD 4G5ZH 3WD2A 1OD8A 2VXUH 1VFBB 4G3YH 4HFUH 4CADB 2W9EH 1R3JB 2JJSA 4WEMB 2WHMA 4EN3B 3RJXA 4HS8L 3BSZH 3WMCA 4ELMF 4H5SA 4JGUA 4FFWC 3BN3B 2I25N 4JFPA 1QKZH 3MV9A 5JDSA 5T3XE 4ONHB 5DTFB 5E6IB 3BW9A 1WCBA 1U8PA 3T0BA 2R0LL 1ZLUH 4UTAH 5DJZA 5D7KD 4Z7UF 4L5FL 4P46B 2BSSB 2RR3A 3QO0B 5DRZB 5GGRA 1KYOK 3JSSA 3W9DA 3EJUA 2QR0A 5GRWA 3W2DL 3AY4A 3WQ4A 4L9LB 5IVXA 3SCWA 5ACZA 1CCZA 3OHXB 3EJYD 1T1ZA 5GRVL 4HSQA 4G9FD 4UT9L 4AWEA 3QXAB 4UT7H 2WBJD 5IFHH 3FAXA 3VFRA 1U8IB 4KRPC 4X6CF 1MAJA 2YD6A 1AQDB 4PJAB 3T65A 3U79A 2HFFB 4ZE5A 4DWSC 1TZGH 1FYTE 4X80H 5ABEA 2X8RA 5FYLH 2EO7A 5J1AA 1UXWB 1XZ0A 4P3WA 1TZHA 2H2PD 3AXHA 3WN6A 3EOBB 1HQRA 4WJ5B 2NNAB 2QQNL 2VLRA 3FAWA 5E99H 3UXFA 3INUH 2ZUNA 3CLEH 3O9NA 2FIKA 3OKEA 1XR9A 3VXUD 3GKWH 1DL7L 2BX5A 1J0JA 4HWBH 5DD0L 5AZ2H 3OGCB 4WKAA 1YJDC 3S4SG 5DDHA 4I1NB 3VWJA 5D5MA 5EOQH 4JRXB 3AU1B 4GQ9H 4FNLL 2WHKA 5ISZD 3D48R 2DLEA 1V02E 3F12B 5IF0A 1YEJL 2KPNA 2CCRA 1UA6H 3MXVL 3SGJA 2QKIA 4HJ0D 4HIIA 1LEKA 3MRHA 2W65A 2WAHA 3ARFB 2IQAB 2AAVA 1Q9WA 3K8LA 2NY1D 4Z77A 1YN7B 4ZFMA 5B8CB 3QP3A 5E9DE 2PW2B 1MLCB 5DS8A 2QBWA 4OI8A 1EH9A 1XFPA 2X4OB 4YHZL 2QADB 4LIQH 3QNZA 4M1DL 5IK3B 3V5KA 4HT1H 4P9MH 4XVJH 3WFDH 3CJJA 3VIMA 3VFTB 2BSTB 3PWUB 4K23L 1FG2B 4H7VA 4HS3A 4OCYL 1W3HA 1ZT7B 1GCYA 1FG9C 1JF1A 4EOWL 1MAKA 4IRJC 2B0SH 5CKGA 1QNPA 1E1EA 1U58B 1SM3L 1KCVH 1DQQB 2VZ3A 1B2YA 1QA9A 2ZZUT 5A6MA 1V6YA 3Q5YA 5EU4B 3HLAB 2BFVL 5HHMD 4CVUA 3O3AB 1F4AA 3WEXA 5E9AA 1H9VA 3I6GA 5JA9A 1A0QL 4NQTA 1D9KC 5ESQA 3HAEH 1T22B 2WWMC 1J0HA 3U4BL 3FO0L 3EYUL 4JO4H 3QI9B 3RZCA 4GI8A 4NKDB 2VR4A 4ORZC 2VCCA 3C9NB 2IMNA 4Z95L 1E28A 3MMEB 4AW7A 3O2DA 4J28A 3PZIA 1DVFD 1FC2D 3SEPA 4PGCA 4GW4A 4WU5A 1LWHA 2VUOA 5ABGA 4D0BA 4XCEA 1KCKA 2YPLB 1LDPH 1MAMH 4ACYA 5IM7B 3KLHC 4AEHH 2KQMA 2IANE 2QMKA 4ZOCA 5ALCH 5DLML 1H0IA 1A47A 5JW4N 4KGLA 1CEOA 1H11A 1BZ7A 1R3LA 1U8JB 1YUHB 2XN1A 2P7TB 5DO8A 1JGDA 2B39A 1IGCH 2UYLB 3IETA 3POHA 3JWOC 4JY4A 4G8GB 1S5HA 3NPSC 1X44A 2OTUA 1T21B 1QFWH 1QI0A 1NCCH 2XM2A 1SVCP 3VWJD 5FO7A 3HS0A 4CVXB 1IAIH 2NTSP 3C5SB 3QUZA 3T08A 1YYML 4CVZB 3WENA 1BBJB 1BD2E 2YRLA 4PJ8B 3LEVH 3HE7B 4OZIF 2AJXH 5IBLC 4R2GB 3WLWD 2K7PA 5JR1H 3H55A 2NX5D 4FQIH 1N5YH 2IH1A 3HC3H 2YUVA 1WPCA 3UTPD 3OIHA 2FX7H 4BQ5A 4DZ8A 4OF7A 2NZ9D 5DYOA 3C2SA 4XVSL 1MHCA 5D2LB 3QIUB 3BPNC 4BUGA 1QLEL 2B5IB 2ESVB 3QAZC 3MJGX 3CFKA 5LGHH 1FIGH 2OTWA 3C09B 4YWGH 5I1CL 2A6KB 1EAJA 4LF3A 3F65A 4KTDH 4FZEL 3RWJA 3UERA 4P59H 4NO0B 1E3XA 1NLDH 3IDMA 1MFCL 3U83A 4RGMC 2JELL 2QHRL 5GGQH 2ADGA 2VLLB 1EGZA 3HI6H 2AJUH 3UEQA 4PMYA 1R5VB 2XHYA 4PJDB 4PSRA 2ARWA 4LLDB 4KU1A 4XBEH 4OGYH 5MENE 2X1QA 5IHSA 3MNZB 1S5IH 5ADOL 4U6VL 1H5BA 4M6OH 3VG9B 4A2MA 4G42B 4OF6A 3ZE1E 2BDNL 5BVJA 2GHWB 1PSKH 2AXFA 4NN7B 5E9DA 1CLXA 3MOBH 3K1KC 5GHWL 2XIIA 3JWOH 5HYJE 4KI5D 3CH8A 1QOXA 5HGHB 5BZWA 1I1AC 5GGVL 4CD8A 1BFSA 1YEIL 1NBZB 1LK2B 5ERWB 3FFCA 1X9QA 5F3HA 3AICA 5GJSH 5FHAL 1JGVH 2YKKA 1N82A 1Q6DA 1MJ7H 1TA3A 1FPTL 2R56L 1UB5A 1MCLA 15C8H 1XIWA 6TAAA 1T0MA 5T3XD 4GRLA 2PC8A 1IAOB 1BMGA 1HNFA 4U3XA 1F2XK 3MLXL 5A2KH 2BNJA 1AI1L 2E9IA 4UUJB 3NA9H 4H26A 1SVZA 4GBXB 3CLFL 2FR4A 4LARL 4MB1A 1ZVSB 1ZHKA 3WEOA 2DWEB 3AIVA 5EIVA 1RK0B 3L3IA 3R1GH 4AMKL 4G8FB 1I3GH 4L29B 1OWRM 1G7PA 1F45A 2YZ1A 3O45B 3S98A 1E6NA 1IEBA 3CXHK 2VLME 1X5ZA 1B3ZA 5KBNC 3FT3B 3CMOH 1CDUA 4ODBD 5AYUL 2XI9A 3T8XA 1NFDE 4OFIA 3AI0A 1FYTD 1ZGLA 1UWIA 3W25A 3Q5TA 2BHUA 2PF6A 3ECBA 2W61A 1H15A 1MLBB 1Z9SA 2J8OA 4PJAF 5I9QC 1EFXA 1YEKL 3JTSA 4RAUB 1UWTA 1FH8A 5F7EH 3ARZA 4M7LT 3MRLB 4ZFZB 2CESA 1EMTL 4TOYL 4D9QE 4MGXA 2ZNXA 3SQOL 3EKCA 3LAFA 2CRIA 3O2DL 3CDGB 3NCYS 5F97E 5E1AB 2HT2D 5EOCJ 3UTQB 3I9GH 1CTNA 1BD2A 2JK5A 1QEWA 3PGFL 3MR9A 3QNXB 3FQUA 2AJVL 1CZ1A 1UM5L 2G4FA 3P9MB 1LMKA 4CL7A 4P23C 3D87B 4PMNA 3CZFB 5I74B 5T3XL 3KZSA 1AQKL 5CZXD 1KCUH 1MCBA 5E9DD 4PYHA 1GZQA 1G1CA 5EDXA 1MREH 4QF1A 3GXMA 4X6FA 4OZHA 3CBWA 1X7QA 4PRWA 5E8PA 1KB9J 4Y5XA 4WGVB 1HHIB 2H32H 4HKJB 43C9B 4M1CD 1Q0YL 4GOSA 5K59E 3U1SH 4HQQH 5JZ7C 1W1VA 2VDKL 5IB4B 5FYKH 3RX7A 1LO5A 3PWLA 5GGTL 1AKJD 3PWJA 1BIIA 3BZEA 1XIWD 3LEXA 5IEHB 2C7UA 2PF0A 1G7QA 4LLUB 1MCJA 4GRLD 3W0KA 4HFWA 2Z93B 2EDKA 1IAII 4BH8A 3ORJA 4EAMA 6A3HA 5C7XL 7FABH 3VMOA 2ZXDA 3RI5F 1W9XA 4M6AA 1T04B 5IGXH 3OAZK 3AFLA 5HYJA 3CFIC 5DK3A 2ATKA 3ZYIA 2OYKA 4R3SB 2QQKL 3L3OA 2GTZA 2DQJL 4XNYH 4FN0A 5EUOB 1LGVA 2WMKA 1NKOA 3W37A 1XF5B 5EZIH 4N5EC 4HKBA 5GRUH 4OZFH 3G5VB 1IC7L 4K3EH 1HIMH 1P7KB 2IAND 2N1KA 4GMSH 2XRAH 3U0WH 1YECH 3D3VE 3WXWL 3F7YB 1VBRA 3FQXA 3MMWA 3L4UA 4CD4A 4PJ7E 4QOKE 2X0YA 3EJSA 3ARGC 5A16A 4FQ1H 2APBA 4KRMB 1DQDH 1YEGL 5C71A 3KWXA 4NGHH 3S5LA 1V0KA 1QBMH 3KPSB 3FO1B 5GZOD 4PTTB 3WDRA 5I6XB 4NZUL 4TVPH 3SDAB 3IK2A 1Q9KB 5CEYB 3WFBL 1UD5A 4L8CB 3PE9A 3VXOB 1BD2D 4ODSL 1IGFL 4JFQB 5DMIL 4XPFH 2QLYA 1Q9OA 3RJQB 5IW6B 3SKMA 3TONA 1A6AA 2BOCA 2ZCHH 3RM9A 1LDSA 3KYOB 2RIKA 3B5GA 3EYQC 1N64H 1QRKA 1M7XA 2P5WA 1O7VA 3E3QC 2ZCKH 1TENA 3VDCA 2ITDA 1ZSDB 4XP9H 5DF0A 2YL5A 5IB1A 2NY4D 4JPVL 2VX6A 5D2LF 3D85B 2ERJB 1N0XL 3BUQA 5C8JA 1G7LA 4ODHH 4S1SH 3NDZA 3TBTA 5DD1H 5C0CA 4MQTB 3OZ9H 3EYOB 1I7TA 3KYKL 3OJDB 2DQGH 4RGNC 1UJ3C 4NC1E 1BREA 1HHHB 5LWYH 5MEND 4DVBA 1PBYA 5HGAB 2XVLA 3EOTL 4OGZA 4X9GA 3WDIA 3RMEA 4OCWL 4NM4H 5MEQA 4Y4KB 4MDIB 4XCNB 3RGVC 3DX4A 4NZJA 3QIWD 3DUSB 1E3ZA 3BD5A 3B9DA 3OR6B 2DWDB 5HYJD 3JVGC 4NF7A 4BELD 1WWCA 4QKXB 3I3BA 4NHCL 3MI6A 1MRDH 3CCHA 3VGDA 2F5BL 4OUUB 2XV6B 2HJLB 5C0EA 1ITBB 4JB9H 2VE6B 5I71B 5JNYA 4LVOC 5AAWA 1PKQB 1SMAA 3BGMB 3VFUB 1FFOB 4S3KA 4K71B 2CDGB 3CVIH 5BW7A 4R4NC 4S2SA 3VXRE 2B1HL 5F1OB 1JZ6A 1PG7H 4HZLA 4NQSB 1D5MB 4LLQA 1AMYA 4GZEA 3AXIA 5E8OA 3S36H 4KTYA 1NGPL 1ZBVA 4KC3B 3TA3C 2YD9A 4NNYB 4TNWK 4GMTH 4WUUB 2FATH 3EYVA 4DKEH 3HCVA 3C6LB 4JHAH 1I8LA 3D51A 1UR1A 2FYVA 3VIFA 5IESL 3AS0A 5FGCE 2IH3A 1XGZA 1DP0A 2E9BA 3QH3A 2P24A 3SY0B 2AMGA 1MFAH 2P8PA 3DX6A 1V6XA 2WMIA 4LGXA 2HLAB 5AEAA 3D39D 3WS3B 1TVBA 1WZ1L 1RIHH 3QWQB 1H0DA 1KGCE 1LO4L 2OK0L 1WZLA 4ZO7A 3P0VH 4M5ZL 5DUPL 3VJ6B 1KQZA 4BKLB 1HH6A 1K4DB 2CDEA 2FHCA 3MFFB 2VLMD 3OGRA 1H3WM 3EMZA 2MQCA 1P9MA 1KTRL 1TCRB 5GQBA 1G6RH 1OD7A 4HZ6A 3P0YH 2C1OA 4TVUA 4UQCA 1T80A 3CPLA 4FQXB 3M45A 3TH3T 1SQ2N 4M43L 4QOKA 4KROD 4LLMA 4X4YB 5HHQA 3CHCA 4HKZB 3GHEH 5E7BA 4GRMA 4HP5A 2EC8A 4TTGA 3GXNA 1W1YA 4AZCB 3KE0A 4F58L 3VWKC 2PWGA 4D9QD 5I2UA 1KN4H 2WVVA 1OPGH 3PWPB 2G3IA 5GJTH 2J7DA 2FX8H 2ZX5A 4Z2JA 1NEZG 3WN5B 5I3DA 5ALBH 1Y0LB 1WEJL 4OD1H 3AB0B 5GSRB 3QISA 2COQA 5JOEA 1KXTB 2GSGB 4OM1L 2R0ZL 3S2CA 1A7QH 2Z8SA 3G5ZB 4MQXC 5DMKB 2E6JA 4R27A 2F7QA 4JFYA 2EECA 5SV3A 1CXLA 2BHZA 4NI3A 3N12A 2IALA 4LHQB 3V4VL 1U91B 3BAWA 1KPVA 2BSRA 1UZ6E 1DBMH 4KDWA 3RVVC 1HX0A 3DSFL 4MD0B 2VZOA 1MWOA 3RAJH 2YBTA 4M6NL 2NXYD 2ADIA 1O5DT 3ARDB 1HHKA 3ZL4L 2X1WL 3O6LH 3BT2H 5L0QC 5EO0B 2W0FA 4X4ZA 3KPOB 2DQEH 3F7VA 2G60H 4S1RH 1HJSA 2I07A 3DJ9A 5D7IA 5D1ZD 2Y72A 1WDPA 5KOVC 5EA0H 2P5EE 1CL7H 5DVNA 3VD5A 4PGDA 2J3SA 4QHUA 3RIFF 4D8PB 3SPVB 4PBGA 1BG9A 1S46A 4L8DA 4AL8H 1JF6A 3MLSL 4NBZB 3RY6C 4PSPA 4AIXA 4PJBE 3HZKB 4YPJA 2DTMH 4ZAKC 1JV5A 2EZ0C 4KZDL 1A2YB 4BFEA 1KN2H 3IDYB 1TMQA 2WZEA 2DLHA 1QR1A 3V7MA 1JUFA 1N4XH 2XWJA 4QXWA 2VDQL 4AYFA 4KXZH 3IFOB 4X0NA 3M17B 4U1JB 2DT1A 3SGKA 3BUIA 2H26B 4QTIH 1R8LA 4GRWB 1HL9A 3GSWB 4U5KA 3KS0H 4K7FB 1UWXH 1AD9A 1RUQH 2BVOB 1ADQL 3D3VD 4LPWA 1P5UA 5KW9H 1X3DA 5EUOF 5C0AD 5J56B 1H4PA 4QOKD 2PR4L 3QDHA 3TO4D 4RGOH 3MANA 2V2TA 4KUZL 1DQTA 3VFNA 1YNKL 3N9GH 1ZJBA 5F6HI 1XGUB 4FK9A 2J1KA 5HJ3B 1QBLH 4PCSA 4IHOB 4TNVK 3CFCL 3TWCH 4IIQC 4FQQA 3D6GA 4MTVA 2OI9B 3UG3A 3EYSH 1E5NA 3T2NL 1MCNA 3IKCA 2BNRB 2R4RL 4L4TA 1FVEB 2FHBA 3BKJL 3BSGA 1ONQB 3HMWL 5EOTB 2AP2A 3DMMC 1RZIB 4XC3L 1SJHA 4PS4H 2XACC 2HVKA 3VDAA 4Q9CA 3TJEL 4Z7NF 2VIRA 2OWXA 1GOIA 4JHOA 1EVTC 1CGYA 1OSZA 4L5FH 4QRPA 5JQ6H 2FZ3A 1CG9B 2DYPD 3CK0H 4PLOB 3W2DH 3MC0A 5FUZL 2V5MA 1B3WA 1H0GA 1IKNA 4GO6B 1NUNB 3O6KH 5A2BA 2APVA 3MRQA 4GLRH 4NQVA 2WBJC 1KACB 3QFDA 3SUUA 3GUTB 3GI9L 5DVMA 2AK4B 2F2HA 3FT4B 3UBXI 4JVPA 3MJ9H 2XQYK 5TFSL 4BFGA 1FNEB 1BZ9A 2ZUWA 4Z7WB 1RZGB 3WY2A 3O4OB 1HTYA 2A6DB 1GPOH 1ZBWA 3S3JA 5E2UH 1XSJA 2JEQA 5MEPB 2R0WH 1PZ2A 3I6LE 5CJXA 4KK6D 2DB8A 5DHVA 3RFZC 1C90A 4G7VH 3W4RA 2HJFB 1U3ZA 3FB7B 3WIFA 5HVHB 5KG9B 1B0WA 4R7NB 2XUCA 4KAQH 3LQAL 2YD7A 4FXKA 3TVMD 4ZFOB 2UY2A 5EMYA 3FN3A 2X0HA 2J7LA 3MXVH 3VGAC 3HI1B 4HJ0C 5F6IC 1A3HA 1CIUA 3GHBL 2O9OA 1RK1A 1Z9LA 4RISL 1MI5A 4PP2B 4F37F 4TXEA 2EXWC 1MW3A 1QNRA 3VFMB 1B0GA 3UAJC 3TPUB 3RUGE 1K5NB 3VXRD 3AHTA 1KJ2L 2RAMA 3BD4A 4M1DH 3BAYA 1UD2A 5AC4A 1KTLB 12E8L 4MZ3A 4S0SD 3LB6C 4C7FA 1RPQA 4ZUWB 1BQHA 5D9SB 2JJSC 4EOWH 4Y19A 1YMMB 4NT6A 5EUKA 3SKOA 4EE9A 4PJBA 2JIXA 3VDHA 4CAGA 3VFWA 3MV8A 4JGMA 5EBLA 1LO3H 1KGCD 5JW5B 2YD3A 3DVFA 1HI6B 4NCDA 3SGDH 3HNSL 4UTFA 1HZHL 5DFAA 4M6MH 3P0GB 2J4GA 4TUFA 1UR8A 5C2BL 4XRCB 1CGSH 2YEZB 5AC5A 1FBIH 4MD4A 3FONA 3WBEA 2WUCL 2EDQA 2MFNA 4KJYB 2CETA 1ZVYA 4NUJB 5CILH 3CLWA 3AY4C 4JY6A 4PGEB 4NQXB 3WH6A 1C91A 1I85A 2J12B 3UMTA 2V7HB 2V9TA 1DVFC 4WI3A 2V6HA 5GSVB 4CU6A 2VKXA 5IKCA 4UQ2B 3WUZA 3U9UB 4K94C 4LPUA 5DLMH 3IS0X 5I8OH 4FLRA 1AE6H 5BROA 4BCEA 1ISVA 3OKKB 1DN2A 2GEEA 2OP4H 3CSPA 5EC1A 4Q97A 1TTGA 3SO5A 1HHGA 1X5AA 1CVRA 4MNQE 3SOBH 1DE4A 4ACZA 3GSOB 3EO1B 4TPRH 2UY3A 1T1XB 4U1SB 1U36A 3DVNB 2RGMA 2LQRA 4FLSA 5HHXH 3VWJC 1R3IL 2WLYA 3UTTE 4UFIA 2W67A 4KXZI 3BESR 1VGEH 4IRSD 5F96L 2VXSL 5BMFH 3BP5A 2ZOKB 3LKPA 5JOPE 4LSSH 4TSCL 4XNXL 5DRNA 1OP9A 3SGJC 3WLWC 2I9TA 1M71A 5D96C 3QQ4A 3TBYA 1KPRB 3WNOA 1F3RB 3EBVA 4WV1A 3OZPA 3TFKD 1R3KA 2NZ9C 4IDJL 3EGSB 3AUVA 5J7CC 3TBWA 1A4KA 3NIDE 5HGDA 1HYRC 3PQYE 4GAYA 1IGYA 4PJEB 3PP3H 1NCTA 2P5ED 3P30L 4U1LA 3WHE1 4F33A 2X4NA 4R0LB 2RFXA 1EBAA 4F7TA 3QR3A 5JMOC 4YC2B 4JL1A 2P45B 2XFYA 3WUBA 2EPNA 2QHRH 4AZGA 3OB0H 2H9GA 4ODTH 3QRGL 1HKMA 2VRKA 1AGBA 2VL5B 5A2FA 1BBDH 3RWCA 4I8DA 3LSOB 5IFAH 2C1PB 5HHPB 4P4RA 3JV4B 4K94H 4HS6B 5GS2D 2NW2A 4KRPB 3RIAK 1XCXA 1L0YA 4C83A 3FQTB 5EBMB 4DWSB 4JJHA 4ZODA 1QBAA 1HCVA 4JFVA 3U0PA 2BDNH 3SDDB 1I8MB 4X9IA 3SJVB 1VFAB 1I3RB 3S5YA 3RZCC 3L3GA 2NT0A 3TBVB 1T2JA 1CK0L 3BD3A 2XVNA 2NY4B 4NOFA 4GRWF 2XWTA 4PUBH 1TQCC 2WUBH 4PRHD 3SO3C 5T3ZL 5FHAH 3BRFA 2W92A 5AUMB 5KSVA 2QSTA 3T0VA 4Q9BA 1NCDL 2VDPL 3DHJA 4GG8B 3V5DA 4HH8A 1P1ZA 2MSPA 3KAAA 1KCSH 3VMNA 1MEXH 2HRPL 4KKCD 1TR1A 1GGIL 2DH3A 3U7WL 3H3PL 4LAQL 1KF9B 4QCIA 3BH9A 5EU3B 4U6XB 5LAXA 5E2WL 1KQYA 5DO2C 3QA3A 3GNPA 3GMMA 1OIFA 1YNLH 4OCXH 1Q94B 4AMKH 3QUZC 5EFIB 4X6DE 4IJ3B 3P4MB 2EEAA 4YDVB 1RD6A 5INCA 4URIA 4XXDB 3REWA 5IBUB 4MQ7B 3GMNB 3H0TA 3IDNB 3OSKA 4AMCA 4KPHH 4ERSL 1CFVL 2HYMA 5TDNA 3C5ZB 3DX9A 5SWQB 2DI8A 2GK0A 3DX0A 1OTSD 5E8NA 4K3GA 2YA2A 2XIBA 2X89A 5I1GH 1K4CB 1DBAL 1UZ4A 3I6LD 3OJMB 4QWWC 4MNQA 4Z7WF 1M7DA 4PJFE 5C0GA 4QRSA 3ALXA 4JO1L 3GBMH 3SGDI 4NKMA 2QQLH 4TSBL 1PLGH 3UTTA 2D7OA 3D39B 2BNUB 2D0GA 3LS4H 1EXPA 5ECUA 3TIEA 2NLJB 3G6JB 3SE8L 2DM4A 4LSVL 5CXPA 3TO2B 1H5BC 5JIKA 5T3XH 5AWNH 2CIPA 1E15A 3VOCA 2K1MA 2A1WH 2XFFA 3PQYA 3RHWK 3MOAH 2FL5B 3KNBB 3S35L 1YEEL 4R4FL 4KMTL 4PLJD 5I79A 3HZVA 2Q3AA 4R8WH 4M1CC 4KMQA 1JHLL 1V7ML 2Q20A 4S1QL 5DQ9B 4MWFB 1G9ML 4HCRA 3WKNA 3BPCB 3WKML 3X17A 3VXPB 5J1SC 4N90E 4TUOB 1EK3A 4XAKE 4P0DA 1Q72L 1XIWC 2HT4D 1EEZB 4GRLC 3F6IA 5I1HL 4F2MB 3FO9A 1KLGA 1T6VN 3UG5A 2WPGA 1WWBX 2C3XA 3OTTA 2ZUXA 3HG1B 5F88B 3KL0A 4F3FB 3VSUA 5DMJB 4M61B 3BPNB 1S9WB 4MJIB 1J0ZA 1XF3B 3QAZB 5F7NC 3VXTA 3EO0A 2R69L 3S9DB 4HOXA 1E0XA 1WC7A 4CGTA 2A74B 5I1DB 5BRPA 1GGCH 1RURH 5EU7E 2HTKD 2VDLH 2EKSA 3LXCA 3QDGE 2B4CC 5CJ8A 4JJ5B 2ICES 5GIRA 1Q9LB 4LSUH 5CJOL 2Q3ZA 5F1IB 3UYOD 3RA7H 2D31A 2FB4H 3NH7L 5IOPA 3KYAA 1QFUL 5SX5K 4AY1A 2WMFA 3QCVL 4JM2D 2X4RA 1AP2B 4W6YB 5CJ5A 2Y24A 4K9EC 2JCCB 4YBQD 3D4YA 3IJHB 4QRUB 2V7NB 4KJWC 4LAJH 2CIIA 4RE4A 1FFNA 5GZOC 2AOSA 4NZUH 4H25B 4M7LL 2XZQH 2UWEE 3WHE0 4W7VA 2Z92B 3WSQH 2VN7A 4X6DA 1LO2H 2CKBL 1IGFH 3U30C 4P3CH 1TNMA