1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclodextrin glycosyltransferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
4P4KC 4EI6B 1R3KB 1A3QA 3AYSA 4P2QD 5JNYA 2XGIA 5I79A 2CKBH 3FCTA 1HEZA 2MWCA 3FZUD 1E4WH 3QUMB 5ID1B 3C08L 2C3VA 4V1DD 5BRZA 2QHRL 3UC0H 3S8WA 3W37A 1PFCA 3BH9B 3X3FH 5IROC 3HPLA 3BZ4B 1CBGA 2OS7A 3TO4B 4PGJA 1JV5B 2V2XB 3PZNA 5C0BE 5I73C 4WEUD 3HC3L 1RURL 1OBAA 2XTJC 3H9SB 1QRND 2VCBA 2PO6A 4PJCA 3TLRA 4R3SA 1HWHB 4K68A 1KCSH 1NMAL 1E4NA 3PZTA 3DARA 4NRRA 4MX7A 3MOAH 4HULB 3OKLB 5SWQB 2Y6SC 2H3NB 4RBPH 2HTLC 3QG7L 1FAIH 1I1FB 4RIRA 3DX4A 4X80L 5FA3B 5DGRA 1X4YA 4LPCA 5T3ZD 3GMMA 2A3CA 5IG7A 2HAZA 4N8PA 1JZ6A 4LMQI 3WD5H 2HFEB 2IAMB 1AC6A 1E72M 3KR3L 5JA8B 4FNUA 4AYSA 3R1GH 3MV8B 1K4DA 1AY1L 1U3JA 2R0LL 2N7AA 3QZWA 4L4VD 3EDKA 4D6CA 3V5DA 4F8XA 1A4KB 4HUWB 3HFML 3ILQC 4W86A 4XNMA 1QRNE 3B9DA 5BVJB 3MBXL 5I74B 1IKFL 2GTZB 3K0WA 5E99L 3L2LA 1F45A 5K9QG 1DEEB 5DO8A 5I76A 5DUPH 3S2CA 3SKMB 4LCCA 4OIIH 2O9RA 1NC4B 4FQHB 3T1FB 4ONHB 3U7YL 3MRPA 2A6DB 4W7WA 3MCLH 4J8RA 2QHAA 2BDNL 3C5SB 3GMQA 3QAZB 4KGJA 3T0EB 4CMMA 1QSZA 5GJTH 3S5LB 5K9JL 4S2SB 3NFNB 2XPGB 4QTIL 1M05A 2GY5A 1XH3A 1YZZA 1NKOA 1U92A 3V52H 4HPYH 4I18A 4UAOB 1DQQA 2P8LA 2PYEB 1J1XL 3HHRB 3RDTC 5HVHB 4ZXBB 3GYCA 4D71A 2MKWA 5D1ZA 3LQAL 4PGBA 5I1AA 1QRNA 4WV1B 2NY7H 5DK2B 2DQIL 3WSQL 3GDBA 5BOZG 4LDOB 1KCVH 3VGEA 4AENA 1GCFA 3FTGA 2E27H 2OP4H 3VIJA 4C83B 1QNSA 3O2LA 3SDDB 1G84A 2ADIA 1Q6FA 2JJWA 4KRPC 2XRAH 3O6FB 4OLXL 2VKXA 2VDMH 4APQB 5FKPB 4AD3A 3PE9A 2D7TH 1XIWB 3TNMA 3WE6A 4OD1L 1EVUA 3WHE1 3GEWB 2B39A 1MCWW 2J6EH 1SBSL 4YHML 2B2XL 3QZWG 5IEHA 5D71H 3AFBA 5EFIA 4UIMA 2DLFH 3TBWB 3QIUB 1WZ1H 3DV6B 1IKFH 4ZXOA 1R24B 1A8JH 5B39A 2A9ML 1GOIA 4BYHA 4X6CE 2WLZA 2X2HA 2KH2B 3PDDA 4PSPA 2CYGA 3IJYA 3EW3B 2EDWA 2FWOA 3PV6B 4LPXA 3G9AB 4LHUG 4Z8FL 4UQBA 1S8DB 4LU5L 2NZIA 3WQVA 2BNRA 5E1AB 2HRLA 4TVPL 3QFJA 1TPXC 5IHRA 1JN6B 4QXTB 5E9AA 3N13A 2F9BT 2VR5A 5FF6A 1UXWA 3VG0H 3W82A 2MCPH 4GKZA 4HJGA 4XP5H 3VXQB 5D5MF 4ZSOA 1W0YT 2QQNL 1ZHNA 1LVEA 1YECL 1FH9A 1YC7A 4QWWD 3LRHA 4KKAC 4EUPB 2GQHA 1LO2L 3PHOB 3HPJA 3QAZC 4U6TA 2K9UA 2MJWA 1U8MA 5LBSL 4JFWA 4MPKA 1D5XA 5A2JH 3PXHA 1DL7H 4KQ4L 4XBGB 4P0DA 4ELKB 5DDHA 5D70H 4UFJA 1JHLH 4BQCA 4OUOA 2MPAH 1HKLL 1DEDA 4HKZB 1IGIH 4KJQC 2H26B 4OF5A 5C8BB 1FCGA 1CL7L 2D03L 4UINL 2V38A 3QFJE 1ACYL 3DXAE 2D73A 3RBGA 1UZ1A 4J6RL 1NEZA 1EFXA 4OZ4A 4QRPB 4FQIH 3U0PB 4C56A 5LCVH 3MLRL 1FVDB 1I1AD 1I7TA 2GVYA 4ENED 1YEGL 2R1YA 3KWXA 4OAWA 3RZWA 1NCBL 5IJVA 3WUFA 4Y4KC 1NCCH 3RGVD 2ZKHH 4XVJH 2VX5A 3HNVL 1MUJA 4ISVB 2H1PL 4N9OB 4BQ8A 1UR9A 3KLHD 5IBLD 5HGDB 4PV9B 3VXRB 4GMSH 1ND0A 3EGSA 1A47A 3HU7A 3H7BA 3ES6B 3GIZL 1SY6L 3TYGH 5KBNC 4R90H 4MYWB 4B15A 1D6EA 3DECA 1NUDA 5FHBL 3MR9A 5D7IE 1WZLA 4HJJH 1N64H 3MV9E 3S6CA 1BGGA 1UCTA 4PLJD 4ZUSB 3WEXB 4DN4L 1OWRM 1BFSA 3EMCA 3TIDA 1CFQB 1JP5A 4RGMC 3GM8A 3GRWA 3HE6B 4HZLA 4RFNB 2ZNWA 3EDEA 5E2WL 3K4DA 3ULVF 1Q4NX 2VRQA 4WKHA 5DA0B 4R0LC 1HJQA 2P5ED 2JF7A 2V5MA 1JWSB 1GZJA 4CL7A 2W9LA 1NC2D 3VI4F 1UZ6F 4N8VA 5GSRA 4NKMB 4Q0XH 1T89C 4XPAH 5DC4B 4IJ3B 5BW7A 3BHBB 3MLSL 3F5WB 3UESA 4JFXA 3HI1A 4ZYKA 3MGAA 1AQHA 2J7LA 1DVFD 4TSCH 4G80A 3RKPA 2EC9T 1AI1L 4IRZH 3WKNA 3RGVC 2MFNA 2ZG3A 3AJ7A 3H2WA 4GH7B 5C0FB 3VH8B 3KJ4C 2VLRE 5T1DH 1QWUA 2A83B 4A2MA 5C0GA 3ARDD 1WWWX 5EU6A 1FO0L 3TZVC 4I5BB 1U8HA 2MHAB 2CGRH 1XIWD 5EA0H 3W5MA 1ODUA 1EUTA 4LHQB 5C08A 2VZUA 5I8KH 2MANA 1TVHB 1N3NA 5IFTA 3BVVA 4PMQA 1LK2B 3SCTA 3X3GL 4M1RA 2AK1H 1BFTA 4JDTH 4LP5A 1OAUH 5EPMA 2J12B 4HUUA 3ARGA 2D9QB 5D2LB 2IBBA 2W9EH 5TE4H 5HPOA 1S7TB 3WHE0 1VPOL 2VI0A 5DMKB 1S5HA 4HHAB 3MRKB 5T3XH 4Z7UF 4KQ4H 2XA3A 3CHFA 1A0QL 2P43B 1AHWA 3RNQB 4DK3A 3MRRB 4P5MA 3SGJA 2YN3A 3JV4B 3OWEA 5GGSY 1OARH 5I19L 3QCTL 1W72L 3HS0B 3EIFA 4OD2B 5EU6E 2XZAH 2EXYD 4ACPA 5IW6B 2VB5A 2HT3C 3WFHA 5DK0B 4X99A 1RHHB 4Q9QH 2GSGB 5BOPA 1OGAA 3MA7A 3X13A 5KW9L 2ZUNA 4XXCC 5C0CA 1FN4A 2EXOA 3D3VD 5DJAA 4K8RD 5A6BA 1IC5H 3BZ4A 1NM9A 2ERJC 4Z7NF 3WJJC 3T0BA 2GSJA 1ZMYA 4ZAKC 1G0DA 2X4SA 3PWJB 2DIJA 3H9SA 5CG0A 4HWEH 4OIIL 1HHIA 3S4SA 5JMRA 5IBTL 4XBPB 4QXUL 4LCYB 1M71A 3QI9D 1CZ8L 4FQQA 4UV7H 2DIBA 4K7FA 5ETUA 5BXTA 1MWAB 5I8OH 1LK3L 1OAZL 1A64A 4I0PC 4MX7B 1KN2L 2R2EA 3MLTB 5T1LB 3WV0A 2X10A 3RWGA 3KZSA 3LHPH 1N6UA 4FQXB 2AXFB 2HG5B 5IG7B 5JIIA 4JN1L 3CXHJ 5E5UB 1T2JA 2BSTB 3D3VE 3LN5A 3R1GL 4OZIB 2BHYA 4XZWA 4XP9H 2ADJA 4K3GA 1BTCA 4MNQD 4AISA 4M00A 1FVEA 4NZDA 5D2LF 1T04A 3RWHA 2IBZX 3GXDA 4PJ7B 1J88A 3VSVA 2XPKA 5HI3D 3WD0A 3ZE1F 1PQZB 1LP9E 2Q7NA 1F3JA 3MOAL 3AISA 3IDJB 1DSFL 3FO2A 1Q94B 2BXYA 1RMFH 5D1QA 5C07B 2R8SH 4N42A 1OLZA 2Q76B 2VL5A 3ARFC 3MXVL 4U2YA 3ZYZA 3SCMA 4FZEH 4AIZA 1YY8B 3O3AB 1T21A 2X1IA 2PYFB 5HDRA 3EJPA 5GRVL 1YYML 4M9OA 3BAXA 3K4ZA 5D2NA 1YPZA 1JZ5A 1INQA 1HIML 1GRWA 2EDQA 3SCMC 3CVHL 5ADPL 3WH8A 4LNVA 1Q0XL 4XXDA 3DMMA 2FX8H 4RMTA 3VIFA 5H37G 4YXKH 1VKXA 1L7TL 1A1OB 3OF6A 2UWFA 2V2WA 3OPZL 4KKLD 4KZEH 4PGBB 1XD0A 4P7OA 4KHTL 1QPKA 4M62L 3VINA 1YEFH 4CN6A 1HJSA 3E8UL 3C6SA 4N90D 5GS0H 3APGA 4TVCA 5DHVB 2G3MA 5BVPL 2H2PC 3BT2H 3H6JA 2OZ4L 5K33A 3RL1B 5DWUH 3U46B 2NPLX 4KV5E 4E41B 2ICWJ 5K9OA 4LCUA 3IFLH 5A3IC 3A6OA 4Y19A 1A5FL 3VRJA 1QBAA 3VXMD 3IETA 1KPVA 1LP9B 2UY6A 4R96A 4DWSB 4IIQC 4U49A 5IB3B 5KEZA 3N17A 1CD0A 4Y16A 2VDNH 4R4BB 5GIRB 3UO1H 3WJLC 3ORJA 3NH7H 1F02I 4U6HA 3V6FA 3OZ9L 1K8DA 5D70L 3IKCB 1F6AA 4OZGA 2OTUB 2NTFB 1Z32X 3BMWA 3TN0C 2P5WD 3BUBA 3PL6D 3MV7D 1BVNP 5DJ8B 3IJYB 3TYFA 1KYOJ 4EBQH 4EN3B 5E1AA 1P7QD 1Q72L 4YFEA 4NJ9H 4PUBH 1MSPA 2FE0A 1E4LA 4AZ5A 4QLRA 4D6DA 4KDVA 5J9PB 4HIEB 4WIWA 5DJZB 3WS6C 1CICD 2AI0H 2XWTA 1TDQA 3VXME 5CJQH 1TJIH 4LCCC 3TBSA 5MENE 1KPRB 4IEFB 5DJ0B 2VQTA 5A43C 5IKCA 1T0NB 2LVCA 4WW1B 4PMDA 3LY6A 5IHBA 2X09A 3PHOA 5GGQL 5IOPA 2E0PA 4K8RL 2CLVA 4PJ9A 3O2WH 3QWQB 5FOBA 4LGXA 2IMMA 3O41B 4O4YL 2HFGL 2XQBL 2AKRB 1I8MB 4WTZG 1BD2D 4KMTH 2GAZB 4J1UB 4YR6B 2DQGH 1IM9A 1CIUA 1RK0B 5DRNB 1TQVA 5ABGA 4TULH 4ZXBC 2GI7A 4H20L 2HJLB 1R3LB 2PWGA 4XWOC 4F7TA 2UYLA 1HL8A 3RY6C 3BLKA 1NBZA 4G7VL 3O8XB 3CH1A 5CZKA 1MY5A 4WUUB 5MEND 1E6ZA 3ULUH 4PN2A 1TQBB 2MQ0A 4NKOB 2GY7B 1M1SA 3BGFB 3BRGC 3BGMA 5CJOL 4HIIA 4PJFE 4NQVA 4D9LH 3HE7B 1TZGH 1MCNA 2VUOA 3UBXA 5C9KA 4OAWB 4KY1H 4UCFA 1KIUA 1MAKA 2CEQA 2AEPH 3INUH 4CN1A 4U05A 3W53A 5I0ZA 5TPWL 4XNZB 3NAAH 1MH5A 5IFJA 1W9UA 3GI9H 3VXRA 1OOAA 1G7HB 3NIYA 2CK2A 4UFHA 4NQCA 4LEOB 4UBDD 3OKEA 1ZA3B 1S7WB 4P2OA 4WSJA 1U3HB 1DSFH 3S37H 3ULSB 5IESH 2R2CA 5FGRA 4PP2B 4QRRB 2NY2C 5IK3B 3O4LA 5DFWH 3LS4L 1I85A 4AEEA 2DIEA 1XFPA 2D31A 4NGHL 3GI8L 5EB9A 1DBAL 3HAEG 1Q72H 4JFEA 3ZKXB 5DHXB 4HUMB 5CGMA 3T0DA 3O6LH 1ZTXL 3GRWL 3GJEA 5TDOA 2EXWC 5T1MB 4F80A 4NCC2 4G8GA 4F3FA 4RFOH 1RZGA 3ME0A 1W1TA 1I9RH 4PD4J 3EJJX 3WO3B 3K4AA 4XNQA 5EU3B 1GZQA 3L1OH 3CHEA 1R86A 3QI9A 5JR1L 3GKZA 5DT1H 1GVIA 2R2HB 3E6FB 4Y4FB 4D0BB 1KTLB 4ZYKB 4WI4A 3OR7A 1SYVA 3MODH 3WFBH 5KVEH 4W8BA 5GS2D 5HHNB 4WW2B 3MLPA 5D1ZC 4C4KO 3BH8B 3CUPA 3CXDH 4NM8L 3D2UA 4GW4A 2EDXA 1YMMD 2J88L 3WYRA 4BFGA 2F61A 3U4AA 1ZANL 1YQ2A 5F9WB 4L3AA 3O2DL 3ZQ9A 1FZOA 1V7ML 2M2DA 3EFDH 3U0WL 1JXJA 5DEFA 4W6WB 3S88H 1OAQH 1JDDA 1FG9C 1H3UA 5I17A 1OIMA 1R0AH 3UDWC 4K7PX 1TTGA 3B9KB 2Q3ZA 1CQKA 4PV8A 4BFEA 2C9AA 1RUKH 4MD4A 5INCA 3WIHL 1HQRB 1LG1A 2DLHA 2J47A 2D0HA 2CUIA 2P47B 5D9PA 3UBXG 3DUUA 5DD5H 4RGNC 3QJHA 32C2B 2OSXA 2AABL 2RQ8A 3RJDA 2CR3A 2VYRE 3BKYL 1NGZB 2XG4A 2G3NA 1XF5B 2XFXA 1FLRL 3MA9H 4P8UA 4PJBE 5I9QC 3WD2A 1GORA 1FV1B 4AG4L 3CZFA 5GZOC 4UV4H 3JBG7 4KJWC 3T2NL 3D51A 3S5ZA 1UENA 4FTVD 4WCYH 4TTUA 4TQEH 5GGTA 1OGAE 3WFHB 2D7QA 1UVQA 3B6SA 1NFDE 3KPNB 5DURB 3ZKXC 4EDWH 3ULVL 4YDVB 5KJRL 3IU3A 4OGZA 5D7JB 4BZ1L 4IHOB 4HK3N 1SVCP 2Y1VA 5DRXA 2HWZL 3OG2A 1H3WM 2QR0A 1R5VB 3P9LA 4P46B 5SWSA 1TETL 1JHTB 3BXWA 4NKQB 2YBRB 4PJDA 1E27A 3A6BL 2PTTB 2EC8A 1IGCH 5IWLA 3LHPL 4MWFB 1KTBA 5AUMB 4X0VA 3FT4B 4M62H 1BM3L 1M71B 3HE6D 4NP4L 1AO7A 1MIEL 2RB8A 4G7VH 4LVHB 5DEGA 2DDQL 3F7PC 3F7QA 4ZOCA 4FTVE 3RKDD 2Q3AA 1JF1A 3X11A 4KI5D 5EZJB 2WAGA 1UZ6E 4FFYL 1MJUH 2EICA 3AHVA 4NO3B 4FQXA 1KTKE 1FP5A 2PC8A 4BH7A 2CIKA 4JHZA 1NBVH 3G6DL 5HVGB 3U83A 2P42B 3VFNB 4JFDB 1E0XA 4UTBH 5HI3C 3WNMA 2ATKA 1QI0A 5D7IB 3RWFB 2CMRL 1VFAB 1FAKT 6A3HA 1FVEB 4D0DB 1TVPA 1LJYA 1CF8L 4XX1G 3BUQA 4CW1A 2BY0A 2VKWA 5ESQA 3UYRH 1RJYB 1CICA 4EKJA 5DRZB 4ZDHB 3HI5L 2JELH 4NFDA 5FYJE 4JRXB 3TA3B 5FKYA 3CFDA 2NY5H 3ZM8A 2JIEA 3D39B 3BP4A 2YD5A 3QUYD 5C0AE 2WSPA 2PYED 2Y2WA 5I2IB 4ODHH 2GJPA 2F5BH 2ZOLB 5C07A 4KKBD 1PY9A 4RGOH 5MEPA 2FZ3A 3BEWA 3EOBA 3K3QA 4M7ZB 4M93B 5E8PB 4AJ0A 2Q86A 3L3JA 3OTTA 1YPZE 4ODVL 4XTRD 5HOSA 3CK0H 5BRZE 4IRJA 1QBMH 2G75A 1V6UA 2FYYB 2NY0D 1Z0MA 5LXGH 1FPTL 1QSED 1T1YA 1UJ3B 4NXSA 3WL1A 3KPRE 4DFHA 5JHDA 2IUZA 3MRBB 4YC2B 2X8RA 3HMXA 3PTQA 1AIFA 1ES0A 3MLYH 2EBNA 2VLLA 4KRLB 4P4KD 4PB0L 4PJCE 3BIKB 3PDGA 4JRYE 3O45A 1C93A 5FOJA 2GT9B 2YMXH 4YX2L 2WZEA 1HQ4A 3MLYL 2ID5A 5BMFH 4PJXE 1BAGA 5C0AA 5T5FL 2DPEA 3STZB 3W5NA 2OW6A 1YN6A 4OCMC 2YRPA 5CQ1A 4RE2A 4PJ8C 3G6JB 3U46A 2VR9A 4WHCA 5B38B 5D7LD 4NQEB 1XIWC 3T8XB 1CTNA 4JRXE 1XGQA 4GFTB 3H53A 4PY8J 3U0TB 3PL6C 5EOQL 1T7XA 5FA4A 4XRCA 1HKKA 2Y07L 4HG4K 3MFGB 4HA3A 2WWKT 4X0KA 5I24A 1TVDA 3KJ6L 1IAIH 1U2YA 4LNRA 4LCIL 4MVBD 5D7LA 5C9JB 3IS1X 1EAJA 2WK2A 3HRZB 3JV6A 3WNNA 4L9LC 5ISZA 1E5JA 4G8GD 2NY1D 4FZEL 1C5CH 3DGGB 2YOCA 5ECJE 3TO4A 1NGPH 1WFNA 1XSJA 4R2GB 5FDWA 5HHOD 2ZWZA 2ESVB 4YDLC 3TEUA 5B8CC 4C59B 3W0WE 5JHLL 2MKLC 3OB0H 1KNOA 4UTAH 5J89A 1BHGA 2V2TA 3QPXL 2HT3D 5CINL 5FXCH 2A6KA 2ZXAA 4EI5C 2DN7A 3FJTA 1XCTB 2O26U 4LVOB 2D0FA 3N85L 2E6QA 1B0WA 1RV6X 4ZNCD 1LQ0A 3VXUA 1E55A 5GRJL 2EACA 3QQ9C 2XG9A 2AJ3B 3MGTB 3RGVB 1ZBWA 3RWIA 4F7MB 4KJYB 2OZ4A 4NQSA 4XMPH 3EAKA 3BESR 3WFCL 4HPOH 2F1BA 5DJXB 1RUAH 1G7JB 2QADB 1DBBL 3SGEI 3WJLA 3WH6A 3HZMA 4N9GB 5IIEB 2QPSA 4JE4B 3MRJA 3AREA 1EMTH 4PJ8A 5CD5C 1JXKA 1B0GA 1E56A 4L4PA 1FIGH 5BV7H 5IVZA 3PQYD 4JFED 4EVNA 1MRDH 1BYDA 2D7OA 2CKSA 3B5TA 3NIGF 1F8TL 2VX6A 1S5IL 5D6DA 3U5YA 3J7HA 1VSCA 1NC2B 3I75A 3VXUE 1QOXA 4MZ2A 1RU9H 5EU4B 3SPVB 3SY0B 3CX2A 3D39D 1HXYA 5EUKA 4B41A 2DQCH 2EDFA 2BNQD 3K7UA 2MCPL 5CIPH 4NZRL 1J87A 5L8KB 2EPMX 3L7FA 1RUAL 4I18B 2V7HA 2B4CC 2BHZA 4MMXC 3KYKH 5TH2A 5EU7C 1BGXH 1RULL 4HUXA 4JFEB 4JPIA 4PGEA 2X89A 3EDFA 5CEXA 4HJ0C 3HMXL 1DE4A 2GITB 5KG9A 5DK2A 5IHZA 2BY1A 2VZVA 3KWWB 1H3VA 1AE6L 4L4TA 1UYQA 4GRWF 3SKJH 5I1JL 3L5WA 3VMNA 1F4HA 2IANB 3EYVB 3TV3H 3RZCD 1V6YA 4NRYA 1T83C 4P23A 1IE5A 4G43B 1PZ3A 5B3JE 1DBKH 1IZJA 2UVEA 4YIQB 4MJ5A 5DTFB 2OYMA 4U1KA 1JHKH 1BBDL 4NKDA 2WINA 4LHUD 1I9RL 2VDRL 4LARH 5ACZB 3ARED 1HH6A 3NCYP 5EN2B 4CADA 4FLQA 3ZIZA 3IAGC 3EZJB 2XZCH 1M01A 2FDMA 1JIBA 5FGSA 5F1IB 1J05B 3ZOAA 3WUEA 2BNRB 1KBKA 5E2TL 3B9KA 5CJ8A 4RDQF 3IGUA 5E7BA 1VJZA 3QFJB 3QUYA 5CGYC 4X4ZA 3RX7A 3WD1A 5L8LB 1FE8L 2I9LA 3GMLB 3ETBF 2ZE0A 1K2DA 2A74A 3S37L 2IH3B 1QKZL 3QEGH 2R4SL 4MLIA 3TN0A 1N5AA 3U48A 1QR1A 3HPJB 4M7KH 1N59A 1JGEA 2A9NH 4NNYA 4XAKD 5LGKA 4K3EH 2EZ0D 4KROB 5C0BD 3FQXB 3CC1A 1OGTB 3AU1A 1RPQA 1N8ZB 3CJJA 5LGJB 5DYOB 9CGTA 1VRXA 3VIKA 5HYSB 2Z9TA 2NY5C 1JGIA 1TZGL 1X5AA 2VLJA 3H9SD 3AIBA 3C09C 1NAMB 4NRXA 3L3OB 5E9DE 1UVQB 35C8L 3B6SB 3KPNA 2O9OA 1PG7W 4OLUH 2SEBB 1WPCA 5D7JA 3V0WH 4PJAF 5C08D 4XB8A 2CR6A 4RWHA 4PGCB 4JPKL 4LPWA 1JYWA 3BN9C 1ZXQA 2ICWA 4NO0B 3A6BH 1WBYA 3ARWA 2J4GA 4KZDH 5F8RC 1A9EB 1FGNL 1E27B 5F70A 4OOZA 1XSKA 3DO7B 4R4FH 3UETA 1ZLUH 1AO7E 1FBIL 3ZDXF 3GSWB 4WWKB 2APXA 1TQCC 7FABL 3OR6A 1OSZA 5I8EB 4AZ7A 3SQOH 1F4AA 1JPFA 1EZVX 2X4TA 3SDDD 3ARYA 4X7CC 5E94A 5GGQH 2EXYC 5MI0B 3ZYOA 1NSNH 2GJZA 3MLZL 1DUZB 5ANMB 1CXEA 2XKNB 4LKXA 3VFRA 5HYJD 3LIZL 1RUQH 4NO0D 1JVKA 1UEYA 1KT2A 4CVXB 4M1GH 5AYIA 1R3JB 3O6FC 3OKMB 5FCUL 4Z7VA 1FH7A 3WEXA 4RWYH 4DJMA 4XHJC 3F65A 1YC8A 1BAFL 5I23A 3SKOB 3A4WA 1KXVA 3IDYC 2AMGA 3BZFA 1RJYA 1S9VA 2CIIA 4LMQE 4OTXH 1E15A 4OV5A 2XVPA 3POHA 1S78D 5J4MA 1HKFA 4IMLB 4PJHE 4U0RC 4QY8B 1CGXA 1DP0A 4UDTB 4XNXH 1IT9L 1NAMH 4JFUA 1BWMA 3F8UB 4HK0A 3C5ZD 3MUGA 5TFSL 2VH5H 2GJ6B 3WIHH 2P24B 2DWDB 2OWCA 1LO4L 1A6TB 4OI7A 1HJVA 1EHXA 1JMXA 4YHLH 3RAJL 5L2KD 2Q86B 4HV8A 4PMNA 4MJ6A 3FAXA 4JO2H 3CPLA 3O4OC 1EXPA 3TJHC 3UTSD 2J1KA 1W8OA 5KN5A 5JXED 1AXTH 2HFTA 3PP4L 3WD5L 5I1HH 1NFIB 2ZICA 5IV2A 1CE6A 1MI5E 4FNTA 5JDSA 4KJPD 4KK6D 1RJZB 4MAYA 2R4SH 2J6EL 5AEAA 4MAUL 1YEFL 1AQMA 1ZT7A 2VXSH 2MSPA 1ZHKA 3BUDA 3O45B 4AZCB 3R0MA 2HA1A 2D3NA 5DJ2B 1ZJBA 5JIPA 5IHUL 1DHKA 4C56E 4AL8L 1T03L 3BP5B 4LASL 5ID0A 1HILA 2YL5A 3ARDC 1QW8A 5D2LA 3I02A 3QIUD 2O61B 5HHME 3L3DB 4AD0A 1EEZA 1NH6A 1WQVT 3WFEL 1AC0A 3DRQB 3D3VA 3WFEH 1TR1A 4F9PC 4G6JH 2R0WL 4JO3L 3VWJD 3IDNA 4LLDB 3DX3A 3ZKMD 2Z8RA 5HGAB 2BVPA 3I3BA 5IBUB 2DLIA 1WISA 3SCMD 1L0XA 1F5WA 1JGVL 3OGCA 1GOOA 1A4JB 1W9VA 1ZLWH 4ZPTB 3THMH 1Y0LB 5DJYA 2ED9A 3EO1B 2VDPL 1MNUH 4D8PA 4ODWB 2RR3A 2ORBH 4UT9H 5J6HB 1BIHA 1SJEB 5A3ID 4BFBD 4X99B 2GJRA 4NN7C 4NQXB 1E4XH 1Y6MR 1JRHH 3EHBD 3H42H 1GZPB 3IJSA 3TBVB 4H8WC 2J75A 1FG2B 5F1NB 3QQ3A 2ERJB 3U7AA 5A2CA 5D2NC 5EBLB 4PJ7E 3GTNA 5IJKC 2EIZA 2OQJB 5E03A 3BQUD 3FO9B 1FL3A 5TQ0H 2ESCA 3GBLA 3U6RA 1H0DB 4ZAKA 2QSVA 1JPGB 3TFKC 4HWUA 4GXVH 1RIHH 4Z7WA 3IVKA 4O5LH 2WHMA 2FB4L 4OSUH 3CUFA 1I75A 4JHBA 1W91A 1WGOA 5D9SB 5DURD 4PJEF 1XR9A 3MX0A 5AYUL 4M03A 3RZCC 3LXBA 3MLTA 1JZ4A 4BSWA 1NWUA 1S3KL 3QEHA 4H26B 3RWGB 3U1SL 1H3XA 2WMIB 5FYKU 3UG4A 3BKML 2EECA 4IRSD 1GUVA 3BQUB 4C58B 1XHGA 3HZKA 3RGVA 3S35H 3SJVE 4WWKD 4UBDC 1G9MC 4BFIB 5FO9B 3VWKD 1CDJA 4NQSB 3GSXB 4KVNL 4PJGB 1VERA 1EEYA 3FB8A 5FV1L 5HHOA 5JQ6H 5DJXA 5EU5A 2BRRH 1MQPA 4HLZH 3BO8A 2DMKA 4PJ7A 1LEKB 4QAWA 1R3IH 2UZYB 2VXQL 2PETA 3R06B 3LKSB 1PQZA 1JAEA 3CU7A 4Q9RH 1MW0A 5HYJB 2EH7L 1S7QB 5FUOH 5CJQL 1B0GB 4KJPC 1US3A 4MQTB 3AHYA 1GJIA 4ZXBD 4F9DA 1PBGA 5BMFL 1PG7X 2LU3A 1ZGLA 5T1KB 1HT6A 4XWOD 1NCWH 4MDIB 5EOTB 1T21B 3AHZA 4EANA 2E7LC 2OL3A 3NCOA 3SJVD 1NC2A 1GGBH 3RILA 5DD1H 1F4WH 2XTJB 4PJAE 3KPSA 3Q48A 3WIIH 3N50A 5TE7L 1XD1A 5TE7H 2AXGB 4OZIF 3PZVA 3ARGD 3GBNH 2HVJB 2AK1L 4EEEA 4MSWB 3D18B 1F4WL 3W4RA 3VIGA 4AQOA 2G5BB 1VKXB 3N04A 1I1AA 4PTTA 3VWJC 1R5WB 4ZAKD 2V2WB 3OG4B 4M81A 3QIBA 5IJKA 3MRFB 1X6NA 1X5GA 3WUBA 2MPAL 2WBGA 3GSVA 4R8WH 2CGRL 2F8OA 3OLDA 1WAAF 1AGDA 1KPUA 3TPKA 4P23C 4XPBL 2A73A 2CRYA 1WAAA 2A1WH 4E41A 4Z7OE 3MRCA 1MCDA 3QQ4A 4P8XA 1RZKL 3KPOB 1LMKA 5SX5K 1UWUA 4MHHI 2FO1A 1OTSC 2X1OA 2EPKX 3UZEA 3TTOA 4U5KA 5IT2L 1TCRA 4PGDB 1V6VA 4XZUA 2UUDK 1UACL 2HJKB 5J1TC 1U95A 2B5IB 4W93A 4YZFE 4U7SA 1P5UA 2WHLA 5E2TH 5DTFA 4AD4A 4Q9BA 1BIIA 5KS9F 3CVHH 5ADPH 4YQXL 3BPNB 1MJJB 2YEZB 2LQRA 2EH7H 5BZWA 5AC5A 2I24N 1SJHA 3AXHA 2BERA 4MXWH 1K3IA 4NQED 3VA2C 5F88B 3QJFB 5AYUH 4UR9A 2KUTA 5IXEA 3BRFA 1INEL 4LLAA 5ILTH 1MFDL 4GXUM 1NBVL 2C0HA 1J8HA 2OLDA 2XWTB 2RAMA 2BSSB 4FP8H 4JY4B 4ODSH 4R4NC 3WL0A 2ZUXA 3KPMB 1MCHA 2BFGA 2DEPA 5I1GH 4HA4A 4LLYB 4X5WB 4X8JA 5JO5B 1DBBH 4ZS7H 2NY1B 3CZEA 3BP6B 4LQ1A 2JCCB 4XWGH 1QBML 4GS7B 4CU8A 2B1HH 3L5JA 2TAAA 2DRUA 2J5LB 5KSAA 2AQ1A 5FK9A 4NI3A 4XPTH 4KHTH 3O3EA 4NQEE 4KPHH 2AEWA 1UD3A 3UTOA 3L5XH 4RAUA 2C5DC 1ZHLB 3H9HB 4Y1AD 1KTRL 3NFSH 2SEBA 4G9DA 2NLJA 3HG3A 3WSUA 1EPFA 2FIRT 4N1EA 4AZIA 1VBRA 1A9BB 5EBWA 3QHZH 4NSBA 3A4XA 4QHKJ 1ISXA 1S7RA 4JO4H 4W81A 4ODUA 4A6YB 3RIAK 5IMMB 5F9AC 3V8OA 2QQLL 4KVNH 4CAGA 4G5ZL 1HH9A 3DPBA 1J0KA 3MCLL 1GOWA 4N5UA 3F7VB 4IISA 3P0VH 2PTVA 5I1LA 2J7CA 5E94B 4PTMA 1MJUL 3EJZD 5F21B 3CZKA 2DICA 4XCCH 3M8OL 4L8DB 1ED3A 1HWWA 4M43L 1K8IA 2CKRA 3DX7B 4LKXB 3UEQA 3KJ6H 3T3PE 2G60L 1CD1B 4WO4A 5DVMA 1Q9LA 4K71C 1S7SA 2GSIA 1S78C 1NWTA 1NAKL 1W3LA 2AV1B 4OUUB 4L29A 4X83A 4HT1H 1YUHB 3P11L 3BN3B 4MA1C 3LPOA 2CDFA 4P5TD 2Y5TB 1UWRA 2Q87A 4HUWA 3CV5A 3NUKA 2DTMH 3RWEB 4L8CA 4K7PY 5CINH 2VXUL 2ARWA 1MCWM 5HHMB 3OZPA 2CJUH 2GTZA 1A6TA 3ALPA 3F7RA 3QHTC 2EPNA 1U58B 5KVEL 3HR6A 4RWYL 1MRDL 3TTSA 4X6DE 5ERWB 4KK6C 3SKMA 4ONGH 3TT3H 4P5TA 5ILTL 4CCCA 2DBLH 4LF3A 4PJIA 5JDSB 4U7KA 4YHNA 3S5LA 1X5FA 3ARBC 4JREC 3KLDA 3EJRA 3OKNB 1RZJL 1YEEH 2A3BA 5A2BA 1A6UL 2HT4D 5J13C 3UTZA 3IRZA 5IMOA 1JPTH 1TVNA 4PYHA 5LQBH 1BD2E 3PGDB 5I19H 1YEKH 1FJ1A 1QEWB 5FL0A 5JW3H 2K7PA 5TGBB 5ID0B 3HAEB 4WV1A 1ITCA 4KKCD 2FATL 2ICEA 2QBWA 2EO1A 4E5XB 3FN9A 3D3VB 4XCEA 1DQLH 1PX4A 4PLNC 4FQLL 1E6OL 3IDNB 3V0WL 2DAVA 1NARA 4PCTA 4PYSA 4Y5XA 5BROA 3T08A 4AMCA 5IFPA 1GL4B 4G42A 1U41A 1P7QB 3HRPA 5C0DB 2W67A 5CLTA 3JV0A 2XWEA 2R0KL 3OF6D 4YX2H 1BZ9B 2Y23A 3AXLB 2C7UA 2J8UB 4PJFF 4G9FE 4JHWL 1NDMB 3A23A 4KZDL 1C1EL 1CXLA 3TWCH 2A0LC 5E9DB 5HJ3B 1XV8A 2J8UE 1NMCB 5J6HA 3MJGX 1XGRB 3ILPB 3CZJA 4K9EH 5ICYA 2OMBA 2VH5L 3WLWD 3BUYB 4UTFA 2RFXB 1B90A 4HXAH 3L4WA 2UWEF 3GHBL 2ZCHL 2WMFA 3MO4A 2BFVH 2DQUL 1FZKB 4H1LH 3HTLX 5IB2A 5ICXB 3AFLA 3EOAA 1R8LA 4YQXH 1Z9LA 3QWRA 1BAFH 3EOTH 1UR1A 2PTTA 4Z7WE 3WUWB 2PWEA 2F7PA 1TPXB 5A8OA 3KPRA 4YWGH 3S7GA 1RZIB 4JAMB 4PRHB 3C8KA 3C5JA 3F62A 3QULA 5H94B 2FHCA 3EOTL 3MS8A 3ALWA 2Z31A 3JWNC 2XN9A 1ZVHA 3BLBA 4QKXB 1JG9A 1WC7A 4L3EB 4U1HB 1NUGA 4ATDA 3UAJD 5F1OB 3IDMB 3U9UA 3CMGA 4BKLB 4R26H 2I9TA 1MJ8H 3C5ZB 3IXTA 1D5XB 3A47A 5CP3A 4X6BB 2YPLD 4NOFA 2GHWB 4WFGE 2P5WE 3CFBB 3GGWB 5EBMA 1KSRA 3H3KA 4WRLA 4XBGA 3ARTA 3ZT7A 1D5MB 2X4QA 1JYVA 4NYLB 3W6MA 5EO1B 1G9HA 1IAKA 1X4ZA 2PCPA 5GPRA 1PIGA 2FGWL 1ZVSA 2VIRB 2FHFA 1DQJB 5ESQB 1MHCA 3CCHA 1ODZA 2BXZA 4S1SL 3KPSD 4KDTC 1ZE3C 3NMEA 1B3JA 1PYWB 1L0PA 2OBGA 3DHJA 4OLVL 1UZ4A 5F3HB 3ZKNC 2GUYA 1P2CA 2VC9A 1SY6A 5DI8B 3GB7B 2HLAB 2Y6SD 4XVJL 5K93A 1QLRA 1J1OL 4WUUE 2FD6L 4UFLA 5I66A 2UWEB 4MGXA 3GZKA 1I1XA 4ZOBA 5DQJA 1WIUA 2EEAA 4HBCL 5FB8B 2YPLE 4LSUH 3RVXC 1A3RH 1AHWC 4GKSB 2R9HD 4AZ6A 1LWJA 4IDJH 4ISVA 3O2WL 2ARJA 3CD4A 1KB3A 1CFBA 4I9WD 5FUOL 1U42A 4ZO9A 4LSPL 4ZQKA 5IQ7L 1ND0B 4EDWL 2IJ0C 2R1XA 3CBWA 2FATH 3VWJB 5C2BL 3QHMA 2BVEA 2AAVA 4DQOH 3B3IB 3OXRA 4BQBA 4OFKA 3PWNB 3QDGE 3DVFA 1ISZA 4MD5B 3W28A 3TBTA 4PJBF 2IPTL 4U1MA 2HYMA 3TT3L 3RTQB 3WFDL 1W9XA 5SWZB 1FLRH 4AZ8A 4EJ1C 2DI7A 5ACLA 4U6XA 4JQXA 3O9WA 1CLYH 3SE8H 4L3CA 5BJTB 2E27L 3K8KA 4O00A 5GISL 1ZT4A 1GGCH 1KTCA 1YECH 3IJ9A 1YNKL 4M48H 4AD2A 2H32H 1TLKA 4JQVC 4F9LA 5F7LB 3LN4B 4HJ0D 4OLYL 1OD8A 2VO5A 4I9WE 1P69B 3VI3E 1UYWH 2WWMD 3C8DA 1TQSA 4HH9B 1NJ9A 3HC4L 3ZT6A 3TCLB 4Z2LA 1RMFL 2R29H 4YN5A 4PG2A 3O9WD 3LRSA 2ADGA 2Z91B 1RJLB 4O9HH 1YMMA 2R4RH 5CHNA 5DC9B 1QNQA 1MLCA 1BEYL 3DI3B 5C09B 3RVXD 2BNQA 3VXPB 3WKMH 4FG6C 3L4UA 3BW9B 2FDBP 4M4PA 3TT1H 3I50L 4JFYA 1UH3A 4Z7NE 2IPKA 3CDGB 1X5JA 3FT2A 4KI5E 5DS8A 2R69L 5GS0L 1RZFL 1PLGL 1KCKA 5A16A 1CI5A 3AZTA 1C7TA 3T2NH 4JY4A 2FD6H 1L7TH 2P5EB 2APFA 4JHAL 1IL1A 3DROA 1AGBB 1YNLH 3QEUB 4TUJA 1W3KA 4OLYH 3IF1B 4UAOC 3WH5A 5BXPA 5D9MA 1GIGL 5DMJB 1RZJC 2OR9L 1EO5A 2VLKB 4MXWL 3BP6A 3PHAA 5F71A 3VXUB 2CXGA 1NL0H 1DFBL 3QIWB 1YMME 3MMUA 2VWEC 2BVDA 1GIGH 3MRRA 4LLMA 4OM0L 2G4FA 1ORSA 3S34L 2ZG1A 2YKLL 4WI3A 3TFKD 2F7RA 3CZSA 1J1XH 1ISYA 1NQBA 3MXWH 1P9MC 5DVKA 2NY6D 4X9IA 1PSKH 2GK1A 4PIRF 1AKJD 2XTJD 1KCSL 3IU4L 3MKKA 5EBWB 3EFDL 2OR7A 5IB1B 1JUFA 1FLTX 3T4YA 5T3ZH 2IAMC 3MUAA 3ROOA 3OZOA 1OGAB 5DJDB 1UQZA 3U4EA 3H0TA 1IAOA 1F11A 3FB6A 1WFOA 1G6RL 3U7YH 2VAAB 3BPCA 3U57A 2DH3A 1Q9OB 2IXVA 2GW5A 4EBQL 4GO9A 2X4SB 4YHLL 1ZKAA 1V05A 1HCVA 1VFFA 5I18H 3F7VA 4MVBC 4QCIB 1ED3B 4J3VA 3ZMRA 4TVPD 1IM3A 1WEJL 5KVFL 3IFNH 4NXKA 4UB0L 4U7MA 4GI8A 4L5FH 4PR5A 3GJFK 4WO4B 1XCXA 1Q9LB 3GSOB 3NPSC 4NO5A 1AGCA 5T5FH 5L6YL 4DZBB 2HTKD 3U7VA 1B0RA 4NUJB 4ZFMA 1A7OH 3VDAA 4FS0A 2KKQA 4QLLA 1QFUH 5CEXB 1YYLL 3ULVD 3OKDA 4HLZG 1FL5B 4OZGF 4PJEE 4W84A 1E71M 3KPRD 3DHPA 2JIXD 5DWUL 3B9AA 2QPUA 4GUPB 1EJOL 1SMDA 5EZIH 2WYSA 2FEEI 3LPPA 2J2ZA 4V1DA 1F3JB 4OQTH 3OAYK 5DHYA 1EAPA 4P4KB 4KHXL 3DMMD 2OTWA 3VXNB 5CS7A 3OKOB 3VH8G 1HXJA 5GRYA 4Y4FC 4HPHA 3L3HA 4UQ2A 3TO4D 3MYZA 2DLEA 4OZGE 1OARL 1HE7A 2WP3T 4MJ5B 4FLSA 2J7FA 1ETZA 3NSNA 5SX4I 2H41A 4KHXH 3NCBB 5JIHA 3GNPA 1AGEA 4M1CD 1J1OH 4PBVC 1A7RL 1P9MA 3ULVE 5A8NA 3NCFB 4RMUA 1P53A 1K5NA 3FQNB 5EBAA 4XXDB 1BD2A 1P4IH 1O7AA 3WDQA 3TJHD 2EE6A 4MNQB 4GMTL 2JJTC 4JFZH 4P3DB 2EDBA 3QUKB 4M3KB 5A40E 2F54B 3AB0C 2AJSH 3FO0H 1QEWA 3FO1B 4J7RA 4BSVA 4K3HA 4O02L 1A6ZA 1JNNL 4IBLT 2A74B 5J13B 4JFFB 5I8KL 3UR7A 1JL8A 2DM7A 3TA9A 4WU7B 3K1KC 5LG1A 8CGTA 4XP4L 5D1XC 4GQ9L 3DVGB 4XI5C 5BXSA 2PXYB 2EIEA 3CU1A 3PXJA 4RMWA 3SGEH 4MNHB 3G6JE 3FQXA 4PRBB 3P11H 1MW1A 3DVIA 2J8UA 4IUGA 5KZ6A 1EGJH 1SFSA 2JK5B 3VFGH 1W32A 3BD3A 1ZLSH 2WWDA 3DX0A 4R4BA 3AROA 3DDGA 4PRPA 3CH9A 1G7LB 2VOTA 4MQSB 4R6UA 3ET9F 1CG9B 4XX1E 3SOBL 2PWFA 1G0CA 1G9MH 2NX5B 4JJHA 4XNUL 4HGWA 3A24A 3IGAA 5FAAA 3ZO9A 1NMCC 1YEHL 2B1AH 2W0FB 2YWZA 4YHKL 5FUCE 5GQBA 3P73A 4TTGA 5ICXA 5DJ8A 2YC1B 4BM7A 5GGUB 1S5IH 1WBYB 3VM7A 1WITA 3QNYA 4ZXLA 2DT1A 4L4TE 2DWEB 3QBTB 4CKVX 1V3IA 3OZ9H 2DT0A 3DO7A 4I1NB 1OP3K 3VWKA 1WBZA 3FN0H 4FOMA 4HIEA 5I8EA 4Y4HA 1CDHA 4JO4L 2XN9E 4MA8L 2X4TB 3SBWC 1YPZF 2EDEA 1XGTB 3VXTA 2O93L 3OIHA 4D3CL 2EDRA 3V2AR 2VXUH 4S3KA 2VT0A 2VISA 2NZ9C 1I8IB 1XAUA 4LLQA 4JFPA 4H8WH 2H3NA 5FOBB 1I1FA 1YNLL 2W07A 4RIRB 4P2RD 1JCKA 1XR8A 5D2LE 4ZSOE 3UTTE 3CFBA 5B38G 1RIHL 1KV3A 1PKQE 1MAMH 3H8NA 3RVTD 5D9NA 5GGSB 1UWGH 4DKEL 1QLEH 2O5ZL 1UWGL 4DKEH 1UKSA 5C0JB 4G8GE 3FY1A 1RK0A 5DRNA 2VIRA 4CUCA 2HKFH 1FFNA 1S9VB 2CIIB 3MV8A 3UJTL 1KGCD 5I71B 4P2QB 1D5BA 3KYOB 2F5AL 3QWOB 1I9JL 1J5OL 4LHUB 4CD8A 3W9DB 1JDCA 4QRSB 1XGUA 3PWLB 3LKRA 4WUUA 5BVJA 4HIHA 2F53D 3RDTD 1HKLH 1KEGL 2VR4A 5JW4Q 2O9PA 3BGMB 3HMCA 4AZHA 3P9MA 4X98A 1GGYA 2XI9A 1SMOA 1U91B 4IRSC 1MELA 1BFVH 1QBBA 3E3QC 1Q6GA 1UC6A 4HKBB 1FO0H 4YJZL 1MH5B 5IFJB 1C12A 1RZKC 2YD1A 3MNZA 2EYSA 3TGXA 3GMOB 3UTPE 4M82A 5AWNH 1OF2B 4U1GC 1ZHKB 4IM8A 4KJQD 3PWNA 3CFKA 2RGLA 2BVOA 5JLZA 2WP3O 3G5ZA 4F8TA 5ABFB 3OJDA 4WVRA 3PWPB 4GG6F 4AWEA 4UQ3B 2E4TA 1A6VL 1U8QA 2VXVL 1EGJL 4Q6IA 1FNEB 1OTTD 4J4PA 2WM0A 4LSDA 3V0VB 2Z93A 1M7IA 2VQUA 5T3XE 3DRQA 1R85A 3L3GA 2XACC 4J3WA 1UXSB 2EYTA 3ARBA 5IVOA 4PRAA 1KJ2B 3VGHA 1OAXL 2QMJA 4LLDA 3KL0A 5CEZH 5E2VL 4GRWE 35C8H 4CU7A 4WGVB 4XCCL 1MCKA 3MRNA 4ZPTA 4U1SB 3LRGA 2JF6A 5EO0A 4AQ1B 4XVTH 3T0AA 5DLML 4YHZH 3RVUC 4AEIH 1PZ5A 5BCAA 4I3GA 5IB4B 4I8DA 5IVNA 1GJUA 2VDLH 4MCZA 5EFIB 2DOCA 1OCWH 4IOIA 4XB7A 1G7IB 4A3YA 5F6HJ 5F89B 2W9DL 1ZGLM 2IPKB 4YGAB 1MFCL 2C7FA 3MRIA 1FO0B 1I9EA 2P1YA 3REVB 4JY5H 4M6NL 3QUXD 3LKOA 5C92A 1FL3B 4EDXB 3PV6A 3VD5A 4NQTA 4PJAA 3WUWG 4DVBB 5E2JA 4FQ2L 3IDIA 1S8DA 1GW1A 1YEKL 4CNIB 5JPNB 3ZR5A 4HWBA 4WI6A 5HHQA 1HJXA 2P5EA 2W0KA 2ITCB 1AGBA 3NIDE 4PRHE 1QFOA 4Y1AA 3EJQA 1NANI 1DJSA 4GKZB 4HJGB 5IESL 2D22A 4ZEPA 2AV7A 1EOKA 3EDDA 5JNYB 2DYPA 3N15A 5L0QB 4YDLB 4FLOA 3SO3C 3A22A 1QPPA 4LPTA 2AVGA 2WMIA 1ZJAA 3CO4A 4Y4FD 4P46C 4S10A 3HZKB 1F6FB 1ZT1A 1QI3A 3VJ6A 3WF1A 3RX5A 2X1WL 1N5YL 1CVSC 1RIUL 3OQ3B 4TSAH 5ADOH 2PF6A 4GRWB 5E8NA 2P8PB 5DUPL 5ITFB 3DLQR 5E8DL 4V27A 4R3SB 4I4WA 4JPWL 5J7CC 4WLCA 4ZMAT 1P7HL 4PMUA 5IB1A 4HD9A 1JUFB 3T4YB 4PRIE 1HHGB 3IFOB 2C1PB 1MI5D 3AUVA 3EJYD 3H0TB 1UWEH 1E0VA 2IFGA 4ERSH 2NSXA 1UB6A 3O2DA 1WDRA 2W4XA 1U8PB 1Z5LA 2AXHA 5JOFA 1Q9OA 2X9WA 4NRZA 1I7TB 4ZUVA 4LYRA 4WTZA 2ZUWA 1NCWL 4YEEA 4XAKE 4X5LA 2OI9C 3QUZD 3W39B 2A6IB 3Q5YA 2LTQB 2Z1SA 5AUMA 2WMPA 1AO7B 4L8BA 1A6UH 2AXGA 4I3RL 4PV9A 1QW9A 3LDBC 5D9OA 3NPZB 5A6LA 3KPQA 5T3ZL 5HGBB 3H9SE 2A3HA 2HVJA 1JF1B 1CFVH 4RL3A 1MF2H 3TH3T 5GZNC 3L4ZA 4YGVA 1I1AC 4OUEA 1F3RB 3TPUB 3MFFB 5FFLA 2EYRB 1CZ1A 1GGTA 3AM8A 4F15C 3SCWA 1MCBA 5LQBL 3GSVB 5ICZB 5EDXA 1VFAA 4CMMB 2BK8A 3KYMA 3T0EA 4HZLB 3NTCL 1F4YL 2WUCH 4V1DE 2APTA 2CKBL 1B4JL 1HXKA 1M05B 5LYRA 1CDUA 2BMKB 4ZFOA 4QNPF 1TVBB 2R23B 1RZ7H 2FL5A 4R7NB 3VFTB 4AL8H 3VX1A 4B50A 1VBUA 2HJKA 4G8FA 3UBXI 4ZXBA 3BAKA 3BPOB 2JJSA 3L3HB 4UQ2B 4HS8L 4M6NH 4CDGC 1KJMA 1ITBB 2R0ZH 4TVPH 4OCSH 1IC1A 5C70A 4XP6L 2P49B 3UTSA 5DO2D 2JKXA 2W9DH 3FQUB 5EOCH 4JQXC 4LQFL 3SJVA 3SE3C 4HUVB 3WELA 3OGVA 1I3GL 3MJ7B 2ADIB 1W0WA 5F88A 4UINH 4TTDC 4KROD 4HS3B 2HVKB 5C0BB 4JFQB 1FRGH 3KXFB 4ZD3H 4JZNB 4EIZC 1A3HA 2NX5E 1YNTB 1U33A 1E4KA 1Z0NA 2I26N 2VX4A 1ES0B 2VLMD 4HMCA 4Z7UB 4ELMA 2CD0A 5I1IL 3TV8A 3G5VB 1J0JA 3HAEH 1H3GA 2IXUA 2UZIH 5DJCB 5TQ2H 1T6WA 1KIRA 1J1PH 4UNTA 1G7QB 3CLEH 5FKAB 2EADA 2FO4B 1FIGL 2YXFA 4HFUH 2X4NB 3S35L 2XVKA 1R24A 5J56B 1ACZA 2Q6WA 4UI2A 4K3DH 1OAKH 1S5HB 4Z0XA 4ELMF 4NT6A 1CLXA 3C60B 3UTSE 3UJIH 2RIKA 4XNUH 5M03A 1P7KB 5L7XL 4GXUN 3O3DB 1KG0B 2J77A 3VG0L 4QXTA 4G5ZH 1UXWB 3WFCH 3VGFA 5CEYB 1E43A 1J0HA 4Y19E 2X70B 1QSEB 1WUNT 2NLJB 2DTSA 2NX5A 3D69B 4JN2A 5CIPA 3C9NA 3N9GH 5F44A 4OZFH 1NSNL 3HRZA 3JV6B 2GSGA 5FYKE 4KROC 2HMIC 5F7WC 4JG0H 3VXSA 4K55A 4EI5A 3SDCD 2VDOL 2XOTA 3QGVA 3LQZA 4WHTB 3QHFH 4HW6A 4DGIH 4GKNB 1WBZB 2Y72A 1IGTA 3BIBX 3MJ8B 4RSVA 4LPYA 2YL9A 1J7VR 3VXTB 3ZKSD 2A77L 4KTDL 3OV6A 1UYWL 5FYJL 1P4IL 4RAVB 5I73B 2D24A 1MWAA 3BAEH 3QXTA 4G6ML 4M02A 1EFXB 2Z4QB 3TO2B 4P7NA 4Y5VB 2UVFA 3VXMA 4WFEE 3MLWH 4E41D 1ORQA 2NT0A 4KMQA 3K2UL 4QGTA 2FGWH 2AXFA 1F90L 5EORL 4WY7L 4EIGB 4P2OC 1QQDB 4OUUA 3B43A 5J11B 1HINL 2L7JA 3PQYA 2OMNA 2VDQH 2FYVA 3A5VA 3M46A 2XQBH 1IC5L 4Y4HD 2CDFB 2Y5TA 1XF4B 4NKIH 4KDWA 4MLSA 5DR5H 2X1PA 3H9ZA 5T1DL 3PWLA 1AQDA 1E6SM 3NA4A 1QKZH 3MRJB 1W9DM 3MV9A 2Y06H 2N56A 1EJOH 3IDJA 4X98B 1C16A 1BLNB 1UKPA 2J8HA 3W6LA 1BFOA 5ERWA 4KC3B 4P59H 1YEDA 2P46B 3RGHA 4UNVA 4P7LA 1YJDC 1ZSDB 4NN7B 3QXDA 5F8QC 3TH2T 1UQSB 4LF3B 5DRWA 5TDNA 3MZGB 5GSRB 3LKNB 5HVFB 1VPOH 1GNXA 1CBVL 1OF2A 5LJYH 4RCAA 1VA9A 1I9IL 2NY2B 3DMMB 1WT5C 2R1WA 2A3EA 3VXRE 1E28A 1N64L 5BYWA 4YLQT 2BVQB 2Z35A 3RM8A 1LL4A 5CZVH 3HNSL 3VWKC 3VNZA 2DQHH 5C0FA 1GC1H 1S9YA 3TV3L 3C6LB 4Y4HC 4E5XA 5MP6L 3RM4A 4F66A 4NZTH 1ZL1A 1VGKA 5JOEA 1B4RA 4Y5XB 5CZVL 1C8QA 1W0VA 1AXIB 3O6MH 1UD8A 1N3NB 1HI6A 1NCBH 2CKBA 3O6KL 1MHEB 1TJIL 4L3EE 1X1NA 4Q22A 2XFFA 5E9DA 4P99A 3V4UL 4KI5C 1G5AA 3CXHK 5F93C 2YSSA 4ZNEA 3P40A 4Y16B 1XGRA 3ILPA 4NQCD 4WHYH 2K3TA 1PY4A 3VXRD 1DL7L 4IMKA 4GG8B 5HHVL 3S97C 4OZGB 3GXNA 3DETD 3FQRA 4PJ5B 2RHEA 2X4OB 3MYJB 3WUZA 4R0LA 5DVLA 5HY9A 2H8PA 2V9RA 2WAHA 5EN2A 3MV9D 1MCRA 2HKHL 2IBZY 5I1KL 1K6AA 5A94A 1JNLL 1ONQB 4LASH 2V3EA 4DVBA 5ESAB 2BVYA 1EUUA 2I27N 4PRHA 4Y1AE 3VE0B 4XVTL 3HN3A 1LO0L 4HOZA 2XUCA 2JJUA 3WY2A 2AJVL 3FRUA 3X12A 4L3EA 3LD8B 4G3YL 3VFOA 1MEXH 2IGTA 5IQ9B 4GMSL 2NY4D 4CD6A 1PS3A 1QFUL 1ZT1B 1PJ9A 4X6BA 3STLB 3TC9A 4K7PL 3IAPA 3HZ3A 4PJIE 1CDIA 1T22B 5BW7C 1BOYA 3GGWA 5EBMB 4BQ9A 4F7PB 5H2BA 4GBXC 5E8NB 3EYUL 4D1IA 5DYOA 3AMGA 5GJSH 2VLRD 5BS0B 1B3WA 3S4SB 3OLEA 4RA0C 3FHQA 4N8CL 2J4WH 4F7CB 3SBWA 4FQQB 3IKKA 4B16A 1A3LH 3UAJC 4PJBA 2WCGA 1BOGA 4RRPA 1IT9H 3PL6B 5A2LH 1ZGLP 43CAA 1FH5H 1P2CB 4MAYD 4QXWA 1E4XL 1C3FA 2RCSH 3GBEA 4U6YA 1JFQL 8FABA 1LEIB 1E3ZA 5I66B 1RIUH 3LN5B 4JFVA 4OZIA 4N0YL 1BPVA 3LXAA 1KUMA 2VTFA 3WFDH 2APVA 4W8AA 2A6IA 1KEML 4Z2GA 1KEMH 2QJDA 1RY7B 4TX8A 1HSAB 1OSZB 2DT3A 5I5RA 1RUQL 4YDKH 1JPFB 4RNRA 2OP4L 1CFVL 4DAGH 5HGBA 5E4EC 3KHOA 2GUOA 4FFWC 5EO9A 1IILE 4PREA 5DJ6A 4UZGA 5D1QB 4ZFZB 3O2DH 2XT1B 4KVCH 3MFFA 4O2CA 1ZBVA 1BG9A 5IM7B 3BVNA 5L7XH 3O4LB 4IPLA 1UJ3C 3SCMB 5BXFA 1S7XB 3CC5B 3CSPA 3HMXH 4P57A 2XXCB 5IW3A 4PTWA 3BUPA 5CJOH 5A95A 2DQJL 2MCG1 3SKOA 3BKCL 3GJEB 2CK0L 3SUSA 1ZT4B 3QNZB 3ECBA 1UWXH 1OW0A 4BUHA 1IGYA 4XNQB 4ZUUB 4AH2A 2EEDA 4XC3H 3CUJA 3HMWH 4R7DA 5FDYA 1MEXL 1CFNB 3NSMA 4M43H 3KXFD 3RIFK 3HE7D 4QHNB 1R3HB 3QDAA 3DYOA 3VFPA 2EE2A 1KXQA 4JGUA 1FZMB 3EO0B 1V5JA 4U3CA 1T66C 5DD3H 3LV3A 3VNYA 5EH1A 2Y36L 3A6CH 5CHNB 4QRUA 3T4AA 4RMVA 3CPLB 4W5ZA 4AD5A 5C07E 3LS4H 1UHVA 3TH4T 1OP5K 3WFLA 4JFYB 4EE9A 4HLJA 4U1IA 4HMEA 3T2OA 3ALFA 1AY1H 5C8JA 4GPNA 4PY7A 4ODVH 4L4JA 4JKPH 3MRMA 3SCUA 3UPRA 1QX1A 3D50A 3F4VA 3RL2B 4PUEA 5M94B 1DWJM 1HNGA 3PDOB 1AD9B 4IOFC 3W9EA 1PG7H 4HKJB 5MEOB 1CFTA 1JMZA 5DJ2A 5D1XB 4GZJA 1HWGB 3ZDXE 4PJHF 4QXGL 3ZE2F 2WZIA 5E56A 3IF1A 4FNLH 3P4OB 3BP5A 1IFHL 2GDUA 3PIQB 3Q3GA 1FH8A 4N0FB 1JPSL 1KN4H 3FCTB 3TYFB 3LVEA 3PZIA 4HCRH 4WW2F 4OGAC 1MLBB 5C07D 2CDEA 5KZCD 4PJXA 5GRVK 3WY4A 2NW3B 2CPCA 2WXDM 4ZENA 1DR9A 3UO1L 2E9JA 1XZ0B 1IV8A 3CZFB 4IRJD 5DLMH 2XFYA 1R33A 3G6DH 1MCOL 4DKDC 4TNWK 1NBQA 1E4WL 4HSQA 4M7LH 2CHNA 4PJCB 4EKXA 3MRDA 1WLHA 3SCVA 5BZDA 1HYSD 4F2MA 1FFQA 1TNMA 4HUKB 4M5ZH 4O4YH 5D6CA 1U9KA 2NY0B 1TZ7A 1CXKA 1L9NA 3QR3A 1UD6A 5H35B 1A7RH 4DGVL 3N12A 4DGVH 4M29A 2PR4H 4H1LG 3GIVB 5JW3L 5JXAL 3ROLA 1FE8H 4GRMB 1JPGA 4LKCA 1L6XA 4NM4L 3QZWB 1K4DB 1I1RA 5DMGC 3KPSE 1HX0A 1SBBA 4P59L 5KVDL 3JWDH 4I2XE 3CIVA 1YY9D 1ESWA 1KFAH 5E95B 1NBYA 4RAVA 4MA7L 1IM3B 1EERB 1QTYT 3CH1B 4JFSA 2H9GA 4FNPA 4PR5B 3B9KC 2CLZA 4NO5B 3V4PH 3BVXA 1ZLUK 3VXMB 3X11B 1N82A 4OCWL 2DBJA 3EYSH 5I76B 1NKRA 2CIKB 4QCEA 1MVFA 3UCRA 1AXSA 4KK8D 3L7EA 1V02A 3QUZC 4J8RB 1BYCA 1L7IL 4PJGA 3MV7E 5EUOF 1JPSH 2A0LD 4OLEA 3OAZK 4XVSL 2BNUB 1D3CA 1KEGH 5HHVH 3SKUD 4QXGH 1FHDA 1R5IB 1MPAH 1S7UA 5FD0A 4LIQH 4CD7A 3MACH 1Y18A 5DHYB 1TQUA 1ZV5A 1UM6H 1C16B 4I2XA 3DVNB 2ZOLA 2CSPA 3AMLA 3RMEA 2P8MA 3C60C 2HH0L 4LAQH 4JN1H 5I9QB 5TDOB 3BIAX 5IGXH 4KRTA 3L3JB 1A5FH 4RFNC 2AEQL 3PZGA 4CD4A 3HB3C 2P44B 4LSSL 1HOCA 1WDSA 3SKJL 2XVLA 1RVFL 3I6LD 2Q7YB 1NPUA 1XCQB 43C9B 2WKLA 3F5JA 3RVUD 3LOWA 3AIQA 1V02E 5E09A 3VFWB 4KKBC 5D7SL 3GXFA 5HHNA 2V3DA 1JRHI 2R0KH 4OM1L 4FQXD 1X5HA 2D7NA 2JJTA 3KPLB 1T1XB 4NUGH 3OPZH 2W65A 4NCC1 4WDIA 2ZNXA 4GW4B 1T5XA 3PZ9A 5IEHB 4MQXC 2GT9A 3VO0A 1FNLA 5BV7C 1T4KA 3LEXB 3UTTA 5B39B 2DSZA 5C0RH 1DBML 1HHJB 4HFWB 1QYGL 3HG1A 4MNHA 1OGAD 4GAYA 3H3BC 1NGYA 4I77L 4NQEA 3GSNA 1MYRA 1PZ2A 2OW7A 4TRPH 1TCRB 1BZ7A 3RWJB 1YJDH 1C08B 2MTPA 3MNVA 4NRSA 3TNNA 5BV7L 2N1KA 5SV4A 2CBVA 2WIIB 1E4IA 1KB5A 4NHUA 1KJ2H 1MRFL 3HI6L 2ZCKH 1MCPH 4JLRB 4M8VA 4LSVL 4DKFH 4P3CH 4JRWA 4XWGL 5C09E 3SDAB 3GXMA 5D93B 4WO4D 2KZWA 3BX7C 3I3EA 2DWEA 1JRHL 3DGGA 1MW3A 3BC9A 1BBJB 3AY4A 4X8XA 3BZDA 4J4PD 1TZHB 4YAQA 1FFPA 1NOUA 4UT9L 2RGSA 2LU4A 1CE1L 2XTLA 2YK1L 3LEVL 1B0IA 5D7KE 5FHAL 2ZSWA 3LDBB 3IDXL 1IBGH 1QPXA 4ZO7A 3CPUA 1CXFA 4UQEA 3M7SA 2CDGA 5IVXF 3EHBC 5JOPE 4PJDE 1W2KT 3RWCA 5DD5L 2BC4A 5GGVL 3NGBB 5EIIA 1CLOH 3ZJ8A 1KBGL 4JM2D 1OLLA 4PLKD 2OSLA 3MGTA 1M6OA 3UDWA 4PJEB 1MHPL 3GNRA 1W72H 4FTVA 4PRPD 1NUFA 4Z5RB 1WFUA 4PGZA 3CDFA 1QYGH 2VXSL 2AK4D 3F7YA 1UA3A 3ES6A 4JFOB 1QSFD 2X2IA 4NO3A 5BRZD 3N1PC 4WW2C 5DMYA 1B2WL 3A3HA 3MR9B 2ESVD 4OZHE 1E6JH 4X6DA 1OWWA 4MNGA 3NAAL 4Y0GA 5DQ9A 4ALAL 2VQ1B 5K9QI 1U91A 5M5DA 1AXTL 2FBJH 3K2MC 2B20A 4JG1L 3TN0D 3B4NA 3OXSA 1TZIA 2PNDA 3EJYC 3Q5TA 3FRPG 5DRZA 5E6IB 2XZQH 5JBDA 2WVVB 1V7NL 3MODL 5FYLL 4XV0A 3SDXB 3T1WA 4PRPE 1UD5A 1KENH 1CR9L 3S3PA 3SUWA 4FFZL 2UZIL 5TQ2L 3HI1B 1HIZA 4IRJC 3WHXA 2W91A 2QKIB 3DV4A 1VACB 2ZKHL 4CCEA 3KGRA 5F72S 1S7SB 3C5ZC 4QEGA 5TDPA 4B9YA 1H3PH 2FJGB 1QFWH 3WJJA 3MRLA 3GMNA 4G6AC 2QADD 2OLHA 3SE4C 5C0GB 4J6RH 2GK0B 2EYTB 3ARBB 5L88L 4PRAB 5JHDD 1ULVA 4JFHE 2V5RA 1A1NA 2GK2A 3U82B 3B8YA 1EOMA 1WTGT 5IFAL 4K9EC 4QHNA 4GSDH 3E0GA 1XCWA 1CVRA 2GTWA 4E2OA 3O3BA 3QNXA 4X7TB 3KS0J 5E2WH 1HNFA 4QRUB 5F97E 1GPOH 5EPMB 1B3VA 2JB5L 1Q0XH 1N7MH 5HDLA 3RU8H 2H2SD 3RPIA 4NKDB 3RJYA 4EUPH 3P30L 2BFVL 2DQUH 4P2RB 1TTUA 1E9LA 2AXJA 3GM0A 1IARB 2WIMA 3JTTA 3SDXE 1WK0A 2L0DA 5KTEH 1UACH 1Z6JT 1C8YA 2W61A 5T33L 4DN3H 5HGHB 5JW5A 3M45A 3ZKMC 4OQTL 2F7QA 4J3OC 4DQOL 2PR4L 5DT5A 1ZA6A 4H20H 3PGDA 4NCDA 2VRJA 1IT0A 3AM8C 1FHGA 3DYPA 5F3BA 5EZIL 1GOHA 5ISZE 4NNXB 2AV7B 3PIQA 1TETH 3D52A 3KNBA 5ISZB 3U5UA 5KVDH 2VE6A 5IMKB 1EXUA 4AY1A 1JGEB 4LDEB 4NNYB 2BVTA 1VDGA 3VJ6B 4NBZB 4NP4H 1MWAH 2CRZA 4FFVC 4MJID 4FABL 1IGIL 1QFWL 3W0WA 4EN3C 5GSVB 1UR4A 1OGTA 3AU1B 1LDSA 2GJ6D 4S1DD 3W29A 5E70A 4J2XA 3SGDH 3KL5A 2DD8H 5HJ3A 3AIEA 3MRDB 3WD3A 4K7FB 5ETUB 1IBGL 4PRNB 1U2CA 2H45A 1HHGA 4OV6F 2VRAA 5E00A 3MRQA 2D03H 4BZ1H 2RFXA 2WBJB 4MJIA 4GKLA 1E70M 1CU4H 4PGCA 4G8EA 2YXMA 4ZPVB 3SEPA 4JG1H 4K3JL 3EOAB 5D8JL 4ZUVB 2YPLA 2DF3A 5AC4A 4OLWL 1KGCE 1MIML 4NF7A 3BWAB 3C8KB 5H8DA 2GJ6E 3SCQA 3FQTA 4HF5L 2QSCH 4U1NB 4F9LC 1XGPB 2XN9B 1TNNA 2BRRL 2VX7A 2EEXA 4NJAL 4ZE4A 3C6LC 4Z7VF 1I4FA 1SR0A 1G1CA 4N0UA 5ITBL 5FUZL 5A2KH 2VL5B 4LSRL 4D6HA 1KT2B 4CVXA 4C7DA 4FMKA 1KIPB 4P48A 5CSZB 3LZFH 1QFHA 4YHIB 4TTDD 3L7EB 3WH9A 5ICZA 3VDCA 3U1SH 4HT1L 1JNHB 4OIAA 3KYMB 4O2FB 4OIBA 2WQRA 4HC1A 5AD0A 5LKNA 4ENEC 3SO3B 4N0CC 5FM5M 1E5NA 4S1QL 4WEBL 2C26A 3MCKA 4WEBH 1OTUD 1U93A 1D9KB 3MSGA 5HHOE 2DQJH 3KLKA 2V7HB 3L9RA 5KVMC 1O7DC 2YBTA 4R4ND 4M7LL 2GJ6A 3X3GH 1SBSH 3WN5C 5EZLA 4CKQA 3CFJB 3EYFA 4NC0B 1DE4B 4XHJD 4WK9A 3D1MC 5CEZL 1A7NL 4QOKE 3HZVB 2F8XC 5DHVA 2J7DA 2WC7A 5DQJB 2E40A 4HCRL 3GJFA 4YE4L 4GKSA 1OY3B 2ZX9A 4DAGL 2W38A 1CDGA 2WBJC 4NZJA 1MRFH 1SEQL 5EU7E 3F6LA 3RY6A 3RA7L 4ODBD 3R4DA 4PLKC 2VDPH 4UOQA 4KTEL 3LD8C 1BX2A 3AB0B 1BQLL 4PRIA 5C6TH 4U4BA 1WSST 5C6TL 1JGDA 4PCSA 3TBTB 4NGHH 1RZJH 1YEEL 3LN9A 1F4XH 1K8DB 4NIKB 3GH4A 3T65B 1JFQH 2FEDC 1F42A 2X4NA 3C08H 3UTTB 1MI5B 2VZ3A 4NNPH 1XC6A 3WXVL 1TQWA 4L3CB 2ADFH 5FIEA 3D0LA 3MRHB 4NT6B 4HXBL 1ZLVK 3GI9L 3PQYE 1T7VA 4X4ME 1DWGM 1UJTA 1OSPH 3QEQD 1E6RA 1MFEH 1FNAA 2HT4C 2Y5EA 3OMZA 3QUZB 1RPKA 3TP4A 4TULL 1IMHC 4PRHD 4ATWA 3QH3B 1XF2A 5A2AA 4F33B 1BVKB 1HCFX 4YK4B 3KR3H 4GW1B 3SQBA 3CZGA 4OF0A 3FNDA 1RHFA 2E3ZA 4KTYA 1M7DA 5EU6D 3WIHA 2JB6B 2BNQB 3VXPA 1TXKA 2CLVB 1E4JA 4GBXD 4HH8A 4AY0A 2C3WA 1JDAA 1GZPA 4Z2KA 2E6PA 1RIVH 4LAQL 4E8DA 4O2EA 2Q8BL 2R0ZL 4P5TC 1I7RB 5K59F 2VUYA 1FFPB 2VLJD 4F79A 5HNNA 1MVYA 4E4PA 1JGUL 1UWEL 1YQVL 1NEUA 3C8HA 4LIQL 1BQCA 2JIXA 4HZ8A 2QEJA 3RWDB 1ACYH 1JJUA 2P4AB 4YBLC 1GHRA 4DEPB 1AKJA 2CDGB 4XPGH 4POYA 3SDCC 2D9CA 1E1FA 1J8HE 4RMRA 4F58L 1XSIA 2OYLA 4LRIC 3BPLB 4NO0A 4AIOA 3MSDA 5KANG 3LXCA 1VIWA 2X6MA 1VF8A 4WKAA 2B0SH 2ED7A 4Y5VC 1FNSH 4PJEA 4XNYL 1UH4A 3B2UC 2J8GA 1RUPH 2VDKL 3GBDA 1B3YA 4DTGL 1KR0A 4FTVB 4BS0A 2F19L 2P5WB 1BYAA 1XF4A 1Q0YH 2E9LA 5L2KE 4XPFL 4RBPK 3B5GA 5ABEA 1H9VA 1NOFA 5ANMA 1LEKA 3QOKA 1N7ML 3RU8L 5B4MD 4QRPD 1BQUA 5D7JD 4LOUD 4LSSH 4OZHA 5HYJA 5AY7A 1D6VL 2IG2H 5HI4D 4PMYA 1X5YA 1TTFA 1BM3H 1T6VN 4MQ7B 2NY2D 4JKPL 3ZSTA 1O5DT 4YDJB 4Z7OF 3EO9H 4N8VG 4PJHA 3BZFB 4NC1C 4P9HC 5JW4N 1TJGH 4NX0A 5LGHH 2J62A 3V6ZA 4IMLA 5HYQA 3WNKA 1EZVY 2WSKA 3PZUA 5I1GL 1IGFH 1VEPA 1TCMA 2DB8A 4GRLA 1B6UA 5FO8A 4HK0B 4IRSB 4HMDA 1GSMA 5GRWA 3WLBA 2DQCL 1NP0A 3QUML 4AM0B 2P24A 4UIKL 3MLUH 2DWDA 2R1WB 3DV4B 4DZBA 2X4PB 3SE4A 5E0FA 1Y6KR 4Y5YA 5E9DD 4F57L 5L2KA 3QHOA 5ELIA 4DN3L 2BNJA 4FQHA 3T1FA 4XT1C 2CMRH 4WTWA 2QV4A 4NN6B 4RFEA 1ZEAL 5BRQA 5FYLH 3QXAA 4F58H 4Q9CA 1V7NH 4N90E 4NBXB 4DZ8A 2A73B 2NX5D 1N26A 4W4OC 1QWNA 4AMXA 3RCNA 1EHNA 4HUNB 3EUUA 4PJ5D 5I17B 4G6FD 3PZOA 3Q6FA 1LG2A 1IEBA 1UQYA 1XF3B 4Y4KA 3O3BB 1QVOB 2XZAL 3S3SA 4MDOA 3RUGF 1MWOA 1NEZG 3K2UH 4WI7A 1MCLA 2DM3A 1ETZB 1YEJH 2YS4A 1R0AL 4GG8A 4LLUB 2XM1A 1FYHB 1MJJA 4G8IB 5BZWB 1UUQA 3LEYL 2V9QA 5L88H 4ZG1A 1NDGA 5HY9B 1I1YA 2H8PB 1XF5A 5A8PA 4RGND 2DSUA 3FQWB 1MQRA 1ONQA 3OGCB 4AEIL 3BD5A 4L8SC 1DCLA 1A4JA 4YHZL 4X5XB 2E7BA 4YK4C 1Y0LA 1QO3A 5IBTH 4MNQA 3L3IB 1KLUB 2FH6A 4O9HL 2NW0A 4OF8A 3FFCA 3M17B 5FOOA 2JJVA 3V7MA 2Y8VA 5E2VH 4L5FL 1K9TA 1ZWIA 3QDMB 1CR9H 4XC1L 5GS1B 4U1JB 4UIMB 4IHOA 3QIUA 4YHYC 2APBA 1QUNA 4LLYA 3RFZC 4QHUA 2ZXBA 3BH9A 2X0YA 3B8SA 1U3YA 5I2UA 4O51A 4P46A 3CZ8A 2QTEA 2VURA 4TSBH 3D48R 1MFVA 3GRWH 3QHFL 4P7QA 3BEVB 3O3EB 4LSRH 1VJSA 4DM2A 5DSCA 3QHNA 1ZVYA 4TSBL 2XYLA 3WMBA 1G7LA 2NY0C 3A4AA 4X9BA 4BSWB 1TA3B 1RUML 3MRQB 1FC2D 2AAAA 5JORB 4G9FA 1MRCL 3O8XD 4ZOEA 3IGAB 3I6KA 1NCAL 5A6SA 1LE5A 4U6YB 4HEPG 1US2A 3QG6A 5GGUA 3KDMA 3S34H 3OJMB 1I1CA 4WY7H 4GAJH 1HJUA 2AEPL 4D0DA 1D5IH 7CGTA 5J1AB 3DUHA 2YFNA 2NXZD 1EX0A 4OKVB 1A4KA 3FQTB 4TN9A 4XAWH 4P9HH 2YLAA 4ZDHA 1V0KA 1AGFB 3PABB 3PTMA 2E6JA 2D7TL 3X14A 3ARDA 1H0GA 3LMYA 3MTRA 5EO9B 3VSUA 2FB4H 4OSUL 2PXYD 3CFIC 4JZJC 3G6AA 2WUBH 5HTSA 2V17L 4XNZC 2OYKA 5FEBA 1X7QB 4JB9L 1MREL 4WNQB 1BWWA 4Y16D 1XR8B 4OTXL 2A6DA 2GSIB 3C5SA 3GMQB 4P57B 1VFBA 1JNHA 5IJVB 2VLRA 5D5MB 4MNLA 4O2FA 1TQBC 5DD0L 5F7MC 1NOWA 4RGOL 1DUYB 3V7AG 2E7HA 2ZWLT 4KK9C 4URIA 3QPXH 3PZQA 4LHUA 4YH6A 4A4AA 1I1AB 5HHPA 1N6QL 2F19H 3HC4H 4R97B 1G7MA 2FJHB 5K9JH 4KH2A 4LSQH 1MFAL 1SVZA 1NGWB 3WH7A 5DFVD 1JGVH 4BQ6A 4JM4L 3IDGA 2JIWA 3OB8A 4EZMA 1QNPA 2XWBB 1YN6B 1B6DA 5I1KH 4YWGL 2I5YH 4WFED 4E41E 4ZTOL 2D1ZA 3SDDA 4YBQD 1PX8A 3SE3A 5GISH 5D1XD 4H2CA 1C8PA 6CGTA 1FFOB 4PRDB 4D0CA 5MERA 5E08H 5FKPA 3QIWD 4OBSA 3T8XA 4PG2C 3D4ZA 3EMZA 1L7IH 1XIWA 1WFTA 4KJWD 3JWDL 4JPVL 2HJFB 4D6JA 4W6YB 4XP5L 4XPHL 3K8LA 4L1DA 4TUKH 2AJYL 3JTSB 5IR1B 4KRPB 1GVYA 1ADQL 1QHZA 3G5ZB 4JIEA 4FG6D 3CH8A 1IZKA 4HKJA 5MEOA 4YPGB 4WFFD 2VWEE 2Q8BH 2FECL 5B21A 2C3HA 2BCKA 3W81A 2ZUVA 3AS3A 4K7PH 3BJ91 4U6VH 3M1BA 3WDHA 2HLFD 3LAFA 2IQAB 5HDOA 2DSWA 4DGYH 4F9PA 2ICEB 4M1CC 1KJ3H 4H25B 3RDTB 5HVHC 3CLWA 1KJ2A 3ARFA 1MOEA 2X4RA 4U6VL 1A6WL 3DXAB 4OCXL 4MTVA 4G42B 3FB5A 5C0DA 1UCBL 3UXFA 3N1GC 1XF2B 4JB9H 1KNOB 1YEGH 3D2UD 1JTPA 1CLCA 1Z9OA 5J6GB 5EO0B 4ACYA 2A6KB 3DX9A 1VAHA 5DMIL 2RBLA 2YZ1A 4AG4H 3VILA 3AHXA 1JD9A 2Q8AH 3ARGB 3GNMH 5FYJH 4EUPG 2ADFL 4KQ3L 4NFCA 3G5XA 2WCSA 3DRTB 1RJCA 3MC0A 3V0AC 5DMKA 1UD2A 1NCUA 4XAWL 1AHWB 3RNQA 3V5KA 3T0WA 1BQHG 1D9KC 3MBED 3AGVA 5D8WA 3KEHA 2BY2A 4S1DC 2PWHA 3ZTJG 1N4XL 4BF7A 4ZTPL 4PMRA 1DBJL 4HKZA 4G9DB 2ITCA 1TMCB 1OW0C 1DBKL 4NPYB 3D9AL 2OSYA 5ACMA 4UQAA 3S5YA 4NQUA 5HDBE 4FQJH 2DYPB 1OP3H 5I77A 3MA7B 3S98A 3VGAB 8A3HA 3MSPA 4HU8A 1U6AL 2WBWB 2AJXL 4POUB 4ZFGL 3IDMA 4Y2DC 1FP8A 1UR2A 5AZEH 1JBJA 1XH2A 2QMKA 2UZXB 3FOMB 4KGLA 2NXZB 3GKWL 5F9JA 1TG7A 3T0EE 2W60A 1MUJB 2R39A 2NY3D 3CGTA 4TPRL 3ZLQC 5M7QA 1J0ZA 2X9YA 5EU4A 3SPVA 1TJHL 1G6VK 3SY0A 1T0OA 1HXYB 5EUKB 1SYSA 4AMKH 3LPGA 1R5IA 3DX7A 1K4CB 1NGXA 5B3JF 2YD8A 4ODTL 5SWSD 3VIOA 5FECA 3LEVH 1HL9A 2HRPH 3SCNA 2HLAA 1UKQA 4MA3A 1KXTA 4JPIB 2DQIH 1RZFH 2AV1A 2I5YL 3HE6A 4UU9A 2WMJA 5IB5B 1G01A 5HXMA 3IFPB 2GITA 4OJFH 1UR0A 3O6AA 3QOMA 2ATPB 3MOBH 5TD4A 4GQPH 1OTTC 4ZFGH 5FB8A 3H42L 1HYSC 5C0NC 1C7SA 1I3GH 4OLXH 2XA8H 3T0ED 3ULVH 3O11B 1FSKB 1U8IB 1B2YA 4LYPA 4L8BB 3ARPA 3NA9L 4OZOA 1S46A 3E6HB 3A67H 3VIMA 4S11A 5MHSD 1OD9A 2X4PA 3VWJA 2E9BA 1WP6A 4Y2DD 3KYNB 5CP7A 3C60D 1RURH 4FQ2H 4UQ9A 3DMMC 4JRYD 5B22A 3LH2H 4LVOC 2IMNA 5ABHA 1X3DA 1YY9C 2XG5A 2F8VA 2PYFA 3LEXA 5EU6B 3QXAB 4YXHL 3SUVA 1BBDH 1HH6B 2V5YA 5IHLB 4IDLA 3RRQA 4ACZA 3OKNA 4X6CB 4GAYB 4JCLA 1NGYB 2WANA 2R23A 4PPTA 1R34A 3SDCA 2FL5B 4R7NA 2DD8L 5GXBB 4UV7L 1WE5A 4F57H 4KK8C 1INDL 2WNGA 5BWFA 5TGBA 3TONA 5HI5C 4BA0A 1MVUA 3QDJA 1FRGL 5I1JH 3UTSB 4HHAA 4IIQA 1PKOA 4JFDE 1HSBA 5I1HL 3V6OA 1ITXA 3HFMH 4M3JA 4AMKL 4CJ1A 4PJGE 3MV7A 4NM8H 1I85C 3BKCH 3T09A 5K9OB 1JNDA 1MRCH 4Y19B 4Z76A 5LGJA 2NR6C 4OCSL 1KBBA 3QEGL 2DM2A 2ZUQB 5F7HA 4LBEB 3U4BH 3LSOA 1KPVB 3QCUH 3FFCE 4D2NA 3QIBD 4DWSA 3L3IA 1IC4L 1QLFA 4NZUL 4FK9A 1IKNA 3AAZB 4RMSA 1RQ5A 4DUVA 3UG3A 3UPCA 5GS1A 4XUYA 1CPUA 1GOFA 4NJAH 3PF2A 1KB5L 4TUJB 4R27A 2NTFA 2IH1B 2WMGA 2Q6WB 3WD4A 4PJFA 2VLKA 3DX8B 3SOBH 1C5BL 5KSAC 4BQ5A 3AIWA 5BRZB 2E7MA 1Y7VA 1HDMA 1SEBB 4Q6IC 1JV5A 2V2XA 4N0YH 4YDIL 4QF1B 1CGVA 2E9WA 2H32A 5HYEA 5IFAH 2D7MA 4JVWA 4OCWH 4Z5RA 5CEYA 4ZS6D 4HEME 1IEAA 3FFCD 4OCXH 1U8KB 1QSEA 3QUMH 4P8WA 1GXEA 2GJZB 2GK1B 1PVHA 4QGYA 3R8BB 3I6KB 3RIAF 2HG5A 1FYTB 1TITA 2IWGA 2NXZC 3OKLA 4PJ9B 5ESVB 3I6LE 4LSUL 2QADC 5J06A 4HQQL 3OKMA 5E2UH 4D6FA 2O5YL 3J8F7 4ZUWB 3G6JF 1H3PL 3BXNA 3CK0L 4JFZL 5DF0A 5J1AA 2B1HL 3FXYA 4GMTH 5EO1A 4FFVD 1ROWA 4HKXA 4N5EC 2CUMA 1UB5A 4P2CG 4NHCH 2QF8A 3R8QA 3ZE1E 3FN3A 3KYKL 4OLVH 3X14B 2PUQT 3MLSH 5F3HA 2W62A 5BRPA 1FZJA 4ODHL 5DUML 1FDLH 4ODSL 3QUYC 1W3JA 3A0OA 4G9FD 3WDRA 3MREA 2Z4QA 4NKOA 2QKIA 2KBGA 3U79A 4WNQA 3RBSA 1KOAA 1PPIA 2F2HA 1WKYA 1GC1C 4ORGA 4NQVB 2GJXB 1L4IA 3O3AA 5CKAA 15C8H 2FJGA 5IVXE 5EWIL 1MFEL 2C4FU 1ADQH 3VI3F 5CJBA 4NWTH 5CD5D 4TUKL 5KN5B 2J5LC 1OD0A 5D2NB 2ZUSA 5HD8D 4HXBH 4MA1B 4YNYA 5DFAA 4HOXA 5HGGS 4S0TD 4PFEA 1PKQA 3HR5B 2GFTA 1MW2A 5DHVH 3OKEB 2DMCA 1EMTL 1H8SA 3E2HB 4YHYB 4MCYA 2DJUA 5I30H 5CSUA 1G7MB 3WENA 1KC5H 3DYMA 5EC1A 1HINH 4X7TA 3QDHA 3RNKB 4U1MB 1CXIA 2X4UB 3PV7A 3NDZA 3OKOA 3PWUA 5CP3H 3TZVA 3C6SB 1Q6EA 3RM9A 4XMPL 2WQ8A 5C2UB 1T0MB 1JNJA 3RA7H 3QXDB 1EEZB 1U3ZA 5KS9A 1FFOA 1J12A 3ABZA 2C4XA 1WBXB 2VITA 1SHMA 4H0IA 2GCYA 2AGJL 3Q5OA 4RAHA 1SYTA 3JWOL 4V2XA 2Y36H 2N4IA 2BOBB 3A6CL 4D0BA 5JOPD 2NY4B 1FCCA 5HGHA 5JW5B 3HKFA 3WBEA 1CZ8H 2VNCA 4HH9A 2DLTA 1CGYA 2EABA 1E28B 5A6MA 4DGIL 5I15L 1FQ9C 2B0SL 1A6ZB 1VHPA 4EI6A 3O81A 4IS6A 1WO2A 4N0UE 1CBVH 1JTTA 4ETQB 3BDBA 4O58L 3VM5A 3TBWA 3MGOA 3TBVA 1GGBL 2C3VB