1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cyclodextrin glycosyltransferase
publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
5ENWA 3OWEA 1TG7A 2CK0H 3QAZC 5ESQA 4JJ5A 3IAPA 2VKXA 4QNPF 5DQJA 3RVXD 2ICWA 1F90L 1JPTH 5IWLC 3KPRD 4GG8A 1MLBB 4H88L 2FHBA 4WI6A 1HHGB 3ULSA 5E03A 3GM8A 2PW2A 4XHJD 4TXEA 1A0QH 1RHHA 2WMHA 2NR6D 5GIRA 4KQ4H 2X9WA 3WXWH 3C5SA 2BHUA 3GSXB 3L5IA 1NAMB 5T1KB 5I5RA 4PMRA 4N8VG 1QFOA 5EDXA 4HK3J 5EH1A 4S1SL 3DO7A 1WCBA 1A6AB 4NHUA 4NJ9H 2IQ9L 1MIEL 1UB5B 2E9BA 4UT7L 3F7RA 1RULL 4MXWL 2YL6A 3B2VH 4O4YH 5EZIL 4ELMF 3LEYL 1HH6A 3I50L 3AQUA 1G7QA 1UJ3B 2F8VA 4V2CB 1A4KB 3MOQA 4HOWA 1G7LB 1YN7B 1FIGL 1CG9B 4Z5RA 2J6EH 2FE0A 3FT4B 4DKAA 1OQOA 2CGRH 4X7TA 5DK2B 5DRNA 5IF0A 3FB7A 1UEMA 3KPQB 1ZBCA 3PL6A 5KS9A 3AHVA 4EE9A 4FZ8L 5A69A 2D3VA 1PKQB 5C9JB 1L4IA 2D31A 4LSUL 5FYJH 2GYSA 1KNOA 3N0PB 1UXWB 3FKUS 2KPNA 4KKBD 3QP3A 2VERN 1HKLH 3RWJB 5F6HI 3VD3A 1QFPA 1UYWH 1JFXA 2YDQA 4LF3A 2DQJH 1BQHA 3U0PB 4UQ9A 5EBLA 1H1NA 1QEWB 1KCSL 5I24A 4HU8A 4PTTB 5J6GA 1MQ8A 5DJZB 3CFIC 2VDNH 2DQXA 3VWJC 4UV7L 1UR2A 4JGJA 4QOKE 2EPMX 4N0UE 3L7FB 2H8PA 4NZJA 4TQEH 2A2QT 1ODZA 5C09A 4IOIB 1V3HA 4JL2A 5HHOB 2DQFB 1HNYA 5MP6L 4PN2A 4IRJC 3DURB 1FRGH 1RUML 3SCQA 1NMBH 2O26U 1CICC 1F4XH 4L3ED 4AIZB 5BV7C 2VWEC 1T5XA 5EU7E 4NKMB 1U8LA 4PRID 3G6JF 3C08L 1F8TH 2D7PA 3QFDB 4PS4H 1X5KA 4R97C 3RQ3A 4LXFA 2X1IA 3EOTH 5D5MF 3OPZL 2OYKA 3NCEB 5F7UA 5D2LF 1GGBH 5C0EB 3SJVA 4XWGL 4HZ6A 4DVBA 2WANA 3HRZA 2NTFB 4NRZA 4CVXA 2NY7H 1F3DJ 1S9VA 1LLOA 3TV8A 4KZEL 3BIKB 3PBGA 2I60H 2V7NA 3D4ZA 2NY1D 2R23B 1IAIH 1RFDH 4YGVA 2VZ3A 5JW3H 2Q87A 1MQQA 1RZIB 3U0WL 3ZSSA 2B39A 4XT1C 3KJ4C 3OX8A 2DWDA 1MH5B 3INUL 4D8PB 1T7ZA 5JXED 4RE2A 1ZA6B 1J8HB 4S10A 4L4TB 5FO8B 4XPFL 3PN8A 4LVOB 1DEEB 4MAUL 3NSNA 1FN4A 3O6LH 1LE5A 4G6AC 2QSTA 3U0TB 2EYSA 2HJLA 3OGRA 5IW1B 1CFVH 1RZJH 3EYSH 1KJVB 1AQHA 4U1MB 5A3HA 3M17A 2R69H 3V4PL 1MVUA 4PP2A 4Y19D 1S9XA 5I1LB 5A2LH 2EDQA 1U93A 3N12A 3V5DA 1U8IB 2Z8WC 2WCAA 4G42A 4PJDA 5TQ0H 2V17H 3QFJA 1KJ2A 3I9GL 4LKXA 5H2BB 1GUVA 4BELD 2CYGA 4A6YB 3WY1A 4BQ3A 3CFBA 3NGBB 3MACH 2MANA 3MREA 1HXYB 2JJUA 4I2XB 1U95A 3P9MB 3WHE1 5JNYA 4D9LH 1U8QB 4CMMA 5HTSA 3KPSD 1N5YH 2P8MA 1NLBH 1HNGA 3UP1A 1V7NL 1YNLL 1EHXA 2V5CA 3U7WH 4FXKB 2EC9U 1D5ZA 4I9WD 5IBTL 1MWOA 5DI8A 2D2OA 4YHKL 1G6VK 1OAXH 2F7OA 4M62H 3D69B 3DO3A 4RWYL 4FLRA 1F6FB 3PG2A 2AV7B 3O4LD 3W39B 3KWWB 4L9LA 4YPGA 2AJYH 1M05B 2QQNH 3IJYA 5EU6A 3WBEA 1GOGA 4AMXA 3RDTB 3BAIA 4HKZA 3BOVA 3MV01 3QUMH 5JBDA 2VE6B 3NCYS 5D7JB 4LVNC 2FHCA 1GZQA 2P5EB 2VXQH 3DSFL 4RNRA 4WHTB 4JDTH 5JUEH 3FQWB 3GO1L 4HUWA 4KH2A 2OYLA 4ZPTA 4PR5A 3N18A 2JCCF 4OZFB 3QZWB 4FLOA 3ZYJA 32C2A 4JPWL 4ZTOH 3FRUA 3IDIB 1P84J 1ND0A 3VSUA 3MRMA 3O6ML 1T03L 3QUYA 1JAKA 1R3JA 3TBSB 4MNKA 1NC4A 4X98B 1XGRB 4L8CB 1S46A 4Y1AB 4WNQA 4FNTA 1TFHA 1JRHH 2NX5A 4OFYA 4GW1B 4Y4FD 4UQ2B 3BPNB 5MI0B 3WQWA 1T1ZA 3AMLA 5HYJB 2WVTA 1ERNA 1UKTA 4N5ED 1QVOB 1OCWH 3WYRA 5M5DA 2OSXA 2ICES 3BKJH 4PJ9B 1OD7A 3RU8L 3BQUB 3KPMB 4NZTH 4QCFA 5D70L 4DCQB 1E1EA 3A6BH 1J1PH 2J8OA 43C9A 1G1CA 1J8HE 1QPKA 4L4TE 1RPQA 2R4RH 3S3PA 3VIPA 4L3CA 1TETH 3L5JA 2NW3A 2FYYB 2J5LC 4JG0L 1HCFX 2GJXA 4DGYL 1A21A 1HEZA 4YIQA 4NSBA 2NY5H 3MV9B 3S5ZA 1ED3A 3F58L 3CPUA 4MX7A 2YDRA 1QR4A 4K94L 2G3JA 4OUUA 1OW0C 2BV9A 1KTDB 3MLTB 4JQVC 1RIUH 3ILPB 3THML 4O2FB 4JFZL 3ZT5A 1G9NH 5K93A 3B5GA 4PJFF 2NXZD 2FB4L 4Z7VA 2D7QA 3T1WA 4M6OH 3SDAB 3A4WA 4V1DB 1E4WH 3BUIA 4ODSH 4Y19A 3CJJA 2B7DT 3QXAB 4PBWD 4XPBL 4JY4A 2FWOB 5FK9B 2VQ1B 4KRPD 4I2XE 5HGAB 2VRQA 1S7QB 1J9CT 5E2WH 3DHUA 4JM2B 4WV1C 3GMLB 1JE6A 5IMKA 2E8YA 1F5WA 4KK9D 3QUXA 4U5KA 3MV11 2R0KL 1ZT7A 4I0PA 1KF9B 1MFBH 4OFIA 3JWOL 2IPUG 3QDJD 3FO1A 2JLLA 4RIRA 1AO7D 3JUYA 3H3PH 3AUVA 3O2DA 2YWYA 4OI8A 3BGMA 1XH3B 2NY2B 1FZOB 3U1SL 2XPGB 3WUWA 2Q8BH 5GGRB 2E9IA 5ALBH 4BFIB 2R8SL 5EORH 1Z0MA 2OW7A 5TD4A 2COQA 5CZVL 4Z77A 4NJAH 4RGNC 3VXRB 4NWTL 5EZOH 5KVMC 1V7MH 3SO3B 1K9FA 1T0PB 4NO3A 3GNRA 4C83A 3O4LA 1GL4B 1GIGH 2RFXA 4BS0A 1CWVA 5HHMD 3H54A 1JNHA 4CD6A 2ZP0T 5AZ2H 3ZKMC 1KLGB 3QOMA 4LLQB 4DAGL 2XPKA 3DROB 2ZJSH 3FOMB 2VT0A 25C8L 1HJVA 3GBML 1KELH 5EB9A 2CDEB 4W81A 4KRUA 4Z18A 1UM5L 2H2PD 1F13A 2CDGA 3K2UH 1D5BA 3Q0HA 1GGIH 1RZFL 1S7UA 2EIZB 3MRQB 4PJEB 5JHDB 1I1XA 4HS6A 1F58L 2UVFA 4RGMB 5GJSH 4ZFOL 3RO8A 4U1SB 2BVYA 4JKWA 5DJDB 1T83A 1FNFA 3UPCA 4XP9H 4AENA 2PBGA 4KROB 4IDLA 3M07A 1HSBB 4WFEE 2J4WH 1MSPA 1XCWA 4Z7UA 1WT5C 3TGXA 4DGIH 3CXDL 2AGJH 1HI6A 1IEHA 1YEGL 4Y4FA 1TCRB 1K2DA 4WRLA 2R29H 3TCLB 5IXEA 1A7RL 4P4RA 4YXKL 2BERA 3GH5A 2OJZH 3HAEG 5T3ZL 1OPGH 3KL3A 1JWSB 3RHWF 3AIQA 2WBGA 3HG1B 3G6MA 3GXNA 3ARWA 1AQDB 4JN1L 1FYHB 1QI5A 5IEHB 2JIEA 5E8NA 1MCIA 1VA9A 1I3GL 3BUTA 2F2HA 4NDMB 5BXSA 3KPTA 5KAQF 1VJSA 4AD3A 3MV9E 1KWKA 2DI7A 2X4NB 1DSFL 4U1GC 4NRXA 1GQIA 2WNGA 3FNDA 1A6ZA 1YN6A 4MB4A 2N56A 4P9MH 3VRIB 2WIMA 5EC1A 4ELKA 1KACB 1KEML 4I48A 4WHCA 1OP5H 4WI5A 5T5NG 3WQ5A 4QRPA 1XF5A 5HYQB 4CD7A 1ODAA 3BAEH 2HH0H 3WQ8A 1VBUA 2HLAA 4W7WA 1JL8A 1FNEA 4PJ7F 1E40A 5KVEL 1FJ1B 4FXGA 3SCMC 1E6SM 4KUZH 3DUHA 3GKWL 2WVUA 4PJBE 1XGYH 1RJLB 1N2RB 4JHWH 1G7MB 5I1AA 1XGZA 3VSVA 1N64H 5I18L 1MWAA 4R26L 4F9PC 3ES6B 5GSRB 4HUVA 1LEGA 3I6KB 5BQ7B 3LEXA 2CMRH 1CD8A 4JY5L 1JHKH 2OX5A 2DH2A 5I8KL 2IPKA 2CD0A 5EIVA 4KJPC 4F8XA 2AQ3A 2FEEL 1XSIA 1JFHA 3PF2A 2J75A 4D6GA 5M95B 1DUZB 1NSNL 3CFDB 3PHOA 3SO5A 3VXUE 1WAAF 1QSEE 5KVGL 2HVMA 4BM7A 4LCWD 4M7JL 3IJSA 2H32A 1OP3H 2P46B 5D71H 2C4FT 2VLLB 2CNCA 4HGKC 4EKXA 4Y7MA 3SCWA 4HC1L 3AI0A 3AY4A 2VLJA 4DJMA 1UENA 5IVOA 3QDMA 1EX0A 1FYTA 1IEBA 5GGTH 4POZD 5SX5H 4AL8L 4W84A 2VH5H 1CGSH 2VDQH 3MJ9L 3HB3D 4JHZA 4ZTPH 4KJYB 3T2QA 1FZMA 5K59E 1LL6A 5D72H 2Z91A 1SR0A 2Z92B 4WW1A 4HWEH 2W60A 1IC7L 2VUOA 3MRHA 4U49A 5F44A 4ZUSB 4GRMB 5JHDE 3VFSA 4NQCB 2X5PA 1OIFA 2GK1B 1AXTL 5F7LB 2ZUSA 1T22A 5IP4A 5DHVB 1TQTA 1XF1A 2UWEF 1HCVA 3UPAA 2BNQE 1CGUA 2AJXL 4GKNB 4KK6C 1NCAH 3G5ZB 1JGLL 4LLAA 4KMTL 1TZGL 5AZEL 3BAKA 1LO0L 3JV4B 2EIBA 4P5KA 3MCLL 2DGAA 4GLRH 1YQVL 4HWNA 1XZ0B 1H15A 5FYJE 2WB5A 2YL9A 1WSST 1CPUA 2X4TB 2MNUA 1AI1H 2W0FA 4NFCA 3X13B 1MI5D 4KJQD 5KG9B 3BVVA 5E0QA 2O9TA 1JPGB 3PL6C 3P4OB 5IESH 3MGOB 5C0IB 4UOZA 4L8SB 1IC4L 3HG1E 4I0KA 4KI5F 5F9WC 1JWUA 2HJFB 1G9EA 1ITBB 2WMFA 4EUPB 3L4WA 5LXGH 3WF1A 3FN0H 1KXQA 5FM8A 2F54B 1H2JA 1A9EB 5A2IH 5LGJB 3MO1B 2OZ4L 1AGEA 4RX4D 2B8OT 3KJ6H 1EUUA 4XP5H 5HGBA 2BFVL 4NNPL 4FQ2H 3GDBA 4XP6H 3U6RA 4X6CE 3VFWA 2XZAL 1CYGA 4FNQA 4LLVB 2EDFA 2QR0B 2XFXB 4KK5D 1FL3A 3HMCA 3GSVA 5DD6A 1S7RA 3I75A 3LX9A 1YYLL 1HINH 2I25N 3RILA 1I7TB 3GMMB 5LQBH 2BVOB 5J6HB 1I8MB 5DMKA 3AYSA 4PRNA 4P2QA 4W85A 2HT2C 2V7HB 4X0KB 1MFDH 1BZ9A 3QQ9D 3LV3A 2R56L 4YPJA 4QP0A 4LYQA 1HTYA 3SQOL 1ZLVK 3W11C 3QIWB 3D0VB 4JDZB 4U6VH 3Q3GB 4DKEH 2FHFA 3H55A 1OF2B 4X9HA 1DWGM 3WE6B 1C3FA 2QTEA 2DPEA 1ZU8A 1FDLH 1YEFL 1KPVB 1J05B 1Q1JL 1CXKA 1XYFA 4D3CL 1U91A 3D3VA 2UY3A 3T77B 2DBLH 5D9OA 4PRDA 2YLAA 1BOGA 3BFOA 3P40A 4NQTA 1IGTB 5K9OB 4Z9KB 3DX7B 2YA0A 5DWUL 3THCA 5GS3A 1FHGA 3MJ6A 4EIZC 4LP4A 4X6BA 1N3NB 3QHZL 3FCTA 4F37K 3MRPA 3FL7A 4N9OB 4OD3L 5DMIL 4MQXD 3R06A 4HIHA 4HOZA 1UWRA 1OAKL 3QUZB 5D1ZA 5HVHB 4K3EH 1FFPA 3BKML 3HMWH 3BH9B 2BC4A 3DHJA 5E8EB 5GGRY 2J74A 3WENA 4ETQA 1HKKA 2X9YA 2NY6D 4OZIA 2F8OA 4X5WA 3PP4L 3QRGL 1EO8L 3TIDB 2QQKL 3X17A 1DEDA 5HHQA 5CUSH 5ICXA 5KJRL 2B1AL 3KLHD 3LKOB 4HIJB 2HT3D 3BP4A 2DLGA 4KGJA 5JXAL 1S7TB 5DS8B 5MEND 4OV5B 1KN2H 4QRTB 4E41B 1V3MA 1MHHB 4MNQA 2WWCA 1OAUL 3CIQA 1NLDL 3GIVB 3RRQA 2E9MA 1QKZH 5LGKA 1RURH 4JHAL 4PV9A 3MU7A 2LAAA 4FFYL 4L8DA 2I07A 5A43C 5JDSB 2OL3H 5FF6A 3W6MA 3RZCD 4FOMA 4AZ7A 4XI5C 2H6PA 5T1LB 2XXMB 4RZCA 1QPXA 4NQDA 3MLWL 2J7CA 1JPFA 5CS7A 3ULUF 4TUOA 1UH3A 3CX2A 3O2WH 3L2MA 4DKDC 2APVA 2NY4B 4DZBA 2AJUL 3SDXE 1C1EH 4AZCA 3EGSB 4G6JL 4H8UA 1B1YA 4YDLC 4L4VA 4O2EB 1PQZA 2F54E 4GQQA 4PGEA 3GBNH 4FTVD 3GMRB 3UBXI 2NY3D 5DD3L 3FT2B 2PWDA 1A2YB 1RV6X 1QRNB 2FX9H 1FFRA 4UQCA 3HC4L 5DT1L 3X14B 1KTBA 3BDBA 1HOCB 2B1HH 4RX4A 2DS4A 2GKIA 3G5VA 2C1OB 4Z95H 3CZSA 3U9PL 5AG9A 3QXDB 1B0WA 2IFFH 5JMOC 5AC4A 5TGBA 1OBAA 2F1BA 5IG7B 1IL1B 1CF8L 3SGEH 4Y5XA 2YC1A 3V52H 2QADC 3QG6B 1AFVH 2DKSA 1KENH 4MJIE 4PB9L 2XWEA 4YBQD 3QUYC 3MXVH 1KYOJ 3VMPA 1LQ0A 1ZANL 4IRSB 4LFHG 2V5RA 4PB0L 3AU1B 5F1NA 4PJIE 3RGVD 2DQIL 1KIPB 4GS7C 4GMTL 5D1XA 1HKFA 4Y2OA 3S5LB 1UM6H 4WI3A 3NCJL 3GHEH 1TVHA 4QRSB 1U3HD 5T3ZD 5DURB 1ZHBB 4NRYB 4GZEA 5KANI 4EBQL 4UNUA 1HHHA 1D5IL 4C7FA 4RFOL 1UQZA 2R9HD 3ROLB 2HN7A 5CGYC 2WM0A 3T0EA 2YBRA 5E94B 3EZJB 2XIBA 3MYJA 3CZKA 4RA3A 5EN2A 3V2AR 1K6QL 1Y18A 5I1KH 5FL1A 2ICCA 1AGDB 5E00B 3GXTA 4Y7EA 2NW0A 1Q9KA 1BTCA 4OLYL 4XB3A 4U33A 3HFML 1TPXC 1QOKA 3SUVA 2CQVA 5KW9H 1ZHNB 2YPLB 4B7IA 3FFCE 2E7CA 1RUPL 4APQA 1OAQL 3H9SD 4W7VA 1WEJL 5A6KA 4LCYA 4UIMA 1E28A 3LRGA 3OV6A 5JIKA 1QYGL 5MENA 3WD3A 5F7YC 2BCKB 4PTVA 3IDMB 4C56E 1UCTA 3OLGA 35C8H 5DFWH 4ZAKB 1NEZA 4J7RA 1HN1A 5IM7B 1BVLA 4NO5A 3O3EA 2IBZX 1KJ3H 3RZCA 5A6BD 3N15A 3V0VA 3QUXC 4K9EH 4KKAC 5DEGB 4I0PC 3LKRA 4WJ5B 3UEZA 3D3AA 3B9AA 2WKGA 3RM4A 1I7ZB 2ZCHL 2F58L 1W1PA 2BSED 1P7QD 2VN4A 4ODTL 1UKSA 3EDEA 2Y5TA 3ALFA 1DWJM 2FBJH 1E9LA 4CNIB 1NGZA 5CJQH 1ETZA 5JQ6H 5ISZD 3LQZB 4L4JA 5C08D 4RGOH 5LGHL 3BWAB 3RP1A 4U1IA 3D85A 4JFDD 2AP2A 3MUZ1 4FTVA 3UMTA 5AUMB 1TUXA 3IXTB 3HZKA 2JEPA 2D3NA 3MRLA 4NN5B 4X7EC 4YE4H 5F88A 5BVPH 3S6TA 4FQIH 4LLWA 1UADC 4PRHA 1RD6A 4XPHL 2FJFB 3SCOA 4QRRA 5E2UH 4JVUA 3KS0J 3DXAD 4XVTL 1E72M 2WC7A 5EZJB 3ARUA 3QCTL 4OKVA 3WMCA 4KVNL 3ULVC 2PWEA 1BFSA 1KCRH 4HHAA 1GOQA 3GBDA 3W0WA 5J11C 4ZFOA 2Z35B 3CX5K 1T83C 3QEQD 1CEOA 5I1GL 1S7VB 1I8KB 2Y36L 4RDQG 4N90E 1OIMA 2DQHL 5DO8A 3GJFK 4X7DC 2JELH 2FEEI 4XNXH 1CFQB 3GK8L 4X99B 1R5WA 4WCYL 3ZJKA 3VGEA 1MW0A 1M6OB 5T1DH 3BW9A 5IEKB 4NN7C 2PTTB 1CDHA 3RWFA 1HYSC 1IZJA 3ARFB 3MRGA 1VSCA 1R5IB 2J3SA 4Q6YA 1JXKA 1YYMH 3N1AA 4CVWA 3QO1B 2BVQA 2AXJA 1MJ8H 1BYAA 3ZYOA 2CKBB 2IAND 5GGVH 2X4UA 4G43B 4P2OB 4B9YA 1B2WL 3DIFA 1KN4L 4G9FE 2HYMA 5I1JL 2ZUVA 1OGAB 4YBLC 1FFOA 3EBVA 3C8KA 3LRLA 1A6WL 1T1YB 4HJJH 3AISA 2A6JB 2BVEA 4JZOA 2DLFL 1FP8A 3WSQH 4XBPB 1HKMA 3FO9A 3RAJL 4E8CA 5HI4D 1HHJB 2EZ0C 3BGFC 2W61A 5FHBH 4H1LB 1I7RB 3QDGB 2DQGH 3BD5A 2GFBB 4F2MA 43CAA 3QA3B 3RWGA 3F4VA 3WUBA 1BD2D 3MLPA 3S88L 3ZJ7A 2J8UB 1R3IH 1TZHA 2AJ3A 5E5RB 4ZO8A 1RZKL 3CFKB 2YS4A 2D1ZA 4X83A 5E0CA 2W9EL 4G5ZL 4YHYB 1FO0A 3VFVB 5A8PA 2AK4D 3ZKQD 2PB1A 3IJ9A 1IEAB 3MO4A 3BSZL 4LLDB 1MQKH 3G6DH 4ZDHA 2BSRB 4IHOB 5IVXA 2DBJA 1QFWI 2R1XB 2I5YH 3KG5A 3D39E 1A6TB 2SEBB 1XRVA 1JYWA 1CLVA 3UEQA 4PMOA 5A3IC 2HWZH 5C8JA 3SKJH 1TQVA 4JO3L 1FNLA 3RL2B 3B43A 3QEHA 4P7RA 3I6GA 1P7QA 5AYUL 3MMUA 3GSRB 2ADGA 5CD5D 1I1WA 2G9HB 3BZDA 3AY4C 3C60B 2NXYB 2XA8L 4M43L 4HC1A 5HI5D 4PREA 1NKOA 2OBGA 3MV8A 3CHCA 4C54A 1AMYA 2YDSA 1GAFL 1I3RB 2DQEL 4P46A 4JFDA 3X3FL 3MV7A 2EECA 4J1UA 1CZ8L 5GS0D 2ED9A 1TENA 5C0BB 2HISA 1OWQA 1A7PL 3SGJC 4HP5A 4OZGA 4JM4L 4M56A 1WCGA 3TO4A 5C70A 4DFHA 4F7PA 1E6PA 15C8H 3GHBH 4U2YA 1IGYB 1W72B 5AD0B 1N4XL 1U58A 1F6AB 4LMQE 3IU3A 3H9YA 4CU7A 2P8LA 3TWCL 4ELMA 4ZFGL 2ZE0A 3EDJA 4NX0A 4FQLL 3UTTD 4N8CL 4ZPVB 1UG6A 1YMMD 2ZUYA 4DW2L 2VVNA 3LH2H 4KDVA 2KQNA 2VC2H 4L8BA 5EUKB 3DV6B 4M5YH 3REVB 3VNZA 5JIWA 4YDVB 1NJ9B 2UY6A 3W28A 1G6RB 4QHMA 4XPGH 4WJXA 4MMZC 1H0DA 1XMWA 4F7CB 5BOPA 3UYRH 3TZVD 3GJFA 3AREA 1B2YA 1V0KA 3V7AG 2R2HB 1LO4L 1S5HB 2JTDA 1QNOA 2CERA 2VLRB 1LO2H 4D9RE 5IJKA 5L2KE 1MOEA 1OGAE 5F89A 4H26A 4LSSL 4W93A 3ARGB 5C07D 1LO3H 1KTKE 2XG4A 5IFAL 4IPLA 1M1SA 2OZ4A 1BJMA 4PBVC 3WIIH 1BAFH 3V6OA 2O5ZL 3WKMH 3FTGA 2AVGA 1PVHA 4KTDL 4QHLB 2VZSA 5DJAA 3UO1L 4F9DA 3EJSA 4PJ5E 2YWZA 2J8UE 4HBQA 5FECA 1AIFB 4JR9L 4J3TA 3STZA 2F9BT 3TA3A 5E9DD 1Q0XH 3GUTA 3RA7L 4N0FA 2DT3A 4XV0A 3H9HB 1UA7A 5KSAD 1TJGH 3VFOB 2FJGB 3I02B 4EI6A 1H5VA 3C9NB 1BD2A 1ZAGA 4JZJA 5E8DL 3DMMA 3CVIH 5CZXC 3T0WA 4PMUA 4ZXBD 1UKQA 3B6SA 3FOLB 2MWCA 5BS0D 1AGFB 3SHSA 3N1PC 3EW3B 2E6JA 4MXQD 2PUQT 5I6XB 4MSWA 1X5GA 3P0GB 3WUEA 4N0YH 4JFFE 3BEWA 3G6JA 4G8GB 3MOBL 4F7EB 4YEEA 1WC7B 4RQQA 1C90A 4ZUWB 2D7NA 4LVHC 4LQFH 3C2SA 3SDCD 3PP3H 2GJZA 5ACLA 5D5MA 3WMBA 4P3CH 2VDKH 1ZB5A 3OIHA 4GBXB 4S3KA 3EMCA 4ZFFA 2IG2H 4QRUA 1RJYA 2EEXA 4NO0D 1F11B 5IQ7H 1MRFH 2N7AA 3TBYA 1ZOXA 2QEJA 5D1ZC 1IGIH 4WUKH 5C3TA 2FEDD 2ATPB 5C0BE 2Q8XA 3PWPB 5DLML 3ORJA 3MTRA 5ANMB 1E43A 4HPYH 1O5DT 1D5MB 1OSEA 2XWBB 4U1JB 3TV3H 4Z7QE 1I8IB 3P4MA 3OGOE 3PZVA 1HILB 4DWSA 3VCLB 2EQDA 1D7FA 2Z4QB 4RMUA 2MKLC 3X12A 6TAAA 3V8CA 2DWEB 1HJXA 4JRXB 5TFSL 4YQXL 4MJ5B 4Q58C 2ZX9A 5HPCA 4AZ8A 2YD3A 2OJEA 4R0LB 4OZ4A 4JFTA 1S9YB 4DM2A 1JK8B 1G7PB 4PJEF 4WUUE 3O3UN 4Q9BA 3ZL4H 3T0AA 4P48A 2IF7A 5ACMA 5FUZL 2FJHB 4QLJA 4TOYH 2XG9A 1EGZA 1W9VA 2Y07L 2BJMH 2CO6B 3OJDB 1WBZB 3TBVB 5L7XL 3MNZB 4U6XB 2XN9D 5D7IB 5FYKU 4YHZL 3WIHA 3WNOA 3SCRA 3B9KB 3C09C 3TO2A 4LIQH 3MLYL 1E6RA 3ULUL 1P53A 5JOPD 4CADA 3L9RB 4R4BB 2XG5A 1U8JB 3EAKA 3REWA 2E6QA 4S1QH 2CRMA 1IGJB 4NC0B 1PYWA 2XTLA 2EADA 2G2RB 4QGYA 1V5JA 3S36L 3QIBD 5AC5A 4P9HH 1KCLA 1FZKA 1BPLB 4GO9A 3T2NL 2XWJB 3V5HA 1T0NA 2F53B 1S8DB 5BZDB 5I76B 7FABL 1A6UL 1NFDE 4KKCD 4FQJH 5EUOB 2HJKB 3TVMA 1EGJL 4D0CA 1SJEB 1QPPA 1KBBA 1T80A 1HHIB 5KAQG 1KYOK 4P4KB 1X3DA 4U31A 2J7DA 2FATL 2A0LD 1M7DB 3BH8B 3C5ZA 3NOIA 5CCKL 1WZKA 4Y5XC 3HUJA 1OD0A 5HHXL 1LK3H 2EBNA 2Z31B 5LCVH 3HMXA 5EA0L 1HX0A 4PTMA 3VFNB 1YEHL 1MWAH 2XVKA 2DYPA 3WH7A 4FG6C 3D5HA 1UWXK 1J86A 4L5FH 5FOBA 4JKPL 3RPMA 1RK0A 3ARBA 2J62A 1TA3A 4ZXBA 5MEPA 3PWUA 2EPKX 4G8FA 4I3SL 4IEFB 2C5DC 2PO6A 3BXWA 1MRCL 4UDUB 4ODHL 1A47A 1K8DA 2GY5A 5D1XC 1WTLA 1G0CA 4TUJA 5CINL 3WEXB 3WFHA 1N5AA 4ACPA 2XACC 1NCCH 1WIPA 3MFFB 5IMLB 2YEZA 4H88H 1J11A 4B50A 4M02A 4XWOC 1EFXB 1GPOL 2QMKA 1F4AA 2YXFA 2JF7A 4BSVA 4X6DE 2V9QA 5C86A 2Y23A 1DDHB 4PP1C 2VABB 4XNMB 3EFDL 3PWPE 5DUBA 2IAMD 3T0EC 1BIIB 4FABL 4NP4H 5IBLD 2BXZA 2X2HA 1UZ1A 3EOBB 2ADJA 5B8CB 5HD8C 1JDDA 1NAML 2BX5A 4OLVL 4NNYB 4AEFA 1FBIL 2CLRB 3S4SA 3OQ3B 4HV8A 4S1SH 1OTUC 5JW5B 2ARJA 2AJVL 2I24N 3U4AA 1CECA 1PZ5B 4JRXE 2IQ9H 1MIEH 2NY6C 5EO9A 4YXLL 3GIZL 5I0DA 3MRNB 3BN9C 1XR9B 4UT7H 1RULH 5ALCH 4APQC 4NPYA 5EZIH 3LEYH 4YFDB 2YSSA 1FL5B 2VX6A 1J8KA 3OGCA 2FGWH 3M1BA 5GZNC 2HG5A 5JR1L 4XCFH 1XCTA 1JWMA 1QP1A 5DHXB 5FIEA 3W81A 5C2UB 4YEFA 1MCFA 4NQEB 3ME0A 2Z8SA 1GZPA 1EO7A 4P2RB 4X4YB 3S2CA 4F58L 3II1A 1DQQA 1XAUA 1SBBA 1FNAA 4UOW0 4IRZL 3BT2L 2YKKA 4GRLD 1NDMB 5FO9B 4PBXA 1MF2L 4LSUH 1MCRA 3JWOC 4Z6AT 1XH2A 2DSVA 4MCZA 4PJAE 3NFNA 5SWQB 1FFNA 5J1AA 3L3DA 2CKNA 4DEPB 1M71A 1JHTA 3HPJB 4P8UA 1NCWH 3IDJA 4OLUL 2YN3A 1VFBA 4PGCA 1I3UA 1B0RB 2HP4A 4U0RC 1KQZA 1JDCA 5DUPL 5ICZA 4U2ZA 3P73A 2XT1B 3BI9X 2Z93B 3FONA 1UWQA 1ORQA 4HQQL 3MROA 2XIDA 1MXDA 1U2HA 1VFFA 1M7IB 4UFKA 4PYHA 3UTQB 3GSNA 1EEYA 2XTJD 4FQCL 1CE6A 3BP5A 3RX7A 3QUKB 1N7MH 3LPWA 4NIKB 1UXSA 5FDWB 3ZHDA 4UDTB 4MZ2A 1E15A 3EHBC 4PJCA 1RUMH 3PQYD 4LEXL 1Z0NA 2W91A 3QPQD 3J8F7 4U5IA 5JW4N 3CZFB 1I1CA 4G80A 1SHMA 3CPLA 4FFZL 4K71C 4O51B 3UTSB 3VIGA 4QF1B 2EPOA 1BJ1J 4D71A 4JREC 3KYNA 3BVWA 3ALWA 1KLFA 3C08H 4QHNA 1WFOA 3CSYA 4G9DA 4MGXA 5K9QI 3L4VA 2ZOKB 4PJ8B 4WSKA 3QHOA 4QY8A 2Q76B 2NZ9C 3KPRE 5ADOH 1H09A 4MXVE 4RMSA 3T4AA 5IHBA 5ERWB 4XWGH 3V95A 1IAMA 4RFNB 5EBMA 1FG2A 4R4NC 4JANA 2GTZB 4KZEH 1KPUA 4XCYA 4S3JA 3QHMA 1YUHB 4JO2H 5EOQL 1X5FA 4Z2GA 1LK2A 4LAQL 1LWHA 4HKBA 5DEZA 1C91A 3INUH 2E3ZA 2CXKA 4HGMA 1IGFL 5IMMA 3IGAB 4L1HA 4MAUH 1OTTD 4CCDA 9CGTA 3CC5B 3K80A 4MYWB 3TNNB 3VGFA 1NFIB 5SV3A 1LNUA 1W9BM 3V4PH 5JORB 2VKWA 3OZOA 3JV5A 5IB4B 1BJ8A 4Z2JA 3RWEA 5A6LA 4NQEE 5IHZA 3D25B 2GSIB 2HA1A 3LVEA 4V28A 1IKFL 4PJ7A 5KSBB 1E0OB 3L3OA 2FO4B 3GRWL 2XGBA 1HJWA 1B4JL 1GYAA 4Q2ZB 5HHNA 1YY8A 3SGDI 4A6YL 2VXSL 4MQ7A 3QQ3A 1I1FA 2WXDM 1L7TL 3R8QA 1HQ4A 1UR9A 3H53A 1F45A 4U0QB 4HIEA 4PY7B 4MADA 5I75C 1FQ9C 1R85A 3SCPA 1CFNA 4H25B 1V7NH 4ZSOE 1YNLH 2E0PA 2EKJA 5DQ9A 2DH3A 1HXMA 2LTQB 4JY6A 4JCMA 5C0ND 3CDFA 4YHKH 1NBVL 4ODXA 5H35B 4NUGL 3VDHA 1CE1L 4AQ1B 4RWYH 2A73B 2ZOLA 4RCAA 3E0GA 4YZFE 1T7VA 5B4MC 3E1F1 1GVYA 4HFUL 7A3HA 4PTXA 4N9GA 1UZ6E 2EE3A 2WHJA 4P46C 1LILA 1EOKA 5DEFB 2FR4A 5EU3A 3C5JB 5CEYA 3O8XD 4XB7A 4A2MA 2QQQA 4QHUA 2XKNB 3DSFH 2XQBH 1CR9L 3TO4C 3GO1H 3IFPA 3DX6A 2WAHA 4JPWH 1WDPA 3FXYA 2P8PA 1XGTB 4L3EE 4PMYA 4MNGB 1A7OL 3UTSE 4XNYL 1E27B 3DI2B 4J3SA 4PRIE 1NL0H 4LSDA 1IC5L 3BUYA 1YPZE 3QI9A 4JAMA 2BSSA 3MQIA 1XR8B 1CGTA 1LEIB 1X6LA 5D4QA 3T1FB 1T0OA 3AROA 2L0DA 5AYQA 4D0DA 3B4NA 4M9PA 3ULUD 5TDPA 3NSMA 1IZKA 2OTWB 2WWKT 3QH3A 1IMHC 4NRRA 1CD1B 1U8HA 3AREC 4HS8L 1BFOA 5J3HC 1DZBA 4JFHE 3RNQA 4R3SB 3BSGA 3GH7A 1J1OH 5HVWA 1UD6A 2R2BB 5HHPA 1RJZB 5IJKC 3AZRA 3D52A 3CU7A 1X5XA 2C1PB 3FQUB 2EYTA 4RAUB 4DZ8A 2ARWA 2WW8A 5CEXA 1NGXA 3SE4A 4MD4A 3G6AA 3QT2A 3DGGA 3OR7A 4P5TA 4BZ2L 1JGIA 3V6OC 1DP0A 1GORA 4JG0H 5DFVD 1VACA 4DGYH 1R3KB 1XF2B 1R75A 3PTKA 1ZSDA 3F58H 5GS1A 4CVZA 4K94H 3IKCB 3OKNB 1TQSA 3JSSA 3THMH 5ID0A 4LGRB 4JFZH 3VGGA 5ECUA 4UAOC 2AOSA 3PTMA 3TA3C 2X1PA 4JN2A 5EU4B 2WMIB 4XZBA 2V2XA 1EXUB 4X6EB 4ZFZA 3O6FB 1MW2A 3SKNB 1WZMA 3RVTD 4Y4HB 4JZJC 7CGTA 3VRLF 3DMMC 3PV6B 5I1DA 1HXKA 5A40E 4Y5YA 1GGUA 2APTA 2IH1B 3KLAA 3V0WL 3BZFA 5IK3A 3TTYA 4UTAL 1M03A 5CD3B 3TYFA 2J2ZA 5D93B 1Q0YL 5EU5A 1MQRA 3KPSE 4P57A 4QEGA 2R0KH 1R5VA 4DN3L 2CK0L 1AP2A 3BWUC 1GRWA 5DVKA 3H7BB 5DO2D 4QKXB 4F9JA 5EO0A 1Y6NR 4I9WE 1D5XB 4JFXA 5JZ7C 3MNVB 3U1SH 3POCA 4NOFA 5E8OA 3O4LE 1ZHKA 2R8SH 3WF4A 4DQOH 1QUNA 4OZHB 4KQ4L 5DJXB 5CZVH 5F9DC 4NFBA 5T1KD 3CZLA 4K7PH 1DQLL 2VR5A 1UT9A 2BXYA 3CMOL 4NWTH 1HIMH 5BVJB 5EMYA 5BXTA 2JB6A 2EE2A 4S2SB 4EI5A 2WZHA 1CENA 5E6IB 4Q9RL 2VITA 5HHMB 4BJLA 4F33B 1KWGA 5E1AA 3AS3A 1IT0A 3PJSA 4NJ9L 3QNXA 4DWSC 4DAGH 4JRYB 1BBDH 1GOMA 3WS6A 25C8H 2V2WA 3HZVA 3ZKSD 3GBMH 4EQ3A 4CL7A 1X1NA 3B2VL 3G04A 1UZ8A 3TIEA 2Y72A 1LJYA 4AQOA 4UI2A 3NABH 3DRQA 1RZFH 2MOVA 1XIWB 3B8SA 4JHOA 4MPKA 4HLZH 3SE8H 1PZ2A 5I1HL 4FLQA 1N8ZB 2J6EL 1MCOL 3JWDL 4PUEA 3IJHB 4ZQKA 4P23C 4LIQE 2DQUH 1NBYB 3MBXL 5DJ0B 3RPIA 5LA2A 2ZKHL 2RCSH 3CXDH 3DVGA 5F1KC 3TPUA 1JGDB 3NACL 2AV1B 4U1LA 1YEGH 2O5XL 4XMLH 5FYJL 1KQYA 3HE6B 1A7RH 3LS4L 1IM9B 1I1AA 5T3ZH 2AEIT 2X89D 3GMOB 5TDNA 1HKLL 5CP7B 1SBSL 3K81A 3DBXB 3MRCB 4JN1H 4F66A 4GRWH 1ZV5A 4GKSA 4X7FC 2F61A 3ZT6A 1I3GH 3BZ4B 3KDMB 5DMGD 3LHPL 4R7DA 5CBEB 4UZUA 2DTMH 4X0VA 2BRRL 3FFDA 3TVMC 1KGXA 1KEMH 1I8LA 1U8PB 1UR8A 2NLJB 3QCUL 1EGJA 1UQSB 1AGBA 2LFGA 5FUOL 4UQ3A 3WN5B 3SE9L 4YK4B 1RZGB 5I1IH 1CLXA 4ACZA 2Y4SA 3C5ZC 5HHOD 2J8UF 4LAJH 3IETA 2HRPL 2CUMA 5KVEH 2CLZB 1NMBL 3GKWH 3WUZA 3DX8A 5ILTH 4H5SA 4QOKA 2D0FA 5F96L 4N0UA 2A3HA 5EFIA 2A3AA 8FABA 5I18H 1V8HA 4R26H 3IAQA 5FAAA 2FD6L 3UESA 1F8TL 4PGDA 2OR9H 3ARBC 1H3GA 1QHZA 4PSRA 1C12A 1BFTA 1P4IH 3CHDA 3QDJE 3HAEB 5TE4L 3EOTL 1AO7E 1QI4A 2PO6C 2EDKA 5I8KH 5E0FA 3GZKA 3QAZB 5ID1A 4PG9A 2BHZA 3A0OA 1V6VA 2X2YA 1NEZG 3LKPB 3PTQA 1A4JB 2Q20A 1XGPB 1NGPL 1NSNH 2X4OB 4NZRL 5C8BB 4TNVK 5DJYB 5I30L 1W8OA 3PHQB 5KVGH 4OZHE 2KH2B 5DVMA 3UTPD 3WIFB 4M7JH 1IAIM 5I73C 1EEZB 1VPOL 5ABDE 1IAIL 1RFDL 4JPVH 4HIXL 1HHGA 1GOKA 1IQDA 4AD0A 5JW4M 4WHDA 4W4NA 3DX3A 1I1YA 5HHME 2OYPA 1NGQL 2BRQA 1J8HD 1S7WB 3GSXA 3PZIA 3L7EB 1HH9B 4ONGH 3MJ9H 3LMJL 2PTVA 2MMXA 1CTOA 5C0FB 5EOCH 1JGEB 5ESAA 5H8DA 1JF1A 1DFBL 3OG6B 2NTSP 4Z7QF 4FZEL 3H6JA 1CFVL 5IV2A 1A6AA 1IC7H 2VDOL 4BYHA 3IYLW 2ITCB 1LF1A 1AXTH 5JA9A 4R2GC 4XGZA 3OKMB 5FV1L 4WSJA 5IOPA 5DDHB 5TQ0L 2V17L 2X70B 5E4IA 2QF8A 5F7EH 1G7LA 2V9RA 4OZFG 5DD0L 1TZGH 1YN7A 5AZEH 1BLNA 1LO0H 2X4RB 4P8VA 3MCLH 1YQVH 3DX9A 4OCSL 4JFOA 4CJ1A 4NNXB 1KIRB 3FT4A 2OR8A 2EEBA 2ZIDA 3KXFD 3STBA 4D9LL 1UD3A 5DK2A 1R0AH 2XWDA 4N1HB 2ZXDA 5FGRA 1N5YL 1NLBL 4FQXA 5DTFB 4NBZB 4LBEB 3BXNB 1QFWH 5C9JA 1R3HB 1E4XL 1QLEH 2OMBA 3RUGB 3BHBB 1DN2A 1OAXL 5E24E 3F7PC 1JF5A 3MRRB 3QNZA 2X89A 4P7OA 2E9JA 3S34L 4NNPH 3VGBA 3DPBA 5A94A 3F6IA 5D1QB 3U0PA 3RDTD 4JZNB 2ZWLT 1NFDF 4P3DA 5EPMB 2XWTB 5D7JD 4Z0BL 1ZBKA 3VWJB 2Q6WB 3AICA 4P99A 1EJOL 2VL5B 2P5ED 1CTNA 1YYLH 3ABZA 5BZWA 1Q6GA 4Y2DA 4M1CC 3JV6A 3L2LA 4Q0XL 2BOCB 5SWZB 4ZTOL 1QBLL 4P5MB 1DLHA 2R56H 3L7FA 2AABL 5B39G 4GUPB 3N1GC 1E73M 3SQOH 3T65B 1K4DA 1CICB 3RKPA 3IVKB 5BV7B 2XIIA 5ICYB 4MWFA 3DURA 1W0VB 4Y1AD 4P3WA 3QO0B 3IDNB 3OR6B 5GXBB 3WNNA 2WMGA 1U8NA 1G84A 5IMOB 1JZ4A 1X5AA 3X11B 4GI6A 4WW2A 1Q1JH 5DQDL 5HYJD 1JPSL 3WHXB 1HF6A 2ORBH 4G3YL 4D6DA 4CU8A 2GTWB 2QPUA 2IMNA 1TQBC 4HUXB 4LCWE 2HMID 3RX5A 3ECQA 4PJ9D 3O11B 4UT9L 5DWUH 3BQUD 2Y5EA 1AR1D 2ERJB 4NZTL 2NW2A 2DSUA 1X4YA 3QULA 3FRPA 3VXOB 5DMIH 5D8WA 2VR9A 4U6YA 1BM3H 2R23A 4ZNCD 4X6DF 4GW4B 3FB8B 1QBML 3VH8A 3QXWA 1UWTA 3IK2A 5D9MA 4D8PA 1EO8H 2X9XA 2O9RA 5CWSB 2QQKH 1MJJB 1J8HA 2YZ1A 4NHCH 4L4TA 1L0QA 5GS0H 1P1ZA 5KJRH 1U0QA 3PGDB 5JXAH 3AZSA 2MQ3A 4HPOL 5C0GB 1UC6A 2WBWB 3BKCL 3U0TA 5GRJL 3DETC 4N1CA 1KXVC 1OAUH 3P0YH 4HTYA 3SDAD 1NLDH 4R96A 2JJTA 1GGYA 4V1DD 3LD8C 1K5NB 1E4WL 4JHAH 3L95A 4UINH 3B3IB 3VFMB 1BP3B 4FFYH 2ESVB 2AK1L 1JFQH 1BF8A 1BYCA 2JJSA 5D7IF 4W5UA 4JM2D 3V6ZB 4PLKD 3PGCB 1I1RA 1IGML 1MI5E 3MLWH 1XSJA 3MX0A 1W9UA 1OTSD 4A6YA 3L3IA 4NWUL 1BGXH 2F18A 1V05A 1OGGA 1E4IA 1GQJA 1E6QM 3DX4A 3SY0A 4I2XA 3P9MA 5IFHL 1LE9B 2AJUH 4G6JH 3LY6A 2NY2D 3V79C 5JPNB 5J9PA 1HWWA 3TBTA 5FB8A 4HXBH 3QBTB 1NAKL 2J47A 4FXKA 4ORGB 3BP7B 5FV2A 1RQ5A 3VXRD 5F7NC 3HC4H 1NPUA 5DT1H 3IDXL 3ESUF 3HR5A 3TESA 5EUOF 3R1GL 4NCC2 2YRZA 3W39A 1ISZA 3U9PH 4UQBA 5AY7A 1L7IL 5D9SA 4XZUB 3RVVD 2P1YA 3THDA 1CXEA 4TVPL 3KLDA 1T1WB 3QG7L 2ZJSL 4WEBL 1ROWA 3L4ZA 4PRAB 1KT2B 4HKJB 1CBGA 4WHTA 1D6VL 2ZCLL 3FQWA 4H8WH 4F8TA 3MRDB 1C93A 4KTEH 3CMJA 4PB9H 5A2BA 4RRPA 5GJSL 4JFPB 3V4VL 3GXPA 5CSYA 1YEDA 2YD5A 2YLLA 1ZANH 3TJHD 2V9TA 5C0CB 2H3NA 3QI9C 1QR1B 4KROD 1VF8A 3LAFA 4PMDA 5CEZL 4NN6C 5CPTA 2A77L 4JFVA 2J7HA 4X80L 2DJUA 4NQSA 4GMTH 1AD9B 5EC2B 1G9MC 3SE3C 4JQXC 1NWSA 2VLKB 2X4SB 5GPRA 1A9BB 1F6LL 4WIQA 2AXGB 2VRKA 4RWHA 1UQYA 1U3HB 1UWSA 3RJYA 2WWMC 1U33A 4Z0XB 4EBQH 1D5IH 3VG9C 4TPRL 2AAAA 4RFOH 5JMRA 4KI5C 2CEQA 1CFTB 1NGYA 4TVSa 1P6AB 5I0ZA 4DCQA 3Q5YA 3SE4C 1VCAA 5C6PB 1K6QH 2D7MA 4P5TC 4PTWA 3CVHB 1L0PA 3OGSA 2FRGP 5LVEA 1YC8A 3SDYL 2BDNL 2J5LB 5ITFB 1DWIM 4OLYH 1FAIL 3LRSA 2FYYA 1H3UA 5MENE 3FB5A 4GG6B 1Z32X 5C6WH 3IT8D 1RUPH 3MV9A 1OAQH 1ZT4A 4YHGA 3MMWA 4HBCL 2ADFH 3VGHA 3FT3B 1DUYB 3CNKA 3MLTA 3ILPA 4PGBB 3VJ6B 4HWZA 1QYGH 3D9AH 5CHNB 4JRWA 4KUZL 4H0IA 4AMWA 1BVZA 3TCXA 3OZPA 2DQCL 4Y5YC 5F9JB 1N64L 2P5WB 3AMDA 4JPKL 3LPOA 3KYMB 3WDIA 2JEQA 1MAML 2FWOA 4UNIA 5HGAA 1S7QA 4PJBA 4M7LL 2CMRL 3IDUA 5IBUG 3K4AA 2X7LB 1W0WB 4QXTB 3HZYA 2ZCHH 2F58H 3UAJC 2VISA 5IKCB 4ODTH 5J06A 3T09A 1VEPA 1CL7L 5JW4R 4J3UA 4HAGA 4PG2A 2WP3T 1U8MA 5LGHH 1YMHB 4OGAD 5JO5A 1E1FA 2V38A 2XPGA 4AG4L 2BY0A 3WNKA 1NMCC 5GGRA 2I27N 1E70M 3RVUD 3VXUA 1NP2A 1QSEA 2B4CL 5LG1A 4RGNB 4P8XA 4ZOAA 3QEUB 4GAFB 4MDIA 5GGTL 1MFEH 2OSLA 2VH5L 3EDDA 4EI5C 4D72A 3QJFA 2H41A 4XP1L 4LLUA 4Z2IA 5D72L 4XPHH 3WS6C 2VZTA 4PLJC 4NQCD 3RBGA 4XVTH 1GOWA 3QJHB 2X1OA 3DROA 3QCTH 1UWIA 3OXSA 3FOMA 2QMJA 1BBJB 3NJ3A 5C0CE 2YBUA 4DK6A 1KB5B 2J8HA 5FOJA 1U8KB 4Y0GA 4XC3L 5E1HB 4LHUB 4OSUL 2P44B 5JHDA 2EIZA 3BP6B 3OKLA 4PRPD 1X44A 2APWA 3RI5K 3N17A 5I1GH 4Z7OE 3FAXA 2YMXL 2J6EA 1BX2B 1EAJA 2BNQA 3GNPA 5FM5O 4JVWA 4WCYH 1ZVSA 5HGHB 5INCB 1TCMA 1BFVL 5T3ZE 3DUUB 3AYRA 1JZ6A 5IESL 1GPFA 3NDYA 4GRWE 3WN6A 3CBWA 4GKLA 2J79A 3UDWA 1I1AC 3WNMA 3MRBB 3MYZA 2AKRB 4PJGB 3WKZA 3VFGL 4M03A 2CKBL 1B2WH 4YUEH 1KN4H 5MEOA 5D4YA 5I1JH 4WDIB 2BOBA 3VFUB 3QR2A 1JYVA 1H8NA 1X5LA 1N6QL 2J8FA 3HG1A 5ABFB 3KJ6L 4OGYL 2WBJA 4J23A 3N9GL 4HJGB 3GI8H 1A3RH 1A6WH 2YIHA 3OTTA 4W70A 5DJCA 2CIKA 4M4RA 3EJTA 2ZUMA 2DLFH 3PNWB 3MJGX 2X4NA 3MLUL 1Z5LA 3RAJH 5F8QC 4DUWA 3H9SE 4HU0A 5JOEA 1I8LC 1Z3GH 2JIWA 3DX0A 5HY9B 1HINL 3VRIA 4S0TD 4DN4H 4X6CA 2F7PA 3PWVB 1DE4B 3S8WA 1OB1B 1VENA 3FO0L 1N26A 3S88H 4NXKA 2PWFA 4KDWA 3IF1B 1RZKH 1T4KA 2P5WE 3FB6B 3SCMB 3QIWD 4G5ZH 2QHRH 4KJWC 5AYBA 3D1MC 4CUCA 5ETUB 4LRNL 4OV6F 1G7MA 3BSZH 5GZOC 1VFUA 4OCWH 4QNPE 4PJXB 3LKQA 5EO1A 4K8RL 4XB8A 4GAYB 3OAUL 4MS8C 5EU7C 5BQ7A 5ENWB 2DBLL 1V08A 3UERA 4XNQA 1HQRA 1E4MM 3SOBL 5ESQB 1E4XI 4JJ5B 4M1DH 2GJJA 1DBKH 2GITB 5DQJB 2ICWB 1R87A 3G5XA 5ISZE 4JO3H 1BG9A 5C08E 3EJYD 1ULVA 5H37G 2DKUA 1DUZA 3ULSB 3CFDA 5AYUH 1PX4A 3LPPA 1QX1A 3QUZD 4K3EL 4M43H 5GIRB 1MYRA 5JUVA 1VKXA 3C5SB 5KTEL 2DQEH 3QB7C 3X3FH 3ET9F 4KK8D 5HSFA 4MAVA 4K7PY 1CZ8H 4HJ0D 2R1WB 1T21A 3O9NA 3SDDA 3DO7B 3DXAE 1WCBB 5CUSL 3PZMA 4JM4H 4CCEA 3TF7C 1ZGLP 4KJYA 3MI6A 3I2CL 2AXFB 3WD5L 4OIAA 1OGSA 3LN5A 4E41D 3KYAA 1HNFA 1W72L 3O3BB 1KSRA 2LQRA 1HH6B 1G7QB 4ZUSA 4GRMA 1KCUH 2DAVA 3BPOB 1UD8A 3QEQE 3TWCH 4ZFGH 1JJUA 2GK1A 4ERSH 4FQLH 4N8CH 5JTWA 2R2EA 1OGTA 1KG0A 3GSQA 4DW2H 3OAYH 3N50A 3HE7A 5T1LD 3VXQA 4GKNA 4Z5RB 1RP9A 3OLEA 1UM4L 3CC1A 3FQXB 1G6RL 5DRNB 3FB7B 1F02I 3E2HC 5IF0B 3TM6A 3O2WL 3SGDH 3TZVB 2NY4D 2X4TA 4HUUA 5KS9B 1Y7VA 4FQXC 4S1DD 5JPMA 3AXLA 2JALA 2D31B 2IANE 3P4OA 1C92A 5JBEA 4YX2H 4OKDA 1KNOB 4BK5A 5F9WB 4HZ7A 5B21A 5C0IA 4L8SA 3GBNL 4IS6B 4GMSL 4LSSH 2YD6A 2D0HA 3SDXA 5C07B 1NDGA 1QRND 1YJDH 4LF3B 2FX9L 4D2NA 1EJ6A 4Z2LA 1UVQA 2F54A 2E40A 1A9EA 5EBLB 5LGJA 2YD2A 4Y8DC 3MO1A 2ED7A 2O5ZH 1L6XA 5J6GB 3WH5A 4HOXA 3B83A 4KTDH 1N6UA 1AC0A 4TVPD 3D87B 2J4GA 5IB3B 3BEVB 3QUMA 3WLWC 2HFFA 2LU4A 5GSVA 2UZYB 4ZMAT 1R34A 4Y2DC 4CD4A 4GINA 1WWAX 5BRZD 4EK7A 3PGFL 3RA7H 3V52L 4DM1A 2BVOA 5C09B 5J6HA 2M8XA 4HZLA 1I8MA 1KENL 1CD0A 4JVPA 4X0KA 2AK4E 2BZDA 4DKFH 4WU5A 4K07A 5K9JL 2CBUA 4GZJA 4IRSD 4MNLA 2Q8AL 2F7RA 5BS0B 5CEZD 1UWGL 1GC1L 1T5XB 1NC2B 1WITA 4EN3A 1U8LB 1ZJBA 5D5ME 1MNUL 1UH2A 3RIFK 4MJIA 3NCBB 3KPPA 5D2LE 2ENYA 2XFYA 3PABA 3BZEB 4WW2C 1AE6L 4ZO7A 5IVZA 3GSOB 3RKDC 1KPVA 4NM4L 3KL5A 5DURD 3T77A 1GHRA 3SJVB 4J27A 1EEQA 2J7GA 2IPTL 4DVBB 3BN3B 5DK0A 2OLDA 4NRZB 1FORH 4MB1A 2VX5A 3D2UA 2V7NB 2E27H 4OZHF 3S35L 3OG2A 2W0PA 4YGVB 2WW5A 3JV0A 3AZTA 5GRVK 2VTFA 3PXHA 3U9UA 3BAWA 1UWUA 1UD5A 2JE8A 3OX8B 5DLMH 2DWDB 2DLEA 4LGSB 4OF5A 5CMAA 5CBAA 1OP5K 3BH9A 2C7FA 2UZXB 5F6HJ 2VVSA 3EYUH 1A1OA 1FN4B 2YPLD 3K3QA 4UQDA 1JPST 4LVOC 1XF3B 1D2KA 1JMXA 1M4KA 2HJLB 3F5JA 4YQXH 5TFSH 3LKOA 4HIJA 2EKSA 2BVPA 5DS8A 3UTTE 3M17B 4OV5A 1Q6DA 1YMME 4PP2B 1OSPH 4QRTA 3CO4A 2JJTC 3FFCA 1R33A 3V5DB 3BYTA 1KGWA 5FUZH 3L4TA 4ZAKD 4G42B 4PJDB 2BY3A 2LV4A 2Y07H 3QFJB 1KJ2B 5HDBF 5I23A 1MXGA 5L7XH 3HPLA 1VHPA 1SEQH 2JJSC 2XN9B 3OF6A 5JDSA 4YHZH 1KJ3L 1VADA 2EDNA 3DNKA 3MREB 4C56A 4P7LA 4K9EL 4MDJA 3NFSL 1GNXA 5FUCE 2F15A 3MLYH 3UTZA 4C57C 3ULUH 4AIXA 3HCVA 4CMMB 3QRFM 1OP3K 4YDLB 5GQBA 4TUKH 3MLSL 3RTQA 1RAMA 5C07E 4C4KT 5CJQL 3S36H 1D5ZB 3Q1SH 3QIBB 4RGOL 5LAXA 3LSOB 2VZUA 4FS0A 4J4PA 4OLZH 5SX5K 3P4NB 7FABH 1FVEB 4M61A 3FQRA 1A6UH 5CIPH 4YPGB 4WO4D 5BVPL 3IJYB 3X14A 1BREA 1EGJH 1TIUA 4HKZB 3TFKD 4YR6A 1HOCA 2C1OA 4OB5L 4Y89A 2JCCE 4Y16A 1JZ8A 4W7UA 4KQ3L 5E9DE 2XQYK 5E2UL 1GZQB 4JKLA 2FATH 2PTUA 5CCKH 4HUWB 3T8XA 4OJFH 1INQB 3UG3A 2QADB 5IG7A 1A22B 32C2B 1QI0A 3FO2A 5HHXH 5BS0E 1ND0B 2EYRA 4KRNA 4JCLA 5EA0H 3QG6A 1E0VA 3Q5TA 1CXLA 1YEHH 3RWHA 1EVUA 1X5IA 4AISA 2Y1VA 3CHEA 1R3JB 1JGVL 1NC4B 4XXCA 4WNQB 5IHSA 4I3SH 2FCBA 1UR4A 3AU1A 1G7HA 3ALXA 4GS7B 5T1DL 3VD7A 3F5WA 1CL7I 1KIPA 1T1ZB 5CINH 3ARFD 4GT7A 1PIGA 4WTZA 1Q6FA 3QOKA 3EOAB 1CQKA 3S5LA 1NOWA 3AM8A 3H7LA 1GPOH 4UQAA 1WV7T 4FFVD 3FZUD 4P2OD 1ZHBA 1T2QH 2P49B 3RIAK 3EFDH 3W2DL 1AKJA 4L9DA 4OCNC 4FABH 1MY5A 1MFVA 4R90L 43C9B 3HS0B 1W2KT 4HWBH 1NAMH 4ODUB 4OLVH 2DL9A 4M8QA 5HBBA 3IFNL 4TTDC 4L3CB 1DBML 5E95B 2VXVL 2FH8A 2J8GA 2NW3B 4G9FA 2RGMA 3WSQL 2GJXB 2ZUNA 3DARA 1CDCA 4YIQB 4OFKA 4YXLH 4XCNA 3GIZH 1TPXB 2XN1A 1ED3B 1YY9C 2DMKA 4MX7B 3QDGD 2BVTA 4OUUB 4PJFE 4JB9L 3BX7C 4HS3A 4G8EA 3O3AB 2ATKB 1DLFL 2VQUA 2YD1A 2TAAA 4UCFA 4AZ6A 3NVQA 5JR1H 4PYSA 3VOCA 3B5HA 3C6LA 2XN9E 2IJ0C 5DJ8B 2Y6SC 2D4FA 5DJ2B 4BQCA 5E09A 4JY4B 2YJQA 2WUBL 4F58H 4M80A 1K9TA 3G6DL 4K8RD 1DWFM 5JBFA 3BT2H 5IMKB 5JOPE 5IM7A 3QUXB 1DVFB 2XVGA 6CGTA 1PX8A 1A6PA 1T1XA 1ZT7B 3MZTA 1XFPA 2OS7A 4HUMB 3CUIA 4FMKA 1MF2H 3W9EB 3WKNA 2EH8L 3AOFA 1TMCB 3FO1B 1LL7A 4RIRB 4WJ5A 3SKJL 2NYYD 2MCPH 4YFEA 1EZVX 3AC0A 1IAKA 3VD9A 4HMDA 3D39A 1ZHLA 3RUGF 5EZLB 3C60D 4OLUH 4CNIA 1E0XA 4XNZB 4NF7A 1WIOA 1EMTL 4Z77B 3RM8A 3TTSA 5DUPH 4U6HA 4Z7WE 5GGTA 3RJDA 3IXTA 4RE3A 5C0BD 2BNRD 3SO3C 1JNHB 1OAYL 3ZE2F 4M7LT 3UZEA 4HQQH 5D8JL 2VCCA 3NAAL 1N0LA 2RAMA 15C8L 3ELAT 3GHBL 1PGRB 3BLBA 1QI2A 2FJFA 2GEEA 2PW1A 3K8MA 1D9KC 1HKJA 2D24A 5A2AA 4TVDA 1MPAL 2CDGB 1P7KB 1PD6A 1VFMA 4LEXH 1AR2A 1D5BB 5KBNC 2CJUL 1S7UB 4FNUA 4FFZH 3DC0A 3U46A 1FC1A 3EJJX 2V3DA 5J11B 1XEDA 1U3ZA 3O9WD 1YEIL 2VC2L 5J12C 1LD9A 2Z35A 1SVCP 1DCLA 3GGWA 5TDOB 3ARDB 3JWDC 4WKAA 1FZJA 2HTKC 3W53A 5DC9B 4QLLA 4Z7UB 3UYRL 4PV8B 5E2VL 1CFQA 1R6VA 3ARZA 4NN7B 4X99A 1C7SA 1HI6B 5FDYA 2VLRD 5IEKA 1K2DB 3U7AA 1NGWA 5BMFL 1BIHA 3V6FA 1NWUA 3UDWC 4P4RB 3VXPB 5E7FA 3QO1A 3SUUA 4XCCH 3ARGD 1PG7L 1HP4A 4Z78A 4LAQH 1ACYL 5FYLL 5E8NB 4P2OA 4CN4A 4YBLB 1OGBA 2WBJC 5L2KA 1IGFH 3WO4C 2OK0L 2DT0A 1ORSB 1OGAA 2VOTA 3AIUA 5DF0A 1UGNA 1SVZA 1UFUA 1TE1A 2G8ZA 4NRXB 1W1YA 2DM4A 3A21A 1A6ZB 1YN6B 1ADQL 5CSGA 2QHLA 5EC1B 4ELKB 2KZWA 4XPTL 3W6LA 5E56A 3BGFB 1XF5B 4OCRL 5IB1B 4H1LA 4DGVL 5C0JA 1I7RA 2GFBA 2HLAB 1TJGL 3WIJA 1FNEB 5SV4A 5A2JH 4PJ5A 3CVIL 1FIEA 2J8UA 4PRBB 2O9PA 1OSZB 2DKMA 1BMGA 3HLAA 3GRWH 2IFGA 2X0YA 3CFKA 3UROR 1B4JH 3KPOA 4A6YH 4N0YL 2P4AB 2G3MA 5BWFA 4G8GD 1L7TH 4HUVB 1LEGB 2M2DA 2WINA 3LEXB 1JG9A 4JPIA 1WAAE 4IHOA 4WLCA 5MERA 3NIGF 4QWWD 5H94A 3PWLA 4BFGA 4JFFA 4GBXD 3PHOB 3RVWC 4YO0A 4OM1L 4FMVA 2H32B 4NUGH 5KZCB 4LOUD 1CE1H 1JHLL 1MRFL 1RIVL 1Q9OA 2VLJB 3SN6N 3QDMB 3PWPD 2XA3A 4HFUH 3MSDA 4UR9A 3C60A 1FYTB 1H4PA 1N82A 4HPYL 1IEBB 2HTLD 5C0RH 5A95A 3SGEI 1FZMB 5DHYA 5EWIL 3SDDC 5HBFA 1LP9E 2XTJE 2Z91B 3GMQA 3KHQA 1A64A 4GQPH 1CR9H 4N0CD 5C0BA 1BWMA 4NXSA 3BJLA 5AG8A 5DSCB 4PYGA 2IMMA 2DI9A 2W60B 3MRHB 1AQKH 2UWEE 1RZJC 3PQYE 5F3HA 4OZFH 3TN0A 3VFSB 4MA8H 4QCIA 1A7OH 2QSVA 4XNYH 1W72A 3ZL4L 5E70A 4IM4A 5M94B 2F5BL 1F6AA 4BF7A 1IC5H 2R15A 4E42A 4TOYL 3WXVL 3U7BA 3AMKA 3VDBA 3HE7C 2OL3A 4AD1A 1EHLL 1ZLWH 3IDGA 2HVKB 1AC6A 3QSKB 2HT4D 4P5KB 3AXIA 3B9EA 3B9KD 4MLIA 3W29A 2Q7YA 2X4PB 4YDVA 2UYLA 5EBGA 3P0VL 2IBZY 3EYVA 2W0FB 4HS8H 1G6RA 1MFNA 1UR0A 1CDBA 4U7KA 1A7NL 4FFWC 2UVEA 1QVBA 1ZWIB 2J88H 5D2NB 3P3YA 4L4PA 1C8XA 1JWUB 4L8SC 5CG0A 2VDPL 2VRJA 4OFPA 1JD9A 4JFED 2RHEA 1EPFA 3ALPA 2F53D 2K7PA 1AGEB 1FNSL 4H2CA 4QXWA 1E3ZA 5HGBB 4BZ2H 4MAYA 4GQ9L 3U6RB 2OI9C 3VFWB 4AD5A 4B0MM 2CRZA 3ROOB 4GG6F 2Y7QB 4M8VA 4AIEA 1FL3B 3T0XA 3GSVB 1NUDA 4UILH 5DD6B 1S7RB 3D4YA 3I75B 1NFDA 4P4KD 1HWGB 4W8BA 3NIFF 3TYGL 2DQTL 5JA8B 1MLCB 2DMBA 3NZHL 4P2QB 5CLWA 4QGTA 4UUJB 3MA7B 2W5FA 3MLVH 1FH5L 4ZUVA 1LK3L 1BZ9B 2Z31D 5LCVL 3UJIL 4PGZA 3GFUA 3ILQD 2FJGA 3V0WH 3C9NA 4UTAH 1D3CA 4EN3C 5AAMA 5L0QC 1Q0YH 2P7TB 4XBEL 4WGWB 3CDGB 5B38A 1P5UA 4ZEPA 1EEUA 2QQLL 3SEPA 4DN3H 3HG3A 5KN5A 1DQJB 2GJRA 1U91B 1QO3B 1SMAA 2HLFD 3D3VB 1AJ7H 1NCCL 4PRDB 1BOGB 1B88A 1EFXD 1MCEA 3IANA 3VD4A 5FGCE 1P9MA 3NIYA 5HJ3A 5IGXL 3HNTL 1HZHL 3CH1A 3LN4B 3O41A 4X6BB 4UV4L 4HMEA 4GBXA 3MRPB 5C0DA 1ISWA 4WWKD 4NP4L 1DQLH 1VEOA 2WBKA 3CMOH 1FFPB 5KZ6A 3AS2A 3IB4A 2BC4B 3VI3F 1FL6B 4M7ZC 3OHXA 4G8IA 4X6DA 1Q4NX 4Y4KA 1BZ7B 4Q9RH 2ATPA 3IFLH 4LLYA 4X5WB 2UUDH 3PWPA 2G75B 1UASA 5DYOA 1EDGA 5JLZA 1PZ3A 1D5MA 3CFJA 4U1JA 4MD0B 2NY5C 4G7VL 5HVGB 4X5XB 5HHQB 4NKIH 1F4WH 5ICXB 1HILA 5ALCL 1TJIL 5GRUH 2YPVL 1VJZA 2IQAB 2FGWL 1G9NC 4JRXA 4H04A 2JIXD 1UR1A 4MNQB 4K7FA 5E2TH 4Y8AA 4XCFL 2IBBA 4R0LA 4PV9B 5I1HH 4NQED 4U05A 2BP3A 4L8DB 2I07B 3JWDH 1MCOH 4P2RD 3QEGL 4WVRA 4LASL 2H6PB 2BFGA 3ULUE 4ZD3H 3MBXH 3PIQB 1G5AA 1LQSR 3BVNB 4RZCB 3OJDA 1WBZA 4NQDB 3TBVA 3DUSA 3MNZA 1R47A 5INDA 2GVYA 2ZKHH 1V02E 4BQ4A 4X9FA 3C09B 3NACH 1BHGA 2O5XH 5D2NE 5MEQA 1ESWA 1FC2D 4DZBB 3MANA 2GAZA 4ODVH 1PDKA 3LS4H 4AZCB 1BFNA 5FM4A 3RTQC 2NY4C 2PXYA 4L4VB 1PQZB 3PWNA 2H2SC 3BISA 4PJGF 4R4BA 4PGEB 3GXMA 1SBSH 2QHAA 1U8JA 3VU2A 3U82B 4XTRC 1NCWL 4M9OA 3HC0A 4PJAA 4J4PC 3LHPH 4Z2HA 2BRRH 3T04D 4X6FA 1S8DA 4LNRB 5D7LB 5BZDA 1S5IH 1AHWB 1WWWX 1LDPL 1RZ8A 3CFEA 3G5VB 2GK0B 1OT1A 3QCUH 2X09A 5FUOH 1KBGL 1DBJL 3MNWA 2GK2A 4Y16C 5TGBB 3SE9H 5HOSA 2WHMA 5HYIA 3CXHK 1UCBH 4U1HA 4YAQA 1HHIA 4WFHD 4RDQF 2HRPH 3MSPA 1N7ML 4Y5XB 3BH8A 2DQDL 4B16A 4J3WA 4LHQB 5F96H 3UTSD 2EIEA 4M1GL 4ZOBA 1C16B 5SWSD 5EIIA 4OGXL 2FD6H 4PJ8D 3U79A 3VFNA 4XXCC 2FL5B 2R39A 4NYLB 2VLMD 4PJXF 3S3SA 5TE4H 3NH7L 3P9WB 4W6XB 3ZKXC 5ADOL 4WI9A 1VFOA 4NI3A 4LDLB 3WLBA 4QRQA 1R24B 3U2SB 3HC3H 1NGPH 1E4KA 4UDUA 4NZRH 1SYSB 5I30H 1TVHB 2DOCA 5CJ5A 4PSPA 4JFHD 4UTBH 3AM8C 3MUGB 2C3VA 3KPRA 1VPOH 3JTTA 3PZQA 2OYMA 4HIXH 5E08L 4JO2L 5FYLD 4MCYA 1RK1A 3H0TA 3CZGA 1INEH 2HN7B 4CW1B 3T0EB 1U3JA 2YBRB 2X40A 3MYJB 1NGQH 2C4FU 1ZKAA 4XNMA 1E6JL 1MCPH 5EN2B 1G01A 1Y18B 3EOBA 3DVNB 5FGBA 1EA9C 3LMJH 1CGVA 5B8CA 2DB8A 5DT7A 1Q9KB 2CLRA 1QBAA 1DFBH 5JW5A 3WF3A 4FZEH 1JF6A 3O2VL 2VDOH 1NCDL 2Q3AA 4APQB 1EBAA 2CRIA 3MRNA 4H8VA 3OJVC 3PDDA 4ZS6D 4FQQA 4LCYB 4U1KA 2W9DL 4UIMB 4X0NA 5IFJA 4R27A 5DHVH 1LGVA 4LEOA 3VXTA 4OF0A 3C6LC 1TQCC 4LPWA 5DD0H 1NEZB 4OCSH 5DD5H 1OB0A 4NQEA 1PKQE 3CK0L 5ITBL 3PP3K 3M6DA 3V0VB 3KXFB 3NN8A 5KS9F 3ZTNL 4GKZA 1JNEA 3O45B 3LKRB 4N5UA 1NDMA 3ZDYF 1E4XH 2Y5TB 4KRMB 1KXTA 4EUPH 5FKAB 4N8VA 1NGZB 1ETZB 4D0BB 4OIFA 2EXYD 5CGTA 1XGUB 4ZSOA 2PF6A 1GHSA 3S34H 3BE1L 1H5BB 3MOAH 1UH4A 4U0RB 3HZKB 5C3LD 2VAAA 5CQ1A 3MRLB 5F88B 1JZ7A 2UV3A 4Z0BH 1MY7A 4KZDL 3BD4A 5GGSA 1EJOH 4LLWB 1OD8A 1FH9A 12E8L 4PRHB 2XQBL 2IC2A 3NA4A 3OJMB 5IT2L 3RMEA 5HHOE 3ZTJH 4QRRB 4D6EA 4Q0XH 2X10A 2BNJA 4OCYL 4GFTB 1QBLH 3PWJA 4E5XA 2AABH 5A8MA 3BDXA 1YDPA 1ODUA 1SMDA 1NL0L 3ARQA 3QUKA 4HHAB 4K71B 3IFOA 4HH8A 2EE9A 3W0WB 5BV7L 4ZFOB 3CZFA 4KKLD 4L3EA 5HGDA 4JREB 3UTSA 1REIA 4QF1A 2KZ1B 4PRIA 5DQDH 4OQTL 1JPSH 1YPZA 1R5WB 2VIRB 4G3YH 3BW9B 2Q76A 5EULV 3UTPE 3E6HA 1EHAA 3BUPA 4UT9H 3MRGB 1B3JA 1J1OL 1BGAA 3B2UC 2BVQB 4OD1H 4PLNC 3P9LA 3CLWA 2X4UB 5TJWK 4K3DL 2CHOA 1YUHA 3LB6C 4UFJA 1QBMH 1FFOB 5L2JA 4KY1H 4LU5H 3VO0A 2QSQA 1ZBVA 3RIKA 5JXEA 3GI9L 2D20A 1B3ZA 1NBZA 1W0YT 3QCVH 5B39B 2GDVA 5A6JA 3IGAA 2DM2A 1ADQA 3OG4B 3WNPA 4LARL 5A16A 4M24A 2W07A 4HPOH 3AAZA 3K74B 3VA2C 1GOHA 4O02L 5DC0A 3BKCH 5GRJH 2LE9A 4UOW1 4F2MB 3MXWL 43CAB 3RWGB 1A5FL 1U9KA 5EG6C 3AXXA 2R0ZL 3O6FD 4Z8FL 1TZHB 3VSTA 4Y4HD 2XM1A 2AJ3B 1TZIA 2AK1H 4PJDF 5EBAA 3D25A 1FO0B 2GSIA 5E4EB 4N0RA 1S78D 4JKMA 1E6ZA 1IGMH 1VRXA 3KXFE 3TT1H 4NWUH 3S97C 5L8JB 3A4XA 1ZS2A 3MLXL 5H37H 5IVXB 3WMSA 5IFHH 3IGUA 3QWRD 4WWID 3MR9A 1FLTX 3QQ4A 4CJ0A 5I75B 1ZT1B 5C8JB 2DIJA 3KPSA 4C59B 1DTUA 1VAHA 4PMNA 3IU4H 3QEHB 4DQOL 1NAKH 4QXUL 3W0KA 2ADGB 2X6MA 5AEAA 4K7PL 5H35A 1HIML 3IDXH 1IV8A 3DHPA 3N1FC 1QQDB 4PREB 3R1GH 2BSTB 2NXYC 4I77H 5E6ID 3MV8B 1BQUA 2P5EE 1GH7A 3FQTB 1L7IH 2I9TA 4IOFC 1B3XA 3MV7B 5DD1H 2A38A 4J1UB 4Z7WF 4TVPH 4JRYD 4ENED 1BBDL 3QG7H 3TONA 1QNQA 4WEBH 4N42A 4OZGB 2GW5A 3VRJB 3KNBA 3TO4B 4MVBD 4CDHA 5KVFH 5EOCJ 3KHOA 3U5YA 1D6VH 1Q94B 2ZCLH 3EJPA 2X44D 1RHFA 3D18B 3N85L 4OUEA 3NABL 4BKLA 3TN0C 1U58B 1XIWD 1UWEH 4AEHL 4Y1AE 5GNZA 3V4VH 2ZSWA 3H3KA 3SE8L 2P8LB 3ZKNC 1WISA 4BUHA 2IPUK 2P24A 3H3BC 2W62A 4HCRH 3V4UL 1J12A 4MAZA 4M1RA 5CEZH 5HYJE 5JOFB 2YUXA 2A77H 1KCKA 4L8BB 2DQUL 4LVEA 3U4BH 1ZLUH 1OM3L 4QHKI 1U36A 4X80H 2QLYA 1XYZA 1F4HA 2PBOA 2RCSL 4DO4A 4QHMB 4XMLL 5GGQL 3MRIA 3UR8A 1JGUL 3SCNA 3GJFB 3HE6D 3VFPA 2OTWA 1L9MA 1IM9D 2VDRL 4IPNB 1EDQA 1K9EA 3QQNA 4TPRH 2MHAA 1UA6L 3ARSA 2AJZB 1M04A 2BMKA 1DWAM 4H26B 4P7NA 2ALWA 5DZLA 4RAUA 4QTIH 2WC4A 3GMNB 4LPYA 5EFDA 2DTML 4R4FL 4YHNB 4ETYA 4MAYC 1GCYA 2WZEA 4HUKB 3SDYH 3G5YB 2BDNH 5CKAA 3CVHL 4K2UL 3TOPA 1FAIH 2EDLA 4LQ1A 1MFAL 4HT1H 1R3KA 1URLA 1TVBA 5I1IL 1LHZA 4HBCH 3IKCA 3OKNA 4V1DE 3EUUA 5FECB 1OY3B 4UAOB 4Z76A 3STZB 3TA3B 4R7NA 4N0FB 4WF7A 4OF7A 3BUBA 4AEEA 2DQCH 5ILTL 3EYQC 4G6FB 5EU4A 1EXUA 1U8OA 4M93C 1HJQA 2F1AA 2MQ0A 4JPKH 3B6SB 1K6AA 2EEDA 2OXHA 1CQYA 4AT6A 1T66D 1MAMH 2OR9L 3R0NA 3WD0A 5IQ9A 4MSWB 1P4IL 3EJZC 4M7LH 5DC4B 1R7OA 4NQVB 1E4NA 3VW3H 5JIHA 3OLIA 3BEWB 3G6JB 1QZ1A 3CLEH 3UC0H 5CP3A 4EJ1C 2N7BA 1FNGB 4RQQB 1EFQA 4MMXC 2GJZB 3QDJA 2CK2A 1B31A 1CL7H 3H7BA 1AO7A 4J3XA 3QYCA 4HDIA 1P9MC 2VCAA 2CH8A 4JPVL 1D5XA 3AGVA 3VXRE 2FIRT 4ZFFB 4AG4H 3VXNA 4QRUB 1RJYB 3O6KL 1PBGA 2APFA 5C2BL 3TBYB 3WS3A 1MFCL 4OZHA 2B4CH 3MCG1 4OI7A 1MHCB 1YZZA 4ONGL 4JGUA 4Y4KC 4ACYA 4XP1H 4HPGA 1NP0A 4OCXH 4FP8H 5EOCL 1AVAA 4LSPH 4ONHB 4DWSB 5CILL 4RFEA 1BPVA 1B3YA 1JIBA 1K3IA 4TULL 3ZE1F 3KE0A 1P4LB 3X12B 1NQ6A 4PJEE 2G41A 1LP9F 4GXPA 1WBXA 3DV4B 1HT6A 1WDSA 3ZHKA 4LPVA 3ULVF 5A8QA 2Z8RA 2OJEB 2FZ3A 1SYVA 4OZ4B 3Q2CA 2FSEA 5IBUB 4XC3H 3EIFA 1B0GA 4R0LC 4OSUH 1PPIA 1XIWA 2VSCA 1CVSC 5F7EL 3AHYA 4PRPB 4FLSA 3PZTA 4QFUA 2YMXH 4EAMA 3GEWB 4P23B 2DT2A 2GUOA 3UJTH 1NBYA 1BFVH 2X41A 5JQHC 1R0AL 1ONQA 4NGHH 4K9EC 2EICA 1QFWM 2JK5A 3JBG7 4X7SL 4UNVA 4CADB 1QFWL 2NY0B 1XF4B 5B3JE 2MJWA 5KSUA 4HH9A 2PXYC 3REWB 3EKCA 3GKZA 3T4YB 1QLEL 3VFGH 4Q9QL 2CKBH 1PYWB 1QG3A 3A6OA 2H26A 2YUZA 1N6QH 1NM9A 3FHQA 2WUCL 1FZKB 2QJDA 3DBXA 4OGYH 3WEZA 3N9GH 5DXWA 1T0MA 3ZDXE 2E6PA 3V5HB 5D1QD 4BH8A 1NOFA 4XVUC 1CGXA 1LO5A 5CBEA 4BQ9A 1AXSA 3BC9A 1RUQL 3MLUH 3VWJD 4LDOB 3TVMB 1I4FA 4D0CB 3MGTA 3VIHA 3I6LD 1I9JL 4H1LH 4URTB 5SWZD 2W4XA 3FO0H 1F4YH 3C5ZB 4NO2A 4LSTL 4ZOEA 1FP9A 3A6CH 4R5EA 1CDIA 4IRJD 4I0CC 5GJTL 1O7AA 3HUJB 3RY5A 3EDKA 4P8WA 1CICD 2XYCA 4UU9A 4EXKA 4KRLB 2WSKA 4LRNH 3U36A 1DQMH 4OLWL 2ZUQC 5FOBB 2DSZA 1RK0B 1TA3B 2C7UB 5MEPB 1EO5A 1BEYL 1CZ1A 4K8RH 3RY4A 3OAUH 4ZO9A 4ZYKA 2ORBL 4QXGL 4HGWA 1UHVA 3SOBH 4ZG1A 1N5AB 2ZUTA 2VZ1A 1NUFA 1WUNT 2YEZB 4X4ME 4RAVB 3RVXC 1O0VA 4ISVB 2FIKA 2X4OA 3TP4A 5I73B 5DJYA 2CETA 4I4WA 3S7GA 3WIFA 4LCWA 1BM3L 3ZIZA 2XNAA 4XHJC 4YXHL 2WNWA 4PJHB 5DUBB 2ESCA 3WFZA 2NR6C 4R9HA 1WLHA 5KTEH 3T08A 4EANA 1SJVA 4XRCA 1V0LA 2KKQA 5FGBC 2FBOJ 3SPVA 5B8CC 1S7WA 4OCMC 4NHCL 4F15B 3S4SB 4HV8B 3F7VB 4X8JB 5GS0L 1IC1A 1MCBA 4G6AD 4NQCE 1E5NA 1Y0LA 3I2CH 5EO9B 2X1QA 2OLHA 3WD5H 5D6CA 1DN0B 1JUFA 1W72H 3P0YL 3WDRA 3JZ7A 1EVTC 3FJTA 5AAWA 4Q6IA 1MJ7H 2ZSVA 4R2GB 4PRPE 1H3VA 1YEKL 3M1BB 3LCYA 4UINL 2ESVD 2HG5B 1JFQL 1XCTB 4A4AA 2M26A 4M48H 2WYSA 2CO7B 4HPHA 2ZOXA 1CBVH 1UM4H 2Z9TA 4TYUA 1DQQB 1BGXL 3CZ8A 4M82A 1G6RH 1JZ5A 1OCQA 5C0AD 5ECJE 2P42B 3L3JA 5CPSA 1GGCL 1B3WA 3NFPA 1MI5A 4PEEA 1JZ2A 4MCZB 3NFNB 2VCBA 1FFNB 4MJ6A 3VWKB 3BPCB 5J1AB 3BO8B 3L3DB 4HXBL 3BXNA 4LBEA 1MAKA 4GMSH 3CDCA 5A1AA 1M71B 3MUAA 1XGQA 4P59L 4KKBC 1B6UA 3HG5A 4L9LC 1VFBB 4PGCB 2DLHA 2IADA 4ZXOA 5FFLA 1JNLH 1E6OL 2CBJA 4F57L 5D1QA 5KVDL 1P84K 3PE9A 5ICZB 4JZNA 3P73B 5EIQA 4ZUTB 3FONB 1ORQB 2XWTA 3MROB 1E4LA 1BLIA 4GI8A 3P11L 1DQDL 3N06B 3GNMH 3PGFH 4ZODA 1TR1A 5BRZB 3TH3T 3MJ7A 3GSNB 2XRAL 4H8WL 1VFAA 2N1KA 5E1QA 2EEAA 4KTEL 3T3MF 3BP5B 2BOCA 1J9YA 1R3LA 5K9JH 4P5MA 4PJCB 2WHLA 2Q8AH 5C0CD 4G80B 1UWGH 3LPGA 1GC1H 3CPLB 4G7YH 1MNUH 5ICYA 3KYNB 4QHNB 1EXPA 3CSYB 2I26N 4J3VA 4NSKA 3IDNA 1AE6H 4YDJB 5F3BA 5IMOA 4JFUA 2VLKD 4NM4H 3WHXA 1TTUA 3ZE0E 5I8OL 1RVFL 1E6XM 2IPTH 2XSBA 2GTWA 5EBMB 4HUXA 1FG2B 3L5WA 1EH9A 1C08A 4RFNC 4PJHE 3WFEH 1KPUB 1JBJA 4XCYB 3S35H 1QNPA 1GJUA 3V6BR 1MAJA 4BQ5A 2NY1C 4ZOCA 1LK2B 4HKBB 1DBAH 4XH2A 5GRXG 1WQVT 3UBXA 3R4DA 4GW4A 3FB8A 5IMMB 1QWNA 5C1MB 4MJ2A 1Z9MA 5JXEC 2J12B 2A6IA 1X9QA 3X3GL 4RMQA 4E41E 4LFHD 2ADFL 2OQJB 5E5MA 3PGDA 1VGEL 4XX1G 5C0GA 2OWXA 3D9AL 5L9DH 4C7DA 4Q7DA 4NKDA 3HKFA 2W92A 2YD8A 3LMYA 5IHZB 2QKIA 2P5WD 1K5NA 4LSQH 2OM5A 3B3IA 1K3ZA 1KJ2L 3U30C 4R6UA 1G94A 5HHNB 3WQ6A 3VX1A 1S7XB 3Q48A 2R1YB 1XH0A 4MQ7B 3QQ3B 3U83A 4YN5A 3NFSH 4LHUG 1HQ4B 1FLRH 1KFAL 5FKPB 3WL0A 4HIEB 2HRLA 3MLSH 1CFNB 4LSVL 2A74A 1QRNE 3HA0A 1HXMB 4JY6B 4S0SD 3LKSA 2CCRA 5DRXA 4QT5A 1IT9H 4PY8I 1CXIA 2F19L 1M53A 2GHWB 2ZOLB 4RGND 4TVPE 1CT8B 1MFEL 1OARL 2OTUA 4WO4B 4N9GB 3W24A 3W9DB 4OI9A 4OB5H 4OD2A 3ZKMD 2VZVA 5EU3B 5FCUL 1CDGA 3Q6GL 5CEYB 4KQ3H 5BRZE 2CESA 4QHUB 4XZUA 2CIIA 1T1WA 3DX6B 2ADIB 4XAWH 2EDJA 2J7LA 4PRAA 4JFQA 5D9NA 3ETBF 5CEZE 4BQ2A 1PIFA 4LGPB 3MRDA 3G6LA 4LHUD 3VXSD 2YPKA 3HI1A 1CD9B 4WENB 1JGVH 4JFPA 3WL9A 3QI9B 4JAMB 2BSSB 4NN6B 5C0CA 4LKCA 3BVTA 4PFEA 3OKDB 4D0DB 3RGVA 4KHXH 2V5TA 5TDPB 4Y4FC 1Z2KA 3QH3B 1NMAH 1H41A 1BFOB 4MZ3A 3RNQB 4X9GA 4N5EC 2X4SA 5DMYA 1U3HA 5HHPB 1N0XH 2PI6A 3VG9B 3SKOA 4PPTA 3EFFA 1CCZA 2EYTB 4YUEL 2Y06H 4KRTA 4DZ8B 3W2DH 5CEXB 5FIPA 4P9HC 4R90H 2XN0A 1C8PA 1JI2A 1MCJA 1A3RL 1FSKC 3GI8L 4F37F 1QFUL