1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclodextrin glycosyltransferase
publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
3EO1A 5EOTB 4ZTPH 3ZLQC 2DLEA 2PTVA 2VDML 1US3A 3CU1A 1RJCA 3BWAB 1QTYT 3CLEH 4JY5L 5CHNB 5E8EB 5L8JB 4OM1L 4PLKD 4PJ8C 2CLVB 2QSQA 1R34A 1ZLSL 4AZHA 1F02I 1E71M 2G3IA 3HE6D 3QNYB 1E6XM 4Y5YC 5ABHA 4LCWB 2VSCA 3KGRA 4U1LB 4WV1A 2D20A 4X6EB 3S35X 4FQXB 4BYHA 4WU5B 2A83A 1FVCB 1PKQB 2AXHA 5J11B 1RSFA 1C5DB 2EIZB 3LZFH 5BXRA 4N0CC 3NFPB 1QLEL 4Z77B 5IMOB 5JXAH 3MBXH 1AHWB 1XZ0B 3N1GC 3U46A 2VITA 1PBYA 3SCNA 3OZOA 1UVQA 2QQKH 2ZCLL 5CJOL 1EGZA 3QDGD 5C71A 4MWFB 2O61B 2J77A 2DQGH 3IJYA 1F4WH 3QULA 2R0KH 3QR2A 5IFHH 3FFCE 5DMGC 4Y4KC 3VFUB 3MJ9H 1DBKL 2A6IA 4UQ3A 3QDMA 2WUBH 3JSSA 1WBZB 3C8KB 3LS4H 4WW2F 4YR6A 2E0PA 3L4WA 3VIJA 4Z78A 3NPZB 5EB8A 2Q7NA 1JPFB 1BLNA 4D9RE 4YHNB 1AJ7L 4HA3A 5BZWB 1VEPA 5EBWB 5FDYA 2IPKB 1OARL 2XTKA 1XCTB 5BXTA 3L3DA 3O6MH 5TFSH 5DHVB 4HWZB 3PGFL 4JZ5A 1PSKH 2ITDB 2VDQH 3NABL 4M6OH 5FUOL 1RK1B 4PJIF 1F45A 4OD2B 4QO1A 1SYSB 5T5FH 3TH3T 1CFNB 3WO4C 3BAIA 5BO1L 4DM2A 2ITCA 4Y8AA 4LSSL 3AIBA 5I73C 3NDYA 4OLZL 3RO8A 1NMAL 3SGJC 3WJJC 4HTYA 1QQDB 5IHZA 3G5ZA 3X11A 1BPLB 4IM4A 1IAOA 1ESWA 1E5JA 4FRWA 5IJVA 3H42L 2V7HA 2AJVL 5IVXF 1G1CA 2DSUA 2Z1KA 3SJVE 1M4KA 3MGOB 3O6LH 3DXAE 4HKBB 5DJAA 1PG7X 1BFSA 4X5LA 1BQLH 1F13A 1KPVA 3HE6A 6FABL 1I7UA 1OTSC 3GHEH 5ESQA 2EO7A 3T4YB 2R0LL 2VDPL 1OPGH 2JB5L 3BAEH 4AD4A 1EHAA 3UXFA 2H45A 2AJXL 1F2XK 5I1CH 3PHOA 1RHHB 3U4BL 2RFXA 2VSDA 3BH9A 2M26A 3VGAC 1TUXA 1X5XA 1QWUA 1EFXD 4JREB 2GUYA 5JDSB 4XTRC 5EU5A 5IW6A 1ZKAA 4ZG1A 1OAQL 1GH7A 1XF4A 5C7XH 3QDGA 4TUKH 2KDGA 1BZ9A 2MWCA 4PJFB 1T0PB 4TOYL 1JD9A 4AL8L 5LGJB 5AUMB 4NQCD 4OFPA 4U6XA 4RL3A 2IH1B 1FLRL 3DO7B 3KPRB 2OJZL 2XTJC 2Y25A 1BJ1H 4YDKL 5FGCB 2VRJA 1GPOL 3HAEB 3KPLA 4GLRI 3TT1L 4M1GH 4FXLA 1FL3A 4L1DA 3V7AE 3RDTB 1OAZL 1LE9B 2ZCKL 4FFVD 3QXAB 3HPLA 2EPLX 4UOZA 1DVFD 3SDAB 4MNHB 2CRMA 4UT7H 3BWAA 3DIFB 2MCG1 3NIFF 3UTPD 6TAAA 1CZ1A 5E8EA 4D0DB 3GRWA 3KLHC 1NFDB 2XZAL 4GKZB 3OG2A 2YC1B 4HC1L 5ID0B 2CLVA 2I60H 3FO2A 5FYKH 3TIEB 4DGVL 3ILPB 4KRPD 4PPTA 3TESA 1KGWA 5GRVK 4PRIE 4LCWA 2NLJB 3N9KA 1G0DA 2DH3A 1KFAH 4U1LA 5F1OB 2VLJD 1WEJH 1D5BB 4LNVA 5AYUH 4JDZB 3MA7B 3U82B 2EIZA 3WFDL 4JN1L 1QP1A 4X6DE 5HDRA 1XFPA 1JGVH 2XWDA 5CP7B 4Z77A 3U57A 4RFOH 5IMOA 2J78A 4HHAA 1XZ0A 1QSEE 1RZFH 1JNDA 3SCOA 5ISZB 5DHVH 1GGCH 4KMLB 4MWFA 2O61A 3RJDA 4ZOBA 1NCDH 4WHCA 1INEH 2FHBA 2I5YH 1FV1A 3ZSTA 5GS2H 2RHEA 1TZGH 3CHEA 2DTML 3VFUA 1NLBH 5DLML 4P2CG 3WH5A 1V7MH 1CEOA 3KPRD 1E0XA 4DM1A 3T3ME 3AS0A 5D1QB 1F6AB 4MA7H 1JMXA 2VQ1B 1JPFA 4YHNA 1CENA 3O3DA 1EFXA 4JGUA 4F7TA 1A7OL 4OCRL 1SFSA 4ZPTA 3C60B 5D7JC 1U2YA 2FJFB 1H3VA 2ICES 3UEQA 2VCAA 3TJHD 3HUJA 5EBWA 1FZJB 1ZSDB 2EYTA 2IPKA 3GIVA 4GAGH 4CCDA 1F4AA 1KN2L 1XCXA 1E6ZA 3WS6A 4JG1H 4HWZA 2MKWA 4K2UH 1T3FB 3O3UN 3F58H 2FO4A 4NQCA 3TA3C 5D9PA 2NY2B 1VPOH 2RGMA 4JDVA 4FNQA 2R2CA 3GSXA 4NNXB 3H53A 3UAJD 1UA3A 3VO0A 1QQDA 1D6EB 4D6FA 1VGEL 3WUBA 1KTKE 1CTNA 2X1WL 2DQEL 3VXRB 3BUYA 4RA3A 1MREL 1KLUA 4JRYE 4PREB 3V0WL 1C16B 1DVFA 3ZHKA 5KG9A 4K3EH 2FATH 2ZWYA 1U93B 1TLKA 4K68A 4OOZA 3QJHB 2AOSA 3MGOA 5ISZD 4HKBA 4JPVL 3AREC 4M93B 4GZEA 3CD4A 4G8GB 3ZJ7A 3GRWL 1CDGA 5H94A 3TTSA 3IFPB 3D39E 3A3HA 3T4YA 1U8LB 5I1EL 1MJ7L 2W9DL 4NWUH 3HLAA 2VLJA 1RIVL 4XP1H 3IFOB 4KMQA 3QI9C 1UB6B 5IHLB 4BQ2A 3S98A 4R96A 4JFFB 3DMMB 1VFAA 1ZGLP 1R5IA 1AY1H 1FBIL 4Y5XA 3HCVB 5JDSA 2J7HA 1NAMB 4NI3A 2IMNA 4PLJC 2E8ZA 4TTGA 1JG9A 4TUOB 4Z95H 3CHFA 5F70A 1XHGA 2VIRB 4P59H 3AI0A 4CDGC 5EFIB 1I75A 4PJFA 3K1DA 1EDQA 1WWBX 2EE2A 1QW8A 2NY2D 5ERWB 3DHMA 1IKFH 2VDNH 3MRHB 4MS8C 4Z7VB 4ZUWB 3KPRA 3DO7A 3LQAH 2RJMA 4DVBB 1SYTA 4ZOAA 4K8RD 3HAEA 4FF5A 5B3JF 2VJXA 1KCLA 4D0BB 3X3FH 5E2TL 1LE9A 1CFSB 4QHLB 2A77H 3JV0A 1QKZL 4NOBA 3T0AA 3PZQA 3VIHA 4MNHA 2B1HL 1KJVA 5J13C 3NCJL 3C09C 5F6HJ 2ZUQB 3DIFA 4JE4B 3DX9A 4D0DA 4ESKA 3L4YA 1HDMB 2EDDA 2YC1A 1N0LA 5FO8B 3F5LA 1KJ2H 3TIEA 4LLUB 3ILPA 4HMCA 4M43H 3IDUA 2NLJA 2ADFL 3ARDC 3MJGX 4UNTA 5IROA 3WN6A 3QDJB 1NGZA 1B3ZA 4JDZA 5D93B 3AMLA 5F9OH 3T4AA 4L4PA 4NM4H 4CCEA 1FPTL 1A47A 4Y5VA 5GJTH 1UZ4A 4MNQB 1LL7A 2YWZA 3ARGC 3DURB 1YMHB 4JIEA 3LKSB 3WF0A 5ABDE 5ISZA 1O7AA 2DMBA 1FZMA 4P46D 2EO9A 4X7DC 2G2RA 4I0PD 1CWVA 1IBGL 3AIUA 4KJPD 4CADB 5CD5D 3KPSD 4K7FA 1MNUL 4MMZC 2Z8VC 2VCBA 1S9WB 4ETYA 3A67L 4BQ6A 1IC4H 4DJMA 2KUTA 3ARBB 1E6OH 3VG0H 5ETUA 5CIPB 3OJDB 3JUYA 1B3XA 1JHLL 2A9MH 4WNQB 1NGXA 3WDRA 1M71B 2ED9A 1A9EA 4NQUA 3IRZA 3CFBA 4U0QB 1G9MH 2GJ6D 4Q9CA 5D6DC 5I30H 5D8ZA 2VTFA 3BQUB 3D85B 3BUBA 2WINA 2DMCA 5KVEH 3BPLC 3I3DA 4L4VE 2AEPH 3TN0B 1D6EA 1VGKB 2CIIB 3QDJD 4OZIB 2FJHB 5DD0H 4PREA 1TTGA 2J8OA 4HX1B 3ORJA 5KZ6A 3VW3L 1LO4L 1YEJL 3HMCA 2W60B 1U93A 5IJKA 7CGTA 2WQ8A 2Z92B 5FA3B 3S36L 3FB8A 1Z3GH 4WFHE 3II1A 3O6FB 4JR9L 1Q9KA 3TO4C 1A6PA 1U8LA 2GHWB 3L3IA 1GC1H 1KBGL 4PIRF 1Y0LB 3P40A 4S1RH 2VX6A 4X4YA 4WK9A 3WMSA 2RBLA 5DFWH 3BPOC 4JLRA 3KS0J 1UB6A 3WQ8A 2YD4A 1MCEA 4ACPA 1MHHB 5C0DA 4I13B 1G6RL 3CPLB 3HCVA 1NAMA 2UWEB 4RWYH 4JGMA 2HP4A 2NY5L 3ZYOA 3FOMA 4LF3B 5HPCA 4ZUVB 4ELMF 3GXNA 5EFIA 5C0AE 2CR6A 4I0PA 3GSNA 2QBWA 4JN2B 4LDOB 1KT2B 1JAKA 1OF2B 1B6UA 3MRHA 5GGUA 1BOYA 4BK4A 3KPSA 4IJ3B 4LKCB 3R1GL 4DVBA 3PWLB 3IF1B 1TA3A 4KKBD 1CFSA 4CVUA 2F18A 1RZ8B 3QQ3B 2XSAA 5IF0B 3S3PA 4Y1AD 1XIWC 4Q0XH 3S35L 2OR9L 3AIVA 4QY8A 1SEQL 2BNUA 2CDEB 5FO8A 1I8LA 5IB3A 2GJ6A 4KI5D 3R8BB 1JZ5A 3ECBA 4LSDA 1HKFA 3IXAB 4HK0B 4TUJB 2OSXA 2HH0L 4KQ3H 4RRPG 5I6XB 3CLWA 1W9UA 2J88H 1HWGB 3AHYA 4I2XB 4JZJA 4R0LC 2F9BT 2GJJA 4HCRA 3QDJA 5D2LE 1J0HA 3N9GL 4YDIL 1FNSL 2OI9C 3RL2B 4OZOA 2E27L 4TSBH 4TTDD 1EHNA 3KNBB 4MNQA 3OIHA 3RWFB 5F6IC 3K1KC 1MJJB 1B4JH 1YMHA 1P4BL 2IBZX 5E2JA 3AMGA 1BHGA 2NT0A 3UPCA 5DO2D 4QWWD 2VXSL 1WJ3A 4M7ZB 5DHXB 1VEOA 3GNRA 2VVNA 3LKQA 4RMRA 4CADA 4CW1A 2DQUL 2A73B 1QSZA 4YNYA 3W81A 3WQ4A 4OBSA 1E5NA 4XPBH 4UIKH 1GAFH 3Q48A 2EC8A 3VI3F 3LQZA 2BFVH 3HUJF 3ARBA 1MW2A 3K81A 1HKMA 4UNVA 4WNQA 1LWRA 3HA0A 4LVOB 3NCMA 4UILL 1H0GA 4GOSA 4M8QB 3NGBC 2BJMH 1JMZA 4CUCA 4UFHA 1IL1B 1NQ6A 5D71L 4DN4L 5CXPA 1LEKB 3WEXB 4M9OA 4NRXB 4DVRL 5MP6L 5J12C 3GBNL 4LP4A 4NCDA 1RPKA 1PG7L 2CIIA 3H8NA 2E9IA 5DEFB 5I76A 1BYCA 3O4LE 1ZA3B 4G6FB 4ZODA 2FJHA 4HX1A 3OGOE 1A5FL 4FXKB 1N4XL 4Y1AA 1DQDH 1TJGH 1VFBA 2W60A 4IDJL 1N6QH 1MFCL 1X6LA 3DECA 1V3KA 5DK2B 5DO8A 2E9LA 4H8WC 3SE8L 3UJJL 3BAXA 1CLYH 32C2A 5LYRA 3O6FA 4L4TE 2FEDC 4DWSD 2UUDH 3Q3GB 2OP4H 1Y0LA 4ODHH 2WSKA 3BZFA 4TVDA 4WDIB 4J28A 1OBAA 4RGND 2H32H 4JZOB 4YHZH 4QNPE 2DAVA 1DWIM 1U2HA 1N7MH 3Q5TA 2CK0L 3TFKC 4PMVA 3VXPB 2UWEA 4JO1L 4OLXH 4HW6A 3MA9H 2ENYA 5IT2L 4WTZG 5LAXB 3WF3A 2DIJA 4ZUVA 1W1PA 3LHPH 1JF5A 2Q86A 4M82A 4JVPA 3P9LB 1WIPA 5F1IA 1MRCL 4JN2A 4KVCH 3SGDI 1KT2A 4PJBF 2WMIB 2VXVL 3I85A 4U1KB 1K6AA 3PWLA 3LVEA 1OOAA 4NGHH 5M5DA 1MLCB 1RJZA 3IF1A 4HZLA 5T3XD 2J7BA 5DSCB 1AXTL 2ZJSH 1LG1A 1FLTX 4U1MB 1Y6MR 4AY0A 3DDFA 2XUCA 3FQNB 5CEZE 1K9TA 2B1AH 3QQ3A 4R90L 2NYYC 3RGHA 3QCVL 1PIGA 4EK7A 1NANI 1XGQB 3EYFA 5T1KD 3WN5B 1DR9A 4S0TD 5FO7A 3WY4A 4OT1L 3BSZH 1UWEL 1T5WB 4MAVA 1V05A 2YD1A 3IXAA 4HK0A 4TUJA 1E4LA 4IMLB 4JJ5A 4BZ2L 5D5MB 4I2XA 2VX7A 4W88A 5F6HI 1G9NC 5B38G 3WXWH 3OX8A 5DK0B 2JJTC 1JF1B 4A3YA 3KNBA 1QNZH 4X0NA 3VGDA 3VVGA 3MLPA 5MEPB 1MJJA 3IETA 4G7VL 3O8XB 3WNOA 1Y6KR 3WY3A 3GMNA 5DA0B 4LLVB 4FP8H 4U1HB 4X7SH 1DZBA 3GNMH 1H41A 4NHCH 3AS2A 2FSEA 1H8SA 4U2ZA 5D1ZC 4DWSA 3P77B 4A2MA 3DVNB 4P2QE 5E1QA 2PO6C 1FIGL 4PB0H 1PZUB 3D52A 3GNPA 3SBWC 3EJUA 3W11C 1A1NB 3C08H 3BXNB 1A1MB 1QLFA 3HB3C 4P2YA 1NSNL 1CGSH 4LARH 1QPXA 3E2HC 4LVEA 5IHUH 1Z0MA 4PCTA 3T2NH 3MR9B 3BXWA 5DR5L 4DUWA 5DQJA 3NSMA 5T1LD 3G6AB 2Z93A 4HPYH 4GI9A 3BRDA 4M8QA 4XP6L 3VMOA 3PIQA 3WD5H 3AHZA 1BJ8A 43CAB 4D9QE 1U3HB 1W1VA 3QDAA 5F1NB 5F3HB 1DANT 3CFIC 4R97B 5BV7B 4WHDA 2QQNL 2VO5A 5D96B 5DEFA 3WY1A 5T33L 1ZA3A 3S8WA 1W72B 4OD1L 3RNKB 5SWSE 3GK8L 2HJKB 4XB3A 3PV7A 4PR5A 1RMFL 2WWMC 2YPLB 5T1KA 1AO7E 2F19H 3ULUL 3O8XD 5DK2A 4UFKA 2AJUL 3ZYZA 5GGSY 1IGFL 2VERN 4GKSB 3FTGB 3CUGA 3WFEL 2NY3C 5D8JH 1OLZA 1BGXH 1NBQA 3KYOB 4P23B 3IVKB 1J1PH 1RURL 1SY6H 3G6JA 1CNVA 1LO0L 4DQOL 3RILA 1PGRB 2CIKA 2QADD 3RGVB 4Y4FB 1TJIL 1TQWA 4IHOB 4NKIL 1ITCA 1CLZL 4JZOA 4X4ME 3OAYH 4JKKA 5GJSH 3RZCD 1UQZA 3UR7A 1MAML 1RUQL 5FKAB 2AV1B 5IDIA 3B2UD 3VXPA 3C6SA 1X7QB 2YBUA 1VAHA 2X2IA 5ADPL 1RPQA 1QA9A 3ARFD 3SDCD 4C56B 4CL7A 2E9JA 5IEHB 3MOBL 1WDSA 3GXTA 3BT2H 3NFNA 5B38B 1V0LA 2RCSH 1SJHA 3TCLB 3UESA 3LXCA 3REWA 3P9LA 4LOUD 3K2UL 3P4LA 4LPWA 3OKDA 1CIUA 1JTTA 2DH2A 3BC9A 4U1KA 4G8EB 4OGXH 4OFVA 3RAJL 3VD5A 2XWTB 1LE5B 1V0NA 4RMTA 5CJXA 5L2JB 5DD3L 4P4KB 3QCTH 1VRXA 1FVDB 2NY7L 3CLFH 3MRFB 4U3XA 5F9AC 3CXDL 4LBEB 1R75A 3WYRA 2WB5A 1XGQA 3TVMB 3WN5A 3MBEC 4PJIE 4PG2C 1Q6GA 2P43B 3MO4A 4A6YH 2IUZA 5JPNB 4TX8A 3LPGA 1CLVA 2DSVA 1J1OL 2VX4A 2UZYB 5CBEB 1LLOA 1XD1A 3ELAT 2BSED 4UR9A 1F4XL 5BW7A 3E3QE 1AC0A 2QKIB 3D69A 4EEEA 2FR4A 3BGFB 3VTRA 1OWWA 5DK0A 4ZFOL 1JF1A 4KPHH 4OCNC 1T0OA 3G5XB 3EJJX 5IVXE 5HYJE 5C0BB 5MEPA 2V3GA 3AUVA 2KPNA 2OQJB 2WZEA 1ZANH 3O8XA 2OBGA 4C56D 1N3NB 1HP4A 4U1GC 1ROWA 2F8VA 1UYWH 2MKLC 5A2IH 5ITBH 4F3FA 2YDQA 1E4KA 3P77A 1L7TL 4P2RB 3DETC 2FYVA 1JDCA 1V7NH 1QR1B 3AIQA 2PYFA 3KYNB 1HCVA 1HXYA 1YEGL 4TVPD 4ZFGL 1OB0A 2HLFD 4UZUA 1GQJA 4DZ8B 1LILA 1A1NA 1XH1A 1BBDH 3BXNA 1VACA 2MSPA 4PJCF 2LAAA 1NCNA 3RZCA 2P8PB 2VQTA 4N0YH 3QR3A 4P4KD 4WUKL 1MQQA 1W72H 1XH3B 1EXUA 3ARFA 4M6NL 4GXVL 3ROOB 1FSKC 2DLHA 4EUPA 4Y2DD 5JIPA 3LS5H 5GGVH 2OYLA 3PWUA 3WFBH 3NDZA 4W70A 4JDTL 1ORSB 2QTEA 2NCMA 3MRLA 1ES0B 4XVTH 4LEOA 4U31A 1D5IL 3WF1A 4FTVB 3WSUA 5CAYB 1S78C 4XCYB 1XF5B 4FLRA 2PBGA 4ZSOB 2GK2A 5D9MA 4I18C 5KSVB 1V3MA 3PABB 3RNKA 5L2KE 2XYLA 3NIFE 2HJKA 4NKQB 5C0BD 1DFBH 4LLWB 4KI5F 4X99B 1YNTA 2D7PA 4FLOA 3KYOA 3AOFA 4BFIA 1B9ZA 4JFYB 3PV6B 1RULH 5EZIL 4P2RD 3RDKA 3QFDB 3WD0A 1IRAY 4HQQH 2E9MA 2AQ2A 3RGVA 5LGHH 2PNDA 4WIQA 2R56L 2I07A 4IHOA 1IAKA 1A3RL 1DQLH 3BZ4B 4QCEA 3PXJA 3N15A 5EB9A 1H09A 3DX6B 2R4SL 4ZD3H 5J1SC 1LP9B 4C56A 4QGYA 3BD4A 4QRUB 4G5ZH 1IQWH 4DZBB 3MFFB 1CLOL 3UJIL 1RZIA 4D6JA 4S1SH 3HZKB 2Z8WC 4JHAL 4Z2JA 3LKPA 2Y8VA 4ZFZB 4CMHC 1E4NA 2VRAA 3WS3A 3L3KA 1YEIH 4LFHD 4TNVF 3VFMB 3AS3A 2XWTA 3MXVL 5F7HA 2WC3A 3PZMA 3PHAA 1I7RA 5L2JA 1HHHB 1J05A 4P4KA 4XVSH 3MLYL 4X98B 3ULUF 1U2CA 1TQBB 4OCSH 4GBXB 3QO1A 1YYLH 4TVCA 2KL6A 4PJ5D 3MRFA 2WBGA 4XX6A 1I1FB 4GRMA 5HJ3B 3DOSA 3V95A 1A9BB 3CFCH 5A6MA 1W3HA 5GGRY 4YK4C 3DV4B 5A2FA 2BHYA 4Y2DA 2GEEA 5HPOA 5C1MB 2FEEL 2VLME 2CKRA 4JO2H 3UEZA 5T3ZL 4HJ0D 3PG2A 5CBEA 2QKIA 3GO1H 3A47A 4QFUA 3VJ6A 1JNJA 4YBLC 5HHOD 1I8IB 1MWAB 4ZS6C 7TAAA 2EXYC 3H0TB 5C0BA 3GBEA 4E8CA 1T83C 2UV3A 2OQJA 1UCBL 3P2TA 4P0DA 1BD2B 4LCIH 3GUTB 5I8CA 1UGNA 3KYMB 3GI8H 4XAKD 3VFRA 5GZOD 3QUKB 1TG7A 3RNQA 3F7RA 3F5KA 4P2RA 2VH5H 5C0GB 4PJ8B 3PZNA 1CXHA 2Q3ZA 1F90H 1OAXL 2AERT 5L6YH 4DZ8A 1IGML 2ADJB 4Y5YB 2DQCH 3BO8B 5E7FA 3MMUA 1BJMA 1XF1A 4P8XA 1E6JL 3BN9C 2D24A 2P8PA 2DI7A 5L9DH 5D7LB 3X13B 1ISYA 5I17A 4GBXD 5HHXL 3VXQA 4F57L 4AZCA 3S4SG 4Z9KB 4MD5B 3ROOA 1LEIA 4NT6B 1X4YA 2AJSH 1P7QB 1XCQB 2XFYA 2KQMA 2A9NL 1FE8H 1H15B 3KPMA 3IRPX 2YFOA 2DKUA 1RUPH 3FMGH 5KVMC 2YPVL 4WEBH 3RY6A 2ADGB 2NZ9D 3PQYE 5KJRH 4KK8C 4N0FB 1ES0A 5B3JE 3OLDA 3PZOA 4U5IA 4Y4KB 5AEAA 3SE9L 4K7PY 1J5OH 1HE7A 1CL7L 4ZSOA 5I71C 2JALA 4PJ5A 3PABA 1OAYL 4G6AC 1C91A 5E8DL 4LLWA 3S34H 2JFEX 1BD2D 4X99A 1ZHNA 4UT6H 1RHFA 2B4CL 5KN5B 4QKXB 4QT5A 4OF5A 4BQ3A 3G6JF 4NHUB 5EU3B 4JFYA 1NGPL 3PV6A 3CZGA 3TBWB 3EZ8A 1U8IA 4Z0XB 3QFDA 4HFUH 3WO4B 1JYVA 3H3KA 4PP1C 3P4MB 5D9SB 5EG6C 3F12B 5HHOA 5I73B 1BBJB 1EGJH 1CD9B 4MNMA 3DX6A 3IKCB 1MPAL 4OCYH 5FAAA 1LP9A 4G9FB 2GITA 3VFTB 2A0LC 4FS0A 2ARJB 3SE3C 4TSCL 4DZBA 2AI0L 3MFFA 2UY2A 3E8UL 3WHXB 1W3JA 3P73A 3HZKA 3SCQA 3VSTA 1T2QH 1TZHB 3STLB 4KROD 1WAWA 3SDYH 1T1YA 2FWOB 1XEDA 4LSQL 5JOPD 4MAUL 4MNJA 3U7YH 5CZKA 2G3NA 4GFTB 4ZOEA 4X98A 3UP1A 2VL5A 2BZDA 4GBXA 3MLTB 3VGAB 1I1FA 1KB5H 5HJ3A 1WCBB 4ZQKA 4NZDA 1YEKH 3MLXH 1PJ9A 1C1EH 1UADC 1A9BA 3OA5A 2X70B 1AGCA 4M5YH 4V1DE 3WH6A 1XF3B 4MA3B 3RBGA 4YHKL 3K4ZA 2DF3A 3NA4A 5TPWL 3ZDZF 5J4MA 4LAJH 5CJ8A 3ZKMC 1RAMA 1FO0A 3ARPA 1DLFL 4PTUB 5I1JL 3UDWC 2DQIL 4MB4A 4JHZA 1MEXL 4O4YH 4KUZL 2XTJB 4B9YA 1QLRB 1T7VA 3MLZH 1I8IA 3MNVB 1MWAA 1JWSB 1LNUB 3S5LA 1MCDA 5KVGH 2EDTA 3F6IA 1HIZA 5J57B 1BD2A 1JK8A 4G9FD 2EE3A 2A3HA 3BKCH 3GUTA 4AD5A 4NQVB 4ZTOL 3MGTB 3L2MA 1MYRA 4NKOB 1CGVA 1R3IH 3EO0A 1BFOA 3L7FB 1FGNH 1BX2B 5C0GA 4P9MH 3CMOH 12E8H 3MRDB 2UZIL 1KC5L 1K4CB 2VDOL 5DZOA 4MCYA 2X09A 4Y5YA 1RFDH 3BO8A 2YD3A 1MQ8A 1KTLA 5D7LA 1CN4A 3X13A 4L8SC 1TTUA 3AMDA 3W53A 1JFQH 3TBTB 3T77B 2F8QA 1HSAB 1JL8A 1PLGH 3P4NB 4I3GA 5EZOH 3WJLC 4ELME 5BRZE 1E6PA 1R3JB 2IANB 5JNYB 3MV9E 4R6UA 4NT6A 4XTRD 4LQFL 1BOGB 1H15A 1ZLUH 1LF1A 3ZT5A 4JZNA 1CE1L 2ORBH 3MV7B 2IFFL 4OTXL 4MJ6B 1ZHKA 3I2CH 4GS7C 1QFWH 2CUIA 2DM4A 4UMGA 2VR9A 1GGTA 4JRXD 4ENEC 1RP9A 1CBVL 2Y4SA 1IGTB 2XTJD 1BZ7B 2CKNA 3BDYL 4LHUD 1XGTA 3B5TA 1T03H 1KWGA 1AQMA 2NW2B 5HYSG 3MJ9A 5CZXC 4WKFA 5I78A 3BUDA 4LVNC 5D7JB 3TEUA 4RISL 3WKMH 4PUBL 2JCCF 3FAXA 3EYSL 3UYRL 1K9EA 4OF6A 3V6OA 5IHSA 2IPTH 5EU3A 4AZGA 4GRWB 1K8DB 2XY2A 3TBWA 1JBJA 5FM8A 3TA3B 3EYUH 2JTDA 2GFTA 3LSOB 2UVEA 2XQBL 1JGUL 5F1KC 3IANA 2G5RA 1XGYH 1OM3L 3MLWL 4OKVA 3ARYA 4WY7L 1PVHA 4HWEH 5FYKD 3U0WL 2HVMA 3IKCA 3UTTE 3GJFH 1Z5LB 4G9FA 3I02B 1BG9A 4TUFA 5JW3H 2IAND 3C5ZD 1MJ8L 3SKMA 2Q8BL 2V2WB 5IG7B 4JFDB 2VN4A 1YYML 1FFOB 4GG6F 3AREB 1IVLA 4ZTPL 2UYLA 1FH8A 3VA2C 2HKHL 5IOPB 2VI0A 1SM3L 4EE9A 5A8NA 4N5UA 2OTPA 1NPUA 4MVBD 2C4FT 1HNYA 3VI3E 1CXLA 2HKFL 3CLEL 3VSUA 1UH4A 3VFOA 4JKMA 3WIHL 1NAKH 3MLTA 3QI9B 3RVUD 3CZLA 1OL0A 5D70H 3WEOA 4P7OA 2M2DA 3OGCB 1S3KH 3HS0B 1US2A 3CX2A 2BHZA 2D03H 5EU4A 5D7JD 4NZFA 1WCGA 4D3CH 1XF3A 3OXRB 2EDFA 1I7TB 4D6EA 5EO0B 4XCFL 3GHBH 2OJEB 1W9DM 4KKLC 4WI2A 1IV8A 4XPFH 2GK1A 3LZFL 3TA3D 5SWZB 1NUNB 5F21B 1OTUD 5JXAL 3MBXL 3WIFA 4JRXA 5I2IB 1A22B 2GKIA 5HBFA 3DPBA 4B41A 1AGEB 2X6MA 4HPOH 2Y9RT 2QQKL 3KPTA 3BZEA 4FOMA 4LHUA 3EYVA 5IMKB 2Y6SC 1F4WL 3PWNB 4FQQA 3PZTA 4KJYB 1N59B 1U30A 3H9SB 5GGQH 5BCAA 1NC4B 4NQVA 2V2TB 5J13B 4Z2KA 1LK3L 3C09B 3T0DA 3BW9A 4F9PC 4Z6AT 2BFGA 4GPNA 1CQKA 4NKOA 4E2OA 2PETA 4JY4B 4M8VA 2ZUVA 1M05B 4JFDD 4CGTA 3GB7B 2XN9B 3ARED 1PEWA 5HYSB 1CDYA 3MRDA 4UZSA 2DIBA 4YQXH 2HRLA 2C5DC 3PL6D 5A2AA 3AXHA 4PJ9C 2DS4A 3ARDB 8A3HA 5TFSL 1PSKL 2VDQL 3ZOAA 2F7OA 3QI9D 1HSAA 3MUAA 3P4NA 5T5FL 4Y19E 1R3JA 2IANA 2Z31C 4XC1H 1YY8B 5JNYA 1KIPB 3C5ZA 3ARGB 4YN5A 3MUJA 3TV3L 3U2SB 4BS0A 1BOGA 1INQB 4PJBE 1I1RA 4UAOC 2WIIB 1BEYH 1EEUA 4X6BB 1XGUB 2GSJA 3NN8B 3IB4A 3GMPA 2Q1EA 4XB7A 3HC3L 5KOVC 4KXZI 5JPMB 5SWZD 4FNUA 4E9LA 5JIIA 3MSGA 4H5SB 4PJAB 4QF1B 1E73M 4MS8D 1WO2A 5MERA 1NWRA 1BZ7A 3O6LL 3EO9H 1HNGA 3VFWB 5E8NA 1BQLL 2H2SD 3WL1A 4M9PA 1AIFA 5JW4Q 2NW2A 3CFEA 3MRRB 3GHEL 5D7JA 3BRFA 2AGJH 1OPGL 3BAEL 1HKKA 3V5KB 2APTA 5LQBH 2BSTB 3QPXH 2B0SH 1K8DA 2AV7B 3TA3A 1WAAA 4JFHD 3LSOA 3VXSB 2XN9D 5I19H 5EOCH 2IBBA 5LJYH 3NIDF 5DURB 1JWMA 3ARDD 2CDFB 5C7XL 5SWQB 1ZA6A 3BPLB 4L8CA 1Q6DA 4UIMA 1I85C 1H5BA 2AJYH 2SEBB 3QBTB 5HTSA 3VWKD 1OSZB 3I02A 2HT4D 2FECL 2VUOA 3LRLA 2P5WD 4C58B 3WSQH 3P9MB 1U8MB 4MDJB 5A40E 2V2WA 2VXQH 5IG7A 4JFDA 4M1GL 3PHQB 1XYFA 3AREA 1JHTA 3MNZB 4IOFC 4L8DA 5IOPA 3DTXA 1UZ6F 2D4FA 4N8PA 3VDBA 1JNLH 3PL6A 3TO4B 4ONHA 4DEPC 4UT7L 3D25B 3AC0A 1YHTA 2W5FA 4HDIB 1JUFA 1N5YH 2L7UA 4HUVB 1AKJD 3BPOB 3QI9A 5GISH 1OGAE 4HEME 3OKKA 4YAQB 2Q8AH 2I60L 4UTFA 3RWDB 1FZKA 4X6CF 5FYLD 3T0EE 1I1CA 1ECEA 4PSRA 3WLBA 2D31A 2H3NB 2BY1A 1KFAL 3BCFA 2JB6B 3W4RA 2YA1A 5AYUL 2OJEA 2BERA 3ZL4L 1JRHH 5SWZA 1YNKL 3EOAA 2XGBA 2EPMX 2FDBP 4RFOL 1LL4A 1U95A 4KY1L 4I48B 4D71A 5IVZB 5I2IA 2R9HD 1RZFL 4L1HA 1AGEA 5FKPB 1JPST 2AQ1A 3M8OH 1NCDL 1INEL 2I5YL 1JZ4A 4KJYA 1J8HD 1TZGL 1N59A 1KV3A 2IPUG 3H9SA 5GGTH 5GZNC 1HKLH 1V7ML 1XIWB 4P7QA 1A0QH 4K9EC 2OWCA 4F7PA 5E9DB 4MA7L 4AYSA 1M05A 2YK1H 2PXYD 2XN9A 3C8HA 3S37H 5TF0A 1FQ9C 3PP3K 1ZWIA 1MFNA 4Z7WA 4IM8A 4AW7A 2WQRA 3B3IA 5KANI 4GAGL 3ARDA 4R0LB 3WMBA 2ILLA 1KJ2A 4JG1L 5GQBA 4EKJA 3OKYA 2OI9B 3F58L 4OLYH 1JPSH 3VWKA 4EVNB 3BE1L 3MV8E 3BIKB 1VPOL 4HXBH 4HOWA 5IB2B 3EW3B 5F6IB 1VBUA 3U2SA 1G6VK 1V3JA 1INQA 5EZLB 1II4E 4O2EB 5ACZA 4X6BA 1XGUA 1N8ZB 2CPCA 3FB6A 3NN8A 4ZO6A 3TF7C 4ZEPA 2QV4A 5E2UH 5GGSB 3A24A 2B31A 4K3EL 4QF1A 1SZNA 4HIHA 2FATL 4QGTA 1AKJA 3HG1D 4HK3J 1KXHA 2AEWA 4PMDA 4KHXH 4KV5F 4JL2A 4XXCA 4UQAA 1C93A 1VDGA 3MRRA 4CN4A 2BNRD 3HMWL 1P6WA 1FVEB 4RE4A 4HUWA 2IWGA 4NWUL 3DI2B 4XP1L 3CTTA 1TZIB 3UX9B 3SUUA 1XIWD 5JXEC 2AK4B 3D5HA 4QHMB 3UERA 5E9DD 4KQ4H 4PB9L 5A8OA 4OZHF 2G9HB 4GKNB 3WQ5A 4FNTA 3U9PL 2IF7A 4J4PC 1KBKA 3D9AH 4R8WL 4JFPB 3QG6A 5H35A 4Z95L 5J12B 4QOKE 3RWEB 2CDFA 5SWQA 4P8WA 2P42B 5BS0B 3WUGA 1E40A 2SEBA 1OCQA 2OMNA 2VZSA 1TQCC 4YXHH 1J8HA 1T1ZB 1IKFL 1X5JA 4XX1G 1R5WB 4LSVH 2V38A 3MUY1 5D1XC 3U7AA 3BD3A 3ZIZA 3LQAL 1YEFH 2CMRH 2FX9H 3OR7B 4FFWD 3VFVB 1U8MA 5IVNA 2PYEE 3TJEH 2F8XC 1E6NA 3IU3A 4PJGB 4RE2A 2PXYA 5GS1A 1S8DA 2D9CA 3C2AH 3MNZA 3X3FL 4S2SB 5F97E 5ACMA 3FOLB 2A77L 4P4RB 4PJCE 1CG9B 4DUXA 1JZ6A 4U33A 3U5UA 4QAWA 4OFKA 4HDIA 1WNOA 4HUVA 1T21B 3S6TA 2P24B 5GS0C 1BREA 2BVQA 1DSFH 1V5JA 4YAQA 3RWDA 4W93A 25C8H 2GT9B 1NCWL 1QVBA 3GMRB 4BKLB 1JP5A 2H3NA 4M43L 2R69H 2JB6A 2BOCB 2VDMH 1YNLL 2HTLC 5F9OL 4NM4L 4S1DD 3DBXB 4D6CA 1CT8B 1A7NH 3Q5YA 4OB5L 4X9HA 1R8LA 5IVZA 2HTKD 3TYFB 4ALAH 3HG1A 5DMKB 2YDRA 4LK4A 2O5YH 5FKPA 3K7UA 5EMYA 1UD5A 1MAKA 1Y6NR 1NUDA 3U9UB 1QRKA 3FNDA 5C07E 2BNRA 4M1DL 1RQ5A 3L95B 4NKDB 4YJZL 5MEOA 2EADA 4WF7A 1XIWA 3ULVH 1X5IA 5AWNH 5E9DA 4JQVA 1QLEH 5DFAA 2PW2B 4NN5C 4NRYB 1KJ3L 5INDB 4MDPA 3HR6A 1Q94B 2PF6A 4U6YB 1DQQB 1E6OL 3VG0L 2Z8RA 2ZCLH 2WBWB 3QFJE 4R0LA 3ZR5A 4KZEL 1VESA 3V8OA 5I1GL 3OXSA 2GYSA 3BHBB 3IDGB 3ISWA 4E41E 4EVNA 1AD0B 3HFML 4GUPB 5IB2A 5C09D 2FX7H 3O9WD 2F61A 1OT1A 4O2EA 1AJ7H 5KVEL 3T8XA 2J74A 1D9KD 3BLBA 1PS3A 5DJXB 1MVUB 4Q6IC 1QUNA 5D1ZB 4RIRB 5GGSA 5DD0L 3GSVA 5FYJE 3SGEH 2WSPA 3ULUE 4AZ7A 2PO6B 2HT2C 2XG9A 3NABH 2FIKB 3QZWG 4UBDD 1Q9LA 3OMZA 5FUOH 2P7TB 3NBNA 4OIBA 3CH1B 1ITXA 4YHIB 3LEVH 3GMOB 1NGWB 3X17A 5BO1H 5I79A 3E2HB 2CSPA 4OLZH 1CGUA 1FVEA 1NMAH 2NX5E 4AZ5A 4S1RL 1JGLL 2NYYD 3F7VA 5MENE 3LD8C 4JQIH 4Z2LA 2AK4A 4IRZH 1QR4A 3ES6A 4YO0B 2RB8A 3ZKXC 3H42H 2A3CA 3C2SA 3K8MA 1A8JH 2GTZB 4RWYL 3QG7H 4XPGH 3W5NA 4JFPA 1IC5H 2W9EH 1IEHA 3V6ZB 4L9LC 3RWEA 5E0FA 3FFCB 3OV6A 4WFGD 6FABH 2PB1A 4OF3A 2O9RA 2R0LH 5HDQH 3TPKA 1NDMB 1KG0A 1FYTD 3VFVA 2OSLB 4R27A 4PJGA 2FCBA 3BPCB 1E4IA 2NY3B 4HBQA 4LAQH 4KMTL 2C3WA 2QQLH 5GGRB 1CG9A 1T1WA 3ILQD 2FX8H 5EIVA 4TOYH 1GOWA 2PO6D 3RWHB 4NXSA 2P24A 2R1WB 3CZKA 4NSKB 4EI5C 3HB3D 3TZVD 3G9VA 1DQTA 1G9HA 2GT9A 2G4FA 2OJZH 3O9WA 4OZFG 2C7UB 3DUSB 4HIXH 1RP8A 3GMRA 5CZVH 2J88L 3TT1H 4MDIB 2ATKB 4ISVB 5TQ2H 1RZJC 1C8PA 3M7SA 4W7VA 1NBVH 1AVAA 3Q6FB 4TSBL 1WFUA 1CT8A 3PJSB 2J6EH 3EJTA 5CSYA 3SJVB 2YD9A 2Y36H 3BIBX 4W68A 5TDOA 1B4JL 3TYFA 1MRFL 1IAIH 2XZAH 5DMKA 5C6PB 3HN3A 7FABL 4PRHE 1E27B 3VIKA 3A4AA 2QPSA 3FFCD 3I84A 1YUHB 2VRQA 4ZO7A 2HJLB 4ATDA 1J1XL 3MGAA 5EO1B 4Z7NF 3L95A 4NKDA 1EAJA 1OD8A 4D9RD 2WAGA 5IHRA 3MBEB 4XPBL 2AABH 1GAFL 4ZE5A 3NAAH 4NRYA 4MJID 2F54E 1BG4A 1Q94A 1EA9C 2BFVL 4U6YA 1DQQA 4NX0A 2BP3A 2NR6C 4ODUB 1KQZA 5KS9B 2VT0A 5ITFB 3QQNA 5EU7E 2XKUA 3IXTB 2V7NB 1W0VA 1NGQH 1J87A 1HN1A 2JJTA 1U8PB 3JXAA 1UKTA 5BXFB 3OHXB 2BJML 1AD0A 1FYTA 1I8KA 3RKDD 4GUPA 4Z5RA 3KWWB 2O9OA 5IQ7L 3OPZL 3DUUB 1UWGH 1OGTB 2XZZA 1A7OH 4U1GB 4I3RL 5DJXA 5H2BB 2P5EE 1MVUA 4PS4H 1GQLA 3BVXA 2ZUNA 3EJQA 5I1HH 3SJVD 1KN2H 5HVFB 1DQDL 1TJGL 2DLFH 2PO6A 2FIKA 3DXAD 4RZCB 1N6QL 3D4ZA 5M03A 2P7TA 3QUXD 3MRIB 1CDBA 4YHIA 2VC9A 4YGVB 2ICWI 3HI5L 1T0NB 4CMMB 4A4AA 1UYQA 1CLYL 2YBTA 4Y16D 4MAZA 1HXMB 4FXGB 2OP4L 2R15A 1FZOB 2VKWA 1O6IA 2RGLA 4ODHL 3MS8A 3BZDA 4F2MB 1E3ZA 2EYRA 1FSKB 5TDNB 4YO0A 4UQ9A 4V2BA 1MQKL 4YHZL 3FO1A 1QSEB 1N7ML 1IJ9A 4BZ1H 1S9YA 3BEVA 3EYQC 4OZFB 5EORH 2GTZA 3TIDA 3MO1B 4PBGA 3MA9L 4TXEA 2J8UE 3FFCA 1E1FA 3J8F7 3WF4A 1P7KB 5MEQB 1MJ7H 2Q7YB 3MOQA 4KVCL 2QLVB 1K3ZA 4V2CB 1OAKH 1GOIA 1CFQA 1FJ1B 3VU2A 2V5DA 2OSLA 4J3VA 3TTQA 2QV2A 4NGHL 1XSKA 4UOJA 1JI2A 2WVVB 2ZJSL 1FAIH 4MJ5B 1U3ZA 1OTTC 4OFDA 3ZKSD 2W0PA 1HJWA 2A38A 2B1AL 1AMYA 3DETD 5SV3A 2YXMA 2PC8A 2I9LB 2R1WA 3BSZL 1UJ3C 5T3ZE 3DVFA 2W0LA 4LCUA 4YH6A 1A6TB 4IUGA 4PRID 4NF7A 3AQUA 2C7UA 3O0RH 1NKOA 2EH7H 2XWBB 1E70M 1ODUA 1HH6B 1Q0YH 1JHKL 1FHDA 4WWKC 4WI6A 2F7QA 3HMXH 4MDIA 2ATKA 4ISVA 2J7EA 3EMQA 3G9AB 4TQEH 3GMLA 5C0IA 3HG4A 3Q6FA 5EBGA 2H6PB 4I0CC 3PJSA 1DBJL 1QNZL 3SJVA 4CMHB 1KR1A 4NKMA 1U8QA 1YN6B 3DXAA 3RVVD 3P0YL 1VF8A 3PNWB 4QEGA 3MJ7B 3QUXA 1FIEA 1G7QA 1E27A 4FP8L 4X7SL 1U8JB 3GNML 3LRGA 4XWOD 3P9WB 1YUHA 4NHCL 4Y16A 2N7AA 3VA6A 2HJLA 4GW4B 4G9DB 2JCCE 5IV2B 2DQFB 3QQ9D 4K7PH 5EO1A 4FZEL 3D3VE 3OLIA 5BQ7B 1PYWA 4BH8B 4OF0A 1FFNB 1B4RA 3MBEA 5E09A 3C08L 4YK4B 2D23A 1FPTH 4NNPL 4PG2A 3I9GL 5ICYB 4AIUA 1CGSL 4WU7A 3T3PF 4LARL 4JL1A 5IHUL 3GDBA 3H9ZA 4AMKH 3HC0B 1P1ZA 1W2PA 3RY5A 1PEZA 1WDRA 2VRKA 4FFVC 4U6HA 5J06A 1J10A 4HPYL 3LPFA 1YZZA 1DVFC 1U8PA 2XI9A 4YBLB 5BXFA 2C3VA 1AH1A 3WD5L 2YL8A 2VZVA 1YJDH 4JFEE 3KWWA 5JHDE 5DQ9B 3DUUA 4DUVA 2VLRB 1OGTA 5JO5A 4GG6E 4XB8A 5FYKU 5L0QC 1NCUA 4PJHF 2BVPB 3FO9B 2X4PB 4KRPC 4JRYD 5H2BA 4ZUSB 3PDDA 2NMSA 1C3FA 4GIAA 2JJUA 4RZCA 4MQTB 2F19L 1PFCA 2H9GA 1Z6JT 4CMMA 3D39D 4PMOA 1T0NA 4Y5XC 5D8JL 3LB6D 2FGLA 4PRIA 1PBGA 1EEZB 1J1PL 2OTWB 1HXMA 4FXGA 1SY6L 5ALBH 1JIBA 3VGGA 4MTVA 4X6DA 1D2KA 3O3AB 4JKPH 3LX9A 3O6AA 5CGMA 2LTQC 5TDNA 2O5XL 4EJ1C 1IM9D 2W0FA 2X40A 1X5FA 2ZIDA 1LO4H 1QSEA 4MNGE 2OYKA 5SX5K 2OWXA 1F00I 4OZFA 3U7BA 4M61B 1IE5A 4KHTH 5KBNC 2QMJA 4MA8L 1PX4A 1T7ZA 3RZWA 4C54A 2YD6A 3BT2L 1AXSB 1T7YA 1P7KA 3GXPA 3FRPG 5I71B 3QA3A 2Q7YA 2GJRA 3WH7A 2GJPA 2AKRB 4M1CD 2ZOKB 4ZS6D 4ZUUA 2EXYD 4L3EE 1ITBB 3EDFA 1UEYA 4MQSB 5E8OB 3X3GH 3DVGB 2MHAB 1H49A 4N8CH 4OGXL 1CCZA 1GHSA 1W0YT 2WVVA 1G6RH 4FQIH 4CD6A 3HI1B 3QQ4B 4MJ5A 4EOWH 2NY5H 4KUCD 3QXDB 3U4EB 5IROC 1MW3A 1K4DA 3DRQB 2V3EA 4WTWA 4NBXB 4Y5VC 2OZ4H 2UY4A 3NPSC 5JQ6H 4A6YL 4ZFFB 5DJZB 3BN9D 3OJVC 2I27N 3SKUD 2ZUWA 4QHKJ 4HULB 2WBKA 5E8PB 4GH7B 2VISB 1R0AH 4L4VB 2XWBA 1HH6A 4JFTA 3PZGA 2VLKD 5DEGB 3MYJB 4JRYA 4KPHL 4NQDB 5I24A 2B7DT 1KNOB 1A6WL 4HS8H 1ETZB 4KVNH 3P3YA 3VG9C 3VXME 5LXGH 3H54A 1YN6A 2XIDA 1SEQH 1GGUA 1NBZB 4LCYB 3RUGF 1OB1B 1EHLH 4U3AA 3D39A 1MCQA 3QEQE 1ZLVK 4QLJA 1UYWL 2YKKA 4GW4A 4HJGA 2ZKHH 1V7NL 5L8LB 5BQ7A 3KR3H 2E8YA 4J3TA 4BH8A 4WHYH 2PTTA 4G6AD 3B2VH 1FFNA 4KU1A 3T0EC 1FG2B 2G5BA 1WPCA 1BBDL 1IM9A 2J5LC 3NH7H 2XPGB 1QZ1A 2EDEA 2PR4H 3CHCA 1W72L 3NIDE 3B83A 4K8RC 3HC0A 5C0AB 2XKNB 2JF6A 3QUMB 3H55A 4P57A 4YWGH 3LS5L 1GYAA 1NFKA 2NNAA 1CFTB 1JNHB 2BSRB 2X2YA 2N1KA 5J6GB 2B39A 3ULSB 2DQUH 4XC3H 2DTSA 4L4VD 3S97C 4O5LH 2VLRA 1CDJA 4XVTL 1EVTC 4QRSA 4HFWB 3FO9A 3H3PL 1UZ6E 3KL3A 4ZXLA 1JN6B 1HT6A 1RJLA 2JEPA 3EYOB 2F74A 1TTFA 3NCYP 4WFHD 1A3LH 2D73A 5D8WA 2OK0H 1E4WH 3HG3A 5E5UB 3U7VA 2E6QA 4JG0H 4L8SB 4RMVA 4DVRH 1EEZA 1RULL 2OTWA 1NDGB 5D2LB 1XCWA 3BN3B 3MV01 3PP4H 1PG7H 4P46C 4HQQL 5CILH 5LGHL 4I0PC 3GSQB 2D0HA 2F15A 1DQLL 4KJPC 5CD5C 1N4XH 3KHQA 1YN7A 4IDJH 4M61A 4DOHE 2CKBB 4KXZH 3ZKMD 1UD4A 2DWEA 4PY7B 4GS7B 1IQWL 4HS3A 3CC1A 4D6HA 1AXSA 4HP5A 4QRQA 4YHGA 2F8OA 4S1SL 5I1LB 1OSPL 4RE3A 3IDXH 5EIIB 2ZOKA 4ONOA 4LX4A 3LV3A 3W2DH 3T0XA 1YEIL 3HR5A 4U49A 1N0XH 2BNQB 4LVNB 1WDPA 3TBYA 3MRKB 3PZIA 3HI1A 3RWCB 4XVSL 1Z9LA 4WUUE 5GRXG 1MRDL 2OTUB 4OCSL 1YYLL 1NOWA 4QHNA 5IT2H 4JZJC 1MW0A 5EU6E 3U4EA 5D4QA 1DQJB 3CVHH 4BSVB 4WJ5B 1CGXA 3EOBB 5F9WC 4RBPK 5KSUA 5DJZA 4JO2L 2I9TB 5E8PA 1GCYA 2NW0A 2VISA 4L4VA 5F71A 1Q6EA 2HFTA 2X4TA 1AXTH 4W5ZA 3WFHA 3O4LB 4LNRB 3GO1L 4JPIB 1G7PB 1KLGB 3PBGA 4R90H 1M04A 2CNCA 1BQHB 1KNOA 3CU7A 1ETZA 2YPKB 3WEMA 3FT4A 1CU4L 1L6XA 3MNWA 3S9DB 5KEZA 4KV5E 1GOGA 5FCZA 5C6WH 2H8PB 4L4TB 3GI8L 3TNNA 1VHPA 5D5MF 4PRNA 4W85A 5HGDA 2IAMD 4BZ2H 1J9YA 3EBVA 2VH5L 1WZKA 3B9KC 4B7LA 3H7BB 1HQ4B 5L6YL 5CZXD 1UKSA 1FG2A 1T1XB 5F9JA 4OZHE 3ZDYE 1ZVYA 3LKNA 5L9DL 4F15C 1KIRB 1YEDA 3F7YB 1MUJB 3D2UD 5JIWA 2R0WL 2JIEA 5C0AA 1E55A 2AS5M 4XZBA 3GSOA 5E08H 4AY1A 3UDWA 4FQ2H 5EOQL 3KYAA 1K6QL 2AJSL 4PJ7F 4Q9RH 1FE8L 2R1YA 3CCHB 4POYA 1JNHA 2BSRA 4PTVA 1JTPA 3NCEB 1RUPL 4FMFA 3FMGL 4AWEA 1H9VA 5BROA 2GQHA 3O9NA 3NTCH 5KJRL 3WE6B 1JE6A 4AISA 3QDHA 4KI5C 3O4LD 3U4AA 5ICXB 4JO4L 1J5OL 2AAAA 4MX7B 3E6FA 3F7QA 5IM7B 1F8TH 1UXSA 3A6CH 2CKBH 3EYOA 1E6RA 3B9DA 3TBSA 4TTDC 4NRRA 4QRRB 5SX4I 4P3DB 4A2LA 4PJ9B 4UT6L 3VKKA 1PIFA 4EXPX 4U7SA 3RHWF 4QWWC 1NDGA 5D2LA 2QQNH 3V6FB 2R23B 3GXMA 3WJLA 3LMJH 4HFUL 3CFDB 2Z31B 1H2JA 1OGSA 2J8GA 4OQTH 5E4IA 4G6KH 2DDQH 2FYYB 3EHBD 4OD1H 4ETQA 4NOFA 1EGJL 4UAOB 5C2UB 2ZUUA 2A6DA 5FYJH 3DX4A 3B6SA 4PUDA 5BJTA 4PY7A 1Y18B 1AGFB 3WFEH 4J8RA 4CRPA 3BESR 3GSUB 4P2QB 4MAYC 2HAZA 2IAMA 1BVKB 5I1LA 3ULUC 1PKQE 1T2QL 1BFTA 5EIIA 2OL3B 3QO0A 1LO0H 1OVZA 2A6JB 2EEAA 2PCPA 3SDYL 1QVOB 1LK2B 3PWJA 3ARVA 3RTQD 5T5NG 1TJIH 3L6FB 1MHCB 4KKCD 4NKIH 3T1FB 3MRKA 5B8CA 4OV5A 1OD9A 3SQOL 3RWCA 5IB5B 4IIQA 4HGWB 5CEZD 2DLTA 3SY0A 4LRIA 3D2UA 3MOBH 1KB5L 1M1SA 1MOEA 1U8KA 1YEKL 3MLXL 1GNXA 4M80A 1C1EL 4BSVA 1MCRA 4RNRB 4N8VB 4WJ5A 1BF8A 5C3LD 3T08A 1W1TA 3EOBA 1UZ8A 1NUFA 1PD6A 3FN3A 3NZHH 2I9TA 2BK8A 1XT5A 1LQSR 3IDJB 3RAJH 3VXNB 3EYPA 3I75A 2X0HA 5FEBA 4G6ML 3O4LA 5DD3H 4LNRA 3O3EB 4H1LG 1G7PA 1KLGA 4DWSC 4O4YL 3PUCA 1AR1D 2Z91B 4E0RB 3MLZL 4TOQA 3G08B 5LCVH 1K5NB 1QBAA 2WCGA 1AO7B 3U83A 1BQHA 1JYXA 5KVGL 3SN6N 4NO0D 1LWHA 4FQPA 4RGNC 1EO7A 4JRWA 1R5VA 2ZX8A 4DEPB 1UKPA 4O2FA 3BKCL 1AI1H 2H8PA 1G9EA 4L4TA 3VDHA 4BSJA 1CQYA 1ISZA 1YDPA 3ZJ6A 5C8BB 4IPLA 1F4XH 1R3IL 1FGNL 4P5MB 4B9ZA 4P9ML 5FV1L 12E8L 3H7BA 1HQ4A 1YA5A 3SDXB 4PJXF 4HGKC 5FOOA 4OZGF 5H37G 2RAMA 2BVDA 4QXTB 1G7JA 5C0EB 4QRPB 1JFQL 2IQ9H 1MUJA 4S3KA 5EZOL 2VZTA 4KK5C 5HYQA 4AD3A 5HI5C 3KLLA 3W37A 4FNSA 1GONA 4LKXA 1ORQB 2FBJL 2YA2A 4D9QD 1L7TH 1XMWA 1M6OB 3IKKA 4W7WA 2GI7A 1YEGH 1BVLB 3RTQA 3PDOB 1WZ1L 1BPVA 2WMKA 2ORBL 2EEDA 3RPMA 3I2CL 2DL2A 1QFWL 1SMOA 3N1MC 4KUCF 1YQ2A 4LQ1A 2DN7A 1B6DA 5KAQF 5SWSD 3CZSA 4M29A 4WTXA 1ZB5A 1AO7D 4M6NH 4G43A 1XGRA 1L4IA 1UKQA 4PBVC 4KJQC 4IOFD 3BH4A 3QEHA 1Q38A 3WKML 3EZJB 5EWIH 1QYGH 3W39B 5F7UA 5FGCE 4HSQA 3VCLB 4Q9BA 4C57C 2IPTL 3PDGA 1NP2A 1HJUA 2V2XB 3OG4B 5EU7C 4BFEA 3EJZC 3G5VB 5JBFA 2XXCB 3V6FA 2R23A 2OSWA 4JFZH 1WWWX 1Z9SA 4GINA 3CFDA 4KK9D 2J7CA 5A16B 4XNYH 1AE6H 2WC7A 4Y89A 4Z76B 3BD5A 5AY7A 5ADOH 1NFDE 1S7SB 4N0RA 1EO5A 3LRMA 1GXEA 2Z1SA 4RCAA 3MCKB 3WD1A 4DFHA 1F3JB 4YFLF 4XV0A 5CJXC 1ZGLB 3N06B 1Y18A 2WK2A 3QEGL 3DV6B 4H1LB 3F65A 3SGKA 4JEGB 3TO2A 3GSUA 2W63A 3QHZL 4P2QA 4DO6A 4PV8A 4QTHB 4Z7NE 1BVKA 1QO3B 5EUKB 1JGEB 2OL3A 4WO4D 3O2DA 1WBYA 1QVOA 2IJ0C 3L3OA 5EULV 2R56H 5HYEA 3F5WB 4BSWA 1MHCA 3UC0H 3ARSA 4OLVL 5HI4D 3T1FA 2X05A 5C0RH 1XYZA 3L5XH 5HHVH 4F37F 5DTFB 4HK3N 5ID1A 4HGWA 5BW7C 4MZ2A 3QSKB 1NAKL 4XZUB 2AEQH 1E9LA 4PN2A 3VOCA 1DBBL 4BQCA 1TNMA 3P4OB 3RIAF 5FB8B 5D70L 5EBLA 1VEMA 4NC1C 1UXWA 2EE6A 4BK5A 1S3KL 2X1XR 4LLQA 1IKNA 3FT2A 4K3JH 4KK6D 4N8VA 2D03L 3MMEA 3VUPA 2ICWB 2P46B 4DKDC 1A6AA 1FH5L 1I85A 1N6UA 3WCYA 4GRLD 4XPFL 3VXNA 3IDJA 1R3HB 5IIEA 1TQCB 3MXVH 4U05A 3PWVA 4KGJA 4MSWA 1WT5C 3VFNA 1PY4A 3PE9A 4HWBH 4XMKH 3O3EA 4Q9QH 1T80A 5D1XB 4YPJA 5L2KB 5GRJH 4Q7NA 2Z91A 1SJEA 5SWSA 1WKYA 5HYJD 5AC5A 4OIAA 1N82A 1U0QA 4HPOL 4PD4J 1K5NA 1AO7A 5DMYA 3LN4B 3V4PL 2QADC 3WD3A 1DANU 1Z2KA 4HBCH 3CSGA 4WFFD 2IBGA 5SV4A 2WCAA 4MQXD 3RZCC 2VDRH 4CD5A 4BUHA 2C7FA 1DBMH 4LPCA 5GGQL 4ML4A 3B2UC 2XQYK 5F93C 3GH4A 4HKZB 3ARFC 4LMQI 3SDCC 2R8SH 3WL0A 4TN9A 5E95B 3VXRE 1MLBB 3ZHLA 5E56A 2OMBA 4X4MA 1GUVA 4X9GA 1RY7B 3O2VL 3VRIB 4YQXL 2YN3A 3KPQA 3FJTA 3C87A 4M03A 1CLXA 4G8FB 5F7WC 1ZS8A 4G8GE 3TCXA 4L3CB 5JXED 4WSKA 3UTOA 2E7LC 4IBLT 4XC1L 4B7IA 1CD1B 1WWCA 1LL6A 1A21A 4WW2A 1N64H 4WO4A 5IB4B 1W2KT 4JFFE 5E00A 1BVLA 2XY1A 3PDOA 2NZIA 3Q1SH 5CEXA 1EBAA 1K3IA 3BLKA 2G75B 4O02L 2HFEB 4XHJC 2YKLH 3LXAA 5L2KD 2ZXAA 3AXLB 3B9AA 2AP2A 5DJ2B 1PZ5B 5IR1B 3CZNA 1P4LA 3EO9L 2VVSA 4PJIA 4L8BB 4MCZA 1GOKA 1DEDA 4NN5B 4GAYB 3CIVA 4WI4A 4Z7VE 1CTOA 3DNKA 3Q5OA 4OKDA 5ANME 4F7EB 4H1LH 2AGJL 1S7TB 1F5WA 1GZQB 3VCLA 2GTWA 5LQBL 3THCA 43C9A 3QHFH 3QPXL 4GRLA 2B0SL 5TF1H 1CGYA 3G5VA 5DYOB 1FC1A 3L4TA 5I19L 5EOCL 5A16A 3GBDA 1JPGA 3VH8B 3BMWA 1A4KB 5IVXA 1EX0A 2RQ8A 4Z76A 1S7SA 5DRZB 3WLWC 1CVRA 2MQ0A 2CITA 4Q6IB 4JQXC 3VXUB 1ZJBA 1ZGLA 4PJDF 3WUWB 3L3JA 3OF6D 3C5SB 2VAAA 2B4CH 1EVUA 3DV6A 1QHZA 2K9UA 4HIIA 3IGAB 5H37H 3V2AR 3C9NB 2YEZB 4QTHA 3WSQL 1QO3A 4N5EC 4M8UA 2VXQL 4W8LA 1FFRA 1B3VA 3D0LB 4Z7UF 4MNQE 4Y2DC 4R7NB 3QAZC 1JNLL 2CXKA 2VQUA 4LSRL 3DHJA 5DVOA 1HWHB 5DTFA 3MUGB 1NC2B 3LD8B 3MRPB 1MPAH 1N5YL 5JXEA 4XZUA 5LA1A 5GISL 1R46A 3P4OA 2Q8AL 4ZPVA 5E1AA 5B39G 3ZKXB 5FB8A 4PJEB 5F89B 1QBLL 1CXIA 3ULVD 5CKAA 1FNGA 3PQYB 4L9LB 5FDWA 2K3TA 1UWIA 3CJJA 3OKNA 5CJQH 2DJ4A 4MAUH 1JRHL 4GKLA 4PJHE 2J8FA 5F7MC 3CC5A 5L2KA 1ULVA 5GRWA 2QSTA 3S88H 2X5PA 4MLIA 4K3DH 1JVKA 5E0QA 3ZE0E 4XMLH 3LN4A 1GL4B 1WFOA 1QFUH 3M8OL 1NMCC 3VMNA 2YD7A 1UR8A 4E5XA 2DM3A 1V6WA 5D4YA 2OSYA 4YBQD 3QT2A 4J12A 1HIMH 5CCKH 5GGTL 3PHSA 2A83B 5ILTH 1KN4H 4OZIE 4HKZA 1ZLWK 4L9DA 3RA7H 5I1JH 2YK1L 1MLBA 1OY3B 4QNPF 4EI5B 1TQSA 2C1OB 2VITB 4KUZH 2WUCL 3T2PA 4K7PX 1MI5E 3MJ8A 5EFDA 5KSAC 2J47A 4G8FA 3IJYB 1NC2D 2DWDB 4F66A 4QRTB 5IFTA 5GIRA 3F5JA 2V5YA 4OLYL 1JPSL 2E40A 4HXBL 1AD9B 2DQHH 3UR8A 3GFUA 3QDMB 4YR6B 1KGCE 1CD1A 4X6FB 1ISVA 3K3QA 1WLHA 2X4QA 5IB4A 3PQYD 3V5HA 2ZUSA 2UZIH 4HOXA 1ZBCA 3APGA 3UJTH 1GPFA 1OW0A 4HIEA 2HFEA 2LAGB 4HJ0C 2WMGA 2MPAL 3KE0A 2JF7A 5DZNA 5CJ5A 1TCMA 3AXLA 3WD4A 2JJVA 4ELKB 4J3SA 1S7WA 4KHXL 5DJ2A 4WCYH 5CEYA 4L8BA 2QL1A 5ALCL 3DROA 4F7EA 1ZK9A 3BKYH 4LQFH 4HU8A 1S7TA 1GZQA 3G5ZB 3BLPX 5K59F 3D3AA 3NACH 3ZO9A 1IAOB 5A8MA 2X42A 4KQ4L 5GZOC 5B39B 5IJVB 4ZDHB 4EI5D 2V7HB 4OAWB 3OAZK 1HKIA 4NQSB 1CBVH 3D9AL 3QUYD 3VH8A 3BDYH 5AAWA 1KPVB 3WFCH 5DRZA 3W24A 1BSIA 4KGLA 4YXLH 1FOBA 4FFZH 5ESQB 3VPLA 2WBJC 4Q6IA 3ARQA 4YXHL 3RUGE 5I15H 4NN6C 4HZ7A 4GRWF 5H8DA 3WUWA 1PPIA 4LSVL 3PHOB 3IGAA 2RFXB 4JPKH 1YEFL 3BH9B 5CPSA 2YEZA 2CMRL 2F5AH 2FX9L 3TJEL 2XQBH 3D0LA 5F88B 1A2YA 3C2AL 1B0GB 5EU5B 3FAWA 3N1AA 1OM3H 4JVWA 5C0FB 4WY7H 1BZ9B 4OGYL 3MUGA 1K9DA 1NC2A 2NZ9C 2J3SA 3ZE1E 2YD8A 4U3HA 3MRPA 1ZBWA 4U6XB 3OZ9H 1HILA 2DBLH 1YPZF 4NIKB 5BWFA 2XRAH 4G6JH 2ID5A 4V1DD 25C8L 3F62A 1W91A 2DT2A 1TETL 2R69L 1I1AD 2F1AA 3ARWA 4PV9A 2WP3O 3PQYA 4L9LA 2HMID 3W0KA 1RD6A 2HKHH 1DN0A 1SM3H 3I6LD 3HPLB 1NM9A 2Y06L 1WBXA 2A6KA 2FEEI 1A7NL 4E8DA 2HKFH 3WIHH 3O4OC 4AIEA 3CXHK 5E24E 4ALAL 3HG5A 1GSMA 2E3VA 3FO2B 2O5YL 2W38A 1BAFH 2FL5B 4OLUL 4UCFA 3LAFA 1EQPA 5CPQA 4XCFH 3BPNC 3ULVL 3LIZL 5AWNL 2C3HA 3ZYIA 1UJ3B 4EI5A 4HHAB 2C1OA 5F7KC 1SBSH 5D7IF 4ZUTB 3QUYA 4LHJB 1MAJA 4KROC 3HAEG 4AENB 3ECQA 4WWKB 3UTTB 1EBPA 5E9AA 2NY1D 2DWDA 1FV1B 5BRZD 2WC4A 3MC0A 4QRTA 4XNXH 5AZ2H 4MMXC 3MV9D 3BVVA 1AD9A 1E4XH 3ZR6A 1UQSB 1LK3H 4NBZB 3RRQA 2FX7L 3EYQD 3EUUA 4X6FA 1UEMA 2QJDA 5D7SH 2YRPA 1EPFA 4O51B 1GJWA 1OQOA 3O3DB 2O26U 1EFXB 2IFGA 3W26A 4F7TB 4G80B 4ZPTB 5JZ7C 4ODBD 3K4AA 5INCA 3U36A 4MJIE 2FH8A 1J18A 3HUJB 3GIVB 2EYTB 5JIKA 4HC1A 3V6OC 4QXGH 5DVLA 3EOTH 3JWOC 3S2CA 4NQCB 2FO4B 4HJJL 4ELKA 3LEVL 4Z7OF 4JDVB 3FQTA 1CDHA 3GSXB 1CL7I 3TV3H 2LU7A 4PTMA 1OTTD 2LABA 4JQIL 4RWHA 5BOZG 5DT5A 4PJAF 4IRZL 3BUYB 3HC3H 4H8WL 1ZHBA 4GAFB 1KLUB 2ICCA 3WFLA 1DVFB 5D2NC 5KG9B 5B39A 3BCDA 3WUFA 4P8UA 4ZDHA 4OAWA 3RX8A 4XCCH 2W4XA 4NQSA 4F58L 3GH5A 3QG7L 4XPGL 1IC5L 2W9EL 1XGPA 4R26L 3VDCA 4WWKD 3UTTD 5L0QB 2HWZH 5H94B 3N17A 4KRPB 2XN2A 1BJ1J 4C7DA 5I1AA 1IQDA 5HDQL 1FGVH 3HLAB 2VLJB 5D5ME 5I8EB 2OX5A 1F11A 4U1NA 4ZAKC 4R96B 1VFAB 3MXWH 1R5IB 3T65A 4Y5XB 3V4UH 5F88A 4LAQL 3QHMA 4GG8B 1B0GA 4I1NB 2QQLL 3PTKA 2R1XA 2PI6A 8FABB 4N90E 1X6NA 1T89C 3O2WL 1HI6B 5EZJB 5C0FA 1T20B 2FX8L 5AC4A 4U3CA 4ELMA 1TMCB 4Y19B 5BRZA 2GJZA 2LTQB 5FIEA 2Y07H 5HBBA 3CK0H 3MV9A 3AHVA 2JJSC 3OSKA 4O00A 5MHSE 4PJBB 4YHLH 4NJAH 4HIXL 5CZVL 4PJ7E 2GUOA 4GMTH 3ZZ1A 5TQ2L 2D2OA 3RU8H 4HGMA 2P45B 1NBVL 4MD0B 1KXVC 4WGVB 3SKJH 1A6UL 5MI0C 4KTYA 1KJVB 2J6EL 4NNYB 5F7EH 2VZ3A 3DX9B 4LPXA 2BX5A 2Y36L 4TULH 1IAIL 3WKZA 4GXUN 4LIQH 4M7LT 1G9NL 4B0MM 2FL5A 1ACYH 4F33B 5EPMA 4F7MA 1T0MB 2X41A 4O2CB 3AY4C 1KCRH 1HHKA 3IS1X 5HVGB 3RL1B 1MCKA 2IG2H 1NGZB 2JIWA 2A1WH 3T4AB 1CYGA 3ZL4H 1SMDA 4Y5VB 1YNKH 3NPSB 2AABL 1UJ3A 3NAAL 1BF2A 5ECJE 3C5ZC 4KY1H 5KSBF 4ZUTA 2YPLE 2J4GA 3E1F1 1KPUB 4AENA 1FZMB 1R6VA 4WWKA 3UTTA 3QP3A 1A7QH 4L29A 5GS3A 3TYGH 2G2RB 3HNTH 3CBWA 4KDVA 1X5LA 4Y19D 5C0NC 1NGQL 4M02A 4MVBC 4OFYD 4C4KT 5TE4H 1DUYA 1UQSA 3VG9B 4K7FB 3KZSA 2D7NA 3HMXA 2IADB 5CGTA 3RVUC 1Y7VA 2FE0A 4FNPA 1UWGL 4O51A 3CX5J 4FQJH 5BOPA 4G80A 2UWFA 2AXJA 3D6GA 4PS4L 4P9HC 5ETUB 3WDQA 2VR5A 3VX0A 5I1HL 4TYUA 3OTTA 1NGXB 2DLFL 3U48A 3T0EB 1S46A 3W25A 3BE1H 3B9EA 1IGCH 5FHAH 2COQA 1OTUC 1A9EB 2J5LB 5BVJB 3CFBB 2O9TA 4D94A 3ULVF 4OF7A 2EYSA 5I16A 4X9FA 4UB0L 1CZ8H 2WINB 1T4KB 3FQUB 3GTNA 2VWEE 1H5BC 1H3UA 1G7MB 1FH7A 4IOIA 4CU7A 2FLRT 3H9YA 4FFYH 4P8VA 4ONFH 2XWJA 2DPEA 1B31A 2V3DA 2EEXA 4BZ1L 5EORL 5GRYA 3AZTA 4NN7C 3HKFA 4IRSD 3WUZA 5DDHA 3MI6A 3FB8B 1IC7H 3GBMH 2J7FA 2ZCHH 5JLZB 4AQ1B 3KLKA 1Q9KB 3PL6C 4C55A 3MRNB 3HMWH 2V9QA 4UQEA 3L3IB 4PRPE 4X4YB 5DVKA 4JCMA 1IZJA 1MCOH 4JLRB 3HAEH 5I8EA 3OB0K 1BWMA 1OAKL 5LG1A 1KFWA 2HJFB 4PB9H 4MXQD 2H41A 4JAWA 3RVXC 5C0DB 3SCTA 3U9PH 4W8AA 1FAIL 1BYAA 3JV4A 4GG8A 4OUOA 1NCAH 4R8WH 4RMQA 4MYWB 4PJXE 8FABA 3FOMB 3MLVH 4LSPH 2WZIA 4OZGE 1X5GA 1HI6A 5EZJA 2EDQA 5A8QA 2O92A 1T20A 4P46B 1I9IH 5KOMC 1OGAD 4Y19A 4I0PB 3GSNB 3T0ED 1MJUH 4OFYA 1PQZB 5CD3B 3LRSB 4PY8I 2YLAA 5GGUB 2J7GA 3KPSB 2UZXB 5EDXA 4PJBA 3O0RL 2GAZA 2EH7L 3IYLW 4AEHH 2ARJQ 1MCCA 4HIJB 1I8MB 2GCYB 3A4XA 4G8IA 1Q0YL 1TA3B 2H2SC 5IBLC 2KZ1B 1GHFL 2APFA 3HMXL 4GAJH 4AXNA 3LQAC 4TQEL 4MD0A 3T09A 5J56B 2PWEA 4ZXBD 1Q8MA 2PW1A 4TPRH 4NNYA 5CP3A 4PGBA 4QY8B 2G3MA 2BNUB 4NZTH 5HD8D 2ZWZA 5JW5A 5IB3B 2GJ6B 3TPUA 1NCWH 3ECBB 4F33A 3BP7B 1T0MA 1AR2A 4O2CA 4HOZA 4K7PL 4JZJB 4TNWF 3RL1A 5CSUA 4H25B 4QDMA 1FN4B 1YNLH 4FTVE 1FL3B 3VWJD 1G6RA 2VLKE 5D72L 5DJ6B 4XVJH 5J6HB 3VWKC 3BP6A 3MQIA 1KR0A 2HT4C 3MRCA 4FQ1H 4OB5H 4ZSOE 5F9WB 4OIIH 2BY3A 1UR1A 3RWIB 3VM5A 4JFVA 3LRKA 4QOKB 1A6ZB 3TTYA 4IRSA 2W0KA 5FGBA 4AMKL 1KPUA 4ODWA 5CSGA 5EC2A 3TBVA 1J12A 5IW1A 4GO8A 3MV8D 3N85H 4M1DH 1I1YB 4XCNB 3LKQB 3JWDH 3K8LA 4CW1B 2PYEB 1YJDL 4YNYB 1FNFA 4KKAD 4WGWB 2IADA 2V5CA 1FAKT 5IB1B 3ALXA 5JW4N 4XXCC 3LQZB 1EFQA 1KJ3H 4BFBD 5HOSA 4UV4L 1RV6X 3W82A 4KZEH 1KF9B 5M94B 2ESVE 3B9KB 4G3YH 1OGAA 5I1GH 5GSRA 3TT3H 4PTTB 3CFKA 3T0EA 3SO3C 3HFMH 5BVJA 2FLBT 1HWWA 3W9DB 2R9HC 2DT3A 4F15B 5L8KB 2I25N 1T4KA 3FQUA 4EIGB 5ALBL 1R3LA 1G7MA 1G9MC 5I76B 1E6SM 4JKPL 2MOVA 3I6GB 1A7PL 1NAMH 1RZKH 4P2OD 5IFJB 5TJWK 4Y1AB 3ZJKA 2ZUMA 1VFBB 5IVOA 2ED7A 3GMMB 4QOKD 3V0VA 1EJ6A 4KHTL 3BYYA 4X7EC 2PXYC 5GS1C 4FABH 4H20H 32C2B 5JLZA 4CD4A 3MRNA 4JJHA 5IFPA 1JGLH 2AW2A 5FO9A 3FQWA 3SOBH 1NQBA 2PWDA 3BZFB 2PYED 2RIKA 1H5VA 3X3GL 1P2CA 2HJFA 4LGPB 4N8CL 4YDLC 5D6CA 1V02E 1GC1C 2IC2A 4FQIL 2MJWA 3FQXB 4EOWL 1ZGLM 3QFJB 4EAMA 3MLUL 2X2JA 3CMJA 1W0WB 1UJTA 3B9KD 3CSYA 4P46A 2Q86B 2Q76A 3DHUA 5F1IB 2OZ4L 5JQ6L 5CD3A 1PQZA 3LRSA 1L8NA 1FCGA 1SR0A 3SKOA 4JFOB 2F2HA 4ZE4A 1R0AL 3MYZA 1RJZB 4HIJA 2GCYA 4HZLB 5E5MB 1W8NA 4OD3L 1I8MA 2GVYA 1NP0A 4YZFF 4ZOCA 4KMTH 5D7LE 2XZQH 4MAYB 2WLYA 3V9FA 4PGDB 3QH3B 3FRUB 4HS8L 4KVNL 1HTYA 2ZP0T 3CDCA 3EYFB 5LXGL 4D6GA 2BVUA 4MJ4A 1IT0A 5FO7B 3SDDC 1ZTXH 4JQVC 4MB5A 5KTEL 2LU3A 4NRSA 2WW5A 1EXPA 4HAFA 1L7IH 1EHLL 5C07D 3TONA 4KI1A 3BP7A 1G0XA 2NX5B 5HVWA 4U4BA 4HH9A 1Q4NX 1BFNA 3A22A 2ZKHL 4UOQA 4JJ5B 4UQCA 2OYMA 4JM2F 1NMBH 4H25A 3KR3L 1FN4A 2WNGA 1T22B 3OX8B 3B2VL 5DJ6A 5J6HA 1VIWA 2BVOA 2F58L 1I3GH 3NH7L 1TITA 4S1QL 5F7DB 2EBNA 4P2OA 2OR7A 3HNVH 5E1HB 5JUEH 3IETB 5CIPH 2PR4L 5AYQA 3QFJD 2X4SB 1MRFH 4FFWC 1QFOA 4QOKA 1A6ZA 1J86A 7FABH 3GMNB 4UU9B 4AIZA 4E41D 2FSEB 1J1XH 4AZBA 4IS6B 4DWSB 3CDGB 5DHYA 4YWGL 4PJDE 1I1YA 4AZ6A 4XCNA 2CHOA 2CBUA 2OWWA 5AG8A 1U41A 2PYEA 5DD5L 3WBEA 4XC3L 1H4PA 4RGNB 5CMAB 1C7SA 1IILE 1QLFB 4XRCA 5IMLB 4O5LL 1LEGB 5IB1A 4ERSH 4Z7UE 3RI5F 2NY0D 5KS9F 4PJCA 3S3JA 4X4ZA 5FYJD 4MAYD 4ZYKB 3M07A 3ULUD 4EI6A 5DQJB 4M81A 2Z93B 4MXVF 3WNKA 3B9KA 1S7UB 4P7RA 2MFNA 4S1DC 3J7HA 4PTTA 3WIIH 3PIQB 1A3LL 2E9BA 1TJHH 3AYRA 1UCTA 2OK0L 1E4WL 1X1NA 3H9HB 2HTKC 1NBYB 3W9DA 5FV2A 2NX5D 5IQ7H 3OPZH 2W91A 4JG0L 5MEND 4ZFOB 3BMVA 1HKJA 1HOCB 3UYOD 3PP4L 4I3RH 5CILL 4EDXA 3I6GA 3VD7A 1QPPA 3DO3A 4HUUA 3D18A 3U79A 4PR5B 4NM8H 5IFJA 2VN7A 3L4VA 1UWXH 5T1KB 2L4OA 1MIMH 3GMMA 1NWTA 5DJCB 1R7OA 3HI5H 2HVKB 4BZYA 3B8SA 1GCFA 5C07A 1WISA 1WGOA 3KDMA 3IDXL 3G6JB 4QXWA 1M01A 2DKSA 2FHFA 2F7PA 2AVGA 2CIKB 3U5YA 2ZG3A 3W2DL 4B53A 1UZ1A 1RU9H 4P5KB 1N0XL 4EUPG 1HHJB 1MQKH 4Q74A 5KZCB 3UTZB 3O9WC 4J2XA 1DP0A 3C6SB 3EOYG 3FQXA 5FHBL 1E15A 1OGBA 3QFJA 2V9TA 4K71C 3MRQB 1QA9B 1ZT1B 3IDIA 4K94H 1D9KC 3K0WA 1W0WA 3NFNB 1R47A 3CVHL 1SJHB 3REWB 4FQCH 4C4KO 2OCFD 1FG9C 3OKDB 5F8RC 3RIFF 3N1PC 4JFOA 3ABZA 1F6LL 3EFFA 4UBDC 4XP9H 3VE0A 1Q0XL 4WKHA 1DWJM 5E5MA 1MCJA 1VA9A 1GGYA 2P5EB 1KB9K 4KK5D 2NTFA 4PMNA 5J9PB 5HI5D 2PUQT 5TH2B 1OAUH 1P4IH 1TPXC 4MAYA 5IMMA 3HJEA 4DCQB 4PGDA 5HI3D 2APBA 5T1LB 3QH3A 3FRUA 5CGYD 3V4VH 3OR6A 3AXIA 3LRHA 4PRHD 1DN2A 2GY7B 4GQQA 1WK0A 3E0GA 3QUML 3JTSA 5EIQA 1U36A 2EKJA 2NX5A 3MRMA 5MENA 1JHKH 3FHQA 3NFSL 1EEYA 3MV7E 3D69B 3MRBB 2FR4B 5K59E 2EZ0D 3UZQA 1T22A 4KJQD 5I1IL 1R85A 2DT0A 2F54D 1JPTL 1DBJH 4MD4B 5F7DA 5KZCD 1B3YA 3K74B 1MY5A 4Y2OA 3I3BA 5A69A 5CSZB 1QRNE 3P0YH 3U6RB 2D7OA 2X4SA 4PSPA 2VC2L 3EJZD 4UU9A 5I9QC 3KPPA 4N68A 1U8OB 4HT1H 5E08L 2X1OA 2EIBA 1BFVL 4FQ2L 2P1YA 2EXWC 3BEWB 4F3FB 4KFZC 2R2HB 4IS6A 3CDGA 4NUGH 5F96L 4FZEH 4GRWE 4IOSD 4Q9RL 1M7DA 3ILQC 4NUJA 5DS8A 2PYFB 2X4OA 2QADB 1HXYB 3QXVA 5JTWA 3BDXA 5CMAA 3NTCL 4NNPH 1VACB 1ZVSB 5IMLA 3I9GH 2DQXA 3TZVC 1LO2H 1LEGA 3RZCB 3OGVA 1IGIH 2P5ED 2V9RA 3TM6A 2ENSA 3BAJA 1JNNL 4W5UA 4ZYKA 1EXUB 3ARFB 3SDCB 5JHLL 2VDLH 1F8TL 5D7KE 3A6CL 2CKBL 4R2GC 3QWOB 4BUGA 1S7UA 1I7ZA 1I3VA 4EUPB 2HYMA 1YPZE 4PMXA 3PWUB 5GRVL 5E6ID 3NA9L 1NBYA 3H9HA 4HZAA 3MRLB 4ZFOA 4NZRH 4LEOB 4RAVA 1HOCA 1G84A 3GIZH 3LMJL 4E42B 1HL8A 2XM2A 4ZFMA 3CSBA 4OQTL 2CLRA 4G6KL 2DDQL 1VADB 3VFPA 5FYJL 4PRHA 4I8DA 3W0WE 5HYIA 5DJCA 2WCSA 1GW1A 2BRRL 1KCVH 2HVKA 1YNTB 1PDKA 3MMDA 3WXVH 2F53E 3D3VB 4BFIB 1XSJA 5ELIA 2YLLA 1D3CA 2P47B 3PGDB 4L5FL 2I07B 4U1JA 4WJXA 4P5KA 2DL9A 2NY4D 3O81A 2E4TA 2O5XH 1IAKB 1HHJA 2D3LA 2F54A 3PP3H 4UNUA 3RKDC 5F7YC 3UTZA 4UNIA 5CUSH 3ROLA 3IJSB 5D7IE 3ME0A 3KXFE 1U8HA 4LFHG 1LO5B 4OQ1A 1KXQE 3MRQA 1ZT1A 4MA8H 2PWHA 3TH2T 1BWWA 1RZIB 3W38A 1BYBA 5T3ZD 1DWHM 4RDQF 3KAAA 3PTQA 3GMQB 2D3NA 4F9JA 3LKPB 3NZHL 3QRFM 1UH2A 1TR1A 3WS3B 3L3KB 2RGSA 4JPWH 3QUXC 4XVUD 4PFEA 2P5EA 1I7RB 1J05B 1GVIA 4Y16C 5J9PA 1V03A 1TQTA 3UYPA 5K9OB 3QO1B 4PYSA 5TH2A 1KENH 4M4PA 4GRMB 5LCVL 4YHOH 4DCQA 3GXDA 3JWNC 1RUAH 5T1LA 1U3JA 4D0CA 3DVIA 1UR4A 1BLIA 1ADQH 4Y2DB 3QAZB 3UBXA 4Z7OE 4LYRA 5E6IA 4OI7A 1AI1L 3GM8A 1E72M 3D3VD 4NC2B 4XHJD 1X9QA 3BUTA 4DKEH 3EJRA 1G0CA 4N42A 4WFEE 3MRBA 3VJ6B 3ZTNH 4DKAA 3O3BB 4PJAE 5A3ID 3MLSL 4MNGB 1YEHL 8CGTA 2CKSA 4MD4A 1A6WH 4IRJC 4PYHA 5CSZA 3U6RA 1WIUA 2IQ9L 3TTOA 1M53A 4OGAD 4JFXB 2C3XA 4WFFE 5I8CB 3VFRB 1U8OA 3L1OH 3RNQB 1WT5A 1JFXA 3BEWA 3T1WA 1UG6A 2R2HA 2ZPKL 4KTEL 4L3EB 4JFED 3KLDA 3VFGL 5JHDD 2IH3B 4HUMB 4WWID 5BV7H 1KJMA 1SBBA 3VXSE 1KSRA 1NMCB 3WLWD 5C0JB 3L7EB 2XNAA 1ZVSA 2WVTA 3GNOA 2BSSB 2VXUH 3F6LA 5I17B 2DB8A 3VXQB 2V5MA 2IGFL 2VDKH 1FP5A 1U92B 3SDCA 4N5ED 1P84J 4AZCB 3CFJB 3QWOA 1LEIB 4ZXOA 3KPMB 1M7IB 5EWIL 1QYGL 2C26A 3S5LG 35C8H 5KSAB 3BKMH 3RVVC 1MHEA 5F3BB 2Z4QA 5F44A 4XMPH 5KVDL 1BYDA 2EKSB 5K93A 3C5JB 4R3SA 4XWOC 1D5ZA 4JVUA 4JFZL 3UETA 2Q6WB 3H3PH 4E42A 2E7LA 4LRNH 3QQ9C 3GXFA 4XNYL 4PJ5B 1AE6L 3VXMB 1FFPB 1VADA 1C90A 5ADOL 1UC6A 3HTLX 1XV8A 1GGBH 4JM4L 3QEQB 4HUNB 3WDPP 3GKWH 1U91B 1ZHNB 4B50A 2WHKA 2JCCA 4QT5B 1QEWA 2EDKA 3FW6A 3D3VA 2Q87A 1H3TA 4L3ED 1U8IB 4TVPH 2EDRA 4ODVH 4U7MA 5GNXA 2PWFA 2ZUXA 5FXCH 3LKOB 3PGDA 2J7DA 3UC0L 1Q6CA 2AXGB 4URTB 5HHOB 5C0RL 3DX3A 1UENA 3L5XL 4J23A 4U7KA 5HHVL 3A0OA 5KSBE 3RJQB 3IJSA 2LFGA 5AD0A 1J01A 1LO5A 3FB5B 3RX5A 1W9BM