1KCLA

Bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNLGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The remote substrate binding subsite -6 in cyclodextrin-glycosyltransferase controls the transferase activity of the enzyme via an induced-fit mechanism.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclodextrin glycosyltransferase
total genus 233
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kclA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kclA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kclA01
3BLBA 3MJ7B 1NAMB 1PBGA 3QWOA 1M7IB 4AEIH 2HP4A 2YUWA 5M03A 5CCKL 2VDLH 3W5MA 3QJFB 3HNVL 3FTGA 4BFGA 5BOPA 1TE1A 1QBLL 4NXKA 4UIKL 1T5XA 3LN4A 3QPXH 2FE0A 3WQ5A 4LIQL 4HWUA 2NY5L 4ZEPA 1MLCB 1CT8A 4Y1AB 4LLQA 1GW1A 1XGUA 32C2A 3C2AH 5DI8A 3M07A 4MXQD 4NCC2 1MFEL 1SM3H 3WLWD 5I73B 2Z8RA 1BFNA 2VKWA 5C08D 4RFEA 1A5FH 4UT9H 4LPTA 1BFVL 4Z0BH 1MHPL 1Q0YH 1T2QL 2HWZL 4F8XA 2B1AL 2PW1A 3D39D 1R87A 5C0FB 3GBNH 5L2JB 2AXHA 5E7BA 1UWGH 3LEVH 4CU8A 2HT4C 4NFCA 3TM6A 4DZ8A 2X4OA 3NACL 4G8EB 4XRCB 3BVTA 1FVEB 4NZFA 3RM4A 5D8WA 3P30L 4ZSOB 3B2UC 4X9YA 2V5CA 5L2KD 5IBTH 2WVTA 2G3MA 4JDTL 3H9ZA 4WU7A 1OAUL 3L7EA 1JXKA 4EDXA 2Y5TA 3MRFA 5GS0C 1E4WL 1IAKA 3D25A 1WF5A 4IEFB 5CILH 4RE4A 1H11A 1JWMB 4I0PD 4P3DB 3FQXA 1U8NB 3CJJA 2BY0A 2Q76A 3O9WB 2PI6A 1FBIL 3KPOA 4X5WA 3U57A 1FBIH 1BBJA 2QEJA 4NKQB 3SPVA 1JF6A 3I50H 3NCBB 4PJDB 2DEPA 2OL3L 4QXTB 4XPTH 9CGTA 4BKLA 4PJGF 2DSZA 2XKSA 5GGVY 4ETQB 5ESVA 3S5ZA 3C5SA 4MWFA 5JQHC 1WDRA 4HV8A 2DQGL 4XNYH 4ACYA 4MJID 1FH9A 1QFHA 3QQNA 4ACZA 1JPGA 4HS8H 3FB7A 4M43L 4OLVL 1HEZA 4QXUL 1CFBA 4HIXL 1TJGH 3KJ4C 2H2PD 4DN3L 3QNYB 5F72S 3RJXA 1T66D 4QHLB 1IGJA 1HK6A 1EHNA 4L3CA 4RAVA 4LVHB 3DHJA 3CUPA 2QADB 5DD0L 1NEZB 3P9WB 3BAXA 4PJHE 2Z31A 1MJUH 1UYWH 2XN1A 3K2UL 2IANA 3MRMB 1G9MC 3GSUA 4ZFMA 3DUUA 5FA4A 1OGAA 1R5VA 2XZAL 2J8FA 1ZT1A 2AV1A 5I15L 1ZWIA 3FFDB 3VI4F 1WB0A 2YBTA 4Y4FB 1JFQH 3ISWA 1UCBH 3MV7B 4KQ3H 4RE3A 4DTGH 2EEXA 3WDQA 4HG4J 5A95A 2W9DH 5CP3A 3RZCB 5E0CA 2VLKB 2WZEA 4U3CA 2VLJB 4KY1L 3T0EE 1CLOH 2F53E 3BEWB 5AYBA 3FO2A 1EO5A 4GSDH 1E6JH 4QRTA 1ZA6A 5DS8A 1QFWH 2ZCLH 2EAEA 4RNRB 1VCAA 3P9MB 3KHQA 1AH1A 5C0BD 5E70A 3EGSA 4CDHA 5H94B 5EA0L 2DQXA 3HMXL 3OB0K 1EGJL 4O58H 3BT2H 4KJQC 3BUYB 4QRPB 4Q2ZB 1H3GA 1YY9C 4I5BA 2XOTA 4XZWA 3WENA 3VXMA 2X7LB 5FYKL 3DRQA 2E5EA 3BOVA 3FQUA 5EH1A 4ZAKC 4HDIA 5DFWH 3MUIA 3MNVA 3BIKB 2XT1B 1MWAA 4M62H 4BZ2L 3MJ9L 4WI3A 2AK4D 4TVPE 2ITCB 1UVQB 4KVCL 1ERNA 2X4UB 5E7FA 3SE3A 3V4UL 5T1MA 1SJVA 3HI1B 2ZZUT 4OZGB 3GXDA 3UZVB 4XBEH 2D3LA 3ZDYF 3Q5YA 4JCLA 2Q7YA 4NNXB 1CFVL 3DRTA 4UINL 4GAYA 4Y4HC 1JMZA 5CGYD 1CD8A 4HBCL 1BPLB 1AO7B 2ZCLL 5SX5H 1QFUH 5HY9B 4JM2B 5AD0A 3CK0H 3WL1A 4L8SB 1BAFH 2WIIA 4NXSA 5IR1A 5F9OL 2YEZA 2YPLE 1WSST 2P4AB 4PJEA 5BXTA 4MCZB 1GSMA 3RZCD 2D2OA 3W9DB 1Q8MA 1T80A 4XTRC 4X4XA 3ULVF 1P9MC 3CPLB 3MLRH 2XWJA 2VXVH 3NIGF 4O2FB 2JJWA 1YEKL 4LLWA 2NW2B 1V5JA 1A7NH 3F65A 4LFHG 2YD5A 2DBJA 1GPOH 1W1TA 3QUXB 4DZBA 1FA2A 2COQA 4EK7A 2Y36H 3CUFA 3EYQD 3ILQD 3GXMA 2HLAB 4QRUA 5C0GA 4LHUA 3U9UA 2JB6B 3GRWL 3BVWA 2BFVH 4Q9QL 3QIUA 4Z7WE 3MACH 5FM4A 1KJ2A 1MAMH 2EE2A 3O3AA 1J1PL 1XGPB 3L7EB 4Y4HB 3SURA 1UADC 4UB0L 4LSTH 3VJ6A 4NQCE 2IMMA 1HIML 1R3LB 3GB7A 1D5XA 3O3DA 1HL9A 4WFFD 2A3EA 5A8MA 5E1QA 6TAAA 3GHEL 5CEZH 5L88L 5GRYA 4PJDA 1KTDB 4QT5A 4OFYA 2WUCL 3VXQB 4LLQB 3ARXA 1LL7A 5FDYA 1LP9B 2A83B 3C5SB 4MWFB 3IDNB 4P48A 1URLA 2EDFA 3PZVA 3MXWH 4X6EB 5F21B 3T1FA 1YNKH 43C9A 2Z9TA 4R3SA 3RWGB 1T2QH 2HWZH 3MRIB 4EZMA 5T3ZH 4EANA 4G42B 3LKOA 2VAAA 4XNUL 4IHOB 4LMQI 2PW1B 3ARFD 4Y5VA 3U2SB 1NL0L 1H3UA 4P2OB 5FKPB 4K94L 4F7PA 1ONQB 1AR1C 2FGWH 2Z35B 5JPMA 5D4YA 2GJXA 4PJ9C 1JGUL 1QWUA 1TVNA 5FCUH 3BDXA 2XFRA 2EH7L 3WEOA 3IRZA 3BH8A 3O3BB 2F61A 4OIBA 5FYLE 4H1LH 1UG6A 1DBJH 1E4KA 1TTGA 4XZBA 3AXLB 1XFPA 5F7DA 3WDIA 5FFLA 2VZUA 3LB6C 3MREA 3VFOA 3WELA 2WCAA 3HNVH 1CG9B 1LDSA 2IUZA 3EJUA 4XV0A 1P7KA 5IEHB 1RMFH 3V7AG 2F54D 2IGFH 3RNKB 5C0JA 2P5EE 4BH8B 3TFKD 5GGQL 2Q76B 3O9WA 3WL0A 1S7WA 1I9RH 1XEDA 1KBBA 4HC1A 3BQUB 2G9HB 5JO5A 2NXYD 3G6JF 1W32A 4JFFD 4BELD 4S1QL 3VXNB 1AIFA 2Y8VA 4UOW1 1A02N 4MNGE 1Y18A 4C7DA 1T7WA 3VXTB 3TNMB 3GSOB 1CQKA 3MJ7A 3BRGC 3L3JB 1DP0A 2NY4C 1XYFA 3QWRA 3X13B 3D18A 2MOVA 4XBPA 1UYQA 1FGNH 1E6XM 1FAIH 2DBLH 1KC5L 3U48A 3WQVA 3F5WA 3FZUD 2VLKE 2Q7NA 4XI5D 1LWRA 4CNIA 4TTDC 3CDGB 5IWLA 4DJMA 2EKSA 4K7PX 3V0WH 2V3EA 3A3HA 4WTXA 4PY7B 1MF2H 3DGGB 4M5YL 3X3FL 4UCFA 1Q9LB 1HJWA 4ORGB 2VR5A 1P4BL 5INDA 3C8HA 2K7PA 1FFNB 1U41A 1BP3B 3LCYA 5C0AA 3GBLA 3ZQ9A 4CN1A 2B5IC 1NLBH 2D3VA 2GJRA 5E4EC 3D3VE 4X5XA 1N8ZA 1IKNA 4NSKA 2YUXA 4OSUH 5ICYB 4PJ8B 5GGTH 5IOPA 15C8L 2IBZY 3V5DB 5DT5A 4GRMB 5C2BL 4KKLD 4PB0L 4YC2C 1UCTA 3DSNA 4JG0L 3TLRA 3U0PB 5I8KH 4I2XB 4JG0H 4K7FB 1W2PA 4L9LC 4WI7A 4JY5H 1I1XA 4OT1H 1RURH 4QXUH 1JHLH 4DZ8B 2VDKH 3DX8B 3TBTB 5CEXA 3GBNL 4UOQA 3ZL4L 2Z1SA 4I18B 2DL2A 1JP5A 3GKZA 3LN5B 4K55A 3S37X 3SCQA 2OM5A 1Z3GH 3L7FB 1CE6A 3OZPA 3AI0A 2RB8A 1B0RA 1KR1A 4OF7A 2Y25A 1QR1A 1A1OA 2K7QA 4YDIH 4F7EA 4P5TD 4WHYH 1NCWH 2PNDA 2PETA 5FIEA 3EOTH 5EO1B 1M7DB 5I6XB 1M05A 1VEMA 5CQ1A 2IFGA 3M45A 2FJHA 4N90E 2V17L 3WLBA 4NN6B 1RIUL 4PJ7F 1U8QB 3MR9A 3S5LA 1AGBA 4NRZB 2BERA 3NA4A 3HE6A 1ZHLB 1ORQA 5D7IE 5KSBF 1H41A 5HHQA 4KHTL 2DQIL 3EJYD 2FH6A 3TBYA 1DZBA 1E6OL 2BSTA 4LLUA 4S3JA 4L3ED 5DRZA 2NY4D 2AEQH 4G6AC 4DTGL 1T20A 2ICEB 5IKCB 3FB7B 5KANG 1LO0L 4E0RB 3GHBL 4OLXL 2VR9A 1XRVA 1S7QB 3B9EA 3E6FA 2FBJH 2X4UA 2EACA 1X9QA 3G5YA 2KZWA 4UT7L 2HT2D 4QOKD 3D3VD 1L8NA 1CDIA 1P53A 4W8BA 2EDEA 3FFCA 2ZUVA 3HMXH 5EZJA 3MROA 4OUUB 4OFVA 2Q3AA 1DN0B 1W0VA 3TH2T 1P7QD 1NQ6A 1NMAL 3MSGA 1T21A 5CJ5A 2KQNA 3T65A 4EI6B 2EDNA 3SO3C 4C7GA 4NOFA 3P40A 1GOHA 2DQIH 3ME0A 5HI5D 1IM3A 3D1MC 4MHHI 1CPUA 1S9VA 4JFTA 3U7AA 3MRLA 3RWGA 4LSVL 2RFXA 2FR4B 1HINH 5CP7B 1RY7B 4KJYB 3R8BB 1GOIA 1T0NB 3BXWA 4URIA 1HH9B 3JTSB 3QO1A 4UR9A 3FQWB 3DX9A 5DC9B 3QAZB 2FX8H 1JIBA 4O02H 2OX5A 4JDZB 2A6IA 3ZTNL 5C7XH 5IIEA 1LQ0A 1FG2A 3HG1B 2OQJA 3U9UB 3K8LA 1P84K 3CVIH 5HDOA 5C0GB 1ZLSL 3P9MA 2EECA 3U82B 5HYIA 1XAUA 5EU6D 2LABA 5BW7C 3EHBC 2YRPA 1TDQA 2Y7QA 2A6KB 4DGIL 5I66A 4QO1A 2VMFA 4Z78A 3VVGA 1CDGA 4L4TE 5ADOH 4FNSA 5KAQG 2O5ZL 4NN7B 4PTUA 3HA0A 2A73A 4MNKA 4XVJH 3BW9B 3BO8B 4NM8H 4YR6B 3ARBD 3EW3B 3WN5A 2HG5A 2OP4L 1BQLH 4GKNA 4PJBA 2DSKA 5A2BA 3QHZH 1D5ZA 3CZKA 2AXFA 5ELIA 5DK0B 3QHZL 5DHYA 4OZHE 4NFDA 1GPOL 3QXUA 3UP1A 3MXWL 3VFPB 3GJEA 3K7UA 5E2TH 3DVIA 1Q72L 1DWGM 3MOBL 5D9SB 1GOGA 2E7MA 1UM6H 2ITCA 5A2LH 4BSWB 5JMOC 2WAGA 2VERN 3CD4A 7A3HA 5KVGL 3BKYH 4FQQB 4WFGE 3MRIA 1W2KT 4JM2D 5KBNC 4OQTL 2DQCL 1QPXA 5T3ZE 3VKKA 1MY5A 4NO2B 3KPSA 4HKJB 5ITFB 4X8XA 4LAQL 1FN4B 2QKIA 1R75A 4LNRB 3GI8H 1I1AC 1OWQA 5F7YC 2ZX7A 4XB7A 3QUZB 4PR5B 2ZXAA 3HMWH 1OM3H 3PQYA 3WJJC 1UJTA 2WMJA 4NSBA 1V6YA 1I9IH 4TUKH 3WFZA 1PZ3A 1EDQA 2BHUA 4AH2B 2VQUA 4XBGB 3VA2C 5HPOA 2ITDB 4P0DA 4GFTB 4IM4A 2NW3B 2V2WB 3GGWA 4R7DB 5H8DA 4P9HL 4Y5YB 5H37G 1CE1L 3OIHA 4EE9A 1GIGL 3C09C 1UXSB 3AS2A 4OIAA 3NPSC 2ICWJ 2J12B 3V6OE 1NM9A 1F4WH 1KYOJ 2NZ9C 1IC5L 1EZVY 3UEZA 4Z5RB 3L3IA 4F15C 4Y19E 1CLCA 2BS9A 5EB9A 5IMOA 4XVTH 4AZ6A 5C0ND 3FTGB 4X7FC 4YHYB 2XQYK 1JHKH 5DD3H 1T5XB 5A2CA 4G8GE 5KZCB 3A4XA 4I48A 4JFUA 1E6SM 2R2EB 3PL6C 4MB5A 1J86A 1AO7D 3D2UD 4Y1AA 3GM8A 3HI6H 1MQKL 2VDLL 4JO3H 4I0PB 4DKEL 1DQQB 5LGJA 1EHLL 2FJHB 2FGWL 1HT6A 3ORJA 1TIUA 1QLRA 2VR4A 1EEYA 3LKRB 4NQDE 3HCVA 3SY0A 4WI4A 5IHZB 1J8KA 2Y6SC 3SGKC 4RZCA 4EOWL 2PKDA 4PRHB 1K4DA 4GG6F 4JAWA 4QT5B 2CXGA 2EEAA 5IK3B 4D0CB 1WCQA 3FT2B 4KK5C 1BVLA 2XSAA 2EJ1A 2DM7A 1PVHA 5DHXB 3OJVC 4V2XA 3WMCA 4GG6E 2HFEA 1V03A 3T1FB 1Q6CA 4JL2A 4YE4L 4P9HH 4HK3N 2WCGA 5L0QC 3BGMA 1VESA 2BXZA 3SGDH 5IHBA 1V0MA 3SE4A 4NHUA 1S7QA 4K68A 4P57A 5FKYA 1BD2D 1B2WL 5JR1L 4LPXA 1KN2L 5GGUA 2JEQA 5ABGA 4L8BA 5DZNA 2Y8KA 4JN1L 1N2RA 2PW2A 1LK2A 1Z9OA 1CE6B 2OZ4H 4ZNCD 2ZJSH 3LS5L 5EUKB 3A6BL 5EB8A 3RUGF 4JDVA 4RQQA 5J3HD 3VM5A 2CITA 3VXOB 5ID1B 1T1ZB 1G7IA 2V5DA 4PMQA 2I5YH 2J88H 1K4CA 3P77A 2NXYC 4XP1L 2IAMC 4Z7UF 4XMLL 2FIRT 2VWEE 4D6FA 3HTLX 1PY9A 2NY7H 3WL9B 4TXEA 2JJTC 2YD8A 4KHTH 4TNWF 3OKNA 4HGWA 4ZO6A 2RGMA 2F9BT 2EIBA 2J4WH 4MJ5A 3VMOA 4CBPA 3HG3A 4C83B 1HEZB 3FHAA 3GMMA 4P23A 5GNXA 3BWAA 3QZWB 4MJ6B 2HA1A 4IOSD 5GRVK 2EKJA 4MNGA 3WJLC 4QHLA 3BP7B 5IWLC 3TO4D 2FYVA 3VXTA 2M8XA 3HC3L 1P5VA 4FZ8L 4FG6D 5FOBA 3HU7A 1FJ1B 4AZ8A 4CMHB 4KRMB 2A0LD 4K9EC 4ZO8A 4ODXB 2Y6SD 1OPGH 3D6GA 1NBYA 1KC5H 2P5EA 5HHOB 5HVGB 4AD5A 1ZWIB 3FFDA 4Z78B 1FHLA 2FJFA 4EI5D 4HBQA 2R1WB 2X8RA 5J12C 3HAEB 2DKMA 3GMLA 4GQQA 1E6ZA 3MBEA 3QDGE 3F5LA 3JUYA 3P4MB 3FFCD 1FFNA 3TESA 3BQUD 5DJZB 4A6YB 3CZSA 1QO3A 5ICYA 2EE3A 5L9DH 1EPFA 4GW5A 3LEYH 5DO8A 4WFFE 1ORSA 1K3IA 4FK9A 4HWBL 3PWNA 15C8H 5EOQL 2GTZB 4XP5L 1EVTC 1CZ1A 3RWCB 1MFUA 2VXQL 1FZKB 3HMXA 4Z7NF 3GI9L 4R9HA 3SQOL 2YL5A 2XWTA 1J88A 5IQ9A 4R5EA 1AFVH 2IQAA 4FTVD 4FTVB 4Y4KB 1ZBCA 3TEUA 4KGJA 1M6OB 1A14H 2J4GA 5I76A 4C56E 4WSJA 3OKEA 3HZKA 4Z0XA 4JFDA 1F3JB 2ADJA 4OZHB 2HH0L 3V52H 3U5YA 1TVBA 1E43A 3DARA 4P4RB 5E5MB 5EDXA 4LCCC 4TTUA 3MLZH 1JNHA 1YPZB 1OAKL 4ODTL 3MLSH 3O0RH 1U95A 3UETA 1MUJB 1QFUL 2FBOJ 2I9TB 4FFWC 3IVKB 1QSFE 5B4MC 1FYTA 1BLIA 1FOBA 1VERA 3WS6A 3G5XA 4NX0A 3T4YA 1IGIH 5ISZA 5FYLD 1X7QA 1A6VL 5J13C 1B90A 4JKKA 1UXSA 5DTFB 1S9WA 3QDJA 3VFWB 3AOFA 4QHMB 5MEQA 4S1RL 5MENA 2MNUA 1SJEA 2ZKHH 2HFTA 3GTNA 1WFOA 4Z6AT 5EU3A 1BGXL 1QEWA 1A7QL 2WQ8A 4HEME 4Y2DD 3TNNA 3SKMB 3ZO0A 2GDVA 1D5ZB 1OAQH 4NDMA 2KUTA 1ADQH 3S3SA 3C6SA 1W9XA 1IC4L 3SCMA 2ADFL 4XCCL 1AGFA 4JY6A 1K9TA 1RZ7H 3WIIH 1G0CA 4HJGA 4Y4HD 1MEXL 3E6FB 3PHQA 3V5HB 1C3FA 2F5BL 3V7AE 4J3WA 3UX9B 3O2WH 3O0RL 2RGSA 3O2WL 1I3VA 1A6TB 3MRJB 3EO1A 2APBA 1BHGA 1A6ZB 2VRAA 4NP4L 2CETA 2HH0H 5GRWA 3K0WA 4PJBE 2YPLA 4YX2L 1E28B 3SOBH 5GXBB 3H9SD 2XICA 3MV8E 2A6DA 1T21B 4JKPH 4WVRA 5GGTA 1OBAA 1ZU8A 1EXPA 1SEBB 4UQBA 5GRJH 3QOKA 4GW4B 3C08H 2ESVB 2EPNA 1WIUA 3LN9A 4S1DD 4YDLB 3CXDL 2JJTA 1CE1H 3PZQA 3RTQA 1FNHA 1UT9A 4NQDB 3D25B 2HLAA 4QRUB 1MVFA 4N0UA 3TVMA 4KJYA 4M8QB 1SBSL 5DURB 4CVZB 4UAOB 3TBVB 4MA3B 4R8WH 3ZE0F 5F97E 4NFBA 3OR6A 1QVOA 1BMGA 4D9RE 3PDOB 1MFDL 4L8BB 5CWSA 3OGVA 3CLFL 3MMUA 2J7FA 4LQFH 4Z7QF 1P4LA 2A1WH 4QOKB 4ELMF 2BDNH 4KDWA 4Z8FL 4X7TA 3SDDC 1DBBH 4TUOB 5IBLD 3PABA 4FFZH 3BRDA 2E4TA 1CFVH 3T2QA 1QG3A 2DQCH 3DMMA 2H26A 2QTEA 4MDIB 4UV4H 1UWEL 3FO9B 3FN3A 1TVHA 4HZLB 4KTYA 3LAFA 1XC6A 1QWNA 5FO7B 3MBEC 3GXTA 2YMXL 1HHGA 1RK0B 4F2MA 3HRZB 4U0RC 2BJML 4QRRA 3EOYG 4W8LA 3BO8A 1NC2D 3KYMA 1OCQA 4R3SB 2C3VB 2DQEH 3SPVB 4RMWA 4DO6A 4MJ5B 3EOBA 5C6PB 4AMWA 4NM8L 3QIUC 4OZGF 3G6LA 5AWNL 4PTVA 2BVUA 3V6FA 1RU9H 4NBYB 5AY7A 1KB5A 2CBIA 4F7PB 1UACL 3T2OA 4U6YA 5J9PB 3VH8B 2J6EL 3QEQB 1ZS8B 3NFSH 2B4CL 5TE6L 2H2PC 3V0AC 5HGHA 1T66C 2QKIB 1Q6FA 3T0EA 4UIMA 2EDYA 3PXJA 4L3AA 1JGUH 2AJUH 4Y7EA 5HVHB 1HXYA 1JHTA 3JWNC 3UAJC 3V4VL 1YEEH 4YDJA 3FO2B 4XWGL 5GGQH 4EKJA 5FGBC 1DWAM 5IJVB 2BJMH 2C3XA 3N9GH 4QYOA 4QY8A 3W2DH 1W72A 5FO8A 3SGJA 1IFHL 1NAMH 1XR9B 4MGXA 5M94B 3QDHA 3UTZA 2VLJD 5IBUG 1D5MA 3RWCA 5IVXB 1PZUB 3WHE1 3H8NA 1FP5A 5A3HA 3VIOA 5I1EL 4ZDHA 2OL3H 2DIEA 2ZWZA 4MX7B 3PWUA 2IFFL 4HJJH 1NWSA 1HSAB 1KGCD 4IOFD 2R4SH 4JREC 4PSRA 3BE1H 3TFKC 3FQUB 5CJOL 1MCOL 4X6DE 3PWJA 2ADIA 5D1XA 1E5NA 3KXFE 2HMIC 4P7LA 4PRHD 5IHRA 4NUJA 4QCIA 3GRWH 1BZ9A 3N50A 3RVXD 1RK1B 3VMPA 3WYRA 2P8LA 2F54B 2CYGA 3S35X 2V7HA 3CCHB 1LQSR 4BQ4A 2BC4A 4W88A 5I6SA 1AE6L 3FQTB 2FJGA 5KOVC 5CFHA 4OZGA 1C5DB 1QP1A 4RMSA 5DWUH 5GIRB 4JB9L 3GBEA 1I3GL 5JLZB 2CDFB 3QGVA 1LNUB 4K2UH 5EU6E 2MMXA 4PJAF 2HT3D 4HLZG 3GMLB 1IARB 4QHMA 3VRLE 4RGND 5SWZD 4I5BB 4GLRI 1T04A 4LBEB 3RAJH 3VWKC 5T3XE 1I9IL 4TUKL 2F7QA 1A6AB 3QA3A 3ZDZF 4ZTOH 1FORH 4P8XA 4ONGL 1G1YA 3MRBB 5T5NG 5CJBA 1EO8H 2GQHA 1FNSH 1I8LC 2VKXA 8FABB 2NY7L 2DLEA 3TZVA 1NGYB 5EPMB 4HCRH 3U7WH 3QIBA 3NCCB 4JRXD 4XPTL 1NDMB 2YC1B 4X6BB 1MFBH 3JUGA 5T1DL 3AJ7A 5EWIL 1JN6B 5I3DA 4O4YL 4IISA 4Z7WF 4FQXB 2P43B 1DWJM 4UV7H 5DF0A 3M1BA 5IHUH 4GRWF 1CF8H 3MV01 3QEUA 4PBXA 3GNRA 4ZOCA 3UTQA 3H3BC 1ORQB 2FGLA 4J4PC 5EC2B 2HFGH 3G6JA 4PJ9B 1E27A 4IIQB 4PRPB 4JR9H 3RY6A 3TBYB 4JR9L 3VXRB 3WJLA 4L4TD 1G84A 3VJ6B 4UUJA 4H1LB 3Q6FA 1W3KA 3K4ZA 3MMEB 4OF0A 2JIXB 4H88L 4UILL 3ZE0E 3HS0B 3KL0A 4H8HA 3TA3B 2D0HA 2EIZB 4X80H 3EFFA 3ZMRA 4KMLB 4PTTB 2X9WA 4N0YL 4JLRA 5FYKH 4PN2A 4ODHL 4CD4A 2O5YH 4FF5A 1JFXA 3BZ4B 2WM0A 3T1WA 5IEKB 5KW9H 3U9PH 2NNAA 1KJ3L 1ZVSB 2NT1A 5A6SA 5F9WC 3S8WA 1A47A 1N4XH 1WWBX 1XF5B 2VABB 3WIIL 1G0YR 4GSDL 2WAHA 2NMSA 2DH3A 3LHPL 3WIFA 1R3JB 2GCYA 1UZ6E 2Y23A 4JZOB 1MQ8A 1NBYB 4JHBA 1WIPA 3WF0A 1A21A 2P8MA 4M8VA 5D2LA 1GQLA 1V7ML 1Q1JL 1U92A 5DO2D 3FB5A 4ZODA 1JGVL 4QOKE 4KRUA 1KGWA 4PG9B 3KYMB 4TPRL 5JOPD 3HR5B 4TRPL 3C60B 2YPLD 1IQWL 1V02E 2AJVL 2YA2A 6CGTA 4FQ1L 1RHHA 4CCCA 3MFGB 3VFTB 3RVTC 1MRCH 3Q48A 1Q9OA 1RVFH 4HH9B 4W70A 3GMPB 2AXJA 4IRSA 2CKBB 3VILA 2VI0A 1YMHA 2EDTA 4YDLC 5EUOA 1H3XA 4MCYA 5KW9L 5GGVL 1HF6A 1NP0A 1W1PA 1PZ5A 1IMHC 3QHNA 2BNQE 4JAMA 4QNPE 3RL2B 3BDYH 1VPOH 4Y4KA 3AXIA 3ULUF 1JI1A 3DETD 1PKQA 1WO2A 1AC6A 5EMYA 3WN6A 4TULL 5KZ6A 3G9AB 2IADB 2CBUA 3G5VA 5D2NB 1I8LA 1A14L 3CZGA 2VTFA 5E5MA 2AEQL 5DRNA 1CZ8H 1BD2E 4YHNA 4YDJB 2QR0A 3CSYA 5EZLB 1EGZA 1C92A 2X5PA 1F4XH 5IB3A 1CD1A 3VXRD 5ITBH 4YNYA 5IFAH 4WF7A 4L4PA 2WMGA 5C0CE 5HD8D 1CG9A 4KGLA 4F7MA 1P69B 2HTKC 2W9EL 5C09A 1OW0A 1KACB 4AD0A 4PRAA 1V7NH 3EJZC 1AHWC 3L1OH 1P2CB 4AEEA 1NMBH 4NT6B 4UNVA 1DL7H 3TGXA 4HPYH 4U1GB 5INDB 1R5WA 2EXOA 5CMAA 1WGOA 4OZFB 4YLQT 2GJ6E 1UENA 2DRUA 5CIPH 4MVBD 3WFBL 1AGFB 1OSPL 1CWVA 1JHKL 1ZBWA 5FECB 1OTSD 3TNMA 3U7VA 4CN6A 3LY6A 2XTJB 25C8H 4E41B 1KXHA 4LASL 1NEZA 2FDBP 1A6TA 3RWJA 3EO1B 4HGMA 4I2XA 4K7FA 2I9LA 4PJ5A 5A3IC 2IANB 4GQ9H 4M9OA 4JFPB 3V5KA 1XH0A 3C8KB 5JUEH 3E6HB 1NJ9B 4I18A 1L7TL 4XBEL 4DVBA 2BNUB 4QRQB 5IB4A 2HJLB 3ARVA 4WUKL 3PL6A 4QHNA 5LXGL 1IC7H 4LCIH 3TOPA 4NQTA 5FEBA 5B38B 1JHTB 3S37H 5E8DL 3CVHA 2XVLA 2EDHA 5JW3L 4WTZA 4QAWA 5GRJL 3TWCH 4CGTA 5JNYA 4X7SH 1GZPB 3QNXA 2CPCA 2W9EH 5IOPB 4WO4C 3KWWA 1F11B 1BG4A 1EGJA 4EUPH 3O2DL 1KIRB 2IFFH 1I1FB 3B5GA 1DLHB 3CX2A 3G6AB 4U1MB 3WS3B 4I13B 4PBWD 2F53A 1FL6B 3TA3C 3EJQA 1UA6H 3AY4A 1CICD 5KSAA 2ZNXA 1A7PH 4HUWA 4NQEE 4GKOA 4UU9A 4XXCC 3PABB 2ADIB 3PWJB 1T7ZA 4NKMA 5C08B 4AY1A 2VJXA 4XNUH 2OR9L 3DMMB 4X99B 1T20B 2ICEA 1MHEB 1T0MB 4WUKH 3X11A 1RK1A 4WJXA 3G6JB 2QADC 4HXBL 1RK0A 1MI5A 1CU4L 2ZUQB 4H25A 1BIIA 3CZFB 3HUJA 1N59B 2MKLC 4HHAA 4KMTH 3GIVB 3MMEA 2JIXA 3KJ4B 1R24B 4NRZA 4OCMC 5BOZG 3QEHA 2OR8A 1ED3B 1WWWX 2J8OA 3ETBF 3VXUE 1UZ1A 2OTPA 4XI5C 2H32B 1PY4A 2DICA 4MQTB 5SWZA 4HWZB 1OF2A 4U7SA 2AJSH 3QA3B 4M1DL 1C5CH 3HI1A 1N2RB 2PW2B 2CBVA 3NUKA 5IKCA 1VB9A 2IPTH 4JL1A 5M3WA 4C54A 3MRLB 3RIKA 4M03A 5EWIH 5CP7A 2H9GA 3MRCB 5GRZA 4C56D 1HKFA 3T2PA 4JRXA 5D2LB 4MSWA 3IFPB 2P7TB 4Y88A 2XTLA 4LXFA 5JW4Q 1XIWC 3QQ4A 1JAEA 5HGDA 2WMKA 1JL8A 5D5MB 4JM4H 4ZOAA 3CFDB 1FVEA 2H8PA 4B5EA 3F5KA 3UPRA 5KJRL 2LTQC 3NFPA 1UM4H 2XRAH 4G7YL 2OL3A 4YHGA 2Y2WA 1H4PA 4JO1L 1DANT 3FJTA 4CD5A 4HS3B 2I5YL 2J88L 4MHHG 3QUXA 5HHXL 2RJMA 2PWEA 4BFBD 4Z7VF 3MODL 4QF1A 2Z1KA 1V8HA 2YOCA 3OJMB 1FNAA 3VD7A 3NYDA 1NC4D 1S7UB 3FN0H 5HDBF 4JFWA 4LVNB 4PV8A 4IOIA 3GHEH 3FN0L 2WWKO 5TF1L 1GOQA 3NTCH 3AHTA 4HXAL 4NQXB 2DQTL 5LQBL 2EDLA 3BMVA 1Y6KR 3HE7A 3HG1A 4XCFL 1MJJB 3UPAA 5JQ6L 1K9FA 1YQ2A 3EFDH 4APQC 3CGTA 4HCRL 3U7WL 2UWEA 1CLZL 1O0VA 5DDHA 3QISA 4MJIA 3EHBD 3OB0H 4EKXA 3FQTA 3SHSA 1J0ZA 1FGNL 1Q1JH 4XCNB 3QJFA 1WVZA 3O6ML 3T3ME 1CYGA 1YYLH 4M7LL 3QNYA 4NKIL 4WUUA 1LK3L 1ZJAA 4GO8A 4O2EA 4H8VA 2VRKA 2WUBL 2A3HA 43CAA 4WV1A 2VSCA 3HR5A 3ZT5A 1R46A 3OLEA 4D9LL 1XGUB 4JJ5B 2HJFA 3RP1A 4ZYKB 3GSQB 2Z31D 1E4IA 4FQJH 5I16B 3VFPA 1IAOA 4A6YL 2D22A 1ZHBB 3UG3A 2OZ4A 3KEHA 4KI5D 1JDCA 4WJ5A 3AY4C 3S98A 3MZGB 4Z77A 4L1DA 1FP9A 4PRNA 3V4UH 1AD9A 1ZT7B 4JAMB 1U95B 4FFYL 5T1LB 3OKKA 3LKSA 3D4YA 1XGTA 1PKQB 4FQCH 4XTRD 5ADPH 3D4ZA 1IAIM 3AXLA 2R29L 2Q8BH 1RFDH 1KV3A 2PWDA 4WTZG 5EN2A 4DN3H 4G3YL 1TQWA 3H7LA 5DA4A 4ATDA 5TPWH 3NOIA 2J6EA 2AK4B 3STZA 4JQIH 1QX1A 2W92A 2NLJB 1XF2B 1K85A 4QRTB 3ARZA 1GZPA 3ZOAA 4M81A 3VXRA 1AJ7L 4MNHB 1WV7T 2QADD 1FIGH 3GMQA 2BHYA 4O58L 2GY7B 5E8EB 5C0IB 4PGEA 1QNRA 5C09D 3NIFE 1J5OL 4FLRA 4E4PA 4P2OD 1CENA 1RZJC 4F37F 4KKAC 4Z5RA 1YEJH 3IKCB 3E3QC 4Q2ZA 1CBVL 4D9LH 3CLWA 1EZVX 4KTDL 4NNPH 3W9EA 1UR8A 4ZTOL 5GS0D 3VFVB 3NZ8B 4B7IA 2CH8A 1CFTB 3ROOB 4D6GA 4XP4H 3KPSE 1JPGB 2VYRE 3V9FA 2ZXQA 1R3HB 3BGMB 5I0DA 4HS8L 5CSBA 1E56A 1Q9LA 2CKNA 5GJTL 3PZTA 4NRYB 4DUWA 2OTUB 3CZJA 2WHJA 2VH5L 3BUTA 1U92B 1LWHA 4XNMB 3BGFC 2CRIA 1MLBB 1QLRB 2XKUA 5LXGH 4NO0B 4HAGA 5LCVH 3GO1L 3VRJB 4OV6F 3W27A 2A9NL 4DVBB 3V5DA 3QEHB 4U3AA 1IGIL 4WV1C 1HHHA 3DUUB 2JE8A 2EH8H 2J7CA 5J1AB 2MQ3A 4L1HA 4N0CC 4P2CG 3S88L 4AZBA 4BQ6A 4FXKA 2ATKB 4UFMA 5E6IC 3ARGB 1RZFL 2MTPA 3U4AA 1OSPH 4PRBB 3RL2A 4X9IA 2YL6A 4GKSA 1FL3B 1VFBA 3RZCA 2CK2A 1F5WA 4HPYL 5I2IA 1GC1L 3ARUA 5D2NA 4ENEC 4JRXB 1JGEA 2QQQA 4LQFL 4LCUA 3D2UB 4D9RD 5C92A 1MCPL 1DBKH 3HB3D 4CCDA 3V0VB 4MJ6A 3ESVF 3PWPE 4WWKD 5EO0A 4IPLA 2ADFH 1F4YH 3BP7A 3KLHC 1N6QH 4NKMB 5C08A 5CXPA 2H8PB 3VXSD 1ZANH 3EJZD 4LHUD 4YHKL 2YBRB 3VXOA 3WEXB 2NYYC 3VFUB 3GEWB 5DZOA 3D39A 1IAII 1RZ8B 1JPST 1K4CB 5JZ7D 3EDEA 4QCEA 1O6IA 2VC9A 4JFVA 2W91A 4J3UA 5E94B 1JF1A 2NY3C 1ECEA 1ZS8A 4D0DB 3ZJKA 3BT2L 3P4MA 1A2YB 4PV8B 2NXZD 3DRQB 2Y5EA 1KFAL 1I7ZA 1TMQA 4JFSA 3SCUA 2BVPB 1KTDA 5FGCE 5BXPA 4OCXH 2VDOL 1AHWA 4JFEB 4ODSL 5HYJA 5T3ZL 4OCNC 1HWHB 2JJUA 1ZLUK 1I85A 3RZWA 1FZKA 5CEYA 5KVGH 4X6EA 5IROA 5I17A 3RM8A 1RHFA 1GGCL 2NY3B 2VAAB 1EHAA 4JFDE 4C56A 4G8FA 3ARFA 4HZAA 3FOMA 4XMKH 3QIWD 4DN4L 4OZHA 1SEQH 3BAIA 1FL5B 1QSZA 1NFIA 4N8CL 3CVHB 2EC8A 5L6YL 4Z2GA 4ZYKA 4EDWH 5J1TC 4WFED 4YHPA 3I2CH 3SJVB 3RUGB 5I1HL 5D1ZC 4LSTL 2NY2C 2NY1C 4C59B 1Q4NX 3BZEA 5KSAC 3LXCA 5BXSA 1DUYA 4UIKH 3A22A 4DGIH 4X4YB 1UASA 1C90A 1EJOL 1XF1A 1P7KB 4RL3A 4E8CA 2CPUA 2OSLB 3FT3A 3G6AA 1U8HA 1KLUB 3QUMH 5DMIH 2J5LC 1BZ9B 4LMQE 3ULUE 4X8JB 1RZIB 3S3JA 2GEEA 1IC5H 3NTCL 4RX4D 3I85A 3MFFA 3O9WD 1JK8B 2IAMD 4LHUG 4O2CA 4ZFFA 3PV7A 5TF1H 4IOIB 3U83A 5KOMC 4QKXB 1LO3H 3BPOB 5CJOH 5FGBA 1Z3GL 1T22A 1OTTC 4PJ8D 1QEWB 4UU9B 2R4SL 1VGKA 3ULSB 2ID5A 3ULUL 5B8CB 4LHUB 3E1F1 3HC3H 3O6FD 5JW4R 2V7NA 3WNNA 5EOCJ 4K3EH 2QHLA 2J8HA 4NZJA 2CXKA 2SEBA 3NAAL 1MCWM 2WZHA 2VL4A 4OZ4A 4MJIB 4KROB 1PKQE 5CGMA 2X2HA 5CJXC 1HZHH 3O6MH 5JIWA 2F8OA 4YXKH 4PGEB 5E8EA 3OAZK 4PJ7E 1R3LA 3GB7B 3MV9B 5DHYB 2G75A 2YN3A 3FQNB 1UWXH 3O3EA 1VFUA 2HT2C 2DYPD 3HNTH 2VCCA 1ZHNB 5AYQA 2O9RA 5F89A 2AK4E 3GSWB 4KKNA 2Z4QA 4H26B 3BXNB 3FB8A 1AY1H 4K3HA 3HR6A 3C2AL 3I50L 4N9GA 3SKMA 3VFVA 35C8H 4S1SH 4OB5L 1OTUC 3A4AA 5C0BA 2DN7A 3FO1B 4AISA 2IH1B 3IFLL 3MRKB 3QWQB 2WWMC 3NFSL 4MSWB 3OKMA 2DB8A 3LRLA 3VXMD 1G6RH 3EKCA 2X1WL 4NO0A 2C4XA 4PRPA 4HIJA 4K94H 2YPLB 1J1OH 1P4LB 5IMLA 5TPWL 4P4KA 2R69H 2XVNA 5DWUL 2DM3A 4I0PC 3IF1B 4D3CL 1AQMA 3I6GB 1HE7A 3WO4C 3D0VA 2D7TH 5D7LE 3BP6A 3W53A 3ZKNC 3BZ4A 2ATKA 4AL8H 3K2MC 4NQDA 5EO1A 3BAYA 1M7DA 2YL9A 3ARGA 5E09A 4RFNB 2VCAA 3AZRA 4BH8A 3VGGA 3BD5A 1X5JA 5F7WC 4X7DC 5MP6L 5D4QA 4QRRB 4OTXL 4LIQH 4JG1H 1DDHA 2Z93B 4DKFH 1JUFA 3SKOA 2YLLA 4PMZA 3VXNA 1RQ5A 5E00A 1JPTL 4YHLH 4FMFA 1L0QA 3S36L 2XZCH 4NQCB 3OLIA 3L4UA 4HWEH 3EJSA 3IYLW 1MIML 2HLFC 2QPUA 1U9KA 4TUOA 5DDHB 4U6YB 1HCFX 4L3CB 1WZKA 3IU4H 1MELA 2OYMA 3CSPA 4H8WC 5C71A 4DKDC 4PJAE 2GK1B 5TQ0H 3F5WB 4DK3A 1OPGL 1X6NA 1BLNB 2WIMA 5HGHB 3QUZC 1J8HE 3GSVB 3CDGA 4G7VH 3PZIA 4GKZB 1AE6H 2XYLA 2EZ0C 2BVDA 1DEEB 4WENB 3DIFA 3ARYA 2H6PA 3D3VA 3V6OA 1V3JA 4NKDA 3UJJH 2WXDM 2W4XA 3OG4B 2VURA 3N13A 3WFEH 1UZ4A 2WWDA 1CGYA 4NIKB 2ATPA 4XCYB 3I6LD 2CK0L 3D69A 4OLYL 1N0XH 1WLHA 2J8UE 4NJ9L 3H6JA 5FIPA 5JOEA 5LAXA 2DQUL 4JGUA 1OAZH 2C3WA 3W0WA 1WAAF 4HT1L 3PQYE 5FXCH 1LEKB 3WUGA 2F7RA 4TUFA 4XNZB 5EU5A 2ENSA 5D8JH 4D1IA 4UFJA 1I3RB 5EN2B 4ZS7L 3PWUB 1FG9C 4YK4C 3TTOA 1T1ZA 4EAMA 4W4OC 2FIKB 1NANH 4CVUA 5L8KB 2QQKH 1C7SA 3O41B 3HPLA 4Y16C 5GS2D 5E03A 2CBJA 3S37L 3VIKA 1RUMH 2YR3A 4S2SB 5ESQA 1MNUL 3U1SL 2CKBH 1I9EA 3MZTA 4AENB 3CAFA 3VXSA 4PJIE 5DUML 4W8AA 4J23A 4PLKD 3BZEB 3WDHA 2BXYA 5HBFA 3TBWA 4OIIL 2G5RA 1YEHH 1JYXA 3QNZB 4MNGB 1ULVA 4WGWB 4TTDD 3UTSB 5ADOL 1QPKA 3OAUL 3DBXB 2F8XC 1LNUA 1BEYL 1U8HB 3BIKA 3D52A 4KK8C 4PTMA 3S88H 1INEH 5I8EA 5IFPA 3RGVA 3L4TA 3WFEL 4PJ5B 1QNOA 1U8MB 5F3HB 4UTFA 3HKFA 2O5YL 1H3PH 3VI4E 2EPMX 2FX7L 4G6MH 4PJHB 3C6LB 1DWIM 4NI3A 3WD3A 2JELL 4KHXH 3SUSA 5GGVH 2OJEB 3BKYL 1EERB 3KHOA 2GUOB 2FZ3B 5FYJU 4CD8A 4M6AA 1F6AA 4JZNA 2NTFB 2F54E 3EYFB 1W8NA 3QIBB 1RUAH 5EU4B 3CFEB 1B9ZA 1S9XB 4JM2A 5AD0B 4ZS7H 1ZGLP 3MQIA 3WH6A 4AZ7A 4C58B 3RWDA 3QCUH 1AQDA 4PGDB 1OT1A 3LPPA 3KPSD 4ODWA 4FZEL 3N18A 5C0EA 3HG4A 1S7RA 4ZPTB 2H45A 4LBEA 3FB8B 1S7XB 3PQYD 1D5IH 4EI6A 1G7JA 4NGHH 2G2RB 4U2ZA 2F53B 4M1DH 4HK0B 2IXUA 3CC5B 4AH2A 5C0BB 1OD9A 4P2YA 4FLQA 1CICC 2XUCA 4GKSB 4JRWA 2RFXB 1ZAGA 1MHCA 1LE9B 1TVBB 3W11D 3QDMD 4YUEL 2CIIA 4NZDA 4KKCD 2CJUL 3KXFD 5C0FA 3QO1B 2DWDA 2X1XR 3GMNB 1WZMA 3WXWH 5K9QG 4TVPH 4GQ9L 2ARJQ 3PWPA 3CZFA 3HUJB 2CRZA 4Y2DB 1OL0A 4KHXL 2QV2A 5GS3A 4B16A 1CZ8L 3DX1A 2J7GA 1PKOA 1R7OA 3ULUC 1YQVL 3WIHL 1DBJL 2H32A 4F79A 1TQUA 3C09B 4HUMB 4WHTA 2BMKA 3INUH 4K8RC 4WKFA 1F45A 3DVGB 5MEPA 1BFOB 3EO0B 4P3DA 1YA5A 3BKMH 2QSCH 1H1NA 1W3LA 4KK9C 3BVNB 3HS0A 1I7TA 4YR6A 4U1KB 5T3XL 3QFJE 5IMMB 2OSWA 4E8DA 4RISL 4WEUD 2CUHA 1FDLH 1JUFB 4FXGB 1Z5LA 1K4DB 4MQ7B 5DQDH 2EQDA 5E00B 2VDQH 2WMFA 4HJJL 5A6AA 4M1GH 4P5TA 1F58H 1KIPA 1KN4H 2B4CC 5D70L 1I1AB 2Q1EA 3WUZA 4IRSB 1IGMH 1KCUH 2VABA 4JO4L 2HFEB 4P46D 5DJ8B 4PSPA 5FCZA 1AXIB 1CXKA 1A3LL 3ARED 1UA3A 4WGVB 3BDBA 3FOMB 1BD2A 3L3OB 4R4FH 5F70A 1X44A 3G5VB 1EH9A 3R1GH 4WSKA 3S7GA 3JV0A 3ALWA 1S7SB 5TDOB 4BFIB 3AQUA 5ACMA 4NO0D 1B3ZA 4TSAH 4NHCH 3THMH 3D51A 4P4KD 2QR0B 3CSBA 5CD5C 3Q3GB 3WDPP 1OQOA 4MMZC 4FFVC 1OARL 4RISH 3QUYB 3L3DA 3GYCA 3D69B 4Z7WB 5CILL 3GGWB 4R7DA 3W38A 4M5YH 3O11B 2QSCL 5HHXH 1KCKA 4GO9A 3T77B 4QOKA 4GAGH 5LAXB 3CFKA 1V6XA 2Y72A 1YMME 4YAQB 3Q1SH 5F9JB 4WFEE 5DD5H 4F9LA 3TVMC 1AKJA 5D9OA 4Y8AA 5B39G 4PMYA 1JPTH 4YHLL 1MCLA 3G04A 3ZL4H 2VLKA 3SDDD 4WEBH 1TETH 2GK0A 3MV9D 3PE9A 5FO7A 5ABHA 1ZV5A 3POHA 5BROA 3WY2A 4FQPA 2CLRA 1NCTA 3QXVA 3HRZA 4ODUB 4CNIB 1F90L 2NZIA 3WFCL 4X9GA 3S4SG 3ZM8A 2B1AH 4D1JA 3TH4T 43CAB 1BYDA 3C60C 4LHQB 5DD1L 1MJ8L 5I8OH 1DJSA 4X7CC 1RH9A 2BVOB 1E6PA 1FO0L 1FGVL 1JDDA 1G0XA 1KBGL 5IW3A 1JNNL 3DHMA 4J7RA 4D6JA 3WUBA 3AU1B 4P2OC 5CUSL 1WDPA 1U58A 4RGNE 5H2BA 5SWZE 1RMFL 2EH7H 1MJUL 1UYWL 3HAEA 4UNIA 5DJ2B 5IVZB 2ZKHL 3DXAD 4JDTH 3RWEA 5IXEA 4WFGD 4DQOH 1VEPA 2H3NB 1V3KA 3FAWA 5DQJA 4ZUVB 2C1PA 3RAJL 1VKXB 1GGBH 1G7QB 5F9WB 3WO3B 5BO1L 3GUTA 3BIAX 1JBJA 1QO3B 4U0RB 4H88H 1DR9A 2IQ9L 1TETL 1XH1A 1NANI 3L2LA 2R2BB 2VXTH 1F6AB 3TBSA 1C5BH 5DVMA 1UVQA 5E8PB 5IFJB 5T1MB 3GM0A 1LEKA 4LQ1A 4QYOB 1W3JA 4JQXC 4HZ6A 3ROLA 1FL6A 4FTVA 2ZSWB 4WHCA 4EBQH 1FC1A 1I7RA 4NO3B 5IB5B 4XCFH 3V52L 5C0IA 4EN3B 2R2HB 4UV7L 2DLHA 4HX1B 1TQSA 3ZJ6A 3DJ9A 1R5IB 4CVWA 2A74A 1D2KA 2ARJA 4PGCB 3NN8B 1YY9D 5GSVA 2W66A 3W28A 3UJJL 4HTYA 1IGTB 2CRYA 4LLDA 1YPZA 4IRJC 3IKCA 3EOTL 3KYNA 5F1IB 3L5JA 1TZIB 2B20A 5HBBA 2ZUWA 2E9MA 1YMMA 2NX5A 4XXDA 4YHZL 3MSPA 1CEOA 3CO4A 4H0HB 3NZ8A 4X0KA 4KXZI 3BI9X 4NKIH 4BZYA 5IMKB 2V2TA 3IAQA 3QNZA 2UWEF 5HHNB 1JZ8A 1V6VA 1FRGL 3MXVL 1ZEAH 3LX9A 5DTFA 3VFWA 4R27A 2GSGA 3MJ8B 5ECUA 4P23B 4MXVE 4LGSB 1M4KA 1T83C 4NQCA 4F37K 5IP4A 4APQB 1DUZA 3IT8D 3AS3A 3LKPB 1ZS2A 3PHAA 5EBLB 2WC7A 2CESA 4GRLD 3ZHDA 4Y2DA 4QEGA 3S5YA 1CXFA 2JB6A 2VN4A 1I9JL 2DGAA 3S96A 2ZPKL 1MHEA 1B88A 4PRHE 3LN4B 2R2CA 1LMKA 3OSKA 3WY4A 2B0SL 1QRNA 4OZIB 4Y4HA 4OJFH 5GISH 5MEPB 1A6AA 2R0KH 4GOSA 5K59F 2QQNH 4J6RL 1SYSA 1T89A 3F7QA 7CGTA 3BFOA 4P99A 5DR5L 3SOBL 5A3ID 1B3XA 1S5IL 1EGJH 5D5MA 5IMMA 3CZNA 1NMAH 5SWSD 3P0GB 3NSNA 5DUMH 3QHOA 4I3GA 3AB0C 3ARSA 2BNRE 4P5TB 1KIPB 1Y7VA 3IGUA 2VT0A 3IU3B 5F3BA 3DX9B 2R0ZL 1RSFA 4YO0B 5EIIB 2J74A 4PUEA 1KLGB 2WMPA 4UT6L 3W0WB 4F7TB 4XP5H 5CGTA 3S4SB 3QFJB 5MERA 3LRHA 3QEUB 1T2JA 5I1LA 4OV5B 4K23H 3RKDD 4F66A 4OD3H 5FHAH 1RPQA 3UTQB 4Y5VB 3U2SA 1HHIA 3P0YL 1EIBA 2VNCA 3MGOA 1JGIA 4M5ZH 4WFHD 1ONQA 5I18L 1E6OH 4PIRF 5F1OB 4BSVB 4P4RA 1G7LB 1QYGL 3NABH 3PWPD 3QI9D 4Z8FH 1KB9J 5KAQF 3M17B 2BFGA 4XVSH 4MQXC 3WN5C 2UY4A 1KELL 5EORL 2A2QT 3MRQB 4KTEL 5DT7A 3CDFA 1D5BB 3HZVA 5IESL 1YJDH 2FYYA 3P0VH 3SGEH 3VFGH 1TVHB 4HZLA 1BAFL 2FD6H 5E2WL 1WDQA 5B39A 5JPNA 1F3RB 1QBAA 1G5AA 5LGKA 1XZ0A 5KG9B 4LEOB 1RULH 3RILA 3WQ8A 4HAFA 2XWBA 1KCSL 4PPTA 4O2EB 3TWCL 4QRRD 1NBQA 4IBLT 1U8PA 3UERA 3QB7C 4LL9A 4NYLB 2AVGA 4TSCL 2HJKA 1KTKE 1HI6B 4IMKC 4CJ1A 2GK0B 3J7HA 4OCLC 1UG9A 3T4AA 5BXFB 1OP3H 1JZ6A 4HKJA 5DJCA 3SDXA 4Q9BA 4P8WA 3FOLA 5TFSL 5D1ZA 4I4WA 3LSOA 1OINA 2NTFA 4KK8D 5J9PA 4PJCE 2X10A 3VG9B 4DWSA 1VACB 1FHGA 4P9HC 3LQAL 5IQ7L 4B0MM 1KBKA 4JRYD 3OKKB 1C1EH 4ONHB 5C07E 3CLFH 8A3HA 3AREA 5FA4B 4EIGB 2VE6A 3PWVB 1TZHB 3MLXL 3T0EB 1OIFA 3T0ED 1YMHB 1HNFA 3WXVL 3F4VA 1QFPA 4GXVH 4Y4FA 3O4LB 5IV2B 1NLDH 1QNSA 1IVLA 4ORGA 2Y1VA 1KLUA 4MS8D 4D94A 1FZOA 1AY1L 3GSQA 1A4KA 3C5ZD 1U2YA 1TJIL 2JEPA 2WHMA 1UOKA 4XPAH 3S36X 3CLEH 1LF1A 2JF6A 2VN7A 3EYVA 3N11A 2ZCKL 4M6NL 1HJSA 2NXYB 1Q0XL 2B2XL 1YY8A 1MFAH 2VLJA 3EMZA 2HKFH 4MB1A 1XGTB 2BK8A 4LARL 4PJIA 3WD5H 3IJ8A 1QUNA 5BZDA 3WD5L 3GIZL 4BYHA 1UWGL 3UO1L 2G3IA 1FE8H 1AKJD 1MCEA 5FYKD 4NKOA 5F9DC 1BQHA 2LVCA 4AEFA 3QUXC 2ADGA 2GAZB 1EHXA 4OLEA 2MQ0A 5DEGA 2EXWC 3O3EB 2ARJB 4JZJA 4DOHB 2AI0H 5KZCD 1DBAL 3QSKB 4PRHA 1X5YA 1JYVA 3BXNA 4AK1A 3TC9A 1LJYA 1VBRA 4DGVL 1KBGH 2DQDL 1A7OL 5C86A 1BG9A 1VFFA 2X4PA 3FO1A 4W89A 2VDNL 2CDFA 3IXTA 5ALCL 2DQJH 3EOBB 5DJ2A 2XQBH 5KVFH 3I6LE 2DL9A 4YFEA 2CKSA 1T04B 4JO2H 1VHPA 5I1JH 2C1PB 1VKXA 3N9KA 4AD2A 6FABL 1D6EA 1FYTD 3BKJH 5DJ8A 6A3HA 3V6ZA 1MREH 3BKCH 4YH6A 2X4OB 4G8EA 4XRCA 1R3HA 8FABA 3EOAB 3HZYB 1JVKA 3MV8B 4WW2B 5F71A 3IFLH 4V28A 2PO6D 2XN2A 3QDJD 4DM2A 5ADPL 1YN7B 3RHWF 4JDVB 4RQQB 2FHCA 4M6OH 2DKSA 3G5YB 4JVWA 1S8DA 4O4YH 2E3VA 3VDCA 3HI6L 3RVVD 2DQFA 3VE0B 4JCMA 3ZKMC 4O51B 1JWMA 1FYHB 2C0HA 4X0VA 4EN3A 4WKAA 4LRNL 5CSYA 4YWGH 1IGYB 1OGBA 3SO5A 3U6RB 2ZJSL 3LS5H 2KH2B 4L4OA 3QPXL 2CNCA 1OOAA 2D20A 3HNTL 5ABDE 4X4XB 4Z7OE 1YYLL 1C8QA 3OXSA 3KYNB 1GGIL 5D1XC 5F3BB 1Q94A 1F3DH 3AFLA 4OCRH 4KDTC 2AMGA 1KLGA 1IM3B 4ESKA 2EDKA 4B50A 1B3YA 1BBDL 1VFBB 4UUJB 4JQVA 1U30A 1PDKA 5MERB 4KMQA 4GAGL 4ZDHB 1K6QL 3H9SA 4HKXA 5D7LA 4GH7B 1X6LA 1GOFA 1AR2A 3HE6C 1IEBB 3NH7L 4F57H 1U8JA 5GGTL 2MJWA 1BAGA 1TVPA 4JDZA 2A6IB 3RRQA 1DUZB 4RFNC 3LRMA 4GKZA 5K9QI 1N59A 4G43B 3EFDL 4Y16D 4JFEA 1K6AA 3GIVA 4PMVA 1BFVH 2P8LB 4F9LC 3ZJ7A 4MA1C 3S96B 3O3DB 3TVMD 1NCUA 5DVKA 5JOFB 1RZ8A 2OYLA 1V3MA 3KLAA 3T2NH 3PZMA 4Y4FC 1MJ8H 3PDDA 1ZLVK 5I8OL 1J8HD 1VJZA 5B39B 2YK1H 3PZUA 3W24A 3WF3A 1E4XH 3D85B 4KJPD 3KL5A 1WKYA 3V79C 1QI5A 5LGHH 3TIDA 4JQIL 2NXZC 3CVHH 1RZKL 4QXGL 2CGRL 4GKNB 3F6LA 1UM4L 4G7YH 2NY0B 4Y89A 1FVCB 1HN1A 4LSPH 3N1PC 1IBGH 2CKBA 3IJ7A 4IRSD 4UTBL 5T1KD 5D9SA 3I02A 5CS7A 3QYCA 4E5XB 3CX5J 4O5LH 3B8YA 5CKGA 4ZFOA 3KNBA 5DS8B 1UQSB 3NJ3A 4AENA 1MUJA 3PG2A 4JPVL 2YHGA 3MUZ1 3KPMB 5C1MB 5CPTA 2GJ6A 1RFDL 4AIOA 2G4FA 1TCMA 5F1KC 3E2HC 5FK9A 3RWIA 2Y07H 1U8OA 1ZLSH 4N1HB 2VXUL 3AYSA 5C9JA 2DI7A 3V95A 1NKOA 4OGYL 5EC2A 2UUDH 3PGDB 2XFXB 5LVEA 3ARBC 3TPUA 1G7HB 4K7PY 1NBZA 2X4QA 5C09E 1E0WA 1KGUA 2LV4A 5A8PA 3C6LA 2HFFB 3PP4H 1IC1A 5EU7C 5HYSG 1CCZA 2AJVH 5D7KE 3GSXA 4GAJL 4JKLA 4LSVH 1CXIA 4LCYB 4WU5A 5I5RA 1TPXC 3FKUS 3L95A 2Q6WA 2IEPA 4PCTA 4KKBD 3V5HA 3ZKQD 3H0TA 5L0QB 1TJHH 5EZIL 2HJKB 5ABFB 4CW1A 3D18B 5HDRA 5B22A 3WF1A 1DBKL 3LEYL 3RWFA 1V3IA 4P5MB 3A4WA 2FHFA 1YEFL 4JREB 4LVEA 2WBJA 3EAKA 1E0XA 1OAZL 5D1ZB 1WTGT 4ACPA 2AJZA 2DOCA 3GMOB 3LD8C 3DUHA 1CWYA 4W87A 2VC2H 1H0DA 4DWSD 4Q6IC 1LO4H 4X6FA 2I9LB 3CC5A 4J6RH 3ZZ1A 1S7VA 3UTPE 1QYGH 4PJ7B 5JHDD 1VGEL 2F58H 4M6MH 3LKNB 3WNLA 1X5KA 4Z7QE 1WDSA 4HMEA 5E8DH 4UOW0 3IXTB 4M80A 2HN7B 3FN9A 3KYAA 3GSWA 5ETUA 1A7BA 3PL6B 4QHNB 5T5FH 4F7CB 4NZRL 3AIQA 3K1DA 1Q9OB 4XVUC 1O5DT 2D31A 2CLZB 1AD9B 1ZT7A 4HMCA 3GMNA 5DK2B 4FQLL 4YO0A 5EIIA 5FB8B 4Z7UA 2AK1L 2RCSL 4Z7VE 4PJEF 3UPCA 3OHXA 3CUJA 1QVBA 5GGRY 2EYTB 5JA9A 2BSRA 3EMCA 4MZ3A 1VENA 1RP9A 2O5ZH 2WLZA 3PGCB 1TMCB 1O7DC 3LMJH 1Y6MR 3UESA 1BEYH 3MLRL 4NO5B 1KJ2B 1FRGH 1K5NA 1GC1H 3MLPA 4LEXH 4BK5A 3LV3B 1U36A 3SKOB 4J8RB 4F7EB 2FL5A 1S5HA 4KRPC 4L8DA 2UYLB 4P4KB 4Q0XH 1BQHB 2GSJA 2A1WL 5JDSB 5AYUL 4UDUB 3BP4B 1JTPA 3EBVA 3SBWC 1U8QA 2AI0L 5C7XL 3IANA 3JSSA 1YQVH 4JFOB 3TZVD 3ARBB 3L6FA 2XVKA 4PRWA 2OI9C 5J6HB 3HZVB 3QXWA 1HOCA 4K71B 3OXSB 1M03A 5AG8A 3IS0X 4I9WD 1MCKA 4UBDD 4N1EA 4P2RE 5HHQB 1K3ZA 1XF3A 3P77B 3JUZA 4H25B 1MI5D 3WV0A 1FQ9C 3VGFA 1BYCA 1XCQA 1DQML 5E24E 1ITXA 5DJAA 4IRZL 2B5IB 4P2QB 2J8GA 4QLLA 1LEIB 1FP8A 4ML4A 3WDRA 4HULB 5GS1C 4R96A 3M8OH 3BSHA 4AZCA 4OZFA 4ERSL 3GIZH 1B1YA 1XD1A 2YD4A 5DJCB 3J8F7 4P5KA 4XNMA 1BSIA 3UTSD 3P11H 5E6IB 4MAUH 1P84J 1QLFB 5E6YA 5F7LB 4RMUA 2D1ZA 1C7TA 4M9PA 1CXLA 3DHPA 1N64H 4XCEA 1YEIH 3EYUH 1R7AA 1FZJB 2PO6A 4UAOC 3MCLH 4MNQE 1UKPA 2X4RB 3VSUA 1U8KA 5DFTA 4QP0A 4G8IA 2APWA 4PLJC 2YD2A 1L7IL 5FCUL 4NJAL 3TIDB 1Q6EA 5M95B 5FV1L 3B5HA 3IFOA 4JN2B 4GG8A 5LWYH 4N8CH 3UC0L 3BQUC 3QG6B 5TQ2L 1MCWW 5IBUB 3CC1A 2ATPB 2I60L 4KAQL 4XCYA 5I1HH 3VXSB 3I2CL 4GW5B 3DX6A 1NAML 2XV6B 2J8UA 1WCBB 5HGBB 1BJ1H 3S6CA 1AVAA 5T33L 1ZBKA 2E8ZA 1H3TA 4HEPG 3OQ3B 2E7BA 4AYGA 3QUXD 3MBXL 1MFAL 2HVMA 2EXWD 4YBQC 2D7NA 1T0OA 4XX6A 1R3KA 5GZOD 4TSCH 5I76B 1IEBA 1LO3L 2GHWB 4R97B 2ICCA 1RV6X 3FRUB 2Y7QB 3MCLL 3NCMA 2FO1A 3SO3B 1FFPB 1A1MB 1A7PL 3TH3T 4ODSH 4AZHA 4H7VA 2OSYA 3HE7D 1QOKA 3HG1D 3KPTA 4GAFB 1NWUA 4AZ5A 4D6CA 1E15A 5JR1H 1X5AA 4JZNB 4UQAA 4FLOA 5C0AB 2G3JA 3AYRA 4MNLA 1FAIL 2DBLL 1KSRA 1LK3H 1NFDE 4C57C 1R24A 4M1CD 5A2KH 4HUVA 3MOAH 3QUKA 1P5UA 4F3FA 3MOAL 1FFRA 2V9RA 4WLCA 2VDNH 2R2BA 4LCYA 2QV4A 3TO2A 3L3GA 4FABH 2ZUUA 1WZLA 1X5HA 3BH9A 1BF8A 2IANE 5ABFA 3WKMH 5CBEA 4UTBH 4PJHA 4WI2A 4XAKE 3BZDA 4HUKB 1EEUA 2DQTH 4U31A 3WUWB 3DX3A 4HF5H 1JNEA 4DAGL 3NZHL 1ZHBA 4OKVA 3VFMA 3QUML 5HI5C 2A9MH 2IPTL 3N85H 2FEDD 3SQBA 1I1AD 3LKSB 4UNUA 1KB5H 1JNJA 3L2MA 3RX5A 3SCVA 3KPMA 2XA8H 1NCDL 2GW5A 5SWQA 1L0PA 2XN9B 3GXFA 1UWXK 4RMRA 2GJ6D 1QBMH 5DJDA 2VB5A 5I1AB 2A6DB 3RA7H 3GSNL 4Y5YA 1MVUA 2D31B 4GZEA 5CHNB 1UXWB 2EICA 2AK4A 4NZTL 1EAPB 2OLDA 4DCQB 3CBWA 5FYLH 2WWKT 2EYTA 4HWNA 5C0BE 4OCRL 4APQA 2ZOXA 3W37A 1GQJA 4TVDA 3IDYB 4HIIB 2X9YA 4MNHA 3M7SA 3KJ6H 4R2GC 1EXUB 4N0UB 4QF1B 1J10A 3X3FH 4JY4A 5F7EL 4JG1L 4Q74A 1PPIA 4LVNC 3V4PH 3QIWB 4OTXH 2JIWA 1DANU 3CUGA 2YN5A 3UDWC 3QR3A 2OS7A 5J0BA 4XP9L 4MD0A 5CWSB 3O6FC 4PJFE 4OZ4B 3THCA 1KCRL 1LP9F 4G43A 5JTWA 3F7RA 3LVEA 4H8WH 2Z91A 4LGPB 3RY6C 1P4IH 4M7JL 1MRDL 3MJGX 1A4JA 4ZS6D 1NGZA 3WSQH 5L7XL 3RTQC 5IHSA 2BVQB 4TOQA 4XGZA 5C0RL 2H26B 2LTQB 4MDIA 2V5YA 5I9QB 1NSNL 3RVWD 1T1XA 2YS4A 5LA2A 3S34H 3VSVA 4HPGA 1JWUB 2F53D 1WBZB 1E3XA 5DVNA 1TFVA 1G6RL 5EOCL 4LDLB 3TP4A 2D03H 3DUSB 5JHDA 4TN9A 1J5OH 4M3KB 4CMMA 2CO6B 1IAMA 2NY4B 1G7MB 4OCYH 3QIWC 1V6WA 4GAJH 3QFJA 1MRCL 3QIUD 2NPLX 5IJKC 5HDBE 2IBZX 5IW1A 2C4FT 1GZJA 1UGNA 4IMLA 1M71A 1N5AB 2VUOA 4R0LC 1QR4A 1VRXA 4YDVB 5I1CH 4Q7DA 1K8DB 4P2RA 2VLMD 5DRNB 1JPFB 4L29B 1XH3B 3CU1A 4M93C 3MXVH 2J47A 3E8UH 3PGCA 2JIXD 4XMPL 2J7LA 3VWJC 2CR6A 3L4YA 4Y8DC 3ARDB 3VGAB 1I4FB 3A24A 2PO6B 3AMGA 2WMHA 1CS6A 4NWUH 4YNYB 4GRWE 4FFYH 1GGUA 2YXFA 1OIMA 3WBEA 1YEFH 2YIHA 3DHUA 4QTIH 4DK6A 4XPGH 3QCUL 5JDSA 2CIKA 4G6JH 3ZLQC 4H0IA 4JN2A 1N6QL 3DETC 4PLOB 4YQXL 1MNUH 1K8IB 2ZP0T 4BJLA 2E27L 3WN5B 4YHIA 3RWHB 2YDSA 3LDBB 4OCWL 5BVPL 1C12A 4FQ1H 4HIXH 1SVZA 1WCBA 2ZCKH 1KG0A 5LCVL 2AXFB 4WCYL 1W2VA 3D39B 3NA9H 5TE4L 4ZFZB 1V08A 3FOLB 2HRPL 3NDZA 1B4RA 4W85A 3GKWH 5F9JA 4YAQA 4G6KL 4LARH 5F6IC 2E9IA 4ACZB 5FOBB 4BQ3A 3F7VA 4G9FD 2UY2A 1F2QA 2W0KA 4ONHA 5CBAB 2IMNA 2JB5L 3WH7A 1MFDH 4OF3A 2DI9A 2XZAH 3ULUH 1XCWA 3MC0A 2CK0H 3ZDXE 1LO2L 1FH5L 4P5KB 3ULVL 3WFBH 5CZXC 5CLWA 1S9KC 5D7KD 1UCBL 1CT8B 2F74A 5BS0B 5I9QC 2F54A 5KEZA 3O2VL 3IJSA 4NKDB 4NOBA 1VSCA 1RJCA 4X6FB 3D5HA 3P0YH 2FJGB 4XBGA 5DJZA 4A6YA 3QNXB 4Y5YC 3MOQA 2X4RA 1ESWA 4R97C 2NW0A 1KWKA 2BFVL 4Q9QH 3GXPA 3K8MA 1VEOA 2R8SL 4X6CE 4S0TD 1P6WA 3O6FB 1H8OA 3UTTE 2XI9A 2OSXA 2DJUA 5D2NE 5D6CB 3POCA 4EDWL 1HDMA 5D9PA 3TO2B 4JVPA 2D3NA 3OTTA 2H3NA 5GSVB 4OGAD 2YMXH 4HZ7A 4DVRH 5JHDE 3UTPD 1E1EA 3UAJD 4WCYH 5GGRB 1KOAA 5D72L 4PRBA 4L4VD 4YBLB 1TQBC 3DX7A 4ZUSB 2WVUA 2BRRH 4WUUD 4X98B 4BQ5A 4GMSH 1P1ZA 4YJZL 3VM7A 3B5TA 1GH7A 3FCTB 1D9KC 5D70H 2R2EA 4P9MH 4MD4B 12E8H 4L8DB 3I75B 3C5ZB 3G9VA 1NCBH 3EGSB 4FQXA 3GJFB 4L9DA 1FH5H 4RBPH 5JIIA 4JFOA 3MLXH 4QWWD 3K74B 4CD6A 3SDXF 1UD6A 1ED3A 4XX1E 3PHSA 3VIHA 3U7YL 4W5UA 3LQAH 5SX5K 1CN4A 5IQ7H 2OWWA 1T03L 2KL6A 2Y9RT 3SKJH 2NX5B 4JKMA 4XXDB 5C3TA 4LSQH 3Q6GL 3CXHK 4ZTPL 3DSFL 2EADA 4Z76B 4PV9B 2ZOKB 4EN3C 3ZO9A 2V6HA 2GSIB 1V3LA 2JCCE 1F6FB 2XA3A 4XHQA 1CDHA 5I73C 3T3PE 3TCLB 3BUQA 2DQJL 3W4RA 3SCMB 1BQHG 2A6JB 3MRHA 1L4IA 1U8LA 2HKHL 1TTUA 3T0WA 1YNTB 2LAGB 3MLUL 4AD4A 1SM3L 1QW8A 4OB5H 4M1GL 3CUHA 4R90H 3HUJF 3NVQA 7FABL 2P7TA 3VE0A 5GNZA 1CGXA 1LK2B 1XF5A 1A5FL 2YPVH 4G80B 4OCXL 2QSTA 2W67A 4KPHL 1FO0A 4RGOH 2HYMA 4Y2OA 3ZE1E 2OI9B 1QFWI 1CL7H 1QNZH 4M61B 2IH1A 4MDJB 5DQ9A 1PZ2A 4U6TA 2R23A 3CFBB 4ODBD 5C9KA 1JV5A 4PJXE 4AEIL 2L7UA 1F8TL 4Q7NA 5K9OA 5HI4D 1J1OL 3QO0A 5BRZD 4AWEA 2HRLA 1ADQA 1W1YA 4PRPD 1NBVH 5IMLB 4L3EA 1G7MA 1MHCB 1LE9A 3DV4A 4S1DC 2CHOA 4J1UA 3U7YH 4FQ2L 3W2DL 3CPLA 2XFYA 5JIPA 5CHNA 3LQMA 3I6KB 4K3GA 3OLDA 2RBLA 4AJ0A 3BP6B 4YHOH 5DFAA 3QDME 3B3IA 2V3DA 3CLEL 3PWPB 3CDYA 3FONB 2O9PA 1MCDA 1LG1A 1PYWA 7FABH 5I1LB 3HG5A 4UT9L 1TCRB 2O26U 2UWEB 4BQCA 2EDRA 1A6WH 1Z9LA 4DO5A 4AD1A 3OJDA 3MANA 3FO9A 4XCNA 5FYJL 2ZOLA 3KPQB 3VXUB 3WSQL 4RRPG 1IQDB 1NUDA 4EQ3A 1BFOA 5JIKA 1MFCH 5DGRA 5CZKA 5D7SL 1QOXA 1WEJL 4Q6IB 3UTOA 4F2MB 1UH4A 1A4JB 4FXLA 3LD8B 5ID0B 5F7FA 2NCMA 1D5BA 4LVHC 5A16A 1VACA 4B41A 4PJDF 3HMCA 3H42H 4IDJL 3VD5A 4EUPA 5I71B 4Z95L 1XR8B 2VE6B 3FB6A 3PWVA 5D7JB 5E99L 2RHEA 5FKAB 2XNAA 3IDNA 4PJDE 4WWKA 1TLKA 4OZOA 5F7HA 3CVHL 2EO1A 4NNYB 2F2HA 5GRXG 2YL8A 4LF3B 3ZE1F 4PMRA 4G42A 3SIMA 4OZFG 5FD0A 2Z8SA 4PRDA 3U0TA 3VI3F 4IDLA 2FX7H 5DLMH 4JFYB 1F42A 5EU6A 1II4E 4FQJL 3L3KB 1A9EA 2M2DA 3ZE2E 4YDVA 3TONA 4BFIA 5BMFH 1EUTA 3P2TA 5TDNA 3UXFA 3VNYA 1OGGA 4M3JA 3P4OA 1UJ3A 3SQOH 1GORA 2OYPA 4URTB 5I8KL 1GONA 1I4FA 1CQYA 1FCGA 3NCOA 2YDRA 4GI6A 4PMNA 5F8RC 5SWQB 4UFLA 4ZSOE 1KGCE 2AV7A 4P4KC 4WEBL 4MNQA 3GSNB 4PJ8C 1MCSA 3HC0B 3KG5A 3ZYJA 3CIVA 5E8OA 1GVYA 3ZKND 3U1SH 2VWEC 4YN5A 4JPIA 3T77A 2VCBA 5C0JB 5HYJD 1MCNA 4LLWB 3B2VL 4S2SA 1NCCH 5ESQB 4RA0C 3RIFK 2G9HA 3CMOL 5JO5B 4Z7NE 3BVVA 2R0ZH 3KWWB 4M7LH 3MU7A 3RQ3A 2R0LL 3RWFB 2NY0C 1CFTA 2JJSA 4GUPB 5ACLA 1RZKH 1DDHB 2F19L 4LCWD 4PYHA 3UYRH 1XSJA 5MP6H 4LCWB 5I23A 2OMNA 3IXAB 1DQDL 1XGPA 4UTAL 2X4TB 4Z2JA 2V7HB 3CCHA 2JKXA 1NCNA 4FG6C 2W0LA 4G9FA 3ILQC 1R47A 1A6ZA 3MV9E 4OLZL 3C60D 3MRPA 3BVUA 2X4NB 5JXEA 1T1XB 4JGMA 3EOAA 4WW2A 4D6IA 5CGYC 1ROWA 4MA1B 4U5IA 1ZOXA 3SN6N 3IJSB 4PJCA 2FBJL 3IJHA 1B4JH 5J1AA 1LP9A 4TUJB 4OT1L 2R39A 4QRPE 1OD7A 1REIA 3KPRE 4MXWH 4RWYH 3MO1A 1F4YL 3HC4L 1PG7L 3F58H 5HHPA 4YIQA 3DIFB 4OQ1A 4PJ8A 5SV4A 4GI8A 5EOTB 4PEEA 4Z7VA 3AMCA 5B21A 4TRPH 4ODWB 3OAUH 1TPXB 4JKPL 1JD9A 4QXGH 5IESH 5E8PA 3VIPA 3F8UB 1CFNA 3MA9H 5SX4I 1KXQE 1S7XA 1WICA 4YXHH 3QUZD 5FDWA 3WD1A 2G2RA 3D2UA 4Y1AD 4Z7UE 3PNWB 2JCCB 4NNPL 3LQZA 5E8NA 1XHGA 3B9KD 4R0LB 1IM9A 1UWTA 2EABA 4U1NB 4ZE4A 2W38A 3IRPX 4X98A 2DYPA 1HQRA 4O9HH 1SJXA 3OBAA 1E40A 4GBXC 2PUQT 5D7LB 3UZEA 3QBTB 4QGTA 3E2HB 4Q0XL 4GMTH 3ZKMD 3DXAB 3JXAA 5J89A 5FHBH 4BFEA 1EVUA 1UM6L 4JQXA 1X4XA 4BA0A 3VA6A 2V3GA 2BV9A 4BH7B 4WY7L 4YPGB 3IDIA 3O4OB 3PWLA 1IC7L 1R6VA 3VX1A 1LEIA 4ENED 1V0NA 3I9GH 1HSBA 3EFFB 2ZNWA 3ULVC 3LRSA 2ZXDA 3DURB 5C3LD 1F4XL 1U2CA 4JLRB 3CX5K 4FP8L 3WEMA 4PYGA 4HS3A 3WSUA 4Z76A 4TYUA 3WH8A 4X83A 2EC9T 5D96B 2BSTB 3TZVC 2C1OB 3T0DA 4RMVA 2BOCB 3LH2L 4GO6B 2DT0A 1JD7A 3SCSA 4NZRH 1I7TB 2VDQL 5CEYB 4YUEH 4HIHA 1UB5B 1U8MA 2NXZB 3FO0H 3S9DB 1F00I 5ENWA 1GOWA 1R3JA 2GCYB 5JZ7C 5KSBA 12E8L 1RVFL 4QRPD 1OLZA 1YN6A 3QDMB 3S6TA 4UIMB 3HE7B 4PBGA 2X89A 4G8FB 5BYWA 1OAQL 3MS8A 4MNJA 2F74B 5BS0A 5KSUB 3FQRA 3QQ3B 5EBGA 1SBBA 2HVKB 2K1MA 3FFCB 3MOBH 4E5XA 4C55A 4KVCH 1D3CA 4OBRA 3VFTA 3AFBA 1B3JA 3W26A 3LB6D 3RWDB 5HHME 4KZDL 2R23B 3CFBA 2J8UB 4P23D 4D0BB 4AEHL 5D6CA 2WBGA 3MYJA 1SEQL 1S7RB 4ZPTA 1BTCA 3REWB 2OMBA 3EYOA 5FK9B 2VZ3A 3BD3A 1YEEL 4MCYB 3RY4A 4JM2C 5E2VL 4IPNB 5FL0A 1EOKA 4HXBH 1N6UA 2P44B 3DX8A 3SBWA 5CEXB 1J18A 2AQ3A 1AR1D 1Y6NR 3TPUB 5MEOA 1XGQA 5CD3A 1ES0B 4PLJD 3SE9L 3DX0A 1YJDL 3VFGL 2IADA 1OP3K 4ZUSA 4HKZB 5DUPL 3JBG7 2XACC 2VO5A 2XQYG 3FRUA 1WBXA 5D1XB 2MFNA 1BQUA 2MCPL 3RL1B 4EI5A 3FCTA 3KYOB 2HVJA 4OUOA 3BHBB 5BCAA 1I1YB 3HZMA 3EMQA 3MNWB 1UR0A 3QEQE 3GDBA 3QR2A 4LEXL 1E0OB 2GJ6B 4WWID 3PN8A 2WBKA 1JYWA 3HC0A 1T5WB 5GIRA 4R4BB 4ZAKB 3ULVD 2J6EH 3MV9A 4HUVB 3M6DA 4PUBL 4HG4K 2WBJB 5JHLH 1D9KA 1G7PB 1QQDA 5ALBL 1BJ8A 3WQ4A 1NUGA 4JFEE 1MLCA 3UC0H 4KJWD 1KLFA 1GGIH 2X4QB 2XGIA 1R5WB 4ZENA 3VNZA 5DK0A 5A8OA 2VISB 3CSGA 5C70A 1ODAA 3RIAK 1Z32X 3GSXB 1ACYH 1K9EA 3BX7C 5CEZE 4KKAD 2D0FA 5DUPH 3AICA 4Y4KC 3AU1A 1X5XA 1T7YA 2GITB 4MA8L 2CUIA 1Y0LA 4EJ1C 3QWOB 3IFNH 1LD9B 3IDJB 1HNGA 2YKLH 1INDH 4GJTB 3BCFA 1W72H 4DWSB 2YKLL 1VFOA 1EO8L 4ELMA 2DJSA 1NAKL 4JFZH 1NFDA 4G9FB 5CEZL 2DD8L 4S10A 4KXZH 4BS0A 5BMFL 1YNLL 3O6AA 5GPRA 3AHYA 4PBVC 1KGXA 2BSRB 4GBXA 1SJHB 3R0MA 3RI5F 1NDGA 3RY5A 5L8JB 1A6WL 3MUGB 1NFKA 4MNMA 3IU4L 2J4WL 4F33A 1LDPL 32C2B 5DI8B 2ESVD 3N0PB 3JTTA 3RGVD 4KRTA 1E27B 2DQGH 4G7VL 2X70A 1C8XA 4NQVA 4OCSH 4ODVL 2V2WA 2DF3A 5IGXL 1L7IH 4JB9H 1CF8L 1OAXH 1G6VK 3SCMD 4JPIB 2OR9H 1H3WM 3QI9C 1E3ZA 3SDAC 5DK2A 2CGRH 4PGCA 4CMHC 3ULUD 3LPGA 2MPAH 2WVVB 4TVPD 2FSEB 2PR4L 1DHKA 3U4EA 4CADB 1H49A 4KDVA 4QXTA 4AL8L 1FLRH 5E8NB 4W6XB 5HDLA 3L3HB 5GSRB 1UWUA 1IT9L 3CFKB 2AQ1A 5DEGB 4POZD 1X3DA 1T2XA 3TO4C 3OX8A 1OP9A 2EC9U 1CR9L 2ZCHH 4B15A 4PP2B 1IAKB 3H53A 2G60L 3OGCB 5C8JA 4S1QH 2UYLA 2OLHA 5F1SA 1MI5B 4PYSA 1BLNA 2I07B 1KJ2L 4NQCD 2X6MA 3CPUA 2F8QA 4KKBC 4X5WB 3MRNB 3U4BL 2X4PB 1CDYA 5FF6A 3LMYA 3C60A 4HU8A 5GS0L 1G6RB 2DAVA 2Z31B 1AQHA 3MLWL 4KI5E 3KXFA 5IK3A 4D0CA 4X6DA 1OF2B 4WIQA 5EBAA 5EOCH 2R1YB 3C2SA 3E3QE 5IB2B 1MCBA 4MA7H 3MO1B 5E6ID 4BSWA 1JGVH 2AS5M 4GG6A 2P48B 1HQ4B 4PGBB 3QQ9D 4MPKA 4XNXH 3U0TB 4QHKJ 4AZCB 3DI3B 3AIBA 5ENWB 3RPIB 2JB5H 4AIZA 1IT0A 3AIVA 3SCTA 4PP1C 3FY1A 1A6UH 4QHUA 1S8DB 2PXYC 3QUZA 1QLFA 2QPSA 3A0OA 5CG0A 1J05B 3U9PL 3OKDA 5I1IH 2I24N 4R0LA 3B9KA 4HOXA 1GHRA 1QI0A 3G6DL 3V4PL 4O5LL 1HQRB 3OZ9H 4OLXH 3VDHA 1ZA3B 5GNYA 2VZSA 3VGBA 4MNQB 3IDMB 2EDXA 5E8OB 2IBGA 1U8IA 5D6DA 3MGOB 5JW5A 3SDAD 1BVKA 4PJXA 5GHWH 4KDTA 1HKJA 4Y5VC 3CZLA 5BRZB 1MFNA 1NMCB 2ZUSA 3QI9A 3X17A 1JNLH 3ARQA 3BPLC 3P0VL 3ZYOA 1DTUA 3QUMB 4M4RA 4K8RH 5DYOA 4W4OA 5FECA 1DQLH 3FMGL 1NQBA 1TNNA 2WKLA 5DJ0B 1J12A 3MJ8A 4GI9A 5A2JH 1DLFL 1UKSA 2VXSL 4OKDA 1DQQA 5LGJB 1H5VA 3NFNA 4HFWA 5A2AA 1U93B 3U0WH 4JFPA 3AIEA 1GPFA 3HCVB 1MCHA 3KLLA 2DKUA 3SCPA 3UCRA 1MW3A 4QRPA 2X4NA 1Q9WB 2BNUA 4QRQA 1T3FB 2KQMA 5DK3A 3GI9H 2HVKA 3RJYA 1FH7A 3G6DH 4H5SA 1A7NL 2AEWA 3VFMB 4WV1B 2ORBH 4R26L 2R0WH 3GK8L 2HJFB 4HFUH 4ZPVB 1G7JB 5KVEH 4QLJA 5GGSY 5SWSE 1BQSA 3B43A 3THDA 3VRIB 1IAOB 1LVEA 3ARFC 3ZSTA 4MAYA 2F18A 1S5IH 3N9GL 4PP1D 2YD6A 5DR5H 3I3DA 3O4LA 5IV2A 3MLSL 1J87A 1KCSH 1LD9A 3IDJA 4N9OB 4WJ5B 4Q9RL 4XPFH 5IQ9B 4JVUA 5ESAB 1UQSA 2J7HA 1KQZA 1KQYA 4UNTA 3DV6B 3I75A 1QSEE 3WUWA 5D9NA 1KPUB 3QT2A 1GRWA 4U7MA 2R1XB 4K8RL 4GAYB 1MW0A 1SBSH 1QRNE 2DQHL 2FEEI 5L2KE 1NWTA 1T0MA 2OK0H 5IBLC 3O45A 2XFXA 2ZX8A 3UTSE 2DMKA 3DXAA 4AMCA 2FWOA 4ZUWA 4XC3H 2AGJH 4ZOBA 2DI8A 5KS9B 3IDIB 4E42B 4GRWH 4XMKL 2Z91B 2Y24A 5DD6A 1U33A 5GS1B 2R8SH 1F6LL 3IAGC 3TV3H 2X1IA 4UZSA 1D9KB 4DCQA 3ECQA 4TNVK 1S3KL 4GW1B 1TJIH 4JFHE 5HYJE 3D9AH 1JCKA 3GSRB 2XSBA 3WNPA 2EIDA 5T3XH 3ROOA 4K71C 2JJVA 2VX5A 1U8PB 2DTMH 4JFFE 5IT2H 3KPPB 5IB1A 1AD0B 1MFEH 2WWMD 4MD0B 3QDJE 3NH7H 5T5NF 4F57L 2KZ1B 1ODUA 1RJZB 3DOSA 3MRCA 3GH4A 1VF8A 3MV11 2UV3A 4KK9D 4YXHL 3BKCL 3CXDH 4JFQB 4WIWA 3ZT6A 3MLTB 3B6SA 2E6QA 1UACH 1PQZB 5TDOA 2VDRL 3OMZA 5TFSH 1CLZH 2H41A 3OLGA 1SJHA 5F88A 2HKFL 2PYEE 1G0DA 2C3HA 4GPNA 5FYJD 3HZYA 4M48L 4LKCA 4E2OA 3BD4A 5C08E 1ORSB 3Q5OA 2A83A 4D0BA 2BNJA 1UR9A 4GMTL 3ILPB 1XGRB 2J3SA 3MUHL 1CGTA 3DNKA 4YWGL 2H6PB 4ELKA 4BQ2A 2FECI 3SE3C 4YXLH 4XPBL 2P46B 3HMWL 3TVMB 2MPAL 4NWTL 2BVYA 4IHOA 4MA3A 4U4BA 1CFSB 5F6IB 1FGVH 1GYAA 3CHCA 4U1LB 4M82A 2QLYA 2YPKA 3RCNA 5CJQL 3VMNA 1AXSB 1T1WB 4RFOL 3VIMA 1IQDA 1JNHB 3RL1A 2E0PA 3TIEA 5FYKE 1MY7A 3CZ8A 4EXPX 2B7DT 3UZQA 1NCAH 5D7LD