1TA3A

Crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor protein I
total genus 99
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ta3A00
1KXHA 3SCVA 4B15A 2D0HA 2VX4A 1DWJM 4U33A 4XUYA 3VIHA 1E55A 2QV4A 4DUVA 1QHPA 5BRPA 3SCWA 4V28A 4XB3A 5HXMA 1W32A 4WK9A 1WE5A 3AS0A 3MMDA 4UFHA 1TVPA 4BCEA 4GKLA 2WVUA 2JALA 2CBVA 3PBGA 1FP8A 3PZNA 2BHZA 2XWEA 3W29A 4PMRA 5CG0A 1B9ZA 2XYLA 4MB1A 3AICA 4GQQA 1TUXA 1NWRA 2XPKA 4UZUA 2RGMA 4PMNA 2VZVA 3NSXA 3RJYA 5FCZA 4C7GA 5KEZA 2VTFA 2C7FA 2BS9A 1WB0A 1XSIA 1E4IA 2CKSA 2VVNA 3NSMA 5ABHA 2E4TA 3WNNA 2YBUA 4MJ4A 4UOQA 1X6NA 4D6DA 1TCMA 2ZXDA 3A4AA 3CUHA 5A94A 4TOQA 1CXHA 2VI0A 5CPTA 4JFTA 1AQMA 3VIIA 2E0PA 2XIBA 4S3JA 1NWSA 1FFQA 2PWFA 4KWUA 1C8QA 3AMCA 3HJEA 1CLVA 3PHAA 3ZJ8A 4AIEA 1IT0A 5C8BB 3WUGA 4J3WA 2YLLA 1W9UA 1JNEA 4U31A 2PB1A 4MB5A 6A3HA 1E6NA 1J12A 3EMQA 1BAGA 2JF7A 4HZ8A 4ZE5A 3N17A 4EKJA 1V3LA 4TUFA 3W38A 5A8QA 1XH1A 4M24A 2XVGA 4MPKA 1E73M 4BF7A 1W1PA 2YL8A 1W91A 1NQ6A 1LG1A 2QMKA 4MDPA 3KZSA 1QI3A 3AS1A 4L4PA 5DF0A 3VGFA 1W2VA 3ARSA 3G6MA 1EDTA 1B3VA 1X1NA 1JZ2A 2WC4A 1DP0A 2OSXA 2BY3A 1UWUA 3AMKA 4AZ6A 2VRQA 3VOCA 3CUIA 4UQDA 4AIUA 2DSWA 5A6JA 1OM0A 4U3CA 1Q4NX 2XVNA 2GSJA 3VIMA 4UCFA 3UESA 3DHPA 5A8MA 1E71M 1EHNA 4Y7EA 3VTRA 1J9YA 4F9JA 3FAXA 4K68A 1MW1A 2VX7A 1V0LA 5A6BD 2ZICA 3FNDA 5BXPA 2J7GA 2O9OA 4LGXA 2WSKA 3WL0A 4UFLA 3SUSA 1V02E 3GBEA 5EFDA 3BLPX 2NSXA 5BWFA 4UFJA 3AIBA 4OKDA 3W25A 3WL1A 3KL5A 3G6LA 2F8QA 2WC7A 2E9BA 1MWOA 2VX6A 1PPIA 1E6PA 1H4PA 4KRUA 3VDHA 3MV01 3F5JA 1Q6EA 3L4YA 3K8LA 2J25A 3POHA 3AMGA 2WLZA 3WH6A 5GPRA 3TP4A 2EO7A 4DUWA 2D1ZA 3RILA 3B9DA 2GDUA 1HN1A 2VURA 3PTQA 1TVNA 3ARUA 5EFFA 2VL4A 5A6BA 4LXFA 1JDCA 4MNMA 2UY3A 3UR8A 3MUY1 4QLJA 1VJZA 3SCTA 1SFSA 3MV11 3DYMA 1KFWA 2FHBA 3WMCA 4Z2GA 4PMXA 3VDCA 5DO8A 5M17A 5FD0A 4WSJA 5I77A 5DFAA 3CZJA 2GFTA 5E6YA 4BS0A 3TOPA 1FP9A 4OOUA 3VGBA 2ZUNA 3W6MA 1BVZA 4GI8A 1UH4A 1G01A 1V0NA 1VEMA 2ZUUA 4JCMA 4JHZA 1GZJA 1HVXA 1WZLA 1J0KA 3K8KA 1NP2A 1WZKA 1CGYA 2J7BA 1EA9C 4U2YA 1GW1A 3ALFA 3DHUA 5EBAA 3KL0A 1NM9A 4UOZA 1JZ8A 5M3WA 3EDDA 3AQUA 2VC9A 3OLIA 2QMJA 1UKQA 5DEZA 4WKAA 2CBUA 1E5JA 3UG3A 1J10A 1DWIM 1X6LA 2VZUA 1IV8A 2E3ZA 1E4NA 1PX4A 3WDPP 1KCKA 2X2YA 1HJXA 4BQ2A 3VX0A 2DDXA 3PTMA 1HVQA 2XHYA 1E6SM 4YHEA 3TTOA 2EPNA 2ZWYA 3F4VA 3ZJ6A 1OGSA 4BQ3A 1UA7A 3WBEA 1TE1A 7A3HA 1H0GA 2BV9A 5AC4A 1GPFA 3QOKA 4M8UA 4ZENA 1BVNP 3TA9A 3ECQA 2W63A 1US3A 1QBAA 1Z32X 1W9PA 2Y8VA 4P7NA 3L4TA 2OYMA 1NOUA 1SYTA 2WKLA 4JKMA 1WPCA 2PF0A 1QNRA 3VGEA 4GI9A 4CVWA 1UQZA 1HKIA 1E3ZA 1Q6DA 2YKKA 4JZ5A 4J3UA 3VILA 3WUBA 2D20A 2WVVB 4QP0A 1PIFA 3EYPA 4AYSA 1KR0A 4HOWA 1KXQA 1UWQA 4L4OA 2E9LA 2CXGA 1CYGA 4W7UA 2FHFA 4S3KA 1CZ1A 4UTFA 1XV8A 2PBGA 4P7OA 3W6LA 4DUXA 2CHNA 5JBDA 3NDYA 1H3GA 4M82A 1B90A 2YA2A 1R85A 1UD5A 1N82A 4TVCA 3BCFA 2J7DA 3AXIA 3AHXA 1WCGA 1SR0A 2PWDA 1EO7A 1LL7A 3MUAA 3B9AA 1FHDA 2ZUSA 1HXJA 1RP8A 4H7VA 1LWJA 4HMCA 5A6AA 5A95A 2WW5A 2VUYA 3SIMA 4J3VA 9CGTA 4PMVA 4AWEA 2D23A 4ZXOA 2WMIB 4MB4A 1PIGA 1G94A 1QNQA 3N04A 4U5IA 4TX6A 1BYAA 1CGTA 3OZOA 3AOFA 1KGXA 2WMKA 4P8XA 1VIWA 1ISVA 2AMGA 4W85A 1QW8A 1W3LA 3WH8A 4HMEA 1OIFA 5I3DA 3N13A 3AXXA 1W1YA 3WQ8A 3GDBA 4AZ5A 4MB3A 3N12A 1TA3B 1TG7A 1XC6A 3EMZA 4D1JA 4GQRA 4PMDA 1KWKA 3QGVA 3WSUA 1UD2A 3CPUA 5I0DA 3GNOA 1NWUA 1B2YA 4DM1A 3B9EA 1XD0A 3CBWA 2V38A 4CU8A 1BG4A 1BYDA 1WZAA 4CD7A 3BMWA 3WH9A 1NH6A 3WNMA 3MKKA 1E9LA 1C8YA 2Y24A 3L2MA 5GQBA 4UOJA 3EDJA 3KE0A 1A3HA 2J77A 1QI5A 4UNIA 1EDQA 4GI6A 1B3ZA 1MYRA 2EPOA 4BZYA 3AIQA 1RD6A 5D8ZA 1CWYA 3WEMA 2BY0A 1UKSA 4CCCA 3UG4A 2FHCA 4LPCA 3ZJ7A 2WZEA 4R27A 3WN6A 4LYRA 4HZ7A 2GK1B 4H2CA 3ZIZA 3WKZA 1Y7VA 5DT7A 1M04A 3FHAA 5LYRA 5AY7A 1GOWA 4D6CA 1CENA 4KRTA 5CGMA 2YBTA 1JZ7A 1XCWA 2UY2A 1PZ2A 3O9NA 3VINA 1HT6A 2IXUA 4AEFA 4PMOA 1PX8A 1V02A 3A3HA 3SUTA 3KWXA 2PWEA 2V5DA 2W4XA 4PMYA 1ZU8A 5D4YA 4D71A 2JEPA 2G3MA 2DH3A 2Z1SA 3NYDA 3CZ8A 5E0FA 3FW6A 3K46A 1QBBA 4E8DA 4JL1A 4OIFA 4Z2JA 1CTNA 5TD4A 2VZTA 3WIJA 1NARA 5E70A 4Z2IA 4DWSC 3N11A 2Y2WA 3W27A 2OWWA 4JFUA 3NDZA 4CD8A 2VO5A 3VUPA 2J74A 3SCNA 1EO5A 4AXNA 3VD4A 2WB5A 3BCDA 4GO8A 2CNCA 1DEDA 3CUGA 4CU7A 3CLWA 7CGTA 3BGAA 3HMCA 2XUCA 3VDAA 2XWDA 1VFFA 5IFPA 4ZEPA 2O9TA 2VT0A 2CEQA 4N0RA 1GORA 3ZMRA 2GUYA 4A4AA 2BY1A 4W86A 1OD8A 4TTUA 3U7BA 4IUGA 5BRQA 3WEOA 2GJPA 5LA2A 2WMFA 5LA0A 1V08A 2YJQA 4U2ZA 2V3GA 2J79A 3T09A 1SMDA 3W81A 4D6EA 2VR4A 2G3IA 4D72A 2YA0A 2CYGA 5IHRA 4BQ4A 3BAKA 4JFVA 1ISZA 4MNKA 5IFTA 1OGGA 1EH9A 4AZHA 2DPEA 1JFHA 5I23A 5FKYA 2J75A 1U33A 2DT0A 1GQIA 1LF1A 1C90A 1FH8A 2GJXB 1PJ9A 3LPPA 4PTWA 1HJUA 1JGIA 2D3LA 3VMPA 4H8VA 1GJUA 4CVUA 1KXTA 3VD3A 5DT5A 4P8VA 3MMUA 1FOBA 4CUCA 3VGDA 3FXYA 1CXFA 4P7RA 1PZ3A 3ARRA 2D24A 2A3AA 2O92A 1B1YA 2V3EA 4PUDA 3RM9A 4PCTA 3AROA 4X0NA 2WXDM 4YHGA 5A2CA 1GOOA 4UFIA 4QCFA 5FIPA 4FLQA 1UWRA 4EE9A 5I2UA 3SCQA 3PZUA 1XYZA 4M1RA 2MANA 5CLTA 3RO8A 2V3FA 4D6IA 4FLRA 4PMZA 1B3WA 3MANA 1J01A 3EDFA 5AYBA 4CN1A 3DYOA 3MUZ1 4MNJA 3GXMA 2XJ7A 3PZVA 1XSKA 4PTVA 2WHLA 3CMJA 2E9MA 1W2PA 4UQEA 4WJXA 1C92A 3LPGA 4RE2A 3CUFA 1UR0A 1W3HA 1QPKA 1KGWA 5CLWA 1B3XA 4KGJA 3MUIA 4JIEA 3POCA 1AQHA 4E8CA 2VRKA 1AQ0A 1DHKA 3N1AA 2VZSA 2J47A 3U57A 4PEEA 2XG9A 4ML4A 1C3FA 3CUJA 1ECEA 5E6ZA 3UR7A 4TTGA 1B30A 2BFGA 4HOZA 1CXEA 3WNLA 3WF4A 1FFRA 2VR5A 4ACYA 1EGZA 2UY5A 1MXDA 1W1VA 4CGTA 1RPKA 3CHCA 2ZXBA 3ZO9A 3GXFA 4TVUA 1LL4A 3AYSA 3PZMA 4FF5A 1LWHA 5JBFA 4W8AA 5DMYA 3WY1A 2ZUTA 1DWAM 1CDGA 1GHRA 3ZR5A 4F79A 4UQBA 5GNXA 2W67A 1ZL1A 1BTCA 3VIFA 4M80A 1VBRA 1PBGA 1VJSA 3IANA 3RM8A 2BXZA 1BYBA 4F9DA 3UG5A 2WCSA 5E9AA 3SCUA 4TXEA 1E43A 3A4XA 4W5ZA 1JF5A 4A3HA 3PZGA 2XGBA 4ZE4A 1J0HA 1GOIA 4TX8A 5KZ6A 3KL3A 2QPUA 2WKGA 4AD0A 2DQXA 1H11A 1HJSA 4FMVA 3WD0A 1MQPA 2X09A 1EXPA 5BXTA 5JBEA 4AEEA 1MW0A 4WSKA 2EXOA 4U3AA 3LMYA 2W5FA 1QNSA 3CZEA 1ZS2A 5A8NA 3WUEA 2XTKA 3AXHA 4WF7A 2JE8A 3AHVA 4NRRA 3L4ZA 3NSNA 2BVDA 2YIHA 1JDDA 3IK2A 3II1A 1VBUA 3UETA 1C7TA 5I24A 4GO9A 1J0JA 1WAWA 4JFWA 2AOSA 1J11A 4FLSA 3BAWA 2DT2A 1LL6A 5D9MA 4WKHA 2WBKA 2O9PA 1PX3A 5M03A 3WF3A 2WYSA 3BAJA 1BGAA 5A8OA 2DH2A 2BHYA 1YQ2A 3NIYA 2EPLX 3U5YA 3FY1A 2DT3A 4QLKA 1E1EA 4OJYA 2WK2A 2WMJA 1CGUA 2XFYA 3OLDA 1FH7A 1QW9A 3TTSA 1BGGA 1IZKA 4EAMA 1KXVA 3HN3A 1HJWA 4LYQA 4PCSA 2WCAA 1GOMA 1U30A 3T2QA 2ZIDA 3AYRA 3OGRA 3WD3A 1HL9A 4C7DA 1K9TA 3VIGA 4E2OA 3VKKA 5IHSA 1KCLA 1Q6GA 2W61A 3U7VA 3WBAA 1J0ZA 1ISWA 1HP5A 1E4MM 1V03A 2E40A 5BXSA 2VNCA 2PC8A 3S6TA 1CGVA 1I1XA 1M01A 1HKKA 3S2CA 3WD2A 5JIWA 1WDSA 2ZXAA 1ZBWA 5CZKA 5CPQA 4HPGA 3GM8A 3THCA 4ATLA 3CO4A 4IPNB 1MXGA 1ITCA 1CXLA 3IJ9A 3TTYA 1BHGA 3PZOA 3SEPA 4FLOA 3PN8A 1L8NA 5IDIA 2WCGA 1MFUA 4HMDA 4JL2A 3CZGA 2JEQA 1HKMA 2XIIA 1VAHA 1B31A 2CBIA 4GPNA 3BAYA 1GUVA 4ATDA 1UD3A 3CZLA 4AIOA 1IZJA 2GK1A 4D6HA 4J3TA 1UR2A 1E0XA 3ARZA 4CD5A 2YL6A 2X8RA 5A3HA 5C70A 2YDRA 1CGXA 4XZWA 3MO4A 2E8YA 4MAVA 2J62A 1PAMA 3WQWA 4PRWA 3AZSA 4B16A 4D6GA 3HU7A 3T0DA 4P7LA 4QAWA 2A3EA 4BA0A 2IXVA 3J7HA 2UY4A 1CGWA 4NZCA 3VX1A 3GH7A 3FHQA 1GONA 1QHOA 4WIWA 3VGGA 3OA5A 4GZJA 5ECUA 1J18A 2D2OA 3NUKA 4P8WA 1GQLA 1OT1A 1LLOA 2D3NA 4OBRA 4YN5A 1EOMA 1CIUA 3T0AA 1ZJAA 1BF2A 3GH5A 3BH4A 4P8UA 4IPLA 1M53A 4W84A 2OYLA 5I78A 1JXKA 2FH6A 1CPUA 5EMYA 1CXKA 1QNPA 1FA2A 2O9RA 1GQKA 4D1IA 3W37A 1E4LA 1U2YA 2J78A 1UOKA 2WBGA 4PYSA 1LG2A 1TFVA 3AS3A 1LQ0A 4JKLA 1OGBA 3AZTA 5E0CA 3AIEA 3AHTA 1ZBKA 2BNJA 2QPSA 4AD2A 1CXIA 1KB3A 2CESA 2J7HA 1K9EA 4BQ5A 5A6LA 4KGLA 5FL1A 4IISA 3K8MA 1V3MA 1ZBVA 1HKJA 4JAWA 3WQ5A 3VM5A 1XGZA 1QOXA 3ZT6A 2EQDA 1UWTA 1JIBA 1WKYA 2WHJA 3WMBA 2DGAA 1V6VA 1UR4A 1E0VA 3MU7A 5CQ1A 3D3AA 2WMGA 1E6RA 2YOCA 3SUVA 3CHFA 1E3XA 2J8GA 1O7AA 3F5KA 3I3DA 2Y4SA 3MS8A 2ZX9A 2G4FA 3CHEA 3ZQ9A 1M7XA 3BXWA 1D2KA 2ZUVA 3AIWA 3A4WA 3M46A 3ARXA 2YA1A 2FH8A 4AC1X 4EANA 1QVBA 3T2PA 4CCEA 4PSPA 1KQZA 3QR3A 1KBKA 1L0PA 5A2AA 2WVSA 3VM7A 3WMSA 1NWTA 1W3KA 4X9YA 3GBDA 4MJ2A 3RDKA 3GXDA 2VMFA 3L4VA 3AI0A 3L4WA 3QHOA 4M81A 1VEOA 2F2HA 2V5CA 3L4UA 1KWGA 5HNNA 1OSEA 1D7FA 3W82A 1V6XA 5I79A 2G8ZA 2VX5A 3ZJKA 5C71A 5AC5A 2CERA 2XVPA 3RIKA 3QHNA 1XRVA 2OWCA 5ABFA 3N9KA 2D0FA 3VD9A 4MADA 3APGA 4PUEA 1W9VA 1VF8A 2GDVA 3ARYA 1ESWA 2XVKA 4PTXA 3PZIA 4NRSA 2ESCA 1EOKA 3VDBA 1JI1A 1E56A 1E70M 2A3BA 2QLYA 4DM2A 4AZGA 1VFUA 2Y5EA 3M07A 2DT1A 2ZWZA 1AVAA 2X05A 5HDRA 3ZSSA 1UHVA 1QHZA 1OB0A 3AMDA 8CGTA 1V6UA 1NP0A 2NT1A 1HJQA 4JCLA 1QNOA 2DIJA 2OWXA 1DWGM 2VZOA 4Z2KA 2DSKA 2C8NA 1W3JA 1EDGA 2EBNA 1UR9A 3RCNA 1UR1A 3CMGA 4AY1A 4W7WA 7TAAA 2ZOXA 1E5NA 5CGTA 2ZUMA 1UKPA 4W8BA 4OBSA 2DEPA 1C7SA 4U5KA 1GVIA 3WUFA 1EIBA 1ZBCA 2JIEA 3WH7A 4RE4A 4HU8A 2B31A 3PTKA 4W87A 1D3CA 1MW3A 1V3JA 3GZAA 4FK9A 5E09A 5CPSA 4CCDA 3THDA 1JYXA 1HNYA 2Q8XA 3WQVA 4JKKA 1LJYA 3O2LA 2YL9A 1TZ7A 5GNZA 2AAAA 1G0CA 1WDRA 1E6ZA 1ZB5A 4PMUA 4AZCA 4MTVA 2Y8KA 4NSBA 5ABEA 3VIKA 2OSWA 1JD9A 1RH9A 3DECA 1HX0A 1JD7A 3ARTA 1CECA 3WQ6A 1VFMA 3SUUA 4J3SA 4B3LA 1Q6CA 2X0HA 4GINA 3W4RA 3QOMA 3EDEA 3WD1A 1KBBA 2A3HA 1JXJA 1UA3A 1MQQA 2GJXA 1BFNA 4UQCA 3PZQA 4CD4A 2WVVA 4ACZA 3IAPA 4Q7NA 4Z2HA 2VVSA 1GNXA 2WWCA 3VD5A 4QDMA 1XYFA 3DC0A 2CPUA 3W53A 1UD4A 2CBJA 1JZ3A 3VIPA 3RMEA 2FDMA 3AIVA 3UERA 4WKFA 4ZFMA 2ZX5A 2C0HA 1J0IA 2XM2A 3IAQA 1TR1A 2YDSA 1XSJA 1BQCA 1UD8A 4AMCA 8A3HA 2J7CA 4H8HA 2V3DA 1R86A 3GNPA 3ZOAA 1JL8A 2A3CA 4RE3A 4DWSD 1QI2A 3VVGA 2WMIA 3WD4A 1H09A 3I3BA 3AS2A 3OGSA 4AD4A 2CHOA 4CN6A 3VIOA 1J0YA 1C93A 1E72M 3D5HA 3VNYA 3AHZA 3AIRA 1GVYA 1WDQA 1US2A 1OINA 2PWHA 1M03A 1OBAA 1GOQA 1G1YA 3OLEA 1EQPA 4GZEA 2VRJA 2XFRA 1TMQA 1OCQA 1DTUA 1KR1A 1OWQA 4Q22A 2VCAA 4W93A 3BSGA 1JZ6A 3LPFA 1E15A 1V0KA 5BXRA 1V3HA 4QFUA 2FGZA 3VMOA 2VCBA 2XFFA 2ZX6A 4HTYA 5EB8A 1BSIA 4W89A 3RJXA 4PN2A 3WENA 1P6WA 2QF8A 1C91A 3B8SA 2DSZA 1VENA 4HA4A 4W7VA 2XGIA 3WNOA 3O6AA 3VIJA 4A3YA 2CETA 1OIMA 2RGLA 3RPMA 2ZX8A 3BLKA 2HISA 1UD6A 3WFZA 3BSHA 4UQ9A 4AZ7A 4CU6A 5CJ5A 1ZJBA 2WLYA 3ZT5A 5FL0A 5D9NA 2IUZA 4AD5A 4P7QA 3W28A 1JAEA 1VRXA 4PSRA 3WF2A 1WZMA 4XZBA 1ITXA 1UQYA 2UWFA 1EQCA 2W66A 4IM4A 4LX4A 3N18A 2DSVA 2G3JA 5BYWA 1V3IA 3WDQA 1R87A 4URIA 1JYWA 1K6AA 3PZ9A 3K4DA 3BC9A 4KMQA 4W5UA 4KH2A 3EDKA 5CSUA 2HVMA 1EHAA 3SCRA 3OLGA 3GH4A 1GHSA 3KEHA 5I5RA 4CKQA 1DWFM 4C7FA 3E1F1 3WNKA 3ARPA 3GNRA 2NT0A 2BY2A 3ZM8A 1WNOA 3F5LA 6CGTA 1UYQA 5A2BA 2QHAA 2XVLA 2OLHA 3K1DA 5CSYA 1JI2A 1JFXA 4AD3A 1W9BM 1JYVA 3AMLA 1NOWA 5F7UA 5D9OA 1E6XM 1OT2A 3CHDA 3M6DA 3T2OA 2CKRA 4H41A 3UEQA 2BVYA 4B9YA 1RP9A 5HBFA 3WF1A 3WELA 2VOTA 3MSGA 4MNLA 3VGHA 1E0WA 4J28A 3CTTA 1JAKA 4OZOA 3OIHA 1CNVA 4GZIA 5D8WA 1UG6A 4NI3A 4AZIA 1WP6A 1K9DA 2WWDA 3NCOA 1NOFA 1F4HA 4AISA 3TTQA 3WDRA 1XD1A 4JFSA 2J8FA 1UZ4A 2EPMX 4GIAA 2YL5A 1ISXA 3WNPA 1MVYA 1YHTA 4NF7A 1JG9A 3IJ7A 2NW0A 2OYKA 2JF6A 4X0VA 1V6YA 3W26A 3FAWA 2DIEA 5JIPA 1JF6A 1WO2A 4TVDA 1CLXA 2D22A 3OGVA 3ZR6A 4Z2LA 2X1IA 3W0KA 4M29A 3WF0A 2GVYA 3JUGA 4AD1A 4YPJA 4F66A 1PEZA 2PWGA 1VFOA 4HA1A 5M5DA 4ZXLA 1UWSA 1O6IA 2JIWA 3VO0A 4AZBA 1DWHM 3M7SA 1WDPA 4M56A 4N42A 2VQTA 1H2JA 2XM1A 5BROA 4HPHA 2DSUA 1V6WA 3BMVA 3ALGA 3GTNA 3U5UA 1W9DM 2G3NA 2VJXA 1I75A 1ODUA 2G41A 1AMYA 1GCYA 2WHKA 1XH2A 2D0GA 1KGUA 2X0YA 4H8UA 3EMCA 1MW2A 2J4GA 2W62A 1XHGA 4UR9A 4H04A 3AFBA 3BAXA 3K4AA 3SCPA 3QHMA 3NJ3A 2FGLA 1B3YA 1V0MA 3PZTA 4CN4A 4AW7A 1W9XA 4PMQA 1SMAA 1MQRA 4MDOA 2VCCA 5ABFB 5A69A 1HL8A 1GJWA 4LYPA 1OD0A 4CD6A 3SURA 2Z1KA 2E8ZA 2WSPA 5GNYA 3WEZA 3RM4A 4AZCB 1BG9A 1E40A 1UUQA 2WZIA 3FN9A 3AIUA 1JZ4A 1JZ5A 1A47A 1HP4A 2BHUA 1UKOA 5A6SA 3ZT7A 1BLIA 3VD7A 2J7FA 1GQJA 2YDQA 1V3KA 4UQAA 2EPKX 1H41A 2XSBA 4XV0A 3SCOA 4OOZA 2BXYA 1JNDA 5BCAA 4ATWA 4HP5A 3SCSA 2PBOA 3MSDA 2YLAA 1KQYA 1BPLB 1R7OA 3UCQA 1JDAA 1Q6FA 3A6OA 4XX6A 1CBGA 2ZX7A 1B0IA 2BVTA 3CH9A 5ABGA 2XSAA 3WDHA 4EK7A 1UKTA 1CEOA 2VQUA 1ODZA 3OG2A 2WNWA 1R7AA 1E6QM 4B3KA 5A6MA 1E1FA 5LA1A 5A8PA 4R5EA 4QLLA 2EJ1A 1UWIA 1XH0A 1UR8A 2TAAA 1HIZA 4J7RA 3GYCA 4B9ZA 4OUEA 3IJ8A 4D6FA 3ARQA 3WFLA 4DWSA 1F4AA 1UH2A 4V27A 4WLCA 1UZ1A 3N15A 1TA3A 2WM0A 1S46A 3ARVA 3AJ7A 1H1NA 1QI4A 2WPGA 4QCEA 3T08A 2WAGA 3AHYA 3T0BA 1FH9A 2JFEX 4J3XA 6TAAA 1VB9A 5IXEA 1I1WA 2ZE0A 4J27A 3OZPA 4GXPA 1FHLA 3ARWA 4HA3A 1H49A 3GXIA 1H5VA 4UFMA 3EBVA 5D9PA 2ZUWA 5I6SA 3A47A 3CGTA 4W8LA 3DYPA 2WC3A 3LPOA 4HZ6A 2J7EA 4ACZB 1HJVA 1VEPA 4JHOA 3L4XA 1K9FA 3VNZA 1UH3A 4RL3A 2W91A 5AYIA 5A6KA 3VPLA 1H0IA 3OB8A 4V2XA 3BAIA 3TONA 4UFKA 2WANA 1QI0A 1R8LA 4HOXA 2CCRA 1ISYA 2W92A 1C8XA 2WVTA 4DWSB 4D6JA 2WMHA 2WZHA 4E4PA 3WDIA 3AZRA 3W24A 3L2LA 1W1TA 3ZSTA 1G9HA 1XCXA 3WQ4A 3OBAA 2GJRA 4UZSA 3VU2A 2EEXA 5A1AA 4W88A 3SUWA 2CITA 3VMNA 4PBGA 3WH5A 1G5AA 2OSYA 5FOOA 5CXPA 2PI6A 1HF6A 4HU0A 5HPCA 5JUVA 3AISA 4LQ1A 3MMWA 2WHMA 1BYCA 4MAZA 5HPOA 2CIPA 4PTMA 3CIVA 3I3EA 3WDJA 5HOSA 2F61A 1GOKA 2ZXQA 4F8XA 1JYNA 3CZKA 1MFVA
chains in the Genus database with same CATH superfamily
1A49A 3AU2A 4IGHA 3QKEA 2PLCA 3VIHA 1QHPA 5BRPA 4V28A 1W32A 1FCQA 1PKMA 1JDFA 3AS0A 4R88A 4LALA 3P62A 1KBIA 1GTEA 1FP8A 1M41A 3PZNA 2XWEA 4FIRA 4B4HA 4DVOA 3NG3A 3Q58A 3CEUA 2W3ZA 5CG0A 3O6DA 5LKYA 4GQQA 4HHPA 1TUXA 2OX1A 3HPZA 3Q65A 1VBHA 1V4YA 1N2VA 2RGMA 3CIXA 4PMNA 3RJYA 2VXNA 3MO7A 1OQFA 4UWMA 2A2IA 3B9NA 1E4IA 3NO3A 2FFIA 3NSMA 3MY9A 2E4TA 4MJ4A 3V3WA 1X6NA 2ZRVA 1TCMA 1NELA 3CUHA 4TOQA 3R25A 2XIBA 3GIPA 3QW4B 1I2PA 3U3HA 4YWIA 1KM5A 1VQTA 1FDYA 4IQDA 4E3VA 1IWPA 4KWUA 4M19A 3ZJ8A 4B5SA 1SJCA 3LG3A 3S4TA 4C1LA 1HGWA 1DJNA 5C8BB 3QV9A 1HUVA 1BWKA 3TMQA 4L9XA 3GVVA 2NSOA 1E6NA 5DELA 4AWSA 3EMQA 4ZE5A 4RXGA 4DBSA 3LCGA 4M24A 2JGYA 1E73M 1JDEA 3Q4DA 1W1PA 1RUSA 3KZSA 1LBLA 1IT8A 4R85A 5DF0A 1SW3A 3N73A 3ARSA 3CL6A 4Q4QA 3ZLHA 1B3VA 3EEGA 4DHGA 2HROA 2OSXA 4WSHA 4NZ1A 2Y5SA 3BQ6A 4JDBA 4JD4A 1UBPC 4NXKA 1FRBA 2HTMA 3CAWA 4U3CA 1Q4NX 3FLUA 1NFGA 2IS7A 3H2MA 4XWUA 1Z42A 1BRLA 4QXIA 1QK2A 3UESA 2V0TA 2ISFA 3P3BA 1E71M 1SGJA 5G1MA 1MW1A 1L6SA 3C52A 4R34A 4WOZA 1V0LA 5CPLA 2ZICA 4LF1A 3KOZA 3FNDA 3QMRA 4LGXA 3PPHA 3BLPX 4UFJA 5TAOA 4OKDA 3W25A 4GY7A 3WL1A 4I8YA 5HQEA 4H19A 1T5AA 1B9BA 3YPIA 2VX6A 4DRSA 2XH2A 3VDHA 4XZLX 3ITVA 2AL2B 3UBPC 1H60A 3L4YA 1IWAA 2J25A 1VBGA 4GZ7A 2PZ0A 2OTDA 1S1PA 4CQBA 4IT1A 5FSEC 4IPJA 2GDUA 1HN1A 4D8ZA 4CNOA 3OA3A 1X96A 3WQGA 4WXYA 5D2WA 2V5LA 4OBTA 2VL4A 1FDJA 5A6BA 3CAVA 1R47A 3PG8A 4QLJA 1G4EA 6ENLA 5A6TC 2WZMA 1VJZA 5B80A 1G4TA 1WOBA 3W2MA 2CZDA 3DYMA 2FHBA 4QE1A 2Z2BA 3C0SA 4AH7A 5I77A 2X30A 1K8ZA 3B8VA 2VFDA 4ALDA 5E6YA 3TOPA 1JCMP 4M7SA 3DC8A 3W6MA 1EWEA 1BVZA 3TVAA 2AQVA 3UW6A 1XXXA 1VLIA 2G3FA 3VNJA 3QPEA 1VEMA 4JCMA 2NZLA 3NA8A 3MHGA 1HVXA 4MUPA 4O8AA 3K8KA 4LRSA 3W1LA 2J7BA 1CGYA 2OO6A 4AF0A 4HU3A 2DFAA 1TB3A 3ALFA 3KL0A 1AD1A 1GKQA 1DJQA 1JZ8A 4JX4A 1W54A 1UKQA 2CBUA 4XUGA 5FESA 1J10A 2VZUA 2ZFAA 3CUZA 5EGRA 1R3RA 3WDPP 4KT2A 1HJXA 3EWCA 4Y9PA 3EWWA 4YHEA 2Z27A 1AW2A 2ZTJA 2EPNA 2ZWYA 1O5RA 1SO4A 3ZJ6A 4FX7A 3A9IA 1M3UA 2P8CA 3WBEA 3WLTA 3LQLA 5AC4A 1GPFA 2GYIA 3P8IA 2QR6A 2H3BA 1TX0A 2ISVA 5TNVA 3GKFA 4ZO8A 4JKMA 4ZQRA 3DESA 2PF0A 3PB2A 1OX6A 3HPAA 3GY1A 2WQPA 1Q6DA 2YKKA 4DXXA 4J3UA 3VILA 2D20A 4MY1A 1E1CB 5FJJA 3AYTA 4DNMA 3M44A 1EYEA 1CYGA 3SRFA 4GD0A 4P7OA 4LVDA 3RR4A 1LOQA 1H3GA 3LBCA 2YA2A 1C9DA 2ZDRA 1N82A 4MVAA 3ID7A 3AXIA 3G8EA 1NDWA 3AHXA 4ERGA 2HJPA 4LJ3A 2PDJA 5FEWA 3CV1A 3SAZA 2QJNA 2E28A 1MNZA 4AB4A 4M1BA 5FEXA 3PUGA 2I5GA 1OCJA 4JNZA 3G1SA 3P93A 4J3VA 1GG1A 4A3RA 2PDFA 2FZ8A 2BLEA 4JTLA 4N9CA 3O6YX 1PIGA 3PPCA 4U5IA 5D04C 1BYAA 2PTDA 3AOFA 3GNNA 4KETA 5KSWA 1SR9A 2QVNA 3S1WA 3EX2A 1DXFA 2RDXA 4HMEA 1W1YA 4MB3A 1DJHA 3EMZA 3TLQA 4GQRA 4PB3A 1KWKA 3QGVA 2F9RA 5KZDA 5I0DA 3GNOA 1NWUA 3LZ5A 3B9EA 4WY0F 1XD0A 4NVTA 3CBWA 4GYKA 1BG4A 4CD7A 1K7XA 1NH6A 1DORA 1AH3A 4AY7A 1VCVA 4BFAA 4R7JA 4F0SA 4ERAA 1EDQA 4GI6A 1MYRA 2BXVA 3PWGA 2QCEA 3LTSA 1TIMA 2FHCA 2PWVA 2A6LA 3THQA 1DE6A 3IV8A 4B4FA 2BBFA 4LYRA 1K77A 4ZB0A 4HZ7A 4KWWA 4ORMA 1TV2A 5DT7A 4HQVA 2V2DA 4XZHA 2ACQA 1RJQA 3I7SA 4KWSA 2DVTA 2YCJA 1FHUA 5AVHA 2Y0FA 1PX8A 2NX1A 4DJEC 3SUTA 3W7CA 1QTWA 2W4XA 1A5AA 3UVAA 3F4WA 3GR8A 4MZ1A 3IUHA 4GJJA 3GD6A 2NQLA 2DH3A 2Z1SA 3K46A 1EJRC 2J66A 4E8DA 4JL1A 4Z2JA 2PDQA 4GCAA 3WIJA 4X2PA 2PCEA 2NQJA 5D2VA 3MPGA 4Z2IA 4IMGA 3ZVIA 3QEZA 3W27A 4J1OA 4LCQA 3TJLA 1VRDA 3DFHA 1R3SA 4GUJA 1H1YA 5D09A 3G24A 1QU4A 2BGSA 2J74A 2C13A 4NJHA 5G1TA 2G4JA 3KXQA 1AA1B 4IGSA 4RV8A 3NYZA 1ZP3A 6TIMA 2CNCA 1DEDA 1FUYA 4C6QA 3HMCA 3A12A 6REQA 2VT0A 4PL1A 3WEOA 2I9UA 3R4IA 3WLQA 3BJSA 3S6OA 5LA0A 2V3GA 3T09A 4D6EA 1YNPA 2VR4A 4ECLA 2YA0A 2ALRA 1K7EA 2OO0A 4Q33A 3JVAA 1JFHA 1XDLA 3E12A 5DY2A 3IK4A 2J75A 1VHNA 1RAKA 4PTWA 3FJ4A 2D3LA 1GJUA 1EJVC 2ZVRA 1KXTA 4LC6A 1IHIA 4UTHA 1OFQA 1RCXB 5DT5A 3HG3A 1T7LA 2JKEA 3MDWA 3MP4A 3B0UX 4NP7A 4G6CA 4DBWA 4P7RA 1PZ3A 4INFA 1O60A 2A3AA 4NL1A 4PUDA 2GDQA 4ZO9A 5AN7A 3GW0A 2F2KA 3RX4A 2WXDM 3OBKA 4LV4A 1UWRA 5I2UA 1POKA 1V7YA 3W71A 3UJ2A 1M7PA 4M1RA 5CLTA 4D6IA 1PTDA 4PMZA 4Q8WA 1J01A 3NXLA 3EDFA 1SZRA 3DYOA 2QXWA 3MUZ1 5HMSA 4PH6A 3M0HA 3PZVA 4PTVA 1T0OA 5LXXA 2E9MA 4Q4PA 1JQVA 2G37A 3O63A 3VA8A 4N7QA 2FQIA 3P67A 4JN7A 1UR0A 1KGWA 5D2TA 2NUWA 4XIAA 3G5EA 2P0IA 1UP2A 1I0BA 4V33A 1ZJIA 2XG9A 4IQJA 1W3TA 3PNZA 3G1RA 4Z17A 1TO3A 3STCA 2FZ9A 2PWUA 3WNLA 3VK5A 1FFRA 5JMUA 1EGZA 3W1PA 1IGSA 3RAOA 3GXFA 2PP3A 1P0BA 3AYSA 3R10A 2FB2A 2NWRA 2RDTA 1A5BA 2XH7A 3CT2A 2ZUTA 3H2NA 3PF3A 3V75A 1XPYA 2CU0A 3D6NA 4GH1A 5GNXA 1KM4A 4RZ5A 4NHVA 3LEPA 2YCEA 3UZJA 5G1YA 3V5CA 4O14A 3E2RA 1GKRA 2WCSA 3PJUA 3CPGA 3DXIA 4ZE4A 1J0HA 1WKFA 2AQOA 2QUVA 2PDUA 5DQPA 3JZEA 2QPUA 3OODA 3L66A 1KLYA 4AD0A 1AMKA 1IYXA 3VABA 3H4XA 2IKIA 4X63A 3UGRA 2OQYA 5JBEA 3GC2A 4WSKA 3W9ZA 2EXOA 2W5FA 4BY3A 1XDJA 5A8NA 3BL3A 4WF7A 4NRRA 1TPEA 1DQUA 3TJ4A 1JDDA 1VBUA 3II1A 1C7TA 4EF9A 5C9UA 1J0JA 1WAWA 2AOSA 1J11A 3QY6A 1VHCA 1LL6A 2VR2A 4H1ZA 4JTKA 2O9PA 5BRBA 2PAJA 3QPZA 1EX1A 4EWJA 1B4EA 3DFYA 3BUVA 4O18A 5A8OA 3BSMA 2FFCA 2QJGA 2AKMA 3B8TA 1YQ2A 5REQB 2PGFA 3VKCA 4FALA 1DKWA 4QLKA 3L5AA 3HZ3A 4NZ3A 4LAZA 1IZKA 2QCFA 2VGGA 4YTTA 5G2HA 1HJWA 3CEPA 3QC3A 2WCAA 1B3OA 4TV6A 1N7KA 3CWHA 5AC8A 1A80A 5I7GA 1UJPA 1KCLA 4EF8A 2W61A 1PCKA 2YW4A 1F5ZA 1E4MM 5BXSA 1R38A 2KZHA 4S3DA 1ELSA 3DI1A 4I9TA 4L64A 4PULA 5PTDA 2ZVIA 2HXTA 1M01A 3WD2A 4A35A 2QCDB 2ZXAA 2XIOA 5CZKA 4DQWA 3ISIX 3RN6A 2MNRA 4MWAD 3VKJA 1SQ7A 3SEPA 4FLOA 2TMDA 3GHRA 3PN8A 3W7PA 3D46A 5IDIA 3VFLA 5LNSA 1CLKA 2XH4A 5GJMA 3R8HA 1NFBA 2XSXA 4QS6A 4ATDA 4HNLA 4RLIA 3IGHX 4FNQA 5H8MA 2O56A 2GZXA 4K7VA 3TAOA 5CPOA 4CD5A 1P0EA 2X8RA 5A3HA 5C70A 3DN5A 3GAYA 3MO4A 4FB7A 4LAOA 3KVJA 1PAMA 2NVAA 4PRWA 4H9XA 3R2GA 4D6GA 4NQ1A 2CXEA 3G0SA 4LW7A 2IXVA 1A4LA 1CGWA 2UY4A 1DXIA 3KCJA 1TWDA 3OEXA 1F6YA 4C6BA 1XIIA 3NPXA 5I09A 1OT1A 1VGAA 2GVLA 2PDYA 4IXHA 2D3NA 1IR1A 4YN5A 4GIYA 1ZJAA 4BI6A 1BF2A 7TIMA 2I57A 4P8UA 4Q8UA 3DIPA 3TXVA 4IOTA 1RY0A 2UBPC 4HNUA 4D2JA 4QROA 4CEUC 3DX5A 1XIBA 1CXKA 1XLLA 1GQKA 2E6FA 1F8IA 4MKVA 4DJDA 3VCCA 1ZAIA 3AS3A 3K5XA 5GJPA 3AWOA 4BK9A 3LSCA 4WY0A 2QJIA 3AZTA 3AIEA 2HVOA 3QN3A 1CI1A 3VZZA 4U28A 1KB3A 2PDBA 3F4DA 3SIZA 4KGLA 4IISA 1H62A 1JCXA 4JAWA 4NJJA 3SJ3A 3VM5A 3LXCA 3BLOA 1ADDA 1ONEA 3KDOA 3WMBA 3L23A 3OVRA 1H7PA 3D3AA 3LHUA 2WMGA 4B5NA 3GDRA 5FEZA 3E0IA 4GGHA 3ZQ9A 1M7XA 1Y0EA 3DU0A 2ZUVA 4AC7C 4OUIA 4KCUA 5K9CA 3AIWA 1J6PA 3A4WA 4JTGA 1YRRA 3ARXA 1Q65A 2FH8A 1BKSA 4EANA 1J79A 2PU0A 3T2PA 4HPXA 1DIEA 1JEZA 1L0PA 5DCEA 3GIYA 1NWTA 1DIKA 3C0JA 3KS5A 3LUTA 4GUGA 3L4VA 4GACA 3QHOA 3AI0A 3M0MA 3PJXA 4Y8FA 2UV8G 2X1RA 1KWGA 5HNNA 1ME9A 3TN6A 1XUZA 3K4WA 1TV8A 2XVPA 4S23A 3N9KA 3NWRA 7XIMA 2NXHA 2IPJA 1XBYA 1EUNA 4PUEA 3THAA 4QBXA 1ESWA 6REQB 1L8PA 4BF5A 3P5YA 3VDBA 1B5TA 1E56A 2PTYA 4LUSA 1E70M 2A3BA 3NQVA 4ZTYA 2XN2A 4AZGA 2DT1A 2ZWZA 2ISDA 4C6EA 1ZCOA 3OJGA 3B0PA 4GWEA 1UHVA 4F0HA 4YLWA 4O10A 5C2XA 3AMDA 1XRFA 3NQBA 8CGTA 1MUCA 4M6QA 4XTDA 4O17A 2WSQA 4AG0A 4JCLA 1AG1O 1QNOA 2BOEX 3H7VA 2DIJA 1S5TA 4ILSA 4UIOA 2VZOA 2C8NA 2B4GA 3FFSA 1AJ0A 3MHFA 4GVGA 3EZ4A 1LOSA 2DEPA 4JQ1A 4AEOA 2HZGA 3WLRA 3NPUA 4NAEA 4GOAA 3TC6A 4LY8A 4A3UA 4B5XA 2AL2A 2YXXA 4IQEA 4WJEA 4X9SA 5FJPA 1D3CA 1MW3A 3SO7A 3GZAA 5E09A 3P0XA 3BOLA 1XX1A 3F4CA 5CPSA 3THDA 1JYXA 1V5XA 3IIVA 3GSMA 1LJYA 3O2LA 1QR7A 2AAAA 1SJDA 1GYNA 3GNXA 4AZCA 3AUOA 5DANA 4NSBA 5CAHA 1QWKA 4NNBA 4LC8A 1YKWA 3FSUA 1EJ7L 5K7JA 4J3SA 3WJSA 5DMMA 4GINA 4O15A 3W4RA 4HMNA 1KBBA 3LDVA 5AHEA 1D3HA 4DO7A 3P74A 1UA3A 4UR7A 2WVVA 1V79A 5EA9A 3IAPA 4Q7NA 2Y7EA 4GQBA 3LTPA 4P5UA 1C9WA 4IG2A 1XI3A 3W53A 2R94A 1UD4A 2CBJA 4GNVA 3VIPA 1LZOA 1Y5VA 4ZFMA 2C0HA 3QZ6A 4Q8PA 4AMCA 3IJIA 8A3HA 2J7CA 2ISSA 1GVOA 3NR0A 3GE7A 4GXWA 5L9FA 1F6KA 1OFBA 2GWGA 3UJFA 2A3CA 1LQAA 4PFMA 3V0SA 3PBWA 2WMIA 1KM6A 3CJPA 4AHQA 3G1VA 2B7NA 1GQNA 2VEIA 3AS2A 3VIOA 1C93A 1D9EA 1E72M 4HU4A 3W83A 4CQAA 1GYLA 5CC6A 1GVYA 3U0HA 3O8AA 1OINA 2PWHA 1GOQA 1XIGA 4A3QA 4GZEA 1IEXA 2EGZA 3E2QA 1RK6A 1KR1A 1S5NA 4G56A 2VCAA 3UA4A 4W93A 1VCGA 1VZWA 3MKVA 3M16A 3LB0A 1E0TA 2QGYA 3KVMA 4MYXA 3MVTA 2VCBA 3KOFA 1DQXA 3ABOA 3CC1A 1BSIA 1OZMA 2QF8A 1VENA 4HA4A 4O0ZA 3G1AA 1RVKA 3VIJA 2YGYA 3KM8A 1KD0A 2PDLA 4ZSTA 2CETA 1OIMA 2RGLA 3RPMA 3RR1A 1H7XA 3BLKA 1UD6A 2QDGA 1X97A 2XU2A 2Z4GA 3P81A 1REQA 1IIHA 4GHRA 5LNVA 1W5NA 4MIMA 3FK4A 2IUZA 3UXKA 2YSWA 1W8GA 4I8DA 3MZ2A 1UQYA 2F84A 1EQCA 5AHNA 4Q6JA 3C3UA 3G0UA 2G3JA 5F1UA 1P1XA 1KKRA 5BYWA 4K1WA 1JYWA 5LGZA 5C7VA 2YCKX 3NEVA 5JH1A 1Q7MA 3OLGA 2VEKA 3UZYA 1XIEA 3E1F1 3CM4A 4KFPA 1GVFA 1ZRQA 3ARPA 3GNRA 3M43A 2PPGA 2JKAA 1A5LC 1QO5A 3L65A 1WNOA 3Q45A 1UYQA 6CGTA 4Y2WA 5A2BA 2QHAA 3K1DA 4AD3A 1W9BM 2QAFA 2V9DA 3M1ZA 4HT3A 1LBMA 2AQWA 3NEHA 4LH8A 2J88A 1RP9A 4HNNA 5LZLA 5HBFA 4JTAA 3WELA 2A5HA 2Z6IA 5REQA 3LRLA 3OIHA 1HQTA 4GZIA 1W5OA 2NV1A 2O4QA 3LCWA 3M0LA 2HBVA 4UTWA 3TNOA 3UZZA 5I03A 1A4MA 1F4HA 3SY5A 2Y7GA 3TTQA 3WDRA 4R7WA 4Q8QA 1XD1A 2OFJA 1DQWA 3TLLA 3DH7A 2PDWA 5HNRA 1YHTA 4NF7A 3WG6A 3MA8A 4F2UA 3IJ7A 2NW0A 3SN0A 1U5VA 1T96A 2JF6A 2C15A 3GTHA 3SGUA 4X0VA 3W7DA 3OQEA 3W26A 3MT1A 4LWWA 3FAWA 1FWRA 3V16A 3URNA 1CT5A 2BOFX 4G5DA 3LGGA 2D22A 3OGVA 5HJXA 1BF6A 2X1IA 2Z1WA 1VKFA 2GVYA 5H1WA 1XLAA 3PB0A 4WUIA 4MWAE 1TTIA 5DMNA 3HFTA 3S2LA 3B8DA 4ICNA 1VFOA 2ZZ1A 2F6XA 1UWSA 4FZIA 5KTLA 1XM3A 1DWHM 1BTMA 3M7SA 1WDPA 3GNDA 2NVDA 2EPHA 4A2SA 2OGYA 1UZDA 1GVSA 3OPSA 2VOMA 2WHKA 1XH2A 3VYLA 4IPPA 1V6TA 2J4GA 4ZVJA 5IRPA 3KZPA 2QW5A 2X1SA 2CZVA 1E1CA 4H04A 2BG5A 2QAPA 4DIAA 1XBXA 1KM3A 3NJ3A 2X2GA 3F2BA 3PZTA 1I60A 3LZ3A 4MDOA 3QYSA 1QJWA 1LRNA 5ABFB 4MG4A 2X40A 2HE5A 1RHCA 3T07A 3RM4A 1SSGA 3KWSA 1M68A 4REQB 4GGBA 1T99A 1JZ5A 4IP4A 1A47A 3LXAA 3ZT7A 1IEIA 2RH9A 1BLIA 1S2CA 1IQ8A 3L2IA 1V3KA 1OF8A 3LD5A 1ECQA 4AX6A 4HP5A 3MSDA 4LBUA 2GWNA 2NX3A 1JR1A 3A6OA 1CBGA 5ABGA 2BVTA 4JTTA 2PDHA 2VC5A 4EK7A 3H53A 2OG9A 2EHHA 3G3MA 3EA2A 2WNWA 1HKVA 5A8PA 4XZ9A 1ME8A 5C9WA 2Y61A 2XDFA 2OEMA 1XH0A 3E0LA 1E9IA 4QNWA 3DOPA 5LIYX 5XINA 3IJ8A 1FWJC 3STGA 3NPVA 1XDMA 1UH2A 3O06A 4JBRA 2C19A 1TA3A 4AUBA 5J5DA 3S5NA 2D2GA 3AJ7A 4LANA 2GGEA 2I7GA 4CLMA 6TAAA 1X1ZA 4PBFA 4O54A 1I1WA 2Q09A 2ZE0A 1V7AA 3AJXA 4GXPA 3PY2A 3ARWA 2NX9A 1H49A 3A5FA 3PR2A 3KW3A 3C2YA 2C6QA 3WMLA 3TXZA 3EAUA 2ZUWA 2Z1VA 3A47A 3CGTA 4W8LA 1FCBA 1LUCB 5BWAA 3T81A 3LY0A 4HZ6A 2FVMA 3N2CA 3OIXA 1VEPA 1VP5A 3L4XA 2IQTA 5C2CA 1FWAC 5A6KA 3WJYA 2Q71A 3PSWA 1DXEA 4JYFA 1MZHA 3CU2A 4DJED 1QI0A 1XQKA 3WQPA 1OX5A 1UBSA 1RY8A 3SQLA 3P84A 2WMHA 4S3EA 1ZALA 3T55A 4E4PA 3FCPA 3L2LA 2B0MA 3H21A 2ICSA 4ADSA 3DEQA 3L7RA 1Q66A 2AAMA 3WK2A 1UASA 4R33A 3VMNA 3EX4A 4IJBA 4LOCA 1VYRA 3PFRA 1O5KA 1K02A 5CXPA 3MI2A 1R46A 5JUVA 4XSMA 3H2AA 4A22A 4Q4KA 3EB3A 2H9AB 1O94A 2F61A 2E68A 1X8CA 1EIXA 3OTRA 1GOKA 3W2LA 2H8ZA 1JYNA 2R9RA 3NVDA 3CZKA 4N4QA 1MFVA 2HCVA 2VX4A 3BJFA 2G50A 3BW2A 3QY7A 4JTEA 3HQ1A 3KP0A 4DUVA 4WEVX 5TF0A 5HXMA 4WK9A 4E6MA 5G4HC 1RZMA 3MMDA 3PTDA 4UFHA 1OFPA 4MJZA 1J5SA 2JALA 2CBVA 3W29A 1H51A 3UFYA 3IGUA 1I2QA 2P3ZA 4PMRA 3HBLA 4MB1A 3AICA 1XC4A 2VWSA 1NWRA 3R0DA 4UZUA 3PNUA 3NSXA 2Z1XA 2A3LA 5FCZA 4C7GA 2BS9A 1KRMA 2WQDA 4IL0A 1XICA 1PO9A 2ALDA 5LSMA 3GHTA 3CV6A 4FEZA 1XRSA 3A23A 4O52A 4CNUA 2BP1A 5F2GA 1HKWA 3EX3A 3TCEA 4D6DA 3A4AA 5AVNA 2Q6ZA 5A94A 5CPTA 4DX3A 1SSDA 1XIDA 3S2NA 1FFQA 4JIQA 1ME7A 2PWFA 5IOBA 3UXDA 4XK2A 4AIEA 1O1ZA 3WLSA 1IT0A 4J3WA 2Y8UA 1XP3A 1T6MA 1LP6A 1W1IE 5F2MA 5BMXA 1A5SA 6A3HA 1R9ZA 4L7ZA 4PODA 1NDYA 4HGXA 1J12A 4HZ8A 1RCQA 3N4FA 2Z1BA 4BEUA 5LIUX 3W38A 5A8QA 1XH1A 4FX8A 4BF7A 2YL8A 4M0XA 3EA1A 3TYAA 3M47A 1DOSA 4L4PA 1QI3A 3HG2A 3VGFA 1W2VA 2ZZ6A 4EXBA 3WX7A 3WLOA 4H9YA 3W88A 1DP0A 1L2UA 1XYAA 4H01A 2PTXA 4IJCA 3AMKA 1K6WA 3CUIA 4UQDA 4B5UA 5A6JA 1UCWA 2YXOA 3URBA 8RUCA 5CSRA 4FI4A 4IJRA 3GG7A 2JQXA 1EBGA 1UP0A 5F1VA 1J9YA 1UWAA 4F9JA 4K68A 2VX7A 4IUOA 5I07A 4QJ1A 3H23A 1RQEA 2WSKA 2Z28A 3WL0A 3SUSA 3GBEA 1XBVA 3N14A 5BWFA 3UCCA 2OODA 3AIBA 4GRSA 2QGHA 1MRQA 3OZMA 2E9BA 3MTWA 1XLEA 1Z9AA 4KRUA 3TIMA 3APTA 3V5OA 3NQEA 3KRBA 3F5JA 5HMDA 1D3GA 2HXUA 3ITLA 5E5CA 1JRCA 1MI3A 2WLZA 1XINA 5GPRA 2EO7A 4UCGA 2A21A 1GW9A 1W5MA 1BWLA 3B9DA 3RILA 3CQKA 5CJMA 4GIEA 5EFFA 3KTXA 3LMZA 4DJDC 2ABBA 3CYJA 2E6AA 4GYJA 4LS2A 3WMCA 1XFBA 2QCCA 4PMXA 3VDCA 2HE8A 2J9ZA 2VDGA 3WLMA 4DJDD 3SB0A 2F6KA 5FD0A 1P6BA 4ZB5A 4WSJA 3MC5A 5DFAA 4GK8A 1X7IA 3PBVA 2VEFA 4OOUA 3VGBA 1VPXA 2PCQA 1Z89A 3GDTA 2NV9A 5D02A 3HTWA 5MKGA 1V0NA 4QIUA 2ZUUA 5U4NA 4JHZA 1GZJA 4BEQA 1NP2A 3S83A 2CLIA 3G1FA 3GDLA 3GYEA 2PF8A 2WSYA 4U2YA 5EU9A 3KRSA 3DHUA 2ZRWA 5M3WA 3EDDA 1A0CA 3VI2A 1P48A 2QMJA 3OLIA 5DEZA 4WKAA 3U6WA 3UG3A 4NAEB 3MCNA 3JU2A 1IV8A 2H9AA 2E3ZA 1RQBA 1PX4A 4O50A 4BQ2A 3VX0A 1P4CA 3BOFA 3PTMA 2XHYA 1E6SM 4UNLA 3F4VA 1EC9A 3H4GA 1X6UA 5DY3A 1H0GA 1I9CB 2BV9A 4EP8C 1JPMA 3M0XA 4EXQA 1J2BA 3P60A 4M8UA 3MP5A 3ECQA 3THUA 4PUNA 3C2EA 1US3A 2Y8VA 1W9PA 4P7NA 1KM2A 1EEPA 4L80A 2WSRA 4J3ZA 4GI9A 4Q8NA 3CTLA 3QSRA 3HG5A 1E3ZA 4OV9A 3CPRA 3DENA 3URQA 3WUBA 1UC5A 2VGIA 2WVVB 1PIFA 3EYPA 4P61A 5HAOA 3TV8A 5C54A 1UMLA 1RBOB 4TX9A 4XD5A 4J2PA 4S3KA 1O1HA 3SGZA 1XV8A 2PBGA 4UR8A 2CHNA 1SVDA 3W7LA 4PCFA 3NL5A 1GK8A 4M82A 5D33A 3RPDA 2R1LA 3B9OA 3RLGA 2PRMA 2PDKA 2Y63A 3CYVA 2J7DA 4JQ3A 5CGQA 3KUMA 4GQ0A 2HMCA 3L5MA 1WCGA 2FLIA 4JQ2A 5KMYA 5FEPA 3MUAA 3V18A 2ZUSA 1KFKA 3RYSA 4H7VA 1OFEA 3W2UA 2VUYA 1D7KA 2KX9A 1YXCA 9CGTA 4J5NA 3BG3A 3FV9A 1G67A 2WMIB 1OCBA 3S5OA 1QNQA 3A24A 4Q3MA 3OZOA 4HN4A 4GUFA 1K8XA 3LX9A 1VIWA 1ISVA 1E51A 3A22A 2OZTA 4W85A 2FTPA 2DIKA 4GMEA 1PE1A 3EOEA 4I9AA 3GDBA 4JOMA 1SM9A 4D1JA 1TA3B 1TG7A 4PMDA 1BKHA 2PTWA 4DM1A 1DBTA 1KM0A 4G1KA 1WZAA 3WH9A 2PEVA 5XIMA 1C8YA 3L2MA 2FTYA 2CWNA 3BW3A 2ZTKA 5GQBA 3KE0A 4R3UA 2EG7A 2J77A 1QI5A 4UNIA 2Y85A 4ZODA 2XN1A 1P0KA 4UMCA 1L2QA 1B3ZA 3I68A 4BZYA 1VD6A 3RNDA 3HGSA 3G1YA 3WEMA 1OYAA 2I1OA 1UKSA 4C90A 2CZEA 4LPCA 2WZEA 4GBUA 5T8GA 2V82A 1PCWA 4DI8A 3WN6A 3GU9A 2GK1B 4AMAA 2Z2UA 3TQPA 3WKZA 3H24A 1OG6A 1EGVA 1M04A 3BCJA 3FHAA 4C5YA 4KRTA 2YBTA 1OZQA 1XCWA 2ACUA 2UY2A 3O9NA 2AL1A 3W7MA 2IXUA 3ZXWA 4AEFA 2WJDA 3KVKA 1V02A 1YDVA 3BGGA 2PWEA 2V5DA 1JULA 4PMYA 3RK8A 4LY4A 4D71A 2JEPA 3NYDA 3CZ8A 3FW6A 3DDMA 3ERPA 4MYAA 4Q8OA 5TD4A 5E70A 3VZYA 3K2GA 3STPA 4IP7A 4JFUA 3NDZA 2YR1A 4LBSA 4CD8A 2VO5A 4LB3A 2QIWA 2VFGA 4A05A 1MNSA 4YTRA 3SCNA 4A21A 5MF5A 4GO8A 4WD0A 5D2XA 3MWAA 2OEKA 2XUCA 4Z1DA 4LVAA 2XWDA 1BD0A 2FDSA 1GORA 1L9WA 4KWVA 1F3EA 4GY0A 2GJPA 5LA2A 1IXPA 2J8TA 1V08A 1ZGDA 2YJQA 4O16A 3LN3A 3FYOA 1R3YA 2ZZ4A 4XO7A 2YPIA 4H7ZA 2FZBA 2PDIA 4BQ4A 3BAKA 1ISZA 5G2IA 4HYRA 4MNKA 1EH9A 1PYMA 3S2JA 1U33A 1GQIA 1C90A 1PJ9A 3LPPA 1W0MA 3W74A 3MVIA 1JGIA 3QR1A 3VMPA 4AIBA 2YBVA 2C71A 5CSSA 3MMUA 3CMFA 2IPWA 1FOBA 4CUCA 3FXYA 1CXFA 2QF7A 1W56A 3BOXA 2BWGA 4UB9A 3S1UA 1OK6A 5T91A 4AF0B 1B1YA 3RM9A 3ZR4A 3AROA 4X0NA 2PC4A 4YHGA 5A2CA 1GOOA 3GG0A 4JXCA 4IFOA 3LU2A 4EE9A 3PM6A 3RO8A 4XVEA 4EPDC 3WQEA 4FLRA 2Y1HA 4Q4MA 5HR7A 1ADSA 2WZTA 3GWQA 4CN1A 1LTDA 4ZOBA 3C56A 4MNJA 1CB2A 3N3TA 2XJ7A 4LCSA 1PSCA 2WHLA 4IGMA 4UQEA 4JIHA 4MGGA 1C92A 1Y8BA 4O1CA 4RE2A 5HJLA 4AQLA 3AAMA 1KM1A 4PCNA 3IVUA 1QPKA 1T8XA 1B3XA 2E67A 1RA5A 4Q4SA 4JIEA 2HS8A 4KEMA 1AH4A 5EMMA 5MHBA 1AQHA 4M6UA 1FBAA 3CNYA 3N1AA 1X98A 2VZSA 3U57A 4Z1AA 1TJ0A 1W3IA 2J13A 3LA4A 5E6ZA 3UR7A 4L9ZA 3W2KA 3HMJG 4X22A 5I00A 4EPKA 3LNMA 3HV8A 4ACYA 2YYUA 4WVXA 4YCPA 4UTLA 3HPSA 2QJJA 3CHCA 1EXBA 4IX0A 3R0KA 2PDPA 4FF5A 4UTWC 1LWHA 5AZ0A 5JBFA 4NZFA 3P5ZA 2WJEA 4XTIA 5DMYA 2W0UA 3EB2A 4RDWA 2ZRZA 3S3GA 1BTCA 3RM8A 3W1UA 2BXZA 3QRHA 1BYBA 4F9DA 1ICPA 1KV5A 5J5RA 4JICA 2XISA 1TTQA 3UG5A 4TXEA 4W5ZA 1DHPA 5KZ6A 2FB3A 3L0KA 5HWMA 2WKGA 3M0VA 1AZ2A 4LUTB 2DQXA 6XIAA 3S6DA 4G7FA 2X09A 5BXTA 4AEEA 3TX9A 4XKYA 1QNSA 1ZS2A 1KFEA 3ICJA 3WUEA 2JE8A 3ANVA 1GT8A 3AHVA 3L4ZA 1DJWA 3NSNA 2YIHA 3EXSA 3IK2A 4HB7A 2XN0A 2KAUC 4JFWA 2DT2A 2WBKA 2QCDA 1XQLA 5M03A 2PTZA 2WYSA 2PP1A 3GU1A 3BAJA 1BGAA 3O1NA 1E9ZB 1EJXC 1EYWA 5E1QA 2DH2A 1UROA 2VYOA 4UTTC 3Q2DA 4V1XA 2VDIA 1SFJA 3U5YA 3CUXA 3FY1A 2DT3A 2PRHA 4OJYA 2WK2A 2WMJA 5DXYA 1CGUA 2XFYA 3OLDA 3UT0A 1FH7A 1QW9A 3TTSA 4Y90A 3GKAA 1KXVA 3HN3A 1POJA 4HNCA 4LYQA 1GOMA 1XIJA 3C8NA 3AYRA 2OELA 4C7DA 1K9TA 3VKKA 2HEJA 3WYZA 2OQLA 1Q6GA 1A0EA 2HV5A 3FSTA 5AC7A 1J0ZA 3S0CA 3HO8A 4QE5A 3S1VA 3TOYA 2W79A 2FMOA 3TSMA 2VNCA 3S6TA 4KBXA 1CGVA 3KCOA 2GSEA 3NZPA 5I3GA 1HKKA 4YMZA 1J4EA 5JIWA 1WDSA 2FZDA 3F4NA 1ZBWA 1KFBA 3V0TA 3EWZA 3USBA 3GM8A 4K7YA 3THCA 3CO4A 1UMYA 3W7JA 4N9DA 3MI6A 1GEHA 4LRTA 2C1HA 1C29A 1XL9A 3UWEA 1YLVA 4CQCA 1HKMA 3GVQA 2X7WA 2I56A 1B31A 2VD8A 2CBIA 2IPGA 1TVLA 5JXQA 2PODA 1UD3A 4HNVA 4AIOA 3GW3A 1IZJA 3NQDA 2PP0A 4WRHA 1UR2A 3ARZA 4HIBA 4IMFA 1LROA 2YDRA 1ZHAA 1E9YB 2E8YA 3G77A 1X39A 3MHUA 4MAVA 2J62A 2E5BA 4IIEA 1NEYA 3AZSA 1ZY9A 5FJIA 1MRAA 3CL7A 1RV8A 2SFPA 2I5QA 2QYGA 1P0DA 2YCLA 3GH7A 5F4SA 3C2OA 1QHOA 4MMWA 1O66A 4GZJA 2FPYA 1CCWB 3T9PA 1W8SA 3NUKA 3WO8A 4WDUA 1KCZA 4OBRA 2ZBTA 2HS6A 4ZA0A 3GH5A 4W84A 1XGEA 2OYLA 2QCGA 5I78A 4XQ6A 2FH6A 1Z6KA 2I9EA 2DY3A 2ZRUA 1QNPA 1FA2A 3UWYA 2O9RA 5DLCA 3SFKA 2QDHA 4KCVA 1H63A 4ZZ9A 1E4LA 1K8CA 4JR5A 2WBGA 3W85A 4NAFB 2HNEA 3DBNA 3SGGA 1YIXA 2HNHA 1Q4WA 5E0CA 3UPBA 2BOGX 2QV5A 1GPWA 3AHTA 2QPSA 3TNBA 1R2TA 2J7HA 1K9EA 1Z8AA 2XIMA 3B03A 4BQ5A 3ANUA 5A6LA 3WQ5A 1K8YA 3I65A 2DQWA 1QOXA 3ZT6A 3VNKA 3XINA 2DGAA 3CIWA 5BNKA 2OCZA 2QNEA 5CCZA 1EJWC 3MU7A 3CHFA 4TO8A 1OVDA 5LNRA 2J8GA 1O7AA 3OYXA 4C6JA 3I3DA 2HK0A 3T7VA 2G4FA 1VIZA 3CHEA 2FVLA 3G22A 4Z08A 3IRDA 3OVPA 1EA0A 7REQB 1IT7A 3M5ZA 5HINA 3MCMA 3QR3A 1KBKA 4CEXC 2QDEA 3SECA 5A2AA 3VM7A 1W3KA 2GVEA 4KFNA 2OZ3A 2P53A 4H9TA 2OB3A 1ZUAX 1M1BA 3WK0A 3GXDA 1ZQ5A 1J96A 4M81A 2V5CA 4XAYA 1TPB1 2ZCGA 3DFPA 3ONBA 3CL8A 3W82A 1V6XA 5MKGB 4C6LA 4GI4A 3W6YA 1XRVA 3QHNA 3G0XA 4DBUA 4GH3A 2D0FA 3VD9A 5LNWA 3B4UA 3ARYA 4RNJA 3VKBA 4Z1BA 4LVBA 4G1NA 2HWGA 3LI1A 3KBMA 3BW4A 1TYGA 2ACRA 1AVAA 3AALA 3VNLA 4DWDA 2V6AA 3NDOA 3WQDA 3ZSSA 4DZAA 3IIXA 1OB0A 1XIMA 2CZFA 1PB0A 1NP0A 4BI5A 1HJQA 2G95A 3LSBA 2Y5JA 1VBJA 4Z2KA 3LCIA 5CH9A 3H2EA 1WKDA 4KWOA 1UR9A 1CW2A 1UR1A 3CMGA 2ZOXA 1UKPA 1O5QA 4KPLA 4U5KA 3WUFA 3T78A 1ZBCA 4N2YA 2JIEA 4MFEA 3VXGA 3SRKA 4HU8A 4Q6XA 2QUUA 4NG3A 1JCLA 2PLMA 3PTKA 1J8VA 1ONRA 4FK9A 1CX9A 3RLHA 4DF0A 4CNNA 4CCDA 1HNYA 2CLOA 1XLIA 3CQHA 2YL9A 2YFNA 1YW1A 5GNZA 3UGVA 3VFCA 1OF6A 3A4JA 5ABEA 5HANA 3VIKA 2OSWA 3ATYA 3DECA 4Y96A 1JD7A 3ARTA 4OHQA 1CECA 3WQ6A 3K1GA 3W2JA 3KTCA 1GGOA 3B40A 3EDEA 5HWJA 1YNYA 4HA0A 3MBDA 1XUUA 1QPNA 2A3HA 3T05A 2GJXA 2V2CA 2JK2A 2DJXA 4Z2HA 1PWLA 2VVSA 3N25A 1GNXA 2WWCA 3VD5A 4C1KA 4IICA 2NUXA 4ZSUA 4OGZA 3LBOA 2Q8ZA 2FZNA 1V51A 4WKFA 4LBRA 3WLHA 3F2DA 2E7FA 3D47A 3JS3A 1EPVA 1XSJA 4E0CA 2V3DA 1WUEA 1R86A 4B3ZA 4KEUA 3T42A 4CQ8A 3BV4A 4ROQA 4NI8A 4DWSD 3VVGA 4K39A 4I7UA 3WD4A 3NL2A 4ONVA 2OGJA 3I3BA 3OGSA 2IQ0A 4I5XA 1J0YA 2ZQ0A 4I5UA 3VNYA 2BVWA 3AHZA 5C6MA 2OX4A 1TSIA 1OBAA 2DUXA 2NQ9A 3UY8A 1TMQA 1OCQA 1UIOA 2E77A 4Q22A 4XD3A 3EWUA 3LPFA 1XGDA 3TQKA 1V3HA 4NZ4A 1R3WA 4OT7A 1U1JA 3VMOA 4S3CA 3KRUA 1BXCA 1MO0A 5EB8A 2A1YA 4W89A 5FACA 3WENA 1P6WA 1C91A 4ZBCA 4WCJA 1F05A 1JUKA 1M6JA 4W7VA 3ZLGA 1LCOA 3UY7A 2F7FA 3KFTA 3IPWA 3WLPA 3EX6A 2ZX8A 5CPMA 3IJQA 4JTUA 1MUMA 1UUMA 4CU6A 4TV5A 1TJ2A 4P7QA 4H9MA 1CB7B 3QQWA 4PTNA 2W66A 1M5WA 4CNSA 4LEFA 1W1ZA 4IIGA 1QCWA 1JCYA 1V3IA 3WDQA 4YWSA 3PZ9A 3BC9A 3NQ7A 3QSTA 2GQ3A 4KH2A 3EDKA 5CSUA 3VOGA 2HVMA 1EHAA 3GH4A 1GHSA 4CKQA 1WDWA 1S5MA 4D8LA 1DWFM 4C7FA 3WNKA 3NGFA 2YFOA 4N9BA 4K36A 2BGQA 4XD4A 4LNYA 3F5LA 4IFKB 3L9CA 4QQ3A 1JFXA 3AWNA 4GABA 4HSNA 2BMBA 4IQLA 2AKZA 1OHLA 3AMLA 1NOWA 5HUOA 4IGNA 1OT2A 3CHDA 1NVMA 3FA4A 2CKRA 4H41A 5AYZA 3UEQA 4B5VA 2R8WA 1FWIC 3WF1A 5HATA 3BDKA 4RPPA 1E0WA 2ZKMX 1QPRA 3TAKA 3H22A 4NI3A 1WP6A 2WWDA 3LHTA 3NCOA 4GX8A 1NOFA 2GGIA 1WQ5A 2ZRYA 2NXIA 4B5TA 1FHVA 1UZ4A 4GIAA 1FKXA 1Q3NA 1W5QA 3QPYA 1TPC1 1ISXA 4PBEA 3WNPA 1ALDA 3BWWA 5I3IA 1RQHA 2G0WA 5DRIA 1TPVA 4IIDA 3C5QA 5JIPA 1JF6A 1NTHA 4S2BA 1CLXA 3G2GA 4LU0A 3JUGA 3WZ0E 4AD1A 2QCMA 4F66A 4FSAA 3V35A 4HA1A 5M5DA 3U4AA 4ZXLA 4FXJA 2JIWA 4DELA 4IWWA 1PZ0A 4N42A 1KFJA 3E38A 2XM1A 3T40A 2DSUA 1ZP4A 1W9DM 3OO2A 3APYA 2G3NA 1ODUA 4NX5A 3WK1A 3BK0A 1TR9A 3CH0A 3WBYA 1WXZA 2W62A 4TIMA 1TKKA 3C61A 1ZZMA 4N4PA 3SCPA 4S1FA 4H9ZA 1YTKA 3QHMA 5C9XA 1B3YA 2VFHA 1V0MA 3OHMB 3W76A 2RDUA 4IFKA 4AW7A 1W9XA 1SMAA 4ZOEA 3Q67A 4MY9A 5BOFA 1H61A 1OFDA 3AUJA 3KAOA 5A69A 4CD6A 3SURA 1P5BA 1TWSA 2WSPA 1E40A 3QV6A 4GVHA 2D69A 4C1NA 3AIUA 2E1WA 2C1IA 5DBUA 1ZNNA 2YCIX 4OFCA 1UKOA 3NGJA 3UWZA 4AAJA 2DZWA 2C79A 4KS0A 1LWIA 3LM3A 5BCAA 5E9XA 2OKOA 3STEA 3SCSA 1GZ1A 1GG0A 5HNUA 1Q6FA 2X1TA 3UJEA 3W75A 4GFSA 2XSAA 4XAFA 3WK3A 4LB4A 1R7AA 4WGHA 5A6MA 1E1FA 1BVWA 3P2VA 3VOIA 5C55A 3IIOA 4Q7IA 3NOEA 3LLXA 5LNUA 3ABXA 3AU6A 3H4WA 5CBBA 4B9ZA 4OUEA 2TRSA 3ARQA 1OCNA 3WFLA 1ZAHA 1T8QA 2J27A 1UZ1A 1LLZA 3XIMA 4JY8A 4QR6A 4YTUA 3ARVA 3TMLA 1QI4A 3T08A 3N4AA 2WAGA 2OOFA 3T0BA 1IXQA 4XSLA 2A85A 4ZQMA 1HW6A 3KBSA 4ES4A 1YPFA 4FXSA 1VB9A 4DJEA 4HA3A 4MLJA 3GXIA 1H5VA 2ZA2A 2JBMA 5BU9A 3LERA 1IXNA 2WC3A 3C6CA 3PANA 4MF4A 3S46A 1HJVA 4RZ4A 4JHOA 1J5TA 1K9FA 4PTDA 3HFYA 1UH3A 3S9IA 3FS2A 5AYIA 3VPLA 1H0IA 2PA6A 1OYBA 4Y9NA 3TC3A 4B91A 3E3HA 3TJIA 4UFKA 2WANA 3MZNA 4A2RA 3NQFA 1ISYA 2W92A 5TIMA 4D6JA 2WZHA 3WDIA 4JEQA 1BRLB 3HPXA 3LYEA 3NQGA 2V5KA 2B7PA 1PUDA 2VGFA 3N19B 4I7WA 2XZ7A 4G8TA 4HCLA 2J6XA 4UZSA 3VU2A 3R89A 3B97A 3GDMA 3EWBX 2R1KA 2GUBA 1F8MA 3DZ1A 1F7BA 4PBGA 3UR2A 5JU6A 4JYDA 2C3ZA 2AGTA 4M5PA 5H2ZA 3EXRA 1NF7A 1HF6A 4TMBA 3N3MA 4MKSA 3AISA 4LQ1A 1IEVA 5AZ1A 5A8GA 2INEA 5C9ZA 5HPOA 2CIPA 3I3EA 3V36A 1XPGA 3DG7A 1DIOA 2ZXQA 4DN1A 1YTDA 3FYPA 3B8IA 1AH0A 3I10A 1AJ2A 3BE7A 4B15A 2Q02A 4U33A 1ZFJA 4IX2A 1E55A 1MDRA 4RW5A 1LUCA 2QZRA 4FXRA 5K4XA 1WE5A 3W1RA 3M41A 1TVPA 4BCEA 2WVUA 1MEHA 4E38A 6XIMA 4FOKA 1P1MA 1TREA 2XYLA 4Y6GA 3DERA 1PTAA 4UTJA 3N6JA 1KFLA 2XPKA 3W1AA 3DFTA 6ALDA 5AC6A 2VZVA 4Y9MA 4XBSA 2CKSA 1A3WA 2VEMA 3QC0A 5ABHA 3MMTA 3WNNA 4G7EB 4UOQA 2HVNA 5CC5A 2QCNA 5J04A 4IMCA 1EF2A 2VI0A 3L0GA 3NQAA 1AQMA 5C0QA 2E0PA 4DUOA 4YTQA 1DV7A 1AK5A 1SW7A 1KRBC 2E5CA 1RD5A 5CKSA 4X3ZA 1C8QA 4I90A 3AMCA 3HJEA 1CLVA 4DJFA 3WUGA 4U31A 2PB1A 2QQ6A 4MB5A 3O07A 4C1NB 1O5XA 3MJYA 3R7MA 2JF7A 1V3LA 1P7TA 4O28A 2H3DA 2G97A 4C6DA 3HF3A 1ICSA 5LGXA 2NV2A 2XVGA 1GZGA 1OEPA 3EEZA 3E02A 4JTJA 5CC3A 4A8IA 1W91A 2QMKA 4QX4A 3GO2A 4O13A 1TX2A 2CLPA 1EP2A 4EPBC 2WC4A 2BY3A 2ON3A 3TYCA 5DCBA 4AZ6A 1NIUA 2VRQA 3T8LA 3VOCA 1R2SA 3BGJA 4LS0A 2P3EA 2DSWA 4GISA 5JQ9A 2OKTA 1OM0A 4FO4A 3W87A 2XVNA 5D37A 4RNIA 1S2VA 1Z7AA 3FXGA 3DHPA 5A8MA 1GJPA 4JDYA 1EHNA 3VTRA 1H1ZA 4JEJA 5A6BD 3CQJA 1ZAJA 5BXPA 2J7GA 2O9OA 3TFCA 1KBJA 1AL7A 4G9PA 4MLRA 1V02E 4ERIA 4PL2A 2NSXA 3KL5A 3G6LA 3MWCA 5CZJA 4ZO7A 2F8QA 2Z7GA 2WC7A 1MWOA 4IMEA 1H4PA 2CLMA 3BLEA 1PS9A 4MM1A 1OX4A 2A0NA 2INZA 4UTUA 1DYSA 3AO0A 1Q6EA 1K1DA 3EWXA 1KTBA 3AMGA 5DBTA 3WH6A 4CCZA 3LM7A 3TP4A 4F0KA 4DUWA 2FIQA 3QH2A 3I4KA 4W4QA 3O3RA 2X1UA 2ZZ3A 2VDHA 3PTQA 1TVNA 4NZ5A 4PRTA 3QFEA 1JDCA 1XR2A 4MNMA 3UR8A 3MUY1 3GTFA 4LV9A 3UR5A 3KOWA 1YPIA 3HB9A 2ADAA 4ICCX 3KOXA 4US5D 3NZRA 4KEZA 2FJUB 3CK5A 1PL9A 5M17A 1EZWA 3TK7A 3FGCA 2Q3OA 4WZHA 3R58A 1TUFA 4BS0A 1RBAA 2REQB 4Z42C 1FP9A 3EWDA 4LUSB 1FWCC 3HM7A 3LHWA 5C7HA 3M5YA 4PFHA 4AVNA 1TV7A 1UH4A 1G01A 4O19A 1WZLA 2DORA 1J0KA 3TDFA 5JVLA 1QOQA 3QLLA 3DG3A 5EBAA 1SZNA 3QY8A 4UOZA 2CLLA 1QO2A 2A7NA 2GQ9A 3AQUA 1BSLA 3SRHA 2I5IA 1E5JA 2JKPA 3S42A 1TMLA 2WO5A 3NVTA 3W00A 4L56A 1MEWA 3CXOA 1KCKA 2X2YA 3R11A 1S2WA 1Q7QA 1N55A 1B57A 3TTOA 4EVZA 2DZAA 1OGSA 4BQ3A 2EF9A 3R94A 1UA7A 3ZYZA 1TE1A 3VE9A 7A3HA 3UYCA 4ZL1A 1V93A 1R3TA 1TPFA 3UWWA 3TA9A 4ZENA 1BVNP 1PDZA 1QBAA 1Z32X 5T9CE 3L4TA 2OYMA 1NOUA 4L6HA 3RGTA 1WPCA 1K70A 4OU1A 3S9ZA 1OC5A 4HKPA 4I3GA 4QSFA 1UQZA 1HKIA 4O53A 4JS3A 4JZ5A 4K8GA 3PBMA 2V8ZA 4QP0A 4NYYA 4AYSA 3COTA 4HOWA 1KXQA 1UWQA 4QEHA 3RXZA 4US5A 3O15A 3WJZA 4GC4A 1AW1A 4B90A 4CNTA 1DJGA 2FHFA 3RUBL 1CZ1A 2CZ5A 2R1NA 3W6LA 4DUXA 5M2FX 5JBDA 2B7OA 3NDYA 1WXYA 3FYYA 1QW7A 5HULA 3DGRA 1XJBA 4O1EA 4E2VA 3ZFHA 5LIKX 1SR0A 2PWDA 5AOUA 3DCPA 3RCMA 2EJAA 1L6WA 2QVHA 1EO7A 1LL7A 3TCSA 3B9AA 1VR6A 4D8AA 5CC7A 3DFSA 2GJLA 4PRRA 1LWJA 4HMCA 4KIRA 5A6AA 3ZS4A 5A95A 3KLLA 2WW5A 4DY1A 1XLCA 4CNPA 2OR2A 4RR4A 4S3GA 3IUDA 3EKGA 2D23A 4ZXOA 4MB4A 1FQ0A 3RCYA 1I8JA 4D9PA 2WMKA 5CAKA 4ZCWA 4Q8MA 1QDSA 1S5WA 3BICA 4FS9A 2AMGA 5AHIA 3UPWA 1W3LA 1OIFA 1VLWA 2H8XA 3KX6A 2PDGA 5DCDA 3N2MA 2L5HA 2RJGA 4KQNA 1EJTC 4AZ5A 3KOYA 3TWAA 3N12A 3B05A 3H8AA 1A53A 3CPUA 4L9YA 3GZ3A 4QG8A 4RE0A 4YVPA 2ASHA 4MZ8A 3H6OA 4CU8A 3S2MA 1F6PA 2R1PA 2Y24A 4WX2A 1HO4A 4UOJA 3UWUA 3M0ZA 1A3HA 4GJ1A 2EPOA 1KO0A 3GLCA 3AIQA 3QYQA 1CWYA 2BY0A 4AFYA 3M6YA 3ZJ7A 3ANYA 3DBPA 3SN1A 3SDOA 4MHBA 1LDCA 4GYFA 2QUMA 3HQPA 3QM3A 1LRQA 1DJIA 3KBVA 3ZIZA 2OPJA 4XBJA 2PRLA 1GOWA 4D6CA 2PGEA 1CENA 5I06A 4RDYA 3ZLFA 4J40A 4DO4A 1I2NA 1JZ7A 2FZMA 2LLEA 1PHQA 3HURA 1HT6A 5AB3A 3E2SA 2BODX 1KTNA 4QITA 1ZU8A 2ZZ2A 5D4YA 4FA3A 4X61A 3NZGA 3SY8A 4R9XA 2FJKA 3IGXA 4PB4A 1TWWA 2VZTA 3E96A 3CAKA 3NAVA 4DWSC 3N11A 3VDGA 2Y2WA 3V1PA 2VEGA 2ATSA 4LUIA 2Z0IA 4FX6M 3U2OA 2OEJA 4QISA 4FNUA 4LUYA 4JY9A 2VC7A 1TJPA 4GUIA 1EX5A 4WGXA 3BCDA 3W7OA 3TQVA 3CUGA 2VHLA 3DAQA 1VCFA 3BGAA 1PYFA 4FR6A 3TN4A 3VDAA 1VFFA 1LYXA 2FKPA 3EPMA 2XIJA 2O9TA 2P10A 4N0RA 3ZMRA 2GUYA 4W86A 4PZVA 4TTUA 3U7BA 3N9RA 5KZEA 3HQOA 5D30A 2WMFA 3KHDA 1KCXA 1WYIA 2J79A 1SMDA 2G3IA 1RALA 1S5VA 4IIHA 2CYGA 5B7ZA 1I6NA 5IHRA 4MKNA 3M5VA 4JFVA 1A5OC 3DKJA 1OGGA 2DPEA 1L6GA 5I23A 1M7OA 4L61A 3IV3A 4YL2A 1FH8A 1SJBA 2YW3A 2NLYA 4H6KA 5C2GA 2P50A 4PEKA 4XAZA 4OECA 3VD3A 1WAUA 4FNRA 4GG9A 3OHIA 1US0A 1ICQA 3UPMA 3ARRA 4NT0A 1UR3M 2D24A 2C14A 3PUOA 4KERA 4B2DD 5BW6A 1DVJA 4PCTA 1Q7ZA 4RDVA 4V1YA 1JPHA 4UFIA 2QDDA 5FIPA 4L1WA 3SCQA 3D3FA 4FIQA 3PZUA 1VPQA 4MUZA 2MANA 1QAPA 1L6FA 2C0AA 1B3WA 4NY2A 3UCDA 5AYBA 2XZ9A 4F2TA 1JGMA 3GXMA 4XIMA 4JTIA 1G6CA 3NPWA 1UW9A 2POTA 2GGHA 3LV6A 1ADOA 4WJXA 1BWVA 2ZA1A 1K3UA 3LPGA 2O4MA 3CUFA 3FDGA 4KW2A 1FX6A 3UNDA 4IXXA 1SZGA 2TYSA 3PJTA 3MUIA 3LK6A 4BHYA 4FNPA 2W9MA 3POCA 1TELA 4JTQA 2VRKA 5AHLA 1AQ0A 1DHKA 3LQGA 1R5YA 3M5XA 1C3FA 4AVFA 4YYCA 3SN4A 1MXSA 1B30A 1EBHA 4HOZA 3RRAA 4DAFA 3WF4A 2VR5A 2DUZA 1VS1A 1RPKA 3ZO9A 2ZXBA 4XG1A 4ORIA 2V67A 4WOQA 1S39A 3WY1A 1DWAM 3TEVA 3W02A 1Q2SA 1JPDX 1CDGA 1GHRA 4C60A 4F79A 4UQBA 3WCZA 3GX9A 2W67A 1Q8AA 3VIFA 4M80A 1VJSA 3LOTA 2VM8A 3IANA 2RJHA 4XKMA 2QS8A 5E9AA 3SCUA 1LOLA 1QK0A 4RV3A 1E43A 3A4XA 2Z2AA 4A3HA 2XGBA 3JW7A 4GYPA 1OABA 1VYPX 4GBDA 4JN6A 5F2LA 3MSYA 1HJSA 3WD0A 1MQPA 4E5TA 2NWSA 1EXPA 3W1TA 5D2YA 4C6OA 4U3AA 2ONEA 3CZEA 1PKLA 2CLHA 2PDNA 3UXLA 2X7VA 1QRQA 4H7CA 2BVDA 2QCLA 4HK7A 1MMFA 2XINA 4A8LA 4GO9A 5KZMA 2GOKA 4LT9A 4FLSA 5D9MA 3C3NA 2VUNA 4DLFA 4N02A 1XYMA 4X60A 4DAIA 1Q6LA 2AMXA 3O6CA 5D03A 3L67A 2DV0A 3WQCA 1LORA 3GC5A 3W7KA 3N2OA 3M0IA 1JVNA 2BHYA 3NIYA 2EPLX 4S3BA 4LYKA 3SZ8A 2OZ0A 5BOOA 2VC6A 5AFDA 4PCSA 5ABTA 1U30A 3TROA 3T2QA 3AXKA 2P8BA 1VFLA 3PP7A 2H6RA 2I16A 1DJYA 4RUBA 1VC4A 1HL9A 1KC7A 4E2OA 1K4GA 1QFEA 2NQHA 5IHSA 3BO9A 1EC7A 4DZHA 2WPBA 2PD9A 4POCA 1XISA 4ZMGA 1XLDA 1FWWA 3WJXA 1I1XA 3KRZA 4DXKA 3GXNA 5FJUA 3M7WA 3HA1A 3R13A 3U2EA 4HPGA 3C4UA 4QTGA 4HK5A 4C6PA 4IPNB 1K7FA 1ITCA 1CXLA 2RUSA 3IJ9A 3TTYA 4O11A 1FWTA 4EWND 3CQ0A 5AKQA 2PDMA 2WCGA 3CLMA 2CFFA 3L68A 5CZTA 3GG1A 4NNAA 4ZQOA 1VAHA 1XLFA 3S1GA 4GPNA 3BAYA 3CZLA 1TQXA 2GK1A 2DUAA 3EOOA 5BU6A 3RLVA 4J3TA 4HHMA 3UJSA 1E0XA 3SADA 2J9YA 3WLLA 2YL6A 3ITYA 4I6VA 1CGXA 3W7QA 4S38A 5FA5A 1B54A 4S2CA 4B16A 3NZQA 3HU7A 4UUIA 3GVRA 3VC6A 1PIIA 3EOLA 2GGJA 4NJIA 4HSHA 4LNCA 1T41A 1Z41A 3J7HA 2B7QA 4HPJA 3VX