1TA3A

Crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
b'AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase inhibitor protein I
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Hydrolase inhibitor/hydrolase
total genus 99
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ta3A00
1UR8A 2VURA 2XSAA 3WIJA 1LL4A 2D0HA 1CGYA 5D9OA 3AS1A 4NF7A 4M81A 3WY1A 1EOMA 1J0JA 2C7FA 3OB8A 3SCRA 3W82A 2PWFA 3VIPA 4TTGA 4PCTA 5JBEA 3G6LA 1UWIA 3AICA 1JDDA 4CKQA 1CNVA 5AC5A 1UA3A 5EBAA 2JIWA 4AISA 3ECQA 3AYRA 3AISA 1CLVA 2E8YA 5LA2A 3GNOA 4PTVA 4HOZA 2WSKA 4UFHA 4HMCA 3WQ5A 1KQYA 2E9MA 3D3AA 2PWDA 4DUVA 3RILA 1NOWA 5FIPA 1GOIA 2YL6A 4BQ2A 3ZT6A 4Q7NA 4AZCB 4BQ4A 2JFEX 2A3AA 1PEZA 1ECEA 1XH1A 4GI8A 4Z2LA 2PWEA 2WBKA 2XPKA 1BVNP 3ZJ7A 3WD3A 1E70M 4XZWA 1VB9A 1VENA 1QNPA 1D7FA 2BY0A 3TTYA 4JHZA 3NYDA 3VIIA 5JIWA 2J74A 3VO0A 4B9ZA 5I23A 4JCMA 3FN9A 1R85A 3QHOA 1QNRA 2WB5A 2WC7A 3IJ9A 4HOXA 1XHGA 3GM8A 1ZBVA 1CDGA 3L4VA 4C7DA 4CN1A 2V5DA 3CHEA 1ZJAA 2TAAA 2FDMA 1JZ2A 3CPUA 2VT0A 1UA7A 1BAGA 1H1NA 5FOOA 1XV8A 4NZCA 3FY1A 3KL5A 3LMYA 5E70A 4GI9A 4J7RA 1DWAM 1VEMA 4E8CA 4MAVA 4MJ4A 4ACZA 2OYMA 2G3MA 1C7SA 2G41A 3T08A 3VD4A 3EMZA 1MQQA 4JL2A 1W9PA 3AYSA 2PI6A 4JIEA 1G9HA 1GQIA 5AYIA 3WDQA 1YHTA 2BY1A 2CCRA 3OLIA 1JIBA 2WCSA 3K4DA 1OGSA 5A6LA 2QLYA 1QW9A 4MPKA 5C8BB 1C8QA 4A3HA 1IV8A 4R5EA 1HP4A 2W61A 5GNYA 1AQHA 2DSUA 3ZO9A 2J79A 1M01A 4JFWA 2ZXAA 2XWDA 3LPFA 4OBSA 1H3GA 3FAWA 3EDKA 4IPNB 4V27A 5IXEA 2J7GA 4UQAA 4P7RA 1UQYA 2IUZA 3SUVA 4TVUA 4H8HA 3WDIA 4AD1A 3AIQA 1GOKA 2EJ1A 5I79A 3U7BA 5A2BA 1U33A 1F4HA 2XFYA 5D4YA 1ISWA 1K9TA 1UKOA 1LQ0A 4J28A 1MVYA 1GJUA 3VDHA 3VM5A 4AD3A 3MMDA 4P7NA 4KGLA 3EDDA 2PWGA 2GVYA 2XFRA 2GK1A 3VGDA 3M6DA 1SMDA 2YLAA 2O9TA 1JZ5A 1GOQA 3NSMA 2YIHA 1JAKA 1MW3A 2XJ7A 2WW5A 3BGAA 1JYWA 2VR5A 1XSJA 2YDRA 4CCCA 1VAHA 3AIWA 4M8UA 2BVYA 2NT0A 2YDQA 2OSWA 3W81A 3BMVA 1UH4A 5HNNA 5A6JA 1B0IA 3CGTA 1KXHA 5E0CA 3VDAA 3AJ7A 5BXRA 4AD5A 2DH2A 4JAWA 3O2LA 2ZE0A 1EA9C 1BG4A 1CTNA 3EDFA 3SCSA 2EPOA 3WF3A 1BF2A 2WVTA 3L4WA 2O9PA 3VVGA 2UWFA 1E1EA 3OBAA 1C90A 2X8RA 3CZ8A 3L2MA 2Y4SA 1QHZA 4J3TA 1AMYA 2ZUMA 1V3JA 1OSEA 3SUTA 4EK7A 2NT1A 3PZGA 1LLOA 1R7OA 1UWRA 3RM8A 4IISA 3WEZA 3VILA 5BXPA 1ZB5A 1PIGA 4Z2IA 4CD7A 2X1IA 3EMCA 1JNDA 2WVVB 7CGTA 2VJXA 1QNOA 3KWXA 1E43A 3WNKA 3K4AA 2VRQA 3G6MA 4UOZA 1JZ8A 1WPCA 1IZKA 1C92A 4FK9A 1JXKA 3B8SA 1J0YA 1PX8A 3GXMA 4EANA 3PTQA 1BPLB 2YL9A 4C7FA 1E3XA 4CD4A 3BCDA 2VX6A 1NOUA 2QF8A 3CZEA 3F5KA 3F5JA 3W6LA 4QDMA 2YBUA 1OT1A 4MNMA 1FFRA 2V5CA 1E71M 4UFLA 4QLKA 4CD6A 5CGTA 4DWSD 5LA0A 1CXFA 4V2XA 1GVIA 3AIEA 5E9AA 3N11A 4YHGA 3EDEA 4FF5A 1CXEA 4GINA 4H7VA 3PTKA 3VTRA 3MUY1 4S3KA 1OGGA 4TX6A 1V3HA 1L8NA 1OD0A 4BS0A 3HN3A 3ZMRA 1DTUA 3BH4A 4Y7EA 1UR9A 2QPSA 5FD0A 4ZE5A 4ATDA 4PYSA 5ABHA 3TONA 2F61A 3AS0A 1C93A 2VX5A 1V3MA 2Y8VA 1W9UA 3ZJ6A 4AZCA 4H41A 4BQ5A 1E0WA 2BHZA 4W89A 3CUIA 1CPUA 5I77A 3IJ7A 5JIPA 1B3ZA 2WCGA 4AWEA 5BXSA 1ISVA 4NRRA 4CU7A 2GDUA 4ACZB 2XWEA 4RE4A 1RH9A 3RCNA 2V3GA 3FHQA 4JL1A 2DSWA 2FH8A 2JALA 2YOCA 4M80A 1PZ2A 4NSBA 4QLJA 1KQZA 2B31A 4CD5A 4HMDA 1VFFA 2PBOA 1G5AA 3RM9A 4DWSB 3ZT5A 4OUEA 2FHBA 2WSPA 3K8KA 3CTTA 1KCKA 4J27A 2WANA 1W9DM 4WKHA 4AEEA 1E4MM 4Q22A 4CCDA 2WPGA 2WHJA 2XVLA 1GHRA 3CMJA 3W6MA 1DWHM 7A3HA 1BYDA 1UQZA 5HBFA 1XH0A 3KL0A 2CKRA 1TCMA 5AYBA 2VX4A 2A3EA 2VUYA 5HXMA 4GZIA 3WD0A 3E1F1 1BYCA 4U3CA 4J3WA 5M17A 3M07A 1QNSA 3EMQA 3MMUA 2ZUVA 3VGGA 3VMNA 4CU6A 1YQ2A 3BAJA 2ZX8A 2EBNA 3GH5A 5BRQA 3SCWA 2C8NA 3RPMA 3QGVA 1CGTA 1TZ7A 3WENA 2ZX9A 2FHCA 4CGTA 1B90A 3PBGA 1OGBA 4OBRA 3AMGA 4PMRA 3BAWA 3N17A 3EBVA 3WD4A 4MNKA 2G8ZA 1HJUA 1ITXA 3THCA 1TMQA 4HZ8A 1KB3A 2QPUA 1DWIM 3T2OA 3WDPP 2OSYA 1HJQA 1Q4NX 3VIMA 2XM1A 2ZXQA 1QI2A 3AMKA 1NOFA 1KR0A 1G01A 4LPCA 4P7QA 2ZUWA 1CGWA 4ZEPA 3QOKA 4UZSA 4TVCA 1QVBA 2E40A 5C71A 3WUFA 2D1ZA 5M3WA 2WK2A 2WZEA 4PMZA 4FLSA 3ARZA 3GYCA 2X2YA 4IUGA 2GJXA 2VQTA 2J7CA 1E6NA 3WQ6A 4CU8A 4M29A 1CWYA 1UD8A 2J75A 1ZL1A 3NUKA 3OZOA 3VIJA 1EDGA 1ODUA 3NJ3A 1JZ7A 4B9YA 4M56A 3W29A 1QOXA 5CSYA 2F8QA 2CETA 4PTXA 1LJYA 4MNLA 1KXQA 4LGXA 4J3UA 2W66A 3WFZA 3PZQA 3U7VA 1U30A 4H8VA 5GPRA 4XX6A 3FAXA 4OOUA 1FOBA 1OT2A 1QI0A 3WF0A 5A6AA 3APGA 1TG7A 1EQPA 1E6RA 2VOTA 3AHTA 3WSUA 4A3YA 5A6MA 3NIYA 3WMBA 2J4GA 4ZENA 5I24A 2WVVA 4MNJA 1H11A 2J7DA 3VD3A 2UY5A 3VIHA 3CZJA 4AIEA 3AMCA 2QHAA 4N42A 3AIUA 1Q6CA 3ZOAA 3WH9A 1CECA 1WZLA 3N13A 2J7BA 5AY7A 4UFIA 3I3DA 1J01A 1KWKA 5EMYA 1MQRA 2CESA 2DIJA 4GQRA 1UR4A 4W88A 3WQWA 2VZVA 5DFAA 2VR4A 3GH7A 2W67A 4PEEA 4U5IA 1BHGA 5CXPA 3WQ8A 5LYRA 1M04A 1TR1A 4PUDA 1MW2A 3VD5A 2OWCA 3PZ9A 1UR0A 3CBWA 1H0IA 4JZ5A 5A6SA 2ZWYA 4UOJA 4LXFA 5I3DA 4Z2GA 4YN5A 4TOQA 5AC4A 2DDXA 4AMCA 3A3HA 2GFTA 1WDRA 3AHYA 1E56A 3AFBA 1ZJBA 5BROA 4WKFA 2A3CA 4TXEA 1HL9A 4RE3A 4IM4A 3ZIZA 2VTFA 2DSVA 3AXXA 2CHOA 3EYPA 4LYRA 3W27A 3VM7A 1W1VA 4Z2KA 1OD8A 2GDVA 1E6ZA 1JZ3A 3PZUA 3A47A 3VX1A 1IZJA 1E73M 2VX7A 1EQCA 1CGXA 3UCQA 1V03A 2DT1A 3NCOA 3DC0A 2VO5A 4J3VA 4D6JA 1K9FA 3FXYA 1E0VA 1WNOA 3LPPA 5IHSA 1ISZA 3MMWA 1US2A 1XYZA 4F9DA 4GPNA 1HJVA 1NM9A 4UQBA 3TTSA 2DEPA 2CIPA 1C91A 1CLXA 1JF6A 4R27A 3MV01 5JUVA 4D6FA 3AHVA 2CYGA 1KGWA 1LWJA 3CUFA 4DWSA 3CZGA 3IAPA 3THDA 3HJEA 1JDCA 3WF4A 1V6YA 3OZPA 4D6DA 1W1PA 3SUWA 3BSGA 4D1IA 3OLGA 1XCWA 2WC4A 1HKJA 4D6CA 1B9ZA 3VIGA 1UKQA 2OSXA 5GNZA 1LWHA 3VMOA 4FLRA 2VC9A 3SIMA 1JZ6A 1XD0A 3GNRA 2W5FA 1V02E 4AYSA 3B9DA 5CLTA 1GONA 4AD0A 4LX4A 2BXZA 2XYLA 1KXTA 1J11A 2GJRA 2VZTA 1XGZA 3DYPA 2OYKA 2E4TA 2E9BA 5E6ZA 3CMGA 5A3HA 2YDSA 3T0DA 2JE8A 5DO8A 5DF0A 3WMCA 3PZTA 1PX3A 1CENA 3VGBA 8A3HA 4F66A 4HU0A 2WZIA 3QR3A 2CBVA 1ITCA 1UKTA 1GW1A 4UQCA 4UQDA 2EPMX 2ZX7A 4EE9A 1KFWA 2CEQA 5A2AA 4AIUA 1W9VA 3KL3A 1FA2A 3N04A 3AOFA 4DUWA 2NW0A 3VNYA 1QI3A 3K46A 3AS3A 2WVSA 4M82A 4HA4A 2PBGA 4AZ5A 2GJXB 1UWQA 2DQXA 4DM2A 2J7FA 3WH5A 1TUXA 2EEXA 2WHMA 4MTVA 3WEMA 3W53A 3VIFA 3WNNA 2MANA 3AS2A 3GBEA 1XSIA 5CLWA 1TFVA 5D9NA 3WUGA 3UG5A 5D9PA 4X0NA 1E6XM 2BY3A 2J47A 5EB8A 2WLZA 1HKKA 3SCUA 4LYQA 2WNWA 3CUJA 3ARTA 1X6LA 3T2PA 3PZIA 1W3KA 1M7XA 3O6AA 4MB5A 5E09A 1SFSA 3VIOA 1JF5A 3WN6A 3GZAA 4F79A 2QMJA 3RO8A 2D20A 1OIMA 1QBAA 1W32A 5EFFA 2ZUTA 3RJYA 1FH9A 3II1A 4JFTA 2WC3A 2D0FA 1VBUA 1VJSA 5BWFA 1KGUA 2WMJA 1WO2A 2EPNA 2BHUA 4P8XA 3BSHA 3WD2A 1WAWA 3PHAA 1DWGM 5FL0A 1Q6FA 1EIBA 1UWUA 2DH3A 2WMIA 1KBKA 4U33A 1WZKA 4PMUA 2W63A 3IAQA 1HL8A 1B2YA 4KGJA 1H4PA 4JKKA 1F4AA 1MFVA 4CUCA 1UD3A 2XUCA 4GZJA 4WIWA 2E3ZA 2WHLA 2G4FA 4HA1A 1P6WA 3IJ8A 1R7AA 1GQJA 3NDZA 1XRVA 3TTQA 1E3ZA 4WLCA 1DP0A 4W8BA 2CBJA 1UH2A 3QHNA 3K8LA 5IDIA 1NP2A 2PC8A 2WMFA 3N15A 1DWFM 3NSXA 1G1YA 2WMKA 2BVTA 2ZXDA 5CPQA 1VBRA 2J25A 1JI2A 4WF7A 3FNDA 3OLDA 2YA2A 4PRWA 1OM0A 1E4LA 1GUVA 2J78A 3ZR5A 2J8FA 2JEQA 3WUBA 2W91A 1AQMA 4YHEA 4URIA 2WZHA 4GIAA 3WNPA 4OOZA 1MW1A 2O92A 3ARQA 3AZSA 2DPEA 2XVPA 3CIVA 5E6YA 1E5NA 1J0ZA 1HKMA 5E0FA 5A8QA 4W87A 2JF6A 1B3YA 2CNCA 5A1AA 5A94A 4MADA 4JFUA 2F2HA 3UERA 4UFKA 4BZYA 4U5KA 2WAGA 1S46A 4AZ6A 1E5JA 2GSJA 1Z32X 3AHZA 3L4XA 4B15A 2WM0A 1CEOA 1HJWA 4PMVA 1UH3A 1LL7A 1EHAA 4FLOA 2J8GA 4P8UA 4FLQA 2BNJA 4U3AA 1ISYA 2O9RA 1QBBA 3VMPA 2V3FA 4N0RA 2CBUA 4KRTA 3CO4A 1FHLA 3VINA 5M03A 3ARPA 1JG9A 2D23A 1J0HA 2X0YA 3ALFA 4S3JA 3KEHA 3SCQA 2D22A 3L4YA 4D6GA 1W3HA 3CLWA 4PUEA 1QNQA 2JEPA 3WH8A 4UCFA 2XVGA 3VGHA 1V3KA 2Y24A 2J62A 1CBGA 2VNCA 3AXHA 1G94A 3DECA 3KZSA 4AZGA 2VQUA 1JD9A 4ZE4A 5JBFA 4PSRA 3O9NA 5A8NA 1KXVA 1CZ1A 4D6EA 3RIKA 3ARUA 3WL1A 2VZUA 5DT7A 4GO8A 4UR9A 2ZX5A 2XTKA 4PMXA 1BFNA 1SYTA 3AIBA 1JXJA 1QHPA 1KBBA 3VGFA 4MB1A 3D5HA 5A8MA 4H2CA 3LPGA 2DT3A 2OYLA 3N1AA 1W9BM 1CYGA 1FP9A 4AXNA 3MSGA 3VD9A 1C8YA 3MO4A 1J18A 1QPKA 1WP6A 3ARRA 4W85A 3S6TA 5A95A 2UY3A 3WF1A 1CGVA 4CN4A 2XIBA 1Q6GA 2PF0A 3VGEA 1A47A 3WBEA 3W4RA 3BXWA 2J77A 1GORA 1W3JA 2FHFA 3OIHA 1UHVA 3EDJA 3ZSSA 4U2ZA 3QHMA 3WL0A 2EPLX 5I2UA 1MYRA 4D72A 1Y7VA 1ZBWA 4AZHA 2V3DA 1X1NA 3GXDA 3UG4A 5I0DA 1XD1A 1J12A 3RMEA 3WNLA 1BYAA 2XGIA 1RP9A 5CJ5A 3DHUA 5A8PA 3BAIA 1GCYA 2ZUNA 1OB0A 2XM2A 1DEDA 4ZXLA 1AQ0A 1E55A 1VFOA 4QFUA 1EH9A 3UR8A 1C8XA 2WCAA 3UETA 4MDOA 3B9AA 4W5UA 3TA9A 2E9LA 3NDYA 4XZBA 4AZ7A 4IPLA 2YL8A 3W28A 1EHNA 1B1YA 4MJ2A 1XYFA 3W24A 5EFDA 5IHRA 3MANA 3VDCA 2WBGA 3ARVA 4BCEA 2A3HA 2WMIB 3MUIA 2UY2A 2HISA 5F7UA 1EDQA 3W26A 3BLKA 2OWXA 1E4IA 4MB3A 2XSBA 1XCXA 3B9EA 1SR0A 3WDHA 1GNXA 3M46A 3ZT7A 1GZJA 1E0XA 3ARYA 2EO7A 3VKKA 2WVUA 3ARSA 2CXGA 3SCOA 1BQCA 4GO9A 1HKIA 3SEPA 1E4NA 3AZRA 3ARWA 1PIFA 4PMNA 3AXIA 4F8XA 1NP0A 4Z2HA 2O9OA 2ZOXA 4AD2A 1TVNA 3AI0A 5A2CA 4V28A 1A3HA 4D1JA 3A6OA 1HT6A 4KWUA 2W92A 3CUGA 4AZBA 4B3KA 1B31A 1BG9A 3WH6A 4CCEA 3SCPA 1EO7A 1TA3B 1W3LA 1CGUA 1W1TA 4E8DA 2D3LA 1BGGA 4B16A 1H2JA 4HZ6A 1UUQA 1RPKA 1D3CA 1LF1A 2W62A 1V02A 1HX0A 1JFXA 1V6UA 2J7HA 1H0GA 3A4WA 2D3NA 5C70A 3UR7A 4K68A 1WZMA 2V3EA 1GVYA 4QAWA 1K9EA 3T0BA 6A3HA 2XVKA 3HMCA 4W8LA 4CVUA 1VEPA 6TAAA 1CXIA 2BVDA 2BXYA 3RM4A 1E15A 4KH2A 2YKKA 1GJWA 1EO5A 4HPGA 5D8WA 4OKDA 2VZOA 1H09A 3JUGA 4UFMA 5BXTA 1WCGA 4AZIA 2J7EA 4JFVA 1KR1A 2D0GA 3BAXA 1JYVA 1LG1A 1UKSA 5HDRA 2YA0A 1PBGA 1WDSA 5ABFB 1UG6A 1EGZA 1UYQA 3ALGA 3VOCA 2ZXBA 5A8OA 1W91A 3ZQ9A 4DWSC 2CERA 4MDPA 1E6SM 2FGZA 2W4XA 4AC1X 1TE1A 3GXFA 1VFUA 1MXDA 4UOQA 1M53A 4LYPA 2VVSA 2XG9A 5BYWA 3AROA 2YL5A 4YPJA 4DUXA 3UEQA 3I3EA 3MKKA 1JGIA 4QP0A 1NWSA 2DIEA 1JYNA 4EAMA 1O7AA 2A3BA 1BGAA 1E9LA 1I75A 3RDKA 4HU8A 4AD4A 4QCFA 3L4UA 1UZ1A 1ZBCA 1ZU8A 3POCA 3UG3A 5I78A 2AMGA 1O6IA 3OGRA 1EDTA 4X0VA 1HIZA 3AHXA 3MUZ1 1WZAA 4OJYA 3FHAA 4CVWA 5A69A 1XSKA 4GXPA 2Q8XA 3W0KA 4UNIA 4BF7A 1BLIA 1NWUA 1AVAA 1V3IA 2C0HA 1HXJA 3WH7A 1I1XA 6CGTA 1QHOA 1VFMA 2HVMA 3TTOA 2E0PA 1W2PA 4TVDA 4AEFA 1HVQA 3BMWA 1CXKA 4OIFA 3VIKA 2WHKA 3IANA 4M24A 2DGAA 1QW8A 1BSIA 2WKGA 1KCLA 1OBAA 4P8WA 1V0LA 3T09A 3WDRA 4J3SA 2RGLA 1GOMA 1NARA 2AOSA 1H5VA 1ZBKA 2PWHA 4UQ9A 2VRKA 3LPOA 3RJXA 1ODZA 4CD8A 4GKLA 1FH8A 5KZ6A 1JYXA 4NRSA 2UY4A 1GHSA 1UD2A 2X0HA 4HTYA 3WD1A 3IK2A 3MS8A 2JIEA 1V6WA 3MSDA 4H8UA 3L2LA 2DSKA 3CHFA 2GUYA 1CXLA 3ARXA 1W2VA 3ZJKA 4PTWA 2XHYA 4U31A 1JDAA 3FW6A 1IT0A 1J10A 5A6BA 4L4OA 3VUPA 2CKSA 2BS9A 2YBTA 1B3VA 1V6XA 4UQEA 5CPSA 4MAZA 3SUSA 1HVXA 2PB1A 3T0AA 3KE0A 3CHCA 1UWSA 2V38A 1ZS2A 3S2CA 1LG2A 3VD7A 1HN1A 3CHDA 1ESWA 2GJPA 2CITA 5FKYA 4PMOA 5IFTA 5CG0A 4PCSA 1XC6A 3OGVA 2WMGA 2Y5EA 3ZR6A 4WSJA 3AQUA 1JAEA 4P8VA 3W37A 2XIIA 3F4VA 4WK9A 8CGTA 4JKMA 3AIRA 3CZLA 1MFUA 1WDQA 2E8ZA 3SCTA 4D6HA 5CGMA 3W38A 1UD4A 3VPLA 3WNMA 4ATLA 2Z1KA 3GTNA 1J9YA 3OGSA 4XV0A 2AAAA 2ESCA 1LL6A 1WKYA 3VU2A 4C7GA 3QOMA 2IXUA 3BAYA 1W9XA 3A4AA 3I3BA 3ZM8A 1CXHA 4M1RA 4TTUA 2XFFA 4JHOA 5GQBA 3HU7A 4GQQA 4Z2JA 1UOKA 2Z1SA 4D71A 2FGLA 4GI6A 4GZEA 2WXDM 4ACYA 2VRJA 4PMQA 4TUFA 4ZXOA 5TD4A 4HOWA 3GDBA 3MUAA 4A4AA 1E72M 1U2YA 2WLYA 1JI1A 1FP8A 1WE5A 5D9MA 1MWOA 5HPOA 1KWGA 1FH7A 5CQ1A 4ML4A 2VI0A 1XH2A 3DYMA 1BVZA 3GBDA 5KEZA 1TA3A 3TP4A 4UZUA 5JBDA 2VCCA 4J3XA 1E40A 3WMSA 1CIUA 1TVPA 4ATWA 2RGMA 2YA1A 4W93A 1C3FA 5D8ZA 3OA5A 4X9YA 1WDPA 1JZ4A 3BCFA 2G3JA 1M03A 2VVNA 3UESA 3WKZA 4RL3A 2OLHA 5I6SA 5DEZA 2BV9A 4QLLA 3K8MA 3WFLA 1V0NA 1QI5A 2NSXA 1HNYA 2QMKA 2WMHA 2DSZA 1JNEA 2G3NA 2DT0A 3BLPX 3GH4A 3W25A 5GNXA 5HOSA 4PMDA 1KGXA 2YLLA 1MXGA 2X09A 1RP8A 1PAMA 5BCAA 2BHYA 1DWJM 4F9JA 5LA1A 2Y2WA 3M7SA 1UR2A 2CPUA 1OIFA 1NWRA 4WSKA 4BA0A 4PBGA 3J7HA 5IFPA 3PTMA 4NI3A 1HP5A 1R8LA 4W7VA 1GQKA 5DT5A 1BTCA 5ABFA 4OZOA 2D2OA 9CGTA 4HPHA 2D24A 3N18A 1FFQA 3BAKA 3GXIA 1HJXA 4W7UA 5I5RA 4ZFMA 4HA3A 4P7OA 3SCNA 3WNOA 2EQDA 3SUUA 4H04A 5A6BD 4HP5A 2ZWZA 1D2KA 2WYSA 3CUHA 4DM1A 1NQ6A 2WWCA 2BY2A 4MB4A 1VEOA 3K1DA 4PMYA 1GPFA 3U57A 4UTFA 3MU7A 2G3IA 2ZUSA 1BYBA 1HF6A 1VIWA 1UD5A 3ZSTA 5ECUA 5FL1A 4W8AA 1WB0A 3L4ZA 1V08A 3PN8A 4U2YA 2ZICA 1E6QM 1R87A 1V6VA 7TAAA 5ABEA 4BQ3A 2EXOA 3WQ4A 2OWWA 2ZX6A 4W7WA 4B3LA 5M5DA 4D6IA 4FMVA 4CN6A 3PZVA 1NH6A 4JFSA 1V0KA 1MQPA 4QCEA 1G0CA 4P7LA 1JD7A 5BRPA 1J0KA 2XVNA 1E1FA 2WKLA 4TX8A 1MW0A 1UZ4A 2ZUUA 1I1WA 3AMDA 1V0MA 1J0IA 2WWDA 3VX0A 5FCZA 3VDBA 2GK1B 1PZ3A 1US3A 3L4TA 2VMFA 2XGBA 1VRXA 1GQLA 5CPTA 1E6PA 3U5YA 2VZSA 5DMYA 2EPKX 4HMEA 2VL4A 2Y8KA 3TOPA 1UR1A 3WUEA 1ISXA 3WQVA 5HPCA 1OWQA 3SCVA 5CSUA 4RE2A 1B30A 3WELA 3NSNA 1B3XA 1N82A 3CZKA 3WEOA 4EKJA 1EXPA 4W5ZA 4WJXA 3PZOA 2JF7A 1JFHA 3DHPA 1H49A 3OLEA 1K6AA 2BFGA 3WDJA 4W86A 1SMAA 3AZTA 2FH6A 3F5LA 1UD6A 3WF2A 2ZIDA 5CZKA 1R86A 1PJ9A 3PZNA 1B3WA 4XUYA 3ZJ8A 3MV11 1UKPA 2YJQA 2VCAA 1PX4A 1RD6A 5ABGA 2CHNA 1FHDA 3WBAA 4KMQA 2X05A 1VF8A 2CBIA 3AMLA 1HJSA 2VCBA 4WKAA 3CH9A 1GOOA 1VJZA 3VNZA 4LQ1A 4W84A 3PZMA 3U5UA 3OG2A 1EOKA 1H41A 4UFJA 3DYOA 1X6NA 4PSPA 3N12A 4E2OA 4AW7A 1V3LA 5A6KA 1PPIA 2QV4A 3POHA 3T2QA 4E4PA 4KRUA 1DHKA 1K9DA 1NWTA 2DT2A 1L0PA 4PN2A 1QI4A 4L4PA 3A4XA 4JKLA 3GNPA 3AIVA 3BC9A 3N9KA 1Q6DA 1W1YA 4JCLA 4HZ7A 4PTMA 1JL8A 1OINA 1UWTA 1Q6EA 1C7TA 1GOWA 2IXVA 4AIOA 4XB3A 4AY1A 3SURA 1OCQA
chains in the Genus database with same CATH superfamily
1A5MC 1TV5A 1LL4A 2GOKA 1XCFA 1TPB1 3AS1A 1RBAA 4M81A 3KBMA 4Q4SA 2NLIA 1EOMA 4ZODA 1MUWA 3Q65A 3NEVA 4IOTA 2F6KA 4IG2B 1UZHA 4TTGA 4PCTA 1K02A 4J4KA 3G6LA 3Q37A 1B57A 2EAWA 3G1VA 4ZA0A 1IE7C 2NX9A 1JDDA 1F73A 2OCZA 2YCJA 1CNVA 3QFEA 3INPA 3WK1A 4LCSA 1O5KA 3TDFA 3AISA 1CLVA 1LOSA 4HOZA 5DXYA 3MJMA 3WK3A 3DKJA 5BZAA 5HNTA 1KQYA 2DJXA 1XDMA 2FFCA 1NOWA 4XVEA 1BXBA 3MCOA 3N6QA 5FIPA 1JUKA 1VH7A 3ID7A 5AHIA 5C9RA 4HYRA 1ECEA 1XH1A 4GI8A 4Z2LA 4KS0A 1ME8A 4OV4A 1C9WA 3WD3A 5HANA 1VB9A 2VWTA 1DOSA 1JQXA 2WJZA 3BQ6A 4HA0A 3E0WA 1FWEC 3N73A 3VO0A 4B9ZA 3QYQA 4BKNA 2QDHA 1HZYA 3C86A 4ZFCA 3FN9A 1R85A 2NQZA 5DN1A 3NQDA 4N7QA 4B5TA 2KX9A 2AL2B 3GM8A 4C7DA 3L4VA 2V5DA 3CHEA 1NAL1 3N14A 1JZ2A 3LM7A 2VT0A 1TSIA 1BAGA 3M0JA 1XV8A 1OF8A 2PU1A 1RQHA 2WSQA 1DWAM 1VEMA 2CFFA 4MJ4A 5AVHA 3OHMB 2ISDA 1C7SA 2G41A 1ENUA 1P7TB 3LNPA 3T08A 1MQQA 4UMCA 3A5VA 3DFNA 1HL2A 1GVEA 3CASA 3V7PA 1JIBA 2WCSA 2CLOA 3SRDA 2WO5A 1OGSA 6XIMA 5C8BB 4EIVA 4A3HA 1IV8A 2P8CA 5GNYA 1UIPA 1M01A 4JFWA 1H3GA 3F4CA 3RPDA 3FAWA 4H9TA 5IXEA 2IUZA 3HPZA 4JDBA 3CXOA 4AD1A 1U33A 1ISWA 1K9TA 1VP5A 5FEWA 1MVYA 2E77A 3PF3A 5FJTA 3VM5A 4Y9NA 3EDDA 2GVYA 4QDWA 2GK1A 4FPSA 3PBUA 1JZ5A 1GOQA 3VZYA 2JKPA 4H9UA 1HFBA 2VR5A 2W3ZA 2YDRA 4MIMA 4QJ3B 2BVYA 4M51A 1KBLA 1Y5VA 3W2JA 3W81A 3BO9A 3B8WA 3V5CA 4QIUA 4B5WA 5D2XA 3G77A 3CGTA 3VDAA 4XKMA 4HHMA 3QV8A 1PSCA 3S8HA 1JPHA 3PWAA 4NXKA 3B3DA 2WV8A 3WLTA 4FXSA 3JU2A 2PPGA 4AAJA 3BLDA 4FB7A 2O9PA 2PDIA 2EGZA 3LHWA 2H90A 7TIMA 4FIRA 3L2MA 1JDEA 1SGJA 2Y4SA 1QHZA 1EJRC 4V1XA 2GZXA 1V3JA 4EPKA 2DQWA 3NQGA 3URAA 3UZYA 5HR6A 1EWEA 1UWRA 4XZMX 4CNPA 1S2CA 3B0YA 1SO4A 1DQWA 3KDNA 4GH3A 3VILA 3WEZA 4UTTC 5BXPA 2WJFA 1PWMA 3GDLA 3N34A 3NO5A 1PIGA 5CAKA 4QGCA 4Z2IA 4IPIA 4CD7A 2X1IA 4MG4A 4EX4A 1X7FA 3H2MA 1BKSA 1IR2A 4WZHA 1E43A 1SJCA 1X97A 1OFBA 3G18A 2EG6A 1IZKA 1C92A 1J4EA 4FK9A 4J2MA 1XYAA 1XLMA 2PD9A 3B8SA 1XYBA 5C9ZA 3W9ZA 4B4HA 1PX8A 3LSCA 4WJ8A 4GK8A 3BCDA 2VX6A 1NOUA 3UJSA 3MHGA 2QF8A 3EWUA 1W5MA 4IG2A 2NQHA 4QDMA 4GD0A 2FZBA 1K8CA 3W7GA 4MNMA 4UFLA 1EC7A 1W37A 3H2AA 3QQ0A 1W3IA 3EWXA 3IUDA 3MT1A 4YHGA 3EDEA 3G3DA 4HK7A 4LBRA 1CXEA 4GINA 3PTKA 1BSLA 1OGGA 3GSMA 4S1FA 1J5TA 1V93A 5JH1A 3GC2A 1KM5A 1AD4A 1J6PA 3GC4A 3BH4A 3VXGA 4IGHA 3W01A 3GC5A 4WSHA 2F61A 1C93A 2VX5A 3IIXA 3VKCA 3OVRA 7PTDA 1V7YA 4BQ5A 1HO1A 3P5YA 1CPUA 4Z0SA 4JEQA 2Q3RA 1H63A 1XIJA 1B3ZA 4H3DA 5C9WA 2WCGA 5BXSA 3ORWA 3AWOA 4L9YA 4S39A 4WXYA 2ADAA 1RH9A 4UTWC 3RCNA 3RUBL 1PYMA 1IGSA 3W7CA 4ZBCA 5I3FA 2AL2A 4KEZA 4NSBA 4LALA 2P10A 3QZAA 3ZT5A 1DIKA 1QAPA 4OUEA 2WSPA 5K4ZA 1KRBC 4F48A 1KCKA 1TTQA 1W9DM 4IFRA 1E4MM 3APTA 1SR9A 1AMKA 2J8TA 4S2BA 1QJWA 4CCDA 2WHJA 1P7TA 4TX9A 2DZVA 4FR6A 1RJQA 3V5FA 2PEVA 3C0SA 4AFYA 4LB4A 4J9JA 2VUYA 4LFYA 4HNUA 4F0SA 4C6OA 4GZIA 3WD0A 3E1F1 3NL2A 3W83A 5M17A 3CTLA 4R9XA 1QNSA 1EC9A 2ZUVA 4IP4A 4V33A 3VGGA 3EX3A 3VK5A 3BAJA 3GG1A 2ZX8A 1VFSA 3NVDA 5MF5A 1EP3A 2POTA 1LZOA 2FVMA 2W27A 2TRSA 3QGVA 1CGTA 2A1YA 1T41A 3KBWA 5I07A 3PBGA 2MNRA 4ROQA 3AMGA 3ZYZA 4PMRA 3ATZA 2G8ZA 3FYYA 4Y9OA 1FHVA 4R9OA 3KXQA 1E0TA 2QPUA 2QQ6A 1VZWA 3BURA 2OSYA 2Q3OA 3CAKA 4B5SA 4KEMA 4DZHA 1HJQA 2XM1A 2ZXQA 3BJSA 3NFUA 3H7VA 4P7QA 1FWHC 3G1XA 1IXQA 1AW1A 1QVBA 2VD9A 4MWAB 3W7QA 3WUFA 4O14A 5M3WA 5I03A 4FLSA 3W2KA 4IQEA 3EEZA 4O54A 2CHRA 3ITOA 1UASA 1EIXA 1O12A 1ZL1A 1EDGA 3B8VA 1ODUA 3NJ3A 4M56A 4Y8EA 4PTXA 1QPQA 4WY0B 4L6OA 1EZWA 3CS2A 4LGXA 2RKXA 1JJKA 4EPEC 3U7VA 1U30A 4H8VA 4R7OA 1XYLA 3LYEA 4CNOA 2ANUA 3FAXA 4ZGYA 4OOUA 3KHDA 5A6AA 4HPJA 1VQTA 2VOTA 1RVGA 2DZSA 2XDFA 2J4GA 2XIMA 3PUEA 4S3FA 4Q8WA 1H11A 3UR5A 3GU9A 1SW3A 4AIEA 2WM1A 1ZAHA 3S9YA 3TH6A 1ZGDA 4LUIA 3N13A 2J7BA 5AY7A 3BPWA 1J01A 3OYXA 1MQRA 3P3BA 4GQRA 1YNPA 7REQB 5DFAA 1AW5A 3UXDA 1HKVA 1BHGA 1M04A 1F8IA 1M9HA 1EC8A 4PUDA 4C6DA 4B5UA 4LAZA 4AQLA 3CBWA 4JZ5A 3PTDA 4DIAA 2ZWYA 2YFOA 2FTYA 4Z2GA 1WXYA 4DB7A 3EXRA 3WLPA 4DHGA 4PUUA 4YNGA 1YW1A 2GVGA 3STPA 1LBLA 3RLHA 2YB4A 3SQLA 1E56A 1QPOA 4MZ8A 1ZJBA 2POZA 4WKFA 4TXEA 1HL9A 3ZIZA 2VTFA 2I1OA 4ZOEA 4C6IA 2DSVA 4ES4A 1O95A 3MZ2A 2CHOA 1DYSA 5I3JA 4HJFA 3UXIA 3VX1A 4DELA 3Q4DA 3LTPA 1IZJA 4H00A 1EQCA 1TJRA 1V03A 3ICJA 2DT1A 2VO5A 1UC5A 3UQNA 1EXBA 1ISZA 3KTCA 1PTGA 4FXFA 2H8XA 4GPNA 3ABSA 4UQBA 3FA5A 1YXDA 4L4MA 2DEPA 2CIPA 4GYFA 5HQEA 2CYGA 3CO8A 1Q6LA 3CZGA 5C5YA 3THDA 3NQ2A 4LF2A 1F3XA 3WF4A 1XG3A 3C4UA 2OJPA 2J27A 4D1IA 3OLGA 1XCWA 3T6CA 3QV6A 1B9ZA 1UKQA 1BRLB 1VD6A 1Q45A 2VC9A 3QMSA 5CPOA 3P14A 3NQFA 4LAOA 1N8IA 3FJ4A 4CEUC 4IGMA 2E09A 3TN6A 1MEWA 4AYSA 5U7SA 1GONA 1QMLA 1T6MA 2MUCA 3TQVA 4G9PA 3B8DA 1XGZA 3HG5A 3DYPA 2OYKA 1ZUAX 2E4TA 4JTKA 3W1PA 3HBLA 5A3HA 4GYJA 4B5NA 2Z2UA 3TFCA 4DEFA 3PZTA 2E6FA 2R24A 1PX3A 2VWSA 5FJJA 5D2TA 2CBVA 2ZFAA 1ITCA 3WJYA 3G1FA 1UKTA 4RV8A 3LB0A 2EPMX 4PCNA 2E5CA 4MY1A 3KL3A 3ZXWA 3EB2A 3PAOA 2QDGA 3OODA 3UR2A 1YKWA 2J9YA 1PCKA 4XAYA 4NIRA 2WVSA 4ZQPA 3V0UA 3E2QA 3IVSA 1K4GA 2X40A 4MWAC 3L23A 1MUMA 1AH3A 2GJXB 2HDJA 2DQXA 1AG1O 2J7FA 1EKOA 4FO4A 4AWUA 4O4WA 5E5CA 4JQ3A 1C8VA 3BUVA 3PFRA 1XSIA 3QZEA 5D9NA 3TA6A 1BF6A 3S5OA 3MO7A 3TYZA 5LGXA 2QCGA 4J2PA 3WQFA 2PTDA 4QE1A 3VKJA 2YCKX 3QGAC 3WLMA 4LSBA 4DX3A 1HKKA 4LYQA 5RUBA 3M64A 3NQMA 4RUBA 1M7XA 3O6AA 4MB5A 4AVOA 1DXIA 1SFSA 3LSBA 3LZ5A 1IT8A 3RO8A 4NZ3A 1QBAA 5EFFA 2ZUTA 2QCLA 1E1CB 3CAQA 4R88A 5FESA 3WO8A 2EPNA 3BSHA 3WD2A 1NF0A 2ZKMX 3MC5A 3RHGA 3ME3A 2F9RA 2DH3A 5KSWA 4X22A 4ZOCA 3B9OA 2RAGA 1TPH1 2QDEA 4HN4A 4E5TA 3T4WA 5MKGB 4HJWA 1UD3A 3MJYA 2ZRWA 4I5RA 2E3ZA 2GVEA 2B7PA 2G4FA 1J8VA 3W73A 1R7AA 3MI2A 1GQJA 1B54A 2PLJA 4MM1A 1U22A 2Y7GA 4QNEA 4HHLA 1K8YA 2WMFA 3N15A 3P5ZA 4IFKB 2Z1XA 4RJEA 7REQA 5CPQA 1Q13A 1OFOA 4WF7A 5F1UA 3MSRA 3OLDA 2Q8LA 4PRWA 3IGHX 1GUVA 2ZADA 3S1GA 4UTHA 2FDSA 3TJLA 4OOZA 4L7ZA 3SY5A 3NG3A 1VCFA 4AVFA 1E5NA 5E0FA 2OEKA 2CNCA 5A94A 4MADA 3S6OA 1TQXA 2F2HA 1QOPA 4O53A 2TYSA 4FA3A 1KBIA 4R33A 2INEA 1S46A 5H8PA 2WQPA 4F3HA 4LVGA 3N3TA 1LL7A 2J8GA 2ZZ7A 3UJEA 1JPDX 4K1GA 3LMZA 4Q33A 3TX9A 5AHEA 2CBUA 3P7YA 4NILA 3STCA 3ARPA 1G4PA 3FVDA 3BGGA 3L4YA 1W3HA 2NXHA 2Y7DA 3L65A 3TAKA 4UCFA 3PY2A 1V3KA 2Y24A 1FWBC 3KUMA 2GUUA 2QYGA 2AL1A 3LCLA 1L8PA 3HF3A 1JD9A 3PNUA 3R8GA 5CBIA 1TWIA 5JBFA 4FP1A 1TMHA 2CZ5A 1FWJC 4FALA 2NQ5A 1CZ1A 1P0NA 3WL1A 1KRAC 1W1IE 5DT7A 3USBA 4GO8A 4MPQA 2PS2A 2ZX5A 4GBUA 2GWGA 1BFNA 1BRLA 3H4GA 1KBBA 2RH9A 2FMOA 3UWQA 2DT3A 4JTDA 1UJQA 1A5SA 1Y65A 3QF0A 1FP9A 5F4WA 2Z00A 3ARRA 3S6TA 4K6AA 4CN4A 2OGJA 1SZEA 2J77A 1O4UA 3QSTA 1F9CA 1UHVA 1KM0A 4TR9A 4U2ZA 4ZB2A 4RDVA 1XLHA 3NZ1A 1SFJA 3KBSA 1XW8A 1MYRA 3W6YA 4QG6A 1ZBWA 4G1NA 4AZHA 4O0KA 1P6BA 1X1NA 4LWWA 3OYZA 1XD1A 1PKLA 1EP1A 1K77A 3V35A 2OT1A 3LRMA 4QE4A 1NVMA 1QT1A 1GVSA 5CJ5A 2TPSA 2ZUNA 1OB0A 3W1AA 4FNTA 3JZUA 4H6EA 4GG9A 4QFUA 1EH9A 1C8XA 1BD0A 2E9LA 3ZWTA 5U4NA 2KAUC 4XZBA 4AZ7A 2PDKA 3W28A 4EPBC 5A8GA 3W24A 3E02A 1ZZMA 4HSOA 5IHRA 3MANA 2E28A 4C1NB 3W2LA 2WMIB 5F7UA 4N6FA 3W26A 1KFJA 1E4IA 1QWGA 3ZS4A 1XCXA 3B9EA 3SRHA 4PE8A 1G7VA 3WDHA 3ZT7A 3GVQA 3ARYA 3TXZA 3VKKA 2B7QA 3ARSA 1TV2A 1BQCA 1TPDA 1HKIA 1E1CA 3G0XA 1E4NA 2NWRA 3AZRA 3UVAA 3G5EA 4Y90A 4Z2HA 2ZOXA 5AOUA 3ZLFA 1FWTA 3WQPA 2VEFA 3HMJG 1H50A 3A6OA 2W92A 4GC4A 4B3KA 4AUBA 3WH6A 1IWAA 3SCPA 5MKGA 1W3LA 1TWSA 1CGUA 4LV4A 4E8DA 1BGGA 4LY4A 4GJIA 3UJ2A 4K8HA 1SFTA 1UUQA 1LF1A 2W62A 1EFZA 4BI6A 2PDHA 2HROA 3PUDA 3C61A 1A5BA 1V02A 1JFXA 3TR2A 3C2VA 3T40A 1KA9F 1V6UA 2J7HA 4MGGA 3THUA 4MMWA 5C70A 4QJ4B 3C56A 2D73A 3SECA 4IFKA 2VFFA 4KEVA 4K68A 2PODA 2V3EA 3CIWA 3HOJA 1UIOA 3KS5A 3SSZA 4FXRA 2PDQA 2XVKA 3KRSA 1VEPA 1RD5A 4WXZA 4HPGA 1LYXA 4JQ4A 5BXTA 1WCGA 2DU2A 2NSOA 2V81A 2QUMA 1K70A 3M0HA 2D0GA 3A24A 3H24A 3HFTA 1JYVA 2LLEA 3LCWA 5AC6A 1YDYA 1GVRA 4LVFA 1UG6A 3GNXA 2OX1A 3HGRA 1I60A 4Z1BA 1GZ1A 1Z42A 3HM7A 3WCZA 3PANA 4JIHA 2BVWA 3PBMA 5EYWA 1YTKA 2W4XA 1TE1A 4EOUA 1MXDA 4LYPA 2XG9A 5BYWA 2QCMA 4DUXA 4MJZA 5D33A 1UMYA 3L21A 2FB3A 3I3EA 3MKKA 2BG5A 3SRFA 4GJJA 1FXQA 1NWSA 1W8GA 1JYNA 3C2FA 3FKRA 1O7AA 1VPYA 2QV5A 5F2IA 1FCVA 1B3OA 3WLRA 4NJGA 4QSFA 5FACA 1MDLA 1ZBCA 3POCA 2VDGA 3ELFA 1G7UA 3LBCA 4X0VA 1HIZA 3MUZ1 4OJYA 4CVWA 2ISFA 3GO2A 4HNTA 4DJFA 1YTDA 4UNIA 3M0IA 1BLIA 1SVDA 4PA8A 2C0HA 1HXJA 1I1XA 4O1DA 4LS0A 2YPIA 1S5MA 3G3MA 1HVQA 4OIFA 2Z25A 2E6YA 1OEPA 1TELA 1BSIA 1TWZA 4HSNA 3G8EA 1OBAA 1OFEA 3QM3A 4P8WA 4POCA 4JIIX 1RSCA 4XZHA 3ES7A 3UP8A 1R3VA 2AOSA 1ZBKA 4JX6A 1C29A 3KLLA 1ZP3A 4I7UA 5C7VA 2OOFA 3H54A 3MS8A 2YW3A 2DSKA 2OEMA 2VEIA 5FJRA 4HNVA 2GUYA 2XH7A 1CXLA 3UWUA 4YYFA 3EPMA 3ARXA 1W2VA 3SO7A 3EX6A 1R46A 4GA8A 2J24A 3ZJKA 4I5UA 4U31A 1JDAA 3D0CA 3GB6A 5G1TA 1IT0A 4L4OA 3RX3A 3MP3A 3KOZA 1V6XA 1X38A 4ZQOA 4DI9A 5I00A 3B9NA 3KE0A 3T0AA 3CHCA 2XSXA 3PBYA 3TW7A 3VOHA 2CITA 3IRDA 3OGVA 2FQIA 2WMGA 4JX5A 4IIGA 3ZR6A 2PDXA 4JTCA 4EWND 1VFLA 3AQUA 3M0YA 3A9IA 5FJOA 5BNKA 3ZZ1A 2ZBTA 1FDZA 3BOLA 4N9EA 1KV5A 1U83A 3W37A 4LAUA 1DJNA 4GACA 1GGOA 3WNMA 2DW6A 3TJXA 1CX9A 2C14A 3SIZA 2NQJA 1J9YA 3OGSA 4IH3A 1LL6A 4GKTA 3VU2A 1K8XA 3LX9A 3QOMA 1H7XA 4GGBA 5H1WA 2ZRXA 3XINA 3KDOA 4YL2A 5GQBA 4IPPA 4GQQA 4XISA 1W0MA 4IMFA 4ACYA 1TPUA 4ZXOA 5TD4A 1A5NC 2PDPA 3MUAA 1OC6A 1R3YA 1E72M 3TXVA 5D9MA 1MWOA 5HPOA 1KWGA 1TPEA 3HGSA 2XISA 3DYMA 5T9CE 3SFKA 3NNTA 1G67A 1SJBA 1YE4A 3WMSA 1I4NA 2PUZA 2IS7A 4W93A 1Q6RA 2PTZA 5D8ZA 2TSYA 3OA5A 1HGYA 2VVNA 2H3DA 4RE0A 2OLHA 5I6SA 1A5AA 4FOUA 1XYMA 3WFLA 2NSXA 1HNYA 1AA1B 4EAYA 3HTWA 3TV8A 3IK4A 3UWYA 3GH4A 5C7HA 4PMDA 1A0DA 1KGXA 1MXGA 4ZQCA 2X09A 1Q4WA 4LCQA 1PAMA 1DWJM 4F9JA 5LA1A 2CPUA 1OIFA 3RO6A 4C65A 1NWRA 4PBGA 1UPMB 3O63A 5A5WA 3R25A 1R8LA 4W7VA 1GQKA 3O1NA 1BTCA 4IIFA 3DUGA 4CQDA 1OHLA 1JRBA 9CGTA 4HPHA 4ZB5A 2XN0A 4OWGA 3SCNA 4P7OA 5C9UA 3WNOA 2EQDA 4JXCA 5BU9A 1D2KA 1YIXA 2BY2A 2ZRZA 1GPFA 1QFEA 4HGXA 4F2UA 3L12A 3W2UA 1DKWA 4GHRA 3E12A 1QK0A 1V08A 1Q2RA 1R87A 3BJFA 1XUUA 7TAAA 1VCVA 2OWWA 4B3LA 4CN6A 3G0SA 5BMXA 5FF2A 4JFSA 5FEZA 4QCEA 4FHAA 3GNNA 2L5HA 5KITA 4Q32A 1J0KA 1FWFC 3GQYA 3NTYA 2ACUA 5G4HC 1UZ4A 4DLMA 1EJSC 1V0MA 2WWDA 1NFGA 1AW2A 4QS6A 4PL2A 2GQ8A 3E49A 1EF3A 1DXEA 1TRIA 4K1WA 2CLHA 4JR5A 4DAIA 2JBMA 1KFEA 3C2RA 5DMYA 1EWDA 1L6FA 4IWWA 1ISXA 5HPCA 1S5TA 3SCVA 1KLYA 1XBVA 1RK6A 3BV4A 4ORIA 3NSNA 1B3XA 4PTDA 3PZOA 1JFHA 3DHPA 3W2MA 2BDQA 1K6AA 2O4QA 2ZDSA 5H91A 2Y8UA 5AC8A 5CZKA 5LNWA 3NWRA 1PJ9A 2C15A 1UKPA 1RD6A 5ABGA 1XLIA 1XQKA 1FWIC 4QSHA 4QJ1A 4WKAA 3CH9A 5HMDA 4UTLA 4FNRA 3N25A 4LQ1A 4W84A 3PZMA 2J6XA 2QJHA 2Y5SA 3CEUA 4CCZA 1W8SA 4UFJA 4PSPA 1BTMA 3JW7A 1Q8JA 2V30A 4KRUA 4A2SA 4JQ1A 1QR7A 1L0PA 3OVGA 4NI8A 3W00A 3A4XA 4JKLA 3LN3A 3GNPA 2DVXA 5D02A 3BC9A 3FOKA 1UPPA 4IMGA 4HZ7A 4PTMA 1F5ZA 3K5XA 3QEZA 3SBFA 4LBSA 3PNZA 1PHQA 4N9BA 1UWTA 2VFDA 2IXVA 4MUPA 4AY1A 3G1YA 3SURA 3DERA 2Z1VA 1UR8A 2VURA 4Z1DA 2XSAA 2DZPA 2OEJA 1CGYA 3ANYA 5D9OA 4NF7A 3RRXA 4LRSA 1U1JA 2A7NA 1J0JA 2EF9A 3TQKA 3OB8A 3W82A 3E38A 3VIPA 3HG3A 3O16A 4Y9PA 3EX1A 1UWIA 3E74A 3LERA 3U48A 4CKQA 3BZJA 3FXGA 3WMLA 3L0NA 1LT8A 3BK0A 2JIWA 3ECQA 1R9YA 4K36A 5CJNA 1JPKA 3ZFHA 1JUEA 3GNOA 4PTVA 5LA2A 3STEA 3D3FA 2WSKA 5E9XA 1TV8A 4Q8UA 3STGA 2PWDA 2VFEA 2PRHA 4JTAA 4WD0A 3RK8A 3RILA 3OBKA 2R1MA 2BWGA 4FX6M 4BI7A 3S1XA 4BQ2A 4Q7NA 3S5NA 1XF0A 5TNVA 4BQ4A 2GOUA 2DV0A 5F4XA 3ZJ7A 3IS4A 1VENA 3BLLA 4JY8A 1F05A 4FNSA 2OZ8A 1Q5MA 3EOSA 3T55A 3VIIA 5JIWA 2QVNA 3KLKA 4G7FA 5GJPA 3U2CA 1OYAA 4NYYA 3QHOA 4GWEA 1QNRA 5BMWA 2HVOA 1ZBVA 4AHQA 3REQB 4G56A 1LBMA 3W84A 3JZEA 2B7OA 4IP5A 3D46A 4GUJA 5FOOA 4NZCA 1H7RA 3FY1A 3LHTA 3AXKA 1I45A 4QE5A 3KL5A 1X96A 2G3FA 5D2WA 2C13A 3KOFA 1R3RA 4J7RA 4DPQA 4E8CA 4MAVA 1MUCA 4K8GA 4ACZA 3TKFA 4EXBA 5ENLA 1Z41A 1FQ0A 2X7VA 4JL2A 1NQKA 4RDZA 2PI6A 4JIEA 4X3ZA 3LTYA 1L2QA 1WKFA 4E4FA 1ZQ5A 3EXSA 1O66A 3S6DA 1QW9A 3CV6A 4R5EA 3UCCA 1U5JA 4RZ6A 2DSUA 1WX0A 4JNMA 4XBSA 2J79A 2PTYA 4LCRA 4UIOA 5F4SA 2ZXAA 3LPFA 3BLFA 1WXZA 4JTFA 4NYUA 3E2SA 4P7RA 4H8HA 3OQEA 1S5NA 5KZEA 3U7BA 5A2BA 1F4HA 2XFYA 3CK5A 5D4YA 4LW7A 1ZCCA 3MZNA 1TQJA 2E68A 1KW1A 5AYZA 2J88A 4H8NA 2HNHA 4AF0B 3DBPA 1PCWA 2GSEA 2XFRA 3LNMA 3M6DA 2YLAA 2NV2A 4QBXA 2VEMA 3BGAA 2WW5A 1JYWA 4CCCA 3AIWA 4CNUA 2NT0A 2YDQA 1KTNA 2A21A 3TJ4A 3QW4B 3JVAA 2HRWA 4GY1A 5HNNA 3WQOA 5BWAA 5E0CA 5T9BG 2GUBA 4AD5A 2QDDA 4JAWA 3OU8A 1PDYA 3CQKA 1KO0A 4C60A 1EX5A 1RY0A 1H61A 4D8ZA 3IVTA 1UBSA 2GJNA 1BF2A 2X1TA 3KBVA 3L4WA 2PGRA 2UWFA 1E1EA 1BXNA 1ADDA 4IXHA 4KWSA 2I14A 4J3TA 1AMYA 1B4KA 4ERAA 4EK7A 2NT1A 2INFA 1LLOA 3C52A 3WLQA 2PRMA 2YFNA 4US5A 9XIAA 1Z69A 5EMLA 1XLEA 4IISA 1ZB5A 7CGTA 1P1XA 1RALA 1QNOA 3H53A 2OVLA 3Q2DA 1R9XA 3GTXA 3GIYA 3G6MA 4UOZA 4H6QA 3KOXA 3BW3A 3TVAA 1J0YA 1MZHA 3MUXA 1WA3A 3GXMA 5DX7A 4G8TA 5CC7A 1H51A 1OZMA 1J93A 2YBUA 1FFRA 3H70A 4FX8A 3MYPA 1KM1A 4DWSD 5LA0A 3M1ZA 1CXFA 3AIEA 1EJXC 3S1VA 2YCIX 3MUY1 4L9XA 1R5YA 1SSGA 1OD0A 4BS0A 3FDKA 1BWVA 3ZMRA 2QPSA 4PYSA 4NJHA 3I4EA 4E2DA 1V3MA 4MHBA 2ACQA 1E0WA 3PPHA 2BHZA 1MDRA 5A6TC 5JIPA 2OQLA 3K1GA 1I2PA 1XLLA 4G1KA 4KCVA 3CNYA 4RKAA 5AHFA 2DZTA 3H2CA 2FTPA 2GDUA 2VC7A 3L68A 1WDWA 3P93A 4U10A 2V3GA 1M68A 3OVPA 4BF5A 1XRTA 2FH8A 3NL5A 3B04A 4BWLA 1N8WA 2JALA 4DRSA 1PV8A 3REQA 4QLJA 2B31A 1VFFA 3NA8A 2REQA 1XC4A 5D38A 3K8KA 3BWWA 2R14A 2TMDA 3TSMA 4WR3A 1TJ1A 3IWPA 2ZYFA 1TVLA 2WPGA 2XVLA 3AXMA 1A80A 3CWHA 3W6MA 1DWHM 2P50A 3GTHA 1XH0A 4DNMA 2OZ3A 2P3EA 2P3ZA 3MVTA 2VX4A 3GKFA 5M1TA 2A3EA 4H9VA 4L64A 1F74A 2DW7A 2HQAA 4GIYA 1BYCA 4U3CA 2V68A 1IEVA 2OT0A 3VMNA 4DXVA 1YQ2A 4H19A 3GH5A 2JK2A 3R8HA 3N2TA 2UZ9A 3SCWA 1RK5A 3UYIA 4H83A 2ZX9A 4H6KA 2BBFA 3WJZA 4OBRA 3S42A 5EU9A 3UPWA 2NUWA 1WDDA 1FDYA 3EWYA 5D03A 3K13A 4E8GA 4HZ8A 1KB3A 1TV4A 1JQVA 4Y2WA 4Q4PA 4GFIA 1S3TC 4AF0A 1W1B1 1SO5A 3NR0A 3VIMA 2EPHA 2BXVA 3CH0A 1QI2A 1NOFA 1ZALA 4LPCA 4PRRA 1K7EA 4YLWA 4UZSA 3WLSA 4DJEC 1O94A 3N9RA 4TVCA 4PMZA 3GR7A 4UBPC 2VGGA 1BQGA 2Z29A 2G95A 4EXAA 4YTUA 3TYAA 1AZ1A 3LV5A 4IUGA 3O8AA 4IMEA 2PDFA 3A21A 3DEQA 3R0KA 3UU0A 4WUIA 2J7CA 1E6NA 3WQ6A 4QEHA 3WFAA 4M29A 4N4PA 4QG8A 3RR1A 3EB3A 3TN5A 3OZOA 1LLZA 5JMUA 3M7WA 1JZ7A 4B9YA 3WBYA 3W29A 4F4RA 1O60A 1LJYA 4MNLA 2PDBA 4PB3A 2WPBA 2IQDA 1T5AA 5GPRA 3NZPA 3W70A 4J35A 3GUWA 1FOBA 1QI0A 2ZZ3A 1EQPA 5A6MA 3AHTA 3H2FA 4CQCA 4XZNX 3LV6A 1CI1A 5I24A 3TWBA 5CZTA 2J7DA 4X2RA 3W2NA 1XLGA 2UY5A 3N29A 1XBYA 2ZVIA 4BR1A 3UNTA 3G8RA 4ZTYA 3UJFA 4UFIA 1FWAC 4B3ZA 1KWKA 5EMYA 1V6TA 3O0KA 3QFWA 1UR4A 1M7PA 4XKYA 2Q71A 3GH7A 1Z9AA 4L6HA 1VJIA 1TR1A 1XLKA 2VDHA 4PMJA 1VFHA 4REQB 3QC3A 1SW7A 4OBTA 3EZ4A 1EPVA 4PB4A 4UOJA 4B91A 3SB0A 5H8MA 5I3DA 3CL7A 3EWZA 3W85A 2DUAA 4LUJA 1GVFA 2Q02A 3S2MA 2W79A 1N55A 3TFXA 3BJTA 4AMCA 2GFTA 1WDRA 1XRSA 3AHYA 1AH4A 3AFBA 3FKKA 4WGHA 2A3CA 4RE3A 4L4LA 2PMQA 3UZ5A 2FVLA 3KTXA 1O5XA 4LYRA 3VM7A 3P61A 1OD8A 1A5CA 1TZZA 3M41A 1AUSL 1DXFA 3QMRA 1IEQA 5K9CA 3NCOA 3DC0A 4OHQA 3UNDA 1WNOA 2PCEA 1CT5A 3F2DA 2PWVA 3N6JA 4Z17A 1YRRA 1PDZA 3B8TA 3CT2A 3TTSA 3ZVIA 4KQNA 1A4MA 4QX4A 4D9PA 3MV01 1KGWA 1LWJA 3CUFA 3L5AA 4KCTA 3UWWA 1DJZA 2PLKA 1SZRA 1DJHA 1XLBA 1W1PA 1I9CB 3SUWA 4OUIA 4O1EA 2WC4A 3U9IA 3PWGA 2AAMA 1JCTA 4CEXC 2QKFA 4JTGA 1LWHA 4FLRA 2YCEA 3SIMA 1XLDA 1TJ0A 2X1UA 3KBJA 5HINA 4LC6A 2FLIA 1GOXA 2H3BA 2YXOA 1T7LA 2QCNA 4KFPA 1J11A 2GJRA 1IT7A 2PCQA 5E6ZA 1K6WA 7XIMA 2YDSA 3T0DA 2JE8A 5DO8A 5MHBA 4BY3A 4E3VA 3VGBA 4AY8A 1MNZA 1YXYA 1EJUC 1H5YA 1EUNA 4HU0A 1DL3A 1SJAA 4UQCA 3DHDA 1XIMA 2BZNA 3UZJA 3B0PA 3OEXA 4WVXA 4DYKA 3SI9A 3LDVA 1Q6OA 3T07A 3R5EA 4DUWA 3VNYA 1QI3A 1LWIA 5AKQA 3R0UA 4MOZA 2O7QA 2V5JA 5IBXA 3EA1A 4I9AA 4N4QA 2GQAA 4AZ5A 2BGNE 3HPSA 4DM2A 2EEXA 2WHMA 5JXQA 3WEMA 3F2CA 1O5QA 2HTMA 3VIFA 2MANA 2R1KA 3GBEA 3KP0A 5CLWA 1TFVA 3O6CA 4TQTA 2CU0A 2VFHA 3LQGA 3EX4A 4X0NA 2ZZ2A 4A3RA 2J47A 5EB8A 3SM0A 3W3OA 4X60A 1X6LA 2ZA2A 3PZIA 6PTDA 1W3KA 4HCHA 1PVNA 4N02A 4HYWA 4DVOA 2QPXA 3VIOA 3B0VC 2DY3A 1JF5A 2C16A 4YTQA 4A3QA 2HZGA 2D20A 1ML1A 1OIMA 1KCXA 1US0A 3RJYA 3PPGA 1FH9A 3IJ6A 2WC3A 2D0FA 1VBUA 1VJSA 5BWFA 4MZYA 2WMJA 2J9ZA 1OVDA 2BHUA 3GFZA 3CQHA 3FEQA 1UW9A 1DWGM 4O1CA 4TV6A 1UWUA 2C3ZA 4XD6A 4S3DA 1IR1A 1OJXA 4KGJA 1MFVA 4CUCA 3I4KA 4JYDA 1HQTA 1H7OA 3LI1A 4UB9A 1ADOA 2XIJA 4HA1A 4XIMA 1P6WA 4NT0A 1GVQA 2OG9A 1JRCA 3G2GA 1XRVA 3KFTA 4GYPC 3TTQA 3E5BA 1HG3A 2WZTA 2QCHA 1DP0A 3KBNA 4W8BA 2CBJA 1UH2A 3QHNA 5IDIA 2QCDB 4E4UA 1G1YA 2Y62A 2WMKA 3PAJA 2ZXDA 3WLOA 3QV9A 1OY0A 1ZY9A 4ZOAA 3AJXA 3PJXA 4REQA 2X1RA 1KFKA 2W91A 1AQMA 2WZHA 4C6KA 3G22A 3H6OA 1IEIA 1DIEA 1R47A 3T42A 2O92A 3ARQA 1LRQA 1IWPA 4LVAA 5A8QA 1NDYA 3GHTA 4W87A 4AHPA 2FZ9A 3V5OA 4A29A 1DIDA 2AQOA 4UTUA 5A1AA 3ABQA 1IZCA 1MRAA 4PFHA 2WM0A 3UT0A 3TUUA 1X6UA 3T7VA 1YMYA 2GQ3A 4FLQA 1B9BA 3E6EA 4UR8A 2O9RA 2ONEA 1WV2A 4AG0A 3VMPA 4GABA 2B0MA 2HEJA 2NZLA 3CO4A 4LUYA 5C9XA 2H8ZA 1H1YA 3VINA 1JG9A 4JOMA 1XIFA 2D22A 4I5XA 1EYEA 7ODCA 3CLWA 4GFSA 1QNQA 2XVGA 1FWCC 1CBGA 3DECA 1ONXA 2C1IA 3GG7A 5G2HA 4AZGA 4CQAA 4ZE4A 4JD4A 3UJRA 4BK9A 5EL1A 4MLJA 2P53A 3QV7A 1KXVA 4C91A 3TCEA 3LA4A 4S3EA 2GGHA 4D6EA 2RJHA 4Q3MA 3FV9A 4ORMA 3H4WA 3ARUA 5C2GA 4UR9A 3IJIA 3W71A 2XTKA 4PMXA 2PURA 1SYTA 3AIBA 1QHPA 2XGZA 4GX9A 3VGFA 3AUOA 3TSDA 4H2CA 4KKXA 2OYLA 2W0UA 3G1HA 3FFSA 1XWYA 1A3XA 1XIHA 3SN4A 3MO4A 1WP6A 3FA3A 4ZVJA 4J3ZA 2XIBA 1Q6GA 1PXGA 4HYVA 4A8RA 5LNSA 4ZOBA 1GEQA 1SPQA 1GORA 3OIHA 2A85A 3EDJA 3QPZA 4M6UA 4KETA 3NGJA 3EPOA 2QJGA 3T0CA 3OQ8A 1IXNA 3WL0A 1W3NA 2HBXA 4LU0A 3HZ3A 1FTXA 4GVIA 1TWWA 3UG4A 1YPXA 3LLFA 3H2NA 1XLFA 3RMEA 3OTRA 1BYAA 1RP9A 3DHUA 3VUSA 3BAIA 3LM3A 3W74A 5M2FX 5ECVA 3VE7A 5GJNA 2A7RA 3E5PA 1BXCA 5DCEA 4G6CA 1B1YA 4MJ2A 2BASA 4GRSA 5DELA 3EKLA 4ZSTA 3OZMA 4U4MA 3M5YA 4RZ5A 4DUOA 4DF1A 2WBGA 3MI6A 3AAMA 3MUIA 2UY2A 3OA3A 4X2PA 5DY2A 3MKCA 1Q63A 4MB3A 1LBFA 3LXAA 2HCVA 3R2GA 1XBZA 3M46A 2VR2A 4IIEA 4L61A 3EWDA 2WVUA 3LENA 2Z6IA 3KZPA 1IQ8A 1XISA 4A8NA 3GD6A 4F8XA 1NP0A 1TVNA 4GI4A 1TMLA 3W7JA 4JTRA 1B31A 4BEUA 1DQUA 3GWQA 1EO7A 5DXXA 1FX6A 1TA3B 5CH9A 4B16A 2FZMA 5LIUX 1V51A 4HZ6A 1L6YA 5DMLA 1OFQA 4AYGA 2P5NA 2ISVA 1HX0A 3M5XA 4M6PA 5REQB 3OVQA 3A4WA 2RDTA 2PDLA 3UR7A 3O0FA 2YDAA 1EA0A 1Z3NA 1WZMA 5FEXA 1Q7QA 1AJ2A 1K9EA 6A3HA 3MB9A 4DO4A 4M6QA 1B4EA 5D30A 6TAAA 4C6MA 3MW7A 2BVDA 4XO7A 1GJWA 1EO5A 1UBPC 5D8WA 2BX7A 1V5XA 1LROA 3SJNA 4AMAA 5DCBA 1LG1A 1UKSA 3S0CA 2YA0A 5LHEA 3S5YA 4A35A 4YU1A 5TF0A 1UYQA 3VOCA 2DUXA 2ZXBA 1W91A 2FPVA 1PWLA 3DN5A 3GVVA 1H7PA 4DWSC 4XSLA 3MDUA 3D6NA 4L1WA 4ADSA 4AC1X 3GXFA 1VFUA 3ONBA 4Q6JA 3LD5A 2VVSA 2HPMA 4J1OA 3AROA 2YW4A 2YL5A 3S2JA 5HR7A 5FF7A 1JGIA 5EA9A 2QCCA 5HATA 2E1DA 1DV7A 3VC6A 2A3BA 4ZMGA 5I3GA 3RDKA 4HU8A 4AD4A 3W1QA 4O52A 3NQAA 5I78A 2AMGA 1RA5A 3UPMA 4I9MA 5HWMA 1WZAA 3FHAA 5A69A 1VYSX 4L1GA 1W56A 1RAKA 2BOFX 4MKSA 3FJNA 4BF7A 1NWUA 4Z08A 4WQ6A 3WYZA 2IPJA 3PPCA 1X1ZA 2PDUA 3BMWA 1CXKA 4GQBA 3A22A 4KWOA 3VIKA 2WHKA 3GLCA 4F0MA 1EEPA 1AJZA 4O4VA 4NG3A 4QJ5B 2WKGA 4FF7A 3VCNA 1TREA 2OPJA 1THFD 4O0QA 3T09A 4G7EB 3LHVA 4WHBA 2RGLA 5K2ZA 3TW6A 2PWHA 4ICCX 2VRKA 3RJXA 1Q7ZA 3GU2A 4GKLA 2GDQA 5KZ6A 1A50A 4NRSA 2X0HA 4HTYA 2QJIA 2Y63A 1S3HA 3L66A 2DVTA 1FWRA 3CHFA 2P0IA 3QKZA 4O50A 6REQB 2XHYA 4OGZA 3KRBA 2YBVA 1J10A 1FWGC 2BS9A 3GR4A 4XZ9A 4F0RA 1ITUA 3UYCA 3NDOA 3I6EA 2ALDA 1GK8A 2QGYA 3SUSA 1HVXA 3IJLA 1UWSA 5CBBA 3N9SA 1ZS2A 2QIIA 4GUGA 3S2CA 2QCEA 1SW0A 3TMQA 1ESWA 2GJPA 2Q8ZA 4PMOA 5IFTA 1XC6A 3VZXA 5DQPA 2GPTA 1MXSA 3MBFA 4GUFA 4HMNA 4HIBA 3URQA 4IJCA 4QNWA 3QR1A 2Y0FA 4P8VA 4WK9A 3WLIA 3MMTA 4Y9AA 5HQMA 3M16A 3S9IA 1UD4A 4V15A 3VPLA 3GNDA 3BLOA 3VDGA 1ICPA 3H26A 3RU8X 4R34A 4LYKA 2Z2BA 1FUYA 3BAYA 3DC8A 5CSRA 5T91A 1JCJA 3I3BA 1CXHA 4M1RA 4TTUA 3HPXA 2XFFA 3DXIA 5KINA 3DFHA 3EWCA 4UTTA 4K38A 3I7SA 4KEUA 2Z1SA 4D71A 1OX6A 3BTNA 4GZ7A 1EGMA 3W88A 4ZQNA 4GZEA 2VRJA 3VKDA 1ONWA 2WLYA 1JI1A 3EOEA 3G1RA 1FH7A 4X63A 1PE1A 2VI0A 1XH2A 3GIPA 2V8ZA 1GYNA 2Q6ZA 1TA3A 2HWGA 3UXLA 5JBDA 4O15A 4DQWA 5B7ZA 4J3XA 4DZAA 1CIUA 3PG9A 1Y5XA 2RGMA 1GKRA 4ERIA 1M1BA 5REQA 4D2JA 1WAUA 1WDPA 2FZDA 3QJAA 3S46A 1M03A 3WKZA 3UESA 3DG3A 4QLLA 3RPTA 1NELA 2YZRA 1V0NA 1NSJA 5CBJA 4MFEA 1JNEA 2G3NA 4GQ0A 4F0KA 1YYAA 4WJEA 3BLPX 4A3UA 4LAKA 2PA6A 4QTGA 2DZAA 3NM3A 2FIQA 4JBRA 4S3GA 1KKOA 2Y2WA 1JEZA 3DBNA 4WSKA 3KP1A 3LRKA 1LORA 1MEHA 3BDKA 1X1OA 4NI3A 1N2VA 4M3PA 1T40A 1GG0A 4JS3A 5DT5A 1R30A 1XIEA 3IUHA 2D2OA 3N18A 1OF6A 1RQEA 3F2BA 3GXIA 1HJXA 3P60A 4HA3A 4AY7A 3GZ3A 4JTIA 3IIVA 3URBA 1ZSXA 1KBJA 4RW5A 4UTWA 3K1DA 2Z28A 4PMYA 3U57A 2EG7A 3PB2A 2G3IA 2ZUSA 1BYBA 1GVOA 2HK0A 1VIWA 3CLMA 4E38A 2I57A 1UD5A 4W8AA 1DJGA 4C6QA 2DIKA 4AXKA 4ECLA 3LUTA 2ZICA 1E6QM 3LEPA 3Q45A 4PODA 3WQ4A 3KM8A 4D6IA 3DI1A 3PZVA 2WSYA 1TPVA 1FWSA 1H7NA 1G0CA 4P7LA 5CAHA 4M19A 3E96A 1GEHA 3ABXA 3VCRA 4I90A 3M0LA 5FSEC 1RCXB 2FMNA 5FCZA 1PZ3A 1US3A 3L4TA 2VMFA 2XGBA 4H01A 1VRXA 2R6OA 3NQEA 4G7EA 1DJIA 1D9EA 2VZSA 2EPKX 4I6KA 2VL4A 3TOPA 4NX5A 1EL3A 3H7RA 1YXCA 3WQVA 1UMLA 1OWQA 3I7QA 4PBEA 1I8JA 3UCDA 3TLQA 3CWNA 3A13A 5CSUA 3SSJA 4RE2A 2FB2A 3WELA 4IIDA 3B0XA 1GJPA 1IIGA 5CPLA 1QU4A 3A23A 4N6EA 4WJXA 1OFPA 1YADA 4C6LA 6REQA 5BRBA 2BFGA 3WDJA 4FI4A 3AZTA 2FH6A 3T8LA 4MFDA 1UD6A 3WF2A 3R94A 4YS1A 4QHRA 3PZNA 3MV11 2VCAA 4NZJA 2CHNA 3WBAA 4KMQA 2ZQ0A 1VF8A 1I0DA 3LBMA 3TJIA 1VJZA 3RRAA 3VNZA 3VKAA 4GVFA 4GISA 4KT2A 5BOFA 2Z26A 4Q7BA 3UPBA 1X6NA 4AW7A 3NZQA 1V3LA 2QV4A 3POHA 3T2QA 4EF9A 2DT2A 4A2RA 1XYCA 1QI4A 4GUHA 1KKRA 3SR7A 3NM1A 1QASA 3N9KA 1W1YA 5CPMA 4JCLA 2RJGA 2CZEA 2PF8A 1KC7A 5K3VA 1OINA 2A2IA 2ZC8A 3FEMA 3CM4A 1TJ2A 4XB3A 2XZ9A 1OCQA 1H7WA 2D0HA 5FSDC 1LOQA 4GX8A 4QEEA 4GJ1A 1FY6A 1W6TA 4S3CA 4NU7A 2C7FA 2PWFA 4LTSA 3L9CA 3AICA 1D8CA 4RZ4A 3W7PA 1P0BA 2ISSA 5LIYX 1P1MA 2HJPA 5EBAA 1SSDA 2YGYA 1DHPA 4LUSB 5HMEA 1TX2A 1Q2SA 4UFHA 1TTJA 4XAPA 1TCDA 4DUVA 1EBGA 1GOIA 2YL6A 1H1ZA 3ZT6A 5LGZA 2ZZ6A 4H9ZA 4O1AA 4AZCB 1T96A 2JFEX 1PEZA 4A21A 3OW1A 3BQ5A 2PWEA 3W7RA 1SO6A 4EWJA 2XPKA 4YWIA 1BVNP 1YNYA 2QAFA 1FWWA 1QNPA 4RV3A 5FAJA 1WBJA 5K4XA 1DJWA 2NV1A 2BY0A 3TTYA 4JHZA 3NYDA 5T26A 1A5LC 1Q65A 4JCMA 3O3RA 3R6IA 3BLIA 3OBEA 4MZ1A 3R79A 4EF8A 4NJKA 3RN6A 2WC7A 3IJ9A 3MWCA 3A5FA 4CN1A 1CDGA 1VR6A 5D04C 2PU0A 1ZJAA 2TAAA 4NQ1A 1UA7A 4IIBA 5HULA 3NQ8A 1QO2A 3LMYA 3GVWA 4GI9A 2V9DA 4OE7A 5FF4A 2G3MA 4Q8PA 3TYCA 3VD4A 3EMZA 4NNCA 3TIMA 3TLLA 3IPWA 1Q66A 1G9HA 1GQIA 3LCFA 1YHTA 4KCWA 3WQCA 3L0KA 4GCXA 3K4DA 4CNNA 3V75A 4A6GA 1HP4A 1NIUA 2W61A 4C6JA 1AQHA 3ZO9A 2V2DA 3THQA 4E0CA 2XWDA 3GAKA 3SDOA 3KX6A 4HVXA 4IPNB 4V27A 2J7GA 4UQAA 5HNRA 2VDIA 1UQYA 3STFA 4IX2A 1RBLA 4TVUA 3IIZA 2OFJA 4YIWA 4XD3A 3AIQA 2IKJA 3TROA 2EJ1A 2PDYA 4LS1A 2QAPA 1VLIA 1GJUA 3VDHA 3NAVA 2IQ0A 3EWWA 4XTDA 3MMDA 4P7NA 4KGLA 3UBPC 3NQ6A 2PWGA 4XIAA 2OZTA 2PDCA 2NLYA 2BGSA 4LS2A 4C6PA 3LLDA 2OTDA 3NSMA 2V2CA 2XJ7A 2E7FA 4E6MA 4EXQA 1EBHA 1XSJA 1QTWA 1GTHA 1M41A 1OC5A 3IARA 3HB9A 2OSWA 1KFBA 4ZR8A 3DCPA 2ASHA 3BMVA 2CZVA 2VM8A 1NF7A 3CL8A 1KXHA 4IFOA 3AJ7A 1Q85A 5BXRA 2DH2A 5TIMA 2FGBA 4DJDC 1EA9C 3RX2A 3SCSA 2EPOA 4ADUA 3E0LA 2Y6ZA 3TTEA 3VVGA 3LHUA 4MWAA 1QNVA 3BARA 3OBAA 4QRNA 2XINA 3HV9A 5HJLA 1EEXA 4L9ZA 4ZO7A 1U5VA 2CW6A 2ZUMA 3GRIA 3FYPA 3W72A 2QUUA 3DFYA 4ADTA 1BVWA 1OADA 3PZGA 3WJSA 4S2CA 1J79A 3FVMA 1HTIA 1VCGA 3RM8A 4K8EA 3O6YX 3EMCA 5CCZA 1JNDA 3RR4A 4WY0A 2F6UA 2DZBA 1XL9A 5C6MA 1FKWA 4UXDA 3WNKA 3K4AA 1R2RA 1JVNA 2ZA3A 2I5GA 2I5QA 2I9UA 4GNKB 2C1HA 3W7DA 1JXKA 4DAFA 1KD0A 1PO9A 2F38A 4JYFA 1BPLB 4W9TA 4XBKA 1PTDA 2YL9A 4C7FA 1E3XA 1IWBA 1FWDC 2I56A 3B8UA 3CZEA 3W6LA 1ZENA 3RX4A 1ZLPA 1E71M 1JCNA 1QK2A 4CD6A 1IIHA 4V2XA 5E9AA 2A5HA 3NPXA 4FF5A 9XIMA 4H7VA 3VTRA 1OX4B 3USZA 3IUIA 4LUSA 3QZ6A 4TX6A 3B0UX 1V3HA 3VNJA 1L8NA 1FKXA 3KVKA 4H9MA 3QRHA 4NX0A 4MWAE 4Y7EA 3MA8A 4M7SA 2I7GA 2JKAA 5FD0A 4ZE5A 4ATDA 3RXZA 5ABHA 2CLLA 3LRLA 1Z7AA 3TONA 2DUZA 3R7MA 5FJPA 2Y8VA 3ZJ6A 4AZCA 2F7FA 1GYMA 4LV9A 4DBDA 3WLHA 4W89A 3CUIA 4QS5A 3F4WA 3PR2A 5IRPA 3RLGA 2VC5A 3GKAA 4Q4OA 4XBJA 4D8AA 1P0EA 4AWEA 3HV8A 1ISVA 4NRRA 1LRTA 4GYKA 4CU7A 2A6LA 4RE4A 1G69A 3TCSA 4JL1A 3RLVA 2AGTA 1D8WA 1WYIA 2G37A 1PZ2A 1SM9A 1KQZA 2DZWA 1YDVA 4CD5A 4HMDA 2PBOA 1G5AA 3RM9A 4OV9A 1R3TA 3W02A 5LNUA 3CTTA 3UGRA 3N2CA 4J27A 4DBUA 2G4JA 4JTTA 4AEEA 3DGRA 3LXBA 2D2JA 1OFDA 3CMJA 4MF4A 2E6DA 3OOQA 7A3HA 1UQZA 3KL0A 4I7WA 1TCMA 3FCPA 4MWAD 3MDWA 2CXEA 3CL6A 1JUBA 3Q67A 5HUPA 1M7JA 1NU5A 4J3WA 4I9JA 1OYCA 3M07A 3U4AA 3EMQA 3MMUA 5LXXA 4LNCA 3LI0A 2EBNA 3T1GA 5BRQA 2C8NA 2Y89A 1TZ7A 2FHCA 1B90A 3KCOA 3M44A 3RCMA 1TX0A 3BAWA 3M0VA 3EBVA 1TWDA 1QPRA 1HJUA 2C91A 3THCA 4NXSA 4HN8A 1XQLA 3MI3A 3T2OA 3WDPP 2X2GA 2P1FA 1PUDA 1Q4NX 3CPGA 3BCJA 2QUNA 2B7NA 3AMKA 1V8EA 4Z42C 1KR0A 1G01A 2ZUWA 1CGWA 3VOJA 5K7JA 3QOKA 1TPC1 5F2MA 2H6RA 3FJ6A 3L5MA 4JQ2A 3ITXA 2WK2A 3QTGA 2VFIA 4GBDA 3ARZA 2FKPA 2PP0A 2QIWA 4Y96A 4XQ6A 3P62A 2GJXA 2VQTA 4I9TA 1XFCA 1VFTA 4I7VA 4CU8A 3ANVA 1CWYA 1UD8A 2J75A 5CGQA 3NUKA 3TC3A 4XD5A 1ICQA 4M0XA 1JR1A 4LF1A 4UWMA 5CSYA 5CSSA 4MY9A 4J3UA 1JPMA 3WFZA 1TJPA 3PZQA 3KAOA 1F3TA 3W7LA 2DORA 1DBTA 2X42A 3TSBA 1OT2A 3WF0A 4FIQA 1DE6A 2P76A 3APGA 1TG7A 2NX1A 3WSUA 2ODOA 2NVDA 2Z0IA 3CB3A 4ZENA 4RCXA 3VD3A 3ITLA 3Q58A 1PKYA 3AMCA 4O19A 1Q6CA 1YX1A 3WH9A 1OK6A 4LBUA 3CC1A 2CLPA 5LNVA 1FHUA 3I3DA 2CESA 1EF2A 4M6VA 4W88A 1Q8AA 3WQWA 3NXFA 3AU2A 2VR4A 2W67A 3WZ0E 2HE8A 4XD4A 5CXPA 1VBJA 3WQ8A 3MY9A 4KIRA 5LYRA 3DIPA 1TE6A 4ZQRA 1RLCL 3T78A 1LT7A 3VD5A 2OWCA 1I2RA 3EPNA 3QC0A 1H0IA 4R53A 4IQDA 3C8FA 3AYTA 3DX5A 4DNHA 1O1ZA 1OX4A 3ABOA 5AC4A 3QY6A 1XIGA 4G5DA 4OFCA 3CWOX 5G2IA 1XPGA 1K4HA 1EPXA 1XS2A 1NTHA 3I10A 5BROA 3G24A 4IM4A 5C55A 3HFYA 3W27A 3QGKC 4KWWA 1W1VA 4Z2KA 2GDVA 3PZUA 1SZGA 3GE7A 2VX7A 4O8RA 1CGXA 4L6DA 1GWJA 4ZCWA 2NQLA 1RXOB 1R3WA 1QPNA 4D6JA 3AO0A 4Q4KA 3FXYA 1E0VA 3LPPA 5IHSA 4JIRA 2GQ9A 2PE4A 5CZSA 5GVJA 3QY7A 1NM9A 1GQNA 4GCAA 1C91A 1CLXA 1JF6A 4MY8A 3GIQA 4WOZA 3AHVA 4QAIA 4L1XA 5HJXA 4YVVA 3VOIA 2JGQA 3W1MA 4PULA 2PGWA 2R9RA 3OZPA 4D6DA 2TODA 4JIPA 4NAFB 3RMJA 4D6CA 3B40A 2BOEX 1WUEA 5J04A 4KIEA 3VMOA 1JZ6A 1KNWA 3GNRA 1V02E 3B4YA 3HQ1A 3SZ8A 3B9DA 5CLTA 4K7VA 4LX4A 3CAWA 1KXTA 3HIJA 2VZTA 2QT3A 5DF0A 3WMCA 3WX7A 4K39A 4PC8A 2Y5JA 8A3HA 4F66A 2C0AA 1A0EA 3W1NA 6TIMA 1GW1A 2QW5A 1OFAA 3TMLA 1R38A 3CV2A 3LY0A 1J5SA 4EE9A 2CEQA 5A2AA 1W9VA 4RNIA 1ZP4A 2YYUA 2NUYA 1FA2A 3AOFA 2WNQA 2NW0A 4PGLA 1FCBA 3S83A 3IACA 4M82A 4QQUA 4RPPA 4HA4A 2ZC1A 3NOYA 2PBGA 1UCWA 4GNJA 2NQ9A 3FK4A 3B05A 3WH5A 4UTKA 4P5UA 4MTVA 4JDYA 3HGOA 5D2VA 4CNTA 1H62A 1WOAA 4MSSA 1ZRQA 4LAMA 1XR2A 2AKMA 3E0FA 1G4SA 3UG5A 4JX4A 2NV9A 1E6XM 2BY3A 2WLZA 3UZWA 2BGQA 2WNWA 3CUJA 3BOFA 3T2PA 1EGVA 4O8AA 2NXIA 4PRTA 1A5UA 4LANA 1VHNA 1JDFA 3WN6A 3TOYA 1OCJA 4JNZA 1W32A 3II1A 1VIZA 2Y1HA 4OQVA 1WO2A 1EYWA 1I6NA 4JIQA 1WAWA 2E6AA 5I3IA 3GVGA 3H2OA 4C1NA 4DO7A 3WK2A 2WMIA 1KBKA 3KRZA 4PMUA 2W63A 2A79A 3NXLA 4ILSA 4UUIA 4UCGA 2V82A 2DJLA 1HL8A 2PDWA 1B2YA 4JKKA 3TE9A 1XBXA 4WIWA 5C54A 5L6UA 5EMMA 3VC5A 3DFQA 3NDZA 4KFNA 3S3GA 3T0TA 1VC4A 4FS9A 3NQVA 2VEKA 1E9IA 3BV7A 1LQ2A 3QLLA 4A8IA 2DP3A 1DWFM 3NSXA 1AH0A 3LLXA 3R11A 4O1BA 1LOLA 2J25A 5E93A 3C0JA 4X9SA 3UA3A 2ZE3A 3GW0A 2UV8G 1OM0A 4S3AA 3ZR5A 1FXPA 2J8FA 2JEQA 3WUBA 4URIA 3WNPA 1V7AA 4DJFD 2IPGA 5AZ0A 2DPEA 2V6AA 3CIVA 3SGZA 3W7KA 5EGRA 2G5WA 4JY9A 2OQHA 3DDMA 2WJDA 4JFUA 4HZMA 3QR0A 3UERA 4GNVA 4U5KA 7ENLA 2RFGA 4AZ6A 1E5JA 3L4XA 4JTJA 1CEOA 1HJWA 3YPIA 4PMVA 1UH3A 1FBAA 1EHAA 4FLOA 5I02A 5BW6A 4P8UA 1RPXA 4GY7A 2GJLA 4U3AA 3HGJA 4IGSA 2C1GA 2ABAA 4RXGA 3W76A 3PBWA 4JTLA 1J0HA 3ALFA 3T44A 2FJKA 1PYFA 1W5QA 4DY1A 1TIWA 3KRUA 3WH8A 3RNDA 3KTSA 3VGHA 3M0XA 4NZ1A 3GTIA 2J62A 4AB4A 2VNCA 3AXHA 1NJJA 1AD1A 4HPNA 2HNEA 3E0VA 5BOOA 3DOPA 2XFWA 4E3TA 2ZZ5A 3NO3A 5AB3A 4PSRA 3N2BA 3CAVA 4ICMA 4NUWA 3V1PA 1D7KA 4NAFA 2X30A 2CZFA 4IJBA 4TU1A 1JXJA 5BU6A 5CC6A 4MB1A