1TA3A

Crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase inhibitor protein I
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Hydrolase inhibitor/hydrolase
total genus 99
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ta3A00
3ZR6A 2GJXB 2PI6A 4PYSA 1IZJA 2D0GA 5E09A 4WKFA 5M3WA 3PZUA 5I6SA 3A4AA 2F8QA 3WN6A 3WFZA 5JIWA 4ACYA 4WKAA 1CPUA 4DM2A 4H8HA 4UFLA 3WMCA 4CCEA 2WNWA 4CU6A 3N15A 1GQLA 3EMZA 4WSJA 2UWFA 1C91A 1WDSA 3RM9A 1QBBA 3SUSA 2GDUA 3POHA 3MUZ1 2GUYA 3PBGA 2J47A 3KL5A 2WW5A 3W29A 1Q6DA 4HA3A 1BYAA 4UQ9A 1E1EA 3SCNA 2VZOA 4GO9A 2VR4A 2OSXA 3BCFA 4U5KA 3ZQ9A 1TG7A 1ZBWA 5A95A 1BGAA 2BHYA 3QHNA 3DECA 4JFVA 3NSMA 4PMUA 5FL1A 1J0YA 2DH3A 4AZCA 4DUWA 1FFRA 2DH2A 3BXWA 3K8MA 2XFRA 3BH4A 1BTCA 2WMFA 5JUVA 1UQYA 3PZMA 3NDZA 5HOSA 4UFKA 4WLCA 5IHSA 2C0HA 5A8NA 1HKMA 4P7NA 1YQ2A 3CZEA 3BC9A 1NWTA 1HJVA 3ARTA 4GI9A 2Q8XA 1A47A 4PMZA 2GJXA 4PSPA 4XX6A 4CUCA 2VCCA 2YKKA 2WMKA 1JZ5A 1EQPA 1O7AA 4M1RA 1H41A 3ARQA 1HP5A 4JIEA 1HKJA 1OD8A 2YIHA 1TVPA 2EQDA 2VX7A 3BAXA 4BQ2A 1UWUA 2O9OA 3B9AA 4KH2A 2FHBA 3AIQA 1ZBKA 4JFWA 4JHOA 3WQWA 1L8NA 1JD7A 1CXFA 4A4AA 1UR1A 1HVXA 2NW0A 1W3KA 5LYRA 3RMEA 3N17A 1E4LA 3UETA 2X2YA 4LYQA 1M7XA 4PMYA 5D9OA 2D22A 4FMVA 3NSXA 3WNLA 4OUEA 4BA0A 1ISYA 1UWSA 4HP5A 2YL5A 5LA2A 4H7VA 3UEQA 1E73M 4H41A 4DUXA 1TUXA 2X0YA 1AQMA 5EMYA 5A6JA 2WMIB 4ZXOA 1BYDA 4W85A 3VTRA 2CXGA 4EE9A 4D6DA 2V3EA 3VGHA 8CGTA 3K4DA 4UNIA 3WDQA 1UKQA 3WL0A 1C92A 2G4FA 4AYSA 2A3AA 4OBRA 2YL9A 2WMHA 4UQBA 2FDMA 3T0DA 1UR4A 2E40A 4M29A 3CHFA 2WKGA 3CHCA 2XM2A 3WUEA 1US3A 1W9VA 5D9PA 4Q22A 3LPGA 3EYPA 4PUDA 1F4AA 4Z2HA 4BF7A 1F4HA 2VL4A 3NUKA 3ZSTA 3W25A 4JCMA 3QOKA 1XHGA 3T08A 1WDRA 3DHUA 1MYRA 1MWOA 4EK7A 3KEHA 3FXYA 3AS0A 4TX6A 1FH7A 1BAGA 1ISWA 2D24A 3PZQA 1HP4A 4HU0A 3KL0A 1XYZA 1E5NA 1NH6A 4MNMA 4PTMA 4V28A 4MNJA 1V3HA 4PSRA 4HPGA 1VB9A 2X05A 2J79A 4H8UA 3WBEA 2XFYA 2GJPA 1OGSA 2DIEA 3M46A 4U3CA 4CVWA 1E4MM 1MFVA 3VD5A 3UG5A 2BNJA 1DWHM 3ARYA 2JFEX 4GIAA 3MU7A 3WQ6A 1ZU8A 2BY0A 1HL9A 2XHYA 4Z2KA 1UD2A 1HJXA 3ZOAA 1CTNA 3W37A 2WWCA 1GOMA 3SCSA 2D20A 2PBOA 3U57A 3PZOA 1E5JA 1VFUA 4H2CA 4ACZB 2D2OA 3PZGA 3WNMA 1J0KA 2BVTA 1W3HA 2BY2A 1V3JA 1XH1A 4B9YA 3L2MA 4M82A 3T0AA 2WVTA 1JYXA 4UFMA 1YHTA 2WVVB 4N0RA 3T2QA 1C8QA 2O92A 1B3WA 1ZS2A 4UZSA 2ZXDA 1E0VA 1GOWA 2ZX7A 4ATLA 2DSVA 4GXPA 3VD9A 1TE1A 2WC3A 3WY1A 2WMIA 5A6BD 3IJ7A 4UQDA 3BSGA 2XG9A 5CSYA 1JI2A 5LA0A 4S3KA 3M7SA 4DWSC 3VINA 3IK2A 3VX0A 2VO5A 5A8OA 3O6AA 4MB1A 3AHXA 4AZ7A 4JKKA 3WSUA 5C70A 1UD6A 3F4VA 3S2CA 1H4PA 1ODUA 5C71A 1GOQA 3QGVA 1N82A 1VBRA 4MJ2A 1NWUA 4JL1A 4AIEA 1EO5A 1MVYA 2XGIA 4FLRA 1HJQA 1E6RA 3BMWA 2PC8A 3VM5A 2EPKX 4TXEA 4QLKA 1PAMA 5HDRA 3CUFA 3WD3A 2GSJA 1GQKA 3OBAA 4AEFA 2VNCA 2XVNA 4CN4A 3FNDA 3K8KA 2W63A 4W88A 5A6MA 1DHKA 4OOUA 1XRVA 3SCWA 4P8XA 3UG3A 1ECEA 1VFMA 3ZO9A 2CESA 3L4UA 2QPUA 4Z2IA 2BFGA 2WSPA 1VF8A 1E55A 4J3SA 3L4TA 5IXEA 5HXMA 1UKSA 1ZBVA 3WD0A 1B3YA 4F9DA 3CUJA 1FHDA 3WEZA 3ZJ6A 1C7SA 2WVVA 1LL4A 2DT3A 2WCAA 5DO8A 5I23A 4QCEA 1UZ4A 1ZL1A 4XV0A 1Q6GA 1W2PA 4D1JA 1WZMA 3N13A 4QP0A 3VIFA 1BSIA 5DEZA 4HTYA 1BFNA 1UHVA 3U7VA 3CZ8A 4LQ1A 4D6IA 3EDFA 1PEZA 4W93A 3T0BA 4UFHA 3LPFA 4AW7A 1JZ2A 1WNOA 4BS0A 5BCAA 1J11A 1LL7A 3WFLA 1HKKA 3AJ7A 4GZJA 1RP9A 2WYSA 3WDIA 5C8BB 3ARSA 3GM8A 4QLLA 2VZTA 3MV01 1OBAA 3U5YA 3PTKA 4P7OA 1E43A 2BHUA 2VX4A 1BF2A 5A8PA 1H5VA 5FD0A 3D5HA 3RJXA 1EDGA 4FF5A 1VEPA 1UKOA 1PBGA 1KR1A 1ISZA 1DEDA 3IAQA 4ZFMA 1MXDA 6TAAA 4ATDA 3VD4A 4UQAA 1KXTA 4JCLA 4NSBA 4WJXA 4W7WA 2ZOXA 1W3JA 3VGBA 3GZAA 4AZ5A 2QF8A 1W32A 2D0HA 2FH8A 3ARVA 3UCQA 4JL2A 2VZUA 2XIBA 1WZAA 4HMEA 2CPUA 5EFDA 3WF4A 1DWGM 1RH9A 2CIPA 1CDGA 1EHNA 1CZ1A 3WD2A 2WMGA 1CLVA 4AZIA 1B3XA 5CXPA 2WAGA 2F2HA 3VMOA 2O9TA 3U7BA 1M53A 3RM4A 3WQ4A 3AXHA 3QOMA 4JAWA 4LXFA 4LGXA 2E9BA 2F61A 3CUGA 3EMQA 5A94A 3CHDA 4V2XA 5M5DA 1I1WA 1UWQA 3MUAA 4J3WA 3VILA 1J0HA 1V6VA 1NOUA 3SIMA 1KWGA 3K46A 1KQYA 1RP8A 3NIYA 5FL0A 2QPSA 5A6SA 1UD5A 1CEOA 1R85A 1WZKA 3A6OA 3VPLA 1MQRA 1QHZA 3M6DA 5CPTA 3TTYA 1CXIA 4PMNA 2E0PA 5AYIA 1QNSA 1H11A 3NCOA 3CGTA 5DT5A 5BRPA 3BLKA 1V3LA 3PZTA 3T09A 2QMKA 4TTGA 1E6NA 1XCWA 4PMVA 3A4WA 2XUCA 2J74A 2ZUNA 3OGVA 1QPKA 3THCA 2J7GA 1DWFM 5A3HA 2WVSA 3VUPA 1W1VA 3VDBA 1R7OA 1MXGA 1LG1A 1EO7A 1BG4A 3OG2A 2C8NA 3W6MA 4JZ5A 1AQHA 3A4XA 3ARPA 3PZ9A 1W9BM 1GNXA 2JIEA 1J9YA 2V3DA 1NP2A 1V0NA 4FLQA 4XZBA 1UZ1A 2PWEA 2WMJA 4AZCB 2WM0A 3WNKA 1OD0A 2DSZA 1JFHA 2UY5A 4AZBA 1KGWA 4QFUA 5AC4A 4OZOA 1Q6EA 2VC9A 2E4TA 4R5EA 2OSYA 1UOKA 1QNOA 5F7UA 2WK2A 1MW0A 2V3GA 4MB5A 3DYOA 4L4PA 1VRXA 1E0XA 3ECQA 1WZLA 1E6PA 3W81A 5CPQA 4AIUA 4KGJA 4S3JA 1TR1A 4OJYA 2VVSA 4L4OA 3VIOA 4ATWA 4D6FA 1OB0A 4AD3A 1X1NA 1MW3A 1K9FA 3OLEA 3AS1A 1WE5A 4NRSA 4J3TA 3ARWA 3VU2A 2YL6A 1QI3A 3AIVA 1KXQA 5FKYA 3GXDA 1CXEA 5BXSA 1JXKA 4E4PA 1CIUA 4W7VA 3A3HA 2HVMA 2WBKA 2WLZA 1UQZA 3AQUA 3GNPA 3WDPP 2WHMA 1SYTA 5ABEA 3WDJA 4CN1A 2XM1A 1EQCA 4MTVA 1FOBA 4AD4A 2ZE0A 1QNQA 1U30A 1HNYA 1K6AA 3W6LA 3ZM8A 2GFTA 3IJ8A 4GKLA 5ECUA 2VI0A 1NOFA 1XSKA 3OGSA 3UR8A 1OM0A 4M56A 3SCUA 3FAWA 1LWHA 2GDVA 1TFVA 2XWEA 3VIIA 1NQ6A 5D9MA 3ALGA 2AAAA 1FH9A 3GBEA 3L4XA 5AYBA 3VGDA 1AMYA 3CUIA 4J7RA 2WZHA 1GQJA 1W3LA 2Y2WA 4V27A 4WF7A 4CKQA 4W84A 4C7FA 1U33A 1FA2A 1QHPA 1JZ6A 4P7RA 1WDQA 2JF7A 2D3LA 2J7CA 2J7HA 1TVNA 3OIHA 1JAEA 1NWSA 1LLOA 1OINA 1VEMA 4GPNA 4MADA 1MW1A 1PPIA 3BSHA 1GPFA 1KFWA 4MJ4A 2WBGA 2QHAA 3VMPA 2J62A 1C3FA 3GH5A 1JNEA 3W38A 4YPJA 1J12A 1UD4A 1W9PA 1QNPA 5GNZA 4LX4A 2W5FA 1CGXA 5EB8A 4NRRA 5I5RA 3BCDA 2DPEA 5M17A 1R7AA 3GNOA 3CZLA 3MMDA 2BY1A 2IXUA 1XD1A 1RPKA 4D72A 4M80A 2VUYA 3EDEA 4HMCA 2J8GA 2O9PA 3WQ5A 3W28A 1K9DA 2VCAA 3NJ3A 3T2PA 5A8QA 3L4ZA 1V08A 1FFQA 3MV11 3WEMA 3ZMRA 2VQTA 4IPNB 1UUQA 1Q6CA 3CHEA 2WZIA 4QDMA 2ZXBA 5GPRA 2OYMA 2XYLA 3SCVA 2Z1SA 2VZVA 4DM1A 1ZB5A 3WELA 3ARXA 3RCNA 3FHAA 4P8UA 4GI6A 1QNRA 4ZE4A 1E56A 1JZ4A 3KE0A 2WB5A 3AROA 4ML4A 3OLGA 3M07A 4DWSA 3N9KA 1UR2A 1QW8A 2B31A 2ZX5A 1HJSA 1B3VA 2JEPA 3DHPA 2E9LA 4Y7EA 2UY4A 3AIUA 1B3ZA 1FHLA 1DWAM 2GK1A 2Y24A 2FGZA 4F66A 1B9ZA 1JDCA 3QHOA 3RIKA 2GJRA 4GINA 5E70A 4CGTA 4TUFA 5DMYA 2XVKA 1XYFA 2X09A 5JBDA 4AWEA 3F5KA 1UG6A 2PWHA 4IPLA 3CBWA 1VFFA 1HKIA 3SCRA 4JKMA 4FLSA 3AMKA 1QBAA 1D3CA 2ZXQA 4D71A 3AXIA 1UWTA 4B9ZA 2ZICA 4RE3A 2D23A 4MDPA 3WH6A 2EPOA 2ZX6A 3LPOA 3MUIA 2OYKA 1ZJAA 5CGTA 5E6YA 4PMQA 1KBKA 3WIJA 1RD6A 2D0FA 3OLIA 4J28A 4XZWA 3VD7A 3VIJA 3A47A 5DF0A 5I24A 1V0MA 1CXLA 5M03A 2D1ZA 1CECA 5HNNA 1M01A 8A3HA 5CLTA 5D8ZA 1SFSA 2WVUA 1MQPA 1B0IA 3GXFA 1XC6A 1AVAA 2WWDA 4W8AA 4AD2A 1DWJM 3DYMA 2WCGA 4X9YA 4CN6A 3SUTA 3GH7A 5HBFA 4EKJA 1W9XA 2NT1A 3VIGA 1WKYA 4GI8A 2ZIDA 1E71M 4WIWA 3GBDA 5I2UA 4M8UA 2X1IA 2DQXA 3KWXA 1JNDA 3WH5A 3WMSA 4H04A 3W0KA 3AHTA 4KMQA 1OSEA 2VCBA 3GXIA 2BXYA 7CGTA 3NSNA 1XV8A 3WL1A 2DSKA 3MUY1 1J0ZA 3AI0A 4JFTA 1JFXA 1KQZA 3GTNA 2ESCA 3FY1A 3N18A 1GHRA 2EXOA 2W66A 2VR5A 3VOCA 4OOZA 3EDDA 2PBGA 1GOOA 1QW9A 2CETA 2Y8VA 3WDRA 4CCDA 3G6LA 2DGAA 1H09A 1J10A 3AS2A 1V6WA 1LF1A 1J18A 3CO4A 1KGUA 1VJSA 5E6ZA 4WKHA 1JYNA 4M24A 1OIFA 1GVIA 3UESA 2FGLA 3DC0A 3W82A 3BGAA 3W24A 1H0GA 4DUVA 1CXHA 5GNXA 1CXKA 3UERA 2C7FA 3AXXA 3CLWA 1QI2A 5AY7A 1DWIM 1J01A 3AISA 2RGLA 1ITCA 3CUHA 3VIMA 4HMDA 2EPLX 4RE4A 2VTFA 4P7LA 1BG9A 1LQ0A 2CHNA 4WK9A 4H8VA 1UH3A 2YA1A 3E1F1 1GHSA 4D6CA 3SCQA 2E8YA 2YLAA 4U2YA 4BCEA 2XVPA 4TTUA 3VMNA 1GVYA 3SCPA 2A3BA 3ZIZA 3WF1A 3GXMA 4AZ6A 3JUGA 4QAWA 3CZKA 1V6XA 1G5AA 3K8LA 4AZGA 3I3EA 5BXPA 4ZENA 3ZJ7A 1BLIA 3VIPA 2XFFA 3AIRA 1WO2A 5DFAA 1R87A 5A2AA 3RO8A 1E0WA 3VGGA 4QLJA 1W1PA 1X6LA 2W92A 1B31A 4AXNA 2CNCA 2E8ZA 1XCXA 4HPHA 2BHZA 2YDQA 4FK9A 2W67A 4Z2LA 1UH4A 1TCMA 1SR0A 2ZUSA 2OWWA 4OKDA 2ZUVA 4MDOA 3ZT7A 4B3LA 4BQ4A 3K1DA 1BYCA 3I3BA 2VZSA 3KL3A 3AMGA 3ARRA 1Z32X 1JDDA 3RILA 1JG9A 1Q4NX 3AYRA 4RE2A 1UD8A 1V0KA 5BXTA 1W1TA 1JIBA 5CPSA 5I77A 5TD4A 4MB4A 1MQQA 4HA4A 4IUGA 2G3NA 2W61A 1JYVA 1HN1A 5KZ6A 4UZUA 3D3AA 2IXVA 5BWFA 3MMUA 3NDYA 1C90A 1UH2A 4AY1A 1E15A 3VGEA 2J77A 4OBSA 1LG2A 4UQCA 1CGVA 3TTQA 1UR0A 1UR9A 4LYRA 3TTOA 5LA1A 4EANA 2V5CA 1G9HA 5ABFA 5HPCA 1C8YA 3PN8A 2YDSA 4TVUA 3WQ8A 4M81A 1K9EA 4MB3A 2VURA 3AZTA 3ZT6A 1NWRA 3VGFA 3HN3A 5BRQA 3VD3A 1HJWA 2Z1KA 3L4YA 2WKLA 2BXZA 3ALFA 3WF2A 1JZ7A 2VOTA 5IFTA 1UD3A 1X6NA 5A6BA 3AIWA 1TA3A 1V03A 1HJUA 1G94A 1FH8A 3OA5A 1VIWA 1W1YA 5JBFA 1CYGA 3IANA 4J3XA 4UTFA 4JKLA 2J78A 1SMDA 1OCQA 4W7UA 2WC4A 1JZ8A 4AMCA 3VM7A 3BAIA 3WNOA 2J7DA 1GJWA 2YBUA 1BVNP 2WC7A 2CKSA 3VIHA 3WUGA 1KB3A 4YHGA 4PCTA 1IV8A 3WBAA 2EJ1A 1KXHA 2BVDA 1HIZA 1B1YA 3ZJ8A 4CD7A 1CNVA 1BYBA 4N42A 1S46A 1KGXA 4E8CA 2V38A 1P6WA 1M04A 3T2OA 3CZGA 1GJUA 4NI3A 5GQBA 1KCLA 5E9AA 1WCGA 3AIEA 1OWQA 4PMOA 2ZUTA 6CGTA 5DT7A 1CWYA 3AS3A 2QV4A 2MANA 1OT2A 3N1AA 2V5DA 1A3HA 1GONA 2VRJA 1OGBA 1D7FA 2VT0A 3W27A 2JIWA 1NARA 2WZEA 4GZEA 5FIPA 1QI4A 2W62A 1UR8A 4NZCA 1SMAA 2OYLA 3N11A 1UKPA 3OLDA 5BYWA 4JHZA 5D9NA 4EAMA 2BY3A 3OZPA 1V0LA 4C7GA 1QHOA 3B9EA 1OT1A 1JYWA 3SUWA 1WAWA 3WEOA 2WLYA 2IUZA 2XVLA 4KWUA 2YA2A 1E72M 4BQ5A 2V3FA 1EXPA 4GZIA 1US2A 3TTSA 3F5JA 1G0CA 4URIA 3HU7A 2J7EA 3EBVA 3RM8A 1C7TA 2VVNA 1V02A 4HA1A 3FW6A 4CCCA 3AMDA 3QHMA 5A2CA 1WPCA 2AOSA 3VKKA 1R86A 3W26A 2TAAA 2UY2A 3CZJA 4F9JA 2DT1A 4HOWA 1Y7VA 4OIFA 1B2YA 1R8LA 4HZ7A 3OB8A 5CQ1A 1K9TA 1NOWA 4ZEPA 1NM9A 1TZ7A 3O2LA 1ISVA 3BAYA 4DWSB 3AFBA 2A3HA 1EH9A 2CBVA 1CENA 1VFOA 1JF5A 2YJQA 7A3HA 2ZWYA 1E40A 2ZUWA 2J4GA 1XGZA 2GK1B 1HT6A 2WCSA 3WH7A 2CHOA 3MANA 1LL6A 5IFPA 3O9NA 3MSDA 1E3XA 2BVYA 1GOIA 3EMCA 4CU8A 3B8SA 3CPUA 2BS9A 2PWFA 3VX1A 3SCOA 5IHRA 2G3JA 2XJ7A 2VMFA 2YBTA 2FH6A 4PMXA 1EDQA 3NYDA 4UOQA 1VBUA 5FOOA 3AYSA 1C93A 4PRWA 3N04A 4AD1A 1DTUA 3BMVA 2XPKA 1OIMA 2CYGA 4NF7A 2PWGA 4TOQA 4XUYA 4J3VA 1PIGA 2CBIA 4A3HA 3WNPA 3EDJA 5CJ5A 4PCSA 4HZ6A 1CGTA 1CGUA 1D2KA 3VO0A 3ZSSA 1HF6A 3DYPA 5I3DA 3MSGA 2EEXA 3BAJA 3HJEA 3TA9A 4PN2A 3WUFA 1EDTA 3RPMA 3AIBA 1UA7A 1HL8A 4XB3A 7TAAA 4Z2JA 4HOXA 3KZSA 3THDA 1JL8A 1I75A 3AOFA 1GQIA 5JIPA 4E2OA 4J3UA 3UG4A 1ZJBA 1UWIA 1V3KA 3IJ9A 2O9RA 3AMCA 5HPOA 3LPPA 4MNLA 3CIVA 4CVUA 1KR0A 1GORA 3PHAA 1PX8A 2YLLA 1ZBCA 4FLOA 4U2ZA 4E8DA 3OZOA 3B9DA 3MS8A 4PEEA 2ZX9A 3FAXA 5BROA 2BV9A 1C8XA 2A3EA 2EPMX 1EOMA 1UA3A 1BQCA 2CITA 1QVBA 1GUVA 1UKTA 2DSUA 3UR7A 3OGRA 5FCZA 1H0IA 3SUUA 4KGLA 1PZ2A 3SEPA 1JZ3A 3U5UA 1OGGA 3MO4A 3WF0A 3ZT5A 4F79A 3ZJKA 1PJ9A 1MFUA 1PX4A 4JFUA 3VVGA 3SURA 2J7FA 3WNNA 2Y5EA 3CMGA 1KBBA 3VDHA 1FP9A 4U31A 3F5LA 3VNZA 2G3IA 3BAWA 4UR9A 1WP6A 3W4RA 3RJYA 1EHAA 4IM4A 3K4AA 4TVCA 2ZWZA 2HISA 2QLYA 1EGZA 1GCYA 3PZVA 2W4XA 2CKRA 1BVZA 2XTKA 1JF6A 2JEQA 1E6SM 1B30A 1LWJA 3WDHA 2NSXA 3PZNA 4BQ3A 4CD4A 4W5ZA 4X0NA 1BGGA 3TP4A 3SCTA 1CLXA 2QMJA 4GQRA 2XSBA 4A3YA 2XIIA 2OWCA 1HVQA 4UCFA 1ODZA 2VQUA 2ZXAA 2YDRA 4D6HA 4LPCA 5CZKA 4MPKA 4CD6A 1H2JA 4RL3A 9CGTA 4ZXLA 3FN9A 2XGBA 5CSUA 1GW1A 3SUVA 2G41A 5I0DA 4PTXA 5IDIA 1IZKA 1GZJA 2G3MA 1E6XM 2CBUA 4D6JA 2RGMA 4W5UA 2Y8KA 4PMDA 1QOXA 5A6KA 1W2VA 2AMGA 3BLPX 4X0VA 3TOPA 2JALA 3TONA 3ZR5A 1G01A 1J0JA 1E70M 4CD5A 2OWXA 2XVGA 2XWDA 4D6EA 4U33A 2YOCA 1GOKA 5I78A 1L0PA 3WUBA 3VDCA 5E0FA 3S6TA 1HX0A 3WH9A 1PX3A 1Q6FA 4K68A 2X8RA 1V6UA 4HOZA 5BXRA 2E3ZA 2D3NA 1XH0A 1IT0A 5CG0A 4ACZA 2WHLA 2WXDM 3MMWA 4PTVA 2DIJA 4UOZA 1J0IA 4MNKA 3I3DA 4J27A 4W8LA 2G8ZA 4LYPA 4B16A 3CMJA 3VIKA 1CBGA 1JD9A 1I1XA 1XH2A 3WMBA 1LJYA 1EIBA 3AZRA 5ABFB 5A2BA 2GVYA 2VJXA 1QI5A 4F8XA 2NT0A 3WKZA 4UOJA 1E4NA 4W89A 3APGA 1AQ0A 4GQQA 2DEPA 5ABHA 1V3IA 1E6ZA 2FHCA 5ABGA 3L4VA 1MW2A 4B3KA 1VJZA 1JI1A 3AMLA 4HZ8A 3QR3A 4TX8A 1TA3B 2J7BA 2XSAA 1QI0A 5CGMA 1HXJA 1JGIA 4AC1X 1W9UA 5A1AA 2J75A 5D4YA 4BZYA 2OSWA 2CBJA 4MAVA 3AICA 1FP8A 3W53A 2JE8A 1WDPA 1E9LA 1ESWA 1KXVA 2CEQA 3RDKA 2VRKA 1O6IA 5GNYA 4Q7NA 4PTWA 3MKKA 3AHYA 5EFFA 3WF3A 3WD1A 1E3ZA 1UWRA 2YA0A 5E0CA 1U2YA 4UQEA 2W91A 1VEOA 1KCKA 1B90A 2YL8A 4YN5A 5I79A 4C7DA 4AD5A 3CH9A 1PIFA 2OLHA 3II1A 1VAHA 5A6LA 2WHJA 3ARZA 2VX6A 1E6QM 3LMYA 3CTTA 4AISA 4B15A 4U5IA 2WSKA 1VENA 1H49A 4P7QA 1ISXA 1UYQA 2Y4SA 4AD0A 1TMQA 4AZHA 1G1YA 3AHVA 4W86A 3WENA 1EA9C 1W9DM 4Z2GA 3N12A 4AEEA 2UY3A 3WQVA 5AC5A 3VNYA 2EBNA 2ZUMA 2ZX8A 5JBEA 5KEZA 4UFJA 4PMRA 2J25A 2PF0A 1E4IA 4MAZA 2FHFA 4DWSD 2VRQA 4CD8A 4UFIA 4YHEA 4ZE5A 3BAKA 1BHGA 2WHKA 1W91A 1V3MA 3PTQA 1M03A 4CU7A 5A69A 4U3AA 1EOKA 1V6YA 2E9MA 2EPNA 1PZ3A 4IISA 4GO8A 4R27A 3J7HA 5A6AA 1JAKA 3AZSA 2DSWA 3AHZA 2J8FA 4TVDA 1DP0A 2A3CA 4QCFA 2X0HA 3PTMA 1JDAA 3G6MA 3WH8A 4HU8A 2CERA 2JF6A 5EBAA 4D1IA 4W8BA 2WANA 2VX5A 2DT2A 1V02E 1NP0A 4JFSA 4P8VA 1H1NA 3EDKA 3VDAA 2ZUUA 1CGWA 3POCA 3FHQA 2CCRA 2EO7A 4PBGA 5D8WA 4P8WA 3GH4A 1JXJA 1CGYA 1E1FA 3WD4A 1XD0A 3L2LA 3PZIA 3HMCA 4PUEA 1XSJA 1ITXA 3GNRA 4KRUA 2DDXA 5CLWA 2PB1A 5A8MA 2PWDA 3GYCA 4AIOA 1XSIA 1H3GA 1WB0A 4W87A 3IAPA 6A3HA 1BPLB 1KWKA 2WPGA 2DT0A 3ARUA 4WSKA 3GDBA 3L4WA 4D6GA 4KRTA
chains in the Genus database with same CATH superfamily
4JPGA 2GJXB 2D0GA 4FF7A 7REQB 4FX6M 2IQTA 2VHLA 1P0KA 4C1NA 3A4AA 2ZRXA 3B8DA 1CPUA 2DZSA 2O7SA 4CCEA 4DJFD 4I6KA 4R3UA 3LM3A 2FVKA 4LY4A 1QBBA 2Z2BA 3HIJA 1EKOA 3KL5A 2DZBA 3UZYA 1DIOA 5LGZA 4HA3A 2NQ9A 1BYAA 1JR1A 3GYEA 1E1EA 4UQ9A 4DVOA 3KDNA 1TWSA 3SCNA 2QJHA 2W79A 3H2CA 2VR4A 4IIGA 3L23A 3NSMA 5FL1A 4UBPC 1U1UA 4DUWA 2CZEA 1FFRA 3URAA 4XAPA 4DBSA 4Q7IA 1BTCA 1ME8A 4K38A 1VQTA 4U28A 4C65A 3UYIA 3LG3A 1LT8A 5C9WA 5IHSA 2PGEA 1HKMA 1YQ2A 2HV5A 3NQCA 3RX4A 3BC9A 3KBWA 1HJVA 5C9UA 2VYOA 3KP0A 1DYSA 4XX6A 3SB0A 4Q8MA 2VCCA 3URQA 1JZ5A 1EQPA 1H41A 2V2CA 1KD0A 4ZA0A 4JX6A 3T78A 4IIBA 4KEVA 2YIHA 1EP2A 5D2VA 4B4HA 3BAXA 1XLEA 4E2BA 4M6QA 1A5BA 4CQ8A 1VFHA 2V69A 4JHOA 1POKA 1XP3A 1JD7A 3RXZA 3BURA 3TYEA 4BF5A 2UBPC 3M44A 1FCBA 4DJEA 4O4WA 4GGHA 5FEXA 3N17A 1OFQA 4PCNA 3QBUA 1M7XA 5FJPA 1S5NA 4I8DA 2BOGX 4RW5A 1POJA 4H7VA 2VGFA 4JTGA 4IG2B 4ZXOA 3IVTA 4YTRA 3N6JA 3WDQA 4EF8A 2CLEA 4UTLA 3LA4A 3FVDA 1MRAA 5CC5A 4A2SA 4OBRA 3FYPA 4FNPA 3KBSA 1UC4A 2ZVIA 2OO6A 2SFPA 3WUEA 1Q45A 3TDFA 1P0EA 2UV8G 3STFA 2HJPA 3UD6A 3ZSTA 3DHUA 1MYRA 3FXYA 3NVDA 4TX6A 1BAGA 3OP2A 1JUKA 4LJ3A 3GIPA 3BARA 3PZQA 4YCPA 1SO5A 1TV2A 1XYZA 1J2BA 3S5SA 1SR9A 1FUYA 3MSYA 1VB9A 1SSDA 4H8UA 1VH7A 4FR1A 1KM1A 1F6PA 5HATA 1PHWA 4AFYA 1MFVA 1E9IA 4JIHA 4GIAA 2VR2A 1P0DA 2WJDA 2PE4A 2ZBTA 4AF0A 3ZOAA 2CWXA 2E1WA 4Q6XA 5C9ZA 2ZRUA 3PZOA 4WXYA 2OQYA 4ACZB 4IHCA 4KT2A 1J0KA 2BY2A 3C8FA 1XH1A 3VUSA 3VOJA 3T0AA 2WVTA 1JYXA 4XAZA 2E6YA 3H22A 2FLIA 4UZSA 4LCQA 2ZXDA 1GOWA 2KAUC 2DSVA 4GXPA 2HEJA 3WY1A 3EX6A 4B3ZA 1DPMA 4DLFA 2YXXA 3QYSA 5CSYA 5D04C 1JI2A 1S2CA 1RPXA 4DWSC 1T0OA 5D30A 5A8OA 2EKCA 1TZZA 3AHXA 4H6QA 1FCUA 2HS6A 2EF9A 3I10A 2P5NA 1N82A 3O0KA 1NWUA 1ICPA 1XBYA 2FZDA 3E12A 1YBQA 5BNKA 1O95A 2XGIA 3TVAA 2B7OA 4BI7A 1TKKA 1Z8AA 2OZ3A 2I9EA 2PC8A 3VM5A 2FPTA 4TV5A 7TIMA 5HDRA 1R9YA 2WSYA 4BJHA 2Z26A 3OBAA 3SN4A 4H2HA 1YPIA 1SZNA 3K8KA 3WQDA 3RPDA 1TWZA 1I2OA 3DHDA 4HNVA 1UP3A 3CQJA 4P8XA 1VFMA 4L1WA 3ZO9A 3L4UA 2BFGA 2WSPA 1VF8A 4DB7A 2X42A 4RUBA 3TC3A 4J3SA 4Q8PA 3L4TA 4O8RA 1UKSA 4JDYA 4MKVA 3R0DA 2OG9A 3W7QA 4KESA 3WEZA 3MPGA 1C7SA 1LL4A 2P76A 5I23A 1UZ4A 3C8NA 4XV0A 1W2PA 1WZMA 3N13A 3VIFA 1RQBA 1BFNA 2FMNA 1UHVA 4S1FA 3CZ8A 2E25A 4LQ1A 4D6IA 4W93A 3T0BA 2PLCA 4AW7A 5JVLA 1JZ2A 1XUZA 4BS0A 4FEZA 1LBFA 3QVQA 1U5HA 1DJIA 4R9XA 3K1GA 3P60A 5AKQA 2WYSA 3WDIA 1GG1A 4YYFA 3STEA 4IFRA 4GG9A 1BRLA 1FBAA 3ARSA 4IPPA 3PSWA 5IBXA 5LSMA 1OG6A 4G5DA 3U5YA 2EG8A 1QUMA 5FD0A 3D5HA 1H7NA 1XGDA 2YZRA 3RJXA 3TZNA 1SU5A 4H9MA 4RE0A 1IEVA 1PBGA 1KR1A 3QYQA 4ZFMA 4ATDA 3VD4A 1BKHA 2OZ0A 2E6AA 3BICA 3BOXA 5U4NA 4W7WA 2ZOXA 3C4UA 3P2VA 4GXWA 4HHMA 3VGBA 4MWAC 1T41A 2FH8A 4N9DA 3ARVA 2ZTJA 2CPUA 3WF4A 2PURA 3WD2A 4BY3A 1ME7A 4TMCA 2V2HA 3UBPC 4AZIA 1B3XA 1GG0A 2WAGA 3U7BA 3N4FA 3WQ4A 3UR5A 3AXHA 3PY2A 3T6CA 5M5DA 1M7JA 4J3WA 3MUAA 2POTA 1J0HA 2QGYA 4GBUA 2NXHA 4DBEA 2TPSA 4GX9A 5A6SA 1CEOA 1C9WA 4O19A 1A5LC 5IRPA 3VPLA 4LFYA 1KTNA 1MQRA 3EB3A 2TMDA 2NSOA 5KMYA 5AYIA 1S2TA 4NL1A 5BRPA 2QUTA 3B8UA 1P43A 3MTWA 3BLKA 4DN1A 1KFCA 3T09A 1H7WA 5A8GA 1E6NA 1XCWA 4UC5A 1QRQA 2DZVA 5B7YA 2VC6A 3MYOA 2ZUNA 2WZTA 3NEVA 1LTDA 1XPYA 4PRRA 4D8LA 1OHLA 3PNUA 1EF3A 1NJJA 1MXGA 2Z29A 3KUMA 3D46A 1EO7A 1KFKA 2XIJA 3CM4A 1EJRC 3T9PA 4JZ5A 4RNHA 3O05A 2PTWA 3PAJA 4UTIA 3AWOA 1NP2A 1V0NA 1WXJA 3EGJA 4M5PA 3TTEA 2OODA 1Y5VA 1KW1A 1PKLA 1UOKA 2WK2A 3W74A 4MB5A 2DFAA 1E0XA 3CV7A 3EXRA 2V5LA 5AC6A 1E6PA 2RJGA 4AIUA 2RFGA 3UU0A 3QN3A 3W7PA 1F9CA 1R6WA 1OB0A 5CCZA 3TYBA 1MW3A 3CAVA 3OLEA 4S2CA 3ARWA 1W1IE 3CWOX 1UZHA 2QJGA 3IACA 3UQNA 1KXQA 4X9SA 5FKYA 3SQMA 3GXDA 4FNTA 4E4PA 1VJIA 1CIUA 3S5YA 3T0CA 1UQZA 2WKJA 4NX5A 3HFTA 1EB3A 3GWQA 4C90A 3OVQA 2ZE0A 3KZPA 1QNQA 1JQXA 3Q45A 3VK5A 3TN5A 4I9AA 2PPGA 4DO4A 2VI0A 4N02A 3IUDA 1LWHA 3REQA 3ALGA 3QC3A 4ZOAA 4CEUC 1FH9A 3OOQA 4K3ZA 3VGDA 1AMYA 3CUIA 4HNNA 3P0WA 4EPKA 3BW3A 4CKQA 1U33A 4QSHA 1QHPA 3NG3A 4P7RA 2RDXA 2JF7A 2D3LA 2QCFA 1KM4A 1OINA 4GPNA 1TR9A 1GPFA 1ONXA 2YXOA 5LIXX 1KFWA 3NNTA 2C14A 4I8YA 1SW3A 4HCHA 4IQLA 1C3FA 3GH5A 3LGGA 3MVTA 4YPJA 3DKLA 1J12A 2DY3A 2PRMA 4ZQNA 1QPNA 3SECA 4GISA 2ZRVA 5FJUA 5FA5A 3D0CA 1T40A 2OZ8A 1CGXA 3C2YA 3EOSA 4RZ6A 4N4PA 3M5XA 4BK9A 1ZCCA 4N4QA 1M1BA 1QCWA 4Y6GA 2QCGA 3CMFA 2NLYA 5DMLA 1X98A 3F4CA 1ZRQA 1K9DA 2F38A 4LSBA 1IEWA 2P1FA 1Y8BA 4TX9A 1K4GA 4A3QA 5EU9A 1XI3A 4HB7A 5I03A 3G8EA 2W9MA 3WEMA 3ZMRA 4IPNB 4LC6A 1YW1A 3CHEA 1Q2RA 2WZIA 2A79A 2OYMA 1RVGA 5LHFA 4LVDA 3GR8A 4DM1A 1ZB5A 3TSDA 3RCNA 3CL7A 2GZXA 1FVPA 4GI6A 3M0MA 2X7VA 1E56A 4H9YA 4HVXA 1P0BA 4RV3A 2I7GA 5G1TA 4A8RA 4BI5A 4JX4A 2H8ZA 4WUIA 5K9CA 5H8UA 3WLQA 2ZX5A 5AHNA 1RHCA 3S42A 1DWAM 2GK1A 3FA5A 2Y24A 1TX2A 2X2GA 3QHOA 4AWTA 4E5TA 4GINA 1LP6A 1M41A 4TUFA 5DMYA 4O0ZA 3DFYA 5CJMA 1WKFA 3F5KA 4XUGA 1UG6A 2HQAA 4IPLA 3CBWA 1P4CA 4G1NA 2QCDA 1RUSA 4LNCA 1VFFA 4YWSA 2HSAA 2PODA 3SSZA 3MHUA 3AMKA 4S3FA 3AXIA 2ZICA 2EPOA 1SZFA 1ZJAA 3KS5A 1OZQA 3E9AA 3WIJA 1RD6A 1IXNA 2FTPA 4MWAB 2JKAA 2X1SA 5HANA 2DQWA 5I24A 1HQTA 1CXLA 3IJLA 3VNMA 3DESA 3BQ5A 1GKQA 1K8YA 2D1ZA 1CECA 4A2RA 5HNNA 8A3HA 5D8ZA 2WVUA 4XAFA 2WWDA 4RX0A 1E9ZB 4LOCA 1RV8A 3PBYA 2WCGA 4DZAA 3W7CA 1LRQA 3VCCA 4ADTA 1A50A 4GI8A 4XSLA 1B4KA 1FRBA 4MY8A 5F2LA 1KBLA 5I2UA 3VDGA 1UBSA 3KWXA 4A35A 3UR2A 4JTEA 4ADUA 3R79A 3WH5A 3QV6A 4H04A 2WJEA 4OBTA 3AHTA 4DNHA 2B0MA 3NSNA 3QM3A 1XV8A 1EX5A 3AI0A 4O8AA 3EA3A 3N9SA 3FY1A 3LCGA 3GDKA 3W1QA 2EXOA 2W66A 3H4GA 3N6QA 3VOCA 3LTSA 3QJAA 4NG3A 3M9YA 3W1PA 3E38A 1DQXA 1H50A 1M68A 1H09A 3AS2A 3FKKA 1J18A 3P62A 1WAUA 1VBGA 4K7VA 5AHLA 3QGKC 1OIFA 1GVIA 1QR7A 9RUBA 4LUTB 3ERPA 4ZO7A 3SBFA 3UWYA 3W82A 3BGAA 3W24A 1FWFC 1I9CB 1VCGA 5GNXA 1CXKA 2C7FA 1NU5A 3CLWA 2W27A 3C61A 1ITCA 2XN2A 3VIMA 1KV8A 2CFFA 5GJPA 5K9XA 2HBVA 1BG9A 5CSRA 4JTHA 3S3GA 3W85A 3SRDA 2QGHA 3E0VA 4BR1A 3LCFA 3LXAA 3PUGA 4Q8WA 4AVOA 3E0FA 3NL2A 3V35A 3VOGA 1TTIA 4QAWA 3DBNA 4WY0A 1V6XA 3O6CA 1LOLA 4GNJA 4UMCA 4F3HA 3PANA 4H9XA 5DFAA 5B80A 5I09A 1E0WA 4XZLX 1W1ZA 1XYLA 1IE7C 3L12A 3H24A 1X6LA 2KX9A 2W92A 1XLHA 3EWWA 4NJHA 4NZ4A 2E8ZA 3S1VA 2OJPA 2PEVA 3IIPA 4Z2LA 2Q8LA 1D8CA 4KEMA 4OKDA 4Y90A 4BQ4A 1FWCC 3I3BA 4PL1A 1EUNA 3AMGA 2KZHA 3NQMA 4MVAA 4CNTA 3ABSA 3AYRA 5DMMA 5K7JA 3GC4A 1U5VA 1V0KA 4K36A 5BXTA 1W1TA 1JIBA 5CPSA 5I77A 1A5AA 2PU1A 4K37A 4HA4A 3I4KA 3VI2A 3AWNA 2W61A 2CLIA 1OCBA 2A1YA 3BGGA 3MMUA 4OVXA 1C90A 4DNMA 4HNOA 4PUJA 3BG5A 1JPKA 1CGVA 2J13A 3TTQA 3B8WA 4LYRA 1FWWA 3NM3A 5LA1A 4EANA 2XIQA 1G9HA 1L2UA 1VHNA 5FJTA 3PJTA 1W0MA 3ZS4A 1EBGA 4WDWA 4IH3A 3IRDA 4O4VA 4M81A 4MB3A 2VURA 3AZTA 4QG8A 4V1XA 4OUIA 4RZ5A 3S47A 3N29A 2OOFA 4LBSA 1FQ0A 2WKLA 2VOTA 4O11A 5EA9A 2INEA 1MI3A 1VIWA 4JGDA 5D2WA 3HZ3A 5FF4A 3NFUA 4YVPA 1A5MC 3UWZA 4LBRA 1OCQA 4PULA 3KM8A 3QFWA 1BXCA 1Q65A 5FAGA 5JH1A 1GJWA 1LYXA 4ES4A 3WLPA 2VC7A 2WC7A 4JR5A 2XSXA 3VIHA 4E6MA 4IZGA 4YTUA 2XU2A 3QW3A 1HIZA 3HPAA 3A5VA 5ABTA 1B1YA 3GXPA 2FPYA 1TPVA 4N42A 1KGXA 1P6WA 1RXOB 4RK8A 1WCGA 3UT0A 3W2NA 1P1MA 3PWAA 2ZDSA 3N1AA 1VRDA 2V5DA 1A3HA 4Z1DA 1KRMA 2OQLA 2R1MA 2GQ8A 4DYKA 1X96A 2DZUA 3PJUA 5CAHA 3TYCA 1SW0A 4Q6JA 2W62A 2P8CA 1KNWA 4Y9OA 1K70A 3FGCB 1UKPA 3V0UA 1PYFA 4EIVA 3T42A 1NY1A 2BY3A 1OT1A 4DLMA 1SPQA 3WBXA 2V3FA 1TTPA 3RU8X 5LIKX 3SI9A 1G0CA 4URIA 3RLUA 3HU7A 1NEYA 2X30A 2VVNA 4HA1A 1V02A 3RM8A 3O1NA 1SZGA 3AMDA 5A2CA 1WPCA 3W26A 1R86A 2TAAA 2UY2A 5I3HA 3CZJA 4NJKA 2DT1A 1YE4A 1ZNNA 3OB8A 1EGVA 3O2LA 4AMAA 4JQ2A 3BAYA 1SGJA 2A3HA 4WXZA 5FEWA 2CBVA 2YJQA 6PTDA 7A3HA 3QRHA 1E40A 1HT6A 4KFNA 1O5KA 3U6WA 3WH7A 2GOKA 4GY1A 2PDMA 3W2LA 3BJSA 1SFJA 2G95A 1DIEA 1GOIA 3W22A 3MZ2A 4MWAD 3WFAA 2XJ7A 2VMFA 2YBTA 4K8EA 5I00A 1EDQA 4N9EA 3BG3A 2HZGA 5FOOA 1X8FA 3DHFA 1DTUA 1JGMA 5AYZA 1GJPA 3GW0A 1YNYA 2PDPA 2XPKA 2CYGA 1TO3A 4TOQA 5F4WA 1PIGA 1L6YA 2OGYA 2CBIA 3VC6A 4N2YA 3WNPA 2R1PA 3EKGA 1CGTA 1PTGA 1D2KA 1P7TA 3VO0A 1XICA 5I3DA 7ODCA 1A0EA 3BAJA 4PN2A 2J9ZA 3COTA 3N2XA 1EDTA 2G50A 1UA7A 1HL8A 2A7RA 1K8ZA 3MP3A 3KZSA 5C2XA 5AOUA 1UMYA 2PA6A 1VPXA 2ZKMX 1QAPA 4Z1BA 1V3KA 2O9RA 4WGXA 1AH0A 4GI4A 1AZ2A 4MNLA 2Z7GA 4GD0A 1CI1A 2Z00A 3H53A 2YLLA 1ZBCA 1VCFA 4U2ZA 3MS8A 4DO7A 1KCZA 5BROA 3CUXA 5I7GA 3QQ1A 1EYWA 5FESA 1EP3A 4H1ZA 1UA3A 1BQCA 2ICSA 1UC5A 3H7RA 3NZRA 1K77A 4W4QA 4O15A 1PZ2A 1R47A 4FNUA 2V82A 1Y5XA 4GJIA 4Y9MA 3CYVA 1OZMA 1PV8A 1VZWA 4F79A 4B5XA 4XZIA 3MCNA 3B0UX 4FS9A 3HPZA 3CMGA 1HGWA 1OX4A 3A3XA 4RXGA 4ZO9A 3VOFA 4XTIA 3MW7A 1DJQA 2AQVA 3VNZA 2OELA 3S1WA 3O3RA 3UXLA 2QDGA 1QDSA 1IR1A 1OK6A 1EGZA 2FKPA 4HNCA 4R88A 4P61A 1RALA 3P82A 2DVTA 2NUWA 1BVZA 4C6CA 2XTKA 1MEIA 5AN7A 1E1CB 4G7FA 3PZNA 4Q8OA 4CD4A 1PKNA 1DXFA 3QPEA 2AMXA 5CPNA 2R14A 3SCTA 1VIZA 5REQB 4CNSA 4CNOA 3WLHA 4F4RA 2DIKA 3M0VA 2XIIA 1VYRA 2VQUA 3QFEA 2FZNA 5BU9A 2YDRA 1K8CA 1THFD 4D6HA 4BKNA 1KFLA 1TJ0A 1XM3A 4CD6A 4ZXLA 3FN9A 3O06A 1JPIA 3F03K 5CSUA 2DJLA 3O16A 4KBXA 5IDIA 2G3MA 4GYPC 2CBUA 2RGMA 3S83A 1QOXA 2YCKX 4Z1CA 2V68A 3RN6A 4E3VA 2Z1XA 3TOPA 5D2XA 4G56A 1XQLA 1GZ1A 1TMHA 3QY7A 1CB7B 3GTIA 2FTWA 1NFBA 4HJWA 1NDWA 1IWBA 2Q3OA 1NSJA 2OWXA 2XVGA 4D6EA 3WCZA 3G1XA 5E0FA 4RKAA 1HX0A 1PX3A 4XD6A 5DELA 4GVGA 1PVNA 1TX0A 2OO0A 2E3ZA 1ONRA 3DFQA 3KOZA 4JOMA 1CB2A 7XIMA 4CQ9A 1JCMP 3BZGA 1YPXA 3ITOA 4ZSTA 1OC5A 4PTVA 2DIJA 3I3DA 4J27A 4MHBA 4W8LA 2ZADA 3ES7A 3VCNA 1O5RA 4XK2A 5C5YA 4QE4A 1DJZA 1JD9A 1XH2A 4J40A 3WQFA 3EWUA 1XDJA 5ABFB 5A2BA 2GGJA 1FHVA 4UOJA 1FWHC 2QCCA 1AQ0A 5ABHA 3G1DA 1XLKA 4N9CA 4EOUA 2G0WA 1IXQA 3GFXA 3L4VA 3F4DA 3LN3A 4B3KA 1JI1A 1R9XA 4HZ8A 3QR3A 4TX8A 1R3SA 2R9RA 4DY1A 1M6JA 1W6TA 1F6YA 1JGIA 2F84A 1XLBA 1DKWA 4AC1X 2J75A 4E2DA 4YL2A 4MAVA 1B3OA 4U4MA 1ESWA 1QASA 1IT8A 2VRKA 2D2GA 3L66A 1O6IA 3RRXA 4RW3A 4EX4A 3C6CA 1F61A 3ATYA 2W91A 3DENA 2YL8A 3NQAA 3HFYA 4C7DA 3CH9A 1PIFA 1XYMA 3H7VA 2WHJA 4RZ4A 4O16A 3U2ZA 3ARZA 3KS6A 3SY8A 4B15A 4H19A 2YYUA 3BGJA 2PDJA 1WOAA 2R1LA 4P7QA 2Y4SA 1K7EA 1Y65A 3EWCA 4NU7A 3AHVA 3PULA 5CBIA 1U1HA 3CU2A 4W86A 1W9DM 3GHTA 2YXGA 4JY8A 3MO7A 2UY3A 3ANVA 1J2WA 3NO5A 5KEZA 2PF0A 2E7FA 5HAOA 1EXBA 4JIPA 2BSLA 4S23A 3UZZA 3NQDA 4ZQCA 1NQKA 4YHEA 2WHKA 1W91A 2R91A 4TIMA 3TUUA 3M7WA 3N2CA 3TN4A 4LRTA 3AZSA 4LEQA 3AHZA 4UTWC 5H8MA 2A3CA 3DFHA 4DRSA 1JDAA 2VENA 1F3TA 3WH8A 4HU8A 1QK0A 3CAWA 4D1IA 3OODA 3HGSA 4IXXA 5EMUA 1GVFA 2QW5A 5IOBA 4PTNA 1D9EA 1V02E 1BWKA 4QQUA 1HO1A 3VDAA 3APYA 3TQ0A 1CGWA 1I8JA 5J5DA 5K9DA 1JXJA 1CGYA 1E1FA 4G8TA 4UUIA 4QBXA 4PUUA 1VCVA 1M65A 3E2QA 4PUEA 1OABA 4NAFB 1Z3NA 3ITCA 2ZRYA 2C18A 1ITXA 1QW7A 3A9IA 5A8MA 2PWDA 1ELSA 4AIOA 5AZ1A 3A5FA 1F76A 4W87A 2ABAA 1NTHA 1OCNA 3IAPA 3R12A 5I3IA 1KLZA 4O57A 4GIYA 4LV4A 1TPB1 2J27A 3G8RA 1KM5A 4ZCWA 3ZR6A 3UXAA 4PYSA 4L1XA 1NVMA 1V8EA 5L9FA 5JIWA 1W3NA 3W1AA 1SM9A 4H83A 3WMCA 4CU6A 4XO7A 4DPPA 1A49A 1FWJC 1GQLA 2WO5A 3N15A 1OJXA 3EMZA 2P8BA 5EGRA 1IGSA 4C6KA 3NL3A 4ZMGA 4LUSB 2GDUA 4LTSA 4G7EA 1IWAA 3PM6A 3GXNA 4CLMA 4QG9A 1Q6DA 3UJRA 1I2QA 3W7HA 2TODA 2JK2A 2PD9A 2VZOA 3VFCA 1MUMA 4NZJA 3ZQ9A 1TG7A 1ZBWA 1XUUA 2GWNA 1BGAA 3QHNA 4JFVA 3W3OA 4E3TA 1H63A 4EF9A 1J0YA 4AZCA 5B7ZA 4CNUA 1SJDA 4QTGA 3FFSA 1QPRA 1IEIA 4GABA 1IHIA 1XX1A 1NDVA 3I6EA 3W01A 3B06A 4KWOA 1XLCA 3I4EA 4WLCA 4ZOBA 2C0HA 4GNKB 2PWUA 4DO6A 5A8NA 3U2CA 3M0YA 1NWTA 3ITXA 2PGWA 1W3IA 3PFMA 1A47A 2GJXA 5HJXA 1AW5A 3RYSA 4Q4QA 1W54A 3LHUA 5CJNA 1O7AA 3N2OA 1I2NA 4Y2WA 3FA3A 1HP5A 4JIEA 1OD8A 4C6OA 1TVPA 3TLLA 2PLKA 3VFLA 1LDCA 1J79A 2EQDA 2VX7A 4FXSA 4PFMA 2O9OA 1TPDA 4LAKA 3SGUA 3SW6A 1L8NA 2DVUA 2YCEA 4Q4MA 1HVXA 1PXGA 3QY8A 3U2OA 5LYRA 1J5SA 3UETA 2X2YA 4LYQA 1BWVA 2D22A 4FMVA 1VPYA 3ZVHB 1YDOA 2WM1A 4BA0A 4HP5A 4AU0A 4FP1A 4Y8EA 1S5MA 1TUXA 2X0YA 3LQGA 2CU0A 1BYDA 4EE9A 4MG4A 3QZ6A 3VGHA 1PKYA 5HQEA 1UKQA 1LOSA 4OV9A 4HGXA 2G4FA 4RCXA 2WMHA 2YL9A 2FDMA 2X7WA 3T0DA 2LLEA 4M29A 4S3AA 1ADDA 3CHFA 3TA6A 4F48A 3U2EA 2XH7A 3O15A 4LUIA 5D9PA 1ZAHA 1IXPA 2BVWA 1F4AA 4BF7A 1F4HA 1YXCA 1XHGA 3T08A 4EK7A 1MWOA 3KEHA 4G6CA 3NZQA 3QKZA 4HU0A 3KL0A 3LHZA 1E5NA 2HS8A 4PTMA 2X1UA 2QJIA 5LIUX 4MNJA 4X22A 3URNA 2X05A 2J79A 1ZAIA 1U83A 2J24A 2XIMA 3M46A 1MNZA 3WLIA 1DWHM 3ARYA 3P8IA 1HL9A 3IIOA 4Z2KA 3Q65A 1EJ7L 1UD2A 5AB3A 3W37A 3SCSA 1AODA 4DJEC 4OQVA 3S2LA 4HNUA 1VBHA 5BMXA 2D2OA 1XL9A 1J6OA 1IEXA 2BVTA 2NLIA 3HG2A 1V3JA 4XIAA 3WNMA 2WVVB 4N0RA 1KV5A 3W75A 2O92A 3P61A 3QMSA 4NZFA 4UR8A 4GCXA 2WC3A 5A6BD 3AUJA 3A21A 1AK5A 2H3DA 2CWNA 3VINA 2ASHA 4MLJA 3OO2A 2ZYFA 3S5NA 4MB1A 3LQLA 4JKKA 1Z9AA 5C70A 3S2CA 1H4PA 1GOQA 5D32A 2QDEA 1VBRA 4REQB 4AX6A 2QCEA 2QXWA 5AHFA 4JTAA 4RNJA 1DQWA 4FLRA 2DZTA 3P67A 3QC0A 1X6UA 1FCQA 3BW4A 1AFSA 1XG4A 2HVNA 3EOEA 3HF3A 3HG3A 4JXCA 1KBJA 3NA8A 1UB3A 2EPKX 3HGOA 4TXEA 5CC3A 4A8IA 1OVDA 4AEFA 1Z6KA 5CBJA 1OC7A 2VNCA 3MI3A 5DLCA 5LNWA 3W1TA 5A6MA 3TC7A 1S3HA 3E2RA 1DHKA 2C79A 3LCXA 1ECEA 4LT9A 3S5OA 1I60A 5I3KA 1FTXA 1M7PA 4S39A 1E55A 4M1BA 3WD0A 3VNIA 3CUJA 5DN1A 3BL3A 4LVFA 2ZZ4A 3IEBA 1T96A 4Q8QA 4QCEA 4ROPA 4PC8A 4D1JA 4QP0A 1Y0EA 3GZ3A 4HTYA 4L6HA 3EX1A 1J4EA 1YDVA 3BK0A 1OG0A 3UY7A 2ISSA 3EDFA 4QJ3B 4L9XA 3I68A 3MI2A 3DC8A 3R1ZA 4QG6A 2CZ5A 3ATZA 5F1UA 3LEPA 1SJCA 1HKKA 1DV7A 3IUIA 3W7EA 2E6DA 4D8AA 5C8BB 1L9WA 3GM8A 2VFGA 1ZAJA 4E38A 3PTKA 4P7OA 3BMXA 2QJJA 2VX4A 4NNAA 1BF2A 5T91A 1JCNA 3V18A 4ADSA 1EDGA 4H7CA 1K02A 2QS8A 1UKOA 3QV8A 3VKCA 1QTWA 3M6YA 3C0SA 6REQB 4JQ3A 4LW7A 3PG8A 2B81A 3VOHA 1KXTA 4HN8A 4JCLA 4NSBA 1UCWA 1LT7A 2FZBA 1RQHA 5C2GA 2QF8A 2EJAA 4C6EA 2CW6A 2EHHA 4PUWA 3F7JA 3QZEA 3UCQA 2PD5A 4MJZA 2CIPA 2NVCA 1CDGA 1RLCL 3S5ZA 4AHPA 1CZ1A 3LLFA 2PDKA 3EA1A 3LU2A 3LX9A 1CLVA 4FIQA 1XIBA 4V1YA 1A53A 3EWZA 3VMOA 2O9TA 4XIMA 1UPMB 3TLQA 2ISDA 4JAWA 3B8VA 2F61A 3CUGA 3EMQA 4H9TA 2JKPA 3WLKX 3CHDA 4V2XA 3DZ1A 1NIUA 1YPFA 5DY2A 3VILA 1NOUA 4XZ9A 1DJWA 3K46A 4LCSA 2PDNA 2FDSA 3R8RA 4M6PA 5FL0A 2QPSA 5FF2A 4IJBA 3BUVA 3G0UA 3A6OA 4MLRA 1QHZA 3QKEA 4YS1A 2W6RA 2CLFA 6XIAA 2JQXA 4PMNA 5IBXC 1QNSA 4C6IA 1H11A 2B7NA 3NCOA 3TCSA 2H8XA 4TTGA 3N4EA 4PMVA 2XUCA 3O7UA 3B9OA 3CQKA 3OGVA 2R94A 4M51A 1ZLPA 3V0TA 5A3HA 2WVSA 3LHTA 3VUPA 4IT1A 1LG1A 3O6DA 2C13A 5KZDA 1BG4A 4WSHA 4A22A 2V5KA 3W6MA 3FYOA 3EXSA 4XBKA 3ARPA 3PZ9A 1J9YA 2V3DA 1BSLA 2DW7A 4FLQA 2EPHA 1IT7A 1SO6A 2DSZA 1SJBA 1TPH1 3W2MA 1GVOA 3NQ8A 3NZPA 4AZBA 1GK8A 2RH9A 4QFUA 5AC4A 4DYJA 2E4TA 4LAZA 3S2JA 2TYSA 2P3ZA 2VGBA 3DERA 2OEKA 3A23A 4US5D 3ECQA 4KWVA 5CG7A 1ZSXA 1WZLA 3TQKA 3HGRA 4S3JA 1TR1A 3IIVA 4O54A 2VVSA 4L4OA 3VIOA 3MJYA 3PBWA 5JXQA 3OVRA 4KQNA 4YTQA 1FCVA 3PC0A 1WV2A 3CNYA 4NRSA 1K7FA 1LROA 2E68A 3GUWA 1QU4A 3VU2A 3Q58A 3MYPA 3KRUA 2YL6A 5D09A 3A64A 4H00A 2R24A 3AIVA 5CZJA 1RQEA 1S2WA 2FJKA 5I3FA 4W7VA 3A3HA 4EAYA 2VXNA 2WLZA 3AQUA 2GQAA 3WDPP 1QO2A 2WHMA 1Q7QA 2BTMA 1GPWA 2GVGA 3GR4A 4M7SA 1R30A 4E4FA 5FJJA 3NEHA 1EQCA 3MCOA 1FOBA 4FAMA 3P14A 1U30A 4LBUA 3W6LA 3ZM8A 3IJ8A 1RY0A 1XSKA 3OGSA 3UR8A 4M56A 3FAWA 2GDVA 2X16A 1TFVA 2A5HA 4HYRA 3EOLA 1XRSA 3DGRA 4J1OA 3RG6A 1XYAA 3W7DA 4HKPA 1R2TA 4J7RA 2WZHA 1W3LA 2Y2WA 1PDZA 3FXGA 4K7YA 1GT8A 2XZ9A 4L80A 4M7TA 1W8SA 4TV6A 3GC2A 3OIHA 1EC7A 3MDUA 3QLDA 1XF0A 1NWSA 3DFPA 1VEMA 4MADA 3CWHA 3SO7A 1PPIA 2NV9A 1F6KA 2W0UA 3AUOA 2QHAA 5C7VA 3U9IA 1JNEA 1YYAA 4GC4A 2GVJA 4B2DA 1UD4A 1QNPA 9XIMA 4XKMA 2W5FA 5EB8A 3C2OA 3HQNA 2C1IA 3CZLA 3MP5A 1KRAC 4M80A 5E93A 3EDEA 4HMCA 1MMFA 3WQ5A 2VCAA 3TK7A 4GE8A 4DBDA 4QS6A 5A8QA 3L4ZA 5H2ZA 1V08A 4AF0B 4PR4A 4UTTA 2VQTA 4IIDA 2GL5A 1Q6CA 4MGGA 4IGHA 2ZXBA 3SCVA 2Z1SA 4PMJA 4O1DA 4XWUA 3P7YA 1T6MA 1KTBA 4DQWA 3LCWA 2QJMA 3RRAA 2FZ9A 1VGAA 2HPIA 3BSMA 3H55A 3R6IA 4R7WA 3M07A 4DWSA 3R10A 2FVMA 5GJNA 3ITGA 1TV8A 2B31A 4LS1A 4OT7A 1HJSA 4NZ3A 2JEPA 2BMBA 3DHPA 2QIIA 4HTBA 2UY4A 4NJGA 3TR2A 3CS2A 2FGZA 1XIJA 4FIRA 4LCRA 4RNIA 3W7MA 1B9ZA 3RIKA 3NAVA 4LVAA 3CB8A 3RLGA 4CGTA 1LQ2A 2FPVA 2XVKA 4MZYA 1RA5A 5JBDA 1YBQB 1K7XA 2Z1VA 3TEVA 3NXFA 1WQ5A 3L0GA 5BZAA 3LLXA 4D71A 4HQVA 4MUPA 5C9RA 2F6KA 1HKVA 3WH6A 2AGKA 3E74A 3OJGA 2OYKA 1W8GA 4LWWA 2NWSA 6ENLA 4O50A 1KBKA 3W7KA 4J28A 3VIJA 2FGBA 1V0MA 3B05A 3LYEA 1PSCA 3NGFA 3PS7A 1O66A 4IGMA 1PTAA 5CLTA 2W3ZA 2YBVA 1SJAA 3E6EA 5LNUA 3VKJA 5MF5A 1DWJM 2PDQA 3DYMA 2ODOA 4X9YA 3G3DA 4LEFA 1FDJA 3GH7A 5HBFA 1B4EA 3TJLA 1W9XA 3VIGA 4K39A 2ZIDA 4ICCX 1FDYA 1KTCA 3PF3A 3GBDA 4XTDA 4M8UA 2X1IA 5CZ0A 1TWDA 3ZLGA 3HBLA 1R5YA 5LZLA 3L5MA 4J3ZA 3W0KA 4IL0A 1Z69A 4KMQA 2BXYA 1BRLB 4B90A 1JCYA 1EYEA 2DSKA 3W84A 3QW4B 2A6LA 3EWXA 5K3VA 3GTNA 2R1NA 3TSMA 3V5FA 2J66A 1GHRA 4I90A 1IQ8A 3EZ4A 2PBGA 1FKXA 1XCFA 2Y8VA 3DAQA 2DGAA 1V6WA 5J04A 2PS2A 3CO4A 3LM7A 1UR3M 2VD9A 3BE7A 5E6ZA 1OX6A 1JYNA 3FS2A 1JRBA 1PCKA 1YADA 3DFTA 1EUAA 4YTSA 2NQJA 3R11A 1YE6A 1H0GA 3G77A 2Y7EA 2ACQA 1F07A 5CEWA 1YKWA 1DWIM 4GHRA 4GJJA 1J01A 2RGLA 2I9UA 1YTEA 4ZO6A 1TUFA 4P7LA 1VFTA 3U4FA 4R34A 4XAGA 3RCYA 3TQPA 3B8IA 3C0JA 2YX0A 1PIIA 3E1F1 3WYZA 2A0NA 3EWBX 3SCQA 2OR2A 4U2YA 4QS5A 2ZQ0A 3VMNA 4Q8VA 1M3UA 3BVJA 1JJKA 2A7PA 3USZA 2PFHA 1K1DA 2ZCGA 3WF1A 3ZYZA 2P53A 1G5AA 1H7PA 3K8LA 4AZGA 5HUPA 5BXPA 2FZ8A 3ME3A 2VFDA 1R87A 3RO8A 3VGGA 4K8GA 2QUVA 5TQLA 3VE7A 1W1PA 4AXNA 4GYJA 3CAKA 3MWCA 3ANUA 1KM2A 4JD4A 4POCA 2YDQA 3E2VA 2W67A 1D3HA 1VR6A 2WJZA 4I5RA 2ZUSA 3TWAA 4C6MA 4Z1YA 2ZUVA 3ZT7A 2I56A 1XLLA 1R3YA 1BYCA 2ATSA 3LS9A 1IZCA 1U1JA 3KOWA 3KL3A 3HPFA 4QJ5B 3ARRA 3PWGA 3FLUA 1A0CA 3CO8A 3OZYA 1Q8JA 3G1RA 1Q4NX 3GB6A 1XRFA 1QT1A 3ZFHA 4B5TA 5FEPA 3SN0A 2BX7A 5TD4A 4MB4A 3LD5A 4DPQA 3V75A 2G3NA 1JYVA 4YCOA 4GGBA 3H2OA 3D3AA 3NQ2A 5C54A 5BWFA 4XZMX 3SRKA 3IJDA 3NDYA 3EKLA 1Q6QA 1TPC1 4FA3A 4AY1A 3O07A 1ME9A 3TFCA 2J77A 1RK6A 3MA8A 2HXTA 1UR0A 2WSQA 1OFEA 2V5CA 4DJED 5HPCA 1Q6LA 3ABZA 3B4UA 3PN8A 4C60A 3W7LA 3H2FA 3WQ8A 3CH0A 1AA1B 3GX9A 3PBUA 2YSWA 5E1QA 1HJWA 2Z1KA 3N4AA 4F0LA 2BXZA 3WF2A 1JZ7A 2OPJA 4NILA 2ZVRA 1I2RA 3W2JA 3AIWA 1TA3A 1FH8A 3RR1A 1W1YA 1LBMA 5JBFA 5C0QA 4JYDA 1CYGA 3IANA 3HA1A 4JKLA 4GCAA 1SMDA 4W7UA 2WC4A 1JZ8A 3LBCA 3VM7A 3WNOA 2J7DA 3H2EA 3XIMA 4M3PA 1GEHA 3GSMA 2CKSA 1TJPA 1N8IA 1IEQA 3IK4A 4CQDA 1XYCA 1L6FA 4PODA 3WUGA 4GH1A 4YHGA 1OY0A 5D2YA 4PCTA 1DORA 1IV8A 4Q4SA 2EJ1A 3WBAA 2AKZA 1KXHA 2A2IA 1FWDC 1YDNA 3BLFA 3ZJ8A 5CZSA 1CNVA 3OW1A 1PWLA 3R4IA 4KCVA 1S46A 2P0IA 4E8CA 3T2OA 3CZGA 1W37A 2JKEA 3W73A 5GQBA 4ZZ9A 3AIEA 1YRRA 3OIXA 4DX3A 2I5QA 1S39A 3QQ0A 2J8TA 3AS3A 2PC4A 2MUCA 5DXYA 1I4NA 2V9DA 1OGBA 1D7FA 3NQEA 4JIRA 2JIWA 1NARA 4JTSA 1QI4A 4R7JA 1UR8A 2DUXA 1SMAA 4NZCA 2OYLA 3H23A 3T40A 2BGSA 3N11A 4A8NA 3IIXA 1FWAC 3OLDA 3BLEA 1T99A 4JYEA 5DRCA 3N34A 3OZPA 4C7GA 1QHOA 3B9EA 1RCOB 1WAWA 3KDOA 2Z27A 2XVLA 4QGCA 1AD4A 3QPZA 1CLKA 1EXPA 4GZIA 4HU4A 3F5JA 8XIAA 5HUOA 3T8LA 3PPGA 2VDGA 3S1UA 4I9MA 4GWEA 2AL1A 2AAMA 3KRZA 3QSTA 1Y7VA 1A80A 1NOWA 4IMGA 3R8GA 3TOYA 4ZEPA 1TZ7A 1KM0A 4UNLA 8RUCA 3TW9A 3CJPA 1XQKA 4RDZA 3TJ4A 1JF5A 3TYAA 3DKJA 3QQWA 1XDLA 3P80A 2GK1B 3CT7A 2DW6A 1MEWA 2VFHA 3PBVA 3MANA 3NO1A 1LL6A 4ZOCA 3F1QA 3MSDA 2BVYA 3B8SA 3VX1A 2BS9A 3SCOA 2G3JA 3TW7A 4JNZA 3UW6A 4PMXA 4UOQA 2QCDB 5CPLA 4J35A 4L64A 2B4GA 3N04A 1ZPTA 4AD1A 4RZBA 1OIMA 2YB1A 4L9YA 4J3VA 4UB9A 1FWTA 2ISWA 3RHGA 3N2MA 1DIKA 4PEKA 1P5BA 1ZZMA 5CJ5A 4PCSA 5I3GA 1JCJA 1OX5A 3ZSSA 1HF6A 4ZQRA 3DYPA 1B5TA 3GIYA 3LCHA 4UTUA 3GTFA 2C71A 3AXMA 3WUFA 2Y62A 4NYUA 1IF2A 1RD5A 3XINA 7TAAA 1AMKA 1RY8A 3S2NA 4O1AA 1XIGA 3V7PA 5CKSA 1GQIA 6ALDA 4DEFA 5JIPA 4E2OA 4Z1AA 3UG4A 1ZJBA 3FCPA 1W1B1 4JTKA 3UJEA 2GVLA 5HPOA 2F6UA 1E0TA 3LPPA 4GVFA 3T4WA 1R2RA 1WKEA 2CLPA 1PX8A 4FLOA 4RPPA 3UGRA 2G96A 4LRSA 3B9DA 3CIXA 2C91A 2ZX9A 2Z4GA 4RDWA 4O18A 2Z0IA 3L0KA 4OFCA 4M6VA 2EPMX 2V5BA 1S1PA 5M1TA 3V5OA 3EKZA 2PTXA 2PDIA 3TAKA 2OKTA 4C5ZA 4O0KA 5I02A 3TC6A 1GUVA 1UKTA 2DSUA 3Q2DA 2I5GA 3OGRA 4PB4A 3ONCA 5AECA 3SUUA 1TJ1A 4KGLA 3ICJA 5DCDA 3QTGA 1JZ3A 3U5UA 3H7UA 3WF0A 4JTQA 5EMLA 1P6BA 1PJ9A 1TZ9A 3UY8A 4O14A 4YMZA 1PX4A 4JFUA 4O17A 3VVGA 5BWAA 6TIMA 1UW9A 1V93A 1H7XA 1S2UA 3AU6A 1EC9A 4H9VA 3B97A 1FP9A 4P2VA 2G3IA 3BAWA 1WP6A 2VKZG 2GJNA 4GQBA 3K4AA 1RK5A 3HO8A 1ZENA 1B54A 2ZWZA 5C55A 1BQGA 2W4XA 2CKRA 4HK7A 4XVEA 3RX3A 2JEQA 1XS2A 3HMJG 3W76A 4ONVA 1TV7A 4X0NA 3RLHA 1CLXA 4GQRA 2XSBA 4IUOA 4A3YA 1OC6A 1TJRA 3H70A 4ZSUA 4DJDC 1HKWA 4US6A 4TU1A 3E96A 1ODZA 1GOXA 1KC7A 1A3WA 2ZXAA 4TR9A 3AAMA 4AXKA 4EWND 3G2GA 4L4LA 3EB2A 4RL3A 9CGTA 3SUVA 2Q01A 3FEQA 3UP8A 1YLVA 4PTXA 1GZJA 4JTDA 3CIWA 5H1WA 3OG3A 2Y8KA 4D8ZA 4EPDC 5HMEA 5A6KA 2A6NA 2BDQA 4X0VA 2IMRA 3UA3A 3TONA 4CCZA 3VABA 4IJRA 1J0JA 2PDGA 2ON3A 1ZHAA 1X7IA 2F7FA 2GVEA 4U33A 5I78A 1L0PA 1XLAA 4K6AA 1EC8A 3L5AA 3JU2A 1BVWA 3S2MA 2GQ9A 1SQ7A 4HOZA 5BXRA 2HNEA 4YJ5A 1ADSA 2D3NA 1S5VA 3UNDA 5RUBA 1GYLA 2WHLA 2WXDM 4X2RA 1NELA 2YFNA 4ZQPA 3CXOA 1E1CA 1NFPA 1DJNA 4RPQA 1J0IA 2CLKA 3GFZA 4Z08A 4F2TA 2G8ZA 2Y5JA 3USBA 3V5CA 1XLGA 3WMBA 1LJYA 1EIBA 1WUFA 1KFJA 2GVYA 3NYZA 3LI1A 4LS2A 3OHIA 4S3GA 5LNSA 3APGA 4GQQA 1F2JA 1MNSA 3NM1A 2VFIA 1E6ZA 2FHCA 1MW2A 3MUCA 1MO0A 2J7BA 1VLWA 2XSAA 3DH7A 4FR6A 5CGMA 3GG8A 4K8HA 5A1AA 3NPWA 4IICA 3KXQA 4FOJA 3ABOA 3G1YA 5H91A 5AFDA 5SWUA 3C2VA 1ZJIA 2DUZA 4UIOA 3EPMA 3TFXA 4PTWA 5EFFA 2YA0A 1M9HA 5E0CA 3V36A 3D6NA 4UQEA 4R33A 1YXDA 4QDWA 5E5CA 2NZLA 1H5YA 4ICMA 2PDBA 2OLHA 3II1A 1EX1A 5A6LA 5HMDA 3H4WA 3R0KA 3T4CA 5F2IA 1OYAA 5AHEA 4H9ZA 4I9TA 3B0YA 3CTTA 4U5IA 2WSKA 4JTUA 2ZZ1A 4JTFA 1REQA 1ML1A 3RX2A 1AQFA 3IUHA 4AD0A 1TMQA 4NIRA 1XG3A 1G1YA 4K2SA 2POZA 1EA9C 1Y5WA 4M0XA 3CL6A 3M5ZA 4Z2GA 3N12A 1K8XA 3C3NA 3DXIA 1AZ1A 5XIMA 2PU0A 3RK8A 3VNYA 3FSTA 3V3WA 1RVKA 4UFJA 3W6YA 3R89A 1G4TA 4BFAA 2FHFA 1XJBA 5LHEA 4XKYB 1K3UA 3WO8A 3BAKA 2CHRA 4PTDA 4CU7A 5A69A 3LI0A 1EOKA 4FOKA 1PZ3A 4R27A 3M4HA 1O1ZA 3J7HA 2DSWA 1Q4WA 1V7AA 2J8FA 1Q63A 1Q8AA 4TVDA 5EMMA 3G6MA 4JTCA 2CERA 4FO4A 2WANA 1DQUA 4GY7A 2VX5A 3ITTA 2PRLA 4C6FA 2VWTA 4ZVJA 4UTJA 3PJWA 1EGMA 1H1NA 2X1TA 3EDKA 4NAEB 4ZOEA 3SRHA 2CCRA 4RXFA 4PBGA 5D8WA 3L2LA 4ZB2A 3V0SA 2PZ0A 3A13A 1NF7A 1XSJA 3GNRA 3BV4A 2PUZA 2PB1A 4PA8A 2HPMA 2IPJA 1Z7AA 3GC5A 1XSIA 2VWSA 1H3GA 2Y63A 6A3HA 1BPLB 4Z17A 2NXGA 4GRSA 1FDZA 3ISIX 3ARUA 5I06A 4AVFA 3L4WA 4PSPA 4KRTA 3XISA 2ZC1A 1IZJA 5E09A 4HPXA 2OXNA 2NUYA 4WDUA 4HCDA 3PZUA 4YXGA 3OYZA 5I6SA 1N7KA 2F8QA 3WN6A 4ACYA 4WKAA 1G6CA 2QVNA 4UFLA 4WGHA 4B92A 1AH4A 4LAOA 4WJ8A 4DO5A 2C16A 2UWFA 1C91A 1WDSA 3TQVA 4M19A 3W1UA 3PP7A 3MUZ1 2GUYA 4GY0A 3PBGA 2IPWA 4HNTA 3H2MA 2DZPA 4JTJA 3W29A 1UASA 4IGSA 4DAIA 1DIDA 2YZ5A 5K4ZA 2OSXA 4U5KA 5A95A 1LLZA 2QAFA 1RLDA 4K1GA 2QZRA 2F9RA 4JNMA 1QPOA 2DH2A 3KBJA 3E5PA 3NPUA 3WLMA 4GZ7A 4B5SA 2XN1A 1OYCA 2WMFA 3UWWA 3GXTA 3KW3A 5HOSA 3UPMA 3NDOA 4UFKA 3UVIA 5HWMA 3CZEA 2Q8XA 4ZL1A 2IQDA 4KWSA 3CT2A 1DL3A 4CUCA 4NZ1A 3GS6A 2YKKA 2WMKA 1OX4B 1SVDA 1HKJA 4N9BA 2VEFA 3IS4A 5G4EA 3VNDA 1UWUA 3DG6A 2FHBA 1ZBKA 1XDMA 3N14A 4S3CA 3KVJA 1ZJHA 1FWRA 2NW0A 2GGEA 1W3KA 1QWKA 3KRBA 3RMEA 2E67A 1E4LA 4HNLA 2VM8A 5D9OA 1GGOA 3ELFA 1BEUA 4OUEA 1UWSA 2YL5A 4KS0A 3UEQA 1E73M 4H41A 1AQMA 1X7FA 1ICSA 2WMIB 5AVNA 3ZWTA 2CXGA 4D6DA 8CGTA 3K4DA 4UNIA 4PUKA 2WNNA 4ERGA 1WDDA 5AC7A 2A3AA 4WEVX 2WZMA 4ECLA 1HO4A 1UR4A 3RCMA 3HTWA 2IW0A 1US3A 3I6TA 1W9VA 4Q22A 3EYPA 3PG9A 1GKPA 2R6OA 4OE7A 2NXIA 2Z28A 3W25A 4GYPA 1QXLA 3QOKA 3DI1A 2EGZA 4GKTA 1ISWA 2HTMA 2INFA 2D24A 1HP4A 3AU2A 5HR7A 3FJ4A 4MNMA 4V28A 3UG8A 1V3HA 4PSRA 1EZWA 1H1YA 3WBEA 3KVKA 2DIEA 2Y0FA 4CVWA 3QF0A 3VD5A 1R3TA 3UG5A 4NJJA 1ENUA 5HNTA 3MU7A 1PZ0A 3MVIA 1ZU8A 1TCDA 3STCA 1S1RA 2XHYA 1HJXA 1UJQA 2VDHA 1PDYA 3BJTA 3CC1A 1GOMA 4QXIA 2D20A 5BU6A 1D8WA 3WLSA 2OQHA 3QR0A 4H2CA 3SY5A 3GLCA 1W3HA 4ZQMA 4B9YA 3MT1A 3S46A 2Z1WA 2P0OA 3L2MA 5D37A 2Q02A 4UFMA 2FIQA 3R2GA 1B3WA 4TMBA 2ZX7A 3L7RA 4ATLA 2F6XA 4OV4A 4I5XA 5KETA 1TREA 3WQCA 2XG9A 5LA0A 3M7SA 1GQNA 2PP1A 3KVMA 3BOFA 3I65A 3O6AA 3ITLA 2WQDA 4AZ7A 1A5OC 2XH0A 1ODUA 5C71A 1YX1A 3QGVA 3MBDA 2IPFA 1Q6RA 4XD4A 1W5PA 4MUZA 5KZEA 4GYFA 1OQFA 1AUSL 3KWSA 5FJRA 2NV2A 1Q3NA 3BMWA 3BLDA 4BWLA 2I57A 2VEKA 2H3BA 4IMEA 3CUFA 1ICQA 2OTDA 3WD3A 2GSJA 1GQKA 2OFJA 3ES8A 6XIMA 3OQ8A 2P10A 3WLLA 1FX6A 3VOIA 4W88A 4D9PA 4DZ5A 2DORA 4UMBA 3SCWA 3UG3A 2OX1A 2CESA 2QPUA 4B4FA 1H62A 3EB4A 5HA7A 2HDJA 4C6DA 5IXEA 1ZBVA 4F9DA 1B3YA 3BZJA 4H6RA 5AYXA 1FHDA 2WVVA 1IIHA 2DT3A 5DO8A 1V4YA 1Q6GA 1BSIA 5DEZA 3GFYA 3GG0A 1O60A 1YNPA 3V4BA 1ZFJA 2WSRA 2Q3RA 2ATMA 4GMEA 4O53A 1WNOA 4MYAA 4Y8FA 3U4AA 3BTNA 5HWNA 4LF2A 3AJ7A 4GZJA 5FAJA 4IP4A 4DI9A 5D33A 4QLLA 2VZTA 4H01A 2BHUA 2XZ7A 5CBBA 5A8PA 1H5VA 3AJXA 3NOYA 4FF5A 1VPQA 1VEPA 5JU6A 4JEQA 4UXDA 4A21A 4C6LA 1YMYA 3EEGA 4HMNA 4UQAA 3RU6A 4Q4PA 3E0LA 2DJXA 1DBTA 2DZXA 4H7ZA 4WJXA 2OLAA 2Z7KA 1K03A 1W3JA 3GZAA 3B04A 3I6RA 4AZ5A 3B4YA 1EF2A 3M5YA 4JL2A 2VZUA 5EFDA 1WZAA 3UZWA 1DWGM 1RH9A 2PTDA 2I17A 2H9AA 1US0A 1RZMA 4ZTXA 1UUOA 2F2HA 1LWIA 1M53A 3CEPA 4FX8A 3QOMA 4LGXA 1H7OA 2BWGA 5G4HC 1KA9F 3LNPA 3TR9A 2BASA 5A94A 5XINA 4IIEA 3G22A 1ZP4A 2O55A 5EMKA 2NVAA 2EG6A 3SIMA 1KWGA 2QYGA 3ABQA 3VKDA 3NIYA 3W7IA 1UD5A 3H2AA 4GFIA 2QUMA 4JTTA 4H6EA 3AO0A 4QJ4B 3H54A 3W72A 5CPTA 4QM1A 2E0PA 5G1YA 2R82A 3A4WA 4QITA 4CNPA 1F73A 2J74A 1XWYA 3P5YA 3THCA 4DJDD 2J7GA 2ZFAA 2QF7A 3LERA 1W1VA 1J5TA 3GDTA 3K5XA 3VDBA 3L0NA 3QXBA 1M5WA 3HG5A 3G5EA 3B40A 4IGNA 3OG2A 4IWWA 1AQHA 3A4XA 1W9BM 2CXEA 4QROA 2VGGA 4QSFA 1EWEA 4XZBA 1UZ1A 4AZCB 2WM0A 2WQPA 5AVHA 1OD0A 3STPA 1JFHA 3VE9A 3TSBA 2UY5A 1B57A 4OZOA 2E09A 3WJXA 4GXMA 4IQEA 1MW0A 2V3GA 4L4PA 4BEUA 4JS3A 3W81A 1DTNA 4MZ8A 4D6FA 3T81A 4XQ6A 1NFGA 4AD3A 4IMFA 3DGBA 3DG7A 3H26A 1VP5A 1X1NA 1K9FA 3AS1A 4O1BA 2GWGA 2JGQA 4J3TA 4DWDA 2QKFA 3QZAA 5HK4A 1RA0A 5HINA 5T26A 5M2FX 1CXEA 3BW2A 5BXSA 1JXKA 1SZEA 3S8HA 2HVMA 1V7YA 3JR2A 2XIOA 5DXXA 3GNPA 2QNEA 4PCFA 4JQAA 4CN1A 2XM1A 3UPBA 5DQPA 4QIUA 5ECUA 3S6OA 1ZTVA 1OM0A 2XFWA 3HQ1A 3SCUA 3QV7A 4JTLA 1PHQA 5CH9A 2XWEA 5HJYA 3VIIA 1NQ6A 3N73A 2AAAA 4O52A 2BZNA 3GBEA 3L4XA 5J8LA 3LHWA 5GVJA 3APTA 4V27A 3NVTA 4C7FA 3GW3A 2C3ZA 3IIZA 1AH3A 4F0MA 4Y9PA 1JZ6A 2J7CA 2GQ3A 2J7HA 1VYSX 1JAEA 3TMLA 1LLOA 4MZ1A 1QWGA 4DUOA 3MJMA 2Q71A 3BSHA 1F3WA 2J62A 2RDTA 1X8CA 3W38A 5GNZA 1OK4A 4G2DA 4LS0A 4NRRA 5I5RA 3BCDA 3PK7A 3CB3A 1R7AA 3GNOA 3UFYA 3MMDA 3NTYA 1XD1A 4Q33A 4D72A 3TWBA 3UZJA 4Q8NA 1EJWC 1WXYA 2J8GA 2O9PA 4IX0A 3W28A 4H4IA 3NJ3A 3KFTA 4NT0A 2P50A 5D03A 1TPEA 2GDQA 2A21A 4JICA 1TMLA 4KCUA 1FFQA 3MV11 3WQEA 1UUQA 3NPVA 1GYNA 4GUIA 4QDMA 5GPRA 3SIZA 2XYLA 4I7WA 3OQEA 1KRBC 1JPMA 3A9BA 3M5VA 3WELA 1Q13A 3ARXA 3G24A 4Q8TA 4I7VA 3G1AA 4P8UA 1QNRA 3CAQA 4ZE4A 1CW2A 3CL8A 2OU4A 1JZ4A 3KE0A 2WB5A 4X63A 3PWIA 3N9KA 3G1SA 1UR2A 3TYUA 3P6LA 2E9LA 3G1HA 1SO4A 4Y7EA 3AIUA 1B3ZA 1FHLA 2XISA 3TXZA 2CLLA 2VD8A 1JDCA 3IGXA 4HSOA 3TJIA 3P5ZA 4FNSA 5E70A 5IM51 3RAOA 1XYFA 3IVSA 4ZODA 2ALDA 4AWEA 1X38A 4I5UA 1FWIC 4IP7A 1KKRA 1HKIA 3SCRA 4HA0A 3M41A 3SSJA 2ZXQA 1D3CA 1YNQA 2Z2UA 1UWTA 4B9ZA 3A12A 4HSHA 3CQHA 2D23A 3M47A 3WLOA 4WX2A 4PMQA 1GVRA 3OLIA 4JEJA 4XZWA 3VD7A 1EWDA 1J93A 5DF0A 4UTTC 2XN0A 1M01A 1QFEA 2L5HA 3LTYA 1B0IA 3E49A 4W8AA 3K13A 1LM1A 4AD2A 1EEXA 4YIWA 1EJUC 4GVIA 4CN6A 1XW8A 4EKJA 2QULA 3SN1A 1WKYA 1XBZA 5BRBA 1MRQA 5G5IA 2BBFA 3LCLA 1P6CA 2PRHA 3RFAA 1DHPA 3Q4DA 4DJFA 3BV7A 3MWAA 5JMUA 3SGGA 4O12A 2DQXA 3CTLA 1VC4A 1E0UA 1JNDA 1TELA 3WMSA 2VDIA 1P48A 1O1HA 5U7SA 3LRMA 3I7SA 3WL1A 3IGHX 2QV5A 3MUY1 4N6EA 4JFTA 3BO9A 3GD6A 4GK8A 1G7UA 2ESCA 2A4AA 4LVGA 3TNOA 4OOZA 1H7RA 3PPCA 1GOOA 2CETA 3HGJA 4R85A 3WDRA 3G6LA 4KW2A 3OBEA 1J10A 1S3TC 2HE8A 1LF1A 4QJ1A 5LNRA 3SRFA 3HG4A 4M24A 3NQVA 2FGLA 3DC0A 1Z44A 4L6DA 4DUVA 4O1CA 4F2BA 3UERA 2V6AA 3AXXA 4GFSA 4JN8A 1QI2A 3PPFA 5AY7A 3AISA 1Z42A 4KETA 1UP2A 1PO9A 2EPLX 2VTFA 3RMJA 4IJCA 1H61A 1LQ0A 2CHNA 3TZFA 4H8VA 2YA1A 4RDVA 4XSMA 2NX9A 1KFEA 1GHSA 4D6CA 3B9NA 5T9CE 4TTUA 2QVHA 2A3BA 3G3MA 2NQLA 3ZIZA 3BANA 4AZ6A 3CZKA 3UZXA 4AHQA 2C15A 4XD3A