1TA3A

Crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor protein I
total genus 99
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ta3A00
5CPSA 1KQYA 4Z2GA 2PC8A 2ZX7A 1BLIA 3PZGA 5CQ1A 4Z2IA 4MNMA 2ZUSA 1GUVA 1V02E 3BAXA 5EBAA 3UG5A 2YL9A 4OBSA 3BAJA 1E0WA 3VIGA 1TVPA 1H3GA 2VQTA 2CKRA 1KGUA 1M7XA 3ARVA 2C8NA 4BQ3A 1BG4A 4MB1A 1JZ5A 1QW9A 4H8HA 1TR1A 4RE4A 5BXTA 4EAMA 3N11A 3FN9A 4WLCA 4E2OA 3WNKA 2XVGA 4MB4A 3TTOA 2D1ZA 1ISYA 3CH9A 3VIIA 1AMYA 4GXPA 1BGGA 3VD5A 4KMQA 1W3HA 2CBUA 1DWGM 1KWGA 4Z2HA 1L0PA 2WWDA 1KXTA 3PTMA 3FW6A 2OWWA 1TZ7A 1ZBVA 3UETA 3N13A 4MADA 2DSWA 3CO4A 4CU7A 2WM0A 1TA3B 2BNJA 1B3XA 2ZX5A 1UOKA 2WHKA 1ITCA 3NUKA 4MNJA 4H8VA 3AZTA 3OLEA 3ZM8A 1NOWA 4JL2A 3QHMA 3CZJA 5D9PA 3RDKA 1ISZA 4M29A 4MB5A 4TUFA 4PBGA 5D8ZA 4D6FA 1YHTA 1A3HA 4MB3A 5LYRA 1JXKA 2W67A 2O92A 4WF7A 3WSUA 4UQDA 5CZKA 1UR8A 3FAXA 4PUDA 4W8AA 5A94A 4W89A 1ZU8A 1FA2A 4JFVA 2PWHA 4WJXA 1RPKA 4ML4A 2VJXA 2ZUWA 1SMAA 2V3GA 1IV8A 4U3AA 1L8NA 3NDYA 4GKLA 4GZEA 4ATDA 3L4VA 3BLPX 5M3WA 2XGIA 2WHLA 3MMDA 3OLDA 2YLLA 3PZVA 3LPOA 1UR4A 4Q7NA 1E70M 1KXVA 1Y7VA 4GIAA 4KH2A 1E6RA 3WUEA 2CITA 3GXIA 1W1TA 2XSBA 3VPLA 3GXDA 4TTUA 1E56A 4AIUA 4W7WA 2WC7A 2QHAA 3DHUA 3EDKA 1V6XA 2WLYA 2FHFA 4JAWA 1LG1A 1GPFA 1VB9A 3B9DA 3E1F1 4B3KA 3HJEA 2J7HA 1ODUA 4AZ5A 2X09A 2DIEA 4AD1A 3PZ9A 2CHNA 2CPUA 2XM2A 2VCAA 4LXFA 2ZXBA 5CSUA 1JD9A 1XCWA 4CUCA 3KEHA 1UWRA 3AZSA 2BY1A 1JYXA 1IT0A 3F5LA 5FOOA 4AD2A 1QW8A 1CIUA 2WCSA 3WKZA 1XYZA 4M1RA 1E43A 1FH7A 2WVSA 2VZVA 3SUTA 1EQPA 4E8CA 3JUGA 4Z2KA 1KGXA 5CG0A 2WHJA 4U2YA 2WKGA 3TP4A 2V5DA 2E9LA 1PBGA 3W26A 3EDJA 4HOZA 4ATLA 1EOMA 2GK1A 1J0ZA 4ZE4A 3POCA 3FY1A 3EMCA 4YHGA 1XH1A 1MFVA 5EFFA 1OT1A 3BCFA 2XVLA 2VZOA 4D6IA 3M6DA 2XWEA 2DH3A 4UQEA 2CBIA 1E0XA 2QMJA 4PCTA 4M56A 3TOPA 3HU7A 1V6YA 4EKJA 3U5UA 1E6SM 4IM4A 2WC4A 4PTVA 1V6WA 2WSKA 4UOZA 3SCNA 4D71A 2WB5A 1GHRA 1J10A 1CGUA 4J3WA 4ZE5A 4UFMA 1ZL1A 5F7UA 1QI3A 3EBVA 1UKTA 3WEZA 1X1NA 1OIMA 1XYFA 4DWSD 2PWGA 2VVSA 3VGBA 1J0KA 1EO7A 4HU8A 3AHYA 1KCKA 1V02A 4MAZA 2CETA 2EPNA 2DH2A 1PZ2A 4D6GA 3WMSA 4CCEA 4CU8A 3WNPA 4HTYA 3VMPA 1OM0A 1HKIA 2J7CA 1E71M 4Z2LA 4E4PA 1CDGA 3ARQA 3UCQA 1O6IA 1KR1A 3AICA 2EEXA 2G41A 3BXWA 3AROA 2NSXA 4P7LA 1ZBWA 4YN5A 2GSJA 1QNSA 2YLAA 3BLKA 2YDQA 3WD2A 2XIIA 1TA3A 4TXEA 2J8GA 3WF4A 3OB8A 1W2VA 3WD0A 3SCRA 5M03A 1NH6A 4CD6A 1QI0A 1R87A 1R7OA 1FFQA 3VDBA 1W3LA 2ZIDA 1E6NA 1C7TA 4PN2A 3CBWA 3AS2A 4PMRA 2VTFA 1PX8A 3N18A 3S2CA 4AMCA 2B31A 3ALFA 1B3YA 3WH5A 3FNDA 2WMIB 5E9AA 3NDZA 4HOWA 1UWQA 2D3NA 4Y7EA 4AXNA 5BXPA 3GBDA 1V3JA 5JIWA 3VU2A 3WL1A 6CGTA 3MS8A 1HJQA 2DT2A 3ZR6A 1GOOA 1H2JA 4WK9A 2GJXB 3WMCA 3ARUA 4GI6A 1WCGA 2EPKX 2CHOA 1VFMA 2RGMA 1LG2A 4IPLA 2YL8A 4HZ6A 4P7OA 1N82A 1KR0A 3TTSA 3ZQ9A 4D6EA 3WBAA 2UY5A 3OG2A 2DSKA 1AQ0A 1BGAA 3THDA 1JZ7A 2GDUA 4N42A 3VGFA 1X6NA 5I79A 1LL4A 3AMKA 3GXFA 1VFUA 1QVBA 2D0FA 2VZTA 5JBFA 5BYWA 2UY3A 3RMEA 5JBDA 1E55A 2FHBA 3AIBA 4UFLA 1LQ0A 3PZOA 2V3DA 2CEQA 1XV8A 1FP9A 1KBKA 2VRJA 2XIBA 3AHXA 3II1A 4CVUA 3AYSA 1BF2A 3ZR5A 3PZUA 2BY3A 4JCMA 1V3IA 3IAQA 1WAWA 1J11A 1OINA 5CPQA 1WDSA 4GQQA 5D9NA 2DSZA 5LA2A 1W9XA 1JZ2A 4W85A 3BC9A 3ZO9A 1WKYA 5GPRA 1FHDA 3BCDA 3WNNA 2J47A 2F8QA 3CZ8A 3ZJ7A 4D1JA 1JNDA 3UEQA 3CIVA 3W25A 5CJ5A 4AW7A 1K9FA 1F4HA 2CNCA 1XSJA 5A6SA 2ZOXA 4AY1A 1OCQA 4FK9A 3J7HA 5I78A 3MKKA 1KQZA 2XFRA 5EMYA 1E3XA 3DYOA 1C8YA 1WDPA 2O9PA 2GJXA 1J12A 2Y4SA 4F79A 4NF7A 3WQ4A 2J7BA 1UR1A 4W5ZA 1B2YA 4X9YA 2G4FA 3GYCA 1DTUA 1E4MM 4RL3A 3CMGA 5M17A 3F4VA 1UKPA 1JYNA 1WNOA 2J7FA 1UWUA 1E6PA 2XVNA 3LMYA 1GOKA 3W28A 5A6BA 5I24A 2CXGA 4V28A 1YQ2A 4W87A 4F8XA 4QFUA 4JL1A 2V3EA 1GOMA 4MPKA 1G94A 3ECQA 2WW5A 2NT1A 3BMWA 1CENA 3K4AA 4MJ4A 1RP8A 3U5YA 4AD5A 2PF0A 4FLSA 3K8MA 4MAVA 2ESCA 3BMVA 3ARZA 3L4UA 3AIEA 3VDHA 4FLQA 4DWSB 5A69A 4HMEA 1MXDA 1LJYA 1GONA 1RD6A 1J0YA 3TTQA 2BS9A 2A3BA 3L4WA 1KCLA 1DWHM 2E40A 1C93A 3SCPA 2TAAA 5A6BD 2J74A 1AQMA 4MNLA 1PEZA 2XPKA 2W91A 2DSUA 1TE1A 1I75A 4J28A 2F2HA 4H04A 4EK7A 1Z32X 4RE3A 3CHCA 1WZKA 3CZLA 2OSWA 1IZJA 1CXLA 3WDHA 2VCBA 3RO8A 1XD0A 5DT5A 1J0JA 3CHFA 3OLGA 1EA9C 5A6LA 4U33A 4H7VA 3EDDA 3RCNA 4J3VA 4W7UA 1SFSA 1G5AA 3AZRA 3U7VA 4HP5A 1VEPA 1HJWA 3WDQA 3GDBA 1DP0A 1XRVA 4ZXOA 1NARA 2IUZA 1OGSA 2XGBA 4DWSA 1OB0A 3WEOA 1OSEA 4TOQA 1WE5A 3QOMA 1PZ3A 3DECA 4MTVA 1JG9A 4PMUA 3MUY1 2WYSA 3CUHA 5BXRA 3QHOA 1HJXA 4X0NA 1CGXA 4AC1X 1K9DA 2QF8A 3ALGA 1KXQA 1IZKA 3F5JA 2WVVB 2WBGA 3T09A 4AZGA 6TAAA 2Y5EA 4AYSA 1W1PA 2ZUMA 5AC4A 2WZEA 5HBFA 4UNIA 1QNQA 1CXEA 3NIYA 3PZIA 1WB0A 3VO0A 3A4XA 2BHUA 3WQVA 1ZBKA 2WKLA 4L4PA 4PMQA 4V2XA 3NCOA 2BVYA 1VAHA 1HVQA 2JFEX 3CLWA 4QDMA 3O6AA 3TA9A 1I1WA 1C92A 3MMUA 2DQXA 4HA1A 2WMIA 4JCLA 2EJ1A 1VFFA 3N1AA 3ZJ6A 2XM1A 1DWAM 1UKQA 1UD2A 4PRWA 1R85A 3POHA 3BGAA 1BPLB 2UWFA 3QR3A 1QBAA 1BSIA 4B3LA 1GVIA 1GHSA 1B31A 2CBVA 3CHDA 5EFDA 5I6SA 4CGTA 4GZJA 1XGZA 4DUWA 3MANA 3DHPA 1BYCA 3W82A 5JBEA 4D6JA 1NQ6A 5E0FA 1E4NA 1E40A 1E6ZA 1VRXA 5FCZA 1PX4A 1PPIA 5ECUA 3I3BA 4N0RA 1NWSA 4PTWA 3AS3A 4NI3A 1BQCA 2WZIA 4AZIA 1CZ1A 2CESA 2JEQA 2EXOA 2A3EA 3PZQA 4D6CA 2WVUA 3O9NA 4OBRA 1R7AA 3RM4A 3WH9A 3GBEA 1C7SA 1UUQA 2OSXA 1BAGA 2VCCA 1QI5A 1JZ6A 1Q4NX 4UFKA 3IJ9A 4B15A 3IK2A 2YA0A 3LPFA 3S6TA 3SEPA 3RILA 2VR5A 1CEOA 3VD3A 3VGHA 1NWTA 2BXYA 1NWRA 4XV0A 2DT3A 2EPMX 3RJXA 4AEEA 1MQPA 4W86A 1V0MA 4KRUA 5A95A 4NZCA 2PWDA 2IXUA 3HMCA 3IJ8A 3K1DA 2BHZA 3BSHA 1V0NA 1QNPA 3VD4A 1RP9A 2OYLA 4GZIA 2W66A 1EQCA 1ZS2A 3WBEA 3QGVA 3OIHA 2VL4A 4TX8A 4AD3A 3U57A 1G01A 2DT0A 4UFJA 1E6QM 4D6DA 5C8BB 1V0LA 4PMNA 2O9RA 2D22A 3ARRA 1UH3A 1B90A 4UQAA 3OZOA 1VIWA 2W62A 3SCQA 3WH7A 3KL0A 3W6MA 3T0BA 2ZUTA 2WVVA 1E4IA 4FLOA 2AOSA 5JUVA 3AMDA 3N12A 4PMVA 1JGIA 3CPUA 5D8WA 1Q6DA 2EBNA 4HMCA 1W3JA 4B16A 4JKKA 1PIGA 4QLJA 3RM8A 4CCCA 2VURA 4ATWA 3WUFA 3KWXA 2VX6A 1UWIA 1U33A 4CD7A 3SCOA 1M53A 2YL6A 5BRPA 1V08A 1LL6A 2VX4A 3MUZ1 2GK1B 3IANA 5HPCA 4MDPA 2Z1SA 1PX3A 4Q22A 1MWOA 1E72M 2YBTA 5ABHA 3UG3A 3PN8A 4GINA 1E5JA 4EE9A 1MW0A 3VIPA 1R8LA 2PWFA 2UY4A 2WMHA 4P8UA 3CUIA 1Q6EA 2E9MA 2PB1A 3D3AA 4FMVA 2UY2A 5E0CA 3RM9A 1V3MA 2J79A 5D9MA 3GH4A 4U5KA 1E1FA 5A8NA 3K8LA 5HOSA 1ZJBA 4WKAA 4C7GA 1OIFA 3WFLA 1C91A 1CTNA 1CGWA 3DYPA 4QP0A 1HX0A 3SCTA 5A8PA 2JF7A 1TG7A 3AISA 1WZLA 4DM1A 3VX1A 1OBAA 4TVUA 3AOFA 4D1IA 5HNNA 4F66A 8CGTA 3AHTA 1JDDA 1JI1A 1Q6GA 1NM9A 1WO2A 2IXVA 3UERA 4PMYA 2VX5A 1DEDA 2WK2A 3SURA 3T0DA 1BVNP 5E6YA 2VRQA 3VUPA 3WD4A 4CCDA 5KZ6A 3NYDA 1US2A 5AYBA 4DM2A 1D3CA 1V6VA 2ZXDA 1JD7A 3KL5A 3N17A 4PMOA 1HIZA 2FDMA 3WUBA 2XJ7A 1W9BM 3N9KA 3M46A 1LL7A 1H1NA 3WEMA 4UQ9A 3DYMA 3OA5A 3VIOA 5CLWA 5IDIA 1GVYA 4XX6A 1UR0A 1JIBA 4P8XA 4U2ZA 3EYPA 3WH6A 3AS1A 1ISVA 2WCAA 2Y2WA 3GZAA 2C0HA 1G0CA 1E9LA 3SIMA 2GFTA 1WZAA 3VGEA 2VRKA 1K9TA 2D24A 4HU0A 2WMJA 3K4DA 3CZEA 2VI0A 1W9UA 4ZENA 3WF2A 3W53A 3UR8A 3NSNA 3W38A 5I77A 2VZUA 1OD8A 4KGJA 1UD6A 2V3FA 3WD3A 5AC5A 4MJ2A 2YDSA 4NRSA 4PUEA 3AFBA 1CGVA 5IHRA 2ZX6A 4W5UA 3WF1A 1EDGA 3AMCA 4P7RA 3GH7A 4A3HA 1B1YA 1EDQA 3VIFA 3SCVA 4TX6A 2WHMA 4XZBA 1BG9A 5C70A 4PMZA 4H8UA 2A3AA 1UR9A 2ZICA 1FHLA 3ARXA 3LPGA 1J0HA 5CPTA 1JXJA 3WDIA 5FL1A 5I2UA 2ZXAA 1UQZA 2ZE0A 3PHAA 2XTKA 3RIKA 5LA1A 2WCGA 4AD0A 2X0HA 4AWEA 3VD7A 1EHNA 2JALA 3RJYA 4OZOA 1QI2A 4TVCA 1MW2A 1W2PA 1HNYA 4W7VA 3VINA 2RGLA 5M5DA 3BAKA 4R5EA 1W3KA 3ARSA 1EHAA 2J8FA 5GNXA 3A47A 3ZSTA 1QOXA 3MSGA 4U3CA 1S46A 1H0IA 5A8OA 3EMQA 1V03A 2HVMA 1WPCA 5CXPA 3WNMA 2NW0A 1CECA 3GXMA 3QOKA 4CVWA 3CGTA 3WY1A 2QLYA 3WDPP 4A3YA 1BTCA 5HDRA 1R86A 4J3XA 4QAWA 5A6JA 3GH5A 3VIHA 2AAAA 2DSVA 2ZWYA 1BYBA 1SR0A 4BA0A 4JHZA 2XFFA 1E15A 1NWUA 2YDRA 4MNKA 3VDCA 1AQHA 3GNRA 4BQ2A 5IFPA 2NT0A 2DPEA 2BY2A 1B9ZA 5I5RA 1PAMA 1FFRA 1H5VA 4AZCB 4W93A 3PZTA 1OGBA 2VC9A 4S3JA 4UTFA 4C7DA 2YJQA 4PYSA 1XH2A 4CN1A 1HL8A 3U7BA 4L4OA 5A6KA 4J7RA 3THCA 1VEOA 5C71A 4Z2JA 4YHEA 1H4PA 1GW1A 2QV4A 5DT7A 2ZWZA 1JZ3A 4WKHA 1ECEA 2BVDA 2CKSA 1U30A 3ZJ8A 3WDJA 2QPSA 5A2CA 2O9OA 3NSMA 2WC3A 4BZYA 1GQIA 4JFUA 1W9PA 3GNPA 1SMDA 2J62A 2XG9A 3SCWA 5GQBA 3WNOA 1E1EA 1VBRA 2FGZA 4H2CA 4ACZA 5ABEA 3UR7A 3L4XA 4JFSA 4OOUA 3VNZA 2X1IA 1BHGA 5I0DA 4J3SA 4UOJA 1C8QA 2YOCA 3BAYA 2PBGA 4U31A 3ZT5A 5E6ZA 3WN6A 4BF7A 4BQ4A 5JIPA 3IAPA 2W63A 1D2KA 3D5HA 2CERA 5CLTA 5DMYA 2E8YA 4U5IA 4UCFA 5DF0A 4YPJA 1I1XA 2D2OA 1UQYA 2Y8VA 3O2LA 4D72A 5A8QA 1VJSA 3W6LA 1CBGA 1KBBA 1TUXA 3VTRA 4F9JA 3F5KA 3A6OA 4AZ6A 1UD4A 2WSPA 1CWYA 2X0YA 4UQCA 4WSJA 3VM7A 4OOZA 2JIWA 3SCSA 3WDRA 3ZJKA 1M01A 3B9EA 1JNEA 1B3ZA 4UFIA 3VD9A 1UH2A 4WSKA 3DC0A 1UHVA 2XYLA 3MMWA 1KFWA 2WANA 2G8ZA 4XUYA 3VIMA 1D7FA 1P6WA 4W8BA 5CSYA 3WMBA 1QNOA 3OGRA 3VDAA 5BRQA 3WQ8A 1B0IA 3ZT6A 4AZBA 5A2AA 3WF3A 4ACYA 4TTGA 3WL0A 1G1YA 5GNYA 1DHKA 2EPOA 4UFHA 3EMZA 2FHCA 4M81A 5FD0A 4PCSA 1J01A 1SYTA 4AIOA 3NSXA 3AXHA 3CUGA 1BFNA 3W0KA 3WELA 4KRTA 3ARTA 1H0GA 4FF5A 1RH9A 1ODZA 1US3A 4UOQA 5I23A 2WLZA 2OYKA 3GM8A 1XC6A 4M24A 2JE8A 2DGAA 2XSAA 2J25A 4A4AA 2MANA 1XCXA 1CXIA 5FL0A 1EDTA 4M8UA 4E8DA 3ZSSA 3L2MA 2YBUA 1M04A 1JFHA 1E4LA 1GORA 3N15A 1UD3A 1QI4A 3BAIA 3L4TA 1XHGA 1G9HA 1CXKA 4LYRA 5A8MA 4P7NA 2XFYA 3VILA 2J75A 3CTTA 4HOXA 1ZBCA 1CXFA 1JI2A 2BY0A 2F61A 1HT6A 3MSDA 4HPHA 1ISWA 4MDOA 4UQBA 3M7SA 4S3KA 1QHOA 2Z1KA 3AIWA 1H11A 4CU6A 1WP6A 1E0VA 2VR4A 4W88A 2A3HA 4PMDA 2BXZA 5KEZA 4PEEA 2WZHA 1V3KA 1Q6CA 1GNXA 3I3EA 1DWFM 5AY7A 4HA3A 1KB3A 4J3TA 5TD4A 4AZHA 1NOFA 1J9YA 3VM5A 4OIFA 4CN6A 1JYVA 3N04A 3T0AA 3T2OA 1CLVA 2E3ZA 1U2YA 1V0KA 1J18A 1MW3A 3AQUA 1HP5A 4OUEA 3ZOAA 3K8KA 3W29A 1JYWA 3OGSA 1UH4A 3APGA 1NOUA 4PTXA 4CD4A 2YL5A 2JIEA 1GJWA 1UYQA 1LWHA 3AXXA 3K46A 5BCAA 1M03A 1UKOA 2W4XA 3LPPA 2V38A 3WENA 1XH0A 3HN3A 4ZEPA 4LQ1A 2O9TA 1MQRA 2VNCA 4NSBA 1MQQA 1JF6A 4JIEA 5DEZA 4V27A 5E70A 3B8SA 2ZUUA 3AMGA 3A4WA 2J4GA 2Y24A 1CPUA 1GZJA 3G6MA 2CYGA 4HZ8A 3VMNA 1F4AA 3MO4A 1AVAA 1HP4A 2CBJA 4CD5A 2G3IA 1UWTA 5D9OA 3KZSA 3PBGA 3W81A 3OGVA 4GO9A 1BVZA 2AMGA 1EO5A 2GDVA 2D0GA 2J7GA 7TAAA 1JFXA 1UA3A 2QMKA 2YA1A 2CIPA 3MV01 4AIEA 1OD0A 1KXHA 2WXDM 4OJYA 1JL8A 1PIFA 2HISA 3AHVA 3SCUA 3L2LA 5DO8A 1BYAA 3AIVA 4ZXLA 7A3HA 1DWIM 3AS0A 3ZT7A 3FAWA 2Y8KA 4F9DA 5ABFB 4JFTA 1QBBA 1VFOA 2OWCA 1EGZA 2YA2A 3BSGA 4JKMA 1KGWA 1EXPA 1NP0A 2VMFA 3KL3A 1HKMA 2FH8A 4LGXA 1GOWA 3CUJA 1JZ8A 1UZ4A 5HXMA 3CUFA 5FIPA 1HF6A 4OKDA 1C3FA 2VUYA 5CGMA 5A6MA 1W9VA 4GPNA 4J27A 3CHEA 4CKQA 1GQJA 1QHPA 4IISA 4RE2A 1UWSA 3VNYA 3WD1A 4W8LA 1TVNA 2XHYA 2XVPA 2D20A 1V3LA 2C7FA 3CZGA 4KWUA 4LYPA 1CGTA 1TCMA 4BQ5A 2J77A 2XVKA 2GJRA 5HPOA 4AZ7A 5ABFA 1JF5A 2E9BA 2XWDA 4C7FA 5IXEA 1FP8A 2GUYA 2WMFA 2BFGA 4AEFA 4CN4A 2W92A 1W1VA 2WPGA 4HPGA 8A3HA 1XSKA 4W84A 1NP2A 3M07A 1HXJA 1EOKA 2WMGA 2G3NA 3AI0A 4GI8A 3BAWA 1HKKA 4AD4A 2JF6A 4H41A 1HJUA 7CGTA 3AIQA 5A2BA 1UD8A 2D3LA 3WNLA 2CCRA 1H41A 1VJZA 4M82A 1EIBA 1W9DM 3MUAA 4PSPA 4D6HA 4XB3A 1GOIA 2DEPA 3L4ZA 5IFTA 3EDFA 4QLKA 4WKFA 3AXIA 2A3CA 4HMDA 1XSIA 1WDRA 1MYRA 1E5NA 1PJ9A 4UR9A 1JAKA 1VF8A 3I3DA 1TMQA 3UG4A 1LF1A 3ZIZA 4KGLA 2FH6A 5ABGA 3GTNA 3AYRA 3OBAA 3AHZA 3SUUA 5I3DA 3VVGA 4IUGA 4LX4A 5AYIA 5CGTA 3W24A 1CXHA 1XD1A 3NJ3A 5EB8A 2E8ZA 3CMJA 2VT0A 1W91A 3VX0A 2DIJA 2EPLX 2D0HA 1K9EA 1UA7A 1HN1A 5DFAA 1B3VA 2OLHA 3FHAA 2EO7A 2PWEA 4M80A 4BS0A 1B3WA 3IJ7A 3W4RA 4X0VA 4K68A 2XUCA 3VGGA 2J7EA 1GQLA 4BCEA 4P8WA 2V5CA 1UKSA 3T08A 5D4YA 1H09A 1EH9A 3MUIA 1OGGA 1J0IA 4DUXA 3OZPA 2X05A 1QHZA 1LLOA 9CGTA 2JEPA 2YIHA 5GNZA 2VVNA 5LA0A 3AIRA 1CNVA 2VO5A 1JZ4A 2FGLA 2WMKA 4JZ5A 1E73M 2PBOA 4LYQA 2D23A 2VZSA 2WWCA 3PTQA 3PTKA 3ARPA 2GJPA 1E3ZA 4J3UA 4QCFA 3WF0A 3L4YA 1OT2A 3WQWA 1GQKA 1HJVA 1CLXA 1HVXA 4GI9A 2WBKA 1BYDA 2X8RA 1GJUA 2DT1A 2Q8XA 4DUVA 2WNWA 2OSYA 4FLRA 3VKKA 3FXYA 2WVTA 4B9YA 1B30A 2VOTA 3AMLA 1VENA 1MFUA 2BV9A 2VX7A 1ZJAA 4UZSA 3VIKA 3WFZA 4AZCA 1CYGA 4WIWA 5A3HA 4PMXA 1FH8A 3QHNA 1MW1A 1TFVA 3GNOA 3W27A 3KE0A 3B9AA 2PI6A 4TVDA 4AISA 1CGYA 3TONA 1LWJA 1ZB5A 1VEMA 3UESA 4PSRA 2OYMA 4B9ZA 4GO8A 2G3MA 3W37A 2ZUVA 3G6LA 1Q6FA 1HKJA 3MV11 2WAGA 5BXSA 3CZKA 1JDCA 1DWJM 1UG6A 2ZXQA 1QNRA 4P7QA 4ACZB 1WZMA 2W61A 3TTYA 3AJ7A 4LPCA 1HJSA 1HL9A 2BVTA 4ZFMA 1JAEA 4JKLA 3BH4A 4DWSC 5A6AA 2BHYA 2VQUA 1WDQA 5A1AA 4P8VA 1X6LA 3FHQA 1MXGA 3SUWA 2OWXA 4CD8A 3PZMA 2ZUNA 5BWFA 3ARYA 1W32A 2ZX8A 2E0PA 2J78A 1O7AA 4JFWA 3SUVA 3AIUA 3A4AA 3OLIA 4GQRA 1GCYA 5FKYA 4IPNB 3ZMRA 3WQ5A 1H49A 1UZ1A 3PZNA 3WQ6A 1W1YA 3A3HA 1ITXA 4HZ7A 3VIJA 2DDXA 2E4TA 4QCEA 1KWKA 4PTMA 1VBUA 3MU7A 1C90A 1MVYA 3VMOA 1UR2A 3VGDA 5BROA 3ARWA 1OWQA 4R27A 3VOCA 2YKKA 2X2YA 2EQDA 4HA4A 5IHSA 1V6UA 4NRRA 3WUGA 1E6XM 6A3HA 3WH8A 1GOQA 1A47A 4EANA 1UD5A 4JHOA 2GVYA 4XZWA 2W5FA 3T2QA 5E09A 1V3HA 1ESWA 1QPKA 4UZUA 1JDAA 3SUSA 2QPUA 1K6AA 3T2PA 4URIA 3WIJA 3EDEA 4QLLA 1FOBA 2G3JA 1FH9A 3RPMA 2ZX9A 2J7DA 1ISXA 1C8XA
chains in the Genus database with same CATH superfamily
1KM3A 5CPSA 1UJQA 5BMXA 1TTIA 2YB4A 1T7LA 3AXKA 3PZGA 4GVIA 3TX9A 1RHCA 2OR2A 2JKPA 1QXLA 1GUVA 1V02E 3IJLA 4OTKA 4Q8VA 4HNNA 3VIGA 2FZ8A 2E7FA 2VEKA 3C86A 1AL7A 1DJIA 1QW9A 3WLMA 4D8ZA 1CI1A 2P10A 3TXVA 3FN9A 5I3JA 4FNRA 4GIYA 4WLCA 4E2OA 3WNKA 2D1ZA 3H8AA 3CH9A 4M6VA 4X2RA 3NFUA 4GUJA 2CBUA 5U7SA 1DWGM 1KWGA 2WWDA 1DJNA 1FWIC 3S9IA 3FW6A 3CAWA 4ZO8A 4EXAA 3UETA 2G95A 3TSDA 1TYGA 1VQTA 4RZ4A 3CO4A 3GXNA 1KM4A 2WM0A 1Z44A 4B5UA 1V7AA 4JIIX 1ZCCA 3N2CA 3OLEA 3ZM8A 5D9PA 1ISZA 3KRSA 2FPYA 4MB5A 5D8ZA 4D6FA 4V1YA 2W67A 4IG2A 4KS0A 4MSSA 4S3CA 2GUUA 2UZ9A 2VUNA 3FAXA 2Y7GA 3ABXA 3TYCA 5A94A 3C2FA 3TC6A 2HNHA 4GWEA 4WJ8A 1ZU8A 3KVMA 1PB0A 1SMAA 4QITA 2P88A 2V3GA 3EA3A 1QNVA 1OC6A 4U3AA 3IV8A 4GZEA 1ZY9A 1ZJHA 3LGGA 1PUDA 4DO6A 4DJDA 3L4VA 1JCMP 3BLPX 4UMBA 1XDMA 2WHLA 3QYSA 1GEQA 3NPWA 4G7FA 3W2NA 3GXIA 3VPLA 3GXDA 5FJRA 1E56A 2HEJA 3VOHA 1KRCC 5AVHA 3NG3A 4GGBA 5EA9A 3BLIA 4JAWA 3GIQA 2XH7A 1GPFA 4B3KA 2P8BA 5FA5A 3FGCB 4Z1AA 1ODUA 3HB9A 1DJQA 2Z1BA 2DIEA 3DH7A 2CHNA 1ONEA 1XIEA 4NNCA 4CUCA 3DZ1A 1JYXA 2QUTA 2CLLA 4WOZA 1CIUA 5FEPA 2QAFA 1B3OA 1E43A 1S1RA 2WVSA 3M7WA 3HMJG 1EQPA 2GUBA 1OFPA 2XIQA 3UGRA 4LAOA 3OHMB 3H4WA 3EEGA 1A5SA 2GK1A 8TIMA 1MEIA 3FY1A 3W2KA 1OC7A 2QF7A 2FPVA 4IG2B 1E9IA 5EFFA 1T5AA 1ZAJA 2D2GA 3EA1A 4H4IA 1NEYA 2Z24A 1ZPTA 4DZAA 4ZZ9A 1KCZA 4MUPA 3NZPA 2VEIA 2RUSA 4Z17A 5AZ1A 5B7YA 1E0XA 2QMJA 2B81A 2DUZA 1XRTA 2X0SA 3LQLA 2HRWA 2ZVRA 2WC4A 1QTWA 4D71A 1J10A 1XPGA 1TV7A 3Q94A 3IJDA 4QS5A 1P7TA 4ZE5A 4N6EA 1ZL1A 3WBXA 1QI3A 3STFA 3U2EA 3LG3A 1UKTA 5CAHA 1VPQA 1OIMA 1W1A1 4JTSA 4DWSD 1TPFA 3VNLA 2ZFAA 3N29A 8RUCA 3ANUA 1J0KA 4HU8A 2I5GA 4MAZA 5E9XA 3HGRA 1PZ2A 1UPMB 4CCEA 3WNPA 4E4PA 1CDGA 1L6WA 4P7LA 1QNSA 3QY8A 4AAJA 1KO0A 2DZXA 3C2RA 2PDMA 2HE8A 2X40A 3SCRA 1FXQA 3N3MA 1Q4WA 1R87A 2NX9A 3H55A 5B80A 1EL3A 2E6YA 2ZIDA 1YYAA 3DN5A 3SR7A 1I9CB 1XG3A 1XQLA 1IR1A 5AECA 5AYYA 3CBWA 3JRKA 2VTFA 1PX8A 3N18A 4QHRA 1SZRA 4HSNA 3RLHA 1B3YA 2X1RA 3TROA 1JCTA 3FK4A 3ZVHB 5E9AA 4YWSA 4HOWA 5HMDA 4FAMA 4Y7EA 3GBDA 3V0TA 1MDRA 3FS2A 1DQXA 3MS8A 1HJQA 3NQAA 3ZR6A 1U1UA 2GJXB 3H21A 2CHOA 1XPYA 1AA1B 4IPLA 2YL8A 2HS6A 3UVIA 4HYVA 3PP7A 4ES4A 2JGQA 2GZXA 4M1BA 1SZFA 1JZ7A 3PSWA 3AMKA 1Y0EA 1I4NA 2VZTA 3TW9A 4AXKA 5JBDA 4GNJA 1E55A 3AIBA 4UFLA 1SO5A 2ONEA 1W5NA 1TV2A 2V3DA 1XV8A 1EBHA 1F05A 1VYRA 1KBKA 3G0UA 3AHXA 3II1A 4Y9OA 1XIBA 3EGJA 4JBRA 5CH9A 3VOIA 1AD4A 1XCFA 2D2HA 3DX5A 3ZR5A 3PZUA 4QJ3B 3S2MA 1WDSA 4X9SA 4MF4A 3KCOA 4F4RA 3C0JA 3TXZA 4W85A 5TAOA 3ZO9A 2YB1A 3TV8A 1WKYA 1R2SA 1FHDA 2Y1HA 1FWAC 3U0HA 3B8VA 3L5LA 2TYSA 3TCSA 2IMRA 3MY9A 3ZJ7A 2HDJA 3I68A 5CC3A 4DI8A 3ES7A 5CGQA 1F4HA 4AY1A 3OO2A 4X2PA 2WSYA 3QY6A 3LBMA 1LBMA 5D32A 1J12A 4C5YA 1R3WA 1IWPA 4F79A 3ZS4A 3V5CA 1QWKA 1WUEA 1P0BA 4Z42C 4PCPA 3GYCA 5DRIA 1DTUA 5M17A 2DW6A 3N2MA 3WLSA 3FCPA 2QJGA 1UKPA 3MWCA 5I24A 2H8ZA 4W87A 5I03A 4QFUA 1GWJA 1GOMA 4MPKA 1V93A 2PTWA 4XUGA 3K4AA 1CENA 2PU0A 4MJ4A 1Q7MA 3K8MA 4MAVA 1TTQA 3A3XA 4RW3A 3W2UA 3ARZA 4O8AA 3AIEA 4DWSB 5A69A 2OEKA 1RD6A 1C29A 1IF2A 3E5BA 1R3RA 3EB2A 3HPZA 4GOAA 4IMGA 4PUMA 4DF0A 4NU7A 2QW5A 2XPKA 1F6KA 4Q8OA 2CZ5A 4H04A 2REQA 6REQA 4RV3A 3CHCA 4O13A 1IIHA 4IMDA 2VCBA 1S2TA 4QAIA 2IQ0A 5DELA 1XD0A 5DT5A 1J0JA 3CHFA 3OLGA 3W7JA 1MI3A 3TZFA 3B0YA 4U33A 1K8ZA 2BXVA 3RCNA 1SFSA 4QEHA 2X1UA 1VEPA 5DCDA 4KCVA 1L8PA 4IPJA 1XRVA 1TPWA 1NARA 1UJPA 1TQJA 3ITLA 3NO1A 1VBHA 1WE5A 2J66A 2PDYA 3P14A 4PMUA 3VA8A 1X97A 4K8GA 5BXRA 5BW6A 2I1OA 4AC1X 5AYZA 3BARA 2A3LA 3P80A 3ALGA 1IZKA 3F5JA 2WVVB 1OK6A 3ANYA 6TAAA 2Y5EA 4ZL1A 5AC4A 1NF0A 3GRIA 4UNIA 4AX7A 1NDWA 1Y65A 3AO0A 3G22A 1PWLA 1OZMA 3JZEA 3V75A 1BTMA 2BVYA 4PUJA 1K3UA 3MVIA 4IP7A 4I90A 1UW9A 2JFEX 4JDBA 4GIRA 1H50A 4QDMA 1RCQA 4LCSA 4HA1A 1OX6A 3KTSA 4DPQA 3ZVHA 4JCLA 3KBWA 1UKQA 3H4XA 3NM1A 2ON3A 4IF2A 4WUIA 4LC8A 2UWFA 1LOLA 1OJXA 3CUXA 1QBAA 4FOUA 1GVIA 1B31A 1UUOA 3G18A 4S3FA 1YXCA 1MEHA 5AFDA 6PTDA 5AZ0A 4K36A 4CGTA 1QUMA 4DUWA 4YMZA 3W82A 5HUPA 1U83A 3FJ6A 1YTEA 1E4NA 1E40A 3H2AA 1VRXA 3DFOA 4LWWA 1PPIA 3OA3A 3I3BA 2VGBA 5B7ZA 4AHQA 1BEUA 1TKKA 4B4HA 3ONCA 1F7BA 2CESA 2EXOA 5DLCA 3PZQA 4S3DA 4OBRA 1R7AA 3W72A 3UR5A 3EZ4A 5BNKA 1K70A 3WH9A 1C7SA 3WQFA 2PA6A 2VCCA 3VE9A 4AVFA 1LTDA 1IEXA 4UFKA 4B15A 3TE9A 2YA0A 2VFIA 1XJBA 3SEPA 4ZTXA 3RILA 1X96A 3WK3A 3VGHA 1S5MA 2E5CA 2ZE3A 1NWRA 1MSSA 3OG3A 2GQ9A 1G7UA 3CTLA 3FSTA 2DT3A 3ID7A 1MQPA 2OFJA 5A95A 1XBYA 1JPIA 2IXUA 3HMCA 2Y88A 2X41A 1O5RA 3GC4A 2GSEA 3VD4A 3TKFA 4GZIA 4RKAA 2B7OA 3UY8A 3QGVA 4GUFA 3OIHA 4AD3A 3W7KA 3OEXA 1TWSA 4D6DA 5C8BB 4J4KA 4PMNA 4O17A 4UQAA 4MY9A 3G8RA 3L21A 3WH7A 3W6MA 1K7EA 1EUNA 3T0BA 3MJYA 3N12A 1ENUA 1Q6DA 4ZODA 2EBNA 3W1NA 3QYQA 4WDTA 2VURA 4ATWA 1UWIA 4FB7A 3ABQA 3LX9A 4GVFA 2YL6A 3A9IA 1XIFA 4IPIA 2OX1A 4GE8A 5HPCA 4I6KA 4MOZA 2P3EA 4GYPC 4DJED 3UG3A 3PN8A 1E5JA 4EE9A 3QKZA 4IIFA 3UCCA 3GIYA 4MZ1A 4XZNX 3VKCA 3RM9A 2X1SA 2J79A 3BURA 2C79A 3W1XA 3JW7A 4RNJA 3NQFA 1YBQA 1R9ZA 4WKAA 3NQVA 4US6A 4NAFA 1C91A 3IV3A 5HQMA 1A50A 2TSYA 3SY1A 1UIOA 1WZLA 1OBAA 3P7YA 4NAEB 2WJEA 4F66A 1R6WA 2XH4A 2IXVA 4UTLA 3E38A 3SURA 4N4QA 2VRQA 4LBUA 3HPSA 1AMKA 4CCDA 4QJ5B 1BXBA 3TIMA 3W7EA 2VR2A 5AYBA 1TRIA 4UTTC 1P0NA 3WUBA 4E0CA 2XJ7A 4BEUA 4BI5A 1LL7A 1H1NA 3HQPA 2KAUC 4QQUA 4HNCA 3O05A 3QF0A 1R3VA 5CJNA 1JIBA 1OF8A 3AUOA 3UW6A 1FHVA 1OG0A 2HE5A 3GZAA 4M5PA 3VGEA 4O1CA 1NELA 4G7EB 1SQ7A 4HU0A 4H9TA 4MUZA 5J8LA 3CZEA 2VI0A 1W9UA 2ZTKA 4XSMA 4ZENA 1HG3A 5I77A 3KOYA 4LAKA 4EWJA 2PZNA 4EPBC 3SFKA 3A5VA 4NRSA 3AFBA 3H7VA 3OBEA 4L65A 3DOPA 4P7RA 3GH7A 4JHMA 1B5TA 4HZMA 3VIFA 4LAUA 3M0LA 1BG9A 2AL2A 2A3AA 1TO3A 2QULA 5H8PA 3DKJA 1J0HA 1D8WA 5FF4A 4OU1A 3G8EA 3BJTA 4UMCA 1TIMA 1YDYA 2Q01A 4HPXA 4UMAA 1IQ8A 3PHAA 4LF1A 3RIKA 2OJPA 2WCGA 5AHMA 2AMXA 6XIAA 1VD6A 3SFWA 2IQTA 2V2HA 2V82A 5I02A 5M5DA 1W3KA 1KV5A 4D8LA 2DU2A 1FWWA 4LU0A 5GNXA 3EOOA 5LIXX 1NTHA 4S3EA 3MSGA 2HWGA 5A8OA 3KRBA 2E77A 1FWFC 1V03A 1N8IA 5AC8A 4IIGA 5JH1A 5HMEA 3QOKA 4CVWA 3CGTA 2FTWA 3KCJA 2QLYA 3WDPP 4A3YA 3C2YA 1BTCA 5HDRA 3TQVA 4D9PA 1R86A 4QAWA 5A6JA 3GH5A 2AAAA 1F6PA 4M6QA 4NUWA 2ZWYA 3WLKX 2PC4A 2ZBTA 1E15A 1NWUA 3HGJA 5MHBA 2DPEA 2BY2A 1PAMA 1FFRA 4W93A 4E4FA 4C7DA 5A5WA 4PYSA 1Q2SA 2Q8ZA 1BWLA 3VKAA 3U7BA 4L4OA 4MY1A 4MFDA 3BZGA 4UR7A 2REQB 4ROPA 3QBUA 2HVNA 3BWWA 1H4PA 1SUXA 4IXHA 1EJRC 1ECEA 3ITTA 2BVDA 1U30A 3ZJ8A 4EAYA 4LNYA 1U5VA 3WDJA 3WJWA 4NNBA 1SO3A 3H4GA 3QY7A 4JFUA 1FWDC 4BWLC 4A3QA 1QPNA 4B5XA 3WNOA 5M1TA 2ABBA 1E1EA 1VBRA 1K03A 4H2CA 4ACZA 2OT0A 2V30A 1ONRA 2EKCA 4HCLA 5DY3A 1MZHA 3CPRA 2PLCA 1XYCA 3QQ0A 2HXUA 2B7PA 5EMMA 3ZT5A 1D2KA 3D5HA 1VFTA 2CERA 3CWOX 1M3UA 5CLTA 4UCFA 3WX7A 5DF0A 1G6CA 1UQYA 3W6LA 3DG7A 3BG3A 2Z6IA 4F9JA 2VFHA 4BY3A 3VM7A 1LBLA 3MHGA 2JIWA 3SCSA 3PBUA 3BLDA 3ZJKA 5HWMA 3B9EA 1XYLA 1B3ZA 3VD9A 4WSKA 1GT8A 1H7NA 3UZJA 3ITVA 3MMWA 4FNTA 2G8ZA 4XUYA 1P6WA 2HCVA 3W02A 4DNHA 3WQ8A 1B0IA 1Q6OA 4PB4A 4AZBA 2WNNA 5A2AA 4ACYA 3T42A 1DHKA 2EPOA 3VNKA 1YNYA 1AK5A 3ISIX 2FHCA 5FD0A 5HJLA 5C55A 2PZ0A 4JX6A 3EEZA 1J01A 5I3FA 3T6CA 2CLMA 3B0XA 4UCGA 1DXIA 2FZDA 5LNRA 4DZHA 4U4MA 5FEWA 3ARTA 1H0GA 4FF5A 3W7CA 1KM2A 1OVDA 3C6CA 3QC3A 3GM8A 2ISSA 4KWVA 3E2RA 1UBSA 3LY0A 4NX0A 4A4AA 3KUMA 1EDTA 4DBUA 4M8UA 3CS2A 3R2GA 2PS2A 3L2MA 2YBUA 1W0MA 1ZENA 3N15A 3L4TA 1TJ2A 4UTKA 1TMHA 1DVJA 1JCLA 3HJZA 4QSFA 4LYRA 3ABZA 4FS9A 4LVDA 4L6HA 4MVAA 3WLLA 1ZBCA 1SJAA 1UMLA 3MSDA 1ISWA 3AWNA 3C3UA 1DV7A 1T6MA 1J2BA 5LXEA 4S3KA 4F2TA 2VR4A 4W88A 4CNNA 1P5BA 2GLKA 3HQNA 3N6JA 4DJDD 1Q5MA 4PMDA 2BXZA 5KEZA 3GS6A 4PEEA 3TQPA 1GNXA 2RDUA 4N9BA 1VHNA 4J3TA 1BSLA 3O3RA 3OPSA 5TD4A 4F3HA 1J9YA 4GVHA 4XZMX 4CN6A 4C90A 2FMOA 1CLVA 2E3ZA 1V0KA 2OQHA 3WJYA 1HP5A 3OGSA 3RR1A 4IPPA 3DU0A 4A8RA 3UJFA 4KCTA 5EGRA 3WQGA 3GNXA 4CD4A 2YL5A 1XIJA 5BCAA 3AXXA 1UKOA 4MYAA 1RVKA 4HJFA 4ZEPA 2PDJA 3NQ8A 4LQ1A 3ZLFA 4TO8A 3CIXA 2VNCA 1MQQA 3QN3A 1KFBA 5E70A 1JJKA 1N55A 3A4WA 1RBOB 5AVNA 1AZ1A 1I2OA 2J4GA 2Y7FA 1H1ZA 2Y24A 2XH0A 2NV2A 1W5QA 1XLHA 1MXSA 2CYGA 3VMNA 2Y61A 3MO4A 3KS6A 3WLOA 2G3IA 1UWTA 3ABRA 3PBGA 2GDVA 3PC0A 5D2WA 2D0GA 4A8IA 5DBTA 1UA3A 1NFGA 1YLVA 1TZ9A 4AIEA 1GEHA 1XS2A 3W7OA 4YTRA 2WXDM 4OJYA 1DPMA 1PIFA 3PF3A 4LUIA 2TODA 2R1KA 4ZXLA 2I14A 4AY7A 4LVGA 1JEZA 2YYUA 4AC7C 1IGSA 4GYJA 4AYGA 3UR2A 2XINA 2YA2A 4JKMA 2VMFA 1DORA 4XBKA 4Y6GA 3WBYA 1GOWA 1UZ4A 1SR9A 2J6VA 5HXMA 2I16A 2PSNA 3OYXA 4OKDA 1C3FA 3KVLA 3ABSA 3PSVA 1S5WA 4J27A 3CHEA 1G67A 1F3WA 4W4QA 3UG8A 4AVOA 4RE2A 3VNYA 3WD1A 2C6QA 3V5OA 2XVPA 4JIQA 4GXWA 4LVBA 3QPEA 5HMSA 4MWAE 5HPOA 2QDHA 3LGEA 1BD0A 3STCA 3UXLA 1G4TA 2XISA 3Q4DA 5ABFA 2HSAA 3HM7A 1RJQA 2GUYA 1REQA 4AEFA 3GC2A 1XSKA 4WSHA 3M07A 1ICSA 4BI6A 2WMGA 3AI0A 4KRZA 4RXGA 4B5SA 1HKKA 4AD4A 2JF6A 7CGTA 2YCEA 2CCRA 3QMRA 3GKAA 3GVRA 4I3GA 2QT3A 3IVUA 4H19A 3BPWA 4L5ZA 4JTQA 3E12A 4GH3A 4TQTA 3FX4A 5FSEC 3M16A 4LUSA 5IFTA 2PDCA 4QLKA 3O7UA 4JEQA 3FA5A 4YTTA 3VKDA 1KD0A 4RPPA 4RJEA 3I3DA 4DBDA 5AHEA 4CQAA 1XISA 3AHZA 5I3DA 9XIAA 4KWSA 5C2GA 4DZIA 5AYIA 1XYMA 3NJ3A 1VYSX 4GYKA 1W1B1 3VX0A 2DIJA 4BI7A 4EP8C 3DKLA 3W2JA 1S1PA 3BV4A 5DFAA 2VD9A 4M80A 4UXDA 3E0IA 1OQFA 3GR7A 3IJ7A 1AJ2A 4X0VA 4K68A 1UC4A 2C19A 4FX6M 1GQLA 1ZLPA 4P8WA 1UKSA 3FEQA 2HBVA 4R9OA 3T08A 3TA6A 1EH9A 4HYWA 1OGGA 1PTGA 3S5ZA 3WLNA 1LLOA 3BOLA 3ATZA 3DGRA 2NUXA 1XIMA 5F4WA 3QV7A 9CGTA 2JEPA 2C3ZA 1P1XA 2YIHA 3CHVA 5D33A 2Z1VA 3BV7A 4TR9A 5GNZA 5LA0A 4MGGA 2O7SA 1JZ4A 1R9XA 2WMKA 1E73M 1SJCA 3PTQA 3RX3A 3PTKA 4JTHA 4GZ7A 3IGUA 4QCFA 4YWIA 1CB7B 1EEPA 4OUIA 3QV8A 1H51A 4IH3A 2IKHA 5C9XA 3A22A 4DUVA 3H2MA 3TWBA 4IHCA 1GYNA 4HNOA 3AMLA 2Q3OA 1HZYA 2I57A 3PPCA 3UY7A 3KOWA 4AWUA 1EJUC 3WFZA 4FPSA 5CBBA 3LZ5A 3WLIA 2VELA 7TIMA 3PY2A 1RR2A 1ZAIA 2ODOA 3KE0A 3ITXA 2R91A 4TVDA 1LWJA 1ZB5A 3EX4A 2ZRWA 2OYMA 1BWVA 1XIHA 1SZNA 4GO8A 1VCFA 2QPXA 3CK5A 1RCXB 3APYA 4H9MA 4J1OA 3GHRA 2GGIA 2XSXA 1QNRA 3OODA 4HHHA 1EPXA 4DBEA 5TF0A 2QR6A 4DWSC 5A6AA 2VQUA 1WDQA 4LSBA 4O11A 3M0VA 3S3GA 1RA5A 2ZYFA 1OY0A 2GPTA 3FHQA 3E0FA 3ARYA 1S2VA 3IIOA 1F07A 3UCDA 4JFWA 3AIUA 2QCHA 1IWAA 1LCOA 3T40A 3HPAA 3KW3A 1WKDA 2HTMA 3A9BA 5FKYA 4IIDA 3WQ6A 1ITXA 1L6GA 4HZ7A 3HGOA 2ZZ1A 2E4TA 3CQ0A 2A6NA 2C71A 1H60A 3WQOA 4A22A 1VBUA 1C90A 3QZEA 3IIZA 3V4BA 5BROA 1OWQA 4R27A 1XP3A 3VOCA 1GVSA 2EQDA 4HA4A 5IHSA 1EA0A 3P3BA 1UD5A 1MZRA 4QJ1A 4XZWA 1RQEA 4MHBA 3T2QA 1GGOA 2WQPA 2LLEA 1EGMA 1ZGDA 2IKJA 4URIA 4ALDA 1F73A 2J7DA 1ISXA 1V51A 3CQJA 3N3TA 5JMUA 2PC8A 3D47A 2NXHA 3PBVA 1Y5XA 2Y62A 4Z2IA 2VXNA 2NVDA 2ZUSA 3UG5A 5REQB 2E67A 2NV9A 1M7XA 4BQ3A 1ME9A 4H8HA 1DYSA 5BXTA 4ML9A 2C18A 2XVGA 4MB4A 3TTOA 1P6CA 3VIIA 1AMYA 4GXPA 4CQDA 3VD5A 3CV1A 3W7QA 1W3HA 1Q63A 3IGSA 3T8QA 4GNVA 3RK8A 3BOFA 3FV9A 4PL1A 4Z2HA 4E6MA 3FOKA 1KXTA 1OFOA 3N13A 3M0YA 5EMUA 4MADA 2DSWA 5T26A 4UC5A 3IJ6A 5BZAA 4CU7A 1QJWA 4GABA 3DGBA 4QIUA 1RY8A 1B3XA 1J2WA 1YPFA 3FKRA 1MDLA 3NUKA 4YCOA 3L67A 3MQTA 3QC0A 4NZ4A 1UZDA 1EB3A 4M29A 4I8YA 2BTMA 3W73A 1YHTA 1A3HA 2ZZ7A 2O92A 3NO3A 3ZR4A 4WF7A 3SECA 4UQDA 1UR8A 1N2VA 4PGLA 5LNWA 3WMLA 1FA2A 4NJJA 4WJXA 1A0DA 4ML4A 2ZUWA 1US0A 4ONVA 2BSLA 1M65A 2PU1A 1JPDX 1T96A 1NAL1 1GW9A 5FEZA 4CCZA 5DCBA 3S2LA 3SRKA 3F4NA 2XGIA 4MKNA 4C6KA 3D6NA 3ITGA 3MMDA 5AKQA 4HBKA 1ONWA 3PZVA 3QZAA 1UR4A 2A7RA 1E70M 1E6RA 4GISA 3BLFA 5LNVA 1B4EA 4W7WA 4IGMA 2NQ9A 2WC7A 2QHAA 4GX9A 3EDKA 5FJOA 1RA0A 3UZYA 1VB9A 4UTHA 2RAGA 1KLZA 3HJEA 2J7HA 4B5NA 1U5HA 4AZ5A 4US5D 3PZ9A 3W75A 2CPUA 5CSUA 1XLBA 3KEHA 1UWRA 3AZSA 5HANA 1IT0A 1FWEC 4GCXA 5F2MA 5FOOA 1JPMA 3U8GA 2QJHA 2Y85A 3GVQA 1RCOB 1DTNA 2PGEA 4FX8A 1JDFA 2PWUA 2HBXA 2GQ8A 3UBPC 4GUIA 4IMAA 3JUGA 4S3AA 2A0NA 3EWZA 5CG0A 1JCXA 3IRDA 2V5DA 2E9LA 4QE4A 3OZYA 3W26A 5LZLA 3XINA 2V67A 3EDJA 4DJDC 2VFGA 3L0GA 4UTMA 3NZRA 3A5FA 4E3TA 2F6XA 2I56A 4I5XA 3R43A 1TSIA 2FZMA 2PGWA 3QSTA 4YHGA 1XH1A 3Q67A 1JCNA 2QCMA 3S8HA 1FWSA 1IGWA 1OT1A 4ZVJA 3BCFA 3B4UA 3LGDA 1KFCA 1D7KA 3FDKA 2Y5JA 1JCJA 1BF6A 2DUXA 4JOMA 4M56A 3HU7A 3M0HA 3BGGA 2BMBA 3G3DA 1LLWA 5E93A 2WSKA 3C8FA 1R30A 3M5YA 1V6TA 4LW7A 2WOQA 2WB5A 5T91A 3THAA 2EGZA 4NX5A 4LS0A 1F61A 1TB3A 4UFMA 3W7DA 3TNBA 3EBVA 3WEZA 2PWGA 1MUWA 1KCKA 1V02A 4DLMA 3TTEA 3Q2DA 3H7RA 3W23A 3VABA 3VMPA 1P7TB 3V7PA 1U1JA 2J7CA 4GFSA 5XIMA 4WZHA 3ORWA 1O6IA 1K02A 3BXWA 2FKPA 4CQBA 1LZOA 3VOFA 3BLKA 3MYPA 1GG1A 1G4EA 3TC7A 3OB8A 3WD0A 3HIJA 3GY1A 2HJPA 1NH6A 3E9AA 1FFQA 3VDBA 4KCUA 4L9YA 4XD4A 1TJRA 3M6YA 4ZB0A 2MNRA 4W9TA 3NQ7A 1IEWA 2DZBA 2GL5A 3BW2A 3BANA 1QPQA 4PMRA 1VH7A 1XYBA 2B31A 1R9YA 1O5QA 4NYYA 1ONXA 3VE7A 2ACQA 5LIUX 2ISFA 4AXNA 2OEMA 1YXDA 3TYDA 5BXPA 1V3JA 3UWVA 5JIWA 3W1TA 3S6OA 3URQA 4DIAA 4ZMGA 2YCLA 3G1HA 4GC3A 1GOOA 3WMCA 1XIIA 4GI6A 1EX1A 1JPHA 3QJAA 1LG2A 5ABTA 3S42A 4P7OA 1KR0A 2ZC1A 3UPWA 3O6CA 2VDGA 4C6OA 5D38A 3EXTA 3IUDA 1YPXA 2BODX 2GDUA 3VGFA 1LT7A 2ZA3A 3GXFA 3QLDA 1L6SA 3BG5A 3LV5A 5CEWA 4Q7IA 4LY8A 2HPIA 1X39A 4YLWA 1OFDA 4GBUA 1FP9A 2VRJA 2XIBA 3BJSA 4F0HA 5LHFA 1R3TA 1PTDA 4V15A 5CC7A 4LVAA 5FAGA 3RG6A 3AYSA 4IJBA 4M7TA 3T7VA 1Z8AA 3PR2A 4KCWA 4NG3A 3Q45A 5JXQA 1WA3A 2W27A 1V3IA 1VFLA 1J11A 5CPQA 5D9NA 5GJMA 2FIQA 2DSZA 3SJ3A 4QR6A 2H90A 4CQ9A 1GZ1A 1RJPA 3WNNA 1OYAA 5HATA 2J47A 4JIRA 3KBJA 1QRQA 4JEJA 2QUVA 4D1JA 4NY2A 4ADSA 5H1WA 1NF7A 3U2OA 3CIVA 3LRKA 7REQB 1K9FA 5A6SA 1RY0A 1V4YA 2I5IA 4FK9A 3RCYA 4OWGA 3MKKA 1EJSC 3O06A 1UBPC 3GDTA 2XFRA 5EMYA 1E3XA 1OK4A 2AKMA 4ZQRA 1OCNA 1OHLA 1A3XA 3RLUA 4I5UA 9XIMA 1AQFA 1JR1A 3WQ4A 2J7BA 4W5ZA 1IEIA 2G4FA 4JIHA 4REQA 3GK0A 1WNOA 3QTGA 1E6PA 2XVNA 4OV9A 3AU6A 3LMYA 4Q4RA 5A6BA 1YQ2A 1GPWA 4FP1A 4BK9A 5RUBA 4JL1A 5LXXA 3B4YA 4DB7A 2V81A 2VC6A 2ZA1A 4PB5A 2NT1A 3E2VA 3W76A 4GBDA 3BMWA 1PZ0A 1RP8A 1YXYA 1AUSL 4FLSA 4AD5A 4V33A 3AC0A 4RUBA 3GU1A 1I8JA 1AG1O 4LT9A 3VDHA 1VGAA 4NAEA 3W84A 4O19A 3G1SA 1J0YA 3TTQA 2BS9A 2A3BA 1DWHM 7XIMA 1AQMA 4GH1A 4MNLA 5DX7A 1UP2A 2W91A 2DZPA 1VCVA 1NVMA 4J28A 2J9YA 3GE7A 3PUOA 5DQPA 1QO5A 3I6TA 3RO8A 3P67A 4J5NA 3EA2A 1EA9C 3G0SA 5HR6A 3EDDA 3N6QA 3PBMA 5BMWA 2JKEA 1M9HA 3S5OA 3U7VA 3LHTA 3O6DA 4QTGA 3QMTA 3R13A 4FIQA 4ZXOA 4S23A 3RXZA 1OGSA 1QATA 1R46A 4JTEA 3TJIA 3KTXA 4LB4A 3WEOA 1IT8A 2C16A 4TOQA 3RX4A 3QOMA 1PZ3A 1KFJA 3DECA 3VXGA 1JG9A 3W71A 1FX6A 3MUY1 3CUHA 3QHOA 3E49A 2QV5A 4X0NA 3NVTA 4O57A 1RQHA 1K9DA 3UZXA 3GWQA 2Z25A 5CSRA 2WBGA 3T09A 4AZGA 1W8GA 1Q45A 2PEVA 2ZUMA 1GYMA 5CCZA 4IIBA 4JYEA 5HBFA 4F0RA 1QNQA 4HN4A 3TYUA 3MSRA 3DCPA 4O1DA 5EKYA 3U9IA 3CYJA 3WJZA 1S39A 3PZIA 3UWUA 3A4XA 4DF2A 3VNIA 3ZWTA 1DOSA 4L4PA 4HSOA 1G7VA 4A35A 2RJHA 1F6YA 1K7XA 1XC4A 5HNRA 3GTXA 3W86A 1WXZA 1BXCA 3TA9A 1I1WA 1C92A 4RCXA 4KERA 1V7YA 4QE5A 1XRSA 2DVXA 3ZJ6A 1VRDA 5FJPA 4HT3A 3NZGA 1J96A 4Y96A 4R88A 4PRWA 3ME3A 4I6VA 3BGAA 3POHA 5IRPA 2XN0A 1Y8BA 3UWEA 3RNDA 1ME8A 2FJUB 4XVDA 4BHYA 3P5YA 2PLKA 1BSIA 3R12A 1B54A 3SM0A 4HNTA 2QJNA 3B0PA 2CBVA 2GYIA 4Z1CA 1IYXA 2JGYA 1E0UA 4YVXA 1KRBC 3EPMA 3SBFA 4TIMA 4GUGA 3UZ5A 1NQ6A 4M19A 2QJMA 4Y8FA 1PX4A 3UZWA 4ZGYA 5ECUA 4C65A 4A2SA 3GAYA 1C9DA 1GTEA 3N73A 1NWSA 4KWOA 4XSLA 4N7QA 2WZIA 4S39A 1H7PA 3M5ZA 4O1FA 3KFTA 4IICA 2EF9A 2WVUA 3LCGA 3E74A 1S2UA 2A85A 1GVOA 1UUQA 5BWAA 1BAGA 1T8QA 3FDGA 1QI5A 3NPVA 4QJ4B 5H8MA 3W1AA 3LHWA 3IJ9A 2X42A 2VR5A 1CEOA 3RPTA 2BXYA 1ITQA 3B40A 1YDOA 1YDNA 4JGDA 1K77A 4XV0A 3W1PA 4W86A 1Z69A 4IQDA 4RDVA 2J27A 3HFTA 3BSHA 1V0NA 1QNPA 3LLDA 4LJ3A 3WBEA 2QUMA 4QEEA 3U57A 4UFJA 1M68A 4UTTA 2OCZA 2D22A 3ARRA 4JIPA 1B90A 4HQVA 3WYZA 1VIWA 1M1BA 3SCQA 3KL0A 4X63A 2QCEA 4HPJA 3NXFA 1L6YA 2WVVA 4FLOA 3DFYA 3AMDA 4O1BA 3W1UA 4PMVA 4YNGA 1JGIA 2QGYA 3CPUA 2VGIA 3CL7A 4YS1A 2XU2A 4B16A 1PIGA 3F4DA 1O68A 4TMCA 5CPMA 3RM8A 4DELA 2DZWA 3KWXA 2VX6A 1LT8A 1P4CA 2OO6A 3THUA 3PJXA 2VEFA 3LM7A 4Q4OA 1V08A 1LL6A 1I6NA 5HAOA 3URNA 1XBXA 2A21A 2BP1A 1K8YA 2ZQ0A 4FSAA 2DJXA 4Q22A 1PS9A 3M0JA 5ABHA 1I2PA 1GVFA 4DZ5A 4P8UA 2B0MA 1Q6EA 2PB1A 3SGZA 3D3AA 4FMVA 5F1UA 1E9YB 4FNUA 2PDFA 4F0SA 3MT1A 1V3MA 1TWDA 1F5ZA 1OCBA 4F0MA 2GSHA 2E6DA 3NQGA 4HU3A 3GH4A 3N2OA 5A8NA 4O16A 3EX3A 3HFYA 4RW5A 3GDMA 1XBZA 1OIFA 1KRAC 2BB0A 1X7FA 1CTNA 5DY2A 1CGWA 3DC8A 3SCTA 3BGJA 2PD5A 4MJMA 4DM1A 5AOUA 3VX1A 4TVUA 3WJSA 5HNNA 1GKRA 3AHTA 3A12A 1JI1A 1NM9A 1EF2A 4RNHA 3C52A 4NASA 1DEDA 1OABA 1BVNP 3VUPA 3KHDA 3N2TA 4YJ5A 4HU4A 3NYDA 4FNQA 1US2A 1SVDA 4DM2A 1M7PA 3CAVA 2ZZ6A 1ZRQA 2ZXDA 3KL5A 1PSCA 3FSUA 4PMOA 3U6WA 1QOPA 4NJKA 3RUBL 4RLIA 2E25A 2PFHA 4OVXA 2E1WA 3OA5A 4JY8A 3VIOA 1DIDA 2CLOA 3V18A 3BG9A 4YYFA 4GG9A 1GVYA 4XX6A 3W1QA 1UR0A 5REQA 3CYVA 4U2ZA 1Z42A 3CAKA 4IMEA 4ADUA 6REQB 3AS1A 4GYFA 2WCAA 3STEA 1KBLA 1E9LA 4DJFC 1WZAA 4O28A 2INEA 2VRKA 3D3FA 3PWGA 1K9TA 1K8XA 3DXIA 2D24A 5D03A 3W38A 3GXTA 1UD6A 4R34A 3NR0A 4AQLA 4C6MA 4LFYA 3VZXA 4TV6A 2INZA 4JICA 2ZX6A 4NYUA 3WF1A 4EIVA 1N8FA 1B1YA 4LS2A 2PE4A 3SCVA 4XO6A 2WHMA 4XZBA 2ACSA 3P82A 3DHFA 4O18A 1AD1A 1WBHA 3EOLA 3REQB 4X60A 4QE1A 3AXMA 2ZICA 1FHLA 2GVLA 1A5NC 5CPTA 3RN6A 3QSRA 5FL1A 2RJGA 1DIKA 1OFAA 3CQIA 5I2UA 3CUZA 4PA8A 3RF9A 1A5CA 3K4WA 4FF7A 2PDKA 2E5DA 2X0HA 4AWEA 1UZHA 1EHNA 4DNMA 1XDJA 3Q37A 2NQLA 4OZOA 1V5XA 1R3QA 3NQEA 2X16A 3S9ZA 1HNYA 3VINA 3N4FA 1TWZA 4YU1A 1EHAA 2WZTA 3S9YA 2GWGA 2PAJA 3DFHA 4M0XA 3W7IA 2WM1A 3GIPA 4RE0A 2HVMA 4NZ3A 4H6QA 5DMLA 1GK8A 2NW0A 1VPYA 1O1ZA 3GXMA 3MVTA 3M0KA 3WY1A 2YZRA 4MWAA 1LUCA 3B97A 4Q3MA 4UTUA 3LB0A 2Z00A 1BYBA 3QR0A 4BA0A 3QV6A 3I65A 3VDCA 4JN6A 4LY4A 1QK2A 2NT0A 5I5RA 1H5VA 1REQB 4NZ5A 3WLRA 2XH2A 3VNJA 1MRQA 4UTFA 1O4UA 4CN1A 1OX4A 3THCA 5KZDA 3UXAA 2D2JA 1GVRA 4PCNA 5C71A 4Z2JA 3P81A 1GW1A 2JBMA 4WKHA 2CKSA 4DN1A 3HGSA 4GNKB 4Q8QA 1FBAA 3GLCA 3NNTA 2IPJA 2O9OA 4GLEA 2WC3A 3CV2A 4XAPA 3GNNA 2XG9A 5FF3A 1UB3A 3GTIA 2Q6ZA 5GQBA 3B8DA 5ABEA 5I06A 3UR7A 2OOFA 1EP2A 3UJRA 4XKYA 1C8VA 1ZALA 4JFSA 1BHGA 4KEMA 1AW5A 3A21A 3T05A 2H9AA 2GWNA 3RCMA 2V5LA 5FI8A 2YW4A 1C8QA 4IQJA 1NJJA 5T8GA 3LA4A 4U31A 1PZ1A 2J13A 3GVVA 4BQ4A 2W63A 4PUNA 1RK5A 2A1YA 4U5IA 1HGYA 4YPJA 1I1XA 2Y8VA 5CBJA 2YFOA 1KBBA 4EWND 1PYFA 4MPQA 1L2QA 3O0FA 3CLMA 1UD4A 4DWDA 1CWYA 2X0YA 4WSJA 1KBJA 1XLKA 2NLIA 4OOZA 3PJUA 3S0CA 1JNEA 4UFIA 4JTLA 2EPHA 4E8GA 1UHVA 1HGWA 2QXWA 4GYPA 3VIMA 1D7FA 1EIXA 2NQZA 4W8BA 1HO1A 3WMBA 2CLFA 2PDBA 3TU9A 3CT2A 5LGXA 4DYEA 2XN1A 2VFDA 2Y0FA 3LHVA 1PE1A 4PCSA 1A0EA 2ZVIA 1SYTA 2A5HA 4A6GA 1EWDA 4ZO6A 4I9AA 1ZHAA 3AXHA 1BFNA 3W0KA 4RZ5A 2HROA 4E2DA 2DIKA 2GQ3A 3K1GA 1NY1A 3W7PA 4ZO9A 1US3A 2WLZA 1YTDA 3TN4A 2XSAA 1GZGA 2V2DA 5FL0A 4E8DA 1YKWA 3F2BA 4XTIA 4RDZA 1SFJA 3MDWA 1MO0A 5MKGB 4KFNA 1D8CA 3BAIA 3MMTA 3U2CA 4B90A 3QFWA 3RMJA 5A8MA 4ZA0A 4QX4A 4P7NA 1R0MA 3W00A 2J75A 4M6PA 4OBTA 3UJSA 1SZEA 1I2RA 2VD8A 4UQBA 2PWVA 4GY1A 3ICJA 5FJUA 2E28A 3ZZ1A 2BZNA 1E0VA 2A3HA 3M47A 2WZHA 4MMWA 1Q6CA 5AY7A 3KLLA 4DO7A 3CV7A 3T9PA 2PDGA 3SRDA 1PDZA 4FXSA 3EX1A 4Q8MA 4LV4A 3T0AA 3T2OA 5PTDA 5AN7A 2GGHA 1H61A 5IBXA 3REQA 1I45A 4OUEA 3TYEA 1YIXA 3DIPA 4DJEC 2OTDA 5I3KA 4PTXA 3WLPA 1TPEA 5K9CA 3VKBA 3PAJA 1PXGA 1UYQA 1X7IA 5J5RA 3BMXA 1XH0A 3HN3A 2O9TA 3I10A 3E6EA 4FXFA 4JIEA 3L65A 2Y5SA 3NOYA 5C7HA 4GGHA 1R47A 3RU6A 3T78A 4Y9AA 4C1KA 1F4AA 3HG4A 1KM0A 5D9OA 3W81A 1BVZA 3MKCA 7TAAA 1JFXA 1SW0A 2GJLA 3G1FA 2YA1A 4L9XA 3CC1A 1KTBA 2CIPA 1PO9A 1GJPA 1MUMA 3NL3A 1JUEA 4QNWA 1IE7C 3AHVA 3SCUA 3GFXA 3L2LA 5DO8A 3OHIA 1EYEA 4IFKB 3AIVA 7A3HA 3ITCA 1DWIM 1TZZA 4IWWA 2P8CA 2QNEA 4ZFCA 1L6FA 4HCHA 1GG0A 1KRMA 1J79A 5T9BG 1QBBA 2OWCA 1I0BA 3HG5A 1KGWA 5A8GA 5DN1A 4NXSA 1MEWA 4PFHA 2X1TA 1HF6A 1J8VA 2VUYA 3GU9A 4GPNA 2ZTJA 3RRXA 1ADDA 3KBMA 3U4AA 4CKQA 1UWSA 1XLIA 4QDWA 1CGTA 1KTNA 4BQ5A 1EXBA 2GJRA 2NWSA 2O4QA 2P3ZA 1IZCA 1EC8A 2L5HA 5G2IA 1JF5A 2PLJA 2E9BA 4C7FA 2EJAA 1FP8A 2BFGA 4IL2A 4CN4A 2W92A 4A8LA 8A3HA 4ZOBA 3IIVA 4C6LA 4GI8A 1XGDA 2CWNA 3L7RA 4FNSA 4HYRA 1CLKA 1HJUA 3RO6A 1BQGA 1UD8A 2D3LA 2YCKX 4M3PA 2NQJA 1OCJA 5H2ZA 3RHGA 4QDPA 7REQA 2I7GA 1W9DM 3KBVA 1V8EA 1GOIA 2OX4A 4RK8A 1TRDA 3EDFA 2J24A 4WKFA 3AXIA 4HMDA 1MYRA 4QG8A 1E5NA 3P8IA 3UG4A 3ZIZA 4KETA 4FALA 4PEKA 3VVGA 4IUGA 5CGTA 4DXVA 3W24A 5C9ZA 4Q8TA 1TVLA 3W2MA 3CMJA 2VT0A 4K8HA 1W91A 1WKEA 1DBTA 4L56A 1Q66A 3TOYA 2BWGA 5FF7A 2DFAA 1UA7A 4L80A 1HN1A 2ATSA 2DVTA 2OLHA 2EO7A 2PWEA 4PMJA 5I7GA 4BS0A 3WFAA 1B3WA 1OX4B 2I17A 3KZPA 4BCEA 2DV0A 2NSOA 1H09A 3A23A 1BRLA 1J0IA 4MG4A 1ZNNA 3TJLA 3OZPA 1PHWA 2X05A 4LUYA 1XIGA 4IP4A 4EPEC 4MZ8A 4PB3A 4GFIA 2PCQA 1FCVA 1YE4A 4N9EA 1A5OC 1BRLB 5HJXA 1XLGA 2GJPA 1E3ZA 4CQ8A 4J3UA 3OIXA 2ISDA 1OT2A 5L6UA 1OYBA 1GQKA 1XLJA 4JD4A 4GI9A 4YTSA 1EC7A 1BYDA 2Q8XA 4JQ3A 1S2CA 2IPGA 2WNWA 3FXYA 5GJNA 2VOTA 3NQ6A 2VX7A 4X3ZA 4UZSA 4AZCA 1DL3A 4WIWA 2I5QA 2QDGA 3N4EA 3QHNA 1MW1A 3W27A 3B8TA 1A53A 4AISA 3FFSA 1CGYA 1VEMA 9RUBA 4XBJA 1GKPA 5KSWA 1PCWA 4NT0A 4B9ZA 1H5YA 3MV11 2PDLA 3NGJA 3CZKA 5D2TA 2ZXQA 2ZA2A 4XK2A 2W61A 4HHPA 3TTYA 4LPCA 2BVTA 3DI1A 4ZFMA 1JAEA 4JKLA 5TBOA 4NZ1A 4WX2A 2BHYA 2CWXA 2OWXA 1WYIA 1NIUA 5CG7A 1O7AA 2VWTA 3P93A 2FTPA 3PPFA 2YCLB 3HA1A 4GQRA 3EPOA 3H2CA 4FZIA 4LNCA 3VAVA 3ZMRA 3UA4A 3NURA 3WQ5A 2PDPA 1H49A 1UZ1A 3PZNA 4ORIA 4JTFA 4JNYA 1KCXA 3EKGA 2CZVA 3WCZA 1MVYA 5H91A 3LTYA 4JTDA 2WJFA 3SIZA 1IWBA 4IGNA 4FXJA 1V6UA 5HNTA 5KITA 1I2QA 3WUGA 1TTJA 4JYDA 6A3HA 3WH8A 4EANA 3JU2A 4L7ZA 2OO0A 4LUJA 3LBCA 2W5FA 5E09A 1V3HA 1FWRA 1I2NA 4YVPA 2RDWA 4FR1A 5CSSA 1JDAA 3NQMA 3WIJA 3SQMA 2G3JA 1P43A 4PFMA 5AC7A 2DZTA 3PB2A 5U4NA 1C8XA 4WY0F 2IPFA 1KQYA 4Z2GA 4L64A 4IT1A 4XD5A 5KETA 2ZX7A 1BLIA 5CQ1A 1KC7A 4O54A 1NU5A 4LCRA 3IIXA 4MNMA 2VP8A 1QFEA 3T55A 3BAXA 3GR8A 1AH3A 4OBSA 2VQTA 1EJWC 2CKRA 2C8NA 3LHUA 1JZ5A 5FF0A 1TR1A 1ZUAX 3LTPA 4EAMA 5HQEA 3N11A 4N02A 5K4ZA 4K6AA 1EF3A 3LK6A 3TLQA 2PP0A 3DBPA 2X2GA 1MNSA 2C1IA 1BGGA 3SN0A 3ELFA 1O95A 4OT7A 1R2RA 2ANUA 2PP1A 3LRMA 3LERA 1D3GA 1ZBVA 2NZLA 2VDIA 3SGUA 4WD0A 5C0QA 3G24A 4R33A 2ZZ3A 4KFOA 3ITYA 2BNJA 4AWTA 2ZX5A 2WHKA 1ITCA 4DXKA 5LKYA 1OADA 3C2EA 4LUSB 1JDEA 3DENA 4H8VA 3AZTA 3B04A 1NOWA 2JQXA 3RDKA 3CZJA 1FKXA 5AHIA 4MB3A 5LYRA 1JXKA 3M5VA 4WY0A 3C4UA 3A3WA 3VI2A 3PTDA 1SFTA 3H54A 5CZKA 2V5JA 4W8AA 4FEZA 4HA0A 3NPXA 4XAGA 3EB3A 2Z2BA 4JFVA 2VJXA 1VZWA 1IV8A 1G4SA 4L6DA 3DFTA 1POKA 3SN4A 4GKLA 1FVPA 1OFQA 3GDRA 1WV2A 3OLDA 2YLLA 4XIMA 5CAKA 3QW3A 4E3VA 4Q8PA 3T1GA 3LPOA 3MBDA 1KXVA 4O10A 2CITA 4GXMA 2GGJA 1Q8AA 4IQEA 1W1TA 2XSBA 3B3DA 3PJWA 4MWAD 4AIUA 1OYCA 3HTWA 1LLZA 2Y70A 2FHFA 5AHFA 1LG1A 3B9DA 3E1F1 2X09A 3CNYA 2ZRXA 3TAOA 4F48A 1ZTVA 2XM2A 4LXFA 1XCWA 3NDOA 1DQWA 1HUVA 4RDYA 1Z89A 2BY1A 3G1VA 3IACA 3VFCA 1F8IA 3F5LA 4AD2A 5F4XA 1TPVA 1QW8A 2PGFA 2WCSA 3FVMA 3WKZA 1XYZA 3MP4A 3EWBX 3MJMA 4AB4A 1JRBA 2V9DA 1FH7A 1ZJIA 2FZNA 4YIWA 3SUTA 4E8CA 3FYPA 3RR4A 3YPIA 3TW7A 4Z2KA 4US5A 1KGXA 3L12A 2YPIA 5ECVA 2WHJA 4UUIA 2Y8UA 2P0IA 1PBGA 4ATLA 4JTGA 1EOMA 1RXOB 1FCUA 3JZUA 3RLGA 4FXRA 4UTJA 2HS8A 5MKGA 2XVLA 4Z0SA 3UPBA 3RITA 3M6DA 2XWEA 1DE5A 4UQEA 2CBIA 1PV8A 4PCTA 3RGTA 3TOPA 3CB3A 3MI3A 4KEUA 3U5UA 1E6SM 4Q4PA 4ZOEA 4PTVA 4UOZA 4KFPA 4C5ZA 1TV8A 1IEQA 3GHTA 4ERAA 1CGUA 3WO8A 4J3WA 2OB3A 3UJ2A 3RPDA 4JTIA 3P6LA 5F7UA 2VDHA 3NM3A 2G37A 2C13A 1TQXA 3CL8A 4HHLA 1XUUA 3N2BA 1X38A 3VGBA 1LOSA 2P50A 4KKXA 3AHYA 2WQDA 4AX6A 2Z7KA 4GC4A 2EPNA 2V8ZA 3S2NA 3GG1A 3AYVA 4D6GA 3QR1A 3WMSA 4CU8A 3UPMA 4HTYA 2YZ5A 2OKOA 1E71M 4Z2LA 3N25A 4ILSA 3TQKA 1TJ1A 3B0VC 3V5FA 1YMYA 5D30A 2EEXA 3AROA 2NSXA 1ZBWA 2YLAA 2FFCA 3WD2A 4WY0B 2R14A 3PVFA 1X8CA 3WF4A 1UC5A 1QI0A 1R7OA 4XD6A 3TCEA 3AS2A 4PC8A 1OFEA 3S2CA 4AMCA 4S2BA 3JVAA 3BJFA 3HZ3A 3FNDA 2WMIB 3NDZA 4CNOA 1UWQA 3AU2A 2Z7GA 1ITUA 3XISA 3M41A 4ZB2A 3TR9A 3VU2A 6CGTA 1VKFA 4JQ4A 4KESA 4O14A 2DT2A 1A4MA 1TIWA 1IHIA 3E3HA 3R79A 4UTWA 1H2JA 1OFRA 3ARUA 1WCGA 2EPKX 4XKYB 2RGMA 2J9XA 1A5KC 2FJKA 3Q58A 3PAOA 3GW3A 4D6EA 3WBAA 4O1EA 4WOQA 5BOFA 1K7FA 3IJIA 1BGAA 2BGNE 1PYMA 3L66A 1EGVA 3THDA 4KBXA 4N42A 1X6NA 1LL4A 1AJ0A 2D0FA 1DIEA 2YX0A 4BR1A 5JBFA 2RH9A 3N19B 3LI0A 1K1DA 3DDMA 3CMFA 1LQ0A 3UWQA 4G1KA 1XLAA 4ROQA 2VEGA 5DBUA 3FXGA 4IOTA 1HQTA 1TR9A 3NZQA 4JPGA 3E02A 4CVUA 4XAZA 3QQ1A 1VLIA 1Q7ZA 1A80A 4HK7A 1TPC1 4NJHA 3PWIA 1TV5A 5HJYA 2BY3A 1SGJA 4JCMA 3IAQA 5CZJA 3NEHA 1OINA 4UTIA 5CKSA 5F2IA 3TJXA 3IVTA 3BW4A 3RYSA 4BWLA 3PWAA 3H22A 1JZ2A 2QYGA 2AQVA 5GPRA 3BCDA 3QPYA 4HD5A 4BJHA 1ZCOA 2F8QA 5FSDC 1JPKA 4NQ1A 4BF5A 3TYBA 3CZ8A 4B91A 4XKMA 4WXZA 1JNDA 1IEVA 3UEQA 5I00A 3W25A 4AW7A 1E9ZB 2CNCA 1QK0A 1XSJA 2ZOXA 1Z9AA 3H12A 4B4FA 4GJJA 5I78A 3WG6A 7ODCA 2BBFA 1KQZA 5BU6A 3USBA 3DYOA 3M5XA 1C8YA 3S1GA 3HV8A 4C6CA 1WDPA 4R9XA 4A3RA 2GJXA 1QU4A 3H7UA 4AF0A 3PFMA 4NF7A 1UR1A 2ISWA 1B2YA 4X9YA 4RL3A 3CMGA 1JYNA 3PFRA 5HNUA 3OOQA 4UB9A 2CXGA 4AUBA 4V28A 3QTPA 3SO7A 1G94A 3ECQA 1FDZA 1VFHA 4DX3A 2CLIA 3U5YA 2PF0A 1VFSA 3WLQA 2ESCA 3BMVA 3L4UA 2B7NA 3E0LA 4FLQA 4HMEA 1MXDA 1LJYA 1GONA 4PBFA 1WOBA 3L4WA 1FWJC 2NUYA 2HNEA 1EWEA 1C93A 3CAQA 2TAAA 5A6BD 3M9YA 4NAFB 1JQVA 1PEZA 1XM3A 4H7CA 2W0UA 2DSUA 1TE1A 1TJPA 4IUOA 3P2VA 4ZQNA 3MI2A 3OP2A 1HKWA 4EK7A 2R1NA 1Z32X 1HO4A 1WZKA 3CZLA 2VGGA 2OSWA 2V5KA 3QPZA 1CXLA 3WDHA 2Z28A 2PD9A 1SO4A 1WXYA 4ZR8A 4Z1DA 5A6LA 4DBWA 3ZVIA 3IARA 4W7UA 3AZRA 4F0KA 1EJ7L 2C91A 3GDBA 1DP0A 5FAJA 2XGBA 3GDLA 4DWSA 1VBGA 2C1GA 1OSEA 5DCEA 3MZNA 1YW1A 4MIMA 3GG7A 5DANA 4LRTA 4MTVA 2Q8LA 2WYSA 4IXXA 3R1ZA 2H3DA 1CGXA 1GYLA 4MKSA 4Y9MA 4HNVA 3O15A 4L1XA 1O5XA 4HKPA 4AYSA 4WHBA 1LBFA 1W1PA 2PDNA 4GQ0A 2WZEA 4H9UA 2A6LA 2ATMA 3TFXA 3NIYA 1EEXA 3GTFA 2R82A 4NKCA 4RDWA 1WB0A 1E51A 1VS1A 4MYXA 1THFD 4K3ZA 1K6WA 3MW7A 4PMQA 4V2XA 2OVLA 3KAOA 1S5TA 4IZGA 1VAHA 4H9ZA 3KS5A 1RV8A 2QKFA 3CLWA 2P0OA 3TVAA 2GVJA 3O6AA 4G8TA 3MMUA 3HO8A 2DORA 2WMIA 4MKVA 4Z08A 3WQPA 3T07A 2ZZ5A 3U2ZA 4E2BA 1OG6A 5C2XA 3LXBA 5I3GA 1DWAM 2QS8A 1R85A 1SSGA 4QSHA 2HK0A 3V3WA 1BPLB 4YVVA 4NJGA 5JVLA 4IFKA 1GHSA 1T99A 2X7VA 6ALDA 5I6SA 4H6KA 1HW6A 2QCGA 4GZJA 3NPUA 3QW4B 3W1MA 3MANA 4K39A 2OZ0A 4JQ2A 4NVTA 4D6JA 1W1ZA 5E0FA 2QCNA 3UQNA 1QR7A 3IUHA 1MMFA 3S5SA 3W7HA 4WGXA 1LRTA 4F0LA 2O4MA 2JEQA 3LLFA 2A3EA 2NQHA 4D6CA 2GOKA 4Y90A 1PL9A 3RM4A 2ZADA 4Q4KA 1KFLA 4LAZA 3GBEA 3KVKA 3MCOA 2B7QA 2CLHA 2GOUA 2OSXA 3PNUA 4A29A 4L9ZA 1Q4NX 4Q6JA 2XZ9A 3IK2A 3LPFA 3S6TA 4IJCA 3BQ5A 3MA8A 3VD3A 4N4PA 1DJXA 5FF2A 5LIYX 1IT7A 5XIAA 3GAKA 2VWSA 1QASA 2EPMX 2Z0IA 1V0MA 3COTA 1FQ0A 4KRUA 4GI4A 4NZCA 4INFA 1G69A 2PWDA 3IJ8A 1XLLA 2X30A 1M7JA 2BHZA 5F4SA 1A3WA 2A7PA 1W54A 2ADAA 4IJRA 1RP9A 3GG0A 4C6BA 1ZS2A 4O50A 4D2JA 1G01A 1GVEA 1WXJA 1V0LA 2Z26A 2AKZA 3OTRA 2W62A 5BRBA 2P1FA 2ZKMX 2JK2A 3TDFA 4QNEA 2H6RA 3STPA 4DI9A 2ZUTA 3LMZA 2AOSA 5JUVA 3V1HA 1HFBA 5D8WA 3STGA 4A21A 1W3JA 3GW0A 3A64A 4JKKA 1SZGA 1Q2RA 4QLJA 2OODA 3BVJA 1IXPA 3LCXA 4UBPC 5TQLA 3WUFA 4J3ZA 4CD7A 3TN6A 4XVEA 3SCOA 1M53A 3I7SA 2V0TA 1DE6A 3MUZ1 4C6PA 3H70A 2GK1B 3IANA 3BLOA 2CZDA 5KMYA 2OQLA 2YBTA 5IDZA 4GINA 1BVWA 5KZMA 3CT7A 3VIPA 1LYXA 1R8LA 2PWFA 1PIIA 2UY4A 2WMHA 5E0CA 1BKSA 3XIMA 5HWNA 1TMLA 3BLEA 2CZFA 4N9CA 4AHOA 3FIGA 5D9MA 1X6UA 3K8LA 1ZJBA 3W88A 2PMQA 1TPB1 3DFSA 4B2DD 1DJHA 4FR6A 4H8NA 4QP0A 1HX0A 1EX5A 2JF7A 3S6DA 1TG7A 3AISA 1FCQA 1ICPA 3AOFA 3QM3A 4GVGA 1YBQB 8CGTA 1JDDA 3W01A 1WO2A 1V79A 2XIJA 3BK0A 5DMMA 4PMYA 3QGKC 1FDJA 5BOOA 3T0DA 3W7LA 5E6YA 3WD4A 1XW8A 3C0SA 3GU2A 3TYZA 5IOBA 5KZ6A 2VHLA 4O0KA 1RLDA 3AJXA 3LZ3A 2O7QA 2E5BA 3CU2A 3KP0A 4Q4MA 1V6VA 3N17A 4C6IA 3VOGA 1HIZA 1W9BM 3N9KA 1WUFA 3M46A 3WEMA 4UQ9A 3DYMA 4Z1BA 2CXEA 4G56A 5IDIA 3MHUA 4P8XA 3H23A 3R6IA 3EYPA 5BOEA 1EJXC 5KTLA 2Y2WA 2C0HA 1G0CA 2VFFA 3BCJA 3PPHA 4JTAA 3SIMA 2GFTA 1I60A 1R5YA 2WMJA 3K4DA 3MHFA 3CV6A 3W53A 3UR8A 2AQOA 2VZUA 2V3FA 4EPDC 3WD3A 2QGHA 4MJ2A 4UNLA 3DG3A 5M2FX 3U48A 5IHRA 4W5UA 1EDGA 3AMCA 3JS3A 3F2DA 4TX6A 3KVJA 4WVXA 3CIWA 4O4VA 5CC6A 5C70A 4H8UA 1P6BA 4UNKA 4IFRA 1UR9A 1I0DA 4ORMA 3W7NA 4PU