1TA3A

Crystal structure of xylanase (gh10) in complex with inhibitor (xip)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor protein I
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Emericella nidulans
total genus 99
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ta3A00
2PBGA 4OOUA 2GDUA 2WM0A 2JF6A 4J3VA 6A3HA 3EDEA 2BXYA 3WNOA 3CHFA 2DSZA 2WCSA 1E72M 3VD7A 5A8MA 3L4WA 5LYRA 3WDIA 2PWHA 1E6SM 5FCZA 4AD3A 2JIEA 1G5AA 1RH9A 1D2KA 3GZAA 2A3AA 2VZUA 4W7WA 3F5JA 4W87A 2FGZA 2VX4A 3VD5A 2VUYA 4DUXA 5JBDA 3U5YA 4CD7A 3A47A 5ABEA 2XVLA 4JHOA 4F8XA 3FAWA 2Y4SA 4UZUA 5A8PA 4CVUA 3PZOA 4YHEA 1FH8A 4D6FA 3DYOA 1EDGA 2DSKA 5A94A 3DYMA 1JD7A 2WMGA 1LL4A 3VPLA 3BAIA 4PBGA 1ECEA 3TOPA 2WSKA 4J3XA 4L4PA 4YPJA 2O9TA 1Q4NX 3HJEA 4TTGA 3OLDA 1V3MA 3PBGA 1FFRA 3ECQA 2O9RA 1XD0A 2BY0A 2ZX8A 1V0NA 1XH2A 3UCQA 2BHZA 1JXKA 1UWTA 2CERA 4B9YA 3PHAA 5I5RA 1KGWA 1GOOA 3II1A 4FF5A 2HVMA 2QMJA 4M80A 1HVXA 4MNLA 1HL9A 4U3AA 3WF3A 1ZBVA 1R7AA 4URIA 3WUEA 1MW1A 4HPGA 1MQPA 4S3KA 1BYCA 4LYRA 1GONA 4W7VA 4A4AA 3EBVA 2OYLA 4FLOA 3VIGA 2YBTA 5D8ZA 5DMYA 1GOKA 3IAPA 5I6SA 4BQ3A 5FL0A 4PSPA 3PZQA 4WK9A 1SFSA 1UR4A 7TAAA 1E6ZA 1H5VA 1TE1A 5A6BA 3N1AA 2FGLA 3WL1A 1KGXA 3IJ9A 4UNIA 1B1YA 1KQZA 3DHUA 3SIMA 3TTSA 3QHOA 2ZUMA 1WPCA 3FW6A 1V0LA 2C8NA 1BFNA 3GTNA 3CUIA 5ABHA 3CHDA 3PZMA 3K8MA 3GXIA 7A3HA 2YJQA 4LQ1A 3L4XA 1UQYA 1BSIA 1V08A 4PYSA 2J75A 1R7OA 2PWDA 1RP8A 2JALA 1BVZA 3O2LA 3VM5A 3ZO9A 4W8AA 3K8LA 1XCWA 3N18A 1E0XA 4GO9A 3L4ZA 4AD4A 4TVCA 2WZEA 3W38A 1ZJAA 4KMQA 3WMSA 1BGAA 1OINA 1JZ2A 3ZR6A 4S3JA 5EFFA 2WPGA 3SCWA 4MNKA 4PTWA 4P7NA 1JXJA 3WQ5A 4Z2LA 4AZ5A 4JCMA 3POCA 2BY3A 5A2AA 3WH5A 4QFUA 2DEPA 3BAJA 2UY3A 4LYQA 2RGLA 4CGTA 8CGTA 3CO4A 1W9DM 1WZMA 4MADA 3M07A 3BC9A 1CWYA 3AHVA 1HKMA 2Z1KA 1M53A 2D2OA 2WCAA 1WNOA 3AS3A 4UFHA 2J25A 3AROA 3T2QA 3WNKA 3ZJKA 5E09A 1D7FA 1DP0A 4A3YA 5AY7A 3GNPA 2BFGA 4UOJA 1QNPA 4GI9A 3ZSSA 3GH5A 2CBJA 1JZ7A 5JUVA 2JIWA 2OLHA 1JF6A 1UD4A 1W91A 2ZWYA 3N04A 5EBAA 1OGBA 2VR4A 3ARQA 2OYKA 4RL3A 2B31A 2J47A 4W8LA 2QMKA 3WKZA 2DH2A 2VZSA 2EPKX 4BZYA 4M8UA 5DFAA 1BPLB 2OYMA 3S2CA 1MFVA 3QHMA 1JYXA 2VRKA 1I1XA 1JAKA 3TTOA 2MANA 5I3DA 1DHKA 2WHLA 1XSIA 1EH9A 4HA1A 4MPKA 4D6DA 1NARA 1C93A 4QLKA 4CD5A 3ARVA 1FOBA 1W2VA 1E5NA 2XSBA 5EB8A 3JUGA 5ABFA 3WFZA 3RILA 5JBEA 3MUZ1 4HMCA 2VRQA 2OSXA 1CIUA 3W29A 1UR2A 1B0IA 4V27A 4P8WA 3LPPA 3BMWA 4MNMA 3VGEA 4MDPA 3VMPA 1HL8A 1FHDA 5ABFB 4CD4A 4WSJA 3EDKA 2CKRA 4RE4A 2ZXBA 4HMEA 2QPSA 3BAYA 1R85A 2XGBA 1NM9A 4M1RA 2YL6A 1JAEA 2WC4A 2VMFA 2YLAA 5A6SA 4ZENA 4F9JA 4OJYA 1OBAA 7CGTA 2WWDA 1MQQA 1K9FA 2XPKA 3NYDA 4HOWA 2WWCA 4BF7A 2DSWA 1BHGA 4HMDA 4E2OA 3WY1A 3ARWA 3LPFA 3TTQA 1I75A 2VVNA 3VDHA 4W85A 1UYQA 2F8QA 1PIGA 2WKGA 4QP0A 3VILA 1LF1A 1E3ZA 1V3HA 2W62A 3QHNA 3VNYA 4IM4A 1WAWA 2J7CA 1QHOA 4HP5A 1EHAA 2E0PA 2GJRA 1KGUA 1BG4A 2CPUA 3ZJ8A 3UG5A 4D6IA 4AZBA 4J3UA 1KR1A 2QLYA 2QPUA 4AISA 1EO5A 1O6IA 2VVSA 5CZKA 4UZSA 3WEZA 2CETA 3BCFA 1XH0A 1GPFA 1V3JA 2JE8A 2ZUSA 3AMKA 1TCMA 5I23A 3NUKA 2VCBA 1CENA 4LYPA 4PCTA 3BH4A 4EE9A 4HA3A 4JKMA 2PWEA 3GBEA 3AI0A 5E0CA 1JG9A 3PZUA 2WHMA 3IJ7A 1H11A 4BA0A 1JL8A 5DEZA 3AHXA 3WDHA 1PIFA 2YKKA 5M03A 5E70A 4IISA 2VZTA 2ZXQA 2X0YA 2DSUA 4MB4A 4FK9A 1P6WA 4TXEA 1K9DA 1UD6A 3SCQA 4MAZA 1E15A 1R8LA 4PMNA 1MWOA 1CZ1A 1OT2A 1W3LA 1E56A 3W28A 4Z2JA 1KXHA 4WKFA 3K4AA 4AZIA 2AOSA 2BY2A 1KCKA 2WHKA 2CBIA 2G8ZA 2GJXA 5FL1A 1GOQA 3LPGA 3VMOA 3WNLA 4IPLA 2CCRA 2A3HA 5D9OA 2E9MA 1H1NA 2GDVA 4B3KA 4JL1A 1KCLA 3T0BA 1EQCA 1DWJM 2E9BA 1NWSA 4X0NA 5GNXA 2GJXB 3AXHA 3RM4A 4WIWA 1EOMA 2J78A 4PTVA 1S46A 1OD0A 5LA0A 4PCSA 1DWAM 4PTMA 3OG2A 3EMQA 4K68A 4TTUA 4AIOA 3B9AA 2D0GA 3AYRA 2W61A 4CUCA 1FH9A 2DH3A 1XSJA 3OLIA 2F61A 3WNMA 4KWUA 4XUYA 3WUFA 1V02A 3AHZA 1V02E 1LQ0A 1XCXA 3VX0A 1TUXA 4XB3A 4CVWA 3EMCA 1XYFA 4UFKA 1ISYA 1JI2A 3AIWA 2XVPA 3BSGA 2G3IA 2V5DA 1V03A 1QHPA 4CN6A 1B3XA 4CD6A 1Y7VA 1BG9A 3O9NA 2JF7A 3W6LA 2E8YA 4PMOA 1VENA 3BCDA 1UZ4A 3FXYA 1L0PA 4FLRA 1JZ5A 4X0VA 1B3YA 1XC6A 4AD5A 1DWFM 1DWGM 3VGFA 4DM1A 4D6CA 1ITCA 4P7OA 3I3DA 5I2UA 2WMHA 1EHNA 1KFWA 3ZT6A 1PZ2A 1WDSA 3VD4A 2WCGA 3OA5A 2EBNA 4PSRA 3GYCA 5HPCA 1JYWA 1HKKA 4LXFA 4ATLA 1NOWA 1JNEA 2IUZA 1LWHA 6TAAA 2V3DA 4IPNB 2HISA 2J74A 3NIYA 1WE5A 2WBGA 1EDTA 1KWKA 1JNDA 1G0CA 1PX8A 1ODZA 3VDBA 5IFPA 3OBAA 1BTCA 1CXFA 4A3HA 2J79A 4YHGA 3WFLA 4OBSA 1E4IA 2ZOXA 1C8XA 1E70M 1B9ZA 3WUGA 3FN9A 2XWDA 3PZVA 4F79A 4CD8A 4E4PA 1ISVA 1HF6A 2IXVA 1J12A 2XIBA 4Z2KA 2CHNA 3SCSA 3TONA 4JKKA 3VIFA 5JIWA 4H04A 5IFTA 4HZ6A 3VKKA 4P8VA 3CTTA 3AHTA 4QCEA 3W25A 4WJXA 1QHZA 4FMVA 2EO7A 4AZ6A 1V6YA 4R5EA 4WF7A 1K9EA 4U31A 3AXIA 2J7FA 3PZTA 1JZ3A 3EDFA 2CKSA 1JD9A 1CGYA 2YDQA 1BYAA 1O7AA 1GW1A 2W5FA 4H8VA 2ZUWA 2J7EA 1FH7A 3CZLA 2YDSA 2VRJA 1M03A 3PN8A 5D4YA 1JI1A 3W37A 5A3HA 3T09A 3SUUA 3BSHA 5DO8A 3ARRA 1H2JA 3GNOA 1VFMA 1DWIM 2W63A 4GQRA 3AHYA 1X6NA 3SCTA 3MSDA 2VI0A 3KE0A 1V3LA 5EMYA 4PEEA 3CMJA 1IT0A 3KZSA 3CIVA 3FNDA 2D1ZA 1XRVA 2UY4A 3ZOAA 3WNNA 3VDAA 3ARXA 3WQ8A 2NT0A 1VFOA 3AIVA 5GPRA 1WKYA 1B31A 5E9AA 1ZBCA 3UG4A 1GQJA 4H41A 3K4DA 1ZBWA 1HVQA 3HMCA 4J28A 3WD4A 1E6PA 1MXGA 1ZS2A 5AYIA 4QLJA 5CPTA 5TD4A 3QGVA 2BHUA 2EPOA 3D5HA 2GSJA 3MMDA 1W9VA 4J3TA 3S6TA 3AZRA 4CU6A 1H0GA 2CHOA 3OZPA 4XX6A 4Y7EA 4DM2A 3CZKA 4UCFA 2E8ZA 1LG1A 2DT0A 2PC8A 3WSUA 4EK7A 2VR5A 1HJWA 4CN1A 1EXPA 1IZJA 5BXTA 2WC3A 1B90A 1VEMA 3L4VA 5D9MA 1QI4A 2D23A 1UWSA 1GVYA 4UFMA 2E4TA 2XFRA 4GI8A 2VQTA 1VAHA 1WO2A 1E0VA 3PZIA 3OGSA 1KB3A 1CPUA 3W26A 1AQ0A 1GQIA 1VEOA 3MMWA 4AMCA 4M24A 3WF0A 1G1YA 3F4VA 1IZKA 3SURA 1V6UA 4CCCA 3O6AA 2PWFA 3NSNA 1NWRA 3IK2A 3MANA 4JCLA 1LJYA 2X0HA 4HOXA 3PZ9A 1CXHA 2WANA 1FP8A 3CZJA 4AYSA 5C71A 5CGMA 2UY2A 2OWCA 4U5IA 3VIKA 3VM7A 2JEPA 1JIBA 4MJ4A 1HX0A 1CTNA 1NP2A 8A3HA 1BF2A 3TA9A 3NDZA 3GH7A 2XHYA 3UEQA 2QV4A 1PX4A 1H49A 1DTUA 1KWGA 4B3LA 4CCEA 1OM0A 3RM8A 2BV9A 3VIOA 1N82A 4N0RA 3RMEA 1NOFA 4UQDA 1W9UA 2GFTA 1DEDA 4NI3A 1Q6DA 2FH8A 4CU8A 5IDIA 4P7LA 4PMQA 5FD0A 2ZX9A 3CHCA 3QR3A 2X05A 3W0KA 2JFEX 1C8YA 2CESA 2WVVA 3PTKA 3APGA 1VIWA 4HU8A 2VC9A 1GZJA 3BLKA 3VO0A 4GIAA 4AZHA 4BS0A 4TX6A 4C7FA 1J0IA 2VOTA 1E40A 4NF7A 3WBAA 3SCPA 4P8UA 2V3EA 3NCOA 2WVVB 3WENA 2ZUNA 1PBGA 2WNWA 3A4AA 5ECUA 5BYWA 3N11A 1WP6A 4GXPA 1UD3A 3ARUA 5FKYA 2VZVA 4UQAA 2RGMA 3RM9A 4LX4A 3FHAA 5BWFA 5A2BA 1KXTA 1US2A 1GVIA 3L4UA 4L4OA 5GNYA 4AEFA 1ODUA 5HPOA 2V5CA 1TZ7A 1JDDA 2WB5A 1XGZA 4PMVA 4HZ7A 4JZ5A 1BAGA 1E5JA 1VJZA 5CLWA 2G41A 1UKTA 2IXUA 1E9LA 3PZNA 1U30A 1EIBA 1GOIA 1ZBKA 2CITA 5A69A 4BCEA 3CGTA 1ZL1A 1J0KA 1GCYA 6CGTA 3WD3A 3AZTA 1W9PA 2X1IA 3ZJ6A 2XSAA 4MB1A 4PUDA 1UR9A 2XGIA 3WD1A 1GORA 2E9LA 2FH6A 1E1FA 2D22A 3CZEA 4IUGA 1C7TA 2YL8A 1A47A 2VNCA 4M29A 1SMAA 4ACZA 1HN1A 4TX8A 3SUTA 4D6GA 3A3HA 3WD0A 1MXDA 4PMZA 1HJSA 3N13A 5BRQA 1E6QM 2VX7A 4GKLA 3CBWA 1C3FA 3WBEA 1PX3A 1OIFA 4JFUA 1M7XA 3OZOA 3ARPA 4JHZA 5BXRA 1HJUA 4AW7A 4ACZB 5A2CA 1V6WA 4D6HA 3WNPA 4J7RA 4DUWA 4GPNA 1WB0A 1XV8A 3AJ7A 1CNVA 2YIHA 1UA7A 1KQYA 4YN5A 2A3EA 1UD5A 3SUSA 1F4HA 3DHPA 3K1DA 1C8QA 4KRTA 2EXOA 4W88A 2D24A 4PMRA 1U2YA 5DF0A 3MMUA 1UR0A 4DUVA 4MJ2A 1XD1A 3BAXA 4BQ2A 2XVKA 2YA2A 4U33A 4UOQA 3VGGA 3D3AA 4UR9A 4V2XA 2QF8A 1QNOA 1NH6A 4C7GA 3CPUA 1C7SA 2WLYA 2WC7A 2XVGA 3B9EA 2VCAA 3N9KA 1CBGA 5E6YA 4UOZA 5A6KA 3ZT7A 1Q6EA 5D9PA 4M56A 3AIEA 3VIMA 5EFDA 1BVNP 2VZOA 3PTMA 4D1IA 2YOCA 1BGGA 3SCVA 2E40A 2WLZA 3MUY1 1QBBA 2AAAA 1GHSA 2GJPA 1TVPA 3RJXA 3WH6A 4AIEA 1TFVA 1JZ8A 2ZX5A 3MO4A 1EDQA 2J7GA 4QCFA 4NSBA 1KBBA 1QW8A 2BVTA 2VURA 4U5KA 4D72A 2WHJA 1QNRA 4AZCA 1W9XA 2XYLA 1E4NA 3UERA 3T0DA 4GZJA 1EO7A 5BROA 4Q22A 4OOZA 1X6LA 2VQUA 5BXSA 2V3FA 2PB1A 4UFIA 3PTQA 1W1VA 3WUBA 3AMGA 1JGIA 2Y8KA 5I77A 1HP4A 1GQLA 1J18A 4AZCB 1J11A 2Y5EA 2EPNA 1JZ6A 1JYNA 1C90A 1Q6GA 1UWQA 2W66A 3BXWA 4UQCA 3VIIA 1ZJBA 3WF1A 1NWUA 2CIPA 1QVBA 1UKPA 2Y2WA 1W1PA 1HP5A 3CLWA 4M81A 1G94A 1R87A 3K8KA 3AQUA 4PMUA 2D20A 1QW9A 5CJ5A 1PJ9A 3VVGA 1LLOA 1W2PA 3B8SA 2ZUUA 1KR0A 4TUFA 3TTYA 5JIPA 3AIBA 2Q8XA 2FHBA 3IANA 4NRSA 3N12A 5D9NA 3MU7A 1MW2A 4OZOA 1CXKA 5I24A 3TP4A 3VGDA 1VB9A 5AYBA 3RO8A 3AS1A 4KRUA 3WH8A 1HJQA 5CGTA 1XSKA 3J7HA 2D3LA 2BVDA 1JF5A 1CXIA 4HU0A 2W92A 3OB8A 4KH2A 3MS8A 3UESA 3N17A 3RJYA 1QNSA 2PBOA 4NRRA 1H3GA 5BRPA 2OWWA 1J0HA 4W89A 3VMNA 1A3HA 3ZJ7A 1CECA 4GI6A 4PMXA 1Z32X 2VT0A 4JIEA 2O9OA 3F5KA 1MVYA 2CYGA 4WSKA 2OWXA 5C70A 4GQQA 4UQBA 5AC4A 1GHRA 1CEOA 1HKIA 3M6DA 3NSXA 1HT6A 4JL2A 4UQEA 5CPQA 1UOKA 4AY1A 4B16A 1W1YA 2J8FA 3LPOA 5A6JA 3E1F1 3RDKA 5FOOA 1TA3A 4RE2A 1B3WA 1VEPA 3VD9A 4UTFA 3OLEA 2A3CA 4P7QA 2DQXA 2WMIA 5A8QA 5HXMA 1CGTA 2WBKA 2DT2A 2XM1A 2A3BA 3EDJA 3HU7A 3MUAA 3SUVA 4AD1A 1E4MM 5KEZA 2WMKA 1MW0A 1FHLA 3FAXA 3ARSA 3LMYA 4C7DA 1V3KA 3L2LA 2WVUA 1TA3B 4J3SA 3GXFA 1RPKA 1HJXA 1B30A 3AISA 2WMIB 4ZE5A 2X2YA 1LWJA 4MTVA 1JYVA 2GUYA 2VL4A 1V0MA 4H2CA 4PTXA 4V28A 1W9BM 1VFFA 3VIJA 2G3MA 3L2MA 1LL7A 3ARYA 2DT1A 3AXXA 1ISWA 3VDCA 3DYPA 1BYBA 1U33A 2YBUA 5A6BD 3GBDA 3ZSTA 1AQHA 2EPLX 2UY5A 2XFYA 3W4RA 1OGSA 1EGZA 2YA0A 3U5UA 1K6AA 1XHGA 3AMLA 4GINA 4ATDA 2F2HA 5M17A 3VOCA 1X1NA 1PZ3A 2J62A 1QI3A 1E6XM 3BLPX 1KBKA 3WMCA 2XIIA 4W5UA 1V6VA 2OSYA 3AFBA 1GQKA 3OLGA 3WL0A 4JFTA 1E6NA 3WDPP 4Q7NA 2OSWA 4CU7A 3THDA 1UD2A 4B9ZA 2YA1A 2ZICA 2Y8VA 2WVTA 5IXEA 1JZ4A 4GO8A 2WXDM 4QDMA 3T2PA 4W5ZA 4XZBA 1AVAA 5HBFA 3AIRA 4Z2GA 3BAKA 3VU2A 4ZFMA 1WCGA 2FDMA 3RPMA 1HJVA 1GJUA 1TR1A 1L8NA 1XH1A 1HXJA 3AOFA 2DT3A 2Z1SA 3B9DA 2BS9A 1WZLA 1GNXA 1G9HA 3ZM8A 1YQ2A 2ZWZA 1UWUA 3BMVA 3W6MA 3CMGA 3WDRA 5A1AA 3ALGA 2J8GA 1E1EA 4U2ZA 4AWEA 4W8BA 4EAMA 3MV01 1AMYA 3VD3A 1H41A 2DGAA 1ISZA 1W3HA 1QBAA 2AMGA 2VCCA 3WELA 1J0YA 1GOMA 1CLVA 4GZEA 1UUQA 1ITXA 3A4WA 2ZUVA 2WSPA 2NT1A 1US3A 2CEQA 2G3JA 2ZXDA 2VJXA 3WD2A 5ABGA 1F4AA 2CBUA 1W3JA 3W27A 2BY1A 2XVNA 3ZMRA 1KXQA 2EPMX 4AXNA 2ZX7A 2EEXA 1UWIA 2XFFA 5I79A 5JBFA 1HNYA 2GVYA 2DPEA 1M04A 2WKLA 1JDAA 2VO5A 4H7VA 3HN3A 2WYSA 4ZXLA 3GH4A 3UR8A 1H09A 4TVDA 3SCUA 3AZSA 2BXZA 2YLLA 1EQPA 3GM8A 1CLXA 2CXGA 3AS2A 3VTRA 4PN2A 1QI2A 4JFWA 2JEQA 1OGGA 1VBUA 2WK2A 1VF8A 2J7BA 1OB0A 3DECA 3WQVA 1FA2A 1H4PA 3AIUA 3CHEA 2CNCA 4HZ8A 4MDOA 1J01A 4N42A 3KEHA 1JFHA 3SCNA 4AD2A 3EYPA 2YDRA 1W32A 4CKQA 4ML4A 1V3IA 2XG9A 1ISXA 3CZ8A 3VUPA 4D6JA 5I0DA 3WDJA 3T0AA 1SR0A 1UKQA 2XM2A 4WLCA 2W91A 4PUEA 3VX1A 4XZWA 2WZHA 1QNQA 2ZE0A 2G3NA 3WEOA 4HTYA 2ZX6A 5BXPA 3PZGA 3VGBA 1HIZA 2WW5A 1WDQA 5DT5A 4QAWA 4W7UA 3EMZA 1BYDA 3VINA 3AMDA 4BQ5A 1E4LA 2W67A 5E6ZA 3OGVA 1TVNA 1HKJA 5A6LA 1J9YA 1CGWA 3N15A 5CXPA 5F7UA 3NDYA 3WQ6A 3WQ4A 4LGXA 2WVSA 3M46A 2O92A 1IV8A 5AC5A 4M82A 1FFQA 3ARTA 3ZT5A 4JFSA 3BAWA 4E8CA 5A6AA 4FLSA 4PMDA 1JDCA 4AC1X 5BCAA 3WH7A 3GXMA 1WDRA 4R27A 3WDQA 1UG6A 4ZE4A 4ATWA 2D3NA 2DIJA 2XWEA 4JKLA 4D71A 4ACYA 3VGHA 3NSMA 2J77A 1C91A 1OIMA 3WIJA 2ESCA 2BHYA 2ZUTA 1GOWA 4OBRA 5D8WA 3WH9A 5HNNA 1UHVA 2NSXA 5HDRA 2TAAA 1VJSA 4MB5A 1FP9A 3AS0A 2XTKA 4CCDA 1MQRA 3AICA 3UG3A 1UR1A 5A6MA 4HA4A 3A6OA 1Q6FA 3CUGA 1ZU8A 1LG2A 1OWQA 1YHTA 3U7BA 5M3WA 4DWSD 4F9DA 3MUIA 2C0HA 3L4YA 4J3WA 3WQWA 5CSUA 4TVUA 4AZGA 1OCQA 5A95A 1SYTA 9CGTA 3KL0A 4P8XA 1VBRA 4DWSC 2ZXAA 3MV11 3OIHA 1C92A 4RE3A 5C8BB 1BLIA 3OGRA 1UD8A 2FHFA 5DT7A 1E73M 1NOUA 3A4XA 1D3CA 4MNJA 4QLLA 1E71M 2J7HA 1PAMA 1E6RA 1UZ1A 4ZEPA 3F5LA 4E8DA 1QPKA 3W53A 2NW0A 3WMBA 2YL9A 1VRXA 5GQBA 4UFLA 1EOKA 2BNJA 2D0FA 1MFUA 4JAWA 1ZB5A 4WKAA 4JFVA 5LA1A 3ARZA 1MYRA 3ZR5A 3IJ8A 1E0WA 4X9YA 4Z2IA 5I78A 4KGJA 4AIUA 1BQCA 2Y24A 3CUHA 4Z2HA 1K9TA 2EQDA 3W81A 3WN6A 2X8RA 5GNZA 5CG0A 3ALFA 1LL6A 2PWGA 5KZ6A 2C7FA 1G01A 4H8UA 4OIFA 4BQ4A 4P7RA 1E55A 1VFUA 4W93A 1UR8A 1MW3A 2V3GA 1CGVA 4DWSA 4AD0A 4LPCA 1W3KA 3M7SA 2DIEA 3RIKA 4F66A 1OT1A 3U57A 1V0KA 1RP9A 5CPSA 5CLTA 3W24A 3W82A 1B3ZA 4U2YA 4PMYA 4DWSB 1SMDA 1QI5A 4HPHA 3QOMA 5M5DA 2DSVA 3NJ3A 2YL5A 4TOQA 2O9PA 4GZIA 1WDPA 4OUEA 3VIPA 3WF4A 2FHCA 3AIQA 1AQMA 1RD6A 1Q6CA 3KWXA 3GXDA 1XYZA 4AEEA 1UH2A 2PF0A 1UQZA 3I3BA 4UFJA 2VX5A 1UA3A 2ZIDA 1H0IA 2QHAA 3SCRA 3ZIZA 1UKOA 1CDGA 3WEMA 3GDBA 2GK1A 1ESWA 2X09A 3SCOA 5IHSA 4UQ9A 2VX6A 4KGLA 3THCA 4AZ7A 2J4GA 1QOXA 1B3VA 3CUJA 1V6XA 1EA9C 1DWHM 1E3XA 4ZXOA 4HOZA 3CH9A 1GUVA 1WZKA 2D0HA 4J27A 2WMJA 2VTFA 5CSYA 3AMCA 2GK1B 5CQ1A 3ZQ9A 2CBVA 1QI0A 4PRWA 4XV0A 1KXVA 1TG7A 2E3ZA 3G6LA 3KL5A 3AYSA 4CN4A 5FIPA 3DC0A 4W86A 1CXLA 1PPIA 3CUFA 3U7VA 1PEZA 5HOSA 3WF2A 1UH4A 3BGAA 1NQ6A 4FLQA 3G6MA 1JFXA 1GJWA 3VIHA 2PI6A 3EDDA 4MAVA 3POHA 5A8OA 1UWRA 1B2YA 3KL3A 3L4TA 1J0JA 2W4XA 1CYGA 3I3EA 1TMQA 2G4FA 3GNRA 4U3CA 4B15A 2WAGA 3MKKA 3CZGA 4D6EA 3UR7A 1NWTA 2BVYA 2WMFA 2WZIA 4EANA 1CGXA 1CGUA 3K46A 1CXEA 1OSEA 2EJ1A 1W1TA 1E43A 3UETA 1I1WA 1J10A 3SEPA 1UKSA 3FHQA 4W84A 4WKHA 1OD8A 3SUWA 1J0ZA 3RCNA 1M01A 1NP0A 2V38A 4D1JA 3T08A 5E0FA 4OKDA 5A8NA 2UWFA 2DDXA 3IAQA 1WZAA 3QOKA 2XJ7A 3VNZA 2XUCA 2J7DA 1R86A 3FY1A 4MB3A 5LA2A 3T2OA 4H8HA 4NZCA 5IHRA 3MSGA 4EKJA 1UH3A
chains in the Genus database with same CATH superfamily
3FJNA 4FPSA 4Q32A 2WM0A 2JF6A 1LUCA 2NVAA 4NZ5A 2DSZA 3CL6A 4XAYA 3L4WA 3CWNA 2NUYA 1E6SM 5FCZA 4AD3A 3GZAA 1D2KA 1TX2A 2ABAA 3TTEA 2XN1A 3L5MA 1Z89A 2ZRVA 3TSBA 2F6UA 4MZ1A 2ZYFA 3E96A 3RXZA 4LBRA 3GG8A 4EWJA 4NQ1A 3HPFA 4ICCX 4W9TA 1J79A 1MNZA 3THQA 3UWUA 4D6FA 3DYOA 3DYMA 2A3LA 1JD7A 1HKWA 2WMGA 4GMEA 2WSKA 2CLKA 3E2RA 3H8AA 1ALDA 1A5OC 4TTGA 2V5LA 3LTSA 1QPRA 3PBGA 4A3QA 4Q8OA 3R43A 4B9YA 3LDVA 1GOOA 3II1A 1ZSXA 2HVMA 1KM4A 4K3ZA 5T9BG 1Y0EA 3E74A 2PMQA 2ASHA 3MC5A 4WHBA 4URIA 4V1XA 3UBPC 4HPGA 2Y70A 1MQPA 4S3KA 4MKSA 1GONA 5DMLA 3V0SA 4FLOA 3PY2A 1O1HA 5CZJA 4XZMX 2OJPA 1F9CA 1FXQA 4MLRA 5FL0A 3T0TA 4LCSA 1AZ2A 1UR4A 1E6ZA 3OPSA 2HROA 1I2QA 3L0NA 3N1AA 3QFWA 4BF9A 1OFBA 1YBQA 4RZBA 3IJ9A 1QATA 4UNIA 4HCDA 3RPDA 4LUTB 1EWEA 4I6KA 3TTSA 1LDCA 3FW6A 1BFNA 1Y5WA 3GTNA 3GVWA 3PZMA 5SWUA 4NAFA 3VCNA 3SY1A 4S38A 3NFUA 1BSIA 1V08A 4PYSA 3UNDA 2PWDA 4I6VA 4C1LA 3VCCA 3MWAA 3O2LA 2ZC1A 4W8AA 4HHPA 3K8LA 3M0ZA 3DI0A 4QNWA 3NNTA 5FEPA 3PB2A 4JQAA 1DIDA 1XIGA 1OINA 5LNRA 4Q4SA 3ZR6A 1NELA 2BGSA 2WPGA 3SCWA 2C71A 1KRAC 4PTWA 3RF9A 3L23A 5LGXA 4M19A 1IEQA 1ONWA 1JXJA 4GG9A 5MF5A 2OELA 1GPWA 3JVAA 2XU2A 4KEUA 3WH5A 4ERAA 2DEPA 4LAMA 4LYQA 2RGLA 4N7QA 4BEQA 5TNVA 1W9DM 1WZMA 5HR7A 1OG0A 1U5JA 2VEFA 3M0VA 3TEVA 1JQXA 1H7OA 3AHVA 5FJJA 1M53A 2D2OA 2WCAA 1WNOA 3INPA 4UFHA 8XIAA 3CAWA 2Y62A 3ZJKA 4JNZA 1D7FA 2J9XA 4A3YA 3CIXA 3GNPA 4UOJA 3U4FA 4GI9A 2PDHA 2Y85A 5CG7A 5I3IA 1GTHA 4DBSA 1JF6A 1UD4A 3RITA 3NEHA 2ZA2A 4DBWA 3E3HA 1RK5A 2B31A 2ZFAA 3PPCA 4JTQA 1RD5A 5REQA 6XIAA 4H9YA 2VDGA 3HB9A 5C2CA 5HQEA 2HSAA 3OZMA 4W8LA 1KV5A 3WJXA 4QJ4B 6REQA 2OXNA 1XKJA 3MZ2A 3SRHA 3W7EA 4OBTA 4M8UA 3C52A 1IEVA 1ZQ5A 1ML1A 3BQ6A 3I7SA 3QHMA 1XUZA 2VRKA 1I1XA 3BJSA 1JAKA 1XSIA 4UNKA 4HA1A 1DJGA 3R8HA 1C93A 4CD5A 1SUXA 4DO7A 3N73A 2AL2B 2IPGA 1O5QA 4IMCA 5HMEA 5EB8A 5KSWA 3RILA 4HMCA 4IG2A 3CV1A 1P48A 4N6FA 2OSXA 3W1UA 5DQPA 1CIUA 5AZ0A 3LZ5A 5DN1A 2F7FA 4C6IA 1IHIA 3BMWA 1YE4A 3VGEA 5EGRA 1HL8A 4QJ1A 5AC6A 4RE4A 5H1WA 3UXLA 3BAYA 4DPQA 2WM1A 3UVIA 1YLVA 2DZVA 4M1RA 1EJSC 2WC4A 2VMFA 3FVDA 2YLAA 2HJPA 3CAQA 4OJYA 3W7QA 1D8CA 1YDVA 3SW6A 2QPXA 3NYDA 4B2DA 1E0TA 1BHGA 4HMDA 3R6IA 4H2HA 3SO7A 4BKNA 2YGYA 4B5NA 1KW1A 4GFIA 4W85A 1UYQA 5D2VA 4HD5A 1KM1A 2O4MA 1V3HA 4P61A 3SQMA 1WAWA 1OFAA 1NVMA 5EMMA 2E0PA 1NF7A 2QKFA 2ISWA 3UG5A 4XAGA 2GZXA 4J3UA 2QLYA 3IPWA 3GTXA 4AISA 1TJ2A 2VVSA 3DN5A 4UZSA 3WEZA 1A5BA 2CLFA 1GPFA 2ZVIA 2JE8A 1K7XA 5D38A 2V68A 3QQWA 4LYPA 4PCTA 1FHVA 3OO2A 3VNDA 4JKMA 4EX4A 3GBEA 1BEUA 3HF3A 3M5XA 4BK9A 3FGCB 2HVNA 1FBAA 3EOSA 1KLZA 4Z1DA 4NUWA 3IJ7A 2VWSA 3WDHA 3UA4A 4AYGA 4LRTA 1LQ2A 5M03A 4A35A 4BI5A 3M0JA 3ICJA 2YXXA 3SADA 3ITGA 2DSUA 4MB4A 4FK9A 3L7RA 1UD6A 3WLNA 4PCPA 2Z2UA 2D2GA 1R0MA 4LAOA 1KFKA 3W28A 1GZ1A 4AZIA 2BY2A 2PDBA 2CBIA 2G8ZA 2GJXA 3QY8A 3N9SA 2B0MA 2F9RA 5AB3A 2XGZA 3BLEA 1E9YB 4JL1A 4LU0A 4H01A 3T0BA 2E9BA 4X0NA 1HKVA 5GNXA 4REQB 2CZ5A 1SVDA 4GRSA 2PUZA 5FF7A 5CZSA 2J78A 2PRHA 3KCLA 4PTVA 3QW4B 4PCSA 4K68A 2D0GA 4L6HA 3W6YA 2POZA 5EBUA 1L2QA 1XSJA 3GDTA 3LENA 3AHZA 4QRNA 1L6YA 4BI6A 3EMCA 4GVIA 1ISYA 3R58A 1BXCA 1JI2A 1W0MA 3BSGA 4JEJA 4RDVA 1K6WA 2OZ8A 2G96A 3OG3A 3EKZA 4A2RA 2OU4A 4Z1BA 2EPHA 5LNWA 1B3OA 2JF7A 1VYPX 1G69A 3GIPA 4PMOA 1VENA 3UPMA 4KCTA 1UBPC 3FXYA 2FVMA 5C5YA 4DYJA 3GZ3A 3MUXA 2HBXA 4DXXA 1GYLA 4FHAA 4D6CA 1TUFA 2H6RA 3S47A 5M1TA 4GNVA 3P60A 2QS8A 1X97A 3GYCA 4F2TA 3QV7A 2DJLA 5F2IA 3TWBA 4KS0A 4Y2WA 4LXFA 4ATLA 3NL2A 2IUZA 4WX2A 6TAAA 2L5HA 2HISA 1TV2A 2J74A 3NIYA 3SR7A 4EACA 4K1GA 1KWKA 2OVLA 1ODZA 1B4KA 3LY0A 1BTCA 5AYZA 4YHGA 3EEZA 3PSVA 2ZOXA 4LEQA 1C8XA 4O0ZA 1TTJA 1P0BA 3MKCA 3WUGA 1F6PA 2XWDA 4F2BA 4CD8A 1HF6A 2X1RA 3NQDA 1J12A 3C0JA 4Z2KA 2GUUA 4IMEA 5HMSA 3IIZA 4JKKA 4J40A 4AMAA 3DFOA 5IFTA 3VAVA 3NEVA 3W25A 4WJXA 3ATZA 2EG7A 3T9PA 2EO7A 1Z8AA 4CQCA 3N29A 1OX5A 3MW7A 4DO5A 3NQGA 1ZP4A 4D8LA 4L6DA 1Q45A 1XXXA 3NZRA 1XCFA 1GW1A 4H8VA 2ZUWA 2J7EA 1FH7A 4JTAA 2B7PA 1EA0A 3NQFA 4KBXA 3PN8A 4GIEA 2YW3A 3GW0A 1KTBA 4UTWA 1UZDA 4CNNA 3T09A 1GT8A 4V1YA 1CT5A 1H2JA 1LROA 1I60A 1DWIM 6XIMA 3PNZA 1Q6OA 3KE0A 2YBVA 4YJ5A 2E6DA 3CMJA 1XIJA 2D1ZA 1XRVA 3ZOAA 1TRIA 3ARXA 1W3IA 2VM8A 4XG1A 3AIVA 1WKYA 1WDWA 2A2IA 1ZBCA 3O06A 4XD4A 4QE5A 3B8DA 2CLLA 1IR2A 3CUZA 5AYIA 4B92A 5CPTA 6ENLA 1MI3A 1Q65A 3CLMA 2VEPA 4FIRA 4K36A 2EPOA 1QWGA 2GSJA 1W9VA 3A4JA 1SJDA 2CHOA 3OZPA 4XX6A 3CZKA 1DVJA 2E8ZA 4ZOBA 2DT0A 2VR5A 4CN1A 3PUOA 2X7WA 3K13A 5FEWA 1EXPA 5BXTA 1B90A 4PL2A 5D9MA 1TV8A 4AY7A 4BWLC 2D23A 3T0CA 1UWSA 1F7BA 4R34A 1GVYA 4YL2A 1BWKA 1E0VA 1DV7A 1KB3A 3G1VA 1ADDA 1GQIA 1K4HA 4GY1A 1AQ0A 4HSOA 4H3DA 1IZKA 1V6UA 2PURA 4CQAA 4CCCA 2ZADA 4JCLA 1LJYA 2BMBA 2G4JA 1U1HA 4ZTXA 4ROPA 3AUOA 1XL9A 1VYSX 3M44A 2UY2A 2NX1A 4NI8A 5RUBA 2OWCA 8RUCA 3VM7A 1JIBA 1HX0A 4GY7A 1BF2A 3NDZA 1W3TA 5CBIA 1F05A 4B3LA 4GZ7A 3PAJA 2BV9A 4GK8A 1N82A 4OECA 3URQA 2HPMA 4K8GA 3RMEA 1W9UA 1IQ8A 4NI3A 2NLIA 3BLOA 1TTIA 2QV5A 2R91A 2X05A 4HCLA 1R2RA 1GVSA 1C8YA 3FYOA 1FWSA 4EXQA 2WVVA 3PTKA 3APGA 3TYUA 4HU8A 2CZVA 3CAVA 4IX2A 2FGBA 2IPJA 4C7FA 1CCWB 1VHCA 4ZFCA 1KCXA 3SCPA 1V79A 3LB0A 4IT1A 2PWVA 4FXSA 2J66A 2QUMA 1PBGA 1VLIA 3M7WA 3N11A 3TYZA 1WP6A 4GXPA 4J4KA 4LUYA 2VZVA 4TMBA 5LHFA 4UQAA 3IUDA 4LNCA 3DG6A 1DORA 4EWND 5GNYA 1JGMA 5HPOA 1IEIA 4QDWA 1XYLA 2Q02A 1E5JA 3B04A 2PDQA 1UKTA 3VDGA 2E09A 1X1OA 3CGTA 5GJMA 5ENLA 4XO6A 2BB0A 1AUSL 1J0KA 4A8NA 2NZLA 1GCYA 3WD3A 5EL1A 2ZRYA 4Y8FA 1X6UA 1W9PA 2X1IA 3RLHA 3L0KA 1F6YA 3R0KA 1AH0A 4MB1A 5D30A 3BURA 1QO5A 1WUEA 3I7QA 1A0DA 3ITCA 5MKGA 3CZEA 2D22A 3VKJA 2GWGA 2Y6ZA 4WY0F 2PP0A 3SUTA 1YTEA 2NWRA 4H9TA 1MXDA 1Y65A 1PKLA 3C2RA 1ME8A 2ZDSA 2RUSA 4MG4A 2VX7A 4GKLA 3JW7A 1DJQA 1VLWA 1OIFA 4JFUA 1SW7A 4HZMA 3HGRA 3V1HA 3Q37A 5BXRA 4AW7A 3QLDA 2GVEA 3OHIA 1OX4B 4QG6A 3UT0A 5B80A 4LC6A 4J7RA 4NJJA 4GCAA 1XV8A 2ACRA 3UYCA 1CNVA 2YIHA 4NHVA 2ANUA 3P2VA 3W1MA 2WPBA 2R24A 5G2WA 4ERGA 3QYQA 3SUSA 4KKXA 3DHPA 3NQVA 3ZR4A 3QZAA 3E9AA 1A5CA 4PMRA 1PZ0A 1XLGA 1OYCA 3QC0A 1UR0A 1D3GA 3FJ4A 1OF8A 2NV2A 1XD1A 3BAXA 4BQ2A 2HNHA 4U33A 4UOQA 4ADSA 4V2XA 1UW9A 2QF8A 4C7GA 2QCGA 5C9ZA 1QWKA 3B9EA 4K37A 3PTDA 3VNMA 1Q7QA 2GLKA 1KBJA 1S5VA 4TV5A 5D9PA 2Q09A 2CXEA 3AIEA 4BEUA 2OEJA 2VZOA 1UMLA 1NSJA 2H3BA 4HNVA 2E40A 2P0OA 3TZFA 3M5YA 4ZO7A 2PSNA 2I5IA 2DZTA 3C2OA 3B03A 2AAAA 4AIEA 1RXOB 4JTJA 5DXXA 4QISA 5HATA 1L6WA 2VURA 1IZCA 3CB8A 1PE1A 4M51A 4REQA 4S3DA 1AW5A 2I9EA 1QNRA 3UXIA 4AZCA 1EPXA 1W9XA 1HQTA 3KBWA 3UERA 3T0DA 4GZJA 1EO7A 3NR0A 5LXEA 1SO5A 1POJA 4G56A 2QF7A 3NDOA 9RUBA 3FIGA 5G4HC 3WUBA 3CASA 4PFHA 4MWAB 4YVXA 2EPNA 3P67A 4YTTA 1XR2A 3T40A 1JZ6A 1JYNA 3VIIA 3H70A 1VR6A 1S38A 1ZJBA 3GNNA 2FB2A 3LI1A 2D2HA 1QVBA 1NFBA 1XLKA 3G1HA 1AW1A 3TAOA 3KRBA 2Y2WA 1W1PA 1IWPA 4HHLA 1JRCA 3O7UA 4KEMA 3K8KA 3AQUA 4PMUA 2D20A 3WX7A 3G1SA 1FWRA 4YIWA 3VVGA 5JIPA 3TTYA 2KZHA 5JU6A 4IGMA 2Q8XA 1Q85A 2PC4A 2PLCA 5H8MA 5EPDA 4NRSA 5LIXX 1XRSA 1CXKA 3P5ZA 3QZEA 3CV7A 3RO8A 1T8QA 3WH8A 1HJQA 3EX6A 3J7HA 1YDYA 1EUNA 1TPEA 3VOJA 3W22A 1OZQA 3N6HA 2YZRA 1PDZA 3LUTA 3RJYA 2PBOA 3PPFA 2HXTA 2PF8A 3U4AA 2TRSA 3E02A 3PBWA 1MDRA 3PBMA 4LAUA 4WGHA 4GI6A 4PMXA 3F5KA 2CYGA 2PD5A 5C70A 1ONXA 3RG6A 1EJTC 2PGWA 5AC4A 1OY0A 4TX9A 4ZR8A 4B16A 2NQ5A 3VNKA 3W1RA 2J8FA 5A6JA 3VUSA 1J6OA 5EY5A 1TA3A 4RE2A 2YB1A 3VZYA 3OHMB 2DW6A 3HU7A 3EDJA 2WMKA 1DXFA 3W76A 1FHLA 3BV7A 3KHDA 1H5YA 3QR0A 5CH9A 1RPKA 1TTQA 4H7ZA 1A3XA 4GCXA 4C6BA 2NXIA 4DJFD 5D2YA 4O18A 4K6AA 1YXDA 4PTXA 5BU9A 1BRLA 4V28A 4WJ8A 3W23A 3LD5A 1W9BM 2C6QA 3VIJA 2VFIA 1SZRA 2PAJA 4FXRA 1A0EA 1OJXA 4ILSA 1L2UA 5A6BD 4LJ3A 3CTLA 1AQHA 3GDRA 2FVKA 2X41A 2XFYA 1XDMA 1GVEA 3U5UA 3DKJA 2PTYA 4ATDA 5M17A 1GKPA 3C86A 4UIOA 2NXGA 1QU4A 1OFEA 3BLPX 3DU0A 4Y9NA 1KBKA 1TE6A 1H51A 3O8AA 3OLGA 3WL0A 1E6NA 4JX4A 3EWBX 3W2JA 4CU7A 1UD2A 4K2SA 2WJEA 2ZTJA 3HQOA 5IXEA 1WBJA 3KRSA 4H9XA 4W5ZA 3AIRA 4JBRA 1LBMA 5EU9A 1NDVA 1HJVA 4AVNA 2WSYA 3FEQA 1XH1A 2AGTA 3DH7A 2Z1SA 3B9DA 4UMCA 2BTMA 3BLFA 1YQ2A 1JJKA 3UJSA 3TW7A 5LNUA 3BICA 3BMVA 5A1AA 1GKQA 3CB3A 4JDYA 1E1EA 1XC4A 4U2ZA 3NQ8A 4AWEA 4IPJA 3NTYA 1XLDA 3KBVA 4GVHA 3VD3A 1H41A 1HG3A 5FI8A 3WELA 2OB3A 1J0YA 3IGUA 5DRIA 3ANUA 4C1NB 3ZVHB 3FA3A 3KVKA 3DC8A 4X2RA 1JUKA 3V5OA 4OV4A 2A6LA 2VJXA 4LCQA 2PP3A 2C14A 1KM2A 5JMUA 1KXQA 2EEXA 3URNA 3JZUA 2XFFA 3E0IA 4DZ5A 3M0IA 1UUOA 4WRHA 1JDAA 2VO5A 3B0UX 5HULA 3U6WA 2BXZA 1EQPA 4DNHA 4LY8A 1CLXA 3VTRA 1OGGA 3HOJA 2E5BA 2QJJA 1RBOB 4DEFA 3NM1A 3LXBA 1FA2A 1KA9F 1XIBA 2YZ5A 3P84A 3GHTA 4HZ8A 4JGDA 4MDOA 2G0WA 3LLXA 2JQXA 4G5DA 3RU8X 4JYDA 1TR9A 3W70A 4AY8A 2YDRA 3N4FA 4H9MA 1V3IA 2XG9A 4RV3A 1UPMB 1P7TA 3QGAC 1SR0A 2YXOA 4WLCA 4PUEA 2A1YA 3LCXA 3GR7A 1HIZA 5I3JA 4F3HA 2EG6A 3AC0A 4QAWA 4FOKA 5HAOA 4W7UA 3JZEA 1Z44A 2OQHA 4NJGA 2PU0A 1SJAA 3VINA 3LNPA 4U10A 3OVRA 5AVHA 5LIKX 1GW9A 5G5IA 1L9WA 1KM6A 1CGWA 5CXPA 5F7UA 3WQ6A 3AXKA 2CZDA 1XYCA 4YNGA 3M46A 3UCDA 1IV8A 5AC5A 4OV9A 3ZT5A 1TPWA 4E8CA 5A6AA 4HCHA 3WH7A 3UY7A 1OCBA 4R27A 1JUEA 4O8AA 1UG6A 4D71A 4ACYA 4HU4A 1C91A 2ESCA 1NJJA 3W7NA 1GOWA 3WH9A 5HNNA 3S6OA 5CC6A 3GAYA 1NY1A 1OX4A 3ZYZA 1XGDA 3AICA 2ICSA 3C4UA 1TJRA 3CV6A 2Z2AA 1DIEA 1Q6FA 3CUGA 2RFGA 2PDXA 3U7BA 3LERA 1LOLA 2YYUA 1A49A 5L9FA 1M41A 4XSLA 4FNSA 3WQWA 5CSUA 4TVUA 4JYFA 1A5LC 5A95A 5F1UA 3PNUA 3KL0A 1VBRA 1XLBA 4O4WA 4X2PA 3G1FA 1YKWA 2G95A 1EJVC 4RE3A 5C8BB 3OGRA 1UD8A 4M6UA 5DT7A 3NL5A 3TLQA 2OGYA 2FZBA 3MSYA 4M5PA 3JS3A 3LU2A 3PF3A 1EOKA 2QDGA 4JAWA 3DFNA 3HIJA 4DN1A 5A8GA 2JKPA 3ARZA 3W74A 2V9DA 3NZQA 1PZ1A 1E0WA 4B5XA 1Q5MA 3NYZA 1OQFA 1ICSA 2Y24A 2FLIA 4Z2HA 4XWUA 1K9TA 3W81A 3WN6A 5GNZA 3VOFA 5KZ6A 3PJWA 4PL1A 1BQGA 3B05A 2OPJA 3VE9A 4BQ4A 3KOWA 3W7IA 4EIVA 1OZMA 3RRAA 1VFUA 3KBNA 1BVWA 4DWSA 3PC0A 3CQIA 1ZAJA 2OOFA 3M5VA 4L1WA 1W3KA 1ENUA 4JN6A 2QVNA 4IICA 3VE7A 1XKYA 4DX3A 3W24A 4C6CA 4UB9A 1DPMA 5EA9A 3QOMA 2ZDRA 5M5DA 2DSVA 2ISSA 4KWVA 5CAHA 3RMJA 2FJKA 4A21A 4OUEA 5CPOA 3VIPA 5HJLA 4B5TA 4UR8A 1VD6A 5U4NA 3EX1A 1XQLA 1ZJHA 2ATSA 1UB3A 3GXDA 2AL1A 2GVJA 1X7FA 4UFJA 3KBJA 4GC4A 5AVNA 1UKOA 1CDGA 1SJCA 3GDBA 2X09A 3SCOA 4DZHA 3GG1A 4E4FA 1OK6A 2QCDB 3THCA 1G7VA 4AZ7A 2J4GA 4M1BA 5D33A 4HOZA 2UV8G 1L6GA 1ONEA 5CQ1A 1AJ2A 1V51A 1X98A 1KXVA 1TG7A 3G6LA 5FIPA 1B9BA 3WF2A 1UH4A 5I03A 4MUZA 4FX6M 1XQKA 3G1DA 4YTRA 7ODCA 1UWRA 3P8JA 3TUUA 1FWBC 4GOAA 1XGEA 3NO1A 3GDMA 3MHGA 1TMQA 4U3CA 3GNRA 7PTDA 3D0CA 4FAMA 3MKKA 3GVRA 4HVXA 2BVYA 4ICNA 4EANA 1CGXA 2V6AA 4CLMA 3K46A 4GX8A 1W1TA 1I1WA 1J10A 2RJGA 4WKHA 5EMLA 5B7ZA 3RCNA 1M01A 1LTDA 1NP0A 3DX5A 5A8NA 2O55A 2UWFA 5LA2A 4H8HA 3OW1A 4EKJA 1PCWA 2PBGA 1U1JA 6A3HA 3N4AA 3PJTA 2BXYA 7ENLA 3WNOA 5D2WA 1SZEA 2PWHA 3DOPA 1T7LA 3OJGA 2JIEA 4W7WA 2A3AA 4W87A 4AWSA 2FGZA 4RZ6A 2VUYA 4DUXA 4UTWC 3BG9A 1FWTA 4MIMA 3B9NA 5JBDA 3U5YA 4XZHA 1Z48A 3A47A 4LWWA 4JN8A 4BF5A 5T26A 5A8PA 4CVUA 3PZOA 3FYYA 5AOUA 1NU5A 1FH8A 4QTGA 4A6GA 3FKKA 1VPQA 4GBUA 4HYVA 4S3BA 1YADA 4PBGA 1FWDC 3IWPA 4I7VA 4Y6GA 4UNLA 4AHOA 3E5BA 2BOFX 3LQLA 1WUFA 3OLDA 4XAPA 4JTGA 5J04A 5C55A 2BASA 1KM3A 5CKSA 2BY0A 2ZX8A 4HNCA 3RO6A 3GHRA 4J9JA 1JXKA 3TE9A 1UWTA 1DOSA 4LUJA 5I5RA 1KGWA 4FF5A 4M80A 1HVXA 1S1PA 4ROQA 1LCOA 2WQDA 4GKTA 4GUJA 2PZ0A 3GC4A 3OU8A 5FAJA 2NX9A 1RBAA 1UJPA 1MW1A 3R13A 3P14A 2Q01A 4W7VA 3RN6A 1KO0A 1KKRA 4IP4A 4NZFA 3CK5A 1GZGA 4JTTA 5DMYA 1GOKA 4FR6A 4K7YA 4PSPA 2HS8A 3PZQA 8XIMA 1MRAA 2ZBTA 1SFSA 4C1NA 3QKZA 2FQIA 1T8XA 5GJNA 3BG3A 2VFDA 3WL1A 4IJCA 3DHUA 3DBPA 4RCXA 3QHOA 1WPCA 3AAMA 2C8NA 3CUIA 3IRSA 4JX6A 1ELSA 3K8MA 1I4NA 1XIFA 3B8UA 3R8GA 2I17A 3L4XA 1UQYA 1ZLPA 4AX6A 1GG0A 3R1ZA 3EEGA 2PTXA 3MWCA 3N18A 3NPWA 1OCJA 1E0XA 4GO9A 4EPEC 3W38A 1BGAA 2XINA 3E0FA 3QEZA 3LGDA 4NY2A 5HQLA 2J27A 1ME7A 3P74A 2OO0A 1UJQA 1X8CA 4P7NA 3W84A 4ZMGA 4Z2LA 3B4UA 4AZ5A 4JCMA 1N8IA 2DZBA 3NOEA 3WQGA 3BAJA 1HFBA 3N25A 1XX1A 4CGTA 4J1OA 1R30A 4Y9PA 1HO1A 8CGTA 4O17A 2HRWA 4C5YA 3STPA 3W85A 1JR1A 3GY1A 4GABA 4QS5A 3EWXA 1HKMA 2QUUA 1T96A 2J88A 2OKOA 3GWQA 5E09A 5AECA 5AY7A 3GUGA 1YPXA 1JUBA 4N02A 3U48A 1JZ7A 3FX4A 2JIWA 4WSHA 4N9BA 3GU1A 4PA8A 3WYZA 1SZGA 2ZWYA 1RQBA 4I90A 3B3DA 3TW6A 4LBSA 2QUTA 2QGYA 3CL8A 4RL3A 3BV4A 2WQPA 1CB7B 4QG8A 1EYWA 1XWYA 2J47A 4O19A 1R2SA 2RDWA 3CEPA 2KAUC 3W01A 1EJUC 1C8VA 2OTDA 3N4EA 5BU6A 5BWAA 2Z7GA 3TR2A 2YW4A 1FX6A 4BZYA 5B7YA 1EUAA 5DFAA 2OKTA 1F8MA 2YSWA 4DJDD 5I7GA 1BPLB 2ZC8A 1I2RA 3S2CA 4Z0JA 3ELFA 2Z7KA 1OX6A 3NZ1A 2NWSA 3WO8A 5LNSA 3WLJA 2B7OA 4UTHA 2MANA 4AXKA 1DHKA 4MPKA 4D6DA 1NARA 4QLKA 1TVLA 4I9AA 3ARVA 4FXJA 3KRUA 3O1NA 1FOBA 3VNLA 3AUJA 5JBEA 4H4IA 3KZPA 3VZXA 4P8WA 3LPPA 2IPWA 1RCXB 3DEQA 2R1LA 2GGJA 3LBOA 5ABFB 4AWUA 3PULA 2CKRA 4HMEA 2QPSA 3LQGA 4MYAA 5EMUA 4H8NA 4HNUA 4XAFA 1TWZA 4JS3A 5HQMA 4F9JA 2XZ7A 5CGQA 7CGTA 2WWDA 2W3ZA 2XPKA 4HOWA 4Q33A 4BF7A 3WMLA 3W71A 2WKJA 5LIYX 3LPFA 1S5NA 3D46A 4OT7A 4R3UA 3VDHA 1RA5A 2F8QA 4C6FA 1O12A 1PIGA 5DLCA 2GJLA 3VILA 1YDNA 3W7JA 1LF1A 2NQHA 3ITLA 1E3ZA 1O5XA 3QHNA 3WQDA 2J7CA 1EHAA 4NAEB 2GJRA 3ZJ8A 4YWIA 2QPUA 4XZ9A 3EPNA 4LB4A 3UFYA 3BCFA 7XIMA 1V3JA 2ZUSA 3AMKA 5EKYA 1TCMA 1UP0A 5I23A 4QG9A 1LT7A 4DLMA 5C2XA 1I6NA 3BH4A 2INEA 2PWEA 5CPMA 3DXIA 1JG9A 1AFSA 2WHMA 3ITTA 1J93A 4BA0A 1RQEA 1XLEA 3T81A 1R3TA 1K70A 2WNNA 3AHXA 4WXZA 4QXIA 5TF0A 4IISA 2ZXQA 1XBZA 4NJKA 1HW6A 5HNTA 4MAZA 1A4MA 1R8LA 4PMNA 3AO0A 2OGJA 1MWOA 4AB4A 3STCA 1X96A 4LW7A 1W3LA 2IQTA 1OABA 1TMLA 2IS7A 3K4AA 3CO8A 1IYXA 1ZALA 3F4CA 2BXVA 3LPGA 3WNLA 1KFEA 2CCRA 3S2LA 1Q7MA 2WJFA 2E9MA 1H1NA 3UXDA 3LN3A 4Z1AA 1DWJM 3HQPA 1NWSA 4MY8A 5IBXA 4M0XA 4U28A 4WIWA 4V15A 2TSYA 5K9DA 1S46A 1W31A 3UJRA 4RNIA 1IGSA 3UWVA 3EMQA 4TTUA 3GFXA 3B9AA 3QPEA 4DF2A 4LCRA 5K4XA 3UJFA 3VX0A 3TIMA 2E77A 5IM51 1QW7A 4UFKA 4DQWA 3GVGA 3RGTA 3PM6A 2G3IA 3SRFA 3U8GA 5CSRA 1RJQA 1BG9A 1L8PA 3O9NA 4R85A 3W6LA 2DZWA 4NNCA 1ME9A 3MP3A 4RPQA 4GI4A 3R7MA 3O0FA 4FLRA 4IIEA 4X0VA 3Q2DA 4AD5A 2V67A 3KCJA 1DWGM 2GOUA 2V0TA 4LB3A 1GVRA 3W72A 1PZ2A 5JVLA 3VD4A 3P0XA 1Q6RA 2EBNA 4QM1A 1UMYA 5LGZA 4LH8A 3F7JA 3CAKA 3TSMA 1JNEA 2A79A 4E3VA 1LWHA 4MZYA 1JPIA 2PODA 4WR3A 4O0KA 3LXAA 4H83A 2QDDA 1JNDA 1PX8A 3OBAA 4RUBA 1CXFA 1DJNA 2W9MA 2YCLB 3P80A 2XIMA 3N3TA 1EJWC 1TQXA 3V16A 3GE7A 1FDYA 3N2BA 3FOKA 4HNTA 3FN9A 4C6MA 3PZVA 1XS2A 4F79A 2DV0A 3ITVA 2IXVA 5CSSA 3R12A 4HT3A 4XZNX 1SO6A 1VJIA 3SCSA 4GBDA 1UPPA 3TONA 3VIFA 3PUDA 1AJ0A 5JIWA 1FCUA 2EG8A 3LOTA 3VKKA 1SFJA 4P8VA 3DGBA 1RR2A 4H6RA 3AHTA 4YMZA 1DJWA 4QGCA 4FMVA 4Q3MA 5TQLA 4R5EA 4WF7A 1YTKA 3PZTA 1SU5A 4PUJA 3SIZA 1V77A 1LLZA 3TZNA 4YTSA 2CKSA 2ACSA 1JD9A 1D7KA 2YDQA 3V5FA 1BYAA 4L5ZA 1O7AA 3H2OA 3T4CA 3PVFA 4I5XA 3GVQA 2YDSA 5AHEA 2ZZ5A 4TR9A 2VGGA 4A3UA 5A3HA 4O53A 3H4XA 3BSHA 5LSMA 5DO8A 4KWOA 3HZ3A 1VFMA 3KAOA 4XD6A 3RYSA 3E0LA 3FA5A 3H23A 5C7HA 3CIVA 4C6LA 1OFRA 2UY4A 3WNNA 1VFOA 1J5TA 1X1ZA 3S5YA 1OEPA 3IGSA 3W00A 5D37A 4J28A 4PB5A 1E6PA 3N19B 4XTDA 5F2LA 3QGVA 1EYEA 2BHUA 6TIMA 2GVGA 2B7QA 3MMDA 3NAVA 1TV4A 1M1BA 5CPLA 2PRLA 4A05A 3G1AA 4O13A 4LAKA 4UCFA 2PC8A 3WG6A 5H6HA 4GE8A 1KM5A 4NZJA 3L4VA 3P81A 4ES4A 1QI4A 2ALDA 1DJZA 4F48A 5F4WA 3SI9A 2XFRA 1R3SA 4GI8A 4MJZA 3W7GA 3QF0A 1VAHA 1WO2A 1U5VA 3G5EA 2JKEA 3LCIA 2QJGA 3H53A 3MMWA 4AMCA 1KRCC 5I3KA 1G1YA 3THAA 1EBHA 3AYVA 1A3WA 1W8GA 4KT2A 3NSNA 4KERA 4F40A 3GS6A 1NWRA 2X0HA 4HOXA 1QAPA 1TQJA 3BZGA 1GVFA 3SGGA 2PFHA 2D2JA 2WANA 1FP8A 3H2MA 4AYSA 5CGMA 4LOCA 4C60A 4CNUA 2DVTA 4MJ4A 4RPPA 1YNYA 1G4EA 1D8WA 5C0QA 3UEQA 4Q4PA 2QV4A 2RAGA 1DTUA 3S9ZA 4CQ8A 3IIVA 3HM7A 3KM8A 1DIKA 1XFCA 4KCUA 1MUMA 4GXMA 1NOFA 4H00A 1DEDA 1KRBC 2PLMA 1Q6DA 3LX9A 1VYRA 2FH8A 3MJMA 4XQ6A 4IPIA 4PMQA 5FD0A 3HG4A 3CHCA 3DI1A 3QBUA 4AFYA 3S2NA 2G97A 3HFTA 4TO8A 1OF6A 3RCMA 2XH0A 2Y61A 2C91A 1GZJA 4GQBA 3U2OA 1VBJA 4GIAA 5DX7A 4BS0A 4JXCA 4QX4A 3C5QA 4UTMA 4LVFA 1ZAHA 4NF7A 4FNUA 3F2DA 3WENA 3KOXA 1CX9A 2PDGA 4JTFA 1AG1O 3FEMA 5ECUA 3PJXA 4IMGA 1UD3A 5FKYA 3COTA 2NV9A 3S0CA 3PFMA 2GPTA 4WGXA 3QXBA 1JRBA 3RM9A 3GIYA 3GNDA 4M7SA 4B5VA 1XLHA 2C79A 5BWFA 5A2BA 1US2A 5G2HA 4AEOA 4L4OA 4L4LA 2V5CA 1V5XA 1TZ7A 2WB5A 1XGZA 4JTCA 3TROA 3UR5A 3P82A 4ALDA 1MRQA 1QNVA 1AJZA 1EZWA 2IXUA 2HVOA 3W7HA 4AG0A 3UWQA 4I9TA 1GOIA 5LZLA 3MYPA 2CITA 2PWUA 3TYCA 5A69A 3G1RA 4HPJA 2NUXA 3VC5A 3C6CA 3S1WA 4DBUA 4M6QA 6CGTA 4PUNA 4I7UA 4JQ4A 3ZJ6A 2XSAA 5E9XA 4MPQA 1RLCL 1UR9A 5F4SA 2FZDA 3ITXA 3WD1A 4MLJA 4LYKA 2GOKA 3IEBA 1C7TA 1TKKA 4ACZA 3BLLA 3N13A 5BRQA 2QCHA 4NAEA 1UIPA 4IHCA 1PX3A 3TK7A 2YCKX 2VFEA 3MI3A 4AH7A 1T99A 1YDOA 3GAKA 3AWNA 3L12A 3EB4A 4QQUA 2B7NA 1KQYA 2INFA 3H7VA 4IWWA 3CWOX 2D24A 3V18A 1TCDA 5HJXA 5C2GA 4DRSA 4LVAA 1W1B1 1IIHA 4MJ2A 1EWDA 2YA2A 4MWAC 1LOQA 4JQ3A 4UR9A 3B8IA 1NH6A 1Q13A 1SR9A 1K02A 2P3ZA 4S1FA 4FR1A 3N9KA 4GD0A 3VCRA 4M56A 4HSHA 4ZVJA 3H26A 5EFDA 3RR1A 5G2IA 3PTMA 4NP7A 4ZCWA 3BGJA 2YOCA 1BGGA 1Q7ZA 1SO3A 2WLZA 2OX4A 3MTWA 4O14A 4JX5A 1S2VA 1QBBA 3QPYA 2GSHA 2QIIA 3WH6A 1JZ8A 1ZNNA 3UVAA 1EDQA 1M5WA 4KQNA 1N2VA 3GTHA 1B54A 3M47A 3TWAA 2QUNA 2XYLA 3GC5A 3RLVA 3IV3A 4JIPA 4JYEA 2VELA 2PB1A 4AHPA 4LV4A 4EXAA 5I77A 4G1KA 4JQ1A 1HP4A 1J11A 1F74A 4CQ9A 1Q6GA 1UWQA 4FB7A 3BXWA 4UQCA 1P6BA 3V4BA 1FWGC 1F61A 1WXZA 5AHLA 1IEWA 4O15A 1HP5A 4DVOA 4M81A 4FXFA 1G94A 1LT8A 1K77A 4O1FA 1W3NA 1PJ9A 4QJ3B 1LLOA 1KR0A 5E93A 1WOBA 4C65A 2C13A 2YXGA 1GQNA 1OC6A 1G67A 3IANA 4QHRA 3XISA 1XYBA 4ZGYA 4KIEA 3AJXA 5I24A 3GQYA 4MUPA 4IP7A 1XLLA 1RLDA 1REQA 1W56A 1JF5A 2BG5A 2WZTA 4E2DA 3A23A 1PVNA 3UESA 4NRRA 1XF0A 3KHJA 5BRPA 1W5QA 1ADSA 4H9UA 5JXQA 4W89A 1A3HA 1PTGA 4GYFA 2XH2A 1MVYA 3M0YA 4WSKA 4GHRA 2ZZ4A 3TVAA 3M6DA 3CL7A 3W7PA 4NNBA 3GXNA 2EHHA 1PV8A 4FIQA 4ICMA 4WEVX 1B3WA 3H2FA 3NPUA 3OLEA 3P6LA 2A3CA 4DZIA 2DVUA 3WK2A 1CGTA 1KFCA 2DT2A 2WBKA 2A3BA 3MUAA 2VHLA 3FAXA 3CQJA 3ARSA 4C7DA 1V3KA 3L2LA 2WVUA 3P3BA 4J3SA 3CT2A 1HJXA 4YLWA 3NVTA 3I4KA 2WMIB 4ZE5A 2X2YA 3FDKA 3KP1A 4Q4RA 2VL4A 1V0MA 4FA3A 3MBFA 2QNEA 1Z42A 1VFFA 3UCCA 4NZ1A 4RW5A 3MDWA 3U2EA 3ARYA 4RNFA 4HKPA 3AXXA 3E2QA 3VDCA 3SSJA 3DYPA 1PKNA 1V7AA 3T7VA 2QJMA 3SFKA 1BYBA 1U33A 3UYIA 3T44A 1ADOA 3FDGA 3GBDA 1VZWA 1E1CA 1AH4A 3H6OA 3AMLA 4GINA 1Q63A 3WLPA 1EP1A 2PLJA 2QUVA 2DW7A 2DUXA 1QI3A 3QMSA 2E7FA 3WMCA 2OSYA 1GQKA 3QTPA 3BDKA 3Q94A 1FDJA 3THDA 2AKMA 4B9ZA 2ZICA 3CPRA 3NG3A 2WVTA 4JTLA 2WXDM 3GR4A 3MP5A 1AVAA 4H7CA 4Z2GA 4QQ3A 3VU2A 3TSDA 1E9ZB 1GJUA 1SO4A 4IFKB 1L8NA 1XIDA 3AOFA 3R79A 2DT3A 2ONEA 2BS9A 1GNXA 2PGRA 1AA1B 5U7SA 2R6OA 2WSRA 3APTA 5HWMA 1H7RA 4ZO8A 2YYTA 4HYRA 1W17A 3W6MA 3CMGA 4JY8A 1IR1A 2J8GA 2VP8A 1P6CA 1YMYA 3H21A 4LALA 2WO5A 2OCZA 3VABA 2AQVA 1KD0A 1PYMA 4C6PA 4RXFA 4ZQCA 3ITOA 1Q2RA 2AMGA 2W79A 1WKFA 6ALDA 1PXGA 3SM0A 3LGGA 5XINA 3OOQA 3PAOA 4GZEA 2NQJA 4RDYA 1F3TA 2WSPA 3T78A 2GGIA 3WD2A 3CYJA 4BJHA 4K38A 1VCFA 3GHSA 3KDNA 1R3QA 1V4YA 3QY6A 4AXNA 4D8AA 3ENLA 4F0KA 3PK7A 4HYWA 3LV6A 4QJ5B 4H7VA 4QR6A 2OQLA 3GH4A 4PTDA 3UR8A 3WBYA 1R47A 1K1DA 4MSSA 4IXXA 3IVSA 3H12A 3GM8A 1QI2A 4EAYA 4JFWA 2JEQA 2IKGA 2WK2A 4D2JA 3GKAA 1OB0A 3VFLA 2CZFA 2YCEA 1H4PA 1TZZA 2R1MA 1SFLA 3CHEA 4QS6A 3B06A 1GKRA 3GR8A 4N42A 3V35A 1JFHA 4AD2A 3DFSA 3QJAA 4XSMA 4DXKA 4ML4A 4Y9MA 3A21A 1ISXA 3BL3A 3QMRA 3PBVA 3VYLA 3VUPA 4D6JA 5I0DA 1MEHA 3T0AA 4JNMA 1UKQA 1EPVA 4G6CA 2HZGA 2W91A 4HMNA 2PRMA 2WZHA 1M68A 1QNQA 1BKHA 1OADA 3HURA 3WEOA 2ZQ0A 4N6EA 2W27A 5BXPA 1JPMA 2WW5A 1K8CA 2QGHA 4JICA 1G4SA 2Q8ZA 3D47A 1FWJC 3EMZA 1VFHA 1BYDA 1EGVA 4LT9A 2W67A 1XI3A 2VEKA 2EF9A 5C7VA 1TVNA 1HKJA 1PUDA 1H7XA 3TN3A 2WVSA 2O92A 1FFQA 3ARTA 1RY8A 1TWIA 3BAWA 1O60A 4S2BA 4FLSA 3SDOA 1O94A 4NU7A 1K7EA 1YYAA 1LWIA 5D03A 3R94A 5KMYA 2D3NA 4JKLA 3ZWSA 2HNEA 1KBIA 1XIHA 3VGHA 2J77A 1OIMA 4O1EA 2ZUTA 3VNJA 4PUKA 4DHGA 3DFYA 2PCEA 1RUSA 2NSXA 3TA6A 5HDRA 3SGZA 3VFCA 3KVJA 1FP9A 5AKQA 3EGJA 4RNJA 3REQB 3TKFA 3UG3A 5A6MA 3UP8A 1E0UA 1O68A 4LY4A 1OWQA 4XZLX 3EAUA 3TAKA 4DWSD 3M43A 4F9DA 1QUMA 4AAJA 3RK8A 7REQB 4JOMA 3L4YA 4AUBA 3L66A 4DJEC 4TIMA 4P8XA 3W07A 2MNRA 2ZXAA 2YDAA 1C92A 3RPTA 4IMDA 1K8YA 4KFOA 4XKYB 4L6OA 2VD8A 1NOUA 3KRZA 4JTKA 1LRTA 3GSMA 4GGHA 1PAMA 5K4ZA 1QPKA 2NW0A 3WMBA 1GWJA 4UMAA 2D0FA 3QH2A 3SGUA 3IIPA 4DB7A 5KZDA 4WVXA 3IJ8A 3AALA 3EPOA 3DG3A 2Z1WA 4KGJA 4AIUA 1M6JA 1J96A 1S2WA 3CUHA 1DL3A 3ALFA 1LL6A 5DMMA 2C7FA 5IOBA 1G01A 4OIFA 1DQUA 5DMNA 3USBA 2V63A 3TDFA 1UR8A 3B0VC 5IBXC 2V3GA 1S2CA 1P0KA 4AVOA 3M7SA 5I00A 2D69A 3WLOA 4H1ZA 3LHYA 3JR2A 3TFCA 1V0KA 1I2NA 5CLTA 3V3WA 4ZA0A 4F0MA 3W82A 4R88A 4U2YA 4HPHA 1SMDA 1QI5A 4DI8A 3NJ3A 2EAWA 3LCWA 4TOQA 3I6EA 1K8XA 3IJDA 1BD0A 2OT0A 1AQMA 2P50A 4AU0A 1Q6CA 5FJOA 2Q3RA 4WZHA 4AEEA 2EKGA 3W1QA 1DHPA 1UQZA 2A21A 4YVVA 3PPHA 3LTPA 1Y8BA 1H0IA 2DZXA 3IIOA 3O6YX 2GK1A 1ESWA 2O7SA 3NQAA 1RAKA 4UQ9A 5FF2A 2WJZA 3FJ6A 2JGQA 1A5SA 2V5BA 5FF4A 4ZXOA 1GUVA 1WZKA 1AW2A 4J27A 3N2TA 5H2ZA 5K2ZA 1WYIA 4PRWA 1H1YA 1NDZA 2E3ZA 3ABRA 2CLEA 2PP1A 5J5RA 4YYCA 1WXYA 1PPIA 1PEZA 3U3HA 3ID7A 4HJWA 3G6MA 3IACA 1GJWA 4XBJA 4XUGA 1Q6LA 1W5MA 2PI6A 3EDDA 3TH6A 3F4DA 4R33A 4NJIA 5CAKA 3GHUA 3BVJA 3W87A 1EL3A 2QULA 1J0JA 4IIGA 3MQTA 1PTAA 2CHRA 4E6MA 1XBVA 3WK0A 4G7EB 2WAGA 2C1GA 3CZGA 4D6EA 1IGWA 2YCJA 4N9CA 3MA8A 1QOPA 3Q4DA 1MMFA 1TPVA 4R7WA 1YTDA 4EVZA 1HGWA 2ZVRA 1UASA 3BLDA 4NNAA 5G1YA 1XIIA 3T6CA 1UKSA 3EA3A 1J0ZA 2V38A 3W1NA 1PSCA 3T08A 3UU0A 4H6EA 4IOTA 2XUCA 2J7DA 3VNZA 3FY1A 2AMXA 4MB3A 3TYBA 4DELA 1ZHAA 3ABSA 4FNTA 1A4LA 4G1NA 5CC5A 2R9RA 3MDUA 1Y5XA 5DXYA 2GDUA 3C61A 4IL2A 5DELA 2HWGA 3EDEA 4MYXA 3UXKA 3CHFA 2WCSA 4QDPA 3VD7A 5LYRA 3WDIA 3BGGA 2VDIA 1IXNA 1G5AA 1RH9A 4F2UA 3VZZA 2VZUA 3F5JA 5I07A 2X1TA 1H7NA 4EXBA 3QGKC 3QR1A 4DAFA 3H2NA 5ABEA 2XVLA 1MO0A 3R8RA 2FDSA 1HTIA 3FAWA 4UZUA 3LCLA 4ZQMA 2P88A 1L6FA 2DSKA 4DWDA 3VPLA 3CHVA 3GC2A 3TN5A 2I5GA 4L4PA 4C6QA 2O9TA 1Q4NX 3HJEA 2FPYA 4A29A 1V3MA 5FF3A 3ECQA 4QITA 2O9RA 1XD0A 4UMBA 1XH2A 4O16A 2BHZA 1UC4A 3PHAA 3N2OA 1YPIA 2E67A 2QMJA 4KWSA 3HG3A 4QSHA 4E3TA 3CS2A 2DVXA 1DXEA 2BVWA 4IZGA 4PCFA 3HPXA 1R7AA 4ZB0A 4E8GA 1U1UA 3WUEA 3ONCA 4R9XA 4M6VA 2A4AA 5G1TA 1BYCA 3OP2A 4A4AA 3EBVA 3ABOA 3VIGA 3GDLA 3GG7A 4XBSA 4ZQOA 3IAPA 3S83A 4LUTA 2G50A 4MGGA 1PHQA 3LXCA 1H5VA 1TE1A 5A6BA 5AC8A 4GY0A 3CPGA 5C54A 2Z29A 1KGXA 3S46A 4Y8EA 1F07A 4YTQA 4CNOA 1KQZA 3SIMA 4TQTA 4ML9A 4WJEA 1V0LA 5ABHA 3CHDA 1PTDA 2OEMA 1YBQB 2QIWA 2YJQA 2BOGX 2ZZ1A 2J75A 1R7OA 5DANA 3WQEA 1F5ZA 3PANA 3MBDA 1BVZA 3VM5A 3ZO9A 4JTEA 1R3YA 3E49A 5BMXA 1XCWA 3GUWA 4LC8A 3LHTA 2WZEA 4XO7A 1ZJAA 3TJIA 3WMSA 4FNPA 4DXVA 4W4QA 3C56A 3MB9A 2P0IA 1XDJA 4S3JA 4F0HA 2NUWA 3IUIA 1AH3A 1ZP3A 3G3DA 1AODA 5FJRA 4JN7A 2XH4A 2DQWA 3POCA 2BY3A 3T55A 4QFUA 2UY3A 1TJPA 3UD6A 4DYEA 3S9YA 2ACQA 4MADA 4MF4A 1MXSA 1CWYA 1P1MA 3A5FA 2Z6JA 3STGA 3B8TA 5LIUX 3T2QA 3WNKA 2WNZA 2IKJA 3ZSSA 2RDUA 3F03K 3GH5A 2CBJA 4J2PA 5JUVA 1LBFA 2RHGA 3TJ4A 1FCQA 2OLHA 1NEYA 3P62A 5H91A 1SQ7A 3AWOA 1W91A 5EBAA 1OGBA 1UROA 5HA7A 2Z1BA 1UR3M 4HK6A 2B4GA 2IQ0A 1TV3A 4MY1A 4PMJA 5AC7A 4YTUA 1GTEA 4GH3A 4PTNA 1RJPA 3ERPA 4JTUA 3S42A 3EWUA 3M6YA 3LZ3A 3D6NA 3DG7A 1J4EA 2QMKA 3G0XA 3WKZA 2VZSA 4JIQA 2EPKX 3QV9A 4PB4A 4OVXA 5REQB 3SY8A 3KOYA 3EOOA 4WD0A 4US5A 4JTHA 4C6NA 2AL2A 5CJMA 3LRLA 6REQB 2V2DA 3TTOA 5I3DA 2WHLA 1UCWA 4INFA 1XISA 4FS9A 1XP3A 1W2VA 4RR4A 1E5NA 3DIPA 1TZ9A 4IX0A 3JUGA 3M5ZA 3WFZA 3MUZ1 1ONRA 2VRQA 3REQA 3TOYA 3NURA 3W29A 1UR2A 3WLKX 3QVQA 4IIBA 2H8ZA 2Z2BA 1QK2A 4MDPA 3VMPA 5EYWA 4CD4A 2ZXBA 3BARA 3NM3A 3LTYA 3GTIA 1UUMA 2YL6A 4XKMA 5A6SA 4ZENA 4BI7A 3SRDA 3MHUA 1FXPA 1RALA 4FF7A 3P8IA 3GTFA 1R2TA 2CLOA 2WWCA 1LLWA 3TU9A 1H63A 3WY1A 3H24A 1XLAA 2AQOA 3TTQA 3EX3A 1I75A 2VVNA 2OEKA 2ACUA 2W62A 3NXFA 3VNYA 2VXNA 4UXDA 3KX6A 2NQLA 1S2TA 3IJQA 3AU2A 2CPUA 3LHWA 4AZBA 1Z3NA 5KZEA 3FGCA 1XH0A 1UBSA 3TQ0A 3NUKA 1CENA 2NVDA 4ZQRA 4EE9A 4HA3A 1OC7A 5FA5A 4OUIA 1S1RA 1VH7A 5HK4A 3PZUA 2PDIA 4ZOEA 1Q2SA 2ZZ2A 1EJXC 5M2FX 1JL8A 3KCOA 4O11A 1PIFA 4NXSA 2DZSA 2F2KA 1SW0A 3MVTA 5LNVA 2VZTA 4MFDA 3LSCA 2X0YA 3CQHA 3LK6A 1K9DA 1E15A 2GQAA 4GACA 1CZ1A 3TC7A 1OT2A 3EKGA 1KTNA 4MJMA 1KXHA 2AOSA 2XIOA 2I7GA 2FMOA 2I1OA 1GOQA 1JQVA 3VMOA 4IPLA 2I9UA 3W1PA 2GDVA 4B3KA 5CEWA 4PEKA 2GJXB 5JQ9A 1EOMA 3W2NA 5HJYA 4GUHA 3ZLGA 1PCKA 1OD0A 5LA0A 1JULA 5FEZA 4LS0A 4PTMA 3OG2A 1ZAIA 2PDLA 2WZMA 2P8CA 2VEMA 3AYRA 2W61A 4CUCA 4GX9A 4KFPA 4XISA 4KWUA 4XUYA 3WUFA 1V02A 2BBFA 3STEA 1LQ0A 4AIBA 5FEXA 5K7JA 4FOUA 4KETA 3IS4A 1R3VA 1JCXA 1LORA 4O4VA 3W86A 2VR2A 1EFZA 4N4QA 2V5DA 1V03A 3WLQA 4HK5A 1B3XA 4CD6A 4CNSA 4PR4A 1Y7VA 3C8NA 4DY1A 2PGEA 2E8YA 2NQZA 1A5AA 2CLHA 2GGEA 3NVDA 3BK0A 4G7FA 4X63A 3PPGA 4Q8UA 1L0PA 1MZRA 1JZ5A 3G0UA 1DWFM 3UY8A 4DM1A 1ITCA 4I5RA 4Z1YA 4P7OA 4OFCA 3G1YA 1KFWA 3P61A 4JDBA 1CB2A 1WDSA 3SN0A 3OA5A 4JTIA 5LIWX 5HPCA 4LVGA 4C6OA 2G5WA 1RPXA 3B0XA 2F6XA 4IPNB 1WE5A 4NL1A 1PKYA 5C9RA 1A53A 3BMXA 1TPC1 2HE5A 5FACA 1M7PA 4PRTA 4A3HA 4DBDA 5DY3A 1THFD 4XD3A 1NIUA 1V6TA 1E70M 2YFOA 4L65A 5LHEA 3SJNA 1TJ0A 4IUOA 2KX9A 3VK5A 3HGSA 3HTWA 2CHNA 1TX0A 1S3HA 3BW4A 3ME3A 1OFOA 4JTRA 4J5NA 2Y8UA 4H04A 3PBUA 2HXUA 3I68A 1BTMA 3CTTA 4QCEA 4AZ6A 1K9EA 3L9CA 2E1WA 1EZ2A 1H1ZA 1T41A 1IWAA 1TPFA 3L0GA 3TX9A 2W5FA 4NJHA 3DFHA 3CZLA 2IKIA 3W1AA 5T8GA 2VRJA 3GRIA 5AN7A 3NQBA 1DQWA 1UC5A 3UWZA 5DCEA 4HPXA 1T5AA 1JPKA 2FIQA 3D3FA 3SB0A 4YU1A 1ZJIA 2R1NA 4DYKA 3SCTA 2QEZA 2DJXA 1V3LA 4PEEA 1DYSA 4LFYA 1IT0A 3KZSA 4EF8A 1K8ZA 1B57A 3WQ8A 2FFIA 1QCWA 4ZO9A 1B31A 2XISA 2NLYA 3IGXA 5E9AA 2C3ZA 3UG4A 1MEIA 1J2WA 3W73A 1HVQA 3HMCA 3MCMA 2DIKA 4QLJA 5JH1A 5G4EA 1YXYA 3Q65A 1DIOA 3D5HA 3IUHA 1Z69A 3WBWA 3AZRA 2VFFA 4N9EA 3UXAA 4CU6A 3C3NA 2DP3A 1H0GA 4DM2A 5KINA 2P5NA 4E2BA 1LG1A 3HGOA 3WSUA 4EK7A 1QRQA 2X16A 4IXHA 2FZMA 1IZJA 2GL5A 2WC3A 4R9OA 1H60A 1QTWA 3LLDA 1JEZA 1YEYA 1VEMA 4E5TA 3TC3A 4UFMA 4Z0SA 2E4TA 2J9ZA 2V8ZA 3ISIX 3GXTA 4P5UA 3C3UA 3NQ2A 1CPUA 1VEOA 1VPXA 5D05A 3F4VA 1SM9A 4RV8A 2AQWA 4GQGA 3Q67A 1R9XA 3CJPA 2PWFA 1JCJA 1EB3A 3BUVA 3IK2A 3MANA 9XIAA 3PZ9A 3NQ7A 5C71A 4JPGA 3R11A 3VIKA 2JEPA 1KFBA 1CTNA 1U5HA 1NP2A 3K4WA 8A3HA 4L9XA 3GH7A 2XHYA 1JVNA 3W7LA 1N8FA 3KLKA 3EX4A 1H49A 2PDCA 1SFTA 2IQDA 4CCEA 1W54A 3YPIA 2C1IA 4S3GA 3V36A 1RVKA 4C5ZA 4UQDA 4Q4MA 2GFTA 1C29A 1VHNA 4CU8A 1Z7AA 3GO2A 2QJHA 2PTWA 3UZZA 2ZX9A 3W7MA 3W0KA 1TIWA 3W75A 3V0UA 1VIWA 3KVMA 3MSRA 3L67A 2G37A 4N4PA 1J0IA 4ADTA 4CQDA 2VOTA 2JBMA 3WBAA 3BJFA 1JCMP 4P8UA 1FDZA 2WVVB 5FJIA 3M0MA 2ZUNA 3G77A 4MHBA 2WNWA 4GA8A 3A4AA 2QCLA 1HO4A 1MUCA 4NZ4A 1JDFA 2X1UA 1M3UA 3I6TA 4Q8QA 3GFYA 4H6KA 5AYYA 1R9YA 1A5UA 3M0KA 2E6YA 3N9RA 4LX4A 2YPIA 1XBYA 3FHAA 4Q4OA 1GVIA 4MZ8A 1ODUA 1J6PA 1XBXA 1O66A 3RNDA 4ZQNA 4PMVA 4HZ7A 5FSEC 5CLWA 2G41A 2Z00A 3PZNA 1OHLA 1ZCCA 1U30A 4NKCA 4BCEA 2DY3A 4AWTA 3FFSA 3IK4A 3O15A 2HCVA 2ZA3A 3P5YA 3H2EA 1OVDA 1W5OA 4KPLA 3N2CA 3QLLA 3S2MA 1EXBA 4PUDA 2PLKA 1GORA 3MT1A 4EPBC 2E9LA 1E1FA 4IUGA 3T42A 2YL8A 3O6DA 2C15A 2VNCA 4M29A 4JNYA 5DCBA 1HN1A 1P43A 4TX8A 4D6GA 3A3HA 3WD0A 4DJDA 4PMZA 2C16A 1PB0A 5TAOA 2VGBA 1AD4A 3DAQA 1TWWA 4ORMA 4RLIA 3CBWA 1C3FA 5MKGB 3OZOA 3ARPA 5K9CA 3VOHA 4JHZA 1POKA 2QXWA 1PWLA 3O07A 3LHVA 2F6KA 4GPNA 3XIMA 1WB0A 2VFGA 3AJ7A 1RY0A 2PZNA 4L9ZA 1UA7A 5F2MA 3A5VA 1F4HA 2PE4A 3K1DA 3L5LA 4KRTA 2EXOA 4W88A 1HL2A 2ZZ7A 2P8BA 5TIMA 2W6RA 3C2FA 1YE6A 3VKCA 4AVFA 3MMUA 4YS1A 4F0RA 4L64A 4PZVA 1OC5A 3C2EA 1R3WA 2FZNA 2XVKA 3PG9A 3VGGA 3MVIA 2VENA 5DCDA 3QN3A 3MO7A 3H2AA 1XPGA 2XVGA 4E0CA 4KEZA 1UOZA 4UOZA 4GYPA 4Q4KA 4NT0A 3ZT7A 1TREA 2VC5A 5H8UA 5D04C 2ATMA 1BVNP 4D1IA 4B5WA 3U0HA 2QR6A 2Z1VA 3W7KA 4UTTA 4WQ6A 1ZUAX 2GJPA 4HB7A 3LCFA 1TFVA 2J7GA 4IQLA 4QCFA 5AHMA 4NSBA 1KBBA 4HHHA 1QW8A 2BVTA 3GIQA 4YYFA 4D72A 3SZ8A 3HQ1A 7TIMA 4IIHA 4MWAA 1AL7A 3STFA 5BROA 3BANA 4WDUA 3WQOA 1AMKA 1X6LA 4A8LA 2V3FA 4UFIA 3PTQA 1W1VA 2Z24A 3AMGA 2Y8KA 5FESA