3W88A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-200
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w88A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w88A01
4ZL1A 1XDMA 3FIGA 2JK2A 3KOFA 3SGZA 3LI0A 3G24A 5G1TA 1TCDA 3W74A 2YYTA 2VENA 1K7XA 3CLMA 2E6AA 1LDCA 1VPXA 3B0PA 3TFXA 5D2WA 5LNSA 3E12A 2V5LA 4JYDA 4RXFA 3EWWA 1W5NA 3EWXA 1W5PA 3G1SA 4IX0A 4S2BA 3BK0A 1JCJA 1WBJA 4IJBA 3HJZA 4S2CA 1H7PA 4GC4A 2ZZ5A 1LLWA 3FJ6A 4UNLA 1WV2A 4XQ6A 3CEUA 1TPUA 1GTEA 5AYZA 3G22A 1GWJA 3DFOA 3W1XA 3BGJA 4PFMA 5D33A 4IMFA 3QFEA 2Z1BA 1F05A 4O52A 2NZLA 5CPNA 2YR1A 2RFGA 5I3IA 5AYXA 2E5DA 1LBFA 1XDLA 2E1DA 1D3GA 3B0UX 3N9SA 4TU1A 4QAIA 1RQEA 1YPIA 4MZ8A 4MUZA 3GR8A 4KWWA 2YGYA 1LCOA 1DV7A 1F74A 3M41A 2C19A 3ZWTA 4JTKA 4K36A 4HPXA 3EKLA 3LXAA 4JTLA 2E77A 1FWTA 5C54A 1J4EA 1WYIA 3GXNA 1FXPA 1SZGA 2NXIA 4M7TA 1LRQA 1H1ZA 4JDBA 1BWLA 1TPDA 3P82A 2WNZA 4TMCA 4M6QA 3T7VA 4OV9A 5K9XA 2OT0A 3M44A 1J2WA 1GVRA 4UNKA 1KM5A 4IGHA 3UXAA 3T40A 3T4CA 1JUBA 1C9DA 1VCGA 1FDZA 1N8FA 2B7NA 1SZFA 2Z0IA 3P60A 3QQ0A 3O1NA 1TPVA 3W07A 2C6QA 3NGJA 2FLIA 2ZZ4A 3R12A 4WUIA 3QQ1A 2Q3RA 2BX7A 2I14A 1I2NA 3C8FA 1EWEA 3DENA 4CCEA 3SGUA 2FPTA 3NYZA 1OFQA 3GVGA 2ZRXA 4FHAA 3NM1A 3S5YA 1GG1A 2A7RA 1I2OA 3R2GA 4RZ6A 1PHQA 3W7KA 1KFJA 3W70A 1HG3A 3KAOA 1KBJA 5CZSA 3TQKA 3N73A 3QMRA 4YXGA 3T78A 3G1HA 1FUYA 3DH7A 3TW6A 4RZ4A 1R2RA 2QCLA 2VOMA 2A5HA 1IXQA 4MLJA 4FNRA 5CZTA 1D3HA 4Z1CA 5D09A 3L66A 1GYLA 1TRIA 3SW6A 5G4WA 1GJPA 4R53A 2RDTA 4J9JA 4JXCA 4MYXA 3U8GA 3TNOA 2NX1A 2PURA 2VEMA 4ZQMA 4OHQA 4NZFA 2QCCA 3B05A 3A21A 1NAL1 2ALDA 2C3ZA 2ZA3A 5IM51 2WSYA 2V0TA 3GX9A 1SPQA 3IGXA 3EEGA 3GKFA 3MP5A 3O63A 1KFCA 3M5VA 2QCNA 4LS1A 4QNWA 1KM0A 1P4CA 5FF7A 2XN2A 2QF7A 3FS2A 3NG3A 2DZVA 2WV8A 2VKZG 2Y62A 1IGSA 1OYBA 4P2VA 1LBLA 1GG0A 3ABRA 2R94A 5LHFA 3A9IA 2YX0A 2D73A 1F5ZA 3L21A 2E68A 3LB0A 5EY5A 3G1AA 5DBUA 5DY2A 2VFIA 1OFEA 3PBYA 1XL9A 1OX5A 3G1FA 4R7JA 3O16A 3FYOA 2Q8LA 3S6DA 2GVGA 3S1VA 3NPVA 1IIGA 1AW1A 3EX6A 4O15A 1OVDA 3GK0A 4N9CA 1JQVA 4QITA 3QZEA 1ZJIA 1MO0A 2Y7EA 5DCBA 3FJLA 4AHPA 1F6PA 3NQEA 1TTPA 3G1XA 1V5XA 5G2HA 1OJXA 1FDJA 5AHNA 2C16A 2GPTA 4MIMA 3M7WA 4PCFA 3EXTA 3LRKA 5CPMA 4RJEA 3FEMA 3Q58A 3BG3A 4K39A 2VFFA 3STEA 1WX0A 1QR7A 2EPHA 5IBXA 4JTEA 2ZBTA 1XI3A 3KRSA 3HPZA 4YCPA 4O54A 3LCXA 1CI1A 2ZCGA 1NVMA 5D37A 3W2JA 3WJWA 1UB3A 3TH6A 3G1YA 3TQVA 3M16A 3W3OA 2FQIA 4JN6A 3FYPA 4MOZA 4H4IA 4XTIA 1UASA 5BOOA 3L67A 2E6FA 1KM3A 3B06A 4AVFA 4ALDA 3LRMA 3CWNA 2CLFA 1MXSA 3NQ7A 4O13A 5E0KA 3BW3A 1TPB1 1QCWA 3QSTA 3WJXA 4A2SA 2YSWA 1JCYA 1G4PA 4DEFA 3UWQA 3C56A 4PL1A 5KMYA 4YL2A 1YXCA 5A5WA 3STFA 1HL2A 2J88A 2QJHA 2A85A 3M9YA 5AC6A 3S8HA 2O7QA 3RNDA 2E6DA 1Q6OA 1H61A 3INPA 1DJNA 5FF4A 1N7KA 4FNQA 2ZZ1A 4QJ1A 4CLMA 1KFEA 1NSJA 1EEPA 4MVAA 2TMDA 3KX6A 5KTLA 3PUEA 5AB3A 4MLRA 3KVKA 3TMLA 3TA6A 2RDUA 3RFAA 4Z1BA 5H2ZA 1QWGA 1P5BA 3NPUA 1GPWA 3RK8A 4Y6GA 1VLWA 3NL5A 5CKSA 5I3GA 3ABOA 2FJKA 5KZMA 3IEBA 1H7NA 3PC0A 1PS9A 4JICA 1GOXA 1FWRA 1S5TA 5TIMA 4HSNA 5FEXA 3SECA 3DBPA 1DVJA 4AF0B 1X1ZA 3TXZA 3C2OA 1THFD 5HWMA 3OEXA 1SO4A 1QO2A 2C15A 5C55A 5I3FA 4KWVA 4O19A 4ZQPA 4A22A 3UWYA 2E5CA 4EVZA 4S1FA 1BTMA 1SO6A 4HNNA 4UMBA 2YZRA 5GVJA 4EIVA 3HG4A 5D02A 5LHEA 3RLVA 3QW4B 5AOUA 3W6YA 3KHJA 1LBMA 2VEKA 7TIMA 2H8XA 1JJKA 3IV3A 1FCBA 2CLHA 1T8XA 4XUGA 4JYFA 4RCXA 3KFTA 3STCA 2DZPA 3NQVA 4O10A 5F2LA 1NFBA 4K8HA 3PWAA 1XUUA 5DLCA 3MMTA 3BLFA 1VR6A 4PA8A 3GDMA 3IVUA 3TDFA 1A5BA 2FB2A 3U6WA 3M43A 4Z0JA 1MEHA 1K8XA 1DHPA 1YXDA 5SWUA 4O18A 2ZTJA 4D2JA 3N2XA 1O4UA 1CX9A 4FXRA 2CZ5A 3C0JA 3S42A 3QH2A 5AC8A 3M5XA 4NQ1A 5CG7A 4JEQA 2GVLA 2ISWA 3SZ8A 4AWTA 3UNDA 3M0ZA 4BI5A 3R8RA 1RQBA 1VQTA 1TMHA 3FLUA 4DELA 1R30A 1XM3A 3P7YA 4GUFA 1BEUA 3PR2A 4QSHA 3LCWA 4LW7A 4ZQOA 2V8ZA 1FCQA 4O1AA 1LOLA 2C18A 3W22A 1FY6A 5F2GA 3W75A 2CFFA 1I8JA 2V2DA 4JTSA 1N55A 4RKAA 3IIVA 1EX5A 2P0OA 3WK2A 2A7PA 1I45A 3ABQA 2DZWA 3TKFA 2WNQA 3A5VA 3SFKA 3MI3A 5DY3A 4EOUA 4Y8FA 4TO8A 3S0CA 1AK5A 2QKFA 4ZQCA 1KW1A 1DORA 3I6RA 5DCEA 1SSGA 2CW6A 1KFKA 4MPQA 3CM4A 3W7QA 4AB4A 3TIMA 1W37A 3RU6A 4OWGA 1EUNA 1TQXA 3GXPA 1TO3A 1CW2A 3NM3A 2I1OA 2B7OA 3MHFA 1XCFA 4JD4A 4O1DA 4XBSA 1PE1A 3TSDA 3W87A 4K38A 4YCOA 3NXFA 2C13A 4LT9A 2J9ZA 3BLIA 4JTHA 3DFTA 5EMUA 4I7WA 1KFLA 3ZR4A 1T0OA 2E6YA 4Z08A 4LVFA 4NJIA 3L65A 1W3IA 2BLEA 3K30A 3M5ZA 4RK8A 4AAJA 1U5JA 3P8IA 1EB3A 3E02A 4AMAA 3I68A 2QDHA 4LVAA 1WA3A 3C2EA 2A6NA 3D0CA 3NPWA 3USBA 1X7FA 4LRSA 2I9EA 5LZLA 3EB2A 4Z1AA 3VE7A 3B04A 1XBVA 1C8VA 1RR2A 2GJNA 5C2XA 2JGQA 2PRLA 3HGOA 4IWWA 1UJPA 3W84A 4O4VA 3TV8A 3S5OA 3W7RA 2CLMA 3EWYA 2WJZA 3GDKA 4A3UA 5F4SA 3RLUA 3IVTA 3NPXA 1KM4A 4DBEA 1W8SA 1YPFA 5F1UA 4MZ1A 3OBKA 5IBXC 1W54A 3W72A 3DXIA 5AFDA 3HPXA 1Z41A 3UZ5A 5EPDA 3NA8A 4WD0A 2YW4A 3LHTA 3TC7A 5K9DA 4L4LA 4OGZA 5TBOA 3ZFHA 1XXXA 1EIXA 2DZUA 1HFBA 4MFDA 4OU1A 4UMCA 3T44A 4LVBA 4DBDA 1KV5A 3LV6A 4AHQA 3QRHA 6TIMA 2NXGA 5LGXA 2JKAA 3N14A 3L5MA 5KITA 2DZTA 3MHGA 3DZ1A 2QUVA 1TV8A 4ONVA 4MJMA 2C0AA 5BRBA 4UR7A 1WOAA 4WZHA 4M6PA 1M7PA 5TQLA 4NT0A 4XKYB 2GUUA 4DO4A 4LU0A 3N2MA 2YW3A 5D38A 3S5ZA 4EWND 3TFCA 3UY7A 1L6YA 4JY9A 3MBDA 4O4WA 4X2RA 3O6DA 2AQWA 3W1AA 3MWAA 3P62A 4O28A 3CIWA 3QMSA 4ZQNA 3EX4A 3NEVA 3QSRA 4TIMA 2QCGA 5HUPA 2ZRWA 5FESA 5CSSA 3HGSA 1OX6A 3UY8A 1ME8A 2WSRA 1VLIA 1UUOA 1SW3A 1DQWA 2B7QA 2DU2A 1EUAA 3BARA 1G4SA 5EBUA 4UTWA 3G8EA 1G7UA 1AL7A 2QUTA 2V2HA 2Q3OA 3EWBX 4CQ9A 1JUEA 4NJKA 2DZSA 4AXKA 3EX1A 1JCLA 3OG3A 3W7HA 4O0ZA 1H63A 1GVQA 1LYXA 5K9CA 3B8DA 4AWSA 2VXNA 4Y96A 1P0KA 2ZFAA 4GRSA 2JBMA 2OT1A 4XTDA 1R46A 3EWUA 2H6RA 4ADUA 3FKKA 2ZTKA 3LCFA 4UXDA 3W7LA 3NQMA 3W76A 1AG1O 3W23A 1KTBA 2ABAA 2HS6A 1JVNA 3NL2A 1OFRA 1LOQA 3CHVA 1XFBA 4LVDA 3HG3A 2P10A 3KRUA 3PULA 1YADA 4LRTA 3P67A 8TIMA 2GJLA 3LHWA 3VCRA 5I3KA 2XFWA 1TTIA 2H8ZA 2ZRUA 3IGUA 1SU5A 3UYCA 1A50A 5HMSA 1KLZA 4IOTA 3LCLA 4NZJA 3QYQA 1XBYA 4O12A 4TR9A 2QCDB 1Z44A 1A53A 3LTYA 1L6WA 4AHOA 1JR1A 1SO3A 3HF3A 4MKNA 3BW4A 3BW2A 3E0IA 4WX2A 4G1KA 4JTFA 3PS7A 5AN7A 5HWJA 4FX7A 1KM6A 3UQNA 3HIJA 4DO6A 2Q8ZA 4UFKA 2WQPA 3E49A 3GAYA 1VRDA 3SY5A 1R2TA 4M6VA 3NQ6A 4NJJA 1W5MA 3SIZA 4I7UA 3ABSA 3PBUA 1H7RA 1RPXA 3EX2A 2OX1A 1B57A 5HR7A 3ATYA 4LWWA 3O05A 2BXVA 1W0MA 1A5CA 3VFLA 1WQ5A 3E9AA 5C5YA 4A21A 3NOEA 5D32A 1X8FA 4PEKA 5D05A 4ADSA 3DHDA 4HT3A 3CC1A 2WOQA 3U2OA 4OT7A 4WXZA 4DPQA 3ZWSA 2CLLA 5E93A 3MI2A 1X1OA 2ZA1A 2Y85A 1JULA 2TPSA 4GWEA 1FWWA 4I9AA 3LBMA 1GT8A 4CQAA 5MHBA 2PE4A 4O14A 2W0UA 1R47A 3TW7A 1TPFA 4NNCA 1TJRA 4JX5A 3AJXA 3MI6A 4FIRA 2DORA 3I65A 2B4GA 1YDOA 1Q45A 3UZJA 2JGYA 3HQ1A 2R91A 4WOQA 3TSBA 5D03A 1LZOA 5HINA 4X9SA 4WOZA 4X3ZA 2Z2UA 2VFGA 4K7VA 1OK4A 1WAUA 2CZFA 3R13A 3IIOA 1H62A 3UPWA 1EWDA 3OVQA 5AHEA 4UUIA 4RLIA 1NEYA 4HN4A 5AHFA 4ADTA 3LGEA 3O06A 3LM7A 5K4ZA 5CSRA 3THQA 5J5DA 2XN0A 3W2KA 4CQ8A 3EX3A 1G67A 3W73A 5LNRA 3LX9A 3CU2A 3HO8A 4IX2A 4RV8A 4BK9A 1ADOA 3C6CA 4RXGA 3DFPA 1TTQA 3VNDA 3G0UA 5LNVA 4PTNA 2F84A 4HIBA 5FEPA 1RZMA 1TREA 3CIXA 4UTTC 4MY1A 1PV8A 3M5YA 4ZVJA 3G18A 3W1QA 2DJLA 3L2IA 3Q94A 4M5PA 4C1KA 1ME9A 2UV8G 5G2IA 3C2FA 1EP2A 3NL3A 4RR4A 4O11A 1K03A 4FB7A 1SFLA 2NX3A 2CLEA 1HTIA 3AO0A 5FF3A 1OF6A 3BV4A 5EKYA 3L0KA 1NF7A 2A0NA 1Q3NA 1Q6RA 3M1ZA 3HPSA 4O17A 5U7SA 5D30A 3NZRA 4JDYA 4LVGA 3TUUA 3O15A 2ISSA 4B5NA 1QPNA 3F4WA 4UTIA 5G4EA 1VS1A 1G6CA 2YXGA 3OVPA 2QR6A 2VFEA 5A8GA 2Y7FA 2B7PA 4WY0F 1B4KA 3S1XA 3YPIA 2OZ0A 1GQNA 2CLKA 3C2VA 1QOQA 3LBCA 1ICPA 3B4UA 3Q2DA 2C1HA 3P5YA 3LTPA 4O57A 3BPWA 1UCWA 2LLEA 3O07A 2YPIA 3CT7A 4PL2A 4GJ1A 2A4AA 1TYGA 4IXXA 1K7EA 1WBHA 1I2PA 3DU0A 3WK3A 4HSOA 3STGA 4FO4A 2OCZA 3FOKA 1ZNNA 3QMTA 4NJGA 3W88A 3QJAA 3MO7A 3W2MA 1SZEA 5EA9A 3NAVA 2F7FA 3L9CA 3CQ0A 3DHFA 4GXMA 3L0GA 3OHIA 1YXYA 4LUIA 1QPOA 4O1CA 3BG5A 1H7XA 1Q6QA 2Z6IA 3W1MA 3P8JA 2DZXA 4UTWC 1RVGA 1LROA 1XUZA 4OQVA 4IMGA 2X1SA 3LCHA 3NO5A 2R8WA 1OYAA 4FIQA 4BI7A 4FNPA 1J5TA 4QQ3A 4UCGA 4DQWA 3OA3A 2EAWA 3GR7A 1B3OA 4O0KA 4ZQRA 4TMBA 4KFPA 3KXQA 4MY8A 3O6CA 4NX5A 5FEWA 1H7OA 1QOPA 1JRCA 3KVMA 1A5SA 1LM1A 1WOBA 4K37A 4JX6A 3GLCA 4NXKA 2QJIA 1ZAIA 1TPH1 1ONRA 2QCHA 2VC6A 4OBTA 2G95A 3G1DA 4BWLA 1TQJA 1OFOA 3TXVA 2GQ9A 1YDVA 3W2UA 3GKAA 1TPC1 1OFBA 2OJPA 4H6KA 2DJXA 2CLOA 5D2TA 5HWNA 3W1RA 1F2JA 5HULA 3PUDA 3V75A 3PAJA 1O5KA 1PHWA 3SI9A 3VE9A 5I3HA 5KZEA 2YYUA 1PIIA 4O53A 2VEPA 3A23A 1FQ0A 4A29A 1FBAA 1VH7A 1AMKA 1XC4A 3GIYA 2KZHA 4HHPA 3C2RA 5D2YA 2FTPA 3FFSA 4DPPA 2CU0A 3PF3A 3NVTA 3DI1A 3PM6A 3NQDA 3TSMA 1YDNA 4UTHA 1FCUA 3C3NA 2V30A 4FF7A 2AGKA 1W56A 2JKPA 1YLVA 2TRSA 3W2NA 3I7QA 3VI2A 2VELA 4UTLA 1F7BA 3A24A 4WY0A 4JYEA 4UIOA 3OIXA 4JGDA 1H60A 2ZZ3A 2X2GA 2EHHA 3SR7A 3TU9A 3M47A 1JUKA 2WPBA 3W83A 3PB2A 2VFDA 3MW7A 5LGZA 1KV8A 4JTGA 1QPRA 2WKJA 4HPJA 1YYAA 4DF1A 4N9DA 5L9FA 1KLYA 3S1WA 2EF9A 3ZS4A 3UPBA 5KINA 3PG8A 4E0CA 2AAMA 1TPWA 1VHCA 3MP4A 2JKEA 4UFLA 2YCEA 3H55A 4HNTA 3IIZA 1I4NA 1ZFJA 4O16A 4Y90A 2QCEA 2V81A 4K6AA 3W1UA 3FA5A 1LRNA 2Y63A 3NZ1A 1EA0A 3BVJA 4MZYA 4CCDA 1M5WA 1AW2A 1H5YA 4FXSA 1TPEA 3F4NA 1K8YA 1FX6A 3Q37A 2ATMA 3TC6A 4NX0A 1MSSA 1KFBA 4UFHA 3R5EA 3L68A 3QF0A 3F1QA 3UWUA 1HO1A 3P61A 3VKJA 1YTEA 2X16A 4OE7A 4RX0A 4WXYA 1S5VA 2Y89A 4JY8A 3H54A 4MFEA 1ICQA 1F76A 2A1YA 3EKZA 4CCCA 4Q32A 1M6JA 5FEZA 1Z42A 1AL8A 2QDGA 1PCKA 2YFNA 3NNTA 3W1NA 1QDSA 1Z48A 4AEOA 1VZWA 1DQXA 3IGSA 1L9WA 3JRKA 5CGQA 1TB3A 2PCQA 2NLIA 4IMCA 1G7VA 1PL9A 4CNPA 2V9DA 4ZMGA 3PVFA 4MY9A 4LNYA 2ISVA 5DXXA 4E2BA 3MYOA 5AHMA 4IPIA 4UTMA 3L0NA 4QNEA 4Z1DA 5K4XA 1SSDA 5HUOA 3DAQA 4EF9A 1RV8A 2TSYA 3WK1A 2NV1A 2ZDRA 1DBTA 1JRBA 3DKJA 1SZNA 1RQHA 1M7OA 4GNJA 3TAKA 4O8RA 4XWUA 3LHUA 1HO4A 5LNUA 4POCA 1FXQA 4IUOA 3BO9A 3HMJG 2Y6ZA 3NL6A 4N9EA 1GZGA 3KVLA 1VYSX 1LP6A 4NNBA 5FI8A 3KRZA 3N34A 3GNNA 3S9YA 3NQCA 3LXBA 1GVOA 4DF0A 1S3HA 1ZAHA 4JTIA 2BSLA 1L2UA 4QISA 4ML9A 2HSAA 5CPLA 1VCVA 1SFJA 3TROA 2R14A 2GVJA 4N6FA 3UWVA 3DFQA 5T26A 1DL3A 1EP1A 2E09A 4OV4A 4MYAA 1KA9F 4TX9A 1QO5A 4WQ6A 1QPQA 3GAKA 3F03K 5G1YA 1B9BA 2P1FA 1F6KA 4N4PA 4EF8A 1AW5A 2QUUA 2FIQA 1K3UA 1K7FA 3E96A 2C14A 2ZYFA 1OX4A 4QM1A 3TX9A 2W79A 3GB6A 4U28A 3GDLA 4UTTA 2FFCA 2NV2A 1WXJA 3M6YA 1G69A 5AC7A 5BMXA 1F73A 2ZRYA 4P61A 5HJLA 3UXDA 5U4NA 1SW0A 4R33A 4JTJA 3LI1A 1SUXA 3L5LA 1WDWA 3V1PA 4IQLA 3QPZA 4KFNA 2Y7GA 3W7NA 5BMWA 1IXOA 4GUJA 2QJGA 1ME7A 1DOSA 2O7SA 1TRDA 3CWOX 1G4TA 1Y0EA 3TK7A 1H51A 3GZ3A 4IMDA 5FF2A 4O50A 1QFEA 3DFSA 3MHUA 3QEZA 1ZY9A 5BW6A 3G1VA 1YTDA 2V2CA 1QMLA 4M7SA 4HKPA 2OMAA 3GXTA 3W86A 2IQTA 2YDAA 4FNSA 2Y70A 1W1ZA 4LUJA 1S5WA 3MBFA 3W1LA 3LDVA 1PVNA 3N3MA 5AYYA 3W7JA 3ELFA 4AWUA 3UWZA 1K02A 3H53A 3LLDA 3I7RA 1W3TA 3IIPA 3NQ2A 4GFSA 2QCMA 2Z6JA 3EWZA 3QM3A 3B0VC 4FX6M 1OFDA 4JTUA 1OF8A 5EL1A 4UMAA 2CWNA 3PUOA 1H50A 1O94A 4ICNA 1MEWA 2GOUA 4CNOA 1VGAA 1FWNA 2WSQA 4LTSA 1JQXA 3THAA 4FEZA 1KBIA 3GNDA 1TJPA 4YWIA 3DFNA 2ABBA 5G5IA 4K8EA 1JCNA 2X30A 4AH7A 3QW3A 1B4EA 4RZ5A 4I7VA 2A7NA 2A6LA 1EP3A 1RD5A 5H91A 2J6XA 3DI0A 2QAFA 3HG5A 3WFAA 5DCDA 2FDSA 1KTCA 4NVTA 4GUHA 1Q6LA 1TV5A 2H3BA 2TYSA 2CZEA 4DF2A 3TAOA 4UTKA 4LS2A 2NX9A 1YTKA 4UR8A 2HS8A 1E51A 2QAPA 3NR0A 4YLWA 5D2VA 4JTTA 4CNNA 2QEZA 4LY8A 1FDYA 1SR9A 5K2ZA 5LKYA 2H3DA 2FPVA 3WJSA 4BWLC 2BTMA 3MYPA 1XKYA 4PH6A 2ZZ2A 1UBSA 3C52A 1G4EA 4Q4KA 2B0MA 2X1RA 5CZJA 4BFAA 1FCVA 3UWWA 3ATZA 5E1QA 1T96A 4JNMA 3W71A 2V5BA 3QPYA 4U4MA 5LNWA 3LV5A 1BWKA 3L5AA 4UTJA 2CLIA 1X6UA 4KKXA 4Q33A 1OYCA 2ATSA 3SJ3A 3G8RA 2BWGA 5EYWA 2HMCA 4E38A 1D9EA 2ZZ7A 3HGJA 1ALDA 1KM2A 5CPOA 2RDWA 3B03A 5AHIA 2HTMA 3P81A 3GYEA 4UTUA 4N9BA 3O8AA 4Z0SA 3DKLA 2G96A 2QCFA 2NUWA 4JX4A 1VYPX 2EKCA 3NQFA 3TR2A 1NF0A 3P74A 1FWSA 1P1XA 1BKSA 3PSWA 5CZ0A 4QIUA 1SO5A 2J9XA 3SSJA 3W7OA 4WJEA 1VHNA 3TJXA 1ZHAA 1OHLA 4K7YA 3W2LA 3JS3A 3G3MA 5F4XA 1DJQA 5D2XA 3WK0A 3MUXA 3CTLA 4N6EA 2ZZ6A 1IIHA 3N9RA 3IVSA 4YMZA 5DXYA 1SQ7A 4BF9A 2VFHA 5K7JA 2ZA2A 3G0SA 3W7GA 1DKWA 1OABA 2G5WA 1ZCOA 2GQ8A 3CEPA 3HBLA 3C61A 3P5ZA 5HQEA 2ZRVA 3W7PA 3GDRA 2W6RA 1TIMA 2J9YA 3PY2A 2QCDA 1O5XA 3BGGA 5HR6A 1JCMP 1TV7A 2PRHA 3LHZA 4LS0A 1MZHA 4AF0A 3W9ZA 5HNRA 1O95A 5L6UA 3A22A 1LLZA 3LRLA 2XN1A 4XBKA 1VC4A 1XBZA 5BNKA 4H3DA 3TCEA 3LXCA 3WJZA 4PC8A 4XKYA 2CZDA 2NXHA 2EGZA 3W1PA 4NJHA 1W5OA 1XBXA 4UFJA 3W7MA 1IF2A 3WJYA 4LV9A 1SW7A 1V7YA 1W3NA 3LCIA 4IXHA 2J27A 1TTJA 3LHYA 4MJZA 3O6YX 3BLEA 3HOJA 2WO5A 4W9TA 4N4QA 5DBTA 4IPJA 2NWRA 6ALDA 1LTDA 1OG0A 3T55A 2A2IA 3G0XA 4O1BA 3P80A 4ORMA 2Y61A 3LHVA 1K8ZA 1PCWA 1ML1A 2NUYA 3LTSA 3TMQA 1MEIA 3PSVA 5D04C 3W7CA 4C1LA 3TE9A 5F2IA 4HNUA 4FNTA 1LORA 1QNVA 1W5QA 4UFIA 3UD6A 1KTNA 2WNNA 3PG9A 1JCXA 3DGRA 3IRDA 1IXPA 3PB0A 4X22A 1P0NA 3N19B 1H7WA 1GVFA 5FF0A 2A21A 5G2WA 3G3DA 4JIPA 1R2SA 4DO5A 1I2QA 4DXVA 4GE8A 3MJYA 1ZENA 2GQAA 3EXSA 1ICSA 3A5FA 1TSIA 4KFOA 2V82A 2NUXA 3BG9A 3R89A 1VCFA 4HNVA 3RF9A 5ABTA 3PBWA 4N02A 3NDOA 5KSWA 1T99A 1A5AA 3TQ0A 3W7DA 3S5NA 2G97A 1O60A 4UFMA 5J5RA 1GVSA 5I3JA 3RMJA 2RHGA 3HGRA 3I7SA 1VJIA 3HB9A 5DN1A 2VEIA 3LLFA 4LOCA 4R34A 3OVRA 2FB3A 3GDTA 3NQGA 4ZZ9A 3W1TA 3ANYA 2Y7DA 3QC3A 4GUGA 2Y88A 4JS3A 3IIXA 4NXSA 4GBUA 1QAPA 1C29A 2BZNA 4BR1A 5F2MA 1ZALA 2NWSA 4LC8A 1EPXA 1IXNA 3FKRA 4UC5A 3LERA 4N2YA 2X1TA 4NU7A 4FNUA 4NUWA 3PBVA 3MP3A 2ZQ0A 1W31A 5AHLA 5DELA 1VYRA 4A2RA 3EXRA 3LOTA 2PRMA 3JR2A 4JR5A 4PODA 2H90A 4GUIA 2RKXA 5C6MA 1GYNA 1OX4B 4Y9AA 1I2RA 3W7EA 1OFAA 2X1UA 4E2DA 3W7IA 2RH9A 3KVJA 4LC6A 1KM1A 4JIQA 1HUVA 2E5BA 1L6SA 5F4WA 4L4MA 4LV4A 3CPRA 5K3VA 3TJLA 5KZDA 5F1VA 2ZRZA 3LCGA 4BI6A 1GEQA 2PC4A 1UUMA 3CB8A 1OK6A 1U83A 1GTHA 3S1UA 5LSMA 1ZAJA 1H1YA 2YFOA 2DP3A 4XZ9A 3NQ8A 4WY0B 3HG2A 4IMEA 4NNAA 4FX8A 1LRTA 1OFPA 3W85A 3NQAA 2J24A 3C4UA 4M19A 2FPYA 3P84A 1LOSA 4ORIA
chains in the Genus database with same CATH superfamily
4JQ4A 3FIGA 1B9ZA 1CNVA 2XVPA 3W74A 1K7XA 1MXDA 1CXLA 1DJXA 3O9NA 2V3FA 3VYLA 2IKHA 4PUJA 4JYDA 2DZBA 3LK6A 3S2MA 3WLNA 3G1SA 4S2BA 3PZ9A 1JCJA 3QPEA 1RCQA 4IJBA 3HJZA 4QS5A 4LYQA 2ZZ5A 2PWHA 1OCBA 3A13A 1K6WA 1WV2A 5BRQA 4NKCA 3P14A 3CEUA 4GD0A 1Q6GA 1GTEA 2IPFA 5AYZA 2E1WA 3BAKA 3DFOA 3W1XA 3URBA 1XD0A 4WHBA 5J8LA 3CMFA 4PFMA 4KT2A 3L4XA 1S2VA 4IMFA 3KP1A 2PUZA 4RNJA 2NZLA 1WDDA 5CLWA 5I3IA 5AYXA 5LA0A 3N9SA 4BQ5A 1YPIA 1GKQA 1K9EA 1XH2A 3GR8A 4O1FA 3BAXA 1DV7A 1F74A 1ODZA 3WDPP 4HU4A 1R7AA 4JTLA 1FWTA 3T81A 2VVNA 1FXPA 3SRDA 3AWNA 4HSHA 4M7TA 5CG0A 3GHRA 4JDBA 1I0DA 2POTA 4MF4A 1JZ3A 3P82A 5LXXA 3M0YA 3M44A 2OG9A 1ISZA 4X9YA 3UXAA 3N1AA 3VKKA 5A6SA 1C9DA 3RR4A 3CZKA 3UBPC 8XIAA 2FZ9A 1N8FA 2B7NA 3QQ0A 3W07A 5EFDA 2ZZ4A 2OO0A 4LYRA 3QQ1A 3WLTA 2Q3RA 3ZLFA 1BGGA 1W1IE 3H4GA 5C7HA 1I2NA 3C8FA 1W2VA 2R1MA 4GH1A 1PKMA 4WKFA 1OFQA 3LENA 4MJ2A 4P8VA 3POCA 3SAZA 4WDUA 3RX4A 3R2GA 4RZ6A 3W7KA 2ZUTA 1KFJA 3ICJA 3W70A 1HG3A 5TD4A 3MUCA 3TQKA 4WRHA 3N73A 3T78A 4DJDC 3G1HA 5LXEA 3NSNA 1UROA 1R3QA 1R2RA 5CXPA 3PNZA 3E1F1 1PEZA 3H4XA 1GJPA 3VIGA 4J9JA 4L61A 4ERIA 4IIFA 2HZGA 2VEMA 4OHQA 2VCCA 2QCCA 3JVAA 3L4VA 4ZCWA 3T1GA 3GZAA 2BY1A 1PIGA 2C3ZA 1X38A 5IM51 1XISA 1FKWA 2V0TA 3IGXA 1PX8A 3EEGA 2ZE3A 5XIMA 4LS1A 1E6NA 1X98A 2J4GA 2Y62A 1IGSA 2IPGA 1NJJA 3CAVA 4DUVA 1GG0A 5FKYA 5LHFA 1LWIA 3L21A 4YTSA 3LQLA 3RIKA 5DY2A 4QJ5B 1OFEA 4PN2A 1XL9A 1R3WA 2Q8LA 2GVGA 3S1VA 1IIGA 3ES8A 2X41A 1E15A 4IFOA 4AFYA 1JI1A 2R1PA 5AZ0A 2PF0A 1V5XA 1QASA 2OLHA 1MZRA 3GIQA 5AHNA 2C16A 4MIMA 4YHGA 4X60A 3M7WA 2QYGA 4RJEA 3Q58A 1ONWA 4FR6A 1WX0A 3AMLA 3KL3A 2ZBTA 4G2DA 3KRSA 3HPZA 4XAPA 3QBUA 4F8XA 4BEQA 1FWCC 2WVVA 1AZ2A 4UOZA 5BOEA 4UQ9A 3M16A 3W3OA 2XVLA 4JN6A 1GQIA 2ZUWA 4G7EA 4MOZA 4HN8A 5REQA 1S2UA 1SJAA 4ALDA 1PDZA 3R8HA 2CLFA 3PP7A 1JDFA 4E2OA 3VOJA 5IOBA 4AQLA 2REQB 1JCYA 3NO1A 1VBGA 2WJEA 1G4PA 4WSKA 3H22A 5MKGA 4YL2A 3STFA 2J88A 3GWQA 3M9YA 3VTRA 4HMCA 2WLZA 3IPWA 2I5QA 3ENLA 4GY1A 4JHOA 4CLMA 4C90A 3G77A 1M65A 3PUEA 4PR4A 4AWEA 3PAOA 3KVKA 3AMGA 1E1EA 1UPMB 4Z1BA 3CUIA 4RE4A 1GPWA 4Y6GA 4R3UA 5I3GA 5DMYA 4HOXA 5KZMA 2O56A 3UPMA 1H7NA 2VMFA 4JICA 2DW7A 1OIMA 1WDPA 1FWRA 2WAGA 3AISA 4HSNA 4DJED 2XG9A 1FH7A 4FXFA 1HJVA 3TXZA 3C2OA 1THFD 2IXVA 5HWMA 1TR1A 1TWZA 1J0YA 1SO4A 2DSUA 4KETA 1BRLB 2C15A 2HV5A 1NOWA 4O19A 5I3FA 2C0HA 1BTMA 4W87A 2YZRA 5LHEA 2OKOA 5A69A 5AOUA 4BF7A 1Q4WA 3AHZA 8CGTA 1E1CA 3ALFA 4Q8TA 1DQUA 2CLHA 4I8DA 3KFTA 5DMMA 2DZPA 4DYEA 3NQVA 1NFBA 1BWVA 1XUUA 5DLCA 3CUZA 4LEFA 2PCEA 2HISA 1VR6A 3GDMA 1J18A 3TDFA 2FB2A 2VEFA 2YDRA 5DMLA 4MWAE 2W91A 4CD7A 1DHPA 1RPKA 4D2JA 4NRSA 1R3RA 1SMAA 1O4UA 3GHTA 4FXRA 1FHLA 2CZ5A 4GNVA 3S42A 5DANA 3AMDA 2DSZA 1J0ZA 1MQQA 1O66A 4NQ1A 3DC8A 4GY7A 4QLJA 4BI5A 2OODA 3VGDA 1TV4A 1V08A 5C2CA 1SYTA 3FLUA 1NM9A 1R30A 3WD3A 3SB0A 3A3WA 3R10A 3GH4A 1TUFA 1TVPA 1FCQA 4JIHA 1BYDA 1LOLA 2XSAA 4LQ1A 4DZ5A 3WH5A 3FAWA 3BCJA 1V8EA 4AZ5A 1FWGC 1QNRA 3CZ8A 1I45A 2ISDA 3VABA 4UZUA 3S0CA 4EOUA 3CQHA 3LN3A 1KW1A 3I6RA 5C9RA 1SSGA 3AXIA 5BWFA 3EBVA 3M0HA 4MPQA 3WO8A 4HBKA 3GHUA 3RU6A 4QP0A 4XBSA 2B7OA 1XCFA 3APYA 4K38A 2Z4GA 4IQDA 3AIUA 1MQPA 4S3JA 5EMUA 3IJLA 1T0OA 4XD5A 4L5ZA 3RDKA 5FACA 4R27A 3I68A 3UP8A 4H2CA 1M53A 4GINA 4ZB2A 4LVAA 1YRRA 1WA3A 4S39A 4LBSA 4DO7A 2NQHA 3B04A 3JZEA 1XBVA 1ZCCA 3EPNA 5C2XA 1XD1A 3KBWA 4K1WA 4H7ZA 1UJPA 3VIPA 4O4VA 3TV8A 2PLJA 3C8NA 4GGBA 4RDWA 1SFSA 4UOJA 3RLUA 1HKJA 4CU6A 4DBEA 3WD1A 4LCRA 4FMVA 2ZC1A 1YPFA 5F1UA 4MZ1A 2WC4A 5I5RA 4XO6A 3APTA 4G1NA 5AFDA 4LEQA 1BHGA 3AZSA 3WL0A 4IQEA 3NA8A 1LWJA 2YW4A 3LHTA 3T0BA 4S38A 1AD1A 5TBOA 1XXXA 1EIXA 4S23A 2DZUA 4KRUA 1KGWA 2Z24A 3Q67A 2PFHA 1Q7MA 3LQGA 3CL6A 1ZJHA 3IV8A 2VZSA 3L5MA 5CH9A 5JMUA 5KITA 2DZTA 4RE3A 1A0CA 4OKDA 4QR6A 4GYPA 3LPFA 4NRRA 2C0AA 4HPHA 1WOAA 1ZZMA 4A6GA 1I75A 1VBUA 3N2MA 2YW3A 5AVNA 1B3ZA 3UY7A 1L6YA 2ACUA 4HJWA 1UR0A 1FWIC 4O4WA 1V0LA 3OQEA 3ZLHA 3MWAA 4O28A 4PMDA 3U7BA 5FESA 4DUWA 1AH4A 1N8WA 2CIPA 3ZZ1A 1ME8A 3T2PA 2XINA 1QI2A 4RPQA 4A05A 2BOFX 2Z1XA 2ZUSA 3WQWA 4Q8PA 3BARA 3KCLA 5EBUA 1OGSA 2PSNA 3AI0A 1AL7A 1Z89A 4DJDD 2HRWA 2Q3OA 3QKZA 2BY0A 3GTFA 5E9XA 1ZQ5A 2BVYA 2BS9A 3SQLA 2WLYA 4OECA 4J3WA 4C6DA 3U3HA 3L23A 3W7HA 1GVQA 2V5DA 1XV8A 5E09A 1AD4A 1BXBA 1NY1A 4Y96A 3OODA 4KCVA 2BDQA 3GNRA 3P0WA 2YL5A 5F7UA 2F6XA 3V5CA 5I07A 3WQCA 4ADUA 3CASA 1AQ0A 2I5GA 5JUVA 3LCFA 3W76A 3NQMA 3S6OA 2E0PA 1JVNA 2KX9A 3LPPA 1CWYA 3UGVA 3NL2A 2ISFA 3RPTA 1XFBA 2OELA 4GVIA 4LVDA 2I7GA 1DWAM 3KRUA 5C71A 1IEXA 3V35A 3VVGA 3KDNA 4MB3A 1YADA 2O55A 1UUQA 4WF7A 1O1HA 2Z1KA 4HA3A 4HU0A 2IMRA 2ZRUA 2JQXA 1SU5A 2PGRA 5HMSA 3CB3A 4HZMA 3ZVHB 3L4TA 4W88A 4M8UA 2QCDB 1A53A 2J7DA 3B0XA 3GFZA 1KXTA 1SO3A 2Y5SA 4AIOA 5FL0A 3PTMA 4F2BA 4UB9A 1BYCA 2VZOA 1TELA 2FVLA 3KOZA 4UFKA 3FXYA 3GAYA 5CLTA 1VRDA 3SY5A 1EC8A 3NQ6A 4HPGA 3B3DA 4I7UA 3SIZA 4KPLA 1H7RA 2OX1A 3O05A 1IQ8A 4LAKA 3VFLA 2YZ5A 1PTAA 2OOGA 3NYDA 4A21A 2VDHA 3DHDA 1TWWA 4GIYA 3CC1A 3U2OA 4OT7A 4WXZA 2E67A 4A8NA 4XSMA 4NYYA 2TPSA 2QV4A 4GWEA 3LBMA 2GGIA 4WK9A 4CQAA 5IXEA 1EDTA 3TZFA 1R47A 3MI6A 2GSEA 4QHRA 2B4GA 4ZTYA 1BG4A 3AZRA 3UZJA 4XVDA 2JGYA 4QLKA 9XIMA 1NDVA 1EDQA 4WOQA 3TSBA 5D03A 3ZR6A 1QHPA 3CZEA 1ZLPA 4WOZA 3RCMA 4Q8WA 1DJYA 1H62A 3K13A 1EWDA 3OVQA 4IJRA 1R3SA 4HMNA 4HN4A 3KS6A 2Z1SA 4XIAA 5CSRA 3THQA 1V3MA 3QZ6A 4CQ8A 4FS9A 3CU2A 3LA4A 4BK9A 1ADOA 3C6CA 2ZWZA 3TJIA 3VNDA 1FA2A 1M41A 4C6IA 3TP4A 5LNVA 4PTNA 1A5OC 4HIBA 1IEVA 3N9KA 3VDAA 4DIAA 3AUOA 1JD7A 1X96A 3HQPA 4ZVJA 4G9PA 2DJLA 3SN4A 3Q94A 4H9ZA 4CN6A 1W9UA 3GFXA 1P1MA 1EP2A 3NL3A 3SN0A 4FB7A 2EEXA 3DC0A 1NFPA 2HWGA 1OF6A 1UWTA 1NFGA 3VC5A 3V7PA 3M1ZA 4O17A 3NZRA 5GQBA 4JDYA 4PMNA 3MWCA 4S3KA 2ZC8A 1DYSA 2ZOXA 5G4EA 1G6CA 3F2CA 4XVEA 4TV5A 1TJ1A 1R7OA 3R8GA 2VM8A 3MKCA 4WY0F 3S1XA 2YXOA 3H24A 2QGHA 2CLKA 1HJQA 2D1ZA 1QOQA 2VUNA 3Q2DA 2C1HA 3P5YA 5A1AA 1ZRQA 5M5DA 4D9PA 3BPWA 2YPIA 1OIFA 1TYGA 3WK3A 4FO4A 4NI8A 3GUGA 2E9BA 3W88A 3EWCA 3QJAA 5EA9A 3ITVA 4FA3A 1CGUA 2W27A 2MANA 2VC7A 5BU6A 2F6KA 5EGRA 4AIEA 1CBGA 4O1CA 1Q6QA 1US3A 1QXLA 3VNLA 3WLIA 1W3JA 1PYFA 1VBRA 2DZXA 1XINA 3TN4A 1XUZA 4Q22A 1OYAA 3QZAA 4QDMA 5FIPA 4BI7A 3EMQA 1RHCA 4UCGA 3OA3A 4DLFA 2WMJA 1B3OA 2G4FA 4GQGA 1ECEA 4O0KA 4ECLA 3URQA 4WEVX 5FEWA 4PUKA 3R7MA 1A5SA 4US5D 2WM1A 4C6MA 4C91A 4NXKA 2QJIA 1ZAIA 4OBTA 2G95A 4D8ZA 1UQZA 2GGEA 1HVQA 1U5HA 1TPC1 4H6KA 3BANA 1CZ1A 5D2TA 5HWNA 1F2JA 3V75A 2A3EA 1O5KA 3K4WA 5I3HA 1EL3A 4WCJA 1ZL1A 1FBAA 3CYJA 1F3XA 1JFHA 3RRXA 3C2RA 5D2YA 4JFUA 3PNUA 1Z3NA 4Q8QA 3L4UA 3PM6A 1MUCA 3MS8A 2FZBA 1YDNA 1D2KA 3DFYA 5CGMA 1WKYA 3UXLA 3UG4A 3CZLA 4FF7A 2OLSA 2QPSA 1YLVA 2VELA 5FJUA 4UTLA 3HZ3A 4WY0A 2FVMA 2XIQA 3AAMA 1A4LA 3AOFA 3TJ4A 4JGDA 3MJMA 1FVPA 2EHHA 2CZVA 3TU9A 3M47A 1R86A 1M7XA 2VFDA 1KV8A 2Z25A 2WKJA 4LB3A 1AJ2A 4LJ3A 3CK5A 1GVIA 5L9FA 4N9DA 4ZOCA 3VDBA 3ZS4A 3UPBA 4GNKB 4E0CA 3EOOA 1PWMA 2WVSA 3SEPA 4EXBA 1RALA 1XG3A 3TTQA 3PFMA 1PKYA 3H55A 4TOQA 1AJZA 3M0XA 1T6MA 4XZIA 1J2BA 1QHZA 4GX8A 1VFOA 1XLJA 4GGHA 3W1UA 2DT0A 2Y63A 4E4PA 4MZYA 3SCUA 1H5YA 4FXSA 3MUY1 1KKOA 3Q37A 3ITGA 3WMCA 3WSUA 3KEHA 3M0IA 8A3HA 3T07A 3AXKA 3V5OA 2QULA 2PDBA 3L68A 3CJPA 4AIBA 4CCZA 1CECA 1UWIA 1HO1A 1W3HA 2J25A 4RX0A 1S5VA 2Y89A 3H2AA 1MUWA 4FK9A 4MFEA 1ICQA 1F76A 4KEUA 4W93A 1PCKA 2YFNA 2FGBA 2ON3A 1W9XA 1QDSA 1Z48A 1F3EA 4RNIA 1VZWA 2YIHA 4V15A 2NVCA 3JRKA 1TB3A 1JYWA 1G7VA 5T91A 4MY9A 3LSCA 3FXGA 4E2BA 1LG2A 2GWGA 4IPIA 3MU7A 1VIWA 2GVEA 2P53A 2PTWA 5JIPA 1SSDA 3R0DA 3DAQA 4EF9A 3WK1A 3R25A 1U1HA 3DKJA 2INEA 4WJXA 2VX6A 1ADDA 4DI8A 1MW1A 4POCA 5GJMA 3PTKA 2QUMA 5C9ZA 2YB1A 3N34A 3TYCA 3GNNA 4B9YA 2D69A 1XG4A 5H8UA 2IKJA 2OO6A 4DF0A 4D6JA 4JTIA 2BSLA 4QISA 4DWSA 4AUBA 2F38A 4BCEA 3M0KA 5FCZA 1DL3A 1EP1A 1QO5A 3GNPA 4WQ6A 2E7FA 3F03K 2P1FA 4EF8A 1GW9A 2FIQA 3E96A 2C14A 3N3TA 1OCQA 1OX4A 5AVHA 4JQAA 1FWEC 2W79A 2BOGX 4H00A 1WXJA 3M6YA 5EMYA 4AZIA 1UG6A 5U4NA 1SW0A 2IKGA 1AZ1A 4QCEA 3N2TA 3QPZA 2ONEA 1DOSA 1TJ2A 2O7SA 1CB7B 4AC1X 1XJBA 4DI9A 1U1UA 1XLBA 1H51A 1JDCA 4LUTB 3WD4A 3MHUA 3TOPA 4GLEA 2V2CA 1QMLA 3DDMA 1NTHA 4S3DA 1Q4NX 1A3XA 1GGOA 3WUFA 5M1TA 3DFHA 4H8UA 2F2KA 1JZ6A 2PDWA 1Q7QA 4MDPA 9RUBA 5DQPA 3UA4A 3VZXA 1K02A 4DAIA 1QATA 3I7RA 3LLDA 3IIPA 5GNXA 4GI6A 4GFSA 4AVOA 2Z6JA 3QM3A 3B0VC 4FX6M 1VD6A 1OINA 4JTUA 1FFRA 3NQBA 5IFTA 3WH8A 5HQLA 1O94A 2VQTA 2PDYA 2GOUA 2ZUUA 3VKCA 3S9ZA 1S5NA 3SRKA 1JQXA 3THAA 4WVXA 4FEZA 1P0DA 1KBIA 4PULA 4KMQA 3BMWA 1TJPA 3DFNA 2ABBA 2YCJA 3GXIA 2ESCA 4GXWA 4HU8A 3E3HA 1WKDA 3AS2A 1ADSA 1KCXA 4BS0A 2PGWA 1CENA 2J8GA 3BJFA 2A7NA 2A6LA 5H91A 1SJBA 2J6XA 3DI0A 2CERA 3OLDA 3WQ5A 4UQBA 3W0KA 3FHAA 1Q6LA 3TCSA 2JALA 3VC6A 5CPQA 2MNRA 3GG1A 4D6FA 1YTKA 2HS8A 1G94A 2DQWA 2QEZA 1SMDA 4KCWA 1KCLA 5HMFA 2PDNA 2DH2A 2H3DA 1XW8A 3LPOA 4C1NA 4YTTA 1XKYA 2ZZ2A 1UBSA 3S6TA 1K70A 3UG3A 3C52A 1E9YB 1EH9A 2X1RA 1UD2A 2XIOA 5LIXX 4KQNA 4PTMA 1O12A 3ATZA 1O68A 3SRFA 1M9HA 5I06A 1XLGA 1NOUA 3UT0A 4K8GA 4AX7A 3OG2A 4J3TA 5HNTA 2YB4A 2WW5A 2ATSA 1AODA 4P8WA 5EYWA 2HMCA 2Y5EA 1D9EA 2ZZ7A 3H21A 4KBXA 1QW8A 5REQB 2HROA 1NDYA 3N6JA 5TF0A 2RDWA 4R88A 1BKHA 3MKKA 3OZPA 2DSKA 1WKEA 2B81A 3GYEA 2WJDA 2REQA 3AFBA 2WK2A 4JX4A 2PI6A 2NV9A 3NVDA 2EKCA 1UA3A 3TR2A 4MB4A 4H7VA 4FZIA 3WBYA 4YN5A 3W7OA 3K8KA 4HMDA 3A12A 3PJWA 3JS3A 1H41A 5F4XA 1WE5A 1KRBC 3WK0A 3OO2A 3SJNA 4GQBA 1WO2A 3B8TA 1E6SM 5K7JA 5BROA 2BNJA 1DKWA 1OABA 2J62A 1OB0A 5LIUX 4F2TA 3WF4A 3CEPA 3LZ5A 4JIRA 4R9XA 3OTRA 1GOKA 1UR3M 2W6RA 2P8BA 2J9YA 1E0XA 5HR6A 3OVGA 3LHZA 4CN4A 1QTWA 5DMNA 4F9DA 1US2A 5HNRA 1V6VA 4REQA 5L6UA 3VNZA 3A22A 3A9BA 1LLZA 2XH2A 2VO5A 3LRLA 1VC4A 2O9RA 3LXCA 3WJZA 4PC8A 4XKYA 2CZDA 3T05A 2NXHA 1J10A 3BWWA 4AD2A 4H6RA 1W5OA 1QOXA 4OBSA 2PGFA 4LV9A 1OG6A 1W3NA 4IXHA 2J27A 3THCA 4YTQA 4LANA 4HTBA 4MJZA 3HOJA 4W9TA 3TQPA 4N4QA 1EO5A 6ALDA 4PBFA 3UR8A 4AC7C 4O1BA 1WNOA 6XIAA 3LHVA 5I79A 1S2TA 1ML1A 1ZPTA 2NUYA 3N11A 5FJOA 1ZSXA 1MEIA 1QBBA 3OLGA 3TLLA 3TE9A 4ZA0A 5F2IA 4HNUA 3TTEA 4LY4A 1Q2SA 3AIBA 4QG8A 1K6AA 1QNVA 2GK1A 2HXTA 2VGBA 3IAQA 5BYWA 1A5KC 4IGNA 1P0NA 3MDWA 2A21A 3CS2A 1W8GA 3M0MA 3OBEA 4DWSC 1UWQA 1ZENA 1JYXA 3EXSA 1MXGA 1ICSA 2PU1A 3A5FA 3B8WA 4OOZA 2V69A 1VCFA 1IT8A 2WB5A 3ZT6A 4RNFA 3PBWA 4K2SA 1N82A 1CB2A 1L2QA 3BAWA 1ZBKA 1GVSA 3WH9A 1XLMA 3I7SA 1VJIA 5DN1A 1LQ2A 4R34A 4GH3A 4OTKA 2FB3A 3VDCA 1P0EA 3NQGA 4C6FA 3ANYA 2CNCA 2ZUVA 3HFTA 4GBUA 2CCRA 4ZB5A 1C29A 4NI3A 1ZALA 2NWSA 4LC8A 1EPXA 1TUXA 1O6IA 1VFTA 4CKQA 3AQUA 4Q4QA 1TA3B 3FKRA 3C3UA 3LERA 3RGTA 3H4WA 3A3XA 3EYPA 4NUWA 3MP3A 1W31A 1NQKA 3OB8A 4B4HA 2QQ6A 4IMAA 3VOGA 4A2RA 3LOTA 4UCFA 4J2PA 2PDKA 3NGFA 4JR5A 4YHEA 4AD0A 4GUIA 1ZU8A 1GYNA 3CV6A 4Y9AA 4O0QA 2X1UA 3VOIA 3ZQ9A 5ABGA 3W7IA 2RH9A 1CIUA 1KM1A 4JIQA 4S3FA 5A95A 5BXPA 1C91A 4R5EA 3CPRA 3WBEA 4GABA 5KZDA 2AL1A 2ZRZA 3LCGA 3A4AA 1QU4A 3WDRA 2EG6A 1GUVA 3AHYA 1RY0A 3EOUA 2DP3A 1P6CA 4C1NB 3NQ8A 4WY0B 4IMEA 4NNAA 2AMXA 4S3EA 3KBNA 1FWAC 2FTWA 4DVOA 3RLHA 3LGGA 2JK2A 1UD6A 4G5DA 2E25A 5G1TA 3F5KA 3MQTA 3CLMA 4IG2A 1LDCA 1VPXA 1UWAA 3AHTA 1JDDA 3TFXA 5D2WA 3E12A 1Y8BA 2NQJA 1IHIA 1P0BA 4RXFA 3EWXA 2QJMA 3PPCA 4IX0A 3BK0A 1V6WA 3SSZA 4IF2A 3WBXA 3KLKA 5I77A 4UNLA 1GYMA 1CLVA 1IE7C 4HD5A 4TUFA 1XYMA 3RAOA 4H83A 3UG8A 5A6AA 4CUCA 1YBQA 2Z7GA 4GMEA 3OZMA 5D9MA 1GWJA 3GC2A 4XAFA 2WMHA 2V3GA 3WLQA 5CPSA 2INFA 3TC3A 1DE6A 4H04A 2YCLB 3QFEA 1F05A 3BLDA 2YR1A 2PD9A 1VEOA 1JXJA 1KCKA 4EX4A 1LBFA 1XDLA 3BZGA 1SZRA 3PZQA 4QAIA 3N2BA 4MZ8A 4X63A 4KWWA 3ZWTA 4JTKA 4RZBA 4HPXA 3EKLA 3LXAA 3GXNA 1TV2A 5D4YA 1UR9A 4TMCA 4M6QA 3GBEA 3RCYA 1ZB5A 3PPGA 1GVRA 2GJXA 2ZX6A 3T40A 3T4CA 4LFYA 1VCGA 1PPIA 1FDZA 2Z0IA 1SZFA 3WLOA 2C6QA 1HKIA 2DUZA 2A3HA 3R12A 4WUIA 4BA0A 2BX7A 2EG8A 4EACA 3RMEA 4KWSA 2WQDA 1MQRA 3SGUA 4BJHA 4GXPA 3NYZA 1EJSC 3GVGA 3HN3A 2ZRXA 3S5YA 1GG1A 3V0UA 1V0NA 2VP8A 4YJ5A 4Q4RA 2NQLA 3KS5A 1FUYA 4DUXA 2VL4A 1D3HA 4Z1CA 1E1FA 5D09A 3SRHA 3S2CA 4DYKA 3NSMA 2WKLA 3SW6A 3CZJA 2GDQA 3TWBA 2RDTA 5M17A 4QFUA 3F7JA 3IACA 3XISA 5HJXA 4ZQMA 1D8WA 1Q8JA 5AZ1A 1R8LA 2ALDA 2ZA3A 3W01A 1Y5XA 2W67A 1YNPA 3N12A 1SPQA 3M5VA 3QN3A 2QCNA 3AIWA 4QNWA 1L0PA 1P4CA 3CHEA 2GSJA 4CQBA 3ZT5A 4F2UA 3NG3A 2PWGA 2PGEA 1Q7ZA 1JFXA 1X6NA 1L6GA 1OYBA 4GC3A 4QROA 3WLLA 1WDQA 2DZAA 4F4RA 2YDQA 3WZ0E 3ABRA 3UR5A 5D9PA 3MA8A 3MCMA 3V5FA 4P5UA 1K8CA 2VFIA 4YVXA 3DIPA 3F4DA 3G1FA 3FYOA 3ZOAA 3BLKA 3U5YA 1AW1A 1KNWA 1GW1A 3EX6A 3BICA 3RLGA 3QR3A 3IK4A 3GK0A 4D71A 3VM5A 5DCBA 4AHPA 1F6PA 4XZWA 4QAWA 1OJXA 3KCOA 3MMUA 2JIWA 5CPMA 4WKHA 3BG3A 4K39A 2VFFA 3MUIA 1OT2A 4FALA 1PZ3A 3BMVA 5IBXA 1M7JA 3UFYA 4ZTXA 3B4YA 3E5BA 2UY5A 1F4HA 2ZCGA 3MY9A 3RITA 4HHHA 3WJWA 4JCLA 4AZ7A 4Q8UA 1MFUA 3HTWA 4P7OA 2FQIA 4FOJA 1W1A1 3SN1A 4H4IA 1UASA 3TN3A 3LMZA 3B06A 3RM8A 4Z17A 1UBPC 1MXSA 3ZJ7A 3KBMA 3M0LA 2PF8A 4IL0A 1CLXA 3T0TA 5E0KA 4A2SA 2YSWA 3OOQA 3DEQA 3VAVA 1DWGM 5IFPA 1I6NA 5AC6A 2O7QA 1GKRA 1DJNA 3T0DA 4FNQA 3T0AA 4QJ1A 1UJQA 2R1NA 2TMDA 3B97A 3H8AA 1OZMA 2VR5A 4IPPA 4TXEA 7A3HA 1QPKA 1SR0A 1VLWA 2VUYA 5CKSA 1UPPA 3N4EA 3EMCA 1UH3A 3VD5A 3IEBA 3IJIA 3GIPA 3PC0A 3GBDA 1PS9A 4C6CA 1GOXA 1YW1A 3E5PA 4XD3A 2VOTA 3B9AA 3F5JA 1XGEA 1S5TA 5FEXA 3SECA 3DBPA 4AF0B 2FVKA 1FHUA 3BMXA 2ACQA 1J0IA 1XLIA 1QO2A 4F0RA 2RGMA 1DXFA 5ABFB 4I9JA 1WZMA 1EYEA 4S1FA 3VCCA 4PSRA 1SO6A 4HNNA 4YTUA 5GVJA 5D02A 2XDFA 3AYRA 3MSYA 3RLVA 3FGCB 1GOWA 5JBDA 4FOKA 2JEPA 3GXFA 2H8XA 4XZBA 1C93A 5AY7A 1T8XA 4JYFA 1GJWA 4C7DA 2W62A 3DN5A 5F2LA 3V3WA 3PWAA 3MMTA 3UJ2A 3WDJA 1JD9A 3BLFA 4HHLA 4L9XA 3LS9A 4PA8A 1A5BA 1ISWA 4J3XA 4JNZA 2OEKA 1NARA 3D5HA 1LG1A 3ZMRA 1Z69A 3EPMA 3S4TA 3S1GA 3AU2A 1C8YA 3CAQA 4PRRA 3HA1A 1A5MC 1AJ0A 5AC8A 1EOKA 3M5XA 2ISWA 2PDMA 1US0A 4AWTA 2VDGA 3UNDA 3GW0A 3QV7A 1OSEA 2AQOA 3RR1A 4ZOEA 5I0DA 4LX4A 1BEUA 4E2VA 1BXCA 3CV7A 4J7RA 1S1PA 2PD5A 3DX5A 3WLJA 1F6YA 4O1AA 4NAFA 2XZ7A 3W22A 2EQDA 2QPUA 1HZYA 4ZEPA 4I6KA 2V2DA 1JIBA 3B8IA 4JTSA 2QMKA 4MGGA 4RKAA 2OGJA 2X1IA 3AWOA 3D47A 3LEPA 1DPMA 2A7PA 1E9IA 1Z32X 3ABQA 2DZWA 4ERAA 2WNQA 3MB9A 1DTUA 5DY3A 3SFKA 4TO8A 4GQQA 1DORA 2V5JA 5DCEA 3HQOA 3WEOA 3CM4A 3W7QA 4AB4A 3TIMA 2I5IA 1W37A 3QY8A 2ALRA 3O0FA 3W24A 1EUNA 2CBUA 1TO3A 2I1OA 5T9CE 3L4WA 3MHFA 4JD4A 3NURA 1HW6A 3TTSA 5HXMA 1AMYA 4YCOA 2C13A 1F3TA 4LT9A 1OGGA 3BLIA 2OSYA 3ZR4A 1JAKA 5AYIA 2E6YA 4Z08A 4LVFA 3EDEA 4NJIA 4RK8A 4AAJA 4AMAA 2ZWYA 2V3EA 3EB3A 3UF9A 4FAMA 3USBA 5LZLA 4Z1AA 3UVAA 1YE4A 1X7IA 2JGQA 2ZICA 2WMIA 4H9UA 1P6WA 3S5OA 1B3XA 1GKPA 3W7RA 1OEPA 4B15A 3W02A 5F4SA 3NPXA 4AVNA 4QE5A 3OBKA 4URIA 1BTCA 3W72A 4Z2HA 3DXIA 2OYKA 3UZ5A 4JQ2A 4JFTA 4ZE4A 3TC7A 3WNOA 5K9DA 2BXZA 4L4LA 3ZFHA 3BOLA 3GU9A 3PUGA 4DX3A 3WUBA 1N2VA 5BCAA 3T44A 3ZLGA 4JCMA 1J12A 6TIMA 3WY1A 1Z9AA 2JKAA 3EOEA 3N14A 3RXZA 3MHGA 3DZ1A 2WVUA 3NO3A 1E9LA 1V3IA 3E0VA 2GGHA 4DWSD 4WZHA 4I9TA 1M7PA 5CBBA 3IARA 4LU0A 1Q6DA 3HFYA 5BXTA 5D38A 1HIZA 4EWND 4JY9A 3PFRA 1Y5WA 3NJ3A 4XV0A 2F8QA 3W1AA 5EBAA 2NT1A 1CPUA 3QMSA 3VNKA 5DF0A 3S47A 5HUPA 2ZRWA 3OPSA 1WXZA 1JNDA 1OX6A 3SY8A 5ABEA 4UBPC 2WSRA 1UUOA 4HA1A 1A5NC 1DQWA 3CZGA 2DU2A 1KRAC 3HV9A 1W9VA 2VGGA 4ZFMA 4UTWA 2DQXA 2XIJA 1J5SA 1G7UA 4F79A 2QUTA 1UWUA 4JTAA 4L6HA 1EKOA 4NJKA 1W1TA 4O0ZA 1LYXA 2C71A 2ODOA 5K9CA 2XFRA 4D1JA 1E55A 2D3LA 1P0KA 3ARQA 4GRSA 2DUXA 4HNOA 4Y9NA 3EA2A 2EPLX 4EAYA 1U33A 4AYGA 3JUGA 3MO4A 1ONXA 4Q4OA 3FJ4A 3FV9A 3W7LA 4PUMA 1LJYA 1LQAA 3V0SA 2MUCA 4TVCA 1W1PA 1OFRA 2OWXA 1A5UA 1XIFA 4QS6A 1BQGA 3UZZA 3HG3A 1E6QM 3F4CA 5HANA 4LRTA 3P67A 3LHWA 3VCRA 2XFWA 4QRNA 5CSYA 3R11A 3HM7A 4H01A 2VQUA 3V16A 3IGUA 1AFSA 3S2NA 4NYUA 1A50A 4PB5A 1KLZA 4JTCA 5I2UA 1XBYA 4O12A 2YLAA 1V7AA 2HE8A 1L6WA 3GO2A 1JR1A 3HF3A 7REQA 1G9HA 1TA3A 3IUIA 1G5AA 4MKNA 3WQFA 3BW2A 4NF7A 4ATDA 4JTFA 3PS7A 2CHRA 5AN7A 3F2BA 1T7LA 3WYZA 1KM6A 3HIJA 4HA0A 4I6VA 1KR1A 1R2TA 4M6VA 4N0RA 3RHGA 1VJZA 3ABSA 1RPXA 1B57A 4LWWA 4WDWA 4XIMA 4PFHA 4I8YA 3E9AA 4QXIA 1VENA 3S5SA 2GZXA 4PEKA 4V1XA 2CBJA 4PUNA 2OU4A 1KQYA 3H7RA 5HAOA 2WOQA 3R0UA 3AMKA 1L6FA 1BVWA 1Q8AA 4OUIA 2PP3A 3MI2A 2I16A 3VA8A 1FWWA 4I9AA 1CGWA 1GT8A 1MFVA 4IGSA 4MWAC 2HVMA 2PE4A 4O14A 3RU8X 3TW7A 4NNCA 1FHDA 1TJRA 3VD3A 4ACZB 4FIRA 2DUAA 1YDOA 1A0EA 3VGGA 2VX4A 3HQ1A 4AXNA 2BVWA 1LZOA 4LCSA 5HINA 3CO4A 4X3ZA 3VOHA 1OK4A 2CZFA 4L64A 4MTVA 4XSLA 4GVFA 5HPCA 4JN8A 4H8VA 3W2KA 3W73A 3LX9A 2OGYA 3AUJA 2X8RA 5CPTA 4IX2A 4RV8A 1JZ8A 1KCZA 2J7EA 3QTGA 1KFWA 1C8XA 3G0UA 1RBOB 3GY1A 1RZMA 4DJFC 4UTTC 1LQ0A 3MC5A 1XC6A 3PTDA 3BLPX 4H6QA 3DCPA 3A4WA 2QXWA 4M5PA 4PUUA 4C1KA 5G2IA 3NZGA 2J7GA 3S46A 1K03A 1V51A 3SCRA 1J8VA 5I02A 2UY4A 2CLEA 1HP5A 1ZUAX 5FOOA 5EKYA 3WQOA 4K3ZA 5H1WA 1REQB 1Q6RA 1BXNA 3HPSA 5U7SA 2FZ8A 3CH0A 4H19A 2DEPA 4M81A 4X0NA 4LVGA 4L9YA 3O15A 1YNYA 3F4WA 3OVPA 2QR6A 1RXOB 4KWOA 5A8GA 4PCSA 3CV2A 1B4KA 1UOZA 3W29A 3YPIA 3MPGA 2BB0A 2OZ0A 3W37A 5JH1A 3ITYA 3C2VA 1ICPA 5CSUA 3AYVA 3LTPA 2PP1A 4O57A 1UCWA 2LLEA 1EC7A 2BHZA 1BYAA 4GJ1A 2A4AA 2C79A 2VR2A 1WBHA 1O5QA 4DJDA 4HSOA 2OSWA 1ZNNA 3GU2A 4O8AA 3QMTA 2P3ZA 3MO7A 3NZPA 3NAVA 4NZ5A 3L9CA 3CQ0A 1W1VA 1FRBA 3L0GA 2ANUA 1V02E 1QPOA 4KRZA 1H7XA 1UP3A 3W53A 3R1ZA 3W1MA 3P8JA 1JYNA 4IMGA 2X1SA 3LCHA 1UWRA 5HMEA 5I00A 1J5TA 3QGVA 4DQWA 1WUFA 4WGHA 2P5NA 2EAWA 4DBWA 1PO9A 3KXQA 3WDQA 1H7OA 4UNIA 1WOBA 4PTWA 4K37A 5CC5A 1B3WA 4JX6A 1OD8A 4BWLA 1QT1A 1OFOA 1YDVA 2HBXA 1OFBA 2ZX5A 2CLOA 3T08A 4L1XA 4HK5A 5HULA 1B90A 2X05A 4ROQA 3TEVA 4NZCA 3GDBA 5KZEA 2WYSA 4O53A 2VEPA 1FQ0A 1KWKA 2VX5A 2KZHA 4V1YA 4HHPA 2FTPA 5FJTA 2G41A 4A8IA 4DPPA 2CU0A 3PF3A 1V4YA 4J28A 4KGLA 3TSMA 4UTHA 1FCUA 1GVEA 1A3HA 3DYPA 3W2NA 1FH9A 3TTYA 1H49A 3A24A 1UKOA 1R3VA 3B9EA 4UIOA 4PE8A 3WMBA 3OIXA 2Z2BA 2FHFA 3UZXA 1H60A 4L7ZA 3TN6A 3SR7A 5DFAA 1F4AA 4GI8A 3DERA 2V68A 3W83A 4DZIA 2WZMA 4ZOBA 1VFUA 4HPJA 1TFVA 3U2EA 4B4FA 4ASTA 1UZ4A 1IWPA 4MWAB 1VHCA 3MP4A 4UFLA 3KL0A 1RLDA 1I4NA 2WNWA 4Y90A 3NIYA 3UCCA 2R9RA 4FXJA 3DG3A 3DBNA 1UMYA 1TPEA 3F4NA 2OKTA 4OVXA 1OZQA 3HURA 4I5UA 3VXGA 1AH3A 2ZE0A 1MSSA 1WUEA 3D3AA 1E5JA 4M1BA 5A6KA 1DIDA 3KL5A 4GO9A 1YTEA 3KW3A 4BY3A 1KD0A 1UKPA 3O0KA 4JL1A 4NZ3A 4ACZA 3EKZA 4CCCA 4Q32A 1H5VA 4B5UA 1YEYA 2BVDA 1S5MA 3NNTA 4FPSA 4ZODA 3FSTA 3RM9A 4AEOA 1DQXA 5CGQA 4DZHA 1PL9A 3O7UA 2V9DA 2EXOA 3PVFA 5KZ6A 4LNYA 2VD8A 2A79A 2VRQA 1E40A 3HMCA 3ISIX 2Y4SA 4L65A 2EJ1A 4B16A 4JOMA 4Z1DA 5K4XA 2QT3A 1QVBA 1HKMA 1JG9A 1RV8A 2TSYA 1CLKA 1DBTA 1JRBA 1RQHA 1M7OA 1EYWA 4GNJA 3WBWA 3BSMA 1A49A 2BFGA 5JQ9A 4I90A 1UR1A 4HK7A 3GTHA 3BO9A 3HMJG 2Y6ZA 3EEZA 4N9EA 1VYSX 4GO8A 1NH6A 1LP6A 3KRZA 3QKEA 4V27A 3MSGA 3LXBA 2FTYA 1X97A 1JZ5A 4IQJA 1GVOA 4UWMA 1RLCL 1AQHA 4GZIA 3PZUA 3OZOA 2R14A 1JAEA 1TMLA 3SDOA 2HQAA 4OV4A 2ZDSA 4MYAA 1QPQA 5G1YA 1E0UA 3QR0A 4N4PA 3THDA 2D2OA 1K7FA 2ZYFA 3TX9A 4FR1A 1U2YA 3GDLA 2NV2A 2X7VA 1F73A 2ZRYA 5HJLA 4R33A 4AIUA 3LI1A 1SUXA 3L5LA 3DOPA 3FDGA 5C9XA 4IQLA 3LZ3A 3W7NA 1IXOA 4C7FA 2ZXDA 3QFWA 1R9ZA 5FJIA 1ME7A 3TR9A 1TRDA 1Y0EA 3QHMA 3WUGA 1D3CA 2X0SA 4FLSA 2W63A 5FF2A 1PSCA 2VC5A 3DFSA 3HJEA 4F3HA 2OYLA 2QS8A 2PDGA 3G1VA 4GZJA 4HKPA 2OMAA 3VUSA 3W86A 2IQTA 3N13A 1TZ7A 1W1ZA 2ADAA 2ZX9A 2CETA 4LUJA 2BXYA 3MBFA 6XIMA 2GSHA 3LDVA 2QDDA 1PVNA 2Z27A 3W7JA 3H53A 1C7TA 3E38A 4QSFA 4XO7A 3ABXA 3NQ2A 4E3TA 4HCLA 2OQHA 1EBGA 3EWZA 3ZJ6A 2HPIA 3RILA 4F48A 3CAWA 2Y1HA 1I60A 3IANA 2CWNA 1IEQA 3L4YA 4ICNA 4CN1A 2VTFA 3DECA 4Y9PA 4LTSA 1OY0A 5HPOA 3GNDA 4YWIA 2IQ0A 3K1DA 1X39A 5G5IA 4AY8A 3QW3A 4RZ5A 3WLRA 4TVDA 2P8CA 3L7RA 1EP3A 1RD5A 3OYZA 1ESWA 1AQFA 3WFAA 3URNA 3WMSA 3OGSA 1DJZA 4JAWA 2Q6ZA 4DF2A 3TAOA 4UTKA 4LS2A 3WBAA 4UR8A 3NR0A 1JGMA 4YLWA 4ZFCA 4CNNA 3BTNA 3KZPA 4YYCA 1RH9A 1RJPA 3AIVA 3G1RA 5I7GA 2FPVA 3VGBA 3WH6A 4PMZA 4BWLC 1R38A 3SCPA 2BTMA 1Q6CA 1BVNP 1R0MA 3WFLA 1UZDA 1KGXA 2EO7A 2G8ZA 2AKMA 4JNMA 3CUHA 3W71A 2D22A 4ENLA 5GPRA 3LV5A 1BWKA 3L5AA 2EJAA 4DJFA 1OYCA 3KTSA 5AC5A 3SJ3A 3EOLA 3FVMA 1VFMA 1M3UA 4AEEA 3VMOA 5CEWA 4FLQA 4A3QA 1GQKA 2PWDA 1S38A 3OGRA 5AHIA 1AA1B 2VEGA 3GH5A 3U7VA 2J74A 2BOEX 1Q63A 4UTUA 4N9BA 4Z0SA 3DKLA 5CGTA 1J9YA 1J6OA 2ZKMX 3VGHA 1XLKA 3AXMA 1FHVA 2YJQA 4GIRA 3LLXA 1POJA 1XPYA 2GGGA 1H0IA 4QIUA 5FAGA 7CGTA 4J3ZA 3K8LA 1QNQA 4K7YA 3W2LA 3G3MA 3MUXA 3CTLA 3IVSA 3I4KA 5DXYA 3OHMB 3MMDA 4FI4A 4AZCA 4Y9OA 3CUXA 1A47A 2OEMA 5CBJA 3I4EA 3HBLA 3V18A 3AROA 2QV5A 4EXAA 2OLAA 1TIMA 1O5XA 3RYSA 1V3LA 1MZHA 4AF0A 4H41A 3KLLA 5PTDA 1O95A 2DT3A 3ITXA 2XN1A 3Q45A 1U22A 4DXXA 5BNKA 2VWSA 3CHCA 2JF7A 3W7MA 3FAXA 4AG0A 2GQ3A 4IZGA 1V7YA 2QW5A 1TTJA 3SCVA 1GOMA 4FLRA 2WO5A 2YL9A 3EA3A 1QNPA 2XM1A 4KERA 1LTDA 4NHVA 1OG0A 2A2IA 3G0XA 3P80A 3PANA 4ORMA 2R6OA 1U30A 1K8ZA 1PCWA 1RP9A 3C86A 1XIBA 3U5UA 4KIRA 1S3TC 2PLKA 2WJFA 3EDFA 1LORA 5A94A 4B5TA 4UFIA 1JPMA 3ECQA 1KTNA 2WNNA 1UC5A 3PG9A 3CYVA 3C2YA 4MB1A 4X22A 2WWDA 1E4MM 4PTXA 3G3DA 3CUJA 1R2SA 4DO5A 1I2QA 4LAUA 6REQA 3GM8A 2GQAA 3EPOA 2POZA 4NIRA 2NUXA 3UR7A 3R89A 4HNVA 3AIEA 1BD0A 1VF8A 3RF9A 1KC7A 3EDKA 3VINA 1BG9A 2C1GA 5KSWA 4AD1A 1T99A 3VX1A 3TQ0A 1VPQA 4MNJA 2DVXA 1CXIA 4U10A 4QG6A 3CMGA 2RHGA 2PLCA 4GFIA 3UG5A 1W9BM 2ZUNA 2WHKA 3SADA 3WMLA 1RP8A 5CCZA 3ARTA 4WSHA 5AYBA 3WF3A 3II1A 2BZNA 4BR1A 3FA4A 4H8NA 4KEVA 5CC6A 1J0HA 3BDKA 4JQ3A 4J2MA 4I3GA 4UC5A 2X1TA 1JZ7A 1GK8A 1A3WA 2DIKA 3UESA 3WQ4A 2ZQ0A 5HDRA 2X0YA 3VNMA 4E8CA 4G56A 1DWHM 3ITCA 3JR2A 3RX3A 2PTDA 4G7EB 3L2MA 1OX4B 3EDDA 4HGXA 3W7EA 3VGFA 1J6PA 4QDWA 4QX4A 3KVJA 4PRWA 1HUVA 3NDYA 5F4WA 4GK8A 3SCTA 5BZAA 4LV4A 1YX1A 5K3VA 4E3VA 7PTDA 4AYSA 4B5XA 3WNPA 1OK6A 1GTHA 5HNNA 3UXKA 2Y0FA 2WM0A 1TZ9A 5MF5A 3SUSA 3VU2A 4FX8A 1OFPA 3W85A 2WZEA 2J24A 2XM2A 3C4UA 4M19A 1EDGA 2FPYA 2PODA 1LOSA 4ORIA 4W8LA 1XDMA 3UJRA 3V0TA 4PMOA 3P2VA 1MWOA 1TCDA 2VENA 2WSPA 3E6EA 2E6AA 2QVHA 3L2LA 1EJRC 5LNSA 3PJTA 4ZXOA 2E3ZA 2V5LA 1VFHA 4ERGA 3EWWA 1W5NA 4C6QA 3QQWA 4IIEA 1W5PA 4Z2LA 3CHFA 1XYFA 1IWAA 1H7PA 4M0XA 2CYGA 1ZJAA 2GLKA 2DDXA 3MSRA 4X2PA 4D6HA 1PZ0A 2ZX8A 3WELA 4HNCA 1JNEA 1TPUA 3XINA 3ARVA 3BCDA 4HU3A 2A3LA 3EDJA 4HHMA 3URAA 5ABHA 2PWFA 1KBLA 4PUWA 2D0FA 4MNLA 2J47A 2CBVA 4M1RA 2RFGA 1BAGA 4U5KA 2RJGA 1XCXA 2E1DA 3UJFA 3POHA 3AMCA 1LT7A 2O92A 3KDOA 2J7FA 3K2GA 1HVXA 3GVVA 2YGYA 1LCOA 2C19A 4K36A 1DP0A 2YBVA 2E77A 5C54A 3EKGA 1SZGA 2GOKA 1BWLA 1VFFA 4XISA 4H9VA 4OV9A 4GKLA 2WHMA 3U0HA 2OT0A 1ITXA 4GIEA 4UNKA 3BJSA 5LYRA 4IGHA 4CD8A 4XD4A 1JUBA 3FY1A 1KXVA 1I1WA 3P60A 3NGJA 5BXRA 2FLIA 3CL8A 4W89A 3LD5A 3N6HA 1NDWA 2I14A 3ZJKA 3H2NA 4B5VA 5A8NA 2RUSA 1NIUA 4EANA 4F40A 1EWEA 3CNYA 2V5CA 3S9IA 1IZJA 3UA3A 2A7RA 2HK1A 1ITUA 4CNUA 2PDCA 2PEVA 3KAOA 4ILSA 1KBJA 2WXDM 3GNXA 3QMRA 3W6MA 4YXGA 3DH7A 3TW6A 3VIHA 1MDLA 1QJWA 4HMEA 4RZ4A 1JDEA 4ACYA 2QCLA 2VOMA 3E2VA 4PUEA 2QIIA 1NP2A 4FNRA 1B3YA 3ALGA 1HKWA 1GYLA 1TRIA 1Z7AA 5G4WA 1JDAA 1GHSA 4R53A 1K9TA 4MYXA 4DJEA 1XFCA 2NX1A 2ZVRA 4BZYA 4MNKA 1LF1A 1CXFA 4NZFA 4AW7A 4E5TA 2BV9A 2PS2A 3M6DA 2OWCA 3H6OA 3S83A 2XGZA 3VD7A 3GX9A 2Y8VA 3O63A 1CGVA 2XN2A 4N7QA 4LF1A 4AD3A 4S3GA 2DZVA 3D3FA 1XLAA 2C8NA 1OM0A 1XRVA 2HBVA 4P2VA 1LBLA 7ODCA 3SQMA 3A9IA 2YX0A 2D73A 4GHRA 4L1GA 2E68A 4XZMX 3G1AA 5DBUA 4DXKA 3PBYA 1E73M 4R7JA 4MAVA 1KB3A 2Y2WA 1HNYA 1W32A 3WQ6A 3ANUA 2BY2A 1IEIA 4IHCA 4QITA 3QZEA 3FJLA 4WDXA 3NQEA 3VKAA 1TTPA 4V2XA 2PTXA 1FDJA 1E43A 3EB4A 4PCFA 3EXTA 3LRKA 3FEMA 1UA7A 1BYBA 1GQLA 3ITLA 1QR7A 1SJCA 3N2OA 4JTEA 3K46A 1XI3A 3G6MA 4YCPA 4YNGA 5BXSA 1NVMA 2VVSA 1XR2A 3TH6A 4MKVA 3G1YA 2JFEX 3TYAA 3TQVA 4WKAA 3ZIZA 4B2DA 2E6FA 1KM3A 4AVFA 5A6LA 4D8LA 4R9OA 4O13A 4JBRA 1QWKA 1ZGDA 4EKJA 1XSIA 3UWQA 5KMYA 5A5WA 1BPLB 1V3HA 1HL2A 2QJHA 5JBFA 3VM7A 2D20A 5C0QA 3FW6A 3T2QA 4EE9A 3S8HA 1GONA 4GG9A 1KFEA 1NSJA 3RO6A 4NY2A 3RO8A 2PDXA 3KX6A 5AB3A 4MLRA 4GOAA 3S2LA 3QY7A 1J93A 3GQYA 3TA6A 3OP2A 3M0JA 3RFAA 5JIWA 1P5BA 3RK8A 2PZ0A 3NL5A 2EPOA 1FH8A 1GOOA 4A8RA 1JPHA 2FH8A 3GSMA 3ABOA 2FJKA 3PK7A 4M51A 3CGTA 4U33A 3I3BA 4D6GA 3M07A 1TKKA 4ZOAA 2UZ9A 2L5HA 3PZOA 2V63A 4CD4A 1X1ZA 1XLLA 3LBOA 1UYQA 4KWVA 4ZQPA 1H3GA 3UWYA 2E5CA 1M03A 1OADA 1R6WA 3AICA 4E4UA 3GVRA 2FGZA 4UMBA 4KH2A 1NDZA 4EIVA 3HG4A 2YBUA 4IGMA 3GC4A 2PC8A 3QW4B 1IR2A 3W6YA 4DWDA 2YLLA 5CBIA 3KHJA 1LBMA 2VEKA 7TIMA 3SGGA 2E4TA 2NVAA 4QDPA 1JJKA 4RCXA 2J75A 4O10A 4IL2A 4K8HA 2EPNA 4I5RA 3TYEA 3GTXA 5BOFA 3IVUA 1XYZA 3DYOA 4B3KA 2FGLA 5I78A 1MEHA 3T2OA 4EPDC 2NQ9A 1YXDA 2FJUB 3K8MA 4G6CA 2ZTJA 4DAFA 3N2XA 5JVLA 4A3RA 3PBMA 2GVLA 1HJSA 7ENLA 1VQTA 1TMHA 1V79A 4DM1A 1XM3A 3UEQA 3WQPA 1RA5A 3PWGA 2WWCA 1PZ1A 4LW7A 3FGCA 3TNBA 1B54A 4B90A 1R3TA 4RDVA 2G3FA 2F6UA 1FY6A 2R82A 3H12A 3W75A 4B92A 3IIVA 5FAJA 3WLPA 1E0TA 4Q7BA 1KRMA 4GKTA 3MANA 3TKFA 3MI3A 4Y8FA 1AK5A 2QKFA 4ZQCA 1TX2A 2CW6A 4C6BA 1KFKA 3QLLA 2G4JA 2ZXQA 4W8BA 1ZTVA 4OWGA 1TQXA 4PYSA 3GXPA 3NM3A 1P48A 1PE1A 3TSDA 3W87A 1NOFA 1XLDA 1Q2RA 3K1GA 3KBJA 5EMLA 1XIGA 4F0KA 1UKSA 4I7WA 3ME3A 3OBAA 1RCXB 2XJ7A 4H9YA 5E5CA 3VX0A 1W3IA 3K30A 1EB3A 3E02A 4MMWA 3C2EA 3D0CA 2A6NA 2C91A 3NPWA 1X7FA 1RR2A 2PDLA 2GJNA 4KRTA 3ID7A 3U2CA 1J0KA 6ENLA 4QGCA 1EJ7L 4Z2JA 2FZNA 2X2YA 4IWWA 1MYRA 3PTQA 2YDSA 2DSVA 2YL6A 2CLMA 3FNDA 3GDKA 4IFKA 2HDJA 4DLMA 3IVTA 4A4AA 1KM4A 3OA5A 4D1IA 3GE7A 3ZJ8A 2GYIA 4CGTA 1UD5A 2BGSA 4ATWA 2W92A 5A6JA 2V67A 1UP2A 4AD4A 3ES7A 4MM1A 3O6AA 3TA9A 5I09A 3VKDA 2X40A 4Q6XA 4OGZA 1QI4A 3LM3A 3B9DA 4MFDA 4AISA 4OU1A 4HK6A 4UMCA 4XKMA 4DBDA 2VURA 3XIMA 1KV5A 2WVVB 3LV6A 3QRHA 1XH0A 3I3DA 2NXGA 5LGXA 3FA3A 3VNJA 3LMYA 1X1NA 1VFSA 1RCOB 5A8QA 3MDUA 4CU8A 1KBBA 2WMIB 5BRBA 4UR7A 3UZYA 2W5FA 4M6PA 2CESA 3NOYA 4DO4A 2ZX7A 3BLOA 4HOZA 3CPGA 3S5ZA 3TFCA 5EB8A 3MBDA 4X2RA 2GUBA 3O6DA 3OYXA 1EJWC 3WLMA 4PCNA 3P62A 2QUNA 3QHOA 1RUSA 4ZQNA 3EX4A 2QCGA 2FKPA 4W7WA 4L80A 5CSSA 4PTDA 1OBAA 1XIEA 2DY3A 2G3MA 1SW3A 2PDPA 2R1LA 3SUTA 2PWVA 1EUAA 2Z1VA 1G4SA 3BCFA 5H8PA 4FF5A 1EFZA 3G8EA 2V2HA 2BGNE 4B2DD 3EWBX 4CQ9A 4YU1A 4XZHA 2JE8A 1JUEA 2DZSA 3SUWA 3R43A 1ONEA 2Q8XA 1JCLA 3OG3A 1BGAA 3AYSA 1TV3A 4R7OA 3CL7A 5BU9A 5XIAA 1VJSA 2JF6A 4AWSA 2VXNA 4EP8C 2ZFAA 1DIKA 4GYJA 1R46A 4EWJA 3EWUA 1VPYA 2B31A 3FKKA 4Z42C 2ZTKA 2IQDA 1TX0A 1E6RA 4UXDA 3A64A 3W23A 1KTBA 2ABAA 4LCQA 2HS6A 1LOQA 4XZLX 3RG6A 3ZXWA 3W4RA 2BP1A 2D24A 1PB0A 3UR2A 3PULA 3T8QA 3TZNA 1HJUA 4NZ1A 4OIFA 2GDVA 4W5UA 1TTIA 2QMJA 2H8ZA 4FLOA 2WPGA 4D6EA 2OZ3A 4HB7A 3NCOA 3UYCA 4PB3A 5XINA 3LCLA 4NZJA 5ECUA 1FFQA 3BC9A 1CT5A 1W91A 3QYQA 4TR9A 3ITOA 5JU6A 2HNHA 4AHOA 1Q5MA 3SY1A 4LXFA 3BW4A 3OGVA 3E0IA 2Y5JA 4G1KA 3TWAA 5LIYX 1QUMA 2ICSA 2Q8ZA 1XLFA 2OZTA 3E49A 2V6AA 4RNHA 3LYEA 4ZO8A 2INZA 1W5MA 3PBUA 3EX2A 5HMDA 4PMQA 3ATYA 2BXVA 3KCJA 4F0MA 1W0MA 1A5CA 5EMMA 4X0VA 3NOEA 1X8FA 1EJVC 5D05A 4ADSA 2CBIA 2DH3A 4HT3A 4B3ZA 4GJJA 1C92A 1KWGA 4DPQA 1NWTA 4Y9MA 1V6XA 3ZWSA 4JHZA 2CLLA 5E93A 1X1OA 4TTUA 1V6TA 1BSIA 1JULA 4W86A 5MHBA 4LUSB 1XCWA 4JX5A 3AJXA 2DORA 1Q45A 1QRQA 3PJXA 4HNLA 2Z2UA 3DG6A