3W88A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
b'SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-200
rcsb
total genus 105
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w88A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w88A01
3OEXA 4OV9A 4TU1A 4WY0F 3F1QA 3EKZA 2OZ0A 4XKYB 4ZQPA 4O50A 2JGYA 4O0KA 2O7QA 1K8XA 3TIMA 1DL3A 3MP4A 4UTMA 2XN0A 1H1ZA 1SO4A 4PTNA 5F2GA 2C13A 3A22A 1YDNA 2WKJA 4AH7A 3LV5A 5L9FA 3QFEA 2FPTA 4WOQA 3SR7A 4J9JA 3OVRA 1W5NA 3B03A 1KBIA 1VGAA 4ORMA 3TC7A 4MY8A 3GDRA 3GKFA 5AC6A 2JGQA 1WAUA 3V1PA 4E2DA 1GTHA 3C2RA 2ZYFA 5DBTA 2YX0A 1W5OA 1FWWA 4Q33A 1OFEA 2NX9A 4LV4A 2A4AA 4PODA 1H7WA 5DCEA 2DU2A 3T44A 4JTFA 3WK3A 5AYZA 1KTCA 3BO9A 1SW7A 2ZTKA 1KFCA 4NX0A 2YZRA 5F1UA 1OG0A 3MYPA 5CGQA 4A2SA 3R12A 3MW7A 2A6LA 4X3ZA 2NX3A 2CLFA 3LHWA 2C19A 3LCXA 3S5NA 1QNVA 3IGUA 3WJWA 4YL2A 3LCWA 1GG0A 3IEBA 4Y90A 3DHDA 3EWBX 4GWEA 2J9XA 2ATMA 1H60A 5FF2A 2P0OA 1F05A 2PE4A 4UFLA 2DZSA 1XC4A 1NEYA 3QH2A 3W86A 3PB2A 3KVMA 2A1YA 3PUOA 3TE9A 4BI6A 1ALDA 5AFDA 3N2XA 1I8JA 4IOTA 2VFEA 4UTTC 4GBUA 5F4WA 1NF0A 4OBTA 3T78A 3ABRA 2OCZA 5LSMA 1M6JA 4ICNA 1SSGA 1VCGA 3FLUA 2WSYA 3UWYA 4UC5A 1H7OA 3E12A 3KRZA 3PAJA 3S42A 5CZSA 4L4MA 3N9RA 2QJGA 5D33A 1T0OA 4N4PA 1KFJA 1WV2A 4O1BA 3NQGA 5H91A 1MEWA 2RFGA 2XFWA 5DN1A 3ZS4A 3T4CA 2BLEA 5CPOA 1TQXA 2NX1A 3G8RA 4EF8A 4JX5A 5FI8A 2F84A 1YTKA 4YCPA 3I68A 5DLCA 1H7XA 3VFLA 4GUHA 5K3VA 2ZZ2A 1Q6RA 3NQDA 2CLEA 3NA8A 1HTIA 2O7SA 2VEIA 1PHWA 1F74A 3TQKA 4BF9A 3LBCA 1D3HA 3QEZA 2RDTA 1PCWA 6ALDA 1MO0A 3KRUA 3NEVA 1TSIA 3DKLA 5EMUA 1TPH1 2R91A 2X1TA 3MHFA 1G67A 4KWWA 5D2YA 3L5AA 3GXTA 3PB0A 3LV6A 1G4SA 2HTMA 2QCDA 2V82A 3G3DA 1EP1A 3HF3A 4FNRA 4FEZA 5I3GA 4IQLA 5DY3A 3QZEA 3D0CA 1DVJA 1H50A 3TW7A 2ABAA 2ZRVA 3W7MA 1AW5A 2TMDA 3W22A 3KXQA 3S6DA 5DCBA 3L2IA 3BK0A 4OWGA 4O14A 4AEOA 3K30A 4WXZA 3O63A 1LBMA 1YYAA 3M6YA 4HSOA 5U7SA 3NO5A 1KFEA 4UMBA 3HJZA 3C52A 3O6YX 4K8HA 4N4QA 3WJYA 2DZWA 1W3TA 5EKYA 3UD6A 4X22A 1XUUA 1LLWA 1FWSA 3C8FA 1FWNA 3W74A 1F2JA 3A5FA 4QJ1A 1G6CA 2Y70A 5AB3A 1OABA 3DI0A 3RK8A 4AF0B 5LHEA 4GUGA 1FBAA 3NQ7A 3TROA 3SZ8A 2YXGA 1YLVA 3NQMA 2WNQA 2WO5A 4RK8A 4Y96A 5G1TA 2IQTA 3DFSA 5AHMA 1AG1O 1JCJA 3NM1A 3GYEA 4WY0B 2ZA1A 5KTLA 5HWNA 4AXKA 1GVRA 2WPBA 1C9DA 3LCFA 4O13A 1EIXA 1OFDA 4OHQA 1JRBA 3I65A 1K3UA 1K8ZA 4I7WA 2GQ8A 4UR8A 3BGGA 5D05A 2VFHA 2EPHA 3IIXA 4Z1AA 4IPJA 1O5XA 1TTPA 3S1UA 5E0KA 4ZQNA 1S5TA 5IBXA 3HGJA 3KX6A 3UY8A 3NQFA 4X2RA 2DJXA 4LS1A 3CWNA 1GEQA 1J4EA 3R89A 3BGJA 3S1XA 4IMCA 3CTLA 4NNBA 1NFBA 3MMTA 3LHTA 4O12A 2GOUA 1W31A 4HN4A 1TV8A 1AW1A 5AN7A 4UTWC 1FX6A 4OQVA 5DCDA 2Y6ZA 1WBHA 2RHGA 1UB3A 3QMTA 2J24A 3A9IA 3BG9A 3W7IA 1PHQA 1I2QA 1W3IA 3MYOA 4UFKA 4E0CA 4JIQA 3W1UA 5C5YA 1H51A 2NV1A 2GQ9A 1LYXA 4K8EA 1RD5A 3BW2A 4JS3A 2CZEA 2ATSA 2Q8ZA 1DHPA 4CCCA 2DZXA 2QUTA 4C1KA 4EIVA 3G24A 1A5AA 3W1QA 2Q3OA 1IGSA 4QNWA 2C0AA 1NAL1 1FXPA 4JTKA 2UV8G 3W3OA 5GVJA 1J5TA 3T40A 4XTDA 3W1LA 1EUAA 3OA3A 3BPWA 5U4NA 3MHGA 4M6PA 2CLMA 3QMSA 4KFPA 4JY8A 3W1MA 5BNKA 3Q37A 4O54A 4AB4A 3GXNA 3DFTA 4C1LA 3TU9A 3W76A 3TA6A 2G96A 2VENA 1C8VA 3IIVA 4Q4KA 3E9AA 4UNLA 2FJKA 4LVDA 2NV2A 5J5RA 4UTIA 3RLUA 3PBUA 3W1RA 2CU0A 1KTNA 4RXFA 3GR7A 4OE7A 1QPOA 2ZRZA 3UXDA 2CZFA 4EVZA 4UFHA 5K2ZA 3S1WA 3W7NA 3Q2DA 2B0MA 4JTUA 5BOOA 2CZDA 3NXFA 1PV8A 1QOQA 5FEXA 3SFKA 5DELA 4HNVA 1LOQA 1AK5A 4O0ZA 5D30A 1KM0A 4MKNA 1QPRA 4N2YA 3MO7A 4OT7A 4A3UA 1Q3NA 3ABSA 3PG9A 3LI0A 1A53A 3TQ0A 3BLEA 4QITA 3O6CA 3GZ3A 2I1OA 5HINA 3IV3A 3GNNA 1K7EA 1OK4A 4UTKA 2J27A 1PS9A 4UTJA 4HT3A 3W88A 1YDVA 3WK0A 3W7LA 1OYBA 1YDOA 2V30A 5IM51 4FXRA 3P67A 1W56A 2OMAA 4QISA 4DF2A 1ZAJA 2QCDB 3TX9A 4NJHA 3W2LA 2E6FA 2NUXA 4O18A 3TC6A 5CZJA 2NLIA 3QRHA 4MIMA 2FFCA 4JTHA 3L0NA 4UFMA 5I3KA 3N34A 3S5OA 2HMCA 3Q58A 1SSDA 5CZTA 3FJ6A 2QF7A 3NNTA 3H55A 3LLFA 3R8RA 1H7NA 1VPXA 4FNSA 3TXVA 1FY6A 1WA3A 3TH6A 3PUEA 1K02A 1DV7A 3ZFHA 3EWXA 2P10A 4Y6GA 1KV8A 2FLIA 2YYTA 4DBDA 4UTTA 1KTBA 2OT0A 3O6DA 3PULA 1TPC1 2ALDA 2GQAA 3CB8A 1R46A 4BR1A 1H1YA 1VYPX 1XDMA 1YTEA 3HG5A 4DEFA 3GDTA 3VE9A 4LRTA 1ZALA 3PSWA 5T26A 1SFJA 3B0UX 3TJXA 4ADUA 5D37A 1LBFA 4E38A 2F7FA 7TIMA 4LV9A 1LRTA 1N7KA 4JICA 4RLIA 3UZJA 3STEA 3CHVA 1T96A 3W85A 3OBKA 3PR2A 5D38A 1ME9A 1WQ5A 4AWUA 1TJPA 2CZ5A 3FIGA 3W7DA 3C2OA 4FNPA 5TIMA 3SW6A 3USBA 2VXNA 2VFIA 3FFSA 5DY2A 1XI3A 3EXSA 1B4KA 1D9EA 1F76A 5KZEA 3EWZA 1LRQA 3P7YA 4A21A 1UUMA 2R14A 1TTQA 3RF9A 4YLWA 1DQWA 3UPWA 3LRLA 1V7YA 3EX3A 4MZ1A 2X1SA 2X16A 3UWWA 3UWZA 3S1VA 4LNYA 4K7YA 3E0IA 4JTIA 1OYAA 1JR1A 2QAFA 4DPPA 4MZ8A 8TIMA 4MYXA 3LTSA 1R2TA 3HBLA 2GPTA 4HIBA 4LC6A 3LCIA 1G4TA 2E5BA 1KLYA 3FA5A 3DAQA 1XBYA 3VNDA 4O1AA 2Y61A 1P1XA 5F2IA 4GXMA 2OT1A 1JCNA 2C1HA 3WJXA 3W6YA 1OYCA 2C18A 3EX1A 5FEZA 3NZRA 3G22A 2VEMA 2Q3RA 2I9EA 1TPUA 4M6VA 3W7GA 3NQ2A 3LHYA 4RZ4A 1M7PA 2E6AA 4FXSA 3CEPA 3NZ1A 1FUYA 1TPVA 1KLZA 1G4EA 1EP3A 2B7NA 1JRCA 4PEKA 3BG3A 5K9XA 4PC8A 4U4MA 3NPUA 2J88A 1FCUA 3DKJA 1TB3A 1I2PA 4JYEA 1GWJA 5FEPA 3HPSA 1L2UA 4WOZA 2C15A 4TX9A 1QPNA 2Y85A 4KKXA 3FS2A 4ADSA 2G95A 5HJLA 3CT7A 4UTHA 3P5YA 5IBXC 4QSHA 3TSMA 4O16A 4A22A 1ME8A 3IIOA 3S0CA 5G5IA 1XKYA 4O57A 3ATYA 3JR2A 2WV8A 1X1ZA 3M41A 4QIUA 4M7TA 1YPFA 4ORIA 3W2MA 5EYWA 4MYAA 3MJYA 3GDKA 3LXAA 4DQWA 3M1ZA 5G4WA 4YWIA 3PUDA 5HUPA 1A50A 4FF7A 3OVQA 4UMAA 4ALDA 4LS0A 2FB3A 2Z6JA 3GAKA 3P82A 2WNZA 2ZRYA 3IVTA 3WFAA 5SWUA 1XBXA 3L67A 2RDUA 2VOMA 1W37A 3M5YA 1D3GA 3EXRA 2E5CA 3MBDA 3CWOX 4UNKA 4YCOA 4H4IA 4EWND 1ZY9A 3W73A 1BTMA 4JDBA 4TMCA 3GDMA 3UWVA 4CQ8A 3TJLA 5KITA 4W9TA 5KINA 4Z08A 1JUEA 3SY5A 2RDWA 2NUWA 3IGXA 5D2WA 3LHVA 5HWMA 5C55A 3U8GA 1SW0A 5H2ZA 3EX2A 3W7PA 2VEPA 3BLIA 3MWAA 3PBWA 3SECA 2QJIA 2E09A 1TREA 2E5DA 2WQPA 1W0MA 1WOBA 2YW4A 5CPNA 2FB2A 2W0UA 3NGJA 1DJQA 5E93A 4Y8FA 2FPVA 1SR9A 2E1DA 3PSVA 4PH6A 1VLWA 1FWRA 1ONRA 2YR1A 3GKAA 4MLRA 4WUIA 1MXSA 5LKYA 1YXCA 1I2RA 4S2BA 4HPXA 3DGRA 1GVQA 1TPEA 1JULA 3P5ZA 1TRDA 5LGXA 1CI1A 1IXNA 3QSTA 3LI1A 4ONVA 1TQJA 4CNOA 2QDGA 4UXDA 4GRSA 3QMRA 1CW2A 4IUOA 4LRSA 4OGZA 2Y62A 3L0GA 3WJSA 2DZTA 2PRHA 3W7JA 4GJ1A 1NSJA 1MEHA 1S5VA 3PVFA 5EL1A 4CCDA 1SW3A 4O4WA 2XN2A 1KFBA 3HIJA 2J6XA 1R2SA 4WZHA 2QCLA 3E49A 4LW7A 4MOZA 3UWUA 1F73A 1W3NA 1VJIA 3P80A 3Q94A 3A21A 4IJBA 4BI7A 1Q45A 5EPDA 2WSRA 1BKSA 2NXHA 3QPYA 5KZDA 3DFOA 4EOUA 4MJMA 1VC4A 1W5QA 4FX7A 1VCVA 1RZMA 3LGEA 5HMSA 3QW3A 4R7JA 3UQNA 3C2EA 2ZRXA 1F7BA 3THAA 2NUYA 3BLFA 1EWDA 4DXVA 2VFGA 1PIIA 2V81A 3EWUA 1LM1A 3P60A 1SUXA 3NOEA 3NYZA 3O15A 2YFOA 3W7RA 1PL9A 5CSRA 5AYXA 5LNSA 3DFQA 5CKSA 1KW1A 2NWRA 3C4UA 4LS2A 3LLDA 1WOAA 1P5BA 3S8HA 3BVJA 1TYGA 4DBEA 2ISWA 2B7OA 3O07A 4JR5A 3KVLA 3ATZA 3G1XA 1WBJA 2Y7EA 1XUZA 4AHQA 1L6YA 2EGZA 1LTDA 3UNDA 3NDOA 1PE1A 1RV8A 3LB0A 3G1SA 2A7RA 2G5WA 4UFJA 3WK1A 1H63A 4NNAA 2Y88A 3W1PA 1ZENA 3N2MA 3NL5A 4QAIA 3E02A 3TMQA 3LXBA 3UWQA 1H62A 4JTEA 3LX9A 1A5BA 1J2WA 4K36A 1RQBA 3TDFA 1O4UA 4MY1A 3W83A 5C54A 3NL6A 1AL7A 5I3IA 2X1UA 1X8FA 1B57A 4DO6A 5D09A 3L66A 3MI2A 4IGHA 4GC4A 3FEMA 3RU6A 3QPZA 3EEGA 3B06A 4ZMGA 5I3FA 1VCFA 2C14A 3HG4A 5D04C 3HG2A 1KM2A 4WJEA 5AHNA 2Q8LA 2ZZ1A 4LVBA 3GXPA 4JTGA 5HR6A 1LDCA 1R47A 2ZQ0A 1K03A 4FIRA 3W87A 3ABOA 2FTPA 3NL2A 4P2VA 3G0SA 4BI5A 3PWAA 5I3JA 1Y0EA 4K7VA 1Q6OA 3JS3A 3LTPA 2WSQA 4ZZ9A 4N9DA 1QO5A 3TAKA 1I45A 5MHBA 1JQXA 4MZYA 1ICPA 3MHUA 3TKFA 2D73A 2QAPA 2Y7DA 3MP5A 2HSAA 3HGSA 3T55A 4M19A 3P8JA 3YPIA 3MP3A 4UTUA 1MSSA 3HOJA 1KM1A 1OFQA 3FOKA 3TSBA 4FX8A 4P61A 5AOUA 3DH7A 1AW2A 3LERA 5LNUA 2JKPA 4TR9A 3O1NA 3W2JA 4ZVJA 1W5MA 1OF6A 1JVNA 3QSRA 2GJNA 1ZHAA 1TPWA 4NQ1A 2TRSA 4A29A 1FCBA 5DXXA 3MI6A 2J9ZA 1YXYA 1K8YA 3F4NA 4QNEA 1GZGA 3E96A 2NXIA 3SJ3A 3TFXA 3M47A 3N14A 3KRSA 1G4PA 1HG3A 1BWKA 5AHLA 4FHAA 3W23A 4OV4A 1JUBA 3RLVA 3STCA 1ZAIA 4XBKA 4JNMA 1I2OA 3LCGA 5C6MA 3LCLA 2YFNA 2ZDRA 5K4XA 2PRMA 4PFMA 5CG7A 1FXQA 5FF0A 3RFAA 3LM7A 3THQA 3PBYA 2YYUA 2CFFA 4RV8A 1WXJA 4NJGA 3IIPA 2ZZ6A 3CIWA 3UYCA 1W8SA 3B0PA 4O53A 3STGA 3W75A 5TBOA 1S5WA 1DOSA 3PBVA 3U6WA 5G4EA 2FPYA 1LROA 2DORA 5DBUA 4YXGA 3F03K 1B3OA 2QR6A 3HMJG 4N9CA 2BSLA 3EX6A 2G97A 2NWSA 3NPXA 1ADOA 5F2LA 2DZUA 2LLEA 2CLKA 3G1FA 4AHOA 1OX4B 5D02A 1ZJIA 4NX5A 4UR7A 4CNPA 1RQEA 1SFLA 3GAYA 2GUUA 1DJNA 3WJZA 3EWYA 3QW4B 1QO2A 3ANYA 3P61A 1T99A 2WOQA 1P0NA 3W2UA 1SU5A 1ME7A 2YPIA 3OG3A 3W7OA 1SZGA 4WY0A 2EAWA 3ZR4A 4K39A 2A5HA 4LOCA 2KZHA 4ZQCA 1HO4A 4DF0A 1FWTA 4RJEA 1R2RA 3BW3A 3HGRA 5EA9A 4JDYA 3DENA 1TTIA 4UMCA 1ZCOA 1EP2A 3HG3A 3KVJA 2FDSA 1EUNA 2P1FA 3EWWA 4TMBA 1NVMA 1OFBA 2RH9A 1GQNA 3QQ1A 1T8XA 1KM3A 1UBSA 3DFNA 2ZZ3A 1SO5A 1YXDA 2X1RA 1M7OA 1O60A 4MVAA 3TV8A 3M44A 4KFOA 4JTSA 4LVGA 3EXTA 1WYIA 1EEPA 2XN1A 3LTYA 3G0UA 1P4CA 4MJZA 3HQ1A 4O52A 1P0KA 3IVUA 3SGUA 2H90A 4WX2A 4IXHA 1EX5A 2H8XA 3TMLA 3NPWA 4JX4A 4JY9A 1YTDA 5D2VA 4S1FA 3RMJA 3G1YA 3STFA 3PS7A 3L5LA 1OX5A 1DBTA 4BK9A 2CW6A 1KM4A 2QKFA 5HULA 1TMHA 1GYLA 3CIXA 3TCEA 1WX0A 2BX7A 4RZ6A 5KZMA 2QCCA 1OFAA 2H3BA 3B04A 1TPB1 3L68A 4UTLA 3LRMA 5G2IA 3ZWTA 4ML9A 2QCGA 4UUIA 4FNQA 4POCA 4O28A 4CNNA 1KBJA 1JCMP 1QWGA 1F6PA 2CLHA 3NQEA 1H7RA 1VQTA 2NZLA 3CM4A 1LP6A 3AO0A 1DORA 1ICQA 2GVLA 3C56A 3HGOA 2OJPA 3BARA 3DU0A 3LRKA 3IIZA 1JQVA 3S5YA 5AYYA 1IXPA 2W79A 4PL2A 2ZCGA 1TV7A 3M5VA 3EX4A 3BV4A 1TIMA 1OJXA 1QOPA 3LHUA 2E77A 5D2XA 1KFKA 1ZAHA 3S9YA 1CX9A 2VKZG 4CQAA 1VHCA 2FIQA 1DKWA 2PURA 4FX6M 2J9YA 1FDYA 4WXYA 1L9WA 3NQ6A 4JTTA 3TXZA 1LBLA 1SPQA 1NF7A 3UZ5A 4AWTA 2ZBTA 4HNTA 3W7QA 5HR7A 1SZNA 3P81A 4NUWA 4JYDA 1DQXA 5DXYA 2TPSA 4I7VA 5TQLA 1VRDA 1U5JA 2A0NA 1GYNA 4N9BA 4G1KA 2ZRWA 1Q6LA 1IIHA 5E1QA 4UCGA 3MUXA 5HNRA 3IRDA 1W5PA 4X9SA 3MI3A 3GK0A 3EKLA 5EY5A 2FQIA 5FF3A 2EHHA 2YCEA 1MZHA 3PM6A 4JEQA 3OHIA 4KFNA 4NJJA 3TNOA 3IGSA 3TUUA 3LDVA 1K7XA 3ELFA 4HSNA 3W7CA 2V9DA 1OX4A 1SZEA 2A6NA 1VLIA 4DELA 1SO3A 2WNNA 1N8FA 1OK6A 2Y7FA 3H54A 2EF9A 3GX9A 4JD4A 3P62A 4Z1DA 2E6DA 1W1ZA 2I14A 2EKCA 3UXAA 1H7PA 3NAVA 4JXCA 4IMEA 4LUJA 3UPBA 3KAOA 3W70A 1TRIA 3FYPA 1QPQA 1QR7A 3W1TA 5I3HA 4M7SA 2A21A 1EWEA 3BG5A 3GR8A 3NR0A 4MUZA 2QCMA 4K37A 1JJKA 3G1DA 2W6RA 5LNWA 4L4LA 4IX0A 4O4VA 4WQ6A 2ZZ7A 3W1XA 4N9EA 3T7VA 3VI2A 4E2BA 2YDAA 1IIGA 4FNTA 1F6KA 4UTWA 1TCDA 4BFAA 4S2CA 4PA8A 2A7PA 5AHFA 4XKYA 4CLMA 1LZOA 3VE7A 1SO6A 3A5VA 3R13A 3AJXA 2CLIA 2X2GA 4RR4A 4QQ3A 1H61A 2E6YA 3JRKA 4RZ5A 1FDZA 3I6RA 1AMKA 6TIMA 3B8DA 4NVTA 3W71A 2H3DA 2ZTJA 4TIMA 1H5YA 2GVJA 5FF4A 1EA0A 5BMXA 2DP3A 1IXQA 3G1AA 4NXKA 3M5XA 3R2GA 4HHPA 4FO4A 2BWGA 2Z1BA 1OFOA 2V8ZA 4GE8A 1OVDA 1PCKA 3CU2A 5AHEA 1L6WA 1K7FA 3GVGA 1A5SA 3FKKA 4HNNA 4N6EA 5LNVA 1RQHA 4PCFA 5A8GA 3G3MA 3V75A 1S3HA 1O94A 1Z41A 1B4EA 1XFBA 3QYQA 4H3DA 4NJIA 4NNCA 4XQ6A 2QCEA 5K7JA 4EF9A 2ZA3A 1R30A 3N3MA 1UJPA 3M7WA 1XL9A 5D03A 1ICSA 4GUJA 1TJRA 3C2FA 3P8IA 1PVNA 3SGZA 2ABBA 1XCFA 4BWLC 3QJAA 1RVGA 3W7EA 4B5NA 4UIOA 2C16A 5BW6A 3NVTA 3M0ZA 4K38A 5CZ0A 1E51A 3BW4A 4CCEA 2V5LA 2VEKA 5K9DA 3G8EA 1VYSX 2JKEA 2GJLA 4BWLA 1I4NA 3HO8A 2H6RA 3FKRA 3QQ0A 4TO8A 1AL8A 1JCLA 1FCVA 4N02A 2TYSA 1LORA 4ZQOA 3NQCA 4R53A 5FEWA 1VYRA 2TSYA 4XWUA 3HPXA 2PRLA 1OHLA 2QCHA 3I7SA 3HPZA 2GVGA 4XBSA 4MLJA 2V5BA 4DF1A 3TAOA 3L9CA 4I9AA 1VHNA 2NXGA 4MY9A 3C3NA 4LWWA 5F2MA 3W7KA 4ZQMA 3LOTA 1X7FA 3OIXA 2E68A 4N6FA 1UASA 3PF3A 4NJKA 5L6UA 1F5ZA 3DBPA 3OVPA 1UCWA 5F4SA 1TV5A 2BXVA 2C3ZA 4LUIA 1GG1A 1G7VA 1HL2A 1GT8A 5AC7A 1G7UA 3KOFA 1VZWA 5KMYA 3P74A 3GDLA 3GIYA 4ADTA 3W1NA 3C6CA 3RNDA 1XBVA 2R8WA 4RKAA 3P84A 3C0JA 1EPXA 4O11A 3U2OA 1FCQA 4JN6A 2QCFA 4Y9AA 2YGYA 3L65A 3W07A 1IXOA 2ZRUA 1KV5A 3VCRA 5A5WA 3UY7A 3ABQA 2X30A 3G0XA 3W84A 2V2CA 3CEUA 5FESA 3LCHA 1TTJA 2CWNA 4MFEA 3S5ZA 3ZWSA 3TK7A 4XZ9A 4AHPA 4Z1BA 4M5PA 1TPDA 3M16A 1UUOA 4O15A 4O17A 5J5DA 4JIPA 1VS1A 4IPIA 1HUVA 3NQAA 2YSWA 4AAJA 1W54A 2DZVA 4XTIA 3TQVA 2V0TA 4R34A 4JYFA 4OU1A 1Z42A 4Q32A 3KVKA 3TSDA 1Q6QA 1VH7A 1GJPA 2B7QA 3W1AA 4KWVA 2VC6A 5LNRA 1OX6A 3TR2A 3B05A 3H53A 1M5WA 4AF0A 1BEUA 5F1VA 1HFBA 3R5EA 4LVFA 4IXXA 3NQVA 3GNDA 5HUOA 1JCXA 3N19B 2A2IA 5F4XA 2JBMA 3O06A 1XBZA 3I7QA 1X6UA 3DZ1A 1ZFJA 4NZJA 1KM6A 1SQ7A 3NQ8A 3QF0A 3DXIA 2PC4A 3N73A 3SSJA 4MFDA 4O8RA 3PG8A 4IMDA 1JCYA 1JUKA 2DZPA 3QM3A 5CPMA 5D32A 1QAPA 3W2KA 2ZZ5A 2RKXA 2OX1A 5K9CA 2ZFAA 1LCOA 2AGKA 2B7PA 3CQ0A 1LOSA 4FIQA 4IMGA 1B9BA 1FDJA 2Y89A 4K6AA 3IVSA 3CLMA 2Z0IA 2QUVA 4LTSA 4O10A 2AQWA 1KM5A 2BZNA 3KFTA 1ML1A 4AWSA 2QDHA 4DPQA 1O95A 1VR6A 3O05A 4IWWA 3HB9A 1G69A 4Z0SA 3G18A 3CC1A 3TW6A 2JKAA 4ZL1A 1QMLA 3F4WA 4FNUA 4ZQRA 3PC0A 4HKPA 3FJLA 1THFD 1TPFA 2CLLA 4IX2A 5KSWA 3PY2A 5FF7A 3L21A 3L5MA 3W72A 5BMWA 1X1OA 2AAMA 4GUIA 3M9YA 5D2TA 4HNUA 1HO1A 3M5ZA 2YW3A 2PCQA 5AHIA 1QCWA 4H6KA 4NZFA 4AMAA 2ZA2A 3GB6A 2V2DA 4O1DA 2HS8A 3B0VC 2HS6A 4RX0A 1OF8A 3INPA 1GVOA 4LY8A 1MEIA 2VFFA 5G1YA 1WDWA 1GVFA 3TFCA 2VELA 2QEZA 1I2NA 1N55A 3GLCA 2ISSA 4GNJA 2QJHA 3CPRA 3EB2A 2A7NA 3NL3A 3NM3A 1EB3A 1BWLA 3M43A 2QCNA 4O1CA 4Z1CA 1KFLA 5G2HA 2Y7GA 5LHFA 4XUGA 1TO3A 5AC8A 5CPLA 4DO4A 1ZNNA 1L6SA 3QC3A 3W9ZA 2V2HA 2ZZ4A 3DFPA 2R94A 1KA9F 4HPJA 4JX6A 2QUUA 3G1VA 4Z0JA 3C61A 3A24A 1YPIA 2B4GA 1U83A 3DHFA 1IF2A 4CQ9A 5C2XA 3A23A 3N9SA 3DI1A 2Y63A 3NG3A 4LVAA 4A2RA 4M6QA 4MPQA 5LZLA 4LU0A 3SIZA 5ABTA 1O5KA 3O8AA 4DO5A 1XDLA 3LHZA 4NT0A 1QDSA 1XM3A 3LBMA 2H8ZA 4RXGA 4JTLA 4NU7A 4JGDA 2Z6IA 4GUFA 4QM1A 3O16A 1OFPA 4R33A 2ISVA 3W7HA 1GPWA 3C2VA 4NXSA 3LXCA 3WK2A 1LRNA 2C6QA 4JTJA 1A5CA 3L0KA 4UFIA 1V5XA 2CLOA 1SZFA 1GTEA 1LOLA 1Z44A 3SI9A 2BTMA 1FQ0A 3B4UA 5HWJA 4WD0A 1QFEA 2WJZA 4LC8A 1GVSA 4YMZA 4I7UA 5BRBA 2JK2A 4U28A 1LLZA 3W2NA 3I7RA 4O19A 5HQEA 3MBFA 3NPVA 4PL1A 4D2JA 1GOXA 5CSSA 2A85A 3FYOA 4AVFA 3G1HA 2DJLA 5K4ZA 1XXXA 1C29A 1RPXA 1YADA 5EBUA 2VFDA 1Z48A 3KHJA 2Z2UA 4RCXA 1OFRA 5LGZA 4FB7A 4IMFA 4GFSA 4LT9A 3VKJA 1RR2A 5G2WA
chains in the Genus database with same CATH superfamily
3AIVA 4OV9A 4WY0F 2W66A 2Y8VA 4LAMA 2OZ0A 3WBYA 1RH9A 1SFTA 1YDYA 1FFQA 3AUOA 3S6OA 4G9PA 3TIMA 3WLKX 1DL3A 1EJVC 3SUVA 3WUFA 4Y8EA 2XN0A 1H1ZA 5AYBA 4OUIA 3GNXA 3QFEA 1QI5A 4WOQA 2CHNA 1W5NA 3NCOA 1VGAA 3TC7A 4F79A 3GDRA 1BLIA 1E15A 1MVYA 3TP4A 2XZ7A 3EOSA 1GTHA 4GIRA 1KRCC 1TA3B 4Q33A 2HVNA 1OFEA 4LV4A 3CGTA 1HVQA 1UH2A 1NOUA 3ES8A 4U2ZA 1KTCA 4O8AA 2GJRA 2XU2A 3BO9A 3KBVA 1SW7A 2ZTKA 4NX0A 2PP3A 2YZRA 4RW5A 3SN1A 2CHRA 4A2SA 4JQ3A 3QTGA 3MW7A 2G41A 2OODA 4BA0A 4V2XA 5M2FX 2PDGA 3LHWA 2BS9A 1A4MA 1QNVA 3BOFA 3WJWA 3RM8A 4MWAE 4B5VA 1I0BA 1KXQA 3IEBA 4Y90A 3EWBX 5JU6A 2YOCA 3N9KA 1H60A 5FF2A 2P0OA 4NG3A 3T2QA 1ZU8A 3B8TA 4HA4A 2J8GA 3OW1A 4NASA 3TN3A 4PTXA 1MUMA 4BI6A 4LANA 5F4WA 4UTTC 1PTDA 4PRWA 2ZX7A 1NF0A 4ZFCA 3ABRA 5HA7A 1M6JA 1ZQ5A 1VCGA 3AXHA 5LYRA 2CXEA 3VNMA 4C6NA 1B0IA 2AKMA 2G3NA 4O1BA 3NQGA 1MEWA 6PTDA 4AG0A 3EMZA 1M3UA 5H6HA 4YCPA 4XB3A 4C6KA 3VFLA 4GUHA 1A5LC 3VGEA 3GR4A 2QT3A 1UUQA 1OGBA 4M56A 4DZHA 2ADAA 2VEIA 1U33A 1RA5A 2F9RA 3QV9A 2OZ8A 4LAKA 3QEZA 4HU8A 3BZJA 3QV6A 1MRAA 1PCWA 3R8GA 1MO0A 3NEVA 1K4GA 4W4QA 2DUXA 2X1TA 1AVAA 3MHFA 4KWWA 3W26A 1M53A 1MW1A 2HTMA 3VD3A 1G1YA 1LQAA 1E72M 4FNRA 1UR1A 4IQLA 3FAXA 3D0CA 2OWWA 3W7MA 4HJWA 2EKGA 1QATA 3LS9A 4JEJA 1HGYA 2Z7KA 2YKKA 3N18A 3PJTA 4FAMA 2ZICA 4L4OA 3K30A 4WXZA 3GFYA 4H2HA 1LBMA 1M04A 3TA9A 4DJDA 4HSOA 3A64A 3C52A 3O6YX 4K8HA 4OJYA 2DZWA 4QXIA 3WNMA 4B3KA 3F5KA 2C71A 1ZBCA 3C8FA 4QJ1A 4XKMA 3QV7A 2P0IA 2Y70A 4CEUC 1OC7A 5AB3A 1S2AA 3SRFA 1SVDA 3DI0A 2BOGX 3RK8A 1VPYA 2QV5A 3WQCA 4H9MA 1L6GA 3BAWA 3SZ8A 2YXGA 1YLVA 3KZPA 3NQMA 2WNQA 2WO5A 2A3EA 4Y96A 3WIJA 1Z32X 2CC0A 1XYMA 3DFSA 5AHMA 5EMJA 5CPTA 2BY0A 5HWNA 3LNMA 1XYFA 3GG8A 3UETA 2WPBA 1OEPA 1K3UA 2PDHA 2GQ8A 2PLKA 3REQB 3H6OA 3WZ0E 2PUZA 1IR1A 4L6OA 4R7WA 1D7FA 2OYKA 1S2CA 1S5TA 5I23A 1MRQA 2BY1A 2E0PA 5A6BA 5A69A 2DH3A 1J4EA 1FWGC 5JH1A 3LHTA 1SJBA 3J7HA 4GPNA 2ZXBA 1AW1A 3R0KA 4UTWC 5IOBA 4OQVA 5DCDA 2RHGA 1VB9A 1UB3A 1HJUA 4I5UA 4WKHA 1I60A 4NIRA 4GVGA 1Z3NA 3GVRA 2DQWA 4JIQA 5C5YA 4RE0A 1JYXA 3OLIA 2FZBA 2QPXA 4NRRA 2QUTA 4EIVA 3W1QA 2WPGA 3AROA 4QNWA 2DIJA 3NIYA 3CB3A 5I5RA 3DESA 4C1NB 3BPWA 4B9YA 1V0KA 1QK2A 3L4YA 1JGMA 2J7DA 2ZXAA 2MANA 3TA6A 1MI3A 2Z25A 1BVWA 3E9AA 1UPPA 3ABXA 4UNLA 1GGOA 1US2A 4G5DA 5I03A 3WNOA 2CU0A 2F8QA 2QDEA 1U30A 3GR7A 5H8PA 1OG6A 3EPNA 4EPBC 2CZFA 2FGBA 4UFHA 3W6MA 1SFSA 3W7NA 3ICJA 2B0MA 4S23A 1KRMA 2XIQA 2BHZA 4LEFA 1QOQA 5FEXA 4DJFA 5DELA 1K4HA 1AK5A 4QS5A 4GISA 4GH1A 3AQUA 4A3UA 1Q3NA 3RR1A 3ZSTA 3PG9A 3EPMA 3LI0A 3TQ0A 4QITA 3B9NA 1VF8A 3GZ3A 3IV3A 4UTKA 2YBTA 3W88A 4E2OA 1M9HA 2DZBA 4B90A 2OKTA 2OMAA 1VIWA 3W2LA 4O18A 1ONXA 2NLIA 4UFMA 1XYCA 5EFDA 3NO3A 4WSHA 3A9BA 1PZ2A 1JYWA 3OOQA 3W6LA 4P8VA 3TXVA 1FY6A 2E67A 4B5UA 1WA3A 1CECA 1XLDA 2BG5A 5CGTA 3S5SA 4IGNA 1X8CA 1KV8A 2FLIA 1BSLA 4UTTA 3O6DA 2FDMA 2PCEA 3SIMA 4DVOA 4BR1A 3BJSA 1F3WA 1J96A 1VYPX 3MV11 2I17A 4M1BA 3CZKA 1SFJA 1BYDA 3B0UX 3TJXA 4ADUA 4PMYA 1ELSA 4E38A 5A1AA 3NJ3A 3UZJA 4DAFA 5E6YA 3CHVA 2OXNA 1CENA 4B15A 1XINA 1UD4A 1GVYA 2GDVA 1CLVA 3SW6A 4DWSA 4HMDA 3VKDA 1XI3A 1F76A 1W1PA 4A21A 1UUMA 5D9OA 4YLWA 4ZSTA 1DQWA 2POTA 5CLTA 4GLEA 3EX3A 3AXIA 1KR1A 3V5OA 4J3WA 3E0IA 3LEPA 3T0DA 4DPPA 5AKQA 3HPAA 4MZ8A 4QS6A 3VGGA 5LIYX 2DGAA 4S38A 5LIKX 1EO7A 3S2NA 1E40A 4BQ5A 3N12A 3I6TA 3DAQA 3VNDA 2NVCA 4GVIA 3E2RA 5BRPA 1Z7AA 4DNMA 5F2IA 1BFNA 4TX6A 4UZSA 1JCNA 5EMYA 2VEMA 4M6VA 3ARTA 3GRIA 1ITCA 1IGWA 1S5MA 4J1OA 1XX1A 1MYRA 1G4EA 5FJOA 4F2BA 3GG7A 1ECEA 1MNSA 7REQA 2QPUA 3BG3A 2BGNE 3F2CA 4ZB2A 1QHOA 4WK9A 3TYDA 4AQLA 1I2PA 4JYEA 5FEPA 1V02E 3FXYA 3WH5A 5I0DA 2WZTA 3SRHA 1QPNA 4UB9A 1PO9A 4W8BA 4JFSA 3O7UA 3OZPA 3TSMA 4O16A 3T42A 1UZDA 4R9OA 1JCTA 4RE2A 1V6XA 1G9HA 1TX0A 5G4WA 1RALA 2IXUA 3PPGA 1MW3A 2E40A 4FF7A 3OIHA 3AIBA 4LS0A 2FB3A 3R6IA 1S2VA 4H9VA 2WNZA 4L5ZA 3WFAA 3MKKA 3OGSA 3M5YA 4NI8A 3GH4A 4JN7A 4QLJA 4AVOA 3BICA 1JXKA 1O1HA 3SRDA 4YCOA 2H9AB 3CMFA 4TMCA 4NAFA 2Y4SA 4Q8MA 4CQ8A 3TJLA 3KCOA 3GY1A 1UD6A 3O0KA 1HKVA 2OZ3A 4MWAC 1R3YA 1JUEA 2RDWA 3CTTA 1NQ6A 4QHRA 2BVWA 5I3DA 4AZIA 1OQFA 3FY1A 3BJFA 3ARUA 2VEPA 1PX3A 4DWSD 4QGCA 4XSMA 1YNYA 1DWAM 3BMXA 3MWAA 2Q71A 5DMMA 4DYKA 2QZRA 5CGMA 2WQPA 4KBXA 3GVVA 2YW4A 5CPNA 3GBEA 3MKCA 1SR9A 3H2OA 2VZTA 4PBGA 3H70A 1XF0A 5I00A 1FWRA 4MLRA 2YR1A 4IP5A 2D20A 3UG4A 5LKYA 3HA1A 2WYSA 3DGRA 3EA1A 3CV2A 4ZTYA 4QG9A 3VOFA 1TQJA 1R9YA 2DT1A 3K4AA 4UXDA 4GRSA 2ZC1A 1FWBC 3BC9A 5T91A 2D3LA 4NZ4A 3UG5A 3W7JA 3RJXA 4AY7A 4ZXOA 2XGIA 2PDCA 1S5VA 4AD4A 5EL1A 2NQJA 2XIBA 4DNHA 4DX3A 1E9IA 1XS2A 2YL8A 4QRNA 2J6XA 1R2SA 2J7CA 2QYGA 4EP8C 1OM0A 4LW7A 4Q4PA 1F73A 5E0CA 1VJIA 1XQLA 1BTCA 1OCJA 2EG6A 2W3ZA 1Q45A 5JVLA 2GK1B 4ZOBA 1G0CA 5KZDA 1PDYA 4UQCA 4LB3A 4MJMA 4PMRA 1W5QA 4CUCA 3T4WA 3L4VA 1TJ1A 4R7JA 3UQNA 3PTKA 3C2EA 1NM9A 3THAA 2NUYA 2WWDA 1R38A 1PIIA 1GYMA 3P2VA 3PPFA 1LM1A 5CSRA 1SUXA 3W7RA 1JPKA 3K2GA 5CKSA 2IPGA 3WD4A 2ZUNA 3C4UA 3S8HA 4ZB5A 1AQFA 4RDVA 4DBEA 3O07A 3K1GA 3R11A 3KWXA 3G1XA 1WBJA 2DT3A 3TTYA 4AHQA 1L6YA 2XVGA 1CDGA 2EEXA 3BJTA 3RX2A 3G1SA 2INEA 1ZENA 3OLEA 1CXFA 2DSWA 3VNKA 3A47A 3MO4A 2VDHA 1AQHA 3LX9A 4US5D 4K36A 5TD4A 1YE4A 4WDUA 4HSHA 3W83A 5C54A 4QBXA 5I3IA 2PWGA 2X1UA 1B57A 1PZ1A 1HKKA 1QRQA 5D09A 4GCAA 2ZUTA 4LY4A 1A47A 3W0KA 1UZHA 2WHMA 2IPJA 1M01A 3RU6A 3QPZA 2YIHA 1VCFA 3G6MA 2C14A 3HG2A 1K9FA 2Q8LA 2ZUWA 1LDCA 2ZQ0A 3KL5A 4ASTA 2FTPA 3NL2A 3TQPA 1XIBA 3G0SA 1XLEA 5I3JA 4KWUA 2PTWA 4RZBA 1E6NA 5DO8A 4ML4A 1EJUC 3TAKA 2FZDA 1I45A 4CN1A 5TF0A 1XLHA 2W92A 4Z2HA 3MHUA 4WEVX 2F61A 2Y8KA 2QAPA 3AMDA 3L4WA 3TKFA 1WNOA 1UZ1A 4W8AA 2OU4A 3MUAA 4LF1A 2HPIA 3P8JA 3MMUA 1GOOA 2P8BA 1MSSA 1NP0A 2VGBA 3ANVA 1HJVA 3DH7A 1OGGA 4RNIA 2O4QA 5BXTA 4GYPC 3RILA 4AIEA 3QPEA 5FL1A 1W5MA 1F4HA 3DN5A 2X7VA 3FCPA 2AOSA 3PZTA 2VWTA 2WVTA 1QW8A 4DY1A 3F4NA 4QNEA 4BJHA 2DEPA 2NXIA 4YHEA 3SJ3A 2PGEA 3N14A 1I75A 3T2OA 3VIIA 2X8RA 1JUBA 4H19A 4DB7A 4EE9A 3STCA 4QE1A 2V5JA 2J66A 2Y1HA 4HVXA 4QE4A 1BGAA 4L56A 1FXQA 4AEEA 1ESWA 1D2KA 5HPCA 2G3MA 1WXJA 4NJGA 4H2CA 5EFFA 3ARXA 4A3QA 4ERIA 2GGGA 4IGMA 3B0PA 3LU2A 1BXNA 3W75A 4QEHA 5TBOA 3BLOA 3MVTA 3PBVA 2GGIA 3U6WA 1NQKA 2ZIDA 3EMCA 3R58A 1LROA 2OEKA 5DBUA 5BU6A 5LIXX 2G3IA 4YVXA 3VU2A 1JD9A 2WXDM 4QSFA 5F2LA 2LLEA 5F7UA 1ZBKA 4D6GA 4NX5A 1S1RA 4KPLA 2HWGA 3WF1A 3EWYA 4D71A 3RRXA 3WBAA 1B31A 2WOQA 3UU0A 5A6BD 3VNZA 2YPIA 4V33A 3W7OA 4LYRA 3BSHA 4AZ7A 3WNKA 2A5HA 1PYMA 3RDKA 3BW3A 1XLBA 1U1UA 3ARVA 5E0FA 1JPIA 1TTIA 4E3VA 2VGIA 3AHTA 3HG3A 3ITTA 2FDSA 1JFHA 5MKGB 3ITLA 3VNLA 1T8XA 1UR9A 1UBSA 5T9CE 1NDVA 2FZMA 4PRTA 3KBJA 3WQGA 2ZZ3A 2X1RA 2F6UA 3QR3A 5BXRA 3TV8A 1CGWA 3H4XA 4H9ZA 1X96A 3EXTA 4TVUA 2XN1A 4IIHA 3IJDA 1P0KA 1UWTA 4QDPA 3SGUA 4WX2A 3VDBA 3ANUA 1QBAA 4HYVA 2V5CA 3LGDA 3TYAA 3MMWA 4JX4A 3BCFA 4IQEA 2ON3A 1FP8A 3G1YA 1HF6A 3OB8A 3AIQA 5REQB 2CITA 3L5LA 3QOMA 3UWEA 3SUWA 1UKPA 2CETA 7XIMA 1Q8AA 1XH0A 4RE3A 2D23A 4L9YA 5FJPA 5KZMA 2QCCA 1OFAA 2O92A 3QGVA 4DZIA 3CAKA 3KDOA 4PUKA 3AYRA 3W4RA 4FNQA 3MANA 2E9BA 1QWGA 3NQEA 3SQSA 3CM4A 1JPMA 1VAHA 1S5NA 1V7AA 3LRKA 1OC6A 1T5AA 2YXOA 1UQYA 4JCMA 1EC7A 2W79A 4IG2B 3VKCA 3M5VA 3EX4A 1M7JA 2E77A 4DRSA 1V6TA 5D2XA 3RRAA 3MDWA 4D6FA 4C5YA 1IV8A 2GDUA 2JQXA 1YE6A 2PURA 4QROA 4FX6M 3NQ6A 1LBLA 1SPQA 4XV0A 3WMSA 3VIOA 2BY2A 3ZLFA 5HR7A 4WGHA 1P6WA 2OQLA 3AHXA 1XSKA 3P81A 1TKKA 4NUWA 5DXYA 4ZEPA 5TQLA 3PFMA 1IIHA 2IMRA 4A8NA 3IRDA 5CAHA 2DVUA 4X9SA 3GK0A 5EY5A 5T8GA 4N7QA 3FSUA 2EHHA 5CPQA 3PM6A 4KFNA 4J40A 4NJJA 3IGSA 3W7CA 3DCPA 1DIKA 2V9DA 1J93A 1OX4A 2A6NA 4DELA 1N8FA 1OK6A 2Y7FA 3AS2A 1TELA 4QG8A 4Z1DA 1WDRA 1W1ZA 1ZTVA 1UQZA 2ZUSA 1H7PA 1Q7MA 3VDAA 4ZSUA 3NAVA 3LA4A 3E2QA 3W70A 3UGRA 1TRIA 3GTFA 3ONBA 4M7SA 1Q4NX 4MNKA 3OTRA 2QCMA 3GXMA 2W6RA 4MJ4A 2GVEA 3RMEA 4IX0A 1ZZMA 2VRQA 1PKNA 4WQ6A 3AUJA 3T7VA 3VI2A 4E2BA 3IJIA 3BAXA 1IIGA 1UR0A 4FNTA 3A4AA 4DWSB 1TCDA 1GJWA 1WKFA 4AC7C 4H01A 1GW9A 2X0YA 3VE7A 1SO6A 1JDFA 4WF7A 3AJXA 1GZJA 2X2GA 1J01A 2E6YA 4NSBA 3MPGA 5DMNA 3JVAA 4XZBA 2H3DA 1HKJA 1H5YA 2J7GA 2QUNA 3G1AA 3M5XA 3LZ3A 4HHPA 1K77A 2BWGA 4QR6A 2Z1BA 1OFOA 2Q09A 3MSYA 1S39A 3CU2A 2FGZA 3FDKA 2HROA 3U57A 1E4IA 1M1BA 3V75A 3V35A 3ZJKA 1O94A 4KRUA 5K7JA 1UJPA 1XL9A 4IIDA 1E1CA 4B16A 3P8IA 4CNTA 2ABBA 3TN5A 3QJAA 1RVGA 3VKBA 1CBGA 3G5EA 4B5NA 4Q4OA 2WBKA 4XD3A 1E56A 3NVTA 5CZ0A 2V5LA 2VEKA 5K9DA 2JKEA 4J2PA 3S6TA 3S2LA 3VD7A 3K1DA 5CBBA 1GNXA 2OO6A 3ARRA 1AL8A 5BCAA 3T8LA 3QYSA 4YJ5A 1IT0A 5HJXA 1W2VA 2TSYA 2FFIA 4XWUA 3U2CA 1OHLA 1UA7A 4PTVA 1XKJA 2YB4A 1BKHA 2GVGA 4XBSA 4PGLA 4PCTA 5HDRA 1PYFA 4F9DA 4LWWA 3VOJA 1UASA 3PF3A 1ZS2A 3NFUA 5L6UA 3MMDA 1TV5A 1EJRC 2C3ZA 2NQ5A 3C0LA 2ODOA 3OA5A 4V1YA 4YN5A 3P74A 3W1NA 5GJNA 3VNIA 3RNDA 1R9ZA 1XBVA 2R8WA 3TZNA 3C0JA 4PUMA 3U2OA 2QCFA 4I6KA 3WDQA 3W07A 4QAWA 5A5WA 4PCPA 3GNOA 1OSEA 4OTKA 2WMGA 3M64A 3W84A 3CEUA 3MY9A 3LCHA 1TTJA 2JIWA 4PUEA 3FEQA 3UEQA 3WQ6A 4DYEA 4QJ4B 4FOUA 3LLXA 3TK7A 4Z1BA 1V93A 1UUOA 4O15A 5J5DA 1IZJA 1P0EA 2BFGA 4PMUA 1MXGA 3TQVA 2V0TA 4R34A 4KRTA 4Q32A 4AU0A 2YCKX 3TSDA 1Q6QA 2XFRA 4KWVA 1OX6A 4RL3A 3SEPA 5F1VA 1PUDA 3L4UA 3N4FA 3R5EA 3UG8A 3AC0A 4A8LA 3SQMA 3GNDA 4FR6A 1TCMA 4XD4A 2ISFA 3I7QA 1ZFJA 1KM6A 1SQ7A 3W01A 3SSJA 1V0NA 3MDUA 4G8TA 3S2JA 4AZBA 3VO0A 4ILSA 3BGAA 1NP2A 1LCOA 3R94A 1LOSA 1B9BA 3CHEA 1PDZA 4AZ5A 2G4JA 4LTSA 4B4HA 1GK8A 4XD6A 1N82A 3NSMA 2QDHA 3PFRA 1W9UA 4DPQA 1KC7A 1ZPTA 1VR6A 3SGGA 1U2YA 1G69A 3G18A 3CUZA 1TUXA 3TW6A 3FJ4A 5GNYA 4ZQRA 3PC0A 1XRFA 3I6EA 1THFD 1TPFA 3ZYZA 4HOWA 4E4UA 1RPKA 3T2PA 1VFUA 1MUWA 1VEMA 3OLDA 2GSHA 2WZIA 2WM1A 1NFPA 5I79A 2PCQA 4X61A 5BYWA 1K6WA 4C7DA 5AHIA 1MFUA 4R27A 3WQ4A 5DEZA 3K8KA 4HHMA 1CGUA 1XRVA 5GPRA 4US5A 1GVOA 1E0TA 1GVFA 2QEZA 2QJMA 1WZLA 4GNJA 4O1EA 3F4CA 2A7NA 3NM3A 4AYGA 4O1CA 2QCNA 2DDXA 4Z1CA 1KFLA 5G2HA 3NXLA 4GC3A 5LHFA 5AC8A 4IPPA 3CZJA 4CQBA 1VPQA 2OLAA 2V2HA 1BQGA 4JX6A 4GIYA 4Z0JA 3A24A 2B4GA 1V6UA 2ASHA 2W5FA 4LVAA 4MPQA 3GQYA 5ABTA 1O66A 5CSUA 4A8IA 3LBMA 1RJPA 2WVUA 1H09A 2Z6IA 4A6GA 1BSIA 4Q8NA 4HD5A 1GPWA 3VMOA 1L8NA 3QHOA 2CESA 1ECQA 2C6QA 1W6TA 4L64A 1V5XA 3PZMA 1BRLB 2D3NA 3DYMA 1LOLA 1XYZA 2VEGA 3A3HA 1UP3A 3SI9A 1JF5A 1FQ0A 3CK5A 3R79A 2WJZA 1DE5A 4QQUA 1A0DA 4LC8A 1GVSA 4YMZA 1FRBA 5GNXA 4O19A 4H9XA 4F48A 1TR9A 1KCLA 3V36A 5IDIA 3FX4A 3WO8A 1A0EA 1DE6A 1DXFA 4XZIA 1YADA 4QJ5B 4ZBCA 2PWVA 4Y9OA 3QKZA 5BOFA 1GW1A 4RCXA 3OVGA 4J35A 4XX6A 2BY3A 4TVCA 4TU1A 1TVPA 3F1QA 3VD4A 4ZQPA 4O50A 4JTQA 3C0SA 1K8XA 3L4XA 4GJJA 1FH9A 1SO4A 3U2EA 3GM8A 1MNZA 1UROA 2F6KA 3SR7A 4J9JA 1DHKA 4OFCA 1KBIA 4MHBA 4ORMA 4LYKA 2PDIA 3THUA 2EO7A 1WAUA 3V1PA 2NQHA 4OVXA 2W63A 3EA3A 3WDRA 4KF1A 4GY1A 4PODA 1H7WA 2DU2A 1KWGA 3GTNA 3AS0A 2FZNA 4G6CA 2EXOA 4QG6A 4X0NA 1KFCA 1NWSA 5F1UA 2VC9A 1P43A 1D8WA 5CEWA 1YBQB 4GY0A 5HMEA 4BZYA 4D6JA 2C19A 3S5NA 3PZNA 5KETA 3IGUA 1UKSA 4YL2A 1OY0A 2FGLA 5M5DA 4GWEA 2PTXA 3OGVA 2J7HA 4W7UA 4KS0A 1KQZA 1F05A 4UFLA 3II1A 4W86A 2DZSA 4FALA 5IFTA 3H2EA 4G7FA 3W86A 1ZB5A 2A1YA 2WHLA 1UH3A 9XIMA 3WLHA 1ALDA 3N2XA 1I8JA 3CZEA 4LBUA 4BKNA 5LSMA 1SSGA 4GYKA 3E12A 3CT2A 3PAJA 2QS8A 3H21A 4L4MA 1SYTA 2QJGA 3T0CA 4GNVA 1FKWA 3TVAA 4CQCA 2VR4A 5H91A 5A8PA 5M3WA 5IFPA 2OSXA 2O4MA 2RFGA 3SJNA 3ZS4A 3T4CA 2BLEA 1K9TA 3ABZA 5FI8A 3RGTA 2W61A 4CN4A 5DLCA 1H7XA 4JNZA 4G56A 3CUFA 5K3VA 4GQQA 3U48A 1Q6RA 2CLEA 2WSPA 1AQ0A 1HTIA 4MSSA 4NAEA 4FLSA 3SCVA 4B9ZA 1ADSA 1S1PA 1D3HA 2UBPC 3LBCA 4QFUA 2RDTA 3VOGA 1A5MC 3TOYA 6ALDA 1NDZA 3KRUA 1TPH1 2R91A 4C6EA 1OINA 1G4SA 1LL4A 4X0VA 2QCDA 2V82A 1XSJA 1EP1A 4F0SA 3ME3A 2QIWA 4HK7A 2FYMA 2OR2A 4FEZA 1NELA 1OCNA 4PULA 3APTA 4D6IA 2TMDA 4KEUA 3CPUA 3ENLA 3V0TA 1MXDA 2HCVA 3MSGA 1D8CA 3L2IA 4IIFA 1BYCA 2BXYA 3BK0A 4K1WA 1PKLA 3B9DA 4OWGA 3TWBA 3M6YA 4DIAA 3NO5A 1KFEA 2ZE3A 1X1NA 4N4QA 1EC8A 2C1IA 2J7FA 3CQHA 3UD6A 4J2MA 1P0BA 4W8LA 2WVSA 1LLWA 3R7MA 1WZAA 1FWSA 1L0PA 4RDYA 1HP5A 3W74A 1FWNA 1RY8A 3DG3A 4JFUA 3KOZA 4WRHA 1TZZA 2W62A 3E38A 1JDDA 1TZ9A 3GIQA 3DG6A 5LHEA 1FBAA 4BQ2A 4DXXA 3TROA 3L4TA 1G94A 1ZBWA 4DN1A 2BBFA 1RVKA 4IFOA 4KQNA 4IFKB 2PWDA 5DMYA 1JYNA 4QJ3B 3NM1A 1HL8A 1TV2A 4GXPA 4WY0B 3NDZA 1E3XA 3QTPA 3NTYA 3RX3A 3U7VA 3E74A 2Z4GA 2Q8XA 2E1WA 1JRBA 3I65A 5BZAA 4I7WA 4E4FA 1R6WA 2KAUC 3CL6A 4IPJA 4PMDA 2IXVA 1TTPA 2AGTA 2PDMA 1QJWA 3CUGA 4NRSA 4EX4A 3N25A 2J75A 3H7VA 1Q2RA 4WHBA 4F2TA 3AIWA 4LS1A 4AZCA 2NSXA 3EBVA 3IARA 5JIPA 3S1XA 2G4FA 2AAAA 1BF6A 3CTLA 8XIMA 4NNBA 4E6MA 4MWAD 3WMCA 1FOBA 1V3IA 2GOUA 4HN4A 4Z17A 4GNKB 4GD0A 5AN7A 4YVPA 3T1GA 3WH9A 4L1GA 2NQLA 1EF2A 3DYPA 1TMLA 3EB3A 2J24A 3A9IA 2VUNA 5HQMA 3DFHA 4F0KA 1I2QA 3AYVA 3W1UA 1TWWA 3LD5A 1F3XA 4JS3A 4C1KA 4C60A 1RCQA 2TODA 2ZVRA 2Y24A 5JBFA 2KX9A 3TLLA 1FXPA 1UR8A 4JTKA 4XAFA 4W84A 1PSCA 1J5TA 3T40A 4XTDA 3W1LA 4CD4A 1Y8BA 2J77A 2E3ZA 3FDGA 3W25A 3LG3A 3QMSA 1V8EA 1IEVA 4JY8A 3GXNA 1CB2A 3VIHA 2G96A 3ITXA 4JTAA 2VENA 2YLAA 3IIVA 4Q4KA 2GSJA 3MT1A 2FJKA 5J5RA 3EA2A 4DJEC 1OZMA 4JQ1A 4OE7A 1BPLB 3KWSA 4XAZA 2ZRZA 3UXDA 1XG4A 1J18A 3DBNA 3TCSA 2PF0A 9RUBA 4HU4A 2HISA 2B81A 3KZSA 1PV8A 3NXFA 5HNTA 4DUXA 5DRIA 3DHPA 2RJGA 3EWCA 1W1TA 4MKNA 1B30A 4N2YA 2DZAA 3SCUA 2IQ0A 3O6CA 3ERPA 2I1OA 4JKMA 1UWUA 5HINA 5AC5A 1K7EA 5TNVA 3O3RA 1YDVA 2BV9A 3WK0A 1OYBA 2ZC8A 3UJRA 4FOJA 4QISA 3H7UA 1ZAJA 2E6FA 2NUXA 5CZJA 3QRHA 4MIMA 2OLSA 5I3KA 4HTBA 4NI3A 2DSUA 3V16A 4K1GA 4WDXA 5BWAA 1T40A 4WKAA 2V3FA 1H7NA 3WQ8A 4Y9NA 4MKVA 3XINA 4ATLA 2V38A 2OG9A 1K02A 1XIDA 2P10A 2HNHA 3Q67A 3UJ2A 2YYTA 4DBDA 3GTIA 3PULA 2YCJA 1MZRA 1FHDA 1H1YA 1BYBA 5A8OA 3P0WA 3HG5A 2Z1SA 3GDTA 3WEOA 2VQUA 4V28A 3VOIA 4LRTA 2ZDSA 3V1HA 5T26A 1U1HA 4H7VA 4JIRA 3EAUA 2I5QA 4C6BA 2PWHA 3MS8A 1LRTA 4H00A 1SMAA 4RLIA 3ARZA 3LQGA 2WW5A 1T96A 3OBKA 3E0WA 5D38A 4TUFA 1WQ5A 2NT1A 1JPHA 3DDMA 5IRPA 1D7KA 3FIGA 3C2OA 3WUGA 4DO7A 5TIMA 2VX4A 4ENLA 3USBA 4JHMA 2WMKA 3P7YA 3MUZ1 4WSJA 4AZ6A 4YHGA 1WKEA 3OG2A 2FZ9A 4GBDA 3CV7A 4E3TA 2X16A 1W9BM 3S1VA 3QV8A 4K7YA 4JTIA 2FH8A 4XBJA 1VFLA 4MYXA 3LTSA 2WKLA 1R2TA 1C3FA 3S9ZA 1J10A 4LC6A 3LCIA 2E5BA 1KLYA 1TFVA 3FA5A 3DHUA 3Q4DA 4NZ5A 1ZBVA 2PWUA 2UY5A 4GXMA 2OT1A 3WJXA 4ICMA 1R8LA 3E6EA 2C1GA 3EX1A 5FEZA 3RO8A 2Q3RA 5C70A 1TPUA 1XP3A 3HQPA 4RZ4A 2HK1A 1E6XM 4DZ5A 2OOFA 2OVLA 3U2ZA 3WFZA 2OFJA 3I10A 1C90A 3WNNA 5JUVA 3WD0A 1KLZA 1Q6FA 2XIOA 1PAMA 2R24A 3A6OA 3WQOA 3QY8A 3NPUA 1P48A 3CZ8A 4HOZA 4WOZA 4URIA 5AVHA 4ZE5A 2Y85A 3FS2A 3P93A 1DTUA 1LG1A 5HJLA 4UTHA 3URBA 1WXZA 3IIOA 1ITXA 3DG7A 1XKYA 5H1WA 3AYTA 1CXHA 1VFSA 2WV8A 2XVNA 4QIUA 1WUFA 3W2MA 5FSEC 4MYAA 3MJYA 4AD2A 3U3HA 2XPKA 2CBUA 2WMIB 3CV6A 3MZNA 3PUDA 5IXEA 1PZ0A 1A50A 3OVQA 4PTMA 2Z6JA 3KBSA 4LEQA 2PDYA 3IVTA 4NZ3A 1XBXA 3L67A 3GU1A 2A3CA 1W37A 1D3GA 4OKDA 2E5CA 3MBDA 3CWOX 1MQRA 4UNKA 4H4IA 3CH0A 3KRBA 3WLPA 3N4EA 4XIMA 1BTMA 4IJCA 4ATWA 3IGXA 1V3JA 2DW7A 3LHVA 3OBEA 2X42A 2VR5A 1SW0A 3EX2A 3BAYA 3F2BA 3UR8A 1DJWA 1VIZA 4YTTA 3FXGA 3BQ5A 3WNLA 5D4YA 4MNMA 4AC1X 2QJIA 2R9RA 1K1DA 2YA0A 5I06A 5C2GA 1W0MA 4UR9A 1WOBA 2INFA 4LAZA 2FB2A 3GNPA 2W0UA 3NGJA 2F6XA 3SCWA 5E93A 4Y8FA 4JL1A 4AX6A 3WYZA 2E1DA 1EZWA 2E9LA 2HE8A 3PSVA 4P7LA 3WNPA 6REQA 3AXMA 1DYSA 1RA0A 3VMPA 1J8VA 1V0LA 4A05A 3PZIA 1V6YA 1TE6A 1MXSA 4JOMA 1Q5MA 1J9YA 1YXCA 4HPXA 2BVYA 4TQTA 3P5ZA 4Z2JA 1HGWA 5LGXA 3ITOA 3CIVA 2OWCA 1QOXA 5LXEA 3LI1A 1Y65A 4CNOA 1VKFA 3CH9A 2IQDA 1BHGA 4Q3MA 1OBAA 4ICCX 4PMQA 2PRHA 2BMBA 3WL1A 3KOYA 1UW9A 1NSJA 1MEHA 3PVFA 4OZOA 4CCDA 2XWEA 4O4WA 1NH6A 3OODA 4IL2A 2FHBA 4JFWA 2YCLB 5A6AA 2XN2A 2ZWYA 4S39A 4GX9A 4AISA 3HJEA 4WZHA 1GQIA 2ISDA 3E49A 3UXKA 2VVNA 4IM4A 1EGVA 2CYGA 2D2OA 3UWUA 3AHVA 1W3NA 3VMNA 3Q94A 3K4DA 9XIAA 2WSRA 2QIIA 2NXHA 2PDXA 3VA8A 5FACA 3RPTA 4BS0A 1S2TA 3MJMA 3QPYA 2X09A 3DFOA 4CD6A 4GG9A 4AY1A 4AD3A 1VC4A 8XIAA 4MDPA 2WB5A 2YDQA 1F7BA 4DXVA 2REQA 4G2DA 1EWDA 2GSEA 2HBXA 2V81A 4H7ZA 2V3DA 3WF2A 3DFQA 1KW1A 4BEQA 4W7WA 2HXUA 3LLDA 1WOAA 2ISWA 4TTUA 2B7OA 4Q8VA 4KIEA 4PR4A 1XGZA 3LK6A 3N6QA 4XAYA 2IPWA 4ERAA 1ZRQA 1LTDA 4A35A 3UNDA 3LB0A 3N6JA 4NNAA 2OSYA 2Y88A 5G4HC 3N2MA 1W1B1 3ITCA 3TC3A 4KGLA 1ADDA 3WMBA 4FPSA 3LXBA 3SCTA 2GGEA 1DIDA 1RQBA 1UOKA 4H7CA 1PZ3A 1CYGA 1JF6A 2PP1A 1AL7A 4FLOA 1P7TA 3N3TA 4RPPA 4DO6A 3N17A 4IMAA 2XSBA 3MI2A 1KFWA 3TJIA 2PPGA 4JIIX 3FEMA 4RW3A 3EEGA 4ZMGA 2Z29A 5D04C 1KM2A 1E70M 4MB4A 4HA0A 4WJEA 1LQ2A 3AMCA 2ZZ1A 3GXPA 4P7OA 3K5XA 4P2VA 3A13A 1Y0EA 3LTPA 4ZZ9A 2PC8A 1V02A 1XRSA 1EJ7L 5MHBA 2CBJA 3RPMA 2D73A 2Q01A 3BLDA 3HGSA 3M0JA 2A3HA 2WMFA 3HOJA 1OFQA 1XGDA 5AOUA 1XHGA 1FH7A 4FS9A 4PRRA 3R4IA 4KEMA 1CXKA 4ZA0A 3LMZA 1QW7A 2HK0A 3TTSA 4YNGA 1LWIA 2GJNA 2XHYA 2O56A 1TPWA 4NQ1A 1Q7QA 2DVXA 4C6IA 3RCMA 1T8QA 2OQYA 1K8YA 3IK4A 4GO9A 3E96A 3DC0A 1G4PA 1HG3A 1BWKA 2I9UA 2O55A 5XINA 4OV4A 5H8UA 4JKKA 3RLVA 4FXJA 1I2OA 3LCGA 5C6MA 2P50A 1YBQA 3LCLA 3BUVA 3FV9A 3E0VA 4Q6XA 2CFFA 3IIPA 1MUCA 3CIWA 1FHVA 3SSZA 1S5WA 4NYYA 1HJXA 9CGTA 4B92A 2DV0A 5C0QA 5G4EA 1IEXA 1RXOB 4YXGA 3T09A 3F03K 4GZIA 3HMJG 2BSLA 1B9ZA 2AL1A 4GJIA 3QFWA 5FJTA 1HX0A 1OX4B 1ZJIA 3SAZA 4CNPA 1QW9A 4ZO9A 3WJZA 1QO2A 3SDOA 3ANYA 1T99A 3W28A 2BODX 1WO2A 1P0NA 3W2UA 1A3WA 2WCAA 3ZXWA 3EKGA 4PCNA 1SZGA 4IL0A 3SN4A 1HO4A 4RJEA 1R2RA 4ROQA 3PNUA 3PZQA 3ARSA 1QUMA 4L7ZA 1EP2A 3WLOA 3IAQA 1YW1A 2ZE0A 4UBPC 2OGYA 4FLRA 1XIJA 4S3FA 1EDTA 3KCJA 1NDYA 1OFBA 1PB0A 2IKHA 3QQ1A 1E4MM 5I2UA 4U31A 3DFNA 1W1A1 1SO5A 4AZGA 2YCIX 4LXFA 4MVAA 4LAOA 3M6DA 1ZL1A 4JTSA 2Z28A 3LENA 2EPNA 1EEPA 3LTYA 2PWEA 1P4CA 1GJUA 4JHZA 3HQOA 1TJ0A 4O52A 3UZWA 1JAKA 3M0LA 2Z27A 3GHTA 1QK0A 1SMDA 1HJWA 4IXHA 5E09A 3WF0A 1YIXA 3M07A 3VVGA 4JY9A 4ZFMA 4L65A 3URQA 1RP9A 3WLNA 2WC3A 4XD5A 3QN3A 3CASA 1EHAA 3D3FA 1ISYA 4H41A 4BCEA 3CNYA 1OX5A 1ZJHA 3NWRA 4H8NA 2VX7A 3SADA 3B9EA 2D22A 3DX5A 3M0HA 1KM4A 1GYLA 4DJED 3WKZA 3E1F1 2P8CA 3AU6A 1N8WA 1ODZA 4HB7A 1DWGM 3ZWTA 1RJRA 2HJPA 4POCA 4CNNA 1KBJA 2CIPA 3T0AA 1F6PA 2NZLA 1VQTA 2VP8A 4LH8A 3GTHA 4K68A 3VAVA 1PBGA 1ICQA 1VJZA 4L9ZA 3C56A 2E8ZA 3HGOA 2P3ZA 3S5YA 2FMOA 4JIEA 3WBWA 1BF2A 1IXPA 3BAKA 4M51A 1EBHA 4AYSA 4R9XA 3WLIA 1OIFA 1DWJM 3LUTA 1OJXA 4DLFA 1R9XA 4REQB 2V5DA 1GKRA 1CX9A 5FJIA 1VHCA 2Y0FA 2YLLA 1FDYA 4WXYA 1ISXA 4HP5A 4KT2A 3AWOA 4DJFD 3TXZA 4KGJA 5ECVA 3UZ5A 4AWTA 4ATDA 5MKGA 2XJ7A 1ITQA 4HNTA 3W7QA 2XG9A 3AAMA 2WC7A 1OIMA 4BEUA 1XIEA 8CGTA 1XIHA 2A0NA 4JFTA 4W88A 1XPYA 4N9BA 1W1IE 4LUTB 3V3WA 3EEZA 4S3EA 4PUNA 1W5PA 4GKLA 3MI3A 4ZO8A 3EKLA 3AXXA 2FQIA 1MQPA 4DUWA 1C7SA 2YCEA 3M46A 2Z1KA 4JEQA 3A4JA 1JZ6A 1SZEA 1YQ2A 1VLIA 1SO3A 2EF9A 3UZYA 3GX9A 4C7FA 2I14A 3JZEA 2EKCA 3QR0A 4QTGA 1DQUA 4CD5A 4JXCA 1TV3A 1U22A 1QPQA 3E5PA 3W1TA 3SBFA 2BASA 2Y8UA 2PDBA 2VT0A 3GU2A 3GH7A 1XIGA 1JJKA 4HTYA 4PUWA 3VCNA 5LNWA 4D1IA 4L4LA 2R6OA 5DRCA 1SJAA 2GJPA 1XLJA 4UTWA 2YJQA 2A7PA 5AHFA 4XKYA 4TV6A 3MV01 1E6SM 4X9YA 2X40A 2CLIA 1BG4A 2IPFA 4RR4A 1H61A 4C7GA 1UKTA 3JRKA 2C8NA 4RZ5A 3WBEA 1AMKA 3UJSA 2NSOA 3CMJA 4NVTA 5GJMA 3NVDA 1KGUA 4H9TA 2XM2A 1R0MA 5FF4A 5BMXA 2DP3A 1E9YB 1CZ1A 3BOLA 1RD6A 2VX5A 4GE8A 3P0XA 3IANA 3ES7A 4WSKA 5AHEA 3CQKA 1L6WA 1K7FA 3GVGA 4H6RA 1JL8A 1B54A 3FKKA 4HNNA 1RQHA 4PCFA 3G3MA 3VGHA 5A6KA 1Y5XA 5EMLA 1Z41A 3QYQA 4H3DA 4NNCA 1GQJA 3WUEA 3TYUA 4HK5A 1ICSA 1K6AA 4GUJA 3C2FA 4IPNB 5I24A 2XVKA 4BWLC 3H4WA 3W7EA 4UIOA 5BW6A 3TR9A 1E51A 3BW4A 4CCEA 4Y2WA 4MWAB 2GJLA 4BWLA 2H6RA 2VI0A 4GABA 4TO8A 2O9OA 4Q7IA 4EPKA 2DT0A 2PMQA 3ZT7A 5FEWA 6XIMA 4JHOA 5LXXA 4MLJA 2OTDA 1XCXA 3TAOA 4I9AA 3OHMB 4S3JA 2NXGA 5A6TC 4ZR8A 3W7KA 1PTAA 2WVVA 3E2VA 3LOTA 4C6QA 2E68A 3DERA 1DIOA 2YL9A 3K46A 2V69A 5BROA 3LGGA 3KW3A 3DBPA 4I6VA 2BXVA 4JBRA 4LUSB 2Z7GA 3MTWA 4U2YA 1G7UA 2J4GA 3KOFA 3RM9A 3GDLA 3ITVA 1JZ8A 4ADTA 1UC4A 3C6CA 2OELA 4GO8A 3AISA 4J28A 2G50A 4NY2A 4G7EB 1FCQA 4PYSA 3W82A 2ZUVA 2VCCA 3R25A 2I56A 4AY8A 4BF7A 1CXLA 3L65A 2ZRUA 5FJJA 3GSMA 2VRKA 3D47A 3ZT5A 2PTYA 3S9IA 3UY7A 2X30A 1FWEC 3QC0A 5A6MA 3VIMA 5LIUX 2XDFA 3GVWA 4GGHA 2VJXA 4MFEA 3ZWSA 3KL0A 1AUSL 4XZ9A 4AHPA 3LSBA 4M5PA 1LF1A 3W37A 3AZTA 3AI0A 2WM0A 4HGXA 1EDQA 1QNOA 1UR4A 4TXEA 2YSWA 1W54A 2QNEA 2DZVA 3RLGA 1AJ0A 4OU1A 3VKAA 5A8NA 1WKYA 4GY7A 4TX8A 1VH7A 3W1AA 1H4PA 2VC6A 3H53A 3RAOA 4YPJA 2W9MA 3BAJA 4AF0A 1BEUA 4JAWA 3T05A 2CNCA 1HFBA 4P5UA 4LVFA 3UXLA 3RG6A 3N15A 1OD8A 4IXXA 2XVPA 3S46A 2HNEA 5CSYA 3N19B 5F4XA 2JBMA 4B5SA 3PZUA 5I7GA 1EZ2A 1XBZA 3VDCA 4H6EA 1X6UA 3DZ1A 4NZJA 4AMCA 2REQB 3QF0A 2PC4A 3N73A 3H12A 4O8RA 3THDA 1JCYA 2XSXA 2QVHA 2UZ9A 2GVYA 4JTCA 3W2KA 2ZZ5A 3CAWA 3NUKA 3V7PA 4PMVA 2AGKA 1EPVA 3CQ0A 1RK5A 4FIQA 4IMGA 2QVNA 3UR2A 4GYFA 4JN8A 3AMGA 3I3BA 2Y89A 3IVSA 2WJEA 5A8MA 1G01A 2Z0IA 3TLQA 1KM5A 2BZNA 3KFTA 4AWSA 4DLMA 2BB0A 3GW0A 5B7ZA 4IWWA 2DSZA 1F07A 4FNUA 4HKPA 1V77A 4DBWA 2UY4A 1EJWC 4IFRA 3PY2A 5KSWA 5FF7A 4H9YA 3OGRA 4Q22A 3I3DA 1X1OA 1VEOA 4GUIA 4IG2A 4HCLA 1O5RA 1TE1A 4TTGA 1HO1A 3UW6A 4O0QA 3CYVA 4AWEA 4JTDA 4F0MA 2VX6A 4DJDD 4EWJA 3EDFA 3VPLA 2OSWA 1Z8AA 3GB6A 2JE8A 3GHSA 1TZ7A 4O1DA 2R1PA 1QI3A 2HQAA 4RX0A 1NWUA 3IJ8A 6REQB 4LY8A 3SCRA 2VFFA 4LB4A 2VELA 3GE7A 1CGTA 1GOMA 1N55A 3GLCA 1W9PA 2ISSA 3UCQA 3XIMA 3WMLA 3EB2A 1VBGA 1AH0A 3H24A 4JQ4A 2Y7GA 4XUGA 3KTSA 4KIRA 3ZR6A 5CPLA 2UY2A 1A0CA 4FK9A 4DO4A 1BVNP 2VD8A 3W9ZA 3U5UA 1KA9F 4HPJA 4AIOA 1KBBA 1V6VA 4WGXA 1V51A 1KR0A 2QUUA 2BDQA 4XUYA 1EQPA 1YPIA 2PDPA 3V5FA 1U83A 1IF2A 3A23A 3N9SA 3VGFA 3NG3A 1CNVA 3GG0A 5LZLA 4LU0A 1L6FA 1AH4A 1X7IA 2FVLA 3O8AA 1XDLA 5AZ1A 4GI4A 1J0ZA 3IJ6A 1LL7A 3EWDA 2H8ZA 1E4LA 2Z2AA 1R3WA 1BAGA 3O16A 1OFPA 3HURA 1M03A 1RCXB 2BGSA 4S3KA 3DECA 3GG1A 3BV7A 1VFHA 4R85A 1A5CA 4E2VA 3L0KA 2D2GA 4UFIA 2CLOA 4C91A 1SZFA 1E43A 2Z26A 2VDIA 2XM1A 1UMYA 4HZ7A 4LAUA 4LNCA 4ZENA 4JFVA 2RDXA 1QFEA 3BH4A 1GQLA 3K8LA 3BQ6A 3I7RA 4EANA 3FYYA 4EK7A 4PL1A 2PDNA 1GOXA 5CSSA 3FYOA 4AVFA 3G1HA 2WCGA 1C29A 3IUDA 4C5ZA 5EBUA 1RJQA 2VFDA 1Z48A 3KHJA 3F4VA 2Z2UA 3ECQA 5JMUA 3CUIA 1UYQA 4MUPA 3URAA 1FVPA 5G2WA 2PP0A 2OEMA 3SCOA 5ABGA 4O0KA 4WR3A 2O7QA 1DP0A 2QMJA 3MP4A 4UTMA 4LGXA 4S3DA 3E2SA 3FN9A 2AL2A 3A22A 1YDNA 2W91A 1XV8A 4AH7A 2FPTA 1DWFM 2DW6A 4KEZA 3OVRA 4W87A 1N8IA 4MY8A 2XVLA 1O6IA 4XZNX 4NYUA 1FHUA 2I57A 4E2DA 4INFA 3CUHA 3C2RA 1EC9A 3AMKA 2VCAA 3NOYA 4IISA 2YX0A 5E5CA 1QVBA 2A4AA 5DCEA 3RN6A 3BCDA 4L1WA 3WK3A 5JIWA 3QXBA 1BXBA 4IF2A 3NZQA 4IIGA 1OG0A 3MYPA 1H2JA 2FKPA 5CGQA 1XW8A 3CQJA 3TTOA 1ITUA 2A6LA 1FP9A 2NX3A 3C2YA 1K9DA 4FLQA 2UWFA 3WN6A 5D9MA 3LCXA 1ZP3A 1JD7A 2DQXA 3CYJA 1IWBA 3LCWA 3ZVHB 4S3AA 1GG0A 2J9XA 3WD3A 1RHCA 2ATMA 3E3HA 1JEZA 2D0FA 4LSBA 2E8YA 4LCRA 3KVMA 2BOEX 5HQLA 2ZXQA 1X98A 3PUOA 5AFDA 4Z2GA 2X1IA 4GBUA 5CJMA 4HZMA 2OCZA 1KGXA 1YPXA 2E28A 4GKTA 3FLUA 4EKJA 4Q8OA 4PSRA 3C8NA 3KRZA 3W27A 2DSVA 3S42A 3N9RA 1Q6GA 5C7HA 4D8ZA 5D33A 1T0OA 2ESCA 4ZOEA 5CPOA 1TQXA 5KZ6A 4EF8A 3KP0A 4JX5A 5RUBA 3RPDA 2F84A 1YTKA 4M1RA 3I68A 3AMLA 2V3GA 2ZZ2A 1H0IA 3NQDA 2EPMX 5EGRA 1UC5A 4MB1A 3B8WA 1PHWA 2ZX9A 4RE4A 2WKGA 4BF9A 4AX7A 2R82A 3R10A 3SURA 1M7XA 1R3RA 3P3BA 4D8LA 1S2WA 1TR1A 2VCBA 5EMUA 3JW7A 3L5AA 3GXTA 3PB0A 3LV6A 1IYXA 3G3DA 4NILA 3HF3A 4GZ7A 1QHZA 1B3ZA 3C86A 4WDTA 4IZGA 3TW7A 2ABAA 1H5VA 2WQDA 1UG6A 1CXIA 3SY8A 4W89A 1LL6A 1RY0A 2CWXA 3S6DA 4JPGA 5DQPA 5DCBA 3RM4A 2J79A 1UWAA 1EOMA 1XIIA 4C90A 4XZLX 3UNTA 4O14A 4AEOA 4P7RA 4LPCA 3BCJA 3O63A 1WZMA 3SQLA 4UMBA 3USZA 4GQ0A 5C71A 5EKYA 4F0RA 4X22A 1XUUA 2VZSA 1RLDA 3QBUA 2EPKX 1V6WA 1F2JA 1JI2A 3A5FA 1O1ZA 4DBSA 1G6CA 1LT7A 1T7LA 4C6DA 4XZWA 4H9UA 1OABA 4AF0B 2VO5A 4GUGA 3UFYA 3NQ7A 2GK1A 2CXGA 1XR2A 2EBNA 2VOTA 4RK8A 2IQTA 4HU3A 2DH2A 4H6QA 1WPCA 5KEZA 3W81A 3GYEA 5JBDA 4AXKA 2HE5A 1GVRA 1C9DA 3LCFA 4O13A 3GXDA 1EIXA 4GI9A 2D2JA 3MQTA 6ENLA 3BGGA 5D05A 3BWWA 1W9DM 1XC6A 5HMDA 3IIXA 1O5XA 3S1UA 4ZQNA 2WANA 2ACQA 1Q6DA 1C91A 5IBXA 3HGJA 5CJ5A 3AOFA 3NZPA 3UY8A 1UWSA 3NQFA 4X2RA 2DJXA 5I77A 3QLLA 3WLQA 4HPNA 3WF3A 3WQEA 1H41A 1U1JA 1XGEA 4IMCA 4UZUA 1NFBA 4GQRA 3MMTA 2CBVA 1W31A 1LJYA 4J27A 2JIEA 2CKRA 1E55A 1WBHA 2YZ5A 2E4TA 1JG9A 2YXXA 5BOEA 3QMTA 2XIJA 3BG9A 4WDWA 1A5UA 1JIBA 3W7IA 1PHQA 3MYOA 4E0CA 2NV1A 1LYXA 2PDLA 1RD5A 2Q8ZA 2ATSA 2QGYA 4Q4SA 5XIMA 2DZXA 3G24A 1A5AA 1IGSA 3Q45A 5BRQA 2C0AA 1NAL1 3MA8A 2FZ8A 3S4TA 3LMYA 3AICA 5GVJA 1EUAA 3OA3A 4IFKA 3EDDA 5U4NA 4M6PA 2CLMA 2PB1A 3ALFA 4KFPA 1W32A 3VZZA 5BNKA 4H8HA 3DFTA 3TU9A 4MNLA 1S46A 5GNZA 1C8VA 3BAIA 3N6HA 1XDJA 3TW9A 3C5QA 3RLUA 3PBUA 5I6SA 2C7FA 1KTNA 5AY7A 4EVZA 1CLKA 3ZJ8A 3AS1A 2VGGA 3BSGA 4JTUA 1AD4A 5BOOA 1G5AA 2CZDA 2L5HA 4YVVA 4PB5A 1I0DA 4YYFA 3VDGA 3AFBA 4PCSA 1LOQA 5D30A 2QW5A 4O0ZA 2MNRA 2ZUUA 5DFAA 1RBOB 3MO7A 4OT7A 3KTCA 3OU8A 3T07A 3LNPA 1A53A 3BLEA 3TN6A 3UCCA 3CZLA 1PS9A 1UA3A 1F8MA 2OYMA 4J3XA 5GQBA 2X05A 4Y9PA 1W56A 4DF2A 2QCDB 3M0XA 3TX9A 3R1ZA 1IZCA 2FH6A 4KERA 4UNIA 4JTHA 3L0NA 1W8GA 3CJPA 3S5OA 2HMCA 2OZTA 3Q58A 1XISA 4PMNA 1SSDA 3GHUA 5CZTA 1S38A 4YIWA 4C6LA 3FJ6A 3H55A 3LLFA 1VPXA 3OZOA 2SFPA 1GORA 3FVMA 3PUEA 4Q4MA 4UOZA 5A2BA 3EWXA 1CT5A 1KTBA 1PX8A 2OT0A 4F40A 2VDGA 3WCZA 1R46A 2PZNA 3OQ8A 2HBVA 1XDMA 3ARQA 3PTQA 4DEFA 1GONA 3IRSA 1ZALA 1B5TA 4E8GA 1VBHA 3EOOA 4J5NA 5D37A 1E0VA 1R3TA 1OT2A 3PR2A 1ME9A 2CZ5A 4DAIA 4QCFA 3W7DA 4O1FA 1JNDA 3ZZ1A 3H8AA 5HNNA 4L6HA 2VXNA 2VFIA 5DY2A 2GUBA 5KZEA 1B4KA 1D9EA 3EWZA 1LRQA 2F2HA 2VL4A 1IWAA 1TTQA 2R14A 3RF9A 3L2LA 1KCKA 1I1WA 1V7YA 1HJQA 4GFIA 2YDRA 3OJGA 3E0FA 3OP2A 4MZ1A 2X1SA 4LNYA 2VQTA 4P7QA 4A4AA 1HXJA 4QE5A 3RR4A 4Z2KA 4CU6A 3EZ4A 1DJXA 2JFEX 3HBLA 5E70A 2GPTA 4TV5A 4Q6JA 4U10A 2PA6A 3HTWA 4IP7A 3UA4A 3IUIA 1XBYA 3K13A 4O1AA 4I5RA 2Y61A 2XIIA 1EGMA 1OYCA 2QDDA 1UR3M 1X6LA 1XICA 2C18A 1E1EA 1XYAA 2I9EA 1KBLA 3NQ2A 1ZSXA 1ISVA 1M7PA 1QPKA 2JF6A 2WSKA 4FXSA 3VUSA 4DUVA 2CZVA 1W3KA 1TPVA 2ALRA 3PBMA 1EP3A 5DT5A 2B7NA 1XCWA 4PEKA 3H2NA 4Q8UA 5K9XA 1TB3A 5ABFA 3BLPX 3HPSA 1L2UA 5EBAA 2C15A 4V27A 2OWXA 3RUBL 4TX9A 5HXMA 4KKXA 3T0TA 4ADSA 2G95A 1WCGA 2VMFA 5IBXC 4QSHA 4P8WA 1XLAA 3PPHA 1HJSA 3S0CA 5G5IA 2YA1A 3ATYA 3JR2A 1X1ZA 4NF7A 3TEVA 4ORIA 1EL3A 1PPIA 3VNYA 1PIFA 4DQWA 4R5EA 4YWIA 2V3EA 1IT8A 4UMAA 3QZ6A 1VFOA 1NDWA 3GAKA 3P82A 1YEYA 2ZRYA 4GQBA 1AODA 4QLKA 2RDUA 2VOMA 1QASA 3WD1A 4D1JA 1Q2SA 4CQDA 3EXRA 2P88A 1GCYA 1WKDA 3HQNA 1XLKA 3LBOA 3PJXA 4EWND 4FMVA 1NU5A 1ZY9A 3DOPA 3TYBA 1FTXA 1ZJAA 2PI6A 1X38A 3WQPA 2GWGA 4IQDA 1H3GA 1R7AA 4AIBA 3PWGA 1QNRA 2VM8A 3K8MA 2JEPA 5D2WA 3EDEA 3GBDA 3U8GA 5H2ZA 4C1NA 3W7PA 1UD2A 5C9RA 3SCSA 2OYLA 3EB4A 4B5TA 3VC5A 5FKYA 4Y9MA 2E09A 2VGFA 1TREA 5AYIA 1C8QA 5ABFB 1W9VA 4D9PA 1CGYA 1DJQA 1A80A 3AIUA 3WDIA 1V08A 4M8UA 3BZGA 2FPVA 4PH6A 5MF5A 2XH7A 3GKAA 1BXCA 4DWDA 1QI0A 4WUIA 3TNBA 2J47A 1HT6A 3GXIA 1P6CA 3GU9A 5A6LA 8A3HA 1TPEA 2R1KA 3A4WA 3UA3A 3UGVA 1EXBA 1WZKA 1IXNA 4MMWA 1JAEA 5CBJA 4ONVA 1JZ3A 7ENLA 3UJEA 5AECA 2QDGA 3NGFA 3QMRA 4OIFA 1CW2A 3DC8A 2Z1XA 4LRSA 4OGZA 3WJSA 4K8GA 4LFYA 4XZMX 2A3AA 2X41A 1C7TA 1KFBA