3W88A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-200
rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w88A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w88A01
4KFOA 2WNNA 3N14A 3LV5A 1F6KA 1XFBA 4IWWA 2WQPA 1EP1A 2HS6A 4RV8A 2CLIA 1OK4A 1ZCOA 4JIQA 5AHNA 5AHIA 4UTTA 3HMJG 2E6DA 5KTLA 3K30A 1KM4A 1L9WA 2TSYA 5CPOA 3HOJA 2E6AA 5J5RA 4BWLA 1BWLA 1E51A 2WOQA 2NX9A 2V81A 4UCGA 4AWTA 5AHEA 3KRZA 5FF4A 4AHOA 4N2YA 3QPYA 5AHMA 4CNOA 2V0TA 3O6YX 3VFLA 3P61A 2QR6A 3G8EA 3QRHA 4N6EA 3WK1A 3G1FA 2P1FA 3DKJA 4C1LA 1R46A 1FDYA 5KSWA 3TK7A 1MEHA 3W7HA 2OT1A 4M6PA 5AC6A 2OJPA 3GB6A 1A5CA 3O6CA 2NV1A 1T8XA 3EWWA 4AHPA 4FIQA 1LOLA 2G95A 4NT0A 3VE7A 1AMKA 1RD5A 3PAJA 4BFAA 1KV8A 3W74A 3LCIA 4LUIA 2W0UA 4PL2A 1SSDA 1AW5A 2YFOA 3STEA 4JEQA 4EF9A 1T96A 3B0VC 1W1ZA 1JRBA 1ICPA 2JK2A 5G2IA 3SI9A 1OJXA 3IVTA 1FBAA 3MI2A 4EF8A 4OT7A 2QJIA 2E77A 3G1YA 4OE7A 2I14A 1LORA 1KLZA 3MHUA 5D2YA 1M5WA 1TV5A 2E5DA 1SW7A 2VEIA 1I2NA 2QAFA 4IMEA 2XN0A 3UPBA 3FKKA 4EOUA 4DXVA 1KBIA 4S2CA 4H4IA 4AHQA 4LRSA 2GQ8A 2QCDA 5CPNA 5IBXA 3O16A 3N2XA 3P82A 5K9XA 1ALDA 4MYAA 3W83A 3S8HA 4JD4A 4K6AA 2CLEA 2BX7A 1RR2A 3TC7A 1XBXA 5AC7A 1GVFA 4ML9A 5MHBA 1FXPA 3TNOA 1VGAA 3SECA 2WV8A 4TMCA 4NXKA 4GUFA 4YCOA 3NPWA 5LNRA 2VEMA 4KKXA 4LTSA 4WQ6A 1P0KA 2V5BA 1WOBA 2CLMA 3D0CA 1C29A 4O28A 4JTJA 2R14A 2YZRA 3NQEA 5CGQA 4ZZ9A 1Q6OA 2A5HA 4U4MA 4IGHA 2QCEA 2J24A 4NZJA 5LNUA 2Y63A 6ALDA 1TMHA 5CZTA 4BI6A 4FX6M 3C2EA 3R12A 4O10A 2DU2A 4XTDA 3QJAA 1LLZA 2CLFA 3W7EA 3PWAA 1NFBA 4DF1A 4MYXA 2ZQ0A 1YYAA 2Y7GA 1CX9A 2YYUA 5D2WA 3SFKA 4QISA 4AWSA 4X2RA 1NAL1 4O50A 1TPUA 3TUUA 1IXQA 3ZS4A 4FX8A 1H7RA 1T99A 4LC8A 4O57A 1A50A 4GC4A 3MUXA 5LHFA 3ABRA 5EPDA 1LLWA 3I68A 2NUWA 1UJPA 2WO5A 1XBYA 1Y0EA 2A7RA 1JCYA 3THAA 2E5CA 1VCVA 3O8AA 5I3HA 3LHWA 3N2MA 1L2UA 2RHGA 4XKYA 2WSYA 4AB4A 1VC4A 4ZQRA 5AC8A 3PR2A 3GVGA 1YDOA 1H7XA 3DFPA 4ALDA 3IV3A 1GT8A 1W8SA 2CW6A 3MMTA 2QUTA 4IX2A 4X3ZA 2C15A 3NQ2A 4UNKA 4M19A 4WJEA 2QCMA 4CQAA 4MKNA 4UR8A 4X9SA 3ZWTA 2A85A 2VEPA 2B7NA 1W5NA 3G0SA 1WAUA 1J4EA 3EWZA 4NJHA 1PV8A 4KFNA 3EX3A 2CZ5A 3VNDA 3I65A 1TTJA 4PEKA 5U4NA 3FA5A 1DJQA 2FQIA 1HL2A 3H55A 3IIXA 4AVFA 3G3DA 2GUUA 3GKFA 4UR7A 3M5VA 1W31A 4M7SA 2UV8G 1R2SA 1QPOA 3DU0A 2EF9A 1W0MA 3E49A 1QOPA 5LZLA 1GWJA 3Q37A 3C0JA 1SQ7A 2HS8A 3W87A 1RQEA 1KFBA 1O5XA 2DZSA 4JY8A 3TFXA 3FJLA 4EIVA 2QCCA 1MO0A 3R89A 2AAMA 5F4WA 4O18A 1ZENA 1GYNA 1X6UA 5IM51 3QF0A 1HTIA 3VI2A 4R53A 4IXXA 2Z0IA 4N02A 2H3BA 3M16A 4NZFA 1P0NA 3MYOA 4UTHA 4JTLA 3W7NA 5AYXA 3INPA 4E0CA 3HGOA 2NV2A 4JTGA 3GX9A 2Y62A 4Y8FA 1XL9A 5F1UA 2X16A 1IGSA 1VCGA 1UB3A 4WUIA 3ZWSA 1JUEA 2A6LA 3PM6A 4GFSA 1FWTA 3W1MA 1N55A 1AL7A 1HO4A 3CB8A 3B06A 2GPTA 1KM0A 3LBMA 3SJ3A 2QJHA 3ATZA 3VE9A 2ZTJA 3NGJA 4IX0A 2Q8ZA 3M5ZA 4IPJA 3EB2A 2QKFA 2X30A 1TPVA 4O13A 4XKYB 4YCPA 5KINA 3A9IA 3QMRA 1IXPA 4MLJA 5DXYA 3W2JA 3NR0A 1H61A 3TMQA 2E09A 4UXDA 2VENA 5SWUA 4JTUA 5G2HA 4O54A 3LTSA 3M47A 4CQ9A 1KFCA 5D2XA 3CM4A 4DF2A 3HG2A 1VYRA 3NL5A 4OGZA 2CZDA 3DKLA 1TV8A 1MSSA 4XQ6A 4UFJA 2J9XA 4AWUA 4HSNA 1AL8A 1S3HA 3UWVA 5FF7A 4LNYA 2NUYA 2J9ZA 3BPWA 3G1AA 1B4KA 3S1UA 3UZ5A 1SZGA 3QSRA 3G8RA 3HJZA 3FS2A 1VS1A 1G4EA 1VR6A 2Y6ZA 1JCXA 4JYDA 2XN1A 3P67A 3TXZA 3HPSA 1XCFA 3TH6A 3ABQA 3WJXA 2YYTA 4A2SA 4FNTA 4XBSA 1ME9A 2C16A 3JS3A 4UFKA 1QDSA 2Z6IA 1H1YA 4LY8A 4LVBA 1QPNA 2ZCGA 3W1NA 4UC5A 5D03A 1F7BA 3MP3A 4TX9A 1R47A 4K7YA 1TJPA 2ALDA 3BW3A 1XXXA 4OHQA 3UWQA 2OCZA 3THQA 4HNTA 3W84A 3MYPA 4QJ1A 1AK5A 3AO0A 3R13A 2X2GA 3OBKA 4O0KA 1PHWA 4LVAA 3NAVA 4QAIA 3F4NA 2YDAA 1IF2A 1I8JA 1R2RA 3FYOA 3TKFA 4RXGA 3UNDA 3SY5A 3NQGA 4B5NA 3B0UX 4J9JA 2NX1A 1I2PA 3TA6A 3TU9A 1SO6A 3ELFA 5F1VA 2LLEA 1N8FA 4FEZA 4N6FA 3W72A 1GEQA 1LRTA 1H7NA 1GTEA 1JCNA 3S6DA 5GVJA 3UPWA 5HMSA 3A23A 2VOMA 1DV7A 3GR7A 1JR1A 2EGZA 3LRKA 1WOAA 3L0KA 4LVGA 2WJZA 4LVDA 3B05A 1TV7A 4Z08A 3BGJA 4IOTA 4UMCA 3OHIA 4GXMA 1UUOA 2WSRA 4LUJA 3R8RA 3NZ1A 4AEOA 2PCQA 1WBJA 5D37A 2QUVA 1FUYA 4N9EA 4ZQPA 1GJPA 4LT9A 2WSQA 2Q8LA 2TRSA 1KA9F 4BI7A 2W79A 4JYFA 3EX1A 3FYPA 2VKZG 4PC8A 5AYYA 3NEVA 1FQ0A 2CLOA 7TIMA 2CU0A 3TQKA 2HMCA 1Q45A 3TXVA 1FWSA 2BTMA 3W88A 2I1OA 3C56A 1U83A 1UBSA 3GZ3A 5F2MA 2C3ZA 5EL1A 4JX5A 3LBCA 1EUNA 3M0ZA 3TAOA 4WXYA 2H90A 4UFHA 3W1TA 1TPWA 5LNWA 5HINA 3DI0A 1ZALA 3WK0A 1TTQA 1ZHAA 3PBVA 2X1RA 2CZEA 1RV8A 4A21A 4YWIA 3WJYA 1SFJA 3E12A 4MFDA 2QJGA 3I6RA 5DY2A 4O12A 5EY5A 1D9EA 3L68A 3W1XA 1SO4A 3KVJA 4LU0A 2B7QA 1H60A 4LOCA 5C5YA 4RCXA 1U5JA 1Z44A 3W85A 3PY2A 3STFA 3N34A 1Q6LA 4GE8A 1ZY9A 4MFEA 2G96A 3NQDA 2DZPA 1QWGA 2TYSA 3MHFA 1MZHA 3ABSA 1H62A 4JX6A 1O95A 3L0GA 2DZVA 3MBDA 4DO5A 4A22A 2C1HA 3W7KA 4GNJA 5FESA 4TMBA 3PUEA 4RJEA 4A2RA 5FEXA 3DHDA 1JQVA 1KW1A 3OVRA 4GWEA 3L0NA 1VLWA 2VFEA 3DXIA 3OVQA 1FDZA 2VC6A 1LBMA 3DHFA 1XI3A 1OFOA 1XBZA 1TTIA 3CEUA 5LGZA 1PE1A 2ZZ7A 3LI1A 1B9BA 3LHTA 3W22A 3W75A 3R2GA 4FNRA 3UXAA 1B4EA 3L9CA 3M41A 2ZFAA 3IIZA 3G22A 5FF2A 1NF0A 2VEKA 3SGZA 3P62A 3BLEA 5HR6A 4PCFA 1YXDA 1H63A 4OQVA 4OV4A 3TMLA 2I9EA 1MEIA 1FCBA 4ADTA 1K8ZA 3GIYA 4QM1A 2GQAA 1KLYA 2AGKA 3TAKA 3G18A 3NPXA 3GDMA 2DJLA 3WJSA 3GNNA 5F2LA 3GDRA 1W56A 2PRHA 4GRSA 4NUWA 4IMGA 3NQVA 4O17A 5I3FA 1WQ5A 1GVSA 3R5EA 1AW2A 3B04A 3FIGA 1W5OA 4O4VA 2ZZ2A 4R34A 3TW6A 4WOQA 3L67A 2QAPA 5C55A 4HPJA 3TFCA 3HPXA 3C3NA 4JDBA 5KZDA 3LRLA 3PB2A 5AYZA 3IVSA 4MIMA 4FF7A 4MJMA 4O16A 3NPUA 4N9CA 5TIMA 1YTDA 3GXTA 3W6YA 4ZQCA 3HO8A 3SIZA 1WYIA 1KM6A 3G1XA 2E6YA 3BG5A 5K2ZA 3DFNA 2IQTA 2DZWA 1X1OA 1KM2A 3FKRA 1JRCA 3ZR4A 2QDHA 4FNPA 1XDLA 2WPBA 1ZFJA 5CKSA 5LSMA 4GUHA 4ZVJA 3T55A 1KFKA 1O4UA 5CG7A 3LHZA 1ME8A 1XUUA 5ABTA 3UZJA 5CZ0A 3HG4A 4HN4A 1TPH1 1LDCA 3S5OA 3RF9A 1QOQA 5L6UA 3NL2A 1FWNA 1TRIA 3LB0A 4IMFA 3P80A 4K37A 4GUIA 3NL3A 3B8DA 1A5AA 3LM7A 4ICNA 5EA9A 1OFRA 2EKCA 1VYPX 3F4WA 3TJXA 3W7LA 1W5QA 3NNTA 2H8ZA 4CLMA 2AQWA 5K4ZA 1X8FA 4NJGA 5HNRA 1PVNA 4JTEA 3L66A 1F73A 4R33A 4NJKA 4I7WA 5HWJA 3PSVA 5K3VA 4Y9AA 1FCVA 2B7OA 2Q3OA 3W2MA 1RPXA 4W9TA 3M5YA 2JKEA 1FWWA 5D2TA 2CWNA 3MJYA 3CIXA 4JTKA 1YDVA 4NNCA 3LV6A 5LNVA 4DF0A 5CZSA 4JTSA 5EMUA 1YADA 5EBUA 4WX2A 1KBJA 2A21A 4JTIA 1OYCA 3IEBA 1FXQA 2BZNA 2YW3A 3IIOA 3T4CA 2R8WA 3NL6A 1A5BA 3WJWA 3UWUA 1KFJA 1GTHA 1TIMA 5K9DA 3E96A 5G1YA 3G1SA 5BOOA 4NNAA 3W23A 4JX4A 4PFMA 5AB3A 3BW2A 3UYCA 3UQNA 3VKJA 2OT0A 1S5TA 3UY8A 4Q32A 1OX6A 5H91A 1PS9A 5BMXA 1IIHA 3BK0A 1TPB1 3DGRA 5D09A 4E38A 3WFAA 3H53A 2E6FA 1XC4A 2YPIA 1H7OA 1HFBA 2V2DA 2ZBTA 5HULA 3F1QA 5D38A 5I3GA 5DBUA 3N19B 4NJIA 2RDWA 3B0PA 4O15A 1M7PA 5D05A 5G2WA 5AFDA 3W7MA 2A0NA 1LBFA 3MWAA 5D33A 1B57A 4K8HA 2J6XA 1EA0A 4QQ3A 4JTFA 5FF0A 2NX3A 5DCBA 3NVTA 4MJZA 1G67A 3NZRA 2ZRUA 4HSOA 3W7QA 1ZJIA 3LXAA 1LBLA 4Z0JA 1I2OA 1K03A 3MW7A 4O1BA 4CCEA 1T0OA 1OF8A 3LCXA 4NX5A 1KTBA 3TV8A 3QMTA 5TBOA 3HIJA 5BNKA 1OYAA 4ZMGA 3Q2DA 3LHUA 4HNUA 3OEXA 1OFBA 1EIXA 2YCEA 3CLMA 2ZTKA 1G6CA 5E0KA 4DPQA 4O1DA 2B0MA 3CHVA 1QAPA 4PL1A 1VRDA 1O5KA 3MI3A 4WOZA 5E1QA 3NQ7A 3C61A 3QPZA 3L5AA 4UTUA 4PTNA 3ANYA 3PS7A 1SZFA 3QW3A 3QW4B 4O1CA 3NDOA 1SO5A 1BTMA 3W76A 2ISWA 4PH6A 3HBLA 3E0IA 3NPVA 2EAWA 3BG9A 3W7RA 1SR9A 4UTJA 3G1VA 4CQ8A 5CPLA 1TTPA 1C9DA 3PG9A 1W54A 1TPEA 2H6RA 1TPC1 1LM1A 4EWND 3PUDA 4JR5A 4JXCA 4QNWA 2B7PA 3NYZA 1XBVA 1SW0A 1NSJA 1OFAA 2QEZA 3W2KA 1I2RA 4UFIA 2YW4A 1QFEA 4UTWC 1OK6A 3LHVA 4M6QA 4O4WA 3G24A 2CZFA 5C2XA 2EHHA 1QR7A 3HB9A 2JKAA 2BSLA 3PF3A 4O8RA 2CFFA 3VCRA 2QUUA 1WA3A 4WD0A 2CLLA 1F2JA 1DJNA 2ISSA 1DQXA 3KRUA 1S5VA 4JIPA 3EXTA 3LTYA 3M1ZA 1G7VA 1F76A 3GDTA 2ATSA 3W1LA 1MEWA 4WXZA 4XWUA 4DELA 2G5WA 1EEPA 3EXSA 1W5PA 2A6NA 1EUAA 2Z6JA 4RLIA 1WXJA 1SSGA 4DBDA 4NNBA 4E2BA 2CLHA 4E2DA 1ZAJA 3TCEA 3HG3A 3LCLA 3W2LA 3C6CA 2ZZ3A 3E9AA 4K8EA 4DO4A 5KMYA 2KZHA 4QIUA 5AN7A 3EX2A 4O14A 1H51A 3KFTA 1GG0A 3DH7A 3P7YA 4GJ1A 3EWBX 3SGUA 4I7VA 3S42A 3LERA 4M7TA 4K39A 3STCA 2RKXA 2Q3RA 5FEPA 2JGYA 2X1UA 3IVUA 1M7OA 5A5WA 5T26A 1Q3NA 2YX0A 3IGXA 2PC4A 3IGUA 4RZ5A 3RLVA 3UY7A 1EP3A 4IUOA 3LTPA 3KVMA 1QNVA 5HUOA 4FB7A 3HGJA 3P5YA 4NJJA 1OVDA 3N73A 1NEYA 3KX6A 3HG5A 4R7JA 2V8ZA 3S5NA 3W1AA 5DBTA 3C4UA 5G4EA 2WNZA 4IXHA 2Y7DA 3GK0A 2E5BA 3BGGA 1XDMA 3UWYA 3GAYA 2GJLA 2ZRVA 4K38A 4Q33A 1HG3A 3DI1A 2FTPA 1WDWA 2YGYA 2HSAA 4MPQA 4IQLA 1SW3A 4FNQA 1Z48A 1TB3A 1TREA 1VQTA 1LYXA 2VFFA 1RVGA 3W7OA 1YXYA 1F6PA 5K9CA 1JCLA 4YLWA 4BK9A 5K4XA 2OX1A 2FPTA 1D3GA 2GVLA 3GXNA 1WBHA 4MY1A 5TQLA 3DAQA 1FY6A 5BW6A 5D02A 4UFMA 3B03A 2ZRWA 3LCHA 3CT7A 4DEFA 2A4AA 2VFGA 1SFLA 3KVLA 1UUMA 4POCA 1W3NA 1C8VA 2RDUA 3QQ1A 4WZHA 1PIIA 1OFDA 2QCLA 1PCWA 4JTTA 4A29A 4QSHA 3W7IA 1YLVA 1I4NA 1BKSA 1AW1A 3LXBA 5HR7A 4RZ4A 1GQNA 1IXNA 3C2RA 3TDFA 3KVKA 3TSDA 1CI1A 5FI8A 4YXGA 1RQHA 3L65A 1EX5A 4FXSA 3C2OA 3P84A 1DBTA 5K7JA 3M43A 3V75A 1F5ZA 3O63A 3QQ0A 3STGA 2GVJA 2NWRA 3FOKA 3A24A 2J88A 3W1PA 3NQFA 1G4PA 3ATYA 1G7UA 4A3UA 1YTEA 3LCWA 3AJXA 4UMBA 8TIMA 2GJNA 4LRTA 3M7WA 2A1YA 1L6SA 3S0CA 4N9BA 4JS3A 3T78A 2FB2A 4OWGA 1JVNA 5DN1A 2PRLA 4TR9A 3C2FA 5HJLA 1K3UA 3W9ZA 4CCCA 5EYWA 1JUKA 4BI5A 5DLCA 1LP6A 2D73A 2ZRXA 4O0ZA 5KZEA 3C2VA 2V2HA 3PC0A 4UMAA 1ZAHA 1P4CA 1R30A 1SUXA 3A22A 1F05A 3G1HA 3HGRA 1SZNA 4GBUA 3SZ8A 2C0AA 1YXCA 5CSSA 4QITA 2O7SA 3W1UA 3PG8A 1LZOA 4FNUA 2V30A 4JNMA 2O7QA 3QSTA 3LGEA 2ZZ6A 5KITA 4AF0B 4LS1A 1G4TA 3W70A 1LRQA 2ZZ1A 4GUJA 1WX0A 1QO5A 2NWSA 4S2BA 4ZL1A 5DCEA 4C1KA 1I2QA 5LKYA 5HWMA 4FO4A 4DQWA 1KM3A 3NQMA 4IPIA 1M6JA 3I7QA 5FEZA 4HKPA 3FLUA 2DZXA 3BVJA 3RMJA 1OG0A 3CTLA 2GVGA 3MP5A 1VHCA 4FX7A 3LOTA 3QYQA 3OA3A 2QDGA 3BLFA 4MY8A 2ATMA 1X7FA 2FPYA 1LTDA 4DBEA 3CQ0A 1VLIA 3TQVA 3W2UA 1RQBA 3A5VA 1X1ZA 3P81A 1W3IA 2NZLA 4JYEA 3NOEA 4PODA 3MI6A 5DXXA 2ZRZA 3CU2A 1Z42A 3TROA 4M5PA 3M44A 3T44A 2V9DA 3GDKA 4O1AA 2PURA 3DFTA 3E02A 4Z1DA 1KM5A 3W7JA 1TPDA 2QF7A 5I3IA 1Q6RA 1BWKA 4DPPA 1P1XA 1OYBA 3BV4A 1WV2A 2VFIA 2FFCA 1ZNNA 5D32A 2VELA 4MY9A 3USBA 2NXHA 4H6KA 1H5YA 3LRMA 3EWYA 3ZFHA 1GVQA 2NLIA 3O1NA 4OU1A 4LC6A 2ISVA 4LS0A 4Z1CA 4CCDA 3TE9A 4WY0A 1G69A 1D3HA 1OF6A 4YL2A 3QH2A 1SO3A 3NG3A 3TC6A 4RXFA 3L5LA 2RH9A 3QZEA 2FB3A 3MO7A 4NQ1A 2WKJA 4KWWA 4N9DA 2RFGA 2DZTA 1O60A 2ZZ5A 3EEGA 4XZ9A 5AOUA 4JDYA 5J5DA 3GR8A 4BR1A 5L9FA 4GUGA 4UTMA 2C6QA 3SSJA 5I3JA 1DVJA 1NF7A 3KRSA 1L6YA 1OX4A 3NQAA 2A2IA 1KFEA 4JN6A 3P74A 1TCDA 3CC1A 1KTNA 4UTTC 2Y85A 3I7RA 3N3MA 4Z1AA 4MUZA 2BXVA 3PBUA 4NU7A 4BWLC 3ABOA 1DORA 3OVPA 3PVFA 4HHPA 2YSWA 1DQWA 1YPFA 3W07A 1AG1O 1OABA 3EX4A 2BLEA 4AXKA 3GKAA 4FNSA 4TU1A 3IGSA 4MOZA 1K7EA 1NVMA 4HNNA 3QM3A 5G4WA 3KHJA 2R91A 4QNEA 3GXPA 3N9RA 2H3DA 4I7UA 2E68A 1FWRA 3IIPA 3T40A 4LV4A 4MZYA 5KZMA 3W7GA 4YMZA 4JGDA 2GOUA 1EPXA 2CLKA 3DFSA 3CEPA 5DCDA 1G4SA 3NO5A 3CPRA 2NUXA 2VXNA 1TRDA 1JQXA 4Y90A 1Q6QA 2H8XA 4MLRA 5D30A 3O06A 1ADOA 5D04C 3A5FA 1DHPA 1OFPA 3MBFA 1LOQA 2J9YA 5D2VA 3V1PA 5I3KA 4IMCA 5DY3A 3M6YA 3FEMA 2Z2UA 2A7PA 1J2WA 2DORA 1QCWA 1QO2A 1EWDA 2JBMA 1FCUA 4IJBA 4WY0B 2ZRYA 4ADUA 2B4GA 1J5TA 1HUVA 1V7YA 4FHAA 1VH7A 2DZUA 4ONVA 1FX6A 4BF9A 3EWUA 1V5XA 1IIGA 3DFQA 3S5ZA 4Q4KA 5IBXC 3WJZA 4UUIA 3DENA 3W71A 3I7SA 1ZAIA 3P60A 2R94A 3PB0A 2Y61A 2NXGA 4LW7A 3S9YA 3LHYA 1OX4B 2ZA1A 5HQEA 4M6VA 3EXRA 4UTKA 4DO6A 2FDSA 2WNQA 1H1ZA 3M5XA 3MHGA 1BEUA 4UTWA 3UWZA 1K8YA 3O05A 3NA8A 3P8IA 3EWXA 1GPWA 5AHLA 2TMDA 2QCHA 3LI0A 3O07A 4RX0A 2ZA2A 4CNNA 1DOSA 1A53A 5DELA 1XM3A 1Z41A 2Z1BA 1K7XA 2PE4A 1K02A 1KV5A 3BO9A 2OZ0A 5FEWA 4G1KA 3U8GA 3SR7A 3UXDA 4P61A 5LNSA 2PRMA 3LX9A 5F4SA 3RFAA 2QCDB 4ZQMA 2ZA3A 1UCWA 4NVTA 3W1QA 2ZYFA 4UNLA 4K36A 1OFEA 2XN2A 2P10A 3PSWA 2FPVA 2ZZ4A 1FCQA 1LRNA 3L5MA 3EX6A 2ABBA 3T7VA 1VHNA 2QCGA 5U7SA 1ML1A 3GAKA 3M9YA 3N9SA 2Y70A 2DP3A 1LCOA 3TR2A 2V2CA 3G0UA 4L4LA 4UTIA 3GYEA 3CWNA 4JICA 4UIOA 4UTLA 2QCFA 1YTKA 3JR2A 1JCMP 3S1VA 1W37A 1H50A 5CZJA 5F2GA 3W7PA 3FFSA 3DZ1A 3TIMA 3TJLA 4ADSA 2F7FA 1SPQA 3P8JA 1GG1A 4NX0A 4RK8A 3W7DA 3YPIA 4HPXA 4LV9A 1O94A 2XFWA 3RNDA 1ICSA 4PA8A 1A5SA 1S5WA 1LOSA 2C13A 1JUBA 3LDVA 3LLDA 4RR4A 1SZEA 1TYGA 5BRBA 4MZ1A 3BARA 5C54A 1UASA 1PCKA 1QPRA 3KOFA 3LCFA 3QC3A 4N4QA 2YR1A 4U28A 4ORMA 4I9AA 3W73A 1TO3A 3Q58A 1IXOA 4KWVA 2J27A 5A8GA 1THFD 3TX9A 1CW2A 3FJ6A 3EKLA 1KFLA 5G5IA 1OFQA 2JKPA 1ONRA 1VJIA 1TQXA 4AMAA 3OG3A 2F84A 4N4PA 1K7FA 3QFEA 3WK2A 1TSIA 3NQCA 3DFOA 2C18A 1LROA 3TW7A 1TPFA 2X1SA 1QPQA 2ABAA 4ORIA 4AH7A 3G1DA 4OV9A 3RK8A 3L2IA 3BG3A 4HNVA 3UWWA 3IRDA 1KM1A 1L6WA 2C19A 2Y88A 1B3OA 1EB3A 3TSBA 1DKWA 3NM1A 2Y7EA 5HWNA 5EKYA 3NQ6A 1ME7A 1OX5A 3BW4A 3DBPA 5HUPA 1RZMA 3HGSA 2G97A 3PBYA 4IMDA 1PHQA 3CWOX 3Q94A 1EP2A 3GLCA 1TQJA 4AF0A 2C14A 2VFDA 2DJXA 1ICQA 1W5MA 3IIVA 3P5ZA 1QMLA 1GVOA 2P0OA 5CSRA 2QCNA 1H7WA 3PULA 4JY9A 4X22A 1W3TA 3PUOA 4MZ8A 3RU6A 3U6WA 4LWWA 4KFPA 3JRKA 4EVZA 4ZQOA 3LXCA 3G3MA 3NQ8A 2E1DA 1SU5A 4XBKA 1PL9A 3O6DA 2BWGA 3UD6A 2RDTA 6TIMA 3KXQA 1R2TA 3LCGA 4L4MA 4D2JA 4H3DA 4Y96A 5BMWA 4UFLA 1MXSA 4WY0F 2V82A 1VZWA 5AHFA 5F4XA 2NXIA 2V5LA 3S1XA 1GZGA 1DL3A 2A7NA 1KTCA 4XTIA 3BLIA 1F74A 2FLIA 3NXFA 5F2IA 3W3OA 5CPMA 3WK3A 2TPSA 1JCJA 3C8FA 3W2NA 3S1WA 4XUGA 1XKYA 2ZDRA 3PBWA 5G1TA 4RKAA 3HPZA 1H7PA 4AAJA 3OIXA 2Y7FA 3RLUA 1VPXA 2HTMA 3SW6A 3L21A 1K8XA 2GQ9A 3GNDA 3S5YA 3EKZA 1EWEA 1VYSX 3G0XA 1GYLA 1N7KA 1XUZA 4LVFA 2X1TA 4FXRA 4Z1BA 3MP4A 3CIWA 4O52A 2YFNA 3F03K 3NM3A 1GOXA 4LS2A 1GVRA 3B4UA 3H54A 4HIBA 4K7VA 3W1RA 3C52A 3HF3A 1YPIA 4ZQNA 2FIQA 4TO8A 5E93A 4TIMA 2EPHA 4RZ6A 4P2VA 1TJRA 3KAOA 5LGXA 3TQ0A 3QEZA 4CNPA 4NXSA 5H2ZA 5LHEA 3W86A 3O15A 1YDNA 3U2OA 2W6RA 4HT3A 1FDJA 4FIRA 1JULA 4JTHA 2Y89A 3LLFA 4O11A 3A21A 3GDLA 1I45A 5C6MA 4MVAA 1OHLA 4OBTA 3QMSA 4Z0SA 4O53A 1P5BA 1JJKA 3TSMA 4Y6GA 4S1FA 3W7CA 4O19A 2OMAA 3HQ1A 2YXGA 2JGQA 1HO1A 5FF3A 1VCFA 2VFHA 2FJKA
chains in the Genus database with same CATH superfamily
3BE7A 1CBGA 2J7BA 1XFBA 3R8GA 2WQPA 1PTAA 2PMQA 2GJXB 2Z00A 2PP0A 4WR3A 1OK4A 4P7LA 3PUGA 3OPSA 2HE5A 1UJQA 2Y1HA 1KM4A 3VOHA 1XLJA 3WX7A 4RNIA 3ITOA 4AWTA 4BEQA 3B0YA 5BOFA 3QPYA 5CGTA 3TOPA 3QRHA 3G1FA 4IIGA 1PTDA 1MEHA 3W7HA 3RPTA 2OT1A 3QY7A 3CMFA 1A5CA 2NV1A 1A3WA 1T8XA 5CC7A 2NVAA 4TUFA 1LOLA 3VE7A 2VGGA 4BFAA 4PCTA 2W0UA 4PL2A 4XAGA 2C71A 1T96A 4YN5A 3GVRA 1OJXA 2I57A 1OBAA 3IVTA 1FBAA 1XKJA 3MI2A 4OE7A 4NZ5A 1GQJA 1LORA 2OQHA 1KLZA 2E5DA 4HMDA 3XIMA 4WDUA 1SW7A 2VEIA 5FSDC 3UPBA 4EOUA 2Z28A 5A6JA 2G4JA 2Z2AA 3QOMA 4LRSA 5CPNA 2EKGA 5DMMA 2VDGA 2CHOA 3WH6A 4DUXA 3KM8A 1PX3A 2CLEA 3TC7A 1J9YA 1GVFA 1XINA 1VGAA 1FFQA 1WZAA 1V6VA 2WV8A 4L5ZA 4TMCA 1XRFA 3NPWA 1EBGA 3SADA 3EOUA 4QJ5B 4C6KA 1P0KA 4K2SA 4ICCX 2VL4A 4O28A 5FJPA 1ZBWA 2YZRA 3LMYA 4AUBA 4ZZ9A 3VA8A 3L2MA 4U4MA 3T8QA 4GVFA 3HV9A 4OECA 5LNUA 2DT1A 2Y63A 6ALDA 4BI6A 1SJCA 3C2EA 3BQ5A 3IUDA 3QJAA 1LLZA 2CLFA 2Q6ZA 1NFBA 2BG5A 1YYAA 3KW3A 2R24A 1XIEA 3VKBA 2YYUA 4AWSA 1YW1A 1LF1A 4X2RA 2QDDA 3TUUA 1IXQA 1DPMA 2HNEA 2DW6A 4LC8A 3L4VA 4O57A 2OQYA 5BXTA 5LHFA 3CNYA 3ABRA 4I9JA 5MKGB 1HJQA 3ZLHA 3I68A 1POKA 1PJ9A 1XHGA 2CETA 4XIMA 4ROPA 1A5MC 3ITVA 3V0SA 1VCVA 4OZOA 5I3HA 3LHWA 2WSYA 4GD0A 1HW6A 1OCQA 3IWPA 1VC4A 1FWCC 5AC8A 3PWGA 5D8WA 3GVGA 1YDOA 1E0VA 3DFPA 4YJ5A 4ALDA 3II1A 3WH9A 5JBDA 3RITA 1LT7A 2HJPA 3TP4A 4C6OA 2SFPA 2CNCA 4H2CA 3NQ2A 3VZZA 4WJEA 2QCMA 4MKNA 3MSYA 3NQBA 3N6JA 1W5NA 2VM8A 1WAUA 3WFLA 4NJHA 3I65A 4H9VA 4QCFA 3H55A 1ZU8A 3IIXA 4AVFA 3G3DA 2E9LA 1K9EA 4WSKA 1UQZA 4UR7A 2PWVA 1W31A 2WLZA 2UV8G 3Q67A 3DU0A 1MZRA 2UZ9A 1QOPA 2VGFA 4XZLX 3AIUA 2HS8A 4K68A 3W87A 2PU1A 3QQWA 2QVHA 1CLVA 4GINA 3KTXA 2DZSA 3FJLA 4DZIA 1YNPA 2QCCA 2AAMA 4O18A 1BKHA 5GNYA 4Z17A 4TV6A 1NIUA 3QF0A 2Z7GA 3DOPA 2Z0IA 1FWFC 4N02A 2H3BA 5CZKA 4ZSTA 3ITGA 5FJTA 1C7TA 3M46A 1US0A 2XUCA 4B3LA 1UZ4A 3GX9A 2EPOA 1YHTA 1BQCA 3PZGA 4IIFA 1YE6A 1JUEA 2A6LA 1W3LA 1WZLA 2OZTA 3PM6A 2PC8A 5ABFA 1HO4A 3C2YA 3CB8A 4REQB 2QJHA 4L4OA 3E0FA 3KBNA 3NGJA 3QGAC 4WDTA 2Q8ZA 2FJUB 1L8NA 3WDQA 4XKYB 5IRPA 3W2JA 3NR0A 3TMQA 2E09A 4UXDA 2VENA 5SWUA 3LBOA 2Q8XA 4O54A 1UD2A 3WLIA 1TJ0A 3QR0A 3ZR6A 4C6DA 3HG2A 1H4PA 3NL5A 7CGTA 2HVNA 1TV8A 1AA1B 2OKTA 1LQ0A 3H2MA 3RCMA 3N25A 2J9XA 4AWUA 2OYLA 3L12A 5FF7A 2NUYA 1RBOB 2OLHA 3G1AA 1UOZA 7TAAA 5IDZA 3S1UA 4H9XA 3H21A 3EMCA 1KRBC 4A8LA 4Z2LA 4GI4A 3UJ2A 3PZTA 3P67A 4S39A 4Q4PA 3TH6A 3ABQA 3LM3A 3WJXA 3R0DA 1QDSA 3GXIA 2Z6IA 1H1YA 4LY8A 3B0XA 2X0SA 4UC5A 3TJ4A 1B30A 5D03A 1F7BA 1KB3A 3BW3A 1US3A 1XXXA 3UWQA 4D1IA 4MB3A 2NQ9A 2PGEA 4HNTA 1J2BA 2XJ7A 1AK5A 1JXJA 2X2GA 3OBKA 4LVAA 1CGUA 2NQJA 2OZ3A 4AZHA 4RXGA 3UNDA 3SY5A 3NQGA 3WMLA 4J9JA 3B0UX 4F0SA 5A8QA 7PTDA 4AX7A 2LLEA 1N8FA 1N8WA 3S6DA 4PBGA 2JFEX 3C8NA 3GR7A 4G56A 3ES8A 2EGZA 4GXWA 3LRKA 1WOAA 1NWSA 4LVDA 3B05A 3AUOA 3WQWA 4IOTA 4UMCA 1BYDA 2OX4A 3DEQA 3TYCA 1F3EA 2WSRA 3R8RA 1UROA 3PPHA 1GNXA 1Y5VA 3KUMA 4IP5A 4AISA 3MPGA 4WCJA 1JYWA 2NVCA 2WSQA 3VNLA 1KA9F 3PTMA 4XK2A 2VKZG 4PC8A 1B1YA 3MSDA 1EBHA 3WLPA 4KEUA 4TTGA 2VWSA 3E0WA 4HA4A 1FWSA 3SY1A 3W88A 3K4DA 3C56A 4ZENA 4EE9A 4GO8A 3FDGA 5I02A 3IK4A 3GZ3A 2C3ZA 4JX5A 1GZJA 1AVAA 1LWIA 3EDFA 3VNJA 4UFHA 1TPWA 1WB0A 4I9TA 3ARTA 5LNWA 2OWXA 5HINA 4DN1A 2HBXA 1P1MA 2CZEA 4C6EA 1C3FA 1H5VA 3QFWA 4PCPA 1L0PA 3H4WA 5JH1A 4Q4OA 3UJRA 3W6MA 5EY5A 2PTZA 3VD7A 4AD5A 1ZGDA 3KVJA 3GE7A 4LU0A 3GVVA 4LOCA 3CHEA 3N34A 1Q6LA 5I2UA 1EQPA 4MFEA 3MHFA 1H62A 4JX6A 1JPIA 4IICA 5CPSA 5FESA 1XLKA 2XIMA 4INFA 3BC9A 4HYRA 1MNSA 1JQVA 3L0NA 2YCKX 3RMEA 1VLWA 3DXIA 3OVQA 5FOOA 2PDYA 4JCMA 1GKPA 1VJSA 4JIIX 3CB3A 3ORWA 6XIMA 5CBIA 1UPMB 4N7QA 1ITUA 3B9EA 5C0QA 3T0AA 3LI1A 1B9BA 1DJHA 1EIBA 2ZVRA 5ENLA 1QHZA 1GORA 3UU0A 5BWAA 3WLLA 1M7XA 3L9CA 3BJFA 4CKQA 4V28A 2FDMA 4AX6A 3D6NA 3SDOA 1XFCA 2ZFAA 3IIZA 3G22A 1DWIM 2ZUWA 4IFRA 2BOEX 4PMZA 3BLEA 4Q22A 3RU8X 4Y9OA 4DWDA 1W9XA 2DT0A 3TMLA 5CGMA 4ADTA 1JD7A 3GS6A 4QJ3B 5AZ1A 1CCWB 4MJ2A 5BCAA 3TAKA 2VHLA 1JG9A 3CTTA 3GDMA 4GZIA 1J01A 1KXVA 1AW2A 4O4VA 1PX8A 2FMNA 4R34A 4BQ5A 3I3DA 4WOQA 5JXQA 5M1TA 2VI0A 4IGMA 1XPGA 1L6GA 4JHMA 2G37A 1E70M 3KL0A 4PZVA 4RPQA 5I07A 1X6LA 1ENUA 3UEQA 3ONCA 1WYIA 3BG5A 3DFNA 5DT7A 3FX4A 1IZCA 1KM2A 1JRCA 2QDHA 3REQB 2XG9A 4DBSA 2BASA 4HJWA 3SFWA 1D8CA 1BF2A 4PMOA 3W26A 1XUUA 3HFTA 1E56A 5I3DA 5A8OA 4HN4A 1QNSA 1LDCA 1ZZMA 2HQAA 2P3ZA 5FJUA 4IMFA 3P80A 1WKYA 1ZP4A 4XD4A 1A5AA 3LM7A 4PB5A 1OFRA 1MW2A 2GWNA 5A6LA 1DE5A 3NNTA 4IQEA 5CSUA 3FXYA 4LANA 1X8FA 4R33A 2GOKA 4V27A 4FI4A 4I7WA 3TTYA 4Y9AA 2B7OA 1ITXA 2Q3OA 4HSHA 2V5DA 4XKMA 5HPCA 4DYJA 1FWWA 5D2TA 2W9MA 4GPNA 3MJYA 3FSTA 2YCLB 1D7FA 3E2RA 4HNOA 3VABA 1UWRA 3QKZA 4WX2A 3LGGA 3LPPA 4V2XA 4ACZA 1CLXA 2FVLA 1FXQA 4H2HA 4H00A 2IXVA 3IIOA 3T4CA 3NL6A 3UWUA 1TIMA 2BVYA 3IJ8A 4E5TA 5T9CE 3NO3A 4HBKA 3G1SA 3JU2A 4AIEA 4AZIA 4NNAA 3CL6A 2J8GA 3VNYA 3BW2A 3VKJA 3WBXA 4AD0A 1S5TA 3EKGA 1IIHA 3K5XA 1Q7MA 5HULA 3WLQA 3M0JA 2WCSA 5D38A 5I3GA 5DBUA 1WZKA 3N19B 3FJNA 4LYQA 1CGWA 3B0PA 4O15A 3E0LA 2PDPA 1M7PA 5D05A 3ARZA 1TE6A 4XISA 3LS9A 3ZVIA 2J6XA 3S2LA 3OJGA 5DCBA 1W9UA 3AS2A 3PFRA 1G67A 2GDQA 1E6SM 2PI6A 4Z0JA 1I2OA 1K03A 3EZ4A 3VGDA 4QAWA 4QEHA 1QI2A 1BXCA 3HIJA 1W1IE 4WKAA 1BGGA 3LHUA 4HNUA 1KGUA 4Z2HA 1EIXA 1BRLA 1J5SA 3E2SA 4PL1A 3PK7A 3ZJ6A 4NYYA 4AQLA 3MI3A 2R6OA 2OGJA 4HCDA 3OYZA 3C61A 3QPZA 2ZX5A 4PUWA 4B16A 2ISFA 3NDOA 1SO5A 3BUVA 1BTMA 3W76A 1GOOA 3GHUA 3HBLA 1R86A 2E4TA 3BLLA 3G1VA 4RE0A 1W54A 1TPEA 4EWND 4H9MA 3KHDA 5E70A 1Y65A 3SIMA 1XISA 1QFEA 1OK6A 5BRPA 3LHVA 4M6QA 2J66A 1QR7A 4OUEA 1HJWA 4XD5A 3TCSA 1YNQA 2CFFA 3VCRA 4DAFA 4E8GA 4GVGA 1XQLA 2PDUA 3PJTA 1DJNA 4DX3A 1J18A 1O1ZA 1G7VA 4XZWA 2PZ0A 4E4PA 4F0KA 2WAGA 3R10A 1EEPA 1PSCA 1W5PA 3N18A 1WXJA 1SSGA 2WZTA 4NNBA 1GCYA 2G4FA 1M01A 2XFFA 4PRWA 3TCEA 3HG3A 2D0FA 4GKLA 4QSFA 2IMRA 3MB9A 4K8EA 4R9OA 4QIUA 5HNNA 5AN7A 4QE5A 1RCOB 3SCRA 2CPUA 1XYAA 1XLHA 3DH7A 4YU1A 1JDDA 3EWBX 1UA3A 3S42A 1OC6A 1GONA 2PWHA 2JGYA 2X1UA 3IVUA 4HK5A 1S2CA 1M7OA 5T26A 3PAOA 1Q3NA 2PC4A 3RLVA 3MVTA 2D2JA 4IUOA 3LTPA 3KVMA 1QNVA 2YDRA 3FVMA 3VOCA 3L4XA 3P5YA 3N73A 4E6MA 1NEYA 4CEUC 4FSAA 3VMPA 3E5PA 4JTDA 4MM1A 3ME3A 5CC3A 1XIMA 4MWAC 3RN6A 2D23A 1MUCA 4TTUA 3GAYA 2GJLA 4Q33A 3WNOA 1HG3A 1S2AA 3MY9A 4PEEA 4EPKA 2VFFA 1YXYA 3W7OA 5K9CA 1ESWA 4P7QA 2OX1A 2FPTA 1CTNA 1WBHA 1FY6A 2J47A 3FA4A 1L8PA 4DNHA 3CT7A 1RY0A 3PZ9A 4DEFA 2A4AA 1SFLA 3L4UA 4PUJA 2PLMA 1I0DA 1S5MA 3CWHA 2QCLA 2FH6A 1XYZA 3VZYA 1R87A 4JTTA 3N6HA 1E1CA 4A29A 4QSHA 2QF8A 1VKFA 3C2RA 1ZBCA 4JFSA 2RUSA 4H6EA 4ZEPA 5FI8A 2XINA 2OO6A 3L65A 1U22A 4JNYA 1EX5A 2PF0A 1AQFA 4E4FA 5A6BA 1DBTA 3M43A 1R85A 2PGFA 3V75A 3WQDA 3O63A 4GGBA 4WRHA 4BA0A 2HXTA 3A24A 1CT5A 2J88A 2P53A 5MF5A 4ZE4A 4ATDA 1VEMA 3V5CA 3LCWA 4W93A 4XV0A 4LRTA 4C6CA 1Z69A 2HISA 4JS3A 3MDWA 2PRLA 4TR9A 1A4LA 5AC4A 1DEDA 3C2FA 4LB3A 5HJLA 3MCNA 3QN3A 4S3BA 3KWSA 4M80A 2D73A 5KZEA 2ESCA 7ENLA 2FVMA 4JNZA 5E0CA 2P50A 1ZAHA 1PIGA 4DJED 1S2VA 1YXCA 3E5BA 1Q6EA 3GVQA 1TV3A 2C1GA 1A0CA 4PMXA 3LGEA 4LS1A 5REQB 1KR1A 2NWSA 3MUY1 1W6TA 4U2YA 4O1EA 4C1KA 2PU0A 4HCHA 5E09A 2OYKA 3NQMA 3T09A 4DYEA 2DZXA 4A8RA 1IEIA 3QV9A 3LOTA 3OA3A 2ATMA 2DQWA 1VLIA 2Z2BA 1W3IA 5E5CA 2NZLA 4JYEA 3NOEA 3MI6A 2ASHA 4LUTB 3RPDA 2HVOA 3FAXA 1MFVA 1J6OA 1NDVA 2V9DA 2NVDA 4O1AA 2PURA 5RUBA 3ARUA 2YBUA 5JVLA 2YL6A 3TVAA 2YCIX 1SJAA 3DFYA 1KM5A 4WDXA 3GC2A 3GZAA 1A0EA 5I3IA 4I8DA 2Y24A 1ITCA 4U5IA 4DPPA 3BV4A 4GIYA 1WV2A 3HURA 2R1PA 2VELA 3LRMA 3ZFHA 4UZUA 5LIUX 3TQPA 3O1NA 4PTMA 2AAAA 2PDFA 4DAIA 4CNTA 4LX4A 1Q85A 3TC6A 4RXFA 2RH9A 1G5AA 5DRIA 3EB4A 4I5UA 2WKJA 1KBBA 2RFGA 4IHCA 4XZ9A 3EEGA 3LQGA 5AOUA 4JDYA 5J5DA 1FWEC 4GYPA 3SCWA 3WQGA 1OGGA 1RAKA 3IK2A 3HMCA 1DVJA 1NF7A 3NQAA 1L6YA 2A2IA 4C91A 4CD4A 4DRSA 5HMFA 3QBUA 4DM1A 1EDGA 1UZDA 2OB3A 2BXVA 2V67A 1LQAA 2VRJA 4NU7A 3ABOA 3KCOA 1XICA 4GK8A 1F07A 3N15A 1OABA 5HJYA 3EX4A 1MRAA 2BLEA 3GKAA 4AXKA 1SZRA 1E72M 2CYGA 1PO9A 2OOFA 5G4WA 4XO6A 3CV1A 2OGYA 3W02A 4I7UA 1FWRA 3GG8A 3T40A 1CYGA 1E6RA 1EJ7L 4LV4A 4MZYA 4Z2GA 2GOUA 3QZ6A 1QVBA 2OXNA 3WMBA 1YBQA 2CLKA 3DFSA 3SQMA 1JDFA 1S5NA 1B2YA 1T7LA 3T0TA 2NUXA 1TWSA 1F4HA 2VXNA 3GTNA 2XM2A 1TRDA 2OTDA 1G0CA 2H8XA 3O06A 4IJCA 5D04C 1OFPA 2J9YA 5D2VA 3V1PA 1PX4A 3GDBA 5G1MA 3M6YA 3FEMA 4F40A 2L5HA 2DORA 2JBMA 1TVNA 4C6MA 4QJ4B 3VIGA 4U5KA 2B4GA 1HUVA 3S3GA 3BOFA 2FYMA 1X1NA 2J7GA 1IIGA 5LIWX 4S3GA 4IPNB 3OVGA 3WJZA 4UUIA 4J35A 1N82A 2J8FA 2Z24A 3WUGA 4JAWA 3S9YA 2DDXA 2ZA1A 3LPFA 3EXRA 1A5LC 2GK1A 1H1ZA 3T0CA 3MHGA 3UWZA 4FZIA 1TX0A 3UNTA 1ISXA 3POCA 2E9MA 1GPWA 5AHLA 1UWUA 2QCHA 4YTUA 4HPHA 1NQ6A 1M68A 5C9UA 1VFFA 2PE4A 1K02A 2J75A 5FEWA 2DZBA 2YB4A 3NSXA 5LNSA 4QRNA 1K4HA 3RFAA 2WWDA 2ZA3A 5IDIA 3SCUA 3FYYA 4Q4MA 2PWGA 2H9AB 2XSAA 1OFEA 1TG7A 3SCOA 1FCQA 2WMJA 5D8ZA 2ABBA 2QCGA 1ML1A 2WBKA 3GAKA 3M9YA 1FH8A 2WCGA 1M3UA 1LCOA 3MMWA 1R38A 1SM9A 1E73M 3G0UA 3OZMA 1AMYA 4FLQA 3ZIZA 1NH6A 4KRZA 1UUQA 1SJDA 4H7ZA 4JICA 1YPXA 3D46A 4UIOA 4UTLA 3D3FA 4AIUA 1JCMP 2VCCA 1FA2A 3FFSA 1JL8A 3DZ1A 3TIMA 4ADSA 2QV4A 3ZZ1A 4IISA 2VUYA 4NX0A 3SCNA 3S9ZA 4A05A 3YPIA 3TYEA 1O94A 2E8YA 2XFWA 1ICSA 4LUSB 1U5HA 4ATWA 2C13A 2ZX7A 1SZEA 3E1F1 4V33A 1PCKA 1W17A 4Q8PA 3LCFA 3WD3A 2HZGA 1QPKA 2WHKA 3W73A 1ONXA 4ZOAA 4G7EB 1W8GA 1IXOA 4KWVA 5ABGA 1THFD 1CECA 3EB3A 3EKLA 1OWQA 5G5IA 2JKPA 1ONRA 1VJIA 4LQ1A 5CPTA 4JKKA 4N4PA 4BHYA 3QFEA 3WK2A 1F6YA 4IFKA 4PRRA 2ABAA 3G1DA 5JIPA 1FHDA 2DT2A 4P7OA 4ZO6A 1WO2A 5DMNA 5CLTA 3L2IA 4NG3A 4HNVA 3UWWA 1VFOA 4W84A 2C19A 1B3OA 3ZT6A 4NHVA 5A6AA 3WF2A 1DKWA 4E2VA 3GTXA 2Y7EA 5EKYA 1OX5A 3C0SA 1EJUC 1YQ2A 4IMDA 3Q94A 1OZMA 4M8UA 4M51A 4AF0A 1E0UA 2C14A 2VFDA 1VPYA 1H09A 1W5MA 3IIVA 1QMLA 2PD9A 3GM8A 4Q4SA 2GGHA 1ISZA 3KBMA 2NQZA 3AHVA 3JRKA 4EVZA 3LXCA 9CGTA 3R0KA 3ZYZA 4XBKA 1IHIA 3QHOA 3O6DA 2BWGA 2PTXA 3K8KA 3RM9A 2WVVA 3GW0A 4AZ5A 1Z8AA 6TIMA 3F2DA 4TX6A 2V3EA 4KW2A 2RAGA 4BQ2A 4F8XA 3LCGA 4GZJA 3N13A 1QI0A 2YZ5A 4H6RA 4D2JA 3WUEA 4Y96A 3GRIA 4WY0F 4JFUA 4B5SA 3VIFA 4MWAB 2HPIA 3S1XA 3WNLA 4XX6A 5D9PA 3GYCA 1XLEA 2A7NA 1F74A 4M82A 3U7VA 1Q2SA 4HMNA 3WLNA 1EDTA 1ZCCA 3WK3A 3W2NA 3I6TA 4B90A 3S1WA 4XUGA 1LWJA 2ZDRA 2PGRA 3BLDA 3VAVA 3PBWA 2NLYA 3M0XA 3GNRA 3RLGA 4AAJA 3PNZA 3B8VA 4PUMA 4A6GA 1MMFA 4H7VA 1XH1A 4HD5A 5AECA 3AHTA 1EWEA 3UERA 1GYLA 4D8ZA 4URIA 2X1TA 4FXRA 3HN3A 1NOUA 3MP4A 4GNVA 4CU8A 3CIWA 1UQYA 1V93A 4G9PA 5M3WA 3F03K 3A3HA 3NM3A 3CO8A 1E71M 1QBBA 1P7TA 1V6YA 3HF3A 2BV9A 3TA9A 4UCFA 4ZQNA 1V6UA 4TO8A 4TIMA 1RK5A 2PBOA 4P2VA 4MNJA 4DIAA 3GTFA 1OINA 1YRRA 4NXSA 1MQQA 5LHEA 3WELA 4H83A 1FDJA 4FIRA 3SUVA 3WLOA 1B3WA 1I0BA 4RE3A 3A6OA 1I45A 2UY4A 1O5QA 3OGVA 1OHLA 3OA5A 4OBTA 3QMSA 4UQBA 2BP1A 3HFYA 1R3WA 1QASA 3LZ3A 3TSMA 4S1FA 2YB1A 4O19A 3RUBL 1UZ1A 2JGQA 3KTSA 5FF3A 4YVVA 1VCFA 3OODA 2FJKA 3A4AA 3LNPA 1F6KA 2DZAA 4FS9A 3DBNA 1EP1A 2HS6A 4RV8A 2CLIA 3SUTA 4JIQA 4F79A 4UTTA 3ZT5A 4MTVA 3W01A 5KTLA 2NQLA 3K30A 1XGEA 1C93A 2ZKMX 2TSYA 4ECLA 2E6AA 2WMIB 4BWLA 1BWLA 2BNJA 4UCGA 3K4AA 3I3BA 4TQTA 4NP7A 4YTTA 5AHMA 4CNOA 3K1GA 3T2PA 3VFLA 1V8EA 3H7RA 2QYGA 1YEYA 4C1LA 3PWIA 4M6PA 3MWCA 1G9HA 5AC6A 3OIHA 3GB6A 3IUIA 4GO9A 2MANA 4Y2WA 2BHUA 3BAYA 1FWAC 2PCEA 4NT0A 1AMKA 3GY1A 3EPMA 1K4GA 1KV8A 3W74A 4H8NA 1SSDA 4JEQA 4EF9A 1FVPA 2REQA 1E40A 1RCXB 1Q7QA 2IS7A 3SI9A 1HZYA 3UG8A 2FTYA 3U7BA 6ENLA 1KNWA 1KR0A 1BWVA 2A79A 4ML4A 1YKWA 3G1YA 1NWRA 1CXKA 2I14A 1RJPA 2JALA 3MHUA 3B8IA 1M5WA 1J11A 4KCTA 1HXJA 4DJDD 1XC6A 1JPKA 3WF4A 1I2NA 3KE0A 3O2LA 4IMEA 3TC3A 3E2QA 4H8VA 4Y9NA 5HA7A 4H4IA 3PPGA 5IBXA 3P82A 1ALDA 3W83A 4GCAA 1RR2A 1XRTA 4YWSA 2OWCA 4NXKA 4GIRA 4GUFA 1AZ1A 2GGIA 1HKVA 4H7CA 3O0FA 5LNRA 2VEMA 1XIJA 2OSXA 4FOKA 3EOOA 4LTSA 2V5BA 2AL1A 1IV8A 3BOXA 5CSYA 1C29A 3VFCA 3RRXA 4ZTYA 5C2CA 4JTJA 2I5IA 4F3HA 3NQEA 3KDOA 2I16A 3SAZA 1QI5A 4IGHA 5C9XA 1C8YA 3L4WA 1TMHA 2W27A 4B5UA 2DU2A 5TD4A 4XTDA 4W86A 1UG6A 3T0DA 3PWAA 3CQHA 8CGTA 3N12A 1TA3A 5FL0A 5A6BD 3CMJA 3UPMA 4O50A 2X42A 1TPUA 4YTQA 2R82A 1H7RA 4GX9A 4Q8OA 1W1PA 4GC4A 1NARA 3VTRA 3MUXA 5EPDA 1XQKA 4NAFA 2WO5A 1XBYA 2BXZA 2X7WA 1CPUA 3PNUA 3UJSA 3IANA 2A7RA 2AMXA 3THAA 2E5CA 4RNFA 2PTWA 1WDPA 1L2UA 2RHGA 4AB4A 1KQYA 5CC6A 4JQ2A 5AZ0A 2WMGA 3N4FA 3ERPA 1H7XA 3IV3A 1W8SA 4IX2A 4EPEC 4HNLA 3TZNA 4M19A 3WF0A 4UR8A 1A4MA 4AZ6A 4UNIA 2B7NA 8A3HA 2F6UA 4Q7IA 1BG9A 1PV8A 3DECA 2CZ5A 1TTJA 3P3BA 1Q63A 4PEKA 2OVLA 4J28A 3AWOA 5U4NA 3FA5A 1HL2A 4RNJA 4DWSD 3WEMA 4M7SA 4LXFA 1GW1A 4R27A 1CXEA 1QPOA 2WMFA 4IF2A 5LZLA 1GWJA 2YBVA 1VF8A 3FY1A 4DY1A 3U0HA 5CJ5A 1KFBA 1DJGA 1O5XA 2XVLA 3TFXA 3J7HA 2Y5SA 1MO0A 1GYNA 3H26A 3F5JA 4B9YA 3UBPC 4PFHA 4R53A 3A4JA 1JZ7A 4IXXA 2GLKA 2XFYA 1DWAM 3M16A 3BSHA 4GZEA 4NZFA 3E0VA 1P0NA 4QG9A 2IW0A 3W7NA 5AYXA 4JTAA 3WSUA 4EXBA 5F1UA 7A3HA 2X16A 4HU4A 1FWTA 3W1MA 1CB7B 3RIKA 5J04A 3VGEA 4I5RA 2F6XA 3VOIA 2VD8A 2ZTJA 1XR2A 2DT3A 2XZ7A 1IYXA 2XYLA 5KINA 5DXYA 4MLJA 1VPQA 3RO6A 3R4IA 3ZM8A 2EG7A 4JTUA 2BBFA 1XLCA 3CM4A 1WDDA 4C7DA 1SMDA 5CAKA 2QS8A 1MSSA 4WJXA 5GJNA 2UBPC 4PRTA 4UFJA 3SSZA 3URNA 1B4KA 1E6XM 3IV8A 3UZ5A 2VVSA 1SZGA 1UBPC 1CB2A 3G5EA 3G8RA 2DIKA 3HJZA 1RPKA 1P0DA 2ZXQA 2IPGA 3KBJA 3SRDA 1JCXA 2XN1A 5DO8A 3A12A 4A2SA 2B81A 3QZAA 3MSGA 1QW7A 3BL3A 1QPNA 2GGJA 2Z1KA 3CXOA 3W1NA 4IIBA 3SCPA 2JIWA 4GVHA 2XH7A 3L2LA 3AIVA 4X63A 3VIKA 1HJXA 1R47A 3MC5A 1DQUA 3W84A 3PJWA 2YXXA 2QDEA 4NI3A 1V3HA 1PHWA 3NAVA 3RX3A 4QAIA 1Z7AA 3LA4A 4LALA 3LLXA 4E3VA 1I8JA 3FYOA 2XFRA 2BDQA 3BCDA 2XVGA 2C8NA 1LWHA 1XIGA 2NX1A 3CYVA 2EEXA 1SO6A 5ABFB 3VU2A 4HZ8A 1L2QA 2E9BA 4ZO8A 3W72A 1JCNA 3UPWA 4ENLA 2VOMA 1W3KA 4QLLA 2BVDA 3L0KA 3W81A 3R1ZA 2Z1VA 2ZX9A 3PJXA 3ZXWA 4HOWA 2D0GA 4LUJA 2CC0A 2PCQA 2QUVA 1FUYA 3QOKA 3CZLA 3TEVA 4PE8A 4IPPA 3VDGA 4CVUA 4BI7A 3FYPA 1V3JA 3PZUA 1A47A 3G77A 1OC7A 1FQ0A 2CLOA 1EJVC 2HMCA 2FTWA 2Y8UA 3TXVA 4DBWA 3AZTA 1KKOA 3EA1A 1UBSA 2W63A 4PMYA 5EL1A 4A35A 2ZE0A 1EUNA 3M0ZA 4HN8A 4WXYA 2H90A 3VCCA 4WHBA 4AD3A 3WK0A 3DI0A 1KCLA 1TTQA 1ZHAA 2EO7A 1HVQA 4OOUA 4C6LA 1RV8A 1V3KA 4YWIA 4MFDA 3I6RA 3VD5A 4O12A 3GH4A 1XG3A 2B7QA 1H60A 5C5YA 4AY8A 1U5JA 3PY2A 3UJFA 1FWGC 2AQVA 3NQDA 1QBAA 3WD1A 1O95A 2A3LA 4PTWA 2DZVA 1BLIA 3UT0A 3MDUA 2PSNA 2XM1A 4C5YA 3IAQA 3WL1A 3GBEA 4TMBA 2BFGA 4RJEA 1E15A 3DHDA 3VCNA 4UOZA 2DSZA 1LL6A 1Q6FA 1PPIA 4XUYA 4KT2A 5I78A 4CD5A 5G4HC 3MVIA 4JHOA 4M24A 5C70A 4GX8A 3U4FA 1XBZA 3HQPA 2ZC8A 2FHBA 3N2BA 1UR9A 3GC4A 1PE1A 2BGSA 3LHTA 4P8UA 2ZADA 2I5QA 3THCA 3W75A 3V3WA 2AOSA 4JTQA 3CMGA 1B4EA 1H3GA 3DCPA 4DLFA 2V5CA 2VEKA 4DUWA 5HR6A 4PCFA 2W91A 1HVXA 1VFHA 4BZYA 4OV4A 5FJRA 4BCEA 1TE1A 3LD5A 1HF6A 4GKTA 1LLOA 3DGBA 2E0PA 3BANA 1KLYA 1EQCA 2AGKA 2YKKA 4GI8A 3G18A 1TZZA 1GKQA 3GNNA 3O9NA 1W56A 4X9YA 4GRSA 4IMGA 1IEXA 4Q8WA 3WQVA 4RZBA 1WQ5A 5MKGA 4B4HA 3FIGA 1W5OA 1EC8A 4US5D 2QAPA 3LYEA 5C55A 3TN3A 4HPJA 2WC7A 4GY0A 4L80A 1OCJA 3C3NA 4JDBA 2BY3A 5AYZA 5A2AA 1OY0A 3TLQA 4MJMA 1GOWA 3WD0A 4R3UA 1B3YA 1X6NA 1E4MM 3HO8A 4P7RA 3SIZA 5K2ZA 1X1OA 3FKRA 4HHMA 3ZR4A 1ONEA 1XDLA 2CKSA 4XD3A 3T55A 1KFKA 3H4GA 5CG7A 1JPDX 1GQLA 5ABTA 4A8IA 2I7GA 3SRHA 4NASA 5C9WA 2WYSA 1UMYA 3S5OA 1NP2A 5HATA 1TRIA 4KIRA 3P14A 5EA9A 2JEPA 2QXWA 2EKCA 3TJXA 2H8ZA 1V08A 4CLMA 2AQWA 4MHBA 5HNRA 1PVNA 1V3IA 3L66A 1F73A 5HWJA 1ADDA 4NJKA 4GQRA 2IQ0A 4J3UA 1AJZA 2BGNE 3UVIA 2WZIA 2D2HA 3UZYA 3CIXA 4JTKA 4GYPC 1OT1A 1YADA 1KBJA 1OYCA 3MCMA 4FXJA 1UWAA 3F4CA 2HEJA 2BZNA 4B3ZA 2YW3A 5A95A 3A3XA 1O6IA 1P48A 3AMCA 3A47A 4J3ZA 1K70A 4B4FA 1FHUA 3OP2A 3RM4A 1XCXA 3E96A 5G1YA 2XH0A 4AC1X 1UH4A 1JZ6A 2WZHA 5AB3A 4D71A 3UQNA 2OT0A 3XINA 6PTDA 4GIAA 1OX6A 5H91A 5BMXA 3BK0A 1TPB1 3DGRA 5D09A 4QQUA 3WFAA 4R7OA 5E6ZA 1H7OA 2X09A 4L56A 2J7HA 2V2DA 4R9XA 2VVNA 4IFOA 2RDWA 2ZDSA 1CDGA 2A0NA 3BSGA 1RALA 1EA0A 2JF6A 1LT8A 2BVWA 2YL9A 2ZRUA 4X0NA 5ECUA 1ZJIA 2VOTA 2JF7A 5IHSA 4D8AA 1WKEA 4PR4A 1T0OA 1Q8JA 2VRQA 1GOIA 3AYRA 4EANA 1A5NC 3QMTA 3OLIA 4B2DD 4ZMGA 3Q2DA 4AYGA 1V02E 4AZ7A 3OEXA 1OGBA 1UWTA 1G6CA 3SBFA 4DPQA 2B0MA 3UZZA 1VRDA 2DUAA 4B15A 1TVPA 1O5KA 1W9BM 2FZBA 3H6OA 1P6CA 2D22A 4W85A 1XDJA 4IM4A 4B5WA 2JEQA 2OEMA 4Z2JA 3AXMA 3DYMA 1RBAA 2V5JA 3M6DA 4PH6A 4DLMA 3E0IA 2EAWA 3BG9A 2ZUTA 3V5OA 3ZO9A 1XD0A 3V16A 1SR9A 4UTJA 1TTPA 2WHLA 1C9DA 3PG9A 3ZJ7A 1K6WA 3TTEA 2OO0A 4ERAA 2W61A 4Q7NA 2QEZA 1OFAA 3PZOA 4O4WA 1JIBA 4WGXA 1ITQA 1OIMA 2CZFA 4FOUA 5C2XA 4L64A 1KD0A 4O0QA 3PF3A 3F4DA 4PCNA 1WA3A 4LH8A 3KP0A 2DSVA 1BGAA 4M3PA 2GGEA 1RHCA 2WK2A 1DQXA 3KRUA 3W00A 4JIPA 3EXTA 3FVDA 1QRQA 1OCNA 4W4QA 4AZCA 2AKMA 3GDTA 3BAKA 2ATSA 3KEHA 3CL7A 4B5VA 2XGZA 3BCJA 3A4WA 1TIWA 2Z6JA 5CBJA 4E2BA 1ZAJA 1TJ2A 4R7WA 5E0FA 4L6HA 1ZS2A 3C6CA 1RSCA 2X8RA 4DO4A 5KMYA 2G3MA 3EX2A 2QIIA 4O14A 1XCWA 4JFTA 3WQ8A 4GG9A 2VC9A 4RUBA 4I7VA 1MW0A 4K39A 2YL5A 2POZA 5FEPA 1BRLB 5EB8A 1E9LA 1F4AA 5A5WA 4Q8TA 1Q4WA 2YX0A 4C60A 1C90A 4RZ5A 4PMNA 1OCBA 3MKCA 4BQ4A 1XSJA 4NZ3A 2VT0A 3HGJA 4AYSA 4NJJA 3KX6A 4W8LA 2QJNA 4Q8UA 3C4UA 5LIXX 1IT0A 3BGGA 1UR0A 1XDMA 3CUXA 1WDWA 3QY6A 2HSAA 2NQ5A 1SW3A 1IZKA 2ACSA 1TB3A 2X2YA 1WE5A 1F6PA 3I4EA 1JCLA 4YLWA 2GVLA 4MY1A 3DAQA 5BW6A 3KWXA 1M7JA 3WQOA 4QE1A 2BXYA 3KVLA 2VX4A 1UUMA 1C8VA 1VEPA 4R85A 4WZHA 2FFIA 3N1AA 3W7IA 1BKSA 3H4XA 1GQNA 4JQAA 1WNOA 3TSDA 4RDZA 3THUA 1CXHA 4FXSA 3M0KA 2CIPA 3ALFA 1S38A 3AZSA 1EEXA 2HBVA 3W1PA 2MNRA 3NQFA 4I6VA 3M64A 1G7UA 4PMRA 4A3UA 3C5QA 1MXGA 4IQDA 1VFLA 2A1YA 1UH2A 1ADSA 3S0CA 4DUVA 3T78A 2FB2A 4DHGA 5HANA 2IKIA 3IJDA 4J3XA 2ZWYA 1DIEA 1JUKA 4BI5A 4O0ZA 2ZRXA 4HU0A 3PC0A 4UMAA 6TAAA 3HGRA 1SUXA 1R30A 3A22A 3SZ8A 2C0AA 4O1FA 4C7FA 1X8CA 1PWMA 4QITA 3S2NA 3CUIA 3JZUA 3VO0A 3PG8A 1U1UA 4FNUA 4PMUA 1E3XA 4OBSA 5BXPA 4OOZA 4F0MA 1TKKA 2ZZ6A 5KITA 2GUYA 1GZ1A 3EDJA 2VURA 2DUXA 4PGLA 4GUJA 1WX0A 4S2BA 3H7VA 4D6DA 4N42A 3B8TA 1F8MA 2J4GA 4U2ZA 1M41A 2DQXA 2XIOA 3CYJA 4FO4A 4DQWA 4LAUA 1M6JA 4H01A 2WVTA 5FEZA 4QDWA 2VX5A 3FLUA 4GABA 2WW5A 1FH9A 4JIRA 3AMLA 1FOBA 5XIMA 1OG0A 3CTLA 2F9RA 2GVGA 1FKXA 2QDGA 3BLFA 2FPYA 4WKHA 3CQ0A 4J1OA 4LEFA 2C1IA 5JU6A 2J7EA 4ERIA 4GY1A 3GVWA 1HQTA 4NSBA 4FALA 4PODA 2ZRZA 3TLLA 3CU2A 5D9MA 1JZ2A 3GFZA 1UMLA 1E5JA 4B92A 3GDKA 4Z1DA 5EFFA 2QF7A 1EO7A 1RXOB 5H8PA 1Q6RA 1BWKA 1P1XA 1OYBA 1Y5WA 4C65A 2FFCA 5D32A 1XW8A 3RAOA 4HPGA 4L6DA 1BQGA 1GVQA 4ZOCA 2NLIA 2QW5A 5AYIA 4OU1A 2ISVA 3P93A 4WY0A 4BF5A 2GUBA 3QH2A 3FSUA 6XIAA 2VZVA 1W32A 4IQJA 1E6ZA 4WKFA 1FWHC 3CZJA 2GGGA 1RY8A 1O60A 3GR8A 4DZ5A 5L9FA 3SSJA 3FDKA 3FNDA 3KRSA 2X0YA 3HQOA 1PUDA 4JN6A 3IJ7A 2G3JA 1TCDA 1PAMA 3ZOAA 6A3HA 4X0VA 4XSMA 4UTTC 2V3FA 1KXHA 3U2CA 2VCBA 4BWLC 1DORA 3NUKA 1LL7A 1Q65A 2UY5A 3BCFA 2YSWA 4W8BA 4HU8A 1DQWA 2I9UA 1AG1O 2O9TA 4TU1A 4MOZA 1OSEA 1K7EA 3SEPA 1NVMA 4HNNA 4DZHA 2R91A 4L1GA 3NURA 4FR1A 5HPOA 4XZHA 4KRTA 4RNHA 2Q02A 3K1DA 1V7AA 4WEVX 3TTQA 2R1NA 4W7WA 3STPA 3WLHA 2FGZA 5D30A 2VZOA 2CBJA 3MBFA 3IS4A 3NDYA 4QR6A 4IMCA 1OQFA 2WANA 2V63A 1ECQA 1QCWA 1NDYA 1EWDA 4A3QA 2HCVA 4XZIA 4JTRA 1J5TA 1V7YA 1I60A 1VH7A 3OZPA 1N8IA 3WQCA 5JBFA 1XP3A 2YXOA 1V5XA 4V1XA 1QHPA 1VBUA 2F2HA 4QHRA 3KOXA 5IBXC 4KRUA 4FLSA 4ZSUA 3DENA 1MI3A 1W2PA 2PDMA 1R0MA 3CZ8A 4P7NA 2HXUA 5HQEA 1X96A 4LCRA 4M6VA 4UTKA 2CHNA 2FDSA 4OUIA 2WNQA 2CLPA 3ARWA 2WKGA 1UPPA 3FCPA 2Y8VA 3NA8A 3P8IA 2TMDA 3CK5A 3O07A 5LIKX 2Z1BA 2RGMA 1K7XA 4Z2KA 1DXFA 1XLIA 2OZ0A 3UXDA 3LX9A 5F4SA 3ARVA 2QCDB 4ZQMA 5KZ6A 4DJEA 7ODCA 4NVTA 5EMLA 2QULA 2ZYFA 3LNMA 1KFWA 1HJVA 1ZSXA 3SN1A 4UNLA 1RK6A 4AXNA 1B54A 2PPGA 2XN2A 1Q13A 2P10A 2XZ9A 3PSWA 2ZZ4A 2ON3A 1PKYA 4U10A 1YBQB 1WZMA 7REQA 1AODA 2ACRA 3KBSA 2Y70A 3BXWA 2ZOXA 2V2CA 2EJAA 4L4LA 3M07A 3RO8A 4UTIA 3AC0A 2Z7KA 4GHRA 3PZNA 3BAIA 1YTKA 3S1VA 2VQTA 1H50A 4GI9A 4H1ZA 4CD7A 4XAYA 3TJLA 4ZA0A 2F7FA 3UR7A 3LZ5A 5DT5A 1GG1A 2DSKA 2P88A 2GDUA 4E8DA 1HGYA 4ILSA 2PTYA 3NDZA 4LV9A 4PA8A 2OOGA 2D0HA 4D6GA 1A5SA 3LDVA 4FPSA 3LLDA 1K9TA 5BRBA 4MZ1A 4DJFD 3USZA 4N4QA 3WDHA 3PN8A 3N9KA 3DERA 1QW9A 4YVPA 1H1NA 2J27A 5A8GA 1CW2A 2GK1B 2INFA 1X39A 4G2DA 4LCSA 3B9AA 4AMAA 2EBNA 3UW6A 1K7FA 4IG2A 4ZBCA 3BICA 5BRQA 2V6AA 1O12A 3T2QA 2PUZA 3DFOA 2C18A 1LROA 3DC8A 4D6JA 3ZSTA 4N0RA 1PYFA 4CNSA 3RK8A 3GNXA 2HROA 4EX4A 3AYTA 3D47A 2PDBA 3N4EA 4HQVA 2Y88A 3BAXA 1R9ZA 3TWBA 3ZVHA 2WMKA 1AJ0A 4I3GA 4JN8A 2CXGA 1EB3A 1DTNA 3L4TA 1GKRA 1WXZA 4NYUA 3DBPA 5A2CA 3GG7A 1RZMA 2G97A 3GW3A 3PBYA 3IACA 4H9YA 1PHQA 1EP2A 3S2JA 5TNVA 1TQJA 4UQEA 1ICQA 5REQA 2O9PA 4C6JA 4JHZA 1XS2A 1GVOA 2OKOA 3R7MA 1H7WA 3PULA 1ZTVA 1W3TA 3F2BA 4MZ8A 3RU6A 1H41A 2Z1SA 2G3FA 3LG3A 3VDCA 4GQ0A 1R3RA 3NQ8A 4DVOA 1S2UA 1SU5A 1PL9A 3QGVA 1E4IA 4K3ZA 4KMQA 3UGVA 1FP8A 1R2TA 1Q6CA 3R8HA 3B9OA 3NTYA 4G1NA 4H3DA 5HNUA 4D6HA 2PB1A 5BMWA 4JPGA 3WQ4A 1MXSA 1K1DA 1R5YA 1XG4A 3Q45A 3MO4A 4JFWA 2ODOA 4CQDA 1UWIA 4KIEA 4CCZA 1S39A 1DL3A 2A3EA 3VPLA 1KTCA 4J40A 2FLIA 4GQGA 3NXFA 3FAWA 1FTXA 1HKJA 3KTCA 1JCJA 5FJJA 1Z3NA 2Y4SA 5G1TA 1AD4A 4RKAA 2KAUC 5CH9A 2BODX 4J4KA 3O0KA 2W3ZA 3RLUA 3SQLA 4W5ZA 1Z89A 1K8XA 2YDQA 1ODZA 2POTA 3I3EA 1XH0A 3G0XA 2X05A 4C90A 1IQ8A 3LN3A 1XUZA 4LVFA 1XPYA 1HJUA 3NCOA 2E28A 2GSHA 4QG6A 4Z1BA 3IJQA 3S83A 3W37A 2WC3A 3KZPA 4O52A 3BURA 1GVRA 3H54A 5FAGA 1YPIA 2E1WA 1GHSA 2DIEA 3MANA 4DBUA 4RZ6A 1CXIA 5HBFA 4Q3MA 3V0UA 4CNPA 3W86A 3WY1A 3O15A 1KXTA 4LGXA 3AXIA 1YDNA 3EOEA 3VGGA 4TVUA 3R43A 1V0NA 4JTHA 2BHYA 3LLFA 2DH2A 2E8ZA 1EO5A 5B7ZA 4MVAA 4JL2A 4S3FA 4O53A 1W1VA 4LF2A 4KWUA 3R94A 1CLKA 1UR8A 2R1KA 3VNIA 3DG3A 3RG6A 1XF0A 2VFHA 2C79A 3LU2A 4O8AA 2WNNA 3N14A 3LV5A 4Q8NA 1HX0A 4IWWA 1FWDC 3S1GA 2KX9A 1Y7VA 2E6DA 4RW5A 1OB0A 1IEWA 3VOFA 5HMEA 3HOJA 3EMZA 3A9BA 4HMEA 1EZ2A 2WOQA 2NX9A 2V81A 1KBKA 3OU8A 5AHEA 2J7FA 3KRZA 5FF4A 3R11A 3PJUA 2V0TA 5BZAA 1MUMA 4L7ZA 2AGTA 2QR6A 3G8EA 1K8CA 3VOGA 3DKJA 3IJLA 1FDYA 1IE7C 4P8XA 2Z26A 2WM1A 4JQ3A 2G50A 5DF0A 4FIQA 2OZ8A 4DXXA 3OYXA 3ITLA 3LCIA 1XLGA 1GJWA 1AW5A 2YFOA 3STEA 3VMNA 3B0VC 2R9RA 1C91A 2XGIA 3FA3A 3OLEA 5FKYA 1XD1A 3AIWA 4GQBA 4NKCA 1UP3A 2QAFA 1V6WA 2XN0A 5E6YA 1QT1A 4HYWA 3FKKA 4DXVA 3MSRA 1KBIA 4S2CA 4C6FA 1KRMA 4DXKA 5CCZA 3WL0A 1KWKA 3S2MA 3O16A 5K9XA 4MYAA 4JD4A 4DO7A 1XBXA 4ML9A 3NO1A 3SECA 3RM8A 2WSPA 4UOJA 2HWGA 1P6BA 4KKXA 4DJFC 4WQ6A 1AH3A 4LSBA 1WOBA 2CLMA 4AFYA 3CH0A 2GJRA 4EKJA 5A8MA 2DPEA 1KGXA 4EACA 3P2VA 1Q6OA 2A5HA 2QCEA 2J24A 2VMFA 4J27A 3URQA 3R12A 3CAKA 3CV6A 4FMVA 3W7EA 4DF1A 1KCXA 2ZQ0A 1IWBA 2Y7GA 1WCGA 3LY0A 3EOSA 3EYPA 2ADAA 3GXDA 5D2WA 3SFKA 4QISA 4BY3A 4I90A 3MMDA 3R25A 2JQXA 3CBWA 4AW7A 4FX8A 1A50A 2XVPA 4GJIA 2NUWA 2REQB 1UJPA 1MFUA 1Y0EA 2DVUA 3O8AA 4ZOBA 3E74A 4RDWA 5FSEC 3N2MA 2Z4GA 3S5SA 1YMYA 2P8BA 1JCTA 2Z1XA 3SUWA 2FGLA 2VGIA 3PR2A 1GT8A 1BF6A 2CW6A 3MMTA 2Q71A 4X3ZA 1A5KC 3CT2A 4UNKA 2VWTA 2DVTA 4OJYA 1RA0A 2ZIDA 5I24A 1J4EA 1MRQA 3EWZA 4NZ1A 4A3HA 1J8VA 3VNDA 3OBEA 4NIRA 1HP5A 4HGXA 3BLOA 1DJQA 2GUUA 1X7IA 3AIBA 3M5VA 3T6CA 3QKEA 1R2SA 1CNVA 3E49A 3MMUA 1SQ7A 3ZQ9A 1ZL1A 3BSMA 4QROA 4MSSA 3NOYA 4JKLA 4JY8A 4EIVA 4KWOA 3R89A 5F4WA 1HL9A 1ZENA 4OIFA 1X6UA 2CEQA 5IM51 1HTIA 3HTWA 2YLLA 4UTHA 4GQQA 1ODUA 4JTLA 1J10A 3QV7A 4E0CA 3HGOA 2NV2A 4I5XA 1PYMA 3BAWA 1XIIA 3WQFA 4Y8FA 1XL9A 1JZ8A 5C9ZA 3V36A 4LYRA 1IGSA 1FWJC 4FAMA 1VCGA 4HOZA 4UQCA 4WUIA 3ZWSA 4JN7A 1CGXA 1KRCC 3DHUA 4GFSA 3WIJA 4NAFB 3G2GA 1N55A 4PBFA 3B06A 2XDFA 2GPTA 1KM0A 3LBMA 1O5RA 3ATZA 1YIXA 4KERA 2WXDM 3EB2A 1R3VA 4QCEA 2E7FA 2QKFA 1U33A 4WSJA 4YCPA 3ITYA 4RV3A 3A9IA 1IXPA 2FZ8A 1H61A 2GJPA 4P5UA 5G2HA 5GJMA 1L6FA 4M0XA 5D2XA 4DF2A 4L4PA 4S3EA 1VYRA 1SYTA 4GOAA 2V38A 4EXAA 1S3HA 3UWVA 4LNYA 4L9ZA 1EOKA 3BPWA 2D2GA 2F61A 4BJHA 1BYBA 3GHRA 3FS2A 1Q66A 4PN2A 1H0GA 1G4EA 4AIOA 2Y6ZA 2VC7A 3DYPA 3NSNA 2IPJA 2GVEA 3SQSA 3TXZA 1HGWA 2YYTA 3SUUA 3POHA 1M1BA 1NY1A 3WD2A 1ME9A 4DJDA 1F3WA 2OODA 1IWPA 3OOQA 3JS3A 4UFKA 1T6MA 4LVBA 1W1B1 3QYSA 2PWFA 1KGWA 1Y8BA 2XIJA 3EGJA 3MP3A 3MZNA 1IWAA 4TX9A 1TJPA 4J3SA 2ALDA 4OHQA 4C6NA 2OCZA 3THQA 4NL1A 3BDKA 3MYPA 3AO0A 2EG6A 3R13A 1GQKA 1CGYA 3GIQA 3S47A 4Q8VA 3DUGA 1I6NA 1JAEA 5DEZA 2HDJA 3UR5A 2IUZA 1ISVA 1R2RA 4PUDA 2VDIA 3U5UA 4B5NA 3LPOA 3TA6A 4AVOA 5F1VA 4FEZA 1JD9A 1GEQA 1LRTA 1GTEA 4DYKA 2RGLA 3LQLA 4D6EA 5FCZA 1DV7A 1JR1A 3PFMA 2WJDA 4Z08A 3DX5A 1UUOA 1BG4A 3ABXA 3AICA 4IJRA 3NZ1A 4GI6A 4AEOA 2BOGX 1WBJA 4N9EA 4ZQPA 2VDHA 3LUTA 4LT9A 4JL1A 2WQDA 2W79A 4JYFA 3K46A 3UZWA 3EX1A 1LG1A 3N2OA 3NEVA 5C7VA 1BVZA 5AYBA 2VEGA 2AL2B 1J0ZA 2ZUNA 2OR2A 5JBEA 3CUGA 5HMDA 4GVIA 2OSWA 2PODA 3WLSA 1TVLA 1QW8A 4RE2A 2CWXA 1ZALA 3E3HA 3PBVA 1W1TA 3KOZA 1I1XA 1XV8A 3IAPA 3TWAA 4A21A 3WJYA 1QK0A 1PB0A 2VR4A 1OM0A 2PTDA 3E12A 4IL2A 2PEVA 3L68A 3W1XA 3VIJA 4RCXA 4PMQA 4IP4A 1Z44A 5BYWA 1MQRA 4F4RA 1R9XA 1ZY9A 4F66A 4J3WA 1TWDA 1QWGA 2J62A 1MZHA 3ABSA 3U5YA 3U48A 3L0GA 2Y2WA 4DO5A 1U1JA 4DWSA 3P0XA 1B3ZA 2WPGA 3PUEA 3APYA 2Q09A 3ZR5A 3W25A 1KW1A 4GWEA 2VFEA 4J2PA 1RP9A 1R8LA 1FDZA 2VC6A 4EPBC 2DFAA 3SM0A 3DHFA 5A69A 1N2VA 1XI3A 3WNMA 3M0IA 1OFOA 3PHAA 4D6IA 1GHRA 3W22A 2ZVIA 1R7AA 4XZBA 1WDSA 4Q8QA 1LUCB 3UXAA 3RX2A 3T08A 4M6UA 5FF2A 1NF0A 2PWDA 3SGZA 3UG4A 1EJWC 1CZ1A 2BVTA 2CKRA 2VX7A 1XYBA 1M9HA 1GJUA 3ZLFA 1G1YA 1K8ZA 3GIYA 2A3CA 3LSBA 3OB8A 3U3HA 3NPXA 2DJLA 5HNTA 3CUJA 3WJSA 4O17A 3NQVA 4H19A 5I3FA 3CAVA 3CPUA 4MB5A 3N6QA 2D24A 3L67A 1SMAA 3EWDA 4ES4A 4CQBA 3LENA 2BS9A 4ZE5A 5KZDA 4GBDA 2E3ZA 3T2OA 2HNHA 6REQA 1QTWA 3IVSA 2D3NA 4FF7A 4O16A 5LA1A 4N9CA 5TIMA 1YTDA 1OADA 4ZQCA 2WMHA 1KM6A 3G1XA 3TYAA 2IQTA 2DZWA 4YIWA 2D3LA 4J3TA 5C7HA 3GG1A 4M29A 4FNPA 3WUFA 3H22A 1OD0A 2DH3A 5LSMA 3MS8A 1E9IA 5I6SA 3LHZA 2ACUA 1ME8A 3IPWA 5GJPA 3UZJA 1TPH1 3UCQA 3RF9A 1QOQA 5L6UA 3NL2A 1FWNA 4XO7A 1ZLPA 1YDYA 4K37A 1ZP3A 1E43A 3UETA 3W6LA 3WEZA 4ICNA 4EWJA 2GQ3A 1S1RA 3F4WA 2RJGA 4JOMA 1RLDA 1W5QA 2V3GA 5A6KA 5LA0A 2EPNA 4XIAA 4JTEA 3HM7A 3W82A 1FCVA 2ICSA 2O9RA 4GYKA 4W9TA 3M5YA 4OTKA 2JKEA 1TX2A 1V02A 4DF0A 8XIAA 1IEQA 4LBSA 1JFHA 4JTSA 3VKAA 5EMUA 4HTBA 2O4QA 5EBUA 5PTDA 3GH5A 1K9FA 4QP0A 3SRFA 4PUEA 1GPFA 2IPWA 3IEBA 3QVQA 1RBLA 1VFTA 1A5BA 1GTHA 3DIPA 5C2GA 4UWMA 1HKIA 3NZGA 4U33A 2PF8A 1BYCA 3RX4A 5M2FX 3W23A 1V79A 1GOMA 3UYCA 3GFXA 4Q32A 4S3KA 3ZJKA 1XC4A 2ZBTA 1R3SA 3VIIA 3COTA 5EFDA 4U3AA 1KXQA 4TX8A 3W7MA 2FMOA 3V5FA 4QQ3A 2QPSA 2NX3A 2WNWA 1PBGA 3NZRA 1DJIA 2NSXA 1UIPA 1JNDA 1PKNA 3LXAA 1MVYA 3MW7A 4HYVA 1DYSA 4NX5A 3QLDA 3CHFA 1KTBA 3VKDA 3TV8A 4Z42C 2QV5A 2J7CA 5HAOA 1OFBA 5I03A 3CLMA 3RCYA 5BXRA 4HU3A 5D9NA 4M1RA 4O1DA 3CHVA 1QAPA 4RL3A 3WH8A 5E1QA 3NQ7A 1WKDA 3L5AA 3UXLA 1SZFA 2BOFX 3AROA 1J0YA 1PDYA 4O1CA 2HVMA 3VINA 2ISWA 3M0VA 3NPVA 4F0RA 3EA2A 2WSKA 1RH9A 2WLYA 5CPLA 2ZICA 3N04A 2YIHA 3AU2A 3CQKA 2H6RA 3MU7A 1LL4A 4JXCA 1UIOA 4QNWA 2B7PA 1Z6KA 4KH2A 3QPEA 1I2RA 1ZJHA 2YW4A 3CAQA 3G24A 3N29A 1I9CB 1NTHA 2PBGA 4J5NA 4O8RA 1UOKA 2QUUA 2PD5A 3KS6A 2B31A 4WD0A 1VFSA 2CLLA 4L1XA 3UG5A 1F2JA 4IGSA 1EF3A 1GOKA 3FXGA 3L23A 3LTYA 4KCWA 3M1ZA