3W88A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
b'SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-200
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w88A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w88A01
1SSDA 3DHFA 1OVDA 3DXIA 5FESA 1SFLA 3LCHA 2YPIA 5LNUA 1B9BA 4NX5A 4OE7A 5K9DA 1MSSA 3LTSA 2E5BA 4OGZA 3PS7A 4CCCA 3GKFA 2V2CA 4Z0SA 1O5XA 3AO0A 4JD4A 3MP3A 1V5XA 1GZGA 3NA8A 2JKEA 2QCFA 3I7RA 3NDOA 2VKZG 2YDAA 4LNYA 2GQAA 1TRIA 5HMSA 2V5LA 4FIQA 1TREA 3DFPA 1IGSA 4DO5A 1SZNA 5D2TA 2DZSA 1SW0A 1TSIA 5T26A 3UZ5A 3NPXA 5F2GA 3LHZA 4TMCA 2ZRVA 4JYDA 5EKYA 2J9XA 4MLJA 1OYBA 3HJZA 2CW6A 4JR5A 3CQ0A 3E02A 3M6YA 3GAYA 4UMCA 4UR8A 5HUPA 2R94A 4JGDA 1GTHA 1AL7A 3LHTA 1RQHA 3GAKA 4IMEA 3TC6A 3W23A 2NWSA 3W22A 2Q8LA 1LOLA 2ZA3A 3PBWA 1EP1A 4UTKA 4ZQPA 3FS2A 4JTGA 1R46A 4FNSA 5C2XA 2XN0A 3HO8A 4ICNA 4A2SA 3JS3A 2YW3A 2W79A 3NQFA 1TPC1 1VCVA 1RVGA 4MVAA 1H50A 1A5CA 1IIHA 4ZZ9A 4QIUA 2ZZ3A 4PC8A 1O94A 2BSLA 2X30A 3IIVA 5DN1A 3BW3A 1JJKA 1TB3A 2WV8A 3ABRA 3G0XA 5IBXA 4I9AA 1G4PA 4MFDA 3O15A 1F6PA 4IMCA 5D2VA 4EF8A 3CIWA 4NJJA 4UXDA 2DZPA 4OWGA 2OX1A 3KVMA 4MPQA 4RJEA 4AWSA 1ME7A 4CQ8A 1F05A 3S6DA 3ZFHA 4EWND 2NUXA 3IV3A 3VNDA 5G2HA 3HGSA 1N55A 2DJLA 2NLIA 4UC5A 4Z08A 3VE9A 4TR9A 2TRSA 3NM1A 3STEA 4YXGA 2Y70A 2VEMA 3EWWA 3NNTA 1U5JA 4O50A 4LT9A 2ZRUA 3N9RA 2NUYA 4MKNA 4ZVJA 3U6WA 1XUZA 5A8GA 5D32A 3P7YA 5AHMA 2NX9A 4O18A 3QC3A 3VCRA 3RFAA 2EGZA 3LHVA 1OFAA 4QNWA 1EPXA 4AEOA 4UTWA 3GIYA 5HUOA 2GVGA 3MP5A 3WK3A 1T8XA 4ZMGA 3TUUA 1T99A 1TQXA 5DY2A 2YSWA 6TIMA 4DEFA 2QF7A 2BX7A 5C6MA 2CLHA 1BKSA 1H5YA 2DZXA 3OEXA 3BG5A 3M0ZA 3RLVA 4AH7A 5I3GA 1H1ZA 3GZ3A 1K8ZA 1JULA 3B4UA 4K37A 4DO4A 3TJLA 3TFXA 3L66A 1I2OA 1TYGA 4AHPA 1OFQA 3MHUA 4DF2A 3QSRA 1H7XA 1KV8A 3G8EA 3TXZA 2Y85A 3WK0A 4OBTA 4N4PA 3NO5A 2EAWA 2GVJA 1X1ZA 2FPTA 1ZALA 2BZNA 4JTTA 3NEVA 1KLYA 4ZQRA 2CLLA 1QO5A 2PURA 4UMBA 5HR6A 1KM3A 3EX6A 1QDSA 1OFEA 5CZ0A 2Y7GA 5I3KA 4CLMA 5EPDA 1P5BA 4O13A 3NQ6A 4OV4A 3BW2A 5BRBA 2FQIA 1Q6QA 3SY5A 2I9EA 4QISA 4A22A 3M5YA 5I3HA 1I2NA 4NJHA 5DXYA 4B5NA 5G2WA 3NZRA 1W37A 1FCVA 1ZNNA 3OVPA 3TA6A 2ISWA 4WXZA 1KM4A 3O8AA 3SIZA 5DY3A 4O52A 1YDNA 3W7NA 1NAL1 1LOQA 2ZCGA 5FF2A 3HPSA 3C2RA 2PC4A 3QF0A 3UPBA 4G1KA 4HHPA 4H6KA 7TIMA 3ELFA 3LOTA 4OV9A 2RDWA 5A5WA 3OG3A 5AOUA 2J27A 3L67A 5IM51 1W56A 5C55A 3G0UA 1Q6RA 3HG3A 1YXDA 2J88A 5F4XA 3QEZA 1TPVA 1A5AA 2A6NA 3M5ZA 4JICA 4UNKA 4FXRA 1QCWA 1VCGA 4M5PA 4MYXA 1OFOA 1VCFA 1A5SA 4BI5A 5F2MA 3MJYA 4GUIA 4I7UA 3GDMA 4HN4A 3W70A 2QCCA 3PB2A 3O6DA 1T0OA 3A24A 1V7YA 5AN7A 2NX1A 3QMTA 1SZFA 3FFSA 3H53A 3HF3A 3STFA 1N7KA 3GK0A 1O5KA 3W71A 2GJLA 1G6CA 2AGKA 3OVRA 3PG9A 1OYCA 3C2OA 3EXRA 3IEBA 2QCGA 2B4GA 4FXSA 3NL5A 2HS6A 1SZGA 1LLWA 4PA8A 1H63A 2DP3A 1SZEA 3BW4A 3NAVA 3S1VA 3TMLA 3HPZA 5MHBA 4O12A 1LRQA 2J24A 2A7PA 4XKYA 3QFEA 3LHYA 3W2UA 3W2MA 3BV4A 3F03K 3G1VA 3W2LA 1OFDA 1W5NA 3UWYA 3L5AA 5G2IA 3MMTA 1P0KA 4OU1A 2OJPA 2DJXA 2OT0A 3RU6A 1DHPA 3ABQA 4UIOA 3W7CA 1FY6A 2JK2A 3DHDA 1GVQA 3LDVA 3FOKA 5HWJA 3L2IA 1OG0A 1K7XA 5HINA 4Q4KA 1DJNA 5H91A 1GYLA 3W84A 1XBVA 2WSQA 2FDSA 4MIMA 3P60A 1YLVA 3W1NA 1WOBA 4Y96A 1TJRA 1IXQA 1VLIA 1F7BA 3LLFA 3P80A 1EUNA 2YR1A 2ZBTA 3BPWA 3G1SA 1CI1A 1M7PA 4O17A 3W73A 1L2UA 1WBJA 3PF3A 3W1TA 3W88A 3FA5A 1FWSA 1WBHA 3GXPA 3G22A 3IVSA 2E6FA 1EP2A 1F5ZA 3SZ8A 1A53A 2WKJA 4JTJA 4LU0A 2RFGA 1G69A 3S0CA 4NJKA 4OQVA 3W1MA 2DORA 1ZAHA 1JVNA 2DZUA 3TW6A 2R14A 3B0PA 1EWDA 3MWAA 3LV5A 3NL2A 4NNCA 1VRDA 2AAMA 2E1DA 5BMWA 1KV5A 1LLZA 4UUIA 2Z6JA 3IIPA 4PH6A 4X22A 4HIBA 1FCQA 3KFTA 4NQ1A 5K9CA 5LGXA 3QQ1A 3DFQA 1EX5A 1D9EA 1ZENA 2FFCA 4LOCA 3UD6A 2J9ZA 3OVQA 1JUKA 2BXVA 1FWWA 3LCXA 5LNVA 1LBMA 1A5BA 4CNPA 5D09A 3P62A 2CFFA 3WFAA 1XI3A 2CZFA 2BLEA 4IMFA 2QCEA 2FJKA 2XFWA 3S5NA 3N2MA 2QJIA 3UWQA 1HG3A 4HNVA 4KFPA 1IF2A 3CWNA 1UUMA 1WXJA 1FQ0A 4NJGA 2NUWA 5K7JA 3NG3A 1R2SA 1NF7A 1WX0A 3QJAA 1YDVA 3BG3A 1XUUA 3AJXA 1XKYA 3STCA 2FPYA 5AYXA 2CLIA 4NZFA 1R30A 1WYIA 3WK2A 5CSSA 3CB8A 4AF0B 4E0CA 3PSWA 3NXFA 4MY8A 4IPIA 3W1RA 3NPUA 4U28A 4FX8A 3QMSA 4OT7A 4DF0A 6ALDA 4R7JA 1G4EA 5LNRA 3BGGA 4JTKA 3BLEA 2GUUA 4CCEA 4DPQA 3O1NA 2NV1A 3E9AA 1MZHA 1JCXA 1JCYA 4BF9A 1W5PA 4JNMA 5LZLA 4O16A 5AHIA 3HQ1A 5CSRA 4PL1A 1AG1O 1HL2A 1LP6A 4ZQMA 1GG1A 1I2PA 2VXNA 3DBPA 1F73A 3KHJA 1BWLA 3HB9A 3NQCA 1LORA 2JBMA 1KBIA 3HG5A 2ZZ7A 4O1CA 2DZTA 3S1UA 3K30A 3L0GA 3LBCA 5F1UA 1OFBA 5FEWA 3F4WA 3CEPA 1H7WA 4IGHA 3T78A 4P2VA 2H3DA 4JTHA 1ZAIA 3M7WA 4WZHA 2NZLA 4JTLA 1KA9F 4LRSA 5FF7A 3P81A 3H54A 2VFIA 4GUGA 1S5VA 2ALDA 3DENA 1LCOA 1AL8A 1GQNA 5D33A 3Q2DA 4R34A 3I7QA 3MYPA 1TPWA 3THQA 1KLZA 3W7IA 2ZTKA 1GVRA 2TSYA 3C4UA 2A1YA 3GDLA 2EKCA 3N73A 3KVLA 2E6AA 2OCZA 3P8IA 1OX5A 3LHUA 2QAFA 2QUTA 3GDTA 4GC4A 2QUUA 3MHGA 4ORMA 1ZCOA 3I65A 3O06A 3C6CA 2WSYA 3E0IA 1TCDA 4FEZA 2A7RA 5D38A 4O0ZA 3EWUA 3Q94A 1Z42A 5LNSA 4FNQA 1C9DA 1L6YA 4MZ1A 4FO4A 3BVJA 1KFBA 3ABSA 2Z0IA 1CX9A 4UTIA 4HNTA 3W85A 5I3JA 1K02A 2CLEA 5F1VA 4U4MA 4O4WA 1EEPA 2Y88A 3HGOA 3LTPA 2E77A 4N9BA 2H6RA 5KTLA 3DKLA 4DPPA 5HNRA 4Y90A 5AC7A 3GDKA 4CQAA 5ABTA 2B7OA 3KVKA 1OJXA 4WD0A 3PUOA 5CPMA 3LCLA 1LYXA 4MY1A 1LBLA 4M7SA 3N14A 1OHLA 5CGQA 3MI2A 4TO8A 2G5WA 2ZA1A 3PR2A 5G1TA 5D03A 1KFJA 4M7TA 1JQVA 1XBXA 2G97A 4O28A 5EL1A 1IXNA 4MY9A 2QCDA 5G4WA 3WJZA 4H4IA 3LXAA 2GOUA 1RR2A 1XFBA 5KITA 5L6UA 4ZQNA 1TPDA 1HO4A 2JKAA 2HTMA 5CZJA 5D02A 1TPEA 4LWWA 1GTEA 1VPXA 5CG7A 2B7QA 3W1QA 1FDZA 1FWRA 3SFKA 3P82A 3P61A 2VFGA 1C8VA 1UUOA 3IRDA 3DU0A 4K36A 2X2GA 1S5WA 3LB0A 3HOJA 2WNQA 3BLFA 2Y62A 5KZDA 1VJIA 3MP4A 3G1HA 2C0AA 1FWTA 1VHNA 3A21A 1HO1A 1ICQA 3I6RA 4P61A 4DBEA 3G18A 4NXKA 3V1PA 3TKFA 2P1FA 4MLRA 2VFEA 3F4NA 1XDMA 4MZ8A 4QAIA 1LDCA 2ZZ5A 1GG0A 5AHLA 1W1ZA 3ZWTA 3EX3A 1OX4A 4AVFA 2O7QA 1SW3A 1YTEA 4Z0JA 1U83A 2YYTA 1XCFA 5TQLA 3SSJA 1OFRA 3G1DA 4O8RA 1CW2A 2X1SA 4POCA 2P0OA 4XBKA 4PEKA 3W6YA 4FX7A 5C5YA 3RMJA 3W76A 5F4WA 2UV8G 1W3IA 5AC6A 3GX9A 1DV7A 3EXSA 1LM1A 3SW6A 5G1YA 3EKLA 1X7FA 3G3DA 1K8XA 1WAUA 2EPHA 4O14A 1VGAA 4DXVA 5FEPA 3W86A 3SI9A 4PODA 3W7EA 4JEQA 5DXXA 3LCFA 4BR1A 3FKRA 1SSGA 2E6YA 2GQ9A 3M44A 4WXYA 1ZJIA 4DELA 4YCPA 1W3NA 5KINA 3TJXA 1TMHA 3INPA 3S42A 1FDYA 5CZTA 2VFDA 3LRMA 3G1XA 5KMYA 2LLEA 3CT7A 4GUHA 4N2YA 4LY8A 1J5TA 4WUIA 1UCWA 1NEYA 3HG4A 3LRLA 2RKXA 3NQVA 4HSNA 5F2LA 4LW7A 2PE4A 3PVFA 5DCBA 1EIXA 4C1LA 5EA9A 2ABAA 4PTNA 2CWNA 4FX6M 1GT8A 3ZR4A 4NZJA 3ANYA 4PFMA 1IIGA 1TO3A 4N9DA 2TPSA 3A5FA 1RPXA 4K7VA 4KFOA 3GKAA 3IIOA 3LX9A 4IWWA 5FF4A 4IOTA 4QITA 2G96A 5D37A 3JRKA 3LLDA 4FNTA 4C1KA 2QCDB 1QO2A 1WQ5A 3ABOA 3W3OA 4QSHA 2IQTA 3P74A 2F84A 1B4EA 3GB6A 4L4MA 1W0MA 5HR7A 2QDHA 4Z1AA 1SW7A 3NZ1A 5LNWA 1B57A 2YGYA 4RK8A 4RXGA 1UBSA 3C2EA 1LOSA 3KVJA 4I7WA 4NUWA 5CPOA 4UTTC 3W7PA 2V8ZA 3W7LA 4NU7A 4GUJA 2RH9A 1J4EA 3W1LA 2OMAA 1QOQA 3UZJA 2VFHA 3MYOA 8TIMA 2FPVA 4IMDA 2QCMA 3G3MA 1PCWA 3CM4A 4K6AA 1NFBA 2PRHA 3OBKA 4ONVA 3N9SA 3NPVA 4O54A 3P5YA 4ADTA 4MJZA 5AHEA 3Q37A 1LZOA 3WJWA 3PBVA 1QFEA 3W1PA 2EHHA 1C29A 1Z41A 4JTEA 2QAPA 1OX4B 3G24A 2E6DA 5G5IA 1D3HA 2KZHA 3BLIA 4W9TA 3FIGA 2X16A 3BG9A 1IXPA 4RXFA 3I68A 1FXPA 4E2BA 3O6CA 3FYPA 3W7GA 1TIMA 3TC7A 1I45A 4DO6A 3EWZA 2C13A 3ATYA 2DU2A 4ZQOA 3B05A 1H1YA 2Q3RA 4AF0A 1OX6A 4YWIA 1OK6A 1SFJA 1BEUA 4YCOA 4ALDA 4WOZA 4LVDA 3GVGA 2X1UA 1XXXA 1VLWA 1XC4A 1KFEA 5G4EA 2VOMA 3E49A 4KFNA 3GXTA 2QR6A 4M6PA 1JRCA 3EWXA 4EF9A 4GE8A 5D30A 2A5HA 4AB4A 2OZ0A 2ISSA 1O60A 2WJZA 3FJ6A 4JX6A 3TQ0A 1L9WA 3BARA 4ORIA 4RLIA 3SGZA 3FLUA 2TYSA 1TQJA 2Q3OA 1H62A 2QUVA 3QRHA 4LUJA 3RLUA 1JRBA 2Y7EA 3PSVA 4AAJA 1I8JA 4MUZA 4BI6A 3PAJA 3G1YA 3P67A 2PRMA 4LS0A 1ZFJA 3NGJA 3M5XA 1Q6LA 1VYRA 1KFCA 1QWGA 2NXGA 4LVFA 4PL2A 4Z1DA 5F2IA 2C19A 3STGA 2ZA2A 3CLMA 4JTIA 4LC8A 3TQKA 5FF3A 4HPJA 3EB2A 2HMCA 5BMXA 3UWZA 3DH7A 4CNOA 1RD5A 4KKXA 2V2DA 5CZSA 3CEUA 2Q8ZA 2CLMA 1EA0A 3FKKA 3IGUA 3C3NA 4JY8A 2WQPA 1B3OA 3NQMA 3HGRA 3M47A 1H60A 2Y7DA 3HIJA 2WSRA 1H7NA 4EVZA 1TPH1 1DQXA 4XTIA 2H8XA 3LTYA 3A9IA 1S3HA 2FLIA 1P1XA 4GNJA 3GR7A 4O15A 3TW7A 4QJ1A 2GPTA 2E5DA 5DCDA 1PS9A 2R91A 1K7EA 1OYAA 2NX3A 1DL3A 1QPQA 2WOQA 3TXVA 3CC1A 4AWTA 4GFSA 5I3FA 1XDLA 2BWGA 1FWNA 3W7HA 3TCEA 1VYSX 1QMLA 3TE9A 1GOXA 3TFCA 5FEXA 1YDOA 3MHFA 1XM3A 1ZAJA 2V0TA 1J2WA 3GYEA 1GVOA 4IXXA 4JYEA 1W5OA 4NX0A 4LVGA 1AMKA 3N3MA 3DFOA 5K9XA 2A21A 1YYAA 4QNEA 1LRTA 3CU2A 1GVSA 2G95A 3UWUA 2F7FA 1FX6A 2C16A 3MUXA 3T44A 3IIZA 3VE7A 3NYZA 4ML9A 3R13A 4JTFA 3ZWSA 3N2XA 5L9FA 1ALDA 1GEQA 4RKAA 3PULA 4JTSA 4UFIA 5LKYA 5HQEA 4DQWA 5EBUA 5AC8A 4HNNA 4M6QA 1X6UA 4M6VA 3THAA 3IGSA 4Z1BA 1JQXA 2CU0A 4N9CA 3N19B 4X9SA 4I7VA 1KBJA 1VQTA 1H51A 3PWAA 1VHCA 3DFNA 3N34A 1P4CA 3LI1A 3Q58A 4ADSA 3NL6A 4MOZA 3S5YA 3B06A 2ZRYA 2C18A 4A29A 4O53A 3CPRA 1MXSA 4N6FA 3UY8A 1AW5A 5KZEA 1VS1A 3PUEA 1AW1A 5EMUA 1PIIA 3TK7A 1VH7A 2YXGA 3QSTA 1PE1A 2J9YA 3TDFA 3GLCA 3DI1A 2X1TA 1ICSA 3W7MA 1W5QA 3LI0A 2P10A 4WX2A 1FCBA 2V82A 4LS1A 4GBUA 1SQ7A 1QAPA 1B4KA 3R5EA 3C56A 2CZDA 1JCJA 3QQ0A 4GWEA 3WJYA 2A0NA 3KRSA 3TSBA 3W75A 2AQWA 3MI3A 1GYNA 1K7FA 4O4VA 4ADUA 4N4QA 1HUVA 3C2FA 4GRSA 3QH2A 2QKFA 1S5TA 3L9CA 1TV5A 4Y9AA 2QEZA 5DELA 1SUXA 3TAOA 1KM2A 2XN2A 4LUIA 4LRTA 1JCNA 3L68A 4LC6A 3T55A 4J9JA 2OT1A 3C0JA 1VZWA 3D0CA 1W31A 3PG8A 2HS8A 1PHWA 4PCFA 3SJ3A 2JGYA 2E09A 1FUYA 2Y63A 5AHFA 3MI6A 1L6SA 3V75A 3EXTA 2H90A 2ZRZA 3EEGA 3IVTA 1Y0EA 4N9EA 4UTLA 5LHEA 3LXBA 3NVTA 3KX6A 3GNDA 4WY0A 3LERA 2DZWA 1FXQA 3TNOA 3W74A 3KOFA 4XUGA 4BK9A 3LCGA 5D2XA 2VC6A 2VFFA 3C8FA 2NWRA 3C2VA 1H61A 3EX2A 1TTQA 1PHQA 3UWVA 4RV8A 4EOUA 4GUFA 3W1AA 4N02A 3BGJA 1DBTA 3HG2A 4X3ZA 1LTDA 3L5LA 2YFOA 3FEMA 4A2RA 3NR0A 1H7OA 5E93A 3HBLA 3LV6A 1JCLA 4R33A 3UNDA 1L6WA 1SU5A 3PUDA 5TBOA 5E0KA 3TU9A 2FB3A 3IVUA 4JYFA 2YCEA 3L5MA 4UTHA 3PBUA 3VFLA 4MFEA 3LHWA 2FTPA 3KXQA 2V9DA 4CCDA 3SR7A 2PCQA 3EWYA 4YL2A 2C14A 1RZMA 1SO3A 5K2ZA 3T7VA 2B7PA 2CLOA 2TMDA 4RZ4A 4UTMA 4AWUA 1FDJA 3B0UX 1NSJA 3UYCA 1JUEA 4GXMA 1RV8A 3RNDA 2VEKA 4ZL1A 1F76A 4BFAA 1GPWA 2RDTA 1OK4A 3NOEA 1KM0A 2BTMA 3MO7A 3E96A 2Y6ZA 1W3TA 1QPNA 3W1XA 1SO4A 1PV8A 1FBAA 1ME9A 1TPUA 5FI8A 1RQBA 1T96A 1F6KA 5AHNA 1YPIA 1RQEA 4S2CA 1YXCA 4FNUA 3G1AA 4XWUA 3OA3A 2R8WA 4BWLC 2GQ8A 1TJPA 3B0VC 2QDGA 1G7UA 1DVJA 2A6LA 4FNRA 3B8DA 4UNLA 3G0SA 1G7VA 4IPJA 2HSAA 3HMJG 3T4CA 2YYUA 4UTJA 3W7JA 3YPIA 3M5VA 3NQ7A 3QW4B 2ZRXA 3S1XA 2V5BA 1MEWA 4UFMA 1G4TA 4UFHA 2CZ5A 5BW6A 4XTDA 1OF6A 3P84A 3L21A 2ZRWA 3WJXA 1VR6A 3MBFA 1QPRA 3HGJA 4AHOA 5F4SA 3W7RA 1R2TA 1DJQA 1WA3A 3OHIA 2NXHA 4JDBA 2ISVA 5LHFA 3WK1A 1ME8A 2YZRA 4IUOA 4WY0B 4HNUA 1M5WA 3M43A 4LTSA 3LRKA 1LRNA 4JS3A 4KWVA 4NT0A 2WNNA 3QM3A 1GWJA 5C54A 1F2JA 2VELA 4O0KA 3BO9A 4K7YA 1EB3A 1GVFA 3TIMA 3W7DA 1HTIA 4LVBA 3TAKA 2RDUA 5AYZA 3P5ZA 4GJ1A 1MO0A 2NV2A 3NQ2A 4Z1CA 1XBZA 3QYQA 3UPWA 4NXSA 3W7OA 3GNNA 3DFTA 5DBUA 1M6JA 5E1QA 1AW2A 3W83A 4Q32A 4TU1A 5D04C 1O95A 3TQVA 5DCEA 4K8HA 5DLCA 2A7NA 1QR7A 4UR7A 4RZ5A 5AYYA 3SECA 1Z44A 5HJLA 4M19A 2QJGA 4HPXA 2YW4A 1YTKA 3QPYA 1OABA 3W2NA 4X2RA 5J5RA 1I2QA 4WY0F 2ZTJA 2V30A 1VYPX 2ZFAA 3TMQA 2VEPA 1AK5A 4TIMA 3ZS4A 1H7PA 3W9ZA 1PL9A 2A4AA 5TIMA 2H3BA 4WJEA 3H55A 3IGXA 4AXKA 2C3ZA 1O4UA 3LCIA 1KTCA 2D73A 4JIPA 5EYWA 4EIVA 1PCKA 1EUAA 1LROA 1X1OA 3NM3A 1R47A 3NQAA 3UY7A 1F74A 1ML1A 4S2BA 3VI2A 1YTDA 1M7OA 4O11A 4CQ9A 1SR9A 2FIQA 2CLKA 1GJPA 3OIXA 2H8ZA 4UCGA 5DBTA 3R89A 1K3UA 1FCUA 4O1BA 1PVNA 3MW7A 5KZMA 1ONRA 3QZEA 4BI7A 5CPLA 1W8SA 1OFPA 5BOOA 4NNAA 3LGEA 5J5DA 5D05A 2ZZ6A 5HWNA 5D2YA 1TTJA 1UB3A 3R2GA 4AMAA 4JN6A 2ATSA 1YPFA 4LV4A 1WDWA 3CTLA 3W87A 2V81A 4Y6GA 3KRUA 4JIQA 2ZZ4A 1BWKA 4E2DA 4R53A 5LGZA 1E51A 3S5ZA 3W72A 1EP3A 3W07A 2QJHA 3KAOA 2Z2UA 3M16A 5U4NA 2RHGA 1NF0A 1R2RA 2Y7FA 4JX5A 4LVAA 1KW1A 3C52A 3GDRA 4H3DA 3LM7A 3UQNA 5EY5A 4UMAA 3TH6A 2C15A 2PRLA 3PC0A 5KSWA 3S1WA 3W7QA 2JKPA 2X1RA 3F1QA 4ZQCA 1KTBA 5I3IA 1UASA 3GR8A 1W5MA 4NJIA 4A3UA 4K39A 4MZYA 3L0NA 1ICPA 3DGRA 4KWWA 3RK8A 2CLFA 1QPOA 1TRDA 3CWOX 5K4ZA 1WOAA 3E12A 3G8RA 2WO5A 3NPWA 1DORA 3M41A 3DI0A 1MEHA 3UXDA 3CHVA 1WV2A 4JTUA 3HPXA 5AB3A 1KFLA 5CPNA 4WQ6A 2VENA 5IBXC 3R8RA 3SGUA 1TTIA 1JCMP 4JX4A 2Z6IA 1P0NA 4UTUA 1SPQA 2JGQA 3NQ8A 1KM6A 4NVTA 1ADOA 2ZZ1A 4JDYA 4MYAA 2GVLA 2ZDRA 4RX0A 2O7SA 2YX0A 3A22A 1KFKA 1VC4A 1W54A 1I4NA 4YMZA 5K4XA 5D2WA 1Q6OA 3U8GA 1LBFA 2YFNA 2ZZ2A 3TR2A 3UWWA 5AFDA 3S5OA 5SWUA 1X8FA 4O19A 4O1AA 4AHQA 4IQLA 3LBMA 3QPZA 3TSMA 3W1UA 3TSDA 1A50A 1KTNA 2CZEA 2FB2A 1G67A 2EF9A 3DFSA 3T40A 4RCXA 2QCLA 2NXIA 3TROA 4HKPA 1XBYA 2A85A 4L4LA 3M1ZA 3O07A 2WNZA 4JY9A 2V2HA 3UXAA 4QM1A 3QW3A 5FEZA 3B04A 5FF0A 1MEIA 2ZYFA 4BWLA 1NVMA 3CIXA 2WPBA 4FHAA 1TPFA 3I7SA 3DAQA 3JR2A 5HULA 4YLWA 4UTWC 4A21A 3GXNA 4K8EA 4UFLA 3QMRA 1IXOA 1Q3NA 2E5CA 2B0MA 2Y61A 3S9YA 3FJLA 3W2JA 3O16A 4O1DA 1SO5A 2A2IA 4TX9A 1DQWA 4LS2A 2ABBA 3PM6A 3L65A 4CNNA 3U2OA 1JUBA 3FYOA 1TV7A 4OHQA 2C6QA 3C61A 3G1FA 4FF7A 3S8HA 4RZ6A 1JR1A 1OF8A 1QOPA 3NQDA 2QCNA 4XQ6A 4D2JA 1I2RA 3BK0A 3MBDA 5U7SA 1H7RA 4O10A 2DZVA 3EX4A 5H2ZA 3ATZA 4O57A 1Q45A 3TV8A 4MJMA 1THFD 4XBSA 4Q33A 4FNPA 2W0UA 3TX9A 4FB7A 4XZ9A 2B7NA 1G4SA 3DZ1A 3W2KA 4HSOA 1ZY9A 3VKJA 3R12A 1YADA 4IX0A 3PY2A 1N8FA 3NL3A 3PB0A 2GJNA 1Z48A 3IIXA 4LV9A 2C1HA 4IJBA 4DF1A 4XKYB 4DBDA 2I14A 5K3VA 4Y8FA 4WOQA 2Y89A 5HWMA 3L0KA 1K8YA 3M9YA 3O6YX 4HT3A 4S1FA 3A5VA 4QQ3A 1DOSA 4JXCA 4IX2A 2W6RA 3O05A 2QCHA 1UJPA 4NNBA 2ATMA 1TTPA 2ZQ0A 1KM1A 3P8JA 1EWEA 4UFJA 3NQGA 4RR4A 4K38A 3W7KA 5LSMA 4E38A 2Z1BA 3DKJA 1DKWA 3EX1A 5BNKA 2J6XA 1ZHAA 3A23A 4TMBA 1YXYA 3KRZA 2XN1A 4UTTA 1BTMA 5GVJA 1D3GA 3EKZA 3USBA 4IMGA 1K03A 1SO6A 3NQEA 4N6EA 5CKSA 3RF9A 1TPB1 3LCWA 2I1OA 2VEIA 3B03A 1XL9A 1HFBA 1QNVA 1TV8A 4IXHA 3LXCA 3O63A 3EWBX 4FIRA 3PBYA 1KM5A 3WJSA 4UFKA 2E68A
chains in the Genus database with same CATH superfamily
4AC1X 3DXIA 2IS7A 1SFLA 4OBRA 5LNUA 1B9BA 3AS2A 2E3ZA 5K9DA 4UOZA 1S46A 2E5BA 4CCCA 3WNPA 3GKFA 4P7RA 3L2MA 4JD4A 5A69A 5XINA 3NDOA 1Q6FA 4LNYA 1XV8A 4D8LA 1F6YA 1IGSA 4LYRA 4PMDA 5H1WA 5D2TA 5T26A 1TSIA 2HZGA 4D6IA 1Q8JA 5F2GA 2CBUA 3ZVHA 4KT2A 1PKLA 1XD0A 3ZIZA 3GAYA 2CBVA 2YCJA 5HUPA 4JGDA 1GTHA 1I60A 2X7WA 3GAKA 4IMEA 5CPQA 2ZUMA 3OP2A 3W23A 1LOLA 4JTGA 2E8YA 1WZMA 1LWJA 1WO2A 4NSBA 2D23A 5CSYA 4ZOAA 4GA8A 4A2SA 2YW3A 3TN4A 4F40A 3NQFA 1TPC1 4E3TA 3HURA 1SFSA 1D8CA 2ZZ3A 2BSLA 3PWGA 4GVGA 4E6MA 1TB3A 1TV2A 4JN7A 1L8NA 3ABRA 3G0XA 1AVAA 2HVMA 1F8IA 3S3GA 5A6SA 1EKOA 4MFDA 1Z9AA 1IEWA 4IMCA 2DSZA 3ZYZA 3CUGA 5CC5A 2DZPA 2OX1A 3OW1A 3KS6A 1QK0A 3EDEA 4AZIA 1HJSA 4C6IA 3H70A 1U1UA 3GR4A 3EA2A 3UVAA 3G6LA 4XAZA 3NO3A 3ZFHA 5D4YA 1TZZA 3N2TA 1L6GA 3IJ9A 2QMKA 1N55A 2DJLA 3KP1A 1O5RA 4Z08A 2WVSA 3NM1A 1IZKA 2OODA 1YPXA 3VCCA 1TMQA 3LUTA 3U6WA 2BVTA 1I0BA 1KGUA 3V1HA 4O18A 1JNEA 2E0PA 4WSKA 2Z4GA 2PP3A 3GG1A 3A9BA 5CLWA 1T8XA 4ZMGA 1NP0A 1T5AA 1P43A 2FDMA 5DY2A 3GFYA 1BKSA 4AH7A 4KCVA 5I3GA 1H1ZA 1SYTA 1A3WA 4N0RA 4DO4A 4YS1A 3TJLA 1SJCA 2J7DA 4Q4PA 3EDKA 4L7ZA 2XIQA 1POJA 4DZHA 3NSMA 4IP5A 1KV8A 3ITVA 3G8EA 3TXZA 3WMLA 4OBTA 1X1ZA 3L4ZA 4Y9OA 2BZNA 3DG3A 1E43A 2CLLA 3KW3A 4UMBA 5I2UA 3R8HA 4EXBA 4DJFD 5I3KA 1JPIA 5EPDA 3EEZA 1P5BA 3PPGA 1LUCA 2VTFA 4O13A 4W88A 1FP9A 1Q4NX 3UCCA 3TWAA 5BRBA 2YCLA 2QF8A 3G1RA 4K68A 4E4FA 2OEKA 4X0NA 4QLKA 2PDBA 2NSOA 4B5NA 1B3YA 1W37A 3OVPA 4XV0A 3TA6A 2ISWA 4PZVA 3O8AA 5G4HC 4O52A 4WSJA 1NAL1 1LOQA 1BYDA 5FF2A 4ZE4A 4MDPA 5GJNA 3USZA 3QF0A 4G1KA 3GIQA 4H6KA 1DXIA 2DPEA 4H01A 3N2OA 3OG3A 4WJ8A 3AYSA 3WF1A 3MT1A 3FY1A 1XG3A 1TUFA 1FHDA 5XIAA 3HG3A 3WX7A 1XPGA 3ARWA 4U2ZA 3QEZA 3M5ZA 3SQLA 1XX1A 3UVIA 3WLTA 4XAYA 1VCGA 4M5PA 4REQB 4I6KA 2W61A 3OOQA 4BKNA 3C3UA 5AZ1A 2F61A 4GUIA 4EPDC 4A3RA 1YNQA 1M65A 3W70A 2MNRA 1S2VA 3THDA 5IHRA 3QMTA 2HWGA 4A05A 1N7KA 3GK0A 3QV8A 2AQVA 2GJLA 3OVRA 3PG9A 1OYCA 3EXRA 2QCGA 2WMKA 1BG9A 2DP3A 3FJ4A 2R1NA 3BW4A 3ANVA 3C5QA 3OZPA 3O3RA 4H00A 3A3XA 1PZ3A 2A7PA 3W2MA 2VD9A 3ITTA 4HD5A 3QY7A 2ISFA 3AHXA 1OFDA 8RUCA 5G2IA 1EJTC 1DHPA 2NT1A 4M6UA 3QN3A 4UIOA 7A3HA 1FY6A 3BANA 2J7CA 3KL0A 2QQ6A 3B9NA 3L2IA 4PMVA 5LA0A 3S9IA 1TMLA 3UGVA 3FDGA 5HXMA 3HM7A 5FJTA 4WGHA 4D9PA 2WSQA 3H7VA 4GY0A 1OT2A 1WOBA 1PZ1A 1TJRA 3KOXA 3OA5A 1BHGA 4PRRA 1Q65A 3EDDA 1E1CA 1EBGA 3W27A 1US3A 4AW7A 1E6XM 1UIOA 3H7RA 3JZUA 1WDSA 1EP2A 1QPKA 2ZWYA 1A53A 2TODA 4PEEA 2XWDA 3PZ9A 2X42A 2VL4A 3U4AA 1UR8A 1EBHA 1ZAHA 2IPGA 1VIZA 1JVNA 2R14A 3MWAA 1GKQA 4CQCA 2AAMA 2E1DA 1KV5A 1LLZA 3N2BA 3EWDA 4Q7BA 2XVPA 3ZT5A 1X1NA 4X22A 3ECQA 1FCQA 4E3VA 3DFQA 1J10A 3NWRA 3UD6A 4ROQA 3S46A 3WH6A 1LBMA 2OQYA 2VT0A 3WLLA 1A5BA 2JIWA 1J79A 4NL1A 1UH4A 1NDYA 3MKVA 2PMQA 1HKIA 3QV7A 3WFAA 1XI3A 1HP5A 4HZ7A 4Y2WA 3QYSA 4IMFA 1UKSA 3N2MA 2QJIA 2VWSA 4HNVA 2OEMA 3R7MA 2R82A 2F6XA 1VAHA 4NJGA 4X2PA 5K7JA 1XLFA 1HF6A 1EDTA 1YDVA 4LQ1A 1XKYA 3STCA 5AYXA 3T2PA 1R30A 1WYIA 4DN1A 4AD0A 4AF0B 3NXFA 4MY8A 2NV9A 4IPIA 3W1RA 4U28A 1EJVC 1ONXA 6ALDA 1GOWA 4LAUA 5B7ZA 1G4EA 3F4VA 3U2CA 3HA1A 4B3KA 3CHCA 2PODA 4CCEA 4HMCA 3GNRA 5I79A 6REQA 4DPQA 1GKRA 3O1NA 5KETA 4G7EA 1JCXA 1XSIA 3RM9A 1HGYA 5CSRA 4MB4A 4PL1A 1AG1O 1HL2A 1K9TA 5I0DA 1LP6A 1GG1A 3RIKA 4FSAA 1I2PA 3VMNA 3H22A 4H6EA 1KBIA 3CO8A 3HG5A 1QI4A 4YWSA 1O7AA 3H26A 1OFBA 1FWFC 5E70A 5XIMA 2VWTA 4RPPA 4PUEA 1H7WA 3NSXA 1H5VA 3CAKA 1E1EA 2J8GA 2G41A 4JKMA 4HYWA 2VFIA 2CHOA 2Q01A 2YA2A 4R34A 4PUMA 3AXXA 1TPWA 3ICJA 1UWIA 3CK5A 2EKCA 3KVLA 2E6AA 3E74A 2OCZA 3P8IA 1WCGA 5BRQA 2QAFA 3PAOA 1XIGA 3GDTA 1YBQA 2QUUA 4ORMA 4LEQA 2QYGA 4FEZA 4DUWA 1M04A 2XIOA 4R7WA 3EWUA 2BHYA 4TV5A 1C9DA 3BVJA 3ABSA 3IK2A 1EA9C 2GJRA 4HNTA 3IJQA 2AKMA 5I3JA 3S6OA 4O4WA 3VDCA 3HGOA 3WQFA 2BFGA 3DKLA 3OGRA 4Y90A 4CQAA 3T08A 4WD0A 4GZIA 5GNYA 4AY8A 4MY1A 1GW1A 1LBLA 4GJJA 2I5IA 1CXHA 3MI2A 3AAMA 4TO8A 5D9MA 4PRTA 1MDLA 4DJFA 1KFJA 4AWEA 1XBXA 4ZXLA 2G97A 5EL1A 4AZHA 4FPSA 4JIHA 4MMWA 3KCJA 2OQHA 3DG6A 3ZT7A 3SUTA 4LWWA 4Y7EA 1K70A 3RGTA 2YIHA 2VC7A 3IAQA 1GQIA 3MC5A 4W7VA 5CG7A 3XIMA 1FDZA 1FP8A 1KKRA 4JFSA 3WBAA 3DU0A 3TW9A 1TJ0A 4HJFA 4Q8TA 3HOJA 3VGHA 1VFMA 4JL2A 5KZDA 1VBRA 3MP4A 2VQUA 2YKKA 1ICQA 1R6WA 1Y5XA 3I6RA 4P61A 3IS4A 2V3FA 1XWYA 3LPGA 1CB2A 1PAMA 2C7FA 3B8VA 3TKFA 3VCNA 2G8ZA 3U2EA 2W62A 2VFEA 1EJUC 4MZ8A 1E4LA 1WNOA 1WAWA 2QPSA 3FVMA 5FA5A 2WZIA 1OZMA 1TVPA 4AVFA 3BE7A 4RNJA 3WQEA 3U9IA 3DYOA 1ZB5A 1R38A 3G1DA 1KXQA 4J3ZA 3WNNA 3W6YA 3RMJA 4RE0A 3VX1A 3K13A 3KBNA 4YYCA 2UV8G 1W3IA 1A3HA 1X7FA 5A8NA 3M0LA 1K8XA 2PD5A 2QVHA 1NFGA 3CMFA 1CGTA 4O14A 4DXVA 5FEPA 3SJNA 4QJ5B 4EAMA 1GW9A 1E1FA 3A4AA 4ERAA 4DLFA 1HN1A 3LCFA 4BR1A 1BVNP 1M01A 3NCOA 1ZJIA 4DELA 1W3NA 1YE4A 2PGRA 3UU0A 3PBMA 3TJXA 3CAWA 1V02A 3NZGA 5CZTA 5FJRA 1Q4WA 4KRZA 3H2OA 2LLEA 3CT7A 1IR2A 3WQVA 2HVNA 4OOZA 3BAXA 3WUFA 4IIDA 1NEYA 3HG4A 2HE8A 4Z17A 1QNRA 2PE4A 2XINA 3RCMA 1EIXA 3VMPA 1U1JA 2CWNA 1AFSA 2GGGA 4HCLA 2VNCA 2SFPA 1RLDA 1FWIC 2YXXA 3MZ2A 3A5FA 3IIOA 3LX9A 4IWWA 5CAHA 1TE6A 1N2VA 3G2GA 1QO2A 4ECLA 1B4EA 2J7BA 5HR7A 4AZ5A 5C7VA 3N04A 3C0QA 3QFWA 1B57A 4RK8A 3TZFA 3BSMA 1HJXA 3ANUA 5CPOA 4UTTC 2O55A 3Q4DA 5MKGB 1CECA 4LANA 4GUJA 4YTTA 3W1LA 5I7GA 3AHTA 3UZJA 1TVLA 5IDIA 1TIWA 1XD1A 1GEHA 2PRHA 4PCTA 2ZDSA 1EF3A 3P5YA 3PJUA 2OO0A 5AHEA 2PDLA 2PDFA 2EHHA 2WZTA 1Z41A 2QAPA 3AS0A 1D3HA 4L9XA 2CKSA 4KMQA 3TC7A 4PB4A 2OYMA 2C13A 1J6PA 3ATYA 4A6GA 4QS6A 2QLYA 4AF0A 4YWIA 2BHUA 1BEUA 3VD5A 4DXKA 4FAMA 3BCDA 2CPUA 2IXUA 3AMCA 1GYMA 3LQGA 1X8CA 4H04A 1VENA 3T81A 1U5VA 2QR6A 4A3QA 4M6PA 2A5HA 3ZQ9A 3HFTA 5EMYA 1UD6A 2ISSA 1EO5A 3WNMA 1ZBVA 5C70A 3RITA 2BP1A 1L9WA 3DYMA 3QRHA 1H62A 2BY2A 2QUVA 4LUJA 4AUBA 1I8JA 4MUZA 3PAJA 2GZXA 4ZGYA 1A0EA 1RBLA 4HGXA 1Q6LA 1VYRA 2NXGA 4PL2A 3STGA 3E3HA 1KCZA 3QXBA 1PIFA 3SBFA 2PDYA 3W28A 1V3LA 2BGSA 4GD0A 4CUCA 3O9NA 4F2UA 3DH7A 1CLVA 3UNTA 1PBGA 3A6OA 3QTGA 3U4FA 4K1WA 3CEUA 1JI1A 1XIBA 2CIPA 3WY1A 2G4JA 2WJFA 2E67A 2VM8A 4A3HA 1H7NA 3WQDA 3S2MA 3RN6A 2BOEX 3M64A 2ZX7A 4QJ1A 1HKJA 2XPKA 3KOWA 1KFWA 2R91A 3UG3A 4C7FA 4YTQA 1QPQA 4GINA 4IP7A 5I3FA 4C5ZA 3GH7A 1FWNA 3I3BA 3II1A 3AU2A 2WZMA 4ZOBA 2E1WA 1XM3A 1ZAJA 1GVOA 3B3DA 3GNPA 2PUZA 4LVGA 2OKTA 3EOSA 2UY3A 3N3MA 1POKA 4C7GA 1TJ2A 2VJXA 1YYAA 2BOGX 3N13A 1A49A 3T44A 5CSUA 4ML9A 3ZWSA 3DYPA 3H4XA 3BJFA 5LKYA 5HQEA 4D1JA 3UJFA 5AC8A 1C9WA 4M6VA 3WLMA 4H6QA 1KBJA 5I78A 5FJIA 1V8EA 1HKWA 3PWAA 1VHCA 3BZGA 3DFNA 3R43A 4W8LA 4RNIA 2W27A 3N34A 3LI1A 3Q58A 2Z7KA 2ZRYA 4DB7A 4A29A 1BF2A 1OCJA 2YL9A 3MB9A 3CPRA 3UA3A 5KZEA 3PUGA 1XP3A 3ZR6A 4RDVA 1UOKA 1L2QA 1EGZA 3TTQA 1E55A 3T05A 2X1TA 2G3MA 3MDWA 4LS1A 4GBUA 4MHBA 1QI5A 1Z8AA 1XGDA 1B4KA 3CZLA 2OZ3A 4I8YA 2XH4A 1JCJA 2NW0A 3QQ0A 4GNKB 5JU6A 3SCOA 2XH2A 2Q6ZA 3ZZ1A 3TSBA 4ATWA 3C2YA 1GYNA 4NIRA 4QRNA 3WN6A 2BNJA 3ME3A 4N4QA 3R25A 2VGGA 2PTWA 3C2FA 3TTEA 4GRSA 4K8GA 3SCSA 3L9CA 3VOHA 3K46A 4J4KA 4DBWA 1XLHA 4YVXA 5A2CA 4XD3A 3KTCA 1O66A 1KM2A 2XN2A 3R10A 4MNMA 3TAOA 1VP5A 1PEZA 4TVCA 2BBFA 4J9JA 5CPTA 3JUGA 5T9CE 3PG8A 4PCFA 2JGYA 2Y63A 5AHFA 1L6SA 4PMRA 2YDSA 1O68A 3D5HA 3UBPC 3MVIA 1RY8A 2H90A 3IVTA 3K4DA 1Y0EA 2XFYA 4CQDA 4N9EA 2NQZA 3NVTA 2QXWA 5AY7A 4WY0A 2WHJA 3LERA 3D6NA 3TNOA 2XVLA 4G1NA 3T1GA 4EX4A 2H9AA 4UB9A 1JG9A 3PANA 2VC6A 3ZSTA 1UWTA 2XZ7A 1R3VA 1XF0A 1BRLA 2IPJA 1XYLA 3HG2A 1LTDA 3SUUA 4EP8C 3FEMA 4A2RA 5A2BA 1JYWA 5E93A 2Z24A 3B40A 3U48A 1JCLA 2Y4SA 1O1HA 1L6WA 1SU5A 1OB0A 3IVUA 4IF2A 2AL2A 2YCEA 3T2QA 5D8ZA 3L5MA 1RPKA 1P6CA 2PF8A 4KGLA 4CCDA 3QGAC 4DHGA 5D9NA 1RXOB 5K2ZA 4HK7A 3KUMA 3VO0A 3UG4A 3PHAA 2TMDA 4RZ4A 1H11A 1FDJA 3B0UX 5C9RA 3UYCA 5CZKA 2VEKA 1AZ1A 4ZL1A 4BFAA 2RDTA 1XLIA 1OK4A 3MO7A 3E96A 1W3TA 1SO4A 1PV8A 4Q6JA 1FBAA 5FI8A 1RQBA 1F6KA 1R85A 3SCTA 1GORA 2PWGA 4DWSD 1YPIA 2WSKA 4S2CA 2DT3A 1ITQA 2R8WA 3NQBA 1W1B1 2QDGA 1G7UA 1DVJA 2A6LA 4FLSA 4UNLA 3G0SA 4GQRA 4V33A 4IPJA 3SY1A 3HMJG 3SQMA 3WBYA 3Q45A 3T4CA 4UTJA 3VKAA 1FVPA 3HPAA 3YPIA 4UFMA 2FZ9A 1G4TA 5FL0A 4F2TA 4XTDA 1BXNA 4LAZA 2HPMA 1AH4A 1XRVA 3B0YA 3NDYA 4JFVA 3PTMA 3L4VA 1DJQA 2I7GA 1WA3A 2DSUA 2XISA 2XIJA 2NXHA 2ISVA 1XYFA 5A8OA 2HDJA 4HNUA 4U2YA 4IICA 1FH7A 4JQAA 3RYSA 2BS9A 5DMNA 1F2JA 4O0KA 3BO9A 1LLOA 3VUSA 1V4YA 3W7DA 1S2CA 1TZ9A 3WBWA 4QEHA 1LL4A 3P5ZA 3M6DA 4PMOA 3GUWA 4DNHA 1FWHC 1MO0A 5BXSA 3IACA 2J7FA 4EK7A 3QYQA 4NZ5A 2NQJA 1XYMA 4DM1A 5DBUA 1W1VA 4JTDA 1UOZA 3CO4A 2D2JA 1V3KA 4Q3MA 4D6GA 4TU1A 4ZOCA 1N82A 4UR7A 5HJLA 2QJGA 1YTKA 2X09A 4R85A 1U1HA 3W2NA 1SZRA 4B3ZA 4WY0F 5A6LA 1JZ7A 2GQ3A 1VYPX 3TMQA 2ZOXA 3A47A 1AK5A 2NQLA 3OGVA 1S1PA 4FALA 3VOIA 1IWAA 1PL9A 2A4AA 3BURA 2C3ZA 1O4UA 2PDUA 3WEOA 1KTCA 2D73A 1VF8A 5A6BD 1PCKA 1B5TA 5HATA 2YA0A 1X1OA 3MVTA 2VURA 1ML1A 4I9TA 7TAAA 4YN5A 4CQ9A 4J27A 2FIQA 1KO0A 3ARPA 3OVGA 3AHYA 1NDVA 1KBBA 5DQPA 4BI7A 1OFPA 5AECA 5BOOA 2ZUWA 2J74A 5CJNA 5C9UA 5HWNA 5D2YA 4IIHA 2ATSA 1CGWA 4LBRA 3NUKA 2YOCA 3GTHA 3STPA 1XLBA 4Y6GA 1UKQA 1GZ1A 4JIQA 1BWKA 2ZXDA 3OPSA 3R11A 5LGZA 3FVDA 4IPNB 1EP3A 3GBDA 3FGCA 2RHGA 1R2RA 4HPGA 4PTMA 1HX0A 2ZKMX 4Q8PA 3CMGA 5IXEA 2FH6A 4H3DA 3UQNA 4ES4A 4UQBA 4PGLA 3VIOA 4B9YA 4ZSUA 2PRLA 1YDYA 1PUDA 2GJXB 4F4RA 3S1WA 1XQKA 3GG0A 3WBXA 3EMQA 1H3GA 1KTBA 4C6KA 5I3IA 1QNQA 3TJIA 4NJIA 3Q65A 1I6NA 1TWDA 3L0NA 7ENLA 1OBAA 1WZLA 1TRDA 3CWOX 2BOFX 3E12A 3RAOA 3T0BA 2WO5A 5DT5A 4IFKA 4HU0A 1WV2A 2O4QA 3LG3A 2WHMA 3MPGA 1AMYA 2PDGA 3R8RA 2IPFA 4MSSA 3UR7A 4WLCA 3NQ8A 4NVTA 1ADOA 3HQPA 1TZ7A 4QG9A 3EGJA 2YX0A 1VC4A 2JIEA 5K4XA 2XG9A 4ZTXA 2HXUA 3U8GA 4P8WA 1FWCC 3S5OA 1X8FA 3CQKA 4D6JA 5FSEC 3LBMA 2J78A 4PSRA 2DDXA 2INEA 3EOLA 2BHZA 3DFSA 1OCQA 4LJ3A 4MADA 1J0HA 3SRKA 4HHLA 2A85A 2ZVRA 3M1ZA 4NILA 4S3AA 4IZGA 2WNZA 2CZVA 2V2HA 3UXAA 2D2HA 5FF0A 2ZYFA 3DAQA 3JR2A 5HULA 1DWHM 4A21A 1PDZA 4MJ4A 4UFLA 1JZ8A 5A1AA 2B0MA 4CVWA 1AUSL 4PTVA 4HOXA 4EPBC 1DQWA 1WDDA 1KCXA 2ABBA 2FMOA 3AXIA 1PDYA 1F3WA 3FYOA 4OHQA 3G1FA 3C61A 3QHMA 1JR1A 1XGZA 2QS8A 4IG2A 2ACQA 2WXDM 4X9YA 2O9RA 5U7SA 2PFHA 1H7RA 2J6VA 5T9BG 5H2ZA 4O57A 4UOJA 2ZICA 3ITXA 4XO7A 3S2CA 3DOPA 1UD3A 3KRBA 2CEQA 1ZY9A 3R12A 3ZVIA 1XH1A 4DYEA 4IX0A 4L56A 3UJRA 3M4HA 5IFTA 3I3EA 1IWBA 2PLJA 4GH1A 1TJ1A 2NQ9A 4ILSA 2YA1A 1DJZA 4Y8FA 5HWMA 2JFEX 5HQMA 3ZR5A 3CV7A 3UCQA 1TWSA 2GGIA 1BTCA 2D22A 4HT3A 4EACA 3A5VA 3HU7A 4IX2A 4NNBA 4HZ8A 2FH8A 1F9CA 1WB0A 4UFJA 2VX4A 4RR4A 5EFDA 4HA0A 5CQ1A 4DWSA 1FFQA 1DKWA 3EX1A 1UD8A 2J7EA 1EOMA 2FVKA 1ZHAA 2O9PA 1YXYA 4OOUA 3BAIA 3WDJA 4LPCA 5LIXX 5BU9A 2GJPA 1F3TA 3USBA 3K5XA 1K03A 4C91A 1JDCA 2P53A 2I1OA 4YJ5A 3EWCA 4Q4RA 4KPLA 1R5YA 2GWNA 5GJPA 3TR9A 1TV8A 4IXHA 3CAVA 2QV4A 4FIRA 4GK8A 4AY7A 1YW1A 4HVXA 2E68A 4OJYA 5REQB 1HVXA 2D0HA 4UZUA 1SSDA 3F5KA 4XISA 4S3CA 1NQKA 3LCHA 1HJWA 2YPIA 4Z1YA 4OE7A 1MSSA 1P7TA 2OOFA 4OGZA 2C71A 4QX4A 2PTDA 3B0XA 3H8AA 3AO0A 1UWUA 1GZGA 1MW1A 1K1DA 3EPNA 2V5LA 4UQCA 3AHZA 3L12A 5E9AA 1SW0A 2VOTA 3H4GA 2ZRVA 3QGVA 3WMBA 4MLJA 2FZDA 1OYBA 1KRCC 3HJZA 3A4JA 2CW6A 4JR5A 3CQ0A 3ES7A 2WBGA 3QLLA 1AL7A 5CAKA 3W22A 2Q8LA 3WNLA 4UTKA 2ZA3A 1EP1A 4ZQPA 4U5IA 4FNSA 2WCSA 3CJPA 2XN0A 1GQLA 3W00A 4LXFA 1R8LA 4ICNA 4WGXA 1R3TA 2XSAA 1XJBA 3VILA 3AYVA 3U2ZA 1VCVA 1ZCCA 1A5CA 1IIHA 4PC8A 1HNYA 8A3HA 3BW3A 1JJKA 4FLOA 3O15A 1F6PA 5RUBA 1ENUA 5E0FA 3CIWA 2MANA 2WANA 4OWGA 1AA1B 3KVMA 3OJGA 3AIQA 2CERA 2EBNA 2Q02A 4C7DA 1M53A 4AWSA 1ME7A 4EWND 1LL6A 1US2A 3IV3A 5BWFA 3VNDA 3R1ZA 5C8BB 4YXGA 1GGOA 2VEMA 1NY1A 2ZRUA 4OFCA 1XKJA 3P7YA 5AHMA 1ISXA 4UOQA 3VCRA 3RJYA 2EGZA 3LHVA 1EPXA 4UTWA 2XWEA 3GIYA 4F0LA 1L6FA 4PUKA 2DEPA 3W53A 1J0KA 2Y0FA 3KBSA 2PU1A 1CZ1A 1TQXA 2YSWA 1YKWA 4WVXA 2BX7A 5C6MA 2DZXA 3I4EA 3BG5A 2ZUVA 3B4UA 4TXEA 2VO5A 4A8NA 4NI8A 1TA3A 3WDQA 3OLIA 3L66A 2DQXA 5HJYA 5BROA 4OKDA 1I2OA 1TYGA 4AHPA 1A5NC 3MHUA 1ZBWA 4KF1A 2XM1A 1UR9A 3WYZA 1H7XA 4HB7A 3KOZA 3FHAA 2EAWA 2GVJA 4IUGA 3MJMA 4JTTA 3NEVA 4ZQRA 2J25A 2CBIA 1QO5A 3LQLA 1QDSA 1OFEA 1W17A 2A3AA 1J12A 4IQEA 3IJLA 1W1A1 3NQ6A 1DTUA 1XINA 1Q6QA 1HZYA 2FQIA 3T8QA 4QISA 4A22A 3M5YA 4KCTA 1I2NA 4NJHA 1WKFA 2DVXA 3NSNA 7REQA 1FCVA 4W7UA 4BHYA 2E9MA 3PZVA 3KM8A 4ML4A 3NEHA 3NIYA 2PC4A 5ECVA 4GY7A 7TIMA 3LOTA 2RDWA 3CYJA 5AOUA 2Z1XA 4AIUA 1ONEA 2PLKA 1JD9A 1LF1A 1Q6DA 1VFTA 3TYBA 3DESA 5C55A 4AIEA 2YDRA 3G0UA 2HCVA 1Q6RA 1WPCA 3NZQA 2J88A 4LB3A 1NARA 5C0QA 1TPVA 3ITOA 3DGBA 4NAEB 4CNSA 2YBTA 1UA7A 3GNXA 3IAPA 4PUUA 4H9MA 4MB3A 5F2MA 2WMHA 1UR0A 5JIPA 4XUYA 4W4QA 3GDBA 3A24A 5AN7A 3ITGA 4JBRA 2NX1A 2ZX6A 2VC5A 4HYRA 3TLLA 3RPTA 3WL0A 3IJ7A 1F3EA 1IYXA 4P7LA 3BMXA 3H53A 4PYSA 3E0VA 3GVQA 1G6CA 2AGKA 2WSPA 4ZO9A 3XINA 2HS6A 1SZGA 1LLWA 1XIDA 1H63A 5JMUA 1M41A 4MWAB 3AFBA 3S1VA 1VFHA 1WUEA 3HMCA 3T6CA 3LHYA 4GQBA 1WZKA 3EZ4A 2QIWA 1UKTA 3G1VA 4H8HA 3UWYA 4PMYA 5F7UA 2QDDA 1P0KA 1GONA 4TTUA 2DJXA 3RU6A 5JBFA 3AICA 1K77A 4ZB5A 2J13A 4GYKA 1VEPA 5HWJA 4RW5A 2PWUA 3MKKA 2ZUNA 4JFWA 5HINA 3GXDA 4S38A 3W84A 3ZLGA 1XBVA 1Q2RA 3CUIA 2FDSA 3B8SA 3AROA 4W89A 2YB1A 1IXQA 1VLIA 4LBSA 1W1TA 1OCNA 3LLFA 1Q6EA 4E8GA 1QXLA 3N4AA 1EUNA 1MWOA 2YR1A 4WDWA 1CI1A 2DT1A 1DQUA 3W73A 1L2UA 3ARUA 3FA5A 3G22A 4GI6A 3SZ8A 4JTRA 5I5RA 4OUIA 4KEVA 4LU0A 4JNYA 1ZL1A 4NJKA 4DBUA 3CPGA 5AVNA 2DORA 4RW3A 2E28A 2DZUA 2W5FA 3N3TA 3VD9A 2WMFA 3B0PA 1AODA 4B5UA 1VRDA 3PZQA 5BMWA 3WF4A 3GE7A 3IIPA 1RA5A 2J7GA 1HW6A 2JEQA 3KFTA 4LEFA 1V0MA 4GABA 4NQ1A 4WJXA 3SUWA 1D9EA 1PTAA 3AIWA 4HA1A 4TX6A 2BXVA 2HROA 3LCXA 5LNVA 2QV5A 2D2GA 3GG8A 1GK8A 4HTYA 3TJ4A 4CNPA 3ITCA 4L61A 2CZFA 2FJKA 1V79A 4V28A 3S5NA 3UPMA 2J77A 2YXOA 1HG3A 4DIAA 1W91A 1WXJA 4GNVA 2NUWA 1NH6A 3KBVA 3CQJA 1F4AA 1R2SA 1NF7A 4H19A 1MW0A 3LPPA 1IR1A 1HJQA 1EXBA 2FPYA 3RCNA 3VABA 4NZFA 3CB8A 3MSRA 1NJJA 1IQ8A 6CGTA 3UXIA 3CAQA 1MFVA 2E4TA 3QMSA 1B0IA 1OC5A 4S3DA 4R7JA 3T0DA 3VAVA 4H83A 4U10A 1UHVA 3V5CA 1DIKA 2D24A 1M9HA 1BVZA 2NV1A 4PUNA 5CLTA 1JCYA 4M51A 1W5PA 3F2CA 4B16A 4C1NB 1F73A 1DEDA 1LORA 4GVIA 1REQA 4O1CA 1O6IA 3VDGA 3K30A 2C91A 3L0GA 3LBCA 5F1UA 2FZ8A 2QMJA 3T78A 2WMIB 3LZ3A 4CD7A 1V3HA 5DO8A 3H23A 1KA9F 4LRSA 3H54A 1RAKA 4KIRA 4DAFA 1RBAA 1V08A 3DENA 5CGMA 1AL8A 5PTDA 1ZSXA 3IARA 1JF5A 9RUBA 3AYRA 2DSKA 2PP0A 1GVRA 1UQYA 5AC5A 2A1YA 2PGEA 3KBMA 3K8LA 1ZP4A 4DI9A 2QUTA 4QXIA 3O06A 3E0IA 1A5UA 1H0GA 2A7RA 3ENLA 5D38A 4LYPA 3Q94A 1Z42A 4W7WA 1QHPA 1U33A 4LB4A 3VX0A 4KWOA 2CC0A 5JQ9A 3I3DA 5T8GA 3VGGA 4C6QA 4AZCB 5CCZA 1EEPA 2Y88A 3GC4A 6ENLA 3LTPA 4N9BA 4GHRA 1X38A 4DPPA 3GDKA 4P8XA 3ITYA 3CTTA 1E71M 3CUJA 3RPMA 4JHZA 4M7SA 4XSMA 4B3LA 4S3GA 1B30A 3KWXA 4FP1A 2G5WA 3L4WA 5BCAA 4YTSA 5G1TA 3TYAA 4R9OA 4O28A 2QCDA 3AZRA 2GSJA 4BQ3A 5KITA 4GPNA 1OC6A 1HO4A 1PZ2A 1M1BA 4M29A 2HTMA 5CZJA 4TV6A 1GTEA 2GOKA 1CXIA 2OPJA 4CD8A 1XQLA 4GO9A 1WP6A 1W9VA 3P61A 1C8VA 1CT5A 3IRDA 2VDHA 4K36A 1BYAA 1S5WA 2WNQA 1Q6CA 3TWBA 3GSMA 2GSEA 2J7HA 3G1HA 2PP1A 3A21A 3KBJA 2DGAA 4JCMA 4IFOA 3OQEA 2ZIDA 3FW6A 3AXMA 1DPMA 5FAJA 4MLRA 3URAA 3VUPA 4QAIA 1LDCA 2GWGA 5IFPA 1VPYA 2ZZ5A 1JI2A 1W1ZA 3ZWTA 4AYSA 3EX3A 1DWJM 2VCCA 2OLHA 3W25A 1LG1A 3GFXA 1YTEA 1XCFA 5TQLA 4EWJA 2EXOA 1AH3A 1A5LC 4O8RA 1CW2A 4POCA 3B9OA 4PEKA 5C5YA 2ASHA 4FX7A 3VTRA 2VR4A 3BJTA 3AMLA 3EMZA 1XIEA 1CBGA 4GZ7A 4ACZB 3W4RA 2P0IA 1QHOA 3WNOA 3SW6A 5G1YA 1Y5WA 3G3DA 2Z26A 5BYWA 1GNXA 3MV01 3J7HA 2B31A 1YHTA 4Z2LA 3VIGA 4W5ZA 3FKRA 4EXQA 3TN6A 4DNMA 2E6YA 3V5FA 1R7AA 1TMHA 1FDYA 2VFDA 4S3EA 3G1XA 5KMYA 3V35A 3R0KA 4N2YA 3G6MA 1ZBCA 1Y8BA 2RKXA 1J18A 3VNJA 2AMXA 3GTXA 5HQLA 1U22A 4I9MA 5ABGA 1TR9A 5DCBA 4C1LA 4PTNA 3ZLHA 1GVEA 3ZR4A 4NZJA 3WQ8A 1TO3A 2TPSA 2REQA 4KFOA 5FF4A 4IOTA 1JPKA 3B97A 5GNXA 4I5UA 4FNTA 1SR0A 1Z32X 5FJPA 3B8UA 4JL1A 5FOOA 3P74A 2F84A 3GB6A 1JFHA 3BOXA 4ZBCA 5LNWA 2YGYA 1LOSA 4I7WA 4IQDA 1I1XA 3VOCA 1MXDA 3WQOA 3VGDA 5DRIA 3REQB 4ZFMA 5I24A 2OQLA 4L65A 4ZA0A 1J8VA 5FJOA 2VGIA 1QOQA 2W67A 1QTWA 5JVLA 1PCWA 5BXPA 2R1PA 4XIAA 3OBKA 4W93A 1SMDA 4MJZA 4ROPA 3Q37A 4Z2HA 3WJWA 1JYNA 3AIEA 1QFEA 2PDHA 3WUEA 4GQGA 1OX4B 3FA3A 3G24A 5G5IA 3UZYA 1C91A 3BG9A 3B9AA 3I68A 4R3UA 4IMAA 3OYZA 2A3HA 1CLXA 1OG6A 1G1YA 3L7RA 4ZQOA 1V6VA 4BQ5A 2VZVA 2Q3RA 1LQ2A 4GCXA 1SFJA 1XG4A 5HNUA 4BA0A 4DUXA 3U7VA 1MFUA 4ALDA 1YQ2A 4WOZA 2Y2WA 2X1UA 1MUWA 2FMNA 5ABHA 2X2YA 5FJJA 4KFNA 4DBSA 4M24A 1AQ0A 4AG0A 2Z1VA 4AB4A 4FOUA 2E25A 1O60A 2FGZA 1IV8A 2WJZA 4QSFA 4JX6A 4NRRA 3KHDA 4GBDA 4XB3A 3AU6A 1T8QA 2TYSA 1TQJA 4AMCA 5TNVA 3PPCA 1EJWC 1JRBA 1OGBA 4BI6A 3QHOA 1W9DM 3G1YA 1ZFJA 3PTDA 4WIWA 4QLLA 1E5JA 1KFCA 4LVFA 1XCXA 3OLDA 2C19A 5CBJA 2ZA2A 4LC8A 4EPKA 4FXFA 3TQKA 5FCZA 3B4YA 1R0MA 4HPJA 4IHCA 3JVAA 2YL5A 4PB5A 5JH1A 1JXJA 6XIAA 3NYDA 3UG5A 1RD5A 2VQTA 2HNEA 1E6QM 2BMBA 2CLMA 1E6PA 3S5SA 3VNIA 2WQPA 3EMCA 1JYVA 1B3OA 3PK7A 4GYFA 4F79A 2DT2A 3L2LA 3M47A 3M0VA 3HIJA 1DQXA 5A2AA 1A5MC 3BQ5A 1MYRA 1AJZA 2CHNA 3E0LA 2FLIA 1QW7A 3R0UA 5H8MA 1W2VA 1WXZA 2WVVA 1PS9A 3BC9A 3AZTA 3LBOA 2NX3A 1UD2A 4DY1A 1DL3A 3SURA 3QV9A 3W02A 3TXVA 4PTXA 3AIRA 3PZUA 4GFSA 4JHOA 2BWGA 3MY9A 1TX2A 2VX5A 1VYSX 1QBAA 3GH4A 1GOXA 2NVCA 3MKCA 1QRQA 3TFCA 4AZCA 5FEXA 2WAGA 4MWAC 1J2WA 3GYEA 2Q71A 4L1WA 4JYEA 1W5OA 2PWVA 2ZE0A 5CBIA 2OELA 3ARSA 4RE4A 1AMKA 1PX8A 2A21A 3UG8A 1GVSA 2G95A 1PX4A 2C16A 1LQAA 3I6TA 1UW9A 3IIZA 3OZYA 4JTFA 4PMQA 5L9FA 4WHBA 1ALDA 3EBVA 1HKMA 4LUSA 1A0CA 4RDZA 4HNNA 4M6QA 3W6LA 2BGNE 4W84A 3IGSA 4Z1BA 1JQXA 3AHVA 1CTNA 1JZ6A 3GY1A 3VIMA 3FSTA 2AAAA 1ZBKA 2DH3A 2WNWA 5CJ5A 1US0A 1H51A 3FNDA 4Q4SA 2OYLA 2ISDA 4MOZA 3FJNA 1UG6A 4ICCX 3B06A 3NVDA 3R58A 3S1GA 4N6FA 1AW5A 1VS1A 4HHMA 4DZIA 3R4IA 1NELA 1XICA 3SQSA 3VM7A 1QWKA 1EPVA 3AUJA 3W7MA 2P10A 1TR1A 3OBEA 1SQ7A 1V02E 4TQTA 3TQPA 3R5EA 3S2LA 4DUOA 1MRAA 3WJYA 4H8UA 3B8TA 3W75A 2GLKA 3MI3A 1E0XA 1TVNA 2PDJA 3UZWA 4ZO8A 5GPRA 4LYKA 3V16A 2XH0A 3BICA 3TCSA 3WG6A 5HBFA 1C90A 3GTFA 1H0IA 4TVUA 2PDCA 4LC6A 2OT1A 3C0JA 1E73M 3D0CA 1OADA 1PHWA 3SIMA 1RVKA 1JZ5A 2PEVA 3W38A 4O1EA 3EXTA 4ZENA 4OIFA 4LCRA 4DLMA 1UMLA 3CMJA 1BSLA 4GXPA 4UTLA 2VMFA 3ZOAA 4S3BA 4XO6A 3KX6A 1IT7A 3W74A 1JDFA 4Q8VA 1Q6GA 5D2XA 4AD1A 2WW5A 2VFFA 3C8FA 3T09A 3FEQA 2VX7A 1TTQA 1PHQA 1BG4A 3IRSA 4N02A 3BGJA 1FWAC 3IJ6A 1H7OA 1W1YA 1RP9A 4FMVA 1U2YA 3HBLA 1ONWA 3LV6A 4NAFA 1PTDA 3KS5A 3TU9A 2FB3A 1PJ9A 2V5JA 1H1NA 4Q8OA 3WLRA 3QOMA 4LF2A 5LA2A 2EG7A 4ZEPA 2XH7A 5A95A 2PCQA 4YL2A 4AVNA 1SO3A 2WZHA 1UD5A 1ECEA 1FOBA 3DHUA 3REQA 2FHBA 1NSJA 4J3SA 3RNDA 1J11A 1F76A 4EANA 2D2OA 3A3WA 3U7BA 2BTMA 3D3FA 4JTAA 2ANUA 1ME9A 1T96A 5E6ZA 3SRDA 1OIMA 1T40A 3AQUA 4Z42C 3GWQA 2V3GA 3SRFA 3BAWA 2OGYA 1E9IA 5HNTA 4HNOA 1TJPA 3B0VC 1FHUA 1Y7VA 4CN6A 3B8DA 5A6TC 2VCBA 2OZ8A 4D6EA 4MDOA 4JPGA 5CH9A 4G56A 4I8DA 2ZRXA 1XLDA 2V5BA 1WKDA 3BLKA 4ZSTA 1MEWA 5LIUX 4UFHA 4XZMX 4DYJA 2FTWA 4J3UA 5BW6A 3L21A 4Y9PA 1PYFA 2ZRWA 3U57A 3WJXA 1VR6A 3MBFA 4F0MA 3OG2A 4J3TA 5HK4A 4PSPA 1B3VA 5IHSA 1WUFA 4PBEA 1RCQA 1FH9A 3R0DA 3VD4A 3WK1A 4M82A 1FWEC 4M0XA 3VC6A 3KBWA 1LRNA 4JS3A 5CJMA 4KWVA 5D8WA 4GACA 1GWJA 5C54A 3RM8A 4K7YA 3TIMA 2G3IA 4JKKA 5HOSA 3GHUA 4LVBA 3VGFA 2ZXAA 3VZXA 1V0KA 4GJ1A 2V68A 2FHFA 2NV2A 4ERIA 1E4NA 4Q7IA 1S39A 1XBZA 3O2LA 3CPUA 4NXSA 3DFTA 3IWPA 3W83A 4I3GA 4MG4A 3MSDA 4Q32A 5DCEA 3WENA 1QR7A 4HPHA 1XRFA 2YW4A 4N42A 4LBUA 4O0QA 5J5RA 2FJUB 3A3HA 2ZTJA 3VNMA 5BRPA 3BMVA 1XLEA 1DHKA 1GHSA 1VJZA 4WJEA 6TAAA 3H55A 4AXKA 1EZ2A 5I02A 3LCIA 1TELA 5EYWA 4V27A 1EUAA 4D1IA 1LROA 1R47A 5DEZA 4OUEA 4S2BA 4GX9A 2XFRA 5A8QA 3WH7A 1SR9A 2IPWA 1PYMA 1DYSA 2B81A 2H8ZA 2QGHA 4CD6A 1VPQA 3R89A 1JL8A 1K3UA 2F6KA 4PBFA 3MW7A 1KXVA 1GCYA 2PD9A 1MQQA 3P2VA 2VR5A 3W26A 3LGEA 3R2GA 3JU2A 4JN6A 5I3DA 3CB3A 3N2CA 3F5LA 1DJYA 1WDWA 4E2VA 2X05A 3HTWA 2OZTA 2AGTA 3PFMA 4F2BA 3KRUA 5EBAA 1E0TA 1MXGA 4HN8A 4HHHA 1E51A 3W07A 2Z2UA 3PWIA 2PDXA 1NF0A 8XIAA 4JX5A 3WF0A 1OM0A 2V69A 1E56A 3DHPA 3GDRA 3JZEA 3AALA 3LM7A 3BCJA 5A3HA 3E2RA 2BV9A 4P8UA 4UMAA 1Y65A 3PC0A 3W81A 5KSWA 2GK1B 1Q66A 1YEYA 3W7QA 2NQ5A 4PUWA 3F1QA 4ZQCA 1UASA 1Q13A 3PPHA 4A3UA 4MZYA 1EC8A 3ZMRA 2XVKA 1ICPA 2CXGA 4GO8A 4KWWA 3RK8A 1QPOA 5DMYA 4JFUA 2R24A 3IJ8A 1WOAA 1CXLA 1DORA 3M41A 2WJEA 5AB3A 1KFLA 5GJMA 4C6LA 1UH2A 4QE4A 2GDQA 2EEXA 4JFTA 2E9LA 3CIVA 1IGWA 2JGQA 1UWAA 4JDYA 4IIEA 3A22A 1KFKA 1I4NA 4YMZA 2DVUA 5D2WA 1Q6OA 3ZJ8A 2YFNA 1HVQA 2ZZ2A 3N4FA 4NYUA 4D72A 4DZ5A 2Z1KA 3WQCA 2F2KA 4M56A 4IQLA 1KQZA 3RG6A 2DUAA 5CC3A 1KTNA 2CZEA 4RCXA 1ZTVA 7PTDA 3TROA 4H8VA 4L4LA 2V3EA 3U0HA 4JY9A 4L80A 1NVMA 3CIXA 2WPBA 4FHAA 1TPFA 1NOUA 2UWFA 1FRBA 4YLWA 4UTWC 1GOMA 3GXNA 4K8EA 1D3CA 4L1XA 3S9YA 3O16A 1SO5A 2A2IA 4TX9A 2I57A 5CEWA 3O6AA 2I17A 3AS1A 3NTYA 1A0DA 1NFPA 1E0UA 4LS2A 3PM6A 3Q67A 3U2OA 1JUBA 1FHLA 3S8HA 4EPEC 3BK0A 2FFIA 4G8TA 3VDAA 1VD6A 1QATA 3K1GA 4HJWA 4MJMA 1EHAA 4LYQA 2A3BA 2W0UA 1OC7A 4XZ9A 1G4SA 4ACYA 1NOWA 3W2KA 4HSOA 2YCIX 3K4AA 1N8FA 3NL3A 3PB0A 3CASA 4B15A 2GJNA 3KZPA 2XJ7A 2C1HA 4IJBA 4DF1A 4XKYB 5K3VA 4MWAE 1KR0A 3PJTA 1NDZA 1K8YA 3B9EA 4S1FA 1DOSA 5FIPA 3VYLA 3O05A 4F0RA 1H49A 1UJQA 1TTPA 3BL3A 2ZQ0A 2WKGA 1KM1A 2XSBA 1EWEA 3NQGA 4GVFA 5LSMA 4R9XA 4C6CA 4E38A 1I0DA 2EKGA 2F2HA 4C6MA 2XN1A 4UTTA 1JGMA 1BTMA 4HMNA 1XLCA 2MUCA 1IZJA 1D3GA 4CNTA 3QHNA 4M3PA 4IMGA 3EB3A 1NWUA 3QOKA 1XIMA 4N6EA 3VD7A 1U5HA 1K9FA 3LCWA 3LU2A 3B03A 1SJDA 1FWGC 2Y8KA 4GQ0A 4CN4A 3WFLA 1FA2A 5FESA 3M0JA 3CH0A 3VM5A 2IQ0A 1EXPA 2WKLA 2PLMA 3G5EA 3PJXA 1ZU8A 4LUTB 4GQQA 2V2CA 4G2DA 3ORWA 1O5XA 3UERA 4KGJA 1J2BA 2IKHA 1V5XA 1E5NA 2JKEA 2QCFA 5EMLA 3I7RA 4UQEA 3SUVA 2VKZG 1DJIA 1X96A 5HMSA 4FIQA 4GYPA 3VK5A 3SGGA 3DFPA 4DO5A 1SZNA 2GL5A 3WO8A 2DZSA 1R3WA 3UZ5A 3NPXA 3NGFA 2PDWA 3LHZA 4TMCA 3V7PA 1I9CB 1R3SA 2QZRA 4QCFA 4F0HA 4J40A 3M6YA 2BGQA 3MDUA 1XLAA 4D6CA 4H8NA 3D3AA 3LHTA 1RQHA 1BAGA 1MUMA 3TC6A 2HJPA 3MS8A 2QT3A 2NWSA 2YCKX 4A4AA 3FS2A 1R46A 3RDKA 4HK5A 1UIPA 4HQVA 1LWHA 2FGLA 4DI8A 1GOQA 3JS3A 3OLGA 3M0XA 5AYIA 4AZBA 3MCNA 1E72M 4MVAA 1TUXA 2DH2A 1W6TA 1ZLPA 4AU0A 1MQRA 1O94A 3H6OA 1KBLA 3IIVA 3SO7A 5DN1A 2EPKX 2R6OA 2RJHA 1XS2A 1DTNA 1G4PA 3F5JA 4NJJA 3WF3A 1RK5A 4ICMA 2AKZA 3ARRA 4MPQA 4KQNA 4GMEA 4KWUA 2VZOA 4REQA 1VEMA 4WKHA 1ZP3A 4CQ8A 1F05A 1SFTA 4KCWA 3CYVA 2NUXA 5BXTA 4NZ3A 2XTKA 1KQYA 3HGSA 4FXJA 1DP0A 2NLIA 4UC5A 3VE9A 4TR9A 2TRSA 3STEA 5B80A 2Y70A 3EWWA 3NNTA 4O50A 4LT9A 2F38A 3N9RA 1P6BA 4MKNA 4ZVJA 4RNFA 1E6RA 5D32A 1UQZA 4AFYA 2G3FA 1WDPA 2WYSA 2PTZA 4IM4A 3WQ5A 4TX8A 4QNWA 3EPOA 2ZX9A 3GVWA 5HUOA 3T8LA 3T4WA 1GKPA 3MP5A 3WK3A 1T99A 4OZOA 5ABFB 3QBUA 6TIMA 4DEFA 2QF7A 1HJUA 1H5YA 3ALFA 3TN3A 2EQDA 2OVLA 4CU7A 3VNKA 2UY4A 3UCDA 3N11A 3TFXA 5JUVA 3P0XA 3RO6A 3QTPA 3LSCA 2W91A 1JNDA 2RUSA 4RDWA 4DF2A 3TYZA 4B4FA 3S2JA 1GQJA 3WK0A 4XBJA 3ZVHB 1JFXA 3TP4A 1V6YA 3GNOA 1ZALA 3TYEA 3WFZA 4GGBA 5LXXA 1V3IA 2PURA 1F4HA 5HR6A 1OGSA 4H2HA 1KM3A 4IGNA 3EX6A 5CZ0A 4CLMA 2OR2A 1RH9A 3GZAA 3QZAA 2IKGA 1J5SA 4HU3A 5DXYA 4JIEA 3UEQA 3NZRA 1KCKA 1ZNNA 4R88A 2QJJA 2BDQA 1YRRA 2VEGA 5DY3A 3TTSA 1CCWB 1YDNA 1ISZA 3W7NA 2I56A 2ZCGA 4WSHA 4MKSA 1Q7QA 5DANA 3BSHA 3UPBA 3K8KA 1C7SA 4HHPA 3VDHA 3P3BA 3QPEA 5A5WA 3GW3A 2XIBA 1PO9A 2A3EA 5IM51 3WQGA 3WQPA 2WJDA 4PMXA 5F4XA 4Q8MA 2PCEA 4JICA 4YHEA 1JAEA 1H4PA 2PZNA 1OFOA 1VCFA 1A80A 1A5SA 2QULA 3CQIA 2X7VA 2POTA 4QCEA 4J5NA 3GDMA 3PB2A 4PN2A 3O6DA 1B1YA 2P8BA 1ZPTA 1V7YA 2QUMA 3AWOA 4G9PA 2VGBA 3KE0A 4LALA 3MMDA 4JZ5A 4Q7NA 3LNPA 1W32A 4RE3A 1C8XA 3GXIA 3VKKA 3C2OA 3IEBA 2B4GA 3QV6A 3NL5A 2D69A 4WF7A 2DW7A 2PDQA 3WH5A 1Q85A 4P7OA 1V0LA 3HPZA 4YTRA 2PDIA 2F8QA 1LRQA 3VINA 2WVUA 4IIGA 4XKYA 2WM1A 1QASA 3DFHA 3E6EA 2Y1HA 3VD3A 1DJWA 4KBXA 2OLSA 5EB8A 3W2LA 4HNCA 4C6FA 1W5NA 3HN3A 1E4IA 3MMTA 3GBEA 2ESCA 1SVDA 1BSIA 5I6SA 4OU1A 1UR4A 1AZ2A 3ABQA 1QNOA 2E8ZA 5BZAA 4TTGA 2PLCA 3LDVA 3UGRA 2Z7GA 1LWIA 4U3AA 5H91A 3WD1A 1GYLA 4HCHA 4MIMA 1SJAA 3WF2A 1EDQA 4Y96A 1C92A 4W8BA 2ACSA 3EOUA 4DAIA 3P80A 2DUXA 2DFAA 2Z27A 1LUCB 2OO6A 1JZ2A 3GH5A 2ZBTA 3BPWA 2XGBA 3GW0A 4NRSA 3V36A 1M7PA 1J96A 2YCLB 1D7FA 3ABZA 1TE1A 3W88A 1WBHA 3IVSA 3AZSA 2CCRA 5DFAA 3CLWA 1G69A 1ITUA 3S0CA 3HQOA 4CKQA 1FKWA 3AMGA 3W1MA 3BXWA 4LGXA 3ID7A 3TW6A 3UT0A 1J0ZA 2WM0A 1XHGA 3WIJA 1UPPA 4J1OA 9CGTA 1UUQA 2QIIA 4US6A 3RO8A 3M0KA 4HSHA 4PH6A 3UJ2A 2VZUA 3VC5A 3ES8A 4MB1A 5K9CA 3U5UA 4HCDA 3FA4A 4GJIA 2P3EA 3CGTA 2PDNA 2J9ZA 1XISA 3LGDA 4FZIA 3QY6A 1Y5VA 4F9JA 5LIYX 2GVEA 4WDUA 5D09A 4GIRA 3P62A 4GY1A 2CFFA 4GOAA 5CC6A 3CZ8A 2ICSA 2BLEA 1LJYA 1S2UA 2XFWA 1N8WA 2XUCA 2PGWA 1QBBA 4FLQA 3CWNA 4HP5A 1UUMA 4LX4A 3WD2A 3NG3A 4ATLA 4JCLA 1KB3A 1EZWA 3BG3A 3AJXA 3AIUA 5CSSA 4J35A 1E9YB 1WZAA 3APYA 4E0CA 4L4OA 5I07A 2CXEA 4J2PA 4C5YA 3CH9A 3R8GA 5LNRA 3VNLA 4JTKA 3MCMA 3BLEA 4L9YA 1ODZA 5E6YA 2CWXA 4QHRA 3M0YA 3E9AA 1MZHA 2ZUTA 1BXCA 5DMLA 4JNMA 5LZLA 2OWWA 2P8CA 3FAWA 2DZAA 3ZXWA 4ZQMA 5I77A 2O0TA 3M0MA 4JIIX 3OBAA 2VXNA 4X61A 3VIIA 3KHJA 5JH2A 1BWLA 3NQCA 4V15A 4CU6A 3SCUA 2JBMA 3N6HA 2E9BA 2ZZ7A 1J6OA 1BWVA 2DZTA 3S1UA 4WK9A 2VP8A 5TD4A 4INFA 2FHCA 4IGHA 3PP7A 4Z2GA 4P2VA 3VKBA 4JTHA 1ZAIA 3M7WA 1UMYA 4WZHA 2VHLA 1E1CB 2J79A 3GHTA 1CLKA 2ALDA 3WKZA 3MA8A 2C79A 1LCOA 5D33A 4ZO7A 3SB0A 3I7QA 3MYPA 1MRQA 2F6UA 1XYBA 3THQA 5C9XA 3W7IA 2ZTKA 2TSYA 1SGJA 1RUSA 3UF9A 3T07A 3EB4A 3LHUA 4GC4A 3WDIA 3URNA 3ONCA 1ZCOA 1IT8A 2WSYA 4QEEA 3DERA 4B2DD 3QLDA 4MM1A 5LNSA 3EOOA 1L6YA 4UWMA 2PGFA 4FO4A 4S3KA 1KFBA 4HU4A 3N1AA 3F2BA 1B54A 1E3XA 1CX9A 3AISA 1FWJC 1EC7A 1K02A 2CLEA 5T91A 4DJEC 4U4MA 3PTQA 2E77A 2YJQA 2H6RA 5KTLA 5HNRA 4B5XA 2GGJA 5AC7A 5ABTA 2B7OA 2WZEA 3MSYA 5CPMA 1ODUA 4E4UA 4AIBA 1K9EA 3LM3A 3N14A 1XPYA 5CGQA 2D20A 3WLPA 2ZA1A 3PR2A 5G1MA 5D03A 3KOYA 4M7TA 1IXNA 2VCAA 1CGYA 2ZADA 4MY9A 2BG5A 2FZNA 4OVXA 1QI0A 5G4WA 1P1MA 3RCYA 3WJZA 3WLJA 4XZNX 4H4IA 3LXAA 2GOUA 1RR2A 5L6UA 1V93A 2VI0A 3BOFA 1TPEA 2VUYA 1VPXA 4YIWA 3EDJA 2IQDA 2ZXBA 2B7QA 1C93A 3WMSA 3W1QA 4CEUC 2CETA 3T2OA 3P82A 5MKGA 3N18A 3PZIA 4EKJA 6REQB 1UUOA 3DIPA 4PE8A 2CKRA 4G7EB 5H8PA 1QNSA 3LNMA 2F9RA 3WMCA 2Y62A 4Y9MA 3PZNA 2NT0A 2C0AA 2PAJA 1FWTA 1EF2A 4MGGA 5C71A 1H2JA 3CL7A 4LAKA 5J04A 2V63A 3F4NA 1XDMA 4RPQA 3WLQA 1RCOB 3TTYA 2NVAA 2FZMA 2GUBA 4OECA 2O7QA 1SW3A 2YYTA 3KDNA 2V38A 1YX1A 1RD6A 4IIFA 1OFRA 3UYIA 9XIMA 2X1SA 3MUAA 4XBKA 2VRJA 3W76A 4L9ZA 4YPJA 5AC6A 3GX9A 1LM1A 2HRWA 2ONEA 4QDWA 4FOKA 3EKLA 3P6LA 4R5EA 2OSWA 1WAUA 1ZJHA 3W86A 4E2OA 3W7EA 5DXXA 2UZ9A 4PMNA 1YBQB 1SSGA 2GQ9A 3M44A 4LUYA 4WXYA 5KINA 2JF7A 3KCOA 2DIJA 4H9VA 3INPA 4O1FA 2QJNA 4BQ4A 3LRMA 3UETA 3S83A 1XH0A 4WUIA 3LSBA 4GCAA 2QJMA 3GTIA 4HSNA 4LW7A 2VVNA 3PZOA 3ZLFA 3GVRA 1XIFA 3PVFA 4C6BA 4FX6M 3ANYA 2XHYA 4PTDA 1IIGA 4K7VA 3BLOA 5I03A 4QITA 4LNCA 1AQFA 2G96A 5D37A 2EJ1A 5GNZA 4C1KA 3BDKA 1WQ5A 2ZWZA 3ABOA 2KAUC 2IQTA 2DQWA 4C6NA 4E8CA 1W0MA 1TG7A 2I9UA 2QDHA 4Z1AA 2ZVIA 3NZ1A 1GOKA 4Z2JA 2W92A 3FX4A 3C2EA 3KVJA 2CESA 2QHAA 4DJDC 2P5NA 3W7PA 1PSCA 1ISYA 4C60A 2RH9A 4W5UA 2IKJA 2OMAA 4JQ1A 2VFHA 3MYOA 8TIMA 1UP3A 3A4WA 1CWYA