1ADSA

An unlikely sugar substrate site in the 1.65 angstroms structure of the human aldose reductase holoenzyme implicated in diabetic complications
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title An unlikely sugar substrate site in the 1.65 A structure of the human aldose reductase holoenzyme implicated in diabetic complications.
pubmed rcsb
source organism Homo sapiens
total genus 107
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1992-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1adsA00
4ICCX 5LIKX 3ERPA 1AZ2A 2IPWA 2PDHA 2HE5A 3LEPA 1ZSXA 1VBJA 2IKIA 4JIIX 4LBSA 1XGDA 4PRTA 3WBXA 4WDTA 4XK2A 3LENA 5JH2A 5LIUX 4XO7A 4GQ0A 3R7MA 2ACRA 2FGBA 3Q67A 4HBKA 4H7CA 4QXIA 1EXBA 1HQTA 1UR3M 2WZTA 3Q65A 5HNUA 1FRBA 2PDUA 2PDYA 2FZBA 1PZ0A 2PDCA 4R9OA 4PR4A 1ZUAX 4IJRA 1K8CA 1MRQA 2NVDA 4FALA 2WZMA 3QKZA 4GQGA 3F7JA 3VXGA 4RPQA 2PDKA 1PWMA 2ACQA 3M0IA 4JQ2A 2IKHA 4WDUA 4JQAA 1Z89A 1OG6A 1QWKA 1X98A 2HVOA 1YNPA 1YE6A 4YVPA 4JQ4A 4YVXA 4ASTA 2INZA 3UYIA 3DOPA 2PDWA 4YS1A 4F40A 3UGRA 4Q3MA 4LB4A 1X96A 1MZRA 1RY0A 1ZGDA 1T40A 3H4GA 1JEZA 3BCJA 4JIRA 3R58A 2IKGA 5AZ0A 1AH4A 2F38A 3WBWA 3H7RA 4XZIA 2ALRA 4YU1A 4GA8A 2HEJA 1AZ1A 3RX2A 4JTQA 2ACUA 3T42A 4XZNX 5LIWX 4IJCA 3C3UA 3COTA 3EB3A 3G5EA 3FJNA 2AGTA 1Z8AA 4PUWA 5LIYX 3CMFA 4JIHA 1ADSA 3M4HA 4XAPA 3LBOA 1HW6A 4EXBA 3S3GA 4WGHA 3R94A 2PDJA 1Z3NA 4XZLX 3DN5A 3LN3A 2HDJA 3GHUA 3O0KA 2C91A 4JTAA 1ZQ5A 5HNTA 1XF0A 4G5DA 2PDPA 3GHTA 4GACA 3RX3A 4FAMA 2FZDA 3ONBA 4DBWA 5M2FX 2INEA 2PD9A 1Q13A 3FX4A 4WEVX 1PWLA 3N2TA 5C7HA 3MC5A 2PDXA 2PDNA 4JTCA 2J8TA 4LAUA 2PD5A 2NVCA 2IPJA 5HA7A 3ONCA 3LQLA 4JQ1A 1AFSA 4ZFCA 3V0TA 4XZHA 3UWEA 4JTDA 2PF8A 3P2VA 3LQGA 4WDWA 1RY8A 1VP5A 1LWIA 3V36A 2IQDA 4QR6A 4FZIA 3GHRA 4AUBA 3G1RA 4LB3A 2F2KA 3V0UA 1IEIA 3LZ5A 3R6IA 2PDMA 2PEVA 3O3RA 4XO6A 5JH1A 1S2CA 2P5NA 4FA3A 1SM9A 4L1XA 4QBXA 2PDIA 3V35A 3R8GA 4QX4A 2PDLA 3UFYA 3V0SA 2DUZA 2I17A 3LZ3A 4DZ5A 4OTKA 1A80A 3CASA 1C9WA 3UZYA 4HMNA 4XVEA 2PDBA 1AH3A 2HVNA 5DANA 3UZZA 4DBUA 1QRQA 4H8NA 2I16A 2PFHA 1PYFA 4GABA 2PZNA 1YE4A 3U2CA 3MB9A 3KRBA 1EL3A 4WDXA 3WCZA 3LD5A 1M9HA 1IHIA 1GVEA 1XJBA 4MHBA 2HE8A 2BP1A 2IQ0A 1EKOA 4NKCA 4EXAA 4XZMX 3N6QA 4LBRA 2VDGA 2IPFA 3CAQA 3EAUA 4GIEA 1Z9AA 4Q7BA 1S1RA 3B3DA 4I5XA 1YNQA 2BGQA 2PDFA 3R8HA 1J96A 2IS7A 4JQ3A 3UG8A 2A79A 2PDQA 3BV7A 3RX4A 2BGSA 4PMJA 3BURA 3UZWA 3CV7A 1LQAA 4GCAA 3CV6A 2CLPA 1Q5MA 3GUGA 3D3FA 5LIXX 3UP8A 3GHSA 4PUUA 2HV5A 1T41A 1S2AA 1PZ1A 5AZ1A 5KETA 2ACSA 3H7UA 2DUXA 4JTRA 2FZ8A 1AH0A 4XVDA 4PRRA 1US0A 3R43A 4L1WA 1S1PA 3LNMA 2R9RA 3BUVA 4WRHA 2ISFA 3NTYA 3CAVA 2DV0A 1RALA 2FVLA 4YVVA 1X97A 3UZXA 1R38A 3LUTA 2QXWA 4IGSA 2IPGA 4LAZA 1MI3A 3M64A 3WBYA 3EB4A 2IKJA 1EF3A 2PDGA 3WG6A 4DBSA 2R24A 2FZ9A
chains in the Genus database with same CATH superfamily
2CLMA 2CETA 3B8VA 3FN9A 1R3QA 3VNLA 3AIUA 3TC3A 3AHVA 2I9EA 3AAMA 1EOMA 3O0FA 3BJSA 1YX1A 3NNTA 2X16A 2PLMA 3TONA 4DWSD 3QOKA 4XD3A 4Q33A 4WKHA 1ONRA 4UQBA 4MLJA 2E40A 3KRUA 4W9TA 1GVRA 2WMFA 3QSRA 4MWAE 1O60A 1XBYA 3DI0A 1FFRA 3UNTA 4Z2JA 2J7GA 4TMCA 1PL9A 3H23A 5E70A 3VXGA 3CJPA 4BEQA 2A1YA 1W1A1 4GY1A 1KGWA 1J2WA 4NJHA 2WKJA 4WXZA 1VQTA 4FEZA 1T7LA 4LAMA 3ZT6A 4BF9A 1VENA 4JY8A 4AIBA 4PZVA 2NUWA 5T26A 3DXIA 2JGYA 1EOKA 3DYPA 1XHGA 2EPOA 4V27A 3THAA 5AC6A 4NNCA 3OZYA 4KWSA 5LSMA 1QI4A 1TJ1A 2R1PA 3ZJKA 2QCMA 2NQ5A 3CIWA 5CZJA 1QI2A 3T40A 3IIOA 3HGSA 6ALDA 5AC4A 4KRZA 2PU0A 2Y24A 4KS0A 4HZ7A 2DIJA 3MZ2A 3Q45A 3UW6A 5H6HA 4HNVA 3H2NA 1B4KA 1JFXA 1HKIA 1NELA 3VDAA 1E4LA 1UKQA 1YADA 1B1YA 2JF7A 2OX4A 4IUGA 3U8GA 2EG7A 2DVTA 4DUOA 2NX9A 3C2VA 4J9JA 3M4HA 4GY7A 2QULA 1HTIA 4DYEA 2BY3A 4M24A 1CEOA 3FHQA 4KETA 3AU6A 1EO7A 4LC8A 4HTBA 3VGDA 2WC4A 2X0SA 4JTAA 2J8FA 3KX6A 4W85A 3U5YA 1VR6A 4AC1X 1J0HA 3LX9A 2ZOXA 4IXHA 4NNBA 1VFUA 2FPYA 2PGFA 4GUIA 1PZ3A 5DBUA 3S9ZA 4W5ZA 1VCGA 1EUAA 1QCWA 4BI6A 3T2OA 3NZPA 3KXQA 1R30A 5AY7A 3NR0A 1Q7MA 2BS9A 1XX1A 3Q2DA 4TTUA 4RKAA 4GIAA 1F73A 4MF4A 1UYQA 3B0VC 1OADA 4W8BA 3QHNA 1HP4A 3GC2A 2BOFX 2X7VA 4KWWA 2PTZA 4BQ4A 3HGJA 3NA8A 5A6BD 1AL7A 5G1MA 2EKCA 1KXVA 2B4GA 1W1ZA 3I3BA 4AUBA 3LS9A 3L7RA 1UC4A 1QAPA 3AYSA 3W0KA 4WX2A 2F2KA 3EWDA 2DW6A 3LZ5A 1CI1A 2RDWA 4LCQA 1DWAM 2X1SA 3A23A 1XCWA 4GRSA 1B9ZA 2POTA 4UQDA 2WSKA 4GZ7A 4ZO6A 3RPTA 4EK7A 1YPFA 1GZJA 3V0SA 1I2RA 3QYSA 5E93A 1GQJA 2QCDB 8XIAA 4C6BA 3RU8X 4FB7A 3ITTA 4C6PA 1RK5A 3CZGA 3Q4DA 4H8NA 3NQCA 1ECQA 3GTFA 4GNKB 3TLQA 1FBAA 3U2CA 3HPAA 3SCSA 3V75A 1VEPA 1EX5A 3IUDA 4AY8A 3VO0A 2VHLA 1FWGC 2XZ7A 3GWQA 4Y8FA 2VD8A 4J7RA 4EIVA 1PVNA 2WMKA 3GX9A 4RXGA 4U5IA 2WYSA 4IX2A 1H7OA 4JL2A 4MZ1A 2ZUVA 5AFDA 4DUVA 1R3RA 2FHFA 1QOPA 3BVJA 2C79A 2WMJA 2IUZA 3ZQ9A 4WHBA 3IGUA 3SN1A 3W7IA 4UNKA 2QZRA 5FEXA 1TJ0A 4PB5A 3RK8A 3N04A 2WZEA 3KUMA 1YMYA 1K7EA 2WCGA 4RW5A 1S1RA 9XIMA 5LNRA 1MQRA 4BA0A 2WV8A 2IS7A 4A3HA 3GG7A 1S5VA 2E25A 3VINA 2Y89A 3W1QA 4O18A 1O7AA 1TWWA 1OEPA 2OT0A 2BY1A 2VGIA 3ZS4A 4IGMA 2J9ZA 3N25A 1RH9A 4JKKA 4IWWA 3JZUA 2ZIDA 4HN8A 3H22A 4PMXA 3L4XA 1W3IA 1K70A 5FEWA 3UPWA 4H9UA 2PRMA 2YCKX 2JE8A 1TTIA 4GZEA 5CQ1A 2VWTA 3GG8A 3F2BA 1XLMA 3OLDA 1XLEA 3ME3A 3NUKA 1JAKA 2BVWA 4AX7A 1ALDA 3E12A 1JPMA 3BG3A 3DFQA 1UD3A 4J2PA 4FX7A 1KCLA 2UY4A 2ZCGA 5LA0A 1CGUA 1RA5A 3YPIA 1WAUA 3P74A 4UQ9A 4CQ8A 3G1HA 1RR2A 4GX8A 3M64A 1WZAA 2NQHA 1DJIA 4Q22A 5LA1A 3VIHA 1UA3A 2J25A 2J7CA 2HQAA 3HU7A 5HUOA 3K4DA 1BVZA 3RILA 1KRMA 3N34A 1HT6A 3DFNA 3KLKA 4B3KA 3VGGA 3MKVA 1NWTA 3GR4A 1P5BA 1W1IE 1M53A 1TELA 4J2MA 3S2MA 2QIWA 4K39A 5DCEA 4DJDC 1GZGA 4GUGA 1V6XA 1I2NA 3AMCA 4C6NA 2Q3OA 4LYRA 4DO7A 2V2HA 1IT8A 1R9YA 3HFTA 4H7CA 5AB3A 3HMCA 1OFRA 3LPFA 3Q65A 4X2RA 4H8UA 1FRBA 1UUQA 1WXYA 3G18A 3GTIA 4LT9A 4B4HA 1IE7C 4Q8WA 2C0AA 3PJTA 1W2VA 2CHNA 4L4OA 3N2BA 2I5GA 2ZUWA 2Z7GA 4NY2A 3PP7A 1XLHA 3FY1A 4NI8A 4JQAA 3OBEA 1QTWA 4P8WA 4KWUA 3MA8A 1IR2A 4ZO8A 2F7FA 3DYMA 1V6TA 1A49A 3IACA 3CL7A 3UXAA 1QU4A 2VGBA 1SFSA 3KVJA 4GIRA 1XD0A 2JALA 3AI0A 3EPMA 1K6AA 1WKFA 2IKGA 4C1NB 1XSIA 2G95A 2WQDA 3MTWA 3RRXA 3W87A 4CVUA 3SGZA 4JTQA 5CC7A 4H83A 4IPNB 4KEUA 3QEZA 5D2VA 1EA0A 1J01A 3FJNA 3TROA 3PBMA 3EDJA 4H2CA 1AW1A 3NOYA 1ITQA 4H41A 2BY2A 3WUFA 5DN1A 1UR2A 3V3WA 5KITA 3AWNA 4H7ZA 4KEZA 4W88A 4W84A 1WDQA 4W93A 4AXKA 2YCLB 4UFIA 1P6CA 4QP0A 3VIJA 1FKWA 3P0XA 2YBUA 3GHTA 1IXNA 2EPLX 1K6WA 5BMXA 1HXJA 2PD9A 3E96A 2BGNE 4UWMA 3AU2A 2CKSA 5I0DA 4M7SA 1ZALA 2OZTA 3W2UA 4GJJA 2D2JA 3VZYA 5D32A 3FSTA 3EA2A 3BLOA 3MMUA 1RA0A 1E6RA 1AFSA 4AZGA 4JAWA 3W28A 3ZWSA 1YDOA 3S1VA 1B3XA 3GXDA 1HNYA 3LQGA 1XIBA 4MKSA 3I4KA 1BXBA 5JQ9A 2I56A 3AIWA 4S3KA 1W1B1 1QW8A 1VKFA 2FIQA 3OO2A 4L7ZA 3VIOA 4Y9NA 4LRTA 1GJPA 4O1CA 2GFTA 3N73A 4Q8OA 1WAWA 4GQBA 3EOUA 1KRCC 4B2DA 3O8AA 1TWIA 3DHUA 5HDRA 3A4XA 3OHIA 2ZUTA 1AL8A 4L1XA 5CC6A 2PWEA 1K9FA 5AOUA 1G67A 3VNIA 3P62A 3N15A 2XSXA 2W91A 4PYSA 3WQOA 3ZVIA 3JU2A 4MKNA 3ECQA 1W37A 2F2HA 1Y8BA 1W8GA 1X1OA 4QJ1A 4PUNA 4ACZB 4XVEA 3L67A 1XS2A 1CXEA 1IWPA 2E0PA 3VKCA 3AUOA 4DBUA 5HMDA 1JNDA 4M6PA 3W83A 4OHQA 4DLMA 4HPXA 6REQA 5I2UA 3TIMA 3QQ0A 4TX6A 3FAWA 1Y5XA 4LV4A 4GOAA 1HJWA 1TJPA 2HVMA 4IHCA 2O7SA 1TA3A 2NX1A 5XINA 3VDCA 4F4RA 1NP0A 1P4CA 5C9RA 4P2VA 4ADSA 1NOWA 4MIMA 4Q4RA 3PZUA 2E1DA 2ZRWA 1EJWC 2DZWA 2QPUA 3FFSA 1L8NA 3SCVA 1E0UA 3WDPP 4IPPA 2V5LA 3PG9A 3TW7A 2ZZ3A 1UH2A 2FZNA 2VOMA 2JBMA 4IPLA 4U4MA 3NL2A 3QY8A 4QIUA 2X30A 1HJXA 3ARZA 4AEOA 5LXEA 1P0KA 1VFHA 3HG3A 2FTYA 4NJGA 3ZIZA 4X0NA 5BOFA 1Q2SA 3E0LA 1H41A 1FHVA 3XINA 4E2BA 3D3FA 3PZVA 1JUEA 3NVDA 4M19A 2NLYA 1LBMA 2VWSA 5FJOA 1OBAA 1LLWA 1VD6A 4A21A 1FHDA 4CQ9A 4TU1A 2WWDA 1EWEA 2Z1VA 2Z2UA 1H5VA 4XVDA 3IWPA 1JR1A 3F4CA 3LNMA 1YXYA 3VD3A 2ZXQA 4XD4A 3O63A 4KFNA 1NF7A 4DPQA 2YGYA 2E5DA 5FF2A 3UJ2A 1IZJA 1MDLA 3TTSA 4N2YA 3NVTA 1XBZA 5LXXA 1VBHA 4OBSA 1E0VA 4S2CA 3SGUA 2V3DA 3FVMA 1XXXA 5HK4A 3W22A 2IPGA 2PAJA 1K1DA 1CXLA 1GG1A 1ZPTA 3LLFA 4LVGA 3EB4A 3R13A 2DSVA 2IKJA 3W1UA 1Y5WA 3BJTA 3T0AA 2CXEA 3WG6A 5TIMA 3HJZA 4PODA 3GVRA 4UOJA 3PR2A 3LI0A 5A69A 5GVJA 4XK2A 2AL2B 4FNRA 4GQ0A 3PPHA 3LV6A 5D04C 2H90A 3WMSA 3F4NA 4DJED 1DHKA 3QQ1A 4O17A 1PZ0A 4QISA 4PR4A 1D3HA 4L9YA 2EG8A 4FSAA 4XAFA 1DWIM 2AMXA 3GC5A 3VI2A 3ITGA 5EMYA 4JY9A 1V79A 2NX3A 2XPKA 1YDVA 3TYDA 1PJ9A 1H5YA 1T8QA 1GKPA 1DBTA 4IP7A 3G1AA 2NQZA 4HZMA 2VL4A 3I4EA 3CUJA 1BYAA 3STGA 4WXYA 4YVPA 3ZVHB 4WJEA 4BEUA 3UGRA 2PUZA 5KZ6A 3K4AA 3RR4A 1CXIA 2GVJA 4KIEA 2YCJA 3K46A 2C1HA 3TW9A 4FXJA 4M81A 5REQB 1PSCA 1WOAA 1AH4A 1KTNA 3PBVA 1RLCL 3OJGA 4R5EA 1XCFA 1KM2A 1XLKA 1UD2A 4GA8A 1XYZA 3W1PA 5BWFA 4PCSA 2GJLA 3C2EA 4GNVA 4MNJA 3RLUA 2RDUA 3P8JA 4NXSA 4G7EA 4RJEA 4UC5A 1W6TA 4V2XA 5J5DA 1ICQA 5HQMA 4O1BA 1ADSA 1TPUA 1OT1A 4EXBA 1JYVA 1S5NA 1AK5A 1JZ8A 2GGHA 1TIWA 1OCJA 3W74A 3B4UA 2OU4A 1RBLA 5HR7A 2BLEA 1XDJA 2PODA 3P67A 3LSCA 3LXCA 1ISZA 1F3WA 2PDPA 1TKKA 4W7WA 3WLOA 4O10A 3SADA 3NQFA 4LUSB 1EJUC 1LG1A 3G6MA 5EU9A 3W00A 5M2FX 4IMGA 3HQPA 4MUZA 2PPGA 1OB0A 3KOWA 5KMYA 2VUNA 4NX0A 3HJEA 4UTMA 1UKTA 1WB0A 3KDNA 4IIEA 3O16A 3L5MA 4WR3A 3CXOA 3TV8A 3ONCA 4Q4KA 1CDGA 5K9XA 3IJ6A 3LRKA 4GINA 4CU6A 1XINA 3VKBA 2VCAA 4KIRA 4Z17A 5K4XA 4BFAA 2VRKA 3E0VA 1M7XA 4ALDA 2YPIA 1L2UA 3QFEA 1JCNA 2RKXA 3W2NA 4Q32A 1H7RA 4RDYA 4XO6A 4ADTA 4J3TA 4PEEA 1QFEA 5ABTA 4AMAA 5U7SA 1XUUA 3W70A 2WOQA 3NCOA 1FWBC 1V6YA 3V35A 3SY8A 4E4UA 2CC0A 3E9AA 3FDKA 4GE8A 3TVAA 1XDLA 2PB1A 1CB2A 3ITYA 1KC7A 3E74A 3RO6A 3M46A 1FH9A 1GOIA 2WCAA 1KTCA 4GXPA 1CLXA 3SCPA 3SSJA 4QAIA 1NSJA 1DYSA 3M43A 3W24A 4WOZA 3GH5A 4CQAA 3GB6A 3UZZA 2OGYA 1PTAA 4IQDA 2PFHA 4GYPC 4R9XA 1AJ2A 3FA5A 2V5KA 1L6FA 1G94A 4F2TA 1FQ0A 2V5JA 2VEPA 5BZAA 3DHPA 2A3BA 2DW7A 3L4ZA 4B92A 2YA2A 3HQOA 4A3UA 2W3ZA 4NAFB 4I9TA 1GVEA 2F8QA 5I06A 2OODA 3MUAA 4O28A 4GQRA 1TR9A 1JQVA 1TZ9A 4E0CA 1UB3A 3TKFA 6XIAA 3N2XA 2WC3A 4V33A 4DN1A 3W9ZA 1KA9F 2A5HA 5C2CA 2NV1A 3G6LA 5L9FA 1Z42A 3CAQA 1QATA 1KCXA 3STCA 4ES4A 3M5ZA 5BXSA 3DKJA 5BXPA 1Z44A 2D0HA 1G0CA 2VEFA 3R12A 1UMYA 4P7OA 4U2YA 2G3IA 4DO5A 1TRDA 1A5CA 4QHRA 4AH7A 1GYLA 4BWLA 3FIGA 3HQNA 1KV8A 3ABXA 4AMCA 1TRIA 3W7GA 5CGTA 2OEKA 1L9WA 1ONWA 4Q8QA 2ZQ0A 3IGSA 3EMQA 4LAKA 1DIDA 3G8EA 3NXLA 4AG0A 1WYIA 2NXHA 1RJRA 1V02E 1EO5A 1FA2A 3KDOA 3E2QA 3OEXA 3L0GA 3DGBA 2Q8LA 3R4IA 4H9MA 5DT7A 2V63A 4D6FA 2Y7DA 4HNTA 3P6LA 3T0DA 1XM3A 1HL8A 3TU9A 1LUCB 3QLLA 3TJIA 3MANA 1YW1A 3NTYA 4B2DD 2ISWA 3AIRA 2QUNA 1ME7A 3C2OA 4XSLA 3P61A 4UXDA 3QBUA 3WQDA 1VBGA 3OVPA 5MKGB 1KM0A 3VIIA 2GVYA 4O19A 3IV8A 1UUOA 3TA6A 1R0MA 3DDMA 4XB3A 4ZXLA 2ZWYA 1ONXA 3PB0A 4OUEA 4A2RA 4YIWA 4OT7A 1EEXA 6TIMA 3WNKA 1K7XA 1I1XA 3ERPA 2PDHA 3TTEA 5K9DA 2YFNA 2GDUA 2QVHA 2J7DA 3CEUA 4PRTA 2WZHA 5LIUX 1VFSA 2VVSA 4JHMA 1G4TA 3MP5A 4HKPA 4MWAA 3VD9A 1CGWA 2PP1A 1ICSA 3L4VA 1ZAIA 5RUBA 4G8TA 1U1UA 2PDCA 1W5MA 3B8TA 3GNRA 4B5VA 3HPXA 1XLCA 1UW9A 2VR5A 1CLKA 2OTDA 4Q6XA 1TE6A 2B81A 5HMSA 4AYSA 3GYEA 6TAAA 3O7UA 1GZ1A 1QHPA 4M80A 2EPMX 5FEZA 4H3DA 2YDSA 2PC8A 2IKHA 4WDUA 4FIQA 4XZ9A 3LCHA 4JGDA 5KEZA 2Z27A 2GGGA 2FYMA 4GYJA 5FL1A 2P8BA 2DZXA 1V0MA 4CD8A 4XBSA 5D09A 2PDWA 2X7WA 4YS1A 3THCA 5LGXA 2YCEA 4WD0A 3GAKA 3LU2A 3LV5A 3VILA 5JBEA 3BCFA 4JIQA 3CLMA 1QHZA 2FJKA 3WSUA 4YU1A 3OA3A 3BL3A 3E5BA 3MBFA 5B7YA 4MY8A 1E9ZB 1PV8A 1NTHA 1HG3A 3BSGA 4OIFA 4ZA0A 1VPYA 3KM8A 7ENLA 4PUWA 4DO4A 5DO8A 3G0UA 3CMFA 1JRCA 4O1FA 4IIFA 1E1CB 4EE9A 2VFEA 4DVOA 3VDGA 1SJBA 4NIRA 3OZMA 1BXNA 5IFTA 1GONA 4K1GA 3V5FA 2R8WA 2NWRA 2V3EA 4DNMA 5AHEA 2V5BA 1U1HA 3T2PA 3NSNA 4K36A 3B8IA 3T07A 1JPKA 4X9SA 4CLMA 4Q4QA 2Q71A 5A8MA 3FX4A 1EZ2A 2YSWA 4J3VA 1TPC1 3P7YA 4FXSA 4ERAA 3E0FA 2OLSA 2QW5A 5EMLA 5G1TA 1TMLA 3OGRA 4E3VA 1MVYA 2P76A 4PTWA 5A5WA 2PSNA 4K1WA 3AXIA 4ZFCA 2VX6A 3W1LA 1J18A 2A7RA 3T44A 4KWVA 4AX6A 1KR1A 4PCFA 2O4QA 3LBMA 2GK1A 4N02A 1QW7A 4HU8A 3AJ7A 4DQWA 4JBRA 1UUMA 2PRLA 3FJ6A 1JCMP 3FYOA 1YDNA 1XYCA 4Z0JA 4C6FA 2XTKA 3NQBA 3EXSA 2VR4A 4UTTC 1TPDA 1DP0A 3IRSA 3G1FA 4LUJA 1FWJC 4PMNA 3UU0A 5I24A 1AUSL 3QHMA 2W67A 2HWGA 1HO1A 1TJ2A 5D2XA 1A80A 2XN2A 1XGZA 3PF3A 1O6IA 5G2HA 3N3TA 1RP8A 2HVNA 3I6RA 2CWNA 4W7UA 1X1ZA 1S2WA 4NZ5A 4UR7A 4UCFA 1OHLA 3N19B 1WXZA 3O15A 1NEYA 1BGAA 3IIPA 3LNPA 3VKDA 3FW6A 2VM8A 1WZMA 3PTKA 3APTA 3E0IA 1V8EA 5D30A 1KCKA 3BLIA 1UWAA 3VYLA 1ZAJA 1EP2A 4X0VA 4O13A 4B3LA 2JQXA 5HWMA 3LDVA 2C1IA 1XYBA 1CW2A 3NM3A 1ZCOA 3K13A 3GFZA 2VCCA 4AD2A 4DJFA 4EPBC 3A64A 4LW7A 2OCZA 3CZ8A 1JFHA 2XN0A 3WELA 2AAAA 5G1YA 4TV6A 4AD5A 1A3HA 2C16A 2NSXA 3LXAA 4NAEB 1ZU8A 3NXFA 3GDMA 1CZ1A 4A8RA 1RV8A 3WF4A 3A21A 4NI3A 5JIWA 1POJA 5CSSA 3V1PA 1BQGA 4AVNA 3UZWA 3V7PA 2D3NA 1XIHA 1QBAA 3CV6A 4INFA 1E51A 4N4PA 2CLPA 2DP3A 4Z1CA 4DYKA 3M07A 3MT1A 3BAJA 1BWVA 1GQNA 2HV5A 2XGIA 2X1RA 3NIYA 2J78A 4HK5A 1XIMA 1B3OA 4L80A 3PTQA 4PTNA 5HNNA 1OC6A 5BYWA 3WDJA 2PBGA 3SDOA 3MV11 4O57A 4ZEPA 1MW0A 4QCEA 3VZZA 1FWWA 4PMRA 2R9RA 3BUVA 4R88A 3TXZA 4UTKA 1Q8AA 5IDIA 1Q6CA 4M51A 3AS1A 1TV4A 3HIJA 4JIPA 1RALA 5D9PA 4FF5A 4A8NA 3S2LA 4UR8A 4LF1A 2QXWA 1KQZA 3UWWA 5E0FA 2YYUA 3ZLFA 3FDGA 2EXOA 4ZTYA 1I2QA 3UCDA 3MSYA 4MKVA 2JKAA 2FH6A 2XN1A 2DH2A 4Q4OA 4QDMA 2PCQA 4W87A 1VBJA 3IIXA 3ARRA 1DXFA 4RNHA 2QYGA 3EZ4A 1ZBVA 4S3DA 1TSIA 3TQVA 5G4EA 3VD7A 1DIOA 3I3EA 2QCHA 3MYPA 3VMNA 1KWGA 1XYMA 1UP2A 3ITXA 2Z1SA 5A6KA 2CBUA 2WZTA 2P53A 3CK5A 3P84A 4L4PA 3H6OA 2VENA 3LERA 3L4TA 2PS2A 4R9OA 2ATMA 3RFAA 3MI2A 1C92A 4PCPA 1QPNA 3QKZA 2VTFA 2VC5A 3A3WA 3F4DA 2HBXA 1FWAC 3W1NA 2GGJA 3RPMA 1LT7A 2ZICA 2Y63A 4I8DA 4XQ6A 2QMJA 2ACQA 3M0IA 1I2PA 1KM1A 1LROA 1U1JA 3DBPA 2J75A 1QWKA 1J9YA 3UCQA 1E40A 4GBDA 1XPGA 1EJTC 2DZVA 4ZO7A 1M65A 4EPEC 2B7QA 1RQEA 3WKZA 3TSBA 3SFKA 2NXGA 3VC5A 3NO1A 2X1TA 2G8ZA 1NIUA 3LTYA 3WJYA 3I7SA 3QZAA 4WKAA 1MZRA 5E0KA 2XDFA 1RJQA 5C2GA 2DZPA 1LZOA 3W85A 3THDA 5IBXC 1HN1A 4GJIA 4L6OA 4FIRA 4JYFA 7TAAA 1K8XA 3T81A 1JI2A 3GXPA 3CUIA 5AHNA 3VPLA 1WZLA 3TSMA 1P7TB 4RNJA 4IOTA 3C4UA 2QCGA 3G5EA 3AO0A 2QCFA 1VH7A 3GY1A 3RDKA 3KP1A 1DORA 1ZP3A 4Z0SA 3GK0A 3VKAA 1VJSA 1WZKA 1E70M 4QJ3B 3GKAA 3S3GA 1NFBA 1REQA 4UBPC 4RZ5A 3GXFA 6PTDA 5K9CA 4C90A 5M3WA 4QLJA 3EEGA 3K2GA 1A5KC 1V03A 3OG2A 5C6MA 3L66A 3T7VA 3M5XA 3KVKA 3L21A 1D7FA 5AYYA 2B0MA 2XH7A 3SQSA 3B8DA 2BWGA 1WBJA 3SBFA 1JF5A 4BS0A 3MYOA 2E09A 2VC6A 1I75A 5C5YA 3RMJA 1TWDA 3S6OA 2DH3A 2CHOA 1TTQA 3ARXA 4UTWA 1JZ3A 2PDXA 1A5OC 2WLYA 3VIGA 4JTCA 3SQLA 3GG0A 2C0HA 1M3UA 3EWWA 1IIHA 3SUSA 2B7OA 4JTDA 4IG2A 4MWAD 2J62A 2W0UA 1WUFA 1ZTVA 1SO3A 2YCLA 2ZX7A 4FOJA 4K37A 1OVDA 3MJMA 5CSRA 1P0BA 2HMCA 3ZO9A 2WSQA 1BTCA 4IPIA 1IEIA 4UUIA 2PEVA 3FEMA 4HSNA 3JUGA 3TP4A 2FPVA 4MDOA 1EA9C 3UJEA 4F0HA 3URAA 2ZA2A 1GOOA 3NPVA 1OYBA 4AZCB 3ZLHA 1X1NA 1OFDA 2GPTA 4NU7A 4N6FA 1WA3A 2LLEA 4OTKA 3SB0A 3KOFA 4K68A 1K9TA 4F0LA 3BAIA 1ZBKA 1HL9A 1UZHA 2PDBA 1THFD 4FK9A 3GNNA 2ZUMA 4C7GA 4NHVA 2MANA 1JL8A 2VURA 1GCYA 4GABA 2ZRYA 1WXJA 3KBMA 1ZNNA 4BQ3A 4CNPA 3LXBA 4F0MA 3S1UA 5EA9A 2J24A 1EIXA 5A1AA 1W9VA 3UWQA 3B03A 4TR9A 1KRBC 4MZ8A 4IIDA 1LYXA 2DIEA 4IUOA 3T4CA 4Q8VA 4ZB5A 4NKCA 4LJ3A 1FX6A 1DKWA 3DENA 4KBXA 3PN8A 1O94A 3AIBA 2VOTA 4MSSA 3MY9A 4UQAA 2VZVA 4RZ6A 1DHPA 1LL7A 3ITLA 4FLOA 3UPMA 4JTTA 2BGQA 3R8HA 1J4EA 1MZHA 5FSDC 2Z1KA 4OBRA 1Q6EA 1RQBA 3ZLGA 1LRNA 5U4NA 3UJFA 1XQKA 2BHZA 2CHRA 1D8CA 2W63A 1OWQA 1S39A 4PBGA 3CBWA 2WMGA 4H8HA 4GMEA 1SMAA 3DCPA 2GDQA 2VRQA 3GHSA 3C56A 2A7PA 1FOBA 4QGCA 4C1KA 4JTIA 1T41A 2DSKA 2WJDA 1RD5A 5FF3A 3IRDA 5G2IA 5CAKA 1IQ8A 1C9DA 1EJXC 5FESA 1W9UA 3QMRA 4LVFA 4ZFMA 5I7GA 3QJAA 2ZZ2A 3CHCA 4KMQA 5TF0A 2YYTA 1D8WA 2EO7A 2ZVIA 9CGTA 4KCTA 2A4AA 7PTDA 2OLHA 2WMIA 4YTRA 4I9MA 5HJLA 3JS3A 3N29A 1FFQA 2X09A 1KFEA 4J3ZA 4HA4A 1J6PA 5FJIA 4RV8A 1DJGA 1UA7A 3TYCA 4KGLA 4XTDA 3M5YA 5JBDA 1BLIA 1DOSA 2Z1WA 4DB7A 1E6SM 5IRPA 1LORA 4DBSA 1Q85A 3VNJA 1EQPA 1DWGM 5LNSA 4H9XA 4UZSA 1D7KA 3GDLA 3TQ0A 4JX4A 4HSOA 4JEJA 2JIEA 1ZB5A 2ZTJA 3HTWA 3VFLA 4GISA 3LENA 1MFUA 5JH2A 1YQ2A 5HAOA 2Y7FA 2FGBA 1JDCA 3CHVA 5DFAA 3RO8A 2V30A 4UCGA 3BC9A 1IEQA 1UR8A 3PSVA 2FZMA 4IIGA 1R46A 3LGDA 4MOZA 4ZODA 3VIMA 2FZBA 3ATZA 5C9ZA 4Q4SA 3BW3A 4IJRA 2PWDA 2ZRUA 3CU2A 5IFPA 3R0KA 2NVDA 1LG2A 2XIJA 3H2AA 4NT0A 4H9YA 4MVAA 2BXVA 5D9OA 1W0MA 1R3TA 2Z25A 4NF7A 3IJ8A 4B5WA 3VOJA 1I4NA 3OHMB 2OG9A 5LNVA 4PBFA 4DJFD 4DWSC 1YTEA 1BTMA 2CERA 4MY1A 4M6VA 4WVXA 4MADA 2YXOA 2AL2A 1FWIC 3N4EA 3QM3A 1GJUA 2ZA1A 1SFJA 6REQB 1RY0A 1JZ6A 5CKSA 1J0IA 4JFUA 2PI6A 4DNHA 4R7JA 2FMOA 1ME9A 4RDZA 2PWFA 4XZIA 3WLSA 1QNPA 4M8UA 4JNMA 1OD0A 4LXFA 4YCOA 3SY1A 3FXYA 3BAYA 4S3JA 4PUEA 2G0WA 4HPNA 1N8FA 3T42A 1BEUA 2Y5JA 3E3HA 2Y70A 4GD0A 3NZGA 4NILA 3GZ3A 3UT0A 1BWKA 4L56A 3UXLA 5I3GA 4IF2A 1XKJA 1FWEC 5FD0A 4DO6A 3VE9A 2PGRA 3ZVHA 3JVAA 1G4SA 2E8ZA 1IXOA 3RLHA 1E6QM 3NGJA 3TAOA 4PA8A 3B8WA 4NZ4A 4DZHA 4IZGA 1TREA 4H4IA 5REQA 3ZJ6A 1DV7A 3A3XA 3NQMA 3WQCA 1VFTA 3TQKA 2Q8XA 2WKLA 3PNUA 1XV8A 4XAYA 3LPPA 2IW0A 4OFCA 2W4XA 1HF6A 1QNRA 2PWGA 3SCTA 2Z28A 1GQKA 1KBIA 1IGWA 1V6VA 1TVPA 1ZJBA 3C0QA 4PB4A 1PWLA 2HS6A 1CB7B 1E3ZA 2FDSA 1Q6FA 3QR1A 1OIMA 2O9OA 3BGAA 5FI8A 2OOFA 1QK0A 4WGXA 1BSLA 1N7KA 1S3HA 1F05A 1XH2A 4F2BA 3C0SA 3VCRA 5AVNA 2DSUA 4QE4A 4ZXOA 3VK5A 2FB2A 1KFKA 3MKCA 4POCA 3U2ZA 1VHNA 1JXJA 3V5CA 4LWWA 4QROA 5FEPA 1LWIA 3EPNA 1X39A 2QMKA 2NT0A 2OX1A 2OELA 1PKMA 2R6OA 4C7DA 1XLIA 3O1NA 3N2OA 3PWAA 1TMHA 4TTGA 3GVVA 4LUSA 4DIAA 1UASA 2A85A 3GKFA 1S2CA 4MJ4A 4FLQA 1Q8JA 1UH3A 3G22A 5A3HA 2CLLA 2FB3A 4MB1A 4NXKA 1E73M 4E4FA 3RCYA 2RDXA 2VFDA 3KTXA 3QV6A 1DXIA 1ML1A 4HCDA 2O92A 1D3GA 2E77A 3VMOA 1NDWA 1XH0A 3UR8A 2EPNA 3ITVA 3ZR4A 1J6OA 1J0JA 1HVXA 1Q7ZA 1F74A 3WFAA 3GIYA 4AIUA 4C6QA 5SWUA 4CCZA 2P0IA 3ES8A 6ENLA 1L6WA 1TO3A 3ATYA 1OFEA 2A21A 3CT2A 2D2GA 3EX6A 1LQ0A 1ZRQA 4OUIA 2WPBA 3TE9A 3TFXA 3LD5A 4O0ZA 2YZ5A 2OPJA 4GHRA 4RW3A 2XVGA 2WB5A 3AYRA 3W73A 1HGWA 1H62A 2IQ0A 3WNOA 4S1FA 4UTJA 5AKQA 2O7QA 5BRBA 1DJXA 3D6NA 3BQ6A 1H7XA 1E4IA 4AISA 1I0DA 2NUYA 1HKKA 2QNEA 1U30A 2D3LA 5E6YA 2YB1A 4GIEA 3HMJG 4K38A 4XBKA 3H55A 5C0QA 2ZX6A 3L2LA 3G0XA 5HQEA 3VX0A 3WUGA 4BF7A 4LY4A 4JQ3A 2AL1A 1UOKA 2JKEA 3QGAC 4U3CA 2WHJA 3BV7A 4BJHA 3G8RA 1V02A 2O56A 4NJJA 1E15A 1TVLA 5E09A 1CENA 4ZQOA 4G7EB 3KEHA 2J79A 4KGJA 3GUGA 3H26A 2YL5A 3W53A 3UP8A 1VEOA 2ZE3A 1R6WA 5B80A 1R7OA 1A0DA 2YBVA 5FACA 1IZKA 1A5LC 4CVWA 1NWRA 1GK8A 5A8PA 3QW4B 1SSDA 4JTGA 3ZM8A 1EF2A 4OOZA 1AH0A 1PDZA 1JI1A 4LCSA 4JOMA 1NOUA 2Z00A 1OSEA 3QPZA 3VOGA 1YLVA 1JDAA 1JYXA 5G5IA 1D2KA 1VIZA 1DE5A 3PZ9A 1T6MA 1RK6A 1FWHC 3P80A 4GZJA 1ZAHA 2DIKA 3JZEA 4QNEA 2E9LA 1OC7A 4Z2GA 2J6VA 2DZAA 3OIXA 3RHGA 1H61A 1R9ZA 3K5XA 5DEZA 3VNKA 5HBFA 3GTNA 4C1LA 1O5QA 3C8FA 3B0PA 3VGHA 3B06A 3ARVA 4FP1A 2IPWA 2OWWA 4CD6A 1UZDA 2IKIA 2FMNA 2FTWA 5DXXA 1LUCA 3W84A 2QCEA 2C3ZA 1MQPA 4HA0A 3DH7A 3CPGA 3UG3A 1TV5A 5LKYA 5DQPA 3R0UA 2H3BA 5MKGA 1F3XA 1K8CA 1UC5A 4AD0A 3CC1A 2D2OA 4QITA 2XGBA 3LLXA 4W8AA 3N9RA 1LOLA 3TZFA 1W9XA 7REQB 4DY1A 4WOQA 1LBFA 1KM5A 3W29A 3ITOA 3PUEA 4D8AA 3MP4A 1R86A 1PWMA 3ZOAA 6A3HA 4PFMA 4HOWA 2ZUSA 3K1GA 1Y5VA 5G2WA 4HP5A 4HMDA 4X3ZA 2J7BA 3WL1A 4CNOA 5LHFA 4YVXA 2CLOA 4QDWA 3VE7A 4LYKA 1XC4A 1V7AA 4LB4A 8TIMA 2UY5A 2ZZ7A 2BXYA 2Y85A 3WJXA 3G2GA 2NLIA 2Z6IA 4PTMA 3K8LA 1XKYA 4JIRA 4JICA 3BO9A 1QOQA 4TMBA 1ITUA 1A47A 1OZQA 2ABAA 5CG0A 3SQMA 2GUUA 1OCNA 5CZKA 4R7WA 3SFWA 4XSMA 1XBVA 2PU1A 4IH3A 4AZ7A 3THUA 1VLWA 4AW7A 2A3CA 3C3UA 1WKYA 3SN4A 3LPGA 2Y7GA 3A9IA 3PNZA 1XBXA 3ZSSA 1SFTA 1HJQA 4TIMA 2D24A 3FJ4A 4UTTA 1R2TA 1HZYA 1Z3NA 2CLFA 5LNWA 1G6CA 3VABA 3GU9A 4WQ6A 2HDJA 3O0KA 1M41A 4UTHA 3QKEA 1C8XA 2E7FA 2CZVA 2G3JA 2RJHA 3AIVA 2E9MA 1E71M 1UWUA 2VR2A 2WJEA 1H7NA 2Z2AA 2NW0A 3HBLA 1R7AA 2BOGX 3HZ3A 2Y5EA 1A5AA 1C8YA 4DBWA 1LL6A 2WJZA 2GJPA 3S5YA 2GSJA 2YA0A 4S23A 4G1KA 3WQGA 3M9YA 3IJQA 4K6AA 4RDVA 4JKMA 4AWSA 1XRFA 2PDNA 1E1CA 3GDRA 3UXIA 4QQ3A 3U7BA 1ZHAA 3BAXA 3CHEA 4GFSA 1TPB1 4C6LA 4QS5A 1O1ZA 1HP5A 4UFLA 1VP5A 1KLYA 2BMBA 4V1XA 1NF0A 1JYNA 1FDYA 4LVDA 5A6JA 2WQPA 3GHRA 1FDJA 3PULA 1C3FA 2F61A 5D9MA 2VZTA 1J0KA 4LOCA 5KTLA 3HQ1A 5JH1A 3POHA 3KCOA 4YHGA 5F4SA 5E6ZA 5MF5A 1XSKA 3M0HA 3LTSA 3QF0A 1P43A 1KNWA 2YBTA 1LCOA 2VZUA 4D1JA 5C54A 5D8WA 2ONEA 4A4AA 4OV4A 4QM1A 1FWSA 4YNGA 1L6GA 1GUVA 3FGCB 3ARQA 1IEVA 4LTSA 1Y7VA 4LX4A 4F3HA 4WLCA 3WF3A 2BTMA 4IP4A 3KWXA 3CUZA 2I16A 2HS8A 4JHOA 5I6SA 4M7TA 1FY6A 3HV9A 1J0ZA 3CHDA 2PZNA 1YE4A 4MPQA 5A2AA 4EVZA 4LFYA 4XKMA 4ZVJA 1EL3A 1SW3A 2GQ3A 2VGFA 4S39A 4JYDA 3PZMA 1Z69A 4RZ4A 1XYAA 3AXHA 1GTHA 1AJZA 4L5ZA 3BTNA 3WLQA 4JTUA 1J79A 4XKYB 3N1AA 5IHSA 3EGJA 2PWUA 3GM8A 3TCEA 2NZLA 1CIUA 1NDZA 5K7JA 3FYPA 3SUUA 3TW6A 3H2EA 3EAUA 4CCDA 2DZTA 1JCTA 3AQUA 3WQPA 3G3DA 3AIQA 1TPEA 1MYRA 3T1GA 4IMDA 1EEPA 1MW3A 3HFYA 3QYQA 1R87A 5F7UA 5I3JA 2ZA3A 5FF0A 2A79A 2R1LA 3HURA 4B3ZA 2PDQA 2R1NA 1E72M 3GU2A 3I68A 5BXTA 3OPSA 4XTIA 2XFFA 1QPRA 3W76A 5XIAA 3W82A 1V6WA 1L6YA 1OFOA 3BURA 4XUGA 3CV7A 1RLDA 3TJ4A 3AYTA 2WM1A 9XIAA 3LCGA 5EBAA 2QJIA 1H3GA 1S5WA 2JEQA 1XPYA 3UVIA 5I3FA 5DMMA 2RUSA 5KETA 2VT0A 3T0TA 1RUSA 4TXEA 3NM1A 3EWBX 3KTSA 5AYZA 4C5ZA 4CEUC 4IT1A 3OYZA 4B5NA 3TA9A 4J5NA 2OO6A 1S46A 1JZ2A 5I09A 3VOHA 4NAEA 1Z6KA 5BWAA 5ABFA 1AMKA 2CESA 3TN3A 3P3BA 3VD5A 3N12A 3GVQA 4O1DA 3OW1A 3FOKA 2DV0A 4GUJA 1EPXA 1GQLA 4OOUA 1EJRC 1B2YA 4YVVA 5JUVA 1JPIA 1V6UA 3W1RA 4D6GA 3KL0A 3EX2A 3WBYA 5D8ZA 5E9XA 3EWXA 1C8QA 4Q8UA 1EF3A 1PCKA 4YWIA 1NFGA 1X8CA 2WAGA 2ON3A 3TZNA 3WUBA 3W7OA 3MMTA 1BF2A 3IJLA 5IBXA 3GNDA 1POKA 1OK4A 4CNTA 2GK1B 1RPKA 1U22A 2WSRA 3MHUA 3WJSA 2A6NA 2ACRA 2D0GA 4XD6A 4I7VA 4L61A 5FL0A 4GWEA 2EAWA 1UR3M 2V5DA 1ZENA 1QNSA 4I9JA 4QCFA 4P8UA 2TRSA 3TN6A 4RDWA 3H2OA 4US5A 3VOFA 3BE7A 3ABQA 1FP9A 2DGAA 2R1MA 1QXLA 3S1GA 5CPNA 1EJVC 4PSPA 4GQGA 4GH1A 4IM4A 2WO5A 2KX9A 3DYOA 1KM3A 3KWSA 2X2YA 7TIMA 4DELA 3QY7A 5IM51 1E43A 4C91A 5FSEC 4Y96A 2V81A 1PXGA 2QJGA 4DJEC 5E1QA 1BPLB 1A5UA 5GJMA 4BY3A 3HF3A 4J1OA 1X96A 2X1UA 2DUAA 3ANUA 1T40A 3TOPA 3GC4A 8A3HA 2G3FA 4NASA 2XM2A 3H4GA 3AMDA 1BXCA 3VGFA 4B4FA 4WZHA 1FWTA 2F6XA 3GAYA 4CUCA 3STEA 2P3EA 1CBGA 2X41A 4FO4A 4NUWA 4OU1A 3R25A 2EG6A 1YBQA 4Q4MA 1Y65A 3FA3A 2XG9A 2Y1HA 1FTXA 3KAOA 3C0LA 3G1VA 4PUMA 2P0OA 1WQ5A 1OF6A 3USZA 4J4KA 1Q3NA 5D03A 2ZKMX 4A8LA 1Z8AA 4GI9A 2QT3A 1DXEA 4LUTB 2GQ9A 4MZYA 1I2OA 1GOQA 2D73A 3GQYA 3N4AA 2V67A 3U57A 1MXSA 3M47A 1GYMA 2C14A 4L6HA 3H7VA 1RBOB 5CBBA 3LN3A 2C91A 1OJXA 4AF0B 1AODA 4ZOCA 3VM5A 5JIPA 4JX5A 3W1TA 4BK9A 1O12A 4ATLA 4FI4A 4GACA 3QC3A 4FAMA 2CZFA 2FZDA 4NX5A 4YTUA 2Q6ZA 1KR0A 1Q6LA 1Q13A 3VCNA 1P7TA 4P5UA 1HJVA 3AROA 3A47A 1S5MA 4GKLA 5H8MA 2A3LA 1YIXA 1XG3A 2QHAA 3T78A 1OYAA 3R5EA 1IR1A 5CC5A 2GYIA 2BY0A 4B5UA 3UERA 5I00A 5FJRA 4K7YA 4DRSA 2GGIA 3CMJA 4H01A 2PURA 1TV7A 2AMGA 1RY8A 5ABHA 1IWAA 3IS4A 3CL8A 2V38A 1EH9A 3NSXA 3PBWA 1GW1A 1XUZA 3G3MA 1VZWA 4U2ZA 4AIOA 1QHOA 4MY9A 4FOKA 3VNDA 4QEEA 2QUTA 3NZRA 2QDEA 1RVKA 1SO5A 4FA3A 3G1SA 2G5WA 2OFJA 3GG1A 1ESWA 1Q7QA 2GJXA 2PP0A 1JDFA 1P0DA 4ML4A 1QNQA 4DAIA 4GYKA 1KWKA 4HIBA 3QV7A 4CCCA 3UFYA 4ILSA 4LRSA 3ABOA 1NY1A 2I17A 1PCWA 4H6KA 4M82A 4PE8A 2OKOA 3HV8A 1IYXA 4ZQMA 4HZ6A 2Y61A 3N9SA 1UD4A 5A6MA 4QG8A 1SSGA 1JUKA 4S38A 4GI6A 1AH3A 1QR7A 4IFKA 2DVXA 3ZWTA 1ECEA 1F76A 4GK8A 1SMDA 2ALDA 3SGGA 4FNTA 4BCEA 3QPEA 2C7FA 2GUBA 5PTDA 2X1IA 3HGOA 3A5VA 1NQKA 4H7VA 1DVJA 3QMTA 3PAOA 3UETA 1NWUA 3WLLA 4KCVA 2TMDA 3GXMA 2CYGA 1AW5A 4AZCA 2GDVA 5DY3A 4AZIA 4O0KA 1H51A 4Q8NA 1NWSA 4ZB2A 1JDDA 5I3IA 4EXAA 2IMRA 2HISA 1UR4A 4KERA 3LCLA 5CAHA 1FXQA 3O6YX 4KESA 4LBRA 4D8LA 4B91A 4PMZA 1T5AA 3AXMA 5M1TA 3DIPA 3HG5A 2NXIA 1C8VA 1CT5A 2XVKA 3DZ1A 3R0DA 3W7KA 1V7YA 3S42A 1CGXA 1BRLB 2BBFA 3UF9A 2DQWA 1XFCA 2G37A 4UIOA 1LTDA 2C71A 3IJ7A 3E2VA 1QDSA 1WDWA 2ZZ6A 3HB9A 3Q58A 2P8CA 4PMYA 3RG6A 1LQAA 3N3MA 2C18A 1K8YA 3SJ3A 4PULA 4QE1A 1G1YA 1UZ4A 3L4YA 1EP3A 1EC9A 3P0WA 4IMAA 2Y2WA 4D6IA 2NQ9A 3C52A 1U5HA 3SRFA 4XIMA 1JGIA 1ZCCA 2ACSA 2NVAA 1YPXA 4PL2A 3QRHA 1REQB 3UEQA 3CH9A 2WSYA 2ZC8A 3W7EA 2EJAA 2YA1A 3RITA 5EY5A 7CGTA 4KT2A 2E6YA 3IV3A 4U33A 4I5RA 2GVLA 4GG9A 1AQMA 3M0KA 2R91A 5C71A 3CAVA 1EDQA 5HWJA 1J5TA 4V1YA 4WUIA 1A4LA 3VDBA 1EX1A 4NYUA 5A8OA 3HO8A 3IIZA 1RCQA 3N9KA 4JKLA 3TWBA 1IT0A 3LB0A 1W5NA 4CN1A 1M7JA 3FXGA 1QNVA 1PKLA 1NDYA 1FWNA 2HK0A 4MB3A 1Q2RA 3S4TA 2GL5A 3EX4A 3BMWA 3GTHA 1E55A 3WX7A 2WCSA 4OWGA 4GC4A 4P8VA 4IG2B 3FK4A 5DX7A 4EPDC 3RIKA 2VC7A 3KVMA 4ZQNA 5I02A 5M17A 3LK6A 3WDQA 4XO7A 1U5JA 4G56A 4GXWA 3U2EA 3OLGA 4HBKA 3CQKA 1B4EA 2OSXA 3E02A 4MB4A 2X42A 2PDUA 3FYYA 4XUYA 2PDYA 4F2UA 1RD6A 3M1ZA 2VXNA 3T8QA 1W56A 4LSBA 3TLLA 4PCTA 1SJDA 1J8VA 2VVNA 4L4LA 4NG3A 4HD5A 4GGBA 4AB4A 1XLDA 1WDDA 2Z6JA 2RDTA 2QQ6A 1ADDA 3MCNA 1UHVA 2ZDRA 3UWUA 4L9ZA 1AQHA 1QVBA 2EPKX 4Z2KA 3QMSA 3WH7A 2VDIA 2HVOA 1E3XA 1PTGA 2XU2A 4QFUA 5JBFA 1DJNA 4AWUA 4I7WA 1JCYA 1W5OA 3MV01 1OIFA 1YNYA 3W7HA 3VX1A 2BG5A 4AHPA 3S5NA 1JEZA 2EQDA 1E6XM 3BCJA 3MZNA 4PH6A 5EMJA 1XG4A 4X63A 3L9CA 1UKSA 4H6RA 3VIPA 1TE1A 1FP8A 3WQEA 3LTPA 1H60A 4AQLA 1MW2A 4NZJA 1BYDA 1QWGA 3WYZA 3RAOA 1OF8A 3UY8A 4YCPA 5CC3A 3W1MA 1RJPA 4J27A 1KCZA 4I90A 3WDHA 1UWTA 2AGKA 4CGTA 3PZIA 5BRQA 4MNMA 4JIEA 3ARTA 1SW0A 3GH4A 4GVIA 4M1BA 4F48A 4PGLA 3RXZA 3ZJ7A 4Q8TA 1GYNA 5F1UA 3W7LA 2QUMA 1E1FA 3T2QA 4K8EA 2XH4A 3DN5A 1PEZA 3GHUA 1MW1A 4V28A 4ATDA 3CNYA 4FOUA 1VAHA 5IDZA 3TC7A 4KRUA 1GHSA 2D1ZA 4HCHA 1TTJA 1SO4A 3GW0A 3NOEA 3HN3A 4WY0F 1EPVA 4D8ZA 4HSHA 2Y4SA 1XFBA 1GPFA 1K4GA 5C7HA 3QV8A 3LGEA 1A5MC 4LCRA 1M7PA 1NDVA 5EB8A 4W86A 1TYGA 3H70A 2QIIA 3TAKA 3CQIA 1CYGA 3OA5A 3L2IA 2WMIB 4MMWA 3CO8A 3BOLA 1W3TA 3WLNA 4US5D 1C29A 1B3YA 2ZZ1A 4WF7A 3BLPX 4HPHA 4YL2A 1G4EA 4JFSA 1EC8A 1GPWA 1UP3A 1UH4A 5FF7A 2HBVA 4AWEA 1DTUA 4I9AA 1C7TA 2KAUC 1GVFA 5FJJA 2BASA 1HKJA 2OGJA 3RN6A 5DMNA 4ZCWA 1LWHA 1PBGA 4KW2A 1E4MM 1O4UA 3W7DA 1W3JA 3PZTA 3DC8A 4RZBA 4K3ZA 4GY0A 2P3ZA 1J2BA 3WLKX 3G0SA 5D05A 3H4WA 3KOZA 3S1XA 2EJ1A 5IHRA 1YHTA 1VEMA 4QQUA 1I6NA 4ZOAA 2A2IA 4MNLA 1GT8A 2ISDA 4GBUA 3MB9A 2P1FA 1O68A 1Q66A 4LGXA 1WNOA 1E56A 2B7NA 2PLCA 2ZRZA 1E0TA 3MSDA 3F5LA 4RX0A 1C7SA 3EDDA 4HU3A 4AWTA 2V3GA 3B0YA 3W27A 2IPFA 3IPWA 5F4XA 3EX1A 1TPVA 4AVOA 1ME8A 2OZ0A 2NV2A 1JGMA 3VOIA 3KRZA 4E3TA 3R11A 1A0CA 3PANA 4MYXA 2G3MA 1VYRA 2DQXA 3AMGA 1D3CA 4WY0A 1FWFC 2DT2A 3GYCA 4RPPA 1J96A 2ADAA 2QV5A 4N9EA 1ITXA 4MTVA 4REQB 2XVNA 3O05A 4ML9A 1MDRA 1NP2A 4MDPA 2A3AA 1S2UA 2DZSA 1KV5A 4KPLA 3GNOA 2ZXBA 3V18A 4HYRA 4ROQA 3AIEA 3CYVA 1B9BA 2XINA 2OYLA 3OIHA 1JZ7A 1VBRA 3DG6A 3M7SA 1KO0A 5BMWA 4L65A 3U2OA 3CQ0A 2FHBA 4PUUA 5BOOA 3NDZA 3EDFA 3WK1A 4K2SA 1SUXA 4L4MA 1V4YA 3QVQA 3S9IA 2TSYA 1KW1A 3EX3A 1BVNP 2FKPA 4IJBA 2NWSA 3BDKA 3MVTA 3E0WA 1JDEA 3CLWA 2OZ8A 1NVMA 3GNPA 1H4PA 1W1VA 2VX4A 1X7FA 4LU0A 2G50A 4HN4A 4HMEA 2Q02A 2WKGA 5EYWA 1HVQA 3WNNA 2GWGA 1B3VA 4J35A 5C9XA 2Y8VA 2GQ8A 3WD0A 3SECA 3WL0A 4B90A 3QY6A 3B9AA 5I77A 4YMZA 4UZUA 3C8NA 2WNZA 4RL3A 4AD3A 2V69A 2ZXAA 3S9YA 1I8JA 2OKTA 4MNKA 3WENA 3D3AA 2BVDA 5CSUA 3BPWA 5D38A 3OBKA 3I6EA 3VNZA 3APYA 2DY3A 4XIAA 2HSAA 4KFOA 3OG3A 3CQHA 3GDBA 3TYAA 3RNDA 3GNXA 4QE5A 1XRTA 1N8WA 2UY3A 1KBLA 3W07A 2FGLA 4QS6A 1XGDA 3M44A 2YW4A 3A6OA 4O8AA 4DF0A 4DXVA 1OX4B 1CXHA 5DMLA 3P8IA 4LPCA 3TSDA 1UQZA 3A22A 4PTXA 2HXUA 3KHDA 5L6UA 5CBJA 3OVQA 2WZMA 5EPDA 1UD6A 4S3EA 5T9BG 1VLIA 3SUVA 2V6AA 1FXPA 1WPCA 4FX8A 4RPQA 4PL1A 4Q7NA 1DWJM 3WLJA 2YKKA 4YPJA 2KZHA 2ZXDA 4JFVA 1YNPA 3NQVA 1R5YA 1RPXA 4PCNA 2NT1A 4FNUA 4NJIA 2YIHA 4O1AA 4F40A 1TCDA 4FXFA 2XSAA 3UWYA 4Z1DA 4F8XA 5A8NA 2A0NA 3RRAA 1OFAA 1V0LA 4GGHA 4XAZA 2XHYA 2CZ5A 2QPXA 2F38A 4NQ1A 3WBWA 4AHQA 2ZC1A 2J47A 2EPHA 4GVFA 4R33A 2EEXA 3UJSA 7REQA 2PZ0A 2WNQA 2HEJA 1AZ1A 3KL3A 1R3VA 3TNOA 3QTGA 1JVNA 1W5PA 4D6JA 5C9WA 2G96A 3COTA 2D0FA 5LIYX 1UWIA 1SR0A 5AECA 3AFBA 1PTDA 4JN6A 2X2GA 3BAKA 3AHTA 1TWSA 1LRTA 4GQQA 3R94A 3BGJA 4CD5A 2Y5SA 2DJXA 3A12A 1TV8A 2VNCA 4E2DA 1JF6A 5AYXA 3UBPC 2ZADA 3W75A 5H1WA 2AQOA 3V5OA 2YXGA 4ZO9A 3DFYA 3RCMA 3IGHX 3TJXA 1NQ6A 3DBNA 3XISA 1TUXA 3GR7A 3UESA 3L4UA 3DECA 3AJXA 1I9CB 2TPSA 5JU6A 1BKSA 1ELSA 4UQEA 3DFOA 4OKDA 4ZGYA 4OV9A 1S2TA 4Q8MA 1O95A 2IPJA 5HA7A 4XX6A 4JQ1A 4NRRA 3UWEA 1ISWA 3WQVA 4DF1A 3IVSA 2Z29A 4QLKA 3A5FA 3CAKA 1ITCA 3ZJ8A 3C6CA 5CLTA 3NPUA 3L0NA 5D33A 5HQLA 3L65A 4YTQA 2FVKA 2WMHA 1E9LA 3EWYA 4AEFA 3R6IA 3USBA 3EEZA 5BOEA 3CZLA 1JPDX 1R2RA 2HRWA 3IJDA 3VIFA 3AHYA 3LHUA 3WY1A 4Q8PA 3STFA 2J27A 2VI0A 1F5ZA 2JFEX 1MEHA 3ELFA 3NO5A 2I1OA 3NQEA 4FMVA 2XVPA 5BU9A 2HCVA 4EWND 4BI5A 1Q6RA 2V2CA 3BJFA 4MWAC 1LOQA 1VJZA 2DT1A 3SUWA 1KBBA 4O14A 4GKTA 2OWXA 1BG9A 3UZYA 4WCJA 1EGVA 1D9EA 3IUHA 3KBJA 4DM1A 3PZNA 3B0UX 4E2VA 3EWUA 3W1XA 1GGOA 5DRIA 4BHYA 2PA6A 4W4QA 2G4FA 1HIZA 3KE0A 1VCVA 2AKZA 3VD4A 4DAFA 1ZJAA 1NARA 4JN8A 3KCJA 3N11A 1PE1A 3VUSA 4BR1A 4O1EA 2EGZA 1B3ZA 1W1YA 5HINA 1IEWA 1XICA 3TMLA 3VKJA 4DBDA 3MW7A 3TR9A 4ADUA 2Y62A 2RGMA 4DZAA 5F4WA 3LBCA 1KXTA 1R9XA 3RU6A 1MNZA 4XZMX 3H53A 3M0XA 1GVQA 1ODUA 5I07A 4JTFA 3MMWA 3I7RA 5D2YA 2ABBA 3FGCA 4B5SA 3AYVA 3PPCA 5TAOA 4C6JA 1MXDA 5TD4A 3I6TA 3NEHA 2J7EA 3GU1A 5BCAA 1GEQA 4FPSA 3M0LA 4Q4PA 3MS8A 2O9RA 3MQTA 3PS7A 4ERGA 4PMJA 3BMXA 1Y0EA 2ASHA 1E5NA 1YKWA 2O9PA 1KM4A 2J88A 4AY7A 1XP3A 1V3JA 4XKYA 3WD2A 5D2TA 4UTLA 5H91A 3ENLA 1JD7A 2G3NA 3P81A 3LCXA 4UMAA 1V93A 1RHCA 1GOMA 4GVGA 1XIFA 2E4TA 3L23A 2L5HA 1W3LA 5AZ1A 1AD1A 1K3UA 3TXVA 5JXQA 1C93A 5BRPA 3K8MA 4GIYA 2FFCA 4IMCA 3CL6A 5CLWA 2QJNA 3AZRA 1QPOA 3NEVA 4M6UA 3RJXA 1US0A 3WH9A 4L1WA 2R14A 2ISFA 3AS0A 2Z1XA 4HZ8A 2YJQA 1CPUA 1VGAA 2A3EA 3LCIA 3GZAA 4A05A 3SIZA 3ARYA 3LRMA 1A50A 1YEYA 5BXRA 3BZGA 3WLRA 1WX0A 4B5XA 2OQYA 3UCCA 3RCNA 3LUTA 2Z2BA 4XV0A 2BXZA 4DJEA 2J8GA 3WNLA 4HNUA 3NGFA 5AHLA 3EDEA 1N82A 1QPKA 2C19A 1VC4A 3EXRA 3CEPA 4RK8A 5LGZA 2FZ9A 5C8BB 3EOLA 3LI1A 4UB9A 4I7UA 4AEEA 2FGZA 5TNVA 1E6ZA 3VU2A 4IMEA 3UWVA 4U28A 3AXKA 3W2MA 2BHYA 3GLCA 1XLJA 4IGHA 1WBHA 2GVEA 2RFGA 4PB3A 3RJYA 5HPCA 1J5SA 5A95A 1V3MA 2UWFA 4QXIA 3OODA 1HQTA 2CLHA 5FJTA 5F2LA 3QOMA 2R94A 4J3WA 3PHAA 1ISVA 1JRBA 3NWRA 3W86A 3GFYA 5F1VA 1UBPC 3CWOX 1TMQA 1IV8A 1EGZA 2Q01A 3OLIA 4Y9AA 5EMUA 1ZBWA 3W6YA 4KFPA 2CXGA 2OOGA 3KRSA 1N55A 4NNAA 1FUYA 3NG3A 1MUCA 4NZ1A 4ASTA 1LBLA 2VEMA 2BNJA 4N42A 7XIMA 1F61A 2J9XA 3B0XA 4LEFA 1LDCA 3ARSA 4H9VA 2D69A 4UFHA 4H00A 1OFPA 4D9PA 3IANA 4LS0A 1XGEA 4PUDA 4HPGA 5I79A 1HO4A 3PZGA 1ZFJA 3G1YA 1MEIA 3BH4A 2YFOA 3WEZA 3CGTA 3LMZA 3WF0A 2ZYFA 3N6HA 1BYBA 1K9EA 3PBUA 4Z1AA 4DJFC 1JZ5A 3BW2A 5LIWX 3QFWA 1F4AA 4AZBA 4HCLA 3CB3A 3U4FA 1DWHM 3BK0A 1K02A 2CNCA 4L6DA 3WFLA 1DTNA 2IQTA 2E9BA 3LBOA 3XIMA 1GVIA 4EACA 1XIGA 3VFCA 4WGHA 2CCRA 5KZEA 2C15A 3GD6A 4TOQA 2OQHA 1OFQA 4TVUA 1VCFA 4HK7A 1UMLA 4MGGA 3FSUA 4GI4A 4HHLA 1AQ0A 3WK3A 1UZ1A 3LMYA 3ANYA 4F0RA 3NJ3A 3H2CA 4D6HA 1EJSC 4M5PA 2YOCA 4OVXA 1B31A 2DJLA 4MAZA 3ALGA 4B9ZA 1EHNA 1S3TC 1F6PA 3F4VA 1OGSA 2Y8KA 4GO9A 3EMZA 5E5CA 4CQCA 3ZR6A 4FXRA 2W5FA 3VKKA 5DELA 3OLEA 2OZ3A 2P88A 3QSTA 4UR9A 2BZNA 4MYAA 3GRIA 3FLUA 1JPHA 1YRRA 4LUTA 2UBPC 3N4FA 2E8YA 2VFGA 4G9PA 2DU2A 1X6UA 3F4WA 5LA2A 3EYPA 3WEMA 3LQLA 1QI3A 2ANUA 3AZSA 3V0TA 5ABFB 3IEBA 2O55A 3LSBA 4AF0A 4FZIA 4I8YA 2CLKA 4XD5A 2EKGA 2E5CA 3BSMA 4DUWA 3PZOA 1W31A 4GNJA 1GNXA 4DJDA 5C2XA 1OZMA 3B8UA 3CM4A 4HYVA 1XRSA 2GGEA 2OMAA 4H6QA 3OTRA 1BHGA 3D5HA 1GORA 3W71A 2PTDA 2ZTKA 1LLZA 3TH6A 5GQBA 1M1BA 1WDSA 2VRJA 4DBEA 2DUZA 4LUYA 3B97A 2R82A 3QZEA 1F3TA 4ZOBA 2I5QA 4LC6A 3R8RA 4LY8A 3QGKC 3CH0A 2FPTA 4XBJA 3GVWA 4O52A 3N2CA 5K2ZA 2Z24A 3WJZA 3C2YA 7ODCA 4UNIA 1TQXA 2INFA 1SZNA 3DX5A 1XYLA 1UQYA 1OGBA 2V9DA 3HGRA 1A3XA 3L12A 2VJXA 3TYEA 2OSWA 1I1WA 3WCZA 1FWRA 5C70A 3JRKA 3QLDA 3QHOA 4NYYA 1M9HA 1E5JA 1XJBA 2OYKA 2VUYA 2HE8A 2BP1A 4K8GA 3W2KA 2F9RA 4XZBA 4RE0A 1VHCA 3MHFA 4LALA 3JW7A 5BW6A 3S46A 2W92A 2VDGA 4A3QA 3C61A 3WLTA 2QCCA 4C6KA 4JR5A 2YDAA 2GQAA 3PJXA 2ZVRA 3B40A 2PTXA 3EKGA 3H12A 5CZ0A 1A5BA 4JTHA 1YNQA 5FJUA 3PB2A 3AZTA 3UZ5A 3BSHA 3P14A 5FOOA 2YB4A 5TBOA 2Z1BA 1UR0A 4CCEA 1YTKA 1YBQB 1JUBA 2QCNA 3WMCA 4QJ5B 5EL1A 1E6NA 3ABZA 1XYFA 5EFFA 1LL4A 1OT2A 1Q5MA 4G6CA 3WLHA 5LIXX 2QR6A 1TB3A 2HROA 3M5VA 4Z08A 4PUKA 3QV9A 3M16A 4DYJA 4HB7A 1FCUA 4QTGA 3GFXA 3O6AA 3PBGA 3ICJA 3LCFA 2VMFA 1PB0A 5GJNA 3HPZA 3LYEA 2DUXA 2BHUA 1PHQA 1SJCA 4TO8A 2CWXA 1GVYA 3MDUA 4Z2IA 1BRLA 2W66A 4JEQA 5H2ZA 3ZZ1A 2GSEA 1VS1A 1DJYA 4PRRA 4YYFA 3C3NA 1LOSA 3LLDA 4LEQA 3VIKA 3B9OA 2CU0A 3GH7A 1TZZA 3REQB 4S3GA 4UTFA 4UTWC 3IIVA 1ZL1A 3SM0A 1AG1O 4MJZA 3VM7A 1W91A 4C6MA 1KXHA 4D2JA 3SSZA 3LHYA 5HJYA 5DF0A 4I5UA 1KD0A 1UIPA 3LOTA 4JHZA 1FWDC 2HXTA 3HPFA 3TDFA 3INPA 2JK2A 2HE5A 3LEPA 1Z7AA 3NL6A 1ZSXA 5CPLA 3TR2A 1A3WA 3DAQA 3FHAA 2QJHA 4ICNA 3LHZA 3WF2A 3T0BA 3IAPA 1XIJA 3WBXA 4C5YA 1K77A 1WE5A 1R85A 3TEVA 1WDPA 3BG9A 2WVTA 2BV9A 3AALA 3WQ5A 3Q37A 2VEGA 5HMEA 1XC6A 3BLKA 1EYEA 1H63A 2WLZA 3EPOA 3TMQA 1M6JA 1ZUAX 3LM7A 3R10A 2VD9A 1EIBA 2GJXB 3F5KA 4WKFA 4WSHA 2QLYA 3F7JA 3EOOA 2ICSA 1WP6A 4NVTA 2WJFA 3GXNA 4P61A 2P10A 4R34A 2PDKA 5AC8A 1B54A 4AD1A 1Z89A 1PIFA 1B30A 1SJAA 1UR1A 1DIEA 4J40A 2DZBA 4JPGA 4F9DA 3EKZA 3TNBA 4IFKB 4JQ4A 3GBEA 3UYIA 3DOPA 3NQ6A 1K03A 3D46A 2XH2A 5HR6A 4Q3MA 3EOEA 3KZPA 2QEZA 2QPSA 2Z0IA 5GNYA 4OZOA 2OEMA 5D9NA 3VC6A 4CKQA 5KINA 3MWCA 5AZ0A 1VRDA 4TV5A 3W7NA 4GLEA 5KZMA 4RUBA 1V0NA 4IPJA 2BOEX 4J3SA 1AW2A 5KSWA 3MWAA 4Z2HA 4O4VA 5G4WA 3PTMA 1G7UA 1RBAA 1UOZA 2GJRA 1VJIA 3KHJA 1K9DA 2V68A 1J12A 1UP0A 3LA4A 4JD4A 3EB3A 3BLEA 3NDOA 3LRLA 3WK2A 1DJZA 2HPMA 4F0SA 1BGGA 1EUNA 4R85A 3PUGA 1C91A 2DEPA 3KS5A 4X9YA 2YXXA 3URBA 3ZMRA 2QDGA 3P60A 3TN5A 1B5TA 5EFDA 3CV1A 1QMLA 1ISXA 4XZLX 3E5PA 3DI1A 1PX4A 5HWNA 2DVUA 1AD4A 3BAWA 4W8LA 3WLMA 3AICA 4M3PA 4FNPA 2VEIA 4LH8A 3T4WA 1IXQA 3IVTA 3MCMA 2DFAA 3RM4A 5ENLA 4UFMA 2YLAA 4O50A 3TK7A 1F07A 3WMLA 4F9JA 1RAKA 1SR9A 3TWAA 3SR7A 3GDTA 4HYWA 4CD7A 1X8FA 3PWGA 4RE2A 1PDYA 3PUDA 4MJ2A 1Q6GA 2VFFA 2V8ZA 3R89A 4C6EA 2NVCA 3NAVA 3MO4A 1G4PA 3FCPA 2CIPA 4QNWA 2YDQA 3UG4A 5CJNA 3KS6A 3P2VA 5D2WA 3H2MA 4HTYA 3VGEA 1DIKA 4A35A 2IQDA 4QRNA 5A6AA 1H1NA 3RLGA 3WZ0E 2C1GA 1BWLA 5EMMA 3S6DA 4Z1YA 4LB3A 4DWSB 4X60A 2OO0A 1WOBA 3O3RA 1PKNA 4UTIA 4JCMA 3LPOA 4QSFA 2RH9A 4LS1A 1FWCC 4DZIA 3IJIA 3EDKA 1QOXA 3TOYA 4I6KA 4UMBA 2OB3A 1B90A 2WANA 5HULA 3E2SA 3OU8A 2AOSA 4AZ5A 3LZ3A 2XISA 3AOFA 4D72A 1UWQA 1J10A 1FHUA 3ANVA 5D37A 1MSSA 4PRWA 2Z4GA 2VC9A 4N9BA 3M0YA 2VZSA 3F1QA 3S2NA 2RGLA 4QAWA 4U31A 5BNKA 4C6OA 1QRQA 3E38A 4IXXA 4HVXA 2WHLA 5F2IA 3ZYZA 4K8HA 5CPTA 3ES7A 2FVMA 3VUPA 1YPIA 4V15A 1RZMA 1GVOA 4WDXA 1LP6A 4U3AA 4CD4A 1XH1A 3D47A 1W9PA 5A6TC 3BCDA 5GNXA 3BOXA 1IHIA 3CO4A 3U5UA 1OD8A 1UJQA 3PJWA 2PE4A 3ABRA 4MB5A 2DPEA 3PY2A 4GZIA 4OGZA 3CZKA 1B57A 2XFYA 5HPOA 1EKOA 1L0PA 4A2SA 4QDPA 1AQFA 3GW3A 3C2FA 2F6UA 3RLVA 1W3KA 1HL2A 4DI9A 2PC4A 3ALFA 3MU7A 2X40A 1IZCA 4O12A 2WNWA 2Y6ZA 3F5JA 3WF1A 2WZIA 1R3SA 4TX8A 3CUXA 3RMEA 7A3HA 3FNDA 1BAGA 2NUXA 3A3HA 1Q65A 3BXWA 3PK7A 1BQCA 4TVCA 3RUBL 3RX4A 2BGSA 3PFRA 4WIWA 2ZZ5A 2DZUA 2VELA 4FF7A 4P7LA 3HG2A 1Q45A 3S8HA 3V16A 3JR2A 2MNRA 3S6TA 3POCA 2XFRA 1EHAA 4HT3A 1N8IA 2VX7A 3T0CA 3WD3A 4DUXA 4JTRA 1KFBA 1PUDA 1NM9A 2QJJA 1PYMA 4Z42C 1RP9A 4E4PA 2GSHA 1K4HA 1QO2A 2X0YA 3FA4A 4REQA 2W61A 2FDMA 3BLLA 4WRHA 2H9AB 1OFBA 1XR2A 4NZFA 4Y8EA 3CTTA 4PEKA 1JXKA 4DJDD 1GW9A 4HPJA 1IF2A 3M0VA 3OQ8A 3SJNA 4HU0A 4EXQA 3UZXA 1UCWA 2O0TA 4ZTXA 4JCLA 1V08A 4J3UA 1UR9A 3D0CA 5DXYA 3LHWA 3PZQA 1MI3A 1G01A 1IEXA 1V3KA 4JYEA 2TAAA 3DHFA 1V3LA 4XWUA 1JIBA 1VB9A 4TX9A 1GOXA 1V5XA 1WKDA 4O15A 1US2A 2WHKA 2PDGA 3ARWA 3MUIA 1KKOA 4ICCX 4WSJA 5EBUA 3MBDA 4HNOA 4NRSA 3TJLA 1G9HA 2BDQA 3UD6A 3BV4A 1R47A 4AAJA 4EF8A 4HA1A 1OYCA 3R7MA 3DGRA 3EA1A 2PGWA 3WD1A 1GOWA 1E0XA 3UR7A 3FAXA 5HNUA 3NQAA 4URIA 3CWNA 2NQJA 1SPQA 2IXUA 4TVDA 1XLBA 1H1ZA 2QDHA 5CXPA 3TYZA 1SZFA 4LF2A 3NSMA 3WBEA 5DMYA 2VEKA 1W3NA 1CGYA 4GYPA 3WIJA 1DPMA 2MUCA 4P7NA 4UOZA 1OG6A 2HPIA 3WDRA 3Q94A 1V77A 3R79A 1A0EA 1TPH1 4UQCA 1M7OA 1YE6A 3SI9A 4PTVA 1SGJA 2INZA 3U3HA 1BKHA 4LANA 4JX6A 1OCBA 1KLZA 5GNZA 1S38A 4GCXA 2VYOA 1W32A 1ENUA 1Q63A 3G1DA 1OX4A 1OG0A 1UWSA 3IUIA 2E1WA 3QGVA 5BU6A 2BODX 2QDDA 3NQGA 3H24A 4Q6JA 3F2DA 4RNFA 1NFPA 4MFEA 3UR5A 4US6A 1H1YA 3O9NA 5LNUA 3OP2A 4CU7A 2RJGA 2C13A 1QO5A 1KGUA 2E5BA 4HHHA 1A53A 1ONEA 2YL6A 1L8PA 1YTDA 4IMFA 4X61A 4TUFA 1JAEA 3B04A 3GR8A 2AGTA 3OYXA 8CGTA 5I03A 2ZX5A 2A7NA 1DJWA 1QI5A 2REQB 2Y8UA 2J7FA 2V0TA 4XAPA 3O06A 4WY0B 1HW6A 3NQDA 2V82A 2FTPA 4ECLA 1ODZA 1WDRA 4PFHA 3W6MA 2Q3RA 5J5RA 1VRXA 1XISA 3PSWA 3A9BA 4G5DA 5EKYA 3PUOA 3N6JA 1KTBA 3BOFA 3KLLA 1R3WA 6CGTA 1V3HA 4AY1A 1HX0A 4H9ZA 3DC0A 2NSOA 3L2MA 2BX7A 4Y9MA 3A4JA 3AHXA 1C90A 2TYSA 1E9IA 4ZQCA 4DXKA 5EGRA 5T91A 2WVVB 4A29A 3ID7A 4O11A 2PF0A 2CFFA 3MMDA 5G4HC 1TIMA 2GWNA 2HK1A 3EBVA 4R27A 3EB2A 2ISVA 4O16A 3CQJA 4XZHA 4GUHA 2XJ7A 1XCXA 1DJHA 1KB3A 4HNCA 3SY5A 1DWFM 2Y7EA 4LUIA 3V36A 2VP8A 4M6QA 4WJ8A 1EGMA 4M56A 4EPKA 1KFWA 1FKXA 1PKYA 4ZBCA 1M68A 4B5TA 4MAVA 3NQ2A 1KBKA 2XUCA 3URQA 1JG9A 1ZBCA 2WVUA 1SM9A 3AUJA 4HOZA 3RYSA 3R8GA 5HXMA 1KXQA 3QH2A 3GS6A 1UG6A 3CIVA 1RCOB 4FLRA 4QX4A 2EBNA 4HGXA 1UJPA 2GOUA 4BF5A 1CGTA 2PBOA 4N9DA 3KZSA 3ABSA 1BVWA 1C9WA 4FNQA 3WD4A 4ZL1A 2PWHA 2YX0A 1MO0A 1Z48A 1GG0A 4ORIA 1WUEA 1EDTA 2QGHA 1QNOA 1RCXB 3H21A 4FS9A 5IXEA 2PP3A 4X2PA 1XRVA 2FH8A 1P1MA 4LS2A 4B15A 3APGA 1Q6QA 3UR2A 3HM7A 4JTKA 5D4YA 5AYIA 3AWOA 1F8MA 1OINA 3MUZ1 1MUWA 4HK6A 1EBHA 4KRTA 2CLIA 1CTNA 3QR0A 4GC3A 3BW4A 2XH0A 3TN4A 1Q6OA 1CGVA 3W23A 1JNEA 3DFPA 3NYDA 3FKRA 2XWEA 1H50A 3GDKA 4LNCA 1F8IA 4H04A 5LHEA 1F7BA 4UNLA 4EANA 1W8SA 4RE3A 4BZYA 1W9BM 1Z9AA 3PFMA 2GVGA 3MJYA 1P0NA 4Q7BA 4ERIA 3UXDA 4ATWA 1EZWA 2PLJA 4FHAA 3OGSA 2JIWA 1TX0A 3RM8A 4ACYA 3UG8A 1MMFA 2QV4A 4KQNA 1LRQA 1I0BA 4HHMA 1B3WA 3MVIA 1BD0A 4BQ2A 3T8LA 4LAOA 4M29A 2ZRXA 2XZ9A 2B31A 3B9EA 3CV2A 4YLWA 4YTSA 2YDRA 1DE6A 4OBTA 1QK2A 2A3HA 2Z7KA 1U83A 4Z2LA 4EX4A 1OX6A 4F66A 2ZE0A 3IK2A 4HMCA 1S2AA 3DG3A 4ZENA 2I5IA 4ZB0A 1LLOA 1KFJA 3MHGA 2G4JA 1H0GA 1IXPA 4CU8A 4K7VA 3BARA 2XIOA 2H8ZA 1OCQA 4S3AA 3CTLA 3TTYA 2E67A 3BMVA 2QS8A 1YXDA 2B7PA 1FH7A 3CB8A 3KTCA 4J3XA 2X8RA 4N4QA 4ZQPA 5LYRA 3TFCA 2DT3A 3CMGA 3FVDA 3WH6A 2YL9A 3ARPA 1GTEA 4IQLA 3OGVA 1G5AA 4ZSTA 1EFZA 1QI0A 2YL8A 3M6DA 1P1XA 1OX5A 1A5NC 1XIIA 2FFIA 4FNSA 1QJWA 2OT1A 2R24A 2J13A 4W5UA 4ZE5A 5LIKX 5F2GA 2QVNA 3DFTA 3PAJA 2ZX8A 3S2CA 1UPMB 1EQCA 4JN7A 4RCXA 2QCDA 3UY7A 4DHGA 1Q4WA 4CNSA 5JVLA 2ZBTA 3Q67A 3C0JA 2QUUA 3V4BA 3ZFHA 1SVDA 4S2BA 1CXFA 3MSRA 1PX8A 5A2BA 3DERA 1TVNA 4DEFA 3CHFA 1MRQA 4PN2A 3R1ZA 1K7FA 5FAJA 3B4YA 3KVLA 3WO8A 3UYCA 3W88A 4F79A 3AC0A 1RQHA 2CBJA 2WBGA 4YJ5A 4AZHA 3SUTA 1OM0A 4NL1A 1G69A 1O5RA 4C6IA 3SW6A 3L5LA 4JFWA 3AMLA 5CH9A 5T8GA 3WQ6A 4GJ1A 2W6RA 3N13A 3OOQA 4YWSA 4IX0A 3HOJA 4NJKA 3W72A 4G1NA 4IFOA 1N2VA 1ZLPA 3U7VA 4XAGA 9RUBA 1US3A 4JDBA 5AN7A 1X6NA 4DF2A 4RV3A 5CPQA 2XIQA 2XYLA 1PZ2A 3AHZA 4GFIA 1GHRA 1XI3A 3KBSA 4OQVA 2ALRA 1DQUA 4L9XA 4EAYA 3CWHA 5CGMA 4B16A 3NQ8A 3RX2A 3T08A 3CYJA 3H8AA 2ACUA 3E6EA 1M5WA 2PTYA 4DLFA 3O2LA 2W27A 3SAZA 2PCEA 5A8QA 1CLVA 2PLKA 2PTWA 1VIWA 2CKRA 1WV2A 1W3HA 1YXCA 1GWJA 5CGQA 4GYFA 1W9DM 2O4MA 4MUPA 4L64A 3B9NA 3LG3A 3UGVA 4HHPA 3VGBA 4AU0A 1PAMA 1TQJA 4XISA 3BLDA 3DKLA 4EAMA 4JNYA 3OB8A 2F84A 1Q6DA 2XIIA 1EC7A 4FR6A 3BZJA 3NDYA 2ZDSA 4MPKA 3NPWA 3DUGA 3MI3A 1SZEA 3O6DA 4WK9A 4KCWA 1J0YA 1WCGA 5FKYA 1FDZA 1TWZA 3WQ4A 2E68A 3VOCA 2VCBA 5I3KA 4O54A 2ZUUA 3GIQA 2OEJA 1H0IA 4JS3A 1CNVA 1TR1A 5I23A 2E6AA 1WO2A 2J8TA 3IK4A 4LAUA 3EKLA 4IICA 4RLIA 5CJMA 3MUXA 4B9YA 2VZOA 3SCUA 2FLIA 3VAVA 2HTMA 3W7CA 3VMPA 4QR6A 5ECUA 5CBIA 3THQA 2XWDA 3W7PA 3G1RA 3KCLA 3TYUA 1VFFA 4N9CA 1H11A 3FJLA 1GQIA 3TQPA 3C2RA 4UFKA 3ITCA 2J4GA 2PRHA 2W79A 1T0OA 4HQVA 2V3FA 4P7QA 3U9IA 1VFLA 3DFHA 3T6CA 1H49A 1M04A 2Q09A 3URNA 5AYBA 4PMDA 4I3GA 4A22A 1RSCA 3WH5A 5KZDA 5ABEA 1TFVA 2UY2A 1TCMA 2OVLA 3CT7A 3B8SA 1TV3A 3I10A 3BG5A 3WNPA 4AVFA 4OECA 3PTDA 4HMNA 4E8DA 6XIMA 4KWOA 1U5VA 4LBUA 3KOXA 3S5SA 5FIPA 3IGXA 3MDWA 1UKPA 1PIIA 3KRBA 4H6EA 4Y2WA 4E5TA 3WLPA 1U33A 1KM6A 4C1NA 1R2SA 2J74A 1ZZMA 4PC8A 3TYBA 4KKXA 1W17A 4A3RA 5C7VA 1JCJA 4C60A 1OQFA 1W1PA 1UD5A 2QCLA 4D6EA 3STPA 1PPIA 1WKEA 4H2HA 3ORWA 1UPPA 3NPXA 3U0HA 3CZJA 3B9DA 4EOUA 3L68A 2GUYA 1XDMA 3NZ1A 3ZT7A 3AMKA 1IGSA 1X6LA 2OR2A 1GEHA 4R7OA 3B3DA 5A6SA 1GVSA 2GZXA 5I5RA 4AIEA 4O4WA 4H9TA 1XSJA 4ZZ9A 3W38A 3LM3A 2JKPA 2J6XA 4EWJA 5CJ5A 2WHMA 5HMFA 4E8GA 1YYAA 3WQFA 3N18A 3W02A 3QZ6A 3KP0A 4MJMA 5FF4A 4GCAA 1PX3A 1RXOB 5DLCA 3W7RA 3N2MA 3QQWA 3O6CA 2DORA 3T05A 1JJKA 4CQDA 4DPPA 5MHBA 3NFUA 1IIGA 2D2HA 3GE7A 3EXTA 2J9YA 1VBUA 2VX5A 3LCWA 2E6FA 4IP5A 4N6EA 2FZ8A 5AHMA 3CUFA 3P5YA 1FH8A 2EHHA 1MFVA 1OGGA 1K8ZA 3PBYA 3S5ZA 1PIGA 2QUVA 4GVHA 3DFSA 2OSYA 2QAPA 3L5AA 1EJ7L 1KFLA 3II1A 4JNZA 2R1KA 1MRAA 4UOQA 1W2PA 1DQWA 1R38A 2XGZA 2QKFA 1LJYA 4QSHA 3CUGA 5CPMA 1ICPA 3W37A 3CUHA 3H4XA 5H8PA 3UA4A 1TPFA 2J66A 1AZ2A 2QAFA 4QLLA 1XLFA 4JIIX 4LBSA 4Y9OA 3ZXWA 2WXDM 4F0KA 5FJPA 3QW3A 2GOKA 1GKRA 3W25A 4ACZA 3K4WA 3REQA 3G77A 4C7FA 4MM1A 1HUVA 1JCXA 1LM1A 3WH8A 1FVPA 3P82A 2H6RA 1YDYA 4ENLA 3SRDA 2HNEA 1SO6A