1ADSA

An unlikely sugar substrate site in the 1.65 angstroms structure of the human aldose reductase holoenzyme implicated in diabetic complications
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
315
structure length
315
Chain Sequence
b'ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title An unlikely sugar substrate site in the 1.65 A structure of the human aldose reductase holoenzyme implicated in diabetic complications.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1992-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1adsA00
3D3FA 4EXAA 1PWLA 3RX4A 4H8NA 2IKHA 3O0KA 3COTA 2IQDA 4JIHA 5LIXX 1AH0A 3G1RA 5KETA 1XF0A 1EF3A 4YU1A 3LN3A 4PR4A 3V0UA 2HVNA 3DOPA 4G5DA 4FA3A 4XZLX 3RX3A 2PDJA 2R9RA 3WCZA 2ACUA 2IKGA 1AH3A 1R38A 4LBSA 4JQ2A 3LQLA 4JQ3A 4XK2A 3CMFA 2PDHA 3LEPA 2IPFA 5C7HA 2I16A 3BURA 3UZZA 1PYFA 3C3UA 1K8CA 2NVCA 3CV6A 1YE4A 1S2CA 2DUZA 2INEA 4IGSA 5M2FX 2C91A 2PFHA 1ADSA 4JQAA 3VXGA 2PDFA 2IPGA 2PDKA 4WGHA 1LQAA 3UWEA 3ERPA 4IJRA 1EXBA 4LAZA 1PZ1A 3EB4A 4EXBA 2HDJA 4DBSA 5DANA 3G5EA 3UZYA 2F38A 4QX4A 2ACQA 3UP8A 1S1RA 3LUTA 2FGBA 4Q7BA 5LIWX 3GHUA 3BUVA 1YE6A 2PZNA 4WDTA 4GQ0A 3O3RA 3ONCA 3CAVA 2PDYA 4JIIX 1AZ2A 2FZDA 4MHBA 4YVVA 1HW6A 2PDQA 2HEJA 1MI3A 2HV5A 4RPQA 3QKZA 1X98A 2PDNA 1OG6A 4L1XA 4XZIA 4F40A 1HQTA 1Z3NA 3MB9A 4XVDA 2IPJA 3U2CA 1ZGDA 4XO7A 2I17A 4NKCA 4AUBA 1C9WA 4JTRA 2FZBA 3WBWA 4PRRA 2PDLA 3UZWA 1Z8AA 4PUWA 1M9HA 3MC5A 4ICCX 4WDWA 2AGTA 3DN5A 3Q65A 4FZIA 3T42A 1UR3M 3N2TA 4JTCA 3UG8A 4ASTA 3N6QA 5AZ1A 4GQGA 4PRTA 2HE8A 1X96A 3GUGA 4I5XA 4WDXA 4JQ4A 5LIKX 3P2VA 1S1PA 1GVEA 1YNQA 4WDUA 2HVOA 3UFYA 4QXIA 2PDIA 2PDMA 4ZFCA 3V0TA 2ACSA 1AFSA 1QRQA 2P5NA 3H7RA 3LNMA 4IJCA 3FX4A 2PDGA 3R94A 2HE5A 4XAPA 2ALRA 3FJNA 1RALA 2IKIA 4XZHA 4GCAA 1J96A 1MRQA 4WRHA 2PDBA 3R7MA 1ZSXA 4LBRA 1RY8A 2F2KA 2FVLA 3R8GA 4OTKA 2QXWA 4DZ5A 1T40A 2FZ8A 3F7JA 3LBOA 2IPWA 5HNUA 1T41A 1QWKA 2BGQA 2PEVA 3NTYA 4H7CA 2PDCA 4LAUA 4Q3MA 1SM9A 3LZ5A 1JEZA 3WBXA 2WZTA 1Q13A 2FZ9A 4DBUA 1EKOA 2PDWA 3ONBA 1IHIA 4JTQA 5LIUX 1IEIA 1ZQ5A 2IKJA 3CV7A 4PMJA 1VBJA 4JQ1A 3S3GA 4XVEA 1VP5A 2INZA 1US0A 5JH2A 2PF8A 2CLPA 4GACA 1PWMA 4HMNA 1LWIA 2VDGA 3BCJA 1A80A 3CASA 3M0IA 4FALA 3B3DA 2DV0A 1ZUAX 4XZMX 1Q5MA 4GA8A 2ISFA 1Z9AA 4JIRA 3LD5A 3RX2A 3KRBA 1XGDA 3V36A 3LQGA 3BV7A 1EL3A 1XJBA 5LIYX 2PD9A 3H4GA 3UGRA 1AZ1A 2PD5A 2PDXA 3H7UA 4XO6A 1RY0A 3R43A 3UZXA 2BGSA 4GABA 4HBKA 2ACRA 1MZRA 3UYIA 2BP1A 4JTDA 4QR6A 2IQ0A 3R58A 2PDUA 4GIEA 5JH1A 2PDPA 2J8TA 3LZ3A 2NVDA 3Q67A 1AH4A 4R9OA 4L1WA 1S2AA 5AZ0A 3EAUA 3GHRA 4QBXA 1YNPA 4DBWA 2A79A 4WEVX 4YVPA 3M64A 3R8HA 4PUUA 4YVXA 2WZMA 3M4HA 5HA7A 3V0SA 3GHSA 2R24A 1FRBA 1Z89A 3CAQA 4YS1A 3LENA 4LB3A 2DUXA 2IS7A 4FAMA 3R6IA 1X97A 3EB3A 3WG6A 4LB4A 3V35A 3WBYA 4XZNX 5HNTA 3GHTA 4JTAA 1PZ0A
chains in the Genus database with same CATH superfamily
1OINA 2G5WA 3NZRA 1UKOA 1GW1A 3K4WA 1LRTA 1M41A 3GYEA 2DQXA 1CWYA 4LUJA 4BQ4A 2HVNA 3NQGA 1FDYA 2XN1A 3PZMA 4EF8A 3C2VA 2OB3A 3AC0A 3M6YA 3EDEA 1G6CA 4V1YA 1IZJA 5HMDA 3GRIA 2NX3A 2DT3A 4C1LA 4HNLA 4Z08A 2JE8A 4P7OA 3S5SA 3A4JA 4FXJA 3WY1A 4NXKA 1UKQA 4QROA 1WKDA 3WNOA 1JAEA 3RMEA 5LA0A 4IGSA 2G3MA 4BF9A 1RAKA 1XHGA 4U33A 1J6OA 2NLIA 4LTSA 1RPKA 4MGGA 1B57A 3IV8A 3VDGA 3CZKA 2NQJA 4RKAA 4CN4A 3CQKA 3NPVA 3SUUA 5A8GA 1NY1A 3KZPA 2YYTA 5E9AA 8RUCA 1WX0A 3AMGA 4YTTA 2VRQA 3PZOA 3L0GA 1VR6A 2J62A 1S2VA 3SY1A 5LSMA 2WK2A 5ABFB 4XX6A 4AVNA 2HJPA 2XN0A 1LOLA 3NM3A 4A3YA 2PDYA 3ZJ8A 1BYDA 3IACA 1AJZA 3VNYA 1KV5A 4PA8A 4HHHA 2HEJA 4GKLA 4JPGA 5BMWA 5I07A 1NARA 2VFFA 3GW3A 5HXMA 4WSKA 4Q4MA 4FX7A 2WVVA 1X98A 1BXBA 4S3GA 3T07A 4F8XA 5A3HA 3QYQA 4RLIA 5E6ZA 1XYAA 4R9XA 4XBKA 1TJPA 4OUIA 2VM8A 4WY0A 5AC4A 1Q6QA 4AVOA 3OIXA 1WQ5A 2BOEX 4DUOA 1F8IA 1IR1A 1JGIA 4AEEA 2BXVA 1X1OA 4GY0A 3EOEA 3VNMA 5L6UA 3W1TA 2C15A 1PKNA 1MUWA 1QK2A 4PCPA 4DXVA 3TSBA 1ITUA 4ICCX 4GQQA 3W22A 2V5LA 3NSXA 3E12A 1GHSA 3VNIA 3TH6A 4A2SA 4ASTA 1BXCA 4Q6XA 2QF8A 1JVNA 3S2CA 3JZUA 1K03A 1W5NA 1UW9A 3LU2A 1V0NA 4UTFA 3GUGA 2I1OA 3EX1A 4WDXA 1EC8A 3TSMA 3H54A 3MSGA 4WDUA 3GNDA 2A3CA 3PZGA 1Q6CA 3TR9A 1TV5A 2E6AA 2CNCA 2PDMA 4M6QA 1VLIA 1TV4A 1VZWA 4AAJA 4DYKA 2VFGA 3L2IA 4N6EA 4MB4A 3MTWA 2J4GA 3PWAA 4UTUA 1GPFA 1W9BM 2DP3A 1UHVA 1E56A 5CPMA 3KBSA 4XAPA 3MMUA 2YB1A 2Q02A 2IKIA 4XISA 3PUDA 4HZMA 1OFQA 4HPGA 5CGQA 4HU8A 1E4MM 2ZUWA 4YTUA 3SN4A 1J96A 4RZ6A 4B5UA 4H2CA 1MWOA 4R53A 2NLYA 4PTXA 5LXXA 1H41A 1XDMA 2Y7GA 3N2MA 4Q6JA 4QEHA 2FVLA 3P61A 2QW5A 1GG0A 4HQVA 2FZ8A 3DFPA 3KL3A 3CHDA 1Y65A 2YIHA 3W1NA 3W02A 5K4XA 5A8NA 1XH1A 1XLBA 5MF5A 3W23A 3W85A 1SFLA 3CH9A 2PRHA 5H2ZA 2O9RA 3QQWA 2WZTA 3EWZA 3ZIZA 2FZ9A 2WHKA 4JN8A 3DEQA 1P1XA 4NZFA 2PDWA 1TIWA 3PPCA 3CZJA 2XGIA 2CCRA 3TEVA 3WENA 2IKJA 3OBAA 4X9SA 4B5XA 2YPIA 1G7VA 2J9YA 3FXYA 7PTDA 3SM0A 4NRRA 1I75A 4GACA 4GRSA 4FOKA 4QFUA 2KX9A 3JR2A 1ZAJA 3M0IA 4MNMA 1I2OA 7ODCA 1RV8A 2WZHA 1C7SA 2UBPC 1M7PA 4GA8A 2ISFA 1JF6A 4H9MA 5F2GA 4JFVA 4JIRA 2GJPA 3EWYA 4JTTA 1F3XA 1W9DM 4YNGA 1XIGA 2PGEA 5EYWA 3MCOA 4B4HA 3W73A 2Y5SA 1P0NA 2E5DA 9XIMA 3TIMA 3ARYA 3WD1A 4ACZA 4S2BA 4O28A 5C2CA 4E0CA 5IOBA 2Z7KA 3R12A 1A47A 3TC6A 5C9UA 2JGYA 1OC5A 4GO8A 3TWBA 3ZMRA 1E0WA 2FLIA 1R2SA 4O0ZA 1H5VA 2VOTA 3UY7A 3II1A 5IHRA 4KERA 4RZ5A 4CU6A 4JTIA 1CW2A 4A3UA 1E1FA 3THUA 4EVZA 1SO6A 4HHMA 4KEUA 2FVKA 2ZCGA 5HPOA 3RAOA 3A3HA 4YVXA 3QXBA 3S2MA 3CB8A 3OU8A 2FJKA 3XIMA 1H62A 3LCHA 1SO5A 2XIIA 3LLXA 4GUHA 5CPTA 3GQYA 4JTJA 3T05A 1F3WA 4C5ZA 4FAMA 4UTHA 3GXIA 3V7PA 3DU0A 4L4PA 4CNTA 1TG7A 3WBYA 1UUMA 1KGWA 3GXTA 3LPFA 4LAMA 5AYIA 4YMZA 3PVFA 1XWYA 4KW2A 4YTSA 4RE3A 2XVNA 3COTA 2O4MA 2Q3OA 1GWJA 1GW9A 4LEQA 3G3MA 1OX4A 2VC7A 3QJAA 4JD4A 4UTKA 2VGFA 2OO0A 3U9IA 4KMQA 3WH9A 3SQSA 5HWJA 3PBVA 1E9LA 4LYPA 3MDUA 4HPXA 3LX9A 2G3NA 2EG7A 5F2MA 2XGBA 4IPJA 2R14A 5KMYA 5IDIA 4Q33A 3WFZA 2F6XA 3VDAA 5JMUA 3U4FA 4HMDA 1V08A 2BOFX 3CH0A 2FH8A 3QLDA 3BLIA 4DXKA 3R4IA 2VRKA 1M68A 4Y96A 4XAYA 3S2LA 3B8IA 2VCCA 3W7EA 4W8AA 3F4CA 2JGQA 2HRWA 4A22A 2ZTKA 4OV4A 1V6UA 3AYTA 2GK1A 3ABOA 3BC9A 3UW6A 2WAGA 2QMKA 4US5A 1SVDA 3LNPA 4F0HA 3GVWA 3GIPA 1RP8A 1TPC1 4DJEA 3QW4B 3UZYA 4GUFA 1HJVA 1GOOA 1SO3A 1LL4A 4RDZA 1ZAIA 1R3TA 1ISVA 4BQ5A 4H01A 2BBFA 5F4WA 2QCGA 4HYVA 1XRFA 2R1PA 4GZIA 3ARVA 2V82A 3UJRA 3T09A 4Z1DA 3TTYA 4C60A 3EA3A 2WHLA 4RV3A 1YDOA 2W5FA 2DQWA 3P62A 1F7BA 4XSLA 4H41A 2QJNA 1HN1A 3Q45A 1PX8A 1SZNA 3BLFA 5LYRA 2L5HA 3KX6A 4HCLA 1E43A 1DEDA 3W6MA 4EKJA 5LKYA 3WQCA 2E77A 3PB2A 3WDQA 1L6SA 4M6VA 2V5DA 3WNLA 5CLTA 2QDEA 2Y85A 2WC4A 1CNVA 1EGVA 2E6YA 3W71A 1QHZA 2CXEA 1TR9A 2EXOA 5I77A 1F6YA 4PL1A 2VR4A 1SJAA 2ZUSA 3NEVA 1IE7C 2J8FA 3AHTA 3LV5A 1W5OA 4LVGA 3UZWA 1PL9A 4K7VA 2F6UA 4OZOA 4WDWA 4JTUA 1QK0A 3GDMA 3W7GA 4TR9A 1TTQA 5AC8A 1J10A 2F8QA 2QCLA 3DG7A 3MWAA 1PKYA 4I7WA 4IGHA 1XIDA 3CLWA 3HGOA 4RV8A 4XB3A 3G8EA 3GU9A 1K9DA 4JN7A 5EFFA 4UFKA 4IIFA 4O4WA 4Z1AA 3UR2A 4UQDA 3VNJA 4AC1X 2H9AA 2G0WA 2C19A 3USZA 3SZ8A 3ZT6A 4AZGA 1X6LA 1OFOA 2E5BA 3GFYA 1LOQA 2BY1A 4DO7A 1BEUA 1FFRA 4G6CA 1OFBA 2EKCA 1EF2A 3FX4A 1I8JA 3R94A 4QDPA 4UMCA 3W53A 2ALRA 4Z1YA 2BG5A 1MMFA 4HNCA 4LCQA 1H5YA 1UIPA 2ZUUA 4K8EA 3AUJA 3ZLHA 5I06A 3ZFHA 5IXEA 1G9HA 1KA9F 1QOPA 3V5CA 2ASHA 5DRIA 4KS0A 4QDMA 4AX7A 2WANA 1P1MA 4P61A 1CGXA 3OZPA 3VABA 3RR1A 1FVPA 3VKCA 5IRPA 3UWYA 3FA4A 4WX2A 4NQ1A 1KTCA 3UR8A 4DF0A 3H2EA 4K8HA 2ABAA 1NTHA 3F7JA 1GVIA 3LBOA 4QE1A 4NZ3A 1DJYA 3VYLA 4A3RA 3M0MA 3WUGA 5AB3A 2V5KA 4NX5A 1E9YB 4IQLA 3VNDA 3WBXA 3FGCB 2ZRXA 1KCKA 4Z0JA 6TAAA 1IEVA 1W8GA 1CCWB 4Q4SA 3L2MA 2RFGA 3O15A 3SN0A 4ORIA 3N13A 1XRTA 1PE1A 3S4TA 3WQEA 1R47A 4WUIA 3VOIA 4XVEA 3LDVA 5DT7A 1YPIA 1W1ZA 2BX7A 4LW7A 2BNJA 4UQEA 2WPGA 4INFA 3TYEA 4A05A 1HO4A 3APYA 1W3HA 1U22A 1YKWA 1KR1A 3VIGA 1JNEA 1NFBA 2A3AA 2JKEA 1ECEA 4L65A 1GOMA 4JHOA 3CU2A 3P14A 1BFNA 4Q8OA 4EF9A 4D8ZA 4GISA 1H0GA 2XFYA 1UASA 3H7UA 4DPQA 1F76A 1UMLA 4J3WA 5D09A 2GJNA 1RQHA 1WOBA 2J9ZA 4CQBA 3PTQA 3ARZA 3S42A 2GGHA 3A4AA 3WDPP 1Y5XA 1WO2A 1WXZA 4W7WA 4PB4A 2JKAA 1XIEA 2CESA 1LOSA 3CIVA 4C6MA 2OLSA 1U5JA 1IZKA 2W9MA 1EO7A 3QTGA 5I3KA 3LZ3A 1Z6KA 9CGTA 3MBDA 1C7TA 4JTLA 5DMNA 1RR2A 1JXJA 3WH6A 5AZ0A 4F3HA 5D03A 3B4UA 5FJPA 3K1GA 1EIBA 1YW1A 3WBAA 4CU8A 4D6HA 1YQ2A 5A94A 2DEPA 1DYSA 4IXHA 3H4WA 4Y9OA 1KBKA 4LUIA 2GPTA 3F4WA 1JFHA 1DOSA 3TJLA 3EB3A 3SW6A 1O1ZA 1JGMA 1UKSA 4KWWA 1R9XA 1MUCA 3OBKA 2A4AA 3P3BA 1KM1A 3BGJA 3E3HA 2UY2A 1BRLB 1D3GA 1PZ0A 2Z6IA 4I9MA 4KGLA 3UPWA 4GBDA 3HU7A 1PO9A 1VRDA 4QLJA 2CZEA 4F9DA 3ZJKA 5KITA 3GE7A 4R27A 3EZ4A 2GUYA 2PCQA 3KTSA 4H8NA 3M0VA 5EBAA 1GQKA 4N4QA 4TOQA 1AH0A 1YTKA 4TV6A 4G7FA 2REQA 4MNKA 1XL9A 4YU1A 3CIXA 3M43A 1POKA 1NIUA 4WY0F 3ECQA 1QI3A 1GJWA 1W3JA 3AQUA 4YWIA 4KFOA 1V6TA 1CXKA 3EKZA 1DE5A 4TUFA 1EJVC 5G4HC 3NFUA 3FV9A 1X7IA 1S46A 4G7EB 2OKOA 3KHJA 1VEMA 1RD6A 3OZMA 1PAMA 2J74A 3HV8A 3B9DA 4MKSA 2I14A 2TAAA 5G2WA 2WMFA 5EMJA 3QSRA 3HBLA 1PDYA 4J5NA 4HMEA 5CXPA 1OYAA 3P0WA 3RNDA 1E0TA 3SSJA 3W00A 3ZXWA 1PKMA 5ABGA 4C7DA 2NVAA 3K1DA 1E6NA 2ZWYA 2ZBTA 3TMLA 3MSDA 1E3XA 2Y2WA 2A3LA 3U0HA 2I9UA 3ABQA 2E28A 1J0YA 4HK6A 4B9ZA 4LAZA 3NOYA 1QI5A 5DANA 5BU9A 1WCGA 4KRZA 1OFPA 1FHVA 3U7VA 4K1WA 3IIPA 3OODA 6TIMA 4Q8WA 4P7QA 1BVWA 3CL6A 2ABBA 3KBNA 3MCNA 2UY3A 2WWDA 3WDIA 3WQGA 4GVIA 1MI3A 4EWJA 3IVUA 2PBOA 2X2YA 1TTJA 1W32A 4GH1A 3RPDA 4LUTB 1PV8A 4GBUA 3W7NA 4KCWA 2RDTA 1FKXA 4CQ9A 1G67A 1QBBA 4KRTA 4GOAA 1J4EA 4Y9AA 5FEZA 3UCCA 2XWEA 4AD1A 3QPYA 3MUZ1 2YFOA 4U3AA 3PFRA 4CCDA 4DYJA 4G9PA 4XAZA 3BW2A 1DWJM 2F9RA 5DMMA 2H3DA 3RLHA 4ZOBA 1V79A 1VBHA 4C6FA 2ZX7A 1B90A 3LCGA 1FWDC 3LRLA 1KNWA 4ML9A 4AD2A 4HCDA 3UR7A 1H2JA 3WLTA 3WNKA 5LA2A 4M1BA 4MIMA 4JTCA 2HBVA 1H1NA 2E8YA 3M0LA 4YYFA 2HZGA 3W38A 4ALDA 1AA1B 1DJNA 3LERA 3I10A 3BXWA 4RE2A 2QV4A 1OFDA 4E2BA 1TPH1 4IP7A 4CKQA 4CEXC 3ZZ1A 3SSZA 2VEPA 1ZBVA 4GCXA 1Q6FA 2PWVA 2Z24A 3PBWA 4ZO9A 3OGVA 1K9TA 2YBTA 4CLMA 4ZFCA 3C5QA 6XIMA 3PZUA 4F66A 2WBGA 3U4AA 4LPCA 2C71A 4Q4OA 1WZLA 5I3HA 1UYQA 4JIEA 4K38A 1KXHA 2JEQA 3VCRA 5T26A 1IXOA 3DKJA 2EGZA 1JUEA 1TREA 3AJXA 4ZBCA 4F4RA 1VJIA 4B3ZA 3TXZA 1MYRA 1QW7A 1J0HA 3SRHA 1BD0A 4P8XA 4PTNA 1S5WA 1JR1A 2WMJA 4BEUA 1CLXA 2Y5EA 2ZZ1A 3RR4A 3AS2A 3SFKA 3W82A 4PMZA 4G1KA 2EEXA 3VOGA 3WH5A 1TMHA 1V6YA 5FSEC 1UB3A 2ANUA 2PTZA 4UR7A 5F1UA 3MUXA 4GYPA 5JIPA 1M01A 4O18A 4GXPA 4HNTA 3ANYA 3CL8A 3FNDA 2QUVA 3QRHA 4UR8A 3U2ZA 3DUGA 1DE6A 1GCYA 2PF8A 1KRCC 3NSNA 3E0FA 1KXVA 3SCTA 3VZZA 2XZ7A 3W1LA 2XSXA 1GVSA 1IF2A 1EC7A 3QOKA 4IX0A 3BOLA 5JXQA 1GYLA 3JW7A 1Z9AA 2ZIDA 3RX2A 4QLLA 4LY8A 3MP4A 1JQXA 4PUMA 2NUWA 2B7PA 1TSIA 4J3ZA 1CGYA 1XSKA 2BGSA 3B8UA 3GZAA 3AHXA 2Y0FA 3B8SA 3GXMA 1NOWA 3JU2A 2WO5A 2VZSA 3R0DA 5A6KA 5ABFA 2BXZA 2VZTA 4OOUA 1TPWA 4UOJA 4L80A 4A21A 2QEZA 4QG9A 3ZR4A 1G5AA 2NVDA 4WQ6A 3S47A 3BK0A 1W6TA 3PPFA 2ZXAA 5FIPA 3CQ0A 3NPXA 2H3BA 5FF0A 3ABRA 3GHRA 3NZQA 4XD6A 2PGFA 1YMYA 3K46A 1OIMA 2ZA3A 1M7XA 3TN3A 3C2OA 1MW1A 1FH7A 3RHGA 3CJPA 1SZGA 2DZPA 3H22A 3QVQA 3ZLFA 1BKHA 2OZTA 4Q7IA 3N14A 5EMKA 1Z89A 1JRBA 3NURA 3CZGA 5EY5A 3QY8A 5FJRA 4M81A 1UD8A 2NV2A 2DW6A 4BQ2A 1V6WA 5IM51 4WKAA 3IIXA 1WBHA 4XZNX 3LTPA 3K8LA 1D3CA 2QF7A 5I6SA 3QYSA 1EDGA 5HNNA 3G18A 3ALGA 5FSDC 3G1XA 3TN5A 2IKHA 4B3LA 2OSXA 2IQDA 2XIQA 4DRSA 1BTCA 3KM8A 4DUXA 3WD3A 1VYPX 2D0FA 2YDQA 7TIMA 1XS2A 4RX0A 1ECQA 1NQ6A 1ZENA 3PF3A 1UWTA 1VFFA 4PTVA 1JCLA 3H2MA 3WDJA 4HTBA 4ROQA 5A6MA 1JXKA 1RHCA 2NXIA 2ZZ2A 3H24A 4JQ3A 2FYMA 4R7JA 3LEPA 2IPFA 1E73M 3VKAA 5D2XA 4WOQA 1PIFA 1Z7AA 4FNPA 1JL8A 1HZYA 4M82A 3SQLA 4DAFA 3C0LA 4U4MA 1ITXA 3UXDA 3GG1A 4IG2B 2YW3A 1V02A 4Y9PA 4JQAA 4JNYA 4QAWA 5FA5A 4GJIA 3VNZA 1R5YA 4ZQNA 3PP7A 1V93A 4HMCA 3TOPA 2QUUA 3KVJA 1GZGA 1WAUA 4EE9A 2NSOA 3UWEA 4NI8A 3O2LA 4ZQRA 2W4XA 4HKPA 4MAZA 2GGGA 4XZWA 1DIKA 2QPUA 3LPOA 4HPJA 3T0AA 1M6JA 2F38A 1DTUA 1KFWA 4PMYA 4ROPA 2RKXA 1OB0A 1SMDA 1V6VA 2ZX6A 1AD4A 4LNYA 1CYGA 9XIAA 3WK2A 5C2GA 2V3GA 2V3FA 3S0CA 2CU0A 5G2IA 3H12A 2FZDA 4IOTA 1FWRA 4IUGA 5DBUA 1K8YA 1ITCA 1KFEA 1TRIA 2VGBA 2QJGA 1ME7A 1LG2A 1ZJBA 2PF0A 2D2JA 4RNJA 3KBWA 2TMDA 3L4TA 4ZOEA 4ICNA 1MEIA 3C86A 4MPQA 1ZCCA 5T9CE 1E15A 4ZQPA 3RJYA 1EA0A 4UQAA 3VKDA 5ECUA 1KM3A 5A6BD 4UWMA 2YKKA 2GVJA 2WYSA 1W31A 3V1PA 3UCDA 1CX9A 1LL6A 1SSGA 1VEPA 6CGTA 3AIBA 3BCFA 2TPSA 2R1KA 2D73A 1G1YA 3NAVA 1WZKA 2XM2A 2NT0A 3DX5A 5CSYA 3ID7A 4FPSA 2GQAA 2OJPA 1XYFA 3VOHA 4IGMA 2FHBA 4Z2KA 4PRTA 1VFMA 4HK7A 1A4LA 1OYCA 1X96A 4JEQA 1JFXA 2ZZ6A 3QV7A 1E0VA 3NJ3A 1L2QA 5I23A 3VILA 1C8YA 1AMKA 4ZQOA 4JTGA 1DV7A 5BROA 1JRCA 4CNSA 1MDRA 4WVXA 1EYEA 1HIZA 5K2ZA 4RL3A 5BXSA 4HD5A 4GVHA 2PGWA 3IV3A 4PEEA 4WHBA 4UTIA 5BOFA 1QUMA 1FDJA 4OECA 1TWZA 3LHTA 4O11A 2HE5A 4LWWA 4QRNA 1UBPC 4W84A 2BODX 4ZTYA 1RALA 4KWVA 2Z1VA 3NXLA 1RLCL 3AS1A 3CHCA 4IMGA 4GCAA 1UP2A 4AWEA 4P7RA 4D6CA 3B8DA 4S23A 1FWNA 4L9ZA 4YWSA 1JYXA 2XIOA 5B80A 3C56A 1UR9A 3KVKA 3QKEA 1JULA 4ES4A 1MXSA 3H2FA 4YPJA 4JNMA 3LSCA 3R8GA 2WNNA 1TV7A 2Z28A 4ERGA 2DZAA 2Y8VA 2VD9A 4JNZA 1JDDA 1SYTA 3QLLA 2FHCA 1FHLA 2FFCA 3VA8A 3T0DA 1KO0A 4FLQA 3KOWA 4LV4A 3TTSA 3F4VA 3ZS4A 1UKPA 3AOFA 4CCCA 2P88A 2VC6A 4J7RA 2X2GA 3VX0A 4WGXA 1JZ3A 4ERAA 2PC4A 4D2JA 1ZL1A 2PP3A 3UJ2A 3MHUA 3R8RA 3LPGA 4YN5A 3N4FA 1QVBA 3FAWA 4QIUA 4N7QA 4BF5A 3K30A 5D2WA 2P3ZA 1Q45A 2DH2A 2V30A 1ISZA 3L21A 2A7PA 1E6ZA 1F3TA 1ADDA 3THDA 4IMFA 3H2CA 3E2QA 4MZYA 4Q8MA 3STPA 4OV9A 5E1QA 3OHMB 1DJQA 4HSHA 1R3RA 3ISIX 3SDOA 3N04A 3DFTA 3QEZA 2A6LA 4HBKA 1ME9A 1TPB1 1LWHA 4MKNA 1ZJHA 4PMQA 5HBFA 4DWSC 4OFCA 2VKZG 1OC7A 1J2WA 1Q63A 2ZC8A 3M44A 1JCJA 4CD8A 1F05A 4Q8PA 1RBLA 3DHPA 5E70A 3FXGA 2PLMA 4XD4A 5BCAA 3MU7A 3R89A 3UZJA 2X41A 2ZYFA 3E0IA 4YVPA 1QI0A 4MFEA 4LAKA 2BASA 1W1PA 2PZ0A 3AS0A 2O56A 1ZPTA 4E8GA 1LP6A 1MQQA 3NGJA 2PP1A 2WKJA 4ZEPA 2PAJA 3WELA 3ATZA 3IVSA 3H6OA 8A3HA 4FHAA 1XKJA 3GDKA 4S3AA 1UZDA 1FTXA 3PSVA 3GDBA 3D47A 1ONXA 5J04A 3IJQA 3DENA 4KKXA 4UNIA 3I4EA 3IEBA 4N2YA 1DWAM 1SJDA 4O16A 3GU2A 3QMSA 2NXHA 2PTXA 3GDRA 1XIIA 4FP1A 3V0UA 4NILA 3SCVA 1M53A 5TD4A 3BZJA 3AIEA 4L56A 4Z2LA 1CGUA 1JAKA 4LX4A 1VGAA 3ALFA 1NQKA 4Q8VA 3CZEA 3QSTA 1FH8A 2IKGA 5CBJA 3VD9A 3QF0A 2OXNA 3M0HA 3W7OA 3DHFA 1OYBA 3BURA 1K7XA 1E6SM 2HBXA 3R1ZA 3PC0A 2DUZA 4ORMA 3VD3A 2C7FA 1A5UA 5GNXA 4L7ZA 3EEZA 2WJDA 1A0CA 4HNNA 3QV6A 2XHYA 4TX9A 3L67A 3MVIA 1K77A 1LQ0A 1RSCA 2OGYA 1K6AA 1RXOB 3LYEA 4JTKA 3BSHA 4TX6A 4EXBA 5EKYA 1NOUA 1PTDA 4IMCA 1TTIA 1M65A 4YHEA 4GGHA 1DXEA 3HV9A 3TCSA 3WD4A 3RPTA 3TFXA 3AHZA 3WDRA 1YE6A 4D6DA 5CC5A 4DZIA 4GQ0A 2PTDA 3QQ1A 1KW1A 2I7GA 4QSFA 1X6UA 1TPVA 4W7VA 3W75A 5TQLA 3P84A 2Y7EA 4U3CA 3FGCA 1A53A 3HGJA 2ZE3A 1SZFA 3VPLA 3A23A 2R6OA 3OB8A 1L6WA 1JZ7A 1XDJA 4YCOA 4URIA 5C7VA 2Z2BA 3P5YA 3W4RA 4HNUA 3KEHA 3L5AA 4UFHA 3E38A 4LYQA 1ZGDA 4IM4A 1ONEA 3RO6A 2OZ0A 1ISXA 1B1YA 2I17A 3IJ6A 1EYWA 2C1HA 2A5HA 2AQOA 1W1VA 5BYWA 1KFBA 1MQRA 4DO6A 2Y24A 2PPGA 3AALA 4K8GA 3U8GA 4A3QA 5TAOA 5K7JA 3S9IA 3P0XA 3URQA 3EOOA 5A8PA 4GZEA 4KWOA 2PA6A 3O07A 1Y7VA 5DBTA 3ZVIA 5D9MA 5C55A 1FWBC 3STGA 4NNCA 4S3KA 5GJPA 4MJ4A 2I57A 2B4GA 3ZSSA 5BRPA 2EG6A 1R30A 2G37A 4TQTA 4UOQA 3WF2A 3MYPA 3BAKA 3I4KA 4O17A 3CXOA 3B9NA 4CN1A 2TSYA 1EQCA 4S2CA 1WOAA 1CLKA 3RM8A 4PCNA 5GJNA 4MTVA 1WAWA 3NIYA 4Y7EA 1P0KA 3HURA 1ZBCA 5CGMA 2P50A 5I09A 3N9KA 4B91A 1FY6A 4E8DA 4WZHA 1XICA 1NP2A 3T7VA 4AY7A 3ABZA 3AJ7A 1BRLA 1J9YA 2PDBA 1RUSA 3NQMA 4QNEA 1EZWA 4LBRA 5D9PA 3LY0A 3GVGA 2CZFA 4V33A 1K70A 3MO4A 3L4VA 4PCFA 4QNWA 4GY1A 3VE7A 4WOZA 3YPIA 4J4KA 1XIHA 2Y7FA 3D3AA 4MM1A 2C16A 4ICMA 3GM8A 3TZNA 3I68A 3G1FA 1XLAA 4PMXA 3TFCA 3O05A 1DJIA 1PS9A 3IRDA 1FWWA 3W83A 1B9BA 2AKMA 4DUWA 4EAYA 2Y1HA 5FOOA 1ZNNA 1UR0A 4G7EA 1E9IA 4PYSA 3UGVA 4C6IA 1L6FA 4YTRA 4UQCA 4L4OA 3EMCA 3OIHA 1V3HA 1VBJA 2ZDRA 2QV5A 4NJHA 2INZA 2WB5A 1D2KA 4M7TA 4WCJA 3N73A 5D30A 3CO8A 3MKCA 4AC7C 3HG2A 5G4WA 3NUKA 5C8BB 1TPFA 1R46A 1A80A 2RGMA 3B3DA 4PB5A 1DJHA 2ZXQA 1FWHC 3O63A 3RK8A 8CGTA 3CYJA 1S38A 2PWHA 1KM4A 4IIBA 1XW8A 3LD5A 3KRBA 2J7FA 3IJ9A 1H61A 1R85A 3MI6A 5D33A 2DSZA 5D2VA 1JUBA 5C54A 2OO6A 1OD0A 4GINA 2HNEA 3LHUA 4HZ7A 3EXTA 1SFJA 2V68A 3N9RA 1I2QA 3JRKA 4IH3A 4C6EA 1EDTA 3QPEA 1H49A 3WJSA 1M5WA 1J93A 5A2CA 3GNOA 4PZVA 3LLFA 1JF5A 1LZOA 1GKRA 4AZHA 2IQ0A 3GXPA 3O9NA 1EJUC 5TBOA 1ADOA 4JX6A 1KTNA 4UB9A 2VO5A 4EPKA 2J47A 3AYSA 1AH4A 2GVYA 2VL4A 4M7SA 4R9OA 4W86A 3BARA 3URBA 4S3FA 3FVDA 3W1UA 4DWSA 1UWAA 3RU8X 4F0RA 5HANA 2GQ8A 5KTLA 1F5ZA 4LAOA 4N4PA 2E67A 5HA7A 4BFAA 3VTRA 3OA5A 1YBQB 4K3ZA 3POHA 4PULA 2ZRVA 1WA3A 3ARXA 2DUXA 1X97A 4ZGYA 4R33A 5IFTA 1FFQA 3B4YA 3H8AA 4LS1A 4MDPA 3VD5A 1TWDA 4HU3A 4B5NA 3HOJA 3RX4A 1VPYA 2EJAA 2Q8LA 4JIHA 4NJIA 4HSNA 1N8IA 3EX6A 3NZPA 3G1RA 3Q37A 4ACYA 1Z41A 2B31A 1K8XA 3NQFA 4NY2A 3CAKA 2BVDA 3BICA 3MP5A 3UWUA 3AFBA 2B0MA 4MSSA 1U83A 4LC6A 4W8LA 4JYFA 2FPYA 2C3ZA 2PDJA 4AHQA 4JIPA 5M17A 3ITOA 3IUDA 4S39A 3WCZA 1OT2A 4ZA0A 4JQ2A 4I3GA 4AX6A 3CMFA 3VVGA 1V7YA 3LMZA 2CZ5A 1TQXA 4PUDA 1F8MA 5REQB 2WMIB 1B30A 2D0HA 3N2XA 4EP8C 4JN6A 3M1ZA 1THFD 1QATA 4DELA 2C91A 2W63A 5LXEA 1UZHA 2PFHA 1ADSA 2A21A 3BAIA 1NOFA 2CBJA 4D1IA 4RW3A 3LSBA 3S1XA 3SCNA 3KCLA 3L4YA 3TLLA 3VKBA 3D46A 3QZ6A 3VGHA 4DM1A 4H4IA 2G3FA 5DN1A 2QPSA 3FKRA 4BF7A 3I3EA 4P8UA 3GG7A 3TQ0A 4AHPA 2BY2A 2F61A 4MJMA 1QPRA 1R87A 4PBGA 1S1RA 4OT7A 2NXGA 3GHUA 1R6WA 3BUVA 2OCZA 4KEMA 3KL5A 4AZ5A 4AXKA 1ME8A 4EAMA 3C0JA 4JX5A 3WO8A 4PFHA 2J7HA 1GVFA 3PY2A 2ISWA 4ZODA 1OC6A 3ZWTA 3Q2DA 4QCFA 3RDKA 4RPQA 5BOEA 3LK6A 2D23A 2Z26A 4LF1A 4JKKA 5H8UA 3S2NA 4XZIA 3TOYA 2BY3A 3QTPA 3AMCA 4ADSA 2GQ3A 1JG9A 4ZMGA 1VKFA 5HWNA 3QQ0A 4K7YA 4QITA 3VDCA 1TV3A 2B7OA 4TO8A 4GUIA 1C93A 4E38A 3IK2A 1GQNA 3DKLA 4DO4A 3PS7A 1EA9C 3BOFA 1PVNA 3LPPA 3SRKA 3PTKA 4UTJA 3V18A 3C2RA 3CQJA 3WUEA 4KPLA 2MNRA 5AC7A 5EFDA 1EPVA 3ZR6A 2E9BA 2EPKX 3L4XA 4N6FA 1DQXA 1LTDA 3UPMA 4J3VA 1KFLA 2PSNA 3FYPA 3SJ3A 4EACA 2GGEA 3S2JA 3F5LA 1CIUA 1FQ0A 4D8LA 4OOZA 2QUTA 1DJZA 4HIBA 4UTTC 1AQMA 3TA9A 2P0IA 3PJXA 1I2NA 4O1CA 5AFDA 4DJFA 3O1NA 3DHDA 3BMWA 3HPSA 2X1RA 5D2TA 1QRQA 4ZO6A 1QBAA 4CNPA 3M5XA 5HAOA 3JZEA 4J27A 4O1EA 4M29A 1RZMA 3MCMA 3PJWA 3R79A 1M7OA 1R3VA 2BGNE 1Q7QA 2CERA 2H9AB 2DGAA 4NAEB 4KCUA 3VE9A 3CEUA 3RCNA 3N4EA 1CB2A 3W76A 4S38A 2WSPA 4M56A 2GGJA 2RDXA 4AZ7A 3R7MA 4PMDA 4CNUA 1JPHA 3QFWA 1ZSXA 2ZRWA 1NSJA 2WSKA 5HJXA 1OABA 3GTNA 2QXWA 3BANA 3WJXA 5CJNA 3U3HA 2CKSA 4D9PA 5FF7A 3OLEA 1UBSA 2JIWA 4V15A 4N42A 5AC6A 1VF8A 1E1CA 2YX0A 4N9BA 5RUBA 1WPCA 3W74A 2J78A 1Q6OA 4GQBA 1SQ7A 1XCFA 3N19B 2EBNA 4J9JA 1IHIA 5A6SA 5A6LA 2UY4A 3HPFA 3NQCA 2PWDA 2QCCA 1MNZA 3PNUA 4NL1A 3WF0A 1W5PA 2I5QA 4M3PA 3STFA 1DBTA 4L61A 3BDKA 3DFQA 3SGGA 4C6CA 3TZFA 1BHGA 3TN6A 1DKWA 4PTWA 4IG2A 4QJ3B 1XFBA 3NNTA 3I7QA 2FTYA 2CHNA 3TDFA 2ZWZA 5F4SA 1V03A 3B97A 1WDPA 3PULA 3W81A 4RCXA 1IEWA 4AEFA 3KXQA 2QCEA 3R0UA 1TRDA 4G56A 4UCFA 4TVDA 7REQB 5C6MA 4N9DA 3S6OA 2SFPA 3VI2A 3PBGA 2BVYA 3K4AA 2PDUA 4BI7A 1H0IA 4IL2A 4D6GA 1EBGA 4DB7A 3WK3A 3J7HA 4HHPA 3GNRA 3LHWA 5K3VA 3H23A 4K1GA 1QT1A 3LOTA 2XDFA 1SO4A 3TQPA 3M64A 3ZJ6A 1XX1A 3WQWA 2VX6A 3NZGA 5I3GA 3MJMA 2GOKA 3VU2A 3BE7A 1WNOA 3BAYA 2BOGX 4FIRA 5FJOA 1KM0A 3N4AA 4NX0A 3FJLA 2YZ5A 4LB3A 1PB0A 5FEWA 1ZBKA 3GH4A 2G4FA 3G0UA 2WCGA 2J7GA 3W6LA 1TVPA 4NUWA 4RR4A 1H63A 4KFPA 2XINA 4Q8UA 3BO9A 1PWLA 2JBMA 3CV1A 5GJMA 1IWPA 3WQFA 3NG3A 3VGFA 1O95A 2WWCA 1UD4A 1E3ZA 2QDGA 3F2DA 1C90A 2CHOA 4F9JA 3LI0A 5TF0A 3QFEA 2I9EA 4GFSA 3WQ5A 2GOUA 1YDYA 3L65A 1FXPA 1EGZA 4GQRA 4MKVA 2O55A 3AXMA 3LB0A 1GOQA 5XIAA 2ACUA 2VX7A 1AH3A 4Z1CA 3VIJA 4CQAA 1S2WA 4O4VA 5JBEA 2ZRYA 1R7AA 3VDHA 4XIAA 2HK1A 3AYVA 2GGIA 1JPDX 3C3UA 4KRUA 3TTOA 4C6OA 3EA2A 2DDXA 4XQ6A 4PUEA 3W24A 3GO2A 2C0AA 1S2CA 4JXCA 1T99A 2QQ6A 3KOZA 1QAPA 1KD0A 4X22A 4PL2A 5EA9A 3ITXA 1VAHA 4LF2A 4FI4A 2VHLA 1EDQA 1LROA 2VFIA 1UJQA 4GFIA 1SGJA 4WGHA 1RQEA 3ERPA 2TYSA 2WMKA 1WKEA 3K4DA 2X1UA 3KWSA 2OEKA 1CEOA 3G5EA 2I56A 1HFBA 4IX2A 4FO4A 1B3WA 5LIWX 3V16A 3HG5A 3IGSA 4KEZA 2EAWA 1KQYA 3E6EA 3L5LA 2P8BA 4FLSA 4NZ5A 1LRQA 1SW0A 2R91A 3H53A 4MJZA 4MF4A 2WXDM 2HV5A 1BLIA 3NDZA 1NF0A 3WNPA 1LWJA 3AIUA 2YXOA 4WXYA 4UC5A 5ABHA 4LUSB 3QGVA 2PLCA 5A95A 1CGVA 1RLDA 1GK8A 5DQPA 1TCDA 4FOJA 2JQXA 1AW5A 3ITTA 4IGNA 3THQA 3S6TA 2C18A 3A47A 3BLLA 4QJ1A 3W7PA 1DIDA 3M0JA 3U5UA 2WC7A 1SR0A 5HJYA 3W27A 4ERIA 3EDKA 3NYDA 2O9OA 2PWEA 3NDYA 5IBXA 4BI6A 3GK0A 5E0KA 1BWVA 1I9CB 1XLLA 4XKYA 3NQ8A 3BPWA 1J01A 2FMOA 3WNNA 2E9LA 3CUIA 1DP0A 1VC4A 4HPNA 1VHNA 5I3DA 4NJGA 1TQJA 2GSJA 1VHCA 4NJJA 1XG4A 3CUXA 4P7NA 2J7DA 5ABEA 3W7KA 4MY9A 3WQ8A 2OMAA 1DL3A 4NT0A 3T81A 4Z1BA 2J7BA 5ENLA 3P60A 3HFTA 3GBDA 1TR1A 3AIWA 1F6PA 1XH2A 1QXLA 4B5SA 2ALDA 2VGIA 4NYYA 1FWCC 4GO9A 3UFYA 3P67A 2GVEA 4JL1A 3N2OA 4L9YA 3RRXA 1ZBWA 1UQYA 8TIMA 4H1ZA 3TAOA 4TTGA 2FJUB 2HCVA 3RU6A 4UTWC 2BVWA 1VIWA 4O0QA 2Z7GA 3U57A 2PLJA 5D9NA 4GZ7A 3W26A 4GY7A 3DIPA 3E49A 4B5VA 1FH9A 4HOXA 1UPMB 2Y4SA 2OOGA 2C0HA 1F73A 1ZJAA 3CWOX 2WQPA 2ODOA 1H7RA 1K1DA 5I03A 3ICJA 4DYEA 3LCFA 5H8PA 2OX4A 3OYZA 4IP5A 3L4UA 3GH5A 5E5CA 1T5AA 4U5KA 4D72A 3UJSA 1QWKA 2NUYA 4W89A 3I6RA 3VIFA 3BG9A 1SSDA 1IXNA 1X7FA 3FW6A 1JEZA 4ENLA 2DJLA 1VPQA 4G8TA 2QCHA 1BXNA 2WHMA 3G1HA 3NZ1A 1IQ8A 2GJRA 2C6QA 2ZDSA 5GQBA 4F2TA 3BJFA 4WXZA 1BG9A 2DT1A 3FAXA 2YLLA 2DT0A 2XU2A 4E5TA 1PWMA 1A3XA 1WUEA 4HYWA 4NSBA 3BCJA 3CASA 3BJSA 4H6EA 2OELA 3LV6A 3WQDA 2QCNA 3W1QA 2XSBA 4W88A 4Q4PA 1TO3A 2F84A 2MANA 5KZDA 2AAMA 3V36A 4E2OA 2WPBA 4XKMA 3PZTA 1UA7A 3WDHA 1WE5A 1MFVA 1J6PA 3H4GA 1CT5A 1E5JA 4OBSA 1QCWA 3VMOA 1PSCA 1Z44A 5HQEA 3KOYA 2Z1KA 1V3LA 1OGGA 4LGXA 1MEWA 4QP0A 3NO1A 5DY2A 1L6YA 1UMYA 4JDBA 3F4NA 3WQOA 4Q32A 3AYRA 4ZOCA 3PPGA 1JD9A 1QWGA 2CLIA 3LXBA 3O06A 1IEQA 3H55A 1EHNA 1E6XM 3STEA 3B05A 3IAQA 3V5FA 3A22A 1KRAC 2QJMA 3TW9A 3BWWA 3ZOAA 1GPWA 4FLOA 2WZMA 2X8RA 4CNOA 1EP1A 2VX5A 3GHSA 2QYGA 4JY8A 3K8MA 1KBBA 3HJEA 2WOQA 3LENA 4US6A 3LBMA 4MOZA 1W0MA 5EGRA 5FCZA 4BWLA 3GVQA 4C7FA 3FLUA 4UR9A 4LB4A 2GQ9A 2O7SA 1MNSA 1PCKA 1W2VA 1Q3NA 3EXSA 1B0IA 2E8ZA 4L5ZA 4HJWA 4IJBA 3GKFA 3GD6A 4OVXA 2TODA 1EGMA 3WL1A 4XSMA 4HA3A 1VB9A 1HKJA 1XBXA 2VOMA 4JFWA 4W4QA 3NVDA 1NU5A 3C3NA 1EB3A 3MSYA 4O0KA 3STCA 3WUFA 3B03A 1L8PA 4PR4A 4JHZA 3SY5A 3LGDA 4G5DA 2XFRA 4FA3A 2X7WA 1XINA 4U10A 4HB7A 3IANA 1M1BA 1BGGA 1XM3A 1HJSA 3M0XA 4H04A 5EMLA 3TN4A 3WUBA 3UZZA 1P0EA 2GZXA 1LT8A 1Q2RA 1P6WA 2CBIA 2C14A 4XBSA 1XLKA 5M2FX 1XISA 1J18A 2CLHA 2CYGA 1NDWA 1MVYA 5T91A 3B0XA 2O9PA 2PDFA 3MY9A 4FB7A 3THAA 1H1YA 5MHBA 4J2PA 1JPKA 3FA3A 1LQAA 4I90A 1GOIA 3P80A 5G1MA 4NZJA 3G6LA 4V27A 2ONEA 1XLHA 5LNSA 5XIMA 1V0KA 3LTSA 4MNLA 2DSUA 3A5FA 4KFNA 1JDAA 3MI3A 3UP8A 3TC7A 2J79A 1TKKA 2VR5A 4HK5A 3AZRA 1YXCA 4WDTA 3W1RA 5HK4A 3BAXA 3DERA 3T2PA 3RLUA 3LG3A 3NL2A 4YVVA 1DORA 3TJXA 1HW6A 5FF3A 3WH7A 2PTWA 1A5CA 3PZNA 4HN8A 4N9EA 3EPMA 2WM1A 1VLWA 3DC8A 1TE6A 1HKMA 2W79A 4OBTA 3FIGA 4C7GA 1VFOA 4UTLA 2PB1A 1S39A 3ZT7A 1YEYA 3PTDA 1IIHA 5FF2A 4JHMA 1XC4A 3HTWA 1RK5A 5I5RA 4HJFA 1ZU8A 1C8VA 1FA2A 2QCDA 3TSDA 2WJZA 4B9YA 1E6RA 3WBWA 4OBRA 3E1F1 3W7RA 2VP8A 4B2DD 3W1AA 2YBUA 4LVFA 1T8XA 4ZE4A 2VVNA 4MWAC 3W2KA 2DSVA 4PUWA 2V6AA 3HN3A 4C6PA 1Q6DA 2PCEA 5EU9A 2QDDA 3NQAA 2Q71A 1UR3M 1VBRA 3N2TA 3FA5A 2YB4A 3TYCA 3WJZA 3P81A 1A4MA 2YCJA 5AHLA 2Z2AA 1GVRA 3W6YA 3CWHA 1XH0A 3L66A 1HKIA 4RZBA 4E6MA 1ONRA 3TTQA 1PBGA 2AQVA 1GG1A 3VGDA 4QXIA 1YPFA 4AISA 2QCMA 2VWSA 3ATYA 1XLFA 1IGWA 3HA1A 4BHYA 4NNAA 1RA0A 4LUYA 4RPPA 1UWSA 3OVGA 3VCCA 1XLDA 2VJXA 3N6JA 3E2VA 2QJJA 4EOUA 2P5NA 2BMBA 2G96A 4H6KA 4GX9A 3AZSA 4LOCA 3SJNA 1QPKA 4WJXA 1YBQA 1IYXA 1TX0A 1ZFJA 4ATLA 3BV4A 1UUQA 3WLSA 5U4NA 3MKVA 2WLZA 4UQBA 5A5WA 5A6AA 1NWSA 3S46A 1JCYA 3MMWA 1OIFA 4UFIA 3MW7A 3MZ2A 1XLMA 2BWGA 3V3WA 1BVZA 3WX7A 2YA1A 3IUIA 1NF7A 1VBGA 1T7LA 1KQZA 3KP0A 5EBUA 3QC0A 4HHLA 4JIQA 4IMAA 3REQA 1O4UA 2X1SA 4HZ6A 1R2RA 2O0TA 3L2LA 4TX8A 4XG1A 1C8XA 2Z4GA 1T6MA 1UWQA 3K13A 1QFEA 3VINA 1Q13A 1W9VA 1AD1A 3IJIA 1GHRA 3RPMA 4QAIA 1MW3A 1ZRQA 4BEQA 1F3EA 5BXTA 1XCXA 4DY1A 5REQA 3AU2A 2WMIA 1W17A 1J0KA 4ZE5A 4LRSA 4O8AA 5DMLA 1PXGA 2OU4A 4O54A 1KV8A 1TA3B 1QNOA 2YCKX 1SJCA 4H6RA 1JCNA 4DF2A 3WF3A 3BV7A 3TKFA 1B54A 1O60A 5LIYX 2GJLA 1AZ1A 1JD7A 2OKTA 1ZZMA 1QO2A 4J40A 4XO6A 2VENA 3UZXA 4DUVA 3W1MA 4GABA 1YXYA 4RNFA 2W27A 2VELA 3M7WA 4MYXA 4V1XA 4IIGA 5D2YA 2G4JA 3NGFA 3H2OA 1IXQA 1BTMA 3U6WA 3MV11 2PLKA 4FX8A 4XIMA 4W5UA 4GIEA 2VZUA 3MBFA 3UYCA 2PDPA 2QLYA 3HMCA 2JEPA 1EJWC 3OP2A 2DZBA 3KCJA 3CB3A 2HPIA 2PWUA 1UOKA 2VFDA 3C0SA 3IIZA 3DAQA 1Q8AA 3UWVA 1B4KA 3M07A 5I2UA 1QASA 3GAYA 4R88A 1GOXA 1D8WA 4WD0A 1XBZA 4MY1A 4GLEA 2G97A 2W0UA 3KS5A 2WVSA 3UCQA 1KLZA 2XPKA 4RZ4A 1XD1A 3PZVA 1B3OA 8XIAA 5DXXA 3GBEA 3WG6A 4IFKB 1VCGA 3G1VA 3QM3A 5CLWA 3S1VA 4MVAA 5CJMA 3GHTA 2R1NA 4QQUA 3GW0A 1J5TA 3AS3A 4LNCA 5KZMA 1A5SA 1HGWA 5D02A 4DJEC 3VGGA 2E1DA 3OLIA 4IP4A 5CG0A 2IXVA 2G3IA 4KH2A 4DJDC 1GYNA 5LIXX 5KETA 3EEGA 1XF0A 2HS6A 4PCSA 1VFTA 3DFOA 3VZXA 3ZSTA 1FWGC 1FWSA 1OEPA 3DOPA 3RCYA 5C9RA 4OJYA 3SQMA 2ZADA 3SADA 3SGUA 4Q4QA 1AW1A 3HQ1A 3B0UX 1R38A 3CPRA 3LBCA 3UXAA 2WCAA 4RK8A 1S2UA 3M41A 3OVRA 2QNEA 2Z2UA 4AH7A 3TE9A 4DXXA 1K8CA 1ESWA 3LGEA 2DH3A 4AWTA 3LCIA 1SFSA 2TRSA 2YYUA 3SI9A 4E4FA 3IJDA 1C91A 1OF8A 2R1MA 2IPGA 2Z1SA 3UD6A 3AHVA 1FWFC 1HL2A 3EDJA 2QGYA 4F0MA 5BXRA 1Y5VA 1WB0A 2HK0A 3CAWA 4NAEA 4FS9A 2HDJA 1RH9A 3AI0A 3IWPA 4Q4RA 4KCVA 3W01A 4IFOA 2J88A 1UR4A 6REQB 3HJZA 2Y7DA 3CUFA 3RFAA 3WLNA 4PUJA 3I3BA 5HUPA 5JIWA 3TYZA 2GWNA 3LA4A 2GL5A 2QAPA 4JY9A 3DFNA 3K5XA 1E70M 4GUJA 1V7AA 3LMYA 1TB3A 1US2A 3CYVA 4DX3A 1Y5WA 3SFWA 2PC8A 1GGOA 2DY3A 1QPQA 1NWTA 5C9XA 2GYIA 4JYDA 3UA3A 4O12A 1YNYA 2POTA 1NH6A 1VRXA 3GKAA 5CG7A 1OG6A 3CV2A 4F40A 2IQTA 3O0FA 4GG9A 1HQTA 4O52A 5G1TA 2P8CA 2BHYA 3GLCA 3AXIA 5T8GA 5CZJA 3SURA 4U31A 1TJ1A 1XXXA 1OCNA 5J5DA 1IT8A 1E40A 3ZR5A 1UD5A 3MP3A 4XAGA 4FF5A 2P10A 3G77A 3O6YX 5FAGA 1GJPA 3T6CA 4GYFA 3T4CA 1Q65A 4UMAA 1J5SA 2W67A 3E0LA 2FZBA 1DHKA 4GK8A 1FP8A 3S83A 1UKTA 2PDLA 5C9ZA 1Z8AA 1G0CA 3GU1A 1QO5A 3GTFA 5AYZA 7ENLA 3KDNA 5G4EA 3TX9A 2XIMA 7REQA 4XWUA 5LHEA 4JICA 2G50A 1TMQA 3A3WA 1UOZA 1RJQA 2EPHA 1A5MC 4J3XA 2E6FA 1LUCB 3VKKA 3P2VA 1QNVA 3OPSA 2V3EA 1S1PA 2EPMX 2QVNA 1QPOA 4XUYA 4UOZA 1W1YA 1VFUA 3IAPA 3KOXA 3B9EA 4HA4A 3FSTA 3W86A 1I2PA 1LM1A 2YOCA 4F0SA 5HMEA 3W84A 4AEOA 3V0TA 1HF6A 4F48A 3E74A 1E72M 3AUOA 4MADA 2DJXA 2BV9A 1MQPA 1O6IA 4H7VA 3T08A 1XCWA 3GC2A 3S5OA 1GJUA 5FD0A 2GUUA 3P7YA 3DG3A 5I02A 4QS6A 1FCBA 1RJRA 3VD7A 3KTCA 3BLOA 3SCUA 2ZVRA 1QNQA 4Y9MA 4IQDA 1U5HA 3EOUA 4LCSA 4HZ8A 3EMQA 3AIVA 3WBEA 1N7KA 1XI3A 3VOCA 1ODZA 3T40A 3KRSA 2YDRA 2VGGA 2CBUA 3NM1A 2E0PA 4AIEA 1CGWA 4BA0A 1AW2A 3F1QA 3VCNA 2WZEA 4L9XA 3AWNA 4GIAA 5A6TC 3D0CA 1FHDA 4K6AA 4F0LA 1WP6A 4ZB0A 1DJGA 1EKOA 2D2OA 2VZOA 2CFFA 5BWFA 5CQ1A 1H7OA 4HSOA 5AVNA 1RCQA 3M0ZA 5FEXA 2HVMA 1EH9A 5CAHA 3MWCA 4JBRA 1FWJC 5MKGB 1CGTA 1QMLA 1R7OA 2PUZA 4UMBA 3T1GA 5JH2A 1VCFA 2JIEA 2ZOXA 3O6AA 3OG2A 3WLOA 3CO4A 3EWWA 1HP5A 5KEZA 3KZSA 1XGZA 1PIGA 2V0TA 3BSGA 3RGTA 1HT6A 3RN6A 3MI2A 4LVAA 5LNRA 4KETA 4C6BA 4JGDA 2OLHA 1GOWA 3QOMA 2NQZA 4C91A 2PD9A 1CXEA 1ML1A 2G8ZA 3CUJA 4RJEA 3CLMA 1NJJA 1ISYA 3L9CA 2YSWA 2PGRA 3HGRA 3A5VA 3T0CA 1KM5A 4G2DA 1MFUA 1J0ZA 3PBMA 3ES8A 1G94A 1J0JA 1W2PA 4JTDA 1BQGA 2ISDA 3GNNA 4W5ZA 5K9DA 4FIQA 3CUGA 1S2TA 3CUZA 6XIAA 1VPXA 5JH1A 1XYMA 1VJZA 4IFRA 4XUGA 2RGLA 1QI4A 3OG3A 4NZCA 1YNPA 3WD0A 4F2UA 2V3DA 1VFSA 4LUSA 4PUUA 3GDLA 2W62A 1A3HA 4RNHA 1U30A 1FWIC 1XQKA 4DO5A 1W1TA 2C79A 1OD8A 4Y90A 1G69A 1W3NA 5CC6A 1BSIA 2WMHA 4DWSB 4REQB 3CT2A 1P6CA 1U2YA 1TFVA 4OUEA 4AZ6A 1TCMA 3LCLA 3VGBA 1HL8A 3VMNA 4ML4A 1R8LA 1XIFA 2FTWA 4ZZ9A 1EF3A 4D6JA 4E4PA 4K2SA 4H7ZA 3LN3A 1P7TB 1HX0A 1GOKA 1KGXA 5FKYA 1H09A 1O94A 3M5YA 2QUNA 4XZLX 3E5BA 4YHGA 2ZUVA 2R9RA 4MWAD 2Q09A 4DZHA 3WKZA 3OJGA 3QV9A 4CQCA 1CTNA 2ON3A 3BVJA 2QKFA 4AY1A 4NU7A 1W3TA 3EWDA 3I7RA 2PP0A 1K7FA 2ZZ3A 1HL9A 1LBLA 4H2HA 1FXQA 1XFCA 3EBVA 3CC1A 3W28A 3GR8A 2EQDA 2ZX9A 3N3TA 2INEA 3WIJA 3H70A 4EPEC 1IIGA 1UD3A 1XIMA 5JQ9A 4UZUA 4Y9NA 1EP2A 2E40A 2X1IA 4GVGA 2JALA 3AHYA 1QPNA 3GB6A 4IT1A 1Z32X 3CMGA 2V63A 3A6OA 2Z1BA 3W2LA 4GXMA 1E1EA 3PZIA 3DDMA 4LANA 4LVBA 3TK7A 2F7FA 3GSMA 4AQLA 4ZQMA 5LGZA 4BS0A 2X0HA 3POCA 1WKFA 3PWIA 3QZAA 2C13A 3UR5A 2XH7A 1YTDA 5CBBA 3ZLGA 3G8RA 4ZFMA 4PTMA 4OIFA 3O3RA 3ONCA 4Z2IA 3TYAA 4KGJA 1AZ2A 4HOWA 3QV8A 4PMUA 4C1KA 1R3SA 2VT0A 4GKTA 2JF7A 2YCIX 5C5YA 1R0MA 3GDTA 4LCRA 1O5KA 1BF2A 1XYCA 4C6QA 3R10A 3H21A 4YTQA 2C1GA 2PDNA 2YXXA 2R1LA 5AN7A 4DHGA 4IIDA 3LCWA 4DWDA 3C8NA 1V0MA 3WLLA 5M03A 1VBUA 4I9JA 2DIKA 2IPJA 1UP0A 4MZ8A 4P7LA 2FTPA 3S1GA 2V9DA 3B9OA 4PH6A 3LM3A 1NEYA 2XN2A 2OYMA 2IXUA 3UZ5A 2BVTA 1XGEA 3F5JA 2CLEA 1MW0A 1UP3A 1M9HA 4HU0A 4X0VA 2BHUA 4EK7A 3BGAA 5A6BA 2EHHA 3SUWA 4O14A 1DQUA 4UFJA 3E0VA 3P5ZA 3GTXA 5H8MA 1IWBA 2HTMA 1XPGA 1E51A 3WLKX 1JYWA 2CC0A 4S3CA 2DSWA 3GXDA 3OQEA 1I6NA 1V3MA 4LY4A 4BCEA 2PWFA 2Y62A 4YLWA 3QH2A 3RYSA 3A12A 4I7UA 3BLEA 1SUXA 2HVOA 4LH8A 1KKOA 4UUIA 4W7UA 1GUVA 1C3FA 1W8SA 3GXNA 7CGTA 1G4TA 5JBFA 1PIIA 2PDGA 3E5PA 1KR0A 3WQVA 1OJXA 1TZ9A 2ZTJA 1VEOA 4XZHA 1NWUA 3IRSA 2OWXA 3TW7A 2PWGA 1QOXA 1HTIA 1QW8A 1DWHM 2V8ZA 1TWSA 2D1ZA 1QDSA 1X8CA 3CHFA 2HWGA 3DFYA 2FIQA 3W2UA 1UH2A 2VUNA 5CAKA 2VZVA 3M5VA 1MDLA 1TV2A 2ZA1A 1FCVA 3ANVA 4OTKA 3SCQA 1T40A 3GIQA 3RLVA 3SUVA 1NM9A 2OZ3A 4IL0A 3M47A 3SUSA 4OQVA 1OQFA 2JFEX 2VI0A 2WKGA 1MUMA 3NTYA 1S3TC 3FEQA 2AMXA 1AJ0A 5TNVA 3AICA 2YCLB 1WV2A 4DJED 1T96A 4MZ1A 4ZQCA 2P76A 4MB5A 2DVTA 4DBUA 1OCBA 3HMJG 3PUOA 4DJDD 1LJYA 3UEQA 4DBDA 2R94A 3WQ4A 2WSYA 2Y61A 4JCMA 2E68A 3H2NA 4X0NA 3TW6A 2OT0A 1E1CB 1VCVA 5CZSA 3QMRA 2VDGA 1GONA 4H9YA 3IK4A 2NZLA 4XZMX 5F2LA 5HPCA 1NDYA 2VFHA 3TTEA 4GE8A 3TXVA 5CC7A 1TPEA 4QCEA 3DH7A 5IDZA 3M16A 3VO0A 1YXDA 4KWSA 1RJPA 1UPPA 1KTBA 3LM7A 1QU4A 1X8FA 4W9TA 2Q01A 3C0QA 4KT2A 4Q8QA 4NI3A 4M24A 3UYIA 1K02A 3T0TA 1A49A 4D1JA 1UR8A 1O68A 1PJ9A 1V77A 4QQ3A 2J13A 3PZQA 4O50A 5FJJA 3QC3A 1NELA 3RRAA 3AAMA 3DCPA 2PRLA 1NVMA 1D7FA 3GIYA 4L6OA 1UD2A 2YGYA 4Z2JA 4K39A 3JVAA 2P3EA 2OLAA 2BB0A 4L4LA 1KC7A 1EP3A 3RCMA 5I7GA 4HA0A 2V67A 4ILSA 4NAFA 1VD6A 1O7AA 1V6XA 2OT1A 1QW9A 1R2TA 4DI8A 1B3YA 2YDSA 5DF0A 3TYBA 3DYMA 2VURA 1KBJA 3L7RA 4FXRA 2EPOA 2DW7A 3TV8A 4A6GA 3QR1A 1VH7A 3IJ8A 1QNRA 4O10A 2DZVA 1W54A 3HG4A 4IZGA 4TMCA 2PURA 4HP5A 4GUGA 4QE4A 3MUAA 2CLOA 4JL2A 1FBAA 2HMCA 4H00A 3RX3A 7A3HA 2V5JA 4GI8A 3GVVA 2WCSA 4LBSA 1KXTA 3R5EA 4CVUA 3DFHA 4RNIA 1HVQA 1BF6A 1WUFA 5FF4A 3L0NA 3MUIA 1X1NA 4X2PA 1H7WA 3FJ6A 5B7YA 3RITA 3AZTA 1EPXA 4JCLA 4D8AA 3EA1A 1EJSC 3SRDA 5HR6A 4QDWA 3B04A 4AMAA 3UWQA 3VNKA 3VXGA 3OZYA 1ZHAA 2OYKA 4PC8A 2ZZ4A 1YLVA 4MLJA 3WNMA 3EB4A 5F7UA 4NP7A 4Y8EA 3ARWA 5FI8A 2NUXA 3AMDA 2BY0A 3ANUA 5EB8A 4PMOA 2NQHA 3TP4A 4I5UA 2XUCA 3AXHA 1EJXC 1PTGA 4JS3A 3N15A 3UG3A 1J0IA 1TWWA 5I24A 2NX1A 3MO7A 3FHAA 3W25A 4ATDA 3SRFA 4WK9A 5F2IA 4AMCA 3ZWSA 2PDQA 1TWIA 3T4WA 3VOFA 2UY5A 3KE0A 3PUGA 1NDVA 3AIRA 1GKPA 1JZ5A 4LYRA 5HQLA 3V75A 1XLEA 3DYOA 4B5WA 5I0DA 1Y8BA 1JCMP 5D38A 3B0PA 3FDGA 4PFMA 3OQ8A 4HU4A 1ZP4A 5AKQA 2J6XA 4X3ZA 2X16A 4RDVA 3SO7A 3G22A 4GI6A 3KOFA 2NW0A 4CN6A 2IMRA 3UQNA 4XO7A 2GVLA 3S5ZA 5L9FA 1AL7A 1C9DA 1CB7B 4X2RA 1TA3A 4JTRA 4A8LA 1OX5A 4D6FA 5ECVA 3F4DA 4OKDA 1G7UA 3D5HA 3PSWA 4JTHA 1GKQA 4XTIA 2G3JA 5HWMA 4ZO8A 3TJIA 3WL0A 3KL0A 3NL5A 3F5KA 1OK4A 1REQB 4AD4A 3HQOA 4PTDA 4J2MA 2GDQA 3UG8A 3PG9A 4KBXA 2XH4A 2PE4A 3NEHA 3TR2A 4FNRA 2V38A 3A4XA 5I3IA 4XKYB 3B8TA 5C70A 5K9XA 2AL1A 4Q7NA 5BNKA 1WDQA 4AHOA 3TLQA 2PU1A 5LHFA 1RVKA 3ARRA 2E5CA 1JUKA 4JDYA 4LQ1A 1JPIA 1BYCA 3FYOA 5I3JA 4B90A 1KKRA 1OFRA 4CGTA 3GS6A 3N9SA 1F4HA 1EJTC 4AZCB 1M03A 1Q2SA 4K68A 2O7QA 1X1ZA 1T8QA 4ADUA 2ZZ5A 5CSUA 1F6KA 1JDCA 3NWRA 3EX2A 4EIVA 4IFKA 3AO0A 4OWGA 3UG5A 4IPLA 3NO5A 4V2XA 2FKPA 1EBHA 3VGEA 3IIOA 3WJWA 4FXSA 3T2QA 4C1NB 3R0KA 1IEXA 4KIEA 1EOMA 3CQHA 1CBGA 3O6DA 4DZAA 1UJPA 1B3XA 4WIWA 3ZJ7A 4WKFA 2QAFA 5F4XA 2NV1A 2VQTA 1CXIA 4H7CA 3KBVA 1O1HA 4Q3MA 3WMLA 3UWZA 4CU7A 2FHFA 4I8YA 1V02E 2DFAA 5CPSA 4Z2GA 1F61A 1O12A 5LIUX 3NVTA 1LLWA 1ZQ5A 4UCGA 3CV7A 4H19A 1VP5A 1US0A 3H2AA 1IV8A 3I3DA 4HMNA 4UNLA 3HO8A 5HQMA 2HQAA 3DZ1A 1TUFA 1ZUAX 1Q5MA 1LL7A 3BW4A 1PZ3A 1VFLA 4A29A 3EX4A 2OSWA 3VKJA 4PRWA 2NX9A 5A2AA 4GI4A 4C6NA 4E8CA 4C6LA 2E7FA 1JDEA 5EL1A 3UXIA 2FMNA 3KRUA 2DVUA 3WMCA 2PDXA 1DXIA 3R43A 1BGAA 1OZMA 4OGZA 2EG8A 6REQA 3RUBL 1E9ZB 3WFAA 3WH8A 4M19A 4O1BA 2QMJA 3DBNA 3QY7A 3BTNA 2QDHA 4WKHA 1SMAA 3PK7A 4RDWA 2W6RA 4HVXA 2XIJA 2CITA 4LRTA 1J12A 4DAIA 2OSYA 4ATWA 3KCOA 5AYYA 3SGZA 4L1WA 1PTAA 3LRKA 4AZBA 1W1B1 1YX1A 4DBWA 4WEVX 1OSEA 2ZE0A 4RUBA 3S6DA 2YL8A 2WSQA 3B9AA 2WVTA 2OWWA 2AL2A 4J35A 4GYPC 2CWNA 3MA8A 3EWXA 4ONVA 5BXPA 2IS7A 3OGRA 1GEHA 3ABSA 4JEJA 1LYXA 2E4TA 4Q22A 3GFZA 2OWCA 2NSXA 5FL0A 1Q6GA 1VYRA 2AAAA 1VENA 1P5BA 1ZALA 5E9XA 3FS2A 3N34A 1XD0A 3ZVHB 2ZXDA 1JDFA 2E09A 4G1NA 1GQIA 1SFTA 1V3KA 4A2RA 3ARTA 3PUEA 2D20A 4AXNA 4AVFA 2HS8A 3G0XA 3CHEA 3CQIA 1P4CA 3Q4DA 2VYOA 4KESA 4LS0A 2FPTA 1BKSA 3BH4A 4B4FA 5AYBA 5LA1A 4WR3A 3T55A 1LUCA 4PMVA 4J3SA 2DZXA 3HQPA 4M0XA 2CKRA 3RF9A 5I3FA 1NDZA 3VIPA 2WV8A 2PDHA 4S1FA 4TXEA 4UQ9A 2VNCA 4M6UA 4MNJA 2PI6A 3GXFA 1OF6A 2O4QA 4L64A 3OGSA 2YA2A 4XAFA 3KWXA 4US5D 2V2HA 1XDLA 1YE4A 1ZP3A 4FNQA 4CD6A 4HYRA 3T2OA 3QPZA 1PYMA 3HGSA 1V3IA 1V0LA 3SIMA 5DCDA 3BQ6A 4R5EA 2J75A 4PGLA 5G1YA 4DNHA 3RIKA 3CTTA 1XLIA 3MKKA 4P8WA 3LCXA 1SW7A 1PZ1A 3ABXA 5HULA 2QVHA 4DBSA 3FFSA 1XPYA 4ZXOA 3M0KA 3PJTA 1S5MA 1AL8A 1B3ZA 4LV9A 2D2HA 5HMFA 3LXCA 2VVSA 1EEXA 1FWAC 2FGBA 3W72A 2C8NA 2V69A 1LLZA 1XBVA 3CAVA 4B92A 3S8HA 2FGZA 3IVTA 2CLMA 2ZFAA 1RCXB 1EC9A 3RMJA 2R82A 3QHNA 1AJ2A 1XYZA 3TQVA 4H9TA 5CPQA 1W56A 1OCJA 1BAGA 4DLFA 1VQTA 1OBAA 1PEZA 3VC5A 3TVAA 2A2IA 5HDRA 2QCFA 3DFSA 3ZO9A 3IARA 3RJXA 1MXDA 4NVTA 3VM5A 5MKGA 4BQ3A 1Z3NA 3O16A 2IUZA 1IR2A 1EWDA 3C2FA 2PMQA 1AK5A 3U2CA 8XIMA 1JI2A 1R3WA 2A3EA 4M51A 1HGYA 4UZSA 2QT3A 1WZAA 3TYUA 4AUBA 1D9EA 2XH2A 1E0UA 5FACA 3A21A 3L4WA 3KLKA 1FOBA 1K9EA 3IJ7A 2OEJA 3PJUA 3MQTA 4FX6M 7XIMA 4TIMA 1I1WA 1AQHA 1N8FA 2WJEA 3C52A 3LS9A 4FZIA 4RE4A 3T42A 4FK9A 3N2CA 3DBPA 3CT7A 2BDQA 5H91A 1JZ6A 3CK5A 2QCDB 2D2GA 3QR3A 1FWEC 3TCEA 4EANA 2OQHA 4U28A 2CLFA 4H9VA 1GORA 5HNRA 3N18A 4CD7A 1K4GA 4O8RA 4AB4A 3C61A 1I0DA 2UV8G 1Q7MA 3A3XA 1GVEA 3QZEA 1YNQA 4IWWA 3CPUA 3ZT5A 3FHQA 3GR4A 4QG6A 3F03K 1F2JA 1DWIM 3QN3A 4LC8A 2BHZA 4GJJA 1AFSA 5CZKA 4FXFA 1UWIA 3EPNA 3DI0A 1WXJA 1TELA 4IJCA 4GVFA 2A0NA 3VFLA 2V5CA 1UC5A 3FJNA 2FDMA 1XC6A 1TV8A 1RBAA 4Z0SA 2DT2A 3SCOA 1XR2A 4HN4A 4REQA 4E4UA 1HJQA 3UXLA 1MRQA 1OFEA 1BVNP 3W29A 2NV9A 3UESA 3BJTA 3O6CA 4X63A 4DPPA 3GZ3A 3ITVA 2CWXA 1RQBA 3NPWA 1KM6A 1FUYA 1B5TA 5B7ZA 1GVQA 3HFYA 1P7TA 3EX3A 2XFFA 2YBVA 1XG3A 4LAUA 1MSSA 3LZ5A 3W88A 1PHQA 3UU0A 4EX4A 2BSLA 1R3QA 3L12A 2MUCA 3BOXA 4R3UA 4YYCA 4A4AA 1HUVA 3B8WA 1O5XA 3UNDA 2F6KA 3LGGA 2OGJA 3N17A 4PMJA 4D6IA 3SBFA 1FP9A 1MEHA 3UETA 4GJ1A 3REQB 4RE0A 3HPAA 4FR1A 2CLPA 3K8KA 1V8EA 2ZC1A 1IXPA 4R7WA 4AF0B 3FEMA 4P5UA 1U1HA 1GVOA 1R9YA 1XYLA 5A8MA 1UA3A 4WLCA 2Y88A 2VDHA 4GHRA 3LQGA 2ZUTA 1W5MA 1N55A 4C90A 2EPNA 4F79A 3BW3A 2OEMA 1WZMA 3LTYA 3NDOA 4FNSA 3MSRA 3MMDA 3TQKA 5G5IA 4NASA 5K9CA 4ZXLA 3UT0A 3VFCA 4Y2WA 4H9XA 3EXRA 3V1HA 2X42A 2CBVA 2J8TA 4GXWA 2XGZA 2QHAA 5E0FA 4O53A 4WSJA 5CPOA 3A24A 4QISA 2Y8UA 4L1GA 2X1TA 3EAUA 4C65A 2FB2A 1A5OC 3BMXA 5C71A 1E6QM 1L6GA 3R8HA 3TONA 6PTDA 2FVMA 4W85A 4B3KA 1DVJA 3W87A 3AU6A 2R8WA 1ZY9A 3CAQA 4C6KA 4F2BA 1FDZA 3BAJA 1BWLA 1LG1A 5AHMA 3PN8A 3V35A 2WW5A 3CMJA 4BY3A 6ALDA 1XKYA 1UQZA 3CTLA 1QJWA 1V51A 2RDUA 4WJEA 3VIKA 2XG9A 1A5LC 1TTPA 5C9WA 1TUXA 4PCTA 1FCQA 2F2HA 3IGUA 5BU6A 2VEMA 4AIUA 1O5QA 1GYMA 1VJSA 1MO0A 2V81A 3P6LA 1PCWA 4DEFA 2WMGA 1UR2A 4TVCA 3WMBA 1UCWA 4EWND 3VUPA 2GWGA 1KGUA 3LQLA 5LNWA 1M04A 4XK2A 2FPVA 4FSAA 1H4PA 1PKLA 4U2ZA 3FK4A 2VDIA 4KWUA 3VC6A 3MMTA 1UG6A 2I16A 4AG0A 2JKPA 1I45A 1PYFA 4DI9A 2FH6A 2NVCA 2GUBA 3ZQ9A 3G3DA 4ZCWA 5C2XA 4CQ8A 3OZOA 1NFGA 3MVTA 5D05A 1HNYA 2J6VA 1OADA 3IUHA 2OZ8A 4LEFA 1B9ZA 1I2RA 3PBYA 2VC5A 3APGA 5D04C 3N25A 4TMBA 3CS2A 5PTDA 4JTEA 3O7UA 3P82A 2ADAA 4MMWA 4AIOA 1IGSA 3B0YA 2WLYA 3PZ9A 1MXGA 2CW6A 3SCWA 1T0OA 4XBJA 2YW4A 3C2YA 4KQNA 4JIIX 3UF9A 2QIWA 4QJ4B 3FY1A 5HATA 4O1AA 3G2GA 5ABTA 1K3UA 4M6PA 4EXQA 2YCLA 1IWAA 3W7LA 3OBEA 3HB9A 4GWEA 5BMXA 3NO3A 3QKZA 1PUDA 1KM2A 1F4AA 2J7CA 2OQYA 4ZL1A 1H7XA 3DECA 3HIJA 3TROA 3PBUA 3GYCA 4U5IA 4GNJA 4J3UA 2QGHA 2BS9A 1LCOA 3IGXA 1RP9A 4A8RA 3HG3A 1W9PA 3OOQA 3NQ2A 4IQEA 1I4NA 4V28A 3A64A 1ZJIA 4PRRA 1Q6RA 2EO7A 4MLRA 1BYAA 3GTIA 3W2MA 5CSRA 5FJIA 4PSPA 3NQDA 1CECA 5AHFA 3DN5A 3APTA 3N1AA 1HKVA 4RXFA 4QS5A 4GH3A 1H11A 2YL9A 2WBKA 4AD0A 4ZO7A 2HE8A 2X09A 3W7HA 5I00A 2PTYA 1KCZA 3L68A 3MUY1 1EEPA 1JIBA 3NQ6A 4LALA 3BSMA 3F2CA 4XZBA 2FZMA 3GAKA 5EMMA 2PDIA 4B15A 1G4EA 1UR1A 1US3A 1P6BA 2WKLA 5CKSA 2ATSA 5FJTA 1XBYA 3WEMA 1A5NC 3EOLA 2DVXA 4N0RA 3UVIA 1DQWA 4MWAB 4EPDC 4IHCA 5AECA 1CENA 3OLDA 1U5VA 3AWOA 3WQPA 4ZR8A 3CGTA 5A8OA 2POZA 3G6MA 1BQCA 2FB3A 3VD4A 3Q58A 2CZDA 1OVDA 5I78A 4LSBA 3WQ6A 3ITLA 4GD0A 1AQ0A 3OO2A 1QR7A 4CD5A 2VQUA 2VD8A 1HKKA 1U1JA 2CIPA 4AW7A 1UWUA 4JTSA 1N82A 2GSEA 5DCBA 4ZENA 1XP3A 5D8ZA 1HJXA 2XWDA 1R9ZA 1WXYA 5HNUA 1GTEA 1T41A 2PEVA 2O9TA 1PHWA 1UH4A 4IPNB 2QJIA 2PDCA 1NAL1 3I7SA 7TAAA 2Q6ZA 1KBIA 2NT1A 3PWGA 2E9MA 2QZRA 4YL2A 1EHAA 1Y0EA 4JTQA 4J3TA 4NG3A 3URNA 4ZSUA 1K7EA 3E2SA 1XIJA 1K8ZA 3PFMA 1ONWA 1BSLA 5AHIA 4S3JA 4H8HA 3A4WA 3OLGA 2WNQA 4Q8NA 4GPNA 3TJ4A 4S3BA 1A5KC 1ZTVA 4DM2A 3FKKA 1W9UA 2YCEA 4D6EA 1XSJA 1AODA 2BZNA 2D3LA 1XGDA 3T8LA 1QOQA 3T0BA 4JKMA 3M9YA 3E02A 4IPIA 3TU9A 3URAA 1XJBA 3TMQA 3FYYA 3BLDA 3UGRA 4WSHA 2PD5A 4OHQA 1OM0A 4W8BA 3UNTA 1TYGA 1Q85A 2H90A 2KZHA 4QLKA 1M3UA 2VEFA 4FNUA 1QNSA 3VZYA 5AHEA 2ISVA 2HPMA 4RXGA 3KBMA 2BP1A 3S9YA 4QR6A 4X61A 4XD3A 2YA0A 4JX4A 4M5PA 3E96A 6ENLA 3UPBA 5HJLA 3T8QA 1TVNA 1X6NA 1OX6A 3Q67A 4Q8TA 3SCSA 4Z17A 1IZCA 4Z2HA 3ELFA 3KRZA 1HKWA 3HQNA 4HNVA 1VYSX 1ENUA 1EFZA 5HOSA 4IMDA 1GT8A 4MYAA 1F74A 3S9ZA 5K4ZA 2P0OA 1ZCOA 1S5VA 2VEIA 3W7JA 1SJBA 1RPXA 3MZNA 1KFKA 1ICPA 4C6DA 2GJXB 2J66A 3D3FA 1TZZA 5CGTA 1TE1A 3EYPA 3GH7A 3H26A 1HO1A 1N2VA 1MRAA 2Y5JA 3ZM8A 1N8WA 3GX9A 3A13A 4GC3A 3MHGA 3PB0A 1WYIA 1REQA 3C6CA 1A5BA 2PODA 4JFSA 4DF1A 5CZ0A 1EJ7L 4I7VA 3VDBA 3ARPA 1FCUA 3LHVA 2Q8XA 4POCA 4U2YA 2VR2A 4IIHA 4JYEA 2GDVA 3W7IA 1E71M 2A7RA 4JFTA 1W91A 5GNYA 4MB3A 1W1A1 2CZVA 1KLYA 3CV6A 5FAJA 4IQJA 3GR7A 3OEXA 1EIXA 1U33A 3KFTA 1KCXA 3GVRA 4PODA 3VIHA 1KB3A 3GUWA 3PNZA 4AZCA 3MV01 2J7EA 3WZ0E 2VMFA 1BWKA 1LBMA 4PE8A 3A9BA 3GC5A 1UZ4A 1DIOA 4LYKA 1RVGA 1YHTA 2PU0A 5AYXA 1SW3A 2XSAA 4P2VA 1UH3A 4IJRA 2XTKA 4GZJA 3N11A 4JAWA 2VEKA 1W1IE 4R34A 4H8VA 3RXZA 3UXKA 1Q4NX 4BJHA 4QX4A 4GIRA 4UTTA 4N9CA 2Z6JA 2OPJA 4C1NA 3KHDA 3U48A 3LUTA 4LU0A 2XVPA 3NCOA 2HXTA 1TPDA 4AD5A 5DLCA 3R25A 3UVAA 5SWUA 3M5ZA 4A8NA 2RAGA 5CH9A 4KF1A 4FLRA 1YDNA 4ZVJA 4CVWA 2HSAA 2O92A 4L6DA 3W0KA 1GQJA 2HNHA 1YIXA 3H4XA 3RILA 2ZVIA 4OE7A 4BI5A 4NJKA 4QJ5B 2XIBA 2RDWA 4LVDA 3W70A 3T44A 1OZQA 2VUYA 3MB9A 1PZ2A 4Y8FA 4PB3A 2E25A 1TMLA 4YJ5A 4IPPA 5H1WA 2PBGA 3BCDA 1DPMA 3NQVA 1L8NA 1UIOA 1WDWA 2YDAA 4ECLA 3TNBA 1ZLPA 5BRQA 4IIEA 3KLLA 5J5RA 1PPIA 2DIJA 1XV8A 1I1XA 4NHVA 3MC5A 3CZLA 3FCPA 4LT9A 1YRRA 2ZUMA 5A8QA 4ZSTA 2E1WA 2E3ZA 2OFJA 1PDZA 3IJLA 4JKLA 3TAKA 2DIEA 5AZ1A 3EKGA 4GQGA 1J8VA 1H7PA 3UG4A 4E3VA 2J24A 1BG4A 5GNZA 4B2DA 1OGSA 3WSUA 1XLCA 3R11A 3GC4A 3LI1A 3M6DA 3G1AA 5D8WA 4Q4KA 3PANA 2WQDA 3DGBA 4X9YA 1RA5A 4S3EA 3V4BA 3NYZA 4XD5A 2J9XA 1D7KA 4FNTA 3GG8A 3NPUA 4NZ1A 1O5RA 3WF1A 4L6HA 3LNMA 3S1UA 5IFPA 2CETA 4PUKA 2X7VA 3D6NA 5KZEA 3GWQA 3C4UA 5H6HA 1TVLA 3CM4A 4AYGA 1D8CA 1W37A 5G2HA 3BGGA 2AGKA 2BTMA 4DN1A 1EJRC 3ZVHA 3G24A 1GVYA 3H7VA 1XYBA 1DXFA 1RY8A 2ZX5A 5AHNA 4DZ5A 4NNBA 2I5IA 3PAOA 2IPWA 2ATMA 4UFLA 1L2UA 2BGQA 3I6EA 1MZHA 2UWFA 1W3KA 4XTDA 3QGAC 4ZOAA 1VS1A 1TIMA 4CCZA 4CD4A 2I5GA 5JUVA 4S3DA 5FJUA 3MDWA 1CXLA 2D24A 3RM4A 5E0CA 4KCTA 2NQ9A 1P0BA 2WVVB 1YADA 1UC4A 2VX4A 4B5TA 3XISA 3S3GA 3TYDA 3RLGA 3AMKA 1IT7A 4WY0B 5FEPA 2C1IA 3VIMA 2QPXA 3HPZA 3FN9A 3LHZA 4Y6GA 5I79A 4FALA 1GQLA 3MS8A 3GFXA 2Z0IA 2DV0A 2X40A 3PG8A 4DJFC 2NQLA 1H7NA 2OVLA 2FDSA 2XH0A 4P8VA 3EGJA 2NQ5A 4FR6A 5CCZA 1OK6A 5DFAA 1P43A 4CUCA 4JR5A 4JOMA 4CCEA 3VK5A 1QI2A 1RY0A 2CPUA 1V4YA 2YLAA 4I8DA 2WM0A 5D9OA 1EUAA 2B7NA 1PX3A 3L4ZA 1NP0A 1VIZA 1XUZA 2HXUA 1JI1A 3M7SA 1DWFM 2GLKA 3W9ZA 2XM1A 4PN2A 1KRMA 1SZEA 1D3HA 3AMLA 2OYLA 4M80A 3CEPA 3N2BA 5KSWA 3WLHA 1E4IA 1JZ8A 1I0BA 4HA1A 3MYOA 3NQ7A 1QHPA 2QR6A 2WHJA 1O66A 3U2OA 2CHRA 1FKWA 3VNLA 3LHYA 3NXFA 1UUOA 4GGBA 3DYPA 1TJ0A 1XRVA 1E4NA 2DZWA 4GI9A 2H6RA 1UZ1A 1ITQA 1RD5A 1SU5A 4LBUA 2PRMA 4IMEA 1WDSA 3CHVA 3U2EA 3SUTA 3KDOA 4PUNA 1LBFA 3QHOA 1CLVA 1GZ1A 1E55A 1Q6LA 3G1DA 3DGRA 2VWTA 2JK2A 3OW1A 3B8VA 1YDVA 3EB2A 3WK1A 2X0YA 1HVXA 4NAFB 4DLMA 5KZ6A 3FVMA 3W7CA 1Z69A 3UA4A 1TPUA 2DZUA 4C6JA 1K9FA 4GX8A 1EUNA 1S5NA 3FOKA 5HUOA 4C5YA 3OVPA 3ARUA 3L0KA 2Z27A