1W3IA

Sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYYYPRMSEKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title The structural basis for substrate promiscuity in 2-keto-3-deoxygluconate aldolase from the Entner-Doudoroff pathway in Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Aldolase
total genus 113
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2004-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w3iA00
3W88A 1G4TA 2AGKA 5BMWA 3QSRA 1QMLA 5AC8A 3W2NA 3SJ3A 1H7PA 5I3GA 3QC3A 1KM0A 4LS1A 1H5YA 3EX4A 5CZJA 3STCA 3NM3A 1VYPX 2Y63A 3BPWA 5HULA 2G95A 5C5YA 2A6LA 3LHZA 1L9WA 1F6PA 3PG9A 4EWND 2WNQA 4O4WA 1VCGA 4HKPA 2V81A 5DXYA 4E2BA 4ORIA 2VEKA 3O06A 4Y6GA 3GXTA 1TJPA 5A8GA 1DL3A 4DO6A 5G4WA 2ALDA 2I9EA 5EPDA 4MLJA 2GUUA 2TYSA 2W6RA 1VZWA 1HUVA 3UXDA 1IXPA 3CIXA 1DJQA 1HO1A 1TQJA 3I68A 5G1YA 4ZMGA 3GB6A 5KZMA 4ORMA 3LRKA 1LOQA 2P0OA 1I2OA 2ZYFA 1GOXA 1OFPA 4D2JA 5E1QA 1O95A 5AOUA 1N8FA 3NM1A 4IXXA 1B57A 4ZVJA 4M6PA 4NVTA 2ZZ3A 1VCFA 3W86A 3S1VA 2QKFA 1F7BA 2OX1A 4TR9A 3QPZA 4HPXA 1GWJA 4FNSA 1YADA 5C6MA 3KVJA 2VOMA 1DQWA 3FYPA 1FWWA 5AC6A 3YPIA 3QFEA 1LLZA 1I8JA 3G3MA 4WJEA 4LRTA 1Z44A 3S1WA 1PCKA 2QCEA 1O60A 4DELA 3CLMA 4NU7A 3WK2A 2V5BA 4TIMA 1H51A 3ABRA 3AO0A 5LGXA 2ZQ0A 3DXIA 4R34A 4LWWA 4UMAA 3W2KA 5CPNA 3O6CA 5HMSA 1XDMA 2GVLA 4JEQA 3HGSA 4GNJA 2NUXA 1EP2A 4ALDA 1TTPA 1SO3A 4QISA 3GNDA 3L68A 3P74A 1Z42A 1KW1A 4A21A 2V2DA 1JUEA 5LNVA 3BG5A 1J4EA 3RFAA 2I1OA 3N34A 4GBUA 1LP6A 1FBAA 1G7UA 4HHPA 4NJJA 1PS9A 3NOEA 2Y7FA 4JR5A 3IGUA 3FIGA 2FPYA 3STGA 4EOUA 4LT9A 1GG1A 1TO3A 3DKJA 3H55A 1DVJA 2QAPA 2Q3RA 3PUEA 2ABAA 2QCCA 3NPWA 4JTIA 4JTGA 1H60A 2DZUA 3P61A 4UTHA 2E77A 2ZRWA 1O4UA 2EAWA 3U6WA 2C19A 4HNUA 1FY6A 1OX5A 2P10A 2GVJA 2ZA1A 1FDYA 2A2IA 3R8RA 5D09A 4LTSA 1FWSA 4HNVA 1QPNA 1XBVA 4DO4A 2NV1A 4X22A 2B7PA 3W2UA 5DXXA 3EKZA 1VCVA 5DCDA 3RF9A 4L4MA 1BWLA 1RVGA 4BI6A 3JRKA 3EX1A 2BZNA 1KTCA 2YZRA 3LLDA 2X1TA 2E68A 2G97A 1TPB1 3M16A 2HTMA 2C1HA 5D37A 5CSRA 2CZEA 2FJKA 3G22A 2YX0A 1KM1A 4LY8A 2NXIA 3S5YA 3W1QA 4AF0B 8TIMA 1W5PA 3F4WA 3NR0A 4ADUA 3G18A 3DHDA 1S5WA 2RDTA 3PB0A 3VCRA 1W5OA 1D3GA 3T40A 2DZVA 3NQFA 5HWNA 3ELFA 4H3DA 3STFA 1KA9F 3OVRA 4U4MA 5LNRA 1IXOA 1FCUA 4O14A 4WY0B 2HS6A 2QUVA 2E09A 3HGOA 3A22A 3ANYA 2VFEA 4UTTC 2CU0A 4NJKA 2V9DA 3L5MA 2NWSA 3MBDA 5FF2A 4AWSA 4P61A 3UQNA 3W7DA 4JX5A 4UTTA 2YW4A 4I9AA 2C13A 4XQ6A 4XZ9A 4FNPA 4FNRA 3TJXA 1FDZA 3P84A 4IMEA 4WZHA 2VFHA 3SSJA 5AHEA 4JYFA 4LVFA 3LDVA 1GT8A 3UY7A 4LOCA 1NEYA 4OWGA 4O18A 3LRLA 3TU9A 4U28A 2XN0A 1Q6LA 3PWAA 4NJGA 5D33A 3QPYA 2YYTA 1XCFA 3R12A 1TREA 2E1DA 3C2VA 4ZQOA 2NX1A 3SR7A 1OF6A 4EF8A 4CNOA 1PHWA 3O6DA 1EP1A 1U83A 1WX0A 4MLRA 3STEA 1ONRA 1R46A 1QO5A 2JGYA 1VYRA 4JY8A 3W2JA 3SZ8A 3TFCA 3CU2A 4PC8A 3CEUA 3PVFA 3DAQA 4UTUA 4BI5A 4H6KA 1D3HA 4O13A 4Y8FA 3IGXA 2ZZ7A 2OT1A 1TPVA 5CGQA 3UWQA 4BF9A 3DI1A 3G1HA 1K8ZA 3PM6A 4O54A 3RMJA 3OBKA 3N9SA 1Q45A 3UY8A 1QNVA 5KZEA 2NLIA 4YMZA 1JCXA 2WSQA 3W1PA 1TV7A 4AXKA 3R89A 4IPJA 5A5WA 4DPPA 4QNEA 3W1NA 3TV8A 4BR1A 3ZS4A 1ZJIA 2Z1BA 3OIXA 3S0CA 4UTWC 3RLUA 3P62A 3PC0A 2CLMA 4NNAA 2W0UA 1C29A 2ZRXA 2NX9A 2C18A 3QQ0A 6TIMA 4BK9A 4Y9AA 1J5TA 2RKXA 1DBTA 4AMAA 3G0UA 3SIZA 1FDJA 1H7NA 4JIPA 3SFKA 5AC7A 3O15A 2F7FA 4O0ZA 4RZ6A 2Y7EA 1LYXA 3SGZA 1SZFA 4MY9A 1WBHA 3MI3A 2VEIA 3G0XA 4N4PA 2J88A 2Q8ZA 4GFSA 2A6NA 2EKCA 3N2XA 5CPMA 1TPDA 2FPVA 1XBXA 3EWZA 5SWUA 2ZZ5A 2AAMA 4UFIA 4QQ3A 5CPLA 4IWWA 3I65A 3C56A 1K7XA 1VRDA 2Y70A 5BNKA 1R2TA 3WJXA 4GUFA 5FF7A 3W2MA 5IBXC 3E02A 1XXXA 1VJIA 1QOPA 4MJZA 4KFPA 1C8VA 2Z2UA 3G0SA 4ONVA 4P2VA 3W1TA 1MEHA 3BARA 2LLEA 2WQPA 2WV8A 1S5TA 1TPUA 3TSDA 4O10A 1GTHA 4OQVA 3UPWA 3LHTA 1TV8A 3B05A 3FS2A 4Z08A 2E6AA 2Z6IA 4Z1AA 1S3HA 1K02A 3TAKA 1PVNA 1A5BA 3NDOA 5D05A 4O19A 1I45A 1HL2A 1LRNA 2VENA 3NL2A 3NQCA 4UTIA 3QYQA 5AYZA 4CCDA 3C8FA 5HR6A 2X1SA 3TQ0A 4UIOA 3Q58A 4MZYA 3NO5A 4AB4A 5K9CA 3HOJA 5LSMA 4RLIA 1RR2A 4O8RA 4W9TA 4YL2A 3PB2A 3IVUA 4H4IA 4UTKA 2RH9A 3UWYA 3KVKA 4DO5A 2E6FA 1JCLA 2A7RA 5DCBA 2V5LA 1WA3A 1LORA 1LM1A 4JGDA 4LV9A 1UB3A 1LDCA 3DFSA 3U8GA 5HINA 1KLYA 3A9IA 4AWUA 5AYXA 2J6XA 2H8XA 2PC4A 5J5DA 3GX9A 1W56A 2YFOA 2OJPA 3I6RA 3C3NA 5HUPA 4FNUA 3P67A 5EY5A 4FNTA 4XUGA 1KM2A 3QRHA 5K2ZA 1O5KA 1SO6A 2JK2A 4UMCA 5F2LA 2QCNA 3S5NA 5D30A 1QCWA 3NQ7A 3W7HA 3CIWA 5HR7A 3MP3A 4UR8A 4RKAA 5I3JA 3NQ6A 1GG0A 1MEWA 1P5BA 5LKYA 3W7MA 3PULA 1GVRA 1RD5A 1HFBA 1A5SA 1ICPA 1TJRA 1N55A 3O07A 4GUGA 3C4UA 2JBMA 4LV4A 4IX0A 2A4AA 1R2RA 3TXZA 7TIMA 3L0GA 3L5LA 1PCWA 1GVSA 1VC4A 2P1FA 4E38A 4RCXA 2Y6ZA 4M5PA 4O28A 1LBFA 4A29A 2CLEA 3MP4A 2B7QA 4UXDA 1H1ZA 3W7CA 1JRCA 4X9SA 2H3BA 3C52A 3THQA 4O11A 3B03A 4GWEA 1YTEA 5DLCA 1O94A 4FX7A 3LXBA 1JULA 2A21A 3M43A 1DORA 2Z6JA 3CM4A 3N14A 5CPOA 1GVQA 4GE8A 5DBTA 3B0VC 3VFLA 3Q2DA 2YYUA 4FNQA 1H7OA 1FXQA 2BXVA 3L67A 3ATZA 3GDLA 3C61A 1KTNA 4TU1A 2FPTA 5G2IA 3LCGA 1KLZA 1SW7A 4ADSA 4I7UA 4O1CA 4LU0A 1VR6A 1JJKA 5AHFA 4UTMA 1KM4A 3N73A 1EB3A 5DELA 3G1YA 1XBZA 2FQIA 3B04A 1GYNA 4M7SA 5KTLA 3W7JA 3OHIA 4O1DA 3DZ1A 1DQXA 2VEPA 4OBTA 3L0NA 3F4NA 4UUIA 2V0TA 3FEMA 4IGHA 2GVGA 2FTPA 1VH7A 3PBVA 2H90A 3M41A 4O17A 4ML9A 1DKWA 4TMBA 1T0OA 1ML1A 3P5YA 4WXYA 2J9YA 3UNDA 5K3VA 4NQ1A 4XBKA 3I7QA 1KFKA 1TQXA 1ZCOA 4C1LA 2YCEA 4QSHA 1OK6A 3V75A 1VPXA 3W7GA 5EBUA 1ZY9A 5FESA 3HG4A 3IIZA 3P81A 3UWVA 4JTTA 1LCOA 3GLCA 3CEPA 2FB3A 4Z0JA 1YDVA 2Y85A 1VS1A 1AG1O 4S2CA 4NUWA 3LHUA 1PIIA 2E5DA 4QM1A 2TRSA 2J9ZA 4AHOA 4CLMA 1ME9A 1W31A 1PL9A 2V8ZA 1UASA 1TPFA 1TSIA 2QCHA 4AH7A 4AF0A 2CZ5A 1EWEA 4DBDA 3TKFA 5BRBA 2VC6A 1X8FA 3TH6A 4PCFA 3S5ZA 3T44A 3W7RA 5L9FA 4WOZA 3TMQA 2D73A 3NQDA 4NXSA 3L5AA 3LBMA 1JR1A 3O6YX 1LZOA 3TIMA 1W0MA 2DU2A 4WY0A 1Q6RA 1TPEA 4B5NA 4UC5A 2IQTA 1ZFJA 4EVZA 2DJLA 3NPVA 1IIHA 3KFTA 1K03A 4CCEA 3E96A 3QMRA 3WK1A 5EMUA 4N4QA 3QMTA 2EHHA 2VFFA 3W2LA 3GNNA 1A50A 3O1NA 3EWUA 3G1FA 2DP3A 3WK0A 1KFEA 4DXVA 4A3UA 5AYYA 1AW1A 3I7RA 3FFSA 2B7OA 1B9BA 5H91A 1XL9A 2A5HA 4UFKA 3PUDA 5K9XA 2V2HA 3VE7A 3W9ZA 1EEPA 3E12A 5AHNA 3KHJA 4MZ8A 3OA3A 3W72A 1W37A 1NVMA 3TFXA 3W1AA 4XBSA 4Z1BA 1TTQA 3OEXA 4NXKA 3GZ3A 1OK4A 3HG5A 3EX6A 3I7SA 1C9DA 4ZZ9A 5IM51 1OYCA 1GJPA 1KFJA 1HO4A 3NPXA 4K37A 2H8ZA 1THFD 1W54A 1GTEA 3QMSA 1ICQA 1OX6A 2QF7A 3SW6A 1P4CA 4LC6A 1GPWA 3KRSA 4O1AA 5U7SA 4HPJA 3D0CA 2YXGA 3M44A 3L65A 1SU5A 3PS7A 5DY2A 1VHCA 4DEFA 1SZEA 3G1VA 3MW7A 2VFGA 2PRHA 4KKXA 2NX3A 1X6UA 3W7QA 1WOAA 5EKYA 4S2BA 4GUJA 4O12A 5FF0A 4JICA 1K7EA 2HSAA 2W79A 3W1LA 2R8WA 1VLIA 3LI1A 4PEKA 3SI9A 3TE9A 3T4CA 5BW6A 2RDWA 3HPXA 5ABTA 3P80A 1G4PA 2R94A 3TQVA 5E0KA 3A21A 4RX0A 1KFBA 1PHQA 1N7KA 4IUOA 1L6SA 3GDMA 3KVMA 1R2SA 3P7YA 3W71A 3BG3A 1ME8A 1SPQA 3N9RA 2F84A 3DFTA 3MYOA 1L6WA 2WNZA 2A85A 2BX7A 3GK0A 2BLEA 2PE4A 3W7OA 4FIQA 2ZDRA 4ZQPA 4WUIA 2DZXA 2Y62A 4EF9A 5BOOA 5FEWA 4AVFA 2UV8G 1F5ZA 3EWXA 3WJWA 2C14A 4NX5A 4QIUA 3UWZA 1MXSA 1ZNNA 4O15A 1EUNA 3W7IA 2H3DA 3NQ8A 4O1BA 1H62A 2JKEA 3NYZA 5D2VA 1YXCA 2GQ9A 4MPQA 1Z41A 2EF9A 1FCQA 5L6UA 3CHVA 1JVNA 4Q4KA 4XTIA 3NPUA 2QEZA 3W87A 2WKJA 3W1MA 2QAFA 5HJLA 1X1OA 2R14A 1JCMP 3IV3A 2WPBA 3G1SA 4GUHA 4OU1A 1P1XA 1XFBA 1RQHA 1TTJA 3FKRA 4FHAA 4MJMA 3M5XA 1VHNA 3SY5A 5AHIA 2ISSA 2E6DA 1F76A 3LCFA 1WYIA 3G1DA 1A5CA 2QUUA 4FO4A 3NG3A 3VI2A 3L21A 1TPH1 5CKSA 2ISWA 3LI0A 2YFNA 5KSWA 1ME7A 1OFDA 1OVDA 5F1UA 1JRBA 2DORA 3W22A 1P0NA 3M5VA 3P60A 4X2RA 4QITA 1B4EA 3IIOA 3HG3A 5KITA 1W3IA 1JQXA 1FQ0A 1V5XA 3NQGA 2QJHA 3GDTA 1FUYA 2EPHA 3TC6A 1WV2A 1OFEA 4IMGA 4AAJA 1HG3A 1SUXA 4MY1A 3ATYA 3KRZA 3V1PA 3G24A 4FXSA 5EYWA 2TMDA 1TB3A 4JX4A 3GXPA 2CLLA 1G4SA 1SW0A 3EWBX 3TNOA 2ZRVA 2QJGA 1LRTA 3MHUA 5K9DA 4XTDA 4JTHA 4EIVA 1IXQA 4DPQA 3GDKA 3RLVA 4N6FA 1Y0EA 2ZFAA 3NQMA 1IXNA 3MI6A 4UFMA 3S9YA 3EWYA 3BW4A 5LNUA 3E9AA 1SO5A 5FI8A 4L4LA 4UTWA 4JDBA 3IIPA 2YDAA 3S8HA 5FEXA 2DJXA 1U5JA 3QSTA 1V7YA 3W83A 2BTMA 2Z0IA 3B4UA 1VGAA 1G69A 2YGYA 2J9XA 3NL3A 1EPXA 4JNMA 1YDNA 2DZWA 3T7VA 3NL5A 2CFFA 1G4EA 3ABOA 3O16A 2GJNA 1MSSA 1OJXA 3C0JA 1UCWA 2PCQA 4O52A 4NZFA 2J27A 2EGZA 4JYDA 1ICSA 1QDSA 1EX5A 3NQAA 4IJBA 1BKSA 2QCMA 3DFQA 1KFLA 1H50A 4QNWA 1CX9A 3F03K 3L9CA 1BTMA 3GDRA 5F4SA 1WDWA 3R2GA 5FEZA 5D2XA 4FXRA 3TA6A 1MEIA 5IBXA 3DFNA 3NEVA 3QW4B 2VKZG 1FCBA 2B7NA 4YXGA 4UTJA 1H1YA 1W5MA 1YTKA 3NZ1A 3TCEA 3TJLA 4HNTA 1IGSA 3G8EA 4AHQA 3FJ6A 3IGSA 1ADOA 3EB2A 1TYGA 3G1AA 1QR7A 3OVPA 1OABA 4LVAA 2Y7GA 1M5WA 4N6EA 1DV7A 3LCIA 4LS0A 1QAPA 1M7OA 1TIMA 3VE9A 1EIXA 4OHQA 1OFQA 2A1YA 3LCXA 4YCPA 4UR7A 3HPZA 4LS2A 3HJZA 3EXSA 2YSWA 1TTIA 2ZA2A 3MHFA 3W3OA 1EA0A 3KX6A 4AHPA 1M6JA 3BLFA 3IVSA 5I3KA 3UZ5A 4YCOA 3KOFA 5U4NA 1R30A 3S5OA 3TK7A 3N19B 3C2FA 1KV8A 5D2WA 5FEPA 2TPSA 3DH7A 4JTSA 1FWNA 4LW7A 1W3NA 2JKPA 1VYSX 2QCFA 4LVBA 1OG0A 4HNNA 1W5QA 3R13A 5I3FA 3DBPA 4HSNA 4IXHA 3MI2A 2PRLA 4DF2A 1TPC1 1TRDA 1XC4A 3GVGA 4JTEA 3GXNA 4QJ1A 2O7QA 3CTLA 4M19A 5CZ0A 2HS8A 3IRDA 3LV6A 2GPTA 2YR1A 4JX6A 3DHFA 5E93A 4AEOA 1ZAHA 4N9EA 4JTFA 3USBA 3NGJA 2JKAA 5K7JA 4FEZA 5F4WA 5TQLA 1A5AA 4K8EA 1JUBA 3PY2A 3DFOA 3WFAA 1T8XA 4PFMA 1JCYA 1KM3A 4PL1A 3C2OA 3NA8A 3PF3A 4UTLA 2RFGA 5D2YA 3W6YA 4DF1A 2NXGA 5FF3A 3EXRA 4O16A 3HGJA 2ZTJA 3NQ2A 1WXJA 2XN1A 3LV5A 1TV5A 5K4XA 1SQ7A 3SECA 3HG2A 2ISVA 3LHYA 5AHLA 4JD4A 1MZHA 4FB7A 4MFDA 1J2WA 2WSYA 5HUOA 3CWOX 1KV5A 3TX9A 3BGJA 1H7WA 1CI1A 3TC7A 4XKYB 1JCNA 1YXYA 4UFJA 4RJEA 3LTPA 3UZJA 1QPRA 4ICNA 2GOUA 5G1TA 2HMCA 4HN4A 3BLEA 5LHFA 3WJSA 3WJZA 3B8DA 1A53A 2B0MA 4DQWA 1SFLA 5CSSA 1DOSA 2YPIA 3LRMA 4PH6A 3NL6A 3NVTA 1B3OA 1SR9A 4M6VA 3EWWA 3HBLA 3A5FA 4OT7A 5G2WA 3MO7A 4Z1CA 3LBCA 4NZJA 2ZRUA 4RXGA 3W7EA 2RDUA 3HO8A 3P5ZA 1NSJA 1YPFA 1SO4A 1YDOA 1FXPA 1FCVA 1NF7A 3QZEA 2QCGA 3DI0A 4PA8A 3ZR4A 1QWGA 1AK5A 3O63A 3LXCA 3LGEA 1YPIA 3LCLA 3MHGA 2CLHA 2QDGA 3MJYA 3A5VA 1OYBA 4FIRA 4A22A 1EWDA 3G8RA 4CQAA 4M7TA 3GIYA 1BWKA 3DKLA 2C3ZA 1F6KA 2GJLA 3LCHA 3LX9A 3NQEA 1Q6QA 1ZAJA 4IOTA 1SSGA 5CZSA 1B4KA 3N2MA 3JS3A 3B0PA 4KFOA 4E0CA 2FIQA 4MZ1A 1G6CA 3P8JA 3TROA 3GAKA 3PSWA 1K7FA 4MUZA 1WBJA 4MOZA 5G5IA 1NF0A 4PODA 1CW2A 1F2JA 1L2UA 1WOBA 1O5XA 4BI7A 3HIJA 3THAA 2V2CA 3NXFA 4X3ZA 2E6YA 1FWRA 1H63A 3A23A 3MP5A 5HWJA 1W1ZA 1PE1A 2B4GA 1JCJA 2ZRZA 5HNRA 2XN2A 4TX9A 3E49A 1OX4A 2CLOA 2ZZ4A 2ZZ2A 3PBWA 3QJAA 1XUZA 4IMCA 2CLIA 2QCDA 4I7VA 5D38A 5D2TA 3TDFA 3QEZA 3LOTA 3ZWSA 4PL2A 4Z1DA 2CLKA 4TO8A 3W75A 2ATMA 1MO0A 3HF3A 3VNDA 2YW3A 4CQ9A 4FX8A 1DJNA 4HT3A 5D02A 3BG9A 3UXAA 3HGRA 3DU0A 3BW2A 3W73A 5C2XA 3QQ1A 3PBYA 3O8AA 4LC8A 1UUMA 5HQEA 1XBYA 3W1RA 4K39A 3BW3A 5CZTA 3IVTA 2ZZ1A 4RZ5A 1HTIA 1XKYA 1I2RA 1S5VA 3S1XA 2NZLA 3TSBA 2NWRA 4MY8A 1OFOA 4JYEA 2J24A 2PRMA 5MHBA 2KZHA 2C15A 2DZTA 3M7WA 1OFAA 3KVLA 4N9DA 1X7FA 4LUJA 2AQWA 1KBIA 1WQ5A 3KXQA 3HPSA 4JTUA 4UCGA 3ABSA 1GEQA 1TPWA 2FFCA 2Y89A 1W5NA 3DGRA 1QPOA 3M9YA 3W1UA 3U2OA 5J5RA 3HMJG 2CWNA 4MVAA 5F1VA 3GAYA 2C0AA 4KFNA 5LNWA 3M47A 3T55A 1YLVA 1NFBA 4UFLA 1FX6A 4IPIA 4FF7A 2QCLA 3OG3A 4FX6M 2RHGA 1X1ZA 1W3TA 4POCA 1KFCA 1BEUA 1QPQA 1IF2A 3INPA 1UBSA 3LM7A 5F4XA 1I2NA 1H61A 1AL7A 2E5BA 3M5YA 2CZFA 4BWLC 2WNNA 3NQVA 2NXHA 4LRSA 4ADTA 3M6YA 2ZZ6A 4CNNA 4MIMA 5D03A 1RV8A 1YYAA 3H54A 4NNBA 3TR2A 3W76A 4BWLA 5LGZA 3PAJA 3LLFA 3FJLA 3LCWA 3OVQA 4R33A 4DF0A 3MMTA 4NX0A 4K8HA 2CLFA 1K8YA 4UNKA 2DZSA 3N3MA 3BGGA 2OT0A 2X30A 3P82A 2Y61A 4JY9A 1SZGA 1I4NA 1RZMA 4A2SA 3W7NA 1OX4B 3ZWTA 1AL8A 4JTJA 1G7VA 1ZHAA 3MYPA 5AN7A 2QCDB 2ZTKA 1L6YA 1T99A 2FLIA 3QF0A 2Q8LA 1F74A 1H7RA 3G3DA 1H7XA 3P8IA 5AB3A 3CWNA 3S6DA 2NUWA 1EUAA 1T96A 3NAVA 3JR2A 4Y96A 1F05A 5D04C 3FA5A 2WOQA 4K7YA 1OFBA 3LHVA 3QH2A 2VELA 1JQVA 5F2IA 4ZL1A 3B0UX 2ATSA 3GYEA 4GJ1A 4NT0A 1ZENA 3F1QA 2ZBTA 5AFDA 1Q3NA 2V82A 4N2YA 3EEGA 5GVJA 4BFAA 4C1KA 5EA9A 4JIQA 4UNLA 5T26A 1GYLA 1OYAA 3BO9A 1E51A 3K30A 4XWUA 3TMLA 4TMCA 3EX3A 2QJIA 4K36A 1GZGA 3S1UA 3KRUA 1I2PA 3LTYA 4ZQCA 3HQ1A 3IIXA 1RQBA 3EXTA 4IX2A 3CT7A 3L0KA 1RPXA 1FWTA 5TBOA 3UWWA 3MWAA 1KBJA 1GVOA 5LZLA 5K4ZA 3GKFA 4WQ6A 3IEBA 4RZ4A 2QDHA 5D32A 1LTDA 1ZAIA 2OZ0A 3M1ZA 3C2RA 3W7KA 3NZRA 5I3HA 3EKLA 4DBEA 5F2MA 1TRIA 3TXVA 4RV8A 3W23A 4NJHA 1F73A 5F2GA 3GR8A 3UYCA 4R7JA 1AW2A 1VQTA 3SGUA 4PTNA 4O0KA 3W85A 4A2RA 3FLUA 5KMYA 2GQ8A 3PBUA 1SW3A 3WK3A 3ZFHA 1GVFA 3H53A 4OV4A 1IIGA 4GC4A 4YWIA 3GR7A 4K7VA 4ZQRA 4LVDA 2JGQA 2WSRA 3DFPA 3UPBA 3DENA 4JN6A 3VKJA 1D9EA 4IMDA 4WOQA 5CG7A 1OFRA 2CZDA 1KM6A 4E2DA 3TSMA 1LLWA 1NAL1 4HSOA 4ZQMA 4WXZA 5DY3A 5LHEA 1XI3A 4N02A 1LROA 4G1KA 4IMFA 1K3UA 4MYXA 3MUXA 4AWTA 2H6RA 3TUUA 2C16A 4KWWA 4NJIA 5DBUA 4YLWA 3M0ZA 4GXMA 3QM3A 3C6CA 2QR6A 4K38A 4JTKA 4O53A 3W7PA 3R5EA 5BMXA 3NNTA 4OGZA 1QOQA 3UD6A 2NV2A 5I3IA 4WY0F 3AJXA 1OF8A 4R53A 6ALDA 2DZPA 1AW5A 2BWGA 4QAIA 3CC1A 3PR2A 4JS3A 3LERA 2I14A 4XKYA 3W84A 5G2HA 2Q3OA 3BLIA 3C2EA 3W70A 4OV9A 2GQAA 1PV8A 2V30A 3CB8A 4RR4A 4O50A 2NUYA 4M6QA 2ZRYA 1Q6OA 2Y88A 4JTLA 4JXCA 3FKKA 3W74A 5DCEA 3TAOA 1XDLA 3TW6A 1YXDA 3G1XA 2CW6A 1ZALA 2BSLA 1QO2A 1ALDA 5C55A 3RNDA 2VFDA 1TCDA 1OHLA 5TIMA 1G67A 5LNSA 1K8XA 2O7SA 2A0NA 4N9BA 3IIVA 4IQLA 4MFEA 4WX2A 2FDSA 4Q33A 2X2GA 5EL1A 2X16A 2XFWA 1RQEA 2ZA3A 2ZCGA 4J9JA 2A7NA 3BK0A 4KWVA 3UWUA 3W7LA 4LUIA 4LVGA 4S1FA 3GKAA 1EP3A 3W1XA 3PSVA 1LOSA 1GQNA 3E0IA 4JDYA 1R47A 5DN1A 4LNYA 2VXNA 3Q37A 4K6AA 3O05A 3BVJA 1SSDA 1XUUA 4I7WA 2C6QA 3FYOA 2Y7DA 3T78A 4MYAA 1JUKA 4OE7A 3MBFA 5C54A 2E5CA 2VEMA 2WJZA 1LOLA 1TMHA 1YTDA 3LTSA 3PUOA 3PG8A 3A24A 1LRQA 1DHPA 5KZDA 2R91A 3LB0A 2ABBA 4UMBA 3TQKA 1UJPA 3TW7A 3CPRA 1SFJA 5AHMA 1UUOA 3KAOA 4CNPA 4O57A 5KINA 5FF4A 1KM5A 4MKNA 4Y90A 2WO5A 3EX2A 2FB2A 1VLWA 4GUIA 3QW3A 3CQ0A 3Q94A 1W8SA 4GRSA 3M5ZA 5HWMA 1Z48A 3RU6A 3B06A 1XM3A 4CCCA 3W07A 1LBLA 1QFEA 4RXFA 5G4EA 4O4VA 2TSYA 4Z0SA 2VFIA 3HB9A 3LHWA 2G5WA 2G96A 2OMAA 1AMKA 1KTBA 1WAUA 4ZQNA 2X1RA 3ABQA 4HIBA 4CQ8A 1LBMA 3L2IA 1I2QA 2QUTA 3BV4A 2A7PA 3LXAA 3S42A 1SZNA 4WD0A 4N9CA 3RK8A 3WJYA 4NNCA 4UFHA 3FOKA 2PURA 2X1UA 4RK8A 2OCZA 5H2ZA 1M7PA 3L66A 1P0KA 4Q32A
chains in the Genus database with same CATH superfamily
3W88A 3PWGA 2QT3A 1BAGA 2E67A 1HL9A 1GVEA 1VFHA 1Z8AA 3RM4A 1H7PA 5I3GA 2IPFA 3SB0A 2WWDA 3SQLA 3MJMA 1IE7C 4LS1A 1PUDA 3STCA 3BJTA 1GK8A 1VYPX 3SCNA 5BZAA 5C5YA 1L9WA 1ZP3A 2F6UA 4B15A 2YB1A 2VEKA 1P6WA 3O06A 3WQOA 1EDTA 3AYSA 1Q8JA 3S83A 3PZVA 1DL3A 1DJZA 4MKSA 4B9ZA 1EJTC 3T2PA 3B9DA 1R5YA 2PGWA 3UGVA 3UXDA 3QLLA 1DJQA 3I68A 3VDCA 4UOQA 4ZO8A 3UJFA 4ORMA 4J1OA 2P0OA 2HISA 2FH8A 2Z25A 2ZYFA 4JIRA 1O95A 3TTOA 4M6PA 2ZICA 4LSBA 1YNYA 1F7BA 1HW6A 1H3GA 3UJEA 2OX1A 3QPZA 9CGTA 1DWJM 4V33A 1GWJA 4FNSA 1YADA 3RITA 4GD0A 2O9TA 5BXPA 7REQB 4HJWA 2VOMA 1B3VA 5A6SA 1PAMA 1ITCA 5A94A 4AW7A 2X40A 1XYLA 2V3GA 5CGTA 2IXVA 3UETA 1Z44A 3RG6A 4DB7A 1EC8A 3WY1A 1O60A 4S3BA 1XP3A 2PP0A 4H9ZA 4PRRA 3WBAA 4S38A 2TAAA 3BLOA 1E6NA 1LT8A 3DXIA 3W2KA 1TVLA 3GIQA 2OYLA 5HMSA 4JEQA 3HGSA 3BOFA 4DVOA 3CV7A 1EP2A 1E6XM 3CV2A 3L68A 2ZADA 1KW1A 3REQA 4Z2JA 1HP5A 4NAFA 1J4EA 1D8WA 1WP6A 3GH4A 1Q2RA 2XSXA 1A5KC 1IR2A 4L6OA 2OODA 4V27A 4LT9A 1GG1A 4E4PA 2VZVA 4Q8UA 1E43A 2ABAA 2QCCA 3NPWA 3ALFA 1DIKA 3WDQA 1H60A 3P61A 3TWAA 5CAHA 2ZRWA 2E7FA 4Z2LA 1OT2A 4HNUA 4IQDA 3VOGA 4RDWA 2ZUMA 2J13A 2C91A 3W00A 2GVJA 2CITA 3A4JA 1FDYA 2A2IA 2DUZA 3R8RA 1AQ0A 2DVTA 4E8GA 1E4MM 1M41A 6XIMA 1MNZA 3FV9A 4ACZA 3MC5A 3N2OA 3VIPA 2B7PA 2WC3A 4ICMA 3RF9A 4L4MA 1R3RA 1BWLA 3LENA 4BI6A 3IS4A 3LLDA 4R3UA 1W9BM 4ZODA 2WLYA 4QX4A 5CSRA 4PBFA 2FJKA 1KM1A 2NXIA 3S5YA 3WLSA 3THCA 3F4WA 3R8HA 3G18A 1S5WA 1A4MA 3T40A 2WZTA 3ELFA 4H3DA 4DXXA 1W32A 3STFA 1KA9F 3LS9A 3W82A 4O14A 1CXEA 2VNCA 2HS6A 1NOWA 4R7OA 2E09A 2PWEA 3HGOA 4ZOBA 2VGGA 3EDDA 4NJKA 4PCNA 5FF2A 1RJQA 2ZVIA 2Z4GA 1BQCA 1F9CA 1L2QA 1E9ZB 2IS7A 1FOBA 3CH0A 4UTTA 4XQ6A 4XSMA 1EBHA 2F8QA 2G4FA 2JEPA 4MNMA 1DJWA 3G2GA 3P84A 4LAOA 2NLYA 4LVFA 3GR4A 4QG6A 4LOCA 4U3AA 2CPUA 4TX8A 2PDLA 2PMQA 5D33A 4KH2A 2YYTA 1GONA 2GVEA 2VX4A 3C2VA 4AG0A 1OF6A 3S4TA 4MLRA 1OC7A 1VYRA 2UY5A 4RW3A 3SZ8A 2PD5A 4PC8A 3PVFA 4YHEA 3UR8A 4H6KA 2YJQA 4FZIA 2E9LA 4XK2A 4NI8A 3IGXA 1AUSL 4GJIA 3G1HA 3THDA 3UY8A 3N9SA 1QNVA 4DY1A 2DZBA 2HV5A 1JCXA 3R89A 1I1WA 5A5WA 4XO6A 3TV8A 3ZS4A 3QY6A 1TR1A 4X63A 2WSKA 4H6EA 3KBWA 3RLUA 3OIHA 2IPGA 4NYUA 3CH9A 2J8FA 3AXXA 5JBEA 2G50A 4QCFA 1PBGA 4BK9A 3CASA 1J5TA 2RKXA 4AMAA 3SIZA 1FDJA 1XIFA 4JIPA 3AIUA 1LYXA 1L6GA 4YNGA 1CGVA 2FZNA 6REQB 1RA0A 2J88A 3N2XA 1REQB 1TPDA 1XLHA 1J01A 1BSLA 1VEOA 1XBXA 3EWZA 5SWUA 2ZZ5A 2NSOA 1O5QA 4UFIA 3TJIA 3OBAA 4JKMA 2A3LA 5CPLA 1JZ5A 3C56A 1VRDA 5BNKA 1SFTA 3LZ5A 3VO0A 4XAFA 2HK1A 4MJZA 4A3HA 1GVYA 3W1TA 3BARA 3SN1A 4A8IA 4O10A 3AU2A 2IKHA 3B97A 3B05A 1ZJBA 2E6AA 4LBSA 3B8VA 2RDXA 1K02A 1KQZA 3RM9A 4YVVA 1UWTA 1WCGA 5DMNA 2PDBA 1LLOA 2ZXBA 2VENA 2CNCA 1OGSA 4YJ5A 4UIOA 1UD6A 1QW7A 3WF3A 3LG3A 3GBDA 2OPJA 3RO6A 5CAKA 1VKFA 3ZOAA 1JPIA 3UWYA 3NOYA 3TVAA 4WCJA 1JCLA 4B5UA 2I56A 1LUCB 3AQUA 3H12A 4D6CA 1LORA 2WBGA 3IRSA 1DJXA 1QHPA 4HMNA 2KAUC 3DFSA 3CUIA 3OHMB 2PODA 4UBPC 9RUBA 4HHLA 3JU2A 2HNHA 5J5DA 2OJPA 3C3NA 1JGIA 3VXGA 1PB0A 2BVDA 2HVMA 4XUGA 3P3BA 3QRHA 3S5NA 4G6CA 3AIVA 1V0LA 5M3WA 3ZT6A 5HR7A 5I3JA 1TMQA 3PTQA 3QR0A 4XVDA 4G2DA 5LIXX 1GVRA 1D3CA 1A5SA 2YA0A 3WQ8A 3AXIA 1HT6A 4CEUC 2Y24A 3C4UA 4IX0A 7TIMA 5I23A 3L0GA 1GVSA 2WHKA 2IQ0A 1JZ4A 4NILA 1Q4WA 1LBFA 3N4EA 4EXAA 4UXDA 4I8DA 5C2GA 1XKJA 2YDSA 2ISDA 1JYNA 2H3BA 2RJGA 4LQ1A 3B03A 1T7LA 4F48A 5DLCA 1S5MA 1O94A 2OOGA 3LXBA 1RPKA 3AYRA 2Z6JA 3N14A 3WNKA 3AS0A 5DT5A 4EPKA 3D5HA 1TA3B 4Q7BA 3GDLA 3C61A 1KTNA 3LCGA 1WZLA 2XSBA 3AUOA 2P76A 1JJKA 1LL7A 1KM4A 3GDBA 4KEZA 1XBZA 4ZTYA 3B04A 4M7SA 2QJMA 3W26A 1VD6A 2VEPA 1KFWA 4OBTA 1B3WA 1QOXA 7TAAA 3MQTA 2VDHA 2V0TA 4L6DA 3IARA 2FTPA 3PBVA 3WF1A 2H90A 3M41A 4L1XA 3VNJA 1I6NA 4RZBA 3UNDA 3T09A 1J96A 4NQ1A 1FRBA 3KBSA 4C1LA 2YCEA 3TYBA 4QSHA 3KRBA 1OK6A 1SMAA 3V75A 3PJTA 5EBUA 5FESA 3SCRA 3GYCA 3HG4A 3HU7A 4MUPA 1FWEC 1LCOA 4GGHA 3DG7A 2IPJA 1V3MA 1GKQA 3B9AA 4LUTB 1VS1A 4S2CA 2BASA 1CCWB 2J9ZA 4OKDA 3RILA 2XSAA 3ZT7A 1EWEA 3TKFA 2VC6A 1OM0A 1X8FA 2DIEA 2Q01A 4LAMA 4PCFA 3S5ZA 3T44A 1O68A 5L9FA 2XU2A 2XVKA 3O6YX 2WVSA 1W0MA 4IFOA 4MHBA 1ZFJA 2V5DA 5TAOA 2I5IA 3SRHA 3E0VA 3NPVA 3H23A 2DFAA 1K03A 4CCEA 1KXTA 4A3QA 3VIGA 5EMUA 3WLJA 2VFFA 3N11A 3O1NA 1TG7A 3EWUA 3WQ5A 1KKOA 3L4WA 3ALGA 1AW1A 1NH6A 1UWIA 5H91A 5K9XA 4MWAD 3W53A 3E12A 4L6HA 4ROQA 1VBJA 5G4HC 1H09A 3TFXA 1KRCC 4QLLA 1UPMB 1W9PA 3VGDA 1TTQA 3OEXA 1V51A 3BDKA 3PZ9A 1TVNA 2ASHA 1OYCA 2H8ZA 1W54A 2OLHA 3URQA 1CGTA 1JDEA 2EJAA 3SY1A 2HVNA 3L2LA 3WDRA 3KRSA 4O1AA 3TC3A 4HPJA 3D0CA 2YXGA 5HQMA 4N42A 2OSWA 1SMDA 1RCQA 5DY2A 1VHCA 4DEFA 1A3WA 4C6LA 4EANA 3URBA 3WUBA 4KKXA 1W6TA 1EF2A 5EFDA 5EKYA 4GUJA 3MV11 1MMFA 4O12A 4LNCA 1AA1B 3V0SA 2PDXA 1XJBA 2SFPA 3LI1A 4W93A 3H7VA 4WLCA 3T4CA 5BW6A 2RDWA 3HPXA 4DYKA 5ABTA 1GORA 2DQWA 1TJ2A 3AI0A 3TQVA 2PB1A 2XIIA 3T8QA 4CD7A 3AXKA 1N7KA 4IUOA 3OYXA 3T9PA 3MYOA 3DHPA 3HQNA 1GKRA 4FIQA 4H9TA 4ZQPA 1SZRA 2Y62A 5BOOA 4AVFA 2UV8G 1TUFA 4WKAA 3EAUA 3NYDA 4WKFA 2C14A 3UWZA 1U1HA 4O15A 3MPGA 4S3AA 2R24A 3K8KA 2H3DA 1RVKA 2GQ9A 4MPQA 1LT7A 1FCQA 4F0MA 2V68A 3GHUA 2QEZA 4W5UA 4PTWA 1EHNA 2YCJA 4EP8C 1B1YA 3W1MA 2TODA 4QTGA 1X1OA 2R14A 2FTWA 1TUXA 4CN1A 2FJUB 3G1SA 4MG4A 1P1XA 3IUDA 1SR0A 2QQ6A 1TTJA 1V6YA 3BH4A 1LWHA 3ITVA 3QR3A 4AC1X 3VMOA 1LQAA 2ISSA 1XLIA 2J7DA 4C5YA 4FO4A 1Q2SA 4IJRA 3NG3A 1JDCA 2PEVA 2Q09A 4PRWA 4LUYA 5I3DA 3TLLA 3KDOA 4I9MA 2XFYA 2YFNA 1FTXA 3ARXA 1OFDA 4BEQA 2PDJA 2VX6A 3HG3A 3C0SA 3URAA 5EMLA 3K2GA 2XINA 4CGTA 3B0YA 3L23A 1FQ0A 1V5XA 1BYDA 4A3YA 2EPHA 3G6MA 3TC6A 1OCNA 3GVVA 4IMGA 1M53A 1XICA 3ATYA 3KRZA 3G24A 4FXSA 2TMDA 4I5RA 5IHSA 1QWKA 1I0DA 1WDPA 3ZJKA 3UJRA 3CMFA 2ACSA 1F3EA 4NZCA 4JTHA 1IXQA 1JXKA 3RLVA 1Q5MA 1Y0EA 2W5FA 1EJUC 3NQMA 1J0JA 3S9YA 1KCLA 4RE2A 5LNUA 1SO5A 2QUNA 4GYFA 5FI8A 3VA8A 4P8UA 4JDBA 3IIPA 3S8HA 1VFLA 2BG5A 3TOPA 2Z0IA 3B4UA 1VGAA 1G69A 5HDRA 1OSEA 4DWDA 3CYVA 1YDNA 1JIBA 1UP2A 3N18A 1U5VA 3ABOA 3CZJA 3FW6A 1J2BA 3O16A 1IQ8A 3A64A 2PDIA 4U2ZA 1R3YA 1W1A1 1UQZA 2NQHA 1UCWA 3K1GA 1W1YA 2PCQA 1HGYA 2X09A 2J27A 2EGZA 4JYDA 3OBEA 3BLDA 4LCSA 1BKSA 3WNOA 4QNWA 5C9UA 4F0LA 4DZHA 2XZ9A 2WVUA 3IJ8A 1BTMA 3GDRA 1WDWA 3KBMA 4U10A 3MUZ1 1QI5A 5D2XA 4W4QA 3EWCA 3VMPA 3H7UA 5C9WA 1FCBA 3WUFA 1XYAA 1BLIA 4YXGA 4UTJA 4TTGA 3NZ1A 4F0RA 1MWOA 3A13A 1IGSA 4QG9A 4Y9MA 3FJ6A 2QVNA 4L4PA 1UC4A 2ONEA 4LCQA 1E55A 1TYGA 3G1AA 1ECEA 3OVPA 3DCPA 1M5WA 1ZRQA 2EG7A 1EOKA 2H9AB 1M7OA 2BMBA 3O0FA 4B3LA 1DJYA 1OFQA 1ODUA 2A1YA 4YCPA 1EYEA 2JIEA 5FAGA 1TTIA 3MHFA 3W3OA 1FFRA 4IQJA 3KX6A 1VFMA 3EOLA 4AHPA 2DY3A 4XD3A 3BLFA 2XTKA 3S5OA 3RGTA 3C2FA 1NDVA 3SEPA 1KV8A 5D2WA 5FEPA 4L1GA 1WDRA 4JTSA 1W3NA 2BB0A 2JKPA 1VYSX 4GVFA 2QCFA 4GIEA 1UIOA 3SQSA 4LVBA 4ECLA 3KBNA 3PFRA 1J12A 4BQ4A 1C90A 3EB4A 3F2CA 3R13A 1PX8A 1A4LA 4HSNA 1P0EA 1BTCA 2WMIB 4JTEA 1XC4A 3M0KA 1DP0A 4Q8VA 2P8BA 3CTLA 1GQKA 1E70M 2OEMA 2CHNA 3WD4A 5A6AA 1G01A 1IR1A 1DWAM 5E93A 3L4TA 4JTFA 5K7JA 2DVXA 1VPQA 1JZ8A 4IMAA 1DEDA 5TQLA 1A5AA 1UR0A 3PY2A 1Z6KA 2Q6ZA 3DFOA 4JQ1A 4BF7A 3BJSA 4PFMA 5H8PA 3C2OA 1NQ6A 2FKPA 1OGGA 4GCAA 1XYBA 3V1HA 1PTAA 2PP3A 4U5KA 2W62A 3F4CA 2ISVA 1V02A 2HRWA 1LL6A 4UQBA 3E0FA 2DT0A 3WLLA 1JDDA 4GY7A 4V1XA 4J3ZA 4ATWA 4XKYB 4UFJA 4PMRA 1H41A 4R27A 1ISYA 1WZAA 4GIRA 3TYEA 5JQ9A 1A53A 2ACRA 3WH6A 1SFLA 2YPIA 3L12A 4M6VA 1UZHA 3HBLA 4C1NA 3A5FA 3RM8A 4DBWA 1FVPA 2VRJA 2UY4A 3IUHA 4QGCA 4NZJA 4RXGA 2J77A 3R58A 3P2VA 4LJ3A 5M03A 1FCVA 3DI0A 1FKWA 2WNWA 4GKTA 3GVRA 3NCOA 3ZR4A 3FHAA 2AKMA 2BY3A 3LXCA 3MJYA 1IEWA 2Y5EA 2I9UA 2VOTA 4PUMA 4JFWA 2IKGA 3LD5A 1F6KA 2ACUA 3GTNA 3RCNA 4AZCA 4RNHA 5C0QA 4Y9OA 4NF7A 1I9CB 1AFSA 1S2WA 4D9PA 3JS3A 5LIUX 3B0PA 5BWFA 5TD4A 4WHBA 1IEXA 2R6OA 1R85A 3FVDA 4MZ1A 4QAWA 3S2NA 1XPGA 3KBVA 3P8JA 4AIOA 1LL4A 3PSWA 4XSLA 4GVIA 3M0YA 4MOZA 4PMQA 5MKGB 1X8CA 1NF0A 1WOBA 2GJPA 3U0HA 2V2CA 2E6YA 3A23A 1W1ZA 1VBHA 4C90A 2B4GA 3K13A 3GUWA 3WQCA 3E49A 1OX4A 2ZZ2A 3D47A 3PBWA 1XUZA 4IMCA 4XAPA 3BQ6A 3WQ6A 4RDVA 5D38A 4KWOA 1X39A 3QEZA 4ACYA 1IWAA 3ZWSA 2VZUA 3EA2A 1JFHA 3VNDA 2YW3A 4CQ9A 1YQ2A 1IT0A 3HGRA 4XZLX 2VDGA 1QASA 4X0NA 3PBYA 4JQ4A 2WW5A 2XG9A 3W1RA 4GJJA 3IVTA 5FSDC 4JHOA 2ZZ1A 3H8AA 1HTIA 2HDJA 3B4YA 1AMYA 1W9VA 4H2HA 1JDFA 1FFQA 1OFOA 4JYEA 2J24A 2PRMA 3VPLA 2OU4A 1SVDA 3IGHX 1LJYA 5BU6A 1DWHM 4LUJA 3KXQA 3MVTA 1GEQA 1NTHA 5FD0A 2Y89A 5H8UA 4Y8EA 2POZA 5J5RA 2CWNA 4LALA 4MVAA 5F1VA 2DPEA 3EDEA 1TZ7A 4D6EA 4KFNA 5LNWA 3M47A 4TOQA 1YLVA 1FH7A 2EXOA 4NZ3A 4IPIA 4ZR8A 3KTXA 1O7AA 2C7FA 2OWXA 2QCLA 3OG3A 4GLEA 3GBEA 2BBFA 1ZP4A 1X1ZA 1PKMA 1KFCA 1W3LA 4J5NA 4S3EA 4C6EA 3K4AA 1UQYA 3VGGA 2EG6A 1UBSA 1J10A 5F4XA 1I2NA 2WK2A 1M1BA 3M5YA 2E5BA 2WNNA 2Y4SA 3MS8A 4AVNA 4MIMA 1MQQA 1OIMA 1NARA 5D03A 2FGZA 1RV8A 4BA0A 3RO8A 3PPHA 1QK0A 3PAJA 3LLFA 3FJLA 4R33A 4NX0A 3ZJ7A 4UNKA 3BGGA 5JIPA 4H8UA 3OLDA 5EMKA 4YVXA 1HXJA 3PUGA 3O0KA 4D72A 4JY9A 3UESA 3AIRA 5CZKA 3ZWTA 2VZOA 4GQQA 3MYPA 1V3IA 5AN7A 1TV2A 4Q22A 1XLGA 2Q8LA 3N17A 3UT0A 2E1WA 1H7RA 4DJEC 3CZEA 3AIQA 3G3DA 1H7XA 1XLCA 3S6DA 1E0XA 3NAVA 4Y96A 5E5CA 3UXIA 3FA5A 1OFBA 3QH2A 4US5A 4FI4A 1IEQA 4HZ6A 1DQUA 1W1VA 2ZBTA 1F07A 2V82A 4E5TA 1UKQA 5EA9A 4UNLA 2XVPA 2OEKA 2R1LA 1E51A 1BVNP 3M0MA 1EEXA 2JEQA 3SRFA 3PFMA 3EX3A 2QJIA 4QSFA 1GZGA 4PUDA 4JNYA 3EDKA 3CJPA 3KE0A 2WC4A 1RQBA 4JN7A 3QXBA 4IX2A 4PMDA 1EGMA 3CT7A 3H2CA 5TBOA 4FLOA 5JVLA 5LZLA 1VFOA 3S46A 4HCHA 1UA3A 2XH0A 3IEBA 2PDQA 4UB9A 1E72M 5CLTA 2QIIA 1V79A 4PEEA 4YTUA 3GQYA 5F2MA 1TRIA 2GDVA 3CUZA 5AVNA 3TXVA 3W23A 4NJHA 1MFUA 3UYCA 1X7IA 5M5DA 2G0WA 4RE3A 1AW2A 1I0BA 1VQTA 2CWXA 3A9BA 3U3HA 4O0KA 4W85A 1XHGA 3MSDA 3SADA 5EB8A 3FY1A 3RPMA 2GDQA 4PTVA 3UCCA 1UC5A 4F0HA 1CLVA 4A8NA 3T4WA 3KBJA 2XGZA 3WK3A 1GVFA 3GY1A 4GC4A 2YKKA 4YWIA 4M1RA 4ZQRA 2JGQA 3IJDA 3DENA 1K9EA 3VKJA 4AD1A 1D9EA 4IMDA 2CZDA 2PLMA 1H4PA 3TSMA 3WDIA 1NAL1 4ZQMA 2J79A 3H4XA 4HZ8A 1G5AA 1K3UA 2VC5A 2DH3A 1MDLA 3SRDA 4M80A 4C6JA 3QM3A 4CNTA 3VIIA 4JTKA 4O53A 3WFLA 2E28A 2QNEA 1IWPA 4RDYA 3WLNA 4WY0F 4JQ3A 1HF6A 4K3ZA 2OLAA 6ALDA 4QAIA 3CC1A 3RCYA 3BTNA 3SBFA 3GE7A 3UGRA 2Q3OA 3FJNA 1M3UA 1YNPA 3RJYA 2GQAA 4FXFA 5B80A 4RR4A 4KQNA 2ZRYA 2Y88A 4PFHA 5EMYA 3S2MA 4JTLA 4JXCA 3LEPA 1V3JA 2QYGA 1QBAA 3H21A 4PTDA 1XDLA 3H24A 3G1XA 2CW6A 2P88A 1X97A 2WMFA 3RNDA 3EOEA 4LAZA 1TCDA 1GNXA 8CGTA 3M4HA 3V0UA 1MQPA 1ZUAX 1S1RA 3VMNA 4N9BA 5DMMA 3QKZA 4YVPA 4IQLA 4Q33A 5EL1A 2ZA3A 4J9JA 2ZCGA 4E2OA 1AQFA 3W7LA 4LUIA 3GKAA 3VTRA 1EP3A 2PWFA 1BRLB 4Y9PA 4LNYA 3WLIA 4ZE5A 4AXNA 2C6QA 3T78A 4MDOA 1DJIA 4C6IA 3N6QA 1JI1A 1JZ2A 3EZ4A 2DT1A 4GABA 3VNKA 5C54A 2VEMA 3PUOA 1TMHA 3TN6A 1D7FA 3C0QA 1TJ0A 4HZMA 3DFHA 4HCDA 2J75A 3QTPA 1LRQA 3VDHA 1DHPA 3GTIA 1QT1A 4XZHA 3TQKA 4DJFD 1OT1A 4W89A 3RPDA 1SFSA 2PDUA 4QE4A 1QJWA 4PE8A 3IJ6A 2PTDA 3N15A 3A6OA 4O57A 3VD9A 4AD3A 5A95A 4MKNA 4Y90A 4D6JA 3EX2A 4CD5A 2BHUA 1B3YA 3WD0A 3CQ0A 1VB9A 3RU6A 5IXEA 1M03A 3B06A 3U7VA 5A1AA 1UA7A 3W07A 3WLMA 5IHRA 2VL4A 3K1DA 4NZ4A 2XISA 4RE0A 1GW9A 3OYZA 5FA5A 4HPNA 3WNLA 3N2CA 2Y8KA 2NVAA 2A7PA 4HCLA 3S42A 1BYBA 3TCSA 1Q6EA 2BY2A 4XD6A 1J79A 3WQPA 2GZXA 1V08A 3KDNA 1JPKA 3ISIX 4DXKA 4RK8A 2OCZA 1M7PA 5D9PA 4Q32A 1EH9A 2PWGA 3CAQA 1YBQB 1QMLA 4BJHA 3QC3A 2PDPA 3WD1A 1KM0A 4HZ7A 3N4AA 4B5WA 1H5YA 4KEUA 5CC3A 3AWNA 3F2BA 3BPWA 4LEQA 3HJEA 1V6VA 3T1GA 4EWND 4O4WA 4DJDA 4ZOEA 4HKPA 1MQRA 2FZDA 4E2BA 4Y6GA 2VCAA 5AC5A 1E40A 3F4DA 5G4WA 4YYCA 2ALDA 1HQTA 3FDKA 1V0MA 4MLJA 4WF7A 3NEHA 2W6RA 2Q02A 1TQJA 4HTBA 3IJLA 4ZMGA 3N2BA 3ANVA 2HCVA 4XAGA 4D2JA 1GOXA 3OQ8A 1N8FA 2BY0A 2WANA 4ZVJA 4GZ7A 2W92A 3RLHA 1VCFA 3W86A 3R0KA 1DE6A 4QXIA 4TR9A 2QLYA 3KVJA 4ZE4A 1DQWA 3FYPA 1FWWA 5AC6A 4L5ZA 3VIOA 4WJEA 3BAXA 1NELA 4CVWA 1PCKA 5BXRA 3GTFA 5HK4A 2QCEA 3WEZA 3AJ7A 3PPCA 2V5BA 4ZB5A 4TIMA 1UROA 3AO0A 4K1WA 4IF2A 4DHGA 1NIUA 4KW2A 3CL6A 5CPNA 3O6CA 3COTA 4YPJA 3GIPA 3VGHA 3TQPA 4X9YA 1GW1A 1TTPA 1EKOA 2CZVA 4KEMA 2YOCA 1EJRC 1C9WA 1QHOA 3OPSA 2UY3A 2I1OA 3N34A 4GBUA 1LP6A 2FGBA 4NJJA 3V35A 3QV6A 1UP0A 3NOEA 3OGVA 4CD4A 2OZTA 4JR5A 3IGUA 2FPYA 4NI3A 1Y65A 4X61A 1E6PA 3DKJA 4H9MA 2E40A 1DVJA 1K9FA 2QAPA 4GQGA 2E9BA 1XH1A 1CLXA 4JTGA 4F0SA 2Z7GA 4UTHA 3U6WA 1JEZA 5D8WA 4L80A 3UG4A 2YBVA 3CQHA 1OX5A 3OGRA 3VIHA 3PZTA 3H2EA 4MJ2A 4HNVA 4H19A 3WENA 4C5ZA 3W2UA 5DXXA 3EKZA 4M24A 3UJ2A 3EDJA 4MWAB 3SRKA 4B5TA 3LLXA 2WAGA 1PXGA 4GX8A 1QPKA 4YTRA 1XGDA 1OCQA 4FSAA 1XQKA 3KP0A 3R94A 4AF0B 1W5PA 2EG8A 1RK6A 2KX9A 1JZ7A 3PB0A 3VCRA 4ZGYA 1EYWA 1D3GA 4GH1A 4H2CA 3EWDA 4UQ9A 2E9MA 1P1MA 1GOIA 4JIIX 4U4MA 1VFUA 2NQ9A 1IXOA 2WJDA 1FCUA 4WY0B 2QUVA 2YA1A 3TZFA 2WXDM 6PTDA 3A22A 4I90A 2VFEA 3IJIA 5KETA 4YS1A 5IDZA 3QHOA 3L5MA 1XYZA 1G94A 3MBDA 1YE6A 4IFKB 4AWSA 5DO8A 1XRVA 2ZKMX 2VEGA 2YW4A 3LPOA 4I9AA 5A6BD 1XLKA 1FWDC 3NGFA 3GFYA 3REQB 5FKYA 1SJDA 1KRMA 1XF0A 2ZE0A 3SSJA 1Z7AA 1GT8A 2GWNA 4OWGA 4U28A 2PU1A 4NHVA 1Q6LA 4I3GA 3QLDA 3IV8A 2X0HA 5HAOA 2YCLA 4JOMA 1XCFA 4YU1A 4ERIA 3QV8A 2E1DA 2GOKA 4ZQOA 2GSEA 4EF8A 1TZZA 1PHWA 4B90A 1WX0A 5GNYA 3BSGA 3WDHA 1WNOA 2QXWA 3ES7A 3T0DA 3GU1A 4BI5A 2WKGA 4EWJA 1YPXA 4NAEA 3ZVHA 1D3HA 3M07A 1WB0A 2D1ZA 4CQDA 4YN5A 3IPWA 3LSCA 4ZXLA 1K8ZA 3PM6A 4O54A 1CXHA 2EBNA 3RMJA 3FYYA 1UZ1A 1ZJHA 1E4LA 5G1MA 3W1PA 5C2CA 3AWOA 1HVQA 3H4GA 1IZKA 1MRQA 1ZJIA 3S0CA 3UNTA 1K9DA 1XIGA 4UTWC 1ZQ5A 2NSXA 2W0UA 1C29A 2ZRXA 4DLMA 3QQ0A 6TIMA 4AD5A 4Y9AA 2NT1A 1GQJA 1M9HA 3R8GA 3QFWA 3PTKA 1H7NA 5AC7A 5LXEA 1FWCC 2F7FA 4O0ZA 3MCNA 1SZFA 2PS2A 3T42A 2VO5A 4DLFA 3M0XA 1OC5A 4UNIA 4D6GA 1P0BA 4YIWA 2VD9A 3G0XA 3AMKA 2Q8ZA 3A47A 2A6NA 4XKMA 4MPKA 4IP5A 5JH1A 2D2GA 3ERPA 2AAMA 1RBLA 2FHCA 2PDKA 4RNFA 1Q6GA 4IWWA 1K7XA 4RPQA 2BGQA 4YWSA 3SURA 3W2MA 1FP9A 5IBXC 4GO8A 3CWHA 1VJIA 2Z2UA 3G0SA 3DX5A 1MEHA 2HEJA 4OBSA 2WQPA 1TELA 3FJ4A 4Q8QA 3SSZA 4QLKA 2Z6IA 4Z1AA 4NRSA 3TAKA 5A6JA 3NDOA 4HMEA 2WMKA 2WSPA 3FCPA 5D05A 4H7VA 4O19A 5FJUA 1HL2A 2BXYA 1UOZA 3QGVA 2XJ7A 4R88A 3MMUA 2ZWZA 5AYZA 3TNBA 3ES8A 4KCWA 2X1SA 3Q58A 2Y2WA 4UZUA 4AB4A 5AECA 2Z27A 4YL2A 4FS9A 3IVUA 4H4IA 4AY7A 3SCSA 3H2MA 3E2QA 2X05A 2A7RA 1XC6A 4HK7A 1V3HA 1LM1A 1V7AA 1XLMA 4EPBC 5HINA 2OO6A 5AYXA 3NDZA 2OXNA 2YFOA 3I6RA 2X8RA 2AOSA 5HUPA 1O12A 3P67A 3AHYA 4FNTA 5FOOA 1TCMA 4WJXA 1KM2A 4HNLA 1O5KA 2JK2A 3EOSA 3CGTA 2GGJA 1QCWA 3W7HA 7REQA 3CIWA 4UR8A 1AJ0A 3UBPC 4RKAA 1NDZA 3NQ6A 2WVTA 4L9YA 3QOMA 1PDYA 3AS3A 5LKYA 4QR6A 3PULA 2FHFA 1PZ0A 1BHGA 2FVLA 3SCVA 1ICPA 3E5PA 1N55A 4MWAE 2ZUUA 3TXZA 1OB0A 4FLQA 3SGGA 1VJSA 2XVLA 3W7CA 1W1TA 4PMOA 4X9SA 2X42A 2WCGA 1HJSA 3CHFA 3E2RA 5CH9A 1A3XA 4XISA 1OIFA 1JULA 2A21A 1GVQA 1RP9A 1VEPA 4EACA 3KW3A 4HOWA 4ZOAA 3P6LA 1UIPA 2YYUA 1Q66A 4CUCA 5AY7A 2BXVA 4IL0A 3HPAA 5TF0A 1S2VA 2F6XA 3F7JA 3WNNA 4GISA 1KLZA 8XIAA 1PZ3A 4I7UA 4LU0A 1S2CA 5ABHA 1VR6A 1R3QA 2X7WA 3N73A 5DELA 3DDMA 3EMQA 3G1YA 3FAXA 4NL1A 4IL2A 4MTVA 3W7JA 3WMBA 2YL9A 1DQXA 3RX4A 4DRSA 2CBUA 4UUIA 3PWIA 4IGHA 2C71A 4ZB0A 1TE1A 4XV0A 4ML9A 3M0IA 4X0VA 3R0UA 4B3KA 1ML1A 2WB5A 3T0CA 2XUCA 3B8TA 4PMVA 3T0BA 2VRKA 3I7QA 2RGMA 4HPGA 3VIJA 3K8MA 1ZY9A 4AISA 3WG6A 3IIZA 3UWVA 3L4UA 3UWEA 3DESA 3CEPA 2FB3A 2VP8A 4AZHA 1AG1O 4NUWA 2TRSA 4G1NA 2J78A 1HZYA 2V8ZA 4BHYA 1TPFA 2QCHA 4AH7A 3WBEA 1W9UA 4AUBA 2WZMA 2W63A 4KBXA 3TH6A 2IPWA 3LU2A 3I10A 1CEOA 1KBLA 2D73A 3NQDA 3L5AA 1LZOA 1Q6RA 4B5NA 1F3TA 4H6RA 2IQTA 3GG1A 4HGXA 5HMEA 4Z2GA 3SM0A 1IIHA 1UR1A 3GFZA 1Z9AA 3W37A 5CBIA 1XIMA 3A3WA 1GKPA 2Z28A 1C92A 4DXVA 3CL8A 1JZ3A 5FJOA 3I7RA 2A5HA 1H2JA 4DZIA 3VE7A 4F4RA 1EEPA 5HPOA 4MZ8A 3KZPA 1TE6A 1NVMA 2EPLX 1Q85A 3T05A 4XBSA 1N82A 4NXKA 2BV9A 3HG5A 3CZKA 3I7SA 2D0HA 3NPXA 4K37A 1THFD 4X60A 1SGJA 3SW6A 1V93A 2Z29A 3PS7A 3G1VA 1B90A 4IIFA 1PO9A 5I6SA 2QJJA 1EZWA 2PGRA 3DN5A 2VMFA 4CNSA 1X6UA 3VD7A 4XAZA 5I0DA 4S2BA 3MZNA 4LH8A 3UW6A 5FF0A 2W4XA 2CC0A 1K7EA 2W79A 3NQBA 3SI9A 1WDSA 1G4PA 1YIXA 3AIWA 4OOZA 5DT7A 1XRTA 1T6MA 2BOFX 4GHRA 3AXHA 2WWCA 1KFBA 4RW5A 3EPOA 3FDGA 3A3XA 1L6SA 1R2SA 3BG3A 4P5UA 2XFRA 3N9RA 1AD4A 3GXFA 4KRUA 1L6WA 2BX7A 2HROA 1AH0A 5AYIA 2ZDRA 3LPFA 2R1MA 3WH7A 1JDAA 4WUIA 1LQ2A 3EOOA 2F38A 4QS6A 4ASTA 1R3TA 6REQA 4NX5A 2CXEA 2V3FA 4Q6JA 4O1BA 1UR2A 1H62A 3F5LA 5D2VA 5I5RA 1ODZA 4KCTA 1KXVA 4XTIA 3NPUA 2INFA 5FL0A 2QAFA 2GUBA 1GQIA 1CDGA 2FHBA 1CYGA 1PIGA 4OU1A 1A5OC 4XAYA 1EHAA 1RQHA 1QUMA 1SYTA 4FHAA 1E0VA 1VHNA 3SY5A 3R0DA 3AU6A 4HB7A 2PTXA 1F76A 3G1DA 1A5CA 2QUUA 4Q8PA 5BOEA 3R11A 3GD6A 3VI2A 1BWVA 1V3KA 3L21A 4H9XA 1TZ9A 2BHZA 1LWJA 4XBJA 4J28A 3BMVA 4XZIA 1OVDA 1JRBA 3IWPA 3W22A 3M5VA 2J66A 1K6AA 3IJ9A 3FNDA 1MYRA 3CUFA 2GFTA 1EOMA 1POKA 1JQXA 2QJHA 3M0LA 2WZIA 3VM7A 1OFEA 1DTUA 5AVHA 1HG3A 1W3JA 1SUXA 1XIEA 4MMWA 1TB3A 1G4SA 2W91A 2DW7A 4Z2KA 3EWBX 5C9ZA 3GNOA 1LRTA 4REQA 2PGEA 2G3MA 1A3HA 3AYVA 4EIVA 3M0VA 3GDKA 3VOIA 2ZFAA 1TR9A 2D69A 2WHMA 5GQBA 4AZBA 3BW4A 1KB3A 3O6AA 3E9AA 4IICA 2HPMA 3NZGA 3Q4DA 5HJYA 3N25A 4UTWA 3Q45A 4YHGA 2YDAA 2BP1A 3GNPA 1EJ7L 1U5JA 1KNWA 3SDOA 1V7YA 3E5BA 4C6QA 2YDRA 1UMYA 3VZZA 5GPRA 3NL3A 3PJXA 1EPXA 4JNMA 4QHRA 2DZWA 4PBGA 1SM9A 2GJNA 1MSSA 3C0JA 1XLLA 4Q8MA 1GOOA 4XZMX 3KTCA 4FAMA 3ONBA 1HKWA 1ZB5A 3WEMA 3KUMA 1EX5A 4IJBA 2XWDA 1KFLA 1H50A 3NO1A 4IJCA 1CX9A 4B4FA 3I6TA 3FXGA 4DZAA 4FXRA 5IBXA 3NEVA 1XV8A 1A0CA 3VABA 2VKZG 5FJPA 4Z1YA 1J0YA 3CYJA 1A5UA 4P8WA 2GK1A 2CIPA 2OQHA 1W5MA 1A0EA 3IGSA 4IZGA 4JIEA 5DANA 2GSJA 1ZBVA 4PCSA 1R7AA 2OR2A 4M3PA 1GHRA 4GXWA 1J6PA 1VBRA 1DV7A 4H9VA 1UKTA 5GNZA 1EIXA 4PRTA 4PSRA 3RU8X 5I2UA 4NYYA 3V5CA 4Q3MA 4UQAA 3ITGA 5GNXA 1EA0A 4U31A 4RL3A 4GYPC 1FWJC 4YCOA 4PN2A 2J7FA 3PBGA 3IUIA 2TPSA 3DH7A 3WMCA 3LNPA 4S3KA 4WKHA 3S6TA 3WX7A 5EU9A 3EPMA 1EA9C 3MI2A 2XIQA 2VGBA 1KXQA 3R10A 5CZ0A 3IRDA 2Z1VA 3DHFA 3AAMA 4Q8WA 4AEOA 4N9EA 4QS5A 3OU8A 4FEZA 5REQB 3FGCB 1HKJA 1E6RA 2V38A 4QEEA 1VRXA 3WQVA 3GH7A 4Q4OA 3ARTA 2QJNA 1T8XA 4ERAA 2EQDA 1ZCCA 3NWRA 3AHVA 1V3LA 5D2YA 4UTLA 2RFGA 3W6YA 4IIBA 4DF1A 2NXGA 5FF3A 3EXRA 5BXTA 3SECA 5AHLA 1MZHA 5HUOA 3VK5A 1KV5A 3TX9A 2UZ9A 3BGJA 1H7WA 4XZBA 4JZ5A 3NZQA 2YL8A 1JCNA 4PMZA 4RJEA 3TYCA 1QPRA 4ICNA 2GOUA 5G1TA 3CQIA 3BLEA 4TQTA 5LHFA 1E1FA 3WJSA 4N0RA 2B0MA 1ITXA 4RV3A 3NVTA 3CUXA 1X38A 2O55A 2R82A 4Q4RA 2V63A 3MO7A 1HVXA 3LBCA 3SCWA 4ILSA 4FF5A 1GJWA 1YPFA 3W6MA 4BF5A 1FKXA 5LIKX 2E8ZA 2VT0A 3EA3A 3PZIA 3QZEA 1R38A 1V6UA 1V0NA 1MFVA 3O63A 3PBMA 4H7ZA 3LGEA 1LWIA 3BCJA 3EPNA 3MHGA 2CLHA 2QDGA 1JPHA 4FIRA 3G8RA 1W1IE 4U5IA 3UR5A 2EPMX 1BWKA 1X6LA 1XWYA 1XG3A 3CAVA 4H00A 3QYSA 1FHDA 1ZAJA 5HJXA 1SSGA 4WK9A 4EAMA 1B4KA 3Q65A 2C8NA 2WM1A 3TA9A 4E0CA 2OWCA 1HNYA 1NDYA 3TROA 3GW3A 2WZEA 3OODA 2Z26A 3KCJA 4F9DA 5A8NA 4JEJA 5G5IA 2ALRA 2J25A 1CW2A 1F2JA 1L2UA 3OQEA 4WSHA 4BI7A 2OSXA 4QE5A 3HIJA 3NXFA 2HQAA 1H63A 4UQCA 1PE1A 1JCJA 1GZJA 5HNRA 2XN2A 5GJPA 2QMJA 3VCNA 2OKOA 1L8NA 2CLIA 2IXUA 3H70A 2QCDA 3E1F1 3AHTA 4PMYA 3TYZA 5CQ1A 1S46A 4BZYA 2EPNA 4B2DA 2CLKA 2P5NA 2QGYA 3W75A 1VBGA 1MO0A 3HF3A 3S6OA 3MSGA 1DJNA 4HT3A 2HZGA 2CBIA 4W7WA 4ZFCA 3UXAA 2D20A 3U7BA 2CBJA 3DU0A 3BW2A 3BLKA 3UEQA 3OLIA 3O8AA 1UUMA 2VHLA 1JI2A 1E1CA 3V36A 1XBYA 3GG8A 4GQRA 2NW0A 1Y5WA 4RZ5A 5A8QA 1UP3A 1XKYA 2ZX8A 1I2RA 3WDPP 1S5VA 4IQEA 1GZ1A 1QK2A 2FDMA 4US6A 2AMGA 3BAIA 3AFBA 3NJ3A 4MY8A 4DI8A 1UPPA 3ZM8A 3BC9A 1EBGA 3DYOA 2KZHA 4GG9A 1AH4A 3M7WA 1OFAA 1C7TA 2AQWA 1KBIA 1WQ5A 4JTUA 4I6VA 4UCGA 2FFCA 2YDQA 1KRAC 3M9YA 3DHUA 3HMJG 3VNZA 3T55A 4UFLA 1FX6A 1QHZA 1R86A 2FZBA 3KOWA 3W29A 4FX6M 3QR1A 4E4FA 2RHGA 1P43A 5HQLA 1IF2A 1G9HA 3QGKC 1N8WA 2VGFA 1AL7A 2CZFA 4BWLC 2NXHA 1MRAA 5CBBA 4LRSA 3CMGA 1FWGC 3M6YA 4MNLA 2Y1HA 3N6HA 3HPFA 2VX5A 4HMDA 1OCJA 3H54A 1WPCA 3TR2A 5LGZA 2OZ8A 3VC5A 5AZ1A 3ZR6A 4RNIA 2DGAA 2DZSA 4GNVA 2OT0A 3LZ3A 2QMKA 1SZGA 2FVKA 3W7NA 1OX4B 3VUPA 4JTJA 2Z2AA 4H9YA 5GJMA 4RDZA 4HBKA 2EPKX 1L6YA 1NP0A 3AMDA 5I78A 1PZ1A 3QF0A 4DWSD 2WHJA 2OQLA 2PUZA 4ZO6A 4GIYA 2PA6A 3CWNA 4LYRA 2NUWA 2V3DA 1S2TA 1F05A 4K7YA 1E5JA 4CU7A 1A5LC 1BXCA 4I9TA 3MSYA 3RRXA 4ZL1A 1ZPTA 3FAWA 2ATSA 3R25A 4GJ1A 3TEVA 3F1QA 4TVDA 3F4VA 4HA1A 1FWIC 5GVJA 3EEGA 4WDXA 4C1KA 1XRFA 8A3HA 1GYLA 3BO9A 2OQYA 4AY1A 1CENA 1DJHA 3BMWA 3H22A 5JBFA 3RIKA 3H6OA 1WXZA 1P7TB 3KRUA 5LA0A 2W66A 3U48A 1I2PA 1UH2A 3EXTA 1JNDA 3VOFA 1OEPA 4MADA 3L0KA 1FWTA 3HN3A 3MWAA 1KBJA 3MANA 1KCZA 3GKFA 1XPYA 2QDHA 2XWEA 5D32A 4Q7NA 1LTDA 1DJGA 1KR0A 5FL1A 3C2RA 1T5AA 4DBEA 5I3HA 3EKLA 1UUQA 2Z2BA 1AQMA 4J35A 5H6HA 1F73A 5F2GA 4Q6XA 4CN6A 2DSVA 4JBRA 3CL7A 2J7EA 3AISA 3GG7A 4A2RA 3MKVA 3FLUA 4J3UA 5BYWA 2WMIA 1CGUA 1IIGA 4OV4A 3TW9A 4J7RA 1NY1A 2J62A 4MGGA 4BKNA 4C60A 3ZT5A 4LVDA 1HX0A 2I5GA 1XR2A 1B3XA 4L7ZA 4WOQA 1GOMA 5CG7A 1MUCA 4E2DA 4ML4A 1QNQA 4WXZA 3ZLFA 1XI3A 4N02A 4IMFA 4MYXA 4FP1A 1FWBC 4AWTA 1IGWA 2P8CA 3DECA 2H6RA 3TUUA 2C16A 2Z1SA 1J93A 3GVWA 1HKVA 4GXMA 2X41A 3BLPX 3R5EA 5BMXA 3NNTA 3RAOA 4H9UA 4OGZA 2NV2A 3HM7A 5I3IA 2HXUA 2ZUNA 3AJXA 3QGAC 1RK5A 4R53A 3WH5A 4XKYA 4IGMA 2ON3A 1IWBA 3CUGA 4OV9A 1DXFA 3KHDA 2V30A 3ID7A 5AZ0A 5ECUA 3VOJA 3GTHA 1UBPC 2AL2A 2O4MA 2XH4A 4B3ZA 2QV4A 1V8EA 5CC5A 1E6QM 5DCEA 5M2FX 3SUTA 1J6OA 4MNKA 1V02E 4MNJA 4ZSUA 3VC6A 1YW1A 3TW6A 1K1DA 4PUNA 2PDHA 1XH0A 4TV5A 3L4YA 1ZALA 2JF6A 3AZSA 1ALDA 3MUIA 4IP4A 5C55A 2VFDA 4B4HA 2YCKX 3JZUA 4M51A 5LNSA 1XRSA 1K8XA 3CHDA 2PPGA 4OTKA 2A0NA 3W24A 1J0HA 1H0GA 3TR9A 3IIVA 3LK6A 1VFTA 2X2GA 2X16A 4F2TA 3BK0A 2YXXA 1FH8A 5HOSA 4OIFA 3CQJA 4LVGA 3W1XA 3PSVA 2WMJA 3E0IA 4JDYA 1R47A 1BF2A 3BZGA 2VXNA 3Q37A 4C6DA 3O05A 5DF0A 3BVJA 1SSDA 3GVQA 3FYOA 2Y7DA 4CU6A 4MYAA 1KC7A 2E5CA 2WJZA 3RDKA 1YTDA 3LTSA 4MF4A 5ABFB 5FJIA 5KZDA 4CQCA 1TFVA 2ABBA 4UMBA 3CV1A 3CPRA 2IUZA 2VEFA 2VR2A 3GXDA 2GVYA 4AEEA 1MUMA 1X6NA 3HQOA 3FA4A 1M01A 1KM5A 2FB2A 3E0LA 3VVGA 1Y7VA 2YL5A 4GUIA 1TV3A 4WDUA 5DRCA 4LY4A 4GRSA 1XM3A 1RHCA 1LBLA 5D9OA 4QG8A 2TSYA 1IYXA 3LHWA 2G5WA 1JD7A 4J27A 3WYZA 1WAUA 4ZQNA 3ABQA 4J3WA 3BV4A 4PUWA 1WXYA 4WD0A 3FSUA 1A49A 3RK8A 4B91A 3WJYA 4NNCA 1M04A 3FN9A 3ITTA 3ARPA 3FOKA 2X1UA 3VX0A 2DIKA 3L66A 1EGVA 1P0KA 4H83A 4WRHA 5AC8A 3W2NA 3GM8A 4D71A 5CZJA 2Y63A 3VKKA 5J8LA 2A6LA 2XIBA 1F6PA 3PG9A 4Q8TA 2WNQA 1VCGA 1RLDA 3WLRA 4ORIA 4RUBA 2F2KA 1GOQA 3BSHA 5A8GA 4DO6A 1QI3A 3O2LA 3C3UA 3QHMA 1RSCA 1E4IA 5EPDA 4HOXA 3WF2A 4OVXA 3RUBL 3WFZA 3UVIA 4JN8A 3TTSA 5FJJA 1VZWA 4PB4A 4KWSA 3CIXA 4MWAC 5G1YA 1BPLB 2OYMA 2BFGA 4HU3A 1U1JA 1OFPA 5E1QA 5C7VA 5AOUA 2D0GA 5HPCA 1V03A 1JNEA 4NVTA 2ZZ3A 2Y8VA 3GHTA 1UD8A 4GVHA 3S1VA 4EE9A 2FZMA 4W8AA 2HE8A 1X98A 1BVZA 4B16A 3QQWA 3V5FA 4HPXA 3VD4A 5C6MA 2WCSA 3YPIA 1LLZA 2JQXA 5A6MA 4BQ3A 1I8JA 3S1WA 2XVGA 3VNIA 3WQEA 3QVQA 4DELA 3CLMA 4C6MA 1H51A 3ABRA 5LGXA 2XPKA 1XW8A 3S1GA 3KL3A 3DC0A 3GC4A 4LWWA 4UMAA 1M65A 2XZ7A 4Q4QA 2GVLA 3CO4A 4GNJA 4PMJA 1B31A 2PTZA 4GO9A 1AVAA 1SO3A 1Z42A 1JUEA 4BQ2A 4R9OA 3RFAA 1G7UA 1NDWA 4HHPA 4XB3A 2Y7FA 4ES4A 1NOFA 3FIGA 3ARQA 5LIYX 3STGA 1R7OA 1MDRA 2J7CA 2IMRA 3H55A 3CNYA 3KOYA 3AZRA 5CC6A 2WYSA 2BGSA 3TLQA 4JFTA 4HYWA 1O4UA 2EAWA 1EO5A 1YEYA 4TVUA 2C19A 4G7EA 4S23A 1J18A 4Q8OA 1FWAC 2ZA1A 2V67A 3WF0A 4LTSA 5D09A 4HA3A 1U22A 1FWSA 4W5ZA 1XBVA 3KLLA 4DO4A 2MUCA 3WLTA 1RBAA 4X22A 1Q6CA 3OG2A 3WQ4A 4JKKA 1VCVA 5DCDA 1RH9A 3VIMA 3I4EA 1UKPA 1RVGA 3EX1A 2BZNA 1Z3NA 2HTMA 2C1HA 4GA8A 2CZEA 1CWYA 3G22A 4ATDA 2YX0A 3NSXA 4LY8A 3PP7A 8TIMA 2ZX7A 2DH2A 4FR6A 1R9YA 3NR0A 2YCIX 3DHDA 1VPYA 3SCUA 3B0XA 3VD3A 5HWNA 2WC7A 3OVRA 5LNRA 5F7UA 4PB3A 2UY2A 2JE8A 6TAAA 1LF1A 1FWFC 3NVDA 4UTTC 4G9PA 5HATA 2V9DA 3I3EA 3VZYA 2PCEA 2PWUA 3UQNA 3W7DA 5IRPA 3ZZ1A 2C13A 4ZFMA 1YE4A 4XZ9A 3UXLA 1WE5A 4FNRA 4HQVA 3QY7A 1ZSXA 3HQPA 1FDZA 1K77A 4IMEA 4WZHA 5B7ZA 2VFHA 4JYFA 3UY7A 1NEYA 3LRLA 1ITUA 3GG0A 4NJGA 2D2JA 4IT1A 3QPYA 1XLJA 3TTYA 3AS2A 3B8IA 5CBJA 3R12A 1RBOB 4JQAA 8XIMA 1ZJAA 2ZX9A 2OWWA 1WKYA 3O6DA 4A8RA 3BAKA 1EP1A 3MT1A 1U83A 3STEA 1ONRA 1R46A 1AZ2A 4AYSA 1JFXA 2JGYA 4JY8A 3RMEA 3UZYA 3TFCA 3WNPA 4H6QA 4UTUA 4GZJA 1ZGDA 3JW7A 4Y8FA 5CSYA 3RRAA 3OZMA 2OT1A 1TPVA 5CGQA 5DMLA 3UWQA 4GX9A 4YTTA 3OBKA 1Q45A 3BV7A 5KZEA 2NLIA 2J7HA 3CPGA 2PF0A 4AD0A 3HFYA 4W84A 2ZOXA 5A3HA 4IPJA 4QNEA 3W1NA 1P48A 4BR1A 4DO7A 3OIXA 2NQ5A 4JKLA 4DYEA 7ENLA 1EXBA 5I07A 3PC0A 4DM1A 2CLMA 5FSEC 2YLLA 4NNAA 4H8NA 3C2YA 2Y5JA 1XSIA 2NX9A 2C18A 3I3DA 3BUVA 1DBTA 3G0UA 1FH9A 4KMQA 3WZ0E 3N12A 4RZ6A 2Y7EA 2VURA 1FWHC 1WBHA 2WVVB 4GKLA 3PAOA 2R1NA 4R85A 4N4PA 2PU0A 4GGBA 4C7GA 4DNMA 2R1PA 2FPVA 4G7FA 2AMXA 3ANUA 4RNJA 3O7UA 3I65A 1R2TA 4GUFA 3UP8A 3E02A 1XXXA 4J2MA 1QOPA 1C91A 1C8VA 2W9MA 2I17A 1U30A 1TPUA 1GVIA 2YXOA 3NFUA 3XINA 4NY2A 3UPWA 3LHTA 1TV8A 3FS2A 4Z08A 1XLBA 1S3HA 5D9MA 1ITQA 2YCLB 2PWVA 1A5BA 2REQA 3ITLA 3NQCA 4UTIA 4IGNA 3DIPA 3QYQA 2OYKA 4YTQA 1D7KA 1UZ4A 3LMZA 1JL8A 5K9CA 3ARWA 3H7RA 3HOJA 5LSMA 4O8RA 4J3XA 1AZ1A 4C6FA 4W9TA 4TV6A 3I3BA 2XH2A 3N13A 4C6NA 1XS2A 2ZX5A 4ZEPA 2RH9A 3KVKA 5CCZA 2E6FA 1ISVA 3ZMRA 3OOQA 5EGRA 1Q7MA 3CB3A 1R8LA 2ZVRA 3GW0A 4JGDA 4LV9A 1UB3A 1LDCA 4PMXA 3U8GA 3N2TA 4ZO9A 3GU9A 3CHCA 2PAJA 1CT5A 2BS9A 2H8XA 2PC4A 1W56A 3BAWA 4K2SA 3AMCA 1WO2A 1W1PA 3PZMA 4IG2A 5K2ZA 5PTDA 4UMCA 5AYBA 4DX3A 3GH5A 4NZ1A 4GQBA 3MP3A 3B9EA 1GEHA 3KZSA 1VENA 4MB1A 1GG0A 1P5BA 2VDIA 2XIJA 3W7MA 2Z1XA 1HFBA 3CPUA 4PULA 1TJRA 2G41A 3O07A 1OCBA 1AD1A 2A4AA 1R2RA 3L5LA 1QBBA 1PCWA 2CCRA 5EMJA 4F2UA 1ONXA 2P1FA 3EYPA 2Y6ZA 4M5PA 4O28A 4A29A 1PJ9A 2B7QA 3AIBA 1PDZA 1JRCA 1Q63A 3VYLA 3THQA 1A0DA 2BY1A 3T0TA 1Q6DA 1Z89A 1E6SM 3M43A 2GJXB 2VRQA 5DBTA 1GYMA 2BHYA 3ZR5A 2VVNA 1GOKA 4P8XA 4CD6A 4TU1A 4D6HA 2RGLA 4EAYA 4ADSA 1QXLA 4O1CA 2CEQA 3M0JA 2NT0A 4JTDA 5HMFA 2FQIA 1BD0A 1GYNA 5DX7A 2CKSA 3OHIA 4O1DA 3DZ1A 4DAFA 1E9IA 4C6KA 4MAVA 4PYSA 3L0NA 3F4NA 3WUEA 3FEMA 1VH7A 4O17A 2FGLA 4E4UA 1DKWA 2VM8A 1T0OA 5EFFA 3T2QA 1AJZA 2PWDA 2J9YA 3XISA 5K3VA 2VQUA 1TQXA 1KRBC 4KESA 3GFXA 3WLHA 1VPXA 3S5SA 3PZQA 1Y8BA 1OY0A 4PGLA 4JTTA 1UR9A 1UWUA 3GLCA 3OGSA 4Z0JA 4LUSB 2DW6A 4MWAA 3MUCA 2Y85A 1PIIA 2Y8UA 3MV01 4PUEA 4JAWA 4AHOA 2DUAA 3D6NA 4CLMA 3GXMA 1ME9A 3DBNA 1W31A 1UASA 3WELA 2CKRA 4AF0A 4DBDA 4L9XA 4HA4A 3TTQA 1ISXA 4KT2A 3W7RA 1XD1A 4WOZA 2AAAA 4AIBA 1XYCA 3LBMA 4HU0A 1JR1A 3TIMA 2DU2A 4WY0A 2PSNA 1TPEA 2J8TA 2GDUA 4UC5A 2O9PA 1KD0A 3ARUA 3ARYA 4B9YA 3HTWA 3D46A 4EVZA 2Z1KA 2DJLA 4IFKA 1Z69A 2XHYA 1OGBA 1OD0A 2EPOA 3WCZA 2DT3A 3VKAA 4UOJA 2I57A 5I02A 1WAWA 2WPGA 3E96A 3QMRA 1V6XA 3WK1A 4N4QA 3QMTA 2EHHA 4MKVA 3GNNA 1A50A 2ADAA 3SQMA 2XIMA 2DP3A 3H2OA 4A3UA 4A35A 2DZAA 1WKFA 3C0LA 4I6KA 1XL9A 3MUAA 1R3VA 4UFKA 3EOUA 3BSMA 1H11A 2QUMA 3DC8A 3TONA 4Z1BA 1PTDA 4AIEA 3NUKA 4GOAA 4QE1A 3CIVA 3GZ3A 4GACA 1FHVA 1OINA 3RYSA 1BGAA 4IPLA 1KFJA 1KCXA 3M6DA 1F4AA 2YBUA 1GTEA 2WHLA 2CBVA 4LAUA 1OX6A 2QF7A 1P4CA 1R0MA 1JG9A 4LAKA 4QFUA 3LN3A 3M44A 1SU5A 4QBXA 3HV8A 1Q7ZA 3A3HA 2DSUA 4R9XA 1CB7B 2DSZA 3VFCA 4LFYA 3B8WA 1OG6A 3QV7A 3W7QA 1WOAA 3F2DA 3IANA 4E2VA 1Y5XA 2HK0A 3EMCA 5ABEA 3VOCA 2OG9A 1YHTA 3BMXA 1ISWA 3LGDA 1VLIA 4GINA 3TE9A 4W8LA 4AZ5A 2E3ZA 3BGAA 3P80A