1W3IA

Sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYYYPRMSEKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title The structural basis for substrate promiscuity in 2-keto-3-deoxygluconate aldolase from the Entner-Doudoroff pathway in Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Aldolase
total genus 113
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2004-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w3iA00
1K3UA 3BG3A 1DKWA 2YX0A 3W7GA 1W54A 1FWNA 3DXIA 3G22A 1I45A 1I2OA 3DI1A 3LV6A 3W2JA 1XBVA 3BO9A 1LORA 5T26A 2QCHA 2HTMA 2V5BA 1DQWA 1H7OA 5I3FA 3STCA 4EF8A 1GEQA 2QDGA 3NOEA 4DBDA 2WSQA 3W1XA 1GPWA 4JTJA 4O14A 3O15A 3BLEA 4GUGA 3M5YA 3EB2A 1G4EA 3PVFA 5H91A 3WJWA 5C54A 2B7PA 5AC6A 1OX5A 4JY8A 5DCDA 1O5XA 3IRDA 3HOJA 3ELFA 3P67A 1TPUA 3BW4A 3L2IA 2Z0IA 3CWOX 3LCFA 1LOSA 2UV8G 4QISA 5BMXA 1OFEA 4ML9A 4L4MA 1XBXA 2DORA 1EIXA 4HNTA 5D05A 4ONVA 3GR7A 5K9DA 1QPRA 1SFJA 3G1VA 4MZ1A 2YFOA 3B03A 2OZ0A 3C0JA 4RJEA 3DU0A 4MZYA 1HUVA 1KA9F 2DJLA 3JRKA 3SZ8A 1TPH1 2NWRA 3C8FA 3CTLA 1I2RA 4EIVA 1GTHA 3BVJA 3KX6A 1C8VA 2VEIA 4UFLA 4GXMA 1L6WA 4AF0A 4IJBA 2PC4A 2CLHA 2VFEA 1Q6QA 1JUEA 2PRLA 5DXYA 3SFKA 5AC7A 2RDTA 2AAMA 4O16A 1X6UA 2VOMA 3EX2A 3LCHA 3GX9A 4JD4A 3PBWA 2V81A 2CLKA 1YPFA 4AWSA 3P5ZA 1DVJA 3P80A 1ZJIA 3CIXA 4XBSA 3R13A 5KITA 2QDHA 3QPYA 4NU7A 1TTPA 4RV8A 1FX6A 2G5WA 2NV2A 1YTDA 1TPC1 4UXDA 1F5ZA 2QCDB 1XBZA 3MYOA 3W07A 3O6YX 2W79A 5AHEA 4LV9A 1I2QA 4RZ4A 5LKYA 4S1FA 4Z0SA 2NWSA 3QPZA 3TDFA 3P81A 3OVRA 3QQ1A 3WJZA 2CW6A 1WBHA 1TRIA 1ONRA 2GVGA 3O63A 4PL2A 4XUGA 4TR9A 3KRSA 3EWBX 1WDWA 1H50A 1RQBA 3W1LA 3E12A 1VH7A 1ICPA 4AWUA 3ABRA 3LXAA 3W7MA 1H60A 2GPTA 3HGSA 1O5KA 3STEA 1Z48A 4A3UA 1T96A 2DP3A 1DJQA 3W7KA 3TCEA 1A5AA 3S1WA 2C3ZA 2GQ9A 4O18A 4WY0F 3MJYA 5E0KA 2E6DA 2W0UA 2FTPA 1UUMA 1ICSA 4QIUA 2V2HA 4LW7A 1NEYA 1MO0A 3FIGA 1J5TA 3FOKA 4PEKA 1WXJA 3EWXA 4NZFA 1WOAA 3W73A 3W76A 4XKYA 1OYAA 4Y96A 3QMRA 1WV2A 3P7YA 1MXSA 1VHCA 4K7YA 3G3MA 3P8JA 3CU2A 3GKAA 3PY2A 1N7KA 5AN7A 3UPWA 2ZRZA 3LX9A 4O4WA 1LOLA 3MW7A 5D30A 1JVNA 4GJ1A 3B0UX 2E6YA 3HGOA 5EY5A 1DL3A 2FFCA 4OE7A 3WJYA 1A5SA 5K4XA 3O06A 4EVZA 2ZZ6A 3W2LA 1YDOA 3QMTA 3NQFA 1TPFA 4LS0A 3LCGA 4O13A 1KFLA 1YXDA 3QW4B 4IMCA 4CNNA 4LTSA 4UMBA 3NPXA 1SQ7A 4WXYA 5LZLA 1RQEA 1UCWA 5C55A 3MHUA 1F2JA 3EXTA 5CKSA 1K03A 1Z44A 3OBKA 2JKAA 4FNQA 3QQ0A 1XC4A 4MKNA 1PHQA 2E77A 2Y63A 2OT1A 1S5VA 4MFDA 3TC6A 1VCFA 4LOCA 3MUXA 1H1ZA 4OHQA 2B7QA 1IF2A 5F2IA 4C1KA 3LBCA 2J9YA 3W1TA 2KZHA 3W83A 5ABTA 1KFJA 4NVTA 2E6AA 1BWKA 1VGAA 3R2GA 4FIRA 4YXGA 2WNQA 4UTWA 4MJMA 1G4PA 1ZY9A 3LCWA 3NQGA 3PG8A 3GZ3A 4M6VA 3HMJG 1JJKA 4POCA 4WUIA 1Y0EA 3O6CA 2WQPA 1ADOA 4GFSA 4ORIA 2ISSA 3W70A 3NL2A 3L5MA 3AJXA 3WFAA 2V0TA 3IGSA 5E1QA 2DZUA 3N3MA 3STGA 3EWZA 5FF2A 2GJNA 3VE7A 2VEKA 1M7PA 1K8YA 1Q6RA 3M44A 3N2XA 4TO8A 3IV3A 1SR9A 5U4NA 1EWEA 1SZEA 1W3NA 5DLCA 3KXQA 1RZMA 3O05A 1SZFA 1EP3A 3W23A 3ANYA 1K7EA 4JY9A 4FNPA 4IMEA 5G1YA 1YDVA 2X1SA 5DN1A 3A24A 1KV5A 1F73A 1XXXA 4UUIA 3S5ZA 3ZWTA 2NXIA 2NV1A 2O7SA 4UC5A 5EBUA 1IXOA 1TQXA 2C19A 3DI0A 3P74A 1LBMA 4P61A 1G67A 3CHVA 3G1HA 4A2RA 4Z08A 1EUAA 4DO5A 4QSHA 1RV8A 4EF9A 3LXCA 1JRBA 1WA3A 2TRSA 3N9RA 4JTSA 4WZHA 3UXDA 3UXAA 1JCNA 2ZRYA 3LTSA 3DBPA 1LP6A 1B57A 2WKJA 1YPIA 3C2OA 4JTLA 5TIMA 5HR6A 4NJIA 1TRDA 1GOXA 3BPWA 1VC4A 4NT0A 4NNAA 3KAOA 3HG3A 1W5QA 4BWLC 4CCEA 3R8RA 2Z6JA 3PBYA 4FNSA 3EWWA 1HL2A 1VJIA 4PA8A 2NZLA 5IBXA 4UTTA 1IXPA 3B04A 3N34A 4NJHA 3PG9A 2DZPA 3PB2A 1A53A 5AHNA 3THAA 3TSDA 1TV8A 2QCLA 3NM3A 1XI3A 3TQ0A 5L9FA 1P1XA 5C2XA 4CLMA 2BX7A 1I8JA 2Z6IA 1P4CA 3GYEA 3WJXA 4KFOA 4HNNA 2A85A 3PS7A 1QO5A 4U4MA 2CLEA 5EA9A 3G1FA 4WJEA 1IGSA 3LV5A 3PUEA 3LCLA 4LUJA 3EX1A 3W1PA 4K36A 5BOOA 4FX7A 1XM3A 4JIPA 1G69A 2DZWA 4O1BA 1XKYA 3TC7A 4OBTA 4ZQPA 3G18A 4Z1CA 1F6KA 1FBAA 3IIZA 3SGUA 3NVTA 3C3NA 4IXXA 3OG3A 1TJRA 1HTIA 4M7TA 1HO4A 1OX6A 5HJLA 1KLZA 5FI8A 2A7RA 4PCFA 5EL1A 4OGZA 5FF7A 4BR1A 3OEXA 3CM4A 3M5VA 3BGJA 3BG5A 4WOQA 5DY2A 1TPWA 2YYUA 3TJLA 1SSGA 1SPQA 4MVAA 2J88A 1GG1A 4UFMA 1PE1A 2A7PA 5I3KA 4MY9A 1T8XA 1JCYA 3JS3A 5C6MA 1GVQA 1PCWA 1KM0A 3C2EA 2VELA 5HQEA 2VFFA 5D2WA 3TMQA 3TW6A 2CU0A 2I9EA 1GT8A 3CEUA 1DORA 5DBTA 3DFQA 3GXTA 3C2VA 3DZ1A 1KM2A 1LLWA 1W3TA 2E5DA 3LXBA 4FX8A 4N9CA 4GNJA 3V75A 2QUUA 1QPQA 1L9WA 2QJGA 2ZYFA 1R2SA 3B06A 3NL3A 1OK4A 1VLIA 1OFDA 2Y88A 3KVMA 4YMZA 4X9SA 1IIGA 3W85A 5EYWA 4QNWA 5D33A 4ZQNA 1JUBA 2OJPA 4BF9A 3GIYA 3NQ7A 3T55A 1DBTA 1F7BA 5IM51 2G95A 2A6NA 3HBLA 3KVLA 1JCMP 5I3GA 4BI7A 2WO5A 3UQNA 1LBFA 1OFPA 2DZXA 5L6UA 5K9XA 3P61A 4YCOA 1SZNA 3RLUA 2Y62A 2Q8LA 2XFWA 3BW2A 1FCUA 4LRTA 5K7JA 3TKFA 1RVGA 4XBKA 1LTDA 3RNDA 1GQNA 4U28A 4N2YA 2F84A 4R34A 2BWGA 2DZVA 3QF0A 1GWJA 3DH7A 3C52A 3GVGA 5H2ZA 3N73A 2NUWA 1T0OA 3T7VA 1QO2A 4ZQOA 4WX2A 3W86A 3CLMA 5U7SA 2FIQA 5J5DA 2ZRVA 5FEPA 4ADSA 3VE9A 5D38A 4DF0A 3DKLA 3UD6A 2CZDA 4LVBA 2YGYA 1R30A 1PCKA 4JTHA 3TROA 1H51A 5AYYA 4QQ3A 4A22A 2GVLA 1W5NA 4MLJA 5D37A 2TYSA 3GB6A 1X1ZA 1ZALA 1V7YA 3N2MA 1TSIA 3WK3A 1YYAA 1H7RA 3G0XA 5AHIA 3C6CA 4JDYA 1VPXA 3IVSA 4WY0B 4BI6A 1OHLA 1UASA 3HG2A 3LLFA 3BK0A 3NPUA 4AHOA 3DKJA 3FKKA 4N9DA 4EWND 3GDLA 4OWGA 1QOPA 1T99A 3W2NA 3GDKA 2FQIA 1VYSX 2C1HA 3A9IA 1K7FA 2QCGA 5LHFA 4X2RA 3LHZA 2EPHA 3EX3A 4Z0JA 2HS6A 4O0ZA 5CSSA 3HPZA 3K30A 4WOZA 1TO3A 3NQAA 1VYPX 4JTTA 1DQXA 1TB3A 3LB0A 4AAJA 5KMYA 1QDSA 1W1ZA 3LDVA 4FXSA 3S1UA 3TAOA 2QF7A 1KBIA 2CLMA 2JKPA 3LHWA 1GYLA 4R33A 3FLUA 2CLOA 4MYAA 3TSBA 3SGZA 4AWTA 4DF1A 4ZMGA 1PIIA 1FCBA 4N02A 5LGZA 3EX6A 2QAPA 1DJNA 2FPVA 1MZHA 5EKYA 4XTIA 1JQVA 1KLYA 3LHVA 2V82A 3CQ0A 5HWJA 5LNSA 3LRMA 1Q6LA 2ZA2A 4UIOA 4UFJA 1FWWA 4UTKA 3M1ZA 4CNPA 5G2IA 5FF3A 3TQVA 4ORMA 3PULA 3NR0A 4IX0A 4DBEA 2Y7EA 3W1MA 3R12A 1TQJA 3TXZA 5K2ZA 1OFBA 3FYOA 4I9AA 5D02A 1RPXA 3W7QA 1GZGA 3EXSA 1R2TA 1EEPA 3H54A 4MY1A 5DXXA 4IUOA 3A23A 4IPJA 3NYZA 4HSOA 3RFAA 3U6WA 1H61A 3MMTA 3DHFA 2ZRUA 3NA8A 2QAFA 1TTIA 3IIPA 1ICQA 1VLWA 1O95A 2X2GA 3P62A 3W71A 4N4PA 4X22A 3BW3A 1F6PA 4QNEA 5D32A 3W84A 2JGQA 1W31A 3SR7A 2F7FA 1QMLA 1SFLA 1MEWA 1J4EA 4BK9A 1WQ5A 2E09A 4FNTA 5D2YA 4E2DA 2J6XA 4AXKA 3F4WA 1J2WA 3NNTA 4MIMA 3W1NA 5DELA 3O1NA 3L66A 2QCDA 1Z41A 3EKLA 3G8EA 3NL6A 3RMJA 3GNDA 2HSAA 4LRSA 4NJGA 1DV7A 3QC3A 3MI3A 2JBMA 5EMUA 1OFRA 3DFOA 2YFNA 2CLIA 5CGQA 3OIXA 3F03K 3GAYA 3FA5A 2D73A 4FO4A 3UWZA 2RHGA 3M6YA 2V2CA 4E38A 4GUHA 4GUIA 2TPSA 2C6QA 2ZRWA 2ZZ2A 4I7UA 3L0NA 1X7FA 4O1CA 1BEUA 4N4QA 3HIJA 3Q58A 2ISVA 4TIMA 4JTKA 4ADTA 3TNOA 4Y6GA 5D03A 5HINA 3NQDA 3NO5A 2B0MA 3S5YA 1EPXA 1H7NA 3GXPA 3C4UA 3T40A 3TA6A 3P84A 2G97A 2O7QA 1H1YA 1LROA 1FWTA 1W0MA 1L6SA 1QAPA 1QWGA 2EGZA 2DU2A 2RKXA 3B0PA 1UUOA 5D2TA 3CB8A 3E96A 1BKSA 4L4LA 4RXGA 4MPQA 6ALDA 1OFAA 1XCFA 4GC4A 2ZRXA 3P82A 4DXVA 1YTEA 3A21A 3Q94A 1O94A 3KHJA 2QKFA 4RCXA 4AHPA 3QFEA 5CSRA 2CZEA 3IGUA 5LNRA 1JCXA 4UFHA 1LYXA 2NUYA 1OK6A 1EX5A 1VZWA 1OG0A 2NX3A 3OA3A 3BLIA 1KTNA 4Y9AA 3ATYA 3IGXA 3YPIA 3UWYA 1KM5A 3QMSA 5AYXA 2X30A 1NFBA 3U8GA 2X16A 4PFMA 2AQWA 3W7JA 3TMLA 2E6FA 3W9ZA 3BLFA 3NQVA 2IQTA 4UNKA 1ME9A 1QPNA 3NQ8A 3W7RA 1QFEA 1X8FA 1KBJA 1YLVA 2FDSA 3LOTA 3B05A 2WV8A 4O1DA 3HG5A 4M6PA 3ATZA 1AL7A 5DCEA 3TJXA 1ZFJA 5AHLA 3LI1A 4UTMA 2NUXA 3LI0A 1KFKA 1EUNA 3E49A 4KFPA 4RKAA 1I4NA 3MHFA 1LDCA 2R14A 3MWAA 3PF3A 3W7DA 3W75A 3S8HA 4N9BA 4W9TA 4AH7A 4O54A 1FQ0A 3C2RA 1PL9A 1UJPA 1MSSA 2PRHA 1KM6A 1P0KA 4HKPA 1GVOA 1WX0A 1W3IA 4K37A 4J9JA 2H3BA 3KFTA 1KFBA 1KV8A 2EKCA 5HWMA 4IQLA 3DAQA 1KTCA 4S2BA 3MP5A 2Q3RA 4RR4A 1GVFA 3S6DA 3T44A 4NNCA 2BXVA 4OU1A 3NGJA 4ALDA 3KOFA 3ZS4A 4QITA 4JYEA 3W87A 1S5TA 2V8ZA 5GVJA 4E0CA 3W74A 2Y7GA 2AGKA 2QJIA 5FESA 3WK2A 3W88A 1OF8A 3LM7A 2VFHA 3QW3A 2Y6ZA 4R53A 3L68A 2TSYA 2X1RA 2A4AA 4JIQA 3LRKA 3B0VC 3HG4A 4H4IA 2XN0A 2GUUA 4K8HA 1TCDA 4OV9A 1ZNNA 3IIVA 2QEZA 3IVUA 3QSTA 4O57A 3LLDA 1GVRA 5F1VA 1TYGA 1FCQA 3USBA 1FXQA 3I7RA 3BV4A 1VCVA 2R8WA 4GUFA 3BG9A 3I65A 3O6DA 4H3DA 3L21A 1E51A 3PBVA 1ME7A 3W7IA 1QPOA 7TIMA 3W2UA 3S0CA 4JICA 2FB2A 2C0AA 3ABSA 3G1DA 3FYPA 1TTQA 5AC8A 1F76A 3LCIA 1D9EA 1EP2A 1LRQA 3VCRA 1SW7A 3TQKA 4PTNA 3HPXA 1QOQA 4PC8A 5A5WA 4YWIA 1B4EA 2OX1A 1XUUA 3F4NA 4JGDA 1RD5A 4Y90A 4LC8A 1L6YA 2ZQ0A 3TSMA 2VEPA 3TIMA 3W6YA 4O19A 4UTHA 4FNRA 3GDTA 4XTDA 3GDMA 1W8SA 4PODA 2BZNA 4JR5A 4G1KA 3HGRA 2GJLA 2LLEA 1D3HA 2CFFA 3M9YA 3UWUA 4HNVA 1WYIA 1ZAIA 2ZA1A 3KVKA 2JK2A 5AYZA 3HQ1A 3T4CA 4IXHA 4AMAA 2ZTJA 3MP4A 4K7VA 3QSRA 4OQVA 1JR1A 1SU5A 4HIBA 3TE9A 3A5FA 4N6EA 1FY6A 2ZBTA 2GOUA 2XN2A 2J9ZA 1YDNA 3NQCA 3EEGA 2YDAA 2DZTA 2YZRA 1TIMA 5AFDA 1O4UA 4EOUA 4FXRA 3FJ6A 5MHBA 5CZSA 4CNOA 5J5RA 3MI6A 4HNUA 5FEWA 1K8XA 3VNDA 1YTKA 2A6LA 2ATMA 3HPSA 1OX4B 3GLCA 4YCPA 3G0UA 4O52A 4K39A 1ZAHA 1S3HA 2I1OA 4S2CA 3ZFHA 4DF2A 3W22A 3WJSA 4X3ZA 2VFGA 2B7OA 3QM3A 2FB3A 3NPWA 4FB7A 3TUUA 5FEZA 4NUWA 1FDYA 4RXFA 1KW1A 5HUOA 3N14A 1RR2A 2TMDA 1VS1A 2Y85A 1LM1A 2H6RA 1IXNA 1THFD 3PR2A 5TQLA 1OFOA 4JTEA 2QJHA 2FJKA 3P5YA 1WBJA 3M43A 1ZHAA 2P10A 3NM1A 3LRLA 4NJKA 3RLVA 4NQ1A 1M5WA 3VKJA 3TFXA 2Y61A 5F2GA 2ZZ4A 2ZZ5A 3M47A 4XZ9A 3HJZA 3V1PA 3UNDA 1XDMA 2ZZ7A 3H55A 3M16A 5A8GA 1VQTA 4UTWC 3B4UA 3M0ZA 1G4SA 3S5NA 1KFEA 4CQ9A 2H3DA 2Y7FA 1XFBA 3FJLA 5I3HA 1AW5A 5F4WA 4D2JA 4O0KA 1LBLA 5K9CA 2QCMA 3T78A 2DZSA 2NXHA 3MHGA 5CG7A 1GVSA 2ZA3A 3RU6A 2P0OA 1OF6A 4BI5A 2C18A 4IX2A 4NZJA 3LCXA 5G4WA 1YXYA 2EHHA 3KRZA 4UMCA 2ZFAA 1K7XA 4IMDA 2CLFA 1GTEA 4O1AA 4NX0A 1ML1A 4UTUA 5BMWA 3I7QA 3WK1A 1FXPA 4GRSA 4NXSA 1W56A 2OT0A 4MJZA 4LV4A 1SO6A 2Y70A 1X1OA 4KWWA 4Q33A 2ZDRA 4M6QA 4WD0A 4CQAA 2GQ8A 1BTMA 3NXFA 3NQ6A 3WK0A 2I14A 3UWQA 5FF0A 4FX6M 1SO5A 3W7LA 1SUXA 3FS2A 4K38A 4CQ8A 4WY0A 3IIOA 5KTLA 3IIXA 1QCWA 3L65A 4QJ1A 1PS9A 2WOQA 3FFSA 4DPPA 3E0IA 4JTIA 3CWNA 3NG3A 1P5BA 4DO6A 3PAJA 1TPVA 5IBXC 1EA0A 4JTUA 4UTTC 5D2VA 3SIZA 3NL5A 4JEQA 1WAUA 4HN4A 4O15A 2J9XA 4NXKA 3ABOA 4A2SA 4K8EA 1TPEA 1VCGA 3OVQA 3NAVA 1MEHA 3L67A 4AF0B 1FWRA 5KZDA 2YR1A 4JTGA 4UTLA 5BRBA 4WXZA 3SI9A 4ZQCA 3D0CA 1AMKA 2Q3OA 3LTYA 4BWLA 2WSYA 3S1VA 1ALDA 2A21A 3L9CA 4DPQA 1TTJA 4GUJA 2X1UA 2V5LA 1UBSA 3QZEA 3QJAA 4YL2A 3QYQA 8TIMA 2E5BA 4RX0A 1OYCA 1W5PA 1Q3NA 2VFIA 3SW6A 2VXNA 1C29A 1VHNA 2H8XA 4GWEA 3EWYA 4UNLA 2WNZA 4JS3A 3DFNA 1TMHA 5KINA 2A2IA 3MBFA 1PVNA 3MP3A 4TMCA 3W7NA 4DO4A 3G0SA 2YW4A 3UZ5A 2DJXA 2B7NA 4NNBA 3UZJA 1GG0A 4MY8A 3UWWA 3E9AA 4Q4KA 3G3DA 1KFCA 2Y7DA 3TV8A 1FWSA 2WPBA 4RK8A 3SJ3A 4I7VA 2ZCGA 3LGEA 3PM6A 3W1UA 3RK8A 1MEIA 3W3OA 2E1DA 2PE4A 4FNUA 1FUYA 4ZL1A 3W1RA 4A29A 1SW3A 2CZ5A 3G1XA 1AK5A 5SWUA 4I7WA 1JQXA 2QCFA 1I2NA 1H7PA 4LUIA 5K4ZA 3IEBA 1VRDA 2Z1BA 2Z2UA 5FF4A 5LNVA 4TU1A 1H63A 4XKYB 3DENA 5DCBA 5BW6A 3PBUA 5E93A 1SSDA 1SZGA 2V30A 3I68A 1EB3A 1TREA 5F4XA 2BSLA 1NVMA 1PV8A 1QNVA 4XWUA 4C1LA 4JX5A 3EKZA 4MUZA 4Z1BA 1N55A 2QCEA 4FF7A 1G7VA 3HF3A 1C9DA 3M5ZA 1GJPA 4LT9A 4MOZA 1ZAJA 2NXGA 4ADUA 4O12A 4QAIA 2FPYA 4N9EA 3GKFA 5LNUA 3U2OA 1DHPA 1O60A 2ISWA 4ZZ9A 3ZR4A 1LLZA 4MZ8A 4HPXA 3A22A 5HR7A 2H90A 2V2DA 3I6RA 3O8AA 1L2UA 4M7SA 3BARA 1R2RA 2A5HA 5CPNA 4Q32A 4LNYA 1XL9A 1K8ZA 3PSVA 4HT3A 4IMFA 4DEFA 5TBOA 1KM4A 2EF9A 5KZMA 2RFGA 1YADA 4N6FA 5CZ0A 3C56A 5D09A 2C13A 4ICNA 3KRUA 2ATSA 6TIMA 3Q37A 3STFA 3TXVA 3B8DA 3GAKA 4OT7A 4A21A 4UFKA 3MO7A 1QR7A 1FDJA 3Q2DA 1HFBA 1R47A 4TX9A 3VI2A 4IOTA 4AEOA 1S5WA 5EPDA 4UR7A 5HUPA 5HWNA 2QCCA 2YW3A 4RZ5A 2J24A 3LHTA 1DOSA 1B3OA 3GK0A 4FEZA 4RLIA 4Z1AA 1Q45A 5G2WA 2CLLA 3KVJA 3P60A 5LGXA 5F2LA 3L0GA 5K3VA 4JN6A 2Q8ZA 4GBUA 2QR6A 2VENA 4HPJA 3R89A 3W7PA 4KWVA 3W2KA 3LERA 3H53A 4LWWA 1GYNA 2RDWA 1A5CA 1XUZA 3PWAA 4NJJA 3GDRA 3CT7A 1W5OA 2YSWA 2PCQA 2H8ZA 3G8RA 1P0NA 2JGYA 4IMGA 3G24A 1JULA 4JDBA 1R46A 2P1FA 2ABAA 3W7OA 2A0NA 1EWDA 5I3IA 1G6CA 1JRCA 1KTBA 3MBDA 1TJPA 3DFSA 3MYPA 1TPDA 3M5XA 5KSWA 5AB3A 1H7WA 3QRHA 3NZ1A 2HMCA 3L5AA 4DQWA 1VR6A 2YCEA 1SO3A 2ZTKA 1VYRA 3TX9A 1Q6OA 1JCJA 3S5OA 1BWLA 4LVFA 4CCCA 1LOQA 3TAKA 3TK7A 1NF0A 3VFLA 2PURA 4IPIA 5BNKA 4LS1A 3E02A 4Z1DA 1B9BA 1U83A 4PL1A 4AB4A 4JXCA 1F74A 1EP1A 4DELA 2E5CA 1LRNA 4JX4A 3TFCA 4JNMA 2FLIA 3OHIA 4ZVJA 5CZTA 4CCDA 3DGRA 3TR2A 1H7XA 2A1YA 4B5NA 2ZZ1A 3AO0A 2WNNA 2GVJA 3LBMA 1IIHA 2JKEA 3W7EA 3UY8A 4LVGA 4O28A 2VFDA 3EX4A 3CIWA 3PUDA 1LZOA 3GNNA 5G2HA 3NQMA 3PUOA 4FHAA 2CZFA 5DBUA 3M41A 3R5EA 1AG1O 3W7CA 1H62A 3L5LA 1A50A 4KFNA 1I2PA 5G4EA 3W1QA 3LHUA 1TPB1 3A5VA 3S1XA 3F1QA 4O53A 5FEXA 2Y89A 5G1TA 5CPMA 1G7UA 3DHDA 3UWVA 3S9YA 4RZ6A 1OFQA 1V5XA 2HS8A 5G5IA 3G1SA 3UYCA 3NZRA 5CPLA 1AW2A 3C61A 1W37A 4UCGA 1M7OA 2ABBA 2PRMA 4O4VA 5F4SA 3SY5A 1CW2A 1H5YA 1D3GA 2ALDA 4GE8A 2RDUA 3SECA 3INPA 4JX6A 4Y8FA 4IWWA 4K6AA 2R94A 4XQ6A 1Z42A 2VKZG 1ME8A 2ZZ3A 4KKXA 1NF7A 3PB0A 1AL8A 1NSJA 2YYTA 3GR8A 5D04C 4UFIA 4UTIA 2WSRA 5LHEA 2C14A 3C2FA 1OABA 3ZWSA 2RH9A 3CEPA 5KZEA 1XBYA 1CX9A 3OVPA 2QUVA 3G1YA 4UMAA 1N8FA 1M6JA 2XN1A 4LC6A 3PSWA 1F05A 4ZQMA 4WQ6A 2NX9A 1WOBA 3S42A 3QH2A 2OMAA 5AHFA 2NLIA 2QCNA 3HB9A 4TMBA 2J27A 3CC1A 3HO8A 3P8IA 5HULA 5F1UA 3FKRA 3LHYA 1PHWA 4QM1A 1YXCA 1LCOA 4ZQRA 4UR8A 3W7HA 4LU0A 3UPBA 5CPOA 5DY3A 1JUKA 1AW1A 1NAL1 3QEZA 4BFAA 1FCVA 3O07A 2YPIA 5CZJA 4O50A 4LY8A 1XDLA 2WJZA 2G96A 5AHMA 3W2MA 3M7WA 1HG3A 4O17A 2C16A 3L0KA 1KM3A 4MLRA 1K02A 4LS2A 3NQ2A 2VC6A 3I7SA 3NEVA 5C5YA 3IVTA 2V9DA 4R7JA 3GXNA 2E68A 3BGGA 1OX4A 3PC0A 4LVDA 4JYFA 5AOUA 3NPVA 4OV4A 1OYBA 3NDOA 3LTPA 3FEMA 1TV7A 1B4KA 3O16A 3EWUA 2QUTA 1A5BA 1CI1A 1KM1A 4HHPA 4E2BA 2OCZA 4LVAA 3MI2A 1OJXA 3N19B 4MYXA 2BTMA 2A7NA 5HNRA 2CWNA 4P2VA 1LRTA 2R91A 4IGHA 2BLEA 3DFTA 3N9SA 1ZCOA 1TV5A 1U5JA 2VEMA 2EAWA 4M5PA 2FPTA 5LSMA 4H6KA 3ABQA 1IXQA 3THQA 1SO4A 4AVFA 1JCLA 5I3JA 1SW0A 4O8RA 3SSJA 3G1AA 1OVDA 4M19A 3CPRA 4MFEA 4O10A 1RQHA 2W6RA 2X1TA 3TU9A 3UY7A 4NX5A 1UB3A 3EXRA 4HSNA 3JR2A 4O11A 4YLWA 2B4GA 3RF9A 3TH6A 5D2XA 1FDZA 4PH6A 2C15A 3TW7A 2GQAA 1G4TA 3W72A 3HGJA 4JYDA 5HMSA 1W5MA 2YXGA 1HO1A 2NX1A 4FIQA 1ZENA 3NQEA 4JTFA 4AHQA 5LNWA 3DFPA 5F2MA 3W1AA 4UTJA
chains in the Genus database with same CATH superfamily
5HNNA 2YX0A 3G22A 3MSRA 1XR2A 3MT1A 1US0A 1XBVA 3WFLA 2QCHA 1Q8JA 5E5CA 5HANA 3UERA 2XVGA 1DQWA 5I3FA 3STCA 4A3HA 3W1XA 1T5AA 4OIFA 4GUGA 3EB2A 3N6QA 3OZPA 5C54A 4H9ZA 4ZSUA 5AC6A 1J93A 4QSFA 5DCDA 1H0GA 3F5KA 4P7QA 1YX1A 3HOJA 3EEZA 4KRUA 1RVKA 2Z0IA 3LCFA 1LOSA 2UV8G 3ZMRA 1AZ2A 3CUHA 1RY8A 2Z2BA 4JFSA 5T91A 4W85A 5K9DA 3WUGA 4MZ1A 2YFOA 1JI2A 2OZ0A 1YNYA 2GZXA 1MWOA 3OA5A 1HUVA 2DJLA 3SZ8A 3WQ6A 1XLHA 4F8XA 4C6KA 2XFYA 3CTLA 1JZ6A 3N4AA 3RAOA 4GFIA 1J01A 1O1HA 1Y5WA 3BVJA 2WC4A 2VEIA 4GXMA 1L6WA 4IJBA 4QJ4B 4L5ZA 2CLHA 1EJWC 2PRLA 1RJPA 4PMJA 3SFKA 4TXEA 2AAMA 4O16A 4Y9MA 1X6UA 2DUXA 3EX2A 4I9JA 4JD4A 4AZIA 3WBYA 4AWSA 3P5ZA 1DVJA 3R13A 5KITA 4CQBA 2QDHA 5D9MA 1R38A 4RV8A 3VGFA 2NV2A 3GG0A 3GTNA 1F5ZA 2FHBA 4M8UA 2QCDB 1XBZA 3MYOA 3O6YX 4LV9A 1I2QA 2J8TA 4RZ4A 5LKYA 3UF9A 3PTQA 3C3UA 2J4GA 2XZ9A 2J7HA 2PBOA 1OQFA 2CW6A 4KCWA 3M0JA 4XUGA 4TR9A 3KRSA 1MQQA 3EWBX 3PZNA 1H50A 3KL3A 1RQBA 1UC4A 3KOYA 2E25A 1ICPA 3ABRA 4W7UA 3WUBA 4A3UA 4QCEA 2CBVA 3W7KA 2RJGA 3TCEA 1A5AA 2C3ZA 1MUWA 4WY0F 2Z4GA 3PZTA 4OOZA 2FTPA 1ICSA 2CHOA 1VFHA 2F38A 1PZ2A 4GYJA 3UZXA 1RP8A 2OFJA 3RCYA 4QCFA 4NZFA 1TUFA 1XS2A 2RJHA 5ABFB 4H8NA 3OGSA 3CAQA 4K7YA 1XRFA 4U10A 4FOUA 4QE4A 4QTGA 2ZRZA 4PE8A 1LOLA 5D30A 3S9ZA 2E6YA 3UXLA 4Y9NA 5EY5A 2YZ5A 4ZB2A 2NV9A 3O06A 4EVZA 3H70A 3NQFA 2P3EA 4WJXA 2ACSA 1TPFA 3C2YA 2Q8XA 3MCOA 5FJOA 1GW9A 1SFTA 1YXDA 3ARPA 5I5RA 4NZCA 1S39A 3TR9A 3RGTA 4GY0A 5B7ZA 1H0IA 1W32A 4DX3A 3EXTA 4XX6A 3T1GA 2PWFA 1U30A 4P8XA 1MRAA 4LAMA 4Q6JA 3OBKA 1XC4A 5DMYA 1BF2A 1Q4WA 1VCFA 4LOCA 3MUXA 3WBAA 2X42A 4GZIA 4NZ1A 4O8AA 4V2XA 5CLWA 1D7FA 3IUIA 1EDQA 3TYCA 1KFJA 4NVTA 3A12A 3T0AA 3BLKA 5H1WA 5D8ZA 2PAJA 3TJ4A 4YXGA 3E1F1 2WNQA 4UTWA 3VIFA 1B1YA 2YKKA 3GZ3A 4Q3MA 1JJKA 4POCA 1G9HA 1BVZA 3VOCA 2E67A 3VGGA 3O6CA 3CZGA 4Y9PA 4HMNA 4FZIA 4ORIA 1XIHA 1E4IA 2JIEA 3NL2A 2PMQA 3AJXA 1AD4A 3VNLA 3IGSA 2XH0A 4HOZA 1UKPA 4AEEA 4JCLA 3SBFA 5FF2A 3CPGA 3VE7A 2VEKA 5U4NA 1ODUA 2EBNA 4UOQA 1RZMA 1SZFA 4D1JA 3W23A 4FNPA 1JD9A 3WQGA 1YDVA 3A24A 1KV5A 1F73A 4AD2A 2I5QA 3S5ZA 1LUCB 2NV1A 2X40A 2O7SA 4RE2A 2C19A 3NQBA 2G3IA 3GM8A 4P61A 1G67A 1RV8A 4EF9A 2F6XA 5EBAA 1JRBA 1AZ1A 4KEUA 4WR3A 1JCNA 4M3PA 2XG9A 3N6HA 1LP6A 1B57A 2WKJA 3C2OA 4ENLA 2H9AA 4ZO6A 4INFA 2A3AA 4QBXA 3HG3A 4GISA 3WIJA 4YHEA 5JU6A 5C7HA 1HL2A 5IBXA 4JN7A 1IXPA 3EMZA 1T7LA 4MKSA 2YL9A 4IIGA 4US5D 5AHNA 1P1XA 2BX7A 1I8JA 3QY6A 2J6VA 4AWEA 4IUGA 2Z6IA 1P4CA 3GYEA 6A3HA 2FH8A 1XKJA 1NWSA 4D6HA 1QO5A 4MNKA 1DJXA 1VIWA 3XISA 1IGSA 2CCRA 2XSXA 3K46A 1MFUA 3GFZA 4L6OA 1G69A 3TC7A 2PI6A 3G18A 1DJYA 2GJPA 1YQ2A 2G4JA 5FIPA 4JKLA 3FCPA 1BFNA 2WVVA 2NT0A 2GJRA 5IDZA 3VZZA 3SGUA 3ZQ9A 1XIJA 1BPLB 3HURA 5EB8A 1BYAA 2ZICA 1PIFA 4WK9A 4Q8MA 3NUKA 2YBVA 6REQA 1JYNA 1TWDA 4C6PA 3I6EA 4OGZA 3V16A 3SCOA 2A3LA 3GVWA 3BG5A 1SSGA 1DJWA 4J3ZA 4AFYA 1GGOA 3TOPA 3HM7A 1VAHA 5C6MA 3AZTA 1DJHA 3A4XA 2UBPC 2BNJA 2IKIA 2VELA 2VFFA 4V1XA 2YOCA 1WZLA 2PDJA 3BAYA 4Z17A 2HQAA 1JAEA 2OLAA 1MUMA 3CEUA 1TJ0A 4IFOA 1DORA 3GXTA 3C2VA 1ISZA 4FX8A 4GACA 3ITCA 3B06A 1L9WA 1B0IA 3WQ8A 4W7WA 4LXFA 4QFUA 1KD0A 4X9SA 3QV7A 1OC7A 1P7TA 1O1ZA 1ZQ5A 1MMFA 1W3JA 1A47A 1B3VA 5C9RA 1LLOA 3T55A 1X1NA 5I24A 1JCMP 4F0LA 3UQNA 3URBA 2AKMA 1LBFA 3QOKA 3SQMA 2IXUA 5K9XA 3EWDA 3SN0A 4QG9A 4DUXA 4CKQA 2FTYA 3ZYZA 5M2FX 3BJTA 1P1MA 1UH3A 1A5MC 2XFWA 3MSDA 5A6LA 2EXOA 1GK8A 1GQNA 4R34A 1B3ZA 1W2PA 1S2AA 3QF0A 1LQAA 3BTNA 1JNDA 3DH7A 3GVGA 3K8LA 3N73A 1WKEA 4PUWA 4ZQOA 3T7VA 2CPUA 2PWEA 5C0QA 3MQTA 3UW6A 5J5DA 2EG7A 1T8QA 3QGKC 1YRRA 4LANA 3SADA 3PNUA 3L23A 3RJXA 3VVGA 5D38A 4DF0A 3MUIA 4CD8A 3NWRA 9XIAA 1R30A 3TCSA 1CIUA 2QS8A 1PCKA 3RCNA 4REQB 3LMZA 1B3XA 2CBJA 2HBVA 3UZYA 2CLPA 4GH3A 2TYSA 4AMCA 3A3XA 3GB6A 2PDKA 5D4YA 4HA1A 3N2MA 1BXCA 3T42A 2DSZA 2GSEA 3G0XA 1JL8A 2DEPA 3PBGA 2ZADA 4RUBA 3LLFA 2QHAA 3GDLA 4OWGA 4GQGA 3G77A 2FQIA 2C1HA 3A9IA 1K7FA 2QCGA 4X2RA 3V35A 7ODCA 4Z0JA 2BVTA 3SY8A 1KGWA 1PO9A 3K30A 5J04A 3PZOA 3BCFA 3B8WA 3FGCA 3S1UA 5CC6A 3N2CA 3VXGA 2QF7A 5A69A 4HPHA 4AZHA 2EPMX 2ACRA 1QJWA 1FCBA 1UWUA 3EX6A 2XZ7A 2FPVA 4HCHA 1DTUA 2WC7A 2RUSA 2Z1XA 1KLYA 2ALRA 2V82A 3R8GA 2V67A 2ZA2A 4UIOA 1Y65A 2CHNA 3M1ZA 2PLKA 4DRSA 4K2SA 3NR0A 4DBEA 4L9XA 4L1WA 2Y7EA 3W1MA 4MJ2A 1G94A 1TQJA 3TXZA 4HPGA 3FYOA 5A6KA 4QDPA 5T9CE 4PTVA 1EEPA 3GS6A 1S2VA 3ZVHB 1SR0A 1XSIA 2IUZA 3GC4A 3LSCA 3U6WA 3MMTA 4NZ5A 3H2OA 2ZRUA 4DYJA 6CGTA 4WDXA 1TMLA 1PAMA 4MDPA 1O12A 2OODA 1O7AA 1TZ9A 5C2CA 4EWJA 2AGTA 4LCQA 1F6PA 3LPPA 5A95A 3W84A 2G3NA 1EOMA 3GH5A 3WD2A 2EO7A 3K8KA 3S2JA 2Q02A 4AXKA 3F4WA 1Q2SA 4LCSA 1DIEA 4ZO7A 1KO0A 1OINA 2JE8A 3G8EA 5ECUA 1A4LA 3GNDA 4Q4QA 3IK4A 1V8EA 4OZOA 2GDVA 3UXIA 1K9FA 3QC3A 4M82A 5DX7A 5CGQA 3UWZA 3WL0A 3WUEA 4B9ZA 5A6SA 5CSUA 3M6YA 4GUHA 2ZZ2A 2ZRWA 3FEQA 4AISA 3IWPA 4TIMA 2J66A 4QDMA 2QXWA 3CUFA 4V1YA 3DUGA 2PF0A 4HZ7A 2XWDA 1Z9AA 4Y6GA 5HINA 1R85A 2B0MA 1H7NA 3T40A 1AJ0A 3TA6A 2O7QA 2GVYA 1VEPA 2EGZA 2DU2A 4RXGA 4MPQA 1OFAA 1XCFA 4JHZA 1BXBA 4C6DA 1PWMA 3T05A 1SJCA 1TIWA 3BLPX 1XDJA 3UR8A 3QFEA 5EMJA 4PMUA 3IGUA 2PPGA 5HNTA 3FDKA 1LYXA 2NUYA 4RDYA 4BHYA 1OG0A 2NX3A 3OA3A 3BLIA 1KTNA 4ZE5A 3I4KA 3W37A 1F3EA 3DOPA 2AOSA 4DZAA 2X30A 3F5LA 1K8CA 2PLMA 2DPEA 1DWGM 4PYSA 3W9ZA 3KWXA 4UNKA 3VD9A 2W3ZA 3UVAA 1QPNA 3NQ8A 5BU6A 2XINA 3WZ0E 1X8FA 3W28A 1YLVA 2FDSA 5BOFA 2WV8A 4LBRA 5C7VA 3WDHA 4M6PA 3N2BA 4YTSA 2XYLA 3BMVA 3TJXA 1UWRA 3LI1A 4Q4RA 2VCCA 3E49A 4US5A 1IEWA 5GQBA 3MWAA 3W75A 2PGEA 1UMYA 1EO7A 2GYIA 1RA0A 5I23A 3S5SA 2P8CA 1GVOA 4KGLA 5HPCA 4GZEA 4IQLA 3DAQA 1KTCA 1RK5A 3LM3A 3APTA 3MP5A 2Q3RA 3L2LA 2C71A 3FHAA 4NRRA 4MNJA 5BWFA 3UJSA 3WNMA 1XIDA 1UZ4A 1RPKA 4QITA 3WEOA 3CV2A 4JYEA 2ZUNA 2PZNA 3U2CA 3W74A 2Y7GA 4NILA 3ISIX 4FAMA 5FESA 1E1EA 3WK2A 3IRSA 3W02A 1ADSA 2HK1A 2YXOA 4KRTA 4JIQA 3LRKA 3B0VC 1WZKA 1JD7A 3KOXA 4OV9A 1QATA 1RSCA 3IVUA 5F1VA 3LLDA 1YNPA 1TYGA 3USBA 1FH7A 3I7RA 3C5QA 1J18A 3L4YA 4GUFA 3I65A 2O9OA 2ISDA 4P8UA 1ZPTA 2QUMA 1VBUA 1K9TA 4QRNA 1CLKA 3W7IA 4K68A 4G7EA 1QPOA 4HJWA 7TIMA 3FXGA 3W2UA 3S0CA 1J9YA 3CYJA 4YTQA 4J3VA 3GTXA 4A8RA 2YLAA 4EPDC 4Q6XA 3QLLA 1EP2A 4PMXA 4B5SA 4PTNA 3VPLA 3MKCA 1S1PA 3PTMA 2WSKA 2DZAA 4TQTA 1XUUA 4X60A 4MB4A 2ZQ0A 2VVSA 3TIMA 4YVXA 4AX6A 1ISVA 3BE7A 2DFAA 1F07A 2OWCA 1R9XA 1IZCA 1XYLA 2GJLA 2LLEA 2OGYA 1X97A 3PN8A 3M9YA 3QXBA 4HYVA 2ZA1A 4CQCA 2JK2A 2XIBA 5H6HA 1XQLA 1XW8A 4HYWA 4LUTB 2E28A 4CQDA 4MMWA 3TE9A 4HIBA 2QDEA 1S38A 3A5FA 3QTPA 4N6EA 4GXWA 2GOUA 2XN2A 1K70A 3GNXA 4NF7A 4OVXA 4FP1A 2J9ZA 1YDNA 2Z26A 3EEGA 3PNZA 5CQ1A 1E55A 2Q01A 3TQPA 3D3AA 2J62A 5AFDA 4EOUA 1MDLA 1KRBC 1OADA 2OKTA 1RY0A 3EOEA 2ZWZA 1K8XA 2VD9A 3VNDA 2ZX7A 3E5BA 3T4WA 3VIKA 1XLEA 3G0UA 3W53A 4EPBC 4O52A 4K39A 4FLSA 3CK5A 3N4FA 2DSKA 1PTAA 4PULA 2WMFA 2XHYA 3H26A 4LY4A 4L1XA 3NPWA 4NI8A 5CLTA 3TUUA 5FEZA 4NUWA 1FDYA 1KW1A 2YXXA 5HUOA 4GPNA 1VS1A 1OZMA 2YDSA 1JZ4A 3UA3A 4BQ5A 5FD0A 4D6DA 1BQCA 2Q71A 5TQLA 2X05A 3FA4A 3GTHA 3P5YA 2XH4A 3NM1A 1VFOA 1TWWA 8XIAA 3IJ8A 3OODA 3VKJA 2Y61A 2G3JA 3AYVA 1CXFA 3I10A 3GHRA 2CC0A 2ZZ7A 4DI9A 4E8CA 5A8GA 1P0DA 4F0MA 1U1UA 3M0ZA 3G1RA 2ON3A 3KUMA 3FJLA 1MDRA 5F4WA 4PRRA 1LBLA 4UQDA 4XZWA 3DYOA 4X2PA 1BVWA 3MHGA 2ZA3A 3E2RA 3WBEA 5MKGA 1I0DA 3UG4A 4GY1A 3R7MA 1W1PA 2VGBA 4IX2A 4NZJA 1RLDA 3S2MA 3BLLA 4KESA 3KRZA 4D9PA 4HGXA 1GOIA 1R9YA 2I5GA 4IIBA 1PX4A 1KC7A 1GTEA 1LT7A 1ML1A 5BMWA 4GRSA 2OT0A 2WQDA 4LV4A 4KWWA 1QK2A 3W01A 4Q33A 4M6QA 3EAUA 3GRIA 1IE7C 7A3HA 2AMGA 3SO7A 2OKOA 3NXFA 3NQ6A 3WK0A 3VNKA 3GYCA 1DWIM 5CC7A 3EA2A 1SUXA 4B4FA 2EPOA 5H8MA 4WY0A 3IIXA 1QCWA 4EXQA 4XSMA 3VAVA 4CN4A 4DPPA 5LA1A 1D7KA 1XG4A 3NURA 4QE5A 4DO6A 1AFSA 3BAJA 1C8XA 4P7NA 4URIA 1ITQA 1BWVA 4JEQA 3GNOA 1WAUA 2J9XA 4QXIA 5BZAA 3SFWA 1TPEA 1XRSA 1MEHA 1W1YA 3BAWA 1JPMA 4PCTA 5KZDA 4B90A 4US6A 1D8WA 4XB3A 4JTGA 3POCA 4WXZA 1J0KA 3ZR6A 3D0CA 4EX4A 1AMKA 1NTHA 4AD0A 2WSYA 2A21A 2QGHA 3KW3A 2GL5A 3WNKA 4PUNA 3G5EA 4PUKA 1E4LA 3AWNA 3QYQA 2V3FA 1IEVA 2E5BA 3CZEA 1U5HA 2VFIA 3WQCA 2VXNA 3EWYA 1HNYA 1U1HA 3DFNA 1YE6A 5KINA 2A2IA 3MBFA 3AXHA 3G6LA 4B4HA 2B7NA 3UZJA 3WL1A 2DV0A 3BCDA 4MY8A 2OEMA 3E9AA 3ICJA 4Q4KA 3ONBA 2QQ6A 1I60A 4H8VA 1QI0A 3QQWA 3WMCA 1MEIA 4YVVA 4FNUA 1FUYA 1QNSA 3W1RA 1SW3A 5IDIA 1UP0A 4B3LA 2WMIA 4TV6A 4X63A 4I7WA 1H7PA 1VRDA 2Z1BA 2Z2UA 4LYKA 5CBJA 1E40A 4AC7C 4PGLA 4C60A 2FVMA 5AC5A 1SSDA 2V30A 4UZSA 4KCVA 2ESCA 3N29A 2OO0A 1R3RA 3NXLA 4NL1A 5JH2A 1PSCA 1XIIA 5LA0A 3EKZA 4FLOA 1V6YA 3BDKA 5DEZA 2QCEA 4FF7A 3UCDA 2ACUA 4ZSTA 3GD6A 3HF3A 4W8LA 3M5ZA 1GJPA 4C65A 4YIWA 1JEZA 4MOZA 3ARXA 4O12A 5E9AA 1H41A 4L56A 3U2OA 3RLHA 2GJXA 3R8HA 1DHPA 4IF2A 2ISWA 3IJ7A 3BSHA 1KBLA 3ZR4A 1JZ7A 3PTKA 4MZ8A 2PWDA 1ZL1A 2XGZA 4M7SA 4OBSA 3BARA 1R2RA 3GVQA 4ZE4A 3TJIA 3CUIA 1XL9A 2D69A 1QI3A 3PSVA 4IMFA 4IIEA 1PKMA 1KM4A 3AAMA 1Z32X 2PTXA 1ZBWA 4N6FA 2OSXA 1XF0A 2GDQA 6TIMA 3A64A 3STFA 3B8DA 4OT7A 3S2NA 4D71A 1M04A 4S3DA 2PTZA 3RUBL 5I3DA 4I8YA 5HWNA 2QCCA 3IJ9A 3GK0A 5FAJA 4G56A 4LNCA 4MB1A 3ANUA 5EMLA 3NIYA 1REQA 3KZSA 3P14A 1OEPA 4JN6A 4H9YA 3R89A 5CAHA 1OCQA 4ASTA 1VB9A 2VR2A 3CZJA 1KQYA 4MDOA 2B81A 1EYEA 3AMLA 3W25A 2PDGA 4HB7A 1P0NA 4GGBA 2WKLA 4DUWA 1R46A 2WW5A 3WLIA 2P1FA 3W7OA 4FLQA 1EWDA 5KZ6A 3OZOA 1B9ZA 3MBDA 1TJPA 3E74A 3AS3A 3QRHA 3ES8A 3L5AA 4DQWA 1SO3A 3S5OA 3S1GA 3N11A 4GMEA 4AYSA 3WLOA 4TUFA 1B9BA 2H9AB 4PL1A 3B9AA 1UWSA 3UXKA 5AZ1A 3GNRA 3QHNA 1LRNA 3QY7A 4JNMA 1TV2A 3UU0A 3LZ3A 4C7GA 3PPHA 4KCUA 3VNYA 4QLJA 4TOQA 3AXMA 2OEKA 3NZPA 3OHMB 3UZWA 1IIHA 4O28A 2VFDA 5RUBA 1KCKA 3PUDA 4LAZA 2DQWA 1NIUA 5JXQA 3NQMA 3PUOA 2NQ9A 2CZFA 3MV11 1QI2A 1H62A 3L5LA 4KFNA 1OCBA 1TFVA 2AL1A 2X7VA 2FZMA 4DHGA 1O6IA 3F1QA 4JHOA 4O53A 2I5IA 1OGBA 5G1TA 1J6OA 1W17A 3LG3A 3EOSA 1V5XA 4FPSA 4HMCA 2WVVB 3UYCA 4UQCA 3QHMA 1HP5A 3GXDA 4IQJA 1GQKA 1E56A 4IJRA 6REQB 5T9BG 4F2BA 4QJ5B 1JNEA 2PEVA 4K6AA 5F7UA 1CWYA 1D8CA 1ME8A 2DH3A 4KKXA 1EGMA 1NSJA 2YYTA 2WWDA 3GFXA 4OFCA 5BXPA 4FSAA 3O0KA 2WSRA 3C2FA 3WMBA 1S5MA 1QU4A 1E9ZB 4J5NA 2VRQA 3BAXA 5XIAA 3CEPA 5KZEA 5AC4A 5C8BB 1FKXA 1UJQA 1WDSA 4ZODA 2W5FA 1E9IA 2XFRA 2XIQA 5HA7A 1F05A 4ZQMA 3E0WA 1WOBA 4UBPC 1JPDX 1Z69A 3HB9A 2NSXA 3BLDA 3GNPA 1DEDA 4HU0A 1LCOA 4ZQRA 4RE3A 4UR8A 1HVXA 4IIHA 3UPBA 5DY3A 5I03A 4CU6A 1A49A 1IT8A 4LY8A 1P0EA 1XDLA 3UETA 1V6VA 4O17A 3WG6A 4MLRA 1E73M 1UZ1A 2ZUSA 3URAA 3VD4A 2VC6A 4R7JA 1W9DM 1Q13A 4WHBA 1OX4A 4ZB5A 3CMFA 4CCZA 1V08A 3LTPA 2C8NA 3O2LA 1A5BA 2IKGA 1Q7QA 1KM1A 4DYKA 4E2BA 2OCZA 4J2MA 4LVAA 5M5DA 1LQ0A 3EDJA 4MYXA 4R9OA 4GKLA 4AC1X 4F0HA 1TWZA 4HHLA 1DTNA 2WHKA 1OD8A 2V6AA 5CBIA 4LB4A 4UOJA 3V4BA 1ZCOA 4J4KA 4KRZA 3GDBA 3TYAA 1IXQA 1SO4A 4JL2A 4AVFA 2X0YA 1JCLA 3AIBA 4GQ0A 3B9NA 4O10A 3LNMA 5I77A 1CGUA 2BGSA 3TU9A 2WMJA 1XLJA 4LALA 3EXRA 4YLWA 3RF9A 3EDEA 1FDZA 4PH6A 2AKZA 3SURA 1G4TA 1ZP4A 3ZVIA 1W5MA 4W86A 3P0WA 1NELA 2PLJA 2PP0A 1HO1A 2O0TA 1ZENA 4JTFA 4AHQA 4IQEA 1Q7MA 3VMOA 5LIYX 4C7DA 3IK2A 3W7GA 2D22A 3DXIA 1FWNA 3W2JA 1UIOA 1SMDA 3BO9A 3WQFA 4MWAD 1EXBA 2HTMA 2V5BA 3LPOA 4EF8A 3FGCB 5JBFA 2QDGA 4JTJA 4O14A 5HQLA 3BLEA 3HTWA 1ELSA 3PHAA 3LPFA 3WQOA 3ZM8A 3U57A 1DIDA 5I79A 1OGGA 3PVFA 2VGIA 2PC8A 5H91A 3REQB 4U33A 4LBSA 4ZBCA 4Q7NA 3QOMA 4QAWA 1FH9A 1O5XA 3WQWA 1JCTA 4L65A 4S23A 1OGSA 3CQJA 3BW4A 5DT5A 3WENA 1XBXA 2HNEA 2DORA 1EIXA 3E0LA 4DM1A 1QPRA 1XYMA 5G4HC 1V6XA 1EA9C 1XPGA 3C0JA 3EZ4A 4F40A 1N8WA 1MW2A 4KT2A 3KE0A 1KA9F 5A8OA 1QK0A 4Q8PA 1W91A 1EBGA 3CUXA 2UY5A 2P3ZA 1I2RA 4Q7BA 1XLFA 1D2KA 4CD5A 1GTHA 3KX6A 4UFLA 3FA3A 4AF0A 1X8CA 3T08A 1XINA 3WD3A 5AC7A 2RDTA 2BHYA 3PBWA 1C7TA 3B8VA 1GW1A 4DJEC 3WBXA 1YPFA 4QROA 1ZJIA 1W2VA 3W29A 2O9TA 4NU7A 2XWEA 1TTPA 3PUGA 3AIEA 3MCNA 1YTDA 1TPC1 8CGTA 3HN3A 3I3EA 3OLDA 3WLMA 1V3HA 1SM9A 3W07A 2W79A 4RW3A 4S1FA 2E7FA 1DHKA 3TDFA 3QQ1A 4LBUA 3O63A 3KS5A 1WDWA 3VC6A 4FOJA 3E12A 2Y1HA 3D3FA 1UG6A 1NWUA 3HGSA 1T96A 1H2JA 1DJQA 3VOIA 4HNCA 3S1WA 2BY2A 2VURA 4O18A 2CIPA 5E0KA 3MJYA 2W0UA 1UUMA 2V2HA 5KETA 5C2GA 1SVDA 1J5TA 4PEKA 1ONEA 1WXJA 3TC3A 3W76A 3W73A 2ZUWA 4AD1A 1WV2A 3G3MA 3P8JA 4EAMA 4JQ4A 3CU2A 1GZJA 1PTDA 1XIGA 1AJ2A 5AN7A 2X2YA 3KDOA 4QJ3B 3R43A 4B5TA 3HGOA 3M0KA 1KR0A 2HROA 1JG9A 3UG5A 1DL3A 4OE7A 3WJYA 1A5SA 5K4XA 3FJ4A 4LS0A 5JVLA 1M65A 3F2BA 3QW4B 4C7FA 3TVAA 4CNNA 4HD5A 1R3YA 3NPXA 5IRPA 2HCVA 1ZBCA 3KBMA 4U31A 1J0JA 3SCUA 1VF8A 2G8ZA 3IJDA 3KL5A 1CGYA 5C55A 4UCFA 1F2JA 2BHZA 5IFTA 1GJWA 4QDWA 1Z44A 4W87A 4FNQA 3QQ0A 2PWUA 2QT3A 4MKNA 4JTDA 2V63A 3GH4A 3DGBA 1S5VA 3TC6A 1EJVC 2YCLA 3TEVA 5F2IA 3UG3A 3A4WA 4C1KA 1T41A 3H21A 3W1TA 3W83A 5ABTA 2E6AA 1BWKA 1QWKA 1UQZA 3B4YA 2HWGA 1FWAC 4RDZA 1G4PA 1ZY9A 3NQGA 5FKYA 4PB3A 2Z2AA 3IJIA 3F4DA 1QT1A 3EPNA 1AQFA 3W70A 3L5MA 4IPPA 3STGA 4UTFA 2GK1A 2ZX8A 3LN3A 1K8YA 1E4MM 4D6EA 1W3HA 3KXQA 3O05A 4ERGA 1UQYA 5IHSA 1PDYA 5DN1A 3ZWTA 1IV8A 2NXIA 2POTA 3VGBA 3DI0A 3P74A 3CHVA 3TTSA 8RUCA 4DO5A 3LXCA 2YDQA 3H24A 3AALA 4JTLA 5TIMA 2EJAA 1E1FA 4NJIA 4JQAA 1TRDA 3BPWA 4NNAA 2VX7A 1W5QA 4G7EB 4BWLC 3OLIA 4ILSA 4CCEA 2CKRA 1V3LA 4Z1YA 3LQLA 4FNSA 3CT2A 2NZLA 1I9CB 4O0QA 1NDZA 3B04A 2DW7A 4GO9A 4RPQA 3U5YA 3PG9A 2DZPA 3PB2A 4IZGA 3THAA 3TSDA 2QCLA 5B7YA 3TQ0A 1P0BA 1NWTA 4ATLA 1V02A 2BBFA 4CNSA 2YCKX 4HNNA 4EACA 1HGYA 2A85A 4OKDA 3PS7A 1LQ2A 2CLEA 1HJXA 3II1A 4WJEA 3LV5A 4BQ4A 3SEPA 2YCIX 3C0QA 5BOOA 1MW0A 4U2YA 2NQHA 3B8TA 2W67A 2PA6A 3EOOA 4TTUA 1F6YA 3IIZA 5IHRA 4FR6A 1JFXA 4XUYA 1XFCA 3OG3A 3AOFA 3UVIA 5BRPA 2BOEX 1XSKA 3RM9A 5JIPA 5HJLA 1HKKA 2ZIDA 3CPUA 5FI8A 4BR1A 1UA7A 3CM4A 1WNOA 2GSJA 1MZRA 4UFMA 1PE1A 2QLYA 7REQA 3DG3A 2DDXA 1T8XA 3W6LA 3QLDA 1MRQA 1PCWA 4FA3A 2ANUA 4H7CA 1JDAA 2XIOA 4JKMA 2I9EA 4GO8A 1GT8A 1UD5A 1A3HA 3DFQA 2HXTA 3LXBA 4XZNX 2BMBA 3NL3A 1R2SA 2PFHA 2HISA 4JFTA 2ZXBA 1L8NA 4JQ1A 1KXVA 3G6MA 5EYWA 4GNKB 1NP2A 2Z27A 5D33A 4ZQNA 1JUBA 5BCAA 2BASA 4BF9A 3NQ7A 1DBTA 2AQVA 3EYPA 5I78A 5IM51 2F6KA 2A6NA 4MJ4A 3KVLA 4BI7A 2WO5A 4JAWA 3SUVA 4DJED 1U2YA 3OOQA 5HJXA 2XSAA 1SZNA 2OX4A 4W5UA 1W9UA 3THCA 1WKFA 4QS6A 3SM0A 1R3SA 2Q8LA 1ZJBA 1BYCA 1FCUA 5K7JA 1G01A 3ITXA 3CGTA 1RVGA 4XBKA 3V0SA 3RNDA 4Q8NA 4U28A 1XYCA 2D3NA 2DZVA 3H2AA 4WGHA 1XLBA 5MKGB 1WO2A 3W6MA 2OG9A 2FJUB 4GD0A 3CLMA 4X0VA 1DXEA 5U7SA 1EOKA 1S46A 5FEPA 2PF8A 3VE9A 2HK0A 3DKLA 1AODA 1GONA 5BRQA 3BAIA 4AX7A 3AJ7A 1KCLA 4H9TA 3FVDA 4HCLA 3BQ5A 1XRTA 2GVLA 3AMKA 4GK8A 3UJEA 1W5NA 4MLJA 4MM1A 4XAPA 1X1ZA 2F6UA 1V7YA 4O1FA 4PMDA 1NARA 3VDAA 1YYAA 3HFYA 1H7RA 2XDFA 3MZ2A 4JDYA 4WY0B 3IVSA 4XIMA 1EC9A 3BK0A 3NPUA 3NOYA 1K9EA 4XD6A 1QOPA 2POZA 3EDDA 5LHFA 3B3DA 3VOFA 1TMQA 3HPZA 4RNIA 3Q67A 1TB3A 3LB0A 5KMYA 1OM0A 3TAOA 4GNVA 1PYFA 1KBIA 3SAZA 3URNA 1LG2A 4ZTXA 2JKPA 3BXWA 5E6YA 4ZCWA 3FLUA 4MYAA 1QVBA 3TSBA 3SGZA 4AWTA 4ZMGA 1PIIA 5LGZA 2WJEA 1DJNA 4KGJA 3UFYA 3CAVA 2NVAA 1JQVA 5EFFA 3LHVA 3QKZA 1CBGA 3M0IA 3VOGA 3CQ0A 5LNSA 3LRMA 3SCSA 1E0UA 4UTKA 5ECVA 5FF3A 4Z2LA 3TQVA 3VYLA 2Y5JA 3UG8A 1XQKA 3MV01 4MWAE 3R12A 3QBUA 1D3CA 4Q4SA 1FWJC 4C6JA 1RPXA 2BOGX 2PDFA 3NZQA 5ABGA 1P6WA 3H54A 3AXXA 3S2LA 1SJBA 3A23A 3WELA 4IPJA 2YA0A 2D23A 1H61A 1LG1A 3FNDA 3DHFA 2VX5A 4M1RA 1K6AA 3S9IA 1O95A 3TZFA 4KERA 2FVLA 4X22A 2BVDA 4KW2A 3BW3A 4L1GA 3LYEA 4QNEA 3FYYA 5D32A 4GLEA 4BEQA 5H8PA 4I5RA 1W31A 2WMIB 3NEHA 2F7FA 4C6LA 2VT0A 3VOHA 2E09A 4FNTA 2J6XA 4U5IA 1OZQA 3NNTA 3VK5A 5DELA 2PDQA 3RMJA 2D20A 4J3SA 3GC2A 3CV1A 3A4JA 2F2KA 2VZVA 3S2CA 3MDUA 5EMUA 1OFRA 1GOQA 3DFOA 2DT0A 3UA4A 4CNTA 3BICA 4MKVA 3TLQA 3ARUA 3FA5A 3OYXA 2V3EA 4E38A 1DPMA 4GCAA 2TPSA 3L0NA 3V5FA 1BEUA 3MMDA 3JW7A 2GJXB 4HK7A 1UR0A 3GBDA 5D03A 1YIXA 1CNVA 2OLSA 3IJQA 2I7GA 3IUDA 4M81A 3KDNA 3LPGA 3P84A 1CYGA 1L6SA 1QWGA 3FSTA 3CV7A 2RKXA 5D2TA 1QUMA 1BG4A 1A5UA 3H4WA 4L4LA 3VNJA 2EQDA 3N13A 1J12A 2ZRXA 2PTYA 2E3ZA 3KHJA 3BJSA 2E40A 2Y8UA 2PU0A 4HA4A 4H2HA 1VP5A 2CZEA 2PDLA 1V0KA 5LNRA 1GKRA 4GI9A 5ABHA 1VZWA 2BY3A 4CVUA 3SCRA 3H4GA 3PFMA 1REQB 3QMSA 4AZBA 2AQWA 2VP8A 4I8DA 3W7JA 2ZE0A 3MO4A 4KBXA 3ZSTA 1V3JA 2IQTA 2P8BA 2RGLA 4HPNA 4O1DA 4I5XA 2E1WA 4NHVA 2WANA 3K13A 3GUGA 4V27A 2P76A 4NASA 1JFHA 5AHLA 1J0IA 5IOBA 1AH0A 4AZ6A 3F2CA 1EUNA 1GHSA 4IGMA 4PTMA 4N42A 3S8HA 1Y5VA 2Y2WA 4N9BA 4W9TA 4CVWA 3CHCA 3JVAA 3RR4A 3KCLA 4P7OA 1TV4A 5A6BD 1XGZA 1M03A 1MSSA 3PZMA 2PRHA 2VRJA 1VFUA 4PSPA 2D2GA 3ORWA 5I7GA 1WX0A 1W3IA 4K37A 3V5OA 2R1KA 2EKCA 4S2BA 5HATA 3H8AA 3ZT5A 4RR4A 4C5ZA 3CZ8A 3S6DA 3LGGA 2FH6A 1K1DA 3NGJA 3MCMA 3RX2A 1E0TA 3BZJA 1DIOA 3ZS4A 1UPMB 2HVNA 3WD4A 1EQPA 2BY0A 1Z7AA 2O4QA 2AGKA 3EOLA 3SB0A 3GQYA 3W88A 1OF8A 3ZR5A 1UR3M 2VFHA 5HNUA 3GE7A 3PAOA 4HBKA 3L68A 1CDGA 2X1RA 2A4AA 2ISFA 1ZBVA 2GUUA 4P7RA 3IIVA 4NAEB 4O57A 3SCTA 5A8NA 2L5HA 1YHTA 2WZMA 3BV4A 4UQ9A 3FY1A 4H3DA 1E51A 2FGBA 2FZDA 1XX1A 3KBVA 1GVEA 1MXGA 3RM8A 2C0AA 4J7RA 5FSDC 3R58A 3CZLA 3FYPA 3PZGA 1POJA 3LCIA 1D9EA 3H7UA 3RRXA 4GCXA 2INEA 4NP7A 1Q8AA 3TQKA 3OJGA 2EG8A 1QW7A 4AZ5A 3R79A 4YWIA 4J3TA 3B97A 3F4NA 3GXIA 4Y8EA 3PPFA 4AQLA 3AMDA 7ENLA 4JGDA 1RD5A 4Y90A 4LC8A 2D0GA 2VEPA 4J28A 3VDCA 3W6YA 3R94A 2PBGA 3GDTA 5JH1A 3CJPA 4XTDA 3WLNA 4DJEA 3GDMA 1W8SA 1KRAC 5C70A 4KH2A 2BZNA 3VDGA 4G1KA 3HGRA 1D3HA 1LWIA 3WQPA 2PP3A 2VX6A 3UWUA 4HNVA 1WYIA 2J79A 2V69A 3NGFA 3N4EA 4XSLA 2ZC8A 5EGRA 3HQ1A 3ID7A 4IGSA 3V36A 4AMAA 2ZTJA 4JZ5A 3N1AA 4IH3A 2QF8A 5C9UA 4KIEA 3AZSA 1SU5A 3CUJA 3I3BA 4M29A 5XINA 4PCPA 3OQEA 1UWQA 1XLIA 3NQCA 3KBNA 4F2TA 4F2UA 3DIPA 2PTDA 3FJ6A 3KRBA 5MHBA 2WLYA 1QOXA 5DRIA 4HNUA 5FEWA 1GVYA 4WLCA 1OX4B 4MPKA 5JUVA 3GLCA 2Z1KA 3L4VA 2I1OA 3S3GA 3ZFHA 2J7BA 3Q4DA 4IHCA 3WJSA 2Y4SA 2VFGA 2B7OA 2FB3A 3QTGA 4RXFA 3SCWA 4PN2A 3O9NA 1C91A 5CPTA 3V18A 1IEQA 1B30A 2H6RA 1THFD 3WLPA 5M3WA 1MW1A 1TJ2A 4JTEA 1WBJA 1F3XA 3UCQA 5A6MA 4MF4A 4NJKA 4NQ1A 1M5WA 1VFMA 3GZAA 4NZ4A 3W27A 4I5UA 2ZZ4A 1W8GA 3C0SA 3L4UA 4XZ9A 3HJZA 2J25A 3V1PA 1KCXA 3LD5A 1XDMA 3RU8X 3H55A 3SRHA 1ZCCA 1VQTA 3BSMA 3BMWA 1S1RA 3VMPA 2VCBA 2E4TA 1KFEA 3BOLA 3B8UA 4CQ9A 2VZSA 1RBAA 4V28A 1AW5A 4WJ8A 1X96A 1J5SA 4FMVA 2O9RA 2NXHA 3U4AA 1GVSA 1F8IA 4OJYA 2C18A 3QV8A 1FKWA 4RZBA 1WUFA 5G4WA 1DWJM 1DWHM 2EHHA 2WXDM 4UMCA 3EA3A 2VVNA 1EKOA 3TZNA 4IMDA 1MYRA 2WJFA 4MB3A 4EANA 3VM5A 3I7QA 4U2ZA 1FXPA 3WK1A 2DIJA 3CYVA 3THUA 1SO6A 5CGMA 3A6OA 1PKYA 1UZHA 1A3XA 2F61A 1BTMA 3NO1A 4FX6M 3LK6A 3W7LA 3FS2A 3R0UA 2WMKA 4XAZA 2WNWA 3IIOA 2P5NA 2BVYA 4GYPC 1RJQA 3VD5A 1PS9A 1N8IA 3E0IA 3ARWA 3CWNA 3HV9A 2OO6A 1TPVA 5CZKA 4GG9A 4JTUA 1IGWA 4UTTC 4H2CA 3V1HA 5D2VA 2GGGA 3NL5A 3SIZA 4P7LA 4E4PA 3AIWA 4HN4A 1XCWA 1H09A 4EXAA 2IQDA 3HA1A 1O5RA 3NAVA 3WCZA 3RYSA 4AF0B 4Y7EA 1FWRA 1UR8A 4FXJA 1IR2A 3RDKA 4TX8A 5FACA 1TCMA 1KWKA 1S2WA 4AU0A 1SJDA 4KWOA 3LTYA 4BWLA 2OPJA 1B31A 3L9CA 4DPQA 2FGLA 2NW0A 3NVDA 1MFVA 3B9EA 4S3AA 1E9YB 4GUJA 1UBSA 4GI4A 4S3KA 4YL2A 1AH3A 1W5PA 1Q3NA 4B91A 3SW6A 2JF6A 1VHNA 3LS9A 1P6BA 3OZMA 3D47A 1E6QM 1ITXA 1Q6EA 4JS3A 3KCOA 1TMHA 4WSJA 2W27A 4DO4A 4NNBA 3AHTA 3FW6A 3AQUA 3KZPA 4LUSA 5XIMA 4AIBA 1FWSA 2WPBA 1JGIA 1HKWA 3V5CA 4ECLA 1OC5A 2D1ZA 3E3HA 2PDHA 3LGEA 3W1UA 4TVDA 4XIAA 4TVUA 4XKMA 1XSJA 4G1NA 4ZL1A 3PZ9A 3VC5A 2CZ5A 4B5UA 4LEQA 4AIEA 5SWUA 3BAKA 1JQXA 2QCFA 4LUIA 4PUDA 5K4ZA 3OP2A 4LQ1A 4TU1A 3RO6A 1XLMA 5DCBA 5BW6A 3PBUA 1WZAA 1HL9A 3WMLA 4NSBA 3T81A 2NLYA 4GJJA 1C8QA 4BQ3A 1TREA 3CMJA 3LUTA 3AWOA 2VM8A 1NVMA 3R6IA 1QNVA 1HQTA 3AMCA 4Z1BA 1BRLA 3R4IA 1QHOA 4C5YA 2BFGA 3M0VA 4K3ZA 3BANA 4QAIA 2FPYA 1BKHA 1OIFA 2WB5A 2AQOA 2Y8KA 4ZZ9A 3O8AA 2OYLA 4ZEPA 1L2UA 3ARRA 1VJSA 4PUJA 4FLRA 1IZJA 3QKEA 2HPIA 3ZT6A 2WM1A 5TBOA 2EF9A 2RFGA 2YCLB 5D09A 4OOUA 4WDWA 4UQBA 3Q37A 4OUIA 2PDPA 3GAKA 1E3XA 3MZNA 4EAYA 1N2VA 1MNSA 5CPSA 3VI2A 4W84A 1S5WA 4WSHA 5HUPA 2PCEA 2YW3A 1JYWA 2J24A 1DOSA 2ZUTA 3SCVA 1S2TA 3BV7A 4FEZA 3RG6A 1A5OC 4GKTA 1M7JA 4RLIA 3GVRA 1IHIA 1TG7A 1A0CA 3C0LA 2VENA 3EGJA 1EBHA 4XZMX 1GYNA 2RDWA 2GK1B 1EYWA 4P5UA 3CT7A 2YSWA 2H8ZA 1L6GA 2ONEA 3RO8A 1JULA 1W9BM 5LIKX 1NDVA 3H2NA 5E09A 2VR4A 2A0NA 3ZLFA 1OSEA 1EJXC 1F3WA 2VC7A 1DIKA 1M68A 3MYPA 3OVGA 4HVXA 9XIMA 3WDRA 2HMCA 1FWGC 4M80A 2ZTKA 1Z89A 1CLVA 1FOBA 1Q6OA 2WVSA 4LVFA 3MVTA 5JBEA 1LOQA 1JDCA 3TK7A 2PURA 4IPIA 4Z1DA 4B2DD 3RXZA 3DHUA 5BU9A 4RNJA 4FXFA 3OGVA 3OW1A 5A2BA 4JX4A 4JIRA 3TFCA 2FLIA 4ZVJA 2OOFA 3BUVA 3E2VA 3WQ4A 3DGRA 1BAGA 1GHRA 3ZLGA 3HZ3A 1QBAA 2ZC1A 1Y7VA 1R7OA 2J75A 1VENA 2F8QA 1BSIA 3H2FA 1YBQB 4L9ZA 3UJFA 1HF6A 3CIWA 1LZOA 2WCGA 5DBUA 3R5EA 1UUQA 1Q2RA 4ATDA 4HTBA 3U9IA 1I2PA 2AL2A 1PZ1A 5G4EA 3STPA 3LHUA 4HTYA 3A5VA 3PZVA 3S1XA 4W5ZA 4MUPA 3DYMA 1OT1A 2Y89A 2AMXA 5CPMA 4HZMA 3UWVA 3QR3A 4RZ6A 4QE1A 4GX9A 1OFQA 3IV8A 1AH4A 4BF5A 3G1SA 3BCJA 3NZRA 2Y0FA 3AUOA 1C90A 2W9MA 3S6TA 1D3GA 4V15A 1UHVA 4D8ZA 1KFWA 1ZS2A 4JX6A 1Z42A 4GVGA 1NF7A 1ZZMA 3HQOA 3PB0A 3FX4A 3GR8A 5D04C 4DUOA 4ZENA 3MTWA 7REQB 1UYQA 3PPGA 2QIIA 3ZWSA 2IS7A 2WVUA 2RH9A 3BC9A 3EPOA 4GGHA 3CB3A 1CX9A 2WM0A 3G1YA 5IFPA 2PB1A 4UMAA 4D1IA 1N8FA 4PTWA 1M6JA 4LC6A 1MUCA 2NX9A 3WDIA 4L7ZA 3HO8A 1UMLA 3B9DA 3MMWA 2QMKA 5FJTA 3LHYA 1U33A 2PDMA 3W7HA 4LU0A 3UYIA 4I90A 5DFAA 1NAL1 3WF3A 2VEFA 3J7HA 1FCVA 3CXOA 2P88A 3KOWA 1J96A 4WKHA 2G96A 3M7WA 1X39A 1V77A 1RH9A 1F61A 1EXPA 3NQ2A 1FRBA 1VFLA 1J0YA 3AIUA 3VKCA 2E68A 3BGGA 2FZBA 3MUZ1 1PPIA 2E9LA 3PC0A 4JIHA 1ZGDA 1VBRA 2Z1SA 2HZGA 5AOUA 3NPVA 3FEMA 1TE1A 2HJPA 5HMEA 3BJFA 4GIEA 1IWPA 1E9LA 4S3GA 5CXPA 3MI2A 3VD7A 4AXNA 2A7NA 4L4PA 2WBGA 1R7AA 2PGWA 3ARTA 2O55A 3CHDA 2XIIA 3R25A 5HJYA 2XIJA 2V68A 3N9SA 2ZVIA 1U5JA 3COTA 2FKPA 3TN6A 2VWTA 4AD5A 3ABQA 4XAYA 5I3JA 2YCJA 3E38A 1Y5XA 4QP0A 2QJJA 3CPRA 2V5DA 2WAGA 4MFEA 2W6RA 4TV5A 4FR1A 3UY7A 1UD6A 4O11A 2B4GA 2C15A 2GQAA 2OSWA 2Y5EA 2ICSA 1PKNA 3HGJA 1CENA 1NFPA 2NX1A 1Q65A 3NQEA 2HV5A 3DFPA 5F2MA 4C6QA 4PBGA 1K3UA 3ZT7A 5C71A 3FJNA 1W54A 1I45A 4DO7A 1I2OA 3DI1A 3LV6A 3GWQA 1LORA 2PDYA 5T26A 2QZRA 2GFTA 2X0SA 3D46A 2VO5A 4KPLA 1GEQA 4JNYA 3IANA 1R5YA 5A6JA 2WSQA 1A3WA 3MKVA 1GPWA 4L4OA 5I07A 1V0NA 4YVPA 3M0LA 4X0NA 2O4MA 2QIWA 3DC0A 1KR1A 3VM7A 5LA2A 1AVAA 5AZ0A 3MUY1 3TW9A 4HCDA 1NOWA 3IRDA 3ERPA 3ITYA 2Z1VA 4J2PA 3APGA 3ELFA 4R27A 4TVCA 4IL0A 1ZLPA 3CWOX 2ZXAA 3S4TA 4KEZA 4QISA 4A35A 3HQNA 4WGXA 4Q7IA 5D05A 3REQA 3G1VA 1CB7B 5CJ5A 2FVKA 4RJEA 4MZYA 4LAKA 3VFCA 1ISWA 1PWLA 1TPH1 4J3UA 4IG2A 2PC4A 4PMRA 2W62A 2VFEA 1IEXA 5GPRA 1Q6QA 3KTSA 5DXYA 4E4UA 1OC6A 1TZZA 2VOMA 4HK5A 4H04A 3WNNA 4YYCA 1ADDA 3HJEA 3ZXWA 1M01A 4EPKA 5CG0A 3CIXA 1TKKA 4XBSA 1YMYA 2EPLX 4ES4A 3QPYA 2V3DA 5A6TC 3WFZA 2G5WA 4UXDA 4Q8OA 2MANA 4HA3A 4HU4A 3I4EA 5ENLA 1MQRA 5AHEA 4LX4A 3QPZA 1FVPA 3P81A 3OVRA 4PMNA 3N12A 3L4XA 1WBHA 5FCZA 4JIEA 2PU1A 4GBDA 3W1LA 1VH7A 1X98A 3BQ6A 3LXAA 3M07A 3K5XA 3W7MA 4L9YA 2GOKA 2GPTA 3STEA 4G6CA 1Z48A 1MXDA 2DP3A 1CECA 4PMQA 3A13A 4PB4A 4HMEA 1HL8A 2E6DA 4KF1A 4QIUA 3SCPA 4LW7A 4JEJA 2RAGA 1U22A 2J8GA 3FOKA 1V3IA 4XKYA 4BF7A 3GY1A 4KQNA 4H6QA 3QMRA 3K4WA 4AY8A 1MXSA 1VHCA 5HAOA 4ERAA 2HE8A 3GKAA 1E5NA 3PY2A 4PBEA 1OY0A 3OBEA 3UPWA 1PBGA 3LX9A 4O4WA 4NG3A 5AVNA 3MW7A 5HMDA 1JVNA 1VIZA 4GJ1A 3B0UX 4DLFA 3WQEA 5JIWA 4M0XA 2FFCA 3ITVA 5I02A 3NSXA 2QGYA 2ZZ6A 3W2LA 1YDOA 3QMTA 4DLMA 2OQYA 4MGGA 2WCAA 2CXGA 4HJFA 2PDNA 2VDHA 1EC7A 3MC5A 1UD8A 4O13A 1KFLA 3PK7A 2BS9A 1JZ3A 4IMCA 4LTSA 4UMBA 2O92A 4WXYA 5AECA 3ZJ6A 1XIFA 3BH4A 3MB9A 1Q4NX 1E70M 1RQEA 1UCWA 2E0PA 3MHUA 4DWSC 2ZXQA 1CGTA 5CKSA 3WBWA 1K03A 3AXKA 3GW3A 1LT8A 2JKAA 1PEZA 4B2DA 1V4YA 5BXRA 4AW7A 1YEYA 4H7ZA 1PHQA 2Y63A 2OT1A 3PANA 4L61A 4RV3A 2XGIA 4MFDA 4GVIA 4JL1A 3GH7A 3WD1A 1H1ZA 3CAKA 4H1ZA 2XVPA 3VX0A 1IF2A 4UOZA 4GVHA 1XIBA 2J9YA 3LBCA 3NCOA 2I9UA 2PWGA 2KZHA 2Y24A 2J74A 4QEHA 3R2GA 1XLKA 1TVLA 1CTNA 3R0KA 3D5HA 3TTEA 2A3EA 3PJXA 2NQZA 4HU8A 3U7VA 3AHZA 4MJMA 3VKBA 3LCWA 3PG8A 1BGGA 3CH0A 3OG2A 3GU1A 2DW6A 4N7QA 2NT1A 2I16A 1Y0EA 3AFBA 1A0EA 1U5VA 1CXLA 4GFSA 1JF5A 2FZNA 5LXEA 1NM9A 3EB3A 4OBRA 1EF3A 4ATWA 4QS5A 3A3HA 4F79A 5DQPA 1Q6RA 3M44A 3N2XA 1BXNA 2GDUA 1US2A 1EWEA 1A5NC 5DLCA 3IARA 3V0TA 4A3RA 1K7EA 4H9XA 4JY9A 3WX7A 4IMEA 5G1YA 2BXYA 2X1SA 2IQ0A 5BXTA 1B3WA 4UC5A 1IXOA 1EJSC 1TQXA 1GOWA 1LBMA 3G1HA 4A2RA 3EOUA 3PTDA 5CPQA 1QBBA 1WA3A 4WZHA 4JPGA 1PZ3A 2NQ5A 4TTGA 1OWQA 2ZRYA 2G37A 4RNFA 4J3XA 1YPIA 5HR6A 1Z3NA 3ES7A 4ROPA 1FFQA 1GOXA 4GYPA 1VC4A 3QHOA 3VNZA 2A3CA 2J77A 2XM2A 3PBYA 2UY2A 3GG8A 3EWWA 2XTKA 2YBUA 1ZJHA 1XIEA 4UTTA 2WZEA 2CBUA 3N34A 3U2ZA 5JBDA 1A53A 1JZ2A 1TV8A 4R7OA 1CGWA 1GEHA 3NM3A 3GXFA 5L9FA 5M03A 5C2XA 1XH0A 1XYZA 4CLMA 1WKDA 3WH9A 4HP5A 4B16A 5DO8A 1J8VA 3OLGA 4JN8A 2YBTA 1UPPA 2VWSA 1PX8A 4WCJA 1HT6A 4UQAA 3CV6A 3LZ5A 5EA9A 1JF6A 3N2TA 3G1FA 3SDOA 1AD1A 2EKGA 4LUJA 4XZHA 3W1PA 3SRKA 3DFYA 1BD0A 1S5NA 4YNGA 4GQBA 4JBRA 4K36A 1Q63A 1HP4A 3AS0A 4FX7A 2DZWA 4O1BA 4OBTA 4ZQPA 4Z1CA 3QZAA 3T0CA 2REQA 2SFPA 4L6HA 2DZBA 1EL3A 3L4TA 2HE5A 2INZA 1V3MA 3C3NA 4IXXA 2G4FA 3BURA 3VZXA 3WQDA 1TJRA 3O7UA 2VDIA 4M7TA 1OCNA 1CXEA 1HO4A 3VU2A 1OX6A 4PCFA 5EL1A 5CSYA 3VCCA 5DY2A 1TPWA 2VUNA 2PZ0A 2QJNA 3TJLA 3UGRA 2BDQA 4MVAA 1AJZA 4DYEA 4HN8A 3OIHA 3BOFA 2VTFA 4UZUA 4GYFA 1JCYA 2BHUA 2BY1A 3W0KA 2J7DA 5HQEA 3R11A 5I0DA 4A8LA 2CU0A 4BKNA 4AG0A 5DBTA 1ZRQA 3POHA 3USZA 1OBAA 1KM2A 1LLWA 1JDFA 2E5DA 1K4GA 1KRCC 3WD0A 1W1IE 4N9CA 3QV6A 3NZGA 2ZYFA 4LJ3A 2Y88A 3KVMA 2QULA 4GX8A 3MMUA 2DT1A 3IGHX 1IIGA 1N82A 3IJLA 1EZWA 1DYSA 5HPOA 3VKKA 1F7BA 2G95A 4IICA 3HBLA 5I3GA 2HPMA 2R1NA 3P61A 4YCOA 3RLUA 2Z28A 2Y62A 2ADAA 3BW2A 3WNPA 4LRTA 1PX3A 3MS8A 4N2YA 2F84A 3ZJ7A 2BWGA 4MNLA 3C52A 5H2ZA 4R85A 3RLGA 4XAGA 4JFWA 1T0OA 1QO2A 3CS2A 1KQZA 2A79A 4GA8A 4D6FA 4I6KA 1YW1A 4AVOA 3KTXA 1DE5A 3UD6A 3KLLA 3FSUA 1B2YA 1RA5A 1UWTA 3QZ6A 4JTHA 7PTDA 1Q6DA 3FAWA 3TROA 1H51A 5AYYA 4QQ3A 4A22A 2O9PA 3MSYA 2V38A 1ZB5A 1ZALA 3N9KA 4NAFA 1TSIA 1V6UA 3WK3A 3GIQA 5AHIA 3B9OA 1VPXA 4W93A 4BI6A 1OHLA 1UASA 4PUMA 5DRCA 3HG2A 4PTDA 3GVVA 5TD4A 4AHOA 3DKJA 3FKKA 4EWND 1AA1B 4YJ5A 4PCNA 4W8BA 3CO4A 2HXUA 2PSNA 3WF2A 3WQVA 4AY1A 2EPHA 3EX3A 1EIBA 2DSUA 4L64A 3WLLA 3APYA 4O0ZA 1X6LA 4MAZA 3NQAA 4WOZA 1VYPX 4JTTA 2MUCA 3VABA 1W1ZA 1WUEA 4FXSA 2XIMA 3UP8A 3TNBA 1RXOB 4DWSD 1XRVA 1GYLA 3WDQA 2Z24A 3TA9A 5I09A 3M0YA 4N02A 4IPLA 1GOKA 1MZHA 1JZ5A 2RGMA 5EKYA 1XHGA 2IKHA 4R3UA 4Y9OA 1WP6A 1CB2A 5HWJA 2QW5A 1Q6LA 4UFJA 3N25A 1FWWA 4DNHA 4B3KA 2P0IA 5G2IA 4CNPA 4ERIA 1TA3A 4ORMA 2YL6A 3PULA 4IX0A 3CHFA 3VGHA 2XVKA 4G2DA 3SJNA 2UY3A 3DHPA 4I9AA 4HNOA 5FJJA 4X61A 1GZGA 4DVOA 1R2TA 4Z2HA 1M1BA 4A8IA 1XP3A 4HSOA 3RFAA 3LQGA 4IP4A 4LUSB 3NA8A 2QAFA 2WKGA 1PJ9A 1VLWA 5CAKA 5GJNA 2X2GA 3W71A 1JXJA 2I56A 1GQIA 2JGQA 1MEWA 1KB3A 1T6MA 1WQ5A 4NI3A 5D2YA 1UH2A 1OCJA 5A2CA 4C6NA 4E3VA 2OZ8A 4MIMA 3W1NA 5HOSA 3O1NA 1Z41A 3EKLA 3L66A 3EMQA 3NL6A 4LRSA 3AISA 1DV7A 2VZOA 3MI3A 4H8UA 3WLHA 1BRLB 2C0HA 2YFNA 2CLIA 3OIXA 4XISA 3F03K 3GAYA 4E8GA 4FO4A 2RHGA 1MI3A 2PGRA 4YWSA 2C6QA 4IQDA 3TYBA 6ENLA 3VGDA 1UWIA 2TODA 2FTWA 2VC9A 4O1CA 4E4FA 2ISVA 1PTGA 2JFEX 4JTKA 1XGEA