1W3IA

Sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
293
structure length
293
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYYYPRMSEKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aldolase
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title The structural basis for substrate promiscuity in 2-keto-3-deoxygluconate aldolase from the Entner-Doudoroff pathway in Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 113
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2004-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w3iA00
2VEMA 4HIBA 5IM51 4JXCA 2YPIA 1VLIA 3STGA 1GVQA 2Y6ZA 1TSIA 3IEBA 3N2XA 4HPXA 3CEUA 1F74A 3NL6A 1OF8A 4AHQA 2NWRA 1H7NA 2CW6A 2XN0A 3G8EA 4MLRA 2YFNA 1EP3A 3UWZA 3TE9A 3Q2DA 2ATSA 4NJHA 2NUXA 3MHFA 1DORA 2C3ZA 4YCPA 2V2CA 3OVPA 3L66A 4IMEA 4FNSA 1BWKA 2Y7EA 4ZMGA 1J5TA 4UTIA 4WQ6A 1DKWA 2Z2UA 3A24A 3TFXA 3TROA 1JJKA 5CPNA 3C2FA 3CU2A 5U7SA 2FJKA 3QYQA 1X1ZA 4GUJA 4O10A 3H55A 2ZA1A 5AOUA 3L9CA 4NX0A 4OQVA 4UTKA 3MI3A 3FKRA 3ABOA 5AHLA 1OFEA 3PUEA 4H3DA 3NQDA 3LHTA 2I14A 1L9WA 2O7SA 4FNUA 1W5PA 4JYDA 2VC6A 1GVRA 4JNMA 1I2RA 4CNPA 3KOFA 1HTIA 3R89A 4LOCA 1VHCA 4LUJA 1OYCA 3LLDA 3W1XA 3HG4A 4FX7A 3W7GA 3Q58A 3YPIA 1JUEA 4BR1A 4GJ1A 3C56A 3FS2A 5LHEA 5BOOA 2ISVA 4AB4A 3NQ8A 3L5LA 3SY5A 5L9FA 2WO5A 3G8RA 2QAFA 4UR8A 2KZHA 2VFEA 1H51A 1W54A 3TH6A 1V5XA 3TUUA 4D2JA 2NX1A 4PODA 5DXXA 4JEQA 1SO3A 4AHOA 2LLEA 3R5EA 1AW5A 1S5VA 1S5WA 3MJYA 2NLIA 3S8HA 3KHJA 3WJYA 4FNRA 4R53A 4Z0SA 3NQ7A 2FPYA 3QZEA 5KZEA 1LOLA 3KAOA 4PTNA 3MW7A 1IXQA 2GUUA 3KXQA 3DGRA 1B4KA 3A5VA 1N8FA 4UFHA 4M7TA 4NU7A 1OJXA 2Z6IA 4P2VA 8TIMA 2YR1A 3OA3A 1DL3A 1UUOA 3E49A 5DCDA 3QMSA 1X1OA 3BG9A 4MJZA 1ALDA 1LZOA 4DF0A 4DBEA 1M6JA 2WNZA 2E6AA 4KWWA 1RV8A 3W1AA 1ZAIA 2VFHA 2Q8ZA 3PBWA 1OFOA 2GVGA 3GAYA 1SUXA 2VOMA 4WXZA 4Z0JA 2VXNA 2XN1A 1TJPA 4K8HA 1R2RA 1L6SA 2YDAA 6TIMA 4TMBA 1KA9F 5I3KA 4BWLC 1XDMA 2TSYA 2ABBA 2NWSA 1D3HA 1O94A 2PE4A 4C1LA 4O0KA 3C8FA 1FCQA 4N9DA 3TAOA 1ZALA 3CC1A 1I45A 3NAVA 3T40A 1GT8A 4RCXA 4OE7A 2ZA2A 1RD5A 1R46A 4X2RA 4AXKA 5CKSA 2ZRZA 3GLCA 3I7QA 1F05A 3UYCA 5FF0A 1I2OA 3NEVA 4IMDA 4EWND 3QH2A 5EL1A 3CIWA 1GPWA 3PF3A 5DBTA 5G4EA 1AW2A 4HNTA 4RX0A 1MEIA 3WFAA 4Z08A 2R8WA 3BLFA 2CLLA 3F03K 3TDFA 2F84A 4JTKA 3HGJA 3TW7A 1GG1A 4M6VA 3LI1A 1W0MA 2QCNA 3UNDA 4FNTA 4JTJA 3NOEA 4UTUA 1VRDA 3W2MA 2PCQA 1CW2A 4XTDA 4QISA 5AC7A 2XN2A 1JCMP 1Q6QA 2YZRA 2A2IA 3TXVA 1DHPA 4OT7A 3TIMA 1UBSA 3KVJA 5AC8A 3MP3A 3FA5A 2DZPA 2V9DA 4RLIA 2C14A 3QMTA 4AH7A 4RZ6A 1QO2A 1LM1A 1WV2A 4WY0B 4A3UA 1TPDA 3IV3A 3HG2A 1SFLA 5F2MA 2ZRWA 1RVGA 1OVDA 5F2IA 2PRMA 4OBTA 1T8XA 3KRUA 1EIXA 3O16A 4I9AA 3M5YA 1T96A 5BMXA 4K6AA 3QMRA 4I7VA 1VCVA 4UTHA 4H6KA 3CT7A 5AYXA 4HPJA 3E96A 3EWUA 1NAL1 4OHQA 4PH6A 1RR2A 2FB2A 3OVRA 1KFLA 4JGDA 3LCGA 3WK1A 2ZZ1A 3DKLA 3O07A 1RQBA 1MXSA 3EKZA 4KFOA 4LVBA 1JRCA 1G4SA 2CZ5A 3W70A 2EKCA 3PB2A 3UPBA 1NF7A 3L68A 1FY6A 3HPSA 3Q37A 2CLIA 4AF0B 2YCEA 4O11A 4QAIA 3W7IA 2WSRA 4O8RA 2QJIA 4K8EA 5G2HA 3H54A 2QDGA 4I7WA 1WDWA 5F4SA 5G1YA 1XBXA 5AYYA 3CWNA 3NQMA 3E02A 1K7FA 5MHBA 3SECA 5K9CA 5K9XA 3N34A 5EA9A 1H61A 4DELA 3LTPA 1KFEA 2QCLA 1IGSA 4NJJA 1SU5A 5AB3A 5K7JA 2JKEA 4X22A 5FF3A 5AHFA 3EX3A 4Y8FA 1R2SA 4B5NA 5AN7A 1SZFA 1JUBA 3P7YA 4GBUA 1YXYA 3UWYA 4OV4A 4UTJA 2EAWA 4FX6M 1YPFA 3LV6A 3MBFA 5DY2A 5CPLA 4O50A 2CZFA 3WK0A 1TQJA 3B06A 2JGQA 3P8JA 3VCRA 1VGAA 1VZWA 1XDLA 4CQ8A 3B03A 1YYAA 2BWGA 2ZRUA 4JX6A 3F4NA 3C2VA 3STCA 5EY5A 1T0OA 1IIGA 1YTEA 4CCEA 3VKJA 4JTHA 2JKPA 3V1PA 3B0PA 4IGHA 3LCIA 4RZ5A 1XC4A 4LV4A 3RLVA 3A22A 4FO4A 4A21A 3UZ5A 1EP2A 3C6CA 3DFPA 2CLMA 4LVDA 1LLZA 4NNCA 2X30A 3P61A 4C1KA 1SPQA 1FDJA 5LNVA 3W2JA 3ZFHA 1M7PA 1TIMA 3C61A 3G1YA 4AAJA 3IVSA 3NVTA 1I2PA 1F2JA 3W6YA 3QEZA 4JTGA 1TMHA 3W87A 2QCGA 3KVKA 2QF7A 2DZTA 4EF8A 3GVGA 2IQTA 1KM0A 1EB3A 1OK4A 4JD4A 3G1XA 5A5WA 3NPUA 4E2DA 5DCEA 3F1QA 2G5WA 5CZTA 2ZQ0A 4HSNA 3RFAA 3SGUA 2C19A 2YSWA 5AHMA 3TU9A 3B05A 1GVSA 1RZMA 3N19B 2B7NA 3WJZA 4WZHA 5AC6A 4W9TA 1LYXA 3HGRA 3I6RA 2H6RA 5FF7A 1IXNA 2QCMA 1GEQA 1Q6RA 4K37A 4LS2A 1PCKA 4N02A 2G95A 4IUOA 1YDVA 3MYOA 4O53A 3QPYA 3UXAA 5ABTA 3LERA 3GNNA 1YLVA 4LC6A 1D9EA 2QKFA 3U6WA 3EXSA 4E38A 1UJPA 1VR6A 1KTBA 3EXRA 5BW6A 1JRBA 1GJPA 1LLWA 3JRKA 4Q4KA 1TPFA 1LRTA 3A23A 3NGJA 4IMCA 4G1KA 3T78A 4JX4A 1IIHA 3DAQA 1NVMA 4NT0A 3N9RA 2RKXA 5U4NA 3B04A 4Q33A 1UUMA 4N4PA 5EYWA 4DQWA 3STEA 1EX5A 2OMAA 1LCOA 1W3TA 3A5FA 3I68A 3DXIA 5DN1A 4KFNA 1EUAA 4PA8A 4XWUA 3BGJA 3U2OA 2AAMA 5LKYA 4Z1CA 1OHLA 1XUUA 5D38A 1KLZA 1B57A 4Y90A 4WD0A 2R14A 4E0CA 1RQEA 4RZ4A 3HOJA 5GVJA 5D2WA 2A0NA 4IPIA 5HR7A 4ONVA 3NQGA 3LOTA 1K8ZA 2JKAA 1ME9A 3SSJA 1G69A 4LWWA 4WY0A 5G4WA 1GWJA 3TSBA 1G4EA 1AL7A 2V5BA 3PAJA 3AJXA 5KTLA 3GDLA 2BX7A 1VYRA 3NPWA 2JGYA 3LHUA 2CWNA 2WNNA 1WOAA 4RK8A 2GPTA 3C0JA 1KM4A 2F7FA 3S5YA 3OVQA 3PC0A 4IXHA 3B4UA 3HJZA 4QSHA 4MYAA 3MI6A 5F1VA 2NUWA 4U28A 3W2UA 2VEPA 2YW4A 1JCNA 3O6DA 2C13A 4JYEA 1GYLA 1TTQA 3MYPA 1PVNA 3IIXA 3FIGA 2NXIA 1KFKA 3CLMA 2NV2A 4O13A 3CQ0A 4ZQPA 3C2OA 5K3VA 2FPVA 4DF2A 1W31A 2RFGA 2Y7GA 3L67A 1H5YA 1QDSA 4IXXA 5D2XA 3IRDA 4AF0A 1A5AA 1OFBA 2V5LA 1YXDA 1I2QA 4JYFA 1MSSA 1VCGA 4DBDA 1TV5A 2OT0A 3BW4A 1PIIA 4JIQA 3L65A 5K4ZA 4N9EA 3W84A 2OZ0A 3TMLA 5HQEA 5CPOA 1QPNA 2PRLA 4R7JA 5HNRA 4GWEA 4S2BA 1TQXA 3QC3A 2V81A 3LHZA 2NXHA 2NX9A 4NUWA 4LNYA 5G2WA 3NXFA 3G1SA 4UFLA 4N9CA 1H7PA 3G1AA 1Q6OA 1FWTA 3NDOA 1H7WA 2DORA 4TR9A 1XFBA 1Z48A 3CB8A 2QCCA 1HL2A 4CNNA 3MHGA 4NNBA 3BPWA 3IIZA 3BG3A 4M19A 3WJSA 4AWSA 3DFTA 3IVUA 4FIQA 5LGXA 1XXXA 4FHAA 3O8AA 3HO8A 4PFMA 3SW6A 2B7PA 2WJZA 3C52A 1LTDA 3I65A 4N9BA 1DV7A 3EX1A 4M7SA 2J9XA 4EIVA 2QCDB 4KFPA 2E6DA 1ZNNA 2I9EA 4AWUA 2J9ZA 3MWAA 3GAKA 1FBAA 4OV9A 3S1WA 3HB9A 4UTTA 4EOUA 4LC8A 1KFJA 3GX9A 5CGQA 3WK2A 3LI0A 3IVTA 1X8FA 3TK7A 3GDMA 1KFCA 2JBMA 4MVAA 3FFSA 1EP1A 4MKNA 4NJIA 1MEHA 4OGZA 3G1HA 3U8GA 5EMUA 1PHQA 4OWGA 2VEIA 4MUZA 5C6MA 1J4EA 3MO7A 2ZZ4A 1GQNA 3M43A 2A5HA 3AO0A 4JS3A 3W23A 3EWYA 2A4AA 1F6KA 4Y9AA 3SIZA 2ZZ2A 4O4WA 1CX9A 5EKYA 4JY9A 2NX3A 5FI8A 3LCLA 3W1UA 3MP5A 1JULA 3G0XA 5HUPA 1HFBA 2B0MA 4UTWC 3KVLA 4DO4A 4DO6A 6ALDA 1WAUA 1A5CA 1GVFA 3QRHA 3HF3A 1NEYA 2H3DA 3LLFA 2CLHA 2ZRYA 3HBLA 4JDBA 3GDTA 3TSDA 4I7UA 3MI2A 1FCBA 2PURA 3GDKA 4M5PA 4UIOA 1FCUA 3DFOA 5DELA 1ADOA 3ELFA 4PEKA 4IX2A 4WXYA 3P81A 1S5TA 3M5ZA 1L2UA 4IQLA 4HNNA 3W7LA 1LRNA 3PUDA 4JTUA 5C55A 1KBIA 3FYPA 3IGXA 1FX6A 1TREA 2ISWA 1J2WA 4FNPA 1VHNA 1IXOA 2HTMA 3P80A 2C6QA 2FTPA 2A21A 4M6QA 4R33A 4DF1A 1JVNA 5FF4A 1GG0A 4O4VA 3CM4A 1IF2A 1W3IA 4NZFA 3QF0A 3INPA 3G18A 3L2IA 5D04C 3QPZA 2P10A 4BI5A 1GZGA 1OABA 4BF9A 4MY9A 5D03A 4TX9A 3N73A 3DENA 5FEZA 3W7QA 3MMTA 5LGZA 3RK8A 1WBJA 2J88A 3W2LA 1VLWA 3W7DA 4AMAA 4XQ6A 3VNDA 1OF6A 1FDYA 5CG7A 5D2YA 3S5OA 3GKAA 3WK3A 2CLFA 5F1UA 1KV8A 4FF7A 1WX0A 1PL9A 3M5VA 2I1OA 2NV1A 2X1SA 1ICQA 3FYOA 4LRTA 3W07A 3C4UA 2GOUA 2GVLA 3PSWA 2RDWA 2FPTA 3THQA 2B4GA 4MZYA 3W7EA 3N14A 2QDHA 3G3MA 4M6PA 4UXDA 3O6CA 4DPQA 1C9DA 3O05A 5K4XA 1K02A 1TTIA 1AW1A 2V0TA 5IBXC 4MYXA 2G96A 1GVOA 3OIXA 5F4XA 3QFEA 1BWLA 1H62A 5L6UA 2H8XA 4PL2A 3T44A 4YL2A 3W1NA 3S5ZA 1TPEA 4UCGA 1OFDA 3PG8A 1K3UA 3FKKA 3G1VA 1QO5A 1TO3A 1M7OA 2DJXA 2VFIA 3NL5A 2HMCA 3M16A 1OG0A 3ABRA 1C8VA 2ZDRA 1A50A 3CHVA 5D2TA 1TYGA 1DBTA 3CPRA 5A8GA 4CCCA 4TU1A 3S0CA 2C1HA 4BWLA 4PCFA 1VYSX 4HNUA 3UWQA 3W72A 1ZHAA 1KV5A 3WJXA 2ATMA 2Y70A 1TPC1 2P0OA 3PM6A 2CLKA 5TBOA 3E9AA 4LV9A 4WJEA 1BKSA 1H1YA 4J9JA 3EWBX 4FX8A 3EWWA 2ZYFA 4ZQOA 3CIXA 4MY1A 3RLUA 5LNSA 5KSWA 2QCFA 3UPWA 1F7BA 1G7VA 5CSRA 2E68A 3EX6A 3LCFA 4NX5A 4R34A 3QJAA 1I4NA 4Z1DA 1VJIA 5FEWA 1V7YA 4HHPA 1LORA 1X6UA 3M0ZA 4AEOA 3FEMA 3W7CA 1Q3NA 3C3NA 1VYPX 1XKYA 4EF9A 1H7XA 1QAPA 4JTEA 2H90A 1FWRA 1VC4A 2VEKA 1W37A 2NXGA 2QCDA 3BVJA 2CFFA 4NXSA 3W7NA 2E09A 2C18A 3NM3A 4MZ8A 2ALDA 1XBYA 1KTNA 3NQEA 5AHIA 2X1RA 3SI9A 3S42A 4LVFA 3W71A 2CZEA 5EPDA 3TC7A 1LDCA 1TJRA 1R30A 1FWSA 3DHFA 5HULA 2WSQA 3GNDA 5LNWA 3WJWA 4LVAA 4FNQA 3G24A 4BI7A 5DY3A 1FWNA 1ZFJA 4HSOA 2GQAA 2BXVA 3I7RA 3P8IA 3P67A 4KWVA 1FCVA 2W6RA 4K36A 1SO4A 2E5DA 1VCFA 3W22A 5D09A 3ZWTA 2JK2A 4CLMA 4JICA 2C15A 2QUUA 3UY7A 3NYZA 1HUVA 2X1UA 3L5AA 1ZENA 2E6YA 4YWIA 4ZZ9A 1FXPA 1KM1A 3PG9A 4JDYA 4NZJA 1SR9A 1GYNA 1H63A 2ZBTA 4JY8A 2E5CA 3I7SA 2WQPA 3MUXA 4LTSA 3N3MA 3OHIA 2BTMA 5I3JA 1NSJA 3E12A 3W7JA 3IIPA 1H7RA 3LRMA 4K7VA 1OYBA 3ABQA 4UMBA 2E77A 4RXGA 2Y89A 2UV8G 3SR7A 1HO4A 2RH9A 2DZSA 3ZR4A 4UFJA 4O1AA 3DFSA 4FIRA 3IIOA 4IMFA 1YTDA 4N4QA 4FB7A 2OJPA 2WPBA 1W3NA 1GTEA 2ZZ7A 4YXGA 4S1FA 5C2XA 4YCOA 3L0KA 1X7FA 1ICPA 1T99A 3UXDA 3TW6A 2C0AA 5BMWA 2XFWA 5HR6A 1PHWA 3LV5A 4QJ1A 1C29A 1OFPA 1KM3A 1RQHA 1TB3A 1AMKA 3G3DA 3NQVA 1VQTA 3N9SA 4UFKA 4Y6GA 1KTCA 2CLEA 2E1DA 2Y63A 3LRLA 5T26A 4NNAA 3O06A 1DVJA 3LDVA 4JTTA 3BW3A 3BLEA 1K8YA 4YLWA 3PY2A 3S1VA 1OX5A 4UUIA 3JS3A 2ZRXA 3HG5A 5HWNA 1EWDA 2DJLA 2Z6JA 2VFFA 4TO8A 4RKAA 4FXSA 2A7NA 3TQVA 3W7PA 5F2GA 2YFOA 2Z0IA 3ABSA 4CQ9A 4JTIA 1FDZA 3ZWSA 3ANYA 3FJ6A 3QSTA 2FB3A 1QR7A 3CEPA 3G1FA 3R2GA 4U4MA 3W1RA 2DZVA 3GYEA 1YADA 3TAKA 4IOTA 1JCLA 3S9YA 4RR4A 1TRDA 4MOZA 4P61A 4ZQNA 4A29A 3LHYA 1LBFA 4AWTA 5LSMA 3PS7A 5HWJA 3W74A 3W9ZA 1WOBA 3CWOX 1THFD 4ADSA 1E51A 3NG3A 2WKJA 3IGSA 5KINA 4MFEA 5D30A 4DPPA 3LXAA 4UTTC 1JQXA 3W86A 2OCZA 2X16A 4KKXA 5E0KA 3PWAA 3W7HA 2V2HA 1EPXA 1KM5A 4UTLA 4RV8A 3VE9A 4O14A 3EKLA 1WXJA 4XBKA 4EVZA 4LS0A 2D73A 4GUIA 1P0KA 1I8JA 5G2IA 2C16A 3R12A 3NQAA 1KFBA 2Y85A 1K8XA 4X3ZA 3GKFA 3DH7A 4FEZA 2Y7FA 4ZQCA 2YXGA 4S2CA 4LUIA 3LB0A 3LBMA 2ZTJA 1DQWA 3EX4A 3SJ3A 3TMQA 3KRSA 2H8ZA 1SO6A 2QJGA 4XKYB 4JTLA 3GXNA 3T7VA 2P1FA 3BK0A 1OYAA 5DBUA 1L6YA 4O28A 2TPSA 4E2BA 1K7XA 2Q3RA 4N6FA 1LOQA 1SW0A 4JTFA 3W76A 1PS9A 3LHVA 5TQLA 3TCEA 3UWVA 5CPMA 4NJGA 3NQ2A 3TA6A 2PC4A 3CTLA 2J27A 4BFAA 3TV8A 4IPJA 1XL9A 3NA8A 2BSLA 3NM1A 3QSRA 2W0UA 4WUIA 1IXPA 4O0ZA 2A6NA 4BK9A 1WBHA 2TYSA 3TJXA 1W8SA 2E5BA 2RDTA 3LXCA 3NR0A 1O4UA 4O19A 1PE1A 3LCHA 4Q32A 3TNOA 1DQXA 3O1NA 5HMSA 1WQ5A 1SSGA 3DKJA 3W83A 4QNEA 3A21A 3PBVA 1EEPA 3NQFA 3HQ1A 3O63A 2BZNA 4TMCA 4GE8A 3VFLA 3M6YA 1K7EA 3OBKA 3FOKA 5FESA 1FWWA 1A5SA 1W5OA 2Y61A 2DP3A 2CU0A 4O1DA 1LOSA 5D32A 5CZ0A 4NVTA 4CNOA 4O54A 4GFSA 1OX4B 4IJBA 4GUFA 2X1TA 2NUYA 5G1TA 3T55A 1A53A 2DU2A 2R94A 4JN6A 2FFCA 5K2ZA 3A9IA 3UQNA 3UZJA 3HIJA 1G67A 5LNUA 4LY8A 1LRQA 2A85A 4Z1AA 4IMGA 4LW7A 1TPH1 2ZZ5A 5LZLA 2AQWA 2B7OA 5AHNA 2QR6A 5HJLA 3C2EA 5C5YA 1W5NA 3HMJG 2O7QA 1GOXA 1QPRA 2HS8A 4HT3A 4JIPA 1O5XA 3NPVA 3QQ1A 4HKPA 4MPQA 1M5WA 4ADUA 1RPXA 3PSVA 3IGUA 4O15A 2DZUA 3V75A 3B0UX 3THAA 1XBZA 3LCWA 1Y0EA 4MLJA 1JUKA 3C2RA 2GJNA 3ATZA 3W1TA 3GXTA 4GC4A 2QCHA 4HNVA 1TCDA 4L4LA 4O52A 1XUZA 5AHEA 3NL3A 1KBJA 3KFTA 1R47A 3PB0A 1HO1A 2HS6A 2VFGA 5HINA 3P60A 2YW3A 3P62A 1KLYA 2A7PA 2B7QA 5K9DA 3BG5A 4UFIA 4MZ1A 3S1XA 3LRKA 3M44A 3M47A 3JR2A 5D33A 1TV7A 5LHFA 1CI1A 1Q6LA 5BNKA 1QWGA 3W3OA 3ZS4A 3NZRA 3MBDA 2YX0A 3SFKA 4MJMA 4TIMA 3W1QA 4GNJA 2E6FA 5J5DA 1G4PA 3LX9A 2ZFAA 3W2KA 1SFJA 1ML1A 1QFEA 1YTKA 5F4WA 3MHUA 2RHGA 2CZDA 2X2GA 5CSSA 4NXKA 4DO5A 1UCWA 3W2NA 1BEUA 3HGSA 1WYIA 1YDNA 3G0UA 3HPZA 2RDUA 3L5MA 1JQVA 3M7WA 2ZZ3A 3D0CA 1PV8A 1TPWA 2V82A 3S6DA 3LTYA 4N6EA 4QITA 4MY8A 3EB2A 1N55A 1QOPA 1O95A 3TQKA 4AHPA 1W5QA 1AK5A 1Z41A 4RJEA 1JCXA 3BW2A 5C54A 5TIMA 4DXVA 4GUHA 3KRZA 3M5XA 1ZAJA 1TTJA 3BGGA 1DJNA 2WSYA 5SWUA 1SZGA 5KZMA 3DZ1A 5KITA 4UTWA 2QCEA 2J6XA 4Y96A 2FIQA 3RNDA 3W1PA 2FQIA 4A2SA 1ZJIA 4XTIA 3S5NA 3R13A 3GR8A 1HG3A 3M1ZA 1SZNA 1K03A 3P84A 1QPQA 3ATYA 2WV8A 3F4WA 1R2TA 3Q94A 4UMAA 3TXZA 4YMZA 3H53A 1ONRA 2V8ZA 2ZZ6A 5H91A 1AG1O 1XCFA 2PRHA 2GVJA 3NZ1A 1VPXA 2YGYA 2GQ9A 1SQ7A 3LHWA 3IIVA 2CLOA 4XBSA 2OT1A 3T4CA 2GJLA 3NQCA 3LXBA 4ICNA 1XM3A 1S3HA 1LBLA 4O1BA 4JR5A 3RF9A 4UC5A 4GRSA 1DOSA 4LT9A 5CZJA 1XBVA 4LVGA 1QPOA 1MO0A 2R91A 5EBUA 1F73A 4MFDA 5D02A 3GR7A 3BLIA 4QM1A 4K39A 1TV8A 1SW7A 4UFMA 2QAPA 2ZRVA 1W1ZA 3G1DA 2DZWA 5I3IA 1LBMA 4XKYA 4ZL1A 2V30A 3GZ3A 1U83A 3NO5A 3USBA 2VENA 3W73A 4RXFA 4ZVJA 4JX5A 3OEXA 3O6YX 5D2VA 3EX2A 4X9SA 3LBCA 4NJKA 3VE7A 2Y7DA 4CQAA 1SSDA 2QUTA 1KM2A 4O18A 5AFDA 4O17A 1L6WA 3SZ8A 1SO5A 4WX2A 2FLIA 1F6PA 3PBYA 4AVFA 1GTHA 4Z1BA 3BARA 3NNTA 3W88A 1TPB1 4POCA 1NFBA 1FQ0A 1XI3A 1OFAA 3DHDA 1ZY9A 3TFCA 5HUOA 1B4EA 4ZQRA 3UD6A 3GB6A 1KM6A 1H7OA 3HG3A 3LM7A 2QEZA 3GDRA 5G5IA 1VS1A 1SW3A 2ZTKA 5D05A 1QNVA 4MIMA 5HWMA 2BLEA 4IWWA 2GQ8A 1MZHA 3FJLA 4XUGA 3M9YA 1YXCA 5IBXA 1PCWA 5LNRA 4QIUA 1KW1A 3L0NA 4PC8A 1P4CA 4BI6A 3TKFA 1DJQA 1G4TA 5BRBA 2FDSA 4XZ9A 1YDOA 2Y88A 4H4IA 4ADTA 1ICSA 3P74A 3S1UA 3EWXA 1P0NA 1OX4A 2EPHA 3EWZA 1G6CA 3NL2A 2AGKA 3LGEA 3E0IA 3TQ0A 3KVMA 3KX6A 3GK0A 4N2YA 4DEFA 3P82A 4ORIA 4NQ1A 5KZDA 3TR2A 1OFQA 1UB3A 2A1YA 1H60A 1I2NA 1W56A 1BTMA 4GUGA 5J5RA 3BO9A 2V2DA 3EXTA 1YPIA 2DZXA 5I3GA 3DFQA 3PULA 5E93A 2EF9A 3N2MA 3W75A 1P5BA 1LP6A 3BV4A 3PVFA 1Z44A 1SZEA 1D3GA 1TPUA 4HN4A 2VKZG 4ZQMA 2YYUA 4WOZA 3O15A 3K30A 3W1MA 4GXMA 2VELA 1H50A 3OG3A 3P5YA 3M41A 1OX6A 3W7MA 3RMJA 2WNQA 2ZCGA 1ZCOA 2VFDA 3QW3A 1TRIA 4UNKA 3W7OA 4O1CA 1QOQA 3G0SA 2TRSA 2Y62A 5DCBA 4UMCA 4UTMA 3HGOA 1F76A 3L0GA 1OK6A 1U5JA 3QM3A 3QW4B 4ORMA 3B0VC 5FF2A 1QMLA 1P1XA 4QNWA 1FUYA 4K38A 4UNLA 3TJLA 3W1LA 3PBUA 1QCWA 1G7UA 2QJHA 1H1ZA 4QQ3A 2YYTA 4UR7A 1N7KA 4WOQA 2EGZA 5E1QA 2Q3OA 3UWUA 4A22A 5KMYA 3FLUA 4OU1A 5DXYA 1VH7A 3PR2A 1JR1A 4IX0A 1B9BA 3W85A 1Z42A 4LU0A 3QQ0A 4PL1A 3EEGA 4LS1A 3STFA 5F2LA 1LROA 1EWEA 3TSMA 3G22A 7TIMA 5H2ZA 1W5MA 3W7KA 1O60A 4L4MA 3W7RA 3HPXA 1TPVA 1ZAHA 1UASA 4FXRA 4JTSA 5D37A 5FEPA 3NPXA 3R8RA 1OFRA 1ME7A 2WOQA 1F5ZA 2ZA3A 2TMDA 5DLCA 3NQ6A 2EHHA 5AYZA 3UWWA 3UY8A 3LCXA 3SGZA 3B8DA 5CZSA 1ME8A 5FEXA 4ALDA 2HSAA 1NF0A 3TX9A 3GXPA 4O12A 3DFNA 3RU6A 3MP4A 3LTSA 2Z1BA 1JCJA 4O16A 4A2RA 1EUNA 3GIYA 4K7YA 1Q45A 1O5KA 1WA3A 1FXQA 2J9YA 2ABAA 3PUOA 2A6LA 3P5ZA 5I3FA 2H3BA 2J24A 1AL8A 3DBPA 2QUVA 4O57A 4ML9A 4WY0F 1JCYA 3VI2A 1B3OA 1MEWA 4LRSA 3TC6A 5I3HA 3DI0A 3L21A 1TTPA 2ISSA 1A5BA 2NZLA 3DI1A 2W79A 1EA0A 2OX1A 2A7RA 2G97A 4CCDA 3DU0A 2Q8LA
chains in the Genus database with same CATH superfamily
4JIEA 1D3CA 2ZWYA 4PULA 5HNTA 1VLIA 3DC0A 3BJFA 4IQJA 2Y6ZA 4E4UA 3IEBA 3N2XA 3V1HA 4DWSA 4U10A 1Q6DA 6PTDA 1IWAA 3NL6A 4YIWA 5I7GA 2HROA 1H7NA 1EQPA 3Q2DA 3B9OA 2HK1A 3NO3A 2C3ZA 2YL6A 3UZWA 4Y8EA 4AG0A 1A5KC 2V2CA 1EXBA 1OQFA 3L66A 2WM0A 4IMEA 1BWKA 3AYTA 2F2KA 2Y7EA 4E5TA 4UTIA 1E0TA 2GGJA 3A24A 1JJKA 2CWXA 4BKNA 4QXIA 1X1ZA 4GUJA 4B5WA 4UTKA 4AD4A 4MNMA 2DT3A 1BG9A 3LHTA 4HSHA 4JYDA 2VC6A 1GVRA 1W9BM 2C1GA 4JNMA 3U5YA 3KOFA 1HTIA 4NG3A 4RNHA 4U5KA 3R89A 4LALA 4NAFA 4LUJA 2J8TA 3ITOA 3W1XA 2OELA 4PUNA 3YPIA 5JVLA 1R85A 3B3DA 4GJ1A 3MUZ1 2D0HA 3VFCA 4CD8A 4ZE4A 1JD7A 3SY1A 1X6NA 3L5LA 2W9MA 1TMLA 3LPFA 2WO5A 1J0IA 2QAFA 2UWFA 4CNUA 2VFEA 4F79A 1ITXA 3BSGA 5DFAA 2XPKA 4JEQA 1S5VA 3IJIA 3WD2A 4FNRA 3NQ7A 2FPYA 4GD0A 4Q6JA 3KAOA 3KXQA 4LCRA 3W81A 1OJXA 2ADAA 2YR1A 3W02A 1DL3A 1UWUA 1X1OA 4C60A 4OOZA 3MS8A 4L61A 1RSCA 2ZE0A 1LWHA 1KD0A 2YL9A 2WNZA 4ZSTA 2INZA 1GGOA 3PBWA 3RM4A 1OFOA 4AIOA 3VGGA 2FGLA 5BZAA 5C8BB 5HPOA 4Z0JA 3KP1A 4K8HA 2GL5A 6TIMA 4C7GA 1K9EA 3D47A 4QFUA 4PMQA 4BWLC 1UWIA 4K3ZA 4IGSA 1XDMA 1I1WA 4DXXA 3MTWA 3LPGA 4QDMA 1FCQA 5C7VA 1XIEA 4AEEA 4IUGA 3K8MA 2BVDA 3NAVA 3T40A 3IAQA 4RCXA 3Q45A 4KWOA 4AXKA 2A3LA 1EH9A 1I2OA 2V5JA 2X41A 1AW2A 2WHKA 1T41A 3CYVA 1MEIA 2OEKA 3VNZA 1PX4A 3QHMA 2WK2A 2F84A 5XIMA 4H01A 3HGJA 3TW7A 2QCNA 1UR0A 4C6KA 1XW8A 1V0LA 3CGTA 2PBOA 1BF6A 3H7RA 1B90A 2OO0A 3M64A 4IIEA 4XTDA 4QISA 2RGMA 1XD1A 3DG3A 3WQ6A 2YZRA 3TXVA 1DHPA 4OT7A 3TIMA 3KVJA 3VM7A 4H7CA 2V6AA 3M0HA 3FA5A 2DZPA 1B5TA 3QMTA 3SRDA 4CVWA 3IV3A 3CYJA 2ZRWA 4HJFA 4QEEA 1T8XA 4DWDA 3KBSA 4I9AA 1T96A 5BMXA 2VD9A 3CL7A 1FHVA 3CZKA 4LF1A 3F7JA 2POZA 1NAL1 4OHQA 4PH6A 3T6CA 1RR2A 1Q4WA 2OYKA 3OVRA 4DZ5A 4JGDA 3LCGA 2Z29A 2XUCA 1UWAA 3BWWA 1RQBA 1MXSA 3EKZA 1FOBA 3NXLA 4KFOA 4RNJA 4LVBA 3MV01 1XJBA 1VRXA 1RA5A 4FR6A 1NF7A 4NZ1A 1RJQA 4CEUC 1HJUA 1W9UA 2XISA 2YCEA 3ARTA 2WSRA 4O8RA 4I7WA 5AYYA 1XBXA 3CWNA 5I77A 1MRAA 3UZZA 4U33A 1NOWA 1GOMA 3W6MA 3SECA 5K9CA 3N34A 3VDAA 2DVXA 3G1RA 3BJTA 1E5NA 3VKCA 1IGSA 2QVNA 1SU5A 3H24A 1Y65A 4X22A 3LQLA 5FF3A 1FA2A 3P7YA 4CNTA 3EA3A 2Z27A 2XM1A 1AQHA 7ODCA 3WQFA 2CHRA 1LQ0A 3WK0A 1VGAA 3B03A 3AMDA 4KF1A 1LT7A 2ZRUA 1HN1A 5EY5A 1T0OA 5ABFB 1V8EA 2Z7GA 1OBAA 3TWAA 4YHGA 3TOPA 3C0LA 4CCEA 5AECA 3IANA 4BQ5A 1JGIA 3MUAA 2YBTA 3VKJA 1AVAA 1AJ2A 3RG6A 2AAAA 4FOJA 2WVVB 2XVNA 3B0PA 3OPSA 4EWJA 2BVTA 2EPMX 3DFPA 3EGJA 4WDXA 2CLMA 3QY6A 1LLZA 2DSWA 2Z7KA 2X30A 4DUOA 2PTZA 3G1YA 3IVSA 3WQ8A 2PLMA 2QCGA 3CH9A 3UXIA 4C6EA 2PCEA 1LT8A 4U3CA 1KR1A 3N13A 3GVGA 4GH3A 4YWSA 3KLKA 5A5WA 2UY2A 2O9RA 5M03A 2ZQ0A 3SGUA 2NSOA 1F9CA 2YSWA 3K8LA 3M0MA 3TU9A 2C7FA 1GVSA 1RZMA 2B7NA 3WJZA 4QR6A 4WZHA 4HHHA 1LYXA 1JFXA 1PZ3A 3ARUA 4Q6XA 3NEHA 3O7UA 5LIXX 2Y4SA 5LA0A 1R3WA 1GEQA 1M03A 3UXAA 5IDZA 3N6QA 3KP0A 1U5VA 4LC6A 3F5KA 2EPLX 1VR6A 1EJRC 4BF5A 1FWAC 3IACA 1JRBA 1LLWA 4FA3A 1EDGA 3A23A 4IMCA 3SGGA 4V1XA 1IIHA 2KAUC 4LJ3A 3DAQA 2X0YA 2VOTA 2A3BA 1O5QA 3BAXA 3P6LA 4YTTA 2RKXA 4BF7A 4N4PA 4DQWA 5A6BA 3DX5A 1W3TA 3A5FA 4XAZA 5C9XA 5A6MA 2JE8A 3T05A 1EUAA 1M53A 4WHBA 5LKYA 1OHLA 3SUTA 2E9MA 5CZKA 4Q4PA 4E0CA 2OOGA 1WPCA 3WD1A 5D2WA 2QUNA 4IPIA 4GG9A 3KCLA 5HR7A 2VC7A 3CL8A 1JD9A 1Q63A 3TSBA 4RPPA 4EK7A 2CHNA 1AL7A 1JPIA 1EO5A 2PP1A 1ONEA 5AVHA 2EXOA 1U1UA 1KM4A 4X2PA 1FVPA 1KRBC 4AD1A 3AJ7A 4DIAA 2V67A 2IMRA 2NUWA 3UZYA 3QTPA 1PZ0A 2YW4A 3O6DA 2VD8A 1ZS2A 5FACA 3B8TA 1V0MA 1PVNA 3GHTA 1KGUA 4PB3A 3UW6A 4O13A 3C2OA 3C0QA 4I3GA 4DF2A 5I24A 1HP4A 4IJCA 4RDVA 3OQ8A 3LPOA 4AF0A 5D2XA 2HQAA 3IRDA 1OFBA 2YOCA 2VWSA 3UGRA 4DBDA 3N3TA 3ITVA 3L65A 5K4ZA 4N9EA 1RJRA 4ZODA 1DJZA 2JIWA 3O0FA 1RJPA 1E1CA 3J7HA 5CPOA 1QPNA 1JZ5A 1S2CA 1ZJBA 3QV7A 5DT5A 4S2BA 1TQXA 4Z2GA 4L5ZA 5FJJA 1C3FA 2Y0FA 2NXHA 4I5XA 3WQGA 2NX9A 4NUWA 3MZNA 4I5UA 5TF0A 4LYRA 3S6TA 3URNA 3NXFA 4GZ7A 3PJWA 4UQEA 4N9CA 2ZX8A 1HL2A 3MHGA 4NNBA 3BG3A 1XXXA 2Q09A 3HO8A 1T6MA 1MWOA 2B7PA 2WJZA 1LTDA 3I65A 2D3NA 1AMYA 3SCNA 2E6DA 3RJXA 1XLCA 4WJ8A 3MWAA 1TVNA 4UTTA 4OUIA 1OWQA 1A4MA 5CGQA 2BY0A 2BXZA 5CCZA 3VKAA 3UJSA 3HTWA 1TA3B 3U2ZA 4W5UA 5HK4A 1MEHA 5EMUA 3U0HA 4OWGA 4N42A 1PXGA 1EJ7L 1OZQA 2OZ8A 4PSPA 3EWYA 5T8GA 3MY9A 1IV8A 4FS9A 2OU4A 4D6FA 3IJDA 1XIDA 2MUCA 4B4FA 2OQHA 3MCNA 1CXLA 4ERGA 2B0MA 4UTWC 1BAGA 3CT2A 3OZYA 2PLJA 4DO6A 4DO4A 4PE8A 1Z7AA 1R3YA 3MB9A 2ASHA 3HF3A 1SR0A 3LLFA 5I06A 1SZRA 2W92A 2PURA 3PN8A 4LCQA 1IZCA 3ELFA 1HT6A 1WDQA 2IKHA 3MJMA 3L4ZA 3AROA 8XIAA 1VF8A 1UR1A 4PUMA 1W2VA 1TREA 2XZ7A 3COTA 3WUEA 1J2WA 1VHNA 2HTMA 3P80A 2A21A 1JVNA 1RD6A 2J78A 3GYCA 1IF2A 1XSKA 4AY1A 4PMZA 5JBFA 4H83A 4NZ3A 3DENA 3W7QA 3RK8A 3T0BA 2HXTA 4H1ZA 5CQ1A 3PPHA 4JIHA 1AQMA 2HPIA 4EE9A 4AMAA 1J96A 2W27A 3VIJA 2XFFA 5CG7A 2CBJA 3OU8A 3S5OA 2P76A 1JPDX 5CLWA 1Q4NX 1US2A 1WX0A 1PL9A 2I56A 2I1OA 4S3GA 3R6IA 4NKCA 3RX4A 2B4GA 4MZYA 3G3MA 4DPQA 2CITA 1E71M 1TTIA 2V0TA 5IBXC 4MYXA 3B0XA 1S46A 1GVOA 3OIXA 4F8XA 1R3TA 2E1WA 5L6UA 3GO2A 2H8XA 3F4DA 3KBMA 1JYXA 3B0YA 3W1NA 4IG2B 4OVXA 4UCGA 1OFDA 3PG8A 3D46A 3NL5A 4EX4A 2VFIA 4E4PA 1OG0A 2IXUA 2VRQA 2ZDRA 1GZ1A 2GLKA 4JKMA 1N2VA 4IICA 4CCCA 4PCFA 3AMLA 3IJQA 1KV5A 3MSDA 3WQPA 2HBXA 5AYIA 3C8NA 3ANUA 4KWSA 2P0OA 1CGUA 2BHYA 4RL3A 1FHDA 5XINA 4FX8A 4BEQA 1GKQA 2EJAA 2ZYFA 5HXMA 2E40A 1H1NA 3RLUA 4HNLA 1EBGA 2Z1VA 3MQTA 5KSWA 2QCFA 3UPWA 3MMDA 3RR4A 1ZBCA 1F7BA 5CSRA 4IZGA 1XRVA 4D6DA 3QY8A 1GNXA 2Z25A 4ROQA 2HE5A 1I4NA 4Z1DA 3KW3A 2Z24A 4HHPA 1XIBA 4LNCA 1LORA 3M0ZA 3LNPA 4UWMA 1PX3A 1CENA 2WJEA 1Q3NA 1VYPX 4EF9A 4TTUA 1H7XA 4DJDD 2BVWA 1DHKA 3LY0A 4EPBC 2CFFA 4NXSA 2Y5SA 3W7NA 3DYMA 4MB3A 3VILA 1SFTA 2WBKA 4H9UA 1XBYA 1KTNA 1J0KA 3CQKA 3NQEA 4QX4A 4GIRA 2X1RA 2NQZA 3S42A 3GG0A 2G3MA 3A4AA 3OGSA 1TJRA 4D8LA 4ERIA 3DHFA 2XIMA 5HULA 2W3ZA 2BHUA 4HYVA 4LVAA 3ID7A 3VX0A 3KL3A 1P48A 3KTSA 2GOKA 3VIFA 3P8IA 3P67A 2W6RA 4XZNX 1PJ9A 2CHOA 2P0IA 4JICA 2XIQA 2YJQA 4LB3A 1XQLA 1POJA 2E28A 4X0NA 1DPMA 2YDQA 8A3HA 2YBUA 2E6YA 5B80A 3SCPA 4MWAD 2E5CA 3BZGA 3N6JA 3I7SA 3H21A 2ZIDA 4LTSA 3HFYA 3L4WA 1MNZA 3VZZA 3N3MA 1HW6A 1NSJA 4KIEA 1N82A 4XAYA 3W7JA 4F0SA 3IIPA 3MKVA 3LRMA 2SFPA 4MNJA 1HO4A 4X0VA 2QJNA 4RPQA 3H2OA 1DJWA 1IZKA 3GHRA 2DZSA 1RBAA 4IFKA 4O1AA 3DFSA 4FIRA 1XYCA 4N4QA 4PUUA 3VIMA 4Y9OA 4F2TA 2WMJA 3H8AA 2WPBA 1GKRA 4UOQA 4C90A 1X39A 3KL5A 3GTXA 4JHOA 3GVRA 4YXGA 1UP2A 4GA8A 1F6YA 3E38A 2VQUA 3S6OA 2OQYA 4QJ1A 1NM9A 1OFPA 3G3DA 3NQVA 2FKPA 1QI3A 3N9SA 1KTCA 3NSMA 2XGZA 2Y63A 4GKTA 4X61A 4HYWA 3O06A 3WX7A 3LDVA 2GZXA 3S1VA 1E6SM 3JS3A 3RUBL 3HG5A 1EWDA 2AQOA 1IZJA 4FXSA 1EJXC 5F2GA 3CZ8A 1ZCCA 3ABSA 1GJWA 1XH0A 1YNQA 2FH8A 1S5MA 4CQ9A 1JYVA 3NZQA 1QR7A 3CEPA 3G1FA 4M56A 3UG5A 1YADA 1HF6A 4IOTA 1XFCA 4GQQA 3WMSA 1UD8A 3EPOA 1DP0A 1KXTA 4DJEA 1TRDA 5AZ1A 4A29A 4DBSA 1V79A 4LBUA 3PS7A 4DX3A 1A3XA 1ITCA 4JZ5A 3VNJA 2X16A 3PWGA 4NHVA 1VBHA 3QTGA 2V2HA 1EPXA 3ZJ6A 1KM5A 2VC9A 3VE9A 4GX9A 4O14A 1WXJA 4PRTA 1M9HA 4HB7A 2ZUNA 2QIWA 1YHTA 4GCAA 1CGVA 2AMGA 4YU1A 5M3WA 2V3EA 3ZLHA 3GW3A 1EDQA 2DY3A 3NQAA 3WNNA 3PZMA 2PDUA 2NQHA 2IPFA 4FEZA 1S2TA 3VOGA 4LFYA 5A94A 3JZUA 3IARA 3LB0A 1R3RA 2QYGA 2VX6A 3EX4A 2L5HA 1TJ1A 1GOOA 4MNLA 1BSIA 3KRSA 5A3HA 2H8ZA 1SO6A 3PJUA 4XKYB 3T7VA 1ZJHA 4O28A 1K7XA 1Z9AA 3TCEA 5C71A 2F2HA 2HISA 4I8YA 3TA6A 1Y5VA 2PC4A 3CTLA 2J27A 3I4EA 1KXQA 1VPYA 3NM1A 4D72A 3QSRA 2VUYA 3FGCB 2VWTA 1W8SA 4LAUA 4O19A 4C6LA 3WBXA 1DQXA 3M0KA 4EP8C 1V3KA 1WQ5A 2NW0A 3DKJA 3QFWA 3A21A 3PBVA 4NASA 3ERPA 3NQFA 3O63A 1IWPA 1PB0A 2BZNA 3WQ5A 4TMCA 4E6MA 5HJYA 3GQYA 4GE8A 1UD2A 3VFLA 2F9RA 1SGJA 1KKRA 2VGFA 1UOKA 4EPKA 2OG9A 5FESA 2GUYA 3M0IA 3OGVA 1A49A 1FWWA 1IEWA 2PA6A 1EJUC 1O6IA 4GFSA 3C3UA 1R9XA 3U9IA 2NUYA 5G1TA 3T55A 2DU2A 1C8QA 3WDJA 2FFCA 1VFSA 3LBOA 3FJ4A 3H2FA 4XISA 4C6JA 4U2ZA 1R3QA 3ZVIA 3M7SA 2AQWA 3NQBA 5C5YA 1HKWA 4Z2IA 4ZO6A 3CPUA 1FP8A 4JIPA 1O5XA 2GSHA 3NPVA 1X96A 3QQ1A 4HKPA 4ADUA 1MRQA 3V18A 2DZUA 4WF7A 4CQDA 3VZYA 3LCWA 4U5IA 4W7WA 3VMOA 5BWAA 3MVIA 3C2RA 3ATZA 2OYMA 3M0JA 2QCHA 1PTDA 1Q6CA 2YLLA 3EMQA 1RHCA 2YW3A 1KLYA 3ICJA 3FAXA 2B7QA 2D23A 3BG5A 4ZB5A 4UFIA 2QT3A 4MZ1A 2YA0A 3M44A 5D33A 5JBDA 1CI1A 1Q6LA 5BNKA 1OD0A 4KEZA 3ZS4A 1EZWA 4GXPA 3SFKA 1H5VA 9CGTA 4AZHA 3W1QA 4GNJA 2DIJA 3W2KA 1SFJA 2CZDA 4LAMA 3HPAA 1TV4A 2WC4A 3W2NA 5BU6A 3G0UA 3GNXA 4IFOA 4GGHA 5M17A 2WLYA 1PV8A 1ZJAA 4XZBA 3S6DA 4PMYA 1N55A 2YA2A 4JCLA 1W5QA 1ZPTA 2R1KA 3MSYA 1JCXA 5C54A 3V35A 2VM8A 2D24A 2HBVA 2E25A 1VFMA 3ZQ9A 3CZJA 3PTMA 1DJNA 2WSYA 2XVPA 5KITA 2J7FA 4S3CA 2QCEA 9RUBA 1KGWA 2DV0A 5M1TA 2FIQA 1ZL1A 4XTIA 5EMKA 1K1DA 4ZA0A 5HQLA 3P84A 4Z2JA 3ATYA 3F4WA 5EFDA 1DWGM 3H12A 3Q94A 1QU4A 3TXZA 4PMNA 3H53A 1ONRA 3GZAA 3G6LA 3WNMA 2DUZA 1SMAA 2GQ9A 3XIMA 1NQKA 2CLOA 3APGA 2OT1A 2PGFA 4FI4A 4LYKA 4H8VA 2GJLA 3LXBA 4ICNA 1XM3A 3WNLA 2Y2WA 4O1BA 4U31A 1HVQA 1OEPA 4JR5A 2OO6A 3KOYA 1EJSC 2OYLA 3AXKA 1CZ1A 4GRSA 4LT9A 3A64A 3LMYA 4LGXA 1XIGA 5D02A 3GR7A 1XH2A 4NI3A 1SW7A 2QAPA 1ODZA 1FHLA 4LF2A 1RY0A 3E0WA 4IIHA 1W1ZA 3G1DA 1LWJA 2DZWA 4KEMA 1CBGA 4URIA 5A8QA 4ZL1A 1QWKA 3GZ3A 3G5EA 1JI2A 1FKXA 3W73A 4RXFA 4J4KA 4A8LA 3O6YX 5PTDA 2VDHA 2WZHA 3GG7A 1UZ4A 3LBCA 3WEZA 3VE7A 4US6A 2PU1A 2DQWA 2WQDA 4DWSB 4CQAA 1SSDA 2QUTA 4FOUA 1KM2A 2J77A 1OG6A 2XM2A 3U2EA 1BKHA 1L6WA 1GK8A 2VGGA 1F6PA 3VGFA 3GTFA 1TPB1 3WUGA 1WUEA 3KWXA 3A9BA 4KWUA 4HA3A 2BGQA 1J0YA 3UD6A 1VAHA 3T0CA 2QEZA 1VS1A 3QKEA 5D05A 2GQ8A 1MZHA 1BVNP 1F8MA 1XGDA 3KS6A 3D3FA 4E3TA 5LNRA 4QBXA 4QIUA 1KW1A 1JZ4A 2D22A 3KBNA 4ZOAA 2GDQA 4DJDA 1G94A 2VR4A 3L23A 1H09A 4XZ9A 1YDOA 5EBAA 3S1UA 1P0NA 4C6IA 1K6AA 2GGIA 3NCOA 6XIAA 1D2KA 1X8CA 4F9DA 1AD4A 4G7FA 4XZHA 4ORIA 5REQA 1KXVA 4NAFB 3NYDA 1VFFA 4TVCA 1QASA 1A5MC 4GUGA 5J5RA 4QCFA 1CYGA 5E93A 2EF9A 3RN6A 3HU7A 3QZAA 1MUCA 4UZUA 2QXWA 3W75A 1VB9A 3TYDA 3ZM8A 4GIYA 1YBQB 1WKYA 3KTXA 2WMHA 4ZSUA 4DUXA 3BV4A 3PVFA 3EA2A 3BAYA 3JVAA 3S2JA 3CUFA 4GIAA 4ZQMA 3GDBA 5I09A 1UKQA 4C7DA 3K30A 1X97A 4NF7A 3W1MA 4MWAE 4KCUA 3OG3A 3RR1A 3W7MA 4MWAA 4NZCA 4UNKA 3W01A 4LEQA 3G0SA 2TRSA 4JTAA 3W38A 5A95A 4DZIA 2WHJA 5E09A 5A69A 3AMGA 1XISA 3CXOA 3POHA 1M7JA 1XYFA 4UNLA 1ODUA 1FWIC 1H1ZA 4QQ3A 2EGZA 4A22A 4WR3A 4YTRA 1EDTA 4H9YA 1EGVA 1Z42A 3QQ0A 4PL1A 1E0VA 3CL6A 3E6EA 2VO5A 4HCDA 3EEGA 3STFA 4GQRA 1B30A 1K4HA 1TZZA 1EWEA 5H2ZA 3VDCA 2PMQA 3W7KA 1JNEA 4JEJA 4EAMA 1NDZA 1IEQA 3N18A 4XVDA 4DB7A 1F07A 3F4VA 3AHXA 5FEPA 1ME7A 1YMYA 2ZA3A 4QAWA 2TMDA 4OECA 3NQ6A 3CAQA 4IPNB 2EHHA 4KMQA 3ZXWA 3W6LA 1ME8A 1WZLA 4I90A 3SCSA 2HVMA 4Z2HA 3DFNA 2PDFA 3LGDA 3MP4A 2Z1BA 1EQCA 2OX4A 1E73M 3BQ6A 5EU9A 1MW3A 4O16A 4PMRA 4D8ZA 3GIYA 2XH4A 2GDUA 4K7YA 1UP0A 2ISDA 2J9YA 3UR2A 3V0SA 3PUOA 4HBKA 1Y5XA 4GISA 2H3BA 2WANA 3UYIA 3PP7A 1AL8A 4ML9A 3E3HA 1S2WA 1AA1B 3TOYA 2P3EA 2C1IA 1UKPA 3SQMA 3TC6A 2DSKA 5I3HA 3L21A 2NZLA 1R3VA 4R3UA 2PWDA 3WLKX 2FH6A 2OFJA 2G97A 3PZTA 1C90A 4CCDA 2PDCA 2ZXDA 4HIBA 4R5EA 3PNZA 4JXCA 1IWBA 1OADA 3STGA 3GBDA 3VINA 4EACA 5IHSA 3E5BA 1MVYA 3S5SA 1BPLB 4HPXA 2YL5A 1MUWA 3CEUA 1AZ2A 1J18A 2WC3A 3UWZA 3PTKA 4KQNA 2AOSA 4H04A 4YCPA 3V5OA 2QGYA 1JNDA 2CYGA 3AMCA 4WQ6A 3GC2A 2ON3A 1CNVA 4IPLA 1H3GA 3M0YA 4F2UA 1W9VA 1MQQA 4O10A 5AZ0A 2GGHA 3H55A 2VP8A 3L9CA 4NX0A 1DWFM 3PZIA 3QOKA 4H2HA 5AHLA 3PUEA 4H3DA 5CJ5A 3AISA 2O7SA 4IP7A 4AISA 1M01A 4L4OA 4FNUA 2CC0A 1W5PA 5A6JA 3CMGA 3RIKA 3QLLA 1QNSA 2Z1KA 3CS2A 4LOCA 2I16A 4CU8A 1OYCA 1MW2A 4FX7A 3Q58A 1JF5A 1A5UA 2FZ9A 1S3TC 3WDRA 3FJNA 2ISVA 3ARWA 3PZNA 4KIRA 1E1EA 3WLTA 4AB4A 4ES4A 3GY1A 2E9BA 4W8AA 3SY5A 3UCDA 2G3IA 3EZ4A 5A6LA 1P6BA 3TUUA 3N2CA 2NX1A 1UZDA 3NJ3A 4PODA 5DXXA 1EHAA 3G2GA 2LLEA 1VFUA 1UROA 1S5WA 2VX7A 3MJYA 4Z0SA 4UNIA 3QZEA 4XO7A 4PTNA 3DGRA 1B4KA 2AKZA 4UFHA 1DIDA 2W62A 3I3DA 4GH1A 1PUDA 1UUOA 3E49A 5DCDA 3BG9A 4MJZA 4UTFA 3FX4A 5I6SA 4RV3A 4DBEA 5D4YA 2G3NA 3H7UA 1OIFA 4KWWA 4LUTB 3CQHA 3CUXA 5CSYA 2VGBA 4JFWA 3ZT6A 5JUVA 5FAGA 2Q8ZA 2DW6A 5DRCA 4BJHA 4QDPA 4HZMA 5D9NA 4RUBA 1Y7VA 2VXNA 1YNPA 1L6SA 2YDAA 3ZT7A 3GWQA 3EOOA 5CGMA 5HATA 3PZUA 3ONBA 5CPSA 2XGBA 5B7ZA 2TSYA 4IGMA 1D3HA 4HCHA 2PE4A 1GONA 4O0KA 3S83A 4N9DA 1ZALA 1F3WA 2CETA 3DGBA 2J66A 1GT8A 2IQ0A 2ZA2A 2PDGA 3P2VA 5CKSA 1EXPA 2ZRZA 3GLCA 3GXDA 3UYCA 1TWSA 4QLKA 3NEVA 2PP0A 3E2VA 3BL3A 3CIWA 5EL1A 5G4EA 5DBTA 3O3RA 4HNTA 4RX0A 3CQJA 1BF2A 3LGGA 2CLLA 4B9ZA 4C6FA 4RE4A 1XD0A 3GH4A 4B5TA 1IE7C 4XD6A 1ONWA 3AWOA 5C2GA 2Y5EA 4UTUA 1CXHA 5D9OA 5AC7A 2XN2A 1XHGA 2XIBA 3HM7A 5AC8A 3D6NA 1KQZA 4GGBA 4RZ6A 4REQA 1Q85A 3VVGA 1TPDA 3HG2A 3TZFA 1R5YA 2J7DA 4OBTA 4C6OA 4NILA 7ENLA 3K5XA 3M5YA 2VDIA 2BVYA 1VCVA 4ZEPA 1E5JA 4H6KA 4PFHA 3CT7A 1ZSXA 4HPJA 3WL0A 4RW5A 3EWUA 1XLDA 5FKYA 3R8HA 2XZ9A 2PDPA 1XYAA 3VIHA 1XIIA 1FFQA 4ENLA 3EEZA 4JHZA 3VOHA 1NFPA 2FZDA 3DKLA 3ARVA 5CXPA 3OA5A 1Z8AA 1JRCA 1G4SA 1LQ2A 3BDKA 1FP9A 3UPBA 5BXSA 3EB4A 4V27A 3Q37A 2AL1A 4PB5A 1U30A 2R24A 4LPCA 4AF0B 4KH2A 5G2HA 4K8EA 3H54A 4W88A 1WDWA 3BJSA 5CLTA 3MDWA 2YIHA 2GVYA 3E02A 4PSRA 4GINA 4F40A 5K9XA 3WH8A 4F0LA 1UKSA 3LTPA 4ICMA 2TAAA 2QCLA 3VD4A 5AB3A 4Q3MA 2JKEA 2DDXA 1U33A 1TIWA 5AHFA 4B5NA 5AN7A 1GHRA 4FX6M 4XB3A 1YPFA 3WO8A 2CZFA 4L7ZA 2XYLA 3B06A 1J6OA 2JGQA 4PCTA 2OEJA 3P8JA 2VZVA 4ATLA 5C70A 1Z69A 2EEXA 4OBSA 4C91A 5DT7A 3SDOA 3F4NA 3STCA 5BXTA 3V5CA 4W85A 3BAIA 1IIGA 1G1YA 2A3HA 2JKPA 2DT2A 1XC4A 2CKRA 3NO1A 3RLVA 1BFNA 4A21A 1H11A 4MM1A 3C6CA 2KX9A 3WDQA 4KT2A 2HZGA 5E0CA 3LN3A 5JIPA 4PMVA 5LNVA 3OLIA 3C61A 3WMLA 3S46A 3GR4A 4JTGA 3KVKA 4GX8A 4XSLA 2I5IA 1M04A 1Q65A 2IQTA 1KM0A 4IPPA 2NQ9A 1RLCL 1UQZA 1Q13A 1YNYA 3F1QA 2R1LA 1SM9A 1UMLA 3QR0A 1IT7A 2XSAA 4HMEA 5AC6A 3U48A 3SCOA 2WW5A 1I1XA 2QCMA 2VVSA 3GSMA 1Q6RA 4K37A 3TJ4A 1JAEA 1YDVA 1ZZMA 3SN0A 3UXKA 3WF2A 1O1HA 4RNIA 3LERA 3N4FA 1JZ7A 3WH7A 1M3UA 3MSRA 3EXRA 2D1ZA 4XKMA 1NWRA 1XP3A 1LRTA 1WB0A 3BQ5A 4JQ2A 4YTUA 1GW1A 3CAVA 3N9RA 5BYWA 2FZMA 2O4QA 1NARA 5U4NA 1UUMA 1V6VA 5EYWA 1IQ8A 3V0TA 2OMAA 1ESWA 4KFNA 5JMUA 3U2OA 2GGEA 3AXHA 3UPMA 3SCVA 1KRAC 2QV5A 3BV7A 4Z1CA 4CKQA 2WVUA 1XUUA 4JFSA 4DNHA 4G8TA 2DUXA 1JF6A 3GFYA 5HBFA 1GQJA 3GC4A 2R14A 3ITTA 2TODA 4NZ4A 5CPQA 5A8OA 3LOTA 3VD3A 2FMNA 3EMZA 4LWWA 4WY0A 5G4WA 1GWJA 5LYRA 4PGLA 1G4EA 4R9OA 3AJXA 3GDLA 3NPWA 3BH4A 2REQA 4J35A 5JXQA 2JGYA 3KZPA 4RK8A 2GPTA 1PKMA 3L4UA 1K70A 1XYLA 4IG2A 3RPDA 3S5YA 3OVQA 1ISWA 3PC0A 1ADSA 3B4UA 4IXHA 2I9UA 2QVHA 5F1VA 4ZENA 3W2UA 1JCNA 1A0EA 4AZCA 3LENA 3IIXA 5ECVA 3FIGA 3C5QA 4XAGA 2OPJA 2UY3A 3CLMA 3KOZA 3CQ0A 3G6MA 3ITCA 1XYBA 4WSHA 1W31A 3WQWA 2RFGA 3REQA 4PMXA 1LLOA 1YXDA 3H2CA 4JYFA 3T2QA 1MSSA 3BW4A 1PIIA 3HZ3A 3NDYA 4M3PA 4L9YA 2OLSA 4NRRA 1GOQA 3F2CA 3II1A 2GGGA 1JGMA 3LHZA 3FW6A 3B40A 3VABA 2ZVRA 4A3HA 1NOUA 4ZGYA 3NURA 4FAMA 1XLGA 4GYFA 3LZ5A 2J74A 3G1AA 3NDOA 1H7WA 2DORA 1XFBA 3HQNA 2QCCA 1ZLPA 2PBGA 3O2LA 1GYMA 2QMJA 5LGXA 3O8AA 4PFMA 3C52A 1IEIA 4N9BA 3MUY1 3GIPA 4F0KA 2J9XA 4TV6A 2QS8A 4KFPA 4EIVA 1C7SA 3EDFA 4GI9A 4PEEA 2J9ZA 4CN1A 4IH3A 3S1WA 3N15A 3RX3A 2BV9A 2YLAA 4LC8A 5E6YA 1KFJA 5H8MA 4ZFCA 3RCYA 3GX9A 4JQ3A 3CO8A 4UCFA 2CZVA 3IVTA 1X8FA 3GUWA 4MVAA 4RDWA 4QRNA 3WQVA 2FHCA 4MKNA 3G1HA 1PHQA 5CSUA 1J4EA 3MO7A 2ZZ4A 3M43A 4JS3A 1KR0A 3W29A 3W37A 1F6KA 1UQYA 4Y9AA 3A4XA 4EXAA 2BS9A 4JY9A 2NX3A 3LCLA 3V7PA 2PDBA 1HQTA 3MP5A 2OLAA 2J47A 1KRMA 2YXOA 2Z1WA 3KVLA 4E4FA 3U57A 1KWKA 3TTSA 2JIEA 1GVFA 3RRAA 2H3DA 2ALRA 3R0UA 4JDBA 4QLJA 4GCXA 3GDKA 3NSNA 3DFOA 5DELA 1CLVA 4JIIX 2PP3A 4PEKA 3APTA 1QHOA 4IX2A 4WXYA 1F3TA 4L1XA 2J7GA 5B7YA 3M5ZA 2O56A 1L2UA 4IQLA 3WDHA 4HNNA 1UBPC 3EPMA 2BNJA 4GBDA 1JFHA 4US5A 3IGXA 1FX6A 1N8IA 4GO8A 3PFRA 4IFKB 3PTDA 1AH3A 2OR2A 3C2YA 1M68A 3GFZA 3PBMA 4M6QA 4R33A 2P8CA 2RJHA 4OZOA 4NZFA 1XYMA 3QF0A 4GVHA 9XIAA 4PUEA 1V03A 3QPZA 4J5NA 3S2NA 4BF9A 4MY9A 1M1BA 3WLJA 3N73A 5FEZA 2CXGA 4X9YA 3UFYA 3MMTA 4EXQA 1TX2A 1WBJA 2O92A 3H70A 3IUHA 1EGMA 2J88A 4AD2A 1Z32X 5A6SA 4WSKA 3MUIA 3N04A 2OSXA 3W7DA 3RO6A 3T07A 1E43A 4B4HA 2E4TA 4W4QA 3CLWA 4QG9A 3WK3A 2CLFA 5F1UA 3IAPA 1KV8A 4FF7A 4R7WA 3M5VA 5H6HA 4G56A 3GU9A 1CTNA 3AIWA 2P5NA 3FYOA 3W53A 3W07A 2G3JA 3PSWA 1A47A 2FPTA 2CCRA 2HJPA 3THQA 4TXEA 1J11A 1HXJA 3W7EA 2BP1A 2QDHA 3UR5A 3QXBA 3PK7A 2OVLA 2Z00A 2G96A 4YL2A 3ZJ8A 2VEFA 4H8HA 1L6GA 2J8GA 3G1VA 1TO3A 1M7OA 5CC6A 2PDYA 3KBWA 3FAWA 4QDWA 3U7BA 3CHVA 1CLXA 1PAMA 3R25A 4WSJA 4HNUA 4U3AA 3HQOA 2Y70A 1J01A 2DH3A 1OCJA 5FAJA 2CLKA 3E9AA 4WJEA 1H1YA 1BKSA 1S2UA 3EWWA 2O9TA 1OT2A 4PZVA 4HZ7A 1GVEA 5LNSA 3U4FA 5A2AA 2PU0A 4Q4MA 4N0RA 2E68A 5FIPA 3LMZA 3DHUA 3EX6A 2NVDA 3QJAA 4J1OA 3DBNA 5FEWA 2VCBA 4JBRA 4DM2A 2DGAA 3AXIA 3CV7A 3M07A 1X6UA 1RK6A 2CLPA 3F2BA 3WELA 3W7CA 1J93A 1DYSA 3L2LA 4J2MA 3VDHA 4JTEA 1EC7A 3MSGA 3R58A 3FGCA 2QCDA 4C6BA 5H1WA 2E09A 3NM3A 2PTYA 5E9AA 4HU0A 3VIIA 2ALDA 3SI9A 3BCJA 4LVFA 1YE4A 5E6ZA 5EPDA 3TC7A 4E8CA 3R43A 5LNWA 3OBAA 5ENLA 4H9XA 4BI7A 1Q7MA 3VCCA 3RILA 1TV3A 1VCFA 5D09A 2WHMA 2JK2A 4GNVA 1PPIA 3EOEA 1UR3M 3FK4A 3WEOA 4A3YA 3Q4DA 4ZTYA 1J0ZA 4K1GA 3NYZA 3L5AA 1ZENA 2UZ9A 3HJEA 1KM1A 1E6QM 3WIJA 1MDRA 1RK5A 1DXFA 1H63A 2OTDA 5KETA 3V36A 3QGAC 2PLKA 4B5XA 4WLCA 3MUXA 3TQPA 3OHIA 2BTMA 4D6GA 2X7WA 3DECA 2F6XA 1H7RA 3FY1A 4FPSA 4GMEA 4UMBA 3TTQA 2NQ5A 2PSNA 3SR7A 2QGHA 4RE3A 1ELSA 4DAFA 4DRSA 2RH9A 3MMWA 4NZ5A 4AQLA 3ZR4A 2HV5A 3NZPA 3TYAA 4IMFA 4XX6A 4FB7A 3S4TA 2IS7A 1Q6EA 1W3NA 2DW7A 2V5CA 3LLXA 4R7OA 4S1FA 1IGWA 3CZGA 5C2XA 1ICPA 3UXDA 2P53A 1RVKA 5BMWA 2ANUA 2XFWA 5JU6A 3JW7A 1TB3A 2E0PA 3S2LA 1AMKA 5KEZA 3OG2A 1UOZA 1D8WA 1I0DA 1VQTA 3IJLA 4QS6A 1TFVA 1IR1A 1BTCA 4UFKA 5DO8A 5LIKX 1BQGA 4GYKA 4DWSC 4E8GA 4JTTA 3BLEA 4ZTXA 2DIKA 1MI3A 4AUBA 2G41A 4AVNA 7PTDA 3G77A 5HWNA 3U5UA 2Z6JA 2VDGA 4RKAA 2PI6A 2A7NA 1QUMA 2WWCA 1J8VA 1KKOA 1X6LA 3ARSA 2YFOA 4Q8NA 1FDZA 3ZWSA 3ANYA 2Z2BA 3FJ6A 4PMUA 4U4MA 3GYEA 1H41A 3TAKA 4Q4QA 4IIFA 4QJ5B 2JALA 2OGJA 3S9YA 4MOZA 4ZQNA 1EBHA 2C71A 2CBUA 1XH1A 1LBFA 5A6AA 5LSMA 3RLHA 4ADSA 3NG3A 3IGSA 2AMXA 4MFEA 1RP9A 4WKFA 5D30A 3SRFA 3LXAA 4H6QA 5ECUA 3HA1A 5E0KA 3WD4A 4ZOEA 1HKIA 5CAHA 2DFAA 2ZUSA 4EVZA 1UR4A 2BGNE 2D73A 4DLFA 3WMCA 3PPGA 1P0KA 1GVIA 1CGWA 4ZE5A 3GTNA 5G2IA 3R12A 4IFRA 4F0RA 4X3ZA 1JDEA 1VP5A 1DJYA 4S39A 4GQ0A 3OOQA 3WF0A 2YXGA 4S2CA 3ZMRA 3LBMA 4YYFA 3SCUA 4LUSA 4W5ZA 3WLPA 1FH7A 3SO7A 5JQ9A 3ZOAA 2EJ1A 2PTDA 3KOXA 2QJGA 3OODA 1BWVA 2P1FA 4MB1A 1NP2A 1SJDA 1C7TA 4Q4OA 1YIXA 4JTFA 3W76A 3AIEA 1AD1A 3O0KA 3TN3A 2QIIA 2JEQA 2PDQA 3M0XA 3T8QA 3NA8A 2BSLA 3ENLA 3HPFA 1RCOB 1L8NA 2Y1HA 3UWEA 2A6NA 3CHDA 4L9XA 2NT1A 4KRTA 3TJXA 2RDTA 3LXCA 3NR0A 4Q32A 1PE1A 3O1NA 4EKJA 3GG1A 3WF4A 3SRHA 4I9MA 1EEPA 3GIQA 5BOEA 4DAIA 1AODA 1WUFA 1ZRQA 3P0WA 3AZRA 3FOKA 2VZSA 1DEDA 1A5SA 3UF9A 1J6PA 3B8IA 3EAUA 1J12A 1E55A 2DP3A 3W24A 2CU0A 4H7ZA 4O1DA 1LOSA 2WZTA 1DE6A 2VC5A 5CZ0A 4NVTA 1DIOA 3FV9A 4IISA 2ZXQA 2ZUUA 1PBGA 3ITYA 5REQB 1YW1A 1GQKA 1YBQA 2ZX7A 4H00A 1G67A 4ZXOA 1A80A 4LY8A 4Z1AA 4B15A 4IMGA 4MTVA 2CIPA 3LZ3A 1W5NA 3HMJG 2O7QA 4WIWA 2PDNA 3PSVA 3K1GA 4O15A 3V75A 3B0UX 2EPOA 1PKNA 3WLMA 4Y9NA 3TN4A 4I6VA 3GXTA 4Q4SA 4L4LA 3TYEA 1XCXA 2A79A 4MWAB 2POTA 3KFTA 5FSDC 3PB0A 1HO1A 3GD6A 2HS6A 1GEHA 3VMPA 1H4PA 3UETA 3CBWA 1C9WA 3LQGA 1F4AA 2HE8A 3S1XA 3LRKA 3M47A 1TV7A 5BRQA 5LHFA 2V3FA 1UA7A 1VBUA 3W25A 3CV2A 2WLZA 3GHUA 1GPFA 4MJMA 3IJ9A 1W91A 2E6FA 3LX9A 1ML1A 2RHGA 4PTXA 2X2GA 4NXKA 4OKDA 4JTDA 4DO5A 2NSXA 2YCKX 7REQB 1BEUA 3QV9A 1WYIA 3SB0A 3OHMB 3H22A 3HPZA 1F3EA 2VR5A 1UZ1A 2ZZ3A 1SMDA 1YKWA 3PZVA 3WBAA 3CUJA 4B92A 3LS9A 3B9AA 1Q6GA 4QITA 4ZCWA 2PD9A 1DJIA 4MY8A 3EB2A 2ZE3A 2XWDA 3ARZA 4S38A 1GORA 4RJEA 3TYBA 1JDDA 5F7UA 1EJVC 3BW2A 4Q22A 1VENA 4GZJA 3GW0A 3KRZA 5BXPA 1ZAJA 2VEGA 4L9ZA 4XIAA 3AZTA 1AH4A 3RPMA 3E2QA 1FFRA 2J6XA 4Y96A 3F5JA 5G1MA 3RNDA 4QSFA 1KFWA 2DT1A 1ZJIA 1W17A 3R13A 2QDEA 2CEQA 5DMNA 3SCQA 4BQ4A 4GC3A 3GR8A 1H49A 3M1ZA 1SZNA 1QPQA 1R2TA 2CPUA 1PYMA 1BHGA 2HK0A 3E2SA 4AZIA 2V8ZA 5H91A 3T0TA 4PCNA 1VPXA 2YGYA 4JQ1A 3IIVA 3S3GA 3MKKA 1X38A 3T4CA 2QJJA 2CESA 5CC7A 1SFSA 3BLDA 2BMBA 1VPQA 2J62A 4LSBA 3VAVA 3APYA 4KCVA 4LVGA 2WMKA 5EBUA 1F73A 3PHAA 3VGDA 4QM1A 4K39A 1TV8A 1QW7A 4UFMA 2UY4A 3HMCA 3A3XA 3WL1A 1NWSA 2V30A 1U83A 1TWZA 2YCLB 4AZ6A 2YDSA 3GVQA 4ZVJA 1ZTVA 1M7XA 4X9SA 2VTFA 4GVFA 1QHZA 1A3HA 2Y7DA 1OD8A 4O18A 3SUUA 5AFDA 1ISXA 1P1MA 1PO9A 1SO5A 3PBYA 4AVFA 4H2CA 4POCA 3KHDA 1NFBA 1XI3A 3LUTA 3B97A 4OTKA 1B3ZA 1Y8BA 1OFAA 1K77A 4IMAA 1H7OA 3HG3A 3GDRA 5G5IA 2BLEA 3FJLA 1SVDA 2NVCA 1YXCA 5MKGB 3BURA 1KWGA 3L0NA 1VFHA 2ISFA 1G4TA 4TX6A 4CVUA 4OIFA 3ANVA 4H4IA 1PWMA 3P74A 3EWXA 4XO6A 4WGXA 1KBLA 1KB3A 2X8RA 3EWZA 3RYSA 4DYKA 1U1JA 4G7EA 4DEFA 3P82A 4NQ1A 3TR2A 1OFQA 4GQBA 4HOZA 1XRFA 3BO9A 1S1RA 4M51A 2V2DA 3DFQA 4IF2A 1F61A 1T8QA 3N2MA 2C8NA 1BRLA 4C5YA 1P0DA 1BLIA 2VR2A 1LP6A 3BUVA 2DZAA 1Z44A 1SZEA 4NYYA 2FMOA 3DOPA 4HN4A 1S2AA 3MPGA 4HGXA 2C91A 2OWWA 2YYUA 4JKLA 2FGBA 1FHUA 3AOFA 4D6EA 3SCTA 3T1GA 3ZYZA 3GU2A 2G4FA 4GXMA 4V1YA 4BHYA 4LUTA 3RMJA 3SRKA 4WDWA 1ZCOA 4Y9MA 4KEVA 3QW3A 1GW9A 1QOQA 1QI4A 1EEXA 5DCBA 5EMYA 5GNZA 2F38A 3JZEA 4UTMA 1F76A 1OK6A 1U5JA 3QW4B 3B0VC 4YVPA 5FF2A 1QMLA 2FTWA 1P1XA 3OO2A 4MUPA 3TTEA 3VKBA 2XSBA 1QCWA 1G7UA 3CV6A 1CDGA 2IKGA 4WOQA 3KEHA 2Q3OA 5E1QA 2ONEA 3FLUA 4LX4A 4C6PA 4F48A 4GYPA 2E67A 3NVDA 5DXYA 4QS5A 3AI0A 3GUGA 4IX0A 5ABGA 3W85A 4HZ8A 1QNRA 4PB4A 2D20A 1OGSA 5F2LA 4UQAA 3W26A 2GJPA 4BS0A 1MYRA 4INFA 3G22A 7TIMA 4LUYA 3ISIX 2GSEA 1WZAA 1QI2A 1UG6A 1O60A 2NV9A 3OYZA 1ZAHA 1UD6A 1UASA 2Z2AA 1OFRA 3QY7A 2WOQA 4HZ6A 3OLEA 5E70A 5C0QA 3VOCA 3FVDA 3FNDA 3UWWA 3RRXA 3CB3A 4TV5A 2G37A 3DEQA 2ZX9A 3OP2A 5FEXA 1XINA 1JDCA 2XDFA 1V6XA 1K8CA 5A8PA 3IUDA 3QV8A 3WBYA 1UR9A 3GXPA 1VEMA 4JL2A 1WKDA 4HOWA 1F8IA 4LAKA 2E8YA 1SJBA 3K1DA 4DVOA 1NTHA 1I60A 3VOFA 4Z42C 1V51A 4ZO8A 1O5KA 2RJGA 2YKKA 4KESA 3K13A 4REQB 4H19A 3NZGA 5CBJA 2Y8KA 3L2MA 5I3FA 1UWRA 5FSEC 1TG7A 3TWBA 4WY0F 3W82A 1XLHA 3K8KA 2O0TA 1BYDA 2FVKA 1TTPA 1XLMA 3DI1A 3TLQA 3PPCA 2OX1A 5FA5A 3R79A 4IQDA 2RGLA 1KCXA 3DU0A 2BY3A 4A6GA 4MAZA 5IM51 3ZLFA 1TSIA 3CMFA 2PWFA 1KNWA 4CGTA 3U7VA 4XUYA 1F74A 3MMUA 2X0SA 2XIJA 4AHQA 1LL7A 2NWRA 2XN0A 1EF2A 2YFNA 3TE9A 4V28A 1Q5MA 3KRBA 2HEJA 1H0IA 3KUMA 1P6WA 3OVPA 2G4JA 3QGKC 4C6DA 4FNSA 4DUWA 3ZVHB 4ZMGA 1J5TA 2D2HA 1DKWA 3TFXA 2WPGA 3DCPA 3WN6A 5AY7A 5CPNA 2QQ6A 3C2FA 2EKGA 2FJKA 3QYQA 2WSKA 1QW8A 2GQ3A 3ABOA 3NQDA 2OOFA 1L9WA 4IIDA 1B3XA 2W66A 3ZJKA 3WQCA 1S5NA 3KCOA 3WLRA 1WDRA 4C65A 3BMXA 3T2PA 1A4LA 1JXKA 1VHCA 3HG4A 2ZDSA 1JUEA 3WNPA 1W1PA 2HPMA 3FS2A 5LHEA 5BOOA 4DUVA 2D2OA 3PZGA 3CUGA 3R0DA 3NQ8A 5L9FA 4RNFA 3G8RA 4UR8A 1CGXA 3TH6A 3ITLA 3LG3A 4AHOA 3N25A 4HYRA 2QMKA 2NLIA 3S8HA 4MHBA 4R53A 3MW7A 4G5DA 1ZP4A 1E9IA 3AYSA 5LXEA 2DSZA 3ORWA 2Z6IA 4H9ZA 1W3JA 2IUZA 3OA3A 2W67A 3QMSA 1OGGA 1BQCA 1ALDA 1LZOA 1MXDA 2E6AA 1RV8A 1ZU8A 3W1AA 2VFHA 3QC0A 3K4WA 4ZOCA 4C6MA 2GVGA 1ONXA 1CEOA 3KL0A 3VOJA 1SUXA 3WLQA 4DY1A 1TJPA 1R2RA 1Z89A 3UCQA 4H6RA 3CTTA 2ABBA 2NWSA 1CXEA 3ITXA 3ONCA 1O94A 4XD3A 2R1PA 4C1LA 3CJPA 2XH2A 3C8FA 1B3WA 3TAOA 3CC1A 1I45A 1OC6A 1RD5A 1R46A 3EDEA 1F05A 2PDXA 1EA9C 4UBPC 4IMDA 4EWND 4Q8OA 4QE4A 3PF3A 1E4NA 2PZNA 2BFGA 1UD3A 4R88A 3BLFA 4FLQA 1S2VA 1JEZA 2PTWA 1KCLA 1GG1A 1W0MA 3C0SA 3UNDA 2PDHA 2I7GA 5LIYX 4GHRA 1Q6QA 2A2IA 2IPJA 3GXIA 3WCZA 3VIOA 4OOUA 2C14A 4ZXLA 1QO2A 3N17A 1LM1A 1WV2A 4WY0B 4XZWA 4LH8A 2B31A 3ZZ1A 2IW0A 1SFLA 3N6HA 5F2MA 1JDAA 1OVDA 3IJ7A 3AHTA 3VIGA 4W87A 2REQB 5F2IA 2PRMA 4JTCA 3A47A 1RBLA 1YDYA 3KRUA 4K6AA 3QMRA 4I7VA 5A6KA 4UTHA 1AJ0A 3B8SA 5AYXA 3E96A 1HJVA 2FB2A 4GI4A 3BAJA 3NOYA 4C6QA 4AZCB 1R0MA 4L6DA 2ZZ1A 3O07A 3UNTA 3UG4A 2CZ5A 2EKCA 3PB2A 3WNOA 3HPSA 4I9TA 5CBBA 2CLIA 4B9YA 5AYBA 3REQB 4O11A 5T91A 3W7IA 3MCOA 3B8WA 2WM1A 5CAKA 3VNMA 5HAOA 3BMWA 3NQMA 3SAZA 5MHBA 2GFTA 1TWWA 4BCEA 4I9JA 4MDOA 1ZGDA 5EA9A 2PDWA 1H61A 3V4BA 1BXNA 1KFEA 4D6HA 3LSBA 1XRTA 1NDVA 1E3XA 2WB5A 4M1RA 3MV11 3EX3A 4Y8FA 1R2SA 3FXYA 1JUBA 4M80A 1YXYA 4OV4A 2A3EA 4GKLA 3LV6A 3MBFA 4YHEA 5DY2A 2I57A 3FA4A 4PTWA 1J2BA 5CPLA 3WEMA 1TQJA 1W3HA 3GC5A 4RZBA 4XZMX 3TZNA 3VCRA 1VZWA 4NL1A 2BWGA 1NH6A 3PJTA 4I6KA 1YTEA 2AL2B 3OZOA 2VYOA 3AC0A 1XV8A 3VD7A 1TX0A 4HA1A 1E9YB 4AMCA 1HKKA 3V1PA 1LJYA 2A3CA 3LCIA 4RZ5A 1TUXA 4LV4A 2FHBA 4FO4A 2P88A 3UZ5A 1EP2A 1CGTA 4NI8A 1SYTA 3ALFA 1G9HA 1P6CA 4LVDA 2D0FA 5TAOA 2ACUA 2ACSA 1XIHA 3P61A 4C1KA 1FDJA 3MDUA 3W2JA 3ZFHA 4M0XA 4AAJA 1C92A 3NVTA 1I2PA 3FA3A 4W7UA 1AQ0A 3QEZA 1T7LA 3W87A 5HOSA 4TVUA 4JN8A 1XPGA 2DZTA 4EF8A 3ES7A 2F6KA 5CG0A 1KBBA 3N2OA 4ZBCA 1K9TA 3UT0A 4JD4A 4E2DA 4DJEC 3CUIA 5CZTA 1HL8A 3SUVA 4P7RA 2E8ZA 1R7OA 3W00A 3B05A 1ZQ5A 5GNXA 1MW1A 3N19B 4Q4RA 2WZEA 5MF5A 4W9TA 2PWGA 2H6RA 4V33A 1V93A 5FF7A 2WC7A 3UEQA 4L6HA 3CUHA 4LS2A 4N02A 4QEHA 4IUOA 3QPYA 1TZ7A 3MCMA 4GLEA 3M6DA 3GNNA 1YLVA 5HDRA 2WJFA 1P7TB 2QKFA 1V3JA 3EXSA 4E38A 1UJPA 2PS2A 5BW6A 2XVGA 3ZIZA 5CC5A 3N12A 1HP5A 1GJPA 1NWUA 3JRKA 1TPFA 3NGJA 4G1KA 4JQAA 4DI8A 4JX4A 1NVMA 3PNUA 1W3LA 4FMVA 2H9AB 4D6CA 3I68A 4DJFC 3VU2A 3DXIA 1BVZA 1TKKA 4PA8A 3BGJA 3CH0A 2AAMA 1KC7A 3ITGA 3B9EA 4G6CA 2V3GA 1DWJM 1M41A 2P3ZA 4WD0A 4W8BA 3AIVA 3DFYA 3HOJA 2A0NA 1E0XA 3CZEA 4Y7EA 4HJWA 5DX7A 2VZOA 1K8ZA 1UZHA 1ME9A 3GFXA 2V5BA 1OCQA 5KTLA 3TTYA 1UIPA 1YQ2A 1G5AA 3LHUA 2IPGA 2WNNA 1FWJC 3C0JA 4B16A 1PWLA 2PD5A 2J25A 4DM1A 4XIMA 4MYAA 3MI6A 4ACYA 3BMVA 3BLOA 3PZOA 4A8IA 4JYEA 3UVIA 4J27A 1D7FA 1UWTA 1KXHA 3ZSSA 2NXIA 1E6RA 1KFKA 2W5FA 4O8AA 2PLCA 4ZQPA 5K3VA 2FPVA 4AXNA 2Y7GA 2WVTA 1H5YA 1A5AA 2PDLA 1OT1A 2V5LA 5DMYA 1RBOB 3ALGA 1US3A 1W1VA 1QTWA 4B90A 1VCGA 1TV5A 3VO0A 4JIQA 1EX1A 2IPWA 4S3FA 4XZLX 2OZ0A 2YCIX 5HQEA 3WY1A 4XD5A 2ZXAA 2PRLA 4GWEA 2PUZA 4RDYA 4LYQA 3LSCA 3QC3A 4ATDA 5EFFA 1NELA 1HIZA 3ARYA 2PAJA 3CMJA 3G1SA 3SUSA 1Q6OA 2QPSA 1FKWA 3SURA 3BPWA 3IIZA 1GVYA 1QK0A 4M19A 3WJSA 4Z2LA 3VDBA 3VGBA 4FHAA 3H6OA 4LBSA 3LK6A 1NQ6A 1DV7A 4W7VA 1F4HA 1Q7QA 4M7SA 2QCDB 2I9EA 2MNRA 4AWUA 2V5KA 2WYSA 4QHRA 4OV9A 1AFSA 3MKCA 1B3YA 4AD5A 1B0IA 2BY1A 4IT1A 5HMEA 3FN9A 2DVUA 3WK2A 3LI0A 3CO4A 3GDMA 4BQ3A 4IJRA 4PBEA 2JBMA 4YJ5A 3FFSA 1PTGA 3F4CA 1QHPA 4XG1A 3U8GA 4LXFA 4PTDA 5I0DA 4MUZA 1CB7B 1UIOA 1GQNA 2PEVA 3AO0A 3E0LA 1UJQA 1OCBA 2X40A 2PWUA 4MJ4A 1PEZA 1HGWA 2VHLA 2ZZ2A 3SIZA 1J10A 1CX9A 5FI8A 1FTXA 3W1UA 5HUPA 1QBBA 1OC7A 2PPGA 1L2QA 1WAUA 3E5PA 1A5CA 2O4MA 1HGYA 3QRHA 1NEYA 2CLHA 4AWEA 2ZRYA 3HBLA 4ATWA 4PCSA 1EZ2A 1MDLA 2I5GA 3MI2A 1FCBA 3OBEA 4M5PA 2OXNA 4UIOA 1FCUA 4XVEA 4P8UA 1XSJA 1S5TA 3U2CA 3B8VA 5BU9A 1LRNA 3PUDA 4JTUA 5C55A 3FYPA 4Q8MA 2ISWA 1V0KA 3PTQA 2C6QA 1TZ9A 5FF4A 8CGTA 3SIMA 3SN4A 1GG0A 4O4VA 3CM4A 3WSUA 1W3IA 3G18A 3SQSA 3V0UA 4AD3A 4BI5A 1GZGA 5IFTA 3T2OA 2BBFA 2DPEA 3KWSA 3UVAA 1WDPA 1M65A 2VUNA 3RX2A 5AVNA 5LGZA 2WCSA 1WXZA 3QHOA 6ENLA 3W2LA 1VLWA 3QR1A 1V6YA 3HV8A 3AALA 4MDPA 4XQ6A 1OF6A 3DDMA 5J8LA 2WMIA 4KCTA 4MF4A 2ICSA 5D2YA 1J5SA 2YZ5A 2WCGA 1NDWA 3GNOA 3QBUA 1VBJA 2NV1A 1QVBA 5A8NA 2X1SA 1ICQA 1BYCA