3LMZA

Crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
VKPKAPKAVNPFHLGMAGYTFVNFDLDTTLKTLERLDIHYLCIKDFHLPLNSTDEQIRAFHDKCAAHKVTGYAVGPIYMKSEEEIDRAFDYAKRVGVKLIVGVPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDLDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVTDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYEKDMKDPFLGIAESIGYFKAVSDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar isomerase
publication title Crystal structure of Putative sugar isomerase. (YP_001305105.1) from Parabacteroides distasonis ATCC 8503 at 1.44 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
total genus 88
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3lmzA00
3N4AA 4Q7IA 1XICA 8XIMA 2X7VA 2G0WA 1I60A 1K77A 3KBWA 3M0MA 3KBVA 4QDPA 5B7YA 4ZBCA 3QXBA 3ITXA 1XLEA 5EMJA 5EMLA 2I56A 7XIMA 1QTWA 1XYCA 2NQ9A 4GQBA 1XIDA 3KCLA 2QW5A 3BZJA 3QZAA 4PFHA 1XIEA 3QYSA 4OVXA 4QE4A 2QUMA 2XIMA 2HCVA 1OADA 3ITTA 3TC3A 3TVAA 5XIAA 3KCJA 1XIFA 4QDWA 4YTRA 4XIMA 1BXCA 4X60A 3OBEA 3AYVA 3BDKA 3DX5A 1GW9A 5FA5A 4PGLA 3ITYA 2OU4A 1XLLA 3KTCA 1DXIA 3LMZA 3M0VA 4GJJA 3IUIA 4QE1A 3P6LA 5XIMA 4ZB0A 4A8RA 1MNZA 5AVNA 4YTSA 3C0SA 1DIDA 3XIMA 5EMMA 1XIIA 2Q02A 5EMKA 3UVAA 3WQOA 3UXIA 3AAMA 2QUNA 3XISA 4GJIA 4X63A 1D8WA 4XIAA 4XSLA 5H6HA 1XYMA 2ZVRA 1XIBA 3C0LA 4ZB2A 5J8LA 3UU0A 1XLIA 3VNJA 1DE5A 3CQIA 1TZ9A 1XIGA 1XP3A 3VNLA 1XLAA 2QULA 3M0XA 3KBNA 4K3ZA 2GLKA 3U3HA 1XLBA 3CNYA 4J4KA 4HHLA 4EAYA 3IUDA 3JU2A 1XIHA 4KW2A 1XLJA 3KBMA 3DBNA 3M0HA 1XYLA 5B80A 3CQHA 4QE5A 2I57A 4DUOA 5B7ZA 4EACA 4GLEA 4HNOA 4X61A 5AVHA 1XLFA 4YTQA 3KCOA 4E3VA 2ZDSA 2GVEA 4QEHA 4XKMA 1XIJA 5I7GA 4A8NA 4DVOA 4K1GA 4XISA 4XSMA 3P14A 1I6NA 5XINA 5C9ZA 4LNCA 1QUMA 3NGFA 1XLCA 4HHMA 3C0QA 4YTTA 1A0CA 3AALA 1XLKA 4A8LA 2GUBA 1A0DA 1YX1A 2NQJA 1XISA 1XIMA 3BWWA 3U0HA 1QT1A 4US6A 3ITVA 1MUWA 3ITOA 3IUHA 3VNMA 5TNVA 2HK1A 3M0YA 1XYBA 2J6VA 3M0LA 1XYAA 2NQHA 4W4QA 2XINA 3XINA 1XLHA 3CQKA 8XIAA 3BZGA 3VNIA 3AYTA 3QC0A 4YTUA 9XIAA 1DE6A 3GNXA 1XINA 5H1WA 3KBSA 4ZB5A 4QEEA 3CWHA 3L23A 3ITLA 3VNKA 3FVMA 3UA3A 3KBJA 1A0EA 1CLKA 1XLGA 3UA4A 9XIMA 2HK0A 6XIAA 1S5NA 1XLDA 2X7WA 3VYLA 4G56A 6XIMA 3CQJA 4A8IA 1BXBA 2GYIA 1S5MA 1O1HA 3BANA 4HGXA 1XLMA 2G4JA 2XISA 1DIEA 3KWSA
chains in the Genus database with same CATH superfamily
1ZJHA 2DZTA 4RUBA 2JALA 1GORA 3KL0A 5HK4A 3TDFA 2PTZA 4BEQA 1R3QA 4DLFA 2WB5A 3PZ9A 4QS6A 4PMOA 1X1OA 4F0RA 3VZZA 3C86A 2VYOA 3SRDA 3RLUA 1H11A 5T9CE 1W31A 1E70M 4GQRA 1VIZA 4IMEA 1QR7A 4UCGA 1XQLA 2QPUA 3ENLA 2C79A 1Q6GA 4GWEA 3W1QA 2DVUA 5HBFA 2C1HA 4AWEA 4RXGA 1EC8A 1FWRA 4BS0A 1GGOA 5DCBA 1UD3A 2OXNA 1UWSA 1KBLA 1JCXA 2UY4A 3RMJA 1OD0A 2J66A 1TX2A 2DZBA 3HN3A 1ONRA 1EBGA 1VC4A 3LRKA 2WWDA 2CLHA 3CZGA 3N2XA 4JTKA 2XYLA 1JPDX 2ZKMX 1X6UA 2V9DA 4KCTA 3WEOA 2D1ZA 4AU0A 2OO0A 4HZ7A 5K3VA 3MKVA 2PE4A 4LBRA 2HNHA 1GOQA 1I4NA 3A3XA 3PB0A 3IIXA 4UB9A 3AXXA 1UROA 3CH9A 3QEZA 1MW0A 1S5NA 1GOKA 1QXLA 3HURA 2G50A 1TV3A 1YKWA 2BMBA 2BXVA 5LNRA 4HHHA 1Q5MA 2F8QA 3K4DA 2PDMA 3EYPA 3NA8A 4B4HA 4HMEA 1UH3A 3WK1A 4AIOA 3VKDA 4ZTYA 4RE2A 4ROQA 2X2GA 3KRBA 2PCEA 3F7JA 1KGUA 3WMSA 1AODA 4HN8A 2ZICA 5I3DA 5AVNA 1ZFJA 4Q8TA 4S1FA 3UXIA 1GJUA 3KZPA 3NEVA 4HJWA 5U7SA 3SADA 5KINA 1EHNA 1EIBA 3GIYA 1HP5A 4ZOAA 3VINA 3MTWA 4F2UA 1QI4A 1KV5A 3N13A 1E3ZA 3B0PA 4DJFA 1TJ0A 4ZOBA 4CKQA 5C71A 3LLDA 4GLEA 5BWFA 1VIWA 3KOXA 1RUSA 3S83A 5CPOA 4UQ9A 3WJSA 3VKAA 5BWAA 5C9WA 1E4LA 2FQIA 2VCCA 3G1SA 1NQ6A 5CPNA 3CGTA 2CC0A 4AXNA 4F79A 1EUAA 2WMIB 1SFTA 5CQ1A 2Z24A 3F4WA 1TB3A 2BB0A 2I16A 4LTSA 3MYOA 3SQLA 3R25A 4XBSA 4E0CA 2DEPA 3S46A 4XB3A 2YYTA 3MUZ1 2P8BA 4GO8A 4YVVA 3KLLA 3L5AA 4LCQA 3S2JA 4GFIA 2Z0IA 3VIIA 4LVDA 4RX0A 5HQLA 3BLEA 3B4YA 3TU9A 3EEGA 5A6TC 5CSRA 2ZTJA 4ZB0A 2VDIA 4TV6A 4ADSA 4C1NA 2WNQA 4Q33A 4KQNA 1B0IA 4PCSA 5DXXA 4JX6A 3BOFA 3I65A 3L4YA 2ABAA 1RK6A 4DHGA 3LCWA 5D8WA 2YJQA 1GVFA 3N14A 1JAEA 5A8PA 4R27A 1KM3A 1ONXA 3KP1A 1TE1A 4EAMA 4AAJA 3LQGA 1AQFA 2YSWA 4D6HA 2R94A 2GJNA 3WH7A 3GSMA 3KLKA 3VNYA 4OHQA 2QMJA 2FZDA 4HT3A 3F5KA 3GR8A 2BY3A 1GK8A 2D20A 1G5AA 2WM0A 3CZJA 4QBXA 4DZHA 5CZSA 2PDYA 3GIQA 6ENLA 4DJDC 2PD5A 5EMYA 1XR2A 3EX4A 3GDMA 4ZO7A 4LB3A 4GC4A 2UV8G 3T2OA 5CCZA 1JNDA 3MCMA 1UC5A 4UR7A 2JGYA 1NDYA 4AG0A 5A8NA 5E93A 1DPMA 3VCCA 3E6EA 2HE8A 1PPIA 3VK5A 4UTWA 1FP9A 2QCMA 1I2OA 4H9TA 5JH1A 2XGBA 3DIPA 3MP3A 4GISA 2FVLA 5L6UA 1VCVA 2Q02A 1OFEA 3AMDA 1XJBA 4M1RA 3CZLA 3AAMA 4GJIA 5CG0A 4D6DA 3W1RA 1M04A 3O06A 3AROA 4NP7A 3P67A 3FW6A 4GH3A 2G8ZA 3S6DA 4AC1X 4KRZA 1EL3A 2EO7A 1DJQA 4QE5A 1MXDA 1KD0A 3S5OA 4X22A 1Z9AA 3KVJA 4A22A 4DVOA 1Z48A 5JXQA 1GW1A 1NOWA 2J7BA 3GZ3A 4Q4PA 2AAAA 1Y65A 1A0CA 1ME8A 5EPDA 1R86A 5CPTA 3ITVA 2CITA 3PZIA 5DF0A 1DJYA 4LS1A 2EG6A 1IT7A 1H1ZA 1YTDA 1RBLA 3BOXA 4PC8A 4HU0A 1KM5A 3PTQA 4KESA 2QIWA 3AHXA 1FXQA 6XIAA 1XH0A 2XM2A 2XG9A 4Z17A 4H04A 3LHVA 5F2GA 5D38A 1BRLA 4LBUA 1A5LC 1PVNA 4CU8A 3WQFA 2INFA 4QSFA 3ZJKA 3R58A 4YPJA 1QO5A 3NJ3A 4DUWA 1UBSA 3D47A 3WLIA 3U2EA 3N73A 2OLHA 1XIFA 4DIAA 2QXWA 1MMFA 3HV9A 3EWUA 3M0VA 1Z89A 4H9ZA 1SFSA 5E0KA 1O5RA 2ONEA 2PEVA 1WP6A 1XYMA 5I5RA 1HQTA 1NF7A 3CIVA 4J2PA 3WQWA 3B0YA 5LA2A 2WVVB 1XSIA 3M5VA 1FCUA 4KEMA 1E72M 4C7DA 3M0XA 1A5SA 3BAYA 4QNEA 4AZBA 3N9KA 3UWVA 2OR2A 3T78A 3RHGA 1DTNA 3BSHA 4GG9A 3OEXA 4V15A 4NNBA 4E8CA 2R82A 1FWDC 2L5HA 3HMJG 1A5AA 3W72A 1V02A 4MDOA 4S3JA 2X05A 4ZCWA 3N2CA 3WK3A 4FOJA 4IL0A 3WQ4A 1JCYA 1MNSA 2ANUA 9XIAA 1ZENA 1SZNA 2Y61A 1OB0A 2PDQA 3MV11 3ZLFA 3WDQA 4J1OA 1O12A 1CIUA 2PP3A 1J5SA 3P0WA 1ITCA 3CEUA 4MZYA 1XUZA 1EDGA 2E25A 1C29A 3IJQA 4UUIA 3NQ7A 4X3ZA 2GJLA 2XU2A 2Z2BA 2VWTA 2YYUA 1X6LA 3TYZA 4FP1A 2OZTA 1E0XA 3TEVA 1UZDA 4B5NA 4GPNA 5K4XA 4CLMA 3ONBA 1DOSA 3EXSA 1DJHA 3OZOA 5LSMA 1XRSA 2PDLA 3ALGA 6TAAA 3H54A 3CH0A 4KS0A 4DBWA 2Z27A 3S5SA 2CBJA 2YBVA 1TVPA 4XSLA 1YEYA 1XBXA 2VQTA 3VOIA 3CQIA 2CLLA 2WLYA 1EC7A 5EGRA 2JF6A 5FSDC 1B3OA 1EKOA 1LZOA 5CSYA 4XZLX 4JQ1A 5M03A 3KVKA 1UD5A 4IG2A 5IFTA 4KGJA 3ZMRA 4M1BA 1J0HA 1OC5A 2E77A 2WKJA 2PDNA 1J96A 4XISA 1CXLA 4L4PA 4HKPA 1F07A 3TYUA 1HL8A 5E9AA 1AD4A 4JTDA 2PDWA 1QK0A 1FXPA 1JRCA 4Q4KA 4WX2A 4TOQA 3DHFA 1JVNA 3BMVA 5LHEA 3EWZA 1G01A 1R46A 3N2MA 1ZLPA 2WM1A 1DYSA 2YFOA 4YHEA 5AYIA 3O15A 1J93A 4NZJA 2BGQA 5LNUA 4OV9A 2ZWYA 1I0BA 3VIJA 4JIQA 3BTNA 4RE0A 4M29A 5AY7A 2FMOA 4EWJA 4GY7A 1KRCC 3RITA 1ONEA 1HF6A 1UA7A 2NLYA 4O4WA 4DJDD 4YTRA 3W1NA 1IEVA 3VDHA 3G8RA 4B3KA 3LD5A 4Y9AA 4J2MA 5REQB 3EA1A 5C2GA 4PTMA 1EB3A 3OQEA 2BOGX 5DCEA 1J18A 4PMQA 3MS8A 4JL2A 4XD6A 4NT0A 3IRDA 2OO6A 2PBGA 1H1NA 3C2RA 1K8YA 3UJSA 1HKWA 5F4SA 4MNMA 3PFMA 5CLWA 2ZZ4A 2BG5A 3WNPA 1C7SA 1UC4A 2AL2B 2OGJA 1UR8A 4UFKA 1OY0A 5HPCA 4GI4A 1C91A 3SJ3A 1DTUA 4OIFA 2QGYA 2Z1SA 1W8SA 2NQLA 2OYMA 3CQ0A 1LL6A 1XI3A 4XZIA 4H6KA 2PDKA 1Y5VA 3CV7A 1W32A 2VFDA 2CLPA 2Q6ZA 4HYRA 5HUOA 1W1A1 4ZL1A 3MMUA 4BWLA 4PSRA 4LCRA 2JKEA 1XPGA 2ZE3A 3W00A 4AISA 4XZBA 1P1XA 2OOFA 1E1EA 4IQDA 5KTLA 2DY3A 8CGTA 4F9DA 3DEQA 1K3UA 2O7SA 4K8EA 1U83A 3W38A 3ZXWA 1UIOA 4UTKA 3TSDA 5FJJA 1SO6A 1W1PA 4J3TA 2GL5A 2JEPA 1HJVA 3B9NA 2TPSA 2GGEA 4XAPA 1VH7A 3LPFA 3QLLA 2Q01A 3V7PA 1TPH1 4KBXA 1XRVA 5DFAA 3EA2A 5AHFA 2QUNA 1TREA 1UP3A 5A8OA 4R7JA 1IWBA 1AW2A 3VZYA 2VFFA 3H23A 3B03A 2WZHA 2WHJA 2Z4GA 3I7QA 1W9XA 2VRKA 3C3UA 3A21A 2INEA 4FK9A 4G7FA 4AC7C 3W7NA 3QSTA 3VGDA 2AAMA 3HGRA 4MWAA 5FF4A 4C6PA 1UP0A 3PHAA 1XLHA 2I5IA 1RD6A 4U5KA 3G5EA 3LGGA 3TIMA 3MT1A 6PTDA 4IP4A 2E6FA 2AGTA 4JQAA 1WBJA 3BANA 2HEJA 1IWPA 1LT7A 4I9TA 3NDYA 3KWSA 3DG3A 2ZA2A 3PBGA 2Z1VA 2W67A 4LAOA 3BZJA 4H8VA 4NXKA 4GC3A 4OJYA 2W61A 2WKGA 3T0DA 1SJCA 3B9AA 2NLIA 4OE7A 3TAOA 2GQ9A 1P6WA 4V2XA 1EGVA 3H55A 2VX7A 3W22A 5A95A 4ZA0A 2DT3A 4ILSA 3ZOAA 3VC6A 3DI1A 2XIJA 4NX0A 4REQA 4AVFA 4JEQA 1TZ9A 3M5ZA 4NUWA 4JTGA 4QISA 2XDFA 4QG8A 3M16A 5CC3A 1NOFA 3IJ9A 1SU5A 3W2NA 4JIPA 3RPMA 4EACA 1OFAA 4HNOA 1EF3A 1TWZA 1XSJA 4QEHA 3GTFA 2R1NA 2EG8A 4QJ4B 1NVMA 4DBDA 2ZUVA 1J9YA 1MW2A 3KP0A 3GC2A 2NQJA 5DMLA 2ZA3A 2Y5EA 5IBXA 2DORA 3QMSA 3TN6A 1XINA 2HNEA 2V5LA 5CBBA 3P81A 2NSOA 4RZ4A 1XDMA 4C6IA 1WX0A 5AC4A 1XLGA 4AYSA 3OZMA 4JTQA 3IGXA 3UWEA 5F2LA 2DGAA 4D6FA 1T8XA 2ZUSA 2RDTA 3P5ZA 3UZXA 3W1LA 2VOTA 4MTVA 1AH4A 3IGUA 1XIEA 3I4EA 5ABFB 4QQ3A 1OADA 3PPGA 4O53A 1ZP3A 2E9LA 3OYZA 3VIKA 1DEDA 4WY0F 2FZ8A 4O1AA 3O9NA 2PP0A 3H2CA 4PN2A 3FJLA 5CSSA 4S3KA 2P50A 5G4WA 3SJNA 1XDJA 1MVYA 4I8DA 2XH0A 4G1NA 4J4KA 5C70A 4AXKA 1VPYA 2FDSA 3N34A 5E70A 1Q13A 4NILA 4Y7EA 4Y9PA 3CWNA 2E09A 3GH4A 3LTPA 3W88A 2RDXA 1H7RA 3QTPA 2IQTA 2XN2A 4ZO6A 5I23A 5TIMA 1VRDA 3VOCA 2YDRA 3EDKA 3HQNA 5D9NA 4EPEC 4L9XA 3AICA 1LQ2A 1U2YA 2BHUA 3H2OA 1C90A 1YBQB 3B0UX 5CKSA 1OK6A 2YA0A 4B16A 1NSJA 2YX0A 4W7UA 1XM3A 1KRAC 1Y0EA 2OX1A 4UTFA 3AYSA 2GUYA 3VIMA 2XVKA 2CBUA 1UJPA 2VJXA 1FWHC 5CZ0A 3BK0A 5A8MA 4FX6M 1K9FA 4H7VA 3HO8A 5FSEC 2WLZA 5HXMA 3H4WA 1Q6DA 3PNZA 5A6SA 3R43A 4GE8A 1HJQA 2WBGA 4D71A 4A3RA 1SMDA 1S5WA 2NXHA 2CKRA 2ALRA 2TMDA 3NTYA 2XVNA 3S2CA 2Y7GA 4NZCA 1E6ZA 1L6GA 4HVXA 1RQEA 2WCAA 5BXRA 5XIMA 1KM0A 2B7OA 4QP0A 3EB3A 1JI2A 4ZQNA 3ELFA 2WC3A 2YLAA 2PD9A 2PGRA 2ZX6A 3VI2A 2Q8ZA 1JZ5A 1KLZA 3NPWA 5M3WA 4M19A 2QYGA 2VXNA 4LVAA 2QUVA 1VHNA 3V5FA 1E9IA 2FHBA 2WMIA 3PZOA 5DY2A 1GVYA 3UQNA 1IGWA 1VBRA 4HPNA 4UFMA 4A2SA 1PHWA 4P8VA 3AHTA 3I3BA 3CHCA 1VEMA 1HNYA 1RZMA 4BF5A 1JR1A 3KOYA 3HQ1A 4GNVA 2ZZ7A 4FMVA 1KFWA 4B5TA 4BQ3A 4ZE5A 3VNIA 2ISSA 4ZODA 2ZX9A 3TN4A 2Z2AA 1M7OA 3L0KA 1HVXA 3SDOA 7ENLA 3FVMA 3HMCA 1EZWA 2Y0FA 1DWJM 3W84A 4FEZA 1EXBA 4H9YA 1JDFA 1TTPA 3H2EA 1GT8A 4ICCX 3VKKA 4JTJA 2I9EA 3NQGA 3BLIA 2P1FA 3TJLA 3S5YA 2ATMA 3GX9A 4AX6A 4BHYA 4MDPA 2NUXA 1OYCA 3DXIA 1BWLA 3LZ5A 4B5XA 3AFBA 1PKYA 3R8RA 2CZ5A 4S3DA 2G95A 1J79A 1E5NA 3EWCA 1GQIA 4PBGA 2A3AA 4QE1A 3GO2A 3RLHA 1FWEC 4Q7NA 4JFSA 2QF7A 2PLMA 3WQOA 1JQVA 2BXYA 3DC8A 3W53A 4OGZA 5AYXA 3PJXA 4AEFA 1W3TA 1AJ0A 3MHUA 1GZ1A 2E67A 2GUUA 4AHPA 3GRIA 2PRMA 3AU6A 1G4SA 5AN7A 3G8EA 2LLEA 2Z2UA 3T08A 2QCLA 5EB8A 4MJ2A 2V2DA 3NPUA 3REQB 3OZYA 5G5IA 2O9PA 3VKBA 3MU7A 1EH9A 4US5D 1WOAA 4QGCA 4M6PA 4LY4A 1JFHA 2DFAA 2DVXA 5LNSA 1RCQA 2ZXDA 3UXLA 1CI1A 3L23A 3QJAA 1PZ1A 4KEVA 1JAKA 1KRMA 3BAWA 5KEZA 2J8TA 3VO0A 1RD5A 3H24A 1AFSA 3U2CA 5A6BD 1W56A 4LPCA 1U1JA 2PA6A 3CV1A 3PBUA 1D8CA 3SN4A 3QH2A 1IXOA 1GTEA 3H22A 1PV8A 4O13A 3QFEA 3INPA 2BY0A 4JZ5A 1W9BM 2A7NA 3KWXA 4H00A 3TXVA 8TIMA 2XWEA 4R5EA 3W70A 3S42A 1DVJA 5LIKX 3C0SA 1FUYA 2FHCA 5LNVA 1J6PA 2J88A 1WXJA 3NQ6A 1HO4A 5HUPA 1YQ2A 1O60A 1GJPA 3V18A 4HSHA 1LG2A 1W8GA 4H6QA 3TCEA 2PODA 1YNQA 3MZNA 2H3DA 4TMBA 1VP5A 3CPRA 4BQ2A 3BW4A 2ZUNA 4C6QA 1LRNA 7A3HA 3G77A 2F61A 2ZE0A 5I3IA 3COTA 1QCWA 3WZ0E 2R1MA 1KQYA 4JQ2A 4YCPA 1HJSA 1ADDA 1ZL1A 5HWNA 1AG1O 4KRUA 2PTXA 4JTHA 2VVNA 1RXOB 3GFYA 4MLRA 4P61A 4GIRA 1JUBA 3BPWA 4YHGA 1SUXA 1VFTA 4N6EA 3CLMA 3V1PA 2TAAA 4KCUA 2VCAA 1GPFA 2X7VA 2OOGA 4A35A 4HB7A 2IPGA 2ZA1A 5LA0A 3K30A 3BUVA 2ZUWA 3LLFA 1SO4A 2QJJA 5HA7A 1XRFA 3NFUA 1O5KA 4XTIA 2WVVA 3URQA 4B90A 2WCSA 1ZJIA 2BVTA 1YW1A 2JF7A 4BQ5A 1VAHA 1X96A 3T07A 1OCQA 1PBGA 1P7TB 1QASA 3PJUA 1H5VA 4TIMA 3UU0A 4DNHA 3VGFA 1OJXA 4PMJA 3THCA 3PC0A 3KHDA 1AZ2A 4YXGA 1S2VA 1HXJA 3BCDA 4WY0B 5DELA 3OO2A 4GNJA 7REQB 1VJZA 4ZR8A 4AY7A 4UBPC 3NPXA 4E8GA 3WK0A 3WJYA 4WRHA 2MUCA 5BW6A 3LM7A 5EA9A 1YDYA 3WF4A 5MKGB 3PTKA 3TQPA 1A80A 1YTKA 1U22A 2CLKA 1IEXA 3FYYA 1GOIA 1UBPC 3I6EA 3WF2A 3M0YA 4FNPA 1TRIA 1TPB1 1XD1A 4GYFA 3L21A 4EF8A 1EEXA 4RZ6A 3QPEA 3GYEA 3MJMA 5K7JA 2WMJA 3DFYA 3HPAA 4ICNA 4FO4A 3QR1A 4CU7A 3MSDA 3W85A 3TAKA 3SO7A 4HP5A 1DHPA 3VFLA 3RLVA 3N12A 3W83A 2OMAA 4EIVA 2PS2A 5KZEA 3I7SA 3ITTA 1LRTA 1GPWA 3U57A 3BDKA 1R3WA 2IKHA 1MNZA 3TA9A 5K4ZA 4PYSA 1LQ0A 1UMYA 5HMDA 2FDMA 4GRSA 3AXIA 1BSIA 4RK8A 1EX5A 1VFHA 5BOOA 4H2HA 4GVIA 4HNCA 3HPSA 4F2BA 5CJMA 1RPKA 2OZ8A 4O12A 1ZB5A 4DJDA 2V6AA 3N3TA 3TYCA 4Z2HA 3S1WA 3RPDA 2ISWA 5A8QA 3WQCA 3ABQA 3GXNA 1QUMA 4JHOA 3GB6A 4IMFA 3S1GA 5HNUA 4RL3A 1VFOA 4K8GA 1VHCA 2KZHA 2OZ0A 7TAAA 3V5OA 1GKRA 1VFMA 2O9OA 1BQCA 1EIXA 1JULA 4JQ4A 5AOUA 5H8PA 1IZKA 3EOSA 1A0EA 2W63A 3TE9A 4I5RA 2Y8VA 3B8TA 5C8BB 2BY2A 3O07A 3ZSTA 3FGCB 1OX4B 1ZUAX 2G41A 3QGKC 1K9EA 4XTDA 5HDRA 4NZFA 2VEIA 1WV2A 1CGTA 4HYVA 5REQA 2PU0A 5FL1A 1R2RA 3LCLA 3ARXA 3PFRA 3A4WA 1M5WA 2O9TA 3ZS4A 3HM7A 1FKXA 3ITYA 4MJZA 4H7CA 4HJFA 3P6LA 1XCWA 1UMLA 3DKJA 1UOZA 3QRHA 1LM1A 2V67A 1D9EA 3GBDA 3PPHA 4JN6A 2AL2A 1F5ZA 2F2KA 3E0IA 5K2ZA 3OODA 1HW6A 4Z1BA 1Z42A 1QOQA 1TKKA 1CDGA 4AZCB 2QPXA 2G3FA 4KCVA 4JAWA 4U2YA 2QJGA 2Y7EA 4M5PA 1MUMA 3LNPA 4MPQA 3SFKA 2XH4A 3TWBA 1QNOA 3VZXA 5A6LA 1VLIA 2J7EA 2VEKA 3E0LA 3IANA 3UG4A 3NUKA 1RP8A 4XAYA 3IV3A 5AHNA 2B7PA 1IR2A 2DSZA 3BLKA 3PTDA 5H8UA 3LY0A 2J75A 5GJPA 1NWRA 4RR4A 5F4XA 1F74A 3KBSA 4FNUA 4Z1CA 1NFBA 2YZRA 4HQVA 3ES8A 1YPFA 2FVMA 1ISXA 2ZTKA 1NP0A 1L0PA 4IF2A 4YVXA 3AIWA 4UC5A 3TK7A 1DIKA 4AYGA 1UUMA 3DYOA 4FA3A 4NKCA 3NIYA 1GVIA 2A4AA 3T9PA 4KFNA 2A3HA 1R3SA 4IJBA 3QBUA 1UR2A 1DJGA 4GUJA 5J5RA 5LXEA 4IP5A 1G6CA 3QY8A 1TIMA 2V5JA 1HX0A 3G0XA 4QITA 1LCOA 4IPLA 1VFSA 3BSGA 4ZENA 3WL0A 3LHYA 3A4XA 1QOXA 3DESA 1H50A 5HPOA 1R87A 3T2PA 1XG4A 3ARSA 1X98A 1OD8A 3DFSA 3E2SA 3TYDA 4MB5A 3SN0A 3VNLA 3NL3A 3WO8A 3PWAA 4QM1A 5HJXA 1T6MA 3PBYA 4IMGA 1PDZA 2HVOA 4XZWA 3JZUA 4IFRA 4LUTB 3E2VA 4GQQA 5JIPA 2NVCA 3WELA 3B8IA 3MANA 3TMLA 4PUUA 3ANVA 4O8AA 1LL7A 5CLTA 4FLOA 2QJHA 1V3LA 3MA8A 1UZHA 4MYXA 3S0CA 4DEFA 3UG5A 2YFNA 3UJEA 1OGBA 4C6DA 4AD4A 4NHVA 5GVJA 3TJ4A 4W8BA 5FJOA 4QAWA 3IIPA 2Y5JA 4M56A 4M7SA 3LHZA 4JEJA 4Y90A 4OECA 5JIWA 1CT5A 4NI8A 4LY8A 3C2EA 1E6PA 5HATA 2OFJA 1Z32X 3LUTA 3UWQA 1HKKA 4CD8A 3PTMA 3HJZA 3BARA 2G5WA 1W9DM 1Q8JA 2JE8A 3GNRA 4DXXA 4H9MA 3DFHA 1UZ1A 1M41A 5A6MA 4GBUA 3TC3A 3OVQA 1T40A 3O1NA 4C6CA 3I6RA 1KTBA 3MI6A 3TP4A 1J4EA 1G7VA 3ICJA 2OZ3A 3AS1A 3AYVA 1Q7ZA 2PBOA 3N04A 4WDUA 1H7WA 2FJKA 4Q8OA 5E09A 5AHLA 2J9ZA 2WJDA 1WAWA 1CLVA 3ZYZA 4PEKA 1GHSA 1CX9A 2ABBA 3L4TA 1XYZA 4W85A 2YW3A 1LG1A 2D0FA 2GGIA 3TONA 2QR6A 2GDUA 4LCSA 3WLRA 1M65A 1XLFA 4M6QA 3VILA 3T44A 1N7KA 3LBCA 4Q4SA 1VBJA 1RK5A 1TV8A 1VCGA 4LRSA 3H70A 2FZMA 3P3BA 1I2RA 1W9PA 2A0NA 2V30A 1MXSA 1O7AA 4LT9A 4CCEA 1ZJBA 1FWGC 4XBJA 5T91A 3QLDA 1DWFM 2DSWA 1TELA 3WBAA 3G2GA 3MCOA 3O2LA 4AF0A 3MY9A 1B57A 4PMRA 3BGGA 3MZ2A 4U5IA 3DYMA 1NJJA 4ERGA 2XIBA 3QW3A 3W71A 2QCGA 5G2WA 2Y5SA 1B90A 3TTSA 1E6RA 3E0VA 4YU1A 1EA0A 2CLIA 2W62A 3GDBA 2QAFA 1OVDA 1YE4A 1PXGA 1J0JA 3Q2DA 4UTHA 2RAGA 1V93A 1QJWA 3PJTA 5I2UA 4HNTA 4FI4A 9RUBA 1K8CA 1FHVA 4IIHA 1UH2A 4UTJA 2ZRWA 3I4KA 2ISDA 1Z7AA 2PRHA 3H7UA 4DUOA 3IGSA 4LF1A 3W7IA 1A53A 1YBQA 3V0UA 2FH6A 2O56A 4XK2A 2ODOA 1EJXC 2C14A 4J3WA 5XINA 5D04C 3E96A 2BASA 2FVKA 4JS3A 3W7HA 2OYKA 4MNLA 4W8AA 1TPWA 1XISA 3LV6A 2CHRA 4IGHA 1PUDA 1KXTA 4IL2A 4IX2A 3AMGA 2WHLA 2PU1A 2EBNA 2JKPA 4PRTA 2J27A 3LPOA 4WSKA 3T8QA 3QKEA 3I7RA 1F3EA 1YDOA 1VR6A 2XPKA 3KBJA 3FKRA 2XHYA 4JX4A 1JPKA 1H62A 2ZYFA 1Q4WA 2AOSA 3TKFA 3P74A 5D9MA 2C91A 2VRQA 3WH9A 3TJIA 1JPIA 4MFEA 1K4GA 4XZ9A 2BTMA 4E2DA 2DH2A 3TYBA 3K1DA 3FAWA 1JEZA 4JKKA 1CGVA 3C61A 2HTMA 3NVDA 5CBJA 1HIZA 3AHYA 3QV9A 4A8RA 4H83A 5A8GA 5IRPA 2F38A 4HTYA 4C6MA 3PR2A 1UH4A 3B8VA 1GZGA 2IPWA 3UBPC 1TV4A 2QLYA 1XIHA 2POZA 3PZUA 3MMTA 3AXKA 1MQQA 3B05A 2H6RA 3KOFA 5A2CA 5I7GA 1SM9A 3CM4A 2YDSA 2WHMA 1QNSA 1HKVA 5C5YA 4YYFA 3GVWA 4GX8A 1LF1A 3G6LA 4K7VA 4HZ6A 1I2PA 1LBMA 3W6LA 1IF2A 3QC0A 2V3EA 1RA5A 4ADUA 1C3FA 1FRBA 1EJRC 1YTEA 2FIQA 1RLDA 3HQOA 3FA3A 1VB9A 3GUGA 1W3NA 2A6LA 2GJPA 1JYNA 2VGIA 3GKFA 4N42A 4QJ1A 1SO3A 2ZFAA 3WQPA 3Q94A 1BF2A 1T5AA 1BYBA 3TYEA 4OVXA 1V8EA 3MC5A 4PUDA 3ZM8A 5FF7A 1SZFA 5CPMA 2CZEA 5I03A 2CZVA 4Q6JA 4ZSUA 5A6BA 1TWWA 1H41A 4E4UA 4DQWA 5J8LA 3PUGA 3IJ6A 1LL4A 1V0KA 4IMDA 3RX2A 4A4AA 1K02A 2PGFA 4IX0A 2Y62A 4MWAE 3HPZA 4PB4A 2PWHA 3DFOA 3UZJA 3F2DA 1H49A 3CTTA 1CW2A 2NXGA 5EBAA 3PP7A 1Q65A 4L1GA 3URNA 4DO7A 3QR3A 1H2JA 1LTDA 1Q3NA 2DP3A 5CEWA 2ZWZA 3EKZA 4U2ZA 1KW1A 3O6DA 1EOKA 4IIEA 2Z26A 1UKSA 3ARWA 1NIUA 2XTKA 3M4HA 1EO5A 3AALA 3N15A 1Y5WA 3W01A 2F6KA 1Q6CA 4M0XA 1ICPA 3ABXA 7CGTA 4OBTA 4IPJA 1VRXA 5H1WA 3AHZA 3TROA 4FLRA 2DUAA 4O11A 3CWHA 2BBFA 1EJUC 4PODA 2PDIA 3P84A 1TA3B 1QNQA 2O9RA 2DIJA 4JOMA 3NCOA 2W27A 4RNJA 2PDHA 1SW3A 3LYEA 5C2XA 1DJZA 4LBSA 5JUVA 5EMJA 3AWNA 3L65A 4JQ3A 3K8KA 2BVYA 3P60A 1N2VA 3OB8A 4Q8MA 4XZHA 3TNOA 3VX0A 1DJNA 1JI1A 1GONA 3SN1A 2NWRA 1TMQA 3PULA 4Q8VA 1HG3A 3WLHA 3AIBA 1AVAA 5I24A 4ATWA 2VT0A 4F0MA 3VOJA 3BJTA 2NQ5A 2RGLA 3Q45A 1US0A 3MV01 2BODX 4PMUA 2Y8UA 3PSWA 2DZXA 4Q8PA 4GCAA 2HPMA 2OGYA 4D6IA 1L2UA 5BOEA 1BHGA 5D2YA 3UESA 1ZAHA 5ENLA 1KCLA 5AFDA 1BPLB 3M5YA 3QHNA 2XFYA 5D33A 1AL8A 3RFAA 3JW7A 2XWDA 3W7MA 2ZC1A 4DO4A 4US6A 4O57A 4GI6A 3FA5A 2EAWA 4NJIA 1E9ZB 3CQKA 1EFZA 2WV8A 3JR2A 3TN3A 3GG1A 3LGDA 1PJ9A 2NW0A 3OBKA 4U28A 3ZZ1A 4GYPA 1D3HA 1IYXA 3VYLA 2A5HA 2XISA 1RJPA 3FK4A 1ZAIA 2D73A 4YWSA 4Q4QA 2ZUUA 3L7RA 3NOYA 3T40A 4R34A 1R3YA 3D6NA 2VUYA 3B8SA 5FEXA 3BAKA 4WVXA 1OSEA 2ZDRA 3EX3A 5XIAA 3IIOA 2ALDA 4LB4A 3CPGA 3BV7A 3SCUA 4C60A 1K7FA 4K7YA 4WY0A 1V0LA 3SIZA 3LTYA 1KBKA 3OVRA 3VE7A 4IICA 2VZSA 3WH6A 2YXXA 5DX7A 2H3BA 3DFTA 1LT8A 4Y2WA 1E73M 5IFPA 4JN8A 2PDCA 4WOZA 3V0TA 4AD1A 1CWYA 5IDZA 5I77A 3RX3A 3AIRA 4J40A 3FYOA 3SGZA 4IPPA 5AVHA 1I1WA 3NZRA 4ZVJA 4AY8A 1LLOA 3WLSA 4JPGA 3MQTA 3WQGA 1XKJA 4ROPA 4LALA 5LIXX 1I2QA 5BU6A 1RBOB 2VZTA 1WBHA 1G4PA 1PIIA 2Y89A 4ERIA 1LOLA 5G1TA 4AW7A 1ML1A 3GH7A 3FVDA 4DAFA 1BVZA 4X9SA 3CZ8A 1ZQ5A 1ZAJA 1W54A 2QV5A 4DYKA 2RKXA 5DRCA 4JYDA 3KRSA 2HBXA 3WFZA 2CERA 3W2KA 4WOQA 3W86A 3F4DA 1QI0A 4AIEA 2ISVA 3PZVA 2WKLA 2I56A 3WBXA 3U2ZA 3ZT5A 2ZRXA 3W7JA 1BYCA 1CPUA 1NWTA 2GOKA 3QPZA 3A23A 1RAKA 3WLOA 3NQ2A 2XN0A 4KPLA 4G1KA 3KUMA 4GIEA 3LM3A 1TR1A 3GNNA 2E68A 5I07A 1D3GA 4HHPA 1TG7A 4ALDA 1CGUA 1JCJA 4JIEA 3B97A 4F2TA 1FWJC 2VVSA 4BY3A 1A3WA 3G0UA 4RNIA 1JD7A 3T0CA 1F4AA 2ZRZA 2X8RA 4ZZ9A 2I5GA 4QTGA 1W37A 4K36A 3F1QA 2GVEA 4PL1A 4RDYA 3SURA 4XAZA 4RW5A 2QDHA 3C0QA 1LOSA 2NQZA 5FJTA 1LLWA 1DHKA 1KGWA 1HFBA 3DYPA 3SB0A 1C8YA 3WX7A 3POHA 1OT1A 2IXVA 3FGCA 1OX4A 3L4XA 4IPNB 4YCOA 1VS1A 3S5ZA 1ONWA 2ACRA 3G0SA 4JFWA 1YPIA 3MUXA 4L9YA 1M9HA 2CYGA 2I1OA 4JYFA 1S1PA 2G3IA 4QG6A 4HTBA 4I7VA 2FZNA 3LZ3A 3QPYA 4ZBCA 4C6EA 2C16A 2VRJA 3WQEA 4O0QA 1EZ2A 4GQBA 3MHGA 3E38A 3R6IA 2VX5A 2QUMA 1GQLA 4JD4A 2MANA 3KL5A 1UPPA 3OBEA 3WDJA 1OFRA 2Z6IA 4Q8QA 2HZGA 3NDZA 2WK2A 1R47A 3OGSA 4J5NA 1JZ2A 2DZUA 4AZCA 1KM2A 3LX9A 1KO0A 4XD5A 5E6YA 4ADTA 1FWCC 4KFPA 3OLEA 4K3ZA 1VF8A 1V6WA 3UPMA 1AL7A 3UPWA 2VFEA 4Q7BA 3FLUA 3WDHA 2PURA 3PB2A 1A5BA 2DJXA 1JJKA 2ZXQA 4HA3A 4PRRA 3W4RA 2GSHA 5CSUA 2ZDSA 3FHAA 2BVDA 1QVBA 3QZ6A 4DX3A 4C1KA 1UD2A 5L9FA 4GI8A 1ISWA 3SSJA 4ACZA 4DN1A 3QY6A 3UZZA 1YNYA 1Q63A 4J3VA 1GQNA 1BTCA 1UQYA 4MY1A 3W24A 2DVTA 2NZLA 4IGSA 1QNVA 1H63A 1TPDA 2ZX7A 4YYCA 1T99A 2GYIA 2WBKA 1ZS2A 4M6UA 5HJYA 3LS9A 2EEXA 4MM1A 4HSNA 1J0IA 3HG4A 4TTGA 1L9WA 5I3GA 3MO4A 4LJ3A 1A50A 1GYMA 2EG7A 5JH2A 3TFXA 1D3CA 1OCJA 3GNDA 4HU3A 2W6RA 3R1ZA 3TR9A 4RDWA 3U6WA 1AZ1A 2NWSA 1TTJA 4LUTA 1KM6A 3F5JA 2DT1A 2P3ZA 3PN8A 4CCZA 3P93A 2CFFA 2F9RA 3OA3A 5BROA 2R1LA 1LWIA 1U5JA 3CASA 3Q58A 3CS2A 1E56A 2IS7A 4WCJA 3GVVA 1FOBA 4DO6A 4YTQA 1W5OA 3V75A 4LNCA 4MWAB 1MW1A 4WHBA 4JTFA 4HN4A 1TJ2A 3MWCA 3CUZA 1UASA 4TX9A 3L9CA 4IISA 3AHVA 3WNOA 1G0CA 2H90A 1B1YA 4RCXA 2XINA 1IZJA 4B5VA 5HMFA 2W3ZA 2HVNA 4LAKA 2WXDM 2WW5A 2UBPC 1IXQA 3SUVA 3MKKA 3VNKA 4UQEA 4JFTA 5FEWA 1K4HA 5CH9A 4K37A 2TYSA 1SFJA 1OCNA 2FPTA 3GC5A 1YE6A 4MPKA 3TMQA 1V6YA 3M6YA 3E3HA 3H6OA 1UKPA 4GVGA 3AC0A 4ZQPA 2YZ5A 2VDHA 2XIMA 4C5YA 2PTWA 3WYZA 5CZJA 3HV8A 1Y8BA 3WQ8A 2YL8A 3VNDA 3M41A 2NUWA 1M7JA 2Z1WA 3GVGA 4GXPA 2YGYA 3WFAA 1CECA 3M44A 3UP8A 2BP1A 2QAPA 1WDSA 4LNYA 3KE0A 1E4MM 3BG3A 3CNYA 2FH8A 5IHSA 1F3XA 3KAOA 2FGBA 4HPHA 3RYSA 4R53A 3NSNA 4Y8EA 1WPCA 3TWAA 4IT1A 4JTAA 3WUFA 3A22A 4FX8A 4HOZA 2A3EA 3Q4DA 3BWWA 3I68A 4GUIA 2FTWA 2NQHA 1W5PA 5KZMA 4HNLA 2OELA 2ZQ0A 3THQA 4CVWA 4PSPA 4WGHA 3W7CA 3EOEA 3DU0A 4UZUA 1E15A 1CLKA 3N29A 4EOUA 3R94A 3KX6A 3S8HA 1GVSA 1FH7A 3N2TA 3P0XA 2V2HA 3OP2A 1TPVA 1XV8A 3L5LA 1W9VA 1XHGA 4ECLA 4GJ1A 4N2YA 2BFGA 2Y70A 4LEFA 4N0RA 2CHNA 3W1AA 3S1VA 1RH9A 3WBEA 3CJPA 4OBRA 4XUGA 1EX1A 4IIFA 3L0GA 1ICQA 4JTUA 1PZ0A 3GU2A 4DUXA 4HD5A 4LUYA 4R85A 3VPLA 3GDRA 4DYJA 2V8ZA 5LKYA 2YW4A 3AWOA 5I3JA 4IQJA 3H2NA 2YCLB 2D3NA 3DBNA 3MYPA 3GLCA 1E71M 2C6QA 1QPQA 3NZPA 2JKAA 3I3DA 3EWXA 5H8MA 3WH5A 1NFGA 3WL1A 4ZO8A 5GJNA 3PZMA 2E9MA 1XLCA 1F9CA 3WDPP 3WUBA 1ZHAA 3WF0A 4D1IA 3ZJ7A 3T6CA 1QT1A 3RF9A 2YA1A 4JN7A 1WZKA 3VA8A 3SGGA 5I06A 4AB4A 3MI2A 3P82A 5CAKA 2W4XA 1UA3A 1NM9A 1O1ZA 2XFWA 2VWSA 3NOEA 4ZFMA 1CGXA 2ZADA 1B3WA 4O15A 5ABGA 4S3CA 3QC3A 3CHEA 4GKLA 4CQDA 1XLMA 4UFJA 1IXPA 1W91A 4Q8WA 3UNDA 1BVNP 5FESA 2C19A 3S2MA 2OJPA 4GYJA 2E1WA 3HGSA 4RW3A 3WEZA 4N4PA 4LH8A 1DIOA 2NSXA 1OFPA 2P53A 2X2YA 1DIDA 5C55A 1XD0A 1EOMA 3A5FA 4W7VA 3STCA 1C92A 2BOFX 4UNIA 1RV8A 3EKLA 1AJZA 3QKZA 4TQTA 4UXDA 1OX5A 3POCA 5GNZA 1WXZA 2DW6A 1FHDA 3NAVA 3QHOA 4MY9A 3AUJA 2V68A 3O6YX 3W7DA 5A2BA 4IGNA 2OPJA 1I8JA 1WNOA 4H2CA 3UZYA 4BR1A 1LJYA 1JPMA 4PA8A 4P7OA 5AC7A 2PC8A 4NAEA 3CC1A 3MB9A 1B9ZA 1ISYA 2XH2A 2P0IA 1PIFA 1TUFA 8XIAA 4GO9A 3M1ZA 4F3HA 4INFA 3RRAA 2EPNA 3UZ5A 4LU0A 1GVEA 1PIGA 3PWGA 1WOBA 3GNPA 5G1YA 1KV8A 2J4GA 2DT2A 3VFCA 4AY1A 3EA3A 4UR8A 1UKQA 3V35A 3E12A 4FIRA 3VC5A 4GMEA 5EU9A 2B7QA 2O55A 2XJ7A 3HA1A 1FBAA 3RM4A 1CLXA 1B30A 3WLTA 1XIDA 2QW5A 5CJ5A 5HQEA 3NQBA 1V5XA 4M51A 1Q66A 3UY7A 3U7VA 2WVSA 1TZZA 2EXOA 3TTOA 1OIFA 4NG3A 1QNPA 3AIVA 2H8XA 2GGHA 4P7LA 5FF3A 4RXFA 4GD0A 3FEMA 4MVAA 3LI1A 3WD2A 1J5TA 2JQXA 3LMYA 2YCKX 1R0MA 1YADA 2GQAA 1E4IA 1EQPA 1DJIA 4J3XA 4E6MA 1LUCB 3AZTA 4JIHA 4C6FA 4GZ7A 3T0TA 3ZJ8A 2P10A 1ZZMA 1IQ8A 2OEMA 1F3WA 5EFDA 3C2FA 3EKGA 4P7RA 1BD0A 4NF7A 2FGZA 2WHKA 3GR4A 1TA3A 3T81A 3K2GA 1A0DA 3C8NA 5AYYA 1MUWA 3CO8A 3R5EA 4U3AA 4HU4A 3AYTA 3AIUA 2F84A 5I00A 4QEEA 4DJEC 4FOKA 4WD0A 2ESCA 3ZWSA 1OFQA 4FXFA 1SPQA 1O68A 1D7FA 1JYVA 5LZLA 3EMQA 2VMFA 3KTXA 3ARPA 2WJEA 4POCA 1TJ1A 4NJHA 4MADA 1E1CB 1AMKA 3UFYA 1ITXA 4AIUA 2HJPA 2FJUB 3CAQA 2PRLA 4C91A 4KERA 4BFAA 4KCWA 4MB1A 5U4NA 1V51A 3QHMA 3CT7A 1RQBA 1NF0A 4HMDA 1MEWA 4FNQA 5HNTA 1MFVA 4NVTA 1R3VA 1MQPA 1P48A 3M0IA 4WZHA 1R8LA 1GG1A 2TODA 2YB4A 5C54A 4D6GA 4L9ZA 3U48A 4UFIA 1HO1A 4EK7A 4JTIA 4DJFD 5FJPA 2Z7GA 2XIOA 1VYSX 1VFUA 4DB7A 3NL2A 5BXPA 3AO0A 3H2FA 3NQAA 3LLXA 4FF7A 3N3MA 1R5YA 3VIPA 4G7EA 1I6NA 4ZEPA 1ZNNA 1TPC1 1KQZA 1W5MA 3N9RA 4RE3A 4EKJA 1LBLA 2CLFA 3VD9A 2HXTA 4QJ5B 1UR3M 5LIUX 5AB3A 2CKSA 2RDWA 3LA4A 4JNMA 1POKA 1Q6LA 4JTSA 3C52A 4YTUA 2P0OA 3MUY1 1E43A 2CEQA 2GWGA 3QYQA 3SCWA 3A47A 4BKNA 1NH6A 3KEHA 1KFJA 3CL6A 2WPBA 1K9DA 1MQRA 3QQ1A 4DNMA 5HR7A 4L5ZA 1EWEA 1KB3A 3BSMA 3EX2A 3UCCA 2P88A 3D46A 3SCNA 4PB5A 4UOZA 3ZR4A 4GZJA 4XX6A 4XUYA 4JICA 1R85A 3W87A 4KETA 4P8XA 4TVUA 1OC6A 3TOYA 2FTYA 4DPQA 3BGAA 4PMNA 4B5SA 4TR9A 1FWFC 4PZVA 3DX5A 3EWYA 3W1MA 3LMZA 2REQA 1EUNA 3RCNA 3G18A 3H7VA 1ZBWA 4P7NA 3UCQA 1C8QA 4MIMA 4WJEA 1S5TA 3E0WA 1C8VA 3DC0A 1NEYA 1W1YA 3UR5A 4KEUA 4KW2A 2CLOA 3BVJA 1V7AA 2QCDB 1E6QM 1FWSA 3OLGA 2VNCA 1SVDA 1GYLA 4ZTXA 4JTCA 4M24A 3H4GA 4OFCA 2EPOA 3CAKA 4P8WA 3QQWA 1J6OA 1S38A 3KDOA 5GPRA 2PDXA 1KCKA 4UNKA 3WSUA 1VPQA 3FEQA 1H7NA 1H60A 2BGNE 4CD4A 1ITQA 3WMBA 1MZRA 4PUWA 3WNLA 2OKOA 2E0PA 4H41A 4PBEA 3USBA 5LGZA 1ISVA 4GOAA 5D2XA 3PANA 3GXDA 2CESA 3SIMA 4W9TA 1Q6QA 2VEFA 3CU2A 4HA0A 2QJMA 1IR1A 3HG2A 1PO9A 1R30A 2VC6A 2CLMA 4HCDA 3M0MA 1UD4A 1B2YA 3W81A 3QXBA 2X0HA 3LGEA 4DM1A 3T42A 4E38A 1KBBA 5AZ1A 1V6VA 4NASA 1E0WA 2A3CA 3NO1A 3VMPA 1WQ5A 3SCSA 1S3HA 2IXUA 3GXTA 1UG6A 1GHRA 3WUGA 5CJNA 1WZAA 3W37A 2BGSA 5D2WA 2V82A 3M64A 1LDCA 4PUJA 1PYFA 3CHDA 3C4UA 2G3MA 2VTFA 3FDKA 3NDOA 4Q4OA 3EPMA 3ITCA 1OCBA 2GSJA 3VIOA 3A3WA 3FHQA 4DI9A 2EGZA 4B2DA 4RPQA 1J0YA 4WUIA 3KBMA 1V3HA 1TRDA 1BWKA 3TZNA 3TTQA 5I79A 2GQ3A 1W3KA 5B80A 1GKQA 1KM1A 5B7ZA 3UGVA 1NAL1 1XBYA 1NWSA 3NQCA 3KM8A 3N4EA 3KOWA 1SJBA 1E6NA 1GWJA 3B9OA 1UR0A 1TE6A 3H7RA 3LXCA 1PCKA 2GPTA 2ZRYA 4L64A 3NSMA 3IRSA 1ENUA 4PMVA 4R9XA 3VM7A 1EA9C 3M0LA 2PDJA 1DQWA 4E8DA 3NR0A 3N9SA 5MHBA 5DBTA 1TJRA 3RR1A 4GYKA 5RUBA 1OHLA 1EQCA 3OYXA 4O16A 3GAYA 1BYAA 3CV6A 1JXKA 5KITA 1GZJA 3QGVA 5LIWX 1K7EA 1L6SA 1IEQA 6A3HA 1N8FA 3Q37A 2GJXA 1XLEA 3CMFA 1FQ0A 2ZC8A 3B8UA 5FI8A 2KX9A 2J6XA 2HCVA 1KWKA 4DJED 4Q8NA 3H8AA 3H26A 4BK9A 2INZA 5IDIA 2AMGA 4O1EA 3IIVA 1J0KA 1BWVA 2A79A 3BW3A 1FKWA 2QNEA 1E51A 4ZB2A 1XIBA 2C18A 2Y24A 4GX9A 1MEHA 2QDGA 3HJEA 1W5NA 3ARTA 1OZQA 3IACA 3GNOA 1UKTA 5DY3A 1QBBA 4GCXA 1O95A 4UIOA 5E1QA 1XFBA 3GIPA 4KFOA 2F2HA 4S38A 1KC7A 4Z2GA 1O5QA 1UR9A 2ACUA 2FZ9A 2OQHA 3LHUA 1JD9A 2EPHA 3STGA 4WKFA 4TVCA 1OT2A 4FS9A 2VDGA 4HPXA 2FB3A 1TPUA 1XKYA 1HN1A 3DBPA 2ZZ1A 3PWIA 4UTTA 4JX5A 2ZRVA 4OKDA 2G96A 4NJKA 3EBVA 3LCGA 1C8XA 4IXHA 3IVTA 1GJWA 3AS0A 1KFCA 3W3OA 1EJTC 4JCMA 2XIQA 4C65A 2QCEA 4QROA 1Q6FA 5E0CA 2QVHA 5DQPA 4Z08A 3NM1A 1H7PA 3GTHA 1Y7VA 4KWWA 2V2CA 5F2MA 1J01A 2FPYA 5D4YA 1F05A 4BZYA 4F0KA 4FLSA 3RMEA 4Z42C 4V28A 2Y1HA 1EO7A 1CXKA 2EPKX 3WD3A 4JKMA 3I10A 3IAPA 3WDIA 3WF3A 4CNNA 1T96A 4M82A 1S2CA 4A3HA 3URBA 4J7RA 4CQAA 3TSMA 2NVDA 3WNKA 1A3XA 4URIA 2NXIA 1BLIA 2XZ7A 5DMMA 5A6KA 4EPBC 4Y96A 3W7OA 3LV5A 1GYNA 4L6HA 3UWUA 3VCNA 3BV4A 4ENLA 2OWCA 1TYGA 3DG7A 1W17A 3SAZA 1AK5A 1W1ZA 3P14A 3NWRA 4W84A 1WZMA 4X0NA 2R1PA 3U0HA 4WSJA 2QJNA 4PTNA 1A4LA 4IP7A 1X8FA 2PWEA 1DWIM 2CETA 1W3IA 1JUEA 1A5NC 3BCFA 1A3HA 5D8ZA 2J8GA 2UY5A 2NX1A 3JVAA 2IW0A 2WVUA 3UWZA 4WSHA 5AKQA 3PK7A 5CBIA 4S2CA 2PSNA 3OBAA 4XVEA 4F8XA 3IWPA 2EJ1A 1FP8A 1UW9A 1RHCA 2Z25A 3PZQA 1O66A 1Q45A 3KBWA 2EJAA 2V3GA 2HXUA 2X1SA 3ZJ6A 3W7LA 4W7WA 4O4VA 1BQGA 3P2VA 4NX5A 5FEPA 1BXCA 3F03K 1XH2A 4GFSA 3WLLA 4JR5A 1HGWA 1VBUA 4MJMA 2GZXA 4C6JA 2WZEA 4HCHA 4WQ6A 3UR7A 4ONVA 3GD6A 1I0DA 5GNXA 4N6FA 1L8PA 3EMCA 4KT2A 2YPIA 2QVNA 1HKIA 4PUNA 4UWMA 5AC8A 3R0UA 1M3UA 2QDDA 2POTA 1TQXA 4IFOA 4HK5A 5ABHA 4L80A 2GGGA 2OWWA 1GCYA 1XYLA 1OFOA 3CAVA 4OQVA 3VU2A 4E4PA 3VIGA 2FYMA 2VFGA 4AMAA 1X1NA 1XIJA 5E5CA 3UT0A 4UOQA 1AMYA 2BOEX 2PPGA 1EDTA 1EJSC 1F3TA 4KGLA 3QV7A 3GTNA 3KTSA 1AW1A 3MCNA 1EPVA 1BG9A 4LVBA 3DGBA 5KETA 3R89A 2BHZA 5T8GA 3VABA 4HBKA 5JU6A 5LYRA 1DQXA 3PVFA 1JL8A 2VCBA 3UA3A 2CZFA 5AZ0A 1UHVA 1HJXA 4QNWA 4AF0B 4ZQOA 4LYKA 4A8IA 1P5BA 3TNBA 1L8NA 2C1IA 3T0AA 2WVTA 1AH0A 3HQPA 4BI6A 4QDPA 3USZA 2WNWA 3RU8X 1NFPA 3D3FA 1LWJA 1QW8A 1HGYA 5BCAA 4JY9A 4U33A 3W26A 4X2PA 3THAA 1VBGA 1YNPA 1WKYA 4IM4A 1E6SM 4QIUA 4CQ9A 1C93A 1IT0A 5A6AA 3ANUA 1PB0A 3BMWA 4QR6A 1W1IE 2MNRA 3PAJA 2YCLA 3HB9A 1GUVA 2OX4A 3WDRA 4C6BA 4ML4A 1Z3NA 5C9XA 2YR1A 5H6HA 3S5NA 1TPEA 1LLZA 2C1GA 2DZVA 1O94A 3LI0A 3ALFA 1X7IA 4PTXA 3GR7A 4EPKA 4KWOA 4FZIA 1H3GA 3LBOA 2YCJA 3CQHA 1IT8A 2AGKA 4J35A 2Y63A 4NNCA 3OHIA 5HMEA 3CZKA 2G97A 1VLWA 4C1LA 1XF0A 1TWSA 1Q8AA 3FXGA 2NV1A 1YDNA 3QVQA 1V03A 3ITGA 6TIMA 4A6GA 3U4AA 4W5UA 5AHEA 3RM9A 4JDYA 1JYXA 3B4UA 4S3BA 4UTLA 1R9XA 3IJLA 5DANA 2RGMA 3AMKA 3LG3A 1KXHA 1LYXA 1OF6A 2G4JA 1E40A 4TUFA 2YCEA 2PI6A 1F8MA 3N18A 3GXPA 2BX7A 4GQ0A 4NAFB 4RZBA 3HOJA 2VC9A 1QMLA 4NZ5A 1WYIA 4D6JA 1TIWA 3AMCA 3L2IA 4LWWA 3P7YA 5I0DA 3WQ6A 3SUUA 5E9XA 1A5OC 4IMCA 4JTLA 1D2KA 1X97A 2AQWA 4DI8A 2FLIA 5EMUA 4GIAA 4LC6A 1KFEA 4AX7A 5C7VA 4TU1A 1GOXA 4WIWA 4PBFA 4YMZA 4PCTA 1Z41A 3UR2A 4QLJA 3C56A 1IE7C 1V6UA 3DH7A 5LGXA 1OBAA 1UZ4A 1DL3A 2BLEA 3FJ6A 1KLYA 4U3CA 2WMHA 1G1YA 4D6CA 4HNUA 2YBTA 3PBVA 1XGEA 1PX8A 2BY1A 1YX1A 1OFBA 1IIHA 2OVLA 1DJWA 5EFFA 2BDQA 5JVLA 1PE1A 1K8XA 3NQFA 1RPXA 1Z6KA 2ZZ3A 1JYWA 3ISIX 4XVDA 4QCEA 5CXPA 4M80A 1NDZA 4NJGA 3L0NA 3S47A 2NT0A 3DENA 1SQ7A 3H4XA 5BU9A 4IIDA 3PBWA 4GUGA 3TV8A 3MW7A 3UETA 1WKEA 3QR0A 4MB3A 2YA2A 5DT7A 3ZSSA 3TCSA 2A3BA 4DXKA 5BMXA 2JFEX 4YWIA 5LIYX 1YIXA 4X0VA 1IXNA 2V5CA 1LUCA 3P5YA 3BW2A 1MO0A 5BXSA 2QZRA 2GSEA 4MGGA 3V3WA 3AS3A 3B3DA 3ZO9A 3GTXA 1QAPA 1LQAA 3GXMA 2J74A 3JS3A 3W75A 3WLJA 3AOFA 2OWXA 4GNKB 1X1ZA 1A5UA 1UOKA 3LRMA 4MZ1A 3WLMA 3SR7A 1UD8A 5C6MA 4H01A 3HZ3A 5D03A 4FALA 1PL9A 5M2FX 4ATLA 4MUPA 4WK9A 3LQLA 1TO3A 3N6HA 2JIEA 3GKAA 3W7PA 2IPFA 3UXKA 3B0XA 3AU2A 1F6KA 2V3FA 3DCPA 4JDBA 3APYA 1E1CA 3ES7A 3W23A 2O4MA 1EF2A 1SGJA 2CWXA 2XGZA 1G69A 3B04A 2PP1A 5JMUA 1MFUA 3OGRA 4G5DA 1W0MA 1T41A 2BVWA 4JKLA 3RUBL 4LYRA 4MYAA 3P62A 3D3AA 1XCXA 3QN3A 3K13A 1RQHA 1WA3A 1BGGA 1DWGM 2R6OA 4UCFA 2WMFA 3QGAC 3VGGA 1J2BA 1ZBCA 3PZGA 3S2NA 3WUEA 3O05A 1ZU8A 1FCVA 1B4KA 3NQ8A 3PY2A 4RJEA 3VAVA 3R7MA 1BG4A 4H9UA 1ZALA 3SGUA 2QEZA 1IEWA 2J62A 3ONCA 5TQLA 4PH6A 2RDUA 3GTIA 4A05A 2A7RA 4H8HA 4XAFA 3ARZA 4DM2A 2O7QA 4FHAA 2YL6A 1MDLA 2X16A 5FD0A 3CPUA 1BSLA 3NGFA 4BI7A 2BXZA 2JGQA 3FA4A 4GK8A 2I7GA 1VQTA 3UW6A 3TYAA 1FFQA 3ZVHB 4UTIA 4WXZA 3IV8A 1ECEA 2QS8A 4QX4A 1SR9A 3BICA 1RR2A 1FWIC 3D5HA 1T7LA 5G2IA 3CYJA 2E6DA 9XIMA 2EPLX 2W5FA 4QFUA 2CXGA 1FWNA 4LS0A 1QW7A 4KWUA 3MBDA 1NDVA 3MVIA 4QHRA 5H2ZA 4H8UA 3H2MA 4IHCA 5TBOA 2VI0A 5AECA 2J7CA 4Q3MA 1R2SA 1MRAA 4JTEA 4F40A 4YL2A 2HPIA 2DT0A 3J7HA 2R1KA 3NEHA 7ODCA 1F8IA 3GFXA 3ARRA 4ZQCA 3IUIA 4BCEA 4WJXA 3LB0A 3L68A 2QCDA 3RCYA 3FIGA 1Z8AA 1QOPA 4NNAA 1CGYA 1VPXA 3ARYA 3N19B 5KSWA 4KIEA 3W1PA 4I9AA 2CBIA 3VGEA 3PSVA 2ICSA 4U31A 4IGMA 5DXYA 1SJDA 4LV4A 2XIIA 4MF4A 1FDJA 4D6EA 4QS5A 3R10A 3NXFA 1HKJA 3DAQA 1SJAA 1UWUA 1FCQA 3A6OA 4E4FA 1JCTA 1OYAA 1FWTA 2ZXAA 1OFDA 4JHMA 3L4WA 4MAZA 2PZ0A 2DV0A 2VM8A 4PE8A 1X39A 3BLFA 4I8YA 3WD4A 5AHMA 2HK1A 3BLDA 1MXGA 4GUHA 4JFUA 3C5QA 4FOUA 2VX4A 1PKMA 1WKFA 3TC7A 3W6YA 3E1F1 1CZ1A 4ZB5A 3GC4A 4GVHA 4NXSA 3AUOA 3CIXA 3FAXA 3ARVA 3P8IA 4CCCA 3W29A 3LHWA 5J04A 1TUXA 3I3EA 3EDFA 1XBVA 4NRRA 1Q6EA 4D9PA 3QZEA 4OOZA 5CPSA 1IWAA 3QYSA 5SWUA 1V3IA 4O10A 2VZVA 3UYCA 5K9DA 1KKOA 2VC5A 1HL9A 3IGHX 1VGAA 4P2VA 2R91A 1JCNA 4PUEA 1EC9A 2XVPA 1QI3A 3R2GA 4MB4A 1C9DA 3A12A 1N55A 3UWYA 2Z1KA 1OZMA 4UTUA 2ZXBA 1E3XA 2GLKA 3G1DA 3YPIA 4DJEA 3ZR5A 1B9BA 1JZ6A 4O54A 1E4NA 4CD6A 4WR3A 1ZPTA 4LAMA 3N17A 4XKYB 5E6ZA 3VTRA 3G6MA 3EXTA 3DZ1A 4LOCA 3FOKA 1KXVA 4NY2A 4XWUA 1CB7B 2IKIA 2VHLA 4Y8FA 1F6YA 5JBFA 5HAOA 1V0MA 4CQBA 1XYAA 3W2LA 3GHRA 4DYEA 4M81A 4LQ1A 3UY8A 4PUKA 3BAJA 8RUCA 4O0KA 4ZGYA 2DJLA 4TO8A 3G1RA 1SZRA 3VD5A 3R12A 3NZGA 3OTRA 1BAGA 4EXAA 1E6XM 3BGJA 1XICA 2V5DA 2SFPA 3OIXA 5I02A 3UG3A 3VUSA 2Z29A 1BYDA 4PCNA 3O0KA 3TR2A 1BXNA 1G94A 3FKKA 4J3ZA 1V3MA 3CIWA 2J25A 1A49A 2ZZ2A 4FXJA 2WZMA 4CD7A 3T2QA 4JCLA 3GYCA 3ZT6A 2GVJA 5MF5A 2HISA 5FKYA 5BOFA 1CCWB 3G22A 4K1WA 5DLCA 2QQ6A 4IZGA 3L4ZA 2C8NA 3G1AA 4W5ZA 3KW3A 4PTWA 3W2JA 2QKFA 1YHTA 2HMCA 4N9EA 5IXEA 4CUCA 3GDKA 3STEA 4GQGA 3RR4A 1UR4A 1ZRQA 4ZE4A 2XVGA 1TFVA 1B5TA 1RJQA 3H53A 3BG5A 4Z2LA 2WQPA 2UWFA 1VENA 2C0AA 3H2AA 4H6EA 5BNKA 4LAUA 1H1YA 1JZ4A 1WO2A 3UJRA 4MG4A 4XKMA 4AWSA 4AQLA 1JDCA 2CNCA 4CN1A 2EHHA 4ACZB 1B31A 5FF0A 3EWBX 4JYEA 2F6XA 2JK2A 1FWBC 4H9VA 1H5YA 4C6LA 3XINA 4V1YA 4AVOA 3WQVA 1MI3A 2V0TA 1F2JA 3K5XA 4QXIA 3Q65A 4OZOA 5FF2A 2J7FA 2YL5A 3PG8A 4CCDA 3IARA 2D2OA 1NWUA 4I5XA 1JUKA 3U4FA 4DBEA 4LYQA 4OUEA 2DUXA 1ZBVA 1P0NA 4JHZA 3N6JA 2OB3A 4IIGA 2B31A 3ANYA 1OYBA 4B3ZA 3B0VC 3OLIA 4GIYA 1ICSA 2HV5A 5FJRA 5T26A 4JL1A 3RIKA 5GQBA 4CGTA 1BEUA 5BZAA 4DZ5A 4IPIA 2OEKA 1ZGDA 3NNTA 2PDUA 4NRSA 2ZOXA 1QPNA 3V1HA 2VQUA 3R11A 3KTCA 3SECA 1KXQA 1PTAA 3E74A 3PUOA 1FH9A 4MJ4A 4GY1A 3A64A 4OBSA 3CHFA 4XIAA 4XV0A 4C6OA 1H51A 2Y2WA 5CPLA 2OLAA 4PULA 4YS1A 1IZCA 4O19A 3T4WA 1UWAA 4LEQA 4GY0A 1M53A 3AQUA 1HUVA 3DHDA 1R2TA 2IUZA 5HNRA 3GHSA 4RNHA 1XH1A 3CUXA 2AKMA 3GG8A 3V36A 3PUEA 4F0SA 2WSQA 1EPXA 4CVUA 3BZGA 3MSYA 3TJXA 1U5VA 1JF5A 1JDAA 3K4AA 2WNNA 2D2JA 3R79A 1EXPA 3N1AA 2IQ0A 3E5PA 3L4UA 2QT3A 1S2UA 3LRLA 4N4QA 3UD6A 3ATZA 3B06A 6XIMA 1BXBA 1S5MA 5FAJA 2VGBA 4W87A 1QPRA 2RJHA 3PM6A 4ZQMA 3OGVA 3UF9A 4O52A 3MUCA 2NQ9A 4G6CA 2J8FA 1XDLA 4M7TA 3WLNA 1V6TA 5IHRA 3A24A 1H7XA 2IKJA 3FJ4A 4HA4A 4XQ6A 1A5CA 2AQOA 2OU4A 4H19A 4J3SA 1XW8A 1J12A 4GBDA 3WD1A 2P8CA 1K1DA 2VOMA 1XLIA 4ZMGA 1TQJA 4LFYA 2O4QA 3WBWA 1AQ0A 3W2MA 4QCFA 1WZLA 1XIGA 2X1TA 1R6WA 4Y6GA 2J47A 1N8WA 5HWMA 3EDJA 1T8QA 1KFKA 3H21A 1EYWA 2QCCA 2XH7A 4I9JA 2V63A 5ABEA 3LOTA 1HVQA 4O1BA 3GU9A 5T9BG 4ZOEA 3GK0A 2VFHA 5ECUA 3ARQA 4OT7A 4OWGA 1QATA 3OPSA 3SW6A 1TWDA 1J8VA 3SI9A 3G1XA 2A2IA 3O6AA 3KRZA 4AZ6A 1L6WA 4FB7A 5TNVA 3LDVA 4AHOA 1IIGA 5KZDA 3HIJA 1ISZA 1M7PA 4OOUA 5GNYA 3L66A 1XS2A 1NU5A 1TMHA 3MSGA 4RNFA 1A5KC 2OLSA 2KAUC 1OM0A 4ES4A 4K8HA 3DGRA 2CPUA 2R14A 4EP8C 3WFLA 3CK5A 3NQVA 2Q3OA 4PB3A 4IJCA 4F66A 1ZCCA 1OG0A 2DH3A 3KCJA 4B92A 4QG9A 3F4CA 5JQ9A 4D8AA 3CBWA 3WKZA 1BKSA 4RKAA 3ME3A 4CNUA 1M7XA 1W3HA 4X63A 1OX6A 4BJHA 1SFLA 2A1YA 4CNTA 1RVGA 1SSDA 3M0JA 4O1CA 1KRBC 2D24A 5D2TA 1G9HA 4B4FA 4NYYA 4C6KA 3VMOA 4EAYA 1OG6A 2ISFA 3G1HA 1FCBA 4NJJA 3THUA 4H8NA 5DEZA 6REQA 4EVZA 1UP2A 4QJ3B 5K9XA 4D72A 3U5UA 1DBTA 1S2AA 1QWGA 2WPGA 3OVGA 5C9UA 4AD3A 3MUIA 3W2UA 3M0KA 1A5MC 4ICMA 2R24A 5D32A 1QPOA 1MRQA 5KZ6A 1W2PA 1TCDA 1Q6RA 3EDDA 4PMZA 4HU8A 1P0BA 4NAFA 2VL4A 3AYRA 3DFNA 1M6JA 4O1FA 4UOJA 3LPGA 2X30A 2IKGA 4MMWA 4FXSA 4W8LA 1T0OA 4X2RA 3BO9A 3C3NA 3DECA 2QIIA 1S3TC 5EKYA 3OU8A 3VXGA 4F9JA 5LNWA 2O92A 1EP2A 5HOSA 3CUIA 3CL8A 1X8CA 1BGAA 4GZEA 2OTDA 1DXIA 3A3HA 3B40A 4DWSC 1I1XA 2G3NA 1OF8A 4S23A 1XRTA 3VD4A 3CYVA 3MO7A 4XBKA 3EMZA 5C7HA 1H7OA 2VR4A 2XFRA 3XISA 3RAOA 4Z2IA 4L61A 5HWJA 3SUSA 1HTIA 4Z2KA 2ZZ5A 5E0FA 5HMSA 4Q4MA 5I3FA 1IEIA 1JPHA 3ABZA 4L56A 4N9BA 3M43A 4FF5A 3M5XA 2CXEA 3HBLA 1B54A 3QOKA 4UMBA 3WLKX 4BA0A 1UIPA 5CG7A 3W7KA 1F7BA 5BRPA 2PLCA 3FXYA 4NAEB 1FVPA 3GDTA 3QTGA 4NZ1A 4A29A 3WJZA 2EPMX 1H0IA 3VNMA 5TAOA 4AWUA 5LHFA 2R9RA 1HKMA 1AA1B 3APTA 1R3RA 4US5A 4JBRA 1E9LA 1DXFA 3KS6A 5HNNA 1TVLA 3U7BA 1SYTA 4UR9A 3AJXA 3HF3A 1UJQA 3WJWA 3CLWA 1DIEA 3APGA 2QCHA 5DCDA 3TW9A 1I60A 2YXGA 3MSRA 4AZ5A 3ZT7A 3N2OA 1NDWA 2HBVA 4AIBA 1ECQA 4PFHA 4WEVX 2Y7FA 3IK2A 2QHAA 4UTMA 5A1AA 1XCFA 1WAUA 4LANA 2PLJA 1YMYA 2QMKA 3IK4A 4U4MA 3UWWA 3HFYA 3DUGA 3OQ8A 4DLMA 1ALDA 4NU7A 1VD6A 2WYSA 3RU6A 3UVAA 3SEPA 3W7EA 2B81A 2CIPA 3PNUA 1PS9A 3ABRA 1VFFA 4EPDC 3ABOA 2W79A 2FMNA 1K6AA 3G24A 4MHBA 4N02A 4GYPC 4W89A 4RZ5A 1DXEA 3QMRA 1R7OA 3BCJA 1CNVA 2H9AB 4PMXA 4QAIA 4ZSTA 3GW3A 1KWGA 1Q2SA 1I9CB 1VBHA 2GWNA 4Z0JA 2D23A 4A8LA 3TQ0A 3R0DA 3OJGA 3SCOA 1MUCA 3ITOA 4R7WA 1F61A 4LX4A 2Y8KA 1O4UA 4ZQRA 3WCZA 4KKXA 3NURA 5BMWA 3A5VA 3TW6A 3AXMA 2A85A 2PFHA 2OEJA 5DRIA 5CC6A 2HK0A 1NY1A 2WOQA 3NO5A 3MHFA 4U10A 3DHPA 6ALDA 3B9DA 1HJWA 2YLLA 3RM8A 1B3YA 4YN5A 3BURA 1UUQA 2CHOA 3DERA 1UR1A 3CHVA 4RV8A 4FLQA 3C6CA 2TRSA 2CZDA 3CV2A 1RBAA 4NZ4A 4X60A 1P0DA 4NL1A 1EP1A 1TPFA 2W9MA 1M01A 1RY0A 1PTDA 3MWAA 4HMCA 3O63A 5H91A 2OSWA 4LUSB 1PYMA 4RLIA 4G8TA 4QQUA 3AJ7A 5EYWA 2DZWA 3WLQA 3NZ1A 1P4CA 3W82A 1GQKA 3LEPA 3CZEA 2XUCA 1GEHA 1Q85A 4Z0SA 1ADSA 1U30A 4G7EB 3ZVHA 4C7FA 2YDQA 2PWDA 4M3PA 2X0YA 2Z7KA 1OQFA 2HE5A 4XG1A 4LRTA 4YTTA 3TX9A 1TWIA 4F4RA 4ERAA 3LERA 2W91A 2WSYA 3FYPA 3VE9A 1DP0A 3IEBA 1M03A 2ZVIA 1E1FA 3E2QA 3TH6A 1TTIA 1VCFA 3VGBA 3W9ZA 3BAXA 2PWFA 3RJYA 3VDCA 1XXXA 1R38A 2EKGA 1FX6A 4XAGA 3M46A 4XZMX 4CN6A 1K77A 3SM0A 3W1XA 3OZPA 2VFIA 2PGEA 3PPFA 2A21A 1PHQA 4DWSB 1HP4A 1JZ8A 4DY1A 3JUGA 4YNGA 3RPTA 1GVOA 3UZWA 1KR0A 1QFEA 1Q4NX 1XYFA 4JY8A 4B9YA 4CNPA 2REQB 3WENA 2G3JA 1V08A 3KHJA 3EPNA 4GVFA 1GEQA 1OIMA 2WC7A 1LP6A 3W74A 1Z69A 3W76A 3CL7A 2ZRUA 1F4HA 4UQBA 1TVNA 2VEGA 3S6OA 2FB2A 3EWWA 4B3LA 2HSAA 3OG3A 3ID7A 3U3HA 1NARA 2E1DA 3S2LA 4FNTA 3EZ4A 4J28A 4AUBA 1U1HA 3BG9A 3K4WA 1HZYA 4MKSA 2V5BA 4DWSD 3STFA 4Y9OA 3SY1A 3HU7A 5FJUA 1U33A 3D0CA 4A8NA 4P8UA 1PZ3A 3O0FA 4D2JA 4S3AA 2D0HA 3O16A 3BE7A 3S6TA 3BMXA 4BQ4A 3A9BA 2E9BA 4RE4A 4PEEA 2E3ZA 4W93A 4KRTA 4MAVA 4PCPA 3K8LA 5FEZA 3VKCA 4CQCA 4HOWA 3RCMA 2Q8XA 4P5UA 4Q6XA 3S4TA 3TW7A 3GVQA 3MVTA 2Z00A 1KTCA 3UR8A 5FACA 4Z1DA 1O1HA 2V3DA 4S3GA 4IMAA 4Q7IA 2Q8LA 1KNWA 3KBVA 4KWVA 2BNJA 2ZZ6A 1YLVA 5JBEA 2XZ9A 2YIHA 1O6IA 2RHGA 1XGZA 2E7FA 3EB2A 4L1XA 3BC9A 1UPMB 3EAUA 3FFSA 5IOBA 3KL3A 3UVIA 4L7ZA 4TTUA 2HROA 3PBMA 3GM8A 3M0ZA 2PAJA 2B4GA 4HMNA 3LN3A 4ZXOA 4XKYA 4GUFA 3ZWTA 3AIQA 2C7FA 5I6SA 3LCIA 3IUDA 1DORA 3TOPA 3MBFA 1PTGA 1N82A 4WDTA 2HVMA 1PKLA 3GUWA 4KF1A 4LUIA 2QGHA 4J27A 4GH1A 4Q8UA 3TLQA 4WXYA 3S1UA 3BLOA 3F2BA 2GUBA 2J24A 1BKHA 3T4CA 2V5KA 4L6OA 1CXEA 2OT1A 1G67A 1FWAC 2NX3A 2VO5A 3QQ0A 1LORA 1XYBA 4W4QA 3V4BA 2C15A 5D2VA 3RO8A 4ORIA 3V16A 4YIWA 3GS6A 2E8YA 2XN1A 5DT5A 3R4IA 5EL1A 1U1UA 3F4VA 5D05A 1YRRA 3V5CA 3FN9A 5K9CA 3CB8A 2AL1A 5AC5A 2GJXB 4LV9A 2VURA 4WF7A 2PCQA 1YXCA 4I7WA 1UWTA 2BWGA 2PB1A 4IXXA 1CXFA 1P1MA 3N2BA 2AQVA 3MP5A 4FSAA 3VKJA 3OA5A 3MDWA 3N6QA 3SY8A 4PGLA 3NZQA 2TSYA 3LU2A 3S9YA 1K7XA 1V4YA 2C0HA 1JZ7A 5G1MA 1UQZA 2VUNA 4PTVA 2Y7DA 2RJGA 1D8WA 3C2VA 3GXFA 4LC8A 2E5DA 3RILA 1W1VA 2YOCA 4R88A 4I6KA 2YCIX 5AYZA 1H0GA 3W7QA 4XO6A 1UCWA 3NL5A 1VYRA 1R9ZA 2DZAA 1US2A 1QWKA 4I7UA 2PWVA 4X61A 3E02A 4IJRA 2YXOA 4H7ZA 1CTNA 3N11A 3ZVIA 4AHQA 2PDGA 1LBFA 2Z1XA 2X40A 4ZOCA 1EJVC 2J9XA 3JRKA 3EOLA 3EWDA 1WE5A 3DKLA 4AWTA 4IUGA 3NL6A 4IFKB 3MMWA 4I9MA 3RG6A 1E9YB 1R7AA 2R8WA 5I78A 1J10A 4OTKA 3FY1A 3E49A 3NQDA 3CQJA 4Y9MA 4DO5A 3RK8A 3ZR6A 2ZCGA 2J77A 2W92A 1XUUA 4ZO9A 3UERA 4DF0A 1CXIA 4ZXLA 4WDWA 4MKNA 4TV5A 2GVYA 5CGQA 1ODZA 2VC7A 1ME9A 5D37A 4S3FA 4PRWA 1WUEA 2J7GA 1ITUA 4PR4A 3LCHA 5D30A 1W9UA 1J11A 4KIRA 1ODUA 2DZPA 3GG7A 3T55A 4JTTA 4Q22A 2XVLA 1KKRA 1W5QA 3CO4A 4R33A 1TSIA 4EXBA 4QLKA 3CMJA 2VGGA 4TX8A 1XP3A 1MEIA 8A3HA 4MY8A 1SR0A 4J3UA 2I14A 1AQMA 1Y5XA 5M5DA 2J13A 1MW3A 2F7FA 2NT1A 3RGTA 3T09A 3K1GA 3LSBA 5M17A 3NQMA 1QU4A 2YL9A 1LWHA 1WDPA 2D3LA 1WDQA 2PMQA 2UY3A 2E4TA 3WH8A 5FAGA 3GU1A 2WSRA 3VOFA 2YBUA 3TTEA 1CGWA 3BJSA 4H4IA 2WANA 2HWGA 3W1TA 4AD5A 2QCNA 3L5MA 1UWQA 3LHTA 3QV6A 2DUZA 2P5NA 1J2WA 5FIPA 4AZGA 4HYWA 3GHTA 2GGJA 3H12A 1SSGA 3HPXA 2GVLA 4F0LA 2AKZA 4DZIA 2WZIA 5C0QA 2X7WA 3M7WA 3DFPA 4Y9NA 3W7RA 3N4AA 1WKDA 3RX4A 3THDA 3QFWA 1R9YA 1FDYA 3ITXA 1QTWA 1VJIA 4S2BA 2ATSA 4O8RA 3GQYA 3QV8A 1TV5A 3IVUA 1TX0A 5F7UA 4G2DA 1PWLA 4B9ZA 1UUOA 3BOLA 4JTRA 4FPSA 4FAMA 1WB0A 3SCRA 3MDUA 4M6VA 4YTSA 1TV2A 3SRFA 4AH7A 4PUMA 3O3RA 2ZVRA 4PL2A 3SUWA 2GDQA 1L6FA 3KFTA 3TQVA 5J5DA 2GJRA 5DMNA 4PFMA 5CZKA 1S46A 1W2VA 4GZIA 1KA9F 1SO5A 3NYDA 2DU2A 1WDRA 1JIBA 4B15A 3HG3A 3CEPA 3A9IA 1MWOA 5EBUA 3QF0A 1XFCA 1A4MA 1OWQA 3O8AA 1TJPA 2W0UA 2WCGA 1UYQA 3ERPA 1J0ZA 3KCOA 4E3VA 2PDPA 4K1GA 1X6NA 3BAIA 3OOQA 5I3KA 3VGHA 3CB3A 1GOWA 2ASHA 3IJ8A 5FCZA 1KR1A 3EEZA 4M8UA 1FY6A 2DSKA 2X1RA 4A3YA 3S9IA 1V7YA 4DF2A 3K8MA 1JCMP 3T7VA 3GNXA 4DUVA 1FTXA 2YB1A 3GHUA 5HULA 1CBGA 2P76A 1FH8A 3SCQA 4DJFC 2DSUA 1REQB 3ABSA 5PTDA 1PX4A 4HSOA 4I90A 4V1XA 4RPPA 1EGZA 2WNZA 2FZBA 4EXQA 3WIJA 4MZ8A 4N7QA 3KVLA 4XZNX 1SMAA 3QW4B 2HS6A 4BF7A 2GK1B 3KCLA 2D0GA 3UYIA 2IQDA 1QBAA 3HGOA 2VEPA 3PPCA 4TXEA 3WJXA 2Z1BA 4EX4A 1AQHA 1K6WA 1L6YA 5FA5A 3VMNA 4K2SA 4LVGA 3P61A 3U9IA 3XIMA 1XIIA 3EXRA 2FPVA 2OKTA 4P7QA 4AZHA 3EOOA 4YVPA 4XO7A 2OQYA 4E2OA 3AXHA 3SZ8A 3C8FA 1NOUA 1G4TA 2V69A 3SFWA 5G4EA 1XLAA 2QF8A 4TMCA 3G1YA 2FTPA 3AZSA 4FNSA 4D1JA 2ZUTA 2A6NA 2DW7A 1US3A 2WC4A 2VZUA 5HJLA 3BLPX 3FNDA 3LNMA 3FDGA 2DIEA 4ACYA 2WAGA 4WGXA 1V02E 2HDJA 5TF0A 1RSCA 3FV9A 4DBSA 1JFXA 3DHUA 2D22A 4NIRA 1E0UA 1ZSXA 4GA8A 3CT2A 1DE6A 1YXDA 3IAQA 4NSBA 1ADOA 1FFRA 1WCGA 4H1ZA 4AEOA 1X7FA 1UKOA 5EY5A 4UMAA 3ZFHA 4WLCA 3KS5A 1VYPX 3UXDA 3VVGA 4ASTA 4DBUA 4AMCA 4F48A 7XIMA 5IM51 3EDEA 1KTNA 4AZ7A 2E5CA 4JFVA 5ABFA 4KWSA 4XIMA 3GH5A 3GW0A 5BYWA 5LXXA 2D2GA 4O28A 5CPQA 3WMLA 2DZSA 3IJIA 4IQLA 3BQ5A 3NM3A 1QHPA 1GOMA 4E2VA 3GZAA 2QULA 3WMCA 3CUHA 1V6XA 2WSKA 1B3ZA 1CXHA 4K68A 2O0TA 3G3DA 1F76A 1PWMA 2IPJA 3II1A 4XD4A 4UTWC 5FL0A 4NQ1A 2I5QA 3LK6A 2RUSA 3AZRA 9CGTA 5C9ZA 1F73A 4H6RA 3GG0A 1UB3A 4AEEA 3SY5A 1B3XA 1EP3A 1JF6A 3T0BA 3TLLA 2BZNA 1V0NA 2G4FA 3MJYA 3OW1A 1AH3A 3CUGA 3BQ6A 2A7PA 2CW6A 2ZX8A 4EANA 3R8HA 1WXYA 4WJ8A 1PSCA 2XFFA 2VGFA 5A2AA 1Q2RA 1JDEA 4LUJA 4LS2A 3C2YA 4N9CA 3DI0A 1RCOB 1RY8A 3WBYA 2G0WA 3WY1A 3HG5A 4UZSA 3VD7A 3IS4A 3VD3A 1LROA 3MI3A 4CNOA 3R13A 1DWHM 5HINA 5F2IA 1TTQA 4ML9A 2OSYA 4O14A 1DWAM 1BVWA 3W28A 2NUYA 1H4PA 1GW9A 3O7UA 5G2HA 4MUZA 4GJJA 1CEOA 4I3GA 1K8ZA 3VOHA 3CAWA 1QPKA 5EMMA 1H61A 1XBZA 4K38A 1S5VA 3EGJA 1XGDA 2GFTA 2OQLA 2ZUMA 2H9AA 4IQEA 1VEPA 1QK2A 3NXLA 4O50A 4C90A 1K03A 1OINA 3VOGA 3M6DA 4HHLA 3FX4A 3R0KA 3IIZA 3TUUA 3AS2A 3V0SA 2PC4A 4HZ8A 2J79A 4GXMA 3TFCA 2DQWA 4H3DA 1QHOA 5DN1A 1XLKA 3LCXA 2WZTA 2UZ9A 4ZFCA 1V79A 1AW5A 3QMTA 1W3LA 4E5TA 4CNSA 5F1VA 1BTMA 4A3QA 2X1IA 2Z28A 3HTWA 5DO8A 1E5JA 4EWND 3AI0A 5GJMA 3W02A 2J7DA 2HRWA 4J9JA 3WF1A 3TTYA 1XC6A 1ZBKA 3NSXA 1PZ2A 3MP4A 4JIRA 3WD0A 2VP8A 1QW9A 2PTDA 5B7YA 3URAA 4R7OA 5EMLA 4IWWA 3NG3A 2FHFA 3CXOA 4JXCA 4UFHA 2CCRA 2QV4A 1TZ7A 4LUSA 4W86A 3L2MA 1JRBA 4QDWA 4S39A 3OG2A 2OCZA 3LTSA 3I6TA 4X9YA 2E6AA 4UMCA 4L1WA 5BRBA 1UD6A 4OU1A 3WN6A 3PJWA 1AUSL 4HA1A 1SZGA 2ZIDA 3UJ2A 1EYEA 3TZFA 2I17A 1OGSA 3QOMA 2BV9A 4KMQA 4QRNA 2WWCA 1W1B1 2X41A 2DPEA 4OUIA 3ZLHA 2JEQA 3FJNA 3SQSA 2WO5A 2FKPA 4C1NB 3VX1A 3TXZA 1V3KA 3SCTA 1L2QA 5CGMA 4ORMA 3OVPA 3VIHA 4Z2JA 1XC4A 2E40A 4HHMA 1MSSA 3EB4A 4TVDA 3GY1A 1D7KA 2XM1A 1JG9A </