3LMZA

Crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
b'VKPKAPKAVNPFHLGMAGYTFVNFDLDTTLKTLERLDIHYLCIKDFHLPLNSTDEQIRAFHDKCAAHKVTGYAVGPIYMKSEEEIDRAFDYAKRVGVKLIVGVPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDLDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVTDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYEKDMKDPFLGIAESIGYFKAVSDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative sugar isomerase
publication title Crystal structure of Putative sugar isomerase. (YP_001305105.1) from Parabacteroides distasonis ATCC 8503 at 1.44 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
total genus 88
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3lmzA00
1XYCA 3BZGA 5FA5A 3KWSA 5C9ZA 1XIBA 3VNMA 4A8NA 2GYIA 2XIMA 3DBNA 1XIJA 3BANA 3U0HA 3VNLA 5TNVA 1QUMA 4HGXA 1XLLA 3CQIA 5EMKA 6XIAA 3UVAA 2GLKA 1XP3A 4DVOA 3VNKA 1I60A 3VNIA 1XIMA 3M0YA 1YX1A 4J4KA 2I57A 5H1WA 1XIIA 4LNCA 3CNYA 3L23A 2OU4A 4GJJA 4XISA 1BXCA 4PFHA 2QULA 4YTTA 4K1GA 1XYBA 4QE1A 4X63A 3AAMA 3AALA 4EAYA 1XIHA 9XIMA 4ZBCA 1XLBA 3CWHA 3UXIA 3C0QA 1XLJA 1XIFA 3KBVA 3N4AA 1XLIA 1XIGA 2HK0A 1A0DA 4G56A 4GQBA 4E3VA 2Q02A 3LMZA 4US6A 2ZVRA 5B7YA 2NQ9A 4OVXA 3ITOA 5AVHA 7XIMA 2NQJA 4GJIA 3CQKA 2HCVA 3M0XA 3C0SA 4X60A 6XIMA 3M0LA 4ZB2A 3AYVA 3CQHA 4XSMA 1A0EA 9XIAA 1D8WA 5XINA 1XLKA 2QW5A 1XICA 1XYAA 1XISA 4QE4A 4QEHA 3ITVA 5AVNA 3ITYA 3VYLA 1OADA 3KCOA 4HNOA 2XINA 4ZB0A 4YTSA 3DX5A 3QXBA 1DXIA 3XIMA 1XLDA 1XYLA 3BZJA 2X7VA 1XLGA 3P14A 1CLKA 1K77A 4XKMA 3M0MA 4XIAA 1XINA 5I7GA 3BWWA 4K3ZA 3TC3A 4EACA 4GLEA 1S5MA 1TZ9A 2HK1A 3UU0A 1BXBA 1XLAA 2QUNA 4DUOA 3KBMA 3BDKA 2QUMA 3GNXA 3JU2A 4QEEA 1QTWA 3FVMA 3QC0A 3VNJA 2GVEA 3OBEA 4KW2A 5B80A 3QZAA 4X61A 2XISA 1GW9A 3NGFA 4XIMA 5EMLA 2NQHA 3QYSA 3KBSA 4PGLA 1DE5A 4Q7IA 1XLMA 4YTUA 4XSLA 4QDPA 3AYTA 1A0CA 1XLFA 3TVAA 3UA3A 1S5NA 1MUWA 3KCLA 4A8IA 2J6VA 1XLEA 5H6HA 3UA4A 4HHMA 3ITLA 2G4JA 3ITXA 3XINA 4QE5A 1DIEA 3KTCA 1XIEA 2ZDSA 4QDWA 1I6NA 4YTRA 3KBWA 4A8LA 3ITTA 5XIMA 1XLHA 3IUDA 3M0VA 5XIAA 1XYMA 5J8LA 5EMJA 1XIDA 2G0WA 3U3HA 3C0LA 2GUBA 3WQOA 1XLCA 1DE6A 3KBJA 3KCJA 3KBNA 4YTQA 1DIDA 3IUHA 4W4QA 3CQJA 4ZB5A 4HHLA 8XIMA 3IUIA 5B7ZA 1O1HA 2I56A 4A8RA 5EMMA 2X7WA 3P6LA 3XISA 8XIAA 1QT1A 1MNZA 3M0HA
chains in the Genus database with same CATH superfamily
5D9PA 1MFUA 3POCA 4XBKA 3V16A 2Q8LA 3WF3A 1DWIM 1I1WA 2XIIA 4YS1A 4ADUA 2E1DA 4L1WA 1LUCB 3W02A 1PEZA 1UD5A 1LWJA 4AYSA 1DORA 3H70A 3ARZA 4J40A 1P5BA 2BNJA 4MWAA 1ZUAX 1US0A 3OW1A 5BW6A 2GOKA 2BWGA 1LBFA 1UKTA 2E68A 1W1ZA 3BOXA 1AFSA 3COTA 4H3DA 4B9ZA 3RR4A 4EE9A 1XYAA 4S3JA 1VENA 4KCTA 1SM9A 5FI8A 2G37A 2VCAA 5I0DA 4ZA0A 2XGBA 1I4NA 3OG3A 2D20A 1MUMA 2E3ZA 2ZRXA 4GFIA 4NU7A 2J47A 4HU3A 1EZ2A 5A6BD 4KW2A 3LZ5A 4Q4QA 5DY2A 3RJXA 3SN1A 2E6AA 2J6VA 4MDPA 3ITXA 2G4JA 1XCFA 4JTEA 4R27A 4CCZA 1L8NA 2ANUA 4MNKA 3NPVA 3PBUA 4HHPA 4NAFB 5G1MA 3LOTA 1OEPA 2X2GA 5A6KA 3U57A 3TFCA 1CBGA 4M19A 1Q7QA 2VX5A 4F4RA 3AXIA 2OX1A 1WB0A 2QCEA 2QXWA 1FCUA 3I3BA 1L6FA 3WMBA 3REQB 5C71A 4NG3A 2FTYA 4FP1A 3PUEA 4E2VA 4JTJA 3D46A 3WLSA 1Q5MA 1SPQA 1F07A 1H5YA 1HF6A 5FJOA 4L56A 5LIWX 4NQ1A 3TOYA 1BF2A 2E9BA 1FOBA 2C71A 3XISA 1XGZA 3CL6A 4AD0A 3WD0A 4P7RA 4MNJA 3RLUA 3EWWA 2C8NA 3HZ3A 4D72A 3SN4A 2GUYA 3QQ1A 2OR2A 1TZ9A 4B5WA 1CCWB 1W0MA 3WQVA 5E09A 2W67A 1HKJA 2QKFA 2WMJA 3AMKA 1HJUA 3BV7A 4NL1A 3NPUA 5H6HA 1TE1A 3L0KA 1P1XA 4W88A 2CITA 3B4YA 2QMKA 4U5IA 3WLOA 4AZHA 2VC9A 4KIRA 3ZXWA 3LHZA 5DQPA 1VYPX 1XQKA 2V5LA 2I56A 3MANA 1E9ZB 2V68A 5HK4A 4A8RA 5AYXA 3PTMA 4RLIA 2X1TA 1X38A 4LX4A 3U8GA 1J10A 2XN0A 3PZOA 4S23A 1X39A 2XH0A 1QUMA 3PBMA 2CCRA 1NP0A 3WQPA 5CAKA 1ITXA 4KFOA 2XFWA 2HE8A 5REQA 3UJEA 4HPHA 2JK2A 2QULA 4ENLA 3SIMA 4IX0A 1BVNP 1XJBA 3VX0A 1XC4A 2CBUA 1UWTA 3W6MA 3A3HA 5EKYA 3AUOA 1OF6A 3EX6A 3NWRA 3GHUA 1CLVA 5HQLA 5EMUA 3KOZA 3GNRA 4LV4A 5G2IA 1W56A 2OTDA 2VT0A 5HPCA 1BYAA 2JFEX 3OP2A 3LDVA 3QPYA 3SGUA 1R2TA 1TVNA 4YWSA 5KZ6A 5BWAA 3LBCA 1TIWA 3RILA 2A5HA 4URIA 4GHRA 3VD5A 4EACA 3BCFA 4AZ7A 1J0ZA 4M5PA 2PSNA 1SUXA 3URNA 4OIFA 3K4DA 3P61A 2GJXB 5H91A 2C15A 2F84A 2V9DA 2PDUA 1WDRA 3AOFA 4D6EA 2WAGA 3SFWA 1JI2A 1KLYA 3EKLA 4PUUA 1EO7A 2JF7A 3O2LA 4Q8WA 4PUEA 3MMUA 3RHGA 2OOFA 4A4AA 2FZ9A 1WKYA 1M41A 3NPXA 3H22A 2QHAA 3H4XA 1K9DA 2A1YA 4KFNA 3BAJA 3AWNA 2BVYA 1EP1A 3WEMA 4PTWA 1JULA 3R0DA 2HEJA 4RPQA 4GQGA 1XFCA 4WUIA 2NX3A 3MU7A 1CXFA 2YB4A 1H7RA 1UR1A 1JZ5A 4HB7A 1OBAA 2BASA 3CWHA 3T55A 3OO2A 4N6EA 3W7JA 5CSRA 4GX8A 5CZSA 2PMQA 4BQ5A 5JBFA 1GPWA 3O6YX 4CNPA 2ZUTA 1YKWA 3WG6A 2C13A 3VGFA 2HVNA 1OT1A 1YE4A 4OWGA 4PULA 4Q4KA 3VMPA 4Z0JA 2VVNA 4MLJA 3UG8A 4H8VA 5D37A 1Q6DA 1EJWC 1CGUA 2PPGA 2EEXA 1UR9A 4XTDA 4J3VA 3DFHA 3FVMA 3WLNA 1HTIA 1GQKA 1OFDA 2A3CA 4C6FA 1K7XA 1RLDA 3NG3A 4RV3A 2V30A 1SZFA 3MDWA 3WDJA 3OPSA 1ZS2A 3O1NA 2FGZA 1KR1A 3ES8A 1QK0A 2WLYA 4C6BA 3GW0A 4UOZA 3Q58A 3UWWA 4D8AA 4O57A 4HPGA 1LQAA 4N0RA 3HA1A 2BHUA 3EEGA 3PPHA 1NFGA 4L4MA 4GIEA 2ATMA 4MOZA 2XTKA 1Z8AA 3M4HA 4Q8MA 3GNNA 5K7JA 3DFNA 4FIRA 4BY3A 1OHLA 3QMSA 4J2PA 3N3TA 4A05A 4L64A 3DERA 5LNUA 3HGJA 5BMXA 3PFRA 4A3QA 3E5PA 1RY0A 2EPOA 3GZ3A 1BHGA 5LA1A 4LQ1A 4OHQA 4FR6A 2YCJA 1Y0EA 2XZ7A 3BE7A 3KRUA 3NURA 3OA5A 5AHIA 5DCBA 1MNSA 1F9CA 4LVBA 4PN2A 3CTTA 2DSZA 3MB9A 4QLLA 4I9AA 3CL8A 3G6LA 3HN3A 2HK1A 4TU1A 4A3UA 5K9XA 4A3RA 4DBWA 1LL6A 5ABGA 1G4EA 2WBGA 3WH5A 4DYKA 3W7OA 4I7UA 1WKEA 1E0XA 4AWUA 1IT0A 1TPFA 3MKVA 2FGBA 4M0XA 1JDFA 3I6RA 4WK9A 3KFTA 1SSDA 4JQ4A 4J3UA 2ZX9A 2VC6A 1C3FA 1YDNA 1GNXA 2ACUA 1G5AA 1IZJA 1R3WA 4S2BA 3IANA 4AZBA 3WZ0E 1H7NA 1HIZA 3ABQA 2NVCA 2NLIA 2Y6ZA 5RUBA 4LYQA 3WLKX 5ABHA 1PVNA 3ZR5A 4QAWA 4M7TA 3QR3A 3WQEA 1PUDA 3IIPA 2ZUUA 4FXRA 1FA2A 2XWDA 3WN6A 2VUYA 4IFKA 2DUXA 2OSYA 4LRSA 1S2VA 1K4HA 5C2CA 2J7BA 5DMLA 4GJ1A 1MI3A 1G4PA 3AIQA 1GEQA 4MZ1A 3O15A 1OGBA 1ZP4A 5DMNA 2HCVA 1WDDA 3QSTA 1KFKA 1A4LA 2J4GA 2VRJA 1HJWA 3HMCA 2WNWA 4N4QA 2ODOA 2Y62A 2CLPA 3QY8A 3SADA 3H6OA 4ICNA 3FIGA 2FZMA 3LCXA 3TONA 4J2MA 3UYIA 1MW1A 5A1AA 1XF0A 3GYEA 3TTSA 3QMRA 3LZ3A 2QUMA 1VPYA 3SCNA 2D2OA 1DP0A 3FFSA 3MQTA 2CLFA 5MHBA 3A12A 1JFXA 1TRDA 1MSSA 3UXAA 3DXIA 3FV9A 3N2TA 3GUGA 3NTYA 4QDPA 2JALA 3GO2A 3OVPA 4EWND 3THQA 1KTNA 5C2GA 4G5DA 2FGLA 1BQGA 4WKAA 4KRUA 3VIIA 3TZNA 3T0DA 5M2FX 1HO4A 3R0KA 3UETA 5HUOA 2H9AB 1R3RA 3BVJA 1OX5A 2ZVIA 4H6QA 1RVGA 3UPWA 3PC0A 2J24A 4WDTA 1JUBA 3NQ7A 4DJDC 4LNCA 4K2SA 3VZYA 3AAMA 2F61A 5GJMA 1W32A 3I6EA 4LVFA 1NFPA 2BVWA 1LRTA 4X2PA 4E3VA 4HOXA 1SSGA 5MKGB 2ISWA 2Q02A 3B0PA 7ODCA 1PKLA 1DJXA 3AJXA 2TYSA 1P7TA 6A3HA 3EPOA 3CB8A 1EFZA 3A4WA 1BF6A 3GY1A 3STEA 4P8UA 2P53A 1OABA 3P14A 4WJEA 1V02E 4AWTA 4Z2LA 3L4TA 3FN9A 3H2AA 5I77A 3AIWA 1XSKA 2X0YA 2XVLA 1VFMA 1M9HA 3GK0A 2ZZ1A 3PWGA 4LTSA 2PRHA 4JHOA 5CPNA 3H24A 2V5BA 1KBLA 1CX9A 4NAEA 4F48A 3MUAA 1XSIA 1M7JA 1GKQA 4EF9A 3EXSA 1S3HA 3K8LA 4H9VA 3EDKA 1JYXA 3NGJA 4IQDA 4CGTA 1J0IA 4DZAA 1QPKA 2GL5A 3RCNA 3WBAA 1AQMA 7TIMA 4W7UA 3CIXA 1QFEA 3R4IA 3HQPA 4R7JA 4P61A 3HJZA 1A5NC 4PMXA 1BXCA 5DRCA 4EAYA 1B90A 4DQWA 2VR5A 1QW7A 3BMXA 2KX9A 1EGZA 3TSDA 3LGDA 3MP3A 2WVVB 5KITA 2GJLA 1LQ2A 1UPMB 3GDMA 1JEZA 4F79A 4RDZA 3WNNA 1TV4A 4HYRA 1SJBA 4PCFA 1CI1A 5EFDA 2WWDA 4QQ3A 4YYCA 3SRHA 1UJPA 3GSMA 3MUIA 5F2GA 1F76A 4IJBA 6CGTA 4MJ4A 1KTCA 3VOFA 4MY1A 4B15A 3W73A 4PBGA 4PTDA 1DWAM 1OC5A 1Z41A 1KQYA 1CGWA 5T9BG 1EQCA 3AYSA 2ZA1A 4EOUA 5EMLA 1L6WA 3EWDA 2OODA 1GZGA 4NAFA 2VQTA 2BGSA 3QQ0A 4X0VA 2VGGA 2YLAA 5AC4A 2FPTA 1A5CA 1DXEA 3IJ9A 3P62A 3T42A 2YLLA 2PFHA 3KP0A 1NTHA 3PN8A 4XKYB 2GUBA 3GC2A 4O12A 5G4EA 2PDQA 3W1XA 4BZYA 1HKMA 1XPGA 1OB0A 1XIJA 1OCJA 1CT5A 1JYNA 3G0XA 3QV6A 1XUUA 3A47A 2VRQA 3T05A 2J8TA 5I3DA 3AMGA 4FALA 4NX5A 4ZXOA 1BWKA 3UG3A 1OIMA 2D3LA 2FFCA 3CZJA 1D2KA 3FY1A 2PTZA 2QYGA 4PMZA 4I5XA 4A21A 4KGLA 1B5TA 1UH2A 1JR1A 2FZ8A 1OADA 1V08A 3IARA 3WFAA 1E6XM 2WMFA 1C91A 3CV1A 2HS6A 3PULA 4WXZA 1VFTA 4JNZA 2UY4A 1K9EA 3LHVA 1XDMA 1VFLA 1I2OA 1O5KA 4YHEA 2EJAA 3LM7A 4UTLA 4Z0SA 2D0FA 1E6ZA 3F5LA 4E8CA 1IQ8A 2ZRZA 3R0UA 4YYFA 1UD8A 2I9UA 2DZSA 4PC8A 1JCLA 5BMWA 2CBVA 4RR4A 3O06A 4ZQNA 3PAOA 4O28A 3ZZ1A 4I9JA 3OJGA 4CUCA 5ABFA 1E9IA 1O66A 5H8PA 4O4VA 4E2DA 1EUAA 1BVWA 3VKCA 2I5IA 2UY3A 3WH7A 4LV9A 3KLKA 4HNLA 3RMJA 8XIAA 4INFA 1XBZA 3SCPA 4I3GA 1TPH1 2W9MA 2BXYA 1VCFA 2INEA 1DTNA 4JKLA 1V3JA 4C6LA 3CHEA 4Y9NA 2B7QA 1OX6A 2YDQA 3A22A 3LUTA 3N34A 3BG3A 4IPPA 3HGOA 2DDXA 3DHDA 4RE4A 1ADSA 3DOPA 1QNQA 2DT0A 1CEOA 1YNYA 1W3KA 3TLQA 3CQKA 1XG3A 2XVNA 4LALA 3BW2A 1W3IA 1W1PA 3EWCA 4NJIA 3W1MA 1ALDA 4I5UA 4LANA 2W0UA 1DBTA 1EHAA 3PBGA 2X1SA 1TG7A 2DFAA 1XLAA 3DG7A 3O07A 3FJ4A 3HF3A 3CT2A 1RD6A 2A79A 4HQVA 4UTUA 4MLRA 1H11A 1VRDA 3ZT7A 3PK7A 4WSKA 3TAOA 2YL9A 3E2QA 2WNZA 3P5ZA 1XIEA 5DBTA 4DYJA 1KNWA 1JI1A 3V1PA 4GY0A 4MUPA 3OTRA 1RCXB 5HR7A 3GFXA 3BAIA 3DENA 2A3LA 2Y5JA 3NM3A 1I1XA 4L1XA 3BQ5A 4XV0A 2PDBA 2D3NA 3ZLFA 3OVGA 3LHTA 3W2UA 4JCLA 2VZUA 2HQAA 2WPBA 3TV8A 3LCLA 4QE1A 4K8EA 1TTQA 1IXPA 5FJRA 4IUGA 3WLLA 4ECLA 4GNVA 5BYWA 5GJPA 1BQCA 4UTJA 3VKJA 5CZ0A 3QRHA 3W2KA 3BG9A 1PV8A 1YXYA 1QNSA 3RK8A 3WBXA 2F9RA 3THAA 3O3RA 1OQFA 3G0UA 4P7QA 2VEFA 3P7YA 3VIGA 3F2BA 4XKMA 3M7SA 3LRLA 4HU8A 4C6PA 2Y7EA 3MV11 4PMNA 4AISA 4UFHA 4ZVJA 1WDWA 3ZJKA 1O68A 1VFUA 5FEXA 4H9TA 4KS0A 2WO5A 1AJ0A 1DHKA 3W4RA 3K1DA 3MV01 1JZ8A 2ZBTA 2GSJA 4LCQA 3NQMA 5EYWA 4JN6A 4UNLA 2OEKA 2OWCA 3U5UA 3VDCA 1YPXA 4H8UA 1G67A 4YVPA 2H3BA 1JZ3A 2TRSA 5LGZA 2PLMA 1EA9C 4JTHA 1S2CA 2EKGA 4Y90A 1PDZA 4NF7A 2Z2BA 4XZWA 3N3MA 4DUVA 2WKLA 1KBKA 3VNMA 4YMZA 1GZJA 3WD1A 1CXHA 3S6DA 7REQB 1UR4A 1TA3A 4TXEA 3HPFA 1FWSA 1RA0A 3L4UA 3O7UA 2VEPA 1OF8A 3WBEA 4FO4A 4PMYA 4QIUA 3NQGA 3CPGA 3KW3A 1H62A 1NSJA 1PZ0A 1PWMA 1AL8A 1EQPA 4OTKA 3WENA 1KC7A 4O1EA 2C16A 3W1NA 3GNPA 3SCWA 3VFCA 2NQ9A 2PDNA 4OVXA 3HTWA 2HDJA 2XJ7A 3GU2A 3BJFA 2FZDA 4W89A 2VUNA 4ZFCA 2NT0A 3GZAA 1UCWA 1GQLA 2W92A 5FD0A 3P74A 2ZA2A 3FK4A 3YPIA 1M6JA 3ZR6A 2POTA 3UYCA 3I7SA 3S5NA 3VC6A 4U3AA 3R12A 2CZDA 2PWDA 5FL0A 4PMOA 1PHWA 3N1AA 1H1NA 2A85A 1PS9A 1I2NA 1QK2A 3W01A 3G22A 4AIBA 2GWNA 4KERA 4MIMA 3BW4A 3S0CA 4ZOEA 2QUVA 2Z1SA 2X09A 3OBAA 1UKPA 2AQOA 2HVOA 4DF2A 5IRPA 2Y63A 4QLKA 4UTMA 4OZOA 2X0HA 4GI4A 4MYAA 2JQXA 4S3KA 3ANYA 2E6DA 4AZIA 3Q45A 4JOMA 4PL1A 1KA9F 1PTDA 3ZJ8A 1QHOA 3VDAA 4MB3A 2DH3A 1AZ1A 3P93A 5GJNA 3INPA 2HRWA 3WUFA 4J4KA 2NUXA 2G3JA 2PF8A 1GVOA 1VJZA 3L23A 1QRQA 1Q8AA 4GZEA 3IIZA 1XLIA 4LB3A 1QO2A 1TSIA 4ZQMA 3L67A 5LNWA 1OVDA 4H01A 2D23A 4Q8TA 4LC6A 3ZWTA 1EWDA 1KXHA 3WJXA 2VX6A 1U1JA 1W1YA 3OODA 2XSAA 3VKKA 4AUBA 4C5YA 3BLLA 3GXFA 2NW0A 4AD1A 2OO0A 3GFZA 3W23A 4Z1AA 1UR2A 2QPSA 3LN3A 3VM5A 3WX7A 3W1TA 1EDGA 3QF0A 2J7HA 4DJFC 3ISIX 5T8GA 5A6TC 3VGGA 2C14A 2PI6A 3FVDA 4PBEA 4DWSB 4B5NA 5HBFA 3F1QA 1PCKA 2VFGA 4Q4RA 1EO5A 3SEPA 3HPXA 3MS8A 4MNMA 4Z42C 1UWSA 1CENA 2ZDRA 2H9AA 2QJGA 3WY1A 1A5AA 3M0VA 4QJ3B 5CKSA 4QJ5B 4J3TA 5C7HA 1TMQA 2VWTA 4IFOA 4NUWA 2OQYA 1K8YA 1I45A 3AUJA 3KZPA 4PZVA 1ZY9A 2XHYA 4Z2JA 1PX4A 4LUIA 1V5XA 5HQEA 3MUXA 1W3JA 3BAKA 3DI0A 4KRTA 4LEQA 4DUWA 5IDIA 4Z1YA 3ZIZA 1V3LA 3WDHA 3W38A 4I6KA 5CG0A 1DJHA 3GB6A 3M5VA 1JUKA 2W62A 4HZ7A 4Q8NA 4UIOA 3B8VA 1GOQA 1W54A 3F4CA 1MW0A 1XC6A 2P76A 4M6PA 3EKZA 4HZMA 5HPOA 5HDRA 1VFFA 5C9WA 3OLGA 3AROA 4Y9AA 2RGLA 1VS1A 3ITVA 1ZBKA 4JHZA 1Q6OA 1LT7A 1VLIA 2J8GA 1EL3A 4WSHA 3FDKA 2YXGA 2WJEA 5DEZA 4D1JA 5CBIA 1YXDA 2V2CA 3T0TA 4TVDA 3W1RA 3DU0A 3LLXA 3W1PA 1EJXC 2IW0A 3QC0A 1B9BA 4CD7A 1C7TA 2V3FA 2AL2B 3BLEA 4RE3A 4S3BA 1Q6EA 3WEZA 4IMCA 1CW2A 1VHNA 3B0UX 1V51A 1LP6A 1KQZA 2L5HA 4S3AA 3N2CA 2D0GA 1ME8A 3BGAA 4RXGA 3M6YA 4AEEA 1XD1A 3CAQA 1OK4A 4NNAA 3TW6A 2I9EA 1OYAA 1V79A 2D73A 4K38A 1A5MC 1KM5A 4J3ZA 3H2EA 1N7KA 2E0PA 4H6KA 3B97A 3TTOA 4Z1BA 4F2TA 3R7MA 4JQ3A 6XIAA 4HHHA 4W93A 2QV4A 1K02A 3C5QA 9XIMA 1XKJA 2GGHA 4C6CA 3R94A 1XRSA 1CXIA 2X1IA 4DWDA 1GGOA 4HPJA 1AMYA 5I3JA 4F9JA 3P8JA 3AYVA 3G1YA 4XSMA 4W5ZA 2EJ1A 2XINA 4F0MA 4JL1A 4N02A 3NQCA 3VKAA 3HQOA 4C90A 1S1PA 1ONEA 4AF0B 1O6IA 5EL1A 1FX6A 4ACZB 2VXNA 4PA8A 3G1HA 3O0FA 4HCHA 4ERGA 4B91A 1A3XA 1DXFA 2VZOA 1OFEA 4DN1A 3WJYA 1YHTA 1GQJA 3QYSA 1RHCA 3J7HA 1EC7A 5IM51 4LS0A 4ZCWA 1FY6A 4XKYA 1Z42A 1K9FA 1EUNA 4MTVA 3QR0A 3H7VA 4MGGA 3T0CA 2J9YA 4IJRA 3GTIA 2JKEA 3EWUA 5DO8A 2WC3A 2QCDB 5BOFA 4N9CA 1XGDA 4DZHA 2ZZ7A 1NF0A 1BTMA 1SU5A 2QCNA 4K8GA 2OJPA 3TA6A 3C4UA 1JZ6A 2BGQA 3A5FA 4ZZ9A 1HVQA 4JNMA 1AL7A 2YCLB 3E96A 4W84A 1FCBA 4OBRA 4AH7A 3ONCA 2IPWA 2ASHA 3LTYA 3O8AA 3SCTA 4UTTC 3WK1A 2WYSA 2R91A 4AD4A 1XBYA 4ZQPA 2OYLA 3L7RA 1A5BA 4RDVA 2ZC1A 2FMNA 4O19A 4O0ZA 1MXSA 4GCXA 3WDIA 2G41A 1P43A 3W82A 3WNPA 1W3NA 4B5SA 1F5ZA 1IT8A 3K1GA 1ZRQA 2A6NA 1P0DA 4M24A 1DJIA 2EF9A 1OX4A 3P3BA 2UY5A 2XG9A 3GBEA 5DY3A 2R14A 3KBSA 3TWAA 3KE0A 3N19B 3PB2A 3Q94A 1AODA 5E6ZA 2E8ZA 5A5WA 4A8LA 2WW5A 4B3LA 1H7WA 3WF4A 4LOCA 2ZZ5A 5A8OA 1AH3A 5HWMA 4JTIA 1WOBA 3WK2A 4JKMA 5AFDA 3K5XA 2O7QA 2OB3A 3G1DA 4IFRA 5JU6A 1GOIA 2B0MA 1R8LA 5EMKA 1KLZA 3UVAA 1I75A 3DECA 1RQHA 3FOKA 3ARTA 2UV8G 1WZLA 4KEUA 3CNYA 4MZ8A 3LI0A 2C91A 2V38A 4PB3A 3N14A 1K8CA 3WD4A 1W9PA 3NYDA 3STPA 1YADA 2QCMA 3W1QA 1PIIA 1GOKA 4CEXC 4AHQA 4J28A 4D6CA 1EOMA 3NIYA 4ADSA 3Q65A 2P10A 2BDQA 1F3WA 3HU7A 3C0JA 5XINA 4C1NB 4QE4A 3LGEA 2VDIA 1JL8A 3NO3A 1A53A 2ZOXA 2PDYA 5JIWA 3PBYA 4JCMA 2X1RA 2RAGA 4F2BA 4HP5A 3TJLA 6REQB 3L0NA 3S8HA 2H90A 4IMDA 1BXBA 5EB8A 3SI9A 3U2ZA 3NQFA 2FH6A 4U33A 3VOIA 5F4WA 4AHPA 2JIEA 3I3DA 1V6UA 3K30A 3K2GA 3BGGA 2YDSA 3L5MA 4LS2A 4AXNA 4N7QA 2FB3A 4M6UA 5E0FA 3M0ZA 5HATA 1V93A 2FQIA 2BHZA 2FVMA 1CB2A 3GVQA 1TUXA 4IP7A 3D0CA 4JICA 4M81A 1GWJA 4PUNA 3RCYA 3WLPA 3P67A 4OOZA 1T40A 1QR7A 4HNUA 1Q6RA 1XWYA 2VM8A 4WQ6A 2ZZ6A 3KM8A 3QFWA 2WLZA 4LAZA 3LU2A 4ZQOA 5TAOA 1HN1A 1VIWA 3DG6A 4H1ZA 3L4WA 8A3HA 4DJED 2YR1A 4C1LA 4IZGA 4JTKA 4ZFMA 3NPWA 3PAJA 1FWFC 3FXGA 1FWIC 4LVDA 4N9BA 3WBYA 3GVWA 3WL0A 2PTWA 4GUIA 4JTAA 1E6RA 3S2JA 1TJ1A 4RV8A 1XLDA 1AG1O 1J6OA 3WDPP 1JVNA 4QG9A 5F7UA 4I90A 2ZIDA 2E9MA 4O1FA 3F5KA 3G1RA 3ID7A 3R13A 4RZ4A 2DIKA 4A35A 1OFBA 4YWIA 1NWUA 2PDLA 1K7FA 3TWBA 5I78A 1K8ZA 2W63A 3EPMA 3K13A 1WBJA 2HJPA 3T1GA 4Z1DA 4A8IA 4JFWA 1V77A 4IQLA 4WJ8A 3FSUA 2PDMA 4C5ZA 1QNPA 3APGA 3ZLGA 2PU1A 3KWXA 2ZTKA 4MVAA 3N6JA 2XH2A 3S83A 3THCA 4GD0A 3MMWA 1HP4A 2Y7GA 1FQ0A 7REQA 4UQEA 4C7DA 4GCAA 1NVMA 3QLDA 2HNEA 3TE9A 4MFEA 3TEVA 1V7AA 3MSRA 4FK9A 4PYSA 2PTYA 3KDOA 1OFAA 3GBDA 4IIGA 4CCDA 5TQLA 1HNYA 1HL9A 1KCLA 4GC4A 1RZMA 4AC1X 2XWEA 3MHUA 2DH2A 3RPDA 2ALDA 3UF9A 4DRSA 5K4XA 3CHVA 1G9HA 5D9NA 1OFQA 3TXVA 1S38A 3H21A 2KZHA 4ZSUA 3CV7A 3RDKA 4I8DA 4EXAA 4ATWA 3OQ8A 2PDIA 5LIUX 3JZUA 5KTLA 4CVWA 2YJQA 2ZVRA 3W07A 1OJXA 2QDEA 5G2WA 3B8TA 1YEYA 3NL5A 3W3OA 1X97A 4S3FA 2F2KA 4JYEA 4UTWC 1ZSXA 3D6NA 2RGMA 5HR6A 3TJ4A 1QI2A 1XSJA 2NWRA 5I7GA 3MWAA 3M5ZA 5BRPA 5HULA 3E74A 3VCRA 4JHMA 4ORMA 1JXJA 3QZAA 1CXLA 1GOOA 4HSOA 2R82A 4GIRA 1QU4A 1Q85A 3KVMA 3ELFA 3CUIA 2PLCA 2DUAA 4OBTA 2O9PA 1PX8A 3PBVA 4HKPA 3CIVA 1JD9A 2NWSA 3UY7A 3LSCA 2NXHA 4B90A 5KMYA 4BCEA 1JYVA 4PTVA 3KBJA 1H3GA 2WMIB 4KWVA 4W4QA 4ZGYA 3B03A 1JD7A 1J96A 1QI3A 3AMDA 3WEOA 2ZXQA 3LHYA 3RU8X 3NCOA 4I6VA 2GQAA 4KF1A 1R3YA 1VJIA 5BU9A 4JD4A 1RH9A 4E4UA 2OX4A 4NZ4A 1E70M 4AWEA 5HMFA 3AS3A 3AALA 1R6WA 2EPLX 3A64A 4O14A 4M7SA 4D1IA 4KRZA 2WHJA 1CTNA 5FJUA 2WM1A 2DZBA 4CNSA 4DJDA 4PBFA 3CHDA 1ENUA 1SR9A 5D8WA 2Q8ZA 2X40A 1ISXA 4ZENA 1XQLA 1ZALA 3L2LA 4WD0A 4MKVA 3TN4A 3L5AA 3B3DA 4GY1A 3GXPA 4IMEA 4M51A 2J6XA 3PJWA 3GDLA 4Y9OA 3LYEA 2W4XA 3RRXA 4D8LA 2PDJA 4W7VA 2QAFA 4D9PA 3GWQA 4CD8A 1VBRA 2Y61A 3VUSA 4YVVA 4IOTA 3RLVA 1OT2A 3AHZA 3QOKA 4QDWA 3UZ5A 1R30A 2D69A 3AXHA 1E4LA 3CLWA 4DXKA 3EB2A 3QTGA 3WQOA 4WCJA 3IAQA 4F66A 4LJ3A 2ZE3A 4A29A 1RUSA 2VGBA 4S1FA 2CHNA 3F2CA 4IMFA 3W72A 1QPRA 2Z2AA 4MWAB 1PZ2A 1SO4A 5AKQA 3CM4A 1Z69A 4TOQA 3NEHA 2FPVA 3RFAA 3I10A 3ECQA 3LBOA 3LPGA 1DV7A 1A0DA 3M07A 4GPNA 4UOJA 5TIMA 4JTCA 3S5YA 3WUGA 4NX0A 5D30A 2DV0A 2F8QA 3GDKA 2Y5EA 1JAEA 3WQ8A 2C0HA 4QHRA 2WSPA 4XBSA 4PL2A 2YA2A 2XU2A 2PU0A 4YCPA 1G4SA 4CVUA 5DXXA 3DH7A 4XBJA 3LTSA 4GUJA 1N55A 3VMOA 2AL2A 1XINA 4AHOA 5BCAA 1HT6A 3CMGA 2LLEA 4NZJA 5FOOA 3E12A 3T8LA 2RDWA 3ARQA 4NZFA 1E43A 3W2LA 4HN4A 3AMLA 1JPIA 2WC7A 5CXPA 3PG9A 4OJYA 3FKKA 5BRQA 1ZNNA 5DCDA 3LERA 2VL4A 2VNCA 3CAKA 3W7PA 1AJ2A 3KCJA 4R34A 2AKZA 4GH3A 3SZ8A 3SUUA 4E2OA 1AZ2A 1BVZA 2DZUA 1AA1B 5KETA 1H2JA 2WBKA 1JG9A 4PTMA 4RDWA 3GD6A 1MXGA 3PZIA 5GQBA 5HUPA 1QATA 2PP1A 1DEDA 2A2IA 4PFHA 2NVDA 2XPKA 4HU4A 2RDUA 5EFFA 2O55A 1S2AA 4JZ5A 4XTIA 5AHFA 2PD9A 3ITOA 4KCVA 1UJQA 3UPBA 2VZTA 2BY3A 5E9AA 3GC4A 4ACZA 6ENLA 1FHLA 3VIOA 4YHGA 3K46A 4WZHA 5HOSA 1RXOB 2PDKA 1CGXA 3S5SA 1THFD 1FP9A 1TPWA 3E0WA 3HQ1A 4JY9A 1O94A 1RA5A 3ATZA 3TN5A 4AC7C 1L6GA 4Z2HA 2WQDA 1DQWA 2Y8KA 5DELA 3U2CA 4GIYA 3SAZA 1SJDA 1P0EA 4UB9A 1YTDA 4UFJA 1WZAA 4Z2GA 1QASA 1CGYA 3KOFA 3KCLA 2BS9A 1YQ2A 1U22A 2OVLA 1UQYA 4V1XA 1QVBA 1QJWA 2E28A 5CGQA 1FWHC 5A6AA 2QCDA 3MSGA 1MO0A 1S5TA 3W70A 1Q4WA 4K8HA 2XH7A 2PP0A 1GPFA 4DF0A 2A6LA 3LBMA 1GK8A 1R86A 4ZR8A 3O9NA 4S39A 4RDYA 5AHNA 4WDWA 1FWWA 4CD5A 3G3MA 3GLCA 2OG9A 5REQB 3BANA 4JIRA 4F0LA 3VNIA 4B9YA 3IIOA 2ZXAA 4MKSA 3QBUA 1MEIA 3ZVHA 5LKYA 3M1ZA 3N29A 3K8MA 3TSMA 3V36A 1L0PA 1LZOA 3H4WA 2V5DA 2VC5A 1JYWA 3W7QA 3LA4A 2XVPA 3B9DA 3TNBA 4FNSA 1KCZA 3OZOA 3KP1A 3W84A 1GYLA 1POKA 4Q8UA 3RX4A 4ZE4A 1JF5A 4MYXA 4B92A 4X2RA 2HBXA 5I24A 2G96A 5SWUA 4I8YA 1FKXA 3GYCA 4JKKA 3R2GA 5FJPA 1XCWA 3UVIA 4EPBC 1KBBA 3T09A 1UP2A 4O1CA 3VOHA 2Z24A 3STFA 1XLMA 1ZP3A 3U2OA 4GK8A 4FA3A 1EJ7L 2Z0IA 4L80A 2ISVA 2BTMA 2WJFA 2WMGA 3R58A 3MMTA 3BCDA 4N9DA 1KD0A 3VE7A 3LPFA 3FDGA 4GXMA 3IUHA 2FTPA 4FOKA 1PTGA 1JDAA 1FHVA 5AC6A 3BPWA 2YDAA 1SJAA 3OEXA 1ODZA 1Z32X 1OCBA 1XIIA 3H23A 3F4DA 3MBDA 4O17A 4NJHA 5KZEA 4F2UA 3A9BA 1WZMA 3GHSA 4IUOA 4G6CA 4JDBA 4C1NA 3P80A 1DOSA 3B40A 4AX7A 1XPYA 4UQ9A 2EKCA 2GK1A 3DBPA 3UGVA 1A49A 4KEVA 2DQWA 6REQA 3QV9A 1DPMA 3EAUA 2WNQA 2GDQA 3S2LA 2ZUSA 3TYAA 2DQXA 3KRBA 4ZQRA 3C2RA 4V27A 1H5VA 1CLKA 4PUDA 1EF3A 3TC3A 5KZMA 1S5MA 7A3HA 1MZRA 3AHVA 3CHCA 4Q8PA 3HURA 3VIKA 3BDKA 4H83A 3TROA 1EP3A 1F8IA 3W75A 3NGFA 4XIMA 1MQRA 4PH6A 4DXVA 1DE5A 1XKYA 2G8ZA 4NP7A 3ITGA 4TV5A 2CLOA 1PHQA 3I7RA 1ZTVA 3SQLA 2PRLA 2OZ3A 4V15A 1GUVA 4BF9A 4GA8A 1WO2A 4FNPA 4GIAA 2Y85A 3WYZA 5JQ9A 1SFJA 4ZB5A 2AQVA 5D32A 3M5XA 4OV9A 1ODUA 2IPGA 4KETA 3URBA 1ONXA 1VKFA 3KOYA 3LENA 4KWUA 3NEVA 5CPSA 3VA8A 2QCGA 1NP2A 4B3KA 2NLYA 3V7PA 5A2CA 3C6CA 3A9IA 1VCVA 4E4FA 3VUPA 1XIHA 1QBBA 1XLJA 4HJFA 2BMBA 3F4WA 1R0MA 3IVUA 3PJTA 4XAPA 1LLOA 3LRKA 1IF2A 3OGRA 1UD3A 3QV7A 1MDLA 2QCFA 1EGVA 5GNXA 1A0EA 3UWVA 3VYLA 4WRHA 4DUXA 3ARXA 4IL2A 4OE7A 2EPKX 3PZNA 3QKZA 4ZTXA 3W2MA 1YDVA 4JGDA 4GX9A 1RK6A 1UP0A 1KM6A 4IIDA 3EXRA 3W53A 4PEKA 1BPLB 1DJWA 1QMLA 3EDEA 4WDUA 3TYCA 4HD5A 1AQHA 4HTYA 3ITLA 4YPJA 3GVRA 3SUTA 3FHAA 1K1DA 1U5VA 4JXCA 1WUFA 4O1DA 2YPIA 3WUBA 3KBNA 3FA3A 3LI1A 8XIMA 1HL2A 2IKHA 5TF0A 4JNYA 4R3UA 4AG0A 4LT9A 2QJNA 1MNZA 4ZO9A 2PGEA 2FYMA 3FJ6A 1RBAA 4G9PA 5LHEA 2CLHA 3UZZA 2TPSA 4YNGA 1NJJA 1VAHA 5D02A 1JGIA 1PZ1A 2P0IA 1EBGA 3QLLA 3ABSA 1Q6FA 4XZNX 4DM2A 4Q4OA 4DZIA 3BAYA 2EG8A 3PPGA 4HNOA 5LIYX 2CFFA 1T5AA 4EPKA 3NQBA 2PLJA 2J75A 2ZFAA 1JDDA 3BSMA 4MPQA 3H7RA 5JBEA 5CEWA 1OGSA 4P7OA 2WJDA 1B3WA 3GR4A 1J93A 5J5DA 1C8QA 1LF1A 3CUGA 3N2XA 4RNIA 5ABEA 2OWWA 1W1TA 2HXTA 1BWVA 4X9YA 1RAKA 4HCLA 3K4AA 3M0JA 1HGYA 1I0BA 4S3EA 3EDDA 2V2DA 2Z25A 3PZGA 3BW3A 3GRIA 5FF0A 4D6JA 4AY8A 3CZKA 1REQA 2WWCA 2Z1XA 5C54A 4DJFA 3OLDA 1R3VA 3ZO9A 2WSRA 2PWUA 4LUTA 3E0LA 1IT7A 2E8YA 3GR7A 5EMMA 1KFBA 2RHGA 3CEUA 3AHTA 3BQ6A 1OINA 5DX7A 3HB9A 1ML1A 4CQAA 2C1HA 3ARYA 1JZ4A 3NZRA 3R11A 4XZ9A 1WNOA 3LEPA 1N2VA 3WQDA 2WV8A 2WSKA 2HNHA 3TQ0A 1H60A 1W5PA 4CU7A 5IHSA 1OGGA 1UPPA 1P7TB 4AIUA 3H4GA 3WLRA 2NX9A 4XVEA 4O0QA 1IZKA 3CYVA 1J2WA 3MUCA 1E5JA 3S9IA 5IOBA 2GJPA 1TX2A 1W9DM 4JIPA 3R25A 3T2PA 4QNWA 3A3XA 2RH9A 3V3WA 3GDRA 4R9XA 5IBXA 2Y1HA 4GRSA 1R9XA 1A47A 3A4AA 4KWWA 3JRKA 4BF5A 4YJ5A 3MHFA 1WUEA 1R3QA 3JUGA 3P60A 5DMMA 3W85A 3ZLHA 3PUDA 4LU0A 1JFHA 1B3YA 1BG9A 2O4MA 4BI7A 4HMNA 1J0HA 1Z9AA 5IDZA 2Z29A 1SR0A 3MCNA 4R85A 1PIGA 5F1VA 4Z17A 1BYCA 5HJXA 4XQ6A 4GINA 4ZSTA 4FF5A 4YTQA 3TW7A 2A3HA 3PANA 3IUIA 3TUUA 2VHLA 5FAGA 1UOKA 3A23A 1ZLPA 1G6CA 1EF2A 2GGJA 3NDYA 3CEPA 3FW6A 1ISVA 4WR3A 2WVTA 1MW2A 1MDRA 5A94A 2IQ0A 3W2JA 2R94A 2PDCA 3QN3A 2A4AA 1K8XA 1QHPA 5D04C 3VIPA 5HJLA 4M82A 3JR2A 2E1WA 3B8SA 3P84A 2Z28A 4LBRA 2QJJA 2PUZA 4KMQA 2I17A 5G5IA 4M1RA 5EY5A 4DF1A 3FJLA 4QJ1A 2IKJA 2ON3A 1VD6A 4H19A 2BP1A 4DAFA 5I02A 2YX0A 4M1BA 4FAMA 3TTYA 1NY1A 3NM1A 1PO9A 2JEPA 2ZX7A 4AEFA 3V5FA 2PZ0A 1PE1A 3GH7A 3VK5A 3PPCA 2FDMA 3ZWSA 4UFMA 1QOPA 5U4NA 3OZMA 1UQZA 4R53A 4IISA 2CYGA 5CPMA 1K7EA 1OM0A 3AHYA 4DHGA 3QYQA 1EYWA 3ARPA 4QSFA 4ROQA 3ZVIA 3CGTA 5CPLA 1R85A 1FBAA 3DI1A 1W9UA 1AD4A 2P1FA 4LAKA 5C8BB 1KCKA 1F2JA 4WLCA 3MUY1 3AS2A 4UR9A 3DEQA 3RLHA 3RMEA 3RYSA 2AAAA 2PGFA 3LXCA 3STGA 3CH9A 4HU0A 4K7YA 4RPPA 5CQ1A 1KRAC 2RUSA 4DIAA 5AY7A 3DUGA 2V5KA 4Q33A 5TNVA 4LEFA 2B4GA 2QCLA 4DNMA 1UD6A 2VELA 1XP3A 5FJTA 4DXXA 2R24A 2WPGA 2C1GA 3G24A 1SMDA 3TOPA 4XUGA 3UG5A 1KFLA 3F7JA 3B9OA 1M53A 1V0NA 5C7VA 2BY2A 4U2ZA 4DAIA 5C9RA 2X8RA 1NWRA 1KM0A 1GJPA 4NJKA 1L6YA 4ADTA 3N9RA 3CK5A 2P50A 4NY2A 3WNOA 4Q8OA 4WOZA 4JL2A 2A7RA 4GFSA 4NSBA 2O92A 4Y2WA 2YXOA 4UTTA 3LGGA 3O6AA 1FUYA 3L4ZA 5I3KA 1UH4A 1GKRA 3LV5A 3W9ZA 5CSSA 3VDBA 1A3WA 1F4AA 1LM1A 1MQPA 3B4UA 3E5BA 3UXLA 3AO0A 4GUGA 3WH9A 1O5RA 1BFNA 4K1WA 4EK7A 5ABFB 5FJIA 4CQBA 4KEZA 3CUXA 4FXJA 4CU6A 5C55A 4IJCA 2IS7A 1AQFA 3SDOA 4AX6A 1GCYA 3TP4A 4ZOAA 3EOUA 3IAPA 2JF6A 1MRAA 1JNDA 4IIFA 4Q22A 3PHAA 4IPLA 1U83A 2F38A 4C65A 4O18A 3RJYA 3EEZA 2GVJA 1E0TA 2BV9A 3QKEA 1KGWA 1AW5A 3KS5A 4UBPC 3LCGA 1Y8BA 3N73A 3EX1A 2HBVA 2HVMA 1IYXA 3Q67A 3BTNA 3E2SA 1L6SA 4NASA 3L2IA 1XRFA 1B30A 4P8XA 3GDBA 1EB3A 3W7CA 5AC7A 2J7GA 4MPKA 5I5RA 2PGRA 2XM1A 3SUVA 2O9TA 5LXXA 1H0GA 2NUWA 4BF7A 1KRBC 4R7WA 2H8XA 1GG0A 2P88A 1NDYA 1MQQA 3FXYA 3MBFA 1DQXA 3G0SA 4A6GA 4C6KA 3W7IA 1LG1A 3RUBL 2QUNA 1XGEA 2C3ZA 5BXTA 1F73A 4YVXA 3QH2A 3ONBA 1QTWA 2VCBA 4C6MA 2V8ZA 1D3CA 2XISA 1CECA 3RO6A 1LOQA 3F03K 2G4FA 1Q13A 3CYJA 5I2UA 1TVPA 3KTCA 1KGXA 1I2RA 3SBFA 1AUSL 1H7OA 2PC4A 4HSHA 4H4IA 3IUDA 4KT2A 1O5QA 2ATSA 4QGCA 3S47A 5D09A 4E38A 1Q6GA 3W7LA 4MWAD 1XL9A 4AY7A 4KPLA 4LBUA 4JYDA 3TJXA 1F74A 3KS6A 4REQA 3ENLA 3MMDA 4NVTA 1UMYA 4HK5A 2QDGA 1W5QA 2WHMA 4TIMA 1FDYA 1AW1A 4NYUA 3N11A 4KEMA 1NF7A 1XLBA 1IEXA 4XWUA 2ZWYA 1KWKA 4PCSA 3DAQA 1TE6A 1QOQA 1QWKA 3A4XA 2IKIA 4ZB2A 1H1ZA 2PDPA 3A4JA 2QS8A 1UZHA 1TTIA 4Y7EA 8CGTA 2WZTA 3QXBA 4BA0A 1G01A 3W71A 1RJPA 1TR1A 4LAUA 1W2VA 3LM3A 2W3ZA 2R1KA 3KBMA 4H6RA 2VRKA 1DKWA 2BY1A 2ZXBA 4WDXA 2CNCA 4QROA 3CC1A 5CG7A 1Y65A 4RZ6A 3WJWA 5CZTA 3ZSTA 1JCMP 1HJXA 4F0KA 2ZC8A 4LWWA 2GVGA 1FCQA 4PE8A 3R8HA 1O7AA 3IV8A 1I6NA 4FLOA 3WKZA 3WSUA 2OSXA 1QPQA 1MXDA 5M3WA 3WFLA 2X42A 2ZICA 1C92A 1GVIA 5ENLA 1R9ZA 2PD5A 4H7CA 3HV8A 1TA3B 1VEMA 4GABA 1VBJA 3I4KA 2XM2A 3C2YA 3PVFA 4P2VA 1LROA 3B9EA 4MB4A 1EIXA 4WIWA 1NDZA 4TO8A 3W6LA 1EJTC 4JFTA 3PF3A 1H09A 3P2VA 3C0QA 1BKHA 1H4PA 3IRSA 4HBKA 5CJMA 5C6MA 2PWEA 1V6TA 1E40A 1W31A 3AZTA 4Q7BA 2TMDA 5AHEA 5CC7A 3MA8A 2ACRA 4OECA 3K8KA 3MPGA 3M0XA 3P81A 1LJYA 1GEHA 1RJRA 2WXDM 1GQIA 3DZ1A 2ZADA 4DBSA 1A5SA 2NXIA 1JCYA 2VC7A 3NSXA 4XD5A 3M7WA 3NDZA 2RFGA 1MUCA 4RL3A 2YOCA 4XZHA 3RPMA 4GZIA 3FEQA 3UG4A 1G1YA 4UOQA 3LV6A 3TYZA 3SRKA 1RP8A 1WA3A 4JIHA 2GVEA 1PBGA 1R46A 4G7EB 4UTWA 4CN1A 5LXEA 2E6YA 4HT3A 3QC3A 2GGGA 3CO4A 1YW1A 3H54A 4U4MA 1ZU8A 2ABAA 1VP5A 1F61A 4KH2A 1KXVA 2PDFA 2DGAA 4E6MA 1BTCA 4AYGA 3CHFA 1ZBCA 2E67A 3VPLA 4Q3MA 3AMCA 4M6QA 2BG5A 2DIJA 2O9OA 4E0CA 3PFMA 9CGTA 3R8GA 3W2NA 3W74A 4XAFA 1YRRA 3CASA 2XGIA 1EIBA 4NILA 2ZWZA 2DSUA 4NRSA 3D47A 7PTDA 2PLKA 5I6SA 4US5A 2HK0A 3OLIA 1ISWA 1VBGA 2NXGA 3QVQA 4M6VA 3SQSA 1VCGA 2V69A 1VEOA 1PIFA 1UH3A 4D71A 1W91A 1XLKA 3EOOA 4IQJA 1M7PA 1A80A 2QVNA 4YIWA 3NFUA 2FDSA 1JPDX 3MKKA 3VGBA 1XBXA 1JF6A 3RXZA 4JR5A 3LCHA 3GAYA 4TR9A 4D6IA 1M68A 3IV3A 1GONA 2V81A 4ZQCA 1J2BA 3IGHX 4X61A 5L9FA 2FVKA 5LNRA 1FWEC 1TCMA 2I14A 3M41A 3UQNA 2BBFA 4HA3A 4HA4A 3TC6A 4FEZA 3QTPA 3B04A 3H2CA 2EAWA 3VOGA 4IIBA 3S42A 2C7FA 5G4WA 2YFOA 5GPRA 1VJSA 3FNDA 5XIAA 1IEQA 1HKVA 4UCFA 3T2QA 3GNOA 3NNTA 3OYZA 5ECUA 1W1A1 5EBAA 1QBAA 1JCJA 1O4UA 4JX4A 5CBJA 2GZXA 3VE9A 2YL5A 2QJIA 5LHFA 1GYMA 1N8IA 5GVJA 4NYYA 5FAJA 1H1YA 4F0SA 4CNTA 5DT5A 3VTRA 2YA1A 1BG4A 1KKRA 1UB3A 3PZTA 3BK0A 3OGSA 1NH6A 3UY8A 4TX8A 2P3EA 3R43A 4GG9A 4ML4A 4BI5A 1PKYA 4UC5A 3MY9A 2FZBA 2WC4A 1LT8A 4GGBA 4C6OA 2WB5A 3NO1A 1C9DA 4PSRA 2IUZA 4LY4A 4D8ZA 1R87A 3G1AA 1YE6A 1TKKA 3E3HA 3BMVA 2QVHA 3CMJA 4Q7IA 3M43A 1MZHA 2PDGA 3IJ7A 3CPUA 1N82A 2R1PA 1YYAA 3M9YA 4NJGA 2OCZA 3PNZA 3WQFA 1LL4A 3ITTA 4A3HA 4ICMA 3GH5A 1JCTA 4O13A 5A2BA 1WXJA 1VBHA 3WFZA 1CPUA 5C2XA 5CCZA 2V5JA 3KVLA 5CC3A 5CGMA 3TSBA 1TWDA 4H9UA 1LDCA 2PC8A 3AIBA 4LUSA 4ERAA 4GC3A 3DC0A 1SZRA 4F0RA 3GXTA 2DJLA 2CWXA 4CLMA 3VM7A 3N4FA 3OU8A 2QPUA 2I16A 2C19A 3MZNA 1GHRA 3SFKA 1XX1A 1VFSA 4FNTA 4HMCA 3EKGA 2VURA 4JTLA 2PS2A 2D2GA 3MYOA 3SSJA 1EXPA 3WQWA 4UCGA 3HGSA 4LUYA 3AQUA 3HOJA 3PTDA 4EKJA 3VU2A 1FP8A 2Z4GA 2FFIA 1BGGA 4GBUA 1GG1A 4J1OA 3NO5A 3T2OA 5AZ1A 4HA0A 2Z1KA 3G8EA 1UZDA 1X6LA 4M80A 4JN8A 3HPZA 4IICA 4F0HA 2XFYA 1E1EA 3H7UA 4GBDA 1AD1A 3WQ5A 3ORWA 4IG2B 1DWGM 4DX3A 1JXKA 4YTUA 2CBIA 3GAKA 5HANA 2ZE0A 4J9JA 4HHMA 3USBA 3H8AA 1KCXA 2XGZA 4Z1CA 4GVGA 1GT8A 1GTEA 1PPIA 2B31A 5A6BA 1V3MA 1L9WA 1W3TA 2OYMA 3TYUA 3D5HA 4JTSA 2OYKA 2R1NA 3DGRA 3UZJA 4D2JA 3C52A 1JPHA 6TAAA 5G1TA 4XO6A 4GH1A 2P0OA 5DBUA 4UQDA 4OU1A 2FVLA 2EQDA 4ATLA 1F4HA 4FZIA 3VKDA 3SUSA 1WYIA 2VR4A 3IGUA 5AZ0A 3CZGA 2EO7A 1ZENA 1TPVA 2X0SA 1UIPA 4GI9A 1TMHA 4J5NA 1PAMA 5I3GA 4A3YA 4JY8A 3IJ8A 3GKFA 2E4TA 4GQBA 2Q09A 4O10A 3IGSA 1SW0A 2QIIA 2F6KA 2NQLA 1TPUA 1PYMA 3ES7A 4N9EA 2XFRA 4L6HA 3M0LA 4NHVA 4U10A 1V0MA 2P8BA 3SIZA 3IACA 1SJCA 4WKFA 5HMSA 1TV7A 2VFIA 4EVZA 1WZKA 3VD4A 2HPIA 1OC7A 3SRFA 4P7NA 5D2VA 4LF2A 4W8BA 5CPQA 4DPQA 1TZ7A 4UNIA 3FGCB 1XLGA 1OX4B 4V1YA 3BWWA 4A22A 1ZBVA 3VIJA 4N6FA 3R89A 2Q6ZA 3EWXA 3SCQA 1WOAA 1WQ5A 3BLKA 1U33A 1A50A 1OFPA 2E6FA 1UR0A 3MW7A 4JIQA 4AVFA 3EB4A 1E1CA 1EBHA 4AVNA 2NQHA 4ICCX 3DYOA 2GOUA 3VOJA 4TV6A 3MI6A 3GXDA 3P0WA 2ZUMA 1T99A 3QHNA 3QSRA 1DJGA 4UTIA 3BSHA 5D03A 3IJIA 4LVAA 3H2NA 3RX2A 2J13A 3TTQA 4QBXA 1EZWA 4MF4A 4I5RA 3CPRA 1VFOA 1O1HA 3AXXA 1SW7A 3FJNA 3ZR4A 2JEQA 4IGHA 4LFYA 4ERIA 3MHGA 1US2A 5CSUA 4OUIA 5FEZA 3C2OA 1CXKA 2CW6A 3MJMA 3KHJA 3G5EA 1XYBA 4Y8FA 4RNFA 1BYBA 1PKNA 1YIXA 4JTFA 4WXYA 4GZ7A 2E25A 1P0NA 2ABBA 4XUYA 2ONEA 3KHDA 1X96A 1FWAC 2FIQA 4FS9A 4S3GA 1W3HA 3QHOA 1UZ1A 3QPEA 4ZEPA 3DKLA 5EU9A 3GXMA 2VFEA 1TR9A 3PJXA 1LRNA 3IS4A 3QHMA 1UR8A 4PUKA 3SW6A 2NV2A 4QISA 2EBNA 5LYRA 1IHIA 4GYPC 3GU9A 2ZUVA 2NSXA 3VD9A 2O9RA 2DZXA 1R7OA 4FI4A 2WSQA 3CZLA 2FTWA 4R7OA 3P5YA 3L0GA 1TJRA 3LLFA 4H9XA 1YMYA 3NA8A 3E2VA 3AS0A 2G97A 1M03A 3ME3A 3GNDA 5A6MA 4CQDA 2PAJA 4LYKA 5XIMA 4FLRA 3V35A 2DPEA 4UR7A 1EPVA 2YDRA 1W3LA 5DN1A 2UWFA 2PB1A 4B4HA 4L9XA 2VFDA 3B05A 3B9AA 4QP0A 4RUBA 5PTDA 5LA0A 2V82A 7CGTA 1VLWA 2XVKA 3LQLA 3W7MA 3LX9A 4MWAE 3S1UA 2VD9A 2ZUWA 3SSZA 4MUZA 4IQEA 3GS6A 5E93A 4PSPA 1UC5A 3PSWA 1EJSC 1PZ3A 1UUOA 2VDHA 1S2TA 1W2PA 3S6OA 3MO4A 3MO7A 2NUYA 2E9LA 4FOJA 3CUJA 3V0UA 4DI9A 1GVQA 3AISA 4GJIA 1J01A 2BY0A 3MCOA 3EYPA 1DHPA 3TX9A 1ZFJA 3GC5A 4QFUA 3OLEA 5EA9A 3KLLA 3BOFA 4JIEA 2B7OA 4KKXA 4WGXA 3W7DA 2QDHA 4E2BA 3EMCA 1JRCA 4QG6A 3SUWA 1L2UA 2PDHA 3HIJA 3TAKA 4XO7A 4NZCA 1ELSA 4PRTA 3E1F1 3QM3A 4B5VA 1J12A 3G3DA 4DNHA 1G69A 3RCMA 1YTEA 3CQ0A 1KW1A 3UWYA 3AICA 3AXMA 1XYFA 2EG6A 2V63A 1V8EA 3VD7A 5HWJA 4LAOA 1LORA 3AYTA 4KESA 5LGXA 5I3IA 4KBXA 4B5UA 1LTDA 5JMUA 4PFMA 2DSKA 4B4FA 1E6SM 4MMWA 1TQJA 2GVYA 3W7NA 1P0BA 3W1AA 2XIQA 4NXSA 4TTGA 2PODA 1P4CA 3AU2A 1PSCA 4P7LA 1DJQA 5E5CA 4LS1A 4EPEC 1V03A 4ZO8A 3ZOAA 4LW7A 3U0HA 5AYBA 1P1MA 3KEHA 4IMAA 1VC4A 3GE7A 1R38A 2MNRA 4AB4A 4XISA 1ZZMA 2XUCA 3AHXA 3LMYA 4M3PA 5T26A 2PWHA 3PJUA 3BSGA 5G2HA 2X16A 2WJZA 4O16A 4DJEC 1NIUA 2Y88A 4WX2A 1PCWA 4JFSA 1X98A 4L5ZA 5K9DA 3CU2A 1UROA 4X0NA 4C6JA 4PR4A 2CZVA 4NIRA 1A3HA 3PPFA 2OELA 3QR1A 1E71M 1IZCA 4NNBA 3IWPA 1OFOA 4G7EA 3TQPA 1UR3M 3KX6A 1SFTA 4GUHA 4EWJA 4TUFA 3NZGA 1E1FA 3E9AA 5M1TA 2HPMA 1CYGA 5AYYA 1TYGA 1P6BA 1UW9A 1EXBA 3B8WA 2Z00A 4I7VA 2Q8XA 1ZGDA 4LBSA 1ONWA 1LLWA 4L9YA 2EPMX 1KTBA 3IIVA 1ZCOA 3LD5A 4XX6A 2VO5A 2FJKA 1FWDC 1ESWA 1IR1A 1F7BA 2W79A 2B7PA 2G0WA 1T0OA 4BJHA 4GOAA 4O11A 3WL1A 2VYOA 3LPPA 1QI0A 1UWIA 4GI6A 4GKTA 3I3EA 3SO7A 3QW4B 1KKOA 4GQQA 3AZRA 3II1A 4RJEA 4LGXA 1FXPA 2FHBA 1PXGA 1M5WA 3W25A 4BQ3A 3ERPA 4IWWA 5C0QA 2OEMA 1NAL1 5A6LA 3ITCA 3GKAA 3PTQA 1JZ7A 2QPXA 2AMXA 4YCOA 5AB3A 1RCQA 3CH0A 3OZPA 4MHBA 4AEOA 3H12A 2NX1A 4WY0A 4EX4A 1CGTA 1BD0A 2UZ9A 3W1LA 4LPCA 3G2GA 4L6DA 1K6AA 1VB9A 4NT0A 3RO8A 3NZQA 3PM6A 3THUA 1FFQA 2VDGA 1US3A 3NDOA 1KFCA 4L4PA 3FSTA 4TX6A 2QR6A 4HMEA 1IIGA 4ACYA 3BV4A 1XV8A 4V28A 1UHVA 5M17A 5JIPA 1JIBA 3KRZA 1WAUA 1S46A 4PCPA 1PYFA 2Q71A 2C1IA 3B0VC 2IPJA 3UR2A 1KR0A 1W6TA 4DM1A 3PBWA 3LHUA 4HMDA 3B0YA 3VGDA 2NV1A 2YXXA 3I4EA 4A2SA 1U30A 1G7VA 3VZZA 4AVOA 1UASA 3MVIA 1RQEA 4C1KA 2OOGA 3ICJA 3OYXA 4AMAA 1V6WA 4ZOBA 5EBUA 2HROA 4QX4A 2W6RA 4GVFA 2Z7KA 3VNLA 2FH8A 4ZOCA 3THDA 4HSNA 3U7VA 3K4WA 3N25A 4GO8A 1Q45A 2AQWA 3S5OA 2GQ8A 4C91A 1B1YA 1U1UA 3BARA 2TAAA 3S2CA 3SN0A 4AZCA 2AL1A 3TN6A 3PSVA 2Q3OA 3RU6A 4WY0F 3UR8A 3E0IA 4Y9PA 4N42A 3M0IA 4AAJA 3OHIA 1OCNA 4PB5A 2QDDA 3R10A 4KFPA 1GOMA 2QW5A 3IK2A 5F1UA 1J8VA 3UW6A 1W5OA 4HN8A 2GQ3A 3EX4A 4ZXLA 3G77A 3BMWA 2IXUA 3NQVA 1G94A 4K3ZA 7TAAA 4IIEA 5C9UA 3GHTA 1NARA 4AD2A 1LCOA 4ZODA 1XXXA 2WHKA 5A2AA 3E02A 1HZYA 1JPMA 1UWQA 4B2DA 2V5CA 2F7FA 1UG6A 3W37A 1OZQA 3CZEA 2BFGA 2YYUA 3TVAA 2PWFA 3FCPA 3WLQA 4HK7A 4W5UA 5HXMA 4E3TA 1S5VA 3FYYA 1TJPA 1MEWA 1XM3A 3C8FA 3T0BA 3VGEA 3C0LA 5FACA 3T40A 3TA9A 4BR1A 3U9IA 1G4TA 3W86A 3RN6A 3NOYA 4OGZA 1LBMA 1HGWA 4CD4A 4Y6GA 4CCCA 3VFLA 2WCAA 3G8RA 3RR1A 1WE5A 5FESA 4IXHA 4IGNA 3NQ6A 2OQHA 2IMRA 3GHRA 1L2QA 1WDQA 3C2EA 3L68A 2D22A 4H6EA 1X8CA 3N2OA 3V5CA 4PCNA 1M01A 3AIRA 3EWBX 3F4NA 1WPCA 1NDWA 5IXEA 1K70A 2CZ5A 5A6SA 1RLCL 1FVPA 2DZWA 3N17A 3HG2A 3JS3A 1Q6QA 5CAHA 2XIJA 2X7VA 4CEUC 4H2HA 3L9CA 4IG2A 4U3CA 1RALA 1FXQA 1RV8A 3CAVA 5JH2A 2Y8UA 2CWNA 2J74A 4EANA 2Y70A 4O4WA 2NSOA 1V6XA 2DT2A 1F6PA 2BOFX 1RK5A 4XK2A 3N15A 4H04A 4PRRA 4IGMA 3VD3A 3P8IA 5TD4A 3BAXA 1J79A 1E0UA 2QMJA 3IPWA 4FX7A 3LHWA 2ZDSA 4PUWA 4N2YA 1TPEA 4LCRA 1HQTA 1UZ4A 1RSCA 4MFDA 3GXIA 3TQVA 2G95A 3GIQA 1GORA 1VHCA 4HOWA 4HHLA 3QGAC 1TELA 5FJJA 3W87A 2IQTA 2PDWA 2G3IA 3AWOA 1DWFM 3WUEA 2VEGA 3ZVHB 4L61A 1A5LC 1BRLB 4FHAA 2HWGA 3ARWA 2CZFA 3BG5A 4ASTA 2I57A 2OZ8A 1HKKA 1DIOA 2AKMA 2QCHA 4RZ5A 4S2CA 5D2TA 3DHPA 5E0KA 5CC6A 5DFAA 3SM0A 3KBVA 3VVGA 2FJUB 2OXNA 2QGHA 2D2HA 4XAGA 3EOSA 3E49A 4Q8VA 3FGCA 3SJNA 4GXWA 3PNUA 2QZRA 5I23A 1TPB1 1FWNA 3EWZA 5E6YA 3LNMA 3WO8A 1GVSA 3EA1A 3AXKA 4J35A 5K4ZA 4RNHA 4QXIA 4H00A 1ITCA 4G1NA 1DWJM 5CPOA 5KSWA 3UU0A 1VZWA 5FCZA 1TCDA 2WKGA 3T78A 4AWSA 2G5WA 2PBGA 4WF7A 1E0VA 2CHRA 1Q2SA 4JTGA 2HSAA 1TWIA 4YTRA 3KBWA 4AU0A 2A3BA 2V67A 3PZVA 4JFVA 3U2EA 3I68A 2DZTA 5EMJA 4DY1A 3ARUA 3MVTA 4JTQA 3AIUA 3TC7A 4Y96A 2GFTA 5E0CA 1KV5A 1U2YA 1JDCA 1X7IA 1LYXA 4I9TA 1MVYA 1TRIA 1Q63A 2TSYA 5BU6A 2XSXA 3MC5A 4AW7A 3KVJA 4P8VA 2GK1B 3SB0A 4RK8A 1T8XA 1Q7ZA 2J62A 3DHUA 2OFJA 5K2ZA 2QAPA 2VFFA 1AJZA 7XIMA 3WQ6A 3H55A 1FHUA 4FNRA 2FHCA 1D8WA 9XIAA 1P6CA 3QGVA 3RIKA 1C8XA 3UPMA 2BVTA 1T6MA 2BB0A 3H26A 3UD6A 3MUZ1 1N8WA 3V18A 4UMBA 1C9WA 2YA0A 4DWSC 4L7ZA 4W85A 1ECEA 3RAOA 3ZT6A 5BOEA 3ZYZA 3UZWA 4GYFA 1C29A 2VX7A 5F2IA 1V6VA 4B2DD 3FX4A 3L4XA 6TIMA 2DW6A 4HZ8A 2D1ZA 3WLTA 4GMEA 2OGYA 4OV4A 3NXLA 3CL7A 2VEIA 4H7ZA 1BKSA 2B7NA 3NR0A 3ALGA 3GW3A 2QGYA 1TWSA 4UUIA 3HG3A 3QMTA 5HWNA 1QHZA 4KCWA 5AOUA 1Z89A 1FWJC 1EDQA 1EEPA 2Y4SA 2R8WA 4OQVA 3SCOA 3EMZA 1UYQA 2WM0A 3P0XA 4A2RA 2FZNA 3HM7A 3I6TA 2QV5A 1A5UA 1XIFA 3WMLA 4R5EA 3S1WA 1LUCA 1BGAA 4HTBA 2C6QA 3UJSA 3M5YA 4ATDA 5A8NA 3JVAA 6XIMA 2O0TA 1NU5A 1TB3A 3CQHA 4YXGA 4L1GA 3RNDA 1RP9A 1M7XA 5HMDA 2OLHA 5M5DA 2EGZA 2H6RA 4LY8A 4RZBA 2POZA 3OVRA 1XYZA 5CC5A 2CLIA 3L4YA 4IF2A 3TFXA 3NQDA 5DANA 2CKSA 3BLIA 3URAA 1JGMA 3IJLA 1IR2A 3TK7A 3CS2A 3LY0A 5HMEA 3EGJA 3V1HA 3OHMB 3V0TA 4PGLA 1XG4A 2DU2A 4QG8A 1DQUA 2JKPA 3UZYA 1WKDA 4L65A 1B9ZA 5CJ5A 4AIEA 3UWZA 2R1MA 2ACQA 1DIKA 3ABOA 3QJAA 1J5TA 1R9YA 3B8IA 5LIXX 1YTKA 3UEQA 1Q8JA 2WK2A 4CNOA 2E77A 3M44A 3B06A 5FA5A 1LL7A 3W76A 5I3HA 1OD8A 2YKKA 1PL9A 1TTPA 1HW6A 3CAWA 3TYEA 1YX1A 4LXFA 3WLIA 1JZ2A 4P5UA 4JYFA 4LF1A 4FNUA 3REQA 2CLLA 4U2YA 4MY8A 1X1OA 1IWBA 4BHYA 3QZ6A 4ZO7A 3LMZA 1Z44A 5BWFA 1AK5A 1VFHA 4FF7A 4ILSA 3MI3A 1XH0A 3PUOA 1T41A 2BXZA 4P8WA 2RKXA 1WCGA 2XZ9A 3VIHA 3AYRA 3N6QA 5AHLA 1GVFA 4H8HA 2DORA 2PA6A 3NQAA 4XZIA 2QT3A 4LVGA 3LK6A 4GYKA 1JQVA 3TDFA 3P82A 1IEWA 4IMGA 4WKHA 2YBUA 2REQB 3OA3A 1W9XA 3JU2A 1FDJA 1AH0A 2I5QA 3OBEA 1GVRA 2AAMA 1REQB 2G3MA 1Q2RA 4O15A 3GR8A 1NOFA 1V0KA 3FHQA 1MUWA 4MAVA 5C9XA 4LUTB 4GGHA 3UFYA 4PTXA 1DJZA 2YZRA 1B3VA 4MNLA 1UD4A 4D6FA 1ADDA 3HFTA 3DKJA 1RBLA 4HYVA 4Q6JA 1RY8A 3GIPA 5CGTA 2CXEA 3CUFA 2IXVA 4R9OA 1H50A 5EGRA 4BEUA 2VTFA 3Q2DA 3WD2A 2OLAA 1XLLA 1D9EA 3VC5A 2WVSA 4L4OA 5F4XA 2ISFA 3EX2A 2WZEA 1X1NA 1NWSA 3Q4DA 1Q7MA 3WMSA 3N4EA 4O54A 4NZ5A 4MZYA 3M6DA 2YL6A 1XIGA 2XYLA 1K4GA 1TWWA 1LOLA 2VI0A 4G2DA 1W1B1 2VX4A 3UESA 4JTTA 5C5YA 1BSLA 5BXPA 2VGIA 4HVXA 1A5OC 1TV3A 1RQBA 2FKPA 1GOWA 1AH4A 2J78A 3FAXA 1QPNA 3IJDA 3OGVA 1HP5A 2YIHA 3CBWA 4XIAA 1IGSA 1G7UA 3EPNA 1LG2A 4H7VA 5GNZA 3S9YA 3T0AA 3A24A 4D6DA 4B16A 1ISYA 1EP2A 1KM4A 2X1UA 2Y89A 3SCSA 3O0KA 3M46A 1BXNA 3MSYA 4MJZA 2Y5SA 3FA5A 5GNYA 1VRXA 2ZQ0A 2FMOA 4PMDA 2G3NA 3VZXA 1KXQA 1UKOA 4UNKA 2GJXA 2ZZ3A 3NQEA 2QUTA 2AGTA 3RM4A 1IWAA 3N9SA 4BK9A 3LPOA 3ARSA 3SGZA 3OZYA 4LAMA 2DZPA 1CNVA 3WH8A 3CIWA 4WGHA 4QRNA 4AFYA 3NVTA 3LQGA 1F3EA 1LBLA 1TIMA 3P6LA 1WXZA 1H63A 2O7SA 3TLLA 4ALDA 4LH8A 1T96A 4HGXA 1SVDA 2CPUA 1EYEA 1XIMA 2DUZA 4RW3A 4C6IA 1LWHA 5AECA 3UJFA 1U1HA 4B3ZA 4YTTA 2DY3A 3E38A 3TIMA 2CEQA 4ZE5A 3DFPA 1F3TA 4WVXA 2PZNA 1SO6A 2VQUA 1HKWA 2UBPC 1EH9A 1CIUA 2Y2WA 4GO9A 1B57A 2OEJA 3NSMA 4UXDA 1IEVA 4Q4PA 4QJ4B 4M8UA 2Y7FA 3BZJA 2GWGA 2GJRA 3VIMA 1E15A 1YDYA 1TVLA 1Q66A 3AFBA 4C6NA 1GJUA 3A6OA 2DSWA 4BI6A 5BZAA 4RNJA 4AMCA 1ECQA 3GNXA 1JUEA 3QY6A 1KRMA 3UCCA 1BWLA 3PUGA 1XH2A 4IIHA 4CU8A 1C8YA 1W8GA 2BVDA 1I8JA 4IPIA 1TMLA 3STCA 1YXCA 2ZRWA 3RX3A 1VIZA 4UR8A 2WKJA 2ZX5A 1Q4NX 3IIXA 1FTXA 5TBOA 2YSWA 2DZVA 2W91A 4BFAA 3BJTA 3HV9A 1Y5XA 5F2LA 5A6JA 2EHHA 1WXYA 4O8RA 3QEZA 1TX0A 2WZHA 4EF8A 1J0KA 2EPNA 2OMAA 3RGTA 3APYA 3TXZA 4DVOA 3O63A 4U31A 4JTRA 3GTHA 4JX6A 1XRVA 2BHYA 3ZT5A 3DN5A 2R1LA 4AZ5A 3WK0A 4MB1A 1GVYA 4UFKA 4CCEA 1OZMA 1O12A 1SGJA 2EPHA 4MM1A 2J25A 3R1ZA 2FPYA 1K03A 1D8CA 1HJVA 4H8NA 2P3ZA 1SW3A 3EX3A 3TU9A 2CLMA 4GVIA 1J4EA 1I0DA 2GUUA 2AOSA 4W7WA 1O95A 4GLEA 4KIEA 1XCXA 4DUOA 1KM1A 4XVDA 4YU1A 2VZVA 5IFPA 3MP5A 3D3FA 4HYWA 4UWMA 2VJXA 2ZA3A 3LNPA 5A95A 4JEJA 1KBIA 4RKAA 1UUMA 1SMAA 8RUCA 2X41A 3DIPA 1KB3A 2OPJA 5HA7A 1OIFA 3T8QA 3GM8A 4PB4A 1UA3A 4ROPA 4Y8EA 3ARRA 1FWGC 4GNKB 1BRLA 2NVAA 2DSVA 3KUMA 4GY7A 1KFEA 5A8MA 1OWQA 4NZ1A 1D7KA 3GH4A 2CU0A 3WNLA 3KAOA 1GZ1A 1P6WA 3PZMA 3TR2A 3DC8A 1NDVA 3H53A 4UTHA 1R5YA 3TMQA 4DJDD 4C7FA 5J04A 5T91A 4QM1A 2PWGA 1ITQA 2VCCA 4BWLC 4AZGA 4TVUA 2D0HA 1W17A 3RPTA 3CB3A 1ZBWA 3NZ1A 1IGWA 5AHMA 3VCNA 5A69A 4JPGA 4R88A 2CXGA 3UP8A 1ZJHA 4BQ4A 1M1BA 1WKFA 1B31A 4GQ0A 1B3ZA 1FFRA 2GDVA 4MJ2A 1SFSA 2CKRA 4RE2A 4J3SA 5HNTA 4DB7A 2ISDA 3H2MA 1XFBA 3W83A 1TFVA 2EG7A 1TV2A 1RR2A 2V3GA 3JZEA 4XSLA 1V3HA 4DLFA 1HKIA 3MWCA 1QW9A 5FF2A 4GYPA 3DDMA 4ONVA 2YCIX 4DBUA 1F8MA 4UQBA 2SFPA 4JBRA 1UOZA 3B8DA 2QNEA 4EP8C 3UCDA 3EDJA 4REQB 5BOOA 3CQJA 2IKGA 2J77A 2JE8A 5B7ZA 3CMFA 5J5RA 2OO6A 1FWRA 4MDOA 3VABA 2P5NA 3BURA 3AS1A 3LG3A 3MI2A 3W29A 3U4AA 3SGGA 4TMBA 4IPNB 3QPZA 2PF0A 2HISA 3VKBA 4C7GA 3GFYA 3UXIA 1SYTA 2W27A 1SO5A 1B3XA 4G56A 3O6DA 3IJQA 2E7FA 3KZSA 1IXNA 1W5MA 3KL3A 1Y7VA 5H2ZA 2GVLA 5FSEC 5EPDA 1QOXA 1F3XA 2OT0A 5MKGA 3EA3A 1X6UA 5D2XA 4ZL1A 3PWAA 5IBXC 4AXKA 3DFQA 4NRRA 1EHNA 4W86A 2INZA 4UMCA 2J27A 1KXTA 2J7DA 4HNCA 1E56A 1VQTA 2YW3A 1QWGA 5L6UA 4IP5A 5CZJA 3JW7A 1R3SA 3M47A 3WNMA 1A0CA 3S9ZA 4FXSA 1XLEA 3GU1A 2E09A 3T9PA 3LS9A 3DYPA 2ACSA 1SFLA 4FLQA 5DCEA 3ZJ7A 3QZEA 2Z1WA 1DIDA 1W1IE 4WHBA 5U7SA 4OFCA 4MWAC 3E0VA 3MJYA 4RX0A 4DLMA 1R7AA 1J11A 3TR9A 3WF0A 1I2PA 4PMRA 5D38A 4F9DA 4TMCA 4D6HA 2ZUNA 3WCZA 3PY2A 3VINA 3DESA 1ICPA 1MRQA 1QXLA 1BLIA 3UBPC 3H2FA 3AI0A 9RUBA 5I03A 4C6QA 4L4LA 1NOUA 3FKRA 3GDTA 2WVVA 1UIOA 3BXWA 2B81A 3GUWA 4JFUA 3IRDA 3DX5A 5F2MA 3S1XA 3WELA 4IHCA 3NXFA 4DJEA 2ZX6A 5BROA 3S5ZA 3R6IA 2W5FA 3AJ7A 4JDYA 3BCJA 2VKZG 4Q32A 3QGKC 2J79A 5AN7A 3VIFA 3CO8A 4UZUA 1HL8A 8TIMA 2J9ZA 1GW9A 3KXQA 4RXFA 2DT1A 3GVVA 3EMQA 4FLSA 1HUVA 2P8CA 1GW1A 2FB2A 1YNQA 5LIKX 2BOEX 1G0CA 1V3KA 4Y9MA 3GIYA 2V2HA 1ME7A 4HA1A 4J27A 1KBJA 1JNEA 3BOLA 3UCQA 2VR2A 3EXTA 5IFTA 3NL3A 2F6XA 3ALFA 4ML9A 1EC9A 1LOSA 4N4PA 1ZPTA 1TJ2A 1E9YB 4GVHA 4TQTA 1MEHA 3ZFHA 1H61A 3WLJA 4QSHA 1R3TA 4RW5A 3L21A 3UT0A 4GJJA 2XDFA 2PE4A 1UKSA 3A13A 4XZBA 2V3EA 3T7VA 5FSDC 1E5NA 3EBVA 4FOUA 1EJRC 5AVHA 4R33A 1B4EA 2E5DA 4QITA 1T7LA 1JAKA 4AD5A 1E73M 2PTDA 1IEIA 2PP3A 4HPNA 1PKMA 2REQA 3TNOA 4B5TA 4PMJA 1VYRA 4NI8A 1ICQA 3WQCA 4TTUA 4IM4A 5FF4A 1Q3NA 4W8AA 2Z27A 3UR7A 4HIBA 1MW3A 3EWYA 3M16A 3G1VA 1M04A 4C6EA 3KL0A 2GSEA 7ENLA 2IQDA 4HNVA 3LRMA 1HFBA 3B8UA 1UP3A 4DO6A 1YNPA 1VEPA 2VOTA 2DVTA 4J7RA 3W28A 3W7EA 5ABTA 1VBUA 4OT7A 3U3HA 1J0JA 3TYDA 3SURA 2O56A 2WCSA 5FKYA 1PDYA 1V0LA 4CD6A 4V33A 1QT1A 4Z2KA 2OZ0A 1WV2A 3PP7A 3CLMA 5C9ZA 1PB0A 1QI4A 3BL3A 2XIMA 1YDOA 3CZ8A 3W24A 1AVAA 3KDNA 4FPSA 1V4YA 2ESCA 3MCMA 1I60A 4QDMA 1YBQB 5AC8A 2BLEA 5BXRA 1J6PA 3ANUA 3HPAA 4NI3A 1ITUA 3W6YA 3PB0A 2OKTA 3RM8A 2XIBA 1ZAIA 4BEQA 1UD2A 2G50A 3W0KA 5F4SA 2CLKA 1XW8A 4NNCA 4F3HA 3LCFA 4JQ2A 3GXNA 3IGXA 5E70A 2OGJA 3KCOA 3VOCA 4U5KA 3W22A 3LCIA 4MSSA 4U28A 4JTUA 3CV2A 2WNNA 4IX2A 3C2FA 3N18A 1UA7A 3GX9A 3W7HA 5JUVA 4EXQA 2WCGA 4NZ3A 1L8PA 3ATYA 3BICA 1SZNA 1EPXA 2XVGA 4JIIX 4IGSA 3PR2A 3BC9A 3EZ4A 2R6OA 1X6NA 2W66A 3AZSA 4QE5A 3QW3A 4NJJA 4K68A 3EDFA 1GYNA 3PZ9A 4DO4A 3G18A 2JBMA 1QPOA 3LXAA 3BLDA 4H9MA 4LUSB 1Z3NA 2PTXA 5H8MA 1FHDA 1WAWA 3MT1A 4GACA 4IT1A 3VILA 4HOZA 1XRTA 3NVDA 1MFVA 1DWHM 1C7SA 3WNKA 1UWUA 3CUHA 1RPXA 5LNSA 2QLYA 3NJ3A 1K6WA 1IIHA 1XH1A 3WLMA 4EXBA 5H1WA 4RCXA 4Q7NA 3NQ2A 2HS8A 4K1GA 2HV5A 4JX5A 1V3IA 4E8DA 3NYZA 2CESA 1GJWA 3L2MA 3WIJA 2NQJA 2PBOA 1VH7A 5D9MA 3G1SA 3I65A 3CWNA 3KVKA 2Q3RA 1X7FA 1DJYA 4UFLA 3SECA 4DEFA 5FF3A 3ABZA 4XB3A 1RVKA 4GUFA 2GPTA 3VCCA 2DVXA 2CLEA 1WDPA 1WP6A 4XAZA 4GE8A 4O52A 3T4CA 3FAWA 1ZB5A 1F6YA 5I00A 1I9CB 3TMLA 1K77A 3HMJG 1R47A 4UTKA 3UXKA 2XN1A 2VEKA 3BGJA 4QCFA 4G8TA 3DG3A 1VGAA 3FYPA 1UUQA 4FSAA 3S46A 4UMAA 2DT3A 2BZNA 1CB7B 4JTDA 4XAYA 5BXSA 1XLFA 4XG1A 3ZJ6A 1W9BM 5KEZA 3L66A 2GQ9A 4MY9A 1GVEA 1NEYA 3BLOA 1QCWA 1FDZA 1JJKA 3NSNA 1OYCA 2Q01A 1SZEA 1XHGA 3L4VA 3S2MA 2NQ5A 4TVCA 2VD8A 4S38A 4GXPA 2XFFA 2OLSA 3HJEA 3VNZA 3SY5A 2ZXDA 3UJ2A 2Z2UA 1XIBA 1SO3A 3UWUA 2WQPA 3UNTA 4LYRA 3B0XA 3UWQA 4BKNA 1OG0A 1R2RA 1VPXA 4FNQA 3BLFA 1PX3A 1X1ZA 3SJ3A 1LWIA 2CZEA 3VMNA 2UY2A 2Z1BA 3DHFA 2Z6IA 1B3OA 1CLXA 4KQNA 2OZTA 3BUVA 3MTWA 3VI2A 2Z6JA 4PTNA 1O60A 1BAGA 1LRQA 2VP8A 5D4YA 1FWTA 1K9TA 4GQRA 2Z7GA 4QTGA 4QEHA 5E9XA 1GQNA 1FCVA 5LZLA 5LSMA 1H7PA 3G1FA 3PWIA 4O1BA 2YCEA 1S2WA 4QS6A 4PMUA 1E1CB 2DW7A 3QY7A 4HCDA 4POCA 4DJFD 3V5OA 1QAPA 3N13A 5JH1A 5KINA 2JGYA 1QW8A 2QF7A 5G1YA 1NFBA 5D2YA 4PUJA 3A21A 2D2JA 3MP4A 1HG3A 1TO3A 5HAOA 4XD6A 1ZL1A 2V0TA 3WLHA 5LA2A 4MJMA 4QLJA 2H8ZA 1J9YA 1TWZA 1ADOA 2DEPA 2BGNE 2NV9A 1W37A 3TN3A 1XLCA 3W27A 3F2DA 1GKPA 1QDSA 2DP3A 2YFNA 1M3UA 5DXYA 3DBNA 4WJXA 4LUJA 4X22A 3SRDA 3W00A 5LNVA 1S3TC 3PZUA 4QAIA 1ONRA 2J7FA 4BS0A 2O4QA 3OBKA 1CWYA 1E6PA 3S3GA 5MF5A 1SZGA 3SCUA 4XZMX 4YLWA 1CGVA 3O05A 2Z26A 1W8SA 3D3AA 3S2NA 1NM9A 5D05A 1C93A 4X9SA 4MAZA 4W8LA 4PCTA 1YPIA 2OWXA 1KGUA 3SCVA 1KFJA 4FR1A 2MUCA 5I07A 1DXIA 1E72M 2CETA 4LYPA 4FB7A 3BLPX 3ZS4A 2BOGX 1RCOB 2J88A 3R8RA 2V3DA 3CV6A 5DMYA 1V7YA 1HX0A 1YLVA 1POJA 2NZLA 3LSBA 4O1AA 2ZRVA 1R2SA 2BXVA 1OD0A 4E4PA 3UA4A 3TQKA 1OFRA 2CC0A 2BODX 3PG8A 4DWSA 4DYEA 3VAVA 1TQXA 1AMKA 5I06A 2HXUA 1F05A 1HJQA 5CZKA 6ALDA 5AYZA 1IXOA 2CBJA 2HTMA 5FIPA 2DVUA 2J7CA 2J7EA 5D8ZA 3L65A 4H2CA 2TODA 4QQUA 3AC0A 4OUEA 1V6YA 4EAMA 4A8NA 4C6DA 2WHLA 4K39A 2A3EA 2OQLA 4ZO6A 5HNRA 1QO5A 2YBVA 3U4FA 1M7OA 3S4TA 1JCXA 1E6NA 1EGMA 1T8QA 3TYBA 1RBOB 4US6A 2I1OA 3QFEA 5HJYA 3GQYA 4E8GA 2CIPA 1FRBA 1E4IA 2QJHA 3S1GA 3C3NA 3G1XA 2CHOA 1TUFA 1EWEA 3SY8A 4MADA 2NQZA 1M65A 1E55A 4NKCA 4XD4A 3RITA 1ZCCA 2DZAA 2KAUC 2QEZA 4ZTYA 4JQAA 1JDEA 1NOWA 2PCEA 1HJSA 3UGRA 2INFA 1ZJBA 2RJHA 2J66A 3N9KA 2VVSA 1FH8A 4E5TA 1C90A 3V0SA 1XBVA 2PCQA 1I2QA 1LQ0A 5B80A 3GG8A 1O1ZA 3C86A 4QR6A 4TX9A 2OKOA 4CQ9A 3U48A 1PTAA 3UA3A