3LMZA

Crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
VKPKAPKAVNPFHLGMAGYTFVNFDLDTTLKTLERLDIHYLCIKDFHLPLNSTDEQIRAFHDKCAAHKVTGYAVGPIYMKSEEEIDRAFDYAKRVGVKLIVGVPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDLDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVTDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYEKDMKDPFLGIAESIGYFKAVSDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative sugar isomerase. (YP_001305105.1) from Parabacteroides distasonis ATCC 8503 at 1.44 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Isomerase
molecule keywords Putative sugar isomerase
total genus 88
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3lmzA00
2ZDSA 3VYLA 2ZVRA 4A8LA 2I56A 3KCJA 4A8IA 1XLIA 1XLCA 3KCLA 1XLMA 2GVEA 4XKMA 4QE5A 4QDPA 1XLLA 8XIMA 3AAMA 4HHLA 1XIBA 4QEEA 6XIMA 4QEHA 5B7YA 1XLDA 2HCVA 4LNCA 2GUBA 1XIDA 4A8NA 5XIAA 3AYVA 3XISA 3VNIA 1GW9A 2I57A 2NQ9A 9XIAA 3IUIA 3QZAA 3CNYA 3LMZA 3TC3A 5C9ZA 3C0QA 3CQIA 3XIMA 2GYIA 2QUMA 1DXIA 3AYTA 4ZBCA 4YTSA 1XIIA 5I7GA 8XIAA 1XIJA 3BANA 3KBSA 3VNKA 4EACA 3BWWA 5H1WA 4XISA 3BZGA 1XP3A 4GQBA 4K1GA 5J8LA 4DUOA 4ZB0A 1S5MA 5XINA 3KBWA 4A8RA 4ZB5A 1XLKA 3P14A 5AVNA 4ZB2A 1K77A 1D8WA 3KBMA 1XIMA 3N4AA 4OVXA 5EMKA 1QTWA 3KWSA 2QULA 3P6LA 3C0LA 4PFHA 4X61A 4XSMA 3CQHA 2XIMA 3ITLA 1BXCA 2HK0A 5B80A 1O1HA 4HHMA 3IUHA 4X63A 3BDKA 2OU4A 4PGLA 4HGXA 3UA3A 3VNJA 3FVMA 3VNMA 4EAYA 3M0YA 3NGFA 6XIAA 1XINA 2G4JA 5AVHA 3KBJA 4E3VA 2Q02A 3UU0A 1YX1A 1XIGA 2GLKA 2G0WA 2XISA 5TNVA 3VNLA 3M0LA 3ITOA 1MUWA 3IUDA 3OBEA 3L23A 4KW2A 9XIMA 3XINA 3BZJA 1A0DA 1MNZA 1I60A 2NQHA 2HK1A 5EMMA 3CQKA 1QT1A 3QXBA 1XICA 3M0HA 1XIEA 1XYMA 2X7WA 4YTTA 3GNXA 4XIAA 5EMJA 4HNOA 1XLFA 3KTCA 1QUMA 4QE1A 1A0CA 3DBNA 4XIMA 1XLHA 1XISA 1XLJA 3ITYA 4QE4A 4W4QA 2X7VA 5FA5A 4GJIA 3UVAA 3C0SA 3U0HA 1DE5A 1A0EA 1XLAA 1XYLA 3DX5A 4J4KA 4YTQA 1XYBA 3QC0A 5B7ZA 3TVAA 1DIEA 1BXBA 3M0MA 3WQOA 2NQJA 4QDWA 4XSLA 4DVOA 1XYAA 3M0XA 1XLEA 5XIMA 4K3ZA 4YTUA 1DE6A 4GJJA 2J6VA 5EMLA 4Q7IA 1XIFA 2XINA 4YTRA 1XLBA 5H6HA 1OADA 1S5NA 1XIHA 1XLGA 1XYCA 3JU2A 7XIMA 3QYSA 4GLEA 3KCOA 3CQJA 3KBNA 3UXIA 3KBVA 2QUNA 1I6NA 3CWHA 3ITXA 3M0VA 3ITTA 1DIDA 3ITVA 4X60A 4US6A 3U3HA 1CLKA 2QW5A 1TZ9A 3AALA 4G56A 3UA4A
chains in the Genus database with same CATH superfamily
3B0YA 3KCJA 4DZHA 3V0SA 3VINA 2QVHA 4LVGA 5EU9A 3W1RA 3Q67A 4MB3A 2VEMA 5A6BA 3NPWA 4QAIA 4PMDA 4DAIA 4HPJA 4WDTA 1V6UA 4CUCA 5BNKA 2Q8ZA 2GK1B 3CPGA 1SFSA 1EJSC 4ENLA 3RG6A 3W22A 2QDGA 3H53A 3RPTA 4M24A 1K4GA 1XRFA 2RKXA 4W93A 3TKFA 1VBRA 4PTDA 3VNYA 2G5WA 5EMKA 4J3UA 1OD8A 1TRDA 1O12A 2CEQA 3ZLGA 1KFEA 4IPJA 2OU4A 1VPQA 3FXYA 2W3ZA 2WKGA 4XUGA 4WGHA 1MNZA 5JXQA 1IR1A 3N34A 4M19A 2OLAA 4IQEA 4JIPA 4JY8A 4LW7A 1Y7VA 3CMJA 3H23A 2GZXA 3E02A 4C6NA 2VX6A 4XZMX 3L2IA 1P0NA 2YDSA 2PFHA 4Y9MA 3GHTA 1KCLA 4AC7C 1U33A 2CNCA 1UKQA 3S8HA 1DIOA 1F4HA 1KM3A 1TV2A 4OTKA 2XINA 2V69A 4B90A 3NQ2A 1EJUC 4GVFA 4C7FA 1GQKA 1FP8A 4KESA 1PDZA 2XPKA 2AL1A 1R3VA 4CQ8A 1XYZA 4Z2GA 3AS2A 2J25A 1HJQA 2RDWA 2DGAA 2WQPA 1GHRA 5H91A 4JQ1A 4QEHA 5HA7A 3CL7A 1P4CA 1HUVA 4JCMA 3NAVA 1LRQA 1KTBA 3AWOA 3LXAA 4R85A 1WXJA 4L6HA 1QW9A 3UWZA 2OXNA 5I3JA 2INZA 3RJYA 4LY4A 1MEHA 4MADA 2NV9A 3DN5A 3QFWA 2XZ7A 4XK2A 4US5D 4B16A 1S5VA 4ZB0A 3OZOA 2IKIA 2ZUSA 3E38A 2PP1A 3A4XA 1LTDA 1JXKA 3BOLA 4JN7A 3CAKA 1RCXB 3VU2A 1H5YA 3D5HA 4AD4A 1UD8A 3GXIA 2C8NA 1SW0A 6TAAA 4ZQRA 1ZJBA 3STGA 3NQ8A 5DMLA 1XDJA 2E6FA 3N2CA 4KMQA 4PTNA 4EPEC 3FEQA 3GU1A 3M0MA 1XLEA 4XAZA 3UFYA 2J24A 4IWWA 4CU7A 1OX4B 3OG2A 5F2MA 5C9XA 4PCSA 4AWSA 4RPPA 3LCFA 2VDHA 1W91A 1WO2A 1HKWA 2ANUA 2WMFA 3FYOA 1VP5A 4WQ6A 4Q8QA 2GVGA 5AC5A 2P50A 1XLLA 3VGEA 2YCJA 3AROA 3G77A 3WCZA 3AHTA 5IHSA 2PAJA 3S2CA 2PS2A 1L2UA 3BCJA 2OO6A 3DFNA 1FWIC 5C9ZA 4B5TA 3AZRA 1NQKA 1V77A 4PTXA 1KRAC 3F7JA 5CSSA 1VCGA 4XVEA 4WIWA 3NFUA 2H3DA 1GGOA 2D69A 1WAUA 2PDLA 3GS6A 1FWDC 5CBJA 4YWSA 4O1EA 2X2YA 3KOFA 5F1UA 4JX4A 2DZPA 2HTMA 3WL1A 4WVXA 4DUXA 4JFWA 5DCBA 3LI0A 2VJXA 3BV4A 3O1NA 4M6VA 2MANA 6CGTA 4G5DA 2KAUC 5D32A 3M7SA 1HL8A 3NQFA 1CGWA 2GGJA 4J3ZA 2J7HA 1ML1A 5CH9A 3WLJA 4J2PA 4H8NA 4IICA 5AN7A 1WKYA 1RV8A 1THFD 3SW6A 4MY1A 1E1CA 3W24A 3ZM8A 1Q7ZA 2W4XA 1QAPA 2BVDA 2X2GA 4S23A 5A1AA 2HBVA 2GVLA 4E8DA 3WBAA 3QEZA 4US6A 3MHFA 1C8YA 4KWWA 2V2HA 3MVTA 3A13A 3NQVA 1BRLB 1OG0A 4UTHA 3HGSA 1GJUA 3GXTA 1CX9A 2W62A 4Q7BA 2BHYA 2CYGA 1W8SA 1OT2A 1U1UA 1UZDA 2J4GA 1P6WA 4PMQA 4JDBA 4P7RA 3SQMA 2ESCA 2BHZA 4I9MA 1TPWA 4S2CA 1CI1A 4H9YA 5C0QA 1QHZA 5C6MA 1T5AA 1XYFA 3C6CA 3I6RA 3W02A 2DZTA 2WWCA 4GQ0A 4US5A 4LVBA 1UWQA 4S2BA 3LTYA 4LSBA 3IVSA 1QI3A 3AYSA 5BU6A 3FDKA 3REQA 5HMFA 1QI5A 2CZDA 3QQWA 3KTSA 1Q45A 5LA0A 2H3BA 1US2A 2OZTA 2FZ9A 2VM8A 1GQIA 4KF1A 3TXZA 1PO9A 1O4UA 3ZO9A 3OOQA 1Z7AA 2PTDA 4J27A 1T99A 4CQDA 3MO4A 1M6JA 3MI3A 5FJUA 2XZ9A 3I3EA 5F2LA 3TCEA 2NQJA 4H6RA 1ZCOA 1AL8A 3OLIA 3EB2A 7XIMA 1BHGA 1UWAA 1VFOA 1K03A 2O7QA 4LX4A 1W5QA 3CUGA 2FZMA 3TZNA 4RUBA 5IFPA 3NQ6A 3EMZA 3MBFA 3W29A 3WLHA 4FAMA 1RD6A 5G4HC 4KCTA 1RA0A 2HXTA 3BC9A 2PURA 3ABSA 5D30A 5HUOA 4MAVA 3U48A 4BFAA 4XTDA 3GW0A 2XGZA 3B0XA 5LA2A 4O12A 4UTIA 1GUVA 2XG9A 2OODA 2NX3A 4DHGA 1DTNA 2XM2A 4B5VA 1DWIM 4UWMA 2VFFA 3MKCA 4XZBA 3CPUA 3NL3A 4LVFA 3N17A 5BXPA 2X0HA 4QHRA 2OCZA 4ZO9A 2ATSA 5JBFA 2Q8LA 3KUMA 4WGXA 4NI8A 1HO1A 3OGVA 5AC7A 3HG5A 2ACSA 4N9DA 4YCOA 3QFEA 4A35A 2BDQA 1O5QA 4A2SA 1XJBA 5D9PA 1I4NA 3TTEA 4O10A 2YLLA 2DY3A 4DYEA 3W81A 4KFPA 2WSYA 2V30A 5FA5A 2GSHA 5BZAA 5LIUX 3UXAA 3RU6A 4LRTA 4ROPA 1KD0A 2V5BA 4DVOA 2GQ8A 3BUVA 3C0JA 5A69A 3M1ZA 4IMCA 1GYLA 4LNYA 4TU1A 1UP2A 2OYLA 1UQZA 1EQCA 3L5LA 3PPHA 2NXGA 1KWKA 1AJ0A 4H7VA 3QKEA 3FW6A 3B4YA 3M43A 4M7TA 1WUEA 2XN1A 2ZZ3A 4WEVX 1EKOA 4Y8FA 1N2VA 1E3ZA 4A8IA 3SJ3A 1R87A 2NV1A 1HNYA 2BG5A 5GNYA 1A3XA 2BTMA 4ATWA 4HMCA 3WF2A 5D09A 3T2PA 1C3FA 3GW3A 3TJ4A 4OE7A 3NDYA 4P7LA 3W6YA 1V0NA 4AZ6A 3DFTA 4XD4A 3CYVA 4IPNB 1DKWA 2PGWA 2G8ZA 5HNRA 1P0KA 1G6CA 5JVLA 3LTSA 2QCFA 4DLFA 1JL8A 2V38A 2VTFA 1GVQA 1MW2A 4JTRA 1K9FA 4QISA 1TWDA 2WZIA 2F6UA 2VURA 1BXCA 1CBGA 3ZR6A 3N04A 4HGXA 2FQIA 3P5ZA 1JCYA 3WKZA 2VENA 3W7NA 1HVXA 2QPUA 4L1XA 2CHNA 3IVTA 4XUYA 4GVHA 3E49A 1TE1A 2BXYA 1P0DA 2FTYA 3IRSA 4F2UA 2QKFA 2QDDA 2ZADA 3WQFA 4F4RA 4PUNA 1DV7A 3EWBX 3H7UA 3BW3A 2GWGA 4BJHA 1QI4A 2VKZG 4HMNA 4S3JA 1Z32X 1W8GA 1W5PA 1AD1A 4ORMA 3TSDA 3LN3A 4CKQA 4IIFA 4NJIA 3TAKA 3EGJA 2ZXQA 4JN8A 5A5WA 1UA7A 3C2EA 1LG2A 3OQ8A 1W3HA 4UFLA 2D2OA 1ISXA 3BJSA 3O6YX 4Q4MA 2AKZA 3QTGA 2Q09A 4CNSA 2CFFA 3M5YA 1RH9A 1Y0EA 3S1XA 1ZB5A 1V6YA 5BMWA 4UIOA 1BGAA 1E40A 2I16A 3PK7A 4K8EA 1HXJA 4IX2A 2G97A 2VCAA 3SQSA 4I3GA 1L9WA 1DXFA 2GFTA 2QULA 4HQVA 1GYNA 1ME9A 2OMAA 3LCGA 1DORA 4ZO8A 4I90A 3L4VA 1K6AA 4YS1A 1KBBA 1V6TA 3GU9A 4QJ1A 3AISA 3AIBA 5CKSA 4JQ2A 2FIQA 3C2VA 3U8GA 4UTMA 5CJ5A 1Z69A 3UWWA 3CH9A 3JR2A 2UY4A 3A4WA 1UYQA 3E9AA 4OFCA 3HQOA 5J04A 4TX8A 1EFZA 3GY1A 4B5NA 1VR6A 7ODCA 4MIMA 2XSXA 1JAKA 3W1TA 1EF3A 3TA9A 4KRTA 1R46A 1M7OA 3WEMA 4CNNA 2VUYA 3UR7A 2PBOA 5CAKA 5TIMA 5M17A 4W86A 1W37A 5A2BA 3RNDA 2OSXA 3VGBA 3UJFA 3URAA 1XLCA 4HPGA 3ZIZA 1S3TC 1ZTVA 2D23A 2WK2A 3SB0A 1HTIA 2C0AA 4Q33A 1K8YA 1ODUA 3BSMA 2GUBA 2E6DA 3GR8A 2YSWA 3G18A 3E6EA 3EKLA 3F5KA 4JQ3A 4C5YA 1LWIA 1A3HA 1PYFA 2XN2A 4D6JA 4DPPA 3KBWA 3KRBA 3KRZA 1OC5A 2QLYA 3W1QA 4ZGYA 5CGTA 4DI9A 4Q6XA 4UTUA 4HNLA 4GACA 5K2ZA 3APGA 1XUZA 4AD3A 3NWRA 5G1TA 1A5KC 3QKZA 4MLRA 3W7HA 5CC5A 3GE7A 5LGZA 3WJXA 3GNNA 4UUIA 1I2NA 1F74A 1QT1A 3BAIA 3KZSA 1NOUA 1GZ1A 1MW3A 2Y61A 3GK0A 2YBUA 4RW3A 7TIMA 1KM1A 1P7TB 4ZSUA 2JALA 2ZA3A 1QI2A 3Q4DA 4QM1A 1H7NA 1A0EA 3TN4A 3TQKA 3WQOA 3CXOA 1JPMA 4Z0SA 1G67A 3A24A 4TR9A 4OGZA 1XIFA 4JTCA 1EUNA 4LAKA 2CCRA 3I7QA 3DERA 3BG9A 5DANA 4IFRA 2BXZA 2XH4A 5KZMA 5FF0A 3JW7A 2GUYA 4AZ7A 5E6YA 4IG2A 2ZVRA 3LBCA 2P88A 2WVSA 1RCQA 2I56A 1ZENA 2VRQA 4LV4A 3DHDA 5LYRA 2PTZA 4FNUA 5FESA 4AUBA 3S1UA 3CZJA 3UZYA 3EKZA 1CGXA 3ABZA 1FH8A 4HSHA 3PBGA 2F9RA 1IIHA 4RDYA 3QPEA 2Z1VA 2EKCA 2WW5A 1W3KA 4PC8A 3RR1A 2QYGA 3EEZA 1M41A 2C13A 3AXIA 4ZTYA 4EAMA 2O9PA 3N2TA 1W1A1 4QJ3B 5BWAA 2HNEA 2C7FA 4XD5A 4U31A 2FZBA 2YYUA 4LOCA 2PI6A 1QTWA 3PJTA 4EPKA 1X38A 3ARVA 4N9EA 4L61A 3ARSA 2GDVA 1ZPTA 4Q4RA 3VABA 4PZVA 2YDAA 1JG9A 1M7JA 3ITOA 4H4IA 1ZAJA 4UZSA 4D8ZA 3IGHX 4C6OA 3AXHA 4MFEA 3SN1A 4DJEC 1JGMA 1UA3A 4CQCA 1E9ZB 1H0GA 4LAMA 4UZUA 2HPMA 3AXXA 4PULA 1BVWA 1WZKA 3T8QA 1GVEA 1QK2A 4HKPA 2ACUA 4GOAA 4K3ZA 3RITA 1HFBA 2QEZA 3VKJA 3TV8A 3QBUA 4O13A 3CQJA 1ADOA 1SW3A 1QO5A 4MSSA 2W92A 4REQA 3DUGA 3VGGA 4AFYA 2QW5A 2XFYA 1QI0A 2BODX 1JXJA 4B15A 4A8LA 3RXZA 1SR9A 2VC9A 1REQB 1LQAA 3GFXA 2QMJA 4KRZA 5M03A 4S3KA 4JICA 2C1IA 2VD8A 1YXYA 1XPGA 4PB5A 4J3SA 2YDRA 2YCLB 1SGJA 1QVBA 1HGYA 3C0QA 3XIMA 4YTSA 1GOWA 4XZNX 5CGMA 3UR8A 3CHEA 3IPWA 1JNDA 5XINA 2WO5A 3HQNA 4LU0A 5E9XA 1OX4A 3W6LA 3WQDA 3AHVA 1YNPA 3H70A 5HWMA 2ZRUA 3P8JA 1M68A 4AX6A 3URBA 3SCSA 1YIXA 1TQJA 4HPXA 3W27A 4JTLA 3DH7A 1JYVA 1VAHA 3F4WA 2OELA 4FXJA 3QQ0A 2RUSA 1QK0A 4QE1A 3HV8A 4DJEA 1S2VA 1BVZA 2F8QA 1OBAA 3HPAA 1GOMA 1XYBA 3HF3A 2VGIA 1DIEA 4AW7A 1CZ1A 4HA4A 1F3WA 4MAZA 3PBVA 2PGRA 4YTRA 4LQ1A 3AIRA 3KTXA 3M0VA 3R58A 4AG0A 2A2IA 5CPMA 1TIMA 2E1WA 3SCRA 3OTRA 3U3HA 4D6EA 3ZS4A 1QHPA 2Z7KA 5HWJA 3KOZA 4C6FA 2VNCA 1B57A 4GPNA 3TEVA 1EGZA 5HMEA 4HZMA 1UUMA 4GC4A 3EX1A 4UFJA 1NWSA 3OVRA 1F7BA 3T08A 1H51A 2REQB 3BOXA 4GYPA 1V02A 4M3PA 1JD7A 3QGVA 3MMWA 1QATA 2WB5A 2FHFA 3UGRA 4ZE5A 3BJTA 4H8VA 1LUCB 1TA3A 3VOHA 4Q22A 5HPOA 4XTIA 1PCKA 4DY1A 2UV8G 4Q8VA 2NVDA 4V27A 3ITLA 1ZZMA 3BW4A 1A3WA 1QO2A 4GBUA 3VIKA 4N02A 1PX4A 3W73A 2XISA 4K8HA 1XD0A 3L23A 3TR2A 4J35A 3LPOA 1CXEA 4UQBA 3B05A 1XICA 1JF6A 1XYMA 4FXRA 4ACZB 5LNWA 4BK9A 3AJXA 1Z3NA 3C0SA 2QCNA 1Y8BA 3AQUA 3W76A 1E0UA 3DFHA 1VPXA 3M0XA 3ARPA 2X09A 2F61A 1C90A 1RJPA 2A6NA 3G8EA 2QR6A 4MYXA 1FH7A 4JFSA 2V3FA 4GY1A 4L4LA 3UZXA 2JGQA 2Y7EA 1CXLA 1TJ2A 3DHFA 2FPTA 4HIBA 1GVYA 3HU7A 1UUOA 1AFSA 1PKLA 5HNNA 4KGJA 2ZX8A 1ZBVA 1EP1A 1DL3A 4LYPA 1LJYA 1SFJA 4Q8NA 4S38A 3C2OA 1C8VA 4CD7A 1YDVA 4ZVJA 1KXHA 3RX2A 1Z6KA 4AVNA 4DNMA 1BQCA 1XUUA 3ZLHA 5EFFA 4E8GA 3KHJA 4M8UA 1VBUA 1YPIA 3KHDA 3WUEA 2RHGA 3LBOA 3KM8A 5KZ6A 3VNJA 3SM0A 4QDMA 3TN3A 4DELA 5JIPA 3UJSA 1KKRA 3OBEA 1G7UA 1MEWA 2D3LA 3VXGA 4UBPC 4HJFA 3L4XA 3AMCA 4Y7EA 3LK6A 1ICSA 1TPH1 1ISZA 4JL1A 4IHCA 4W5ZA 3E74A 1PHWA 3E0FA 5A6LA 2E68A 3TR9A 5AY7A 3P61A 1JZ2A 2ZZ1A 3MWAA 3RM4A 3CHFA 1YTDA 1RQHA 5CJNA 3W7LA 4PUJA 1R2RA 1R38A 3AUJA 3HTWA 2OSWA 4DI8A 1ZP4A 4LBUA 4P5UA 3C8NA 3R0DA 1W1PA 2BHUA 4V1YA 1EDGA 3QW4B 3W85A 3AHYA 1V3KA 1K1DA 3OBAA 2R1NA 4RXFA 5MF5A 1J10A 4AX7A 1OZQA 3ANYA 4FR6A 1VFTA 3W7RA 1KBLA 1B5TA 1JQXA 1UWRA 4FSAA 4FOKA 4Z2LA 4PTMA 2J75A 5FD0A 1PL9A 3RLHA 1ITUA 3NDZA 3BVJA 1YDYA 3GX9A 2R1MA 2CLHA 3NO1A 2EQDA 4M6QA 2GSJA 4M29A 4OVXA 1OX5A 1FHDA 2YLAA 4QCEA 4HU8A 1E55A 1A50A 2V3DA 2GJXA 1LQ0A 1DWAM 3C3NA 1UZ4A 3W88A 4NZ1A 2OWXA 2CHOA 1I60A 3HO8A 4UFIA 2XIIA 2UWFA 2EPNA 1BD0A 2J7GA 4U3CA 1XD1A 4H3DA 1KV8A 5CZKA 1RK6A 3U2ZA 1ZFJA 4KEVA 1R0MA 1R6WA 2QJMA 4JNMA 4F8XA 4KFNA 3NSXA 4GJJA 4RDZA 2QCEA 4L56A 3VFCA 1FWFC 4KETA 4URIA 5DT5A 5I5RA 5DRCA 1EP3A 5CBBA 3R8HA 4Z1CA 1OX6A 3T40A 1FCBA 1VBGA 2Y2WA 4C6LA 2VFDA 3MWCA 4HNNA 1QNSA 3GXNA 1DJQA 4D2JA 5KITA 2HVMA 3SCWA 1J2WA 4IOTA 5DMYA 1XI3A 2YGYA 3Q45A 4MLJA 1AJ2A 1EX1A 4TV5A 5DCEA 3COTA 1O60A 1H63A 2PDIA 4NZ4A 5A6JA 2TYSA 1BRLA 4L1GA 4JTFA 4DJED 4CVWA 1ZSXA 4W9TA 3NXFA 2J74A 3WDQA 2GPTA 4IUOA 1PJ9A 2XGIA 3H2EA 4LJ3A 4C6IA 5HR6A 5EB8A 1YHTA 3VVGA 1G4EA 1SZFA 1TTJA 4JDYA 2OKOA 1WDRA 3RLVA 1G94A 1VPYA 3CV6A 1PVNA 3CTTA 1WB0A 2O0TA 1YPFA 4AY8A 3EWYA 4LF2A 3WQCA 3S1WA 3MANA 3TK7A 1EYEA 4UTTA 3Q58A 5K9CA 3EWDA 3OLGA 2XHYA 3L4YA 1Z89A 2CBJA 2E6YA 5A8PA 2YL5A 3VKCA 1I2OA 3USZA 2CWXA 2FPVA 3TVAA 5HXMA 1XCXA 4AHQA 4GCXA 3P93A 4PYSA 4X22A 2BGSA 3GTIA 3FIGA 4MYAA 2BB0A 3IAQA 3CHDA 4ICMA 4BQ4A 4XX6A 2Z1WA 1J11A 1KRBC 3W2UA 3DAQA 4B9ZA 3TYZA 5E0CA 1Q6EA 2J77A 3B4UA 3HPSA 3CV2A 5HOSA 4GUJA 1K9EA 3R7MA 1JAEA 2W91A 1KFBA 3LMYA 4HU4A 3WQEA 5ABTA 3O0KA 3FJLA 1GOQA 1LL7A 1US3A 4R7JA 3EA1A 1DHKA 1CNVA 5DY3A 3W83A 2R82A 3O6AA 2X8RA 5AFDA 1PDYA 3AXKA 3JVAA 5BOOA 2Z00A 1VHNA 1W2VA 2G3IA 1NJJA 3I65A 1Y65A 1EZ2A 2PCEA 1P1XA 3G8RA 4EVZA 5EA9A 3G3MA 3ITGA 4Z2IA 1S2TA 3G1FA 2VZUA 3AI0A 4IH3A 3PZUA 4RNIA 3V5FA 5AB3A 1KXTA 1FHVA 3KS5A 3SUVA 5DBUA 3ARUA 4GYFA 3P5YA 1LDCA 4H7CA 5BOEA 1W3TA 4S3BA 1B30A 4CEUC 5TNVA 3TIMA 3SCNA 4LB3A 1AQFA 3M5ZA 2J27A 1DJWA 3M44A 2BWGA 3W7EA 2AQWA 1EJRC 1GKPA 3WEZA 5FJTA 2BXVA 2GGEA 4AHPA 4S3DA 2NVCA 1H7PA 3VD9A 4UFMA 3WF4A 4QNWA 5C7VA 2ALDA 1XBXA 1G1YA 2ZWYA 4ZODA 4X9YA 3TNOA 4O57A 5CSRA 4PMZA 3OLEA 4K7YA 3OJGA 1EPVA 1V6VA 4CQBA 2PLKA 1VFLA 2GUUA 4HHPA 4MOZA 1GOXA 2Y89A 3T78A 3OBKA 2Q3RA 2ZICA 3CAWA 3CV1A 4O1CA 2GVEA 5HUPA 3IK2A 3LRMA 2ICSA 1ZP3A 2AOSA 4MWAE 4O18A 1XIDA 2Z1BA 5J5RA 4EXQA 1W17A 2NQ9A 1Z41A 5EBAA 3H2CA 3NZQA 4OJYA 1ITCA 3STFA 4FNRA 3TLQA 1WNOA 1DQXA 4JCLA 1F3TA 1U5JA 1DJIA 3WNLA 1JDAA 4IL2A 4AXNA 1K8ZA 2QT3A 3M0IA 3UA3A 2J7DA 4DYKA 3V35A 1Q4NX 3V1PA 3DHPA 2F84A 3A4AA 4FF5A 1A5OC 1W1ZA 3JZUA 1SZRA 2EPLX 3DYMA 3LERA 3GNXA 4AB4A 3U57A 1P5BA 4DXXA 3N13A 2W61A 4OBSA 1I45A 2A7PA 2VQUA 1OYBA 3BO9A 5GJPA 1SFLA 2G96A 2J6VA 2X30A 1NY1A 2VEPA 1ZS2A 4C6DA 5ABGA 2DT2A 3VOCA 3NEVA 3TXVA 6TIMA 1SR0A 4MNMA 3UA4A 2ISVA 4H9UA 3O07A 1JDEA 3K2GA 4QLKA 1ONRA 5KETA 1ODZA 1YMYA 3WLTA 4EK7A 4QDPA 3G1RA 2OPJA 2XWEA 1JZ4A 3AZSA 4JHMA 2WBGA 3W00A 4U28A 4WSHA 5I0DA 1YEYA 4FK9A 5I3GA 3M4HA 1S5WA 2WC4A 1BTMA 4RX0A 1YQ2A 1UCWA 3GM8A 3EB3A 5CXPA 3BW2A 2PP3A 3W7OA 1YDOA 3OPSA 2VZTA 3VUPA 2Z2AA 1NSJA 3RX3A 2VEGA 1I1WA 3W2LA 2WMIA 2X40A 1DJHA 3MW7A 3DENA 2VVNA 3UWYA 3U6WA 4R88A 3CWOX 2FDMA 2FPYA 1XGZA 3T09A 3KVLA 5IHRA 2W67A 4PR4A 4R3UA 2YXXA 1QXLA 3IJLA 3QSTA 4EIVA 1Q65A 4I7VA 3H54A 5DY2A 2O92A 3MHUA 4AWUA 4MDPA 1CLXA 3I6EA 1BXBA 3WQ4A 1JRBA 5SWUA 2VL4A 1KM2A 4DZIA 3H2AA 2Z1SA 2BOGX 5H8PA 2OX4A 3S5SA 4Y8EA 1NFGA 2BNJA 3MSGA 1W6TA 4AWEA 1V51A 3KWXA 3V5CA 3PZGA 4PMRA 2Y7DA 3CQ0A 1MI3A 4U33A 1LLWA 1JDFA 1WPCA 1TV5A 3UJEA 4GFIA 4WY0F 1EIXA 4ASTA 2YPIA 4QE5A 4XKYB 2GWNA 1ZBWA 4Y9PA 4B5WA 3R10A 2CHRA 1JEZA 3DCPA 1UR3M 5MHBA 4FIRA 2I14A 4BF9A 1SZEA 4IP7A 1ZY9A 1CXKA 3LCLA 4HZ8A 5IXEA 3NVTA 3TWAA 1JPHA 2D2HA 2JKPA 3LDVA 3EPMA 3WH6A 1OYCA 1E0XA 3CB3A 5G1YA 4XO7A 3THAA 3CUZA 3VC6A 2JEQA 1XC4A 2PE4A 5DEZA 4RE0A 3N12A 4WSKA 2DQXA 1VEPA 4RR4A 1Q6GA 2BBFA 3N14A 3N18A 4YYCA 5C70A 3QV6A 3U7BA 4GJ1A 1CGTA 4FXFA 2E5DA 2IPWA 2WPGA 1R3RA 2GJLA 1XLJA 4R34A 4UB9A 4DZAA 5CJMA 2JBMA 1Q7QA 3T7VA 4JS3A 3O63A 3UY8A 1QPNA 1OD0A 5FL0A 2CBIA 4MZYA 4DIAA 4AEEA 3HQPA 2A1YA 3WF1A 2EPMX 4GE8A 5KSWA 4FS9A 4B91A 2J7BA 1QOXA 2ZE3A 4L4OA 7A3HA 3EEGA 2WMHA 4HHLA 1E4LA 4MB5A 3P2VA 3E2SA 2XVLA 2CESA 4PUWA 3S3GA 2V2CA 4H6QA 4ZMGA 4JQAA 1EJ7L 1DTUA 2PSNA 3R43A 3G1YA 2V5LA 1T96A 2D2GA 4HCDA 4G8TA 1TB3A 5J5DA 4EF8A 3RO6A 4CCEA 3N4FA 1SUXA 3DFQA 4EKJA 2H9AB 2J9YA 1AMYA 5DELA 1UMYA 3L2LA 1IGSA 3BL3A 1B3WA 4I5RA 2HMCA 2BOFX 3UYCA 2NXHA 4ZOEA 1D3CA 2FZNA 1ISWA 3AU2A 1B9ZA 5JU6A 2WVVB 1ZGDA 3W84A 4UNIA 1VFUA 3W7KA 1VEMA 3B0UX 3UP8A 2ISWA 3PG8A 3E2RA 2IKJA 2ZE0A 1R9XA 1A0CA 4PCPA 4GJIA 2WCAA 4DO4A 2QIWA 1TR1A 4JTUA 4XZLX 3BH4A 5IFTA 2JQXA 2V81A 3DC8A 2J8GA 3RPDA 4GLEA 4PUEA 3R25A 3TTOA 1I6NA 2VX4A 1TG7A 1IXPA 1ZL1A 3LBMA 2VCBA 1MEIA 3MMUA 4AZHA 4BEUA 1I2PA 2WNWA 1H61A 3FA3A 4F0KA 3NG3A 5RUBA 3AO0A 3OQEA 5A8QA 4C6EA 2QMKA 3PTMA 3WLKX 3K4WA 3WF3A 4L5ZA 3TMLA 5XIAA 1EH9A 1V8EA 2NZLA 3POHA 2Y5SA 4RV3A 3UG4A 1NELA 1TJ1A 1F4AA 4C6JA 4WJXA 1EXBA 4Z0JA 3UXKA 1RY0A 5AHLA 3VM7A 3FAXA 1S3HA 3WMLA 1TPC1 4UMCA 3U5UA 3VDCA 3DI0A 1I2RA 1D3HA 4LS2A 1DWGM 3VNLA 4Q7NA 2XIBA 1UR8A 4JIIX 4GG9A 1IXOA 4FNQA 4UFHA 1AA1B 4AMCA 1BWKA 4HOZA 3NSMA 1KGXA 3IIPA 4LS1A 1F6KA 3NOYA 3G5EA 4JTJA 1IV8A 4HNOA 1BQGA 4E2DA 2BS9A 2DSKA 4QRNA 1ZUAX 2WM1A 2R14A 4LUIA 4MWAC 2VHLA 2V0TA 4OUIA 4QG6A 1EJTC 1XYAA 2VC7A 3GRIA 4YTUA 1Z42A 1H0IA 2V3GA 3NPXA 1QWGA 5GVJA 1FXQA 3IJ8A 4YVVA 5LNSA 5G5IA 1WZLA 5E93A 2QJNA 2QCDA 2Z28A 3BLEA 4NASA 4I9JA 1JJKA 1E3XA 2HPIA 1CCWB 1UMLA 3WLMA 2Z29A 4H7ZA 3KLLA 4H00A 2XH0A 3SUSA 4C5ZA 2O56A 1OEPA 2ZZ2A 4AIEA 3K4AA 3W4RA 2NW0A 2VUNA 4QG8A 1GQJA 1R3SA 1KO0A 4K68A 1V3MA 2BVYA 1PKYA 5FCZA 3W7JA 5FSEC 4LUJA 3CZ8A 3KBSA 1KBKA 3GIYA 1EOMA 1L6FA 2A6LA 3K8KA 1UROA 4LCQA 2GJPA 3B0PA 3AFBA 2NX1A 4W88A 5EPDA 4LAUA 3NZGA 4Q4KA 1O1HA 3AUOA 2RDXA 3IGXA 3MDWA 4WJ8A 1XRVA 2DSVA 3CIWA 4CCCA 1E6XM 2MUCA 5I23A 2E1DA 4O1FA 1DOSA 1Y5VA 4QFUA 5DLCA 5D4YA 3CZKA 4KCUA 1AZ1A 3T2OA 4W4QA 3VCCA 1H1YA 1OVDA 4YHGA 2JE8A 4KBXA 3FA5A 1F07A 1MUMA 1LBLA 3VM5A 1AL7A 3EZ4A 4RCXA 1VFMA 4PB4A 1EUAA 1M1BA 3GHRA 3ITTA 4AHOA 3DDMA 3WFLA 3CZEA 3T6CA 1PTGA 4AC1X 4Q8OA 6ENLA 3IGUA 1TV4A 2C91A 4WXZA 4M51A 1PIFA 2W79A 3V5OA 1MZHA 5AHIA 5C9WA 3OP2A 4GBDA 1RPKA 4TTGA 5LHEA 1NP2A 2YCKX 4RL3A 1MZRA 1JVNA 1M03A 4GYJA 1UKOA 4GHRA 1LL4A 3PZNA 3UWQA 3P74A 2GYIA 5E0KA 4UOQA 3GVWA 4FALA 2HS6A 1GOOA 3QGKC 2QCMA 3W26A 4LYKA 1TCDA 1U1JA 5AYZA 3VCNA 3TOPA 1QASA 2C6QA 4CLMA 4A29A 5B80A 4DB7A 5BRQA 5LA1A 4IISA 1VH7A 1H3GA 4ML9A 3UZ5A 2W27A 4A22A 2UBPC 3WQ8A 2CC0A 1P1MA 2PA6A 4HSOA 1TWWA 1NDWA 4RDVA 1BAGA 3OZYA 3P84A 4J1OA 2QCGA 1UR4A 3GVGA 1YXDA 3IJQA 2XTKA 4GNVA 4ZOCA 4LEFA 3PTDA 4D6HA 4CU6A 1RQBA 2ZKMX 4RXGA 1XLGA 1BSIA 1R8LA 1ZJIA 5DMMA 3T55A 4JD4A 3TU9A 3MV01 1TUFA 2QUVA 3GSMA 4FNSA 2ZZ7A 4ZZ9A 1J5SA 1XF0A 2XYLA 4L9ZA 4CN1A 5HMSA 3TZFA 3SO7A 1MQRA 4HZ7A 1UZ1A 5G4EA 1TV8A 3EMQA 5A6KA 2H8XA 2QJHA 4ML4A 4K38A 3PTKA 3NOEA 3W3OA 1Y5XA 1XIIA 3TSMA 4A4AA 4JTSA 3GXMA 1T0OA 1EQPA 1C9WA 1NFPA 2WMKA 5AVNA 3T0BA 1D8WA 4H83A 5A2AA 9CGTA 2AQVA 1Q85A 3KRSA 3GTHA 4MB4A 2J62A 6PTDA 3KVKA 2V82A 4YXGA 3AS3A 1F05A 2DUZA 3RM9A 1E43A 1S1PA 3A4JA 2NVAA 2DPEA 3OB8A 3S9IA 2HK1A 1UD5A 4BF5A 4D71A 1E9IA 1ZALA 1PWLA 3H26A 2V5CA 3QLDA 1IQ8A 1D9EA 3G0SA 3WN6A 1E71M 3U2EA 4PA8A 4IGHA 4IXXA 2XWDA 4FPSA 2OKTA 2B31A 3PB0A 5E6ZA 2GGIA 3EWCA 4BR1A 3MZ2A 3GQYA 4XZHA 1C8XA 3RO8A 3SJNA 5I77A 3QR0A 3GVRA 4GZEA 2NX9A 2R1PA 2XVPA 1TVPA 1GNXA 5AYBA 2DJXA 3LPFA 5HJXA 3NO3A 2E4TA 1JUEA 3AMGA 3VI2A 5D2TA 4UCFA 2QF7A 4POCA 1NOWA 1L6YA 4LALA 1M7XA 1V08A 3EDJA 1BXNA 1AMKA 1D8CA 5GJMA 4Q6JA 3CWNA 4I6VA 1JZ7A 1ALDA 1EZWA 4JTGA 1MMFA 4ZENA 3KVJA 4NZ3A 3SN0A 1RR2A 3I3BA 1S5TA 3TTQA 3M47A 1QPQA 3VDAA 1QNQA 2NQ5A 4UTWA 1Q13A 1LROA 1TVNA 1J6PA 1VRDA 1XH1A 1ENUA 4HTBA 2ATMA 2PF0A 4K6AA 1R5YA 3EA3A 1V79A 1XBVA 3QMRA 1FWGC 3T07A 3RCYA 4ZOBA 1L8NA 4ZO7A 2HWGA 1TPEA 1IGWA 1E51A 4D8AA 4YYFA 1KTCA 1TFVA 1OG6A 1WV2A 4NHVA 3C5QA 3MZNA 2VDGA 3CUHA 2YA2A 2D20A 3PBMA 7REQA 5DN1A 1ITXA 4LH8A 5A2CA 1WQ5A 4GIAA 3ZLFA 2ZA1A 4MJZA 2QGHA 4BY3A 4OU1A 3GDMA 2VOMA 2IKGA 5KZEA 2UY5A 1H11A 3SFWA 1VF8A 3LX9A 2WC7A 3RILA 3MPGA 3R4IA 5K4XA 3GC5A 4DM1A 3LZ5A 3OW1A 2QCHA 5KINA 2PDMA 4JFTA 1XLDA 2AMXA 1FWAC 2H8ZA 3FX4A 3O06A 1LOLA 3HN3A 2PC4A 3CNYA 3LB0A 5FOOA 4V28A 1VYSX 4GZIA 1F9CA 4YIWA 1TX0A 2GJNA 1I0DA 2ISFA 2O9RA 4G7EB 3QW3A 3P67A 1W0MA 2CLLA 1KGUA 3CS2A 3GKFA 2PWHA 2VYOA 5EMUA 3L66A 4PGLA 1XHGA 5D38A 4M80A 3UU0A 4Q32A 3WBWA 3GO2A 3WY1A 1JDDA 1SJAA 4ZXOA 3VGHA 3WLNA 3A3HA 4NIRA 3VD7A 3N4EA 3YPIA 2I5IA 4AYGA 4PUKA 4WLCA 2BVWA 2E8YA 5JUVA 3W1AA 4L1WA 2YBVA 3ANVA 3HG2A 1IWAA 4AH7A 3R13A 3PPGA 1XYCA 4PTWA 1GPWA 4IIEA 2A0NA 3ATZA 1BLIA 4FI4A 5M3WA 2BSLA 3MY9A 3W1MA 5EYWA 3H2OA 4M56A 1KFLA 1TYGA 1QFEA 2LLEA 5AC6A 3BLIA 2CKRA 1J0HA 4GVGA 2WXDM 3OZPA 4P7NA 5D02A 2PRMA 3N29A 3O3RA 1JZ6A 2IQDA 3HG3A 4LV9A 3CQIA 3AYTA 5E5CA 1V7YA 2IKHA 4NAEB 3CASA 1IEQA 3WMCA 4GUIA 1A4MA 3SZ8A 1UD2A 1VQTA 2Z6IA 3M5XA 3ZOAA 4HNVA 1J93A 3B8WA 3N4AA 3KX6A 3CQHA 2WMIB 3LM3A 2PP0A 3T42A 2J7EA 1KM0A 1WDQA 5IRPA 4NG3A 2DUXA 4KKXA 3KBJA 4L6DA 1Y5WA 1KR0A 2OO0A 4WKFA 1TQXA 1WKFA 4C6QA 3GWQA 1XLFA 1VBHA 1OCNA 3TA6A 3IJ9A 1XLAA 1JF5A 2WHKA 3FY1A 3IEBA 4KH2A 1DQUA 1TVLA 2NUXA 3LRKA 4JIHA 5F7UA 1XPYA 2AL2A 3CUJA 3NXLA 2BY0A 2J8FA 1R9YA 3GKAA 1MNSA 3F2DA 4GXWA 1WOBA 2VGBA 4XIMA 2Z4GA 1E0VA 2E8ZA 1XS2A 2JIEA 4WRHA 1E6NA 2VD9A 1IEXA 3FAWA 2F2KA 1QNOA 2D2JA 5FF4A 2CZVA 3AWNA 3W7DA 4MTVA 1BEUA 1NAL1 1XRSA 3QY8A 4AD1A 3WF0A 3DC0A 1CIUA 3EXTA 1WKEA 4ICCX 4CNTA 4Q4QA 2Y88A 1JDCA 1YRRA 1O94A 5HK4A 1HGWA 1T40A 1J4EA 3UD6A 4X2PA 3R8GA 1KW1A 5AVHA 4DWSB 4QS6A 2DEPA 4P8VA 1IZKA 1B3YA 1VHCA 3HGRA 4MFDA 1W9XA 3EOLA 1PIIA 3QF0A 3GDRA 4QE4A 3PNUA 4F2TA 3TROA 3P81A 1XYLA 3W28A 1TR9A 3W7CA 4M6PA 2POTA 2JEPA 4ZQMA 2YB1A 3ES8A 4CNUA 3IIXA 2Z25A 4Z42C 1GCYA 4LC8A 1D3GA 1NDYA 5B7ZA 4GX9A 4NX0A 5LNVA 3SCUA 1L6GA 1NU5A 1JIBA 4MWAD 3F5JA 1UD3A 1YTKA 2ZXAA 3TYUA 1E73M 1YBQA 3BLDA 4J3VA 3UCQA 3M0KA 1DJXA 4DWSD 1EJXC 4RV8A 3O6CA 4CQ9A 3W74A 3WLIA 4F0SA 3E12A 3SCQA 2BY3A 2DSZA 3MUXA 2HDJA 1WDSA 3W1LA 1K9DA 3DFOA 1B3XA 3ATYA 3NZPA 2PDUA 3VK5A 1A4LA 1I2QA 4GUHA 1XKYA 1DJYA 2AGTA 1AH3A 2XH2A 2YCIX 4F2BA 3KWSA 4FIQA 5I03A 2YL9A 1AH0A 1W54A 3S6OA 1CENA 1N8WA 4HB7A 4EAYA 3L7RA 4DJDC 4DO6A 2VZSA 4PMNA 2PWVA 4IJBA 4OKDA 2CLIA 2VRJA 1IEWA 4QNEA 1F73A 1IWBA 1W32A 3SN4A 4MJ2A 4UQDA 1C93A 3CHCA 3SCVA 4I9TA 4AD2A 2QNEA 4XV0A 4F79A 1FWRA 2ADAA 4O4VA 1UH2A 4LUSA 1ISVA 1XX1A 5ABFA 2OLHA 1EC9A 2OWWA 1O1ZA 4B92A 3B0VC 3STEA 3CIXA 2PZ0A 1BFNA 3AS0A 2Z2BA 3WLPA 3VCRA 2GVYA 5DO8A 4HU3A 1XFBA 1X7FA 2E9LA 3KCLA 2WVTA 1RVGA 3T8LA 1TJRA 3GZ3A 3ARRA 2D3NA 2PDXA 4HYRA 2R1KA 1TTPA 3EMCA 2OJPA 3TYBA 3E3HA 1AUSL 4MHBA 1XR2A 4FX6M 1WDPA 5EL1A 2PGFA 3BANA 1IT7A 1SJBA 4CGTA 1KQYA 3KZPA 3MKKA 3P14A 4HPNA 2P3EA 3HZ3A 4GH1A 3BDKA 4ALDA 1XGEA 2VEIA 3DFPA 1LORA 1V02E 3GG0A 3CB8A 6XIAA 4IPIA 3VDBA 3LSBA 5CQ1A 2GQ3A 5FEWA 1BPLB 1K9TA 2GOKA 4XG1A 4IM4A 1EP2A 3TYAA 3UERA 1VC4A 2Z1KA 4EANA 3GUGA 5HJYA 3DHUA 1Q8AA 4MWAA 3FHQA 1ZAIA 3GUWA 4GQRA 2BGQA 2VQTA 4GINA 1HN1A 1PE1A 3S5NA 2GJXB 2OZ8A 3LM7A 2YL8A 1J01A 4U3AA 5I3IA 3MUIA 1H50A 2PTXA 2Y5JA 3RCMA 2PDPA 1Q3NA 1ZJAA 1OGSA 1AZ2A 1J96A 3AHZA 5FAGA 4Q8PA 4S1FA 3D46A 3B8TA 4CCDA 1PBGA 1EGMA 2R9RA 1YDNA 6REQB 1GG1A 2WHJA 4AZIA 5BCAA 3LHYA 3IS4A 3BLFA 3E1F1 5CPLA 3GDTA 2NUYA 3LY0A 4ILSA 4W89A 5I24A 1V0KA 4M81A 2FMNA 4JTAA 3WBXA 2YIHA 1JNEA 3M07A 3N3TA 3PN8A 4BS0A 4YLWA 2OQHA 1RUSA 1O95A 4H9TA 3JS3A 4N6EA 3TSBA 3BMVA 2A3HA 1QRQA 4AAJA 4DJFA 1MFUA 4IPLA 4E4FA 3PUOA 3TC7A 1QR7A 1ME8A 1YX1A 4Y96A 1S46A 4I7UA 3W75A 4RKAA 4KS0A 4QGCA 5FAJA 4WKHA 4A3YA 3WH9A 1DBTA 1JI1A 4PTVA 5A8NA 4HP5A 1OQFA 4J3XA 3S6TA 2DZXA 1EGVA 1V3IA 2WM0A 1NWTA 2PDJA 1EB3A 3ZT6A 2PTYA 2QCCA 3TAOA 3WH5A 1GKQA 4FB7A 2PEVA 4M1BA 3NR0A 1IZJA 5C8BB 1S5NA 4BA0A 1CT5A 1XFCA 1ZBKA 3UXIA 1GVRA 3WZ0E 3AALA 1T41A 3C61A 2VR4A 1ADSA 1A53A 3P0XA 4Z2JA 1X7IA 4NXSA 4A8NA 4QAWA 3RPMA 2ZZ4A 2DVUA 1O7AA 1XC6A 1UR0A 3QZAA 3VNZA 3W7MA 2W63A 4F0LA 3UESA 4FF7A 4Y9AA 1A5SA 5F4SA 4U5KA 4GKTA 2OVLA 4DUOA 3TQPA 2G3FA 4XB3A 1FQ0A 1RK5A 3NEHA 4GGHA 3FDGA 3C0LA 5LIWX 3ZYZA 1CDGA 1IWPA 2PWUA 3VNMA 4UQAA 5MKGB 2R6OA 3REQB 2XM1A 1RA5A 6ALDA 1CEOA 3HM7A 3MYPA 3KOXA 3DYPA 1HP4A 3SUUA 2DVXA 3G2GA 3SURA 3TJXA 5FEZA 3QHNA 4XZWA 2V9DA 1W56A 1QNVA 4D1IA 3IARA 2V2DA 4RJEA 3F2BA 4JTTA 3OG3A 2RGLA 1NDVA 4QDWA 3ALGA 1JR1A 1EF2A 1TPVA 2QJGA 3ZWTA 2C0HA 1WDWA 1DE6A 3VZZA 1FWHC 5A6SA 3F5LA 3BGJA 1TJ0A 5AYXA 3C2YA 1FWTA 3QY7A 2QUUA 2E5CA 4YNGA 1XSIA 2W6RA 3DFYA 4S39A 3E0LA 1D7FA 1G5AA 1SJDA 2AQOA 3G24A 3MSRA 3PPCA 2CLEA 1SM9A 5CPQA 1ZJHA 3D6NA 3U2OA 1SVDA 3ZJKA 2VFIA 3EKGA 3G6MA 1UBSA 3F2CA 4Q4OA 2EJ1A 4LAOA 4ZOAA 1OFRA 3BICA 2I57A 4Z17A 4D72A 4QROA 3FHAA 3UZJA 1GKRA 2FJUB 4ERAA 1WE5A 4PEEA 4IMEA 3LCWA 5TF0A 3QH2A 2OOGA 3A12A 4LB4A 4PBGA 1FDJA 2TRSA 1EC7A 1X96A 1OFQA 1HZYA 1QOQA 3PZIA 4DX3A 3HFTA 3IJDA 3HGJA 1TV7A 2PDYA 1PZ1A 3CZGA 3WD0A 3USBA 4XD6A 4DJDA 3MCMA 4LXFA 1TZ7A 4GUGA 3THQA 4HOXA 3WEOA 5TBOA 1EEXA 3GLCA 4ORIA 4GYKA 1VCVA 4Z1DA 2I5GA 3JZEA 5GNXA 1FCQA 1KRMA 3SBFA 5AHFA 3QV8A 2J66A 2W5FA 5LIKX 2PDGA 2QGYA 3GIPA 3LXBA 4YN5A 2Y1HA 4LUYA 3SECA 3HPXA 2PF8A 5DQPA 4GZJA 3T0DA 4IGNA 1UKTA 4KIRA 2OT0A 4ADTA 3KS6A 5BOFA 3BTNA 3HOJA 2XIJA 3NNTA 4DUWA 2E9MA 1E4NA 3Q37A 4I8DA 3FFSA 1FKXA 4GC3A 3GTXA 3OVGA 3IGSA 1OJXA 5H2ZA 3KE0A 4NUWA 1W9UA 2EGZA 3CAQA 1LP6A 4XBKA 3S2JA 5H1WA 2WV8A 4YL2A 2A5HA 2D73A 3V3WA 4O0KA 4ZB5A 1K77A 3G1SA 1VIWA 4PN2A 1XIMA 4OOZA 3TYCA 4NRSA 3SRFA 2VEKA 1YE6A 2PDFA 3HURA 3LPGA 3PHAA 3T81A 3R11A 4W7WA 2ZX6A 4MY8A 3UG8A 4OT7A 3QN3A 3GTNA 3UPMA 2B7PA 4J3WA 2CLFA 1G4TA 2ZXDA 1FWSA 4DF2A 3FYPA 4N9CA 1C92A 4AIBA 4NNBA 2QIIA 3SUTA 3VMNA 2X42A 5CZSA 5HDRA 3H4XA 4RDWA 2XVGA 2OYKA 3OIXA 4C65A 4GK8A 3LI1A 1SQ7A 2J6XA 3RYSA 3PP7A 3GH4A 4NQ1A 5CC7A 1EL3A 3WBEA 2WHLA 3W7IA 2PDKA 2ZCGA 4P8UA 4U4MA 3B40A 3SQLA 5A6BD 4H19A 3AIWA 4LF1A 2VI0A 1UC5A 4HHHA 5FJIA 2HCVA 1DWFM 2FGBA 3NZ1A 1NIUA 3BG5A 3DZ1A 3AYVA 4NKCA 3UETA 3NVDA 3VDGA 3AIEA 3MYOA 3UGVA 3W1NA 2RDTA 4MKSA 3DESA 3LQGA 1TV3A 4I9AA 3F4VA 4NXKA 2EEXA 1AD4A 4AZ5A 2B0MA 4LCSA 4MUZA 3PWIA 1D7KA 5HINA 3WLQA 2Z2UA 2ZVIA 4DO7A 3IUHA 1FTXA 1LRNA 3HMJG 2A3BA 7ENLA 3IJIA 4KIEA 2J9XA 1T6MA 2V5DA 2CERA 3CEUA 3B8VA 3EB4A 3VOIA 4YTTA 1A5LC 1E6PA 3WBYA 4B2DA 2Y7FA 3SY8A 5I79A 3TX9A 3TN5A 5HQLA 3W2JA 2FYMA 5I02A 1GVOA 1WX0A 1KXQA 1T7LA 4JR5A 3QYQA 4MKVA 2VX7A 3AIUA 4M5PA 1RZMA 5PTDA 3B3DA 3TUUA 1A5UA 4P7QA 5G1MA 4JKLA 3WQ5A 3DECA 2CW6A 2NQZA 3BLKA 3W70A 3P0WA 3DI1A 3AIVA 1M04A 4PODA 4TXEA 1GOKA 3UEQA 5CLWA 1QWKA 3O15A 4W7VA 1Q66A 2HS8A 1OFDA 4O4WA 4H8UA 4F0MA 4H9ZA 1FDZA 3SAZA 1FCVA 1UWIA 2GVJA 2B7QA 2FDSA 1BGGA 2EXOA 1I9CB 4EACA 4JZ5A 4UCGA 3LQLA 1FHUA 1KB3A 1HL9A 3G1XA 1CXFA 4GABA 4AD5A 3ZMRA 2ASHA 4IF2A 1HL2A 2I1OA 3PJWA 3GC4A 3C8FA 3VIHA 3W86A 1MQQA 5FI8A 3OODA 3P8IA 4ES4A 3IIVA 1QPKA 4PMOA 3QXBA 2PRLA 4WX2A 1FRBA 1W3NA 2YCLA 1CXIA 3H2NA 1SJCA 4IQLA 3WLSA 5CG0A 2ISDA 1QW8A 5TD4A 3UVIA 2X41A 5C54A 1W1YA 4JIEA 4KCWA 5AHMA 1OFOA 1P43A 2IXVA 1RD5A 1US0A 4O28A 4NYUA 1LT8A 3GR7A 4PL2A 1DVJA 1S2CA 4E4UA 1CECA 3ORWA 3UYIA 3GXPA 3IJ6A 3LHZA 1O5RA 2D0FA 5D9NA 2PDWA 4R9OA 3UQNA 3QR1A 3TFCA 2OFJA 4UTKA 1ZLPA 3UBPC 3KL0A 1XXXA 2WYSA 1TIWA 4HK5A 2YZRA 1Q6CA 3MCNA 2QCLA 2XH7A 4ZCWA 3W82A 4FNTA 7CGTA 1TWZA 4O53A 4OQVA 1YYAA 3L4WA 3THCA 3KOWA 4C6KA 3LRLA 1GHSA 4JAWA 2HK0A 1B3VA 3BV7A 1O5KA 3A23A 4DF1A 1XINA 4AXKA 3TMQA 3BK0A 4HCLA 2VP8A 3ARQA 4DBUA 3WLRA 5LIXX 5LIYX 4HMDA 1J9YA 3M0HA 3LD5A 2C71A 5E70A 5EMJA 5EMYA 3OVPA 3V7PA 1HQTA 3E2VA 3WD1A 3O0FA 3QV7A 1HG3A 4EXBA 1PV8A 4M82A 4U2YA 4DWDA 3GHSA 4OV9A 5EBUA 3UG3A 4XSLA 3MS8A 3QV9A 4FR1A 1XLBA 3NQBA 1HJVA 3INPA 3I68A 3A5FA 1PKMA 1TCMA 2PDQA 1LWJA 4NI3A 3H55A 4HU0A 4X60A 4FO4A 1JZ8A 2NLYA 4DXVA 4V15A 4ZE4A 3QY6A 1W5NA 5KEZA 3R89A 3PWGA 1QW7A 3H7RA 2H6RA 2GQ9A 1H60A 1WYIA 4NNCA 1SZGA 1MYRA 4GISA 1JCNA 1PS9A 3IANA 3QRHA 3STCA 3EXSA 4IFKB 1SSGA 3SI9A 2WSKA 4MMWA 2QUMA 1DXIA 1OIFA 4UFKA 1I0BA 3G1VA 2FFIA 3R79A 1H2JA 4OWGA 1OCQA 3DXIA 2DT3A 2F7FA 1OC6A 1GJPA 3CT2A 4CQAA 3MT1A 4LUSB 4B3KA 2CPUA 1KFCA 2E40A 2E9BA 3BLOA 1XGDA 4C7GA 3MC5A 3FVDA 4O8AA 1XWYA 2JK2A 1GEQA 2VFEA 4UC5A 4E4PA 1OHLA 4QSFA 4Q4SA 2WJDA 4HSNA 2OGYA 3WNOA 5L9FA 5ABHA 3QTPA 1IHIA 4QG9A 5C5YA 5FSDC 1FUYA 2FHCA 2YDQA 4F48A 1ADDA 5M1TA 1F6PA 3A21A 3VZYA 3GXFA 1E5JA 3PSWA 1LG1A 4IPPA 3PULA 3W23A 3CH0A 4GKLA 5EMLA 5DF0A 4MZ8A 5H6HA 4F0RA 3NJ3A 1UG6A 2VR5A 2VCCA 1KA9F 5E09A 4HOWA 2X16A 3UJ2A 2CLOA 2FTWA 4R7OA 1TWIA 1P0BA 4LCRA 5BRPA 1TJPA 2A85A 1VIZA 3U7VA 3VMPA 2P0OA 1UZHA 3BLPX 2ZZ5A 1NVMA 2GDQA 2XN0A 2CBUA 2X1RA 5CG7A 5D2VA 1K8XA 3MVIA 4DO5A 2ACQA 3DG7A 4TX9A 4AF0A 3PTQA 9XIAA 1R9ZA 3UCCA 2IQTA 3VD3A 3BXWA 3C86A 2FVLA 2XFFA 4RZ5A 3O05A 3F4CA 2E09A 3MO7A 1UR2A 3QGAC 3NQAA 1OIMA 1JCMP 4B5SA 2PC8A 1LLOA 3B8IA 2QV5A 4JY9A 4PRTA 5T91A 2CXEA 4PFHA 5HAOA 1FFQA 4FA3A 4BWLA 4GD0A 4KEZA 3ZVHA 3NGFA 2HROA 5JH1A 3MP4A 3W2MA 1XH0A 3THDA 3XINA 1NWRA 1F8IA 4NAEA 5EMMA 1GTHA 4GVIA 2DP3A 3GC2A 2FVKA 2B7NA 3UWUA 4QX4A 1RLCL 2R24A 3AHXA 4NT0A 4L9YA 5CPTA 3W2KA 3NQ7A 2DH3A 3GYEA 1AQ0A 1DE5A 2Z26A 1UR9A 3B9NA 1UIOA 3K1DA 3GBDA 3HFYA 2E28A 2P8BA 3HA1A 4RK8A 1XQLA 4UR7A 2J7CA 1OFBA 4TQTA 3WQVA 1D2KA 4H2HA 4AZBA 2OEJA 3BCDA 3VKAA 3UWVA 3AMDA 2WCGA 1E6RA 1NOFA 4FNPA 2AMGA 3KDOA 5FJOA 1XIBA 4OBTA 2DU2A 2OR2A 4N7QA 1VENA 3LLDA 4GI4A 2YBTA 5HATA 4O17A 2EKGA 3VO0A 1F6YA 3M41A 2OGJA 1VS1A 1G01A 3W1XA 5AHEA 3OA3A 2YW4A 4PRWA 3SIMA 1XP3A 2OQYA 3QQ1A 3ZJ8A 1K7EA 4YVXA 2P8CA 4LS0A 3GNOA 2ZRXA 3T0TA 3G0XA 1W9PA 2DVTA 1U5VA 3SSZA 2YFNA 1K70A 4WHBA 2I17A 3ALFA 4PBFA 3NQGA 4KW2A 1A0DA 2BLEA 4GQQA 2X7WA 4WK9A 4KFOA 1XLHA 2Y70A 1I8JA 1EHAA 1FHLA 4IIBA 4FP1A 1J18A 1FWEC 1CYGA 2VGFA 3C56A 1XG3A 4K1WA 1DWHM 3TP4A 1ONEA 4JIQA 2R8WA 1UH3A 1R86A 2G41A 3NIYA 3BURA 3AJ7A 4IG2B 1HKVA 1UB3A 3VA8A 1ICQA 3B8UA 1BKHA 4G1NA 3OYZA 3VYLA 2ZRZA 4HZ6A 5ECUA 5A95A 4GYPC 2OEKA 1IR2A 1WDDA 1XLMA 2OLSA 1S2AA 4J2MA 3B9OA 4PMVA 3CL8A 1NEYA 2PWFA 4TOQA 4C60A 5C7HA 4JKMA 3GH5A 1LOSA 1TO3A 2VMFA 3DU0A 1KR1A 3R94A 4PMUA 3O6DA 3MCOA 1FP9A 2X0YA 1XV8A 1O5XA 4XISA 1YE4A 3BAWA 4K7VA 2OQLA 1EO5A 4JYEA 1P48A 4NRRA 4O16A 3A9IA 3CUIA 3IIOA 1SO5A 1GEHA 3E0VA 3W0KA 4LY8A 2FB3A 4HYVA 4DWSA 2I7GA 3T0AA 3L65A 4J28A 4QSHA 2NXIA 4R53A 4R5EA 1JZ3A 3MUAA 3UCDA 2NWRA 3TYDA 1Q5MA 3DBNA 3EDKA 4W87A 4DRSA 3WSUA 1XW8A 1X1OA 4H6KA 3RJXA 3S9ZA 3UVAA 1QNPA 4H2CA 4KPLA 2VO5A 1DHPA 2WZTA 3N25A 4F40A 1MRAA 3ARYA 3W7GA 4ATDA 4DPQA 1OADA 3PUDA 3EBVA 3R12A 2QUNA 4QP0A 3L67A 3R0KA 5I2UA 3S46A 2R91A 1KM4A 5LHFA 3IV3A 2VX5A 4ROQA 2ZRYA 3UXDA 1Z48A 1X39A 2HE5A 3NURA 5D2XA 3L0GA 1ZRQA 3LYEA 3N2XA 2VZOA 3F4DA 5JMUA 4F9JA 2WCSA 1TUXA 1U30A 4ZL1A 3A9BA 4Y90A 4FEZA 2X1IA 3T9PA 3WDJA 5I7GA 2WZHA 4MPQA 3KDNA 1AH4A 4J40A 3GG1A 3MUCA 1AVAA 4K1GA 2P5NA 2Q8XA 3MU7A 3PSVA 1GG0A 2DZSA 3N9SA 4NP7A 3JUGA 1TTIA 2Z27A 2ZX7A 3BOFA 1TWSA 3OHIA 3TQ0A 1QJWA 4O8RA 1ITQA 2Y8KA 4HNCA 4IFOA 1R3WA 4I6KA 3ABOA 5T9CE 1OFEA 3V0UA 2J13A 1OK4A 3LCXA 3R5EA 4E0CA 3M6DA 3D3FA 4UOJA 1GWJA 2BGNE 1VJZA 3ABRA 4GNJA 4CD5A 5FACA 2PMQA 1IF2A 1KBJA 2OWCA 3V18A 1UH4A 3KAOA 4LYRA 4PH6A 2ZXBA 1V3HA 3FS2A 1TMQA 5GJNA 5HNTA 3GZAA 2IUZA 3ECQA 4GMEA 4L64A 3S5OA 3VIOA 1W9VA 1L8PA 1KKOA 3UPBA 4WY0B 1WP6A 1P6BA 4IZGA 3VOJA 4HA0A 4CVUA 4J5NA 1XSKA 2Q3OA 1TPB1 1B2YA 3ES7A 4JNZA 3ZWSA 1FWJC 4XKMA 1JQVA 4N0RA 1KCXA 3N2OA 1J0ZA 2EHHA 3PZTA 2P3ZA 4PRRA 2A3CA 4YCPA 1MXDA 3TJIA 1U1HA 3NPUA 1POKA 3ELFA 3FLUA 2CZEA 3MP5A 3VTRA 3MB9A 3P7YA 4GX8A 3CEPA 3S2MA 1GONA 4GQGA 3PZ9A 1LUCA 4PUMA 1DIKA 4E6MA 4NYYA 1VCFA 3D47A 3T1GA 5F2IA 1JI2A 4WDWA 1RP9A 3PJUA 3RN6A 4V2XA 3ERPA 3LCIA 4LANA 2G0WA 4TVDA 4O52A 1CLVA 1MFVA 3BZJA 1YKWA 1E6QM 2YCEA 2TSYA 3NA8A 1LM1A 3OO2A 4AF0B 4O1AA 4X0VA 1ZNNA 3NO5A 4AD0A 1S38A 4ZO6A 4B2DD 3GAKA 1EJVC 3APTA 1HKJA 4O11A 2WSRA 1J2BA 4MM1A 1WZAA 4IP4A 1AW1A 1LZOA 1R85A 1QDSA 2A79A 5D04C 3EDDA 2NSXA 1I75A 4H8HA 3PG9A 1CLKA 3EWUA 4H41A 1UC4A 3QM3A 4IMDA 3OU8A 2EG8A 1UP3A 4H9XA 4R27A 1XBYA 3GG8A 3DGBA 3VE7A 3PZOA 3VAVA 2HVNA 2OB3A 1EPXA 4I5UA 5AC8A 1CWYA 3WDIA 1REQA 5FF2A 1DEDA 4IMGA 2FLIA 2JGYA 3MHGA 1QBAA 3DKJA 2DZAA 4K8GA 4CD4A 3ARTA 3FA4A 1XIJA 3N73A 3SDOA 2V5KA 1ONWA 3L0KA 1X8FA 5I09A 3TQVA 1VJSA 5HMDA 1OFAA 3C2FA 4DLMA 3FYYA 4L6OA 4AMAA 5H8MA 5LXXA 1SO6A 1V6WA 2WSPA 1NTHA 5D9MA 1A80A 4LGXA 1AJZA 1R2TA 1WBHA 2ZC8A 4UTJA 3D0CA 4UQCA 4Z08A 1GZGA 3WYZA 3A47A 1G4SA 2ZZ6A 5HANA 3KRUA 2QVNA 1ICPA 1WZMA 5A3HA 2AAAA 1RALA 3O7UA 3PFRA 3HG4A 2DSWA 2WSQA 5BWFA 3PY2A 3LCHA 3WK1A 2ZUWA 3MTWA 3VKKA 1PXGA 1B0IA 5I78A 3BARA 1LCOA 5BXRA 3EYPA 4LBSA 3S5ZA 4N6FA 3NQCA 2IPJA 4J7RA 4AZCB 4J9JA 4ZR8A 4ZEPA 2X05A 1RJQA 4P61A 1J5TA 3LS9A 4WSJA 4AVFA 5HULA 1Z8AA 4MDOA 4ICNA 4WOQA 2Y85A 3W7PA 4A3QA 1YW1A 1A5AA 3NQDA 1V4YA 2RH9A 1Q6RA 4H1ZA 4WDUA 3UG5A 1L6SA 3NL6A 1J0JA 2INEA 4XO6A 3ENLA 3O2LA 5D8ZA 3LSCA 4JQ4A 3LUTA 3ZQ9A 1C91A 4GH3A 1Z44A 3PZVA 3LNMA 3CTLA 4X63A 3SSJA 4CNPA 2VVSA 1W5OA 4ZTXA 3BJFA 5B7YA 3GR4A 2EF9A 1V0MA 3L21A 2DQWA 5D2YA 2E77A 4RE3A 3WK0A 2P1FA 3S1VA 4ACYA 3CC1A 4QTGA 3PB2A 3IV8A 2GK1A 4PSRA 4PL1A 2YYTA 2CWNA 4QITA 4LRSA 1M9HA 1HJXA 3FOKA 2C14A 3LNPA 1JCLA 4YHEA 1B9BA 1GQLA 1IT0A 3QC0A 3P60A 3TW6A 3G1HA 3OEXA 2J79A 4H04A 1F8MA 4NJKA 5IBXC 3P82A 2DH2A 3MDUA 2PODA 2HXUA 3RRAA 1SU5A 2O7SA 3STPA 3WMBA 1FWNA 4OIFA 1EC8A 3ITVA 1XDLA 3WQ6A 4M0XA 1SPQA 2PGEA 4XAYA 3WFAA 3MSDA 3NGJA 3ZFHA 4L65A 1IEVA 2Z0IA 3IK4A 3ZR4A 2OX1A 2V67A 3CIVA 1WAWA 2B81A 2XUCA 4D6GA 4CD6A 2EAWA 6XIMA 2I5QA 3M9YA 3RMJA 3RM8A 1EJWC 2NWSA 4HYWA 2OSYA 5CZTA 4XWUA 4H01A 1EBGA 4QR6A 3P80A 2Y4SA 4P7OA 3PZMA 3NL2A 3HPFA 4L4PA 3W9ZA 2BASA 5A8OA 1KLYA 1XCWA 4GY7A 4EPBC 4BQ2A 3L68A 2V3EA 2O9OA 3ARZA 3AICA 3QOKA 4AWTA 3SADA 1RBAA 2OZ0A 4AQLA 2QDHA 2GLKA 2ODOA 1VLWA 4HD5A 4GI8A 1E9YB 9RUBA 4JTKA 1CGUA 5I3HA 3TN6A 3U4FA 3FSUA 3KXQA 4NJHA 4XIAA 4Y9NA 2JF7A 3KW3A 1UD6A 4CU8A 4JPGA 1RXOB 3MI6A 1KBIA 1W1B1 4IQDA 1IE7C 4X0NA 1W1VA 2RFGA 4JKKA 3UR2A 1G7VA 2A3LA 4C91A 4B4FA 3KCOA 2TODA 3CT7A 4RZBA 5T9BG 3SCTA 1KFWA 1MUCA 4E2VA 3VIFA 2HSAA 2VFGA 5LSMA 3WQPA 3MQTA 2DUAA 3CJPA 1JCXA 1H1ZA 3ARXA 1VBJA 1PKNA 3VZXA 1W3LA 1Q2SA 2EG7A 2ABAA 3WDHA 1RBOB 3EXRA 3KFTA 3HGOA 5GPRA 3S9YA 1V03A 3WUGA 2BZNA 1KC7A 4W8LA 4JBRA 1TPDA 3TC3A 5HNUA 4B3LA 1C9DA 3WH7A 3B03A 3CM4A 1PX3A 3CBWA 3NPVA 3UY7A 1AQMA 3C4UA 5LXEA 4JYDA 4NZCA 1FFRA 3LXCA 4TX6A 2A7NA 3SRKA 4HHMA 2XFRA 3VIIA 3PWAA 4A2RA 5AHNA 2QJJA 4Q8MA 3JRKA 1EDTA 4HK7A 4H6EA 4CN4A 1Z9AA 3T0CA 3U4AA 2F2HA 1GW1A 2ISSA 4AEOA 4FOUA 1T8XA 3IJ7A 4WR3A 2KZHA 4JN6A 4U10A 4UQEA 2V68A 4XBJA 3N2MA 2R94A 4MJ4A 3RLUA 3LLXA 3UJRA 1EWDA 1RPXA 1GYMA 2VWTA 1J12A 3RMEA 3T05A 4EWND 2WMGA 1JFXA 4ZQPA 3WENA 2ZA2A 2VZVA 1H7WA 5HQEA 4ECLA 2IQ0A 3E5BA 3GNPA 5IDZA 5AC4A 3H21A 2OZ3A 3DFSA 1FCUA 1JYWA 3GHUA 1K7XA 2QQ6A 3SGGA 2ZUVA 4C90A 3AAMA 1EO7A 4FMVA 3CMGA 2D0GA 4UTLA 4Z2KA 2CIPA 2Y62A 3PZQA 4GCAA 1R3QA 1IXQA 1KFKA 5AYYA 4F0HA 4IMAA 1Q6QA 1J0IA 2F38A 5I06A 3N6JA 3WH8A 4QLJA 3L5AA 3PS7A 2BY2A 3W1PA 5LNUA 4HK6A 1XSJA 5J8LA 4XD3A 4WF7A 1A5BA 2WLYA 3S42A 3N15A 3POCA 3SY1A 2ALRA 2RDUA 3SCOA 3VX1A 1V5XA 1CXHA 3QJAA 3PUEA 1W9BM 1HP5A 1B31A 4PB3A 3W07A 2HISA 4GIYA 1H7OA 2XGBA 2GOUA 3Q94A 4CN6A 1K7FA 3FJNA 3BLLA 3S1GA 3VIPA 3CAVA 1GQNA 2X1SA 2VGGA 3SIZA 1E1FA 2PU1A 3U0HA 1JRCA 4RZ4A 3OVQA 4B9YA 2J9ZA 3LPPA 4JHZA 1OC7A 3SFKA 1XIHA 2YJQA 2HE8A 1OB0A 1EA9C 3E5PA 1VB9A 3UT0A 2ZDSA 4V1XA 3S47A 4AEFA 4IFKA 1W3IA 3II1A 3W7QA 1V3JA 3H2FA 1OF6A 4WY0A 2CXGA 2C16A 4IGSA 3UZZA 1CGVA 5BW6A 3W87A 3FNDA 3N3MA 3WD4A 4NY2A 2QAPA 1BG9A 3R8RA 3W2NA 3LV5A 1GTEA 5BRBA 2X1UA 2JKAA 5A6AA 2QZRA 3FKKA 3VNKA 2B4GA 1MRQA 5CAHA 1X6LA 2BFGA 1EOKA 2Y0FA 1SMDA 1G9HA 3SRDA 1KRCC 3RLGA 1KLZA 1UWSA 3WG6A 1M65A 4JTIA 4HVXA 2DIKA 1G4PA 3TNBA 4E3VA 1XIGA 1YLVA 4JHOA 1R7OA 4FLOA 1OCBA 2ZBTA 4K39A 2DT0A 3GXDA 3I4KA 1C7TA 3MUY1 8RUCA 2O4MA 3HIJA 3E96A 1RAKA 1ONXA 4JX6A 3KTCA 3PC0A 4OUEA 1NWUA 2DDXA 1VZWA 3WUBA 3G1AA 3NM1A 4D6FA 2RJHA 1BKSA 1QPOA 5XIMA 4FX7A 2ZC1A 4DAFA 5HJLA 2NT0A 2ON3A 3FSTA 5DXXA 2XJ7A 1H62A 4MF4A 2PD9A 3UNDA 4FX8A 1RQEA 1E56A 1QCWA 1R30A 1U83A 3T4CA 3LHTA 1RHCA 3B9DA 1WXYA 3WK3A 3G22A 3LENA 2TPSA 1UKSA 1FDYA 3L4TA 4N42A 4I7WA 4Z1BA 1X1ZA 5C71A 2V5JA 4QBXA 3GVQA 4W5UA 3WQWA 2O4QA 3V4BA 5C2XA 4TMBA 4R33A 4JNYA 3AIQA 3EWWA 4JYFA 1E15A 3GU2A 4DJDD 1TREA 4V33A 2I9EA 2WZMA 1DQWA 1HF6A 4D6IA 4BQ5A 2XIOA 3RCNA 5C2GA 3WJWA 3ITCA 1VFHA 1ZHAA 3PM6A 1NFBA 3MA8A 2DIEA 1XRTA 1E72M 1NM9A 4S3EA 1JUBA 3HMCA 4GWEA 2ZUUA 2FFCA 3O9NA 3EDEA 4QS5A 1R47A 1FBAA 2JKEA 2WJZA 4GXPA 3WUFA 1VJIA 4NAFB 5ENLA 4KQNA 2Y8UA 3N9RA 1PYMA 2E67A 3B04A 1AK5A 1O66A 4A6GA 5D8WA 4TIMA 2PWEA 4AU0A 1ME7A 1OSEA 5DMNA 4I5XA 4JXCA 3L2MA 3U2CA 4BKNA 3EOSA 4YTQA 3KL5A 3L12A 3B06A 4GUFA 3H8AA 2QV4A 2HQAA 4MVAA 2PPGA 1EYWA 2ZYFA 2VWSA 4HJWA 4HBKA 4IIDA 3L5MA 4F66A 5L6UA 4DBDA 3GFZA 2PCQA 4OOUA 2WHMA 2J78A 3U5YA 4MPKA 2FVMA 3MMTA 4E2BA 3VE9A 2Z1XA 4GFSA 3HV9A 2DIJA 3CO4A 3KP0A 3KLKA 4ZA0A 4D6DA 2XSAA 1IIGA 1DJGA 4JEJA 3BAJA 5FJPA 2UY2A 1XKJA 3NTYA 1W3JA 5DBTA 1QPRA 1IZCA 4R9XA 4JTHA 4N4PA 3VNIA 1BVNP 4JFUA 3SR7A 2EBNA 4NX5A 5JIWA 2J8TA 1NARA 1TZZA 3EPOA 4RE4A 1Q6OA 3OLDA 1PZ0A 2CETA 4EPDC 1IXNA 4IGMA 3O16A 1XBZA 3KBMA 3HJEA 4ADUA 2AL2B 2PZNA 3M0JA 1HX0A 3LEPA 1KM5A 4J3TA 1W5MA 4CD8A 2CLMA 2QXWA 3M0LA 1MUWA 4JIRA 2D22A 2G37A 1BTCA 3FKRA 3A3XA 1MDLA 3NYDA 5LNRA 4DEFA 4XAFA 2ZWZA 4IX0A 3VIMA 4AY1A 4XZIA 1FY6A 1VYPX 1UW9A 3BMWA 2RAGA 5IBXA 1O6IA 5HPCA 3BCFA 2IS7A 4IL0A 5KMYA 3BAKA 1WUFA 1RP8A 3KBNA 2E0PA 4X2RA 2NLIA 3NQEA 2CKSA 4O50A 2WVVA 3VOGA 1CTNA 3H24A 1FKWA 5REQB 2FZ8A 3VILA 3PJXA 5IM51 3ZXWA 2VEFA 1UR1A 3QSRA 5CBIA 4QEEA 7REQB 1ZBCA 2PLJA 2PBGA 3LHWA 4S3FA 3I6TA 3ZJ6A 1UHVA 2E7FA 5E9AA 3LHVA 4MZ1A 4A3UA 3CV7A 1H49A 5FJRA 1KV5A 1QMLA 4XAPA 5A6TC 4L9XA 4PSPA 3UXLA 3S2LA 3NSNA 2V6AA 2DZVA 3MP3A 1KCZA 3QPYA 3N19B 5REQA 3RX4A 1E9LA 4XVDA 3LGEA 1EWEA 2G4JA 4A3HA 4LT9A 2O55A 2PDNA 3LLFA 1GOIA 2PTWA 1LQ2A 1MXGA 4HT3A 5CC3A 3QLLA 1MVYA 3BQ5A 1ECQA 4QIUA 3N2BA 2REQA 4DJFC 3L4UA 3CZLA 4I8YA 3OHMB 1V93A 4KWUA 5TQLA 1ZQ5A 1G0CA 4QCFA 1JCTA 4PFMA 5DX7A 3URQA 3M46A 2WBKA 1K3UA 3UZWA 1E70M 1S1RA 5DRIA 3UW6A 4C6CA 1N8FA 5DT7A 4WJEA 3R2GA 2GGGA 3GB6A 1DJZA 3LHUA 3F03K 4N2YA 4H9VA 4DBEA 2INFA 4PMXA 4QQUA 2YW3A 5D03A 1NQ6A 5D9OA 3W71A 1Q4WA 4EP8C 3TWBA 4RNFA 4UNLA 1ZAHA 2VC6A 2ZRWA 3MKVA 1KTNA 1TPFA 2QF8A 1IEIA 2BV9A 2WVUA 4JOMA 5C55A 2H90A 1GVSA 5C9RA 1YNQA 4QQ3A 2A3AA 1OF8A 1Q63A 1V0LA 2WJFA 3GIQA 4X3ZA 2JF6A 1W2PA 1YTEA 3PAOA 1TPUA 2DW6A 1LLZA 2FTPA 3MMDA 4DQWA 4PUUA 1QNRA 3THUA 1JUKA 4YPJA 1H7XA 4NF7A 3QVQA 3V16A 3WNNA 4Z1AA 4WOZA 3WNMA 1VRXA 2ABBA 1TRIA 1SO3A 3RUBL 1FWBC 2NV2A 1VGAA 2HBXA 3H6OA 3ONCA 2FHBA 4JTQA 3B9AA 2C19A 3M0ZA 3AS1A 2WC3A 2WZEA 2J7FA 3LZ3A 3PAJA 1PPIA 3QYSA 2PWDA 1WCGA 4IXHA 3GFYA 3CWHA 3ITXA 1KFJA 4XZ9A 4XKYA 2FH6A 2WANA 2WMJA 4G1KA 5KTLA 1XCFA 2UZ9A 4IMFA 4JFVA 5JQ9A 4GXMA 3GNDA 1IT8A 1RY8A 3PBWA 1SZNA 4M1RA 2C3ZA 3QMTA 1W1IE 1HKIA 4O54A 5LKYA 2YOCA 1JFHA 3ZZ1A 1E0WA 4UTWC 5BMXA 3IRDA 3CMFA 4IIGA 1PHQA 2CLPA 4WCJA 3VX0A 4D6CA 4K37A 2CZFA 2HEJA 2G50A 5DCDA 3KOYA 1MQPA 3O8AA 3ZT7A 1TELA 2WPBA 4LTSA 2QS8A 3V75A 3QZ6A 3ZJ7A 4DBSA 5U4NA 3TC6A 4IP5A 1F5ZA 3EX6A 4IUGA 4F9DA 2QAFA 5CPSA 4XQ6A 3PBYA 2YXOA 3H4WA 2CBVA 4INFA 2P76A 2HZGA 3M7WA 2BP1A 3W38A 3WDPP 1UASA 4EE9A 1U2YA 5MKGA 3NZRA 1QUMA 4E2OA 4FLRA 1PIGA 1H1NA 4YVPA 4D1JA 1T8QA 1OINA 1N7KA 3W37A 1EDQA 5A6MA 2XIQA 2DV0A 1BSLA 3QOMA 3WELA 2PUZA 1L0PA 3VIGA 3WFZA 3FN9A 4DN1A 5EFDA 1M01A 4KWSA 5ABFB 3QHOA 8A3HA 5FF3A 3G0UA 4HMEA 2JFEX 3SUWA 1XG4A 1V7AA 2ZQ0A 4ADSA 3K8MA 4NZ5A 2WKJA 4EF9A 4MY9A 2XVKA 1E1CB 4G6CA 3VDHA 1JYNA 4GO9A 3VUSA 2NUWA 2G3NA 1OM0A 2YX0A 3WJZA 2ZUMA 5A94A 1FVPA 3CU2A 2P0IA 3LV6A 1QBBA 5C2CA 1Q7MA 1TMHA 2VR2A 4UR9A 3WJYA 4AIUA 4XSMA 1PSCA 2ZX5A 3N11A 3BGGA 4NU7A 3I3DA 4O19A 3M0YA 2CU0A 2Q02A 2W66A 1BWLA 3MBDA 4MG4A 4YWIA 4FHAA 4E5TA 2NQHA 3ZR5A 3TFXA 5CPOA 1XIEA 3B97A 1F76A 1YBQB 3ITYA 3LA4A 3EWXA 1BWVA 2X1TA 4HN8A 1Q6LA 1TA3B 4L80A 3W25A 2PLCA 4NJJA 3M6YA 1YNYA 1M5WA 4Q7IA 1PWMA 1MW0A 4UMBA 3WIJA 1EX5A 2YFOA 4LAZA 3S83A 1GORA 4BZYA 5GQBA 3DOPA 2HNHA 1KXVA 3K4DA 4FLSA 1VEOA 1OABA 1XLIA 4RPQA 4LBRA 5A8MA 5I6SA 4NZFA 1VD6A 3TOYA 2F6KA 3CO8A 3R1ZA 1K4HA 1BYDA 3V0TA 1GT8A 1RSCA 3QHMA 1EA0A 1G69A 3K46A 1YPXA 1BYBA 1B3OA 5IOBA 1UBPC 1H4PA 3ABQA 3BWWA 5FL1A 4PCTA 4CCZA 4RNJA 1XLKA 2CZ5A 3Q2DA 5F1VA 4UOZA 3CLWA 4ZB2A 3OZMA 3B8SA 3GVVA 2QPXA 1X98A 2YL6A 1FXPA 2ZOXA 1BF2A 1PX8A 5EGRA 4MNLA 3QZEA 2FB2A 3EOOA 3ISIX 3ICJA 1M3UA 2A3EA 4BI5A 4Z1YA 1OK6A 1A5MC 4L7ZA 1WOAA 2A7RA 4REQB 3TTSA 3CUFA 4ZSTA 1V3LA 2HVOA 6REQA 3WX7A 1WXZA 4LYQA 3DG6A 3DX5A 1W1TA 4PBEA 2V63A 2QPSA 3WL0A 3W1UA 4A3RA 2CITA 3HB9A 1YADA 1EEPA 3UPWA 4JTEA 4AZCA 4P8XA 4W8BA 4O14A 3TONA 1DIDA 1B54A 4DF0A 2C18A 1CGYA 4O1BA 2D1ZA 4Y9OA 3WNKA 3RFAA 1UWTA 1Q6FA 1E5NA 2WNZA 1TMLA 4NVTA 1UP0A 4DM2A 2NQLA 1OGGA 2ZX9A 1E4MM 4PE8A 1B3ZA 5BROA 2OT1A 1W9DM 1DP0A 2Y8VA 1GW9A 4P2VA 1QU4A 7TAAA 1MDRA 3QMSA 2PWGA 1QOPA 4KEMA 1GJWA 1X1NA 3BE7A 3LOTA 3ANUA 3R6IA 1DWJM 3GYCA 1E1EA 5AECA 3I7RA 2OEMA 3CL6A 3DYOA 1JCJA 4FXSA 3I10A 3VPLA 2ZUNA 2IW0A 2E5BA 1YXCA 5FEXA 1H41A 2DZUA 2BVTA 2UY3A 4RW5A 4BF7A 2POZA 2Y7GA 1LL6A 2X0SA 1XH2A 1OT1A 3GDBA 5M2FX 4S3CA 9XIMA 4MUPA 2E6AA 3TYEA 2QUTA 4WDXA 1BYAA 3R0UA 1LT7A 1MSSA 5F2GA 4IIHA 1PZ2A 1R3TA 2W9MA 3CPRA 5JBEA 1WBJA 1L6WA 2P10A 1JD9A 1UUQA 2ACRA 8TIMA 1R3YA 1RVKA 3M64A 1B4EA 2G4FA 2ZIDA 5JH2A 3UF9A 4Y2WA 1XDMA 2G3JA 2Q01A 4W7UA 3GD6A 3URNA 2GDUA 5F4WA 4GIEA 4MKNA 1W31A 4O15A 4ZQOA 2JIWA 3PBUA 3NYZA 4CEXC 3B8DA 2C1HA 1SMAA 5A8GA 5FJJA 2RJGA 1UPMB 3XISA 4AIOA 1PZ3A 5EKYA 4AZGA 1F3EA 4TTUA 1KWGA 1NH6A 3ZVIA 4E38A 5M5DA 1H09A 1ISYA 5CSUA 2DSUA 2B7OA 5G2IA 4PCFA 1JPIA 4GQBA 2WKLA 3IWPA 4D9PA 2GJRA 2A21A 1E6ZA 3E0IA 3N6HA 3P6LA 2WNQA 2NSOA 4B3ZA 5I00A 5K4ZA 4ERIA 3K5XA 1HJUA 3Q65A 1JGIA 2A4AA 1N8IA 3EX3A 2PRHA 2OG9A 2BMBA 3APYA 1ELSA 2R1LA 4AY7A 3KL3A 3OGSA 3A6OA 4JX5A 4GNKB 1HO4A 1V6XA 2BOEX 2WNNA 2YKKA 3P3BA 2AAMA 5ECVA 2AKMA 2L5HA 3GAYA 3EOEA 4KCVA 2Z24A 4J4KA 1ZU8A 1PB0A 3UWEA 3A3WA 2J47A 3SGUA 3ZSTA 4Q8WA 2BY1A 2HRWA 1OY0A 4S3AA 3W53A 1XL9A 4Y6GA 3EPNA 4AYSA 4W85A 4HTYA 1M7PA 4MWAB 3BSGA 1KQZA 1AQHA 1WKDA 2WLZA 3MJYA 1DJNA 5E1QA 1X6NA 4EX4A 4A05A 4QJ5B 3GDLA 1JPDX 1RCOB 8CGTA 5HWNA 4KWOA 3DKLA 2WWDA 4RNHA 4C1NA 5TAOA 2FJKA 3EX4A 3UNTA 4JEQA 3S0CA 5ABEA 4OECA 3KEHA 1OWQA 4TVUA 3EA2A 1A49A 1BF6A