3LMZA

Crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
VKPKAPKAVNPFHLGMAGYTFVNFDLDTTLKTLERLDIHYLCIKDFHLPLNSTDEQIRAFHDKCAAHKVTGYAVGPIYMKSEEEIDRAFDYAKRVGVKLIVGVPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDLDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVTDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYEKDMKDPFLGIAESIGYFKAVSDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative sugar isomerase
publication title Crystal structure of Putative sugar isomerase. (YP_001305105.1) from Parabacteroides distasonis ATCC 8503 at 1.44 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 88
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3lmzA00
1XLJA 4QDPA 3JU2A 3KCOA 4J4KA 3GNXA 5B7ZA 3QXBA 3C0QA 1OADA 1DIEA 2Q02A 2XIMA 3TC3A 5EMKA 3CNYA 1S5NA 1XIDA 2HK1A 1A0CA 3UU0A 4DUOA 3KCLA 3M0XA 4QDWA 3KBMA 3P6LA 1XICA 3ITTA 3UXIA 8XIMA 3KBWA 4QE4A 4QEEA 4YTSA 4X63A 3FVMA 3QZAA 5AVHA 5XIMA 3XISA 9XIMA 3AALA 3VYLA 1TZ9A 3DBNA 3ITLA 4HNOA 3IUHA 3XIMA 3ITYA 3VNIA 2XINA 1QTWA 2I56A 2ZVRA 3ITXA 1D8WA 4A8IA 5FA5A 3P14A 1XIGA 1XINA 1XLLA 3IUIA 4K1GA 5B80A 1BXBA 4YTRA 3C0SA 1YX1A 4XIMA 6XIMA 3L23A 1XIEA 3KBNA 3OBEA 3M0VA 4HHMA 1CLKA 1XLHA 4W4QA 1QUMA 3CQJA 3XINA 4EAYA 3U3HA 3ITVA 3UA3A 1XLIA 4Q7IA 4LNCA 4ZB0A 4ZB5A 4XIAA 4X60A 5TNVA 2G0WA 2QW5A 4QEHA 3UA4A 2GVEA 4HHLA 3C0LA 2OU4A 2GLKA 3DX5A 5EMLA 3WQOA 3CQIA 3TVAA 3M0LA 2HCVA 1DE6A 1XLCA 4GJJA 3AYTA 1XYMA 2XISA 1DE5A 2QUMA 2QUNA 5EMJA 1DIDA 1MNZA 5C9ZA 1XIHA 1XIMA 3BANA 6XIAA 3KBJA 3NGFA 3M0YA 2NQ9A 3BZGA 8XIAA 1A0EA 4KW2A 4ZB2A 4GLEA 1S5MA 2J6VA 3BDKA 4X61A 4ZBCA 3VNJA 3VNKA 5B7YA 1XLGA 2ZDSA 3KCJA 4A8NA 3ITOA 3U0HA 4GQBA 4US6A 4QE5A 3VNLA 3QC0A 4XSMA 3UVAA 4YTTA 2G4JA 1XP3A 5I7GA 3KBVA 3CQKA 4G56A 7XIMA 1MUWA 4YTUA 1XLMA 2GYIA 3CQHA 3KBSA 2HK0A 3KWSA 4EACA 2GUBA 4HGXA 1XISA 1XIFA 1XLFA 3BWWA 4GJIA 4XSLA 1XYBA 3BZJA 4QE1A 5XIAA 5H1WA 2NQJA 1K77A 2X7VA 1XYCA 2X7WA 5XINA 5EMMA 5H6HA 4XISA 1O1HA 3AAMA 4XKMA 3QYSA 1DXIA 1GW9A 2QULA 4YTQA 3N4AA 1XIIA 1XIBA 4K3ZA 3VNMA 4A8LA 1QT1A 9XIAA 3IUDA 4PGLA 4PFHA 1XLAA 1XLEA 1XLBA 5AVNA 4OVXA 1XYLA 1XLKA 3LMZA 4A8RA 1BXCA 3AYVA 4DVOA 2NQHA 1I60A 1A0DA 1I6NA 1XLDA 1XYAA 3KTCA 3M0HA 3M0MA 1XIJA 5J8LA 2I57A 4E3VA 3CWHA
chains in the Genus database with same CATH superfamily
2A3CA 4PTXA 1KFBA 4MJZA 3ZJ7A 2PU0A 3HURA 1XRTA 2OO6A 3S9ZA 3IIPA 3S46A 5FAGA 1G4TA 2V5KA 2OZ0A 3AALA 1XCWA 4BF5A 1VJZA 5F2IA 4JTGA 1T6MA 4XBSA 1KO0A 2OXNA 1EBHA 4LUSB 1Q13A 4RW3A 3M6YA 5CJMA 1E0UA 3MW7A 1EFZA 2DIJA 3PNZA 1B2YA 2PWDA 1L6WA 4EXAA 1AQHA 1AK5A 3EB4A 3K1GA 1B3XA 4ZFCA 2F9RA 4KGJA 4H9XA 2OT1A 4FPSA 3BZGA 3TSMA 2EHHA 4Z1DA 1VIZA 3PANA 4AX6A 4X61A 1V3IA 3QOKA 3VIIA 1R3RA 3JZEA 5CPTA 1AMKA 4IUGA 4O53A 1QNQA 3APTA 4AHQA 5AFDA 7TAAA 3O6DA 4WJ8A 5FL1A 3LENA 1H3GA 5A6LA 1E15A 3CGTA 4GQQA 2YXOA 1SW0A 2CBUA 3WH5A 3KVKA 4HVXA 4D1IA 5CCZA 2QCGA 1GW1A 3LGGA 4XK2A 4DVOA 2BX7A 1UH3A 2E3ZA 2H3DA 2J27A 4UZUA 3VE7A 5KITA 3GU9A 2YDQA 1YRRA 3I7RA 1JDEA 2IXUA 3C56A 5CPSA 2QUTA 3GVGA 3LHUA 4EOUA 3PJTA 3C61A 1MQPA 3EXTA 4JIIX 5F4WA 1FY6A 2BVTA 1X6LA 4NXSA 1OF6A 2VWSA 1TPB1 2YA1A 2J7EA 5HAOA 5FF0A 3QC3A 3FSUA 4JTFA 3GS6A 3T7VA 4CN4A 4ZE4A 4GRSA 1IR1A 4RNHA 4M7SA 1EJWC 1CT5A 3SUSA 1W3LA 4JHMA 4KS0A 2I16A 1TVLA 3GUWA 2E8ZA 2QDDA 1XPGA 2V0TA 2YZ5A 4TX8A 3G1VA 3SQLA 4UXDA 3W7JA 1LLZA 4B4HA 2PTYA 1GHSA 1Q45A 1G7VA 3UZZA 1XR2A 5D2VA 3ZS4A 1VF8A 2ZVIA 2WHMA 4MF4A 5D02A 1BTMA 3W2UA 4MUPA 2JF6A 4G56A 1Q2SA 1ZCOA 2OYKA 4JTTA 1S2WA 5K4XA 1EP3A 1B3ZA 1U5JA 3TNOA 2GQAA 1YYAA 2DZSA 3M0KA 4H2HA 5G2HA 1W5OA 4KCTA 2E9MA 5CBJA 3NZ1A 1K7XA 5HMSA 4WDTA 3DUGA 3AMCA 4MZ8A 1YE4A 1OB0A 3OPSA 2PP0A 4DBEA 4XAZA 1VJIA 4LU0A 1TPDA 3UESA 1C9WA 1ZPTA 3GAYA 1VFHA 1I6NA 1XLDA 3M0MA 4M6VA 3KP1A 3CJPA 2AMGA 4IIBA 4UOJA 1AQ0A 5HUPA 3ARYA 4QAIA 3CWOX 1U1JA 2C71A 1EGVA 3AUOA 4ILSA 3REQA 3ZT5A 3FJNA 3PUOA 1BVZA 1OFBA 3FA4A 4MIMA 5M5DA 3SCVA 1T40A 2Y6ZA 4C6NA 4IIDA 2OWWA 3QFEA 3WNOA 1V0NA 2Q8ZA 1HJXA 4Q4MA 4LUJA 4ONVA 3LK6A 2PPGA 3BV4A 1SZFA 1PIFA 4GUJA 2C14A 2V69A 4H6KA 3EX6A 4H83A 5FEZA 1E71M 5D9OA 3QV8A 1EHAA 3WL1A 3OLEA 6CGTA 5HQEA 2JEQA 1V3LA 2BHYA 2VC6A 2PFHA 2WSPA 4HA1A 5JBDA 4V15A 2J7CA 2ATMA 3D47A 3QY7A 2OOGA 2Q09A 1Z42A 3DFHA 5K2ZA 1B30A 3FIGA 1EL3A 4IL2A 3RILA 2X0YA 2DUZA 4JIQA 3MC5A 1IGWA 3RYSA 2ZA2A 3LERA 4M1BA 4N0RA 3S2JA 4ZTXA 1FCQA 2WJDA 4J3TA 1YQ2A 1GZGA 3TLLA 4EX4A 4LRSA 1PE1A 2QXWA 4IJRA 2OKTA 1JVNA 3OZOA 9RUBA 3TAOA 2UZ9A 2EPLX 1VBRA 3ZLFA 4AIOA 1OZMA 4XKYA 2YYUA 1K02A 3U4AA 3ARUA 3E2SA 1UASA 5BXPA 2DUAA 4GZJA 2NVAA 1Q6FA 4DUWA 1OBAA 2VEGA 1WE5A 3SCSA 1V3MA 2O9PA 5D2XA 2E6DA 1Q63A 3QTPA 3GVQA 1FP9A 4Q6XA 2WCAA 2XN0A 1JPIA 3KP0A 1JNEA 1FFQA 5CXPA 1JYVA 1CXLA 1XGDA 2P76A 4XKYB 1Z41A 5DMNA 4HA4A 2G0WA 1Q66A 3UA4A 1IT8A 4NZ4A 5EKYA 3EPMA 2Y88A 2VZOA 3TE9A 1O60A 4TO8A 3UG4A 2CLHA 3BLEA 4EPKA 3M0LA 2YA0A 2Z1SA 4FX8A 4IICA 1OK4A 1BFNA 1P6CA 3IS4A 3IJ8A 3NURA 1QVBA 3LHTA 5CC3A 5CBIA 1Q7QA 4GIEA 1G69A 4RX0A 3RMEA 1KTBA 2OYLA 5D9MA 2AGTA 4D8AA 3EX1A 3PSWA 4IMAA 4C6CA 1ZJHA 1XRVA 4ZXLA 4F2TA 5DX7A 2Z6JA 4Q8QA 4NAFB 1E40A 3UJRA 4CNNA 4QP0A 1M7OA 1EJRC 5LA2A 3BLLA 1EX5A 2OEJA 3S9YA 5BMXA 1KFEA 3TTYA 3TN3A 1XLBA 3G3MA 1ONWA 1SZGA 4I7WA 3H2OA 1XIJA 2X09A 1JCNA 1J6PA 2DSKA 3LCIA 5HDRA 1E4NA 1W8GA 2CZVA 2G5WA 2PC4A 4A3YA 4RR4A 4UQBA 4O8AA 1LG2A 3R2GA 5IHSA 4JKLA 1XKJA 3S5SA 4HA3A 2XN1A 3WQ6A 3NZPA 2JGQA 3AZRA 1WXJA 1OD8A 1NTHA 1PX8A 2XU2A 4QIUA 5G4HC 1QOQA 4YTRA 3GWQA 1NELA 3B8SA 1TPWA 4W4QA 1ZJBA 1OX4A 1R3QA 3U3HA 5AYBA 4CNOA 4DXVA 3G1RA 7REQB 4O4VA 1F61A 3MI3A 4MKSA 4XAGA 4IIFA 1CXFA 2G50A 4AWEA 1VQTA 3B9EA 3PAJA 1KA9F 1JYNA 1EC7A 4U3AA 3W27A 1T7LA 4CN6A 4WXZA 3WQEA 1TPUA 1L8PA 3GO2A 2VVSA 1RV8A 3AHVA 3WLKX 1UKPA 1WBJA 1XM3A 4HU3A 1KRBC 3QPYA 1KM0A 3SJNA 4UFLA 3AXKA 4TU1A 4NT0A 1JRBA 3TJIA 3CB3A 3U9IA 5GVJA 2FYMA 2WJFA 3MBDA 2J9YA 2OT0A 1XIBA 3FAXA 4KESA 4J3ZA 3WH7A 1NWSA 2CETA 3DDMA 2Y5EA 3QPZA 2XSXA 3U2OA 4WSKA 3UJFA 3CHDA 3BCDA 3JU2A 1ISYA 1JGIA 2WVVA 5BRBA 1G67A 3P6LA 3WL0A 2IKJA 9XIMA 4A3RA 3E0LA 4O12A 2HRWA 2WMIB 3VA8A 1KFCA 4XBJA 4DHGA 5FJUA 3GLCA 1TO3A 1P7TA 4GQ0A 3W23A 4BQ4A 4HTBA 3UCQA 2GDUA 4FXFA 1B1YA 1W17A 4QG9A 4S3CA 3TTEA 4PMJA 4ZL1A 3N2BA 3UR8A 4HSHA 4N9CA 2OEKA 2QJGA 3C2VA 1LQ2A 3AWNA 4AISA 5LNWA 1ZP3A 1EIBA 3DKLA 5G1TA 1VS1A 2DPEA 3FW6A 1LJYA 3SUWA 3WQPA 2D0HA 1E9YB 3VGHA 3KE0A 1PIIA 3WQ8A 2G96A 3SI9A 1PUDA 3ELFA 4MAVA 1M7JA 4IP4A 3GFYA 3N1AA 4DZHA 4I9JA 3CIXA 2AQVA 1XIIA 5BXRA 5JIWA 5FCZA 2ADAA 5SWUA 4GWEA 6A3HA 4LANA 5HMFA 1CLXA 3OA3A 1R8LA 2WLZA 4PMRA 5C0QA 3LHVA 4HPXA 4TXEA 4GNKB 4JFTA 4XZIA 4A4AA 3C0QA 4V1XA 1HN1A 3LXCA 4HMNA 3TLQA 4LC8A 3UU0A 1EGZA 1DWFM 1OEPA 4Y96A 3C52A 4XD4A 3NM3A 3A6OA 1L2UA 3ES7A 2CLMA 3LPGA 4AD0A 4HK6A 2BTMA 1SPQA 1JAEA 3U2ZA 2C18A 3PSVA 2PD9A 3QY8A 1UC4A 3GR7A 4KH2A 3GC2A 3CQJA 3A3XA 4CCCA 3FKKA 3DH7A 4RV8A 5GNXA 3BQ6A 4KERA 1PPIA 1Z6KA 2F6UA 2D73A 4EVZA 3VDBA 1Q7MA 5HNTA 5LKYA 1J79A 5CGMA 5LNSA 3C86A 1DQWA 4AX7A 1H61A 3QR1A 3KHDA 3NPVA 4GC4A 2SFPA 6ENLA 2VFIA 1BYDA 1D9EA 3S1WA 2FPVA 1CBGA 2NX9A 4R7WA 3LG3A 5K9CA 5HA7A 3TUUA 1E4IA 4FNRA 2QJHA 1AL7A 1TWIA 2AAAA 1UWQA 1XLFA 4J3WA 1GVOA 3U48A 4RJEA 1XF0A 3AXIA 3ZR4A 1G4SA 3E12A 1KBBA 2PODA 4JY8A 2GVGA 1O1ZA 1EUAA 3BLIA 3FDKA 4NL1A 2GJLA 4GMEA 1V02E 4QE4A 3OODA 4ZTYA 3MKKA 2O7QA 2YKKA 1D7FA 3MS8A 4A3HA 1TFVA 2VQTA 3NO3A 1VFFA 3O6AA 3HIJA 4LUIA 1J4EA 3MHGA 5F4SA 4YTSA 4JX5A 4PUWA 4ATLA 1W1TA 1OFAA 3TH6A 4UTTC 4S39A 3WDQA 5J5RA 2YA2A 2PURA 2J88A 1DJXA 1E9LA 2BV9A 2WZIA 2Y4SA 1MZRA 2I9UA 1SO6A 1TPC1 4GUIA 4IX0A 4DBSA 2IQ0A 3WLOA 4YCPA 4MG4A 2EKGA 3C5QA 4XX6A 4HPHA 1E0WA 1ISVA 2FMNA 5DCDA 3PK7A 1XIHA 1JZ8A 3DFOA 3EX4A 1MFVA 1GT8A 1FXQA 1WXZA 1DTNA 3S6DA 1XKYA 2HVMA 3QY6A 1XFCA 3EOSA 2CYGA 4B9ZA 2GFTA 4NQ1A 3L68A 1XSIA 2V2HA 1KM5A 1V0KA 3RN6A 1ZAIA 3F1QA 3VDCA 2PWUA 4ZO8A 1L6GA 2QMKA 1Q8AA 1F3WA 2V5JA 1SMDA 1E5JA 3B0UX 1UZ1A 3BPWA 1FWIC 3L4WA 3ICJA 3H21A 3SCRA 1FWDC 4MKVA 1LOQA 3LLDA 3PUEA 1HGYA 3L5AA 1I60A 2FZ8A 4Q4KA 2E25A 1K1DA 3A64A 4R5EA 3BXWA 2VM8A 3EKGA 2P10A 2E6YA 5BCAA 4IISA 3K30A 3HG4A 4XUGA 4GI6A 4AY7A 2ZYFA 5U7SA 4EK7A 5GNYA 2H3BA 3VNIA 2ACQA 4YWIA 3G3DA 4QBXA 1GVSA 2CLIA 1RBLA 3LTSA 3RLUA 4LY8A 1US0A 1A5AA 4JNZA 2WVUA 4DI8A 1QPKA 4MPKA 1PKLA 2WQDA 3N15A 4L1WA 1RA5A 3E02A 4RDVA 1GQNA 4UQDA 2WV8A 3AC0A 4JIHA 2FJUB 1E73M 2HXUA 5AHNA 2CPUA 1V93A 3M0YA 1LT8A 4UFIA 3W24A 4J40A 1Y7VA 2DZBA 3W1LA 4HN4A 1X39A 2OWXA 4LV4A 4HCDA 1EF2A 4KIEA 3KBVA 1KTNA 2BGNE 1WDDA 4LC6A 2X2YA 3M4HA 4W87A 3WLTA 3E5PA 2DT0A 3A4JA 1ZZMA 1XYBA 4QJ1A 4Y9NA 5XIAA 4H41A 2FVLA 4YXGA 2J4GA 2PDLA 2P88A 4GIAA 2GOUA 2QJMA 3UWUA 2DIEA 3N73A 2X1IA 1RSCA 3V36A 3S6TA 4B4FA 1LRTA 3PC0A 3ITXA 4LY4A 4M6QA 2FJKA 4BJHA 2W4XA 3FKRA 2FZBA 2UV8G 3UJ2A 1W54A 1H63A 3H55A 1PCKA 3W7NA 1AODA 2QDHA 4KPLA 4QDWA 3VX0A 1ONXA 1JDDA 4K1WA 3W00A 5DMLA 2WNWA 1BD0A 1R3VA 1HO1A 3S3GA 2J66A 4Z2IA 3GHUA 1ZTVA 1OC7A 2GK1A 2VC5A 5CAHA 3RPDA 4RNIA 5HNNA 1C3FA 3WQOA 2WCGA 2R91A 4IQEA 2BY3A 3FJ4A 2VJXA 3MUAA 2WWCA 1Q6DA 1MUCA 1XIMA 3GDLA 3TW6A 1PCWA 1TTIA 4I7VA 5IOBA 1RP8A 2I7GA 2GK1B 1OZQA 3PR2A 1T41A 3P3BA 1XLMA 3APGA 5E09A 3P0XA 4L9YA 1UUOA 2JQXA 4XISA 1Y5XA 4GVGA 1GW9A 3NTYA 2R1MA 1BSLA 6ALDA 4IQDA 2ZZ4A 1FVPA 3WF0A 4XD3A 1G4PA 3CHCA 3V0SA 3M0HA 3N6HA 4PMDA 4UBPC 1Z8AA 4FHAA 3O07A 5DEZA 1W5PA 1LT7A 3A47A 3VDAA 2ACUA 2HWGA 1ADOA 3OHIA 3OVQA 4P8WA 3HQPA 2YXXA 2REQA 4FOKA 3GU1A 1LOLA 1FWEC 3VOGA 1XIGA 2PZNA 1HF6A 3LV5A 3QW3A 2YZRA 4LYPA 3T09A 3W7IA 2VEKA 2F6KA 1BG4A 2CU0A 1MRAA 4X60A 7CGTA 4FX6M 1T5AA 5F2LA 3SN4A 2OSWA 2EBNA 1HO4A 5HQMA 3QGKC 3WLMA 1FP8A 1E9ZB 2D20A 4P8XA 4PMZA 2REQB 3CUJA 4ACZA 1S2AA 3R8HA 3SGUA 2R1LA 4R85A 4HYWA 3AMGA 1J0JA 4RXGA 4UCGA 4PMVA 3T81A 1XP3A 4Z1CA 2RDXA 3IIVA 3M5XA 4OV4A 3L67A 1EOMA 1TRDA 6REQB 2PDMA 4M19A 3FEMA 3CMJA 3B8TA 3NR0A 4Z17A 1RPKA 1OF8A 2ZX7A 1W5MA 4KIRA 1WZLA 3O63A 1US3A 3A4XA 1FWHC 2C79A 2XH4A 4ACZB 2PWVA 5HANA 2X40A 4C60A 1S2VA 3QKZA 1SW3A 1J0YA 4XO7A 1Y5VA 1DIOA 3OQ8A 4ICNA 4TTGA 1TWSA 4LAOA 3K8MA 4FK9A 4DX3A 4JFUA 4D6HA 4X2PA 2OWCA 4FZIA 4O28A 2HDJA 1GTHA 1NY1A 2DSUA 3BAXA 4GJ1A 2WBKA 2IXVA 2ZRYA 3IJDA 2V2DA 1SU5A 3VMPA 3CQ0A 5BXTA 4R3UA 4XZHA 2QCLA 1GZ1A 4HU8A 4M7TA 4AB4A 4ROQA 1WKFA 4HCHA 4REQB 1W1VA 2QHAA 3GH5A 1KBKA 3PJUA 1XLIA 5DMMA 1M68A 2O4MA 1BGAA 4XVDA 3M6DA 4CQ9A 3KZSA 1P5BA 3DIPA 4YHGA 2CESA 3THCA 1VRXA 2PA6A 1ZQ5A 3E0FA 1AVAA 4A8NA 1F5ZA 3W2JA 1A49A 1J6OA 3MWAA 1CGUA 2ABAA 3KDOA 1E0XA 4HOXA 4CN1A 3GXDA 4YJ5A 5AC8A 2QDEA 2D3LA 2NSOA 5A6BA 4H9YA 4LB4A 3I65A 1NOFA 1AMYA 3NFUA 4DWSA 2GQ8A 3N3MA 1UJPA 3MCNA 2C1GA 2HVNA 2CLOA 5E9AA 2Y24A 2I57A 1BTCA 4O17A 1JCJA 5AC7A 2F2KA 3THDA 1X97A 4GIRA 3CC1A 3DYMA 5EMKA 3FN9A 4JTSA 4PMQA 1EX1A 1OYBA 1SJAA 3QZAA 1N55A 5FEWA 2CLPA 4DWSB 3SY5A 2A3EA 4JTUA 2R1NA 3AICA 2O0TA 4AMAA 1Q6EA 3GR4A 1AD4A 1QI3A 4QLJA 4H3DA 1ZAJA 1UWUA 2Q6ZA 3S1GA 1I4NA 3WSUA 4LCSA 3JS3A 4FB7A 4HP5A 1YPIA 5HPCA 2A21A 4QLLA 1N82A 2XISA 4H7VA 1VD6A 1NFPA 1PDZA 2POTA 3VOIA 2WWDA 3T1GA 3FA3A 4HK5A 4OGZA 5B7YA 1MQRA 1XLGA 3M7SA 4WEVX 5PTDA 4DO4A 4MNKA 2Z26A 3CUIA 3CQKA 3GIQA 4A22A 3IVSA 3RX2A 1GQLA 1DKWA 4QE1A 1PTDA 5I3IA 5A69A 3PBYA 1ZBVA 2YOCA 3LB0A 2E8YA 5EMMA 3P0WA 1XGZA 4XKMA 3B9NA 1QO5A 1W3NA 2DH3A 2VEFA 2BGQA 3RNDA 2GGIA 3TZNA 2W5FA 5CC6A 4GABA 3A9IA 4C6KA 3N9RA 4MUZA 3DEQA 3HA1A 4MB1A 3EWZA 2Q8XA 3AIEA 2FTYA 3ES8A 4QSHA 1KQYA 4DLMA 1RD6A 4EAMA 3GKFA 3MVIA 4LFYA 1JPDX 2JF7A 3NL3A 2PDFA 2E5DA 3CO4A 3NZRA 5AYIA 3G2GA 1OIFA 3W53A 4DAIA 1K9TA 4K8EA 6XIMA 1WNOA 2W3ZA 1AJ2A 3KVMA 3WNKA 1R9ZA 2VDIA 1YXCA 1J0ZA 1GEHA 3LCHA 1YTKA 3TKFA 2DW7A 4M8UA 1O5QA 4QJ3B 1EC8A 2DT2A 1B31A 1NJJA 1B3OA 3H4WA 1X1NA 1LOSA 1EDTA 1W9XA 3WF2A 1UYQA 2AAMA 2DZWA 3LPPA 3TMLA 1IHIA 4HPNA 1UD5A 1XFBA 3AZTA 1BRLA 4JCMA 1Q6GA 1GOMA 4FNQA 1M53A 2R9RA 1KXQA 1BEUA 2EPMX 1UWIA 2RUSA 4IIGA 3OG2A 1TTJA 1QPOA 3BLFA 1XYCA 2IPJA 3RUBL 1G1YA 4XAPA 3NL6A 3PULA 4K36A 2PZ0A 3VNMA 2V82A 3ARZA 1FWFC 4BK9A 1GQKA 4GQGA 4WQ6A 5HATA 1BXNA 4YMZA 2P0OA 4DI9A 2P1FA 3Q2DA 5AC5A 1KXVA 1BRLB 3N9KA 1NQ6A 3S47A 1WB0A 3I4EA 4QS5A 2UY2A 1FDJA 2I9EA 1G7UA 2E0PA 4CU6A 2PCEA 1JDFA 4L4MA 5BRQA 1VPXA 4B9YA 4I90A 5K7JA 3MYOA 4N2YA 3M5YA 8RUCA 2FMOA 5TAOA 4Q3MA 1M5WA 3WBYA 4HU4A 3UR7A 3GAKA 3O15A 3MMWA 4HHMA 4NAEB 1YPXA 3W1QA 4PB4A 1F76A 3CUFA 3B3DA 4TMCA 3CUXA 3G1AA 1VBJA 4IPIA 1J5TA 1P0KA 1PEZA 2GLKA 3W7EA 1FKXA 3I6RA 4H6EA 4AC1X 1DE5A 1EIXA 1N2VA 4PH6A 2UWFA 4FSAA 4B5WA 3IAQA 1V51A 2B7QA 1E1FA 3S4TA 2ZDSA 3KOWA 1TMQA 4GO8A 2GSJA 3VNLA 5T91A 1UBSA 3S2LA 2I5QA 3AS1A 2GQ9A 4MWAC 1PSCA 2HK0A 3MTWA 1QFEA 3L4VA 1CGVA 2VYOA 2CHNA 2V38A 4M82A 1TWDA 2A4AA 4XAFA 1NVMA 2PDWA 3MANA 4DYEA 4JXCA 1PHQA 3R12A 4PL2A 1JQXA 4FNUA 2B31A 3CT2A 4Z2GA 2XFFA 3DGRA 1CZ1A 3NG3A 4TX9A 3IRSA 4E3VA 4MTVA 3QHNA 4R34A 2P3ZA 4ES4A 4O8RA 3ARPA 1EDGA 3TNBA 3BJTA 1EQCA 3AWOA 1A0CA 2CLLA 4PN2A 2BSLA 1HKIA 4H9VA 5LA1A 5G5IA 4U4MA 5K9XA 3VPLA 4PUMA 2XINA 1FH9A 5LIKX 3BCFA 3GSMA 3W70A 4NVTA 1BYAA 3W83A 1OD0A 3AXHA 2GQ3A 2W66A 3M0IA 3W1XA 3FSTA 2FB3A 1I0DA 3BAKA 3GTHA 5KSWA 2V2CA 4S23A 3STGA 5E9XA 4DM2A 3NEHA 4JX4A 3W25A 1XBVA 1OG0A 3ITGA 1S3TC 3PUDA 2AMXA 1E4MM 1OIMA 3SRDA 1JZ7A 1RHCA 1EXPA 3ZFHA 1QNRA 1SFSA 5ECUA 1U2YA 1PX4A 1OJXA 3WO8A 1FWGC 1Y65A 4R7JA 4E3TA 2J7GA 3DC8A 3RLGA 1WDSA 4JYFA 2XSAA 2ABBA 4K2SA 5TIMA 2CHOA 3IJQA 4BQ3A 1UQYA 2ZWYA 3VABA 1BKSA 1IEWA 1J0IA 2XH7A 3MKVA 3W2LA 4MLJA 4H2CA 4GBDA 4IMEA 1MNSA 1W8SA 1Q7ZA 3KRBA 2YW4A 4H8VA 2DQXA 4ALDA 4KCUA 3WQFA 1HVXA 3RIKA 5H2ZA 4JEJA 3DI1A 2NSXA 3SCNA 3URQA 1AL8A 3KOZA 2PDKA 3MZNA 2DZUA 4J2MA 3RLVA 4ZOAA 1SO4A 1EJUC 3F5LA 2YR1A 1UR0A 1WUEA 3BGAA 1AQMA 1BYCA 5C2CA 4O0KA 4LF1A 2H9AA 3VD7A 1M9HA 1A5KC 4R53A 5CPQA 4XV0A 3EKLA 2KAUC 2TYSA 4ZXOA 1G5AA 2E4TA 3IGSA 1F07A 1M01A 2CXGA 2NX1A 3EDJA 4OTKA 3AYRA 3VC5A 4FLOA 1JUKA 4AD3A 2FTPA 2X8RA 4IQJA 1EYEA 3F4WA 4PTMA 1R9YA 4GY7A 4PEEA 1LG1A 4KW2A 1OG6A 2QCFA 4JPGA 3T0DA 3M41A 3L65A 2H9AB 1C7TA 2Z1BA 4LVDA 2Y8UA 1FWTA 1EZ2A 1HJUA 2FZ9A 4W8BA 1EEXA 3W7DA 5F7UA 4L65A 3W1RA 4LV9A 3NQFA 1OX6A 5A6BD 3VTRA 2V8ZA 5FJOA 4A3QA 1H49A 3SIMA 1N7KA 2GJPA 4DWSD 1XC4A 1B9BA 3ANYA 4YTQA 3BW3A 3LPOA 2VEMA 4XBKA 1VFOA 3SN0A 1TMLA 4W85A 2YJQA 4GFIA 3ORWA 2CEQA 2WMKA 3DYOA 2VXNA 4W86A 4H9MA 1DJYA 3W6MA 4GPNA 5BMWA 2EEXA 4W93A 3G77A 1JCXA 2GSEA 1XUZA 3B97A 2PDXA 2QVHA 3CZ8A 4OKDA 1VCFA 3E9AA 4Z1AA 2IKGA 4PRTA 3A5VA 3POCA 2VRKA 1B3YA 2RJGA 4PMXA 4YHEA 2DU2A 2H8XA 3CV7A 1Q6RA 3HU7A 4GCAA 3UNDA 1U83A 4TQTA 2HPIA 3W7CA 5KMYA 2ZICA 1I2OA 3BV7A 2OU4A 3FYYA 5EMLA 3GY1A 3AROA 3GNPA 4PBEA 1XHGA 2PC8A 3KEHA 3TOPA 4BWLC 4YN5A 4PL1A 3SW6A 3VIFA 2NLYA 4DF1A 4GYKA 1A50A 4B5XA 2W61A 3BUVA 1IQ8A 1T96A 5D4YA 4S3GA 4M0XA 1VYPX 4P7QA 1HKWA 1XCFA 1OABA 3EOOA 3FJLA 4MHBA 2Y63A 4TR9A 2QCCA 3AFBA 4I7UA 4PMYA 1KD0A 2ZC1A 2PGWA 3LOTA 4BZYA 3ME3A 4DZAA 1UWRA 5IXEA 4TVCA 3FGCA 3LTPA 3JVAA 3RCYA 5T9CE 3WD3A 1E0TA 1MMFA 1H1ZA 1FQ0A 4IJCA 1W3HA 3PTQA 4QHRA 4S3JA 1GOXA 1A5SA 4E2BA 1OY0A 5I3HA 3WD0A 3PBUA 4ZQNA 1JZ4A 5EBAA 1ZAHA 2XIOA 4O14A 2FQIA 4JDYA 1DBTA 4H6QA 3FYPA 2YGYA 4H4IA 2YIHA 3E96A 3KLKA 3GNNA 2GL5A 4OBTA 4C5ZA 3T0TA 4O0QA 3TN6A 4IOTA 2RH9A 4H8NA 3O6CA 2ZX5A 3CH0A 2BVYA 1ADSA 2YCEA 3VKJA 3DYPA 3I10A 3FVDA 5I0DA 1GKRA 4OQVA 2V3DA 2CLKA 2ZKMX 4W5UA 4QX4A 5CGTA 4JN8A 3CQHA 5EYWA 4MDPA 3VOCA 3UZJA 2FDSA 3L2LA 1Q4WA 4U33A 4TV5A 1VP5A 3UWQA 5M2FX 1DXIA 4ACYA 1HX0A 5IBXA 5K3VA 2E09A 1CGWA 3NJ3A 3W88A 3SZ8A 5LHFA 1A4LA 2A6LA 2ON3A 2HSAA 1LQ0A 3WDRA 3RDKA 4L9ZA 3AIUA 1OQFA 2WZMA 3GVRA 4DM1A 4IPPA 2WHJA 2WK2A 5A8GA 4Z2LA 1ZJAA 3S1XA 2OG9A 2RGLA 3T0BA 4DJEA 2E67A 3OLDA 4JNYA 1TTQA 2BY1A 1XJBA 1O95A 1L6FA 5AZ0A 3W3OA 3ZR6A 5IM51 3L21A 4ATDA 1QNSA 3W73A 1A80A 5MF5A 4QM1A 1DJWA 4QQ3A 3BAJA 3RCMA 1XL9A 2ZXQA 4Y8FA 4QS6A 5IBXC 4RZ5A 3GHTA 5E0FA 4R9OA 3FYOA 4A29A 3M44A 1WV2A 3W74A 1QR7A 1GVQA 1TB3A 1JG9A 4WGHA 3V0UA 4DJEC 4ZBCA 2H8ZA 1F4HA 4QCEA 4IMFA 3RF9A 1MFUA 4OFCA 4ZCWA 2FGZA 4Q4SA 2NXHA 1LWIA 4K8HA 2VDGA 1VBGA 4DF0A 1CYGA 3S5NA 1ONRA 4X9YA 3OP2A 2ZZ3A 1LTDA 1KCLA 2DV0A 3C3UA 3THUA 1SZRA 4JX6A 4TIMA 3E38A 1SYTA 4Y6GA 4CEXC 1UW9A 1N8FA 2QGYA 1X6UA 1A0DA 4I8DA 3LLXA 4Q4OA 1PKMA 1R7OA 1YTDA 3R6IA 1XQLA 1YDNA 1OADA 4H8HA 4Y7EA 3STFA 1IT0A 5JBEA 4YNGA 3F7JA 4YVPA 1XIDA 5LZLA 1TJ0A 3AU2A 2VO5A 2DVUA 3O7UA 4H6RA 3SCUA 1QTWA 3GR8A 3A24A 4IPNB 1BXBA 3UETA 3EAUA 3WBXA 3BLKA 2GVJA 3NNTA 3MMDA 4FI4A 4PTNA 2A3LA 5FF4A 3QM3A 3CUZA 3OVGA 1JIBA 2XH2A 1U22A 4GA8A 1SJCA 3WUFA 4PMNA 1E6SM 4Q8WA 1TPFA 3W02A 1DE6A 1LCOA 1LL6A 3T55A 4AZCA 1O12A 1KRMA 4N7QA 4L7ZA 5I06A 4ZFMA 2KZHA 1JPKA 1SW7A 3MSDA 3CL8A 1D3CA 3QH2A 2D2HA 4FP1A 4J3XA 3WMCA 3CL7A 3YPIA 2W27A 4YTUA 3W81A 5I77A 3ZR5A 4XSLA 3NM1A 3BZJA 1A3XA 1AJ0A 3DN5A 3BARA 2CZ5A 5ECVA 5FL0A 3W9ZA 2YL8A 4AZIA 3S1VA 2INEA 5HOSA 4AZCB 2GJXA 3B8DA 3PPCA 1W56A 2QQ6A 1RALA 2VI0A 2ZTJA 5CAKA 2ISVA 1NDWA 3NO1A 3LN3A 3GDRA 3MDUA 3HMJG 3WBAA 4AVOA 1E1CA 3MVTA 2IKHA 4ADSA 4JL1A 1FWWA 3K4DA 3W7GA 2J7FA 2WNZA 4ECLA 3UNTA 1GG0A 2PRHA 2WMHA 4A2RA 2OJPA 1JCMP 4LCQA 4UFKA 1FHLA 2HEJA 3Q65A 2VCBA 3BC9A 4F40A 4PMOA 3NL5A 4N42A 5C9UA 2FH6A 4H01A 1BLIA 2NZLA 3VOFA 4KWUA 1E1CB 1K9FA 3VIGA 3F03K 4C6BA 1UMYA 1RR2A 1PIGA 1EUNA 1XYFA 4GI8A 3NQDA 5LNRA 1TQJA 1AZ1A 4C5YA 1TCDA 2FZNA 3WCZA 4HZ6A 3UZ5A 4HMEA 1UA3A 3PZ9A 1HVQA 3KBSA 3W7RA 3WFAA 1OYCA 1C8XA 3NGJA 3DENA 4Q8MA 3QV6A 3NVDA 1LF1A 3AAMA 1P4CA 3II1A 2QCEA 4NYYA 1KQZA 5FSEC 5C2GA 3VD5A 2WYSA 1YBQA 3I3DA 3LYEA 4XD6A 3FFSA 3IV3A 2BXVA 5JH2A 1EH9A 3TC7A 1GCYA 1G94A 2VD9A 4O16A 2NX3A 2VTFA 2HK1A 2PP3A 4EPDC 2E5BA 4MY1A 3VCNA 3XIMA 3UBPC 1D8WA 1SVDA 1FHUA 2XHYA 1RP9A 3HJEA 4HSNA 2PTXA 2X0HA 1Q2RA 1UR8A 3CT7A 2J7DA 1M1BA 1E9IA 3H53A 1JZ2A 1H2JA 1CLVA 4GX8A 2YSWA 5CG7A 2F2HA 2JIWA 1S5TA 2CBIA 5D9NA 4DB7A 5I02A 1O7AA 2RKXA 1GVEA 3MUXA 4DEFA 2A7RA 4GYJA 4FX7A 3VNKA 1SJBA 3F5KA 3KL3A 5GPRA 1SUXA 3U0HA 3JZUA 1KCXA 4US6A 3WDIA 4OE7A 5G1MA 2OLSA 2BOEX 1FDYA 1IWAA 4G1KA 2G3IA 3B8IA 3IGHX 3Q37A 1W1YA 3TA6A 5DT5A 4NF7A 2PWGA 1OFEA 5FACA 3OOQA 3OBKA 3K46A 1XISA 3D46A 4IP5A 2JKPA 3B9AA 3EOEA 4WKHA 1JQVA 3VKKA 3OGVA 5I09A 1H4PA 3GXPA 3RITA 4I5XA 1QT1A 1XSJA 2XZ9A 5J04A 1HW6A 4GG9A 3LMZA 4B5VA 1YW1A 2XVPA 1AUSL 4QFUA 1V6YA 2LLEA 3I7SA 4MNLA 2J6XA 4GHRA 3NQMA 4OUEA 1MDLA 1TKKA 2VKZG 3LRKA 3V3WA 5AOUA 4DUOA 8XIMA 3IK4A 2QZRA 2CBJA 4BR1A 3DBNA 2UY5A 3WY1A 4IFKA 4WX2A 5FSDC 4JTDA 1WO2A 3ZLHA 3AHXA 3IIZA 1QNVA 1LWHA 2QF7A 3CPUA 2J25A 3IUIA 4DQWA 3QJAA 1MWOA 1HP4A 3BMWA 2JALA 2GJRA 2VEIA 3ZZ1A 2EF9A 3VOJA 1W3JA 3HQNA 3PTMA 1TSIA 4KCWA 1Q3NA 2GGHA 1R2RA 1AW5A 1FH8A 2OZTA 3QR3A 3DX5A 2ESCA 5F4XA 4AD5A 3FS2A 1V7AA 2B7PA 2PDCA 4G7EB 3DFTA 3HN3A 3ONBA 4IFKB 3VNZA 2F7FA 2Q3OA 3OLGA 3BGGA 2J6VA 3BLDA 3LHZA 4JNMA 2GPTA 2OO0A 1HL9A 7PTDA 5JVLA 3UVAA 1Q6LA 2G4JA 1MW3A 1AW1A 4CNUA 5JU6A 2MANA 2EGZA 1WOBA 1A5OC 2YYTA 1B5TA 1JPHA 4PTDA 4BI6A 3P84A 4HCLA 4Q4RA 3VU2A 1W91A 1CEOA 1VEMA 2ISFA 2PU1A 1F8IA 2DZTA 1V03A 3R89A 3RRAA 2OMAA 3UXDA 4J3UA 1HXJA 1GQIA 2OFJA 3U57A 3VIJA 1RZMA 5EBUA 1B3WA 4DJED 1FHDA 1UOKA 2PBGA 4C6PA 1XXXA 5CJNA 3P74A 3CAVA 3GFXA 5XIMA 1TV7A 2XDFA 3GC4A 3QFWA 1L6SA 4AH7A 5DT7A 3A12A 3N6QA 3DG6A 2PB1A 1WKDA 1ZBCA 4NZJA 4QR6A 3F2DA 1ISWA 4O50A 5KTLA 1H51A 4HJWA 4CEUC 4GYPC 3VFLA 4AHOA 3H6OA 1BAGA 4E2OA 2QVNA 1E1EA 3AISA 4Q7NA 4XG1A 3BOXA 4QQUA 1TA3A 4R88A 1XRFA 3WEOA 3AYTA 2ZRUA 1MNZA 9CGTA 3QF0A 3NL2A 3WN6A 4XQ6A 1OSEA 1LRNA 4GIYA 3NQEA 4QE5A 3KOYA 1A5UA 3NEVA 3CL6A 3CB8A 1RPXA 3I68A 2C0AA 4NX0A 3GHRA 3M0ZA 2OQHA 1WQ5A 2Y0FA 1DP0A 4TVDA 4DLFA 1V6WA 1TA3B 1UMLA 4B5NA 3V18A 2WKJA 5F2GA 3BG9A 3O6YX 4EP8C 5CLTA 1K6WA 3N11A 2PLCA 2FFCA 1J10A 5DXXA 3HF3A 5A8MA 4HPJA 3O06A 1RK5A 3CZEA 2WC3A 3KCLA 4IGMA 4GISA 4Q8OA 2J8TA 2YCJA 4GGHA 3VUPA 1AA1B 1A53A 1SM9A 1QWKA 3W1UA 3UCDA 3WYZA 3WBEA 3FY1A 1MUMA 4AY8A 4HNNA 3PWIA 1LLOA 4B90A 1EF3A 3IV8A 3H7VA 4M6UA 4AIEA 2X1RA 1E56A 1D2KA 4H9ZA 3GW3A 1FFRA 3G1DA 2O9TA 4HZMA 2CLFA 3NDZA 1P0EA 6TIMA 3UWYA 4P7OA 1DXFA 3E2QA 1OGSA 2V5BA 3LNMA 1W37A 1JD9A 3QBUA 1NF0A 1QRQA 4NIRA 1W9DM 3UJEA 3WK3A 3A3WA 4XZNX 1S5WA 1X6NA 4ZSTA 4QJ4B 1OVDA 3H54A 4AUBA 1N8IA 1UPMB 4HPGA 4FF7A 4UTFA 3BWWA 2PWEA 1SR9A 5D05A 5HXMA 2QCDA 1HUVA 2P3EA 3UD6A 1MZHA 4CLMA 4C7FA 2QULA 1PHWA 4S3EA 4LAZA 3VZZA 4Z42C 3HTWA 4P7LA 3G5EA 4IIEA 5AC6A 1XYAA 1E6NA 2B0MA 2CLEA 4CGTA 1NDVA 3WK0A 3ZOAA 3W71A 4GACA 4YVVA 1A3WA 4UR9A 5FEXA 4RDYA 3PM6A 3G6LA 1GPFA 4QRNA 2H90A 4GH3A 4HSOA 1KFKA 4NXKA 4DPQA 4DZ5A 4E4UA 3OVPA 1QATA 3SUTA 1JFHA 4KT2A 4V27A 1K4GA 4EKJA 5JBFA 4LYKA 3DHUA 4EXQA 3GG1A 4K8GA 4MM1A 3P61A 3R0DA 3RFAA 5L9FA 3ZLGA 4J28A 4CKQA 2OKOA 1F6KA 5FF2A 4PEKA 1DHPA 4QGCA 1ISXA 1U1UA 2CKSA 1CI1A 1QDSA 3RO8A 1GONA 2XM2A 3OZMA 3MO7A 2PRLA 1DVJA 1NWTA 2RHGA 4LBRA 3SRFA 3OTRA 2DDXA 2WANA 3HGOA 3VDGA 1ITCA 1CENA 2XVGA 3VM7A 2GGEA 4Q32A 3UR2A 3LRLA 2VZSA 1KFJA 2OLHA 1Q8JA 2W63A 3HO8A 4D8ZA 4A3UA 3W75A 1IXNA 2FKPA 3Q58A 1QW8A 2YBTA 3COTA 4AXNA 4JAWA 3C2FA 1V02A 1MEIA 2DSVA 3DGBA 1TV4A 4LBSA 4JDBA 4ZE5A 2QS8A 5CGQA 2I56A 4RV3A 4NY2A 3P14A 2VX6A 3TXZA 3HJZA 1YDYA 1R5YA 3TQ0A 5CPNA 1MW2A 1H7XA 3MP3A 2DJXA 5D9PA 1RCQA 5ABFA 2H6RA 3GBEA 2R24A 4F9DA 1LWJA 4EWJA 3HV9A 3MO4A 4PB3A 1HZYA 1NARA 4UNKA 3T08A 1POJA 3AIWA 2PS2A 3U7VA 3P80A 4C65A 1Z9AA 1VFSA 3K8LA 1BKHA 3N2XA 1O66A 2XPKA 5I00A 3ITCA 3P82A 1HL2A 3VNDA 1KGXA 1Q6QA 1TMHA 5AHEA 3W7MA 3DU0A 7XIMA 5A6AA 1KM6A 5ABFB 4FOJA 5CG0A 4IMGA 2D1ZA 3HG3A 2V3GA 3MMTA 5XINA 3U2EA 1ITQA 3EDEA 4GKTA 3OJGA 4RNFA 5A2BA 3PBMA 3P67A 3E49A 4LT9A 2ACRA 4W9TA 3FEQA 2G3NA 4WD0A 3U8GA 3QMTA 1M03A 4V33A 2OZ3A 4QTGA 4NKCA 3WENA 1EWDA 3W2KA 1QWGA 3MB9A 3RRXA 2VC9A 3TTOA 3S5OA 1S5NA 1XRSA 1QHOA 4S2BA 2XWDA 2F8QA 2ZRXA 3XISA 4CD8A 3WEMA 1AW2A 4O1AA 4OIFA 1ODZA 3ISIX 2F61A 4LYQA 2XIIA 2NUYA 1QNOA 2YCLA 3OVRA 2Q8LA 2XIBA 2WMFA 3K13A 1CPUA 3TXVA 1UH4A 5I3DA 4KFPA 2ASHA 5KZMA 3GTXA 1MSSA 2CIPA 1J12A 2JK2A 3LI0A 1TCMA 4Y90A 2OSXA 3R58A 1XBYA 3H12A 1TR1A 3ZIZA 2ZX9A 4A05A 5CZTA 2HJPA 1B57A 4JTIA 2A79A 4D6GA 1VBHA 1GYLA 4UCFA 4JN7A 3V5OA 3WQVA 4M6PA 5BZAA 4ZB2A 3TK7A 1I8JA 2YCLB 3O2LA 1VCVA 4ZGYA 2RDTA 3MHFA 3G18A 1E3ZA 4DF2A 1GZJA 2JFEX 2BXYA 3V75A 4HOWA 3QSTA 2D22A 3AQUA 4NZ3A 4UMBA 2QJNA 3VMNA 2A6NA 4RNJA 5H1WA 1NAL1 1K8YA 4EIVA 1Q6CA 3WJYA 1TVNA 3KRZA 1G9HA 1QCWA 5D2WA 1GOIA 4H1ZA 3B03A 2I17A 1ZP4A 1DYSA 4PRWA 3QV7A 4E2VA 4FA3A 1IE7C 1UR9A 3EBVA 4Q33A 4DXKA 1JZ5A 2Z1WA 2XIQA 3KBMA 1UP0A 5EPDA 2HV5A 4NG3A 1V77A 5M3WA 3BAYA 3ITYA 3LV6A 3CAKA 1Q65A 1V79A 3ARQA 3DFNA 1XIEA 1RK6A 3VX1A 2NXGA 5I3FA 2WMGA 3QMSA 2E28A 3BMXA 4GZ7A 3W86A 2IMRA 1KBIA 3R1ZA 1VRDA 1AH0A 4C1NA 2HNHA 1L8NA 2TMDA 5AKQA 5F2MA 1XD0A 4L5ZA 3WLHA 2FB2A 1YXDA 5EFDA 3BLPX 1S5VA 1W9VA 3BW2A 3B05A 2INFA 1FUYA 1KV5A 4PMUA 5I3JA 3O3RA 1ISZA 2DQWA 3AJXA 1V3KA 1XWYA 2PDPA 4AEEA 3U6WA 3BTNA 3L2MA 3QC0A 4JTLA 5EY5A 1U5VA 3BMVA 1LROA 3MJMA 3T8LA 1M3UA 4C1NB 2TODA 4PE8A 3NZGA 2PP1A 3NSMA 1BHGA 2CWXA 1EPXA 1A5BA 3CASA 1OCQA 1FWSA 3G22A 1VH7A 1EDQA 2W91A 3RJXA 2QAPA 2Y1HA 1GPWA 3AHYA 2DJLA 3LSCA 2XVNA 2PF0A 2NW0A 4XWUA 4TV6A 3QV9A 4AIUA 4MFEA 2HVOA 4LRTA 1DJGA 1KNWA 2E77A 3KL5A 2PAJA 3V1HA 1QPQA 4X0VA 4NAFA 1X8CA 2CKRA 2Z0IA 1YPFA 1JUEA 4O1BA 2ZVRA 2VGBA 2P53A 2F84A 4PCPA 4RE2A 4UTLA 2VD8A 3HFTA 1B9ZA 1WZAA 2XGBA 1GVYA 2XGIA 1VEPA 2CW6A 4S3KA 1LZOA 3U4FA 2DP3A 1G01A 2XIJA 3W6YA 5FAJA 3R94A 1JRCA 1B0IA 3NQCA 3KDNA 4AD2A 2E1WA 2C1HA 1H62A 3ARWA 4WUIA 1GJWA 1I1WA 2DFAA 3R8GA 1X8FA 3TR9A 3WNNA 2NQ5A 1AJZA 5DMYA 5KEZA 4EANA 4IUOA 2A3AA 3WLNA 1XDMA 1JI2A 1VHCA 2Z4GA 3L66A 1C8YA 3WD2A 2OVLA 3B9OA 3EWBX 1DXEA 2PLMA 3WH9A 4UTJA 4MB5A 4O1FA 3MV01 1ZB5A 2XSBA 7REQA 5EMUA 1OC5A 5CKSA 1TVPA 2UBPC 3UG5A 3MI2A 4CNTA 3KS6A 1V3HA 1JFXA 3PP7A 5T9BG 1J11A 3ZWTA 2IW0A 2P8BA 4KMQA 1U1HA 3LCLA 4NJJA 1EQPA 5CH9A 1GK8A 1S1PA 2Z2BA 4YS1A 5I6SA 4Z0JA 4E8DA 4B92A 2ATSA 3T78A 1NSJA 4UZSA 3W1PA 4GGBA 1KRCC 3VM5A 4A21A 2HS6A 1XLLA 1ZY9A 2QF8A 3L0GA 1AH4A 2WPBA 3NSNA 1XV8A 2A7PA 3BO9A 4IHCA 3ZSTA 1E51A 3JRKA 3MUZ1 2PF8A 3TWBA 4B2DA 2HCVA 1IXQA 5U4NA 4G1NA 4B16A 1KR1A 4JZ5A 3KBJA 4C7DA 3GDMA 3UWWA 2VCAA 2WMIA 1C8QA 3VKAA 1VLWA 3EEGA 3CYJA 4M24A 2Y7FA 3BJFA 3GZ3A 2Y7GA 3NXLA 4IM4A 3W7KA 2DZPA 2VUNA 1V6VA 1M41A 4U28A 4WCJA 2GUBA 4AXKA 4PUUA 2Q3RA 2X30A 3CH9A 4LOCA 4GX9A 5HINA 1O1HA 2G8ZA 4GXMA 3HOJA 4IT1A 4AF0A 4ZO7A 2ZZ7A 4ZQRA 4CVUA 2HROA 4GO9A 1GWJA 5LA0A 1BSIA 1ME8A 1DEDA 4AVNA 4D6JA 3IJLA 1IZJA 3C8FA 4AY1A 1JXKA 3ARVA 3GG8A 3GX9A 2D3NA 3W85A 4HZ8A 1KV8A 4MJ2A 3IRDA 3GVVA 3FK4A 3UZXA 4AF0B 5DELA 3AO0A 5CZKA 2QJIA 5BOFA 3NSXA 3PBWA 3M0VA 1XLHA 1RAKA 1OC6A 4FMVA 1WA3A 3MA8A 4XIAA 3DHDA 3KZPA 5D03A 1TZZA 4Q8UA 2YL9A 1RVGA 3SUVA 4HK7A 3O1NA 1J9YA 4DN1A 1VCGA 4UIOA 3L4ZA 4CCDA 2WCSA 2PRMA 3UCCA 1GKQA 1DHKA 1H0GA 3T40A 1W1B1 1UZHA 3IGUA 1PZ0A 3N13A 5DFAA 1DWHM 2NWRA 3G0SA 4AWSA 2JGYA 4C1KA 4A35A 1DJHA 4P2VA 4RKAA 3KVLA 3QYSA 2BGSA 2FVKA 3R4IA 2UY4A 1JEZA 2V63A 1GVRA 3J7HA 3W1MA 3VGBA 5DCEA 4AHPA 5LIWX 1JL8A 2A85A 1UC5A 4C6OA 5E1QA 1RCOB 1TX2A 4WOZA 1YDOA 3B8UA 3HM7A 3OO2A 1HTIA 1V6XA 2VRQA 3LZ3A 1GHRA 3RHGA 3PBGA 4J27A 4I9TA 3C2EA 2BHZA 3EWUA 3EX2A 2VUYA 2I5GA 3TJXA 2ISWA 4C6MA 4E5TA 3CU2A 2DW6A 4OV9A 2PD5A 1FWCC 3GHSA 3I3BA 2EG7A 2YXGA 1HIZA 3EDDA 4XZWA 1QHZA 4ERAA 1KLZA 2YBVA 5I07A 1VAHA 1EKOA 4CNPA 3LCXA 4JN6A 3H22A 1DJZA 4ERIA 3W7PA 4LF2A 5A2AA 4DJDA 3P60A 4W84A 1P6BA 3TX9A 2A0NA 2XUCA 3SY8A 4NZFA 1GJUA 3OW1A 2GDQA 1GYMA 3NGFA 4JTKA 4OBSA 3HB9A 4JCLA 3VGEA 1GUVA 1CB2A 4M80A 3B0VC 4HB7A 4WJXA 2PDYA 5AHLA 3N12A 3PJXA 5BW6A 1R7AA 3PZQA 4JOMA 4IPLA 2OR2A 1QAPA 3LBCA 4C90A 1BXCA 5BU9A 2G3JA 3LQLA 3MYPA 3ABZA 1N8WA 3STPA 2O56A 2A5HA 3DFQA 1PV8A 2OGYA 5AHIA 2WHKA 5BYWA 3BSHA 3RMJA 1WDWA 1UOZA 4LGXA 1F05A 3AIBA 1POKA 1DQXA 4XZBA 3H70A 3IUHA 4I8YA 2G3FA 4BA0A 1JD7A 1RJRA 1OM0A 3VIPA 2EJAA 1YX1A 3VINA 1ZUAX 4AVFA 2V6AA 3UA3A 1UWTA 3M47A 2ZC8A 1S38A 4YYFA 1B3VA 2YB1A 4GINA 1LBLA 1PYMA 5BOEA 1XLCA 4JEQA 3TR2A 3H2MA 2QCNA 3MSRA 3MP5A 1F6YA 3IARA 1BQGA 5T26A 4CQ8A 4F2BA 1UP2A 3GBDA 4UFMA 4GZIA 5C7HA 4ZOBA 4LWWA 3DESA 4LJ3A 3WLPA 5CPMA 1PTGA 4MGGA 4BCEA 2BHUA 2DT1A 2YDRA 2EJ1A 2QCHA 1OFDA 5C54A 1EGMA 3SADA 3CK5A 2I1OA 2BLEA 4JGDA 2E5CA 3ABOA 2D0GA 3NAVA 5BROA 4L4OA 1NH6A 5TQLA 4KETA 3LTYA 4FNPA 5FD0A 1QK0A 3TMQA 5DXYA 5DANA 4JTQA 2ZDRA 2GZXA 2V5DA 1X98A 2IPFA 1PWLA 5B7ZA 3WJSA 4FLSA 4ZZ9A 3AIQA 3LGDA 4L6HA 3POHA 1H7WA 3VE9A 2NV9A 5DBTA 1VFUA 2QUUA 3SN1A 3WDPP 3LD5A 2PBOA 1S2CA 4OZOA 3R0KA 4HU0A 2QIIA 4AZ7A 2D2GA 1I2QA 3O0KA 4XZLX 1W5QA 1XINA 1WCGA 4CQDA 2VELA 4UQEA 1WUFA 4CQBA 2ZZ6A 1DWIM 1THFD 2W92A 3WQWA 2XFYA 3ZT6A 2QW5A 4GYFA 4LVBA 4R27A 4KWSA 5I24A 1PZ3A 3IJ6A 1GKPA 4G6CA 4O52A 3B9DA 4WY0F 1FWBC 1JUBA 2WMJA 2Y8VA 2O9OA 1R0MA 3UPMA 4BEUA 1XS2A 1PZ2A 1H5VA 2FTWA 4F0KA 4RPPA 3LHYA 7ENLA 1PXGA 1KGUA 2Z00A 1P0DA 3K1DA 2DUXA 3K2GA 3WFZA 5FF7A 2J8GA 4KBXA 3UYCA 4R7OA 3TYBA 4RDWA 4WRHA 4RDZA 4TUFA 3G1XA 2FDMA 3WG6A 1S39A 3N4AA 1BQCA 1D7KA 1V6UA 3O9NA 3HZ3A 3E74A 4WDUA 1GYNA 3RGTA 2BS9A 1C29A 2OODA 1WOAA 2OCZA 2GWNA 3MJYA 1JCLA 4PRRA 1XLJA 1XSKA 1R30A 1KW1A 2C7FA 3VKDA 5ABGA 2PDIA 4E2DA 2XIMA 4E38A 5CZJA 3M0XA 2VX7A 4GE8A 3IK2A 1R85A 3TYZA 3GDBA 1JXJA 1ZS2A 2VVNA 3VXGA 1KCZA 4JHZA 1HNYA 2XGZA 4IIHA 3HPAA 4ERGA 1OFQA 4RE4A 4B2DD 2A3BA 3PBVA 4C6IA 1XDJA 3SDOA 3SBFA 3S0CA 3PZVA 1OT2A 2FLIA 3AHZA 4HHLA 4Y9MA 2FGLA 4LAUA 3M5ZA 2BB0A 4JY9A 1YHTA 3IWPA 5AY7A 4UQ9A 4UNLA 3TN5A 2J7BA 4GY0A 4ZQPA 4B5TA 3QPEA 4UC5A 3NDYA 3BJSA 3GKAA 3SCOA 4AAJA 5CPOA 4FIRA 5LYRA 1ENUA 3AOFA 3UWVA 4GVIA 3FV9A 3EMCA 1LRQA 3DZ1A 2VFGA 3AMDA 1VENA 4RZBA 5JMUA 3ZVIA 2OELA 2VHLA 3QVQA 4Z08A 3N14A 4LNYA 1QW7A 5K4ZA 2HBXA 3QZ6A 2X7WA 3ZSSA 3RJYA 1UR2A 5HUOA 2FPTA 4RPQA 1P1MA 4AQLA 2UY3A 5AECA 2BBFA 1YNPA 4J3SA 1H60A 2FGBA 2OX4A 2NQHA 1EJTC 4L1XA 4WHBA 4DUVA 4QDPA 3QLLA 2HBVA 3EDKA 5AYYA 3URBA 4AYGA 5KZDA 2ZUUA 4LEQA 3EOUA 4MADA 3TAKA 6REQA 2WO5A 3BICA 2PTZA 3AI0A 5MKGB 4MNJA 3ITLA 1W1A1 2CNCA 4CD6A 3GNDA 2EO7A 3TC6A 1K4HA 1TJ2A 3KAOA 2VC7A 2EXOA 1F3TA 2G95A 2DIKA 5CQ1A 1M6JA 2YDAA 1P43A 4UQCA 1C7SA 6TAAA 1WPCA 5D8WA 2EKCA 3CPGA 4HOZA 4JTCA 4MAZA 3LXBA 1TPH1 2ODOA 1XGEA 5C9ZA 2VP8A 3M0JA 4UNIA 5ABTA 1RA0A 3ALFA 1FCUA 2VFDA 3RXZA 2A1YA 1J0HA 3MY9A 1ML1A 2V68A 1VEOA 4GY1A 3T8QA 3TYDA 3N34A 5I3KA 2CC0A 4JICA 3KM8A 3BCJA 5GJNA 5KETA 4REQA 3W0KA 5JIPA 3P93A 3OBAA 1CNVA 2L5HA 1SZNA 2OTDA 3D0CA 2VCCA 1IEIA 2NQJA 1ZENA 3WLQA 1EXBA 4PCTA 1WKEA 4DZIA 3RR1A 2G4FA 1Y5WA 2P50A 1NU5A 3WFLA 3P81A 4FIQA 2WM1A 2ZX6A 2BXZA 1J96A 1MW1A 5C2XA 1GNXA 5D32A 3UQNA 2NT0A 3ID7A 5D38A 1OGGA 3GNOA 3VGFA 3E3HA 4ASTA 4OOUA 2OEMA 2BVDA 4NASA 4O57A 4JFWA 3V16A 3VGGA 3GK0A 4D1JA 1TR9A 3LZ5A 5LIXX 3K8KA 3TV8A 3OYZA 1RQHA 2NWSA 1W3IA 4O11A 4DJDD 4J9JA 5G1YA 1SSDA 1GTEA 4Q7IA 4PTVA 2NT1A 4KRTA 2C8NA 3QQ1A 4XUYA 3F4CA 5HPOA 1NM9A 2QUMA 3DI0A 2YFOA 4U3CA 1V4YA 1VLIA 4Q7BA 4Z1YA 1H09A 3TFXA 4E6MA 3NOEA 3ARTA 3V5CA 4AIBA 4WSJA 4JTAA 2DVXA 3CAQA 3N04A 4JL2A 1JZ3A 1KCKA 2PDBA 1RD5A 3PZNA 4O18A 3ZJ8A 4HN8A 4AD1A 4RE0A 4PA8A 5DF0A 2J79A 2Z1KA 4Y9AA 3SCWA 1FBAA 3W76A 5DBUA 2OQYA 1TJ1A 4K3ZA 1TTPA 4EF8A 2BY2A 3MV11 4AZBA 2YLAA 1X7FA 4KKXA 5AYXA 3VI2A 1Z48A 1I0BA 3HPSA 3LQGA 1CDGA 3VGDA 2DEPA 4B5SA 2Q02A 4B3ZA 1SFTA 3UT0A 3LS9A 3NQ2A 3CAWA 3WNMA 3W82A 4DWSC 2PDUA 2IKIA 5JUVA 8TIMA 4CD7A 1EB3A 3ERPA 1H7PA 2ZZ5A 4IGNA 4F79A 1IIGA 4P5UA 1UZ4A 3GTIA 1CGYA 5G2WA 1QUMA 1HG3A 2OPJA 1R6WA 3VD3A 4EAYA 5IFTA 3NXFA 4AZHA 1VR6A 4DO7A 2WZHA 3LI1A 2A2IA 1VFMA 4EF9A 4BFAA 4Z1BA 4U31A 1HKJA 5LXXA 4F66A 3AZSA 3W6LA 3MI6A 4ML9A 3WDJA 2V81A 4F48A 4P7RA 4ORMA 5LXEA 1HQTA 3REQB 1UWSA 2QGHA 3PHAA 1P6WA 3MSYA 3UR5A 3CM4A 1YXYA 4CQAA 1DL3A 3OYXA 4MYXA 4IZGA 4A2SA 2B7OA 2NXIA 1KM1A 4UOQA 3QLDA 4ICCX 1TE1A 4NI3A 3N2OA 2Y7DA 4GVFA 1EA0A 4KRUA 1CW2A 4ZO9A 2WC7A 2AL2A 3MCOA 3LSBA 1UIOA 2Y62A 5AVNA 4W8AA 5G4WA 4C1LA 1TREA 5J8LA 2AKMA 3CPRA 1G6CA 1ECEA 1FWJC 3DKJA 4D72A 2O9RA 1YNYA 2E6FA 3QXBA 4E4PA 3TTQA 1OGBA 5T8GA 1I1XA 4WVXA 4WXYA 3S2MA 3LPFA 4W8LA 1ZSXA 1W9UA 4F4RA 1X38A 5FJRA 4QXIA 1MXGA 4N4QA 2AL2B 2C0HA 3FA5A 3O0FA 1Q5MA 3HG5A 1CX9A 4O1CA 5BWAA 3UERA 2J13A 5IDIA 3ZWSA 2WJZA 1KXHA 3A13A 3R43A 5DY2A 3CV6A 3PG9A 2BMBA 2O55A 3NYZA 2PMQA 1KFWA 2JBMA 4MJ4A 4EE9A 1GOQA 3WLIA 6PTDA 2I5IA 3WH6A 3P62A 3ZT7A 3GM8A 3VILA 4DYJA 2G41A 3M43A 4PSPA 5TBOA 2Z29A 2W62A 1TYGA 2EPHA 4BY3A 3EB2A 4NAEA 1GOKA 4M5PA 2V30A 4JYEA 1O5XA 3CLWA 1DIKA 3TQVA 3ZJKA 4B5UA 4J7RA 3BOFA 3ECQA 5EA9A 1OYAA 4ZOCA 1S2TA 4GI4A 4UTMA 3I7QA 1JGMA 4CU8A 5L6UA 5AYZA 2PCQA 1UD6A 3TZFA 4V2XA 1C92A 3GNXA 4A6GA 3DG7A 4Z2HA 4QROA 3N17A 2ZOXA 2OB3A 1MQQA 3ANVA 2C13A 1RJQA 3TSBA 3VYLA 2BOGX 2ZXBA 4AMCA 3OLIA 2YL6A 3C3NA 3QQWA 1UP3A 4O1EA 4XZ9A 3MMUA 4KEZA 4YPJA 3OBEA 4S1FA 3H23A 4C91A 3E6EA 2Z2UA 3UW6A 3T2QA 4LCRA 1KR0A 3ARXA 3KOFA 1XH2A 3PB0A 3GXFA 3C2YA 4K37A 1TJPA 2BY0A 4NSBA 3M07A 4TOQA 2Y70A 3EMZA 5HULA 4UMCA 3KTSA 1A0EA 3WK1A 3PZGA 3NVTA 4IG2A 3LXAA 3KCJA 3U7BA 4WK9A 2XG9A 1J18A 3H7UA 1JYXA 5I7GA 3VC6A 3OA5A 1KLYA 2CITA 4PR4A 1I45A 1KXTA 3MP4A 2I14A 4NILA 4UWMA 3H24A 4W7UA 4LW7A 3PNUA 1SJDA 2HS8A 2HQAA 4NRRA 5LSMA 4GZEA 2DORA 1K9EA 3GG0A 3B8VA 4A8LA 3S6OA 2VFHA 3W7HA 4DBDA 1UKOA 1OCBA 3GD6A 4IG2B 1OX4B 3OU8A 2R1KA 1NQKA 4FR1A 1VZWA 3WBWA 3EXRA 1W9PA 4HNUA 5D04C 5IHRA 1F9CA 2RFGA 2V67A 4KGLA 2BG5A 4JIRA 2XFWA 2D2JA 5TD4A 1FX6A 4X9SA 4UTKA 3TW9A 2J7HA 3UXKA 2PDQA 1T0OA 4LYRA 1H11A 3GW0A 1MW0A 2Z2AA 4PB5A 3S2NA 4QLKA 4US5A 3SY1A 4KWVA 1YE6A 7A3HA 1E5NA 1NP2A 2P8CA 4IFOA 5HJLA 3W7OA 1QXLA 2GGJA 4X3ZA 3S83A 2E9BA 1NWUA 1QOXA 2R14A 1OCJA 4INFA 1WYIA 3IACA 3ZJ6A 2OYMA 3R11A 3BDKA 2WVVB 1NOUA 2ZX8A 3UWZA 1HKVA 1QBAA 3GIYA 4E8GA 3KWSA 3B4YA 3I6TA 1PYFA 3GH7A 4I3GA 2QYGA 1V8EA 5A3HA 4KQNA 4I5RA 3PZMA 3JW7A 5AB3A 2J9ZA 3E2VA 2CCRA 1P1XA 2XVLA 1AQFA 1XPYA 4DNMA 3CEUA 3SO7A 1P7TB 5AC4A 3MZ2A 2QNEA 3D5HA 1MI3A 3M16A 3E2RA 3AS0A 3W72A 1EZWA 1IIHA 1EC9A 2IQTA 1F2JA 1RY0A 2V9DA 2AQWA 4JIEA 4S38A 1DWAM 4LX4A 1JF6A 2QPSA 4QNEA 2PWFA 1YDVA 4MYAA 2X1SA 2VL4A 4WSHA 3D3FA 4B15A 2GOKA 5RUBA 4GOAA 1CECA 4C7GA 3KBNA 1TIMA 1KKOA 3Q67A 3D6NA 3W26A 1E6ZA 2WZEA 2D2OA 3TFCA 3L9CA 1TV5A 1QASA 2CXEA 3AJ7A 4JQ3A 3CZGA 1KFLA 1PL9A 4U5IA 5ABEA 4QISA 1FKWA 4RXFA 2ZXAA 1YTEA 2DVTA 2E7FA 3K4AA 1OFPA 1D3HA 8XIAA 1T8QA 3PVFA 3T6CA 3VNJA 1JCTA 2W6RA 3B04A 3PTKA 2R94A 1SR0A 3N3TA 4NNAA 2ICSA 2VZTA 3B0XA 3PPFA 2XZ7A 1QJWA 3AS2A 3R79A 3CTLA 1A4MA 4GFSA 1CGXA 1WBHA 3SECA 3ZYZA 4LALA 3U2CA 3I3EA 2J78A 2VDHA 4U10A 4L4PA 1DPMA 5HR7A 4ML4A 3B06A 3ABRA 1E3XA 3LMYA 4UTTA 2YBUA 1PKYA 3HPXA 1TV8A 2GVYA 2W79A 1SMAA 1GJPA 2QAFA 3WLJA 3T9PA 4D6IA 3QZEA 1GVFA 3BH4A 2CBVA 2PSNA 3GUGA 3FDGA 3VKCA 4MNMA 4HNLA 4URIA 3LCGA 5DN1A 4K6AA 3SCPA 1EOKA 4O19A 5M03A 4M81A 1JDAA 3T0CA 2YW3A 1XQKA 4LS2A 4ICMA 3NDOA 4FALA 1W2PA 4K7VA 3CWNA 2WLYA 1GOWA 3ENLA 1NEYA 4LS1A 3R5EA 3EB3A 4O0ZA 1Z7AA 1JULA 1B4EA 1VHNA 1J93A 4FXRA 2E40A 2PLKA 2RDUA 2PTDA 3U5YA 1OFOA 5A1AA 1FCVA 5C6MA 4DAFA 3H8AA 3P5YA 1X1OA 3ABSA 1H7NA 2ZZ1A 1TWWA 3PTDA 5E70A 1IXPA 1VC4A 4LH8A 3M46A 1WDQA 3VDHA 2Y5JA 1F7BA 3C0JA 2EPOA 3WZ0E 1W2VA 4PZVA 4OVXA 2DSWA 3CUHA 2WHLA 3KTCA 4QJ5B 3UXLA 4AZ6A 3SFWA 3Q45A 3GFZA 1S46A 4M29A 1GEQA 1W3TA 3ZVHA 5C5YA 3OGRA 1DIEA 3BE7A 2WNQA 3V7PA 3CIWA 4JIPA 1EWEA 3FNDA 4IPJA 1K7EA 3R7MA 4W7VA 5A6KA 5IFPA 4CU7A 4KRZA 3TONA 4Q8VA 3NQ8A 4QSFA 3L23A 1TG7A 2FH8A 5ABHA 3B40A 4C6DA 3DFYA 3WD4A 4P8UA 4LVFA 4MKNA 3ZVHB 3GC5A 3EKZA 3UWEA 1QI0A 5EFFA 3WD1A 1P0BA 2EAWA 1DTUA 3WQGA 4DYKA 2ZE3A 3IJIA 3PB2A 2JKAA 4NU7A 4ZQMA 3GNRA 4JFVA 1V7YA 3GQYA 4QITA 3QKEA 4N9BA 3E0VA 5EL1A 4PCSA 3TCSA 1HKMA 1ELSA 1O68A 3VUSA 1AD1A 1MDRA 5I3GA 3UG3A 1PBGA 2FZMA 4F0LA 2XFRA 2XWEA 1EHNA 2AGKA 5CSUA 1O5KA 4HKPA 4AU0A 3HQ1A 1OX5A 1F3EA 3DFSA 4J35A 3LRMA 1XYLA 3AYVA 3B0PA 1PJ9A 3CHFA 3F2BA 2HXTA 3W1TA 4FF5A 3I6EA 3THQA 2AOSA 2FHBA 3IJ7A 5A2CA 4ADUA 1C93A 3ZO9A 1BG9A 3SGGA 3PS7A 3OHMB 1HFBA 4S3BA 4OT7A 3PG8A 3GE7A 4BI7A 5E6YA 1EJ7L 2ANUA 3QN3A 2AQOA 3KVJA 3GG7A 3PPGA 1UUQA 2GVLA 5EMYA 4MY9A 1HP5A 3WDHA 5A8QA 2O92A 2VT0A 1B4KA 2VMFA 4QG8A 3GU2A 5REQA 1IGSA 2ZUMA 1UR1A 4TTUA 1BPLB 2QUVA 2Y5SA 1G4EA 4L56A 5DO8A 4Q8NA 2WAGA 1M7XA 4WOQA 4R9XA 5K9DA 3LY0A 4QAWA 4RE3A 4Q4PA 5EGRA 5HJXA 1P0NA 4FXJA 4PCFA 3AIVA 2ZFAA 4D6CA 2VR5A 3A9BA 5FEPA 3HV8A 1XIFA 2BOFX 3QSRA 1QU4A 1BWLA 4FEZA 3S1UA 3TYEA 5REQB 3TDFA 4UFHA 3GRIA 3G0UA 1F3XA 4XD5A 3S8HA 3NIYA 2PDGA 1SGJA 4DO6A 4D6DA 1L2QA 4AEOA 5D09A 4L6OA 4DNHA 4YLWA 3SFKA 5HJYA 1H7OA 1J8VA 1BGGA 4ZMGA 3WLSA 4I6VA 3HFYA 3SAZA 3TYCA 3S5ZA 4CQCA 5KZ6A 2VGFA 1BVWA 1JDCA 3GZAA 4H19A 5GJPA 4ZO6A 4XZMX 1KM3A 4US5D 3W2MA 3LX9A 3N18A 2XTKA 1WDPA 2A3HA 1LLWA 4FXSA 3WELA 2AKZA 2VOTA 5G2IA 5FJPA 1OCNA 3O8AA 4NRSA 4U2ZA 3P8JA 4O4WA 3MQTA 1I2PA 1UD8A 4K7YA 1R3WA 3CO8A 4JR5A 1RCXB 4FO4A 4LS0A 3K4WA 3P5ZA 1KB3A 4QNWA 3LHWA 3ITOA 2QCMA 3VD9A 1CXKA 1CGTA 2V3EA 1V0MA 3SJ3A 2OGJA 1YIXA 1RJPA 3OIXA 4I5UA 4MZYA 5M17A 4K39A 1MXDA 3WUGA 1OINA 1K77A 5H6HA 2P0IA 3DBPA 2WNNA 2X42A 3AMLA 3C8NA 5G4EA 3RU8X 1JJKA 2P5NA 4AWTA 1XCXA 4LBUA 4GNJA 3LU2A 3N6JA 4CD5A 2FHFA 1TPEA 2FHCA 1XBZA 1FDZA 1GQJA 4JQ2A 4J4KA 3H2EA 1J2BA 3VIKA 3IIXA 3M7WA 5HWNA 2BZNA 1LBMA 4X63A 5GJMA 1S3HA 4YU1A 1FH7A 4PULA 3THAA 3EWDA 4AEFA 1OK6A 3KXQA 1F8MA 2PTWA 1PX3A 1XBXA 5I78A 1BF6A 5LHEA 4RUBA 1VKFA 2VOMA 2XN2A 2FZDA 5E5CA 3S9IA 1TZ7A 2FVMA 2G37A 1XH1A 2ZUTA 3CZLA 3UPBA 3VNYA 4C6LA 4GJJA 4DY1A 4F0MA 3B4UA 2DSZA 1SZEA 3KLLA 3EDFA 4KEVA 3AS3A 4S3DA 2PLJA 3EGJA 5A8OA 4EPBC 3L4UA 1WP6A 5BXSA 3S5YA 1TWZA 4J5NA 1DJIA 5CBBA 3QGVA 1ICQA 2WJEA 3A23A 2VFEA 4G5DA 3BLOA 3G8EA 4F0RA 5JH1A 2ZA1A 4KWOA 4H9TA 4YCOA 2HE8A 3AMKA 2YCKX 2VRJA 1IEXA 2PDNA 1JZ6A 4ZQOA 2JIEA 3W01A 1JCYA 4JKMA 4NJIA 2CHRA 5FF3A 3MUCA 4H8UA 3GTNA 3AU6A 2NQZA 2HE5A 1C91A 9XIAA 1GGOA 2B4GA 5HWMA 5KINA 1E72M 1UCWA 1Z89A 1W5NA 2J9XA 4AZ5A 3SRHA 1SO5A 4HHPA 1E4LA 5F1UA 4HIBA 1FHVA 1R2TA 1QPRA 1LL4A 2D0FA 3ZMRA 4J2PA 3HGJA 2DH2A 1UD4A 1QHPA 3AXXA 1UWAA 1RXOB 1FWRA 3L2IA 1MO0A 1LP6A 2YPIA 3A4WA 2PEVA 4BS0A 4X2RA 3RAOA 4RK8A 4UTIA 2YCIX 4KEMA 3LM3A 1JAKA 2GUYA 4G7FA 1ZJIA 2DY3A 3OIHA 1NF7A 1ALDA 3WQ5A 1KC7A 3ZXWA 3WJWA 1UIPA 4XVEA 4LUYA 3APYA 1Z3NA 5BRPA 4NZCA 3GDTA 2QMJA 1FA2A 2WM0A 3WMSA 4ZSUA 1HGWA 3WQ4A 5ENLA 4D9PA 4ZQCA 4MB3A 3KOXA 1VFLA 1AFSA 1Z32X 3CXOA 3NWRA 1Z69A 5DY3A 3UYIA 2EG8A 1R3SA 3PPHA 1KBJA 4PUKA 4Q4QA 4AW7A 5C7VA 2QT3A 3LBOA 1XUUA 2WC4A 3T4WA 5I23A 5D2TA 5FKYA 3EWXA 4C6EA 3EMQA 3F4VA 4ZODA 1H50A 5CEWA 4OBRA 3STEA 1RLCL 3IUDA 4G7EA 4HNTA 3KRUA 3DECA 4IGHA 3LGEA 2VGGA 2YX0A 3M9YA 3RX3A 2VEPA 4H7CA 3FOKA 3OB8A 3W37A 4IP7A 1Q85A 3TU9A 2F6XA 1XG4A 3PZUA 3TA9A 2ZRWA 2DZAA 1K7FA 3EWYA 3KBWA 4DBUA 1XG3A 3FVMA 2NV2A 4HNOA 1FWAC 5DCBA 3W4RA 3STCA 3DHFA 1US2A 1O4UA 3EWWA 4E0CA 4WLCA 1X96A 1HL8A 1UD2A 3HPZA 1JR1A 2QPUA 3C2OA 3QGAC 2YDSA 1KWGA 1NDYA 1S2UA 2ZUWA 4TMBA 3T44A 3WMBA 4HTYA 3HBLA 3QTGA 3LNPA 1W9BM 1K3UA 2FIQA 5CJ5A 1OWQA 5HBFA 3UGVA 3JUGA 4L4LA 4M3PA 2V5CA 1VJSA 5H91A 2VZUA 1PZ1A 3G1SA 2VGIA 3L4TA 3FCPA 5HR6A 1E6XM 3WLRA 4HNVA 1MUWA 3N2CA 4GUFA 4O15A 5CZSA 2RDWA 3NPWA 4GJIA 1J0KA 4CUCA 5GQBA 2WVTA 1M04A 4E8CA 4YL2A 3E1F1 2X05A 3P7YA 3CV2A 3SR7A 2MUCA 3NQAA 4D71A 1IEQA 4XTIA 3SM0A 1QI5A 2Y7EA 5D8ZA 3WUBA 2W67A 2WXDM 3G6MA 2IPWA 3AIRA 3NPUA 5D30A 3PZIA 3TP4A 5BOOA 4HMDA 3TWAA 2VENA 2B7NA 2VFFA 3BOLA 1JYWA 1SFJA 1FCBA 1TRIA 3DERA 3W07A 2NUXA 4O1DA 5C55A 2G97A 3DAQA 4FOUA 3Q4DA 1K8XA 3C6CA 3USZA 1UR3M 1PAMA 1W1PA 5CC7A 3U5UA 3IGXA 4NNCA 4F0HA 1H5YA 4ZEPA 1HJVA 4HA0A 3CEPA 4MWAA 4PUDA 5CSYA 2OQLA 5A95A 1W0MA 1NIUA 3LCWA 1WAUA 4DUXA 1K03A 3ABQA 1C9DA 1GORA 4PBFA 1DV7A 3PY2A 4PFMA 1O94A 1ECQA 3N2TA 1R2SA 1BVNP 1EP2A 4JBRA 4UTUA 5LNVA 1MVYA 3EA1A 1CIUA 4GUHA 3V35A 4M51A 2CZDA 4Z2JA 3T07A 4JKKA 1U30A 1LL7A 4N6FA 4MWAB 3TIMA 3VAVA 4XB3A 3CUGA 1BF2A 4NJHA 3H7RA 4IL0A 2OSYA 4JS3A 3VZYA 3KHJA 2R82A 4V28A 1O6IA 3GYCA 4O54A 1ONEA 4EWND 2OOFA 4GXWA 3CYVA 1W32A 3FJ6A 1FXPA 4JFSA 3SQSA 4UTWA 3UXIA 3CHVA 1EO5A 3V1PA 4L1GA 2WQPA 2R6OA 1B54A 1UUMA 5H8UA 1UPPA 1ZALA 1J5SA 1X1ZA 3R13A 4P8VA 4XO6A 1FWNA 2JE8A 1A3HA 1R47A 1KM4A 3QRHA 4PSRA 4I6KA 3VKBA 5H8PA 4AYSA 3ITVA 2GUUA 4DO5A 5HWJA 2CFFA 3GDKA 1AZ2A 1RBAA 1I9CB 1Q6OA 2WB5A 1G0CA 4IXHA 1A5MC 5C9RA 4KEUA 1YLVA 1VPQA 3PF3A 4IQLA 1XW8A 1TIWA 4EPEC 4UMAA 2ZBTA 1T8XA 5I03A 4JTHA 3TCEA 3VMOA 4UTWC 1CTNA 4EXBA 1UR4A 2VWTA 3UZYA 2WPGA 1RQBA 4KWWA 1ESWA 3A5FA 1Y8BA 2WZTA 3WJZA 2GGGA 3W7QA 3HMCA 3O05A 3KWXA 5CPLA 1NFGA 3FLUA 1BWVA 1M65A 2CZEA 4PTWA 1J01A 5AHMA 5CLWA 3W87A 1HJWA 4MZ1A 2PDJA 4W5ZA 4S3FA 3DHPA 2TRSA 1XLKA 3LUTA 2IQDA 3MPGA 4LEFA 3UPWA 3WUEA 3RLHA 4FLRA 3TYAA 4Z2KA 4CNSA 3PZOA 1BWKA 3DC0A 1HT6A 2IUZA 3TTSA 4S2CA 1XICA 2ZUNA 1VBUA 1ICPA 5HNRA 2J24A 4GD0A 1ZCCA 4Q8PA 3UGRA 2CZFA 2VURA 5HMDA 4IX2A 5FA5A 3TW7A 3ZQ9A 1DORA 4LB3A 5B80A 4NZ5A 3C0SA 2BDQA 1YEYA 1XD1A 5HMEA 1VFTA 3MCMA 3K5XA 3MKCA 3Q94A 2Y85A 2XYLA 4IWWA 2PDHA 3IVTA 3TVAA 2Y2WA 3LEPA 2ZA3A 4NP7A 3T42A 5LIYX 3SRKA 3TEVA 1L6YA 2HTMA 3CMFA 3UVIA 1WKYA 3OQEA 4DPPA 3NQGA 3EOLA 1PO9A 1Y0EA 5A6TC 4ZENA 4N4PA 3H2FA 1FOBA 1ICSA 4WF7A 3CS2A 2J47A 2ZXDA 2BNJA 3A22A 1UHVA 2ZQ0A 1LUCA 4RCXA 4FNTA 5C9XA 3WF4A 4H7ZA 3TJ4A 4UR7A 1YADA 3SCTA 3IEBA 2XH0A 2EQDA 4NHVA 3RPTA 4OOZA 4PC8A 3VD4A 2Z25A 1K9DA 4LAKA 2VZVA 3KFTA 2A7NA 4K38A 1R87A 3LBMA 3EZ4A 1EJXC 3KRSA 1Q4NX 3USBA 1IEVA 3IIOA 1YNQA 5EB8A 4IXXA 4LVAA 3GXTA 1LUCB 4WR3A 2QIWA 3BG3A 4HBKA 3GXMA 3MBFA 3GB6A 4MJMA 1ITUA 3RG6A 3HGRA 3GXNA 1CXHA 2ZCGA 4JTEA 2TAAA 4BWLA 1WZMA 2PGRA 4BHYA 3IVUA 3QHMA 1UG6A 2E1DA 1EEPA 3E5BA 3L4XA 4YIWA 1DJNA 4Z0SA 2PGEA 3C0LA 2GWGA 1A5CA 1E6RA 2XJ7A 2WOQA 4OUIA 3DFPA 1V6TA 5C9WA 4D8LA 1QW9A 4NJKA 2C6QA 1AH3A 5FJTA 2Z7GA 5CSSA 5D2YA 3F4DA 3SURA 4YTTA 1QNPA 1B90A 4MSSA 3IAPA 1W1IE 2GYIA 4W7WA 1REQA 3D3AA 4YYCA 2KX9A 1P48A 3MSGA 2ZTKA 3RR4A 4WKFA 2Z24A 1SQ7A 2VX4A 3CZKA 3AYSA 3IJ9A 2ONEA 3NYDA 3QQ0A 5IDZA 2WSYA 4MB4A 5FOOA 2J77A 1DQUA 1U5HA 3WLLA 2G3MA 2AL1A 3KCOA 3RM9A 3LA4A 1K6AA 1REQB 3CNYA 1TX0A 1QI2A 5AHFA 5C70A 1WZKA 1E43A 1ME9A 1IR2A 1DJQA 4K1GA 5TF0A 4FS9A 4XIMA 1HJSA 3N29A 4JHOA 2MNRA 2Z27A 4U5KA 4MOZA 4BQ2A 1S1RA 4QCFA 4IGSA 1E55A 3A21A 2Z1VA 4Y9OA 3M64A 4WIWA 3AUJA 2ZE0A 4LSBA 1SSGA 2WSRA 3ARRA 3TSDA 2JKEA 2C91A 1Z44A 2Z6IA 1OT1A 2OX1A 2QJJA 4G8TA 5A6JA 3FGCB 1J2WA 1S5MA 2Z7KA 1RLDA 4O10A 3BVJA 1EP1A 3SCQA 4S3AA 3F4NA 1IYXA 4GXPA 4GH1A 4WY0A 5J5DA 4GQRA 4NUWA 4K68A 3V4BA 2HMCA 4IMDA 1E6PA 3WIJA 2QEZA 3RK8A 1LM1A 3SEPA 4Q6JA 3CWHA 3GYEA 4CCEA 5A8PA 4QDMA 3NCOA 1E6QM 3VIHA 1IT7A 4ATWA 4WY0B 3BK0A 1UROA 3BGJA 1F74A 3G1YA 3NQBA 4W88A 2X1TA 1H1YA 4ZA0A 2Y61A 1F73A 2HNEA 2BP1A 4KF1A 3N9SA 2ZUSA 3QEZA 3CIVA 3WKZA 1EBGA 3EA3A 3V5FA 4MWAD 2GVEA 2CWNA 3QYQA 5FESA 2XVKA 5GNZA 1MEHA 3BSGA 1UKQA 1XI3A 4KFNA 5A6MA 6XIAA 4BF9A 5AN7A 2PGFA 3CZJA 3GVWA 2JEPA 3CBWA 4UTHA 3QHOA 4N9DA 4HT3A 1VYRA 7TIMA 5D33A 3PUGA 1JNDA 5DLCA 3L7RA 1EA9C 1IF2A 3HG2A 3BURA 3H2CA 1VB9A 3B0YA 1KBLA 2C3ZA 2POZA 3KX6A 4HHHA 2QPXA 2IPGA 5DQPA 3CHEA 3T2OA 1ZU8A 1GOOA 2V3FA 4D6EA 4IH3A 4ENLA 7ODCA 2BVWA 3BSMA 4UFJA 4TX6A 4G2DA 4Q22A 3ZM8A 1L0PA 3EPOA 2RJHA 5AVHA 5HNUA 3EYPA 3N4FA 1DWGM 4LQ1A 4IF2A 4L64A 3N25A 3TYUA 3OEXA 1I2RA 4POCA 4G9PA 1OFRA 1D8CA 4LXFA 3ABXA 4Q8TA 2BASA 4QEHA