2YYUA

Crystal structure of uncharacterized conserved protein from geobacillus kaustophilus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
225
Chain Sequence
TPFIVALDFPSKQEVERFLRPFAGTPLFVKVGMELYYQEGPAIVAFLKEQGHAVFLDLKLHDIPNTVKQAMKGLARVGADLVNVHAAGGRRMMEAAIEGLDAGTPSGRMRPRCIAVTQLTSTDERMLHEELWISRPLVETVAHYAALAKESGLDGVVCSANEAAFIKERCGASFLAVTPGIRFADRVVTPRKARALGSDYIVIGRSLTRAADPLRTYARLQHEWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus
total genus 74
structure length 225
sequence length 232
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yyuA00
3TXZA 2JK2A 1GEQA 3HGSA 1K02A 3I68A 3R13A 4O17A 1P1XA 3UXAA 1NSJA 4GUJA 4NUWA 2VOMA 3S9YA 3A21A 2V2HA 1GG1A 2YDAA 1JCMP 2PCQA 4UFKA 3ABSA 4FNUA 2H3DA 4AXKA 1UCWA 2C14A 3W70A 4U4MA 2C1HA 4FEZA 3QW3A 5D2VA 2CLKA 5EA9A 3QM3A 4X22A 2ZDRA 3GXNA 3UXDA 1T99A 1G69A 3IV3A 5F1VA 4O4WA 3G0XA 1L6WA 1QOPA 3T44A 4GWEA 5CPNA 3HQ1A 1QPQA 2CZEA 4AF0B 1XDLA 4IOTA 4LVGA 5I3KA 3NQAA 1KA9F 4ZMGA 5C5YA 4AAJA 2ZRZA 2ZTKA 3CIXA 1TPWA 4ZQPA 3TFXA 1OJXA 3W1XA 2QAPA 3HOJA 5K3VA 2J24A 5CZJA 3KFTA 2YYTA 3GDMA 4RR4A 1I2RA 1SZEA 3F03K 3UWZA 1VR6A 2PE4A 4WZHA 1KV5A 1HO1A 1H5YA 5AB3A 4JEQA 2WSYA 3CC1A 1C9DA 4E2DA 2I14A 3GNDA 3ZFHA 5EMUA 3LCLA 5CPLA 4TIMA 3EKZA 1HO4A 3OVQA 1F73A 1KFEA 3BVJA 2EKCA 4FO4A 2QR6A 4CNNA 5D33A 3LRKA 2H8XA 3BW2A 1VCFA 5CPMA 1F05A 3CT7A 1G7UA 4RX0A 2JKEA 5TIMA 3CEUA 3LCHA 1VYRA 1ZFJA 2O7QA 3LHUA 3QZEA 5FI8A 4R34A 1RPXA 1PHWA 1LLWA 3CIWA 4O12A 1YADA 2YZRA 1GVSA 2DZWA 2H90A 1JCXA 3UPWA 1H1YA 3NOEA 3AJXA 1DBTA 3W76A 1NEYA 4UCGA 1MSSA 4IPIA 1TCDA 3EX3A 3SY5A 3QMTA 4P61A 3T55A 4RK8A 3W2JA 4O54A 3TK7A 3G0SA 2B0MA 1R2TA 1H60A 3M5VA 4GC4A 2ZA3A 3C2OA 4JTFA 3QPZA 4LT9A 3O15A 2V2CA 5HR6A 4O16A 1KM1A 3W7NA 1L2UA 5D2YA 3HJZA 3ABRA 4JIPA 2V5BA 2AGKA 1AK5A 5J5DA 1WBHA 1KFKA 1VC4A 1DQXA 5C55A 4O57A 3DKLA 1QCWA 2V9DA 4DBDA 3R89A 1OFQA 3W07A 2EAWA 5BOOA 1YTEA 5E0KA 3IIXA 2Y7EA 4NXSA 1G4TA 3W22A 5HQEA 1TRDA 4LS0A 3G8RA 4RZ4A 2ZA2A 1OFOA 3MI6A 4OV4A 1M7OA 4MFEA 4LUJA 5CPOA 3G1AA 3C61A 1W5OA 5U4NA 3TSBA 5D2XA 3V75A 3N9RA 5H2ZA 3L5LA 1ALDA 3W83A 4NNBA 5EPDA 1S3HA 3LV5A 3DXIA 3RLUA 1N55A 1TPVA 3MWAA 5AHFA 2ZRVA 2C19A 1AL8A 2CLMA 2E6DA 4LOCA 3MW7A 3BG5A 3IEBA 3S1WA 1YDOA 1OF8A 1RR2A 1TV5A 3PUDA 5DXXA 3N9SA 1OFEA 1PS9A 1OFAA 1H7PA 2V2DA 3L65A 2ZRUA 1HTIA 2OT0A 3QSRA 3TW7A 2NWRA 1YPFA 4XKYA 1GG0A 3UWVA 2R94A 3IVSA 4HKPA 4N4PA 3SR7A 3TV8A 3W72A 2EHHA 1GQNA 4QJ1A 1Q6RA 3PY2A 1KM0A 1R30A 3G1DA 4JDYA 4O18A 4Y96A 4CCEA 1YPIA 1SUXA 3L9CA 1VLIA 2ZZ4A 2NX1A 3NPWA 1FQ0A 5AOUA 1HUVA 1Q6LA 3E02A 1LDCA 2CLOA 4BWLC 1RD5A 1TJRA 4YCPA 1EEPA 1TTIA 1FDYA 1AL7A 5LGZA 3PG9A 4NJIA 4GRSA 1DV7A 2X1UA 3WJSA 4A3UA 4MZYA 4P2VA 1KM4A 1O95A 3NPUA 2XN0A 3LI0A 4MKNA 3TROA 4UC5A 4UR7A 3WFAA 3G1XA 3MJYA 3DFTA 5LZLA 1EP2A 4JNMA 4UFLA 3RNDA 2FDSA 3DKJA 1LORA 4DBEA 4UTLA 1QPRA 1GT8A 4ZL1A 1H7WA 2CLHA 4IMDA 5HULA 4BR1A 1JCLA 4YMZA 4ZQOA 3QH2A 1KTCA 4MZ1A 4EIVA 3HG4A 1WDWA 3NQ2A 1GOXA 3LHTA 1XDMA 3PR2A 2BTMA 4LU0A 4GJ1A 1FDJA 3W23A 1ZAIA 2B7NA 1K8ZA 4JICA 1VYSX 4DXVA 2Y7GA 5KZMA 4FX8A 1TTJA 4HNVA 1SFLA 4UTIA 2GVGA 5T26A 1VCVA 5LNRA 4FXRA 1NFBA 1FWWA 3TUUA 5DELA 3DGRA 2G95A 4RZ6A 1H61A 2YW3A 2A6NA 3VI2A 1OABA 3CU2A 3PB0A 1G6CA 2V82A 3BLIA 3SW6A 3NL5A 4LNYA 3E0IA 1Q3NA 3P62A 2OCZA 2HS6A 1IIHA 2A85A 4R7JA 3TQ0A 2LLEA 3PUOA 3LRLA 4Z0SA 5G1YA 4I7WA 5G2WA 2VFGA 5LGXA 4QSHA 3W2UA 3IRDA 3PB2A 4UR8A 5FEXA 1TTPA 4LW7A 3GDTA 2YCEA 3AO0A 2FQIA 3CM4A 4OE7A 1TRIA 1U83A 5EKYA 3A22A 3BGGA 1S5TA 3GAYA 4ORMA 4AEOA 1SSGA 1SZGA 1YDNA 2A5HA 1JCYA 3Q37A 1AW1A 1J5TA 3VCRA 2GQ9A 3LV6A 4DO5A 2A1YA 2YW4A 5AHEA 2GJLA 3QF0A 2ZZ1A 4MVAA 1KW1A 3O05A 3CQ0A 1DOSA 5AHLA 2Z0IA 1H7XA 3UD6A 1E51A 1ZAHA 3MYPA 3UWWA 1I2QA 3LGEA 1A5CA 4ADUA 4UFIA 3QYQA 4NJGA 4YXGA 2AQWA 3USBA 2C15A 2VEKA 2UV8G 4FF7A 3RF9A 2NX3A 1RQHA 3HG3A 3N19B 4NVTA 5HR7A 2A4AA 3HIJA 4IJBA 5FESA 4HN4A 1QOQA 1K7EA 3GB6A 3DENA 3QW4B 2ZFAA 3P61A 2DZXA 2HTMA 4O15A 1U5JA 4M6QA 1W56A 3W6YA 4WX2A 2P10A 4ORIA 3P82A 1VCGA 4LC8A 1SW3A 3MP4A 3M5YA 1O5KA 4N02A 5DCEA 1HG3A 2A7PA 1J2WA 4LVFA 1UB3A 3W73A 2I1OA 2DJLA 4X3ZA 3I7RA 4IPJA 1M6JA 2QUTA 4BFAA 3R12A 3WJZA 3UQNA 3I65A 3ATZA 8TIMA 2E09A 2ABAA 3G3DA 3SECA 2FB3A 3SJ3A 3W7GA 3GIYA 1XFBA 3E9AA 5D2WA 4FHAA 4D2JA 2HSAA 1SO6A 5HNRA 2G96A 2YR1A 4NXKA 1ME8A 3W2MA 2E6FA 4KFOA 2NV1A 4DELA 2VFHA 3NM3A 1AW2A 1T8XA 2Y88A 3DI0A 3W7RA 1JR1A 4IX2A 4N9DA 4O10A 3MI2A 4AWUA 2TMDA 2ISSA 3PBYA 1Z48A 3EEGA 3PBVA 4B5NA 5ABTA 2V0TA 2BX7A 3GZ3A 3L68A 3KHJA 2FPTA 2YFNA 1GJPA 3HPSA 5KITA 1H62A 1PVNA 2XN2A 5BNKA 2DJXA 5HINA 4UIOA 1FY6A 1TPUA 3SFKA 3P5YA 4E2BA 4QQ3A 4W9TA 3F4NA 4LY8A 4NT0A 4IXHA 1B9BA 3SI9A 3W1NA 3TIMA 3NPXA 1H51A 4UXDA 3OBKA 4N9EA 3O1NA 3TNOA 1K03A 4S1FA 2A6LA 4FNRA 4CCCA 3NQFA 1P5BA 4MIMA 5I3JA 5F4SA 1LTDA 3TQVA 2QUVA 3TMLA 1B57A 1W8SA 3VE9A 1YTKA 5KZEA 3LM7A 2QKFA 1MEIA 3R8RA 5BW6A 4YWIA 4ZQCA 1OFDA 1UUOA 3R5EA 2ZBTA 1LRNA 4QITA 3SSJA 1MEWA 2JKPA 1T96A 1Q45A 2ISWA 2NWSA 1WXJA 1FXQA 4MJMA 5TBOA 1V5XA 1EB3A 1NAL1 4WY0A 2GUUA 3LTYA 3IIPA 1K8YA 4UTJA 3JR2A 1DVJA 4UMBA 2C0AA 5FEPA 1OFPA 3THAA 2GOUA 1TYGA 3LB0A 5KTLA 3PUEA 4FNQA 4JXCA 3S5OA 2C3ZA 3NNTA 1KM2A 1EX5A 1KLYA 3OHIA 1TPC1 1I2NA 3GR7A 3A24A 3BLEA 3B4UA 1KFBA 3M16A 1ONRA 4QNWA 4ML9A 1LOSA 1ZNNA 4POCA 2E68A 5FF0A 1EUAA 3ZR4A 3PBUA 1XBYA 1W1ZA 3TW6A 1W3IA 4CNOA 5DXYA 5GVJA 3NQEA 4AHOA 2JGQA 1ML1A 3MHUA 3GR8A 4Y9AA 1FDZA 3B0UX 1TO3A 3TQKA 4JY9A 3O6DA 3Q58A 3GDKA 1PCKA 3DHFA 1YXCA 4M5PA 5D2TA 4CNPA 4HPJA 4UUIA 3LXBA 1GPWA 2J88A 3NO5A 4IMGA 1ICQA 2B7PA 3PSVA 1WOBA 3IGUA 1NF0A 5FEZA 3S8HA 5FF7A 3TU9A 4JTKA 1OG0A 3A23A 3IVUA 5F2LA 2WJZA 1GYLA 3LERA 2GVLA 1ICPA 1B3OA 5D32A 3W7LA 3MI3A 3OVRA 3EX1A 4UTUA 3MMTA 3G22A 1F6KA 3LOTA 3RLVA 1GYNA 5EY5A 4PCFA 3LTSA 1OX4B 4K37A 3NQ8A 1I8JA 1EWDA 1ICSA 4YCOA 3EWBX 1R47A 1KV8A 4JX4A 4WXYA 3TDFA 3KAOA 3FS2A 3KRSA 3CLMA 2W79A 3GLCA 2RHGA 5TQLA 5AN7A 4FIQA 5D38A 4RCXA 4PL1A 4UNLA 3WK3A 4MYXA 3INPA 2G5WA 4ALDA 1B4EA 1XM3A 1PV8A 3UWYA 2VEMA 2IQTA 4JTIA 3LXAA 5DCDA 2Z6JA 4ZQMA 1VHNA 4BF9A 1O5XA 4CQAA 3ANYA 3LHYA 3FIGA 4GBUA 5SWUA 1LOQA 1ME9A 3NAVA 2PRMA 3VFLA 4DF2A 1OX6A 4RLIA 2J6XA 2WO5A 3BG9A 3P7YA 3A5FA 4N6FA 1BKSA 3G0UA 2O7SA 3M7WA 2Q3RA 1TPEA 4CQ8A 1QR7A 4IWWA 5F4WA 3DFQA 3FKKA 4I7UA 4JX5A 5G4EA 3EX4A 3NL3A 5F1UA 3MUXA 3C0JA 3DFNA 3WK2A 3S42A 3W84A 5BMWA 4TMBA 3C2FA 1XKYA 3NQMA 4C1KA 4TU1A 2FPYA 3MYOA 4WUIA 4LV4A 3C3NA 2E5BA 3BPWA 4TMCA 1OHLA 4LVAA 2B7OA 2TYSA 4JIQA 4BI5A 1F74A 3IIOA 5I3IA 1AMKA 1T0OA 2CZFA 3W1AA 3ZS4A 4UTKA 5CZ0A 4AH7A 4OWGA 1F2JA 3UZJA 1H7NA 5AYYA 2J27A 1Z41A 3FYPA 4K39A 2NZLA 4O11A 3KVKA 2VC6A 3IGSA 5BMXA 4MOZA 4K38A 5F2IA 4WOQA 2HMCA 4TX9A 2VFIA 3ABOA 1M5WA 3OG3A 5AYXA 3LLDA 2J9YA 1LP6A 5I3FA 3L0KA 3DZ1A 4XBSA 4YLWA 2Y85A 3M44A 1YYAA 4BWLA 3LCXA 2PRLA 3E96A 4M6PA 2CW6A 3LCFA 3QMSA 2ABBA 3QQ1A 2P0OA 1THFD 3NA8A 1MXSA 3W85A 5K2ZA 3U8GA 5HWNA 1X8FA 2XFWA 1K7XA 2P1FA 1O60A 3C2EA 1QNVA 1VH7A 2PRHA 4JYFA 4A22A 3WJXA 4RKAA 4HPXA 2FPVA 2KZHA 1YXYA 1X7FA 3NL2A 1I45A 2YSWA 4GXMA 1IIGA 3UWUA 2RDWA 3I6RA 3P8JA 3W86A 3DAQA 3NVTA 5LNWA 2ZRWA 4S2BA 2J9XA 3DI1A 4QM1A 3W87A 3M5ZA 1JRBA 1LLZA 1RZMA 3OA3A 3S0CA 1G67A 1SO3A 3G18A 5AHIA 2E1DA 2QDGA 5D37A 1P0NA 3A5VA 3LCGA 3HPXA 4LUIA 4WQ6A 4AMAA 4AF0A 1VLWA 4NQ1A 2VEIA 1XBZA 4AHPA 3RU6A 1BWKA 3KX6A 3B05A 5H91A 3CWOX 2DZTA 5F2GA 3EXTA 3C4UA 1OYAA 2QCDA 3QMRA 4HIBA 4Q33A 3NQ6A 3ATYA 3EWXA 3UWQA 4WXZA 1G4EA 1V7YA 3NM1A 1L6SA 1W5QA 3IIVA 2VENA 3EWYA 2C13A 3NXFA 3LBMA 3UY7A 5LHEA 4FNPA 5KMYA 3QEZA 3N2XA 3TH6A 1TSIA 3MO7A 4OU1A 2W6RA 3C8FA 3P81A 4JN6A 3U6WA 2ISVA 1W54A 5I3HA 1Q6OA 4NJKA 3T7VA 1NF7A 2B4GA 2Z2UA 2OMAA 4UFMA 5FF3A 2Z6IA 3CEPA 2XN1A 2R91A 1QPNA 5IBXC 1A5AA 3N2MA 4MY9A 3SZ8A 2NXHA 3EB2A 4EWND 3P74A 4N4QA 4X9SA 1N8FA 1W37A 1TQXA 1LRTA 1G7VA 2RKXA 4RXGA 1TMHA 3P67A 1W0MA 1EIXA 4O1BA 4UMAA 2W0UA 3UNDA 2OZ0A 3KRZA 1VHCA 3GAKA 3MP5A 5EBUA 4Z08A 2A0NA 5AHMA 1IF2A 3GKFA 4XQ6A 1XUUA 1R2SA 4N6EA 5D04C 4J9JA 2PC4A 3HG2A 4R53A 5CZTA 3C2RA 2WPBA 4XBKA 3O63A 3MHGA 2NV2A 1YTDA 3W2KA 3TMQA 3WJYA 1S5VA 1KBJA 1QPOA 1LBMA 3BG3A 4Q32A 3NZRA 2DZUA 1LBLA 2E5DA 1MZHA 3STFA 3K30A 4GE8A 5D05A 4K36A 1EP3A 2ZZ3A 3W1LA 3M1ZA 2JGYA 4MY1A 1QO5A 5EL1A 5L6UA 4JTTA 3O07A 3BLFA 4IX0A 2F84A 1SPQA 4O14A 1FCBA 1O94A 3GXTA 3IGXA 1K3UA 1FWNA 3PG8A 2WQPA 4A2RA 1I4NA 2YYUA 3I7QA 1Z44A 5F2MA 1FBAA 1WOAA 3H53A 1AW5A 4Z1BA 4O1DA 2NUYA 3TA6A 3EX2A 2QCCA 4IGHA 1ZALA 1H50A 4LVDA 1EPXA 3MP3A 2QCEA 3MBFA 2RFGA 2A21A 2J9ZA 5FF2A 1TB3A 1XI3A 3LHWA 5K9DA 2E6YA 2ZRYA 3UYCA 4JYDA 3T4CA 2DZVA 2QAFA 2ZA1A 3KOFA 4GUIA 3L67A 4UTWC 3CWNA 1LBFA 4WY0F 3FFSA 3LI1A 4UMCA 4O0KA 5AC7A 1RQEA 2DU2A 3KXQA 2Y61A 2CU0A 1KFLA 4ADSA 5I3GA 4EVZA 5C6MA 4NNCA 1FCUA 3IVTA 1JCNA 1LCOA 2DORA 5C54A 3P60A 4JTUA 2CLEA 1A5BA 1JULA 1CX9A 4DO6A 3SGUA 1Y0EA 1KBIA 1VQTA 3B06A 4H3DA 1A5SA 2AAMA 1DL3A 3NQ7A 1J4EA 1MO0A 1OFRA 3F1QA 3PS7A 4N9BA 3W75A 4A29A 3W7QA 3LXCA 4LVBA 1VZWA 4Z1DA 4XKYB 4UTHA 2NXIA 3DBPA 3KVJA 5G4WA 3F4WA 4FXSA 4TR9A 2CWNA 2VKZG 4UNKA 4KFPA 4YL2A 2H6RA 3QJAA 3TC7A 1SO5A 1GWJA 5AYZA 3GDLA 3FKRA 2H3BA 2ZZ6A 3W71A 3W7PA 1BTMA 2DZSA 5CGQA 4E0CA 1JCJA 3S5NA 4CLMA 1X6UA 4PFMA 5AFDA 2ALDA 1IXPA 2WKJA 1L9WA 4UTTC 2QCLA 5HWJA 4NZFA 3EX6A 3NDOA 1G4PA 2NUXA 2Z1BA 2X1RA 4ZZ9A 5HWMA 1LOLA 2C16A 4IMCA 4O1CA 3S1UA 1O4UA 3ELFA 4Z1CA 1P0KA 4WD0A 1QWGA 3S1XA 3W1TA 1VJIA 4QNEA 3TFCA 2RDUA 3NYZA 2GQ8A 3TE9A 3M0ZA 3LHZA 4L4MA 3S5ZA 3P80A 5F4XA 3B8DA 1Q6QA 1IGSA 3Q94A 4WOZA 4AHQA 2I9EA 4DF0A 1G4SA 1W31A 4JTHA 1ZJIA 3NQDA 3BW4A 2C6QA 3TX9A 5D02A 2QCFA 2ZCGA 3T78A 1JUKA 3G3MA 3TJXA 3QRHA 3V1PA 3GNNA 4DPQA 1GVQA 3NQVA 5CG7A 2G97A 3TC6A 1PL9A 1LROA 3W9ZA 1DHPA 5MHBA 1TV7A 2CZ5A 3DFSA 3EWWA 2WSRA 4MLJA 4PA8A 3EXRA 2QCGA 3TSMA 5CKSA 3DFPA 3QFEA 1I2OA 2Q8LA 1XL9A 1FUYA 7TIMA 1KM5A 2BSLA 4LC6A 3S5YA 4R33A 2X1TA 1HFBA 3DFOA 2Q8ZA 3GKAA 3LCIA 1CW2A 4H4IA 2YXGA 4MFDA 3I7SA 3B0PA 1OK4A 4JTJA 1JUEA 3L66A 4O50A 2QCDB 4K7VA 1PIIA 2V81A 4GUFA 3YPIA 4FX6M 2B7QA 2C18A 1RVGA 5C2XA 4JR5A 3LTPA 3W2LA 3TCEA 2DZPA 1SO4A 1XBVA 2VFEA 4MYAA 3W7JA 4RV8A 3QC3A 4LS2A 3TXVA 4M7TA 1SZNA 5HUOA 5LHFA 2E6AA 4ADTA 1ZAJA 5KSWA 1UJPA 2TRSA 3HGJA 2WNZA 3TJLA 6TIMA 2E5CA 3RK8A 1TPH1 1JQXA 1LM1A 1SQ7A 4RZ5A 1LZOA 1JRCA 1ZENA 3EWZA 5AC6A 4C1LA 2FIQA 2ZZ7A 2Y89A 4HT3A 1KTBA 3H54A 3IIZA 5DN1A 5CZSA 3NQGA 4Y6GA 2ZZ2A 3W7DA 5LNUA 2NX9A 1SR9A 2FJKA 4GUHA 3M47A 2BWGA 4ICNA 2NUWA 1ZCOA 2TPSA 2JKAA 2OX1A 5E1QA 1AG1O 1TQJA 1KTNA 1SU5A 2VELA 4LV9A 3RFAA 4K7YA 4UFJA 3TAKA 3DHDA 2QJHA 3PBWA 2OJPA 3NGJA 1OF6A 3QSTA 3GK0A 4FIRA 4XUGA 5DBUA 1HL2A 3O16A 5A5WA 2Y6ZA 3GDRA 1UUMA 5K9CA 4M6VA 1FWSA 3STGA 1FCVA 3R2GA 4IQLA 1GVOA 4MPQA 2X30A 1R46A 4BK9A 4XWUA 3VKJA 1YXDA 3HBLA 2ATMA 3P5ZA 1S5WA 2WNQA 1SW0A 1FWRA 3LLFA 1BEUA 1H7RA 4OHQA 2QCHA 1XBXA 5CSRA 4JDBA 4U28A 2YPIA 1JUBA 3M41A 5FEWA 1D3HA 3G1SA 3PF3A 1DKWA 4NU7A 3JRKA 2NLIA 1TPFA 3FJLA 3L5AA 3G8EA 4N2YA 1C8VA 1SZFA 3CPRA 1GTEA 3G1VA 1H1ZA 1K7FA 4WJEA 4UFHA 5D09A 5DY2A 3NEVA 5IM51 1F5ZA 4O1AA 4A21A 3CHVA 4DPPA 3LHVA 5BRBA 4PODA 5HUPA 2CZDA 1K8XA 1EA0A 3QQ0A 3FJ6A 4MLRA 3BGJA 2V5LA 5DBTA 2EPHA 4RXFA 1OK6A 1B4KA 2Y7FA 4JYEA 3ZWTA 3LX9A 3W7MA 2ZZ5A 3W7IA 1SSDA 2FLIA 1W5MA 4HNTA 2ZQ0A 4JTEA 4NJHA 4Q4KA 1PCWA 2GJNA 3JS3A 3O6YX 1X1ZA 4NJJA 5DLCA 4OBTA 2A7NA 3GX9A 1TIMA 5DCBA 4LWWA 4OV9A 3WK1A 3SIZA 3GXPA 1KLZA 3N73A 4NNAA 4RJEA 1VGAA 1EP1A 1VS1A 2E77A 3KVLA 4DQWA 3STEA 1WYIA 1GVRA 2X16A 5D03A 5K7JA 2QF7A 4PH6A 3CTLA 1QAPA 4A2SA 3W1QA 5G2IA 5K4XA 3L0NA 5CSSA 4LS1A 4MY8A 4ZQNA 2OT1A 1FXPA 3WJWA 5KINA 2YFOA 3KVMA 4IMFA 2A7RA 3BO9A 3W7KA 3PM6A 3NZ1A 3PULA 1VPXA 3FOKA 5LKYA 4LTSA 4GUGA 3BW3A 4XTDA 3L5MA 3W74A 1W5NA 5FF4A 4CCDA 2X1SA 2Y70A 4DF1A 3C2VA 1YLVA 4NX5A 6ALDA 3OEXA 2V8ZA 4JGDA 2ZRXA 3C6CA 4IXXA 1W5PA 4Y8FA 4E38A 2GPTA 4OQVA 3C52A 4KFNA 4EOUA 4TO8A 2VXNA 4UTMA 3P8IA 3TAOA 1YDVA 4WY0B 4ZVJA 1DJNA 3HF3A 3HGOA 4M19A 4O28A 5G2HA 5E93A 2JBMA 4GFSA 3S6DA 2QJGA 1UBSA 4O4VA 5G5IA 4PTNA 3NQCA 3G1HA 4JTLA 3PWAA 5K9XA 1JJKA 1LYXA 1W3NA 2PURA 2RDTA 3VNDA 5LNSA 1WQ5A 4EF9A 3PSWA 4K6AA 2QUUA 4Z0JA 3U2OA 3TKFA 1TTQA 1KM6A 1OYCA 5LNVA 4JTGA 2TSYA 2F7FA 5HJLA 1JQVA 5IBXA 5K4ZA 1W3TA 2Y62A 3L21A 4K8EA 4BI7A 1QO2A 4DEFA 3DH7A 2YX0A 2V30A 4AWSA 2CLIA 1DJQA 1ME7A 3FLUA 3BARA 4I9AA 1XC4A 3G1FA 4HSOA 3SGZA 1TREA 4PC8A 4N9CA 3D0CA 1L6YA 3W1UA 1GZGA 4Z1AA 3B04A 1P4CA 2ZTJA 5AHNA 1TV8A 4KWVA 5LSMA 2R14A 4QISA 3M5XA 1IXNA 4O53A 4AB4A 4XZ9A 4MZ8A 3OVPA 1OX4A 4FX7A 2EF9A 1TPB1 3LRMA 5KZDA 1ZY9A 4X2RA 3BK0A 2A2IA 1XUZA 4PEKA 5EYWA 2EGZA 1F7BA 4HSNA 4O19A 1M7PA 1UASA 3W1MA 3LCWA 4S2CA 3HO8A 5U7SA 3A9IA 3HPZA 2DP3A 1D9EA 4HHPA 3NR0A 2RH9A 3W88A 3PC0A 2WOQA 1WX0A 3FYOA 4I7VA 4PL2A 3RMJA 5A8GA 3FEMA 4MJZA 3VE7A 3HG5A 2CFFA 3STCA 3T40A 1XXXA 3B0VC 1A53A 4JS3A 4QIUA 4NX0A 3G1YA 1N7KA 4FNSA 3MBDA 1GTHA 3GYEA 2HS8A 4MUZA 5DY3A 5L9FA 1X1OA 2CLLA 4KKXA 3TR2A 4HNNA 4QAIA 3HB9A 3G24A 3HMJG 1NVMA 3N3MA 1IXQA 3N14A 1BWLA 1WBJA 1F76A 3M9YA 3PVFA 2QJIA 2WSQA 2ATSA 4JY8A 1DQWA 2X2GA 3S1VA 4OGZA 1ZHAA 2VEPA 3KRUA 1QDSA 1WV2A 4IMEA 3UY8A 1R2RA 3W7OA 4H6KA 3OIXA 3HGRA 2YGYA 3WK0A 3N34A 1WA3A 4Y90A 1DORA 5D30A 3O8AA 3W2NA 2NXGA 1I2PA 3E49A 1D3GA 1JVNA 4UTWA 3W7EA 2CLFA 4AWTA 2BZNA 2BXVA 3DU0A 3H55A 4ONVA 1RV8A 1MEHA 4O8RA 3UPBA 2VFDA 1GVFA 1FCQA 3EXSA 4CQ9A 3BV4A 1PE1A 2FB2A 3W1PA 3UZ5A 1OVDA 2H8ZA 2WV8A 2QCMA 5AC8A 1EWEA 3GVGA 1VYPX 4O0ZA 1QMLA 3L0GA 4OT7A 4JD4A 1SFJA 2QEZA 1Z42A 1PHQA 4JX6A 1RQBA 3FA5A 2Y63A 4L4LA 1KFJA 1TPDA 1QFEA 3LDVA 3L2IA 3W7CA 1KFCA 1H7OA 1OFBA 3MHFA 4G1KA 1FX6A 2VFFA 1EUNA 2Y7DA 3NG3A 3ABQA 2GVJA 4O13A 4FNTA 4GNJA 3P84A 5J5RA 3M6YA 1A50A 4ZQRA 1IXOA 5HMSA 4LRTA 1CI1A 1H63A 2FTPA 4DO4A 1LRQA 2FFCA 3M43A 1VRDA 4LRSA 3PAJA 2QDHA 4M7SA 3THQA 1ADOA 3C56A 3W7HA 3O6CA 3O06A 1OX5A 2QCNA 2D73A 3ZWSA 3LBCA 1WAUA 3NPVA 2Q3OA 1F6PA 4JTSA 4UTTA 2ZYFA 4K8HA 3CB8A 4EF8A 4IUOA 3B03A 4XTIA 4KWWA 3EKLA 2R8WA 4HNUA 1TJPA 3W3OA 4NZJA 4BI6A 3TSDA 3QPYA 3NL6A 4FB7A 4AVFA 1KM3A 4O52A 3E12A 2GQAA 3W1RA 3Q2DA 2WNNA 1FWTA 1XCFA 2BLEA 1C29A 5G1TA 3EWUA 1SW7A 1OYBA
chains in the Genus database with same CATH superfamily
5IDZA 1HJSA 4NAFB 5D9OA 3I68A 3D6NA 3OBAA 3UXAA 1NSJA 4GUJA 4PYSA 4Z17A 4J40A 4NUWA 1PWLA 3A21A 4AZCA 4LUYA 2YDAA 1JCMP 4FNUA 1TWWA 4Q8WA 4KESA 1UCWA 2C14A 4K3ZA 1EKOA 3SSZA 3BMWA 3CAVA 5TNVA 3QM3A 1UD3A 1MUMA 1NDYA 2GUBA 2VR4A 4X22A 1E6SM 2FH6A 5F1VA 4R27A 2OKTA 3VNJA 1FHDA 3T44A 1GPFA 1QPQA 5AZ0A 2NVAA 4W8AA 3UCCA 1REQA 1FHVA 4XK2A 3WMBA 2WMGA 4HOZA 1UZ1A 4P5UA 3CO4A 4PMVA 2ZTKA 1W8GA 1OD8A 3B9EA 4XVEA 5K3VA 4G5DA 3UA3A 3CBWA 5HQLA 3GDMA 3F03K 4NF7A 4ES4A 3WLJA 4WZHA 1HO1A 3B40A 5AB3A 1I9CB 1AODA 1DWFM 2WSYA 1EQPA 1FWBC 3MKKA 2O4QA 2I14A 3Q4DA 2D3LA 1E3ZA 3VKCA 2WM0A 5EMUA 5CPLA 5PTDA 3BVJA 2QR6A 4CNNA 4YWSA 5CPMA 1G7UA 4X2PA 2O7QA 3LLXA 3BCFA 3CIWA 3TTSA 4O12A 2YZRA 2VWSA 3NSMA 2H90A 4IFKA 3CTTA 3AJXA 3RCMA 3W76A 3KS5A 1MSSA 1Q2SA 8CGTA 3QMTA 4AD0A 3IJLA 3EMCA 3ARSA 1JAEA 1JIBA 2B0MA 4GC4A 2OQLA 1Q63A 4F3HA 4JTFA 4AIOA 4C6KA 4B5XA 3QPZA 4E8CA 3O15A 1KM1A 1L2UA 5D2YA 4CN1A 4AIBA 2GZXA 5HNUA 3VINA 3ABRA 2P53A 4JIPA 1JPDX 3K46A 1C8YA 2V5BA 1XLEA 1IWPA 2AGKA 1AK5A 1WBHA 1VC4A 1DQXA 1CB7B 4O57A 3SUVA 2QJMA 1QCWA 2V9DA 3W07A 2EAWA 2BY0A 5BOOA 4IGSA 1YTEA 2G3NA 2D3NA 2DPEA 2VCCA 3MUIA 1UD6A 2BY3A 5LYRA 3QHOA 1TRDA 1UH2A 4HPHA 2HRWA 4MJ2A 2OYLA 4PTMA 1M7OA 1Q66A 3R79A 4GZ7A 3VA8A 4L61A 1QW7A 3VOJA 3HMCA 3N2TA 1N2VA 1W3LA 4NZ5A 3I4KA 5D2XA 1XLHA 1KRBC 1SZRA 1ALDA 4NNBA 3SUUA 3RLUA 1N55A 1TPVA 5AHFA 2C19A 1UUQA 1J0YA 2CLMA 1BXCA 1AVAA 1BQGA 1ZCCA 4YU1A 1XD0A 3ICJA 4KQNA 5DXXA 3QY6A 1PS9A 1OFAA 3L65A 2NQ9A 2QJJA 3QSRA 3TW7A 3T08A 3AHZA 2NWRA 1YPFA 1GG0A 3R58A 2R94A 1V6UA 4WHBA 3RU8X 1O12A 3TV8A 2GL5A 3ABXA 3AU6A 4KF1A 1GOKA 3GW3A 1JEZA 3RO6A 3FA4A 4O18A 4Y96A 4IQJA 2GJRA 1YPIA 3LPGA 3L9CA 1YX1A 3NZGA 1NWRA 4C7FA 5I23A 1RD5A 2GSHA 1XD1A 4NJIA 1ZBKA 4GRSA 1Z32X 3WJSA 4A3UA 1MW2A 1VEPA 4MZYA 3QLDA 1KM4A 1O95A 3NPUA 4FOJA 1FA2A 2J7HA 2PEVA 2PCEA 3O3RA 1FWDC 3G1XA 4MGGA 3DFTA 2ACSA 3AFBA 1IEQA 1V02E 1XIEA 3V5FA 6REQA 1LORA 5C7VA 1GT8A 5CZKA 4AYSA 5HPOA 4IMDA 4HJFA 4JHOA 3T81A 4BR1A 5XIAA 1E6XM 4XZWA 2D0FA 1WDWA 1L0PA 3WYZA 1XDMA 2E40A 3PR2A 2ICSA 5JXQA 3ZQ9A 1FDJA 3W23A 1K8ZA 2E0PA 4DI8A 3DFHA 1K9FA 4JHMA 5KZMA 1KWGA 4S3KA 1FWWA 3AMGA 3TUUA 3M0MA 1UKOA 3DGRA 4AZ6A 2A6NA 1IV8A 2Y8UA 4GIYA 3CUZA 4J7RA 2PDWA 3WLSA 2HVMA 1ZBCA 2A3HA 4A05A 4D6HA 4AY1A 3R7MA 4I7WA 4XV0A 2C7FA 3PPCA 3TN4A 3IRDA 3PB2A 3L4YA 3H2MA 3VX0A 4UR8A 1TTPA 1R8LA 3V18A 4RE2A 4GXWA 3AO0A 4AX7A 7TAAA 3ARRA 4MWAB 4OE7A 2YCLA 4ACZB 1TRIA 1WKFA 5EKYA 1OADA 3BGGA 3KP1A 1RD6A 3M0LA 1CEOA 3Q37A 1Z8AA 1J5TA 1WXZA 4DO5A 5AHEA 2GJLA 2ZZ1A 4MVAA 1KW1A 3O05A 1DOSA 3UD6A 4WDWA 3SAZA 5HJXA 1E51A 3LGEA 4ADUA 4UFIA 1QI4A 4AZGA 4NJGA 2AQWA 3NOYA 3PZOA 4QEHA 2UV8G 3AHVA 1LL6A 3WX7A 1NFPA 4Q7IA 3UVAA 1E9YB 4S3JA 2HXTA 3N19B 4NVTA 1B1YA 4IQDA 5HR7A 3HIJA 4IJBA 3VPLA 1FRBA 4GXPA 3ARUA 3MMDA 4CD5A 4S3BA 4PMZA 4O15A 4E4FA 3W6YA 2BP1A 1E72M 1OY0A 2P10A 3RX3A 4ORIA 4NZCA 4LC8A 5CGMA 7ENLA 3LU2A 1SW3A 3M5YA 2YXXA 2A7PA 2ZKMX 4KERA 2I1OA 1PWMA 2IQDA 2VGFA 4X3ZA 3MT1A 2OQHA 1GKRA 2QUTA 3CQKA 3GUWA 5I7GA 2PF8A 3ATZA 3TN3A 8TIMA 2CLPA 1IHIA 3CQJA 3G3DA 1IT0A 1SMAA 3SECA 1OGGA 4C6MA 3KZSA 3IRSA 1UYQA 1GEHA 2UY2A 3WL1A 4D2JA 4BF5A 1BYAA 3P3BA 5HNRA 3OIHA 2UZ9A 2Z1XA 2D2OA 4NL1A 1EQCA 2E6FA 4KFOA 4DELA 1RLCL 1MW1A 3W7RA 4O10A 4N9DA 4AWUA 3PBYA 2IKGA 1BKHA 1BSLA 2BX7A 4IISA 1K1DA 4LBUA 5TF0A 2FPTA 1GJPA 4HCLA 1TPUA 2VC5A 4QDPA 4E2BA 3BJTA 4PR4A 4J3SA 4B3KA 3BQ6A 1B9BA 4IXHA 4JTQA 1B3WA 4UXDA 4N9EA 5BWFA 3L4WA 4HNCA 1AD1A 4YIWA 3IJ6A 4S1FA 1TUXA 1RJQA 1VBRA 5FL1A 3NQFA 1J93A 5F4SA 3TQVA 3TMLA 3SCVA 4CD8A 3QY7A 3PPHA 3GVWA 2GK1A 4Z2JA 2QKFA 3CZLA 3FXGA 1CGUA 2PU1A 1Q13A 5EMYA 2GLKA 4UTFA 1UUOA 3R5EA 4QG9A 1UZDA 1TVLA 1R9XA 3KP0A 3R0DA 3LQGA 1MEWA 1YKWA 2ISWA 2NWSA 9XIMA 4IJRA 2QZRA 1DWAM 4MJMA 1IWBA 3TW9A 4DUWA 1ENUA 1HKKA 3RYSA 1KWKA 2C0AA 3AU2A 3I3DA 3LB0A 5KTLA 1UH3A 2QDDA 2PDHA 2ZIDA 2Y1HA 4JXCA 2R1KA 3AXHA 3S5OA 2C3ZA 4QTGA 3NNTA 3DN5A 3KOZA 1C9WA 2X2YA 4R7OA 3A4WA 4D72A 1ECQA 3GR7A 3A24A 3IK4A 2GFTA 3BLEA 3UERA 1A5LC 1PUDA 1BHGA 1KFBA 3FXYA 1LOSA 4POCA 4H9YA 5FF0A 3L7RA 2WBGA 5M5DA 1PEZA 1EHAA 1W1ZA 3BCDA 4INFA 3NQEA 4U2ZA 1J10A 2POZA 4IIFA 4LCSA 5GNZA 2VHLA 3VCNA 2XG9A 5FD0A 4CNPA 2F6KA 4L6OA 5D2TA 3ZIZA 1U5VA 4H9VA 3LXBA 1VF8A 3FEQA 3PSVA 1WOBA 3IGUA 1NF0A 3S8HA 5FF7A 1GW9A 3TU9A 3JZEA 3WL0A 5GPRA 5LA2A 3AIRA 4H41A 4GOAA 1B3OA 3LOTA 1F6KA 4B5WA 3B9OA 5EY5A 2VRKA 3CZKA 3BCJA 1OX4B 2P0IA 3V7PA 2F2KA 1EWDA 1ICSA 4AD1A 1KC7A 2CNCA 1R47A 1V03A 3MUAA 3KAOA 3CUIA 5T9BG 4WDTA 1NFGA 4QE4A 2EBNA 1RK5A 3R8GA 3INPA 4HZ7A 3VGGA 4LH8A 1CGYA 1DXEA 3LXAA 1VHNA 3MS8A 1O5XA 4ZXLA 1LOQA 1XYAA 4PMDA 1VEMA 1OIFA 3V16A 2PRMA 2GOKA 4F0RA 4WKAA 3BG9A 3P7YA 3U2EA 1IZCA 1AD4A 3A5FA 4GX8A 1BKSA 1E9ZB 4GA8A 3CV6A 3ARXA 3CMJA 4WKHA 5F4WA 5CPSA 5A6SA 1GQJA 5F1UA 5KEZA 1WDPA 1Z7AA 3EDKA 5CLTA 3NQMA 3BOFA 1A5MC 4WUIA 4LV4A 2E5BA 2B7OA 1CLXA 1MNZA 4GZJA 4JIQA 4QE5A 3IIOA 1EX1A 3GXMA 2QV4A 1G0CA 1TV3A 3I3BA 4UTKA 1S2VA 5CZ0A 4OWGA 1F2JA 3UZJA 1H7NA 3QY8A 1V6TA 2YXOA 2UY4A 2BODX 4O11A 5BMXA 4C65A 2AMXA 1QK2A 2FGZA 3LPOA 4R88A 1XH2A 3OG3A 4ZBCA 1MRAA 2J9YA 5AYXA 1PIGA 2GUYA 4XBSA 3MCNA 3T8LA 3WBXA 3OBEA 3AMDA 3OGVA 2IKIA 4M6PA 1N82A 4DYKA 2KAUC 1THFD 1SJCA 5K2ZA 1X8FA 3AISA 2D24A 3APGA 1K7XA 1X8CA 2DUXA 2FZNA 4US6A 2BDQA 2PB1A 3W02A 1LL4A 4RKAA 1NU5A 4RUBA 2V38A 4HPXA 3RCYA 5B80A 1I1XA 3ZVIA 3V0TA 4GC3A 4DY1A 1I45A 4HCDA 3UWUA 3I6RA 3OZMA 1Q8AA 3VMNA 1ZLPA 1C91A 1G67A 1XSIA 4MNKA 4GYJA 4HHLA 1YEYA 2ZXQA 4EK7A 2E1DA 1TA3B 2X7WA 3UPMA 4CNUA 1US3A 2VQTA 5KETA 4WQ6A 2VDHA 4AF0A 1Y65A 2VEIA 5DF0A 3RU6A 3WSUA 1IT8A 4CD4A 1IQ8A 1E1CA 3B05A 5H91A 2DZTA 2I57A 3EXTA 2IKJA 3UGVA 2QCDA 4E2VA 4Q33A 3UWQA 1KCLA 5CBIA 3EWCA 3BJFA 1HKIA 1WXYA 4PFHA 5LHEA 3U2ZA 3MO7A 4OU1A 1C8XA 2W6RA 3C8FA 2ISVA 1W54A 2AKZA 2EG6A 4PUUA 4W7UA 1Q6OA 1NF7A 4J35A 1H0IA 3CEPA 5C9UA 2FYMA 1A5AA 3WMCA 4AYGA 3TTEA 4DJEA 1YNQA 2DGAA 3EB2A 3N4FA 1TG7A 1N8FA 1W37A 1LQ2A 1K8CA 4DM2A 4EACA 2G8ZA 1UR3M 1XYCA 5JU6A 4GVHA 1TMHA 4O1BA 1UKSA 1E70M 2OZ0A 1FHLA 3GAKA 4AIEA 4Z08A 1V3LA 1TWSA 4CUCA 1YPXA 3C86A 3GC4A 1HW6A 3CL6A 3HG2A 1E6PA 3KCOA 2WPBA 4XBKA 2NV2A 1S5VA 1KBJA 3BG3A 4UNIA 2VGGA 3WCZA 1HXJA 4QQUA 5T9CE 3IAPA 4IFKB 3STFA 3W01A 1C92A 2D0GA 3GZAA 3W81A 4K36A 1EP3A 2ZZ3A 3ARVA 4I5UA 3RMEA 4IZGA 2VL4A 4K2SA 3BLFA 3F2CA 2WC7A 3NJ3A 3RJXA 5A8MA 1FCBA 4PUKA 2I56A 3IGXA 1FWNA 4DIAA 2YYUA 3OLEA 1QRQA 2DQXA 4Z1BA 4O1DA 3EMZA 4S38A 3SCQA 2C91A 3R25A 3VDBA 1SFTA 2J9ZA 2NQ5A 4U3CA 2WKGA 1OQFA 1DWHM 3T4CA 1PKMA 5CSUA 2ZA1A 1VIZA 3AQUA 1V0MA 1AH0A 3C0QA 4CQBA 1J12A 3JU2A 4F0MA 1MQQA 2CU0A 1UHVA 4ADSA 3KL5A 1FCUA 1TCMA 4GG9A 5HA7A 3QV7A 2CLEA 2VEFA 3OODA 4Q8NA 3GH5A 4S3EA 2R6OA 4OUIA 2PDFA 2QULA 1CX9A 5AVNA 3VC6A 1J0IA 1VQTA 3IJQA 1EH9A 4EPDC 4JOMA 4H3DA 1A5SA 2AAMA 1DL3A 4TVCA 3W75A 4A29A 3URNA 4F9DA 4LCQA 4A6GA 9RUBA 4LVBA 3KLLA 2IQ0A 4GYPC 1ZPTA 4OBRA 3SY1A 1XSKA 3DBPA 1XWYA 2YA0A 4YL2A 3SCPA 3QJAA 1SO5A 1GWJA 1B31A 3GDLA 3FKRA 3W7PA 4YHEA 1SJAA 3LSCA 2HDJA 2OKOA 3P0WA 3UESA 4YHGA 1LF1A 1HJVA 5ABFA 3WQOA 2QNEA 3VD5A 2J8FA 3LSBA 5HWJA 3NDOA 1G4PA 2NUXA 4S3AA 2J74A 1RXOB 5GJPA 4O1CA 4V33A 2XSBA 4REQA 1O4UA 1P0KA 3W1TA 1VJIA 3TFCA 1GHSA 4W8LA 3DDMA 4QJ5B 1CWYA 5BZAA 1J9YA 4U31A 1TR9A 5F4XA 3B8DA 2E7FA 3CPGA 4K1WA 2Z24A 2MUCA 2OEJA 1OC6A 1ZJIA 3BZJA 2YL6A 3TJXA 1O5QA 1WNOA 3GNNA 3NQVA 3TC6A 1PL9A 3W27A 1HX0A 1YHTA 2FMNA 3MUCA 3GE7A 4MLJA 3TSMA 3NZPA 1FWJC 1I2OA 4GVFA 2BSLA 1IT7A 3B0YA 4TX6A 2Q8ZA 1CW2A 3LK6A 2OWCA 4GQRA 4O50A 2CHNA 4GUFA 4H9UA 2B7QA 1ONWA 2BVTA 4MWAC 3V36A 3TCEA 4ZCWA 2DZPA 1KBBA 1NP0A 3MVTA 3OPSA 4G9PA 2VFEA 3W7JA 3QC3A 1K6WA 2ZVRA 1SZNA 1C7TA 5HUOA 5LHFA 4EANA 1ZAJA 3F4DA 3L4TA 3HGJA 5FJOA 4Q4QA 1J6OA 3CZ8A 3RK8A 2YCLB 2F61A 2CXEA 3HJEA 2FIQA 4H00A 3QGKC 3H54A 5CZSA 3NQGA 2ZZ2A 2E4TA 2GDUA 2FJKA 4GUHA 4ICNA 2NUWA 1ZCOA 3QV6A 1EYWA 2WANA 1KTNA 5JBEA 2VELA 1U1HA 4LAOA 2EPMX 2PGRA 3UBPC 3PBWA 4EP8C 3POHA 1OF6A 3QSTA 2FVMA 5A5WA 5K9CA 4GQBA 3WDIA 1PX4A 1V6VA 3VKKA 1WUFA 4RPQA 3R2GA 4HNOA 4IIBA 1GVOA 4LUSA 2X30A 4E6MA 4XWUA 1HF6A 4Q3MA 3OW1A 4PCNA 4X63A 4L9YA 3WDJA 1FWRA 1G5AA 1HVXA 2WSKA 2ZX6A 4BA0A 4GYFA 1LLOA 1XBXA 5FEWA 3PF3A 3TOYA 2BS9A 1B3YA 2ASHA 3NXLA 1TPFA 3GWQA 3G8EA 1IYXA 1SZFA 3CPRA 3N1AA 1H1ZA 3VIHA 3VZYA 2WCGA 1V77A 1V3MA 3L4VA 4KCVA 4C1NA 3LHVA 5BRBA 1DJIA 5HUPA 4PB3A 4LCRA 3DYOA 1ITXA 2V5LA 3N29A 5DBTA 1A4MA 4AXNA 1B4KA 4GI8A 2HBXA 3W7MA 2VT0A 2W61A 2FJUB 5FJRA 2FLIA 2OOGA 3SCSA 4HNTA 4KCTA 1UOKA 2E8YA 1UBPC 3IACA 4OBTA 3VNLA 5BU9A 1E4NA 2PZ0A 3WQDA 1NELA 2JIEA 2Z25A 3GXPA 3N73A 4NNAA 3BAKA 2ON3A 3AWOA 5CCZA 2HXUA 3CQIA 3VTRA 3WQEA 2QF7A 5G2IA 3L0NA 1UD5A 1YNYA 3ITVA 4LS1A 2WC4A 4ZQNA 4UWMA 2OT1A 5KINA 3VNYA 1ONXA 1FWGC 3GVVA 4TUFA 1JZ8A 3PM6A 4PN2A 4HJWA 2DVXA 3N6HA 2VCBA 3NZ1A 4GI4A 3PULA 4QFUA 3FOKA 4DXKA 2A3EA 4GZEA 1W9UA 1EC8A 3BSGA 5I06A 1XF0A 4XTDA 1K77A 3GRIA 1W5NA 3IPWA 1V93A 2ALRA 1YLVA 3GC2A 3VNKA 1SJDA 6ALDA 3C6CA 5BRPA 3TJIA 1FWIC 1L6FA 3ES8A 2GPTA 3ZSSA 2GJXA 3EPNA 4TO8A 4BS0A 3SURA 3P8IA 2XSAA 1DE5A 4RPPA 4H1ZA 4JTLA 4EPBC 4C6QA 3T0BA 3B3DA 2PURA 2RDTA 5LNSA 1WQ5A 1CXKA 4QCEA 4K6AA 3U2OA 1Q8JA 4JL2A 1IZKA 3QN3A 1BSIA 3W37A 3SFWA 2F7FA 2DIKA 4GIRA 4RNFA 5IBXA 4FMVA 2Y62A 4DHGA 4PTXA 1Q6EA 4RE3A 3MCMA 4I9AA 3O2LA 2VRJA 1K70A 2QUNA 3B04A 4DI9A 2Z1SA 4UBPC 3VAVA 3R6IA 2ZTJA 5AHNA 1WE5A 2GGGA 4QISA 4DJEC 4MZ8A 1TPB1 2XTKA 3BK0A 4CD7A 2WK2A 4M81A 4PEKA 3IJDA 1W9BM 1M7PA 1M7XA 4MDPA 4GIEA 3W1MA 4AC1X 2PDCA 3LCWA 3SBFA 3A9IA 3VIGA 3H2EA 4GKLA 3W88A 5REQB 3NCOA 4PL2A 2DVUA 4IMAA 5A8GA 3FEMA 3MSYA 4MJZA 2YA1A 1XXXA 3B0VC 4JS3A 1UW9A 3WLHA 1GTHA 2PWFA 3CAKA 4MUZA 1X1OA 3TR2A 3HMJG 4QAIA 1NVMA 3N14A 2V5DA 1WBJA 2ATSA 4S39A 1BD0A 3IUIA 2I5IA 4PMJA 2XWDA 4TX8A 1TE6A 3GTHA 4OGZA 4ICCX 4WVXA 3CASA 3W7OA 4H6KA 2D2JA 4GI6A 1XRFA 1WA3A 3A9BA 2GDVA 4B91A 5D30A 2NXGA 1C7SA 3GG0A 4G8TA 1BRLA 3H55A 4O8RA 2DSZA 3OLIA 4MNJA 2VFDA 1GVFA 4D1IA 3W25A 2ACUA 3EXSA 3DUGA 3BV4A 1PE1A 2PWUA 3W1PA 1X1NA 2WV8A 1F8MA 4IL2A 4K8GA 3ZT6A 3ARYA 3UCDA 1UD8A 3OHMB 2QEZA 4DJFA 4HA0A 1PHQA 2XUCA 4JX6A 5DMLA 4EWJA 4G1KA 4NSBA 1FX6A 2VFFA 4TXEA 6A3HA 2GVJA 4O13A 4EX4A 4ZO8A 9CGTA 1X6LA 1K6AA 3M0KA 3M6YA 4ZE4A 2JF6A 4NI3A 1IXOA 4LRTA 3E3HA 7REQB 1GZJA 4LRSA 2CKRA 2RGMA 4GJJA 1JL8A 3THQA 1ADOA 3O9NA 3W7HA 3O06A 4HYVA 2D73A 4J28A 1C3FA 1UZHA 3ZSTA 4B16A 2IPFA 1JNEA 4UTTA 2R82A 3CB8A 2NT1A 1XG3A 2XVNA 4EF8A 4P7LA 2HE5A 4XTIA 1RLDA 2R8WA 3P0XA 1TJPA 1U2YA 4NZJA 1CGTA 3VOFA 3UR8A 3F4CA 1S2TA 4WRHA 3NFUA 5M3WA 3W1RA 4W85A 2O9TA 3TYZA 4PFMA 3QKZA 1MXDA 3TXZA 2JK2A 4X61A 3SUTA 4O0QA 4R85A 1K02A 4V1XA 2VOMA 1GG1A 3KBVA 2JEQA 3AXIA 4IFRA 2I17A 4AY8A 4U4MA 4NAEA 2AL2B 1W9XA 4F0LA 3ARZA 5D2VA 2VI0A 2CLKA 3WQWA 5EA9A 2WPGA 2ZDRA 3UXDA 1G69A 2WMKA 2ZUVA 3DG7A 3G0XA 2VP8A 3DG6A 4GWEA 1XLBA 5CPNA 4AF0B 3LGDA 3EB3A 5JIPA 3NQAA 3WKZA 4JIHA 2Z7KA 3D3FA 4AU0A 2JQXA 2TODA 3CIXA 1TPWA 2QAPA 3HOJA 4QRNA 1F9CA 2YLLA 4G6CA 4CGTA 2NQJA 2YYTA 5CJNA 4RR4A 3UCQA 1O1ZA 1SZEA 2YL9A 3UWZA 4AZ5A 1KV5A 1H5YA 3G1RA 1C9DA 1J01A 4E2DA 3CV2A 2X0SA 4M29A 3PTDA 3LCLA 1K4GA 3EKZA 5FSEC 1RH9A 4L6DA 4FR6A 1LUCB 1VFFA 3WENA 1XGDA 3LRKA 3BW2A 1VCFA 3CT7A 2BNJA 3O0FA 5TIMA 7XIMA 3LCHA 4LAMA 3AIWA 1ZFJA 2ZDSA 1JZ3A 3GC5A 1XLDA 1SM9A 1L6GA 1YADA 3QV8A 3CIVA 3RRXA 4BQ2A 4NYUA 4XAYA 4UCGA 1MDRA 3APTA 1E15A 1TCDA 3B8TA 4P7NA 3T55A 4RK8A 5J04A 4O54A 3M5VA 5BRQA 1MNSA 4HQVA 1QK0A 3FK4A 1PXGA 4LT9A 5HR6A 4O16A 1OC5A 1QT1A 1O6IA 2V3FA 2VRQA 3ALGA 3TYEA 1JG9A 1OG6A 4Q8VA 3GD6A 2INFA 2IXUA 5J5DA 3K13A 3DKLA 2EQDA 4I9TA 2ONEA 3KM8A 5E0KA 4GNVA 5HMDA 4D1JA 7CGTA 2AAAA 2CHRA 3L4UA 4NXSA 4LS0A 2VD9A 1OIMA 1GZ1A 2QVNA 3W4RA 2I9UA 5H2ZA 1RAKA 3RLHA 4WLCA 4PMRA 3URAA 5EPDA 1WKDA 5I79A 3WH8A 1WZKA 3E0FA 2O92A 3S5SA 3A3XA 1E4IA 3GFXA 3BG5A 3MW7A 1UH4A 1YDOA 4PRWA 3HTWA 3N9SA 4H01A 4Q4PA 1H7PA 1WCGA 5CC7A 4GHRA 1ZJBA 1X7IA 3QLLA 3SN0A 1IEVA 2XFFA 4RL3A 4N4PA 1EXBA 1EZ2A 3W72A 2EHHA 1GQNA 1KM0A 3T2OA 1G9HA 1M53A 3E0VA 4PSRA 4CCEA 2EPNA 1VLIA 1OZQA 2ZZ4A 1PKLA 4L4PA 1CZ1A 1F3EA 1QI0A 1LDCA 4BWLC 2WHKA 4Y9PA 1JDFA 4PSPA 1TTIA 1FDYA 5CBBA 5LGZA 3MU7A 4QJ3B 1UROA 3K5XA 1O1HA 2ZXAA 5IOBA 3GNPA 4PCPA 1P6WA 2JFEX 3G6MA 3ANVA 4GO9A 2INZA 2CBVA 2BB0A 3H22A 3WFAA 5EMJA 1VFTA 5AECA 5D8WA 2XVLA 1Q65A 2CZVA 1A3XA 2RGLA 4JNMA 4WEVX 4HP5A 3DKJA 5ABFB 1GJUA 4LEQA 4UTLA 1QPRA 4ZL1A 1H7WA 2CLHA 4YMZA 1LWJA 4BKNA 3NQ2A 3LHTA 3BLPX 2BTMA 4AEEA 1S3TC 2FZBA 4ZFCA 4JICA 1VBJA 4IF2A 3KCLA 1POKA 1SFLA 4UTIA 3CWHA 4GK8A 1P48A 1VCVA 5LNRA 1BG4A 1RY0A 4IFOA 4V1YA 1WUEA 2ACRA 5DELA 5G1MA 1XX1A 2G95A 1H61A 2YW3A 4H8HA 2J7FA 2E67A 1IZJA 4DWSD 4W87A 3CU2A 3PWGA 4DUVA 3ERPA 4EE9A 2D2HA 4LXFA 2V82A 3SW6A 3NL5A 1TJ2A 3TCSA 4AUBA 5A6KA 2OCZA 2Z00A 1M03A 1LQAA 2Q6ZA 2VUYA 1PDZA 1UWIA 4RNJA 2WVVA 3PUOA 3TYCA 5G1YA 4C6BA 5G2WA 2VFGA 3LBOA 4M1RA 5IFPA 1W9PA 3TTQA 2FHBA 3ZT7A 4CEXC 2OXNA 1E0UA 4NP7A 1W1A1 2O9OA 4LW7A 2ISDA 2PS2A 3WH9A 3CM4A 1AQMA 4F79A 1S5TA 4LF2A 4ORMA 2ZC8A 1SZGA 4ZB5A 1ITUA 2A5HA 1JCYA 1AW1A 1YQ2A 4A8NA 4WSHA 3CQ0A 2Z0IA 1H7XA 1RHCA 1ZAHA 4B5UA 1A5CA 2P3EA 5AC5A 3ITGA 2XIJA 3QYQA 4DBSA 4YXGA 3MB9A 3CGTA 3LPFA 3NYDA 3OZPA 3WBWA 3I6TA 2NX3A 1RQHA 1YE4A 3LS9A 4PTVA 4D8AA 3HG3A 2FHCA 4IICA 5FESA 3T1GA 4PTWA 3DENA 3QW4B 2V5JA 2EO7A 3BH4A 4PE8A 2GJPA 3P61A 2DZXA 5C9XA 3LNPA 4KH2A 2Z1KA 3T8QA 1R3QA 2PDMA 2WAGA 3MA8A 6ENLA 3WLLA 2IMRA 1J2WA 3PTMA 3UW6A 1P0DA 1KNWA 4IPJA 1M6JA 1PAMA 3VZXA 2Q02A 4BFAA 3R12A 3WJZA 3UQNA 1R7AA 3CH0A 3I65A 2NW0A 2E09A 1NWSA 2ZX7A 2ZUWA 2AL1A 3RM8A 1UWAA 3VABA 3GIYA 5C9WA 1XFBA 3E9AA 4DJFD 1B54A 1MWOA 1CXIA 4C6JA 2HSAA 1SO6A 4G2DA 1C90A 2NV1A 2VFHA 3CAWA 1AW2A 3NM3A 2Y88A 3DI0A 4IX2A 2UY5A 3I10A 2CPUA 2TMDA 3EEGA 2NT0A 2V0TA 4DJDA 1R3YA 2VVNA 3ENLA 1Q7ZA 3GZ3A 2J6VA 2YFNA 3HPSA 4W5UA 5BNKA 1KQZA 1S38A 4JQAA 4UIOA 3RR4A 3K4AA 2A3LA 3F4NA 4LY8A 1RPKA 3SI9A 4GLEA 3TIMA 4IH3A 4XBJA 3OBKA 1UWQA 2Y5SA 3FAXA 3GUGA 3O1NA 3TNOA 1K03A 3UR7A 2A6LA 3RILA 4CCCA 1JZ4A 4KGLA 1TVPA 4MIMA 3MANA 4LAZA 1I1WA 1DJXA 2QUVA 1W8SA 3VE9A 3QOKA 5KZEA 3ZLHA 1XS2A 3VD7A 2PZNA 1KXHA 4FSAA 3TWAA 3R8RA 4IT1A 4UZSA 2XPKA 3M0JA 5D4YA 4YWIA 4ZQCA 4ZGYA 4QITA 2JKPA 1VFLA 1GOIA 3CV7A 3QR0A 4I6VA 1FXQA 1EB3A 5CC3A 3HFYA 5A6LA 4DYEA 3LUTA 3M7SA 5I02A 2Y8VA 3IIPA 4HU4A 1EGMA 4UTJA 1ZGDA 4JCLA 3D5HA 1DVJA 5FEPA 4J27A 2W91A 1OFPA 5T8GA 1PKNA 1S1RA 2GJXB 2W5FA 1EX5A 3OHIA 1TPC1 3U5YA 4L9ZA 3D46A 3VDGA 1DXIA 3T4WA 3VZZA 4BEUA 3OP2A 3WNMA 3M16A 2YB1A 1ONRA 1SYTA 1QNPA 4CEUC 4DLMA 3WY1A 1E71M 1PZ2A 3B8WA 1PIFA 1D8CA 3ZR4A 4CU7A 3PBUA 4QDMA 2ZOXA 2VO5A 3W29A 1ZTVA 4CNOA 5DXYA 4FA3A 5GVJA 1NJJA 5DQPA 3UXKA 1YBQA 1KBKA 2PAJA 1FDZA 3B0UX 1TO3A 4JY9A 3O6DA 3Q58A 3GDKA 3DHFA 4M5PA 4F48A 4NRSA 3VGHA 3ITYA 3NO5A 3WF3A 2PPGA 3ORWA 5FEZA 3RIKA 4JTKA 4DWSB 3A23A 4FP1A 3B8VA 5CJMA 3IVUA 4DUOA 3OQ8A 5F2LA 4HYWA 2PTDA 1ICPA 1K9EA 4JFUA 1OT2A 5D32A 1DYSA 3BSMA 3W7LA 1U1UA 1GOOA 3G22A 4MMWA 1W6TA 5CLWA 3OZOA 4PCFA 1E1EA 1DTUA 3MKVA 4DO7A 1BF6A 4C6LA 4K37A 1F4AA 1I8JA 3B8IA 2PWVA 2E28A 5E6ZA 4YCOA 1GOQA 4V27A 6CGTA 2BOEX 3EWBX 3A3HA 4ZTYA 3TDFA 1J8VA 3KRSA 1JD7A 1R3VA 5I0DA 3CLMA 4H7VA 4WR3A 2W79A 3GLCA 3B8SA 4FIQA 5D38A 4KGJA 1Q7QA 2MANA 4KBXA 1B4EA 1XM3A 2VEMA 2AOSA 4R3UA 3QR1A 5DCDA 2Z6JA 3N6JA 3GFYA 4BF9A 3ANYA 3FIGA 2QHAA 4GBUA 3NAVA 3UNTA 2Y5EA 4GVGA 3VFLA 3I6EA 3KTCA 4KEUA 1W32A 3OO2A 4Q4OA 2DUZA 4M80A 3G0UA 2O7SA 3M7WA 3DFQA 1ZBWA 1S46A 3EX4A 2BVYA 3MUXA 2OZ3A 1LT8A 2ZICA 3WK2A 3UZZA 4ZA0A 3VC5A 4XZIA 2XIOA 4QE1A 4XG1A 3C2FA 3GU2A 3CH9A 3GH4A 4B3LA 3C3NA 1BRLB 3AYTA 1OHLA 4LVAA 3LD5A 3II1A 4BI5A 5MKGA 5I3IA 3AI0A 3MMUA 1HZYA 1QBBA 2VD8A 3WH7A 5EU9A 1ESWA 4MF4A 1VB9A 2J27A 2XVKA 1XKJA 5C0QA 1Z41A 4L1WA 1UP0A 3IGSA 4MOZA 1QNSA 1HP4A 4WOQA 4TX9A 3MJMA 1M5WA 4U2YA 5I3FA 2OYMA 2OG9A 4HU8A 1YYAA 3LCXA 3CHFA 3P14A 3E96A 2DIJA 3SCUA 3LCFA 3QMSA 1QI5A 2QJNA 2WWCA 3DHPA 3NURA 5C9ZA 3GTFA 2FHFA 3U8GA 3QGVA 2MNRA 4C60A 2UY3A 3A12A 3S83A 2DSWA 2YBVA 2XGBA 3C2EA 4M8UA 4ERIA 1VH7A 3CV1A 2PRHA 4JYFA 4ZODA 3ZR6A 2DV0A 1BYCA 4RDVA 4H19A 1J18A 1XICA 1YXYA 3CB3A 1X7FA 3VO0A 1NWTA 1NOUA 2YCJA 1UR9A 4AD2A 1IIGA 3SCRA 4PMNA 3DAQA 3W86A 2HBVA 4GYKA 3MDUA 1QATA 3QTGA 4S2BA 4AVOA 1RA5A 1JRBA 4W7WA 2PFHA 2CCRA 3S0CA 1VP5A 1DXFA 1SO3A 5EBAA 1N8WA 3OYZA 3N12A 3UG3A 2HE8A 1O66A 5D37A 1US0A 1MQPA 1UPPA 3HPXA 2OODA 4HZMA 1XBZA 4A8RA 4AHPA 2UBPC 2OLSA 2OGJA 3PK7A 3GG8A 3VUPA 3CUJA 1LJYA 3CUFA 3R8HA 3K4WA 3WDPP 3KWXA 4TOQA 2YDQA 2XINA 3EWXA 4WXZA 3NM1A 4D8LA 4P8XA 3H24A 4ZENA 3IIVA 1AH3A 3UY7A 3LBMA 4J3WA 5GNXA 3QEZA 3BC9A 3TH6A 1TSIA 1UA3A 2Z2UA 2B81A 2Z6IA 2R91A 4X0NA 3NGFA 1QPNA 4GD0A 2YZ5A 1WKYA 5LIXX 1X97A 3ID7A 2HZGA 4HK7A 2J7BA 3P74A 4X9SA 1JDEA 4MKSA 4A3RA 1OBAA 1TV2A 4IG2A 4RXGA 5C2GA 2DW6A 1W0MA 4OOZA 4L4OA 3H7RA 3ME3A 3KRZA 4BJHA 4CD6A 4WJ8A 4QBXA 3MP5A 5AHMA 1IF2A 2HROA 2BGQA 4KMQA 1R2SA 2R1PA 1XP3A 2D1ZA 1VPYA 1Y5WA 4X0VA 4J9JA 4J3VA 1FWAC 3BSHA 5CZTA 5FJPA 5A8NA 2E3ZA 4H8NA 1P43A 1YDYA 3MHGA 3W2KA 4HA4A 3K8KA 3WJYA 3GW0A 2P50A 1LBMA 2WMIA 4Q32A 3NZRA 2GDQA 1O7AA 5DT7A 1JPMA 1CXEA 2PLKA 5D05A 3DYMA 3URBA 4XKMA 3M1ZA 2JGYA 4XAFA 5JBDA 4JTTA 4ZE5A 3COTA 2V3EA 1M1BA 4O14A 3H8AA 2DSKA 3GXTA 4YTRA 1I4NA 1N8IA 4ZOCA 4EKJA 3I7QA 5F2MA 2PDLA 1W1IE 3H53A 3UA4A 3WLKX 3TA6A 3EA3A 5CC5A 2G3IA 4PBEA 3WD1A 2QCCA 4IGHA 3KBJA 1ZALA 1P7TB 1R0MA 3UEQA 2WQDA 2A21A 1TB3A 3LHWA 1E55A 5K9DA 4DJDD 3T6CA 4OVXA 5M17A 2O0TA 3K1DA 4O0KA 5AC7A 3IUDA 1RQEA 4YS1A 4LY4A 4KCWA 2DU2A 3KXQA 1A3WA 3AICA 4JBRA 5C6MA 3PN8A 1JCNA 5C54A 2DORA 4P8UA 2HV5A 3KCJA 3A6OA 4UQAA 1KR1A 4DAFA 3C5QA 2DFAA 1AQ0A 4GQQA 5HJYA 4Q8OA 1S2CA 5B7ZA 4L80A 1F4HA 3TWBA 3VNMA 3VGEA 1EGVA 1OFRA 3PS7A 4LAUA 3LXCA 1DJZA 5HQMA 4CN6A 2NXIA 3KVJA 4FXSA 2CWNA 4KFPA 5E09A 3TC7A 5AYZA 4MKVA 2H3BA 2ZZ6A 3VCCA 3L4ZA 1JCJA 1GQLA 1J5SA 5DMMA 1X6UA 2ALDA 2P76A 1AA1B 1DIOA 1V0LA 1EXPA 3RPTA 1UWSA 4NZFA 3MO4A 4ROPA 5HWMA 3RCNA 5DANA 2PMQA 3ELFA 4Z1CA 4QAWA 3URQA 1CLKA 3GS6A 2GQ8A 3TE9A 3WBEA 1TJ1A 2I5QA 4L4MA 3SN4A 1Q6QA 4C6PA 2R9RA 4WOZA 4AHQA 4JFVA 3ES7A 1G4SA 3GXFA 2FFIA 3PZNA 3RAOA 1JYNA 3VNIA 3BW4A 1CENA 2QCFA 4M0XA 3T78A 3G3MA 2J4GA 4DPQA 3RX2A 3IUHA 4L9XA 5CC6A 5DX7A 1WZLA 1DHPA 1TV7A 2CZ5A 1A4LA 4MB3A 3SQSA 2W62A 1J96A 3EWWA 1DE6A 4B4HA 2Q8LA 1V6YA 2C79A 3S5YA 1W1PA 4R33A 3TOPA 4F66A 5ECVA 3GKAA 4XD4A 2YXGA 2ADAA 1OK4A 4JTJA 1JUEA 1JZ2A 4K7VA 3WLMA 2HK0A 3VD9A 1T6MA 4FX6M 3MZNA 3PFRA 4TQTA 3V0UA 1SO4A 2CERA 3BAIA 4MYAA 1XCXA 1B0IA 2PWGA 3SQLA 3TXVA 3V3WA 4BY3A 1EBHA 4HMCA 2CETA 1UJPA 3QXBA 1L8PA 3STPA 1JGMA 1Y7VA 6TIMA 2E5CA 3WLTA 3OGSA 1JQXA 4LYQA 1ZENA 1A47A 2PLCA 2Y89A 2PI6A 1KTBA 3IIZA 2V68A 5BXPA 1QVBA 1PJ9A 4LUTA 3W7DA 2J66A 5LNUA 2TPSA 2Y8KA 1SU5A 2PSNA 4J3UA 4UFJA 5FJUA 3TAKA 2PLJA 5DRCA 1PX3A 1SFSA 3E2VA 2V5CA 3ARTA 4C7GA 1HL2A 4YVPA 4JQ1A 3T0CA 1FWSA 1H2JA 4QR6A 2G37A 2FZ8A 1CTNA 4Y2WA 1R46A 3VIOA 1S2WA 3VKJA 1TKKA 1I0DA 2F6XA 1HKMA 3HBLA 2O56A 1E6ZA 3P5ZA 2A3BA 3RGTA 3H4GA 2WNQA 4OZOA 4EAYA 2QCHA 1AUSL 4XX6A 1TZ7A 2OO0A 2J77A 5I5RA 3G1SA 2IUZA 4NU7A 3OU8A 2JF7A 3JRKA 5E5CA 1JDDA 3FJLA 4D6JA 3L5AA 1D7KA 4N2YA 4DZAA 3CS2A 2P8CA 1HJWA 4Z2LA 3GXDA 4UFHA 3QC0A 2ZXDA 2REQB 5A94A 3AXXA 4FOKA 3CQHA 5DY2A 5D9PA 1W17A 4A21A 5IHSA 1LL7A 1ECEA 3QQ0A 2PDNA 1VFOA 3ITCA 4MAVA 2EPHA 1ZJHA 3ZWTA 2AGTA 2CITA 5EMLA 1W5MA 3MMWA 4QDWA 2WZHA 3FAWA 3O6YX 3EEZA 1X1ZA 5DLCA 3GX9A 5LIKX 1JYVA 4U33A 3MSGA 1TIMA 4YVXA 2NQZA 1VGAA 1EP1A 1BXBA 2PDGA 2EKGA 1XLLA 4DAIA 4RW5A 2W63A 3S6TA 1RY8A 5D03A 5K7JA 5EFDA 3S9ZA 3MDWA 3W1QA 1KFWA 4AD5A 3WJWA 1JYWA 2YFOA 4W4QA 3LZ3A 3M0VA 5ABHA 3ONCA 2GYIA 4E4PA 1Y5VA 4JAWA 4DXXA 1BWVA 4GUGA 4Q8QA 4JEJA 3W74A 3ZZ1A 4CCDA 2X1SA 3UR5A 4DF1A 1B5TA 3KTXA 4NX5A 1MVYA 2WWDA 3OEXA 2V8ZA 2CC0A 1JPKA 4XAZA 3M0YA 4C6NA 1W5PA 2IS7A 3C52A 1EGZA 4XZLX 2E9MA 2WB5A 1V3IA 4ATLA 4AEFA 4UTMA 3VGFA 1WO2A 3HV8A 3UFYA 1DJNA 5E0FA 4ECLA 3HGOA 3KBWA 2FZDA 5G2HA 2PD9A 3S6DA 3F5KA 4ZO9A 4DZIA 5G5IA 1PBGA 4PTNA 4DNMA 1OWQA 3NQCA 3PZ9A 1FH8A 2XH2A 3G1HA 3QVQA 1LYXA 3VNDA 3FDGA 4Z0JA 1TTQA 1R9ZA 5LNVA 1CBGA 2TSYA 4L5ZA 5HJLA 1JNDA 4AD4A 1PTDA 3L21A 1QO2A 2YX0A 3KWSA 3AS3A 4HNLA 3FLUA 4L1XA 3SGZA 4PC8A 4N9CA 1L6YA 4UB9A 5FAGA 4PCSA 1RBAA 3HA1A 5LSMA 3M5XA 2WJEA 4CQCA 3J7HA 1JD9A 4XZ9A 3AOFA 3OVPA 3SIMA 5FJTA 3LRMA 2V6AA 4GACA 2ZE0A 1YRRA 4LBSA 1NWUA 4XSMA 5A1AA 1UWTA 4XSLA 3HPZA 1SMDA 4A8IA 2X09A 1F3WA 2YKKA 1GJWA 2V5KA 4I7VA 4JFWA 2J7DA 3DCPA 3VKDA 3N4EA 4NHVA 3VE7A 2VZTA 2CFFA 2NV9A 3GYEA 5DY3A 1IXQA 4ROQA 3SRKA 3PVFA 3PBGA 3FGCA 2J8GA 1AFSA 4N42A 2WMFA 1GVYA 5ECUA 1EFZA 2VEPA 2XWEA 1R38A 3O0KA 2F38A 1WV2A 1AJ0A 3E1F1 2C8NA 3HGRA 3I4EA 5IXEA 4J4KA 3WK0A 2Z4GA 3UG5A 4LSBA 3FA3A 2EEXA 1T5AA 3O8AA 4QS5A 3D3AA 3VIPA 5GJMA 5I03A 1ISZA 3B4YA 1NQ6A 4FR1A 2WKLA 3U7BA 3E49A 4QLKA 4B90A 4AWTA 2BZNA 1RV8A 4JN8A 1XLIA 4CQ9A 3AS2A 3AIQA 4MNMA 3UZXA 4JNYA 4I9JA 4AW7A 2H8ZA 2VJXA 3A3WA 1KKRA 5AC8A 3CZEA 4TVUA 1E6QM 1EO7A 1C93A 3BAYA 1Z42A 3DOPA 2Y63A 4KRZA 1QFEA 1RUSA 1OFBA 4MPKA 1H7OA 2C1GA 1EUNA 5MKGB 2OLAA 4FOUA 2Y7DA 3NG3A 1S5MA 1F8IA 4GYPA 4CNSA 4LNCA 3WNPA 3L12A 2WVTA 1UWRA 2HVOA 1CNVA 1H63A 3AYSA 4FK9A 3DBNA 2BG5A 5A8PA 1DTNA 1VRDA 3ZVHB 4S3FA 3C56A 4HU0A 1OX5A 2QCNA 3T0DA 5JIWA 4H9ZA 2FKPA 4WGHA 1W3JA 1EHNA 1F6PA 4JTSA 1VBHA 4N7QA 1UOZA 3EMQA 4KWWA 4M56A 2XU2A 3IAQA 3DX5A 3EKLA 1TJ0A 5AKQA 4HNUA 3QPYA 3NL6A 2F2HA 4UOQA 5RUBA 1GGOA 4AVFA 3E12A 3OLGA 1CDGA 3KBMA 1FWTA 4IQEA 1AQFA 3EWUA 1SW7A 1OYBA 1GEQA 3HGSA 1E3XA 1EDTA 1P1XA 4MHBA 3S9YA 2V2HA 2PCQA 3BDKA 1XH1A 2I5GA 4K68A 3ARQA 3QW3A 3AIBA 1BTCA 4OKDA 1G94A 3SCOA 3IV3A 1A5UA 1QOPA 1KCXA 3SN1A 2WXDM 3L4XA 1XDLA 4XAGA 5FIPA 1FWFC 1JFXA 4LVGA 1KA9F 2NQLA 4PUMA 1UMYA 5LIWX 3K1GA 4AAJA 1X96A 4AG0A 1OJXA 4MWAA 4ACZA 3KFTA 2VX5A 2HNHA 4NI8A 1I2RA 3THUA 4AZ7A 2E9BA 2TAAA 3CC1A 4AY7A 4B3ZA 1DWGM 5JH2A 2YOCA 2ZUUA 1HO4A 1EJXC 4V28A 1MQRA 1KFEA 3CUXA 4H9XA 2WZTA 3C8NA 5D33A 1E9LA 2H8XA 1ODZA 4RX0A 2JKEA 3CEUA 3WO8A 3LHUA 4OECA 5FI8A 2X0YA 4Q6XA 1LLWA 1EA9C 1XC6A 2XSXA 5HANA 2DZWA 1H1YA 1XW8A 1UIOA 4LB4A 1DBTA 2BHYA 2G4JA 3WF0A 3EX3A 2JALA 3TVAA 3AHYA 3TK7A 3G0SA 1EL3A 1R2TA 3C0SA 5CQ1A 3IARA 4PUEA 3PTQA 3C2OA 2FMOA 1X38A 1QW8A 4PEEA 3U9IA 4HPNA 2V2CA 3S1GA 4GGHA 3WNKA 3HJZA 2D0HA 2OEKA 2OPJA 4D6IA 4C5YA 1UZ4A 4GY7A 1B3XA 4ENLA 3FVDA 2VNCA 1JF5A 4DBDA 1UD4A 4Q22A 2Y7EA 1G4TA 5HQEA 1S39A 3G8RA 3MI6A 4OV4A 5D9MA 4MFEA 4LUJA 5CPOA 2Z29A 1UIPA 1VJSA 1FTXA 2PTWA 1UKQA 3LG3A 3C61A 1W5OA 5HNTA 3V75A 3N9RA 4E8DA 2XGZA 3WDRA 1UWUA 3W83A 3WEZA 3B0XA 1S3HA 3LV5A 2WZEA 3DXIA 3MWAA 2ZRVA 3OJGA 4XISA 4ZSUA 1VFMA 3E2RA 2E6DA 4LOCA 3S1WA 3IEBA 1V79A 1TV5A 3PUDA 4QEEA 3OVGA 1XLFA 2PDQA 2VUNA 4BCEA 5EB8A 3JZUA 2OT0A 4TTUA 4HKPA 3IVSA 3PJXA 3SR7A 3BOLA 5HK4A 4H9TA 2PBGA 3V0SA 1BFNA 4S3DA 3PY2A 1R30A 4HK5A 4JDYA 3H7VA 3RN6A 1SUXA 4PRTA 5BXRA 3WMSA 1FQ0A 3THCA 1HUVA 2CLOA 1VBUA 1TJRA 5JH1A 4F2TA 4ZB2A 4KW2A 4AZHA 4JTDA 1W2VA 3CJPA 1EOMA 3PG9A 3G2GA 4LJ3A 1DV7A 2OSWA 2WHJA 2XN0A 1W2PA 4J2MA 2FVLA 1TIWA 4MKNA 4M24A 1XQKA 1Z6KA 1V0KA 2L5HA 4UR7A 4WCJA 4YVVA 1R87A 1EP2A 4WK9A 4KS0A 2FDSA 3AMKA 5F7UA 3UJEA 3SB0A 2BBFA 2A3AA 2XIQA 3N13A 5FOOA 3T42A 1P0EA 4DNHA 5HULA 1JCLA 4ZQOA 3VOHA 1M3UA 4M3PA 4MZ1A 4EIVA 2F6UA 2HISA 3GHUA 3BV7A 1FWCC 1WKEA 1QNQA 3FX4A 4LU0A 2B7NA 2Y7GA 4LGXA 4HNVA 2Z26A 2J8TA 4FXRA 1NFBA 3OA5A 1CXLA 2OSYA 4AZCB 1S5NA 5E6YA 1HKWA 2RAGA 2Y4SA 2PTZA 3VI2A 1XHGA 1M41A 2EJAA 4IPNB 1A0EA 1G6CA 3Q67A 3A64A 3LPPA 1OZMA 1VFHA 3E0IA 4LFYA 1Q3NA 3P62A 4F0KA 1NDZA 2HS6A 1IIHA 2A85A 4R7JA 4TV6A 3LRLA 3V5OA 1HGWA 4Z0SA 1REQB 3T9PA 1CGXA 1KRMA 5LGXA 3W2UA 4Q7NA 3LA4A 1NIUA 3QQWA 3U5UA 1H4PA 1B3ZA 4JIEA 2GSEA 4GPNA 1U83A 5BCAA 3A22A 4AEOA 1D3CA 5A6TC 1TZZA 1SSGA 1YDNA 4ZFMA 1S2UA 2GQ9A 3LV6A 4MDOA 3GR4A 2A1YA 2BY1A 3UWWA 1I2QA 4L7ZA 2DDXA 4AQLA 2C15A 1EF2A 3G77A 3M46A 5GQBA 3CYVA 4KETA 2D69A 4LX4A 4LYKA 4QHRA 3ZM8A 5HMEA 1W3HA 1QOQA 3GB6A 3GXIA 3B9NA 4FS9A 2QQ6A 4XD3A 3BJSA 1ZBVA 4MB5A 5FCZA 1R86A 1W56A 4ZB0A 4WX2A 3WZ0E 4RZBA 4Q8PA 5HBFA 1VRXA 5A8OA 1OCBA 4N02A 1O5KA 5DCEA 3WLQA 4YTSA 1HG3A 4B5TA 3H26A 3AXMA 3OQEA 1UB3A 3TN5A 4WF7A 3W73A 3AALA 2DJLA 3I7RA 1X6NA 3S6OA 3LYEA 1F07A 3QPEA 3VIJA 1XV8A 2FB3A 1W9VA 1QJWA 5D2WA 5H8UA 2PWHA 1A3HA 1MRQA 3MV11 4V2XA 3MKCA 2YR1A 4Y9NA 1KO0A 1ME8A 4I8YA 3W2MA 1KGWA 3N2BA 1J6PA 1EZWA 1T8XA 1ZP4A 3PFMA 1DIKA 1TWDA 2F8QA 4Y7EA 1JR1A 3MI2A 3EOUA 1T8QA 2ISSA 4ASTA 5C7HA 4B5NA 1X39A 2HEJA 2OWWA 2VURA 2RJGA 3KHJA 3RDKA 4PUNA 1H62A 2XN2A 4C6OA 1UQZA 3WNLA 5HINA 2FTYA 3SFKA 3VKAA 4H6RA 4NT0A 3D47A 3NPXA 1H51A 4GBDA 2VDGA 3N25A 1VD6A 1CXHA 1A0CA 3H70A 2BY2A 4FNRA 1P5BA 5I3JA 3HM7A 3AYVA 1PSCA 1IEIA 2XM2A 1RK6A 1FP9A 4D71A 3SRHA 1YTKA 2WM1A 3LM7A 3HN3A 4AD3A 3EYPA 4Y9MA 4Q6JA 1V51A 1OFDA 3RJYA 3SSJA 1TA3A 1XRSA 1UD2A 2Q71A 1WXJA 4CVUA 4US5A 1AZ2A 5TBOA 1V5XA 1NAL1 3EOSA 3P2VA 3KLKA 2AKMA 2GUUA 4G56A 5BU6A 6REQB 4UMBA 1XLJA 3THAA 1BYBA 1TYGA 2GOUA 2WJDA 4FNQA 6PTDA 2D2GA 5I2UA 4NZ3A 1XIGA 3OZYA 3BAWA 1KLYA 4MWAD 1I2NA 1XLMA 2C71A 3B4UA 2O9PA 2CWXA 4QNWA 4ML9A 3W00A 2E68A 3WIJA 1EUAA 1I60A 1X98A 4H83A 1D2KA 3S9IA 3OG2A 4NIRA 1JXKA 2XIIA 4RDWA 4DLFA 1ML1A 1ADSA 3MHUA 4JTCA 4Y9AA 3TQKA 5EMMA 3EA2A 3BAXA 4HPJA 4KIEA 4UUIA 4A4AA 1GPWA 2J88A 4IMGA 3AC0A 2B7PA 1CCWB 3QKEA 2ZUSA 1OG0A 4R5EA 4AIUA 2WJZA 2GVLA 3RPDA 1QNOA 3OVRA 3EX1A 4UTUA 2J75A 3MMTA 6TAAA 3E0LA 1GYNA 3NSNA 4XZHA 5DO8A 5HNNA 3OB8A 5M03A 2C0HA 4FLRA 3NQ8A 4PB5A 4HGXA 3FSTA 3ONBA 3FS2A 2HPIA 1H41A 3RPMA 4UNLA 3WK3A 4MYXA 4A3YA 1Q6CA 3H2CA 1EF3A 4ALDA 2P88A 2POTA 3UWYA 2IQTA 4Q4MA 5FJJA 3EDEA 1Q6FA 4CQAA 3WQ4A 3LHYA 4ZSTA 1ME9A 1R6WA 2C1IA 3CHEA 4XB3A 1CT5A 1OX6A 4RLIA 2J6XA 3WG6A 2WO5A 3FGCB 3MWCA 1AZ1A 4QG6A 3N2OA 1HGYA 1S1PA 1DIDA 2Q3RA 4F0HA 1TPEA 4CQ8A 1QR7A 4BQ5A 3N6QA 5I09A 3NL3A 3NO1A 2ISFA 2VQUA 4BQ3A 3S42A 4MADA 4TMBA 1W1TA 1KGXA 4RDZA 4RE0A 2V3GA 3S47A 4LYPA 3PZQA 1B3VA 1DEDA 3MYOA 2G0WA 4HTBA 1I75A 1GHRA 1AMKA 4AFYA 1K9TA 4FF5A 2CZFA 3CK5A 4AH7A 3BANA 3E74A 5G4HC 5AYYA 3SY8A 3SRFA 2VR2A 4ERGA 2VC6A 5F2IA 3WF1A 2HMCA 1EJTC 3ABOA 1A49A 1LP6A 4HTYA 4B5VA 3L0KA 3DZ1A 4GH1A 2Y85A 4BWLA 2PRLA 2YA2A 4YYCA 4N0RA 3QQ1A 1CB2A 2D22A 4C6DA 2P0OA 3NA8A 2WNWA 4AZBA 3H12A 2OX4A 3FJNA 5E9XA 4H04A 1W3KA 3W26A 3CPUA 1O60A 5GJNA 3LM3A 1QNVA 4A22A 5ABGA 1GCYA 1GQKA 3AYRA 3WUBA 1FKWA 4KCUA 3GBEA 3APYA 2FPVA 2GQ3A 2AQVA 2KZHA 3UJFA 1BLIA 4EXAA 5BOEA 2UWFA 2VGIA 1XISA 3P8JA 4NKCA 3NVTA 5LNWA 4WSJA 2YIHA 3DI1A 4QM1A 2GK1B 3W87A 3BMXA 1LLZA 1XJBA 3F5LA 1RZMA 2FZ9A 1XPGA 3OA3A 4HOXA 1BVNP 4JKLA 4HB7A 4QXIA 2PD5A 5AHIA 3DC8A 3WUGA 1EJUC 3A5VA 4J2PA 4XD6A 3LCGA 3M0IA 5CXPA 3KBNA 2YCKX 4EAMA 1VLWA 4NQ1A 1EEXA 4WGXA 1AJZA 2R1NA 1WZAA 1JPHA 2YDSA 1BWKA 3CWOX 4IJCA 5F2GA 1I0BA 3C4UA 4E3VA 4HIBA 3NQ6A 3TZNA 3M64A 4IUGA 4F2UA 3S2LA 1G4EA 5LA0A 1W5QA 2VENA 3EWYA 2CXGA 5BWAA 1HIZA 1BQCA