2YYUA

Crystal structure of uncharacterized conserved protein from geobacillus kaustophilus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
225
Chain Sequence
b'TPFIVALDFPSKQEVERFLRPFAGTPLFVKVGMELYYQEGPAIVAFLKEQGHAVFLDLKLHDIPNTVKQAMKGLARVGADLVNVHAAGGRRMMEAAIEGLDAGTPSGRMRPRCIAVTQLTSTDERMLHEELWISRPLVETVAHYAALAKESGLDGVVCSANEAAFIKERCGASFLAVTPGIRFADRVVTPRKARALGSDYIVIGRSLTRAADPLRTYARLQHEWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
total genus 74
structure length 225
sequence length 232
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yyuA00
4A22A 4LTSA 4RZ5A 2JKEA 2E6DA 2A7RA 2Y85A 3P82A 4NT0A 2EGZA 2A5HA 1K3UA 1SO4A 1RD5A 5AHNA 3OG3A 1WOBA 4PFMA 4DBEA 2GJLA 4WD0A 2RH9A 5CZTA 1H7RA 1G4EA 2OZ0A 2YPIA 3PVFA 2ZZ5A 4O19A 4IUOA 1FWTA 4TR9A 1I4NA 3A23A 4Z1DA 1PV8A 2QEZA 2VOMA 1H1ZA 1RQEA 1EIXA 4XWUA 3QF0A 2FQIA 3B8DA 4O14A 1IXOA 3PUDA 4MY8A 2VFGA 3GVGA 4FNSA 4OGZA 4U4MA 2JK2A 3H55A 4BR1A 4JX6A 4YXGA 1OX4B 4I9AA 5KZMA 3W1QA 1SSGA 2Y7DA 2ISSA 5LNRA 3UY7A 4FB7A 2ABBA 3KVMA 3TROA 5L9FA 4OV4A 4O15A 3P81A 3W1AA 3S0CA 2R8WA 4JIPA 2A0NA 2A21A 3FYOA 4W9TA 5J5DA 5AN7A 5CG7A 5LSMA 1VPXA 4MY9A 3EWUA 3BLIA 1UUOA 4RKAA 4CQ9A 2J6XA 4DXVA 1JCLA 1TPC1 1JCJA 4ZZ9A 4IMEA 4NU7A 2P10A 1SPQA 3MHFA 3W2UA 2A6NA 3C2RA 3EB2A 4IMDA 2LLEA 3QZEA 4O1CA 4S1FA 3TIMA 4WOQA 2ZRVA 3QQ1A 3FKKA 1TREA 4ORMA 3N19B 1I2OA 4N9DA 4JTIA 1QOPA 2BSLA 5FEXA 3S5OA 1B57A 2QCDB 6ALDA 2FFCA 3GB6A 1H7PA 2XN0A 3PSWA 4O1DA 3LLDA 1Z44A 1JQVA 3M41A 3DI0A 1EUNA 1KM6A 3PBUA 3L2IA 3PY2A 2VKZG 4C1LA 2QCEA 3L66A 2FPYA 4AH7A 3ABRA 1BWKA 4U28A 3OIXA 1KM3A 2F7FA 4FIRA 5TIMA 3STCA 1KM2A 3KAOA 4ZQOA 1W3NA 5F4XA 1OYCA 4AHPA 4RLIA 4JTUA 3CWOX 5EPDA 2I14A 4O16A 3E9AA 4PL2A 4RXFA 1DJNA 1XL9A 4P2VA 5AC8A 2ZFAA 1KLZA 3M6YA 3LCFA 3S1UA 1F2JA 4M6VA 4N6EA 1S5VA 2FB3A 4R7JA 3NM1A 4O4WA 3KRUA 3P67A 5BMWA 4AMAA 1X8FA 4MLJA 2FLIA 3NXFA 1HFBA 2DJXA 5BNKA 2VEPA 4Z1CA 4EIVA 5HQEA 5KZEA 1B4KA 3M0ZA 2TMDA 4JICA 3P5YA 3ZFHA 3HBLA 3PB0A 5AOUA 3TC6A 1YXCA 3DH7A 5HR6A 4UR7A 2CLMA 2YGYA 4HNNA 5AHFA 1OX4A 3QH2A 3GNDA 2E5BA 3QPYA 4YL2A 3B0UX 3G3DA 1DV7A 5C55A 4O10A 1SUXA 1S3HA 1PL9A 2ATSA 4LW7A 1AW5A 2ZRWA 1OFAA 4Y96A 1OFPA 3UXAA 1VR6A 2PCQA 2WSQA 2WV8A 3C3NA 4O53A 3U8GA 2Q8ZA 3USBA 2A7PA 5G2IA 1Q6QA 2RDUA 3M44A 4DQWA 3L0NA 1B4EA 5HUPA 3O6CA 5IM51 4ZQMA 2CLLA 1G4PA 3BV4A 3LCGA 3A5FA 1LDCA 3G1FA 2PRHA 2GQ9A 4UTKA 1QCWA 1WOAA 3HJZA 4OQVA 4HNUA 1U5JA 1MEWA 1SU5A 2C6QA 4N02A 4HNTA 3L5LA 3QMSA 1DQWA 2NXGA 4CCDA 4JN6A 3W7DA 1AMKA 4DO5A 3LTPA 1J4EA 2NXHA 3GYEA 3LBCA 2JGQA 3SIZA 2CU0A 3P62A 3I65A 3S1WA 1H1YA 2ZRUA 6TIMA 1ZFJA 4YCOA 2CLOA 3I7SA 4UTJA 3IV3A 4UFHA 3UPBA 4IGHA 3TUUA 1Q6RA 3C56A 4M7TA 2C16A 3NQ8A 2KZHA 5J5RA 5D2VA 3V75A 5AYXA 2E6FA 2HS8A 3MUXA 1LBMA 3DAQA 4GUJA 4FXSA 4JTSA 3KXQA 3ZWSA 1TMHA 1EP2A 1G69A 1FXPA 4HPXA 3CEUA 1TO3A 3W70A 3PBVA 1WBJA 2NWSA 4RZ6A 3MJYA 3A24A 4AB4A 1OYBA 1ZJIA 2Y7EA 3TSMA 2ZYFA 3DHDA 1H60A 4NJHA 1F6KA 3P8IA 3G1DA 3CQ0A 1YPIA 3LI1A 2GJNA 1W31A 3LHYA 4RV8A 1OK4A 1FWNA 2CLKA 4QQ3A 1VYPX 1NFBA 3M47A 1UCWA 2WNZA 4DBDA 5K4ZA 2ZRYA 5HWMA 3W2KA 5C5YA 1TQXA 2HS6A 2GVLA 2PE4A 1FWSA 1K8ZA 4OBTA 4LVDA 5FEWA 1LYXA 2DZTA 1DBTA 1A5SA 3I68A 3DKLA 4H3DA 4O0KA 3OBKA 4HKPA 3BW3A 1FCVA 4AHQA 2J88A 4N4PA 5K7JA 3LI0A 1H7OA 1QO5A 4GRSA 4ZVJA 1FXQA 3N9SA 3DI1A 4GXMA 5BMXA 5H91A 2E09A 5C6MA 4O8RA 3GK0A 4UCGA 3DZ1A 1LBLA 3NGJA 4CLMA 2WSYA 3INPA 2WNQA 5G2WA 1QFEA 3MI2A 3CIWA 5LNVA 2H8ZA 4K38A 1TPUA 1GWJA 1TTQA 3NPVA 3WK1A 1SW7A 1SQ7A 5K9DA 2GVJA 3BW2A 2NWRA 4AF0B 3LM7A 2VC6A 4O1AA 2QAPA 1VQTA 3GKAA 2IQTA 3O6YX 1G4TA 4XKYB 2E5CA 4K37A 3A5VA 3F1QA 1PE1A 1QAPA 4HSNA 4NXSA 3GXPA 2Y61A 3HB9A 2NX3A 3P84A 2QCHA 3ANYA 4O12A 1ME7A 3O07A 3HPXA 2A85A 1KM5A 1ZY9A 2V8ZA 3A9IA 5DELA 1GQNA 1QOQA 4YLWA 1S5WA 5GVJA 1XKYA 2CLHA 3BG5A 4FEZA 4KFPA 4LT9A 1T99A 5K9XA 2DZWA 1JVNA 4BI6A 3KHJA 2Q8LA 2XFWA 3LRMA 5L6UA 3BLEA 4MJMA 4WY0F 4NJIA 3W75A 2GUUA 1R46A 3K30A 3O05A 3VNDA 3UWVA 1ML1A 4O4VA 1IXQA 5DLCA 1G7VA 2P1FA 5D38A 5IBXC 3LCXA 1EWDA 3PG9A 4OWGA 1C9DA 2X1RA 5H2ZA 1KW1A 2TRSA 4UFMA 2RHGA 4O54A 4Z1AA 3FA5A 3L65A 4FX6M 1MXSA 1NAL1 5HJLA 3W87A 1UBSA 3HG5A 4EWND 5KZDA 2YXGA 3B0PA 2C13A 1OYAA 1H7XA 1FQ0A 1OFBA 3NQVA 4BWLA 4QNWA 5E1QA 2Y7FA 4PODA 1P5BA 1R30A 2PRMA 3EX1A 3W86A 3KFTA 1JCMP 1LP6A 2RDWA 5CSSA 3VE9A 4Z0JA 2V2DA 1EX5A 3L9CA 1L2UA 2OCZA 3W88A 4XTDA 1VZWA 4DF0A 5AHMA 4N4QA 3W7JA 1YYAA 3O16A 2NZLA 1Y0EA 4HT3A 3TKFA 3HGOA 5K4XA 3GZ3A 3ZWTA 2A6LA 1SW3A 3TK7A 4RX0A 1FY6A 1OF6A 3P60A 3G1XA 1SSDA 1JCXA 5ABTA 4NNBA 2NUYA 3W1XA 2DU2A 2OX1A 1JRCA 3N2XA 5D04C 4AF0A 3DHFA 5FF4A 1TQJA 1A53A 1QDSA 2WNNA 3B4UA 1ME8A 1I2RA 4Y6GA 3OVQA 3SGZA 1XC4A 1ICPA 4UTIA 4M7SA 3NQ2A 1G4SA 1A5BA 1OFEA 3PB2A 4ZMGA 4HNVA 1W5PA 4X9SA 3RNDA 4GWEA 3PC0A 3T7VA 3NQ7A 3GIYA 5HWJA 4DPPA 1GG1A 2UV8G 3L67A 3B0VC 4GJ1A 3PBWA 3W71A 3N9RA 4LV4A 3CLMA 3NPWA 4M19A 3C2OA 1A5AA 3B05A 2C0AA 1LOSA 3HGJA 3NM3A 5G4WA 3EXRA 1GVRA 4B5NA 3Q37A 4NJJA 3W7MA 1AL7A 4LU0A 1WXJA 5DXXA 1RQBA 1GVFA 4KWWA 7TIMA 4LRTA 1WBHA 3UWQA 1H50A 3LHTA 4S2BA 3DGRA 5K2ZA 3BVJA 4WOZA 3W1TA 1YTDA 1KV5A 5F4WA 4FO4A 4BFAA 1GT8A 3NVTA 2BLEA 3A22A 3TNOA 3C0JA 1D9EA 4N9EA 3LCWA 3P7YA 4M6PA 1HO4A 1Q6OA 1SFLA 3GLCA 3OVPA 1AL8A 1G67A 4JIQA 1TYGA 1NF7A 1L6SA 4Z0SA 1LOQA 4ADSA 3O8AA 3UZ5A 4AHOA 1GEQA 4TMBA 3JS3A 4MLRA 3NQGA 4CCEA 3E12A 2FJKA 1PCWA 2QDGA 4JD4A 2JKAA 1I2NA 5I3GA 3KRZA 1YXYA 4AAJA 3TSBA 4O28A 4ORIA 5DBUA 4LVBA 3LV5A 1TPFA 5TBOA 1FCQA 1FDJA 1JUBA 3FIGA 1XBZA 4J9JA 4QNEA 2Z1BA 3TW7A 2E6YA 1W5MA 3MI6A 3S42A 3ABQA 2I1OA 5A5WA 3W7GA 1XBYA 4G1KA 2JKPA 3L21A 1QPOA 4TX9A 3G1AA 3F4NA 2QJGA 3UQNA 5FF7A 3FS2A 1R2TA 2HTMA 4CCCA 4QAIA 3HOJA 1OVDA 4CQAA 2I9EA 1QPNA 3F4WA 3W84A 3RMJA 3FFSA 4E2DA 2V5LA 3EXTA 4N9CA 3G1HA 3M16A 3BLFA 1T0OA 1XDLA 2AAMA 4IWWA 5AHLA 1TPH1 1P0NA 2ALDA 1SZFA 1M6JA 2QCCA 3LXAA 5DCBA 4E38A 1QPRA 1YDVA 3P74A 4MFEA 5HUOA 4RJEA 1QWGA 1IIGA 1WDWA 1Z42A 5I3KA 5G1YA 4UTTA 1ONRA 1OFQA 2NV1A 5FF2A 4E2BA 1SZGA 4ZQPA 4PTNA 3WJSA 2PRLA 3IIXA 3C2FA 1DJQA 4X3ZA 4JNMA 4IPIA 3VKJA 1H5YA 3SW6A 1D3GA 1K7XA 5F2IA 4FNTA 4POCA 3Q94A 3WK0A 1F7BA 3C8FA 4O1BA 2EAWA 1PCKA 5D37A 3S1VA 1L9WA 3NL2A 4JYFA 1K03A 1GTHA 1Q3NA 2A1YA 4LNYA 1H7WA 3B06A 3WJZA 1YADA 2HSAA 4OU1A 3EX6A 1DQXA 3KX6A 4L4MA 1W5OA 3FJ6A 3LTYA 4JDYA 1DORA 3QW3A 3R89A 3TE9A 1VC4A 1OFDA 4O11A 4WXYA 1F5ZA 2WJZA 3MP5A 3BO9A 4ICNA 2B7QA 4BI7A 2RDTA 1BTMA 3DFQA 4L4LA 3D0CA 1W8SA 4FX8A 1W1ZA 3BG3A 1Q45A 1LTDA 4WXZA 2DP3A 4KFNA 3WJYA 1SFJA 2X1UA 5FEPA 5D32A 1FUYA 3TJLA 2H3BA 3GDMA 3DFTA 4R53A 1R2RA 1ZHAA 3E0IA 2B0MA 3PSVA 5AFDA 2BX7A 3ABSA 3PBYA 1DVJA 3G0XA 1FX6A 1TJPA 3NO5A 1TTPA 4LV9A 1S5TA 1F73A 3EX4A 2A7NA 2GQAA 4A29A 1K7EA 1XDMA 3O15A 1VHCA 2DZVA 3EKLA 3G8EA 4O13A 3NQ6A 3HG2A 1PS9A 3H53A 1LORA 1I8JA 4JDBA 3TQ0A 4D2JA 4ZQNA 1KFCA 1G7UA 4QM1A 5T26A 4UXDA 3KOFA 3V1PA 5KITA 3DFOA 2DJLA 2FIQA 5TQLA 5KTLA 2YW4A 3LV6A 2ZA3A 4DO4A 3QM3A 3W7EA 3STEA 3G0SA 4MVAA 3NAVA 1TPDA 4MPQA 4JYDA 3LCIA 2ZBTA 4IOTA 1W56A 1OF8A 1UB3A 4IJBA 2PC4A 1LOLA 4MYAA 3CPRA 3PR2A 4IX0A 3L5AA 4LVAA 3E49A 4Y9AA 4UMAA 5FESA 4WY0B 1TTJA 3YPIA 1IXNA 5I3IA 2CW6A 4XZ9A 2QCDA 1XBVA 3LRLA 5FF0A 4DO6A 4GUHA 3UY8A 1C8VA 1GVSA 4NJGA 3W23A 5BW6A 4UNKA 3B03A 3MW7A 1GTEA 1OJXA 3NQMA 4JY9A 4XBKA 3AO0A 3I7QA 4NJKA 3SZ8A 2ISWA 3W7RA 3TR2A 1TPWA 4GUGA 3WFAA 3G0UA 2OT1A 4AVFA 1CX9A 3GDRA 2VFEA 3STFA 3W7LA 2W6RA 1EUAA 5LNWA 4A21A 5K9CA 5D30A 4TU1A 3MP4A 1SO3A 3HIJA 2X2GA 3NPUA 1QO2A 3R2GA 4JTKA 2CLEA 2DZPA 1VYRA 4WZHA 5E93A 1GYNA 2ABAA 1ZAIA 2QCLA 3BW4A 3NL6A 2YYUA 2ZZ3A 4EVZA 1RVGA 5AHIA 4LOCA 2QUTA 3UWZA 3QSRA 1GJPA 1TRIA 5D03A 3TSDA 1GVQA 1P1XA 1TV8A 1K8YA 4R34A 3W2NA 1H63A 2Y89A 5LHFA 1KV8A 3OEXA 2E1DA 1KFBA 1EP1A 4O52A 4FF7A 1FBAA 5D2YA 1T8XA 2WSRA 1YDOA 2AQWA 3LXCA 2CFFA 4GNJA 3W7HA 3PAJA 3VCRA 5AC6A 3UWUA 3TMQA 5U7SA 3RK8A 1EA0A 5U4NA 4UC5A 5EY5A 1G6CA 4OE7A 1O60A 1XXXA 4JX4A 4CNOA 3HGRA 2C18A 1OX6A 1FWRA 3PULA 5LHEA 1SR9A 2VFIA 3QQ0A 1JCNA 2C15A 1L6YA 2DZXA 2ZTJA 4IXXA 4O17A 3HQ1A 3T78A 3S8HA 4Q4KA 1QR7A 3L68A 1M5WA 3RLVA 1MEIA 2ZRXA 4I7UA 3SR7A 2GOUA 4X2RA 3UXDA 2R91A 3O1NA 1DL3A 5CZ0A 3GX9A 3W7KA 4Y8FA 2Y62A 1PHQA 3MMTA 8TIMA 1VLIA 1KBJA 3TFCA 2J27A 1TB3A 2H6RA 2DORA 2NXIA 5LGXA 1WAUA 2WKJA 3TW6A 4MUZA 1Z48A 3LTSA 3TAOA 1Q6LA 3R5EA 3W7PA 2ZRZA 1X1OA 4LS2A 1M7OA 4CQ8A 5EL1A 1EEPA 4MIMA 1VCGA 4ALDA 1DKWA 3TMLA 5G1TA 2YFOA 5EKYA 1NVMA 3PUEA 3QRHA 5CKSA 4JGDA 4LUJA 4ONVA 4GE8A 3RF9A 1EWEA 4BWLC 1H61A 3SJ3A 3S5ZA 1K7FA 1QPQA 4ADUA 3FLUA 5F2GA 3O6DA 1MEHA 1EB3A 3DKJA 4TO8A 2CZDA 3W2LA 4MFDA 1IIHA 1YDNA 1EPXA 4K7YA 2A2IA 5D09A 3DU0A 1K8XA 1KFEA 4JXCA 2VELA 4I7VA 3EWXA 5D2XA 4ZQCA 2V9DA 4NVTA 2QUVA 1QNVA 5CPOA 3CC1A 3TV8A 1W3IA 3AJXA 1EP3A 3G1SA 1H51A 2NV2A 3EKZA 3ATZA 3TQVA 4MYXA 5D02A 5F2LA 1Z41A 5FEZA 1JUEA 2FDSA 5EBUA 4HN4A 5DBTA 5BRBA 1WX0A 4HSOA 4PEKA 2TYSA 1AW2A 3IEBA 4HIBA 1LRNA 3TAKA 2V30A 4DF2A 3LBMA 1DOSA 3N2MA 2P0OA 3UWYA 1TV5A 3MO7A 4N9BA 4UMBA 3IIPA 3I7RA 3W7OA 3NOEA 2OT0A 2E77A 2XN1A 4GUFA 5KINA 3FEMA 4N6FA 4UTMA 1CW2A 3EWBX 2DZUA 1RZMA 3NG3A 3CTLA 4MKNA 3LDVA 2YCEA 3LRKA 2QCFA 4NNCA 1ICQA 4PL1A 2JGYA 2V0TA 4XBSA 4XKYA 3H54A 5F1UA 1VYSX 3SFKA 5HINA 3BARA 3C4UA 2B4GA 2CLFA 4X22A 4MZYA 2V81A 3ZS4A 3F03K 2Y6ZA 4AEOA 4GC4A 1T96A 5AYZA 4PH6A 3RU6A 5EA9A 5KSWA 2X1SA 3EX3A 4A2RA 1XM3A 1KA9F 4JY8A 3HF3A 1LRQA 3G1YA 4Z08A 1SW0A 5K3VA 1SO5A 2WPBA 2ZDRA 3S5NA 3BPWA 1ADOA 3GKFA 1AK5A 1F6PA 1TPEA 1O95A 2YR1A 1ZAJA 4H6KA 3TDFA 2G5WA 2EPHA 1BEUA 1ZENA 3FYPA 3WK3A 2YDAA 3NQEA 5DXYA 1LCOA 5HULA 1TPB1 1H7NA 5D33A 3G24A 3TXVA 2Y63A 4IMFA 3W7NA 1KFKA 3W22A 3L0GA 5SWUA 3S9YA 1JUKA 5G4EA 1RV8A 2Q3OA 2G95A 3NNTA 3T44A 4YCPA 4NX5A 3ZR4A 4UTWA 3FKRA 2YZRA 3NQAA 1O94A 4FXRA 4LVFA 5D05A 1UASA 3CT7A 4WUIA 2V2CA 5HNRA 1RPXA 3LLFA 4Q33A 2C19A 2VEIA 1M7PA 4TIMA 4QIUA 2X1TA 2YFNA 2EHHA 3SY5A 2VXNA 4K6AA 2HMCA 1KBIA 3NR0A 4NZFA 5AC7A 5LKYA 1J2WA 1P4CA 3U2OA 1DHPA 4K8EA 2GQ8A 5CZJA 2CLIA 3EWWA 1NSJA 2QDHA 3UWWA 1VCVA 3THQA 4IMGA 4M6QA 3HGSA 4MZ1A 5G5IA 2EF9A 2X30A 4KFOA 5DY3A 4EF8A 3EEGA 1ICSA 1ALDA 3R8RA 4JYEA 4RXGA 4JTEA 3NL5A 2E5DA 3OHIA 4UTTC 4UTHA 4N2YA 4LWWA 1THFD 4LC8A 5EYWA 3W7QA 3TJXA 5FF3A 1OX5A 2C14A 5AB3A 3EX2A 2B7OA 3FOKA 2Y88A 3TXZA 3LCLA 1MO0A 4IMCA 3LOTA 3LHWA 1B3OA 4UFLA 2QF7A 3DFPA 3W7IA 1HG3A 4JTTA 3QFEA 5MHBA 1OFOA 3GDTA 4O50A 5F4SA 3W1PA 1LROA 4NNAA 3G3MA 3UYCA 3CM4A 2ZZ2A 2J9YA 1XUUA 1SZNA 3IIVA 1PIIA 5D2WA 3W1UA 1JJKA 2CWNA 4PC8A 3W72A 4UFIA 2YX0A 5LGZA 5C2XA 4BF9A 1OK6A 3M9YA 4ADTA 3IVUA 4PA8A 3W1NA 4LUIA 3PG8A 1W5QA 3HO8A 2YSWA 2V5BA 3W76A 5KMYA 1N8FA 2OJPA 2QCMA 3HPZA 4KWVA 3W07A 1LM1A 3LXBA 2OMAA 2A4AA 1OFRA 5DN1A 3HMJG 3PWAA 5F2MA 1TSIA 3VFLA 4FNRA 5AHEA 4DEFA 3LHUA 3LX9A 3QJAA 4TMCA 4UTUA 3B04A 1R2SA 1X6UA 2BWGA 4OT7A 1H62A 4XUGA 4LY8A 4RCXA 3HPSA 3T40A 1ZNNA 3BK0A 1VGAA 1XI3A 4GBUA 4MY1A 4QISA 2WO5A 5BOOA 1ME9A 3TFXA 4UNLA 1P0KA 4K36A 1I45A 4OV9A 4WX2A 2ZA1A 4EF9A 2VFFA 1F74A 2R94A 3P5ZA 4FNUA 4JX5A 4AWTA 3IGXA 3QPZA 1BKSA 4QITA 4M5PA 3SSJA 2TPSA 1RQHA 4BK9A 2R14A 4DF1A 1TPVA 4ZL1A 1D3HA 2DZSA 1U83A 1IF2A 2RFGA 1I2QA 1YTKA 2QKFA 2RKXA 3WK2A 5I3HA 1KFJA 3NQCA 3W6YA 1LBFA 2H90A 2Z0IA 3W1MA 5FI8A 2ISVA 1JRBA 4JEQA 2WOQA 4AWSA 4OHQA 4Z1BA 4A3UA 3CB8A 1F76A 1VJIA 4GFSA 1YLVA 3L5MA 3QYQA 2FTPA 4IX2A 3EXSA 4JTGA 3TC7A 5E0KA 3GDLA 2Z6JA 1FDYA 3MHGA 1N55A 3LB0A 2J9ZA 1VCFA 3W2JA 3CEPA 3UNDA 2Z2UA 3G18A 3NYZA 3CIXA 4E0CA 1LLWA 3RFAA 3LHVA 3GDKA 3HG4A 1GOXA 1W37A 5HR7A 1RR2A 1KTNA 1VHNA 1GPWA 3C2EA 1QMLA 2CZEA 4JR5A 4IXHA 2PURA 3M43A 5HMSA 3TX9A 4YMZA 1XFBA 5I3JA 1LLZA 4H4IA 5DCDA 5DY2A 3U6WA 3P61A 2V82A 4MOZA 4NZJA 3GR8A 2FB2A 5G2HA 3QEZA 3W83A 4GUIA 4KKXA 3JRKA 2B7NA 3M7WA 1I2PA 3TH6A 3CU2A 5EMUA 3DENA 1JQXA 3I6RA 4HHPA 1KM4A 4BI5A 3VI2A 4K39A 1OHLA 4ZQRA 3MP3A 2F84A 2X16A 4IPJA 1CI1A 3G1VA 3NDOA 2VFHA 2VFDA 1XCFA 2CZFA 1TV7A 4S2CA 3IIZA 3W2MA 1XUZA 1AG1O 4I7WA 2BTMA 1FWWA 1LRTA 4PCFA 1JULA 2V2HA 1HL2A 1JR1A 2YYTA 3IIOA 1O5XA 3C6CA 3NQDA 4LS0A 4A2SA 3MI3A 4UIOA 4NXKA 1KTBA 3W3OA 2C1HA 1TRDA 1O5KA 1VLWA 3M1ZA 4IQLA 3QC3A 5CSRA 3QSTA 3A21A 3UPWA 3SECA 2G97A 4Q32A 2Y7GA 4RZ4A 4FNQA 5F1VA 3BGJA 1OG0A 2NX1A 2EKCA 2W79A 3MYOA 5CZSA 1VS1A 3GAKA 3MYPA 1SO6A 1W0MA 3UZJA 1B9BA 3MBDA 4UFJA 2W0UA 4UMCA 3IVTA 4NQ1A 2J9XA 3DFSA 2ZZ1A 2AGKA 3M5ZA 1O4UA 3E02A 4UTLA 3S1XA 3GR7A 1W54A 4LVGA 3ELFA 4FIQA 1UUMA 3EWYA 3NZRA 4WY0A 5LNSA 4YWIA 1HUVA 1WQ5A 1C29A 3GAYA 3L0KA 1TIMA 1TTIA 3NL3A 2VENA 1KM0A 4UR8A 3W9ZA 1UJPA 4QJ1A 1ZAHA 3BG9A 1V7YA 3NQFA 4LS1A 3VE7A 3NZ1A 3DXIA 3QMRA 1FCBA 3T4CA 1YXDA 3LERA 3PF3A 1VH7A 1IGSA 2QCNA 3KVLA 1KFLA 2O7SA 3WJXA 5HWNA 3ABOA 2ATMA 4K7VA 3N34A 1PHWA 4P61A 2NUWA 3W74A 1WA3A 3TCEA 1FDZA 2H3DA 3MWAA 2O7QA 1R47A 4AWUA 2GPTA 3M5XA 3S6DA 3GXNA 2BXVA 1E51A 4O18A 3NPXA 1WV2A 1GZGA 4AXKA 2NLIA 5I3FA 1HTIA 3KVKA 4XTIA 2Z6IA 5C54A 3TA6A 3PS7A 1KLYA 1TJRA 2QR6A 1VRDA 3KRSA 5D2TA 3DBPA 1F05A 2QJHA 3BGGA 2ZZ4A 2QCGA 2VEMA 3OA3A 3LCHA 1J5TA 3THAA 4XQ6A 3UD6A 3IGSA 3M5YA 4UUIA 4DPQA 4JTJA 1YPFA 2ZQ0A 3STGA 2ZTKA 2Y70A 2JBMA 1ZALA 4MZ8A 3E96A 3PUOA 1A50A 5CGQA 3R12A 5IBXA 2YW3A 5LZLA 3JR2A 5A8GA 4WQ6A 1WYIA 3C52A 2ZZ7A 5LNUA 5CPLA 1X1ZA 1X7FA 3M5VA 4ML9A 1GG0A 3WJWA 3O63A 4UFKA 2FPTA 4FNPA 3SGUA 2WQPA 2TSYA 4C1KA 2G96A 3PM6A 3O06A 1TCDA 2XN2A 3SI9A 4NX0A 1NEYA 1W5NA 3NEVA 1AW1A 2NX9A 3QMTA 2QUUA 1GYLA 1FCUA 3LHZA 1MZHA 3N73A 3W7CA 4NUWA 1GVOA 2ZCGA 1XBXA 3GNNA 4CNNA 2Q3RA 3QW4B 4JTHA 3TQKA 3FJLA 2ZZ6A 2BZNA 3KVJA 3MHUA 4MJZA 4O57A 3HG3A 3TU9A 2VEKA 1SZEA 3GXTA 1MSSA 4LRSA 1OABA 1IXPA 3N3MA 3C2VA 2GVGA 1KTCA 3IGUA 2QJIA 4FX7A 4RR4A 3P80A 1K02A 2B7PA 4RK8A 1HO1A 3CWNA 1W3TA 1N7KA 4JTLA 2E68A 3ATYA 3IRDA 1KM1A 3W1RA 2J24A 4FHAA 3N14A 3C61A 3Q2DA 4UTWC 4LC6A 3W85A 4O0ZA 3Q58A 3EWZA 3T55A 2FPVA 4HPJA 5CPMA 1A5CA 4CNPA 3IVSA 4R33A 3NA8A 1PVNA 1L6WA 3DFNA 2CZ5A 3G22A 1JCYA 2NUXA 4Y90A 3RLUA 1ZCOA 3W73A 5CPNA 3S5YA 2D73A 1NF0A 2E6AA 3MBFA 3OVRA 4WJEA 1BWLA 2QAFA 4DELA 3P8JA 5DCEA 2C3ZA 4QSHA 2ZA2A 2H8XA 4EOUA 3CHVA 3R13A 4JTFA 1V5XA 3LGEA 5AYYA 1YTEA 3G8RA 4K8HA 1LZOA 4JS3A 3W1LA
chains in the Genus database with same CATH superfamily
2WZHA 3L7RA 2J7CA 3FGCB 2A7RA 3P82A 2H9AB 1RD5A 1U2YA 2FH6A 3RU8X 3D3AA 4G9PA 3IUDA 2OZ0A 2PDFA 4O19A 3UCQA 1B2YA 5A6BD 1Q7ZA 1H1ZA 2DFAA 1A80A 4MY8A 4S3EA 2Z25A 2JK2A 3H55A 1AQMA 4LF1A 3LUTA 4K1GA 1M9HA 1OX4B 2Y7DA 3CHCA 4DLFA 1TVLA 2BGSA 5JQ9A 3REQA 3TROA 5L9FA 1DPMA 1RCXB 4WKFA 4MAVA 4HYVA 2IQDA 4ES4A 2AL1A 2A21A 4H19A 5AN7A 4LPCA 1EGVA 5LSMA 4UWMA 4XUYA 3M0XA 3GXMA 1VPXA 2D20A 3KLLA 3OBAA 2WM1A 1KCLA 2J6XA 4J2PA 3ISIX 1JCLA 1TPC1 4IMEA 2O55A 2P10A 3KL0A 4XO6A 1SPQA 3MHFA 1LL7A 4IMDA 3HFYA 4YTQA 2YB4A 3WF3A 3ITTA 2ZRVA 3QQ1A 1TREA 4MHBA 4N9DA 1OZMA 5B7YA 4JTIA 1UIOA 3S5OA 5I2UA 1UWSA 3AXMA 2XN0A 1NQKA 1MWOA 3H21A 1Z44A 3TWBA 4IQDA 4W7UA 1JQVA 5D9OA 3M41A 3L2IA 3L66A 3O6AA 3SRKA 1BWKA 3RCYA 3Q67A 4JKKA 1KM3A 3RCMA 3ECQA 3STCA 4FSAA 1KM2A 1CENA 3MB9A 7XIMA 4JTUA 5EPDA 1JDCA 4PL2A 4UZUA 4W7VA 4ZTYA 4QLKA 1XYZA 2XIQA 2Z1KA 5GJMA 2I9UA 2V6AA 1O66A 2X8RA 3SUUA 4RE3A 1JL8A 3KOXA 2QV5A 2I7GA 4AMAA 3ABXA 4MLJA 2FLIA 2RUSA 5BNKA 3AXHA 1SM9A 4TVUA 4EIVA 3W24A 3K1DA 3HBLA 4PMOA 3T8LA 2DSVA 4UR7A 3R0KA 3QPYA 1NJJA 1UWQA 1JZ2A 5C2CA 2DT2A 2QJNA 5C55A 1OFPA 4UQEA 3A9BA 4YNGA 1U22A 2XIMA 4ACZB 1MUWA 3NFUA 5A94A 4O53A 3USBA 4EAMA 1Q6QA 2RDUA 3M44A 1JIBA 1B4EA 2IKIA 4LUYA 2EG6A 1W8GA 3MY9A 2YLLA 3LCGA 4W4QA 3R8GA 4AZCA 1WOAA 5HMDA 4H01A 3H4GA 4R3UA 2NXGA 1QNQA 4G56A 3ARRA 4DO5A 2GVEA 3LBCA 3AU2A 3TA9A 3AS1A 4DNMA 1H1YA 1M1BA 4QRNA 2CLOA 4UTJA 2OOFA 4M7TA 2C16A 2HV5A 2KZHA 5J5RA 1TMQA 4NSBA 1LBMA 4GUJA 1TKKA 3ZWSA 1G69A 3W70A 4RZ6A 2WHKA 1OYBA 3RX2A 1JEZA 3W53A 4HK5A 1EQCA 3LI1A 2GJNA 4RV8A 1TX2A 3U3HA 2CLKA 2VGGA 1VYPX 2NLYA 4GD0A 1F3TA 3NEHA 4JFVA 4F0HA 5C5YA 3TN5A 2WHLA 1QK0A 4OBTA 1JCTA 2DZTA 4UOJA 3VC6A 4CU7A 2ZXAA 5BRQA 4O0KA 3OBKA 3A3WA 3LI0A 1H7OA 3LGGA 3CK5A 4ZVJA 5BRPA 3DI1A 4NI3A 3WL1A 5H91A 4I6KA 4LX4A 3USZA 2E09A 1MW1A 4O8RA 4CLMA 1AQFA 1YW1A 1VP5A 3CIWA 5CJNA 3QVQA 1TTQA 2P50A 1FH8A 1E3ZA 2V5DA 2GVJA 1PBGA 4UCFA 1CBGA 3U0HA 3GKAA 3DG7A 1EJWC 3O6YX 2V5JA 1WB0A 4HK6A 4HSNA 3GS6A 3SCVA 3UA3A 3ANYA 4O12A 3RPDA 4OFCA 2A85A 1KM5A 1E6RA 1QNPA 4DYEA 4LT9A 4KFPA 1T99A 3OPSA 5K9XA 4HA3A 4BI6A 5GNYA 1CLKA 3BLEA 3E38A 3ZJ6A 5A8OA 4JPGA 3MMUA 3ZR6A 2ZUWA 1IXQA 1W1TA 3W82A 1P6WA 1NH6A 4O54A 3L65A 1HGWA 4FX6M 1NAL1 1S1PA 1DP0A 3HG5A 5KZDA 3I6EA 3MWCA 4AXNA 4KS0A 3LQGA 4JL1A 3OQ8A 4QNWA 2E9BA 1CIUA 1DIEA 2PRMA 4GHRA 1ZPTA 1LP6A 1UQZA 2XVLA 2VEGA 4JFUA 2YL9A 4XTDA 4HYRA 1VZWA 4DF0A 5AHMA 1R7AA 3BL3A 1YYAA 3VZXA 3TKFA 3AROA 5HQMA 1SW3A 3FV9A 3P60A 1BG4A 1ITXA 1PAMA 2NUYA 4KT2A 5I79A 1JF5A 4QS6A 1KXVA 5FF4A 3ITCA 2QMKA 4AIUA 2OX4A 3FA3A 1A53A 1QDSA 3M0VA 3KBMA 4Y6GA 1Q4NX 2R1LA 1RAKA 4M3PA 1ICPA 3LA4A 2XDFA 4WJXA 4M7SA 2BOGX 3IAQA 1OFEA 3CHFA 3PB2A 4ZMGA 2QF8A 4GI8A 1W5PA 4GWEA 2PDWA 3NQ7A 4ATWA 1MQRA 5A6SA 2BHUA 2DZAA 2D24A 2UV8G 3CMFA 4GJ1A 4NAEA 5A6TC 2OXNA 3CLMA 3ZSSA 4M19A 2C0AA 4A05A 4B92A 2Z7KA 3HGJA 3NM3A 5G4WA 3AICA 3W7MA 1AL7A 1OGBA 1HT6A 3KP1A 4LU0A 4PB4A 7TIMA 3F5JA 4LRTA 2VL4A 3LHTA 4S2BA 3UZWA 3DGRA 5K2ZA 3BVJA 4WOZA 2JFEX 1YTDA 3BJTA 3VDBA 3KDOA 3ONCA 1J10A 3NVTA 4WIWA 3KCOA 3TNOA 3LCWA 4M6PA 3C0LA 4CVWA 1Q6OA 1SFLA 1VPYA 1OGSA 3WG6A 4AIBA 4D6JA 1P43A 1FWHC 2HBXA 1TUXA 1L6SA 1XRFA 2WHJA 1UBPC 3UZ5A 1XCWA 3NSXA 3TOYA 4AHOA 3UJRA 1Z7AA 3IJLA 4MLRA 1PCWA 3KRZA 4LBSA 1IWPA 4LVBA 1TPFA 3TCSA 3PZUA 1PDZA 4IP7A 1JUBA 1XBZA 4J9JA 3AIRA 3WLIA 2I1OA 1XBYA 4G1KA 1QPOA 2CXEA 2IKGA 3S5SA 3F4NA 3UQNA 4CVUA 1UOKA 4GI4A 4D6DA 1I75A 1EF3A 1GQJA 4LJ3A 3W84A 4N9CA 3UR8A 3G1HA 2CNCA 1GUVA 3WQVA 4Y9MA 1E4MM 2QXWA 5C7HA 5DCBA 4C7FA 2QUNA 1QPRA 1XIFA 4AD0A 2OZ8A 1CZ1A 1QWGA 1X38A 1XINA 1PB0A 5CCZA 1ONRA 2NV1A 2GGGA 1SZGA 3EOEA 2VCCA 5AECA 3IIXA 3C2FA 1DJQA 1NTHA 2R6OA 4CN6A 1BQCA 1E43A 3Q94A 1EDTA 8XIMA 4AWEA 5D37A 3S1VA 3RILA 1L9WA 5FJRA 5LIWX 3OLDA 3PZGA 1Q3NA 2VOTA 5ENLA 4LNYA 3W4RA 1NFPA 2XVKA 2PWDA 3B06A 5D9PA 4GGHA 3HURA 1DQXA 2DVXA 4JQ3A 3LTYA 1UP0A 3TE9A 4E5TA 4WXYA 2WJZA 3MP5A 3BO9A 1US0A 1EC9A 4AX7A 4BI7A 1BTMA 3DFQA 3AZSA 4HN8A 4FX8A 2FGZA 1EDQA 3ZJ7A 3CZKA 4Q4MA 3N11A 5FEPA 5D32A 3TJLA 3DFTA 2WB5A 4R53A 1QNOA 3MDWA 3T0AA 4UOQA 5AFDA 3ABSA 3PBYA 3G0XA 1FX6A 1TVPA 5JUVA 1VIWA 3BAXA 4QLJA 1KXTA 3AHYA 2A7NA 1K7EA 1XDMA 1TV3A 3EKLA 3G8EA 4O13A 4K1WA 2R1NA 4LGXA 1LORA 1I8JA 1MUMA 1AFSA 3WQWA 4D2JA 1WKFA 5JBEA 1G7UA 3KOFA 4W5UA 3V1PA 2WSKA 4QE4A 5KTLA 1NP2A 2ZA3A 4DO4A 3W7EA 3STEA 2ZBTA 4IOTA 1J6PA 1W56A 1OF8A 3GTFA 4IJBA 4WDXA 3S9IA 2Z1WA 2XG9A 3HQOA 4MYAA 3T4WA 3GD6A 2XGIA 3VCNA 3UYIA 1C8YA 4NY2A 2XM1A 3V0SA 4NP7A 2Y5EA 3VGBA 2QCDA 4US5D 2G0WA 4ZXLA 2XIIA 4GUHA 1L8PA 2DGAA 4IL2A 2ZIDA 3A13A 3B03A 3MW7A 2GGHA 1OJXA 3CUGA 5HQLA 4J7RA 3W7RA 3TR2A 1TPWA 4EACA 1CX9A 3GXIA 4PUWA 1FRBA 3MMDA 4QGCA 3W7LA 1OIFA 3FVDA 1A0DA 9XIMA 1EUAA 4GY1A 5D30A 1E9ZB 5BOFA 3WH8A 2P8CA 3GYCA 2CLEA 4IIDA 4ZGYA 3HZ3A 2ABAA 4LAUA 4IIFA 2ZZ3A 2VDHA 1ZJHA 4EVZA 1EZ2A 4LOCA 3RCNA 3ERPA 3QSRA 1GJPA 3B0YA 3LMZA 4RNIA 5D03A 2AKZA 2DPEA 1V02A 4GQRA 3W2NA 2PDCA 1H63A 4G1NA 1PKNA 2VWSA 1GKPA 2E1DA 1KFBA 4FMVA 4LEQA 3SRHA 1S2VA 3LXCA 1QI3A 3VNLA 4MJ2A 1EA0A 3RK8A 3ZQ9A 1HGYA 3ARPA 4OE7A 5J04A 2WVTA 1RLCL 3HGRA 2C18A 1OX6A 3QBUA 1RY0A 3VUSA 1NOUA 2C15A 2DZXA 3HFTA 4J3WA 1NDVA 3S8HA 3L68A 3RLVA 4I7UA 3SBFA 3CZ8A 2R91A 3UETA 4H2HA 5CZ0A 3WEZA 3QC0A 2IXUA 3MMTA 2HROA 2OSWA 4ZSTA 2XU2A 4GZIA 5LGXA 3PZMA 3TAOA 3LTSA 4YYFA 3R5EA 2ZRZA 1X1OA 4CQ8A 1E9IA 5IFPA 1DKWA 1OGGA 4IUGA 1Y65A 2YFOA 5EKYA 1BG9A 7PTDA 2VGIA 3VNYA 3KCLA 3BLLA 4MKVA 4HTBA 3FDKA 4GE8A 3TYBA 3WLMA 1N8WA 1UR2A 5FAGA 4J3VA 4AMCA 1K7FA 1XIMA 1H1NA 1EJUC 3FLUA 1CEOA 5F2GA 1SGJA 3O6DA 3MCNA 4TO8A 4MFDA 1YDNA 1X96A 4LB4A 1JZ5A 2O92A 4DAIA 2CHOA 1K8XA 1KFEA 5G4HC 4PUJA 2SFPA 4NVTA 1DE6A 4DO7A 2QUVA 3WBAA 5CC5A 1ISZA 1CTNA 3LG3A 4YPJA 4JFWA 4I9JA 5D02A 1WKDA 2XIOA 4F0KA 5F2LA 3H23A 3PP7A 3GH4A 1BXCA 2GSEA 1WDPA 2HPIA 1O1HA 5EBUA 1T5AA 1BHGA 5BRBA 1KRCC 4HSOA 3WLSA 3VDGA 4HIBA 3IANA 3VOGA 2OELA 3AC0A 4RL3A 3EDJA 2P0OA 3WBEA 4C5YA 3LK6A 3UWYA 4A3HA 3MO7A 3WDQA 4UMBA 1MW0A 4I90A 3N25A 4LYQA 3T0BA 3WN6A 2QLYA 3V4BA 2E77A 5KINA 1IGWA 3E0FA 5DT7A 1GW9A 1RZMA 3NG3A 4MKNA 3WZ0E 2PCEA 3LDVA 3LRKA 4A8LA 2QCFA 1S2UA 3UCDA 1ICQA 3IUHA 4FR6A 5LIKX 3C0QA 3C4UA 4X22A 2V81A 2WKGA 3W25A 4Q8OA 2Y6ZA 3R11A 3RJXA 1EXPA 3ME3A 3RU6A 1PDYA 3MT1A 2OKTA 4GYPC 1HIZA 2IMRA 1EO5A 1Q6GA 5G1MA 2Z00A 4XZIA 3T9PA 3QY8A 4A2RA 5CG0A 1KA9F 4JY8A 4IISA 4Z08A 3E5BA 2GDQA 4D72A 4F2UA 3DCPA 3WMCA 1Y7VA 1T8QA 1TPEA 1XYCA 4GY7A 3AAMA 3PPHA 2HVNA 1H5VA 3NQEA 5DXYA 3SCSA 1LCOA 5HULA 1TPB1 1GQKA 4Q7IA 2Y63A 1EH9A 1KFKA 2ZXDA 3EMQA 5CLTA 2Q3OA 5IRPA 2HVOA 1ONEA 2WMGA 4H6EA 4NX5A 1MFVA 4RZBA 3WLKX 3RO6A 4LBRA 4F0MA 3DN5A 4D8AA 4F66A 4LVFA 5D05A 3C2YA 1K9TA 1VAHA 3MCMA 3WUEA 2VP8A 1HW6A 1U1UA 1N8IA 3M4HA 3UGRA 2VEIA 1VFOA 1M7PA 4QIUA 2G4FA 1S5NA 4H9TA 2YFNA 1E0VA 2J25A 2HMCA 1KBIA 1J2WA 3WX7A 2PDPA 1DHPA 3K4WA 3U2EA 5CZJA 3EWWA 3S4TA 3VO0A 3BANA 3UWWA 1VCVA 4US6A 3MMWA 3THQA 4IMGA 3ZXWA 4KFOA 4WDWA 5DY3A 5CBBA 1ALDA 4JYEA 3SO7A 2VM8A 3AHZA 3CH9A 2E5DA 1B5TA 2PDLA 3RRAA 1THFD 2PLCA 3VYLA 3MUAA 1MQPA 2J79A 3VKKA 3PHAA 4UTFA 1OX5A 4M0XA 1ZJAA 3GBEA 5EMLA 2Y88A 3TXZA 2PDMA 3DG6A 4UQAA 2D0HA 1PZ1A 2PC8A 3LOTA 1PZ0A 1EC8A 1EGZA 3WLTA 1UH3A 3DFPA 1HG3A 2WJFA 4WSHA 1TR9A 1OFOA 4O50A 5F4SA 3CM4A 1JDAA 3WD4A 1XUUA 4E4UA 1IEQA 1Y5WA 2CWNA 1E73M 3W72A 4GNVA 3VNJA 2JALA 4URIA 3CYVA 2YX0A 3UFYA 5LGZA 5C2XA 1OK6A 3M9YA 1E4LA 1P0BA 1XP3A 2ONEA 4ZB2A 2DSUA 4LUIA 3S1GA 4HMDA 3R43A 4AZBA 3MUCA 4CD6A 5KMYA 5A2BA 2QCMA 3HPZA 1UD3A 4LYPA 3BMWA 3LXBA 5A6BA 2A4AA 3VDHA 2XWDA 1RP9A 2XIJA 2Y5JA 1E40A 3PWAA 4YN5A 3VKDA 5AHEA 4W89A 4V2XA 3P6LA 3QJAA 1M04A 1H62A 4E2OA 2GJXA 1ZNNA 3BK0A 1VGAA 2DVUA 2WO5A 1PYFA 1A0CA 3ANVA 3BSHA 1P0KA 1I45A 3D46A 1J93A 2ZA1A 2VFFA 3WD2A 4JX5A 3IGXA 1SMAA 1AQHA 3ZSTA 1R8LA 2BVTA 3ITXA 3RM8A 2VX4A 2PI6A 2HPMA 3DBNA 1VFTA 5DFAA 3O3RA 1YE6A 3A4WA 2A3AA 3E5PA 1I2QA 1JPDX 1YTKA 2RKXA 1D8WA 3WK2A 3NQCA 1GNXA 5A8PA 5CJMA 5FI8A 3ARZA 4LALA 2GGEA 2WOQA 2OOGA 4JIEA 1UWTA 2XSXA 2J74A 4GFSA 1YLVA 3L5MA 3NCOA 1A5OC 4JTGA 2PTDA 3NYDA 3WNOA 4ERGA 1N55A 4D8LA 4TXEA 1B3WA 1Q2RA 3OLGA 1VCFA 2DQWA 2Z2UA 4E0CA 2VDGA 1DHKA 1HJWA 3UJFA 1DYSA 4N0RA 1S46A 1W37A 1RR2A 3OHMB 4PTMA 2OLHA 3BZJA 3MUZ1 1MZRA 2P0IA 1FH7A 1GYMA 1S2TA 5CQ1A 3ZZ1A 1GPWA 2CZEA 4JR5A 5H8MA 3M43A 5E0FA 3L4UA 3B8WA 1VIZA 4J3TA 3BLDA 3AMDA 2HXTA 4MNKA 3ARXA 1R86A 5DCDA 2FDMA 3L12A 3U6WA 3WIJA 4MOZA 3GR8A 5ABFA 2FB2A 1VFUA 4H2CA 3QEZA 3W83A 3UNTA 3TH6A 3CU2A 1JQXA 4JQ2A 2WCAA 1S3TC 3EPNA 4HHHA 1GHSA 4ZQRA 1OHLA 4U31A 1H41A 2X16A 1CI1A 4IPJA 2VX5A 4L65A 1CGXA 2XH2A 2BTMA 1UZHA 1FWWA 3L4YA 2IPFA 1LLOA 4U5KA 3NQDA 3T1GA 1TZ9A 4MGGA 4UIOA 1HJUA 2C1HA 4GQBA 4WDTA 4QR6A 5CSRA 3QSTA 3A21A 1Y5XA 4C6JA 2Y7GA 4FNQA 4W85A 1OG0A 2NX1A 4ZB0A 5CZSA 3GAKA 4JCLA 1VEMA 1SO6A 3KZSA 3GVVA 3U4FA 1HVQA 1QJWA 1P0EA 3IVTA 3CQIA 3TYEA 2BVYA 2ZZ1A 2AGKA 1G1YA 4M24A 3KS5A 4NRSA 3O0KA 1UUMA 4KCWA 3CUIA 3NZRA 1E0WA 5A8MA 4WY0A 1VEOA 4WK9A 3AI0A 3TTYA 2VQTA 1HZYA 2Q09A 4V1YA 1LT8A 1UKSA 1JDEA 1W3KA 2YBUA 1W17A 5A2CA 2WJDA 4NZ1A 1ZAHA 4PUEA 1EA9C 3VE7A 3T4CA 3DXIA 3DX5A 1OG6A 3LERA 2PZ0A 4LUTA 1EOMA 3KVLA 1KFLA 3C86A 4V1XA 3WJXA 3ABOA 2ATMA 1NQ6A 4QE5A 4K7VA 4P61A 3B9EA 3RYSA 4JFTA 4M80A 4ZO9A 3SJNA 3MWAA 4AU0A 2O7QA 2HEJA 2GPTA 2PGFA 1PX8A 4AZ7A 2BXVA 3RR4A 3SCWA 4Y9OA 4ECLA 1R3SA 1RCQA 2NLIA 2OPJA 1R6WA 4GH1A 4QSFA 3KVKA 2Z6IA 4XISA 3TA6A 1TIWA 1TJRA 1VRDA 3NQBA 1B0IA 4NZ3A 1F05A 3LYEA 1EYEA 3AUOA 1UG6A 3LNMA 3OA3A 3LCHA 2REQA 4XQ6A 4INFA 3NDZA 1ODUA 4B9YA 3SQMA 3UXKA 1KCXA 4IM4A 1XRVA 1UKTA 1A50A 5A6AA 1JD7A 3WNLA 4KQNA 1YQ2A 4PR4A 3JR2A 1ZQ5A 4QJ4B 4WQ6A 5LNUA 1K70A 2DY3A 1X1ZA 1FWIC 3WJWA 4NAFA 3HPFA 1ZCCA 3VMOA 5EMYA 1ZSXA 4GGBA 3F4VA 3SGUA 3AS0A 2Z28A 3PM6A 1QT1A 3SI9A 1EJSC 2F6XA 4AIOA 1AW1A 1B3VA 3H24A 3QMTA 3EAUA 4GK8A 3LLXA 4NUWA 1GVOA 2J7FA 2ZCGA 4G2DA 2Q3RA 4W84A 2ZVIA 1X7IA 3KVJA 3TU9A 1SZEA 2JF7A 1OABA 3C2VA 4MWAB 3KS6A 3IGUA 1KTCA 3NSNA 4E4FA 1K02A 4RK8A 1HO1A 5TNVA 1W3TA 1C7SA 1IEVA 1KM1A 2C8NA 1XD1A 2QUMA 4L80A 3EWZA 5HANA 2J8TA 4XAFA 1OCBA 4CNPA 5IHSA 4R33A 4A8NA 2R1KA 3FN9A 2DUXA 1GOKA 1JCYA 2NUXA 3G22A 5E70A 5A69A 2DUZA 1QRQA 1JGMA 4AFYA 4JFSA 3AUJA 1NDZA 2AAAA 4WJEA 4AX6A 4CN1A 3P8JA 4H7VA 3R13A 1V5XA 1XSJA 4XD6A 1SYTA 3CV1A 3W1LA 4A22A 2P5NA 3UW6A 4P7LA 4C6OA 4PCPA 2DH2A 2HJPA 4NT0A 2Y85A 2EGZA 3U2ZA 2Z1SA 1SO4A 1O5QA 5AHNA 3OG3A 1WOBA 3JUGA 4WD0A 1VPQA 1VF8A 2RH9A 1H7RA 4B91A 4XD5A 3WBWA 1XIEA 3KEHA 4IUOA 1XLLA 4PBGA 4TR9A 4DUWA 1Q8AA 3A23A 1PV8A 2VOMA 3ZVHA 3N15A 1J5SA 1IQ8A 2PZNA 4WSKA 3QHNA 1BYDA 1IXOA 4WKAA 2VFGA 4XZMX 1XCXA 4U4MA 3S9ZA 3GG8A 1A5MC 5LNRA 3UY7A 3KDNA 2FZDA 3EDEA 1E56A 3KVMA 4IJRA 1R3YA 1PTDA 1ZS2A 2A0NA 2WPGA 2RGLA 1Z3NA 2P88A 1EQPA 1J0IA 3SY8A 4Q3MA 4MY9A 3EWUA 3BLIA 2VGBA 1S39A 5PTDA 1QHOA 1V93A 4CQ9A 4DJDD 3JVAA 1JCJA 4ZZ9A 1DJIA 3W2UA 2XGZA 2A6NA 3C2RA 5M5DA 3QGVA 2LLEA 3QZEA 5FSEC 1OCJA 4O1CA 4DUOA 3LPPA 5CPSA 3TIMA 5A95A 1B9ZA 1QNRA 3FSUA 2L5HA 2INFA 3XISA 2BSLA 1B57A 2QCDB 3QFWA 1BSLA 2FFCA 6ALDA 3PSWA 3TYCA 3DI0A 3B9OA 4PMJA 1REQA 2NVAA 1Q2SA 4FLQA 4IFOA 2ZE0A 3IK2A 3WH6A 3AXIA 3UA4A 4FIRA 3WDPP 4ZQOA 3MQTA 4H83A 4LCSA 4AHPA 3CZGA 4DJDC 1Z69A 4GLEA 3NDYA 3CWOX 4Y2WA 3H26A 2I14A 4DJEC 1HJSA 3AISA 4JOMA 1PX3A 2FVLA 1DJNA 1VJSA 1KLZA 1F2JA 1OCQA 2X0HA 1RK5A 4UQDA 3TW9A 3IJ8A 3KRUA 1XS2A 2R9RA 1J9YA 1I1XA 2VR2A 1XIBA 5HQEA 5KZEA 3M0YA 4GFIA 3M0ZA 2TMDA 4JICA 4CNSA 3P5YA 2GSJA 4JCMA 3T0TA 2ACRA 4J1OA 3F4DA 4N7QA 3DH7A 2Q02A 4H9VA 3BJSA 3W37A 3K8KA 4HNNA 5AHFA 3GVWA 1OX4A 3EEZA 1PIGA 3A47A 4B3KA 2E5BA 2E1WA 2GK1A 1EKOA 4NI8A 1RXOB 1AH4A 4O10A 3GTIA 5HPOA 4PUMA 1AW5A 3ES8A 4W8LA 3UXAA 1JPMA 1XGZA 2WSQA 2WV8A 4L9YA 2PUZA 1VD6A 1A0EA 3C3NA 3AIQA 4HMNA 2G3FA 4B5VA 1H4PA 2UZ9A 1KB3A 3BV4A 1CGVA 4L4PA 1LDCA 4A8IA 4KEVA 4M56A 2GQ9A 1XRSA 3HJZA 4CQDA 1U5JA 1D7FA 4J3ZA 1SU5A 4M82A 4TVCA 4L7ZA 1DQWA 1U30A 1W9VA 4C91A 4L64A 3W7DA 2BS9A 4IL0A 2FZNA 1J4EA 4DZHA 1M7XA 2NXHA 4O1EA 2JGQA 4GQGA 1A4LA 2CU0A 3IAPA 4JN8A 2F2KA 6TIMA 3E6EA 5GQBA 5IDIA 3RUBL 1Q6RA 3C56A 4I5RA 1YHTA 2YDSA 2W63A 3NQ8A 4GBDA 3KOZA 2F9RA 2E6FA 1LG2A 4I8YA 4JTSA 4F40A 1XLEA 1TMHA 1FXPA 1TO3A 1RPKA 2Z7GA 5C71A 4YHGA 1DWHM 2Y8VA 4HVXA 4AB4A 2YCJA 2EPNA 2Y7EA 2CWXA 3AALA 3B8TA 3ZT7A 3W0KA 2YL5A 3CQ0A 3VIMA 1OB0A 1W31A 1OK4A 1OADA 1M53A 4QQ3A 1CWYA 2WLYA 1LL4A 3M47A 4CD8A 4QG8A 2WNZA 3NOYA 4MB1A 5HWMA 2HS6A 4B5SA 1K8CA 1KKRA 4LVDA 2POTA 5FEWA 1DBTA 1R3QA 1A5SA 5FJOA 2VRKA 2UWFA 4N4PA 5K7JA 3WQDA 2Z4GA 3K8MA 1IYXA 4GRSA 1FXQA 3N9SA 3W29A 4M8UA 4GXMA 4US5A 2YL6A 4ACZA 2WBGA 4G7EA 2Z1XA 2PF8A 4A3YA 4UCGA 3DZ1A 5I0DA 5G2WA 2OZ3A 3RX4A 1TA3A 1EOKA 2H8ZA 1LQ0A 4DRSA 2YCIX 4B2DD 1JZ7A 4LYKA 1W1B1 3U7VA 2PDKA 3FVMA 2XZ7A 2NWRA 2VX7A 4JKMA 1TWWA 3LM7A 1CT5A 2VC6A 1VQTA 3BJFA 4RW3A 4A3RA 3F1QA 1BVWA 1BGAA 1PE1A 1QAPA 4NXSA 3BGAA 3H7RA 2Y61A 2NX3A 3P84A 2QCHA 4MG4A 3R94A 1FHLA 3O07A 3HPXA 3UZXA 3A9IA 1ZY9A 5BOEA 1O68A 1EGMA 1XKYA 3BG5A 4FEZA 5E5CA 3U9IA 2DZWA 4XZHA 2Q8LA 2XFWA 4MJMA 1NP0A 2GUUA 3K30A 1XF0A 1R85A 3O05A 1Q66A 5HMFA 3UWVA 5DLCA 5IBXC 3AHXA 5AY7A 2X1RA 3ID7A 4K8GA 1FOBA 2TRSA 4F3HA 4UFMA 3FA5A 5IHRA 3N4EA 4UQCA 4KWUA 4H6RA 2V68A 2YXGA 3B0PA 2VURA 1OYAA 1H7XA 1FQ0A 1OFBA 8CGTA 5E1QA 2Y7FA 2QYGA 2IS7A 2WCGA 2X41A 3VE9A 3VX0A 4Z0JA 4WKHA 3E2RA 4GIYA 3L9CA 1L2UA 2OCZA 4ICCX 1EF2A 5CAKA 6TAAA 4N4QA 1X39A 3O16A 4HT3A 5D4YA 3PFRA 5A6MA 3B3DA 3H22A 3HGOA 3ZWTA 2A6LA 3TK7A 4RX0A 1FY6A 5FIPA 3TLQA 5FJPA 2D2HA 5LA2A 1AMYA 2AOSA 3VGHA 4DYKA 4S23A 3G1XA 1JCXA 2WZEA 1LL6A 3GU2A 2DU2A 1HP5A 1UA3A 2WC3A 3N2XA 5CPQA 5CGMA 4LUSB 3TYZA 3VMNA 1CB7B 4Q22A 5CH9A 1QBAA 2DV0A 1TQJA 1PKMA 3I4EA 1E71M 2WNNA 1JNEA 3B4UA 2OWWA 1RH9A 2BV9A 3GTHA 4Q8WA 2X09A 3HN3A 4YVPA 3SGZA 2RDXA 5HPCA 1RCOB 1Y8BA 4V27A 1XISA 2D0FA 5CC3A 1G4SA 4UOZA 4KF1A 2C91A 5HDRA 3P3BA 3T0CA 4ENLA 2VC7A 5AYIA 4X9SA 3RNDA 5LA1A 3GIYA 4DPPA 4NZ5A 1KBBA 3E74A 2G37A 1NOWA 2OYMA 4E3TA 2F6UA 1ZB5A 1UA7A 4LNCA 4XAPA 3V3WA 3QLLA 3B05A 3VILA 4GYPA 3RXZA 1WKEA 4F4RA 4MWAD 4B5NA 3Q37A 5I23A 1WXJA 5DXXA 1RQBA 1GVFA 1P6BA 1Q8JA 2EBNA 4PB3A 4AIEA 2IKHA 4WSJA 3W1TA 2W66A 3DGBA 3ALGA 4QCEA 3OGRA 3SN1A 4FO4A 3CQHA 1GT8A 2BLEA 5FKYA 3A22A 2PU1A 3DG3A 4N9EA 2X7VA 3URAA 3P7YA 4L9ZA 1HO4A 4Q8PA 3GLCA 1V77A 3OVPA 1AL8A 4JIQA 1OC7A 1TYGA 1CXLA 1NF7A 1S38A 4H9UA 3QZAA 1LOQA 4ADSA 4B4FA 5AC5A 2PB1A 2DSWA 4CCEA 3E12A 2GQ3A 4MWAC 1EJTC 1ZLPA 2JKAA 2W61A 4O28A 3P0WA 5DBUA 3PBGA 3WKZA 1Q6DA 3MVIA 3VDCA 1FCQA 1FDJA 4JHZA 5I00A 2Z1BA 3TW7A 3APGA 1J11A 1W5MA 2BP1A 5A5WA 3W7GA 2JKPA 4GX8A 4TX9A 1X8CA 5FF7A 3FS2A 1BXBA 4B5UA 2HTMA 3HOJA 1I6NA 1SJBA 3RMJA 3FFSA 3FSTA 3BAIA 4E2DA 3EXTA 3LPFA 4GO8A 4KCTA 4MNLA 1HKVA 3W81A 1S2WA 4PE8A 2XWEA 3LXAA 1SZFA 1M6JA 2F8QA 4RDZA 1YDVA 3P74A 4P7RA 4MFEA 2PBOA 1ISYA 4RJEA 1IIGA 1Z42A 5I3KA 2W3ZA 4HA4A 2XHYA 1BKHA 3UG5A 2OKOA 4E2BA 4PTNA 2GLKA 4JNMA 1KGUA 4GKTA 3SW6A 1GJWA 1H0GA 4JIIX 4FNTA 4POCA 4PMRA 2BGNE 4CN4A 1F7BA 2E25A 3K13A 2IKJA 2ZX8A 1ZRQA 3C8FA 4O1BA 4F2TA 1DXIA 2EAWA 3MC5A 2PS2A 1PCKA 1V3MA 4JYFA 2A1YA 3MJMA 4WHBA 5FSDC 3J7HA 4LFYA 3WJZA 3WQGA 4OU1A 3W01A 2ISFA 2ZVRA 2E9LA 2XVPA 1VBJA 2GSHA 3QW3A 3WQCA 1OFDA 3U2CA 4HZ8A 4ICNA 4U10A 3D0CA 2DH3A 4QG9A 1GKRA 2FVMA 1MI3A 1W1ZA 1B3YA 1BYCA 4GVIA 1LTDA 2O9TA 2DP3A 4ZOBA 1KR1A 1QI0A 1SFJA 1LUCB 1FUYA 3W26A 3KTXA 2CBJA 1ZBWA 2B0MA 3KBSA 5DO8A 3A64A 3WQFA 4LV9A 1BSIA 1S5TA 3WH7A 3QYSA 2PSNA 1QHZA 1F73A 3EX4A 2POZA 5LXXA 3UR5A 5F7UA 3HG2A 1PS9A 1J01A 3H53A 3UU0A 2ESCA 4YHEA 2BDQA 2OEMA 5CZKA 4PMDA 3TQ0A 1FA2A 4QEHA 4L61A 4QM1A 2FHCA 3DFOA 4C7GA 1IZJA 3FJNA 4EXQA 4M1RA 3LV6A 3F2DA 3K2GA 4FF5A 3NAVA 4MPQA 4JYDA 1KCZA 3WQ4A 4LCQA 1CYGA 4ROQA 3GNRA 4YTTA 1US2A 3QPEA 2VUNA 3PR2A 4C6NA 3R6IA 4LVAA 5JU6A 4TTUA 4Y9AA 4UMAA 1HL8A 4WY0B 1TTJA 3YPIA 2CW6A 1R87A 4XZ9A 3I10A 4Z2GA 5FF0A 4DO6A 1W1IE 1XSIA 3FW6A 3OZOA 3UY8A 1GVSA 4OOZA 2UBPC 1QOXA 3VKAA 3NQMA 1CXIA 3QZ6A 5BU9A 3DERA 3LBOA 3I7QA 4NJKA 3GNOA 3SZ8A 5EGRA 1P6CA 1LQAA 3GDRA 4LUTB 3STFA 4S38A 2VI0A 2W6RA 5LNWA 4ASTA 4A21A 1BVZA 4DBSA 3PJWA 1GOWA 2PDNA 3WQ5A 1JYVA 3MP4A 3NPUA 4JTKA 2DZPA 4RDWA 1GYNA 1RA0A 1ZAIA 3BW4A 1EJRC 2YYUA 5AHIA 2QUTA 3R58A 4F0RA 1J8VA 1TRIA 3OW1A 1P1XA 1TV8A 2VCAA 3XIMA 4W7WA 2Y89A 2REQB 3BWWA 2ALRA 2XSBA 3M0LA 4O52A 3PZIA 4XAYA 1T8XA 1YDOA 2CFFA 1B1YA 2FHFA 5AC6A 3NIYA 1E9LA 2CXGA 3PTMA 5U4NA 4KH2A 3E2SA 1DXFA 4CNOA 3PTKA 2A3HA 3IGHX 5A3HA 2GZXA 1MRQA 3SCOA 5I3DA 1ECQA 1SR9A 3WQOA 2KAUC 1UIPA 3TZNA 4NAFB 1JCNA 1RA5A 4IXXA 4Q4KA 3G77A 3TZFA 4C60A 2ZRXA 3EOUA 5EBAA 3SR7A 2GOUA 3QHMA 1S2AA 3IS4A 5DEZA 2IQ0A 2QVNA 4CEXC 4ZEPA 2WKLA 3N2BA 2Y62A 2Z27A 4NZCA 3L4ZA 2PEVA 2D3LA 1P48A 3HQNA 5EFFA 5BCAA 4LS2A 4GISA 3LQLA 1EEPA 1BF2A 4MIMA 5EL1A 3S83A 4DWSB 1UW9A 4DM1A 4ERIA 1NVMA 4KIRA 2OQYA 1Q4WA 4GVHA 4F9JA 4JGDA 1YEYA 2PGEA 3W6LA 3RF9A 1FWEC 1EWEA 3H2EA 2WMKA 4J35A 3S5ZA 1QPQA 4ADUA 1PZ3A 2J13A 3VIJA 3WNPA 2ICSA 4FI4A 3T8QA 5JH2A 1ADDA 1IIHA 1MNSA 4QFUA 1HKIA 1JI2A 1XIJA 1LG1A 5D09A 4M29A 1W9BM 3CUHA 3EWXA 5D2XA 5M03A 2ODOA 3WBYA 4OVXA 4XBJA 1W2PA 2IPJA 1EP3A 3ATZA 1G9HA 1IEIA 3QKZA 4H8UA 3E0VA 1IZCA 3SN4A 2E8YA 4HN4A 3QXBA 4NKCA 4DY1A 3CL7A 4PEKA 4A3QA 1QXLA 3IEBA 2CYGA 3TAKA 4DF2A 1BTCA 3LBMA 3T0DA 1DOSA 3N2MA 4RNFA 1J0JA 1H09A 5BWFA 5A6KA 5EB8A 2FHBA 3IIPA 4GZJA 1GW1A 3W7OA 3RHGA 1XYMA 3QOKA 4N6FA 1WDRA 4D9PA 3AU6A 5C9XA 2YCEA 3ZVHB 5F1UA 4NG3A 2CLFA 4R5EA 2D1ZA 2XIBA 3F03K 3ZS4A 4AEOA 4D6HA 4MJ4A 4GC4A 1T96A 5AYZA 4PH6A 1KKOA 2X1SA 3EX3A 2DIKA 3OLEA 1LRQA 3G1YA 5I09A 4RDVA 1KQYA 5CC7A 2PDHA 2E8ZA 4PSRA 4W8BA 2WPBA 3S5NA 1ZL1A 4HA0A 3VOCA 1O95A 2ZUMA 3AIUA 3RN6A 3TDFA 1NELA 2HWGA 2WMFA 2GDVA 4XVDA 6XIMA 1XH0A 3TC3A 1Q7MA 2FTYA 1XR2A 3MZNA 5D33A 2BHZA 2QZRA 3O0FA 3W7NA 3UERA 3PJUA 3ITOA 1E1CA 3L0GA 2O56A 1JUKA 4Q4RA 2GJPA 5G4EA 1UMYA 1RV8A 1TJ1A 3ZJ8A 4TQTA 2J62A 2ZXQA 4DZIA 1REQB 3PN8A 4Q4PA 4YS1A 4LANA 1HJQA 3CT7A 3VAVA 1A3HA 2V2CA 5HNRA 1UP3A 5CAHA 2G3NA 4TIMA 2EHHA 1QU4A 3H2CA 4K6AA 2G3MA 4KCUA 5FA5A 5LKYA 3GFYA 1WXZA 4IIEA 4L56A 4K8EA 4B5TA 2GGJA 4HU8A 1DXEA 3DHUA 1K4GA 1V79A 4GI9A 3QR0A 1UP2A 1ICSA 3NL5A 2D2OA 3S6OA 4U3AA 2DUAA 4N2YA 3BAYA 4LC8A 4DUXA 3WFZA 4GVFA 2C14A 3WLPA 1AZ1A 2GK1B 3A4AA 2B7OA 3FOKA 3LCLA 4WDUA 2YOCA 4IMCA 3RM4A 4C6PA 3LHWA 2QF7A 1FHDA 3EOOA 2V67A 3GDTA 4B5XA 4D6EA 2QDDA 3CMGA 2J9YA 3GNXA 1SZNA 1PIIA 3SB0A 4PC8A 4AD1A 2E7FA 1E55A 4JTDA 4OBSA 4ADTA 3IVUA 4PA8A 3CPGA 6A3HA 3W1NA 2EJAA 1HKMA 1W5QA 1IEXA 3DIPA 4DI9A 2V5BA 1N8FA 2OJPA 3LSBA 1PSCA 3W07A 4KBXA 2V5KA 5DN1A 3HMJG 5F2MA 2QDEA 4FNRA 2Z24A 2R82A 1XLHA 4PMZA 3DYPA 3LX9A 4CD4A 3WEMA 1XIIA 4OT7A 3V5CA 4LY8A 1QI5A 4PRRA 1HVXA 1W9PA 3GQYA 3T40A 4GBUA 3D6NA 4QISA 2NQ5A 3QV7A 5MF5A 3TFXA 1A5NC 1V3HA 1JYWA 5D8WA 2ZADA 1F74A 2R94A 4FNUA 4J4KA 3QPZA 4ZO6A 4QITA 4GINA 2Y2WA 2ISDA 3SSJA 1PX4A 4DBWA 5C9WA 3MANA 4PUNA 4BK9A 4DF1A 4B3ZA 4DJDA 4ZL1A 1W1YA 4JKLA 4DJEA 3U4AA 5JBDA 2RFGA 4YWSA 5I3HA 3THCA 1Z32X 3W6YA 2C7FA 1UYQA 2ISVA 2WVVA 2GYIA 4HJFA 3B4YA 4NF7A 4AWSA 1E1FA 3UGVA 4Z1BA 4A3UA 6REQA 1O7AA 1QUMA 1QW8A 2OSYA 3SIMA 1Y5VA 7REQA 5E0KA 1UD2A 4G7EB 2NSOA 2Z6JA 1FDYA 2J9ZA 1CGWA 1MRAA 1TA3B 4XAZA 3EA3A 5FL0A 1BAGA 3UNDA 3NYZA 2EQDA 1DE5A 5GPRA 3RFAA 3GDKA 3HG4A 4S3DA 3ZT6A 1UC5A 1KTNA 4QDPA 1D7KA 1QNSA 4XZLX 4ZOEA 3S2MA 1QMLA 4IXHA 1E1EA 4W87A 3VMPA 3WF1A 4HGXA 3IPWA 3M0IA 3P61A 5D9NA 4NZJA 4BCEA 3BSGA 4GG9A 2YCLA 5ABEA 4KKXA 2PWGA 4EPKA 2C71A 3M7WA 5EMUA 3BV7A 5HXMA 1EBHA 1EPVA 4BI5A 3MP3A 2F84A 1F6YA 4W93A 4WLCA 2PDUA 3NDOA 2VFHA 2CERA 2DDXA 2CZFA 1C8XA 4S2CA 3TOPA 3IIZA 2PPGA 3M0KA 1XUZA 3N6QA 4I7WA 7ODCA 1U1JA 1MVYA 2VC5A 2IUZA 4ATLA 2DT0A 3I3BA 4A6GA 4ERAA 3IIOA 3CLWA 3GWQA 4KETA 3C6CA 2DSKA 3T07A 4A2SA 3QV8A 3GY1A 1AVAA 3W3OA 1R3TA 3WEOA 4H7ZA 1BYBA 3SECA 4PBEA 3UPWA 4RZ4A 4L1GA 4Q8TA 3FY1A 3EDDA 4EE9A 3MYPA 2P8BA 3MBDA 5CSUA 2I56A 4UFJA 4UMCA 5I06A 2VVSA 3CZLA 3M5ZA 3B97A 3VUPA 1W54A 4LVGA 3ELFA 1OM0A 1TJ2A 3H2OA 3V36A 4PMQA 2Z1VA 5LNSA 3RX3A 3WLJA 4YWIA 1HUVA 3ZR5A 1MQQA 3OYXA 1ESWA 1F4AA 4UR8A 3QTGA 3ICJA 1FFQA 3MSGA 4AUBA 1E5JA 2OVLA 1DQUA 3B8UA 3PF3A 2PWFA 3ZOAA 3N34A 4XK2A 3OODA 2PGRA 3TCEA 1DWAM 3M5XA 3S6DA 3GXNA 1UJQA 4HD5A 2ZOXA 2DIJA 2VD9A 3DESA 2J7HA 3KHDA 5I3FA 3LY0A 3GO2A 4D1JA 1X98A 4B15A 2G3IA 2OGYA 3CYJA 1DJYA 5TF0A 3BGGA 4DWSD 4JTAA 2NVCA 3UD6A 3AMKA 4KESA 5GJPA 3TEVA 2ZQ0A 3STGA 2JF6A 4B2DA 4LBUA 1F07A 4L9XA 5CBIA 3VD5A 1JZ3A 1ZALA 3BOXA 3PUOA 3HV9A 5IBXA 4PCNA 3WY1A 1W32A 4JQAA 1MMFA 5CPLA 3M5VA 1GG0A 3WNKA 2ZKMX 4DI8A 1XD0A 1J0KA 1JNDA 4FLOA 4FNPA 3LGDA 2NSXA 4IG2A 4C1KA 4DWSC 2XN2A 3R0UA 1KGXA 2ACQA 4HMCA 1JAEA 4QEEA 1MZHA 1V3IA 4OJYA 3W7CA 3TLLA 3UJSA 3POCA 3W27A 3GNNA 1AD4A 3JZUA 3DFYA 1CGUA 3FJLA 4IMAA 4WJ8A 3GXTA 1MSSA 4LRSA 3F2BA 1GQLA 3CWHA 1I1WA 2Z2BA 4JEJA 4GI6A 4FX7A 4RR4A 2B7PA 3EPOA 2ZUUA 1YBQA 3E3HA 4ATDA 3QGKC 2V3FA 3IRDA 4OUEA 4D6GA 3W1RA 3KBNA 3VPLA 4O0ZA 4I6VA 1F61A 3PBMA 3ZT5A 3V18A 1QVBA 1VBGA 2R1PA 3IVSA 3N29A 3KM8A 2XPKA 2WW5A 1RSCA 4Y90A 1WCGA 2D23A 2E6AA 1V6YA 4WGXA 3MBFA 3OVRA 4AZGA 2BBFA 5B80A 4AD2A 1BWLA 4DELA 3N9KA 2H8XA 4EOUA 3CHVA 4JTFA 3VD4A 1Q6EA 4Q6JA 1YTEA 4K8HA 4KWOA 3HM7A 1LZOA 1VBRA 3WF2A 4XX6A 3THDA 4LTSA 2ZXBA 1HJVA 3H12A 1AJ2A 2O0TA 1J2BA 3SAZA 4PFMA 2GJLA 2ACUA 5CZTA 5EMJA 1G4EA 4CUCA 5DT5A 2W4XA 2BHYA 3PVFA 2ZZ5A 1FWTA 1XHGA 1EHAA 4J3SA 1RQEA 1EIXA 4HHLA 4XWUA 3FNDA 2FQIA 2YXOA 4MWAE 3GVRA 4O14A 3GVGA 4FNSA 4OGZA 3CQKA 2WWCA 1I9CB 4PYSA 3OTRA 4FOKA 4JX6A 4YXGA 2FZ9A 1SSGA 1YDYA 1SFTA 4OV4A 3VIGA 2FTWA 1UR1A 4H6QA 2R8WA 4MWAA 3VC5A 1IWBA 3CHEA 3TWAA 1E0UA 3VIFA 1GOQA 1XYLA 1MDLA 1BVNP 1WP6A 2PF0A 4RKAA 1UWAA 3HQPA 3GC4A 4DXVA 2XTKA 4F2BA 4PFHA 3U5YA 4NU7A 3ORWA 5RUBA 4KEUA 4W8AA 4QJ5B 1JPKA 4WOQA 1DJHA 4HOZA 1JDDA 2PP0A 3M6DA 1I2OA 5T9BG 4BJHA 3GNPA 1F3EA 4MSSA 2HK0A 1QOPA 5FEXA 1RUSA 3RG6A 4O1DA 4U3CA 1ADSA 1OY0A 3AXKA 1KM6A 3PY2A 1NM9A 2VKZG 4C1LA 2QCEA 1CGYA 2FPYA 4S39A 4AH7A 3ABRA 4S3CA 2WC7A 4U28A 1J12A 5TIMA 4GMEA 9CGTA 2CC0A 3KAOA 3BLPX 1K9DA 3BH4A 4RLIA 4EPBC 4MB3A 1GGOA 2WQDA 1JYNA 4RXFA 1DWIM 4MB4A 2BFGA 4ZBCA 2PODA 4N6EA 2OFJA 1S5VA 4PGLA 3RJYA 4O4WA 4A35A 3P67A 2FJUB 5BMWA 1Q85A 3NXFA 1HFBA 2EXOA 2VEPA 4Z1CA 2FGLA 5HMEA 3ZFHA 3VDAA 4LF2A 5AOUA 3TC6A 1ISVA 3AWOA 4HZ7A 4PMYA 2CLMA 1E6PA 4C5ZA 4WGHA 5E6ZA 1UPPA 4OECA 3QGAC 3QH2A 3GNDA 3WDIA 3OLIA 3G3DA 3K4AA 2CIPA 1DV7A 3GU9A 4AZIA 1S3HA 1PL9A 1XYBA 2ATSA 4LW7A 2ZRWA 1OFAA 2AMGA 3OZPA 2QPSA 1R9ZA 2GJRA 4NHVA 3CTTA 1V03A 2HZGA 3SCNA 2V38A 2A7PA 5G2IA 2OTDA 2WZMA 3M46A 3MPGA 1W6TA 1QI2A 1V6UA 4D71A 5HUPA 3V16A 2D22A 2GUYA 2VDIA 2CLLA 3BAJA 4ZODA 3IJ6A 2C79A 3A5FA 3PNZA 2PRHA 1QCWA 1MEWA 4Y7EA 5I5RA 2VO5A 2O4QA 2C6QA 2WC4A 4N02A 1XLJA 3URBA 2OYKA 3L5LA 3QMSA 4MADA 1M03A 2WVSA 1AMKA 3LTPA 3PZNA 3BURA 2VZTA 2ZUSA 3I65A 4DUVA 2VJXA 4O1FA 2INEA 4YCOA 1E3XA 4UFHA 4GYKA 1E5NA 4IGHA 3RGTA 4EKJA 3V75A 2F38A 3V35A 3MUXA 3VK5A 3WUGA 4AVOA 4JTRA 3KXQA 1WPCA 1ZUAX 3UXIA 3MJYA 3A24A 1HXJA 1ZJIA 4UBPC 3KL3A 3TSMA 1A3WA 2ZYFA 1V02E 3DHDA 1H60A 2CKRA 4NJHA 1F6KA 3P93A 2WHMA 1YPIA 3S3GA 3LHYA 1UR3M 1NU5A 3P14A 3VIKA 1E6QM 2VWTA 4L6DA 1UCWA 4DBDA 5K4ZA 2CLPA 3W2KA 2PE4A 1FWSA 2OO0A 3W02A 1GQIA 4I8DA 1LYXA 2W91A 5T9CE 3CS2A 3I68A 3L4XA 3DKLA 6XIAA 5DMLA 3RPTA 3WDHA 2XH4A 4HKPA 4FS9A 1FCVA 2J88A 1IT7A 3UPMA 4IFKA 4MDOA 4Z2HA 5BYWA 4FK9A 4RNJA 1EX1A 5FAJA 3CAQA 3GK0A 1LBLA 1RBAA 1U5HA 2WSYA 3INPA 4ML4A 5LNVA 1TPUA 2IPGA 3GXDA 1S5MA 3NPVA 1R3WA 2CEQA 1SW7A 1SQ7A 4IP4A 3BW2A 3H70A 5C0QA 4AF0B 1K6WA 4O1AA 4IIGA 3NVDA 1G4TA 4KGLA 3AIEA 2XGBA 1ITUA 1EEXA 1EIBA 2CZVA 4C1NA 3GXPA 4D6FA 3TTEA 3HU7A 5AYBA 2PDYA 1L8NA 1ME7A 3FXGA 5E09A 4WR3A 2V8ZA 3KTSA 3VOFA 3BCFA 5DELA 2J4GA 1GQNA 1W9XA 3TYUA 4YLWA 1S5WA 5GVJA 1W3JA 1IE7C 5AC4A 1JVNA 1HP4A 3O2LA 3CNYA 4L6OA 1LT7A 3N1AA 4HZ6A 3KZPA 4NJIA 1F8IA 3FX4A 1R46A 3O9NA 3VNDA 1HN1A 3UXLA 5D38A 2KX9A 3LCXA 1EWDA 3PG9A 4OWGA 4LB3A 3PK7A 5DMNA 1XIHA 5HATA 1H2JA 2PWUA 3MV11 5H2ZA 1AJZA 4Z1AA 1MXSA 3W87A 1UBSA 2BASA 1CXKA 4EWND 3GTXA 3WD1A 3OQEA 4GVGA 3WMSA 1E1CB 1XLFA 4ZFMA 2ZUNA 4JHMA 4ZR8A 1M7JA 4F79A 1POJA 1P5BA 1R30A 3UR2A 3DC0A 3W86A 3KFTA 1TZ7A 1JCMP 5CSSA 3ZO9A 2HISA 2V2DA 1EX5A 3E0WA 3MCOA 2J77A 1Q5MA 4U33A 3W7JA 1ZBKA 1Y0EA 2DEPA 1TUFA 5K4XA 3GZ3A 1DWGM 2EPKX 3GFZA 1OF6A 3R8HA 3HPAA 4BQ2A 4CCZA 3W38A 1U5VA 1FWAC 1DJZA 1JRCA 5D04C 1ZBVA 1E6ZA 5ECUA 1YE4A 1XLIA 1I2RA 3MDUA 2EEXA 5H1WA 2CBUA 1XC4A 1V7AA 3I4KA 4UTIA 1MNZA 3P2VA 2YDQA 2CKSA 4DX3A 2PDBA 3T7VA 3T2OA 3PC0A 4RV3A 1T41A 2CHNA 2GDUA 2OB3A 1Q6FA 4L5ZA 3PPCA 3L67A 3B0VC 3K1GA 3A3HA 3PBWA 3BOFA 1G94A 3FA4A 1CCWB 1XLAA 1LOSA 3CZEA 3R25A 4CD5A 3EXRA 1C9WA 3OO2A 4OIFA 1B90A 3VGDA 4KWWA 1DJWA 4Z2IA 3TR9A 1L0PA 1WBHA 1QK2A 4B5WA 3S46A 2CBIA 5DANA 3ZLFA 2JEQA 5F4WA 3GW3A 4X0VA 6CGTA 1VBHA 2UY3A 4Q6XA 2WVUA 1G67A 2EJ1A 1HNYA 1E0TA 3PJTA 1K1DA 3O8AA 1QPKA 1DTNA 1AH0A 1GEQA 5M17A 3JS3A 3A12A 3NQGA 1F9CA 2FJKA 3AIWA 3KWSA 1PIFA 1I2NA 5I3GA 3TSBA 1EZWA 1V08A 4ORIA 4DVOA 4H8NA 2QVHA 5TBOA 1A47A 3WUFA 3FIGA 4LAMA 2NQHA 3EMCA 3MI6A 4LUSA 2DT1A 2WCSA 3VFCA 4TV5A 4AY7A 3TJIA 1P7TB 4CCCA 2PDXA 4S3AA 4QAIA 4KIEA 3I3EA 3K8LA 2I9EA 1PJ9A 3F4WA 2V5LA 3WH5A 3M16A 3BLFA 2WVVB 3UZZA 3QOMA 4IWWA 3N18A 1JPIA 1ONWA 1GPFA 1TPH1 6REQB 1RBLA 2ALDA 4IFRA 2B31A 4HTYA 4E38A 3PZ9A 4P5UA 1UD8A 5HUOA 7REQB 3DHPA 4DXKA 4C6EA 5G1YA 3GHRA 1PKLA 1OFQA 1NDYA 1TX0A 1TWIA 3WJSA 1XRTA 4HSHA 3II1A 4X3ZA 3ARSA 2HNEA 3T08A 3VKJA 1DTUA 1VB9A 1H5YA 1PZ2A 3BE7A 4UQBA 1FWDC 5F2IA 2F6KA 1XLDA 3BQ5A 5A2AA 4JIRA 4PTXA 1PUDA 1S2CA 1UKQA 3AXXA 3WH9A 3NL2A 2PMQA 1U1HA 1K03A 4XIMA 3CPUA 1NARA 1JXKA 4LCRA 2PA6A 1H7WA 2AMXA 5ABHA 1VJZA 3EX6A 3JZEA 3KX6A 3GSMA 1F8MA 1DORA 5REQB 3R89A 1VC4A 1V3JA 2YCLB 2ZWZA 1F5ZA 3PPFA 2B7QA 1TFVA 1VKFA 2RDTA 2VC9A 3BG3A 1Q45A 3KP0A 3N3TA 3IV8A 3N2OA 5JMUA 4R9XA 4KFNA 3N04A 4KRTA 3GDMA 3E0IA 4R7WA 4UZSA 1UH2A 5AKQA 1MYRA 3H2NA 2WYSA 1TJPA 3NO5A 4Q8VA 2A3LA 2VNCA 5A8NA 4A29A 1UD4A 1XQKA 3O15A 2J8FA 4QS5A 1BWVA 5JXQA 1BPLB 4JDBA 5MKGA 3F5KA 5XIMA 2ZX5A 5T26A 1KFCA 2VZUA 2DJLA 2FIQA 4S3BA 2YW4A 3G0SA 4MVAA 2PTYA 3WENA 2PTXA 1W3HA 5LA0A 2PC4A 1LOLA 3WLQA 3CPRA 5C8BB 1XWYA 2ACSA 1OT2A 1IXNA 5ABGA 3WMLA 5I3IA 3S2CA 1FWFC 1XBVA 3LRLA 2YB1A 1C8VA 3G6MA 1JPHA 4TUFA 3CT2A 2G41A 1ISXA 3AO0A 4XG1A 4GUGA 2YCKX 3G0UA 2OT1A 5I78A 1AQ0A 3GUGA 2VFEA 3THUA 2V63A 2P3EA 1JD9A 4IHCA 2XH0A 3H2FA 2DW7A 5H8PA 5IOBA 3EB3A 1ODZA 4C7DA 5K9CA 4TU1A 5FACA 4DNHA 1SO3A 3HIJA 2X2GA 5J8LA 4UB9A 1VYRA 5E93A 3CAVA 1ZBCA 2QCLA 4IPPA 3BXWA 2FYMA 1RVGA 5A6JA 3UWZA 1R9XA 4Z2JA 1LUCA 3R79A 2FGBA 4QXIA 1K8YA 2BG5A 2EPLX 2YBVA 3FDGA 2ZX7A 1KV8A 4UR9A 3CUZA 3SQSA 4HOXA 1Q65A 4FF7A 2PDJA 1FBAA 1H0IA 2VYOA 2WSRA 3NO3A 2J6VA 2AQWA 3I6TA 1D3CA 3W7HA 5E9AA 3VCRA 2GL5A 5CXPA 2P76A 5U7SA 3SQLA 3T2PA 4UC5A 1G6CA 3WBXA 3PULA 5LHEA 2GWNA 4K68A 2VFIA 4C6IA