2YYUA

Crystal structure of uncharacterized conserved protein from geobacillus kaustophilus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
225
Chain Sequence
TPFIVALDFPSKQEVERFLRPFAGTPLFVKVGMELYYQEGPAIVAFLKEQGHAVFLDLKLHDIPNTVKQAMKGLARVGADLVNVHAAGGRRMMEAAIEGLDAGTPSGRMRPRCIAVTQLTSTDERMLHEELWISRPLVETVAHYAALAKESGLDGVVCSANEAAFIKERCGASFLAVTPGIRFADRVVTPRKARALGSDYIVIGRSLTRAADPLRTYARLQHEWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized conserved protein from Geobacillus kaustophilus
rcsb
source organism Geobacillus kaustophilus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 74
structure length 225
sequence length 232
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2yyuA00
4RX0A 1YDOA 3W1UA 2G97A 1VZWA 3R5EA 3VKJA 3NZ1A 4AHQA 1KV5A 3HGJA 2YGYA 3LGEA 5DXXA 4IMDA 2E68A 3HGRA 3IVTA 3P80A 1Q6OA 4EIVA 1YTDA 3EEGA 1G4EA 4M19A 4HNNA 5C55A 3PBUA 4HNTA 5EA9A 3CIWA 2FTPA 1F05A 3SY5A 1FDJA 4O11A 1U5JA 4IXHA 3WJYA 3IGSA 3L68A 4LT9A 3DKJA 2WQPA 3NL5A 5CPMA 3DGRA 1JJKA 3W85A 3W7IA 4BI6A 3VCRA 3PB0A 3MP4A 1R47A 4MFDA 3TAKA 1FWRA 3ATZA 1IIGA 4POCA 3C2EA 1TTQA 1L6WA 5J5DA 2CLEA 1FY6A 4UFHA 3QJAA 4PC8A 1EUNA 2C3ZA 2RDWA 3GDTA 1EP3A 1H63A 3HG4A 1VCGA 3LOTA 1W31A 3KHJA 3NEVA 2D73A 1EWDA 4BI5A 1OHLA 4KWVA 5MHBA 3M41A 4ALDA 1UASA 4FX7A 4WD0A 2Q3OA 4XWUA 1LTDA 5HULA 3KX6A 2F84A 3HMJG 1WBJA 2V9DA 1M7PA 2A7NA 1OFQA 5D2YA 1DJNA 1S5VA 2CW6A 1RQBA 1K02A 1KBIA 4N9EA 4OQVA 4Z1BA 2PRLA 3KOFA 2CWNA 1OK4A 4X3ZA 4UR7A 3T4CA 2WNQA 3TC7A 4DO6A 3E0IA 1W3TA 4GWEA 1I4NA 1WX0A 4O28A 1D3HA 3HOJA 3O1NA 3W70A 2FDSA 3CPRA 3R12A 4FO4A 4FIRA 3DI1A 1ME8A 1ADOA 2FFCA 3DZ1A 1T8XA 3LCGA 1OVDA 3NPUA 1H5YA 5LHFA 2TSYA 2CU0A 2VFGA 3UWQA 1ICSA 1WBHA 4CLMA 1SW3A 2EHHA 5EKYA 3BG5A 4ZMGA 4BFAA 2BZNA 2Z6IA 3WJZA 5AHIA 1K03A 3GR7A 2A0NA 1H1ZA 4NVTA 1NVMA 1B3OA 5LZLA 3QSRA 1R46A 4OHQA 3W2UA 3T7VA 4EVZA 5AHMA 1YYAA 3S5ZA 4DO5A 3JS3A 4ZL1A 1TQJA 4IOTA 5AC6A 5AYXA 3LHTA 1KM4A 1SFLA 5KZMA 3ZWSA 1PE1A 1VQTA 1RR2A 3E96A 3N9RA 2VFEA 1Q6RA 5SWUA 3CLMA 1JVNA 4UFMA 5K4XA 1L6YA 3HPZA 5FF4A 3TNOA 4NNAA 1LOLA 4O0ZA 2JGYA 2GVGA 3LXAA 4JX5A 1KFCA 3V75A 1DQXA 3WK3A 4QNWA 1H7RA 4NJGA 4UTTA 3SI9A 1SO4A 4WXYA 3Q58A 1QO2A 2A2IA 1WYIA 3L0GA 1PHQA 3OA3A 1FQ0A 2C1HA 4EF9A 2OT0A 3UXAA 3LI1A 4TMBA 1XKYA 3MI3A 1Z42A 5L6UA 4D2JA 1VHNA 3P61A 1NFBA 1TV7A 1LCOA 2GJLA 1SO5A 2GUUA 2CZ5A 4MKNA 4HHPA 1PIIA 2B4GA 2WV8A 1TPWA 4WY0B 1EEPA 4PTNA 4AB4A 2QR6A 3W71A 3LRLA 1JCYA 2QDHA 5KMYA 3SSJA 4O52A 3ZS4A 2RH9A 1H1YA 2V2CA 3TA6A 1K8ZA 5H91A 1NF7A 3O6CA 4K7VA 1KM5A 3G3MA 4MYXA 1LORA 1W37A 2OMAA 1EUAA 4Y9AA 3TQ0A 5CSSA 2NUYA 3FYPA 1LBLA 2WSRA 1MXSA 1VGAA 1JCXA 4MYAA 3W72A 4BI7A 4JTFA 5CKSA 4K7YA 5G4WA 2EPHA 4NXKA 2VENA 1HL2A 3BO9A 1OFBA 1PVNA 1C8VA 3GYEA 4RCXA 4Y96A 2FPTA 4CNPA 2IQTA 3NM3A 2B7QA 1Q45A 2A1YA 1LRNA 4CCEA 2CZFA 4O15A 3EWWA 2XN0A 5FF2A 4CCDA 3NNTA 4JD4A 2ZZ5A 1W8SA 2AQWA 4U4MA 5KSWA 1SU5A 2O7QA 4LS1A 5G1YA 2QAFA 3L0NA 3W7GA 3BPWA 3I7SA 3PSVA 4S1FA 5KZEA 4AWTA 4AVFA 4IQLA 1FUYA 1W56A 1TPC1 1UJPA 3PG9A 3N2MA 4NX5A 3GLCA 1H7WA 3EWBX 4UUIA 4NZFA 1XC4A 5E93A 1HG3A 4UC5A 3O6YX 3L67A 4ICNA 5ABTA 3MI6A 4GUIA 1QPRA 1YXDA 3LXBA 4UXDA 4YLWA 2P10A 3PS7A 2XN2A 2F7FA 3F1QA 5HQEA 1JUKA 1KFLA 2NZLA 4BR1A 3CHVA 1EIXA 1T96A 2HS8A 2X1RA 2YDAA 4GUHA 3UYCA 1K7XA 4JTUA 1QOQA 1C9DA 1K3UA 5F2IA 5G2HA 4M6VA 2ZFAA 1D3GA 5AC8A 3IIXA 4FIQA 3EX4A 3B0UX 4UTWC 1R30A 2ZDRA 4MUZA 4Q32A 4JX6A 4JTKA 1HFBA 3C3NA 5F2LA 3KVKA 1AW1A 3QFEA 2ZZ3A 2NXIA 3DFSA 4LY8A 3NL6A 5CZTA 3B06A 4IX2A 1JUBA 2R94A 4O17A 3CC1A 3S6DA 3HGOA 5I3JA 4XBKA 1L6SA 3EWXA 4AHOA 3HQ1A 5D2WA 2WNZA 3QYQA 1V5XA 4JY8A 4Z1DA 5EBUA 1O5XA 3NQMA 1KFKA 4XUGA 2AAMA 1P1XA 3HF3A 1TJPA 1GYNA 3UY8A 2GPTA 3RK8A 2CLIA 3GDRA 3WJWA 3GXPA 2Y85A 4KKXA 3NOEA 3S1WA 4I9AA 4YL2A 1FDYA 1J4EA 4N4PA 1BEUA 1KM2A 3EXSA 4Z08A 1S3HA 5EYWA 1TMHA 4YCPA 3VFLA 1QPOA 1JUEA 2J9YA 2ZZ1A 2E1DA 4GUFA 1GQNA 1F74A 3SR7A 1M6JA 1OYAA 2JKEA 3FA5A 3SIZA 1BTMA 4K8HA 5FESA 4GBUA 2CZDA 2NX9A 1O60A 1JQXA 5BRBA 2JGQA 1I2OA 3LV6A 4PH6A 1W5QA 2ZZ7A 5IBXA 4WY0A 3EKLA 3OIXA 3S9YA 4LTSA 1VR6A 3G0SA 1W3NA 4K36A 3TH6A 2KZHA 1TSIA 4A3UA 5DCEA 4JEQA 4LV4A 1PS9A 1SO3A 2PURA 3LTPA 4DO4A 1GT8A 2FJKA 4JDYA 3YPIA 1TPEA 3GB6A 7TIMA 4E2BA 4B5NA 3RU6A 5LNRA 2UV8G 2H8XA 1TO3A 2EKCA 3NYZA 4UTKA 1AMKA 3UWVA 1XBXA 2GVLA 1TCDA 3B05A 2QJGA 2GVJA 3R89A 3C6CA 2OJPA 3SGUA 3LHYA 4ZVJA 3OVRA 5HR6A 3T78A 3TW6A 4PFMA 3CM4A 1HTIA 1ICQA 4NJJA 1QPNA 3EX3A 3RLUA 3JR2A 3MW7A 1IXQA 2OCZA 1GYLA 4AXKA 2Z6JA 5CGQA 5D05A 4Z0SA 4FNPA 1JQVA 4MVAA 3USBA 1YPFA 2Y7GA 1W5OA 1W5PA 4UTMA 1NAL1 3W7LA 4BWLA 4IWWA 1K7FA 2CFFA 1ZJIA 4IMGA 1EP2A 4ONVA 4P2VA 2ATSA 2FB2A 2O7SA 3TKFA 3W1TA 4N2YA 3UXDA 4ADSA 4WOQA 2VXNA 4ZQRA 2A7PA 4O10A 1H7OA 4J9JA 1R2SA 2DZVA 3KRZA 4UMAA 3MUXA 2DZWA 2GOUA 4S2CA 1TPUA 4N6EA 5AC7A 4O0KA 1IXPA 4IMFA 1FDZA 4AWUA 3W6YA 4FXRA 1GVSA 2H3DA 1DL3A 3N2XA 3CQ0A 2ZZ2A 3INPA 2PC4A 3BGGA 3H55A 1AW5A 1TQXA 1C29A 2VC6A 1JRCA 4Z0JA 2VFFA 4TIMA 5FEPA 2QUVA 3Q37A 3BW3A 3GNNA 1G7VA 1M5WA 3A5VA 3GKAA 1BKSA 2DZSA 4KFPA 5HWMA 3B4UA 1TPVA 1FBAA 3LHWA 3V1PA 4A21A 5AB3A 4FX8A 4A29A 2NXHA 4JIPA 5DXYA 3Q94A 3TXZA 4ZQOA 3L66A 4UFKA 4LVDA 1VLIA 3PAJA 1JCJA 4LVGA 1F6KA 5KTLA 1LZOA 4MY1A 1TV8A 2G5WA 2X1SA 2Y70A 3W7EA 2BWGA 3STEA 3W1MA 1UUMA 4QSHA 4U28A 1F73A 3MP5A 3NAVA 3C2FA 3EX2A 1H7XA 2YSWA 3K30A 3R2GA 2HSAA 3PY2A 4WXZA 3G1FA 3RF9A 1GTHA 4FNRA 3P5YA 2B0MA 4JX4A 1XL9A 3IGUA 3S42A 1TTJA 2NUXA 3VE9A 3MJYA 3L5LA 6ALDA 1MSSA 4O19A 3U6WA 1FCVA 3NG3A 4X22A 2YYTA 1EP1A 3UQNA 5D04C 4JNMA 5FEZA 2YYUA 5K3VA 4O54A 3BK0A 2CLFA 3EXRA 4LRSA 5HMSA 3QQ1A 3G8EA 4O50A 1OG0A 2Y6ZA 4A22A 4QIUA 2VEKA 1ZCOA 1ZAIA 2W79A 2V2DA 4NQ1A 2QCLA 5F2GA 4JTTA 5D2XA 3E12A 5BMXA 3OBKA 3KRSA 3L5AA 2BTMA 1XBVA 2VELA 4G1KA 2NXGA 3LBCA 1KLYA 2RHGA 1QCWA 3BGJA 1GZGA 2E6YA 5KINA 5AHFA 4GE8A 3O16A 2H8ZA 3I7QA 4R33A 5GVJA 4JYDA 3M1ZA 3THQA 3PSWA 4CNNA 5G2WA 3LX9A 2V8ZA 3DFQA 2G96A 1T0OA 1ZY9A 3NO5A 4EWND 4JTGA 3QZEA 3GKFA 1VHCA 2C18A 4O1DA 2BXVA 3LHUA 1YTEA 3RNDA 1DVJA 1I2QA 1G67A 3L21A 1ZNNA 2WSYA 4WJEA 2NWSA 2Y63A 3PG8A 3TSBA 2QAPA 3QMRA 3FOKA 5HINA 5LNWA 1GVOA 1X7FA 1M7OA 4N9DA 3L5MA 3C2RA 4FEZA 4M6QA 3VI2A 5AN7A 1G6CA 2RDUA 1ML1A 4L4MA 5AOUA 2HMCA 1BWLA 1ZENA 1WAUA 4XTIA 3UZ5A 1KM6A 2OT1A 4JTEA 3P62A 2QJIA 2X1TA 1LOQA 4NZJA 1ONRA 4O4VA 1X8FA 1D9EA 1IIHA 4M7SA 2FIQA 4FNUA 3A23A 4OU1A 3N14A 3DKLA 2OZ0A 2ZA2A 4HSNA 4PEKA 1LOSA 1DV7A 3LCWA 5I3HA 3W2NA 4HPJA 5TQLA 1VJIA 3WK2A 3B0PA 1WXJA 3NQAA 4JN6A 4ZQCA 1AG1O 4ZQNA 1K7EA 4PA8A 4O14A 5HWJA 4TX9A 4Y90A 2B7NA 2RDTA 2B7OA 1ME9A 3OVQA 5AFDA 5LKYA 5LGXA 3A5FA 4A2SA 5I3GA 2P1FA 4RV8A 5BMWA 1AW2A 3ZWTA 3UZJA 2CLKA 1FCQA 2H6RA 1VYSX 4Q33A 3PUEA 3W1XA 1TJRA 3DH7A 1SFJA 4XKYA 3PVFA 3C8FA 3IIZA 2WPBA 3BVJA 3DENA 1SSGA 1E51A 3FFSA 4X2RA 2G95A 3P8JA 2AGKA 1GPWA 3GX9A 1V7YA 3CWNA 2DZPA 3F03K 5F1VA 5D09A 3LRMA 5D2TA 3BLIA 2Z2UA 2W0UA 1YXCA 2DORA 5CSRA 4DPPA 2JBMA 3IRDA 4KFNA 3VNDA 3HPXA 1MO0A 2ZZ6A 3O05A 5K9DA 3QMTA 3SGZA 2Y62A 1R2TA 5DN1A 4JTJA 3N3MA 1WA3A 1F6PA 4ML9A 3CTLA 3TAOA 5LNVA 1FWSA 3GDKA 3W7PA 4NNCA 3LERA 3MO7A 4UTWA 4XBSA 3EWUA 4R53A 4FHAA 1QPQA 3PBWA 3ABSA 1R2RA 5D2VA 3W86A 1H7NA 1K8XA 4RLIA 2Y61A 4NX0A 1CW2A 3DI0A 1OFEA 1DQWA 5T26A 2ISSA 1QWGA 5F4SA 1YDNA 3N19B 1AL8A 1XUUA 2TMDA 1TPH1 3TMQA 3PUDA 5HJLA 3UWWA 2I9EA 4Q4KA 3N73A 4QITA 4XKYB 1RVGA 2A21A 1L9WA 4K6AA 4XQ6A 3EWZA 1PCKA 4K38A 1L2UA 5DCDA 2JKPA 1PHWA 4UCGA 5DY3A 5EL1A 5LGZA 1W54A 3KVLA 5F4WA 3HG2A 1RD5A 3TW7A 3W73A 3I6RA 3CWOX 1G7UA 2QCGA 3CT7A 1NEYA 2Y7EA 4MZ1A 5EY5A 1KW1A 3NPVA 3TV8A 3ATYA 2ZBTA 2E77A 3LTYA 1FCUA 1Y0EA 3C4UA 5KZDA 3T40A 1A5CA 4NJKA 1YPIA 3BLEA 2QCCA 4P61A 3W7MA 3DXIA 5CG7A 4E0CA 1P4CA 3TU9A 5L9FA 2E6FA 3NQCA 2QCEA 4UNKA 3LM7A 5FF3A 1BWKA 5K9XA 1HO1A 1TIMA 3HG3A 3PB2A 4ORMA 2Q8LA 1LBFA 1TREA 3S8HA 2QUTA 1P0KA 1SZGA 3O07A 3TQKA 1TPFA 2ZRXA 3ABQA 2FQIA 5I3KA 3W1NA 1FCBA 2CLMA 3W7KA 2C0AA 5LNUA 3W2KA 3B0VC 3Q2DA 4O53A 1FX6A 4UTIA 5G5IA 3THAA 3EB2A 3G1YA 3LBMA 3QQ0A 2H3BA 1VC4A 3WJSA 4DF2A 4K8EA 4UFIA 3W7QA 1QFEA 4GUJA 1VS1A 3H53A 1JCLA 2ZA3A 1FXPA 3C0JA 4NT0A 5BOOA 2JKAA 4RZ5A 3SZ8A 4GNJA 3R13A 4LV9A 4N6FA 3W1PA 3JRKA 2Z1BA 4H4IA 4L4LA 3CEPA 1DBTA 3PM6A 1ME7A 1VLWA 4RXGA 4GUGA 4YMZA 1JCNA 3P7YA 5FI8A 3UPWA 4O1CA 1LRTA 2VKZG 1WV2A 3E49A 4O1BA 2ABBA 3STCA 1G4TA 1SR9A 2TPSA 3M5YA 3NL2A 5IM51 3LXCA 3L9CA 3LDVA 3C52A 3S5YA 2NX1A 2WKJA 4XZ9A 1QOPA 3TK7A 1LROA 3KVJA 2QEZA 3TFCA 1N7KA 4RJEA 4WZHA 4JYEA 3GDLA 2NV2A 2A85A 3TIMA 1AK5A 5EMUA 3W1RA 1MZHA 3LCFA 5DELA 2XN1A 2E09A 4AF0B 3GNDA 4CNOA 3LHZA 1DORA 3T55A 3MMTA 4AWSA 3CIXA 5D30A 4O13A 1PL9A 3IEBA 3W7JA 2Y88A 2PRMA 5K9CA 1RZMA 2NUWA 3GK0A 3T44A 2HS6A 3NQFA 3W84A 1YXYA 2YW3A 1ICPA 1Z41A 4M5PA 2X2GA 5D38A 4WQ6A 1EX5A 4RR4A 3W9ZA 3NDOA 4JICA 5U4NA 1HUVA 2DZTA 1A5BA 5HNRA 3SJ3A 3TSDA 1THFD 1T99A 3CEUA 2JK2A 3A24A 3DFNA 3WK1A 3LCLA 5E1QA 3M16A 1Z48A 1GEQA 3D0CA 3DAQA 1Q6LA 3NQEA 3IV3A 4IGHA 3VE7A 3LB0A 3TROA 3HPSA 1WOBA 5A8GA 4UNLA 3W23A 4QM1A 3BG3A 5AYYA 2E5DA 2QF7A 1YTKA 2YFOA 1W1ZA 1HO4A 1O95A 4OT7A 3FKKA 3FLUA 3HJZA 4M7TA 1LM1A 1KFBA 2CLOA 4KWWA 1AL7A 1Q3NA 3LV5A 3G1XA 3OHIA 3UWZA 2Q3RA 4I7VA 3M9YA 1SW7A 1UCWA 3QW4B 2ZRZA 4DQWA 3UPBA 2ISWA 3MHGA 3F4NA 3TCEA 3MI2A 1DHPA 3LLDA 3NXFA 1I2PA 4QISA 2I1OA 5F2MA 1KA9F 5C6MA 4NUWA 2C15A 4LRTA 4OE7A 2A6LA 4N4QA 5HUPA 4DF1A 5CPNA 2YPIA 2E5CA 5LHEA 2P0OA 4W9TA 2V30A 2DZUA 4RZ6A 3EXTA 1UUOA 2BX7A 2ZA1A 5U7SA 4AEOA 3W2JA 3I7RA 1YADA 3PUOA 3MBDA 4FB7A 5I3IA 3FYOA 2OX1A 2ATMA 1A5AA 4DF0A 1I2RA 1YLVA 3QH2A 1GJPA 1LBMA 2QCNA 4R34A 2XFWA 1OFAA 3RLVA 2A5HA 3W83A 1XDLA 1OABA 3NQDA 4JY9A 3UWYA 4C1LA 1VH7A 3W88A 4HIBA 2A6NA 3STFA 3G8RA 4IXXA 1VRDA 3NGJA 3S5NA 1O5KA 4UTTC 3LRKA 3H54A 4C1KA 2GJNA 4XTDA 1VPXA 3M47A 4O12A 4O4WA 4JIQA 3QPZA 5TBOA 2ZQ0A 4N9BA 2Z0IA 3OVPA 3W74A 4M6PA 4HNUA 4GRSA 3DBPA 3GXTA 4JXCA 4JS3A 3LCIA 3GZ3A 4ZQPA 4DPQA 4GJ1A 3SFKA 4KFOA 4N9CA 1LP6A 2NX3A 2Q8ZA 3FS2A 3W7HA 4DBEA 3A22A 1VCFA 4RKAA 3W7NA 3GAKA 1FWTA 5CZSA 1N55A 5IBXC 4LU0A 2YW4A 3C56A 3DFOA 4DXVA 1IGSA 2QUUA 1H61A 1KV8A 2ZYFA 3DFPA 2Y89A 2DZXA 3AO0A 3EX1A 4TO8A 1KM1A 2W6RA 1DKWA 3B03A 2DP3A 3BARA 5F1UA 2J27A 2QKFA 3G1VA 1QAPA 3LTSA 3G22A 2NLIA 4HT3A 4HKPA 1J2WA 4MJZA 3STGA 3HGSA 2TYSA 4QNEA 3IVUA 3PR2A 1TRIA 3MWAA 4FX6M 3P81A 3W7OA 3PBYA 4IUOA 3C2VA 2X30A 1P5BA 4NJIA 1CI1A 4IMCA 2A4AA 4MLRA 3M0ZA 1H62A 1SW0A 2ZTKA 2QJHA 3MBFA 4BK9A 4CQAA 3SECA 4JTSA 3TE9A 1SSDA 3TJLA 1IXNA 1H51A 1B9BA 2PRHA 1OFRA 2VOMA 4LWWA 3NL3A 3G18A 3W1QA 4AMAA 1VYRA 3OEXA 4JYFA 1P0NA 3KXQA 2BLEA 2PCQA 2BSLA 3NPWA 4MPQA 1GVRA 5BW6A 3RFAA 1TPDA 2QCMA 4PCFA 1OYCA 5DCBA 3MHUA 4OV9A 3IGXA 2R14A 3B8DA 3M43A 4TU1A 4YXGA 4BWLC 1OYBA 3HB9A 1A53A 4IPJA 4FNSA 4MY9A 2VFDA 1PV8A 2RFGA 1S5WA 3TDFA 1SUXA 3G1DA 3A9IA 4MZYA 5AHNA 2LLEA 2GQ9A 3I65A 2J88A 1RV8A 4JDBA 3N34A 3ABOA 1GVFA 3PF3A 1KBJA 1KTNA 4JTHA 1W5MA 2E6DA 1LLWA 3TMLA 3M44A 4WY0F 1CX9A 5J5RA 4LS0A 1GWJA 1XBZA 5FF7A 1RQEA 1W5NA 3SW6A 3GR8A 5AHLA 1XXXA 4WX2A 5E0KA 5DLCA 1EA0A 3GXNA 2VEPA 2DJXA 1X1ZA 3DHDA 1H50A 2E6AA 2R91A 1QO5A 4X9SA 1VCVA 1Z44A 3TUUA 1TYGA 3NM1A 3QRHA 3G1HA 1TTPA 4UFJA 4NU7A 3DU0A 1XDMA 5CPOA 3QPYA 3BLFA 2V0TA 2WJZA 4ADTA 1K8YA 3QW3A 3TSMA 3E02A 1NF0A 4H3DA 3W2LA 3W7DA 3S5OA 4PODA 3GIYA 4JR5A 3TR2A 3NZRA 1SQ7A 3P5ZA 4QQ3A 4AHPA 1H60A 4R7JA 2VEMA 3NA8A 3W87A 4EOUA 3TC6A 1A5SA 1DJQA 5H2ZA 3ZR4A 3S1UA 2VEIA 3BV4A 3ABRA 3MHFA 3TFXA 1F76A 1LYXA 1WDWA 3S1VA 3P84A 4GC4A 4ZZ9A 4DEFA 3BW2A 2VFHA 3KRUA 2QCHA 4NJHA 5AHEA 2J9XA 2DJLA 4RXFA 1OX5A 3M7WA 4GXMA 3PULA 4UMCA 4UTHA 1UBSA 1SZFA 2X1UA 3L65A 4RK8A 2I14A 3G1SA 4QAIA 4IX0A 3RMJA 1FWWA 4Z1AA 1OF8A 3NQ8A 2YR1A 4LUIA 3G1AA 4PL1A 3ZFHA 1G4PA 1DOSA 4MZ8A 3DFTA 3M5XA 2J24A 2ZTJA 4LVBA 4UTUA 3KAOA 2FB3A 1F7BA 1ZALA 3W1AA 2RKXA 5HWNA 3HG5A 4IJBA 1H7PA 1G69A 1OJXA 4O16A 4MY8A 3NQ2A 1EB3A 2V5BA 3GVGA 2EGZA 2YZRA 3FIGA 2CZEA 5I3FA 3F4WA 5G1TA 2DU2A 4HSOA 4LVAA 1ZFJA 5G2IA 4FXSA 4N02A 1VYPX 3S0CA 3W07A 4WOZA 4ADUA 5D02A 3NQ6A 4AH7A 3O15A 2J9ZA 1ALDA 3EX6A 1MEWA 1KFJA 1B57A 1O94A 1JRBA 3P74A 3UWUA 4EF8A 3EWYA 3TXVA 5HR7A 1LLZA 4HN4A 1KLZA 2NV1A 5KITA 1O4UA 1RPXA 1W0MA 3P82A 1GG1A 2ZRWA 3PWAA 5K4ZA 4O18A 3O63A 4DBDA 1YDVA 4LC8A 4Y6GA 2GQAA 5DY2A 2YXGA 4MFEA 3GDMA 5C5YA 1KTBA 3L0KA 4MJMA 3UY7A 3E9AA 4K39A 4I7WA 5DBTA 1OFPA 4PL2A 1KM3A 4FNQA 4NNBA 1MEHA 1QDSA 2YCEA 2C19A 4E2DA 5C54A 1WQ5A 1X6UA 4LUJA 3W75A 1GG0A 4AAJA 2QCFA 4JTLA 4MLJA 1XI3A 3UD6A 3P8IA 1FWNA 2WOQA 3G0UA 2V5LA 3W22A 3O8AA 2ZRUA 4CQ8A 6TIMA 4H6KA 5F4XA 2ISVA 3W7CA 4BF9A 2TRSA 3CU2A 3FEMA 5CZ0A 3M5ZA 2CLHA 3L2IA 3BW4A 2CLLA 4MIMA 3B04A 3U8GA 4YCOA 1W3IA 2C13A 2PE4A 4OBTA 5BNKA 1N8FA 5D33A 1SPQA 3TJXA 4AF0A 1TPB1 3P60A 5CZJA 1XCFA 2C16A 1ZAHA 2YX0A 5LSMA 4ORIA 3QF0A 3CB8A 1U83A 4O1AA 4LNYA 2H90A 5FEXA 1OK6A 4IPIA 2J6XA 1QR7A 1RQHA 1B4EA 4IMEA 1J5TA 2QDGA 4CCCA 2A7RA 3NQ7A 5DBUA 3W7RA 3WJXA 4TR9A 5D32A 2ALDA 4FNTA 4E38A 1QMLA 3NQGA 2YFNA 3UNDA 3QMSA 1LDCA 3IVSA 3O6DA 2VFIA 2ZCGA 1QNVA 4LVFA 1LRQA 3BG9A 2QCDA 2EF9A 1I8JA 2QCDB 4LOCA 4UMBA 1XUZA 2V81A 4JTIA 2NWRA 1KM0A 2FLIA 3PBVA 1F2JA 2ZRYA 2Y7DA 5EPDA 3NQVA 4QJ1A 3AJXA 2GQ8A 3G24A 4LS2A 1I45A 4A2RA 1KTCA 3LCXA 4Y8FA 3ANYA 3LI0A 2E5BA 4UTJA 1X1OA 1SZNA 3MP3A 4K37A 3MYOA 3FJLA 3P67A 2FPYA 4OV4A 1F5ZA 5A5WA 3EKZA 4RZ4A 1XM3A 4ZQMA 4UIOA 1GTEA 3NPXA 1TB3A 3C61A 3MYPA 3N9SA 1TV5A 4GFSA 3KVMA 3FJ6A 4MOZA 1XBYA 2HTMA 3C2OA 4HNVA 2R8WA 2WSQA 3PC0A 1GOXA 3KFTA 1JCMP 1SO6A 2Y7FA 1B4KA 1OX4B 1Q6QA 3W76A 4NXSA 2ZZ4A 5D37A 5HUOA 1EWEA 1WOAA 2ABAA 2WO5A 1OX6A 2V82A 4OWGA 4Z1CA 5K2ZA 3IIOA 3WFAA 8TIMA 3IIPA 3NR0A 5K7JA 3QEZA 1MEIA 3TQVA 3LCHA 1FXQA 2EAWA 4WUIA 3R8RA 4TMCA 3GAYA 4O8RA 4DELA 2B7PA 4FF7A 1OFDA 1TRDA 3FKRA 1GVQA 3I68A 3LHVA 5CPLA 5FF0A 1S5TA 3QC3A 3QM3A 4UTLA 2V2HA 4UR8A 3G0XA 5C2XA 1G4SA 4OGZA 3OG3A 1IXOA 4UFLA 3QSTA 4S2BA 4O57A 1EPXA 1XFBA 2C6QA 1ZHAA 3NVTA 3A21A 5AYZA 1UB3A 4I7UA 1A50A 1TTIA 3ELFA 3U2OA 2WNNA 1JULA 5G4EA 3HBLA 4JGDA 4LC6A 4LW7A 5LNSA 3TX9A 3W1LA 3G3DA 4CQ9A 3M5VA 3O06A 2FPVA 2X16A 3WK0A 1SZEA 1I2NA 5FEWA 1OX4A 4YWIA 4HPXA 3S1XA 5D03A 3IIVA 3M6YA 3HO8A 3DHFA 5TIMA 1IF2A 1JR1A 1OF6A 1NSJA 3HIJA 1PCWA 3W3OA 2C14A 1ZAJA 3LLFA 2ZRVA 1KFEA 1OFOA 3W2MA
chains in the Genus database with same CATH superfamily
5H8UA 3W1UA 2X0HA 3VKJA 2ZWZA 1KV5A 1Q8AA 3LGEA 1XCWA 3ID7A 3IJLA 2DIKA 3HGRA 3N15A 1YTDA 3KRBA 4M19A 1ISVA 4HNTA 1W9VA 2FH8A 4H7CA 2AL1A 3N4EA 2FJUB 2WK2A 3CIWA 2FTPA 1KQZA 3WJYA 3IGSA 3L68A 1R9YA 3N17A 1VFUA 2VEFA 3NL5A 4RDZA 3ZLHA 3DGRA 2GGHA 4RNFA 2G3MA 5CLWA 2QUNA 2W9MA 2X8RA 4MFDA 3TAKA 3ATZA 1IIGA 1NDVA 2ZADA 3GHUA 1EJSC 1DJXA 3KBJA 2R1MA 2RDWA 4J2MA 4OVXA 3VD7A 1H63A 2XH7A 3QLLA 3OQEA 6REQA 3HG4A 4P7RA 3CQHA 1VCGA 2ONEA 3KHJA 1EWDA 4MAVA 4US5D 4PMNA 4FX7A 5TNVA 2X2YA 4XWUA 1J12A 1LTDA 1WCGA 3KX6A 2HV5A 4GI8A 2F84A 4C6BA 3MY9A 1TVPA 2V9DA 4PUEA 5D2YA 1DJNA 1XRFA 4EAYA 4PGLA 4WKAA 1KBIA 3TYZA 3GTFA 2CWNA 3MZ2A 4X3ZA 3TC7A 2BS9A 3E0IA 4DO6A 3ITVA 5A3HA 3WD3A 1WX0A 4O28A 1J5SA 2BODX 4QJ3B 1D3HA 2FHFA 3UEQA 4D9PA 3C86A 3WBYA 3ZT6A 3DI1A 1ADOA 3VGBA 5ABHA 1BYBA 2V68A 3B97A 1OB0A 1H5YA 5FAGA 2IKHA 1KRBC 3WQ4A 2Z1SA 4BFAA 1LUCA 2BZNA 3WJZA 5AHIA 3GR7A 2A0NA 4NVTA 1CLXA 1NVMA 3T2PA 3QSRA 2OGJA 3GW0A 3SEPA 3BMXA 4EVZA 4HNCA 5BYWA 4DO5A 4WGHA 5D9PA 1VJSA 8A3HA 3LHTA 4H9XA 1V7AA 1VQTA 1RR2A 1JVNA 1IQ8A 4EWJA 5K4XA 1PYMA 1L6YA 2JALA 3CO8A 3GIPA 5BXPA 3EBVA 2JGYA 4Y9OA 3KLLA 1XLLA 2GVGA 2V3DA 1T5AA 3MDUA 4NJGA 3TYDA 5E5CA 4WXYA 1FQ0A 1PKMA 4EF9A 2NQJA 3ITGA 3ZT7A 2GJLA 1ZBWA 1UZ4A 4HHPA 3R0UA 1V0NA 1MDRA 4JNZA 2V3GA 4PTNA 2QR6A 4MADA 1V6WA 1XIDA 4O52A 1H1YA 5CQ1A 1K8ZA 3KL0A 1M7XA 4S23A 5H91A 4MYXA 1SMAA 1B5TA 1LORA 1XIBA 4Y9AA 3KL5A 4IM4A 5CSSA 3L4XA 4D72A 2WSRA 1V6VA 3UR8A 3W72A 4W84A 4JTFA 5CKSA 3WFLA 4K7YA 1E15A 4F66A 5G4WA 3HM7A 3SQSA 4JQ2A 2B31A 2IPFA 2QW5A 1WO2A 3WEOA 3XINA 1QI4A 4HGXA 3KZSA 1Q45A 4C6OA 5T9BG 4O15A 4XAPA 5A2CA 4PMOA 2DGAA 4CCDA 5HNTA 3MMDA 1W8SA 4XIMA 4C6DA 1SU5A 4LS1A 3RYSA 4GG9A 3BMWA 3PSVA 3MMWA 4MWAA 4AVFA 3N6JA 4IQLA 1W56A 3GLCA 3EWBX 4UUIA 3AXKA 2YL6A 1TUXA 4HK5A 3MI6A 4GUIA 1W6TA 1YXDA 3LXBA 4NZ5A 1D7KA 3WNLA 1TVNA 1JUKA 2NZLA 1RPKA 3UESA 3CHVA 2X1RA 4GUHA 4JTUA 1R3TA 3L4TA 5HQLA 1YQ2A 2G0WA 1N82A 3CQIA 5HNNA 2ZFAA 4E5TA 3IIXA 3MUAA 4FIQA 2ISDA 3IJ9A 1AJZA 3POHA 4J3SA 2CLPA 4JTKA 1FVPA 1HFBA 3C3NA 4IP5A 4ILSA 3N18A 1O5RA 3GC5A 3TZFA 1EIBA 4IX2A 1N8WA 3B40A 1K70A 1NDZA 2OVLA 4AHOA 5D2WA 2WNZA 4PB5A 4AD4A 4Z1DA 5EBUA 2AAMA 1KO0A 4FR6A 1XLIA 1B31A 1TJPA 1GYNA 3UY8A 2I7GA 1S2UA 2CLIA 1UHVA 1VFFA 2Y85A 3KOZA 4KKXA 4QHRA 4MUPA 1EJVC 2R1PA 3NZPA 4ZEPA 1LT7A 5GQBA 2J47A 3HTWA 3RGTA 2PPGA 2HBXA 2P0IA 3V4BA 4YCPA 2CBIA 3RG6A 1Z89A 4BQ2A 1I1WA 3H22A 3SR7A 2VWSA 2JKEA 4LEFA 5FESA 2CZDA 2V5CA 2HE5A 3GNPA 1JQXA 1E1CB 1B0IA 3VOFA 3W28A 1I2OA 4ZA0A 4PMXA 4OOUA 3SGGA 1UWAA 4C5ZA 3EKLA 3OIXA 2HK1A 5C7VA 2Y1HA 3TH6A 3G0SA 1LWHA 2KZHA 3DBNA 1TSIA 3WLIA 4GJIA 4KWOA 3TR9A 3YPIA 1TPEA 7TIMA 2H9AB 2PB1A 4U3CA 3CT2A 3RU6A 2ZX8A 1T8QA 5FACA 2OKOA 3IK4A 2H8XA 1TO3A 5ABFA 3S2MA 5CSUA 2GVLA 1HKIA 1US2A 1E3XA 2D2OA 4WDUA 2VVNA 3SGUA 2PGFA 4ZVJA 3WQEA 4GYJA 4PFMA 3CM4A 3RJYA 4NJJA 3VK5A 2D0GA 3ZVHA 1TUFA 4NF7A 2GK1B 1JPKA 3LPOA 3R0DA 4Q7IA 1LUCB 4R9XA 3SUVA 3APYA 5FL0A 4BZYA 5HQMA 1W5PA 1NAL1 4BWLA 3LMYA 1OCNA 4S3EA 2CFFA 2DDXA 5DX7A 2PCEA 1FA2A 3PUGA 4MHBA 5BU9A 1R7AA 2O7SA 2BNJA 3IJQA 5IXEA 4WOQA 4ZQRA 4ZE5A 1A0DA 4H8UA 2WWDA 2XIBA 3MUXA 3M7SA 2GOUA 4S2CA 4DBSA 4O0KA 1IXPA 4IMFA 3EOUA 3CZJA 2OSYA 4AWUA 4BS0A 4NZ1A 3INPA 5B7YA 3K2GA 2PD9A 4NYYA 4E4UA 1PXGA 4W8LA 2DT1A 1JZ7A 3WUEA 4WSJA 3ZOAA 3URNA 3I6TA 4I9TA 2VC6A 4U5IA 2PLKA 1Y5WA 4DZ5A 4Q8UA 2OB3A 1RD6A 3BW3A 1G7VA 1M5WA 3M4HA 3GKAA 1BKSA 2DZSA 1S5NA 3E0FA 4XVDA 1F3XA 4WDXA 3OOQA 1H3GA 2G4FA 3VNJA 1VPQA 1OZMA 2NXHA 4JTRA 5DXYA 3BANA 1X6NA 2C7FA 3AS3A 1UW9A 4KETA 3L66A 1Q66A 1JCJA 2HZGA 4WLCA 3DYOA 3ICJA 3VZXA 2FHBA 1TV8A 3N2CA 2X1SA 1RJRA 3UJRA 4FXFA 3W7EA 3STEA 1MRAA 3W1MA 1UUMA 4U28A 5FCZA 1HVXA 1EGVA 4DI8A 3EX2A 4DWSB 1KWGA 1Q6DA 2YDSA 1XL9A 3AXHA 5CAHA 3AMLA 1TTJA 3OYZA 1GOWA 2PWEA 4GKTA 4U3AA 3WBEA 3U6WA 4X22A 1CCWB 5D9OA 3UQNA 5JUVA 1NIUA 2PWHA 5FEZA 3BSMA 3UZYA 3FA4A 1A5LC 2OO0A 1EYWA 2ACRA 3DN5A 3WDPP 4HU4A 5HMSA 4IL2A 1XPGA 4O50A 2GDUA 4PSPA 1EKOA 4QIUA 4NKCA 2PGWA 1E0TA 4IP7A 4G2DA 1BD0A 2WQDA 3G2GA 1QVBA 5F2GA 2GVEA 1QBBA 3E12A 3MVIA 3OBKA 4C6IA 3TNBA 2NXGA 2DUZA 1Z8AA 3GU2A 2AGTA 2OFJA 5BRQA 2RHGA 1OIFA 7TAAA 2FKPA 2IPWA 4O1FA 5GVJA 1K9TA 2EKGA 3B3DA 1G5AA 3THQA 3WQ5A 3H8AA 5G2WA 1K77A 2W91A 1T0OA 2BHZA 1AQ0A 4EWND 4XAZA 3F5JA 1TWSA 1IZJA 4W86A 2PWGA 1AODA 3POCA 3U4AA 4Z2HA 1YTEA 4LBSA 1DVJA 3MCNA 3R43A 1MNSA 2NWSA 3NFUA 1VAHA 1GVOA 1TG7A 1VRXA 4GC3A 3E5BA 3K1GA 3L5MA 4N9DA 2HXTA 4L4MA 1ZENA 2JEQA 4F2BA 2P5NA 4NZJA 1EX1A 3B8VA 1KCKA 3AHXA 3GHSA 4HA0A 3T8LA 1KCLA 2OZ0A 2OEJA 2OZTA 2PEVA 4JBRA 5I3HA 1BGGA 2QDDA 1VJIA 3B0PA 1EH9A 3GBEA 4JN6A 4ZQCA 1K7EA 4O14A 3W0KA 5B80A 1EDGA 3VINA 2PTDA 3FGCA 2B7NA 3QFWA 2RDTA 5AFDA 1P1MA 3M0IA 2WB5A 4M29A 4DWSD 2PDNA 1BLIA 5E0FA 3A47A 3BWWA 2CLKA 3B0YA 2H6RA 4Q33A 3N4AA 2E7FA 6A3HA 1T7LA 4XKYA 3PVFA 3IIZA 3H23A 2QIWA 1UQYA 3SN0A 3URQA 3LD5A 2YKKA 4HMNA 3VA8A 4E3TA 4B9YA 1T40A 2VMFA 4TVUA 5D2TA 1DWAM 2ANUA 2HRWA 4KFNA 3VNDA 3HPXA 4ACYA 1RAKA 2AQOA 3QMTA 4A35A 4S38A 3WCZA 3EWCA 1WA3A 3V3WA 1RA0A 1W3LA 3KTCA 3S83A 1TWIA 1S39A 1FWSA 4IPPA 1XPYA 3WO8A 1VIWA 4R53A 4EXBA 2YBVA 3VABA 3WH6A 4IPLA 5M5DA 4L4PA 2Y61A 4NX0A 1CW2A 3BQ5A 3LQGA 3VD5A 4NP7A 1V3JA 5T26A 5F4SA 2FZNA 3RR4A 2PDMA 2TMDA 1Z6KA 2Y0FA 5ABFB 3UWWA 4Q4KA 3EMZA 4QX4A 2A21A 3MV11 1J9YA 1OEPA 3TC3A 1L2UA 2EG7A 2JKPA 3S2LA 1W54A 4XIAA 5F4WA 3TW7A 3R94A 2WBGA 3CWOX 4ZODA 2OEMA 1G7UA 2QCGA 3VX1A 3TV8A 3FVMA 2XWDA 3V1HA 2ZBTA 4B90A 3LTYA 1FCUA 2CEQA 1A5CA 1YPIA 3CUXA 2XM2A 4E0CA 3TU9A 3RPTA 2YA2A 3LM7A 4IFOA 2OQLA 4JFVA 1TIMA 3HG3A 3S8HA 1SZGA 3IANA 3QOMA 3VILA 5HATA 1IEWA 2Z29A 3P93A 1EQCA 3UVAA 3W7KA 1RBOB 4O53A 4QE5A 4QJ5B 3WF2A 3EB2A 1LF1A 2VVSA 3LBMA 3SCQA 3QQ0A 2P50A 4LUYA 3VD9A 4DF2A 4XZIA 3ZMRA 3HFTA 3W7QA 4YTQA 3F2DA 5CZKA 1JCLA 4NILA 2WMJA 1FXPA 5BOOA 3SZ8A 3R13A 4LV9A 3W1PA 4CD8A 4YTSA 4H4IA 1JFHA 3LQLA 3OP2A 3PM6A 5AVHA 4IH3A 4RXGA 4GUGA 4YMZA 1JCNA 2BVWA 1OT2A 1WV2A 3VIKA 3VDAA 3PZ9A 3LXCA 3SUSA 2V38A 1UKTA 3TK7A 1LROA 1H49A 3KVJA 5EFDA 3VNKA 3BXWA 3GBDA 2NV2A 4MJ4A 1PWLA 1SM9A 3W1RA 4F40A 5DELA 1VENA 3SCWA 4W7VA 4ZOEA 3TCSA 3LHZA 4CQDA 5XIAA 3CIXA 5D30A 1PL9A 2PRMA 3W84A 3MUZ1 2YW3A 4CD6A 3QC0A 5D38A 4WQ6A 3CL8A 3KWSA 4RR4A 3NDOA 5H6HA 1GQKA 2I16A 2BB0A 2BY0A 1A5BA 1KCXA 3WX7A 1THFD 1EEXA 4V1YA 3CEUA 3MCMA 2JK2A 3A24A 4HPGA 3WK1A 2DQWA 1GEQA 3NQEA 3IV3A 3GU1A 3TN3A 1QNPA 4H6QA 1UC5A 3DOPA 4H83A 3W23A 4QM1A 3BG3A 5AYYA 2FZ8A 2RJHA 1XYBA 2YDQA 2PDQA 3ENLA 4B4HA 2QF8A 2YFOA 3MPGA 4OT7A 1UH4A 3BJSA 4IIEA 3FKKA 3VNLA 2YXXA 1E1CA 1YE6A 1LM1A 4AX7A 5EU9A 4KT2A 3UWZA 1KBKA 4GZEA 3QW4B 5TF0A 3SQLA 1IV8A 4HYRA 1DHPA 4QISA 2CETA 2I1OA 2J4GA 3F4CA 5C6MA 2D2GA 2VCBA 2MNRA 4XZBA 4Y9MA 2E5CA 2B81A 2DZUA 1OINA 2IKGA 3AHZA 1UUOA 4AEOA 3I7RA 1C9WA 1YADA 4FB7A 2CCRA 4I3GA 1S1PA 3OLGA 4ZO6A 3QH2A 1Z3NA 1EHNA 1LBMA 2QCNA 4D6GA 3PNUA 1RK5A 2GUBA 3RLVA 4DBWA 4E2VA 1QJWA 5HANA 4C1LA 4H2CA 4A3YA 3W88A 4HIBA 1EBGA 3ABXA 4YU1A 4C1NB 4DJDC 4IXXA 3S5NA 1O5KA 4UTTC 3LRKA 4C1KA 3TJIA 3C2YA 3M47A 4HU3A 4O12A 2CBJA 4O4WA 4JIQA 1KGUA 1ZL1A 2EO7A 1JNDA 2ZQ0A 3GYCA 3M07A 2HPIA 5CLTA 3OVPA 3WD0A 4M6PA 2CERA 3GG0A 3SJNA 3DBPA 3GXTA 2DSKA 3ES8A 1JZ6A 5JU6A 3ERPA 4DPQA 2WHKA 3SFKA 1WUEA 3DCPA 2Q8ZA 4RKAA 2EEXA 1DIKA 3GAKA 4WVXA 1N55A 2PMQA 1YNQA 1WDRA 1OWQA 1IGSA 1W1A1 3MUIA 1PKNA 1UH3A 1XICA 3OBAA 4TO8A 1DWIM 1KM1A 1WKYA 1CPUA 1HJVA 2QKFA 3G1VA 1QAPA 2NLIA 5MF5A 4HT3A 3NXLA 2Z00A 1J2WA 4L61A 5A6BA 3QN3A 2EPLX 3IVUA 3PBGA 3W7OA 5IHSA 3PBYA 1M65A 3WUFA 1XIHA 1P5BA 1CI1A 4IMCA 2A4AA 2ZTKA 2QJHA 4BK9A 4JTSA 3WLRA 4LWWA 2WKLA 1VBGA 1VYRA 1P0NA 3KXQA 1RK6A 1KWKA 1RVKA 2BLEA 2E25A 3CNYA 4MPQA 5HAOA 3QV6A 2P88A 5DCBA 3D5HA 1WUFA 4OV9A 1XKJA 3N3TA 3IGXA 5IRPA 3B8DA 3M43A 3PN8A 4YXGA 3WQGA 4EXQA 4QJ4B 1UA3A 3N13A 4IPJA 4MY9A 2BY3A 4W89A 2RFGA 4A3RA 1PZ3A 4F0RA 2QXWA 3UG3A 1S5WA 3G1DA 2Z2AA 1VEMA 2LLEA 2X0SA 3TTQA 2INEA 4ZXOA 3ABOA 3IWPA 1ELSA 1V3HA 3SM0A 1LLWA 3APTA 4GIRA 3CAKA 1A80A 2JQXA 3VOIA 5CBBA 4Q8MA 4WY0F 4HNLA 1CX9A 1BG9A 3TLLA 4DJEA 1UC4A 3SW6A 1XXXA 3GXNA 5A95A 2DJXA 2E6AA 4OFCA 1Q7ZA 3DIPA 3OB8A 5FIPA 2WVVB 2Z1WA 4UFJA 4NU7A 3DU0A 5AKQA 2BGQA 5CPOA 3P2VA 3T2OA 3QGVA 4LCSA 3BLFA 2V0TA 5ABGA 1Q63A 4XD3A 2HDJA 4H3DA 3WQCA 3W7DA 3H4WA 4ERGA 4X9YA 4QAWA 3P5ZA 2VZTA 4HHHA 3VNZA 2XZ7A 3CL6A 2CHRA 2VEIA 3ABRA 1Q8JA 3AQUA 3KOWA 3MHFA 4JQ1A 1JF6A 2R1LA 1WDWA 3ZJ8A 3U0HA 4DEFA 2QCHA 1CB2A 1YDYA 5AHEA 2DJLA 1OX5A 4L65A 3M7WA 1UBSA 2X1UA 2PP1A 4RK8A 1NFPA 3VGFA 1R3WA 2I14A 3GM8A 4IX0A 3RMJA 4CN6A 3A3XA 1FWWA 3G1AA 1YIXA 2O56A 2IXUA 1XLEA 1D8WA 1DOSA 1LQ2A 1E9YB 3KZPA 1AUSL 1Q7QA 4UQCA 4XZWA 1M03A 3W01A 2WM0A 3UFYA 3ORWA 2ACSA 1H7PA 4WDTA 1AD4A 1W1YA 1DTUA 3NQ2A 4HOZA 3TP4A 1W1PA 3GVGA 3W27A 1Q2RA 1GQLA 3B0XA 4F0HA 2VWTA 3UR7A 4S3FA 2DU2A 4C6KA 3R1ZA 4FLSA 4GIEA 2EPKX 3IJ8A 3L4YA 1PTDA 3QR0A 2QVNA 2F2KA 1O94A 1UR9A 4JTQA 3P74A 3WBWA 2YBUA 4EF8A 9XIMA 2Z1XA 1KLZA 2NV1A 3WLSA 3P82A 1EPVA 3B4YA 4X0VA 3AAMA 5K4ZA 4O18A 1E3ZA 3O63A 2E9LA 4RNHA 4Y6GA 2I57A 5DY2A 2YXGA 5C5YA 3AIEA 4AX6A 2PDPA 4F0KA 4FNQA 4YHGA 4NNBA 1AFSA 2YCEA 2VRQA 1VFHA 1S2CA 3GNRA 3QR1A 1TIWA 3W75A 4I6VA 1GG0A 4Q3MA 3R58A 4LYQA 4CUCA 1E0VA 2QCFA 3FHQA 1MW3A 2XVGA 4UQDA 3O8AA 3SCPA 1A3XA 1UD8A 3W7CA 2TRSA 5CGMA 2VNCA 3ZYZA 3LG3A 3BW4A 3VYLA 1DIDA 4ICCX 1QI5A 5D33A 3TJXA 3EMCA 1XCFA 4E6MA 4ORIA 4L80A 3GUWA 2XFFA 4LB3A 5FEXA 2J6XA 1QR7A 2O4MA 3KCJA 4HPNA 1B4EA 4IMEA 1J5TA 3NO1A 2A7RA 1IGWA 4TR9A 5D32A 2AAAA 4FNTA 3UVIA 3TA9A 3NQGA 1HKWA 4AD0A 2YFNA 3QMSA 1LDCA 3O6DA 3DX5A 1UUQA 9XIAA 1LRQA 4O8AA 4AVNA 1I8JA 4UMBA 1XUZA 4GHRA 3TQPA 2XGIA 4GQRA 2FLIA 5AY7A 4I9MA 2Z27A 1CGVA 1M7JA 2BG5A 2ZRYA 2GQ8A 4LB4A 1Z69A 5T9CE 4LS2A 3G1RA 4H7ZA 1KGXA 3VD3A 4QLJA 3FJLA 1J2BA 4Y9PA 4BA0A 3EKZA 1XM3A 4QP0A 4PBFA 8XIAA 2VR4A 4LF1A 1H11A 1J0ZA 3NWRA 2IQ0A 4P7OA 4KIRA 3E0VA 3H2NA 4OWGA 3I6EA 3WFAA 3IIPA 1VBRA 4J4KA 3LCHA 1WXYA 1NH6A 4DELA 4A8LA 4ZFMA 1OFDA 1GVQA 3I68A 1S5TA 2G4JA 1QNOA 3CHFA 3QBUA 4WK9A 1XLBA 4UTLA 5IDZA 3G0XA 1B3WA 3H21A 2OU4A 2FZDA 4UFLA 3QSTA 1Q65A 4O57A 3VGHA 1RH9A 1QPKA 1I6NA 3NVTA 1SFSA 5D9MA 1AQFA 5A8NA 3VCCA 4I7UA 1FHVA 4G7FA 4QSFA 4OKDA 2WNNA 1ZPTA 3AALA 1JULA 3HBLA 4JGDA 3R4IA 4LC6A 1FRBA 4DJFA 1V6XA 3M5VA 1ZUAX 3Q67A 3PHAA 3GH5A 1SJAA 1P0BA 2VQTA 4AQLA 4KCWA 4GVIA 1WKFA 3B9DA 3DHFA 4C5YA 2XH4A 3HZ3A 3QY7A 1NSJA 3FJNA 3HIJA 3EA3A 2JE8A 3QOKA 3THUA 1ESWA 1VZWA 3NZ1A 4AHQA 2YGYA 3CLWA 1BPLB 2E68A 1P0EA 3IVTA 1Q6OA 5IHRA 1G4EA 1RLCL 4ZTXA 3PBUA 3QHMA 1BXCA 3DERA 3SY5A 4IXHA 2QNEA 3RUBL 4FLQA 4H9UA 5CPMA 4DVOA 1HKKA 3PPCA 1MMFA 1JJKA 4PCTA 3W7IA 1T41A 3MP4A 1EGZA 1QW8A 5FJRA 2OLHA 1W9UA 2CLEA 1BF2A 1L6FA 3SRDA 4FLRA 2XIOA 4H04A 2CHOA 1EUNA 5AVNA 1E0UA 1D7FA 3TONA 2FMNA 5I3DA 2WVVA 3CWHA 1GVEA 3LOTA 3NIYA 3QKZA 4BI5A 1OHLA 1F4HA 2W61A 3KS5A 2WZTA 1WKDA 4HK6A 5CC3A 1QU4A 4AD3A 1Y5XA 4W8BA 4MB3A 4LX4A 4NSBA 3VPLA 1JEZA 4GNKB 2WZEA 4J5NA 3HMJG 2WZIA 5MKGA 2OSXA 1RQBA 3O6AA 3T6CA 4IG2A 5GNYA 4H41A 4M56A 4GWEA 1Q6CA 3S6TA 3VIGA 2XHYA 5DMMA 3HOJA 4J28A 3WLKX 3E2RA 3CPRA 3R12A 4D71A 3VDBA 4U2ZA 1R3QA 2FFCA 3LCGA 3NPUA 5LHFA 2CU0A 2VFGA 5DEZA 4CQBA 3FXGA 2QPSA 5DMLA 3F2BA 3UNTA 1H1ZA 1P6WA 5CJNA 1TVLA 5C7HA 2IKJA 4LH8A 2PD5A 1UA7A 4QCFA 4ZL1A 5I03A 2V69A 2VFEA 1JGIA 2Z25A 5SWUA 3CLMA 3ZJKA 2VRJA 6ENLA 4NNAA 2AMGA 3UCCA 1H1NA 3IRSA 1DQXA 2GJRA 3WK3A 3WQFA 3BCFA 1PUDA 1PYFA 1H7RA 4DWSC 5I78A 1GHRA 3U57A 1SO4A 2Z2BA 4WKHA 1BAGA 1E71M 3L0GA 4EANA 2C1HA 3UETA 2O9OA 3ZVIA 3UXAA 1XKYA 2OQYA 1KC7A 3PFMA 5L6UA 4D2JA 2J7EA 3A13A 3TZNA 1JPIA 2GUUA 3BAYA 2CZ5A 3NSXA 4MKNA 5D8WA 4OBRA 4GH3A 3QYSA 1PIIA 2B4GA 1TPWA 2V5JA 3BTNA 2QV4A 4TX6A 5KMYA 3ZS4A 3AS0A 2RH9A 4AZ6A 2P53A 3QPEA 4ZB2A 3O6CA 4OJYA 3SCSA 1KM5A 3NJ3A 2J79A 3WZ0E 4AYSA 2ZWYA 4YTRA 1GKQA 3E6EA 2ZOXA 1S2WA 3HPAA 4XB3A 1VGAA 4WSKA 2OODA 4NXKA 3GIQA 2VENA 1HL2A 1PVNA 1MW1A 3A3WA 5A6LA 3GYEA 4B2DA 1DXEA 4Y96A 2FPTA 4QROA 1DJYA 3HJEA 3WDIA 3GG8A 3H26A 2WHMA 2XPKA 2NQLA 2Z24A 3WQOA 2XN0A 2IPGA 3NNTA 1SFTA 5JIPA 2PDXA 2ZZ5A 2GGGA 3CYJA 5KSWA 2P8BA 4L4OA 1R0MA 2V3EA 4DWSA 3TTYA 2IW0A 2QAFA 3BPWA 1YMYA 5KZEA 4AWTA 4JNYA 2OWCA 1UR8A 3N2MA 4NX5A 1H7WA 2WAGA 3ZLFA 3VIFA 1OD0A 4JHOA 4NZFA 4AZHA 5E93A 1HG3A 4UC5A 4INFA 3L67A 3RO6A 3VC5A 4ICNA 4DWDA 3NZGA 3OZPA 2HISA 4UXDA 4YLWA 2P10A 2E40A 3TTSA 1ZU8A 1RXOB 2XN2A 3F1QA 3BLKA 1E6ZA 1F61A 1R5YA 2VTFA 2HPMA 2YDAA 3PNZA 1QOQA 4LAUA 1LT8A 2D24A 2DUAA 3IPWA 2OGYA 5F2IA 1XGZA 3VKDA 4H01A 4J2PA 1IWAA 3B0UX 4UTWC 1R30A 2ZDRA 2R9RA 4QQUA 4PUJA 4KW2A 4L9YA 3KP0A 1AW1A 1TFVA 2NXIA 3HV9A 4LY8A 2J75A 1CDGA 4IFKA 1JUBA 4LCQA 1EOMA 2QHAA 2R94A 3WSUA 1XYZA 4XBKA 3EWXA 3HQ1A 3U48A 1V5XA 3L2LA 4FS9A 3NQMA 4XUGA 1XLKA 4M0XA 2FGLA 5JBEA 2QPXA 3GDRA 4LEQA 1BGAA 4I9AA 2YCIX 3AU2A 4KPLA 4J3XA 3OGRA 2DW7A 4JTDA 4N7QA 1JYWA 5EYWA 1OCBA 4QEEA 4AZCA 1JUEA 2ZZ1A 2E1DA 3OVGA 2CWXA 1IWPA 3UERA 3RHGA 1F74A 3RAOA 4MB4A 1OYAA 3FA5A 2PDKA 4EXAA 1BTMA 2NQZA 4K8HA 4GBUA 5T91A 1O60A 4WF7A 4FMVA 4D8ZA 4NRSA 2PDUA 4WY0A 4AZIA 1WE5A 5HNUA 4A3UA 4JEQA 4LV4A 1I9CB 1PS9A 4DYKA 1SO3A 5AZ0A 4DO4A 1GT8A 4GXPA 3GU9A 5GNZA 3RM8A 3WKZA 3MC5A 4RE4A 1J0KA 3EPMA 1XV8A 2OX4A 1BWVA 3DG6A 4XKMA 2EKCA 4UTKA 4GXWA 1DPMA 1X6LA 4BEQA 2WW5A 5A6SA 1PDYA 2WCGA 3F5KA 2TAAA 2GVJA 3R89A 1XH0A 3LHYA 4ACZB 4UR9A 4HHLA 1IEIA 3RLUA 3WQ6A 3MW7A 2UY3A 3ES7A 3UU0A 4JHMA 5I09A 1GYLA 1H41A 2WC3A 3QV9A 2CESA 1BQCA 4Z0SA 3CK5A 4MVAA 1YPFA 3RN6A 5FJPA 2EPNA 3IJDA 2XDFA 4IWWA 3ITXA 1B90A 1ZJIA 1KBLA 3GE7A 2Z7GA 4P7LA 1DIOA 1EP2A 4ONVA 4PBEA 4RPQA 1KKRA 2ATSA 2BVDA 2W5FA 3W1TA 3UPMA 4N2YA 3DHPA 3WUGA 4J9JA 4KH2A 4DAFA 2DZWA 3PJUA 4HU8A 1XRVA 4XZLX 3I3BA 4PE8A 2A3CA 3N2XA 3CUIA 3BGGA 3XIMA 4ATLA 5LIWX 1NQ6A 1AW5A 1TQXA 1XJBA 5M3WA 1C29A 4KEUA 1JRCA 7REQB 1BG4A 4Z0JA 4JTCA 4AEEA 4TIMA 1RCQA 2D20A 2QUVA 3ZT5A 1DEDA 3NGFA 5I06A 3WMSA 2RAGA 3L4ZA 4GQ0A 3A5VA 5I5RA 5HWMA 3KDNA 2XGBA 4NAFB 5AC4A 1FBAA 2ZX7A 2PDWA 3A4JA 1IR2A 4XAGA 5HA7A 5AB3A 4S3CA 3MQTA 3BV7A 4A29A 3LU2A 4IIFA 3Q94A 4AZ5A 3OLEA 1US3A 3TXZA 3GY1A 4Z42C 4KBXA 2F61A 3LA4A 2YJQA 4YVXA 4UFKA 2Y8UA 3ABZA 2QGYA 4P8XA 2YLAA 2XUCA 1LZOA 4Q4OA 4ES4A 1DJHA 1GOQA 2Y70A 4JN7A 1WDSA 3BC9A 3EKGA 3RU8X 3QY8A 1F73A 3NAVA 1KR1A 3L2MA 2HSAA 3SAZA 4FNRA 3P5YA 4ZBCA 3R7MA 5DQPA 2I5GA 3RR1A 4ZTYA 3IGUA 1XG3A 1HP4A 2UY4A 1CTNA 3VE9A 1XLHA 3MJYA 4JCLA 3L5LA 3PP7A 2G3JA 5EMLA 4JQ4A 4NZCA 4O19A 4EPBC 1FCVA 3NG3A 2J7HA 5D04C 4B5UA 4JNMA 1B3VA 5K3VA 3A3HA 4O54A 4CN1A 4MWAC 3KBVA 1S46A 3QQ1A 3G8EA 1OG0A 4A22A 2C0HA 2VEKA 4UQAA 3GVQA 2V2DA 2X09A 1GW9A 2XSXA 4LUSA 2HQAA 1XBVA 1KLYA 1QCWA 3BGJA 7ODCA 1KXQA 1KR0A 3O16A 5DF0A 1E9LA 3I7QA 3M1ZA 4KERA 2VYOA 4LCRA 3OGSA 2PZ0A 4GX9A 5A6BD 3NEHA 5LXEA 3DFQA 4HTYA 2V5DA 4JTGA 1CGYA 3BOLA 3GKFA 1EJUC 3E2QA 3VIOA 6TAAA 2D22A 2BXVA 4LALA 2FVMA 1J79A 5EMKA 4CD7A 3RNDA 1K8CA 1PO9A 2J25A 4AZBA 1G67A 2WSYA 2Y63A 3PG8A 1B3XA 3QMRA 1X7FA 1E6RA 3KWXA 3IJIA 1G6CA 2RDUA 5AOUA 4XTIA 3UZ5A 1EJXC 1KM6A 4JTEA 3PFRA 2QJIA 3M0MA 4HB7A 4L6DA 2PDGA 1D9EA 1IIHA 2FGZA 1GJWA 4FNUA 3A23A 6XIMA 3N14A 4CNTA 1UP2A 4G1NA 3CV1A 3D3FA 1DHKA 1HW6A 3W2NA 3WK2A 1WXJA 3NQAA 4XG1A 2DZBA 4QDWA 5XINA 2OO6A 3VD4A 3GFZA 5CH9A 4EPDC 4LAKA 4GK8A 5LKYA 3S9IA 5I3GA 3SCOA 5A69A 1PBGA 5BMWA 3ZWTA 3U4FA 3UZJA 2XM1A 3FSTA 1JDEA 2A3EA 1XGEA 4HJWA 1A5KC 3W1XA 1CXHA 1TJRA 1QI3A 3DH7A 1SFJA 1FKWA 3K46A 2WPBA 1E51A 4QXIA 2WMKA 2C91A 2BASA 4X2RA 3P8JA 3GX9A 3CWNA 1WZAA 2DZPA 3CJPA 1G9HA 5F1VA 5D09A 1LL4A 1YBQB 2Z2UA 2DORA 1W1IE 2JBMA 3TYUA 1LWIA 1R7OA 1F4AA 3WD4A 4M24A 3GFXA 2D69A 3N3MA 2BFGA 1ADSA 3BSGA 3LSCA 1BSIA 4ML9A 2PTYA 3O9NA 1FHLA 4QCEA 2X7VA 2G3IA 3DC0A 1QPQA 5D2VA 3W86A 3CH9A 3UJEA 4KRUA 1OFEA 1XRSA 4AZGA 4IQEA 4PCSA 5LA2A 2INFA 1YDNA 4PB3A 1W2VA 3CH0A 1UOKA 3KTXA 1UD5A 1AL8A 3AIQA 1XUUA 3GTIA 1F3WA 1TPH1 3TMQA 3PUDA 4DRSA 1XRTA 4H8VA 4C60A 4QITA 1RVGA 1X1NA 2PC8A 1MQRA 4K6AA 4XQ6A 2Q09A 4K38A 1VPYA 1TWWA 4Q6XA 5DY3A 5LGZA 2JIWA 1Y8BA 5LYRA 4HQVA 1RD5A 1JZ5A 1B3ZA 1QHPA 3I6RA 3K8KA 4MZ1A 3CT7A 1NEYA 4GNVA 4AIOA 1KW1A 3EB4A 3ATYA 4XUYA 3T40A 2UBPC 5J04A 3LGDA 3EAUA 3MZNA 4W7WA 3NOYA 3MWCA 3WDRA 1P4CA 5L9FA 3NQCA 2QCEA 4UNKA 3LPPA 3PZNA 2OOGA 3K13A 5FF3A 4DB7A 1DXIA 1HO1A 2VX5A 1TREA 4IF2A 2QUTA 2UWFA 3AS2A 3O07A 1BYCA 1TPFA 4GI4A 3QTPA 3V0UA 2RJGA 4N42A 5I3KA 1WDDA 2YL8A 1QOXA 2YLLA 3K8LA 3P0WA 4WDWA 3Q2DA 3JZUA 4XVEA 3M64A 3F7JA 4P8UA 4LUTA 1EC9A 4L5ZA 2YB1A 3G1YA 2GSHA 2H3BA 1VC4A 3QLDA 1ONWA 4JTAA 5BRPA 4K8EA 3N2OA 1MFVA 1QK0A 1TR9A 3H53A 4F0SA 4RZ5A 1HKJA 2Z7KA 2Z1BA 4L4LA 2XISA 1DBTA 2C79A 3AISA 1E1EA 3TYEA 3MSDA 1LRTA 2VKZG 4PUUA 2ABBA 4QRNA 4J1OA 1SR9A 3M5YA 3NL2A 3L9CA 1BVWA 3S5YA 2WKJA 2X05A 1V51A 1QOPA 1VJZA 1UZ1A 3TFCA 1N7KA 3MKKA 1DWHM 3VGEA 4JYEA 3DFHA 1REQB 3GDLA 3WNKA 3TIMA 2AQVA 1JYXA 1AK5A 1FP9A 1MZHA 2O9PA 3LCFA 3ZR6A 2ZDSA 1FWGC 1GJUA 2AKMA 1DORA 3T55A 4Q8OA 3WL0A 1RZMA 2DW6A 3NQFA 1UROA 3VOJA 2X2GA 2A3AA 3T08A 3BQ6A 3W9ZA 4JICA 4V1XA 5U4NA 5BZAA 1XR2A 2V5KA 3RCYA 3GC4A 2DZTA 2O9RA 3N29A 3SJ3A 3SBFA 3UG5A 3WEZA 5E1QA 3HPSA 4BF7A 3SADA 1HGWA 1JF5A 3CMGA 5A6AA 2WMGA 4HZ6A 3BSHA 3HJZA 2PDHA 1W91A 5C71A 1FH7A 1KFBA 1AL7A 2ZUTA 3WF4A 1Q3NA 3LV5A 4RW3A 4HNOA 3OHIA 4E2OA 1UWRA 3PWIA 1N2VA 2WC4A 1UCWA 4OECA 3V5FA 3VOHA 3RLGA 4GYKA 3MI2A 3H4GA 3NXFA 1AZ2A 5F2MA 5FJJA 3FDGA 4LF2A 4MMWA 3H7RA 2C15A 4OE7A 1A5OC 4DF1A 2OQHA 2O92A 2P0OA 4W9TA 4HBKA 2V30A 4RZ6A 3BDKA 3ZVHB 4K68A 3ITYA 2VZVA 4ATDA 2BX7A 2ZA1A 3W2JA 3MSRA 2VRKA 3NSMA 1XFCA 5I3IA 3B8WA 4GOAA 1W9BM 5HMDA 4EK7A 1VFMA 1I2RA 2PSNA 2O4QA 4PCPA 1RCOB 5D4YA 4DLMA 3GZAA 1XDLA 3PJTA 3UWYA 5FSEC 2QMKA 3RM4A 1H0IA 4ZOBA 2YXOA 3G8RA 5AZ1A 5A2AA 1VRDA 1PZ1A 2XH2A 1NDYA 2I5IA 4J35A 5TBOA 2VD8A 2R1NA 4WR3A 3UJFA 3V36A 3W74A 3PK7A 1SJDA 3N12A 4GRSA 4W88A 3DC8A 4GFIA 2JEPA 4S3BA 2XU2A 5A8PA 1JZ4A 3NDYA 1JG9A 4GJ1A 4KFOA 4A3QA 1S1RA 1OBAA 4DBEA 3A22A 1VCFA 4HYVA 4AC1X 4DXVA 3DFOA 2QUUA 1KV8A 2C71A 4DI9A 4OUIA 4GBDA 4GA8A 2W92A 3FYYA 1YPXA 5CBJA 1UPPA 3F4VA 1K9DA 1GQJA 1QATA 4Y2WA 4HOXA 3LTSA 2Q02A 2I17A 4YIWA 3STGA 4NG3A 4ECLA 3EOOA 4G6CA 4R85A 5JBDA 2X41A 3FAWA 3P81A 4BJHA 3C2VA 1MWOA 3LZ3A 3FW6A 4B2DD 1H62A 3N9KA 3FHAA 1V03A 4CQAA 3TE9A 1SSDA 3TJLA 5CJMA 2PDBA 4UCFA 3G18A 4WGXA 3WF1A 2PWUA 2PCQA 4GMEA 1DWJM 1EA9C 1GVRA 4HP5A 1TPDA 2QCMA 1AJ0A 3U3HA 3MHUA 3WLNA 4LYRA 1MNZA 1PWMA 2R14A 4HSHA 1UIPA 3I3DA 4H00A 4BWLC 5GNXA 1A4LA 2BBFA 2DY3A 1A53A 3MUCA 3NSNA 4RE3A 3NCOA 1XHGA 3PZTA 1IEVA 3A9IA 4MZYA 5AHNA 3PPHA 1WKEA 3I65A 2J88A 2PDIA 3VOCA 3TYBA 3RRAA 1KBJA 2HE8A 1OM0A 1W5MA 2E6DA 4PMVA 3SN1A 3AMKA 3S9ZA 3M44A 1TZ7A 5M17A 5J5RA 4ATWA 1GOMA 1OSEA 4PZVA 1AD1A 3OZOA 4F3HA 2BGNE 4AMCA 1AMYA 1W5NA 1SZRA 3S6OA 5FKYA 3I4EA 1EA0A 5DLCA 1X1ZA 4FLOA 5I79A 3M6DA 1H50A 1RY8A 2NQ5A 6REQB 5H8PA 1TTPA 3SURA 4YJ5A 4DNHA 1Z32X 3BLLA 3QPYA 1KFWA 2WJZA 1RBLA 3UXLA 2AL2A 3WEMA 4LXFA 3E02A 1NF0A 3SN4A 4AZ7A 3W2LA 4UQ9A 3GIYA 2HNEA 3TR2A 1O6IA 1X38A 3RX2A 2OEKA 2PS2A 1A47A 1DJQA 1SYTA 1E70M 3BV4A 3QZAA 3UBPC 1CIUA 1QI0A 4GC4A 1AVAA 1EBHA 4ZZ9A 3RITA 3BW2A 1EO5A 2VFHA 1Y5VA 3PULA 5JXQA 2E67A 3G1SA 4DHGA 3WQWA 4B5WA 2EPMX 1OF8A 2YR1A 1CXKA 4LUIA 3ZFHA 1CXLA 3CL7A 3GNXA 3TTEA 3COTA 4L1WA 4LBUA 4MZ8A 1JAEA 2J62A 5LXXA 3VXGA 1F7BA 3VKAA 4DUVA 1G94A 2OPJA 3TYCA 3W1AA 4IJBA 2GWGA 1UR2A 4C7FA 4DUWA 3LBOA 1CGXA 4NASA 4ERIA 4A4AA 3VTRA 3ARTA 5C2GA 5G2IA 4FXSA 3S0CA 3W07A 2OZ8A 3NQ6A 4AH7A 1ALDA 4GYPA 3C0SA 1ZLPA 3UWUA 1O5QA 3EWYA 5HR7A 5KEZA 4HN4A 1J8VA 1W0MA 3O3RA 2NW0A 1PKYA 4AWEA 3URBA 3AYSA 2GQAA 1E6XM 4MAZA 4H1ZA 5AYBA 3D3AA 3LSBA 2VEGA 4MJMA 3VFCA 3CUFA 3UY7A 3E9AA 1FKXA 3QTGA 4QLLA 5DBTA 4PL2A 1DJGA 1MEHA 3LPFA 4E8GA 2VC5A 1M53A 3K4DA 2DSWA 3GD6A 3L4WA 4LUJA 3WMBA 4F0LA 1OGSA 1VIZA 4JTLA 4MLJA 1XI3A 2D0HA 3UD6A 1JZ3A 4JKKA 3IAQA 1FWNA 2WOQA 1QTWA 2V5LA 4US6A 3W22A 2Y5EA 4C6MA 4CQ8A 4H6KA 4DJDA 4P7QA 3T0TA 3M0JA 4FAMA 4C6JA 3U8GA 4HU0A 4YCOA 2C13A 4UOZA 2PE4A 1VBJA 5BU6A 3P60A 4H19A 4KWSA 1POKA 5CZJA 4YYCA 4C6CA 3A6OA 3QF0A 3B8TA 2H90A 4IPIA 1AQHA 4MWAE 1RQHA 3QQWA 4CCCA 3NQ7A 1XH1A 3NQBA 3WJXA 2XINA 4E38A 1QMLA 2F8QA 2RDXA 3KM8A 4GPNA 3WNMA 3VNIA 1WZLA 2DZAA 3THDA 4S3AA 2V81A 3ITLA 2NWRA 4JL1A 4MNMA 3OGVA 4AIBA 1SJCA 4PUWA 1EXPA 4U10A 3PBVA 1F2JA 3R8GA 2NLYA 3NQVA 4QDMA 5D8ZA 1CEOA 3A9BA 5CBIA 1V4YA 3ANYA 1KQYA 3AXMA 5EB8A 4UTJA 2Q01A 1UWTA 2G3FA 2VCAA 3W4RA 2XTKA 2XSAA 3MYOA 1F5ZA 5A5WA 4RZ4A 3V18A 4D8LA 4M81A 4ZQMA 1XGDA 1XLAA 2O0TA 2CIPA 4QE4A 1F6YA 2Y4SA 5FSDC 3B9NA 1NWSA 4MOZA 2XFRA 2DT3A 2J7CA 4HNVA 1E5JA 2R8WA 2WSQA 2AL2B 1B30A 2VD9A 1SO6A 3W76A 1Q6QA 4NXSA 3PZGA 4IQJA 2ZZ4A 1XG4A 2V82A 3JZEA 3IIOA 4UQBA 4HOWA 3CHEA 1GK8A 3NR0A 4QR6A 3QEZA 3DG7A 3VMPA 2EAWA 2VZUA 4WUIA 4Y8EA 3GAYA 4FOJA 4FF7A 4ZOAA 1L0PA 2Y8VA 2ZICA 3QM3A 4KCTA 4MDOA 2V2HA 4W8AA 4U33A 1UOZA 3OG3A 7ENLA 1IXOA 3VKCA 3ARZA 5LIYX 3AI0A 3W6MA 2C6QA 3W26A 3WQVA 4HMEA 1L8NA 1UB3A 3R11A 2DT2A 1E40A 1TCMA 3XISA 2VL4A 4L1XA 4LW7A 4ZOCA 3KBWA 3G3DA 4CQ9A 4IGMA 1GONA 1I2NA 7XIMA 1CBGA 1OX4A 1UP0A 4YWIA 4P8WA 3S1XA 3M6YA 5TIMA 1XISA 3W3OA 1ZAJA 3LLFA 4JHZA 1OFOA 2J7BA 1XS2A 4H2HA 4RX0A 2G97A 3R5EA 3VKBA 3W02A 4A8IA 3HGJA 3VAVA 4MB5A 5A1AA 5CEWA 1UIOA 1M3UA 4LAZA 3VZZA 3ZJ7A 4OBSA 3UGRA 5C55A 3OA5A 4H6EA 5C2CA 3KHDA 4S39A 5EA9A 4C6NA 4BF5A 4D6CA 4NI8A 1U5JA 3N4FA 4LT9A 3WY1A 3DKJA 2WQPA 2VDHA 4IT1A 2D23A 1O12A 4O1EA 4KGJA 3D47A 3GTHA 3W85A 3PB0A 1R47A 1FWRA 3C2EA 4UOQA 2IMRA 4AUBA 2W63A 1LG1A 1FY6A 3VM5A 5CJ5A 3QJAA 4E4FA 4PC8A 4B3LA 1VFOA 2C3ZA 1XC6A 3GDTA 1EP3A 1W1TA 1S38A 4EE9A 2GJXB 1X39A 2DH3A 1W3HA 1W31A 3QR3A 4GH1A 1WPCA 2D73A 1REQA 2L5HA 4KWVA 2SFPA 3ALGA 1P7TB 3M41A 1M9HA 3GHRA 5REQA 4ALDA 4U2YA 4WD0A 2Q3OA 4YS1A 4QGCA 3FX4A 5HDRA 1WBJA 1M7PA 1OFQA 1KXVA 1S5VA 4C7GA 2POZA 2CW6A 3VOGA 4N9EA 4OQVA 4Z1BA 3PANA 3GQYA 5D9NA 1OK4A 4LAMA 2ZX9A 1PSCA 3WUBA 2NT1A 1GPFA 1I4NA 3IUIA 3EDJA 3GG1A 1CXEA 1JPHA 2R1KA 1EC8A 2VR2A 4FO4A 4FIRA 3AZSA 1R86A 1ME8A 4D6IA 2OG9A 2V6AA 1VB9A 3MB9A 2PP3A 3SCRA 1E43A 3DZ1A 4JQ3A 4DUOA 2TSYA 3FA3A 4UB9A 1C93A 1ICSA 4B3ZA 1WBHA 3MSGA 1KXHA 3GG7A 4CLMA 3WNOA 1PTGA 3HPFA 3CQJA 2Z6IA 3GW3A 4CNSA 1Q6GA 3R10A 4LQ1A 4DUXA 5LZLA 4W5UA 3TYAA 4ZFCA 3E1F1 4IIGA 4OHQA 3W2UA 1OGBA 3VGGA 5AHMA 1YYAA 3S5ZA 2J74A 3BOXA 1GYMA 1L6GA 3LZ5A 1TQJA 4IOTA 2GGIA 5AC6A 4JIRA 1KM4A 3ARRA 3WLPA 4UOJA 3E96A 4DXKA 1Q6RA 1UR1A 1J0HA 1CGTA 5HK4A 4AY7A 4CEXC 4UFMA 5FF4A 4O0ZA 1LOLA 4FALA 3LXAA 1GGOA 2ZC1A 4JX5A 3FNDA 3ZXWA 1HIZA 1W32A 1W17A 3SI9A 2FTYA 3Q58A 1QO2A 4AY8A 1WYIA 2NVDA 4AYGA 3OA3A 1FWHC 4F79A 1EXBA 3LPGA 3EMQA 2OT0A 3LI1A 4TMBA 5DRCA 3PZOA 3MI3A 1Z42A 2V63A 3PPGA 4L6OA 1W9DM 1V0MA 1NFBA 4EPKA 1F3TA 3NVDA 1TV7A 4YVVA 4G8TA 2PODA 4MF4A 3GO2A 4PR4A 4MDPA 4AB4A 4TTGA 3SCTA 4QS6A 3DGBA 1HN1A 5A6MA 2I5QA 4YHEA 2ZUWA 2V2CA 2W27A 2D3LA 4DLFA 3G3MA 2GGJA 1RLDA 4JFWA 1W37A 3OODA 3TQ0A 4ML4A 5GJPA 4PMUA 3S46A 3FYPA 3H4XA 3N11A 1MXSA 1UKPA 4BI7A 4M1RA 1K4HA 2EPHA 2XGZA 3BO9A 1W3KA 4GY7A 5DRIA 4CNPA 4C90A 2B7QA 3T9PA 2A3HA 1KRCC 2A1YA 1LRNA 4J7RA 4CCEA 2WKGA 1ZB5A 1M68A 1LQAA 2WJFA 5FF2A 1Q6EA 3OU8A 4GQGA 1R8LA 2AQWA 4NIRA 3E3HA 2OKTA 3RIKA 3GNOA 4HMCA 1MI3A 4YWSA 1MUCA 3I7SA 5M1TA 4S1FA 1X8CA 1FUYA 3T1GA 1TPC1 3WD2A 4PTXA 3W25A 2IXVA 4PTVA 1QPRA 2VUYA 4GGBA 4LYKA 3VIMA 4US5A 4I90A 4RDYA 3W81A 3R79A 4QLKA 3NYDA 1JZ8A 5HQEA 3VGDA 2ZIDA 1EIXA 1T96A 3UYCA 1K7XA 3OIHA 1NFGA 1U33A 1HQTA 1C9DA 3U2EA 4M6VA 2QDEA 5AC8A 4DJFC 5KZ6A 3H2EA 4JX6A 4K1WA 5F2LA 1K6AA 3KVKA 3TN6A 4PMRA 2ZZ3A 1XLCA 3MTWA 4OTKA 3DFSA 5ENLA 2H9AA 3NL6A 5CZTA 3FCPA 3B06A 1JDDA 2ZUMA 4O17A 3S6DA 2IQDA 4WKFA 5I3JA 3RCNA 4XD6A 2WMIB 2AOSA 5T8GA 4AXNA 3QYQA 4JY8A 2GVYA 1O5XA 1MFUA 4PRTA 1KFKA 2DT0A 2KX9A 1JNEA 1P1XA 5I23A 3HF3A 3VDHA 3KDOA 3GXPA 3MJMA 3C8NA 2DIEA 4RZBA 3NOEA 1W9XA 6PTDA 4AC7C 3GUGA 1TJ2A 4N4PA 1BEUA 1KM2A 3SRKA 4Z08A 2WHLA 1KNWA 1ISXA 1N8IA 1TMHA 3VFLA 2J9YA 1JPDX 3IGHX 3GDBA 4GUFA 2YCLB 3KBNA 1V0LA 5LA1A 2BXYA 2Y8KA 1J6PA 1YBQA 1XQLA 4OUEA 4W4QA 1R9XA 5BRBA 4PH6A 4FOKA 1W5QA 5IBXA 3E0LA 2VDIA 4PCNA 1OQFA 4LTSA 4K36A 1IT0A 5DCEA 4AD1A 1EZ2A 2QMJA 1W1VA 4TVCA 3NURA 4IGNA 1WAWA 4JQAA 3GB6A 1OCJA 1SJBA 5E09A 4B5NA 4HHMA 4K3ZA 4G9PA 4DN1A 4MWAD 2X40A 3PTDA 2UV8G 1NJJA 2PZNA 1AMKA 3OQ8A 1GEHA 3P3BA 4PN2A 3LY0A 1XBXA 1E9ZB 3O7UA 1WXZA 2QVHA 5EMMA 1UWSA 3I10A 1TCDA 4NAEB 4Q4PA 4CQCA 4PTWA 1A0EA 2WZMA 2E3ZA 2ZUSA 4A3HA 2OJPA 3OVRA 5C9UA 2P3ZA 1EJ7L 3T78A 2GGEA 1HTIA 1ICQA 1PPIA 1QPNA 2PF8A 3EX3A 3LS9A 4PFHA 4RW5A 4R27A 2VCCA 3JR2A 3UYIA 3HA1A 2OCZA 1HL9A 4CVUA 4AXKA 3S2NA 1F9CA 5JH1A 2Z6JA 5CGQA 1H0GA 3P6LA 2FH6A 3FY1A 1JQVA 2Y7GA 1W5OA 2GOKA 4UTMA 2CXEA 2DUXA 3REQA 3BICA 4IMGA 3PAOA 3VMNA 4U31A 2QJJA 1OC6A 2R6OA 1FH8A 2FB2A 3OHMB 4PBGA 5CPSA 2VXNA 3UR2A 2A7PA 4O10A 1H7OA 1PIGA 1R2SA 2DZVA 3KRZA 4CEUC 1TPUA 2DVTA 5AC7A 1FDZA 1X7IA 3EDFA 3U2CA 3TW9A 3W6YA 5LA0A 4FXRA 2EXOA 1DL3A 1DE6A 2ZZ2A 2QYGA 2W3ZA 2WSKA 3FSUA 4JIEA 9RUBA 2WPGA 4KEZA 1E1FA 1P7TA 4K8GA 1R85A 1Q13A 3TWAA 3GNNA 1SVDA 2OR2A 1IZKA 5IOBA 3VZYA 2WLYA 4KFPA 4I5RA 1XF0A 5HXMA 1NU5A 3V1PA 1M01A 3C0LA 4DAIA 4FX8A 4JIPA 3CV6A 4WEVX 1R3RA 3W53A 3HFYA 1SMDA 1GZ1A 4LVDA 1EHAA 1VLIA 2VOTA 3PAJA 1F6KA 2ACUA 2UY2A 5I00A 2GYIA 3UG4A 3EOEA 4QSHA 3LENA 1UD3A 3MP5A 3OTRA 3WD1A 1ZBKA 1S2AA 2YSWA 3K30A 2FZBA 3R2GA 4KGLA 4R88A 3G1FA 3IJ7A 3RF9A 3WH5A 1NDWA 3FVDA 4JX4A 1ECEA 1MXGA 3S42A 4S3DA 2FZ9A 5IFTA 1R6WA 4ZO9A 4LAOA 6ALDA 3BUVA 2WMHA 1MSSA 3VMOA 4JKLA 2YYTA 1EP1A 2X1IA 4L9ZA 3WYZA 4F0MA 2VZOA 1OZQA 2YYUA 3M0LA 1UD2A 4IIHA 2CLFA 3H2CA 1C3FA 3EXRA 3N1AA 4LRSA 4X63A 4Z2LA 1V93A 1ZCOA 3KBMA 1ZAIA 2W79A 4PYSA 4NQ1A 2QCLA 4GGHA 4JTTA 1IWBA 3BLOA 3KRSA 3L5AA 2BTMA 4G1KA 2VELA 4WJ8A 3FJ4A 4I8YA 1TA3A 3PBMA 3LBCA 4IISA 4MJ2A 2E6YA 1XSIA 4JFUA 1IZCA 5AHFA 4GE8A 5H8MA 4R33A 1RBAA 2Y24A 2QGHA 1C8YA 3KW3A 1ECQA 3LX9A 3SO7A 3VO0A 1M41A 2G96A 3NO5A 2QV5A 3QZEA 2WZHA 3W29A 2Y2WA 4O1DA 1S3TC 2UY5A 1P48A 1I2QA 3L21A 3TSBA 3HN3A 3FXYA 2ISFA 4FZIA 3FOKA 5LNWA 1M7OA 4M6QA 1ML1A 1EF2A 4DM2A 4KCVA 3OZMA 1WAUA 1F8IA 3B8SA 3AHVA 2OT1A 2WXDM 1K6WA 1LOQA 1ONRA 2Z1KA 1X8FA 3N6HA 4M7SA 4D6DA 5BOEA 3CV7A 4OU1A 1V77A 1ITQA 2VGFA 2ZA2A 4HSNA 3WDQA 4PEKA 1LOSA 1DV7A 3LCWA 5XIMA 3AUJA 4PUKA 4HPJA 5TQLA 1AG1O 4GCAA 3IUDA 1Q6FA 5HWJA 4PEEA 4KEMA 4TX9A 3AFBA 4Y90A 1AJ2A 3RO8A 2ZE3A 4DO7A 2B7OA 2VZSA 5LGXA 1NTHA 1FHDA 3QV7A 4V2XA 2P1FA 1AW2A 1U5HA 1EF3A 1VYSX 4ICMA 2NT0A 1J0JA 4C7DA 1TV2A 1FH9A 1C91A 3BAXA 1C8XA 3FFSA 4Q8WA 2AGKA 1V7YA 2R24A 3APGA 3LRMA 5JMUA 1M1BA 5C9ZA 4MSSA 2PF0A 4F4RA 5CSRA 1NY1A 2OWWA 3O2LA 2OLSA 1YE4A 3IRDA 4Z1YA 1QWKA 5CPQA 2ZZ6A 1WP6A 2C8NA 4Q8VA 4KMQA 2W4XA 3AXIA 2HBVA 3BMVA 3WH8A 1OY0A 1P0DA 3WQ8A 4M3PA 2ZVRA 1C92A 1F6PA 1QUMA 1UR3M 1V02E 4J3ZA 3TAOA 4K2SA 4L7ZA 4UTWA 4HCLA 3WL1A 4PMYA 4FHAA 1QW7A 1HJUA 1R2RA 4XAFA 4BCEA 4RLIA 2WVUA 4FOUA 4HZMA 3DI0A 1DQWA 4A8NA 2NQ9A 1TE1A 2MA