3LBOA

Human aldose reductase mutant t113c complexed with idd594
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
314
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 109
structure length 314
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lboA00
1AH3A 3RX3A 1RALA 3MB9A 4YVXA 2ALRA 3LUTA 3BV7A 4GCAA 3M0IA 4L1WA 2FZDA 2PDNA 4JTDA 3WBWA 5AZ1A 4WDXA 4XZLX 3UZWA 1X98A 3UFYA 3UWEA 4YVPA 2ACRA 2NVCA 3GHTA 3LBOA 4DBSA 1YNPA 2HVNA 2FVLA 4GQGA 1SM9A 3LD5A 4EXAA 2PDJA 3COTA 4MHBA 3R6IA 3N6QA 4LBRA 3FX4A 3DN5A 4WDWA 2PDWA 4HBKA 1MI3A 1EF3A 3S3GA 4PRTA 2PDMA 4JQ2A 2VDGA 1YE4A 3LNMA 1IHIA 4FAMA 4XZIA 3UP8A 2PDBA 1QWKA 4FALA 4QR6A 2PDQA 2PDUA 1VBJA 4F40A 2HEJA 3RX4A 2PDLA 4HMNA 3ERPA 2PDYA 3R8HA 1OG6A 5HNUA 3VXGA 5LIYX 2BP1A 3UZYA 3CV6A 1ADSA 2ACQA 2NVDA 2INZA 4QXIA 4LAZA 1A80A 4XO7A 2HVOA 1MZRA 2WZTA 3BUVA 1Z3NA 1Q13A 2I16A 3BURA 3UG8A 4LBSA 4DBUA 1XF0A 4QX4A 4JIIX 4H7CA 2HE5A 4ZFCA 1HQTA 1Q5MA 1UR3M 3CV7A 4IGSA 3CAQA 3LEPA 4H8NA 3ONCA 2IPWA 1K8CA 2I17A 4LB4A 2P5NA 4PR4A 4JTQA 2A79A 5LIWX 1AZ1A 2PZNA 3MC5A 1FRBA 3R8GA 4Q7BA 4JTRA 2ACSA 2HV5A 1M9HA 1AZ2A 2F2KA 4R9OA 3UYIA 2PDXA 2ACUA 2PDFA 3LQLA 2PDHA 1PWMA 2IPJA 3EB3A 3DOPA 1EL3A 1US0A 2F38A 2PD5A 3UZZA 3B3DA 1ZSXA 4XZHA 2WZMA 2IKHA 2AGTA 1IEIA 2DUXA 4XK2A 4LAUA 1AFSA 1XJBA 2PDPA 2HE8A 3Q67A 2DV0A 3U2CA 5C7HA 1PZ0A 2PDCA 4LB3A 3WBXA 3FJNA 3H4GA 3T42A 4OTKA 4XAPA 2IQDA 1YE6A 2HDJA 2FZ8A 3LENA 4WGHA 3N2TA 1R38A 2INEA 1QRQA 5JH1A 5HA7A 3Q65A 3LQGA 4YU1A 3V0UA 4NKCA 1VP5A 3R43A 3R58A 3V0SA 1T40A 3WCZA 5JH2A 1AH0A 3R7MA 3R94A 2IKJA 3G5EA 2IKIA 3M64A 1PWLA 2FZ9A 2PDKA 1Z89A 3NTYA 4GABA 4ASTA 2R24A 4AUBA 4GQ0A 5LIUX 4IJCA 4JTAA 4JQ3A 4WRHA 1MRQA 4QBXA 3H7RA 1Z8AA 2DUZA 3V35A 1S2CA 3V36A 3UZXA 3CMFA 4DZ5A 4FA3A 1X96A 4GACA 3O3RA 3EB4A 4XO6A 2BGQA 1RY8A 2BGSA 3CAVA 4ICCX 2CLPA 4PRRA 2IPGA 4L1XA 4XZNX 3G1RA 1LWIA 4FZIA 3GHSA 3WBYA 2QXWA 3EAUA 3GUGA 3WG6A 3O0KA 1S2AA 4DBWA 1S1PA 3CASA 3GHUA 4Q3MA 4YVVA 4IJRA 1RY0A 2PEVA 2IS7A 2C91A 2FZBA 1ZQ5A 3P2VA 3LN3A 5KETA 3LZ3A 4XZMX 1PYFA 4PUUA 2PD9A 1ZUAX 3GHRA 4JQ1A 4JTCA 1ZGDA 5AZ0A 4WEVX 3M4HA 1S1RA 2ISFA 4JIRA 1EKOA 1HW6A 5LIXX 1GVEA 3C3UA 4JQ4A 1AH4A 5HNTA 3F7JA 4PMJA 1EXBA 3KRBA 3UGRA 1YNQA 4JQAA 3RX2A 2IKGA 2PDGA 5M2FX 2FGBA 5DANA 2PDIA 1LQAA 3ONBA 4G5DA 4XVEA 2IQ0A 5LIKX 1T41A 2PFHA 3BCJA 1Z9AA 1J96A 4WDUA 1JEZA 2J8TA 4GIEA 4EXBA 1C9WA 4WDTA 2IPFA 4GA8A 3D3FA 4YS1A 1PZ1A 1XGDA 4PUWA 1X97A 4I5XA 2R9RA 4RPQA 3H7UA 4JIHA 4XVDA 3V0TA 3QKZA 2PF8A 3LZ5A
chains in the Genus database with same CATH superfamily
4HPGA 1A0CA 4US5A 1GW9A 1L6FA 1O60A 4BWLC 1J8VA 4AWTA 1P4CA 1E0WA 4X0VA 1DE6A 2BOFX 3FV9A 4QDMA 1J5TA 3NQVA 1FWSA 2BS9A 3UFYA 3FKRA 2XH7A 1XXXA 1YLVA 3PNUA 1M7OA 1E1CA 1TV8A 4NASA 4MG4A 3W2NA 1GOQA 5I6SA 1JQXA 2NXIA 3EOOA 3H2FA 4MLJA 2NLYA 1H09A 4AD5A 1RK5A 3VE7A 4KEVA 1Q45A 5DMNA 4LBRA 3W7DA 3O15A 3VFLA 2VC9A 1EF3A 4GUJA 2DZWA 1UKOA 4JQ2A 4CU6A 1RR2A 2VDGA 1M03A 1MW2A 3W28A 3MP3A 4C6QA 4XZIA 1BGAA 3OG2A 4GYKA 3TC3A 4RZBA 1MUWA 4FALA 3KVKA 3VGBA 4PB4A 2OZ0A 1VBUA 5LA1A 3CYJA 3QW4B 4ERIA 4HCHA 4MY8A 4S2BA 3RPMA 1LL6A 3H54A 4TVUA 7TIMA 1TR9A 2CW6A 1GJUA 1UP0A 3F5LA 5C2XA 5FACA 1BG9A 4AZ6A 2BSLA 3FHAA 3AJXA 4NZJA 4GJJA 4ZCWA 3M7WA 4B9ZA 1UIPA 3GIPA 3H8AA 4P5UA 2R94A 1H7OA 1UWTA 1MZRA 4LV4A 3SW6A 1WZAA 2VWTA 3WKZA 3RUBL 3GVRA 5AHEA 3GZ3A 4WX2A 3MSRA 4DJDA 1EDGA 2I14A 1UH4A 1ZTVA 2V3GA 3DYOA 5E6YA 3W07A 2OG9A 4UTTA 1D9EA 1HJXA 4IFKB 3B0VC 3QKEA 4W4QA 3IGXA 1TV3A 5A8MA 2ZUWA 4IFKA 2CLLA 3THDA 3SM0A 2D0GA 3TU9A 3EEZA 1AMYA 1XYZA 5CZ0A 3GC5A 4G56A 4E38A 1NFGA 1V77A 2VZSA 1PTGA 3UWQA 3TA9A 2SFPA 2V2HA 1HP4A 4NZ5A 1FRBA 3WD0A 4DO5A 4Q7BA 1TJ2A 3EWCA 6XIMA 5AVHA 5EMMA 3QV8A 2QJHA 4E0CA 3GU9A 1KWGA 2ZRVA 2W79A 5I07A 4UOZA 4S3KA 3LHZA 3U4AA 2FFCA 3I6EA 4O1EA 3AJ7A 3EKZA 3MSDA 2JE8A 4FOUA 2B7NA 1N8WA 5FL0A 1HJVA 1IEIA 3CHDA 5A2CA 3EOSA 4O16A 3AWNA 3S2CA 1QOXA 3O9NA 2J75A 2VM8A 1YPIA 2PWGA 1ECEA 3K30A 3DECA 5FESA 3WLMA 4JCMA 2OJPA 2B7OA 1B4EA 1EB3A 1UA3A 4AHOA 1J12A 2IQDA 3TZNA 3AZSA 3GR8A 1CXHA 1EJXC 4QFUA 1UWIA 4ZBCA 5E70A 4J2PA 4BEUA 3AC0A 1DL3A 4S1FA 1ONXA 3KP0A 3ORWA 3L66A 4NKCA 1U2YA 3WUBA 1GKQA 4LCQA 5EMJA 2XH4A 1SUXA 5FJPA 3P7YA 1JF5A 1AH0A 2A3HA 3APTA 1OT2A 1V6XA 2IKIA 4AZCB 1K6AA 1BRLB 1A5AA 1Z89A 2CLHA 4IIGA 3AS0A 3B03A 4DJDC 4NI8A 3I7RA 5LIUX 2DDXA 2VOMA 4M6VA 1V6TA 1OHLA 3WK3A 2X0SA 3C6CA 3TN6A 2OWCA 5ENLA 1K8ZA 5BMWA 2VHLA 3RGTA 3H53A 3Q37A 1VAHA 1XKJA 3GM8A 3R79A 4C6MA 3TLLA 1MXSA 2WC7A 1CT5A 3I3DA 5XIMA 1PIGA 3B04A 1ZS2A 3CT2A 2ZE0A 2D3LA 1T0OA 4GQBA 4UTIA 3TWBA 1D8WA 3DG3A 2P3ZA 2QIWA 3PZTA 1CW2A 4MGGA 1ESWA 3AMKA 3NQ6A 2HBXA 5TNVA 4O19A 3SUWA 2Z26A 3LX9A 3CZLA 3CHEA 5IBXA 3BPWA 3S8HA 1S2UA 1LJYA 4D8LA 2ZRWA 3LZ3A 4Q4OA 2EPNA 4D71A 8RUCA 4DM2A 1F07A 4ZSTA 4B5UA 3UXDA 2FHCA 2DT1A 4MJMA 1LLOA 2G8ZA 3C2YA 3PULA 2ADAA 4XTIA 3AYVA 1DJHA 4C7FA 1RP9A 1AH4A 2ZUVA 2XWEA 1UUOA 3TTQA 3I4KA 4WSJA 4HPXA 4H6RA 1YNQA 1Y5XA 3BSMA 3O63A 1VEOA 1UKSA 2DSVA 4POCA 5M3WA 2AQVA 2XVNA 1V02A 1QHOA 4EAMA 4J4KA 1OX4B 1W54A 3DZ1A 1MEHA 1E4MM 2JEQA 2PGRA 5K9CA 1MFVA 1KBLA 2Z4GA 2VX5A 4IWWA 3E96A 3DKLA 2G0WA 3ZSTA 4X61A 3IIXA 3LMZA 4UTMA 1YTKA 4YXGA 1IZJA 4GKTA 3TJ4A 4RW3A 1HKKA 1TA3A 3OVRA 5JQ9A 2EO7A 3UETA 4PUJA 1KCXA 3TN5A 2VGGA 4PCPA 2ALRA 4AZ5A 3STEA 5A6AA 3G77A 3L0NA 4L80A 4V1YA 1QNOA 5FF3A 4D2JA 3E0FA 2PTWA 2WHKA 1XLEA 1P0BA 1R8LA 5H8PA 1NTHA 1JRCA 2ZADA 3UWEA 3GS6A 3TC6A 2GPTA 2H90A 3LGDA 3SECA 1Q2RA 3RLVA 4LYPA 1KRBC 4CEXC 4MAVA 4C6PA 4RNJA 4N9DA 1XDJA 3R0DA 4PA8A 2ALDA 1XSKA 2PTXA 2E25A 4G9PA 2XSXA 3N3MA 1Q6LA 3GXMA 1XIIA 3VNMA 2D23A 4GIAA 2VVNA 3VOFA 4FAMA 3CM4A 2UWFA 3W7EA 4W5UA 5D2XA 3G6MA 3L4TA 4MWAC 4R5EA 2CXEA 1E9IA 3CAKA 3MO7A 2ZRYA 4OGZA 4FXJA 1Q66A 3EXTA 1M68A 4J3XA 2PDYA 4PUMA 4IIEA 3W53A 3GDLA 3GFZA 1VBGA 1KM2A 3I6RA 3MCOA 3KL0A 4DJEC 4AX6A 3TV8A 3N73A 1FP9A 2MNRA 3ARXA 3AMGA 4CN4A 2E1DA 2YCLB 2PBGA 2BP1A 1ZALA 3VDAA 2D3NA 2J24A 1KKOA 3W7HA 4CNUA 1NH6A 1MVYA 4B15A 4AZCA 4J3WA 3VGFA 2GUUA 5G4EA 1TVLA 1E73M 2TAAA 1A80A 4M5PA 3WIJA 3UR8A 3MA8A 4DAFA 5AFDA 3S1WA 3C56A 3WLNA 5FSEC 3NZGA 4GQQA 1OADA 1RJPA 2DZXA 2QCHA 3VVGA 3OYXA 3SCUA 1HJUA 1XRFA 1JFHA 1RCOB 2WMIB 4N9EA 2YR1A 4B3LA 2HMCA 3TCSA 3RITA 1UR3M 1SZGA 2EGZA 1Y65A 4C6JA 1KXVA 1R6WA 3RRXA 4F8XA 3SQMA 1H1YA 2VURA 3VI2A 1KTNA 4JKKA 3QGAC 3ANUA 3RM9A 3VUSA 4K37A 1IR2A 1E4NA 4YWIA 2ZOXA 2Z2UA 2WHLA 3TSMA 1DHKA 4MKVA 2PTDA 2CPUA 4HSOA 4UUIA 3BH4A 3GFXA 3BAJA 3RHGA 3N2OA 1JZ6A 3M0MA 5H91A 3FEMA 1FWDC 5LA0A 1QI2A 3KOFA 3A13A 1RLCL 5HUOA 4H19A 3MP5A 5FEWA 2FZNA 2EG6A 3AYRA 5BRPA 1E43A 2XZ9A 3E0VA 4ZENA 4NRSA 4UR7A 5FD0A 1O6IA 5H8UA 2DSUA 3BO9A 2XGBA 4I7UA 4GYPC 2GVYA 3NOEA 2ASHA 4WR3A 2XIQA 3BOXA 3U2CA 1BF6A 1BSIA 5AOUA 4LB3A 2BHUA 2QIIA 3QFEA 5AC5A 1B90A 3BLEA 1XBXA 4AD0A 2B0MA 1WXJA 4LUYA 3CPRA 1L8PA 3WH7A 1QRQA 4OIFA 4Q7IA 1DVJA 3G1SA 4F9DA 1RHCA 3ZVIA 3U2ZA 4O0ZA 2P53A 3DEQA 4XZBA 2W66A 1S2WA 1YXYA 2VCCA 3BE7A 4EPEC 2IKJA 5A6BA 3NEVA 1KC7A 2FB3A 1EXPA 2PTZA 2QEZA 4HCLA 1Z7AA 1OSEA 2DQWA 5ABHA 5HJLA 4KEUA 2JIWA 4JIPA 5FJJA 4XWUA 4WXYA 5C5YA 1E5JA 1K9EA 1BTCA 2ISDA 4JCLA 4GBUA 1PCKA 3QR3A 5PTDA 2E28A 2P8BA 3H2NA 4L9YA 2PU1A 1G4EA 1ZU8A 3UCQA 3GC2A 5A8OA 2D2GA 4A3RA 2ZA2A 1CBGA 3HZ3A 3ZR4A 3KS6A 2PWUA 3IGUA 2WLZA 3T09A 1E9YB 3P5YA 1BEUA 2ISVA 4CQAA 3W7PA 2ZZ6A 4KFNA 3GHUA 3KS5A 1US3A 2FZBA 1ZQ5A 4C6LA 1QHPA 2W61A 4RV8A 1FWIC 1Q7QA 1ZUAX 3PM6A 3B40A 1BYAA 4GI6A 1O95A 3ZIZA 1W5NA 3MDWA 2FMNA 3IIZA 3NIYA 1V3MA 3MO4A 5HMEA 1IWPA 2WSPA 3NL6A 3HQNA 3WUEA 1A5NC 1DTUA 2VEKA 4K3ZA 1TUXA 2X7WA 5DCBA 4M56A 5HK4A 1I0BA 1MDLA 1UOKA 2V5CA 1YADA 1OZMA 1C9DA 4RNFA 1I2RA 3P8JA 3WLIA 4BI6A 1OFPA 3PTKA 4TIMA 1TX0A 2BXYA 3FDKA 3VGHA 3W00A 1V6VA 2GGHA 4KT2A 5AYXA 5A6LA 5J04A 1GK8A 3NQMA 3STCA 3B9OA 3HTWA 4FHAA 1W3IA 1T8XA 2F84A 1B4KA 3PSWA 1V6YA 3TDFA 5AHFA 1GQIA 5M17A 3TW7A 1VC4A 3T2PA 1EEXA 2Y5SA 3LHTA 4GLEA 1TWWA 2BB0A 1WBHA 4JEQA 2FKPA 4ZGYA 5A95A 1JDFA 1TSIA 1V3JA 4HU3A 3LB0A 2G3JA 5CLTA 5H8MA 2R82A 1K6WA 5CSRA 3MDUA 1CXKA 1TWSA 4MLRA 2WJEA 4F4RA 2ZA1A 3NWRA 4U4MA 3MMTA 3ZSSA 3WBEA 1AD4A 4YVPA 3RO6A 3V18A 5BW6A 3DIPA 3K1DA 1F4HA 3W1LA 3W24A 1GHRA 4WKFA 3HPXA 5T9BG 3F03K 2FVLA 1RPXA 1SM9A 3TYUA 4UTLA 3UVIA 3RCYA 1DJIA 2ABAA 3WQFA 3GW0A 3AQUA 1G5AA 2ZQ0A 4HYRA 1MI3A 4PRTA 4O10A 4WKHA 1YE4A 2Y6ZA 3VO0A 1DIKA 4Q8MA 3MS8A 4AW7A 1KBJA 4IPJA 5HAOA 3AHZA 1MW3A 4GH3A 4FSAA 1Z42A 3ABZA 3M0YA 3IVTA 4C6CA 3LHYA 1RQEA 1UPPA 1VPYA 5KTLA 1K7FA 3IPWA 5H1WA 4FNUA 1XLCA 3MVIA 4PMOA 2E0PA 3FK4A 3TYDA 3UXKA 3WEZA 1BWLA 1PTDA 2WMKA 2DPEA 1XUZA 1A4LA 1F9CA 2J9XA 3E74A 1EGMA 2PWVA 1O5RA 2P8CA 2XTKA 4KCUA 1JRBA 1JQVA 1H60A 3WDHA 4LFYA 1PAMA 3MSGA 3WH9A 3CJPA 3R12A 2YDQA 5CAKA 1XDMA 4C6BA 3O05A 3KL3A 4AEOA 4E5TA 2OQHA 1IXOA 3OIHA 4P8WA 4E4UA 2G5WA 4LTSA 4WHBA 2A3LA 2G41A 1EBGA 4ZQMA 3W6MA 3AXIA 5EY5A 3WLLA 3UWVA 1VZWA 1VRDA 1Q5MA 4IGNA 3N2MA 4JXCA 1M5WA 4EIVA 4GWEA 4W88A 3TWAA 3WNPA 3T7VA 3GBDA 4IMDA 1TQJA 4R85A 3NZRA 2R6OA 1PIFA 3PSVA 4R9XA 4ZQNA 3QC3A 3SBFA 2GL5A 2RJHA 1XWYA 2A1YA 4DEFA 3TUUA 4GMEA 3SUVA 3QH2A 2BVWA 2BXVA 1K8YA 4H9XA 5D2TA 2NQJA 4X2PA 2DSKA 2R1NA 3MI3A 4QM1A 4O12A 2TSYA 3WEOA 4P61A 1QW8A 4DLFA 4M1RA 4QTGA 3GSMA 4PTDA 3K4DA 4PGLA 5LSMA 3K5XA 1NELA 1FP8A 1IE7C 1XCFA 3EPNA 1EJRC 3L2LA 3O0FA 2IKHA 3HQOA 5CLWA 3GE7A 1A4MA 4YYCA 2HNEA 3DFQA 2DUXA 3QY8A 2VXNA 2XVKA 1U1JA 1SZRA 3GG8A 3W72A 2CZEA 3INPA 2RDUA 1JG9A 4F79A 2V82A 3G0UA 4FB7A 3MKVA 1W0MA 2XYLA 3FJLA 4ZQPA 1TV4A 2OSWA 4GGBA 1QK2A 2V5LA 4J27A 2P0IA 2NX1A 4HKPA 3A4AA 4TR9A 5AYIA 1M53A 3VNZA 1SW7A 3FN9A 1OFRA 4BQ2A 4L65A 3T81A 3R43A 4ACYA 1Q7MA 1P43A 2VZTA 4LQ1A 3CQHA 1H5VA 4OBTA 1EP3A 2DT2A 4AVOA 1NWUA 1XSIA 3PB2A 3GLCA 1DP0A 2EXOA 3W25A 2J7HA 3MMUA 2G3NA 3SCWA 3TYCA 4A3UA 1E4LA 5CPMA 1MW1A 4JHMA 3E12A 1E1CB 1FHDA 4QBXA 3USBA 4CD4A 1TPB1 2VEIA 4WF7A 1F61A 3SRDA 4IGHA 5FF7A 1TFVA 2CWNA 5C7VA 2QGHA 3CAVA 4UOQA 4E2VA 4JZ5A 4ZVJA 7REQB 5ABFB 2RGLA 1QTWA 4L1XA 5KZEA 5FSDC 1R3QA 1TCMA 2W3ZA 4ENLA 4IT1A 1OF8A 3M07A 3EAUA 1KFBA 1P1XA 1C7SA 3REQA 4IFOA 1XQKA 4M6UA 3WDJA 1TUFA 3S2NA 4KW2A 2CLIA 2J6VA 2NSOA 3P5ZA 5DY2A 3LPGA 2ZZ2A 4K68A 3FEQA 1BQCA 1IXPA 4OOUA 4PMZA 1UD5A 1HZYA 3GH5A 4HHPA 3FCPA 1EQCA 1A5OC 2ISSA 3VNJA 1QAPA 4H41A 1EA0A 5FF4A 2BY3A 3OIXA 5CGTA 5FAGA 2I1OA 2VT0A 1UMYA 3BAIA 5HNTA 1EZ2A 1XLGA 1DEDA 3VKCA 3OVPA 2P10A 4PBFA 2PF0A 2VFEA 1V0KA 5MF5A 1FTXA 2INFA 2HNHA 2ZXDA 5AB3A 1GUVA 3M5ZA 2DZUA 2GK1B 5D05A 3GKAA 5KZDA 4PMRA 2EPMX 2YDSA 4UCGA 5M03A 1HG3A 2Z28A 1JUEA 2QULA 4PUWA 4IGMA 1XM3A 5D9PA 4H4IA 4Q22A 2EKGA 4U10A 5FI8A 1EC8A 2J7EA 1DJWA 4K7VA 2JF7A 2FFIA 4CLMA 4WD0A 1IIGA 1P7TA 2C18A 3A12A 5KINA 3EDJA 1B3OA 5EYWA 3W7KA 2DZTA 5BWAA 4GD0A 5LNVA 4PCSA 5J5DA 1PVNA 5AYYA 1EYWA 1EQPA 4IPLA 1TJPA 3SCPA 4LSBA 3DX5A 2QDGA 3C4UA 3EXRA 3W7LA 1YNPA 1HF6A 4OZOA 2V5KA 1MXDA 1KLZA 1UMLA 3KRZA 1REQA 4UQEA 3GU2A 3LHWA 4F2UA 1PCWA 3EDKA 4EK7A 4NVTA 1R0MA 4J1OA 3QTPA 1OF6A 3ZR5A 3OPSA 2PP3A 3GVVA 4LEQA 4MJ4A 4V27A 4F40A 4CNPA 3NM3A 4NUWA 1H4PA 4H9VA 2V8ZA 3L4XA 1TZZA 4GJ1A 3H26A 2E6DA 3WJSA 1PHQA 1JVNA 3ZQ9A 3R8HA 3DKJA 1JCNA 1R3SA 4DX3A 4MMWA 3M7SA 4GZIA 3KBMA 2YZRA 4G1NA 2X0YA 1YPFA 1YDNA 1ADSA 5DMMA 3TJXA 1R3YA 4W87A 4DF1A 1IEWA 1RQBA 3F4VA 3NSMA 4GQRA 1J01A 1FH8A 4QG6A 1Q13A 4JD4A 3MI6A 2PTYA 1ITUA 1WBJA 2E6FA 1AMKA 2KAUC 5D2YA 3TH6A 1W3HA 4YL2A 4MZ8A 4OBSA 4JIIX 4N4PA 1E1EA 4AAJA 1LP6A 3ITCA 1F8IA 1W1ZA 3GYCA 3VNIA 5CZKA 5LNUA 1K7EA 4HD5A 2JQXA 2ZICA 3ARSA 5A94A 1NWSA 2IPWA 2O4MA 1KFJA 3BQ5A 1RPKA 3E2RA 5JVLA 1P1MA 1WX0A 5AC7A 1E72M 2YCEA 2WB5A 4LVAA 4P7RA 1JAKA 4QQUA 3UYCA 4K8GA 4RUBA 3TZFA 2PZNA 1EJWC 3AHXA 1R2RA 1LQ2A 4HOZA 2YCJA 5BU6A 1GPFA 4AD3A 4J3VA 2HV5A 2W92A 4IICA 3IAQA 3GTXA 5FJIA 1BXNA 3WQDA 4CU7A 1PSCA 4E8CA 3EWDA 1SFSA 1D3HA 2I5GA 3DOPA 1H0IA 3LA4A 3NQGA 2VQTA 3W26A 3TR9A 4IG2A 3QMRA 3B3DA 2NQZA 1EPVA 3NYDA 4C65A 1VKFA 1YW1A 3LCXA 3N9KA 4QEEA 3E6EA 3O8AA 4LAUA 4RKAA 3GDKA 1AFSA 4GCXA 3WQVA 4QLLA 1HVXA 2BMBA 4TVDA 2G4JA 2Z7GA 3O16A 2DV0A 4IP7A 4PH6A 4C6OA 1KR0A 4A29A 3GDTA 3K46A 2PDCA 2WVTA 1ADOA 1V3LA 3RR1A 4H6KA 4JTLA 1ITQA 4INFA 3CBWA 2Z6JA 4TXEA 3RXZA 6TIMA 3DHFA 3N19B 2ZX8A 3WBAA 3U57A 3GDRA 2ZFAA 3RPTA 1SVDA 5KZ6A 1GW1A 2ZA3A 3DESA 2FDMA 4HA0A 3OA5A 1J0ZA 4W93A 4W84A 1EJ7L 1XICA 3NL5A 5CGMA 3WENA 3P61A 1FWRA 2ON3A 4EOUA 2PDKA 4YHEA 3E2VA 3KBVA 2BG5A 2VZOA 3M47A 4UTFA 4ADSA 1UASA 5D9NA 2V69A 1K4GA 1W56A 5I3GA 2VEFA 4GY0A 3VTRA 4ACZA 4K39A 3EB4A 1OCBA 2CU0A 3S5NA 1SJDA 1HKWA 1HUVA 1MWOA 3GTIA 1VYSX 4MUPA 2IPGA 1GCYA 3TCEA 2QPSA 4WLCA 3UR5A 3SUUA 4C6IA 3EB2A 4LWWA 3T0DA 3S0CA 3WBYA 3U48A 2HXUA 3GUGA 4UNKA 2Z1WA 1ZBWA 5AC8A 2R8WA 2E68A 1QASA 3GTNA 3AIRA 3D0CA 2BX7A 3PJTA 4FI4A 2C91A 8TIMA 2VZVA 1XC6A 2FPYA 2OCZA 2QV5A 4IX2A 3W75A 4CN1A 1VYRA 5DF0A 1FOBA 5FL1A 4NQ1A 4D6CA 1J0IA 4V1XA 3TIMA 3KBNA 3TJIA 4Q8VA 5BROA 1ONWA 3P84A 2VMFA 3UY7A 1NJJA 3EX1A 2OZ8A 3G1DA 1GQLA 3QQWA 4C1KA 1RBLA 4B5TA 3H2CA 2NXGA 3WSUA 2YFOA 1X6LA 3RX2A 1L9WA 5HWMA 4MM1A 2IKGA 4FO4A 5GNXA 2OYLA 1O5QA 4KGJA 1E9ZB 2QS8A 3OHIA 2CKSA 1N8IA 5LIKX 1Z9AA 3BC9A 4LX4A 3ZM8A 1J0YA 4ZZ9A 4Q33A 2Q3OA 4EPBC 1RZMA 4RW5A 4WDTA 3TC7A 3PZIA 1UD8A 2IPFA 4GUGA 1C8YA 4AZHA 2F9RA 4BF7A 2WVVB 2RGMA 1J6PA 4XD4A 3KZSA 3QGVA 2CC0A 2A3BA 2VRKA 3GZAA 1MEWA 1RP8A 1FXPA 1WUFA 4Y9AA 1XSJA 2PWFA 3QC0A 1JZ7A 1CGUA 2IXUA 2C1IA 2WSRA 3RLUA 4DELA 2PA6A 3UCDA 2R1LA 3EPOA 3NQAA 4O4WA 3W2UA 4M8UA 1DJYA 3PTQA 3MTWA 3B8DA 2GQ3A 4QE4A 3SJNA 1O68A 3U4FA 4GKLA 3HV8A 3MUIA 5D37A 4A22A 4WQ6A 1S38A 2W9MA 2ZKMX 4FIRA 3VDCA 2WV8A 4NNAA 1G01A 4O1CA 4KERA 4AYSA 4JPGA 4IG2B 1VBHA 2D22A 1GT8A 2NWSA 4JFUA 4DQWA 3BQ6A 4O1BA 1WUEA 3C0JA 2OEJA 3SSZA 2JKAA 4EXAA 1VEMA 4YTUA 5CJ5A 2TRSA 1CXIA 2WMGA 3N6QA 5I02A 4LRTA 1YXCA 3WLJA 4E4FA 1NY1A 2ZBTA 1I2OA 3SO7A 1QT1A 2XFFA 1KRAC 1R2TA 1TCDA 4D72A 3GRIA 4GYFA 2GGGA 2WJFA 1XIFA 2PLJA 1KCKA 4XD6A 3SN1A 3RX4A 3P82A 1BKHA 2QF8A 5HPCA 1XP3A 4BFAA 1RV8A 4S3FA 4LYRA 4WJ8A 4N4QA 4W7UA 1AW5A 3M0LA 4LCRA 2VELA 3PZQA 3NL2A 2ZRUA 4RX0A 3VCRA 4Z2GA 3XIMA 2OVLA 2YZ5A 1J2WA 2V0TA 1VD6A 3C0LA 2XZ7A 2WCAA 3A24A 4IP4A 3KBSA 4L4LA 1E3ZA 4U28A 1BFNA 4N2YA 4XX6A 1WA3A 4C7GA 3P8IA 7TAAA 4RK8A 4Q6XA 1EPXA 2GWGA 2DIKA 4XSLA 1W3TA 3UG8A 3BURA 1XCXA 3CYVA 4Y9PA 5LGZA 1XF0A 2PLMA 1H1ZA 1QO2A 3C86A 4N0RA 3POCA 1SGJA 4O8AA 1UJQA 2ZUNA 1XIBA 1UW9A 2VCAA 4E4PA 1TPDA 4UR8A 1AQFA 5IRPA 2J4GA 3AIQA 1JNEA 1B3WA 6ENLA 2ZIDA 4ADUA 1Q6OA 2C71A 3KTCA 3LCLA 1SJCA 4Q4SA 2YJQA 1A50A 4FNRA 2P5NA 2FDSA 2E4TA 5KEZA 1V08A 4GINA 4MB3A 4MTVA 4DNMA 1PB0A 3WDRA 1CGVA 3QQ1A 2WMIA 3F4CA 2PGFA 2ZZ3A 4AIUA 2YXOA 5GPRA 4ATLA 4O0KA 5T8GA 2AAAA 1XISA 5DO8A 3KUMA 1WV2A 1Q6FA 3QZAA 4H7ZA 1MZHA 1A49A 5DBUA 4JTTA 3ZYZA 3VOGA 2IPJA 1I2QA 2NUWA 4URIA 3WQPA 4MY1A 3KE0A 1Q6DA 4UC5A 2AL2B 1IT8A 4A3HA 1KM3A 3RRAA 4JL1A 4HN8A 1B54A 3A6OA 1ZZMA 4JFVA 4DJED 5IM51 3C61A 3ZMRA 1XYFA 1XD1A 1GG1A 4BCEA 1PPIA 1Q8AA 1POJA 4AU0A 5D8WA 1TV2A 2X05A 2PDPA 3P81A 3S47A 3CPUA 4C6NA 1Y5VA 3NM1A 3L4UA 1N82A 3IARA 3WL1A 3FYOA 1C8QA 5CPNA 4JR5A 2RAGA 4XTDA 2NQHA 1UOZA 5LKYA 1A5UA 4OUEA 1PYMA 1LROA 4IQLA 3OP2A 2FZ8A 4HNTA 3WQWA 2MUCA 2Y7GA 1PV8A 1JULA 2WSQA 1CXLA 4I8DA 1T6MA 1L8NA 4KEZA 1F05A 2VFIA 2PSNA 1W3NA 1QNPA 4JTUA 3W84A 2DSZA 3NZ1A 3THAA 1G7VA 3NQ8A 4GGHA 2KZHA 3FS2A 2FVKA 3RU6A 2VUYA 1TJ1A 4PMXA 3NDYA 4HP5A 1PWLA 1X39A 3EDFA 2H9AA 4CCEA 1W31A 5T9CE 1EZWA 2R24A 4UWMA 2OGYA 1UWAA 1C91A 4IUGA 1PTAA 3VCNA 2XVLA 3L5AA 2OLAA 1E9LA 4WY0F 4PODA 5MHBA 2DUZA 5DT7A 2FQIA 3QV6A 3AFBA 2BOGX 2GJLA 3I6TA 4MWAE 4PL2A 3BGGA 2H6RA 3MMDA 1EA9C 2E6AA 4OE7A 1FWWA 2OZTA 4JICA 3OA3A 2QZRA 3PTDA 2IUZA 1K8XA 3RLHA 4PBEA 4KWUA 3TONA 3WG6A 4A3YA 2BVDA 1EUAA 3HJEA 1GVOA 1S2AA 2QJGA 3NQFA 4ES4A 4KH2A 3H12A 4RV3A 1S1PA 2VFFA 2PODA 1CECA 1OIMA 1LL7A 1DQWA 1XIGA 2NT1A 1LWJA 5CJMA 1XYAA 2B7PA 3KFTA 2OO6A 2WSYA 3SQLA 2NX3A 4MIMA 1R3RA 2Z1XA 4WVXA 4G2DA 1S1RA 5D9MA 2ISFA 4D6JA 1ITXA 3LCFA 3RF9A 1HW6A 3N3TA 3AOFA 2VFGA 2JGYA 3F7JA 3UGRA 4TUFA 3PJUA 4F2BA 3URQA 4M0XA 5KITA 3VZXA 1QUMA 3WH8A 1S46A 2ONEA 4DI9A 1HX0A 2FTPA 4XIMA 1QVBA 2BV9A 2A2IA 2ZXBA 4GFSA 1W9UA 3MUCA 3AS2A 2PP0A 4GXMA 3VDGA 1W1PA 3LLFA 4MNMA 3KP1A 1DJGA 4S3JA 1R87A 7PTDA 5JBDA 3BCJA 4TO8A 4AY1A 3VDHA 4DXXA 4TQTA 3E0WA 1VIWA 2OT1A 3LCHA 2DU2A 4EXBA 1FH7A 2NQLA 3W38A 5AHNA 1DJNA 3P67A 3UGVA 1HGYA 3TAKA 4IL0A 3SCVA 4AX7A 4K8HA 1F73A 1NP2A 1GGOA 4BS0A 4YYFA 3M1ZA 1X97A 4H9MA 1XLJA 3B8IA 3CUHA 3TJLA 3AXXA 3CUXA 4J5NA 3MVTA 1KCZA 5T91A 1HL2A 4WSHA 1W1VA 4JTFA 3F5JA 1V7YA 3FGCA 2CZ5A 1IT7A 2C0AA 2FZDA 2PDNA 4Q6JA 4KBXA 3EMCA 1NQKA 4XZLX 5BXSA 1THFD 1X98A 2JFEX 1XHGA 1ME9A 3GHTA 4B90A 4JL2A 3C2OA 5E9XA 2ISWA 2PPGA 3A23A 2VGFA 1FY6A 1KR1A 2CEQA 1M6JA 3NPWA 4LJ3A 3LD5A 1RK6A 3LBCA 4GYJA 3EA2A 1SO3A 1ZJHA 3DN5A 2PBOA 2RUSA 2GQAA 2X41A 4KIEA 1YNYA 2J7FA 2YFNA 1NOFA 5HPOA 1UKPA 3BOFA 2UV8G 3L5LA 3H2EA 5JXQA 2YA1A 3UP8A 3WLSA 5FAJA 3VA8A 1HJSA 4UQ9A 4WIWA 3WNNA 2I56A 2UY3A 2AAMA 2XIBA 3M0VA 2GVGA 2WWCA 3FA4A 2HK0A 3QY7A 2XFYA 3HQPA 3O2LA 4PB5A 1Q6RA 3BTNA 4RZ4A 1RLDA 4TMCA 4E2OA 2ZRZA 3II1A 1EF2A 3ZS4A 1OG6A 3NQEA 3VXGA 3PHAA 3FA5A 5HQMA 3MUY1 5LIYX 3SGGA 5HBFA 2NLIA 3QPZA 3CV6A 3TX9A 3B05A 3K1GA 4QXIA 3LCIA 3PWAA 4M80A 3KM8A 4LAZA 4XO7A 5ABEA 4PCNA 4XSMA 3VKKA 4X9SA 3IJDA 3TN3A 1CZ1A 3BUVA 2CFFA 2WQPA 4DWDA 4DBUA 3RAOA 3ZLFA 5DEZA 4NJJA 5HR7A 2HCVA 3DBNA 5HMSA 4MSSA 4ECLA 3M0JA 4LYQA 1IGSA 3T55A 4BQ4A 3QZEA 3FXYA 3CV7A 4W86A 3F5KA 1A3WA 1LBFA 1U1HA 5CEWA 1UQZA 4H8NA 4EP8C 4QJ3B 1QOPA 3PUDA 3SURA 1PDZA 5A6SA 4BKNA 2YIHA 3DFNA 4KF1A 2JEPA 1E0UA 3ITXA 1TTQA 1CLKA 3JZEA 3F2DA 1XH1A 2P0OA 3GIQA 3R8GA 2YKKA 2O55A 4ORIA 1K02A 4TX8A 1J5SA 5CZJA 4CKQA 1VGAA 4C6KA 2PI6A 1YYAA 1OT1A 1YDOA 1XRVA 1KD0A 3UR7A 3LS9A 2J9ZA 2C79A 3UXAA 4EE9A 4E8DA 3LDVA 1CEOA 5HNRA 3K8LA 4KEMA 4N7QA 4US5D 5CGQA 1MRAA 1MDRA 3MU7A 4GNVA 1UD2A 3C2RA 2G3IA 1Z32X 3QF0A 1W5MA 3FLUA 5FCZA 3I4EA 5A2BA 3O6YX 1I6NA 5C7HA 1NFPA 4DXKA 4JNMA 1B9ZA 4M3PA 5D04C 5BOOA 1QI0A 2HDJA 1H7RA 9RUBA 5FEXA 4ORMA 5HJYA 4H6QA 1IR1A 4LGXA 4XAFA 4HT3A 4XAGA 5F4WA 8CGTA 3LQGA 4YU1A 5L6UA 1B57A 4KWWA 4HA3A 2FGLA 2MANA 3UXIA 3TQPA 4UTWC 2W62A 3FKKA 1I4NA 1W8GA 3SI9A 1K9TA 5I09A 3EOEA 3UXLA 4HNOA 3UEQA 1VFOA 2P88A 4NZCA 3MCMA 4IISA 3NPXA 3IVUA 3NDZA 1Q65A 3LV5A 4W9TA 2WJZA 4BWLA 4W8LA 2X42A 1Q6QA 1ONRA 4WRHA 4KCTA 2TMDA 3ZT6A 4CQ9A 3PAJA 1S2CA 4LS1A 4UZSA 2DVXA 3CO8A 2J62A 1OYAA 3L4ZA 4DJFA 1GYMA 1MMFA 2XISA 2YXGA 2DZBA 1PBGA 3KOXA 1Y0EA 1PX4A 3G1RA 4P8UA 4NYYA 1PKLA 2Y5EA 1X7FA 5C9XA 4Y2WA 2R14A 3PZOA 1XUUA 3WELA 4DBWA 4K38A 4AB4A 1OG0A 1SO4A 5CH9A 5A6MA 1PUDA 3C52A 3SDOA 1KM0A 1ZAHA 3ZT5A 1YRRA 1B5TA 4XZMX 1PYFA 4DB7A 1WDWA 1YDYA 2WCGA 4IMAA 3T1GA 3PF3A 2CERA 3W1XA 1FCUA 3TNBA 2Y61A 2C13A 3UNTA 2TPSA 8A3HA 1FWCC 5BRBA 1F6KA 1R9YA 2F2HA 4LXFA 2WOQA 1GORA 3KDOA 3DUGA 1EEPA 4ZO6A 4DNHA 4HPNA 2VI0A 3GIYA 3IAPA 2VFHA 5H6HA 2GVLA 2CLFA 1Y7VA 5IDIA 4BEQA 4X22A 1JCMP 3QV9A 4AD1A 1H7XA 3BSHA 3GH4A 5C9UA 1JDDA 1LQAA 1MEIA 1O1ZA 3P14A 1JI1A 3W7CA 3NQ7A 5I7GA 2XSBA 5MKGA 4IOTA 1RA5A 3RU8X 3SEPA 4PTMA 1VHNA 3EA3A 1H5YA 4UMBA 4YN5A 1ELSA 2PRMA 3S5OA 4C1NB 1ODUA 4CQ8A 1ZCOA 4MDPA 3BW2A 3HGRA 3CTTA 4JTIA 4B92A 1E6PA 2O7SA 1K9DA 4EX4A 3NAVA 1AJZA 3WD2A 4UB9A 3KXQA 2F61A 4CUCA 2EG7A 1JYWA 3E9AA 2DORA 3NPVA 1KB3A 5BXPA 3GXIA 2YBVA 5AZ1A 5BRQA 4C6EA 1KM1A 1YPXA 4JN7A 5G1MA 2A21A 4E8GA 1V6WA 4JS3A 1M7JA 4U3AA 2BASA 3FSTA 4LF2A 4DAIA 3W0KA 3MANA 4IXHA 1B30A 2PUZA 4DO7A 3BGAA 4O4VA 4O13A 2Y4SA 1CGTA 4AVNA 6PTDA 4HHMA 5C71A 1NAL1 3T78A 1L2QA 4AHPA 2J6XA 5F2LA 4O1AA 4WDWA 1LWHA 4DBDA 2NV9A 1Q4WA 3VINA 3AIEA 1JZ3A 1XLIA 4HNUA 2XVGA 1B31A 5A1AA 2XN2A 3MJMA 1EJTC 3NXFA 4Z2KA 2V67A 4GO8A 3WD3A 2ZUUA 1Q85A 1SZEA 1JYVA 1KFLA 2YXXA 1OQFA 3RM8A 4HOXA 4J3SA 1FCBA 4QDPA 3G22A 1EWDA 2Z1VA 2EPOA 3WLHA 3UPBA 1M41A 4S23A 2WW5A 1EO7A 4NG3A 7REQA 5ABFA 3OEXA 1P0EA 3T08A 1BXCA 1B3XA 3NO1A 1FDJA 1W3KA 1O66A 3FVMA 3LK6A 4UTUA 1VFFA 2NWRA 5HWNA 5CC6A 3QLLA 1E6ZA 3T0AA 1G4PA 2ZE3A 1CB2A 3D3AA 5FJTA 1KTCA 3DHDA 3PS7A 1DYSA 4QNEA 1UQYA 6REQA 4JTGA 4J28A 2Y63A 3T07A 1A3HA 3ZWTA 3KTSA 4R34A 3OLDA 4W7VA 3VMNA 3AMDA 3SY1A 2QCFA 1GTEA 1LYXA 4GPNA 2WPGA 4I5UA 1TYGA 3LV6A 4DO4A 3BW3A 4UNLA 3GXNA 4GZEA 3S9ZA 2XH2A 2WCSA 4O1DA 3CHCA 4M6QA 2E9MA 5CPQA 3HG4A 4BR1A 3LI0A 2V6AA 4V2XA 3OGVA 3K8MA 3P74A 3S2LA 1QWGA 1M9HA 1UH3A 2EBNA 1ZJBA 5A6JA 3ELFA 3CZ8A 2CXGA 5D2WA 4B4HA 4UFLA 4U3CA 3TTOA 5AKQA 3VGDA 4LPCA 4R7OA 8XIAA 1EGZA 4PTNA 5EKYA 3H55A 4FX7A 4Z2LA 3AHVA 1MQPA 2UY2A 5AC4A 2WNNA 2ZUSA 5HUPA 2XVPA 4UFMA 2E8ZA 4Y9OA 3WD4A 4MKSA 3A3HA 4ERAA 1PZ0A 2DP3A 2OX4A 2GOUA 5K9DA 4ZTXA 3DU0A 4OV4A 3VUPA 2W0UA 5AHLA 4OOZA 5HINA 3O07A 4HTYA 4WUIA 4H8HA 1P5BA 3L7RA 3V0UA 3N6JA 4WY0A 1ADDA 3KVLA 3LXCA 5LNSA 3W7JA 4JOMA 3R94A 4QNWA 2Z24A 4JX4A 2WJDA 4Y8FA 1UH2A 5BMXA 2YOCA 3TQVA 2BY2A 5BWFA 3VZYA 2JGQA 4IHCA 3EGJA 4RDZA 1CX9A 2W27A 3NR0A 4KCWA 1U83A 4Z08A 4JTAA 4NAFA 3HMJG 1CLVA 3IJLA 1RSCA 1ISXA 3W7IA 1O5KA 2Y89A 4TTGA 3GTFA 3DENA 2X0HA 5U4NA 4EANA 4IZGA 2V2DA 3NQCA 3GDMA 2R91A 3BMXA 3S1XA 3EKGA 3ZVHB 3SCRA 1LWIA 1KGUA 4FZIA 4GVFA 4NAEA 2Y7DA 3T0BA 1ZL1A 2XUCA 3R25A 5EU9A 3IEBA 3W71A 1ZFJA 1W3JA 4GX9A 4Q3MA 1TRDA 4YVVA 4HZ6A 5EBUA 3P2VA 2V2CA 4JGDA 2GWNA 1CNVA 1LRNA 1W32A 5I3JA 4DPQA 4YJ5A 2WKGA 5AECA 4JTCA 3VD9A 4J9JA 3UESA 4WEVX 1BXBA 5KZMA 1OK4A 3L9CA 2GSHA 4A2RA 4NAFB 3PFMA 2QV4A 2ZZ1A 3N18A 1DPMA 4H6EA 4B16A 4HTBA 3DAQA 4HOWA 1W37A 3C0QA 4O57A 4I9MA 2F8QA 4OBRA 4EPDC 4FF5A 1D7FA 3DFPA 2B81A 3OQ8A 1XG4A 3LCGA 4DPPA 3D5HA 2W6RA 4J3TA 4UXDA 1J96A 5BNKA 2OR2A 5D9OA 1C9WA 4DLMA 3W29A 4ICNA 3T8LA 4FNPA 3EMQA 3TN4A 4KQNA 4LU0A 3WD1A 2HJPA 4DZIA 4BI7A 1SJBA 4OT7A 1W5PA 2Q8ZA 3FIGA 4JIHA 4JIEA 2AOSA 3URNA 3CEPA 4WOQA 4N9CA 3QMSA 1ODZA 1X6NA 4ZB2A 3THCA 1LL4A 3LZ5A 3WNOA 3VYLA 3UWYA 1D3CA 1SYTA 3OZMA 2CESA 3USZA 3WQ5A 1W17A 3E3HA 4CGTA 4GI9A 1KQZA 1QATA 4G7FA 2BODX 4QSFA 1XD0A 5C54A 1UIOA 4GVHA 1OCQA 3QMTA 2OU4A 3WLQA 2YL8A 3A4WA 1SSDA 2AQWA 4PCTA 1BHGA 4FS9A 4DBSA 2X1SA 1D8CA 3LPOA 2QAFA 4E3TA 3L4VA 4C5YA 3TNOA 3QLDA 3AROA 1YEYA 3E0LA 1F8MA 4HU8A 4I6VA 1YBQA 5F4SA 4DXVA 1TMLA 1LOQA 3SRKA 1Q6EA 1QWKA 1O1HA 3C8FA 2X1RA 3AO0A 4W89A 4F0SA 3B9AA 3STFA 2DZPA 4NT0A 3SFKA 4K1WA 4RDVA 3V75A 3IV3A 4YTSA 1OBAA 2GK1A 4S3CA 3T0CA 1DORA 2ZXQA 2J9YA 4Q4QA 3GDBA 4IP5A 1KGXA 4ZEPA 4NJIA 4FP1A 1GVIA 4UTKA 3AXHA 2ACQA 3D47A 2WQDA 5FA5A 3CH9A 2TODA 2VZUA 4X60A 1GNXA 2PP1A 3UA4A 2FGZA 3WF4A 3CQJA 4J40A 4WJEA 5FIPA 1CDGA 4GIYA 3PNZA 1BVNP 1H49A 3AIUA 3L2IA 3FW6A 4QS5A 3VZZA 2A7PA 1B3VA 5IBXC 3BLFA 3HU7A 3W2KA 1KFKA 1EJSC 3PPGA 4R7JA 1BLIA 3G3MA 4JTEA 6CGTA 1UHVA 4YWSA 2QYGA 4RZ6A 4XBSA 3W2JA 3VOCA 2HSAA 3CB3A 3EOLA 4ZB0A 3PUEA 3GG1A 3G8RA 4O17A 3G6LA 2A3EA 2VL4A 1EOKA 3E02A 3VIOA 3U5UA 3N15A 1EBHA 3B9NA 5ECVA 1UD4A 4H83A 2VVSA 1F4AA 1NOUA 4F0HA 5C9RA 1GOMA 3DERA 3HF3A 3W7RA 5CJNA 1TB3A 2JIEA 4UQCA 1W91A 3AI0A 3AZRA 4QAWA 2UBPC 4FNQA 1ME7A 2Z1SA 4L64A 4F3HA 2Z25A 4Q4KA 4CQDA 3TXZA 3F2BA 4FIQA 1KXTA 1RVGA 3UZZA 1BVZA 1UZDA 1DKWA 1UR8A 4WKAA 1H7NA 3TW6A 4F0MA 2Q3RA 5FJRA 1J79A 5AVNA 4DYJA 1NF7A 3PANA 4ERGA 4XD5A 2Z27A 1U33A 1YXDA 2CHOA 4GHRA 3HV9A 3WK0A 3VMPA 4JN6A 4S3DA 4F9JA 4XAYA 2DGAA 2QCEA 3M0ZA 3TYEA 1FWNA 1RVKA 1C93A 1YKWA 3ES8A 1SR0A 4WGHA 1UBPC 3ZWSA 1AVAA 1Y8BA 1BRLA 3JW7A 3B8SA 3BVJA 4AZBA 2NV2A 3PBWA 5TQLA 2OKOA 3OTRA 3WMSA 1V3HA 4ZXOA 1ICQA 3BG3A 3LHUA 3V0SA 2DW6A 2DIEA 4KS0A 5CAHA 1OYCA 1SO5A 3KW3A 3I7QA 4IQDA 3VIHA 5I3FA 1TG7A 3M64A 2WPBA 3TFXA 5BXRA 4QSHA 4M7SA 3N14A 2VR5A 1UR2A 4C6DA 3N29A 1OX6A 2CZDA 3K4WA 2ZXAA 1KGWA 1Q6CA 2D1ZA 4IJCA 3PBMA 1NDWA 1NDZA 1LOSA 1VRXA 2BBFA 3FJ4A 3GR4A 4DZ5A 2YCLA 3GAYA 3O3RA 4JDYA 2G3FA 3NO5A 4XO6A 4S3AA 1ISWA 1JDEA 3H4XA 5A6TC 3A22A 1S5WA 1IV8A 4V15A 1KBIA 1KFWA 4BHYA 4D1JA 2ZZ4A 2BTMA 3VC6A 4REQA 4CCCA 1KRMA 4KFPA 5GVJA 3CIVA 3C0SA 4HZ7A 1QNSA 1PO9A 4WK9A 4LUSB 1SPQA 4ZQOA 2YA0A 1ZNNA 2OOGA 3WF1A 4QDWA 1KXHA 2WM0A 4ZL1A 5KETA 3BCFA 3G24A 4NXKA 3DH7A 4BF5A 4JQ1A 4BJHA 3NCOA 4PUDA 4KESA 4GUIA 2VNCA 2ZWYA 4G7EB 4HK6A 2O9RA 1R3TA 1EKOA 3E49A 1QI5A 4LW7A 3ARWA 3UZ5A 2RDTA 4PMNA 4M29A 3EOUA 3WF3A 1T96A 1IT0A 3KCOA 2AL2A 5M1TA 3W9ZA 3IIOA 2NUXA 3SCQA 3H22A 1EYEA 2OYMA 2QVHA 3QPEA 4AWEA 2J7DA 2OPJA 4JHOA 5FOOA 5M2FX 1XI3A 3CS2A 4UBPC 1K7XA 2GUBA 5CG7A 1E0VA 3M6YA 1VIZA 5RUBA 4PCFA 3V5OA 4DZAA 2BZNA 2QJIA 1K9FA 4CEUC 4IQJA 3TMQA 1S5NA 3B0UX 1K1DA 2C14A 3GVQA 4W7WA 3CWOX 5AHMA 3VKJA 4I5XA 2QW5A 1WQ5A 4I7WA 2DZVA 4X9YA 1I45A 1Q7ZA 3FXGA 1B9BA 1TKKA 3WUGA 3DYPA 4ZQRA 4NU7A 3PK7A 3OJGA 3B4YA 1RALA 3UR2A 3SY5A 3M0XA 2V63A 3NG3A 3UJ2A 3PWGA 3QR1A 3IUDA 1F2JA 1YHTA 3M5XA 3KZPA 1F7BA 4B5NA 4TMBA 3S9YA 4QG8A 3HPSA 2E67A 2NVCA 6TAAA 1LQ0A 5AC6A 3LBOA 3KL5A 1H1NA 1V79A 5I03A 1UUQA 2XIOA 1I75A 3NFUA 4DN1A 1A5BA 4AWSA 4GQGA 3IK2A 3M46A 1F5ZA 2C0HA 1GVQA 2Y2WA 4YTTA 1D3GA 4Z0SA 2WC3A 3NQBA 5A8GA 5FJOA 4DI8A 4O11A 1TVPA 4AWUA 4AF0B 2PDBA 4P2VA 2BHYA 2PDQA 4W8BA 2Y7FA 4W85A 3QEZA 3WL0A 2GDUA 2XGZA 5CSSA 1ZAJA 3B06A 1A47A 4XB3A 1UWSA 1EJVC 3OHMB 2AMGA 1N7KA 2D73A 2Y70A 4Z1AA 1AJ0A 1OWQA 3U7VA 1A3XA 3VGEA 3WMCA 2XHYA 3AAMA 2VDHA 2V81A 3WDPP 3TKFA 4C60A 1XBVA 3EWZA 3MHFA 2W67A 2I5QA 3BLIA 4A3QA 4LRSA 1XDLA 3NNTA 2ZVRA 3M5YA 3VNLA 3ID7A 2I16A 3M43A 3WMLA 1KTBA 3PUOA 1SFTA 3WH6A 3LBMA 3BICA 4S39A 1AK5A 5DRIA 4X3ZA 3PC0A 1C3FA 1CGYA 2V38A 4XUGA 2J88A 2FVMA 1TJRA 3N2XA 4Z17A 1DXFA 2PLCA 3ONCA 2WNWA 3IVSA 4MDOA 3RK8A 1UCWA 1PXGA 1A53A 2D2OA 4U2YA 4S3BA 4QJ4B 3GR7A 5D2VA 3DBPA 3AXKA 1AZ1A 1FVPA 4AC1X 5KMYA 5DX7A 4H8UA 3LLDA 4C1NA 3IJQA 1ECQA 1UB3A 4X63A 1H41A 3A21A 1ZHAA 2VD9A 4QEHA 3TMLA 2F2KA 4LNCA 3A9BA 1GOKA 4AC7C 4NJKA 1CCWB 1W1IE 1M65A 4PMDA 2R1MA 3GD6A 2OSXA 4NF7A 3VPLA 2HVMA 2ZRXA 3ZJKA 3S2JA 1KM4A 1HKMA 2TYSA 2AGTA 2ZC8A 3W6YA 2YBUA 3FA3A 3UG4A 3NDOA 1LLZA 3AU6A 2YSWA 3N11A 1XJBA 4XZ9A 1YTEA 2D69A 4AYGA 2QUVA 5ABGA 4UFIA 1EWEA 1TV5A 4J7RA 1A0DA 3KDNA 5GNZA 3OVQA 3WX7A 4F0RA 3NQ2A 5EMLA 4KWSA 4ZE4A 2EJAA 1KNWA 3YPIA 4FXRA 1NEYA 2INEA 5BU9A 2GGJA 1DQUA 2OSYA 5JH1A 4KWOA 1X8FA 1G1YA 3GXPA 1DWGM 3BGJA 1XLAA 3GWQA 4QAIA 3TSDA 1ZBKA 2VENA 3QYQA 2F6XA 3DFHA 2CZFA 2DQXA 2VC5A 1LORA 5T26A 1MQRA 1N8FA 1DIDA 1VQTA 3HPAA 3SCSA 5HXMA 4JIQA 4XAZA 2NQ5A 3A3XA 3ARVA 3IJ6A 2OQLA 1Z8AA 3N9SA 3V35A 3KOWA 2PMQA 3WFZA 2JK2A 3CMFA 1V0NA 3RR4A 1E3XA 1ZENA 1LTDA 1X96A 1JIBA 3P0XA 1T7LA 1T99A 1RY8A 2BGSA 3KCJA 3GC4A 4ICCX 3VX0A 1XRSA 2WKJA 2YYUA 2PWHA 5TIMA 3H70A 1SW3A 3ARRA 3MWAA 1FKWA 2IXVA 4H3DA 4ZO7A 3ENLA 2B31A 4LT9A 5CQ1A 3STGA 2Y8VA 4IXXA 4KETA 2G4FA 2G37A 3V4BA 5DELA 1CIUA 3PZ9A 3EMZA 3LN3A 4GBDA 2ZC1A 3P62A 4WSKA 3PG8A 3MP4A 1QOQA 3SB0A 4HK5A 3GHRA 1AQHA 4BY3A 5CC5A 2VCBA 3GKFA 1LUCB 5CPOA 3VGGA 5HQEA 1TRIA 4JIRA 2XH0A 2P3EA 2XSAA 2HROA 4N02A 2J7CA 4PTWA 4ZMGA 3WLKX 1OK6A 3KRBA 5EL1A 4JTHA 1BQGA 5G2HA 3NUKA 1PZ2A 4Z0JA 3W1QA 3A3WA 3A9IA 3T2QA 5E9AA 2PDIA 4A2SA 2PE4A 4JY9A 3WDIA 3ONBA 4BI5A 2WANA 1U5JA 1TWDA 5REQB 4NSBA 3H6OA 4UQBA 4WDUA 3RCMA 4RNHA 5CBBA 4ZOBA 4ZOAA 5EMYA 5DMLA 4GYPA 3RPDA 4HGXA 1R86A 3T6CA 4N9BA 2Y0FA 4L9ZA 4YS1A 9XIAA 1M7XA 1OD0A 2PCEA 1EP2A 2OX1A 3NZQA 3KLKA 3CZKA 2RDXA 4QHRA 5EMKA 4XISA 1MNZA 3V0TA 1WB0A 4FK9A 1DOSA 5C9ZA 1AH3A 3NA8A 1G6CA 3RX3A 1HVQA 4C90A 2PRLA 2ZCGA 3ITYA 4M1BA 3MWCA 1TMQA 1UA7A 4NJHA 1FWEC 3MYOA 3R0KA 4GVGA 4JTDA 2ZUTA 3BG9A 5E0FA 2CCRA 4JDBA 4AMAA 5JMUA 3ZLHA 3IK4A 1VJZA 2CKRA 4DUOA 4H8VA 3WFAA 2OQYA 4L7ZA 1S39A 3BL3A 3W1UA 4QE5A 1CENA 2QCLA 3L68A 2CZVA 4Q8UA 1QHZA 1R46A 2CBIA 4PN2A 4L6DA 3ARQA 2VD8A 3UJFA 3N9RA 2ATMA 4O1FA 3CUZA 4HBKA 3C8NA 3QN3A 4H04A 4ALDA 1XH2A 1NM9A 3W7MA 4DYKA 1W1B1 2VJXA 1TV7A 1HFBA 1W1TA 3I68A 1IHIA 1VFMA 3LNMA 4XZWA 2XIJA 2XPKA 1O4UA 3ARTA 1HKJA 2QDEA 3DC8A 3N1AA 4MB1A 4EWND 1K03A 3HIJA 3W7QA 4CD8A 3SN0A 4GNKB 3WZ0E 5BZAA 4LH8A 3KOYA 1DHPA 3ERPA 1TWZA 4UTWA 3VOJA 3LGEA 1QI3A 1OC7A 1VENA 3QHNA 4LY4A 4GG9A 3ZJ7A 2O9OA 2QJJA 2BY1A 3DFOA 1CPUA 3EYPA 5DCDA 1QW7A 3WEMA 2INZA 2XIIA 3Q45A 1GTHA 3LMYA 3SY8A 3LCWA 4HU4A 1XLHA 2D20A 3OZPA 3CPGA 2AGKA 4ROQA 3ABQA 1KBBA 3QQ0A 3OODA 1AL8A 1G67A 1VPQA 4HNCA 1VFUA 2WMJA 3DXIA 3GG0A 4M19A 3MZ2A 4R27A 2PWEA 1ML1A 1KKRA 1L6GA 5GJNA 4BQ3A 3E38A 3DCPA 3H4WA 1RJQA 2WBGA 1H63A 2QAPA 2DVUA 1E71M 4ILSA 4FEZA 5E1QA 3VNKA 1U5VA 1QI4A 1ZPTA 4U5KA 2LLEA 1F3TA 4UFJA 3VNYA 3CUGA 3H2AA 1OFAA 1W8SA 3A4JA 3B4UA 5LIWX 3KEHA 4EACA 1BAGA 3VK5A 1S5TA 4MUZA 2J47A 4JTRA 3CC1A 5FF2A 4D6EA 5F7UA 4QG9A 1JCYA 4OHQA 4LAOA 4NHVA 2GGIA 4ZE5A 1AZ2A 3LRMA 3UWUA 2PDFA 2E3ZA 2F7FA 2Z2BA 3CV2A 3ABOA 5F4XA 3WQOA 4M7TA 2WKLA 2VGIA 2QCDB 1XRTA 2YDRA 1JNDA 1OD8A 1LG1A 3PPHA 1EGVA 2Y88A 1JXJA 4B2DD 1KV8A 2CLEA 5XINA 4YLWA 4HNVA 5C6MA 4ZTYA 3Q67A 1JZ4A 5DFAA 1KM6A 1JGMA 3CUIA 2YL5A 2RJGA 2X40A 4JX5A 1G4TA 1PX8A 1TQXA 3G2GA 1YE6A 1E70M 2DJLA 1KV5A 3PBYA 5DXYA 5A8PA 2PC8A 3KLLA 3LNPA 3BAXA 1UROA 2QPUA 2NX9A 3U2EA 1ZP3A 2O92A 1FFQA 3G1XA 5I2UA 2FTWA 5CSUA 5IFTA 2Y8UA 4QE1A 1RBAA 1OCNA 1FWHC 3CK5A 1MYRA 4JYFA 3WK1A 3PY2A 4EAYA 3DHUA 3NTYA 2FZMA 1QNVA 3SJ3A 1UBSA 4NZFA 5ABTA 4Q4PA 1BD0A 4QIUA 3L12A 4Z2IA 2WZIA 1AUSL 7ENLA 1SFLA 1C90A 1VYPX 4AF0A 1XL9A 1JR1A 1J11A 3C3NA 4O52A 2J77A 3D46A 4EXQA 2UY4A 4CQCA 3BANA 2G95A 3EWBX 4DBEA 4JNYA 3AS1A 3R1ZA 4CQBA 4YIWA 1W1YA 1I2NA 4AEFA 2PWDA 2HK1A 3TSBA 3QHMA 2OYKA 4B3ZA 2A4AA 5FKYA 1VJSA 1EUNA 4ATDA 1EH9A 3V3WA 2FHBA 3IWPA 3AYSA 4ZFMA 5I3IA 5EA9A 1DWHM 1U30A 1XLDA 2R1PA 4B5VA 1XYMA 3XINA 1VFTA 3VFCA 2VEMA 2NT0A 4UFHA 1XIJA 3QGKC 1GOIA 2WBKA 1UD3A 4PFHA 5K2ZA 3KHDA 4JTKA 4PB3A 2NSXA 1NU5A 2PDGA 2YGYA 3GNOA 3W88A 2DH2A 2IQ0A 4G6CA 1E56A 3FFSA 2QNEA 3W22A 1Z48A 2ZX5A 1OFDA 4GIEA 3QXBA 4NYUA 1GVRA 1MUMA 3L23A 3D3FA 2G97A 3WUFA 4PEKA 4TV5A 4GUFA 3JU2A 1EDTA 1A5MC 2P1FA 4MNKA 3GH7A 5DMYA 4IF2A 4TX9A 2KX9A 3RILA 1VCGA 1FCQA 2V3DA 4ADTA 3NURA 4JY8A 5HDRA 3KRSA 3VIMA 3MUXA 2VRJA 1J10A 1S5VA 3W23A 4HNNA 4NZ3A 3ZOAA 1JUKA 4PMVA 5BCAA 1C8XA 3BMWA 3DDMA 2QQ6A 2XINA 5C2GA 4P7LA 1DTNA 2GJXA 4HJFA 4ZQCA 3APYA 5HJXA 1OC6A 1V3KA 2D2JA 1XLFA 2YW4A 3E0IA 1XINA 5CPTA 4RDWA 4WDXA 3CAWA 1X1ZA 4EPKA 4UTTC 5FEPA 1XBYA 1DBTA 3PZNA 2Q71A 5CBIA 3WMBA 3GNRA 3RJYA 2Z1KA 3LTYA 4AD4A 4FLOA 3GB6A 2CNCA 3AWOA 4S3GA 1KCLA 2PDJA 2WVUA 5L9FA 1EC9A 2FH8A 3ABXA 3CT7A 3FAXA 4A8IA 3IACA 3S3GA 1WDDA 3MYPA 4F48A 4DVOA 4I5RA 1S2TA 2V68A 3PTMA 1IEXA 2RDWA 3QY6A 5DXXA 2D0FA 4MF4A 5I23A 3V7PA 1TPFA 2J78A 1QBAA 2CLKA 4S38A 3OQEA 1D2KA 1VPXA 2O0TA 1JFXA 4Q8PA 2V3FA 4YCPA 4AZGA 2QCNA 3EXSA 3J7HA 3FOKA 5D03A 3CIXA 5HNUA 2ZTJA 3RNDA 1PJ9A 1WPCA 3EWYA 3OBAA 4BQ5A 1WOAA 2YBTA 4LBUA 5K4ZA 3MZNA 4HU0A 1EC7A 4L6OA 1XBZA 2OWXA 2HVOA 1VEPA 3S42A 1W2PA 2Z00A 1R85A 3THUA 5D33A 1RCXB 1Z3NA 3MKCA 3W74A 3V16A 3PUGA 1FH9A 4RZ5A 3LSBA 2DUAA 4QROA 2X2YA 2GJXB 4LCSA 1X1OA 8XIMA 3ZO9A 2ZX6A 1AODA 2VX6A 3ITLA 4LVGA 3C5QA 3CHVA 3NZPA 4JTJA 4ZFCA 1HQTA 1JPHA 4MWAB 3NXLA 3CAQA 3OBKA 1ISZA 4GI4A 1HTIA 4ZOEA 2OB3A 4AZ7A 2EG8A 4HZMA 1IWBA 4DWSD 2I17A 3L67A 2FTYA 3APGA 3ZXWA 1JCTA 1XLBA 1MO0A 2BVYA 2RKXA 2WLYA 2YB4A 2CBVA 1PZ3A 3Q4DA 1JCJA 1R3VA 4V28A 3MKKA 4DJFD 1J93A 2OXNA 1E55A 4RE2A 3M6DA 3GUWA 3HPZA 2FJKA 4MFEA 4AHQA 1TIMA 3CMGA 2PDHA 3R11A 3W81A 1R9XA 1UKQA 3ALFA 2REQA 1UYQA 3TP4A 5EBAA 4HQVA 4J35A 1WYIA 1RQHA 3VIIA 2ZX9A 3WLRA 1TREA 4XZHA 4M82A 6A3HA 1AA1B 4ROPA 3CQKA 3WYZA 3UVAA 3U6WA 4AY7A 1FA2A 1EOMA 4GIRA 4UNIA 2NUYA 3GNDA 1KW1A 1SZFA 1Z41A 2WMFA 5LA2A 4CVUA 1P7TB 4L1GA 3TYAA 1VB9A 1GEHA 2UY5A 1VR6A 3FGCB 1E40A 1Q3NA 1QDSA 4CD5A 3E5PA 4WJXA 1XLMA 2WO5A 2J74A 2C7FA 1WXYA 4AMCA 1WOBA 1XGEA 3R2GA 1UPMB 1WE5A 2QJNA 3L65A 4CU8A 4ZB5A 1BWKA 3W85A 4PFMA 3S1VA 1VP5A 4DJDD 3CWHA 1OB0A 3RN6A 1Z6KA 5DT5A 5CZTA 5JH2A 3SUSA 3R7MA 3OG3A 2WVSA 3WNMA 4JKLA 1GZJA 3KCLA 3N12A 2QHAA 4D6FA 1TO3A 4L6HA 2J79A 4C5ZA 3M0KA 4FX8A 1F74A 5BYWA 1BF2A 3Q58A 1FQ0A 4GQ0A 4F0KA 4FF7A 3WK2A 3W1MA 1WZLA 2C1GA 2QCDA 1Q6GA 1I60A 2WYSA 3H7RA 3DGRA 1V03A 4D6DA 3IIVA 4I6KA 3V36A 1QNRA 5G2WA 4GACA 4Y96A 3MUZ1 3NEHA 3NGFA 1GZ1A 1IZCA 4I9JA 2YLLA 3M41A 3L21A 4GI8A 1G9HA 4Y8EA 4CCDA 3HG5A 3WNKA 4E2BA 3TA6A 4A4AA 1KWKA 2OKTA 1OVDA 3SIZA 1UUMA 1QXLA 1DXIA 3G1AA 3KTXA 2ESCA 3N25A 1JPKA 3ITOA 1FWTA 2H8ZA 1W9PA 1A5CA 5G2IA 1LM1A 4REQB 4X2RA 4E6MA 3H23A 1UWUA 3WJXA 5LXXA 2P76A 4O28A 1ZP4A 4GZ7A 3M4HA 3RFAA 4DY1A 1KFEA 4HN4A 5IDZA 5JUVA 3NYZA 3PJWA 4D6IA 3QOMA 3AS3A 2J25A 2UZ9A 1OX5A 5HWJA 1V3IA 3SUTA 1C92A 3ABSA 5CC3A 1WNOA 1QR7A 1XYBA 2PFHA 3OZYA 1UZ1A 3S9IA 1K4HA 3TYZA 4F0LA 1YQ2A 3NOYA 4PMUA 1WDQA 2PB1A 3KVMA 1P6WA 5GJMA 3R5EA 1JZ5A 3VKAA 1X7IA 4GJIA 1ZBCA 4GH1A 3I65A 2XFRA 1GKRA 3UF9A 3LRKA 4NZ4A 3QKZA 3VOIA 3JZUA 4QP0A 4LALA 1T5AA 2VEGA 3F2CA 3PP7A 3BCDA 5M5DA 2OTDA 3OYZA 3THQA 3MB9A 2EPLX 1ZY9A 4YVXA 4FMVA 4P7OA 4XIAA 3M16A 1XYCA 3HA1A 2L5HA 4CD7A 1HGWA 3HO8A 3PBGA 4NP7A 3VDBA 5HR6A 4FOJA 3LY0A 3LPPA 4Q8OA 3UZWA 3AALA 3RIKA 4Y9NA 1REQB 4BZYA 5D02A 1S5MA 5I3DA 4A8NA 2WWDA 1MSSA 3CL6A 4G1KA 3HJZA 1XH0A 3H21A 4RE4A 4ZO8A 3S6OA 2XU2A 4DO6A 2ZDRA 3BLDA 3DGBA 5F1UA 5HANA 4EF9A 4L61A 4MHBA 3WO8A 3HPFA 4L4OA 3GNPA 1LF1A 3S4TA 1J0KA 4YNGA 2FH6A 4LYKA 2C8NA 4GUHA 4MNLA 2GGEA 1AJ2A 1O12A 2YDAA 5D30A 1AL7A 3TK7A 3KWXA 3U9IA 4YCOA 2A3AA 3QW3A 1V7AA 3V1HA 3KBJA 2EPKX 2CHNA 4Y7EA 3AIVA 3S1GA 1XX1A 4YMZA 2HEJA 2O9TA 2PDLA 3ZZ1A 1WZKA 5I3HA 1DXEA 5IXEA 4DWSC 3WLTA 5A6KA 5IHRA 4QLJA 4O50A 3UZYA 3W37A 3SN4A 1LCOA 3SRFA 4PTXA 5HMFA 2DY3A 3W1AA 1M1BA 3GXTA 1BWVA 3FVDA 4IPPA 5AYBA 3AYTA 2DFAA 3PPCA 2H3BA 3L5MA 4WOZA 5I24A 3B9EA 2VUNA 2VC6A 2ZVIA 5GQBA 1C29A 3CL8A 3LI1A 1GONA 5SWUA 3PFRA 1B3YA 2EAWA 5AHIA 1TZ9A 4IGSA 3UT0A 3LEPA 2BOEX 1W9XA 3SSJA 3HQ1A 1K8CA 2RHGA 5HULA 1WDSA 1W9BM 3N2CA 4KRTA 1N2VA 3OW1A 4JFTA 2C1HA 3B0YA 4E2DA 3HGOA 4Z1BA 3UQNA 1PEZA 2OODA 5EB8A 3FNDA 3WNLA 3ME3A 1CXEA 2Q01A 2GJPA 1JD9A 2ZDSA 2A5HA 3UYIA 2NQ9A 3IANA 4GXWA 4X0NA 1FWFC 1OCJA 2X30A 5F2IA 1EJUC 1TZ7A 3IJ7A 2ZX7A 1ICPA 1F6PA 2Y5JA 1H51A 2FYMA 2I7GA 3W86A 1UJPA 1W3LA 2ANUA 4ATWA 3D6NA 2VOTA 5AYZA 3QZ6A 1FDZA 1H7PA 3QYSA 3A47A 3BAYA 2E5BA 4IMGA 1UZ4A 3NPUA 3E2SA 2DSWA 4IIDA 1H11A 5G1YA 4NILA 4PUKA 1XC4A 3AICA 3BSGA 3FJNA 3NGJA 2J8FA 3Q94A 3P3BA 4RXGA 2XG9A 3T0TA 4B4FA 4LVBA 4TOQA 1RA0A 4H1ZA 1EIXA 1V0MA 3ITGA 1PL9A 5H2ZA 1XFCA 3BLOA 3AUOA 2GSJA 3S5ZA 3A5FA 4LUJA 5G1TA 3Q2DA 2NVAA 1ZJAA 4ICMA 4DIAA 2WVVA 4IJBA 3R58A 3QPYA 4LS0A 1XV8A 4XD3A 1I0DA 1BSLA 2ODOA 3GU1A 4A35A 4TU1A 3VIFA 4RXFA 2A85A 3CQIA 4CN6A 4O15A 2GQ8A 4GABA 4FPSA 3L0GA 1V51A 3VIGA 4ASTA 4AUBA 4KKXA 1XIEA 2PGWA 1BKSA 2YB1A 5HNNA 4KGLA 1YX1A 5E5CA 1ZBVA 1R47A 3TE9A 2EEXA 5C2CA 2BGQA 4MJ2A 4B5XA 2JKEA 2CYGA 1R2SA 3UG3A 3WY1A 4LUSA 4XZNX 3BZGA 3CU2A 1MQQA 4HA4A 3UPWA 4LUIA 2YW3A 1RBOB 2I9UA 3O0KA 1HL9A 2Q8XA 2E6YA 1L6SA 5LNRA 3MPGA 5JBFA 1AD1A 4IJRA 1RY0A 4E3VA 1HJQA 5EMUA 3W70A 3SR7A 1X38A 1VLWA 3T44A 3G0XA 3MBFA 3SCTA 2YCIX 4TVCA 2PD9A 4BA0A 1J18A 1OABA 4NAEB 4Q8WA 3W1NA 4D1IA 1TPUA 2O7QA 4JYEA 2QCMA 2XGIA 4UQAA 4P7QA 1E6SM 2VRQA 3HFYA 3LG3A 3N04A 3MT1A 2OT0A 3PB0A 3VNDA 3PZVA 4JQAA 3DFYA 2FB2A 1XQLA 5CPLA 2FGBA 1GYLA 4J3ZA 2NV1A 1MNSA 1LDCA 2E5DA 2GOKA 4MFDA 4RPPA 4AQLA 2QUUA 4LVDA 4LS2A 1RUSA 4AXKA 2B7QA 1RCQA 4U33A 1WP6A 2GVJA 4RPQA 1O7AA 3H7UA 1XCWA 3ES7A 2QKFA 3GXFA 4RLIA 3B8UA 2PF8A 3LXBA 4PTVA 2YPIA 4FR6A 2CIPA 3S5YA 3WQGA 2XWDA 4AVFA 3HM7A 1PKMA 9CGTA 1I1WA 3PBVA 4H2HA 2GSEA 4GCAA 3M0IA 3QOKA 3S1UA 2W63A 4GXPA 1BVWA 2ZZ7A 1Q8JA 2A7NA 5CXPA 4Q32A 4LUTB 3U8GA 3S6TA 4MZYA 4MWAA 3UWWA 2OO0A 1RAKA 3KAOA 5CSYA 2CWXA 2BGNE 1PE1A 1UD6A 4A8LA 4OECA 4H7VA 1OINA 2BVTA 3EDEA 3UW6A 3WQ8A 4GK8A 3JRKA 1NWRA 3COTA 1J0HA 1XS2A 1H3GA 4G7EA 3OO2A 3GXDA 4UTJA 3LM7A 1QW9A 4DYEA 1F3WA 4LY8A 4PSPA 3REQB 2YX0A 3IJ8A 3BLPX 5FEZA 1QPNA 4MNJA 4QR6A 2PDUA 4NNBA 4HPHA 1IZKA 1HO4A 3UBPC 2I9EA 3G1FA 1CI1A 1JDAA 5CBJA 2OFJA 4LNYA 2HS8A 3UJRA 3WJYA 4GRSA 1XIDA 3KOZA 4TX6A 1FWGC 5DN1A 2CLMA 2WHMA 4MPQA 4P8VA 1FUYA 3JS3A 1X8CA 1O5XA 3CUFA 3O06A 5GNYA 4OFCA 1GHSA 3L4WA 2WZTA 1QFEA 1AQMA 2Y62A 3FYYA 3CLMA 2CITA 3CL7A 2WK2A 2XJ7A 4P7NA 4O14A 3EBVA 5A8QA 1E6NA 1FXQA 1LT8A 4UR9A 3OBEA 3BW4A 4QX4A 4H7CA 3QV7A 3TVAA 2AKMA 4MADA 3HFTA 2VKZG 4PULA 2BHZA 4U31A 3WJZA 1E5NA 3BAWA 3SCNA 2X1TA 3GVWA 2Y85A 1K3UA 4GNJA 5J5RA 1JPIA 1XLKA 4C1LA 3LLXA 5C0QA 1SW0A 4DJEA 4PR4A 1TELA 3EZ4A 3T4WA 3GG7A 2POTA 1CYGA 4DM1A 1U1UA 3CIWA 3TOPA 4OQVA 4BF9A 3MC5A 4HA1A 2HS6A 3GY1A 3MCNA 1GJWA 2E8YA 2PS2A 5D4YA 2CETA 1W5QA 3W7NA 1P0KA 3CB8A 4HMEA 2AMXA 4MVAA 3POHA 3A4XA 3ANVA 1VHCA 3EB3A 3G1YA 3HG2A 1E6QM 2HRWA 2F38A 3M9YA 4L4MA 3BJTA 2DEPA 3E2QA 5LYRA 4K36A 1H62A 5HQLA 1DJZA 4I7VA 2QCGA 4CVWA 1FWAC 3VIPA 1BTMA 1ALDA 2IQTA 3BV4A 3IIPA 1QNQA 1TR1A 3U0HA 3V5FA 4XK2A 5LGXA 4YHGA 2FHFA 3O6CA 3CLWA 3RMEA 1I8JA 4LVFA 3OGSA 3EEGA 3MW7A 4AIBA 2GJRA 3WBXA 1MUCA 3MV01 1VFSA 3FY1A 4J3UA 4RDYA 2PRHA 2GLKA 3RM4A 3UG5A 5J8LA 4UQDA 5I06A 2QUTA 1SMDA 3AHTA 3G0SA 2O4QA 1DIOA 4FXFA 3L4YA 3OVGA 2OOFA 4H9TA 4C91A 3HGJA 2RH9A 1PIIA 3CH0A 4I9TA 2JALA 3N4EA 4DWSA 1L6WA 3P0WA 3U5YA 1NDYA 2E9LA 2V30A 3VD7A 3VU2A 4JAWA 3F1QA 2WC4A 2FZ9A 5G5IA 3C2FA 3B0PA 3LM3A 3EWWA 2VEPA 5ECUA 1E0TA 4OJYA 2BLEA 3S83A 3I3BA 4JQ3A 1TPVA 5TF0A 1MRQA 6XIAA 1B3ZA 4ZO9A 3NJ3A 1XIMA 2VX7A 1HN1A 4IM4A 5DLCA 2A3CA 2C16A 3GQYA 3R10A 2OEKA 1GQJA 3DG6A 2Z2AA 3T2OA 3RJXA 3K4AA 3DG7A 2HTMA 3VE9A 3W82A 2QMKA 1VLIA 3CASA 3ZVHA 3OB8A 3WJWA 2QT3A 3PAOA 1UR0A 2PCQA 3XISA 4MYXA 3VKDA 2POZA 2QGYA 4PMYA 1J0JA 2WHJA 1GOWA 1EHAA 1SJAA 4IMEA 5AZ0A 1K70A 1DIEA 4M51A 1Y5WA 5LIXX 1TX2A 3C3UA 4JQ4A 3PZMA 4KIRA 1H2JA 4WCJA 4PMJA 1JAEA 4NNCA 3QSRA 5G4WA 1K77A 1XR2A 5CZSA 2Z7KA 1E4IA 4HYVA 4J2MA 1E6XM 1F76A 4GX8A 4XG1A 4N6EA 1OY0A 4UFKA 4LAKA 3SGUA 4DF0A 1IGWA 1E51A 1XW8A 2VWSA 4EKJA 2FJUB 4IIFA 1G7UA 1HP5A 4PYSA 3BMVA 4KPLA 3LSCA 1RXOB 4F2TA 2CHRA 4GY7A 3CO4A 1WXZA 3F4DA 3EWUA 4QCEA 3H2MA 4GA8A 1UR1A 4KCVA 4JFWA 1PZ1A 3LRLA 4PSRA 1DV7A 1FKXA 1P0DA 4MOZA 3ARYA 1NVMA 2QLYA 3CGTA 3JR2A 2IMRA 3OLIA 4FR1A 4RNIA 4QISA 1WDRA 3BG5A 1AW2A 1M7PA 1XYLA 3W1RA 4F66A 2BWGA 4KRZA 4GISA 2GYIA 3B8TA 1WZMA 2CLOA 2J27A 3G3DA 3ARUA 1ZCCA 1VF8A 1U22A 4L9XA 4NIRA 4B9YA 4Y90A 3HGSA 3NVDA 2WNQA 4UMCA 1NF0A 1UC4A 1FBAA 2O9PA 2ICSA 1YIXA 4H9UA 1RJRA 4W8AA 4M24A 3BARA 2H9AB 3T40A 2J13A 2PDWA 2ZYFA 4XUYA 2DJXA 3GO2A 1GVFA 2PDMA 1A5KC 3TROA 3CZGA 4PC8A 4Z42C 1KRCC 3FYPA 4NL1A 1ENUA 2DZSA 3N4FA 4FLRA 5D38A 2HWGA 1YBQB 2ABBA 4UIOA 1J4EA 3URBA 3MSYA 2WMHA 1VBJA 5K3VA 5LHEA 3NL3A 5I5RA 3UZJA 3TR2A 4PBGA 3HN3A 3IJ9A 4HMNA 1MXGA 3W1TA 1E0XA 1OFOA 3PJXA 4PL1A 4NY2A 4NX5A 1ISYA 3W3OA 1LG2A 1JYNA 1GYNA 5K7JA 2E7FA 2J66A 6REQB 2GFTA 4PRWA 4EVZA 1WKDA 4JHZA 2QJMA 4MB5A 4HMCA 2NVDA 2YLAA 1SU5A 5I78A 1E15A 1H50A 1V5XA 2EHHA 1V4YA 4M6PA 1DE5A 4D9PA 4I3GA 2WM1A 4UTHA 1QPKA 3MHGA 1QMLA 5I00A 1JPDX 7XIMA 4CCZA 1ONEA 5EFFA 2ATSA 4IMCA 3URAA 3VD4A 3LXAA 1SQ7A 1V02E 2WNZA 2B4GA 5A6BD 5CC7A 3DFSA 4GC3A 1T8QA 2X8RA 3B8VA 1V0LA 4OV9A 4HNLA 4A21A 2YL9A 2O56A 4FLSA 5CPSA 3GBEA 4AH7A 3G18A 3ATYA 3WF2A 4S2CA 3T4CA 4I90A 1FX6A 1R7AA 3GVGA 3WFLA 5KSWA 3DHPA 1X1NA 1GVSA 1VS1A 3ZR6A 5HATA 2E77A 3TEVA 3LPFA 4R3UA 3IUIA 3ZT7A 2ACUA 2E5CA 4Q4MA 1PWMA 2X09A 3RG6A 3T05A 2V5JA 1YMYA 1EL3A 1US0A 1AG1O 4O0QA 2PD5A 2JF6A 4Z1YA 3VABA 1H7WA 4IPIA 1OGGA 1Q4NX 3PG9A 3UJSA 3ZJ6A 3EPMA 3R0UA 1H0GA 1VCFA 4DZHA 3AUJA 1HT6A 3KWSA 1TTIA 4LEFA 4G8TA 4WGXA 1A0EA 3VIKA 1L0PA 1XIHA 3RLGA 4Z2JA 1LRTA 4NI3A 4WY0B 1IYXA 2W91A 4Q7NA 1FHUA 1YTDA 4XAPA 1QBBA 3ISIX 4Y9MA 5HOSA 3LENA 1ISVA 3CEUA 4NX0A 3T9PA 3FHQA 2QUNA 2EF9A 5HA7A 3Q65A 5D09A 1J6OA 9XIMA 1P6BA 1E6RA 2FPTA 5DBTA 1RD5A 3VX1A 1PKYA 2XFWA 1T40A 3CNYA 4JYDA 3WCZA 2OEMA 1TMHA 1OC5A 3ICJA 3W4RA 3G5EA 1PDYA 3I3EA 1UWRA 2VQUA 3AU2A 1SMAA 4U2ZA 1S3TC 1G69A 4L5ZA 5B7ZA 3W27A 1R9ZA 1DWAM 1LZOA 3BLLA 3VD3A 3NSNA 4MY9A 1GQNA 3ZJ8A 1IXNA 4HVXA 1Q2SA 1XG3A 1V93A 4H9ZA 2PURA 3UU0A 1CLXA 1HL8A 3M5VA 3ECQA 2BFGA 3CZEA 1GVYA 1B0IA 3FSUA 2WZHA 4KWVA 1IQ8A 4N42A 4DWSB 3W73A 1ZAIA 5EPDA 3WN6A 2QXWA 3GW3A 1XPGA 4US6A 4JFSA 4ZXLA 5DCEA 3R4IA 2FMOA 3BXWA 2D0HA 3KBWA 3QFWA 4YTQA 2IS7A 1JPMA 3UNDA 1W6TA 5I0DA 5DQPA 4LF1A 1ME8A 3KX6A 2BDQA 3MMWA 3W7GA 2CBUA 1LOLA 5IOBA 3CHFA 3MI2A 1GVEA 3AIWA 1GEQA 1P48A 2VR4A 3TQKA 3GNXA 1US2A 4NXSA 4RL3A 1BYBA 1CTNA 1PHWA 4PMQA 4UZUA 3H2OA 1HXJA 4I8YA 4H2CA 4IH3A 5DANA 1QPQA 2Z1BA 2WZEA 4Q8NA 3BJFA 3DI1A 4HIBA 3WQ6A 5XIAA 1AW1A 1R3WA 1M3UA 1VFLA 3LERA 5JIWA 2QR6A 5CKSA 2J8TA 1KM5A 2X7VA 4D6HA 2J8GA 5F2MA 4AG0A 2D2HA 4DUXA 1UKTA 3GK0A 4Y6GA 3LOTA 2OLHA 1ICSA 2GJNA 1Z44A 1X6UA 4TTUA 3P6LA 3OLGA 3OOQA 4GC4A 2GDVA 5E0KA 2R9RA 3G8EA 1BYCA 3IGHX 4HPJA 4XVDA 4JEJA 4TV6A 3W6LA 1JL8A 1LT7A 3WDQA 1BG4A 2V5BA 1I9CB 2Y1HA 4XKMA 5B80A 3AXMA 3LUTA 3BV7A 1TPWA 3QTGA 2I57A 1W1A1 1KBKA 2W5FA 1AQ0A 2DZAA 1XLLA 4R33A 7ODCA 1JXKA 4HJWA 3DYMA 4ZR8A 1Z69A 2XM2A 3VAVA