3LBOA

Human aldose reductase mutant t113c complexed with idd594
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
314
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 314
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lboA00
3BURA 4YVXA 3R6IA 4GA8A 4PUWA 4OTKA 3CMFA 4GABA 1S1PA 2VDGA 3GHSA 4AUBA 1US0A 2PZNA 2PDLA 3Q67A 5HA7A 1VBJA 3LZ3A 2PDQA 1T40A 1GVEA 2BP1A 3LENA 4PUUA 4L1WA 3CV7A 3LQLA 3LZ5A 3UGRA 2PDMA 2FZDA 2HE5A 3UWEA 1Z89A 4GQ0A 4JTCA 2C91A 3WBXA 2HV5A 5AZ0A 3LBOA 4WEVX 1AZ1A 4EXAA 4I5XA 3DOPA 3GHUA 4IGSA 2PDWA 4QX4A 3ERPA 2CLPA 3F7JA 3GUGA 2IKJA 2IKIA 2INEA 3G1RA 3G5EA 4JTRA 4XAPA 2NVDA 3WG6A 4LB3A 4GACA 4WDTA 3B3DA 1RALA 2ALRA 3UYIA 2ACQA 2HVNA 3V0TA 1QRQA 2PFHA 3CV6A 2PEVA 4Q3MA 1VP5A 1Q5MA 3MB9A 4YVPA 2HE8A 5HNTA 1SM9A 2BGQA 3V36A 4LBRA 3M0IA 4YVVA 3RX2A 4QBXA 4Q7BA 1Q13A 2PDNA 4F40A 4JIRA 1PYFA 4YU1A 4WDXA 4LAUA 4H8NA 3VXGA 1XGDA 1RY0A 4JQ1A 3V0SA 4XO6A 4GQGA 3WBWA 1C9WA 1JEZA 1T41A 3ONCA 2I17A 3CASA 1LQAA 2ACSA 4R9OA 4JTDA 3WBYA 4XVEA 3O3RA 3EAUA 2INZA 5HNUA 1IHIA 4H7CA 1Z8AA 3T42A 4ICCX 2WZMA 1YNQA 2HDJA 4PRRA 4RPQA 4FA3A 4JIIX 1RY8A 3UZYA 1Z3NA 3H7RA 3BV7A 3CAQA 2HEJA 2I16A 3N6QA 5LIUX 1HQTA 5KETA 3UZXA 1S1RA 2PDCA 3S3GA 3V0UA 1AH4A 2DUZA 4JQ4A 1MZRA 2ACUA 3D3FA 1YNPA 3N2TA 3M4HA 1IEIA 2DV0A 2HVOA 2PF8A 3UZZA 1EL3A 3Q65A 4GIEA 2F2KA 3LEPA 3WCZA 4LBSA 1PZ1A 3FJNA 3GHRA 1R38A 2IPWA 2IKHA 5AZ1A 2A79A 3NTYA 1K8CA 2FVLA 1ZQ5A 3KRBA 3EB3A 2PD5A 2FZBA 3R8GA 1PWMA 3UP8A 5LIXX 1Z9AA 4JQAA 3MC5A 1EF3A 4WGHA 3R8HA 2PD9A 2IQDA 1M9HA 4XZHA 4PMJA 2J8TA 4NKCA 5JH1A 4FALA 4XO7A 4XZLX 3R94A 1YE6A 1ADSA 3H4GA 2PDBA 3EB4A 4YS1A 3LQGA 3C3UA 4LAZA 4LB4A 2IPGA 4XVDA 4XZMX 2FZ9A 4EXBA 3R7MA 1ZSXA 4DZ5A 2PDJA 3UG8A 2R9RA 1LWIA 4DBSA 4WRHA 3LD5A 2FZ8A 4IJRA 4XZIA 1S2CA 1XJBA 1YE4A 2ISFA 2PDYA 3FX4A 5LIKX 2IQ0A 1J96A 1XF0A 4HMNA 4FAMA 3RX3A 1EKOA 1ZUAX 3P2VA 3GHTA 2P5NA 1AH3A 2R24A 3R58A 4DBWA 4WDUA 3UZWA 5JH2A 3U2CA 2PDIA 3CAVA 3M64A 5DANA 4G5DA 4HBKA 4JQ2A 2BGSA 1MI3A 2PDPA 4ASTA 1OG6A 1QWKA 1X98A 2DUXA 2IPJA 1AH0A 2FGBA 3COTA 2QXWA 3O0KA 2PDHA 1FRBA 1X96A 3H7UA 1HW6A 2PDKA 4ZFCA 4MHBA 1EXBA 5LIYX 2PDXA 3DN5A 5M2FX 4JQ3A 2IPFA 2F38A 5LIWX 4QR6A 3LUTA 1MRQA 4JTQA 3V35A 4IJCA 5C7HA 3ONBA 1PZ0A 2WZTA 1AFSA 4FZIA 3UFYA 4JTAA 4PR4A 2PDFA 1PWLA 3LN3A 3R43A 4GCAA 3BCJA 2PDGA 2IS7A 1A80A 2PDUA 4XK2A 1UR3M 4L1XA 3QKZA 4JIHA 1S2AA 2AGTA 2IKGA 3LNMA 2ACRA 1AZ2A 1X97A 4PRTA 2NVCA 3RX4A 4XZNX 4DBUA 4QXIA 1ZGDA 3BUVA 4WDWA
chains in the Genus database with same CATH superfamily
4NAEB 4YVXA 3TSBA 5AHLA 5MF5A 4FR6A 3W1LA 2DT2A 4ZXLA 5D2VA 1KM3A 3QBUA 2YKKA 2XIMA 3MUIA 1WPCA 4AIEA 3TTEA 5T9BG 4D9PA 4P8XA 4ATWA 2Z27A 3NYZA 1D3GA 1TJ1A 3A3HA 1NWTA 4TV6A 3H24A 2Q8ZA 3TQKA 1K4HA 3FXYA 5IDIA 2VVNA 4JL2A 3BAXA 2J8GA 3HB9A 2Z1BA 4JEQA 4DN1A 3USBA 4ZFMA 3IANA 4PCFA 4MLJA 4PMYA 4C5YA 2V5LA 2C91A 4WJ8A 2Z00A 4OUEA 1EHAA 2VGBA 1ESWA 4IJBA 3GVGA 3EWWA 1XW8A 2J13A 1YDVA 3SGUA 4HSNA 3VIKA 4B2DD 3PZVA 5LA1A 4L56A 4FO4A 4B5XA 1FCVA 1IXPA 4JFWA 4QX4A 4JX5A 5EBUA 3EA2A 3MUZ1 3HGSA 5CC3A 4UTJA 2QUNA 2CHOA 1XLDA 3M7WA 5D8ZA 3NYDA 3HBLA 3Q58A 3ZOAA 3VCNA 2J8FA 1TPH1 4DYEA 2C0HA 4M3PA 1H7NA 3GAYA 4D6JA 6TIMA 4PEKA 3S0CA 4K1GA 4RE4A 3QFWA 2PFHA 3WJXA 3NQBA 4XBJA 1GOQA 4NZ1A 4A35A 4PZVA 1EP1A 3S2CA 3EOUA 4FLQA 4LV9A 1VLIA 3DDMA 3AHZA 4PL2A 4GO9A 1JCXA 5L9FA 1CXHA 5I5RA 3DUGA 1LBFA 1KGUA 3UVAA 4YJ5A 4O0KA 4LOCA 4CLMA 2EKCA 1NF0A 4QHRA 1R87A 3CH0A 1RPKA 2OMAA 2YBUA 3LU2A 3VUPA 5M17A 3UJEA 3NJ3A 4RUBA 3O2LA 4GUFA 3L67A 1JEZA 2FKPA 1XKJA 1TPEA 2A3CA 2QAPA 3K4WA 1T8XA 2PCEA 1XLIA 4GO8A 1I6NA 3QGAC 3FLUA 2INZA 3C0SA 2I14A 5CPSA 4ZEPA 3M0ZA 1YNQA 4LTSA 1K7EA 3P6LA 3GDKA 1GKQA 3A4JA 3HIJA 1VD6A 1N8WA 2JEQA 2FTWA 2Q3OA 3PSWA 3P84A 1S1RA 1F3EA 3A4XA 3NQMA 4MNKA 1UZ4A 1I75A 4DI9A 4ALDA 3EX4A 2C0AA 2ON3A 3ARXA 3SZ8A 4UIOA 3CWOX 3VOIA 1XG3A 4PFMA 1LDCA 1XWYA 4M1BA 3PJXA 3FEMA 5AC5A 4GBUA 5DT5A 1PZ3A 4NZJA 3GXFA 2ZZ5A 2FVLA 4ERGA 2WKJA 3U57A 1LQ0A 5HINA 1ZQ5A 2FZBA 3TLQA 5A6JA 1J0HA 4Y2WA 1G0CA 2VFHA 3M5ZA 1H0IA 2J7CA 3TC6A 5FACA 3R8HA 4W93A 4BK9A 3GVRA 3OZPA 4OV4A 1V51A 4GNKB 3NZQA 3NEHA 4NJGA 4WUIA 3AXXA 3VIMA 3PFRA 3KX6A 4MWAE 1CGTA 5DBTA 3D47A 1NDWA 2QPUA 4P7QA 3C3UA 5EB8A 2WMIA 2QAFA 1GYLA 3WK2A 3UXKA 3UGVA 5LZLA 1OCQA 1PHWA 1P5BA 3TV8A 1I0BA 1OABA 1A5NC 2EF9A 3H2OA 3CV2A 2FZ8A 4CGTA 1OK6A 1K77A 5LNRA 3TK7A 3WLKX 5J5RA 3M0LA 3ITTA 4W87A 2BXZA 4HMNA 1FCBA 2NQLA 5LGZA 3TX9A 1Q63A 2BBFA 4NI8A 1XGZA 5DELA 3S1VA 4JYEA 3IJQA 1TG7A 1W1B1 3CHEA 3FKKA 3SY8A 2G97A 3SUWA 4K68A 3MP4A 5C6MA 2XIBA 2NXHA 3N73A 1TWIA 1UZDA 1BFNA 2YCLB 1VHCA 5F2IA 2R94A 4B5TA 3KZSA 4Z1CA 2TAAA 1A0DA 1EUAA 4RK8A 5FOOA 4F3HA 2WJDA 4RL3A 1OIMA 2BZNA 3BLEA 2P0IA 4A05A 3KWSA 3V5FA 1BD0A 2VFFA 4A2RA 1J2WA 2HXTA 1GORA 1QNRA 2A21A 2DVTA 1F76A 2V38A 2NQZA 5CJ5A 1GPFA 2BHZA 4E38A 1RPXA 3KM8A 4YN5A 1FHDA 2P10A 3WQOA 3NAVA 5U4NA 4HYWA 4S2CA 5CG7A 4JD4A 3UFYA 3WLJA 3G1DA 1W0MA 4UOQA 2VDIA 1EWEA 1GW9A 3MMTA 3WIJA 2W6RA 1Q6LA 1UD2A 4MB5A 2PGEA 1LF1A 4A8RA 4I7VA 1GVIA 3AYSA 1S2AA 3PWIA 2J75A 3EMCA 2O7SA 3UG3A 1OC5A 1ME9A 3O8AA 1H7OA 2GJXA 3PBUA 3SCSA 4J3VA 4IXHA 1F4HA 4UOZA 4BWLC 4WDWA 3BURA 2DFAA 4JX4A 3MVIA 4PUWA 3L0NA 1E0WA 3G1VA 3ITLA 1I2OA 2VDGA 3UG5A 2O9TA 2UY2A 3TAOA 4KFNA 2EO7A 1BF6A 3IS4A 5FJIA 2PDQA 3THUA 4NJJA 4I3GA 1QK0A 1CXKA 3O16A 2F6UA 1HO4A 6REQB 4ZQPA 4JNYA 1HGWA 3KL0A 3NM1A 3FV9A 1E6ZA 1VR6A 3NQEA 2CLFA 1BG9A 5KSWA 4WKHA 4O57A 3W23A 2C7FA 4GXWA 1MNSA 1TE1A 5DRCA 1S38A 4Q6XA 1OGSA 2HV5A 3DXIA 3LDVA 4MAVA 4WSHA 5K2ZA 3APGA 2EPHA 3LBOA 4KWSA 3UERA 1KTNA 5I0DA 4ZQRA 1TVNA 3GR7A 1QBAA 3NQ2A 1SW7A 2QJIA 1DIEA 4JIQA 4P8VA 4LUTB 4IGHA 1BGGA 4XBKA 1M04A 1EX5A 2Y8UA 3VIGA 2QMJA 1SZGA 5LNVA 3BSHA 3ALGA 3OLGA 2YPIA 1BHGA 4JFVA 1H61A 1UPPA 2YZRA 3LCGA 4FLRA 1O4UA 1PSCA 1VJIA 1ONEA 4HN4A 3WDIA 4NZFA 3DFQA 3R13A 2OOFA 5AC7A 1FWWA 5HNTA 3ALFA 1M1BA 2X05A 2DT1A 1YQ2A 5IBXA 4LBRA 5BXPA 1GHRA 1A50A 5GJMA 2WPBA 3WLTA 4CNTA 2XH2A 4CN4A 4J3TA 4QBXA 3UPBA 3MUXA 2CHNA 2OWWA 3B8SA 2Y7FA 1QPQA 4MFEA 2YDRA 2Q01A 4LAUA 4H8NA 3IJLA 1QNOA 3PAJA 2GWGA 1JZ3A 3LCIA 2YW4A 3MWCA 4M6QA 1QWGA 1IWBA 4AYGA 2ACSA 3URAA 3GG8A 1BWKA 1SVDA 1RHCA 2XM1A 1V03A 1GG1A 2DZXA 2JGYA 2ZX5A 3CEUA 1FXQA 3P3BA 3ARYA 5FCZA 1F74A 4RR4A 4AWUA 2HPMA 1ZJHA 3W7JA 4IICA 1JQVA 1ZP3A 4FOKA 3IK2A 2VR2A 5EMYA 4D6IA 3AYVA 2O7QA 4IG2A 1DORA 2XVNA 3AS1A 4HU3A 1X39A 1Q6RA 2DSKA 1WUEA 5HULA 3M44A 4D8ZA 3WJZA 5JBFA 4Z1AA 6CGTA 4GBDA 4L4PA 1XYFA 3SRDA 3T0CA 3QPZA 1U1JA 4ADTA 2PLMA 4CCCA 1NOFA 3PANA 1XPGA 4TIMA 1UH3A 4DJDA 3Q2DA 1DBTA 5J04A 5ABFA 1LORA 1KFWA 2R82A 3PTKA 3S5SA 5I00A 1EC8A 1X7IA 4JFSA 4PUKA 4Q6JA 3OVPA 1EF2A 1EXPA 3TLLA 3RRXA 2Z24A 2OZ3A 3GH5A 3E1F1 3Q45A 1RK5A 3BLLA 4FXJA 4QLJA 1WOAA 3TC3A 4R27A 1GT8A 3KOWA 1Y0EA 1E3XA 3CNYA 1GYNA 3R94A 3KOFA 4M6VA 1JDDA 4L9XA 4YS1A 4I9JA 2BLEA 2X16A 4ZODA 4V33A 4YTRA 3SJ3A 2EEXA 4ZZ9A 2D3LA 3BMXA 1K8ZA 3WNMA 1JUBA 2PDJA 2RUSA 3BAIA 3G8RA 3VD5A 4WRHA 1KM5A 4TR9A 4CKQA 4GI6A 2OFJA 1KTCA 4B5NA 4O13A 2IQ0A 3KL5A 1NAL1 4JDYA 3ZSSA 3CLWA 5G2IA 1L9WA 1W8SA 2Z1SA 3KW3A 2DZAA 2PAJA 2BOGX 4TUFA 1GG0A 1QI3A 4DVOA 1P0BA 1S5WA 3W37A 4K1WA 1PEZA 1UWRA 1AH3A 2PLJA 5D32A 1XLGA 1RR2A 4DY1A 1T8QA 1LM1A 1ECEA 2VEPA 2VDHA 3CAVA 3W1AA 1BYCA 2FPVA 1VC4A 4IMDA 2PDPA 3EXRA 1TV8A 2WLYA 4UB9A 3LXBA 4FIQA 4BI5A 4MZ1A 1JDCA 3H53A 3M5VA 3EWDA 3RDKA 5HBFA 1Q6DA 4K36A 3WY1A 4L5ZA 3WH9A 2QCEA 1FWAC 3ME3A 4GC3A 3B40A 3VDBA 3GKAA 4LWWA 1BSIA 4PGLA 1W6TA 5TF0A 4M81A 3DN5A 4O1FA 3BCFA 4GKLA 1KFEA 2C6QA 3ONBA 4PMDA 3NQCA 4D6CA 1FFRA 3EKZA 3BAJA 5F2LA 3WNKA 4IUOA 3LI0A 4ZQMA 2PDFA 5DXYA 4UR7A 1XIIA 4DUWA 1JRBA 2J62A 4REQA 3T40A 2V3GA 4MSSA 3IACA 3QZ6A 4IXXA 3NL2A 3TN3A 1FWFC 4YXGA 2Z6IA 4GVIA 4ZA0A 2RGLA 3UJFA 1E5JA 1V6YA 1C8VA 4NF7A 3MANA 4O1DA 2CLIA 2A6NA 4D6GA 3W84A 2NQJA 5JBDA 1XH1A 1Y65A 3H2CA 3MKVA 3ITVA 4WKAA 4IFKB 4KESA 1S39A 4KEZA 4DRSA 4OKDA 2OGYA 4NZ3A 3WJYA 4AUBA 1IZCA 2QCNA 1RVGA 3P0WA 4Z2HA 3HGOA 2QW5A 4HNNA 1VCVA 4RW3A 3VD9A 3U9IA 1XLLA 4DWSD 3G0SA 2OOGA 4JPGA 2GVLA 2FIQA 3VKJA 1QATA 1SZNA 1J6PA 4Q4MA 4PMNA 1H50A 3W53A 5FJPA 3ARSA 3UZJA 3P5ZA 3WLOA 1Z89A 4JTCA 2FH8A 1VIWA 3LXAA 3PR2A 2WWCA 2V9DA 2V2DA 1D3HA 5CKSA 3WD3A 3VOFA 1X1ZA 2PLCA 2KAUC 1MEHA 3BLPX 3NCOA 1MUWA 1CPUA 3B97A 1SSGA 2AQWA 3H2FA 1J11A 3IJDA 3TJXA 5BYWA 5C9XA 2C19A 1I1WA 1IXNA 4UNKA 1G67A 1SGJA 2FDMA 3WG6A 5DT7A 4OE7A 1AW5A 4XZWA 3NPWA 2JQXA 2PBGA 1VBRA 4EVZA 1TIWA 1YLVA 4A3RA 1UP3A 3UYIA 1RJQA 3V0TA 4ONVA 3W9ZA 3T2PA 2JIEA 5IHRA 3OGRA 1ENUA 3OP2A 4ZBCA 4EAYA 1JNEA 2BHUA 1VRXA 3WK3A 3NIYA 5LHEA 4DYKA 4LY4A 1FKWA 5LA2A 3OA5A 2TMDA 3IVUA 1EEPA 1V0KA 4L1GA 1XKYA 3M0KA 2QDDA 1TVLA 4N0RA 2WKGA 5JU6A 3EBVA 4GXMA 4WDXA 5ECVA 1XM3A 3UY8A 3E2VA 4GIRA 1XIMA 3HPXA 5J5DA 3NXLA 4L4OA 4LW7A 5FAGA 4LC8A 1HN1A 4J27A 3UWYA 2F2HA 3EAUA 5A6BA 4JYFA 3L4ZA 5HNUA 1VRDA 1FCUA 4GVHA 2OXNA 4FPSA 1O5XA 2BX7A 3BVJA 4XAGA 2VX7A 2XISA 2XSBA 4XZBA 4FXFA 4XIAA 3CPGA 4GNVA 5D05A 3WLLA 3CAQA 2I16A 5A8MA 4BS0A 3KCOA 2ESCA 3FJ6A 3MHUA 3HMJG 2ZVIA 3LBMA 3LGDA 2HVOA 3FAXA 3O05A 4J3SA 5EYWA 1K9FA 4X0NA 1HJVA 2ZDRA 4LUIA 4XKYA 1UQYA 3C2VA 5BU9A 1CBGA 1K8CA 4WOQA 3SFWA 1BXBA 3MV11 3BOLA 2PD5A 1POKA 1VYSX 4QG9A 4UFHA 1QI5A 4C6FA 2F6KA 1UB3A 1EF3A 4I7WA 2NWSA 1EIXA 4WGHA 1VQTA 3CHFA 2AQOA 3HV8A 3TE9A 1V7YA 1H60A 4KMQA 5DFAA 4DXKA 1E15A 3U2ZA 3S5OA 1O95A 5DLCA 2FDSA 3WK0A 2XGIA 1UD8A 3OG2A 3HG5A 1QDSA 3WBEA 2O56A 4C1NA 1PCWA 1SO4A 3AMCA 4JTJA 3QTGA 3MO7A 1P6BA 5CSSA 1VS1A 4RDWA 3LTPA 3LOTA 4WCJA 5G2WA 3UJRA 2OQYA 4LYKA 1G94A 1C90A 4KH2A 1PIGA 4LSBA 5I24A 2FPYA 2P53A 5CEWA 1FH9A 4P8UA 4GINA 3S1XA 3C5QA 3S5NA 1DVJA 2P5NA 4RDVA 1KBLA 5FIPA 2J7DA 1E6NA 3KLKA 3RJYA 4AZ6A 3K2GA 3W2JA 1HZYA 4FXRA 4DM1A 4C60A 3MSYA 1P4CA 2IUZA 1QWKA 1XBXA 1X98A 2EJAA 3SUTA 4UXDA 4MWAD 3KVKA 1B90A 1FDZA 4N9BA 2WPGA 5HNNA 3T05A 4XD5A 1GPWA 4GY1A 2ZX6A 4LS0A 4X22A 2BS9A 3OIHA 4GK8A 3MMWA 2OKOA 1OC7A 4HK7A 1ZP4A 4NL1A 3SUSA 3IV8A 4IZGA 3DBPA 2PDXA 2CITA 1E6PA 1UW9A 1G4PA 2UWFA 3G6MA 2Z1XA 5I03A 4DI8A 2BY2A 5C7HA 4AVNA 1EA0A 2VEKA 3WELA 2WMKA 2XN0A 1IXQA 3DX5A 4D72A 4RNJA 2EBNA 3WQGA 3F5JA 4AHOA 3LRMA 1N2VA 4A6GA 3STCA 1GQLA 1DTUA 4QTGA 2GZXA 3B8IA 3L23A 4IPLA 3UR8A 3WBAA 1G6CA 4F9JA 1A5AA 3E12A 3QYSA 1B2YA 2YCKX 4ACZB 2OEJA 3SRHA 2VZSA 3VCRA 1K4GA 1OC6A 4H04A 1BTCA 1NIUA 1ITXA 3KWXA 4QS5A 4Q33A 4AF0B 2JKPA 1W9XA 3WQPA 1QPOA 3GR4A 1XISA 5KITA 3SB0A 1PE1A 3EA3A 1W2VA 3IRDA 2QZRA 3LHZA 3GHSA 3WJWA 1IT0A 1A5CA 3DU0A 2PZNA 1LBMA 5D4YA 1RQHA 1ICQA 3LX9A 3M0JA 4GYFA 3VKAA 1P6CA 4TO8A 4PCSA 2J88A 2Y61A 3ITOA 5I7GA 3TA6A 3TNOA 3ECQA 5C2CA 4OV9A 4S3GA 5BMWA 4EXQA 1UZHA 1DWFM 3LI1A 2VX6A 3K1DA 4MIMA 5A6AA 4KS0A 1BXCA 3KXQA 2ISDA 2VXNA 5IXEA 4LALA 4O12A 4OJYA 3N15A 2WXDM 4U33A 2WW5A 1U30A 3VIPA 3WDPP 4X9SA 4POCA 3O15A 2CLPA 1M03A 1CENA 1HG3A 1EX1A 3B0PA 3G0UA 1XCFA 2EPLX 1TJ0A 2ZZ4A 2Z1WA 1W3JA 5I3DA 3O1NA 4DWSC 4GJIA 5E09A 1HP5A 3OPSA 1HJUA 3OVRA 3UU0A 4KCVA 2ACQA 2HVNA 2GSJA 1TA3A 1I0DA 1VPQA 2PBOA 1FDJA 1BXNA 4US5D 1GCYA 3AXHA 3QY6A 2A3AA 1LRQA 3H70A 4UTWC 4V27A 1FFQA 3B0VC 3HJZA 3IWPA 3CO4A 5BMXA 3C2FA 3FY1A 2PDNA 4F40A 4X2RA 4LCQA 3CAKA 4JIRA 1SZRA 2X42A 3FXGA 3NL5A 3WLNA 2VZVA 1QT1A 4AMCA 3RNDA 1OFAA 4FP1A 2OELA 1E1CA 3WL0A 2V3FA 5HAOA 3HPAA 1C9WA 3E0FA 1DWGM 2I17A 4O4WA 2WMFA 2EPOA 5CCZA 5D8WA 1TTIA 1SZEA 1IHIA 2Z7GA 3SCUA 1FWJC 3GB6A 3WYZA 2HDJA 3VVGA 4V2XA 4LH8A 4RV8A 5A5WA 3LXCA 3GKFA 4Q8MA 4GC4A 2CBVA 2PTYA 3KLLA 5EFFA 1OT2A 3T0BA 3CL8A 3NQFA 2WWDA 4DXVA 3RFAA 3AISA 1SR9A 2V82A 5B7ZA 2YFNA 2PDCA 3S3GA 3V0UA 2OJPA 4GZJA 2FHBA 4AWEA 3N2MA 6XIAA 3OU8A 3B04A 1XIGA 1W5QA 3GTHA 3W25A 4DBDA 3M4HA 1ZJBA 3MWAA 3TMQA 3RCNA 4OECA 4W8AA 2BXVA 2QCGA 4NAFB 3NPXA 3E74A 4UQDA 3FJNA 2QQ6A 2A79A 4DB7A 4D8AA 5A1AA 5BROA 3RGTA 2QJNA 4B3LA 1W3NA 1BRLB 4N4PA 2JALA 1LL6A 3WDJA 2WJFA 3A23A 2W63A 3R8GA 3I3BA 1GHSA 2W91A 3TW6A 2Y85A 1P1MA 4MYXA 4EOUA 5GJPA 2IQDA 2V63A 3BAYA 2R1LA 4AZCB 3PTQA 3WF2A 1XL9A 4O16A 1DP0A 1GOWA 3B0XA 3HFYA 2G4JA 1OCJA 1I60A 1EB3A 1ITUA 5C0QA 3LPOA 1LOSA 4QG6A 1UUOA 1RQBA 2JKEA 4UZUA 1A5KC 2P8CA 1V93A 4JTKA 1NVMA 2A3HA 3FEQA 3AIBA 1J4EA 4OQVA 3TP4A 2ZE3A 4AX6A 2VD8A 3TVAA 3ZJ8A 4ICNA 3DYOA 1OCNA 4OWGA 4WR3A 1WAWA 2VELA 1OZQA 4EANA 1B5TA 4LYQA 4W7UA 5I02A 3MTWA 3VMPA 1NY1A 3UJ2A 3BDKA 4BWLA 3AS3A 3VGHA 3T0DA 1R9XA 4O14A 1JUKA 2ZQ0A 1R85A 1QW8A 1TRDA 2WK2A 1E40A 3WQEA 4Q4OA 4WY0F 3HPSA 1S2TA 1WBHA 2OT0A 1GVFA 3AHYA 2ZYFA 3O0KA 2FHFA 1D8WA 2WNQA 1L6WA 3GU9A 3WMLA 1PX3A 3OVGA 4R88A 3DESA 1X6UA 4MY1A 4CD5A 4PE8A 3VC6A 1WBJA 1H63A 5FEWA 1JJKA 3T78A 2CIPA 2OR2A 4UFMA 1XYAA 2A0NA 2HPIA 4DNMA 2Y62A 2G8ZA 3BJTA 3APTA 3LUTA 4QAWA 3W6MA 2GGEA 1WDQA 5C9UA 4HHMA 5DXXA 3F4DA 3LK6A 1UC5A 5AYZA 2GK1A 3DC0A 4MADA 3AALA 3ES8A 1EP3A 1TMLA 2Y70A 5BXRA 4MWAC 2PDUA 1GVSA 3FA5A 4P8WA 3P80A 1YIXA 5BCAA 3CB3A 3L4TA 3FJLA 4IOTA 1LL4A 1KV8A 1UD4A 1UHVA 4ZMGA 3E49A 5HQEA 3ARUA 1ZS2A 2VT0A 4H9TA 4UTUA 3MMDA 4PA8A 1DHKA 5F4WA 4QXIA 2PCQA 3ANYA 5D02A 5FL0A 3C2OA 3G1XA 3VI2A 2DIEA 5G4WA 1AD4A 1B30A 3QV9A 4KGLA 4IX0A 1FKXA 4G2DA 3K46A 4M7TA 3WQ8A 4DWDA 1IZJA 3R12A 4B2DA 1J8VA 1XLCA 1Q4NX 1VBJA 3L5LA 3AMLA 4C6EA 4UQBA 1EDQA 4V15A 3GU2A 2A6LA 4X9YA 3G6LA 3U3HA 2VOMA 4E2VA 5E5CA 3OEXA 1G69A 4YYCA 4TVUA 5C9ZA 2QMKA 3W6LA 2O4QA 1WDDA 1JZ8A 4LEFA 4LUTA 1GEQA 2XH4A 3UXLA 1ICPA 2PDMA 1LLOA 1BQGA 3QPEA 5GPRA 2DH2A 3OLDA 4AB4A 1FHLA 2NT1A 3UWEA 3TONA 1UKSA 2YCEA 3HO8A 4GG9A 2INFA 1GOXA 4D6HA 3S5YA 3STEA 4WY0A 3AQUA 1KCZA 3ATZA 2ZXAA 1TREA 1Z42A 5H1WA 1YPFA 4F0HA 3PFMA 1DXEA 3CBWA 3W22A 3J7HA 1GZJA 4S3KA 2SFPA 4TV5A 4FK9A 1UKOA 3GUGA 4A21A 3G5EA 1KXQA 2OSYA 4JTRA 4KRZA 4LCSA 3EEGA 3VGFA 3LS9A 3C2YA 2Y4SA 1HKKA 3WUBA 2GFTA 2X0HA 3ZT5A 3B8VA 3UPMA 1A3XA 1EHNA 1WDWA 1RALA 2ALRA 3LCFA 3QSRA 3ATYA 4Q8TA 3TSMA 1QRQA 3PG9A 2O55A 2WM0A 2FGLA 3CIXA 4H01A 2E3ZA 2D22A 1ZBVA 2H3BA 3GXDA 3NVTA 3KHJA 5M1TA 3BICA 1JZ2A 4HMDA 1E6SM 1W5OA 3VKKA 2NW0A 2ZADA 4S2BA 3ENLA 1VFFA 2J7FA 3VFCA 4ZTYA 1DOSA 1OF8A 1PYFA 2ZUSA 4KFPA 2WM1A 3WLSA 4CUCA 3UESA 1KBBA 2B81A 4WKFA 1J0ZA 3P14A 3SEPA 4O1AA 4RNIA 2ZC8A 3C0QA 4J3UA 3UYCA 1UASA 3DCPA 5I3GA 2VGIA 1AQFA 3F4NA 2AOSA 3QZEA 3AIEA 3FK4A 4TTUA 3WF0A 2H3DA 3WQ4A 2DVXA 3ZWTA 5HNRA 1VIZA 2WMIB 3PSVA 3GY1A 1XGEA 4JFTA 2YBTA 1VH7A 4HK6A 3PPHA 4D6EA 2R1KA 2WJZA 3RPTA 2HVMA 3H2EA 2PRHA 1LROA 1H3GA 4ZO9A 5GNYA 2J9ZA 2ACUA 2VFIA 3D3FA 1V4YA 3TW9A 1IEXA 3THQA 4K8GA 4AD1A 3SRFA 1PAMA 3UXAA 3H6OA 4RNFA 3CV1A 4B4HA 3O7UA 1QOPA 3LBCA 2TSYA 1AW1A 4DHGA 3IGXA 3EOSA 3IIPA 1R38A 1MFUA 5AZ1A 2RDWA 2CLOA 2W62A 3IJ7A 1E6RA 3T9PA 3ZS4A 2QCMA 4A3HA 4PTDA 1WZKA 2CXGA 4JN7A 3FHAA 1T5AA 1O5KA 5H8MA 2YYUA 1HP4A 4HK5A 5EGRA 4GQQA 3AWNA 1YBQB 3BMVA 3APYA 2R6OA 4GJJA 4ROQA 2VRQA 1C8QA 4A3UA 1DYSA 4H6EA 1GKPA 2FVKA 2GGGA 4R53A 4B91A 9CGTA 3R11A 1ADSA 8RUCA 4WX2A 3TQ0A 3FYPA 3EB4A 3HQOA 1ZJIA 3V75A 5BXTA 4LF2A 4AIUA 4JKLA 1EOKA 4QISA 4S3BA 1OEPA 1I2QA 4NU7A 1J5TA 4IPJA 1KRCC 3O0FA 3AMKA 3KBWA 5FF2A 3W71A 3FX4A 3GO2A 4LUJA 1XF0A 5BOOA 4AISA 3N6JA 3STPA 1S2WA 5D09A 1AD1A 4XZ9A 4LPCA 2I9UA 1R2SA 4PSPA 3IJIA 2XPKA 1G9HA 3XIMA 1TRIA 3VYLA 4WDUA 2GJXB 3BSGA 1J2BA 4B16A 3U2CA 4PMUA 3B06A 2PWEA 3TFCA 3RILA 1D8CA 3LCXA 3GTXA 1NARA 4ADSA 1C93A 4WJXA 2V6AA 4ZOAA 3PPFA 3TR9A 8A3HA 2BVWA 4XTDA 1TYGA 2Y6ZA 1XIJA 2XWDA 1WDRA 4RE3A 1OT1A 3UEQA 2DZPA 4IMAA 3UVIA 3I3DA 1LG2A 3JRKA 2EG6A 4CEUC 2C1GA 3Q37A 4S23A 1E0VA 4FNRA 4QR6A 1U2YA 1F8IA 3SDOA 1DJWA 1I45A 4A4AA 2L5HA 3L66A 2YL9A 2CLKA 4IIGA 7ODCA 1F6KA 3FW6A 1BAGA 1MUMA 3CHCA 5D9NA 2C3ZA 1PWLA 2B7OA 5AHMA 4AVOA 4IFKA 1UUQA 3U7VA 4L80A 1B3WA 3H12A 1OINA 1M3UA 3LTSA 4JIHA 3PY2A 4MKNA 2Y5SA 2F9RA 3QW3A 1HKJA 3AHXA 4PRTA 3RX4A 2Y8KA 4GRSA 2QNEA 1OK4A 3BUVA 2YXOA 4ZTXA 1W17A 3PUEA 1Q6CA 2EQDA 3R6IA 5E93A 3MV01 2BNJA 4Y9NA 3TWAA 2BMBA 5EY5A 4QRNA 2C79A 3L4VA 3EPOA 5BOEA 3VIOA 1R6WA 8XIMA 3QTPA 2B31A 3NUKA 4XBSA 3GSMA 1XLFA 2J24A 3W83A 2NV1A 3B05A 4BF7A 4FF5A 3JVAA 1N55A 3A6OA 3QN3A 2BSLA 4PMOA 5BWFA 2RDXA 3W27A 1FWIC 1UR8A 4XKMA 3IRSA 4O53A 3VDGA 3L68A 1UD6A 3WQVA 3WUGA 5AYYA 4FF7A 1B3OA 4Z2JA 4URIA 4AD5A 3VOCA 3PPGA 4NZCA 3P5YA 3DAQA 4PBFA 4LNYA 1TIMA 5HMEA 4AD4A 4LVAA 1KXHA 4PTMA 3OG3A 2IMRA 1X6NA 2INEA 4HNUA 1UG6A 3QMRA 1OHLA 3NFUA 2ZDSA 1BWLA 1W1PA 4IPNB 4Q8UA 3WN6A 1ZL1A 3DI0A 3W7RA 3EOLA 4TMCA 3IUDA 3NVDA 2WHMA 4J9JA 2DQWA 4BQ4A 3T7VA 1Z48A 1F4AA 3K4AA 1Z44A 3N6HA 2YJQA 3BZGA 3W24A 1BEUA 2Z2UA 2FFCA 3W76A 4AHPA 3RX2A 3DYPA 2F84A 1Q13A 1JAEA 2CEQA 3H4XA 1WE5A 1LCOA 1Y5WA 1AG1O 3A24A 5ABFB 3WLHA 4DJFD 2VKZG 1GQJA 2CZEA 2D2HA 4XO6A 2ZRVA 3AU2A 3C2RA 3ONCA 5AHIA 4C6KA 5JQ9A 3CASA 4IWWA 4RXFA 2C15A 3WD4A 1ISWA 1JZ7A 1LWHA 1GEHA 5BRBA 1GJUA 7ENLA 4Q22A 3U4FA 1V0MA 3LV6A 3GBDA 1DE6A 2YGYA 3LLDA 1GOKA 4UTLA 4P7RA 1KV5A 4JIIX 3HFTA 2WVVA 4GZ7A 2HEJA 4YMZA 3W2UA 1JVNA 1RBLA 4S39A 5HK4A 2X1UA 1GQNA 2RHGA 1JI2A 1UR9A 1ZRQA 4V1XA 2DT0A 4AZBA 3G1HA 2W67A 1W9PA 2YCJA 2X40A 5XIAA 4GUGA 3HQ1A 4RE0A 2F2KA 3NM3A 4B92A 2HXUA 5T91A 4MYAA 1E72M 1UIPA 3H2AA 2OLSA 4IP7A 3KOYA 3PAOA 4UBPC 1AODA 3BG5A 4PMZA 2YX0A 4UOJA 1M41A 1NWUA 3C8FA 4DIAA 2ISSA 1WV2A 1KRAC 4MJ4A 2GQ8A 2YSWA 5MHBA 2CKRA 3CZEA 4JQAA 1UR2A 2FYMA 5DEZA 1EJRC 3EXSA 1NFPA 2PP0A 2D24A 4TU1A 1TJ2A 3GUWA 3LGEA 4IPIA 1REQA 4O50A 2MUCA 3P0XA 3SSZA 1VPYA 1Q8JA 3QM3A 4LRSA 4CCEA 4GLEA 2O0TA 1A47A 5AB3A 1PO9A 3EMZA 3AS2A 1K02A 3CUHA 2IPGA 3B4UA 2ZZ2A 2G3NA 2FZ9A 4EPKA 3R7MA 1RD6A 2E9MA 3PUDA 4K7YA 3E3HA 1UIOA 1D2KA 3OLEA 4O0QA 2Y88A 1W37A 1S2CA 1SFJA 5E9AA 3QFEA 1YE4A 5GVJA 3HPFA 3THCA 2BVTA 3VNDA 3RYSA 1H41A 3PZ9A 1FHUA 4E8DA 4LUYA 1FWHC 2D73A 1HJQA 1QTWA 1QVBA 3BW3A 4PCNA 4GXPA 4BQ3A 3CLMA 1VPXA 3PWGA 4X0VA 1ADDA 3PJTA 4L4LA 1UR1A 4E2OA 4M80A 1I9CB 3CZ8A 3W28A 1OSEA 1MUCA 2PDIA 4LGXA 4P2VA 4G5DA 1HFBA 1TQJA 3VILA 4QAIA 1IR1A 3H8AA 8TIMA 2OWCA 3FN9A 2ZIDA 2VNCA 3W1MA 1X7FA 1XX1A 1NU5A 3VKBA 2VP8A 3H54A 5HPOA 1CLXA 3VKCA 3LHTA 4O18A 1E6QM 1TWDA 4ZOEA 5CSUA 1OX6A 3PJWA 1QHOA 1H5VA 3NXFA 1KR0A 3SY1A 5CQ1A 3POHA 4IUGA 4Z2GA 2REQA 3WEOA 3TFXA 1R3YA 1KBJA 1HL9A 1FP8A 1K7FA 1NOWA 1MRQA 5EPDA 3CAWA 3KVJA 3RCMA 4C91A 2OU4A 3CL7A 4AF0A 3IK4A 3QQ0A 3MJYA 3N29A 4HA0A 1UR3M 1BYAA 1S3TC 3ABQA 3STGA 3QKZA 9XIMA 1KW1A 2ATSA 2W3ZA 1QO5A 3OGSA 1BWVA 5FI8A 4DWSA 6XIMA 4C6QA 2NX1A 2WNWA 3VM7A 4JHZA 4I9TA 3GIYA 1ZGDA 1MVYA 2WSYA 1TTQA 2GGIA 4LJ3A 4U3CA 3KUMA 3B8UA 1I2NA 4Q32A 1SZFA 3WH8A 2HNEA 2GVGA 4F2TA 5CPOA 1UP0A 1XD0A 1US0A 1FWSA 4UTWA 5A2BA 3AU6A 1J79A 1K8YA 3GW0A 3ZM8A 2XG9A 3CTLA 5CPMA 1Q7MA 1OWQA 4GFSA 2BP1A 5BOFA 3ZJKA 4A22A 4DNHA 4R34A 4PUUA 1Q7ZA 1AUSL 2XN2A 4ZB5A 4O8AA 2EKGA 5D9PA 4RXGA 4UUIA 3WMBA 1C9DA 1KKOA 3UG4A 3M0MA 1CXLA 2HE5A 4QJ1A 3S9ZA 5IHSA 3MI2A 5XIMA 1MW1A 2PC4A 5AFDA 1J6OA 4JHOA 4Y9AA 3LCHA 3QJAA 4MPQA 2BHYA 1QUMA 2BODX 3DOPA 4HNOA 2W27A 1O7AA 1VHNA 2G41A 4W85A 3CQIA 2IKJA 4DF0A 3LCWA 3SUUA 4N02A 3WF4A 4XAPA 1T6MA 3FSUA 2ISVA 1GJPA 2E77A 4JYDA 2Z7KA 2I5GA 2E9BA 4F0MA 3POCA 5JBEA 8XIAA 2DJLA 3LHYA 3UWUA 1V0LA 1JG9A 2XHYA 2ZXBA 4I7UA 1LQ2A 5K4XA 4KEUA 4LY8A 1J5SA 3V36A 3QKEA 5K9DA 4YVVA 1HGYA 4KCUA 1TKKA 1V77A 4XKYB 3GYEA 3XISA 4OIFA 3ZR6A 1KXVA 1UMYA 1IGWA 1VYPX 4GI8A 3HQPA 2OLHA 1JFXA 5K7JA 4PL1A 1XQLA 1ZHAA 2GL5A 4YU1A 5FEPA 4UTIA 1ZAJA 3N1AA 2E8YA 3V0SA 1VCFA 1Z32X 5BRQA 1HNYA 1Q6FA 3WMSA 3E0IA 4DAFA 1PKNA 3I6TA 4KCTA 1B31A 1KGWA 1IXOA 2GPTA 3V16A 1XLBA 3S6DA 3G3DA 3K8MA 1PTDA 1H1ZA 2CZDA 1UYQA 1EC9A 3PULA 4Y7EA 1SSDA 1E4LA 3WKZA 1YTDA 3E38A 4ZSTA 3ZR4A 5CC5A 3KS5A 3OLIA 3W29A 4G7FA 4PRRA 2ZICA 3QOKA 4EACA 4Z42C 4C1NB 4QCFA 2VOTA 2OB3A 3EKGA 3UZYA 1UWAA 1Z3NA 3H7RA 4OU1A 3PZIA 3TA9A 3MBFA 1MNZA 5HANA 4PULA 1TZZA 1FWEC 2QPSA 4F9DA 5D38A 1GVYA 1B1YA 3DKLA 3OZOA 2FLIA 4HZ6A 4QIUA 1XUUA 2GUBA 1IEIA 1C8YA 7REQA 3UZZA 3BWWA 1EL3A 1X38A 2PGRA 1OFOA 3W7GA 1LOQA 1WQ5A 3TYCA 4JR5A 4NILA 3KOXA 3SFKA 1M7PA 3TWBA 4LYRA 2AGKA 5HDRA 3EWXA 3HF3A 1R3SA 1UKTA 2XH0A 5CGMA 2PLKA 4I9MA 1DQUA 3A4WA 3GNNA 3IVTA 2DIKA 2DW7A 3VK5A 1WZMA 1W31A 2VTFA 2CESA 3UP8A 2G50A 3LLXA 5CGQA 1C7SA 2ZXDA 3UWWA 4AZGA 4XZHA 4FX6M 1RVKA 3BAWA 4AWTA 3GXPA 5CJNA 5E9XA 3H4GA 1XINA 2WV8A 5FJJA 4HMEA 2B4GA 4DUVA 3G24A 3PF3A 4IIDA 1EGMA 5E0CA 2VRJA 2Q09A 2J47A 3BLFA 4NXKA 4RZ5A 2A5HA 4L4MA 1KQYA 1W3TA 4XZIA 3TOPA 1KCXA 4MWAA 3I4EA 2QJJA 4BF5A 1XRSA 3MS8A 4QDPA 5MKGA 4J4KA 2O9PA 4IMEA 1C91A 4IL2A 1TQXA 2EPMX 5A94A 3LRKA 1IEVA 3AICA 4R7WA 2C1IA 2MANA 2ZWYA 4DBWA 3PB2A 4H8VA 3UZWA 5JH2A 4DO7A 4IIFA 1PDZA 2PP1A 2BGSA 3E5BA 4AWSA 2VZTA 1JPKA 4F0KA 3RM9A 1OG6A 4KEMA 3IJ6A 3VDAA 1ISVA 2DUXA 2VUNA 4JTTA 4O1CA 3G1AA 3LYEA 1H51A 3EMQA 3CEPA 1XPYA 1P0NA 3GXNA 5HMDA 3D0CA 1F2JA 2E4TA 5CJMA 3VOJA 1VENA 4L6HA 3CMGA 3WD1A 5CPTA 3F2BA 3VE7A 1WZAA 1GZGA 1MDRA 1LRTA 4EPDC 3LSBA 4C6NA 4EE9A 4UMBA 5CAHA 3GNDA 1S3HA 3ICJA 3I4KA 4GCAA 5A3HA 1ODZA 2PDGA 2PGWA 1ZLPA 1TUFA 3CS2A 2YBVA 3PZNA 2J7HA 4NX0A 1FH7A 3H2NA 3TTOA 4AC7C 4KWVA 3GXMA 1FWTA 3IIOA 1AZ2A 1CDGA 1OG0A 1PTGA 1K6AA 4GZEA 2NVCA 2XIQA 1K9TA 1JF6A 1BGAA 3QC0A 1GGOA 5D37A 4LU0A 1YXYA 2E5CA 3AFBA 1E70M 4I5RA 3AZSA 1V3LA 1X6LA 3NDYA 1I2RA 1ZBWA 1QU4A 4Y8FA 5JVLA 4QS6A 2A3LA 3ZZ1A 1OFEA 3K8LA 1TA3B 1SJCA 3YPIA 3IPWA 3Q67A 3P67A 3F4VA 3LZ3A 2ZZ6A 3OHMB 4CNPA 1GVEA 1TTPA 2YDSA 4M82A 1XFCA 4LAKA 1N8IA 3NQAA 1A5UA 3BARA 3KE0A 4ZB2A 3NQDA 3FCPA 1PZ2A 3N2XA 3W7PA 1TUXA 1EJWC 3RLGA 2QULA 3P93A 3D46A 2CZ5A 4CQ8A 1E1CB 2ZTKA 3UY7A 3MCOA 2CLHA 2QCFA 1V79A 1DQWA 4HZ7A 3AYRA 4GHRA 1V6VA 4US5A 3NL3A 3FOKA 2AKMA 5CGTA 1XBZA 4EKJA 4IGSA 4RNHA 2XINA 5C54A 3AHTA 1ZCOA 4LFYA 5C55A 3ZLFA 4N6EA 3GBEA 4WDTA 3KFTA 3TW7A 3LV5A 5CZKA 4H6KA 1CXFA 2H90A 1KFBA 2V5DA 3BPWA 1PL9A 3S46A 3C61A 3V1HA 2HNHA 4JX6A 4YVPA 4HNVA 1FOBA 2GQ9A 3W7IA 5BNKA 3VO0A 3WLMA 4HCLA 5HQLA 4HA3A 3M0IA 1GK8A 1YMYA 2NXGA 4E8GA 1J0IA 1XD1A 3EX3A 1QI4A 4Y9OA 3VFLA 4Q7BA 3N4AA 3T81A 3H22A 2C16A 2E28A 3E96A 3TJ4A 4Z1YA 1XIBA 4OUIA 1VKFA 1OFDA 4JY8A 3S83A 1XGDA 4K38A 4F48A 2E8ZA 5BRPA 4CQCA 5KZEA 1AMYA 1WXJA 4R9OA 1YRRA 2RH9A 4J40A 1MXDA 3VGEA 5BZAA 1C92A 1EWDA 2I57A 1JYVA 3BL3A 1Z8AA 4MM1A 1Q6QA 2TODA 2AQVA 1JAKA 2PTXA 5AVHA 3UCCA 2BFGA 3BW4A 1OX5A 2P0OA 2UV8G 1RK6A 2C18A 3IAPA 2NSOA 3LMYA 5CPLA 1ISXA 5HMSA 4IP5A 2ASHA 1FXPA 3NL6A 1XUZA 1KFCA 3TSDA 4UNLA 3INPA 3BXWA 3RIKA 2ZBTA 2NWRA 1PCKA 3MI3A 1XIHA 3BLDA 1UQZA 1YBQA 3EOOA 1VBUA 1UMLA 5DN1A 3W7KA 2QDGA 4U10A 4NHVA 4H2HA 3WCZA 3EA1A 1W5PA 2F7FA 2D0HA 1JZ5A 1AA1B 2ZA3A 4AZ7A 3LM3A 1VZWA 4IT1A 1EC7A 1G7VA 1KKRA 5D9OA 1TV5A 4LVDA 4W88A 3UNDA 1P43A 3L7RA 3NO3A 5FF7A 3V7PA 3WL1A 4C7GA 3MC5A 3PP7A 4C5ZA 3VINA 1GWJA 3QF0A 2QVHA 3DIPA 3VNJA 1XH0A 2VZUA 3P7YA 2J8TA 3KDOA 9XIAA 1CGWA 4I9AA 4NZ4A 5C9WA 4HCDA 2ISWA 1DQXA 3PPCA 4AXKA 1MXSA 3VNMA 3RLUA 4H00A 5EFDA 4UQEA 2G95A 4LAZA 2VFGA 1YDOA 4GQBA 1UKPA 2B0MA 1SO6A 2VX5A 1TTJA 2D2JA 3WUFA 2CBIA 1EQPA 2GK1B 4IMGA 1TWWA 1V02A 4EX4A 3PZMA 3RN6A 3W07A 3W02A 3URBA 4XISA 2QCDA 1IIHA 3DFNA 3L2LA 4JDBA 2GJRA 4DAIA 2D2OA 3HPZA 2E9LA 5TNVA 3NDZA 3GU1A 4Q8VA 1AJ0A 1QR7A 1R2TA 2NZLA 3BTNA 1EGVA 1HF6A 3OW1A 4N9EA 4JTIA 3SJNA 1CLVA 4AEEA 4NNCA 1JPIA 1JCJA 4R7OA 1ZJAA 1NDVA 3BH4A 1QI0A 1TSIA 3XINA 2PDHA 3FGCA 3SN1A 2PU1A 3SCOA 6TAAA 5IM51 3EB2A 3UZ5A 4DYJA 5D2TA 4F2BA 5A6KA 3VKDA 3LB0A 3IVSA 2Z2AA 3N13A 4RKAA 1Q3NA 3S2JA 3W7DA 2FMOA 4IIEA 4M0XA 3AXIA 2BGNE 4PMQA 1E9LA 4IJCA 4HVXA 4O11A 2GVYA 1PZ0A 3QPYA 3ZSTA 1M01A 1CGXA 3OBAA 2DQXA 1FUYA 2FQIA 3OODA 5CLTA 2A3BA 4AYSA 4CQDA 3W85A 4WY0B 3CK5A 3WD0A 1VGAA 2UY4A 4U5IA 3ZWSA 1WKYA 3GZAA 3E2QA 4LS2A 4F4RA 2R14A 4H83A 4XQ6A 3HQNA 1IE7C 4BHYA 6PTDA 1ZNNA 5F1UA 1W8GA 4MLRA 4ZVJA 3PB0A 4Y8EA 1YYAA 3WD2A 1XG4A 3PWAA 1MZHA 1J9YA 2WZIA 3UR5A 2H9AB 1ZZMA 2OEKA 2TYSA 1NELA 1B57A 1WB0A 1KRBC 4JICA 4AY1A 1VFUA 2CHRA 1TPWA 4D1IA 2WBGA 2EAWA 3DHPA 4H2CA 3BOXA 1MQPA 3PNUA 4EF8A 1T40A 3OBEA 2P1FA 4XAYA 2DZBA 4W86A 3OTRA 4XSMA 1A53A 1D7KA 3NZPA 3CIVA 5G2HA 1W1TA 4QQ3A 3CC1A 4E8CA 2XZ7A 1K70A 3ZXWA 4PYSA 2QV5A 1OGGA 2DP3A 3A21A 4M51A 4AAJA 4DEFA 3FVDA 4Q4PA 3R0UA 1PXGA 3K4DA 5AZ0A 1PKYA 3NOEA 4F66A 2PURA 5CSRA 4WEVX 3MVTA 2WSPA 4EXAA 3GHUA 2ZVRA 3RUBL 3CPUA 3SCQA 4ZO8A 4GQRA 4NIRA 5D03A 1HL2A 4YTSA 1KNWA 3CGTA 3S47A 3G2GA 4PODA 1CTNA 1EJTC 2DJXA 2PGFA 2H8XA 3CZJA 4ZOBA 4NZ5A 4H6RA 5HJXA 3T2QA 1H7PA 1KM6A 2VEIA 3GR8A 1QHPA 3HU7A 3PM6A 2ZZ3A 5HWMA 3QLDA 2HE8A 3EYPA 4C6OA 1WYIA 4J3XA 4CEXC 1ONXA 3SURA 3QRHA 1SMDA 2VFDA 3NPVA 4OHQA 4C6LA 4RZ4A 1OF6A 2YB1A 4QNWA 1W3LA 2VL4A 2ODOA 4J5NA 4YYFA 3T07A 3OVQA 3SUVA 3MJMA 5I07A 2XSXA 2ZA2A 1U22A 4KIEA 3SY5A 4YNGA 4FMVA 5A2CA 1M7OA 2Y7EA 4K8EA 2J4GA 1DXFA 3UXIA 4FXSA 5DCBA 1Z6KA 4C65A 3TTQA 3BO9A 3ES7A 1O60A 5ABGA 3N2BA 4QE5A 3KRUA 4P5UA 1RA5A 3CYVA 2XWEA 4HHLA 5FSEC 2QYGA 1ZU8A 4ECLA 1TV3A 5FEZA 4PTWA 1TR1A 4HCHA 4ACYA 4XAFA 1EEXA 3RLHA 1M7XA 4S3JA 3VCCA 4R85A 4GUIA 3CL6A 3S4TA 4YL2A 3WNLA 3IUIA 3WF1A 3VGDA 1W9DM 3A64A 1OD0A 4J3ZA 5I79A 2ZX9A 3SRKA 4QSFA 4OVXA 2DUZA 2FGZA 1OY0A 3HMCA 1NDYA 3VD3A 4A3YA 3W2MA 1CT5A 2YXGA 3QQWA 1JCNA 3B9AA 2CNCA 3E2RA 1C8XA 1TPVA 1O6IA 2CLMA 3GK0A 4I8DA 1L6YA 3W2KA 1K9EA 1PZ1A 2VVSA 4CD6A 4QLLA 3LGGA 3C4UA 3W7HA 4JEJA 1SMAA 2IXUA 1GOIA 5CBIA 1DE5A 2WO5A 5DMMA 1A4MA 1UBPC 5DMYA 4KRTA 4PMXA 2ZFAA 5G5IA 3O6YX 3WSUA 1MW3A 2PWVA 3R79A 2Z29A 3DKJA 1M9HA 3U8GA 5CH9A 1XSJA 3W1RA 1E9YB 4G7EA 1CZ1A 1KRMA 2QEZA 4D1JA 1TPDA 3ITCA 4EK7A 3RJXA 3TXVA 4NRSA 3CT2A 2OYMA 3N14A 3TKFA 4BQ5A 1TMQA 2OG9A 4XVDA 3GM8A 3TQVA 1WXYA 3ABZA 3H7VA 1B9BA 4XIMA 1NJJA 1XQKA 5KTLA 3OGVA 3F1QA 3LD5A 1GVQA 2ADAA 1GUVA 2NQ5A 4O8RA 2NQHA 1JZ6A 2GDVA 5LYRA 3KCLA 4PUEA 1S5MA 3ITYA 2OZ0A 3URNA 1PX8A 1K8XA 2D69A 1TB3A 3N19B 2GYIA 1NFBA 3B8TA 3PS7A 1TFVA 3DENA 4L61A 3GHTA 3U4AA 4CD7A 5K9CA 2ONEA 4AMAA 4UQ9A 7XIMA 3GD6A 1PS9A 4UC5A 1GNXA 5I3IA 1E55A 5REQA 1S5TA 2G3JA 4L65A 1F8MA 1Y5VA 3S6TA 1JGIA 1B0IA 4Q7NA 2B7NA 3FYOA 3BW2A 5CZSA 3C52A 2I5IA 3COTA 2EG8A 3D3AA 4ATLA 5C2GA 1JZ4A 3AO0A 1RLDA 1GYMA 4ZQCA 1NP0A 1HKIA 3GRIA 1SO5A 4QDMA 3LM7A 3SI9A 1IIGA 4GYKA 4E2BA 1DJXA 1LL7A 3UF9A 5HXMA 1WP6A 2PTZA 1KFKA 1EXBA 2ZX8A 4GUHA 3VGGA 4JQ3A 3AZTA 4UTKA 5IDZA 1XC6A 3OZYA 4NASA 3S5ZA 4CVWA 3V35A 5FAJA 2A7NA 1W1A1 1RUSA 1GZ1A 1MO0A 3G8EA 3S1WA 4KKXA 3GIQA 3A12A 3GDLA 3WH7A 3PBGA 5G4HC 1FTXA 3M0VA 2VQUA 3BCJA 1O66A 2E6YA 4D6DA 5K3VA 3MHGA 1CGUA 4W8BA 4RW5A 1R47A 1LT8A 1V5XA 1YDYA 2IKGA 4K7VA 2DT3A 1DJGA 4F0SA 3EDEA 3EWUA 3KTSA 4HNLA 1ML1A 3BGAA 3R10A 5HPCA 1CIUA 1N82A 3AJ7A 2VO5A 4TQTA 3LSCA 4H6QA 1X8FA 1PYMA 5FA5A 1AVAA 4QEHA 3R25A 3GTFA 2OT1A 2NUXA 1W1VA 1VEPA 2E5BA 4GABA 5IFPA 3LNPA 2Z0IA 1LG1A 4Q8PA 4DLFA 2UZ9A 4QGCA 2PDLA 4HYRA 2CC0A 4EAMA 3NOYA 5EU9A 4BQ2A 1KXTA 1A3HA 2NX9A 2E68A 3PBYA 1B54A 2OO6A 3LHWA 3NZGA 3W7CA 1NDZA 1QPKA 2PB1A 5GNZA 1YNYA 2TPSA 2PS2A 1W1IE 4CQBA 1G4EA 3VTRA 2FZDA 1ZAHA 3GDRA 3RPMA 2V8ZA 1CNVA 1M68A 3MY9A 4UFKA 5F4XA 2XUCA 4GQ0A 3SGZA 3SO7A 1VBGA 4ZGYA 4YLWA 2VENA 2VR5A 4YCPA 1VAHA 1DWHM 2ABAA 3V3WA 3LCLA 2G3IA 3GNPA 4UR9A 4AY7A 1RQEA 4PMRA 3DBNA 1KWKA 5LKYA 3G1RA 1HKMA 3T2OA 4AEOA 3ABSA 4ERAA 3BOFA 1MW0A 5D04C 2YL6A 2WVVB 4J7RA 4QG8A 4DJFA 3CB8A 2ZRUA 4PCTA 2A2IA 1KR1A 3B03A 1H7XA 2RGMA 2GQ3A 3EDKA 2VEMA 3U6WA 1QFEA 2PEVA 3ZYZA 1TV4A 1Q5MA 2E1WA 3WQCA 5E1QA 1NQ6A 1Q66A 1SM9A 3BAKA 4KWUA 4F79A 2BASA 2BGQA 3DG6A 2WMGA 3KCJA 1XIEA 1JDEA 4CD8A 2YL8A 1DJNA 5F2GA 4WSKA 2VI0A 3UNTA 2B7PA 4Q4KA 1TMHA 2PWHA 4NYUA 1LRNA 5ECUA 4IFRA 4G8TA 3LERA 3JU2A 2A7RA 2YCIX 4GQGA 3WBWA 4FLOA 2XGZA 1T41A 4UTMA 3CYJA 4M5PA 3S2MA 4NQ1A 1EQCA 3N9SA 4JTDA 4IF2A 2Q3RA 3MUY1 4Q7IA 5BWAA 1REQB 1XYZA 4ICCX 3QV6A 4ZO6A 1ME7A 1H4PA 2HS8A 3LY0A 4RPQA 3MW7A 1Q8AA 4GIYA 1UWQA 2QHAA 2CLLA 1JYWA 1A5BA 1H62A 3HN3A 4NXSA 3N6QA 2JEPA 5KETA 3GDTA 1TR9A 2OLAA 1AH4A 3RAOA 3O07A 4CU6A 1MZRA 4QDWA 2HJPA 1FHVA 4LRTA 1QCWA 4IL0A 4ZSUA 3H26A 4UR8A 1Q6OA 4DQWA 3TU9A 2CETA 1AQHA 4RZ6A 5DY2A 1W9UA 4AC1X 4OT7A 2XIIA 1US2A 1SJBA 1H1NA 2G96A 2X8RA 2CFFA 1NH6A 3VE9A 3BLOA 2H6RA 5H8UA 3L4UA 1IYXA 5DQPA 3NA8A 4GE8A 1QBBA 4M29A 3KP0A 1YX1A 5CPQA 1DL3A 3AMGA 5TD4A 6ENLA 5C70A 1Z9AA 3MYPA 1UR0A 4V28A 4FNQA 4UFJA 4LT9A 3N9RA 4PUJA 1JL8A 2PC8A 4O1EA 3BANA 1GJWA 5M5DA 4A2SA 2XFRA 1YE6A 3E0VA 4AD2A 2REQB 3MZ2A 1FY6A 3A13A 3DFYA 3LQGA 1EO5A 1Z7AA 3AC0A 4XB3A 3SQMA 2WC3A 4WSJA 3F5KA 5JMUA 4EXBA 2WZHA 5KZDA 1R8LA 2J25A 3TCEA 3GLCA 2J7BA 1U1HA 3W70A 3LTYA 2PDYA 2ISFA 5TIMA 4EPBC 3SAZA 2GUYA 4IX2A 3W88A 1T0OA 4JTUA 3NQ8A 4JKKA 3Q94A 3AIVA 1VYRA 3NZ1A 3WH6A 2YDAA 2WVSA 2VHLA 1D3CA 4DWSB 1MWOA 4FSAA 3N04A 4RDZA 2E25A 2W9MA 3L21A 3MCMA 1XBVA 4JTFA 4M1RA 2LLEA 4E3VA 2DZWA 1UR4A 4K8HA 1XLHA 1Y8BA 1TCDA 1Q2RA 1BVZA 4O15A 1B3YA 1ALDA 3W7MA 1B3XA 4IP4A 1LZOA 3MHFA 4W4QA 1X96A 4Q4SA 2VCBA 1DKWA 2FB2A 4UZSA 2PDKA 1OADA 3R1ZA 3CWHA 4ZFCA 3TYAA 3OYXA 3N11A 2Y5JA 2HK1A 4N2YA 3T09A 3SCPA 3ZLHA 4M19A 2D0GA 4F2UA 3WLPA 3MBDA 2OWXA 1QOQA 2VRKA 4JFUA 1TVPA 1OJXA 5LNSA 4MB3A 3EWCA 3GNOA 4BJHA 3AZRA 2GSEA 2VCAA 3LN3A 1R2RA 4JAWA 4L6DA 5AVNA 1A80A 4JTSA 5H6HA 2X1SA 5I3KA 1QNSA 2WSKA 2QIIA 1ZBKA 4PBGA 1HVQA 4RJEA 1W56A 2OPJA 5HQMA 3WJSA 2Z1KA 1EPVA 2P3ZA 4P7OA 1XYCA 1X97A 4IH3A 2VCCA 2V81A 2JKAA 3IJ8A 1RLCL 4NJKA 3U2EA 1R3VA 3DH7A 1VEMA 1W5NA 3BLIA 3VOHA 1FP9A 1XBYA 3URQA 4OTKA 4CNUA 3GDMA 1NQKA 1ZB5A 3CHDA 1S1PA 1CGVA 3HG4A 3STFA 3I6EA 1XLKA 3TDFA 3MP5A 1P0EA 3NQVA 5AYIA 1H7WA 2JIWA 2CPUA 7PTDA 3LENA 4P7NA 1PIIA 3ZT7A 3FJ4A 3LLFA 2J9XA 3NGFA 4LX4A 4L1WA 5AC6A 1U83A 3TTSA 4X3ZA 2GSHA 5JIPA 5F7UA 4GKTA 1I2PA 5I06A 1RCQA 3FYYA 4TX9A 1QXLA 3VZYA 4DO4A 2DZTA 4Z2LA 2CW6A 3W7LA 3HG2A 2W0UA 2P88A 3M0HA 4HU0A 1TZ7A 1GTHA 3KRZA 3HV9A 3MDWA 2Q6ZA 2NLYA 1QNPA 3MYOA 4KPLA 4YCOA 4W8LA 1B3ZA 2X09A 4MZ8A 3GX9A 2PDWA 4ERIA 4PUMA 5A2AA 1O5RA 1TO3A 3SCRA 2IKIA 3TMLA 2W92A 4JNZA 4JTEA 3VIJA 3QHOA 2XIOA 4HNTA 1V3JA 5G1TA 3T4WA 2I7GA 2JGQA 5DMLA 1TPFA 2DIJA 3B3DA 2A7PA 4AHQA 4GGHA 1AQMA 4YTQA 4IQJA 2PWGA 3B8DA 3KZPA 1IT8A 1VP5A 4AFYA 1VFOA 1E73M 3CMJA 4KT2A 1QW7A 3TXZA 1AQ0A 4INFA 3VC5A 4O28A 4B5UA 7REQB 5I3FA 1W3KA 2R1PA 2Y24A 2WBKA 1J0JA 3KBJA 3QY8A 3QR0A 3BSMA 1RBOB 5AECA 4AG0A 3HGRA 3VM5A 4QJ3B 4DM2A 3RO6A 4DZHA 4B5WA 2XSAA 3TEVA 2Y0FA 1EBHA 2CU0A 1JYXA 1XP3A 4N42A 2O9RA 3H55A 1UOKA 1B3VA 3JZEA 3BG9A 5CXPA 1OFPA 3VXGA 4LANA 1KCLA 3ISIX 1C3FA 5AOUA 4BI6A 3O3RA 1HX0A 4MKSA 1L6FA 1EPXA 3P8IA 1UZ1A 3VMNA 2TRSA 3T42A 2XYLA 4C6DA 2E40A 1UBSA 2DSVA 4G1KA 5TQLA 4XV0A 4UCFA 3WFZA 3GWQA 3W87A 1J0KA 3WDQA 1E1FA 1T7LA 1EFZA 2JK2A 1BKHA 2XN1A 4J35A 1XIDA 2POZA 3S9YA 2D3NA 1XYMA 4DO5A 3AS0A 1O5QA 3ZJ6A 1V3MA 4L64A 4MWAB 4B4FA 3N2TA 5FEXA 4M24A 4EPEC 1SR0A 1YTEA 3L5AA 1DIDA 2VC5A 1WAUA 4HJFA 4DF2A 5MKGB 1AK5A 4RDYA 3RMEA 1U5HA 3V5CA 3T8QA 5A6MA 1ONRA 2XU2A 5D2WA 1UOZA 2J66A 2X0SA 2R1NA 3N4FA 4PFHA 1MYRA 1ZENA 4C1KA 1DWJM 3QW4B 3W1TA 3NG3A 1GVRA 3EPNA 4LXFA 3EB3A 1CXIA 1IF2A 3L5MA 2FJKA 5HMFA 2E09A 3WLRA 3AI0A 1SPQA 1ZTVA 3R5EA 3VX1A 4CU8A 1ODUA 2WSQA 4BA0A 3UA4A 3VIHA 4HOWA 2NT0A 1KM0A 4X61A 2PWFA 2FZNA 3ZFHA 5HOSA 1P7TB 1F07A 3EX6A 4NKCA 1PBGA 3NR0A 2Z25A 3GW3A 2JFEX 5A8OA 4GX9A 2QF8A 3N25A 4H9ZA 5DO8A 1YTKA 1UWSA 3E5PA 5B80A 4MUZA 3DERA 2DEPA 1ZBCA 1P0DA 3M6YA 4FOJA 3DGRA 2FTPA 4H9VA 2VWTA 1O1ZA 4B90A 2CERA 3MDUA 4TX8A 2HWGA 3REQB 3GNXA 5I2UA 4B3ZA 1Q45A 3TR2A 1US3A 1WNOA 4NG3A 1LOLA 4JHMA 4UQAA 1A0CA 4HB7A 2OZTA 4S3AA 5FSDC 2CWXA 1H5YA 2GLKA 3M5XA 4N4QA 3MSDA 3EXTA 5LIKX 4Q4RA 4FAMA 2NLIA 3W1QA 1OYAA 2WSRA 1ME8A 3ZIZA 3ZVHA 3VZZA 3QR1A 3UCQA 3T6CA 4MKVA 1MMFA 5IRPA 4DZAA 2HMCA 3VGBA 3AIRA 4NJIA 2C14A 4M8UA 3VNKA 5AC8A 1S5VA 2PE4A 4E4FA 3DFOA 3KBNA 4NVTA 4J2PA 1QI2A 3R89A 1MXGA 5DANA 4HBKA 4MDPA 4Z1BA 4HPNA 3SIMA 4BZYA 3UPWA 3C2EA 3PZUA 3W7OA 1IZKA 2QDEA 1AH0A 2FGBA 4H7VA 1Q2SA 2QLYA 3PZGA 5E0KA 5FJRA 4ZENA 1JUEA 2FH6A 4LBUA 4XX6A 1TCMA 2UBPC 4AQLA 2WVUA 1SW0A 3WDHA 5E70A 3ABOA 3B9OA 4O1BA 5LIYX 1KC7A 4MJ2A 4Z17A 3S6OA 3VIIA 3VNIA 1DJHA 4UMAA 2PA6A 3TC7A 1UWTA 5LIWX 1HKVA 4ZO7A 3PZQA 4AZIA 3P61A 5AYBA 1P1XA 4HYVA 3GH4A 4HQVA 1WOBA 5CSYA 4FNSA 2H9AA 1G4TA 2ZUUA 2DSZA 4YHEA 2NSXA 1BG4A 3IGUA 4XUYA 3G0XA 3QY7A 1V02E 3U0HA 4ZR8A 3CQKA 5F4SA 1XDJA 5EMMA 1SFTA 3MSGA 5U7SA 4PB5A 3LNMA 3N4EA 1OB0A 3JS3A 3M16A 1W91A 1U5VA 4DUXA 1E1EA 4M6UA 3RK8A 3CWNA 4A8LA 4I8YA 3MQTA 1IEWA 4LAMA 4RV3A 1FWRA 2OGJA 4Y9MA 4TX6A 1WXZA 3UW6A 5ABEA 4Y9PA 3B0YA 3E02A 4NJHA 3AHVA 4C6IA 2WCAA 4DJED 3CHVA 2FTYA 5AHNA 1ITQA 3M41A 4DXXA 5DBUA 1L6SA 5I09A 3I6RA 2CYGA 2VEGA 4L9ZA 4OOZA 1J10A 1A3WA 1O1HA 2G4FA 1UPMB 2CZVA 1TZ9A 5A8PA 4KWWA 3WQDA 3EOEA 4C6CA 4ORMA 4QCEA 3MT1A 3M6DA 4WD0A 1PDYA 1AW2A 3FVMA 4KW2A 1E4IA 1I1XA 3JZUA 3SR7A 3OOQA 3ARVA 1K6WA 2CWNA 3GDBA 3SCWA 5E0FA 2A3EA 1Q4WA 1LYXA 1GONA 1ADOA 2Y7GA 1XR2A 4EIVA 4UTFA 3KVLA 2E6AA 1J01A 1XH2A 3SQSA 2YYTA 4U2YA 1CI1A 3ARPA 3W1XA 1JDFA 3TROA 1XLMA 1XLJA 1LWJA 4LB3A 1UROA 4GACA 3I10A 3WX7A 4Z0JA 4JTGA 1G7UA 3K1GA 5K9XA 3CV6A 3DECA 5ABHA 3T44A 1R3QA 1CB7B 1E51A 2ZXQA 3DGBA 3D6NA 2OYLA 3ARRA 2ZWZA 1OYBA 1VCGA 1KFLA 5AKQA 1RXOB 4NNAA 3LHVA 2AKZA 2DUAA 4GFIA 2RAGA 4JTHA 4C6MA 1ZY9A 1QPNA 3BC9A 1E4NA 3L0KA 2ZUTA 4B9YA 4JOMA 3CXOA 1UCWA 2Q71A 2C71A 3C3NA 4KFOA 4KQNA 1DTNA 4JBRA 1FA2A 1RY0A 4DO6A 5G1MA 2XGBA 5CBBA 2DDXA 1DPMA 4K3ZA 2P76A 3UXDA 1YXCA 1TX0A 4DZIA 3NZRA 2JBMA 3GAKA 3NGJA 1E4MM 5DRIA 3MZNA 3RPDA 4R3UA 2BOFX 3RXZA 1XI3A 3A9IA 4H7CA 2VR4A 4PUDA 5LA0A 3BE7A 3LPPA 3TIMA 1C7TA 1BKSA 2V0TA 3PBWA 5D2YA 5EMUA 2OX1A 1RA0A 3G1FA 1U5JA 4H9UA 3NQGA 4WXZA 5LIUX 4OOUA 5T8GA 3O6AA 3HOJA 3BQ5A 5FJUA 2MNRA 1TE6A 4IQLA 4HPHA 4JQ4A 1MEIA 1CW2A 1XSIA 1I4NA 1YPIA 3GXIA 4LCRA 4GYPC 3ITXA 2DV0A 4CCDA 1UH4A 3L12A 3ARZA 3DG7A 2NUYA 4MNMA 2QCDB 2QVNA 3RG6A 1Z41A 2OZ8A 1WA3A 3GHRA 4AXNA 2IPWA 1GVOA 3TYUA 3N12A 4IHCA 2KX9A 4PCPA 3G1SA 1LT7A 5D9MA 1B9ZA 4ZOCA 4IMCA 3AIUA 4BFAA 3M46A 4US6A 3VIFA 3KEHA 3W7NA 4JIPA 3VPLA 4GI9A 1Q65A 2CXEA 4S3CA 3EKLA 3AIWA 4FNUA 1JIBA 2NV9A 2ABBA 3VNLA 2DVUA 3FGCB 4PMJA 4GD0A 2X1IA 2W5FA 2V5KA 3WQ5A 1WUFA 2YW3A 4HZMA 4ADUA 3GQYA 1VFHA 4W5ZA 4HIBA 3A9BA 4R33A 1EZ2A 3QEZA 1OX4A 5DCEA 4IIHA 1TPB1 5EBAA 1V08A 2HISA 2DY3A 4OZOA 1OCBA 2R9RA 4GOAA 2ZUMA 1WCGA 4W7WA 4IJRA 5HWJA 1S2UA 4XD4A 3O6CA 1R5YA 2AAAA 3A47A 1BYDA 1J12A 3NO5A 1F3WA 1BSLA 2W66A 2HROA 2WJEA 3QLLA 2X2YA 3FS2A 2QUUA 2F61A 2ZZ1A 3BGJA 2V30A 4KCWA 4PB4A 1X8CA 3E2SA 1G5AA 1ZPTA 4C1LA 3CUXA 3PC0A 2XIJA 1FQ0A 4IMFA 1NSJA 3PNZA 3AOFA 1HVXA 2WHKA 2OX4A 1IEQA 4TMBA 4LEQA 1XICA 4LUSA 3FKRA 3W0KA 1G1YA 4AD3A 1OBAA 4QP0A 4QM1A 2G0WA 3MI6A 1E9IA 3GTNA 1WO2A 3CJPA 9RUBA 2QXWA 4GH1A 2HS6A 4DLMA 3VX0A 4GIAA 4FOUA 4C6JA 2Y8VA 1SFSA 3I3EA 3VMOA 2Z1VA 2V5CA 4MUPA 4KF1A 1AL7A 3U5YA 2Z4GA 5ABTA 2I56A 3CQ0A 4HSHA 4FLSA 3OJGA 3CUZA 3QMSA 3ABXA 5M2FX 1QNVA 2V2HA 4ORIA 3QVQA 4B3KA 1P0KA 5HWNA 1FCQA 2WZTA 1A0EA 2E1DA 3EWBX 1QPRA 1TPUA 4JTAA 4PR4A 3E0LA 3P62A 4LC6A 3S8HA 1R7OA 1FH8A 3TZNA 2IS7A 4B5SA 3F03K 2R8WA 4GZIA 1EJXC 4U4MA 1E56A 4RCXA 3W2NA 3PTMA 3PTDA 3KOZA 2QCCA 1L0PA 2VJXA 2HZGA 1Y5XA 3WQWA 1H2JA 1KO0A 3S1UA 3CM4A 4QSHA 4BCEA 4DUOA 2PP3A 1JCTA 3V5OA 3G18A 4H8UA 3H4WA 2QJMA 2WC4A 4MHBA 3WLIA 5EKYA 3RRAA 2PWDA 4S3EA 3DHUA 2P50A 4YTUA 4X63A 3C6CA 4GA8A 5A6SA 7CGTA 3CMFA 4CVUA 1KLZA 4XUGA 3UT0A 2WMHA 3NDOA 4CU7A 1JQXA 3GFYA 3NURA 2OO0A 5DMNA 3DZ1A 3PJUA 3A22A 3S1GA 1R9YA 3IGHX 1MQQA 2AL2A 2DSWA 1E0UA 2G37A 4AU0A 1KM2A 3JR2A 5JUVA 5TAOA 2AL1A 4V1YA 3TZFA 1RJRA 2PRMA 3NSNA 3CZLA 4F0RA 1W1ZA 3EX2A 3WLQA 4WXYA 1V3KA 4D2JA 2JE8A 2E67A 5HR7A 1QJWA 2OQLA 4U3AA 3WBXA 2D2GA 3AWOA 1YADA 4JGDA 1NWSA 2Q8LA 3OHIA 4MAZA 4Y90A 3QGKC 3TN6A 4HA4A 1FWCC 4I5XA 4Q8NA 3ZMRA 4DJEC 1M5WA 3ERPA 3F7JA 4E3TA 3M7SA 3RM8A 3ZQ9A 5I3JA 4I6VA 1JCYA 1VJSA 3GNRA 5I77A 2Z2BA 3EDDA 1CLKA 3R0DA 4JKMA 4H41A 4NAEA 3LRLA 2QGHA 3BQ6A 5AC4A 6ALDA 3T0AA 2WYSA 1ZFJA 1MRAA 4Q3MA 3WO8A 3A3XA 4HOXA 4IFOA 1F05A 1JNDA 4GY7A 3MP3A 3PBVA 4AX7A 1PUDA 1UKQA 4MZYA 2GDQA 4MY9A 1LLWA 1DWAM 2E6DA 2C8NA 4S3FA 1W9BM 4DPPA 2Q02A 5BW6A 3IJ9A 4P61A 1OM0A 4M6PA 4NYYA 4JXCA 4AH7A 4O10A 5E6ZA 1FBAA 3KHDA 4ZE4A 3CQHA 1JD7A 1MEWA 1EGZA 4J28A 4W9TA 3RHGA 1H7RA 1LJYA 3LMZA 4FI4A 4PEEA 2WLZA 2WQPA 3ARTA 3WBYA 5EMKA 3NPUA 3IAQA 5A8QA 4MB4A 3W00A 2X1RA 4G7EB 5AHFA 1XDMA 3BV4A 3MCNA 3PN8A 3KBVA 3MKCA 5EMLA 1QAPA 1PIFA 2F8QA 4N7QA 3BJSA 3GIPA 1V6XA 4LNCA 2YLAA 3SSJA 2NV2A 3LA4A 5CG0A 1E6XM 1GKRA 4HN8A 4PTNA 2QUTA 3HURA 2WQDA 1U33A 2AMGA 3CT7A 4HTYA 3HZ3A 3RR4A 1L8PA 3M1ZA 4HNCA 3TQPA 4LVGA 4TVCA 4MMWA 2PF8A 4QROA 4XTIA 4M56A 4HA1A 2PRLA 3MUAA 4KETA 3ZLGA 4PSRA 3N17A 1KLYA 3TTYA 3NQ7A 3T4CA 3KRBA 1S2VA 1Q6EA 3C86A 2EGZA 5REQB 4GISA 1FWBC 3N2CA 4C6PA 4MTVA 1TJPA 2VUYA 3GH7A 4YWIA 3DC8A 1XV8A 1HXJA 1BQCA 3AAMA 3OZMA 3GG7A 5D33A 4ZE5A 2H8ZA 4BY3A 2ZRXA 4BR1A 1T96A 5JH1A 3S42A 1C29A 2POTA 4ZQOA 2WHLA 3WK1A 1CCWB 1S46A 5A8GA 1M65A 3ZO9A 1TV7A 2WANA 1EUNA 1Q85A 3TAKA 4XZMX 2FPTA 1IGSA 2A4AA 3L4XA 4NY2A 1R86A 3SQLA 3ID7A 3W75A 5DX7A 4DBSA 4XWUA 3N9KA 4AW7A 3I65A 3S2NA 1R30A 4HTBA 2ZOXA 1EH9A 2XJ7A 4A29A 3NO1A 1EKOA 1GTEA 1ZUAX 1AJ2A 4MB1A 2VD9A 1AJZA 3I7SA 3KL3A 1EYWA 1K7XA 2OQHA 4RPPA 3R58A 1DHPA 3H23A 1XRFA 2QUMA 3MMUA 2RJHA 2Z6JA 4C7DA 4FIRA 2V67A 2R91A 3RLVA 1VEOA 1XLAA 2J79A 3V4BA 5HJLA 3GG1A 4UFIA 4ZXOA 1BF2A 3NQ6A 4QQUA 2EPNA 4C90A 3O63A 3MUCA 3PG8A 4MNJA 1QNQA 4KIRA 3R8RA 2ZUWA 3SCTA 4X2PA 1XIFA 2HRWA 1WX0A 5I23A 4MY8A 3L9CA 5BXSA 3K30A 1HTIA 3IIVA 4WZHA 2GVEA 3U5UA 3W6YA 3OQ8A 3OBKA 1KQZA 4UTTC 2YLLA 1JXKA 4DX3A 3GFZA 4PB3A 3QHNA 3M07A 2WMJA 4G6CA 1Q6GA 3E9AA 2PODA 5KZMA 1ZALA 5A95A 3CPRA 2XZ9A 4W7VA 1E43A 5HJYA 3VZXA 2ZCGA 4QJ4B 4Y96A 4CNSA 2VC7A 1A5SA 4FEZA 3R2GA 1YKWA 2QUVA 5KEZA 5K4ZA 7TIMA 2I5QA 2BDQA 1LUCB 1QOXA 3NEVA 4LS1A 1UA3A 4YIWA 2FHCA 2JF6A 4NP7A 1EJSC 4PTXA 2J9YA 4EP8C 3W81A 2YCLA 3KDNA 5KINA 1DJZA 5DF0A 1UJPA 1PKLA 5D30A 1HL8A 1N7KA 1KCKA 2ZUNA 5SWUA 5FF0A 3ZVIA 1RAKA 4QFUA 4AVFA 2NQ9A 4UFLA 1N8FA 4PBEA 8CGTA 4AY8A 3WH5A 4GGBA 1PVNA 1EOMA 2GWNA 5FL1A 4HZ8A 4H1ZA 1S5NA 4E4PA 1H09A 3LZ5A 1TJRA 3UGRA 3QHMA 4HT3A 3T0TA 3UJSA 1R7AA 2BV9A 1V8EA 3CUJA 1NOUA 2UY5A 3OO2A 4IQEA 4JY9A 4DF1A 1EJ7L 2P3EA 3GZ3A 2EG7A 1UJQA 1IWPA 4WVXA 4FS9A 1JCMP 2VGGA 3TN5A 4YWSA 4KGJA 4IPPA 3CH9A 1W5MA 2NXIA 3W7QA 3CQJA 4UWMA 1BVWA 3M0YA 3WUEA 3NNTA 3GS6A 4GH3A 2WVTA 4GX8A 2G3FA 3MSRA 5EA9A 3UWVA 1F3XA 1EIBA 2EHHA 5LNWA 4R5EA 1JXJA 4E4UA 1D7FA 1JR1A 3DHDA 3VU2A 4YHGA 2OKTA 1HJXA 3RR1A 4KEVA 1VFSA 4RX0A 1V3IA 1NF7A 3MB9A 5BU6A 2O92A 2PTDA 1JGMA 3B9DA 1F6YA 1BPLB 2ZRWA 6REQA 1O68A 2PSNA 2ATMA 1ISZA 4PMVA 1SQ7A 1HKWA 3B8WA 1NEYA 1THFD 1BYBA 4K6AA 3RU8X 4Z0SA 1VFMA 4N9DA 1LP6A 3W86A 4GVFA 3B0UX 3WNPA 3ZJ7A 5C2XA 3N3MA 3B9EA 3P60A 2YA1A 3DI1A 3GTIA 5A8NA 1XRTA 3WFAA 3THDA 2BVDA 1K03A 2Y63A 1KBKA 4W89A 3JUGA 3RM4A 2ZRYA 4HKPA 3SCVA 1ELSA 2PUZA 1H11A 2J7EA 1MFVA 1JULA 2NVAA 4S1FA 5CZJA 4B5VA 1VJZA 4Y6GA 4HGXA 2J27A 4JN8A 1HQTA 2VMFA 2PPGA 5A69A 1CECA 2WAGA 1W1YA 2XVKA 4DELA 1WDSA 1TPC1 1YNPA 4O0ZA 3RO8A 3M5YA 3W01A 1M6JA 2AMXA 1HUVA 3Q65A 3I68A 3WEMA 3LEPA 1P7TA 3TH6A 2VM8A 2J74A 3F4CA 1JFHA 2XDFA 1OGBA 5GNXA 1V6TA 4PH6A 4NRRA 5HR6A 2Z28A 3KS6A 4NX5A 3REQA 3KTXA 1ONWA 1PWMA 1OFBA 3HG3A 5LIXX 4UCGA 2J78A 2XM2A 1SYTA 3GFXA 4ZQNA 3W82A 3K13A 1KBIA 1RP9A 1WKEA 2BY3A 2A85A 1IV8A 3W7EA 2Y2WA 4WQ6A 3GC5A 2HTMA 2P8BA 1IWAA 1RBAA 2CZFA 4Q8QA 2DZVA 2V5JA 4DJDD 1LTDA 2GQAA 3TYBA 1XRVA 4R7JA 2YL5A 2GGHA 2RDTA 4RE2A 2YOCA 1QW9A 1ZSXA 3R4IA 3N18A 1LWIA 4HPGA 2RFGA 2HBXA 1W3IA 2YFOA 4AZ5A 4NT0A 4H4IA 2XFFA 4WK9A 4F0LA 4OFCA 1I8JA 1ITCA 3HM7A 1J96A 3RITA 2WHJA 3H2MA 3W72A 3OB8A 2VQTA 4TVDA 3T08A 2VC6A 3L2IA 2WB5A 2A1YA 3QV7A 2YIHA 4GVGA 4A8IA 4H19A 2R24A 5A6LA 3IV3A 2DZUA 1DV7A 4LV4A 4WOZA 5AYXA 4KWOA 1UH2A 3L4YA 4JQ2A 3HTWA 3QOMA 4XSLA 2V5BA 5T26A 2G5WA 1YXDA 1PKMA 1UWIA 3N3TA 2QGYA 5C71A 2GJLA 2XVPA 2V69A 5AHEA 5H2ZA 3PUGA 3WF3A 2PU0A 2ZE0A 2CCRA 1EJUC 1GOMA 3W2LA 7TAAA 3KRSA 1RP8A 2VC9A 1R0MA 4G9PA 1HW6A 3ARWA 3RF9A 3BMWA 4A8NA 1V0NA 4S38A 2V68A 2GOUA 3C8NA 4K37A 4IIBA 3W3OA 1KA9F 3F4WA 7A3HA 3M9YA 4BKNA 1PTAA 4JTQA 1O12A 4R9XA 4JN6A 3S9IA 3IIZA 2PZ0A 4FNPA 1AFSA 4U28A 3QZAA 2X2GA 3WENA 4GY0A 2WC7A 3VNYA 4K2SA 3QV8A 1W9VA 4FX7A 4S3DA 3K8KA 4HPXA 3TYZA 3O06A 3I7RA 3PBMA 3TN4A 2EXOA 3G1YA 4XK2A 3SBFA 1MQRA 1R3TA 2GOKA 3SADA 5HATA 5GQBA 1OD8A 1KM1A 4LAOA 2ZA1A 3EZ4A 2JF7A 4MVAA 4GNJA 2ZZ7A 2PTWA 5KMYA 4AIOA 1OYCA 1JYNA 1E71M 3B4YA 4XAZA 4TXEA 1W32A 3C56A 1F6PA 4YPJA 1HIZA 4HSOA 2V2CA 3KTCA 2QIWA 5KZ6A 3WFLA 2QT3A 4E6MA 3SECA 3NWRA 2FZMA 2BVYA 2QR6A 3PUOA 4JIEA 2GJNA 3SCNA 5TBOA 2QCHA 1YEYA 4JTLA 3G77A 1SW3A 3USZA 2PWUA 2VYOA 3SM0A 4N6FA 2BWGA 1DJQA 1CB2A 1EYEA 1XSKA 2VGFA 1L2QA 4WGXA 4QNEA 1AMKA 4H8HA 1CX9A 2YB4A 1EA9C 4C7FA 1F7BA 1QASA 3E6EA 4AIBA 2WCGA 3FHQA 1PHQA 4KBXA 1DIOA 2HBVA 5I6SA 1X1OA 2VFEA 3TNBA 2GJPA 3FNDA 4H9YA 4WLCA 3FIGA 3TOYA 2XFYA 3C0JA 2HQAA 3W26A 4AZHA 2ALDA 1A49A 5PTDA