3LBOA

Human aldose reductase mutant t113c complexed with idd594
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
314
Chain Sequence
b'ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 314
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lboA00
3M0IA 2IPFA 3Q67A 2BP1A 1ZQ5A 2PDFA 1UR3M 1RY8A 3WBWA 2PDUA 4JQAA 4PMJA 2I16A 5LIUX 3LD5A 2INZA 3MB9A 4YU1A 5HNTA 3BUVA 2PD5A 1C9WA 1EF3A 1FRBA 2J8TA 1S1RA 5AZ0A 3LEPA 4DBSA 1X97A 5C7HA 4JQ2A 1Q5MA 1Q13A 3DOPA 3LN3A 3WBYA 1YNQA 4I5XA 3R58A 2PZNA 1K8CA 5LIWX 1AH3A 1AZ1A 4LB4A 4XO6A 3M64A 4QXIA 4F40A 1S2AA 3MC5A 4JTDA 1T41A 2PDBA 1VBJA 2ISFA 4H8NA 4XZMX 1AZ2A 4JIHA 3LZ5A 5AZ1A 3GHRA 4XVDA 2C91A 3ERPA 1HQTA 4HMNA 1HW6A 2PDLA 1ADSA 1PZ1A 1AH0A 4R9OA 3CAVA 2BGQA 2PD9A 1LQAA 1EXBA 3T42A 4ASTA 3VXGA 4FA3A 4NKCA 4ZFCA 3G5EA 3LQLA 3F7JA 4L1WA 2FVLA 3R94A 2R24A 4JIIX 3WCZA 3R43A 2PDIA 2HVNA 1AH4A 2P5NA 4XZNX 2IQDA 1QRQA 4FAMA 2HEJA 1US0A 1EL3A 3EB4A 1YE4A 2HDJA 3M4HA 4YS1A 4LBSA 1Z89A 1XGDA 2DV0A 1PWLA 4DZ5A 3R6IA 2PDYA 1S2CA 3G1RA 1RY0A 3EAUA 4XAPA 3COTA 1OG6A 2IPGA 3S3GA 4FALA 3BCJA 1YE6A 4L1XA 2NVDA 3BURA 4PRRA 1GVEA 3O0KA 2FZ9A 1XF0A 2PDCA 5DANA 3UG8A 1AFSA 2QXWA 4WRHA 4LAUA 2ACSA 1MRQA 4JTRA 2PDHA 3GHUA 1PWMA 1IEIA 1J96A 4DBWA 2PFHA 2IPJA 1X98A 1PYFA 3UZXA 1XJBA 3C3UA 2IQ0A 4MHBA 3UZWA 4IJRA 4OTKA 4QX4A 1T40A 2F38A 2HE5A 3LUTA 2PEVA 4Q7BA 4XZIA 4RPQA 4H7CA 2IKGA 1EKOA 4HBKA 2ACQA 1IHIA 4JQ1A 4GQGA 4PUUA 4DBUA 4WDWA 2IS7A 1ZGDA 1A80A 3H4GA 2DUZA 3UP8A 3N2TA 2F2KA 2IKHA 4XZLX 2I17A 2FZ8A 3UFYA 1Z9AA 2WZTA 5KETA 1MI3A 3QKZA 3R8HA 4GACA 1R38A 3P2VA 4YVVA 2IKIA 4EXBA 5LIYX 3LQGA 3UZZA 2ACRA 2HVOA 4LB3A 2R9RA 3V0TA 3BV7A 3O3RA 3UZYA 2ACUA 2BGSA 4WDXA 3V0UA 2FZBA 2DUXA 3FX4A 2PDXA 3H7UA 4XK2A 3GUGA 3ONCA 1JEZA 2A79A 4LAZA 1RALA 2PDNA 5HA7A 2PF8A 3KRBA 4G5DA 3CMFA 3LBOA 3CASA 3ONBA 5JH1A 4QBXA 3R8GA 3LNMA 4FZIA 2IKJA 2IPWA 4IGSA 2NVCA 4WDUA 5JH2A 1MZRA 3R7MA 3H7RA 4EXAA 4JQ3A 1ZUAX 2PDGA 3B3DA 4GABA 3EB3A 1PZ0A 4IJCA 4JQ4A 2FGBA 4YVPA 4XVEA 3GHTA 4XZHA 3Q65A 1X96A 1Z3NA 4Q3MA 1SM9A 4WEVX 1YNPA 5HNUA 4WGHA 1Z8AA 3LENA 2PDQA 3RX3A 3WBXA 4XO7A 3V35A 5LIKX 2HV5A 4JTAA 3UWEA 4JTCA 2CLPA 3RX2A 3LZ3A 4AUBA 1S1PA 3FJNA 2PDWA 3D3FA 4PRTA 3NTYA 1M9HA 2PDJA 4GQ0A 4PR4A 2WZMA 2PDPA 3GHSA 3U2CA 2AGTA 1LWIA 3CV7A 4GA8A 3N6QA 4JIRA 1ZSXA 2PDKA 3UGRA 5LIXX 4GCAA 3V0SA 2INEA 2PDMA 2ALRA 3CAQA 3V36A 1QWKA 3WG6A 2FZDA 4GIEA 4LBRA 4PUWA 3RX4A 2HE8A 4JTQA 4QR6A 1VP5A 4WDTA 3DN5A 2VDGA 3CV6A 4YVXA 4ICCX 5M2FX 3UYIA
chains in the Genus database with same CATH superfamily
3NQDA 1HJXA 1HKIA 4J7RA 1QAPA 3CYJA 4FNTA 3S5OA 3GX9A 2ZZ7A 2DZUA 4NZ5A 3QH2A 2X09A 4G56A 3TQKA 3BOXA 4I6KA 3UNDA 2ZWZA 4OFCA 1OCQA 1S5NA 1B90A 4QROA 2O4QA 2YKKA 3L5LA 3TYUA 3LX9A 5AZ0A 4O50A 2H8ZA 4KW2A 4L6DA 1BVNP 4HP5A 2QUNA 1X97A 1S3HA 3GC4A 3DYPA 3WQFA 4QCFA 5BYWA 4LSBA 5I77A 2VP8A 4JTSA 2GDUA 4HCHA 1EO7A 1XLBA 1MNZA 1C93A 3M0HA 1YBQA 4MWAE 1CXIA 4CNNA 1V0LA 3CPGA 3T4CA 2ZRZA 4ZSTA 2BNJA 2B81A 3BQ6A 1GOQA 4S3EA 3W22A 4HPJA 1UP3A 1R7OA 1HFBA 2BHZA 2C79A 2YB4A 1W5QA 4MB3A 4Q4QA 5AHFA 2ZX8A 1E0VA 5DMNA 3REQB 1KM4A 1KBIA 3A22A 3P60A 1FXPA 2QAPA 5CC3A 1WDWA 3QTGA 1PVNA 1UKOA 4GYJA 4KESA 1CLKA 3BAKA 1S3TC 1EC9A 1OCBA 4JHMA 2YDQA 2R24A 3L2MA 4FR6A 4PUKA 3ES7A 4X0NA 5AN7A 1J11A 1U1UA 3W9ZA 4GC3A 4HIBA 4H01A 1J18A 3WQCA 2E28A 4O8RA 1J6OA 2BY1A 4ATLA 1RVKA 5MF5A 1ONXA 3W7OA 3W7GA 4RZBA 4L61A 5IM51 3AHZA 4WGXA 3E0VA 1TVLA 1EP2A 4QDMA 4ZMGA 1QATA 1VPXA 3QSTA 2XGZA 1XR2A 2VCCA 3SM0A 1BXCA 2XINA 2D0FA 3GUWA 1TV2A 1YE6A 4NASA 2HXUA 5E0KA 4GQQA 4UUIA 2PRHA 3UU0A 4D71A 2PDCA 2ZZ6A 4V15A 2PLCA 1DJZA 3BAYA 4O10A 2ZUNA 4IQDA 1H7NA 4WD0A 2CLIA 2Z7GA 4QLLA 2ZXAA 4MNLA 1JDDA 1GW1A 2PDHA 1UD6A 2QJIA 1V7AA 3GHUA 4JCLA 2JGYA 3L5MA 1A5CA 4D6IA 3P5YA 4ACYA 4GFIA 1F4HA 2JIEA 3WQDA 3WLPA 1V3KA 4TV6A 3USBA 2E8ZA 3PWAA 1XJBA 3C3UA 4U2YA 1UWAA 3LHTA 3TFCA 3A6OA 1XH1A 2G50A 4OV9A 2ZX5A 3AZTA 5U4NA 1KNWA 3GKAA 2PEVA 1E0TA 1DQXA 2BVYA 5BXSA 4P7LA 2VI0A 2W61A 1C92A 2FFIA 2W91A 4JQ1A 3GFYA 4GHRA 2GL5A 4B5XA 2HPIA 4DBUA 3QMTA 1M7JA 3THCA 3OVGA 3FA3A 2O92A 1M01A 2GDQA 2XWEA 4EACA 4UOZA 1EP3A 2UY5A 4UTLA 1LYXA 3PY2A 3ENLA 3M5VA 4LC6A 4Q33A 4GKLA 1MZHA 4QP0A 1R3WA 4S2BA 4N2YA 3CUHA 1UHVA 2PCQA 4YVVA 1DXEA 2ZUVA 5HJLA 4UFKA 5C2GA 1IIGA 3A9BA 1OT2A 3MSGA 1O4UA 3P67A 3I6EA 3OHMB 4GXPA 4E5TA 3QSRA 4C65A 2YYUA 3RNDA 1Q6QA 3KTCA 3KLLA 1J2BA 2YXGA 1EJTC 3MSYA 3S5YA 3ZR4A 2D3LA 7TAAA 2V3EA 4C1KA 2UY2A 3KDNA 3B8DA 2VD9A 2B7OA 3MO7A 3TW6A 3KBMA 3LLDA 1CLXA 4LANA 4LVAA 3EA2A 3WUFA 4CNPA 3CZGA 3Q45A 5EFDA 4LALA 3FYYA 3JR2A 2NVCA 2DSUA 3IGHX 3PNZA 1P0KA 3GNPA 2ZA1A 4EWND 4XB3A 1PTGA 4PZVA 4AIOA 1BQGA 2PDGA 2VX6A 3B8SA 1FOBA 1YQ2A 3DFQA 4JQ4A 3VOFA 1M04A 2D23A 4Q3MA 2VZTA 4RZ4A 3ISIX 4GBDA 3S6DA 1H41A 3SN1A 3KVKA 2WC7A 3WL0A 3SBFA 2G41A 5LA0A 1SSGA 1KKOA 2WANA 5C0QA 4C6IA 4M80A 1SO5A 4DYJA 4XBKA 1M6JA 2J74A 4GQBA 4D8ZA 1VBUA 1GZGA 4AHPA 2ZRXA 1OF6A 3W2LA 4M6QA 2GGGA 3MUCA 1BYCA 3BAWA 3M5ZA 1NQ6A 1DIOA 5DCEA 1XD1A 2FKPA 2QJJA 3N2XA 3MSRA 1CZ1A 4JIRA 4MWAA 1XLEA 4YCOA 1IXQA 1WDQA 1V02A 2ALRA 2Z2BA 3TONA 5H1WA 1X7IA 5HBFA 4GIEA 3MZ2A 2UZ9A 1XYCA 3L0GA 4WY0A 1XIEA 4O19A 4L64A 3FGCA 4YVXA 1VENA 4LUSB 1LLWA 5DRIA 2ZZ1A 4LUIA 1KLZA 1UKSA 3KOYA 3HV8A 3ZLHA 3D3AA 2O0TA 4A3QA 1A0CA 3TNOA 4JQAA 2WMIA 2J66A 5EPDA 1ICSA 2PUZA 4TX9A 3PFMA 3MB9A 3URQA 5JU6A 1XGZA 2G96A 2PD5A 5AVNA 2V38A 1RD5A 1WB0A 3LXBA 2GVGA 2PRMA 1EJWC 1CECA 2QCEA 1BEUA 1VPQA 5DBUA 5C7HA 4O1DA 3SCPA 4Q22A 5DMMA 4X9YA 1Q13A 1LG1A 1WP6A 3S9YA 1BRLA 4HNTA 4H6KA 1LOLA 2PWHA 1GVSA 3QZAA 3P8IA 4FNPA 3OVQA 1AMYA 1TO3A 2OLHA 3RPTA 5FJPA 3TR2A 3IJIA 1XQLA 4HOXA 4CVWA 4IFOA 2P50A 4DJDC 4BQ5A 1Z69A 2X1UA 5AZ1A 1KFJA 4BCEA 1XLIA 1GZ1A 3G1SA 3W7QA 3CHEA 3L4WA 4DZHA 5DQPA 3VDHA 4IPPA 3UZJA 4NYYA 2XH7A 5FJTA 1GVFA 1V93A 3C56A 4MIMA 1VFUA 4XKYA 3BGAA 5EA9A 1Z6KA 4JFWA 4O8AA 2ZX7A 1TR9A 1I4NA 2QHAA 3FKKA 3UPWA 2HK0A 4S39A 3PSVA 3WLSA 2O9OA 2WMKA 2YCLA 2E09A 2Q6ZA 4PN2A 3CUGA 3ANYA 5D03A 2NQ5A 3WLKX 5FD0A 3GR8A 1H7XA 1MUMA 4EKJA 1EL3A 5A6BD 4DNHA 4CVUA 1O5XA 4KIEA 4Z0JA 1GPWA 2ATMA 2HDJA 2TSYA 1DHPA 4Y6GA 3WH7A 4YS1A 2EG6A 5I07A 2E3ZA 1R47A 3PF3A 4D6EA 3G1RA 3WQ6A 3MUIA 3R0UA 3PN8A 2YCKX 4JX6A 1XYBA 4QAIA 2P0OA 5E93A 4AWSA 5G4WA 1OX6A 4ZTXA 2QVHA 3FJ4A 3L4ZA 1K7EA 3AHVA 1W3LA 4QEEA 3LB0A 3LCFA 3PBYA 3G3MA 4WX2A 3VIHA 4DBEA 1GOOA 1SMDA 1YIXA 1QO2A 1MXDA 2DT1A 3RILA 3QHOA 1Q65A 4LAUA 3PBVA 2B0MA 3PZNA 3H8AA 3EMQA 4H2HA 5IBXC 1WDPA 1SVDA 1DJHA 3QKEA 3S5SA 2IQ0A 2XWDA 1MMFA 4IPIA 4D72A 1NWSA 5I2UA 3LCWA 1OC6A 4AEEA 1R3TA 3B05A 3K8KA 5EB8A 1TA3A 2VR5A 4A22A 1K3UA 3MCMA 4E6MA 1UJQA 8CGTA 5CC6A 4JICA 3W1XA 1ZGDA 3N2MA 3VIIA 2FDMA 5JBEA 2IMRA 4LYRA 2WVUA 4F3HA 3LPFA 3UETA 3CZJA 5AHNA 2YFNA 3W1MA 3TQVA 3TZFA 1VBRA 3AICA 4MKSA 5MKGB 3PZMA 3L23A 1EJ7L 4HJWA 3QGVA 4GACA 1LBLA 2ZDSA 4FX7A 1VJZA 2A3CA 1Q6RA 4EXBA 3PBUA 2QCDB 2E6AA 4KRZA 3JU2A 1E3XA 4LB3A 3PHAA 4ZO7A 3SCUA 3WLQA 1W9XA 5BXTA 3FXGA 3UZYA 5AHMA 2EAWA 2BGSA 3TN3A 4MKNA 2DUXA 1Z42A 1UH3A 3IV8A 3MU7A 1GONA 2PF8A 3S0CA 1KTCA 5HNNA 2A0NA 4I8YA 1B3YA 2JALA 3PTDA 1P4CA 1DTNA 5C9UA 3B9NA 5CQ1A 2Y24A 1H51A 1XH0A 1OK6A 5LHFA 5TAOA 2WHLA 1A53A 3VM7A 1J8VA 3HZ3A 3QLDA 3VD5A 5LGZA 3O06A 3WLHA 1R2RA 4NXSA 3DKJA 3SUVA 1H62A 3DENA 3R11A 2CHRA 3C5QA 3GR7A 3QY6A 1QI0A 4M81A 4AF0A 1C8YA 1GPFA 3TJLA 3SCOA 3SUTA 3ZVIA 2BX7A 4UMCA 2GLKA 1AQHA 3V5FA 3ARWA 3R13A 4WGHA 2YFOA 1GCYA 4HA3A 4EXQA 1GOKA 2VDHA 3K13A 5FAJA 3VD7A 3S9ZA 2PGRA 3FYPA 4HPNA 4WR3A 2HV5A 3RCYA 3SFWA 3ATZA 2PURA 3BJSA 1SFTA 3E0IA 1REQA 4B9ZA 3BPWA 1S1PA 4CN6A 2Y5SA 1V6TA 3S4TA 4RKAA 5D8WA 4J2MA 4LYKA 1WA3A 3TA9A 1R3SA 4IP5A 1QPOA 1W3TA 4N9BA 4GZEA 1XRVA 1CTNA 3GHSA 1LWJA 3MO4A 5U7SA 3ARUA 2Z25A 5I3JA 3V5CA 4J9JA 7ENLA 4C7GA 4C6LA 1RJQA 3AC0A 3MHFA 2XSAA 2INEA 3OZPA 3ICJA 1PS9A 4IWWA 3OEXA 3W1AA 2W66A 3W73A 1W3IA 5K9DA 2YBUA 3WKZA 2UBPC 1G4TA 1E9IA 1WDDA 3GZAA 4B5WA 2VDGA 4JD4A 1UKTA 3U7VA 3N4AA 1P43A 3E49A 4PL2A 1ZBCA 3M0JA 4U4MA 2XM1A 1EPVA 1KRBC 1UWQA 2E4TA 3A4JA 4IT1A 3RO8A 5CBBA 2PGEA 2CLHA 1TE1A 1G9HA 4Y9AA 4GCXA 3SR7A 2OYKA 3CIVA 1FUYA 2C15A 5K9CA 3BLDA 3GFZA 3GNXA 5M17A 1OWQA 3V3WA 3AO0A 2YCIX 4LFYA 4JTEA 5FIPA 2F2HA 3L4VA 3RLHA 4ZE5A 1JCMP 2VEKA 3WQ4A 1GJPA 1TPFA 3ZT5A 4R27A 5CJ5A 2YXXA 4D6JA 3EX3A 3BGGA 1B3OA 5E09A 1YEYA 1XLGA 1RSCA 4YL2A 3C4UA 3S2NA 3K30A 1TUXA 3BG5A 4BQ4A 1XUZA 5CBIA 1OCNA 1QNPA 1SGJA 3FK4A 2E5BA 3LHZA 1UD3A 3VE7A 1CT5A 4NQ1A 3IJLA 3KX6A 3TW9A 2QJGA 3LY0A 1WE5A 1UOZA 2WKGA 4NJGA 3AMLA 2QCMA 3R0KA 4IIDA 2PD9A 3B8UA 3RGTA 1FDYA 4FA3A 1GVIA 3SCRA 4U3AA 3W7HA 3WDRA 4XD3A 2JBMA 3IANA 1T96A 4JEQA 3OGSA 2FJKA 4UQEA 1OY0A 2Z1KA 5AC7A 1EGMA 4UTWA 4MKVA 2R82A 3UR8A 1CNVA 4JTUA 1QNSA 4MPQA 2VHLA 1WZKA 4RXFA 5A6JA 3K46A 1FHVA 1U5VA 3GG1A 3MYOA 3QFWA 2XJ7A 3IS4A 2VC7A 4S3GA 3H12A 4QTGA 2GUUA 3SCQA 3GXIA 3R6IA 3W2JA 1LUCA 3TDFA 1MQRA 2PMQA 3W87A 2A7PA 1CB2A 3QTPA 2V0TA 2HISA 2PI6A 1O66A 3TTEA 1YMYA 4L1XA 3E5PA 1C29A 2X0YA 4M1RA 3OYXA 3VNIA 3GDLA 3W82A 1F8MA 2BHUA 1HJQA 2FZ9A 2WLZA 2Q71A 4QDWA 4PMVA 1I2PA 3LPOA 2PP1A 4IPLA 3G6LA 3TWBA 1H0GA 4Y9PA 1MRQA 4FLQA 4IIEA 1LROA 2ZRWA 5EMLA 3NQEA 3EWCA 3GNOA 3VZXA 4CNOA 3LOTA 5JUVA 3BE7A 3T08A 1UOKA 3LCIA 3C8FA 1KD0A 1AJ2A 3ZIZA 3AWOA 4GVHA 5CJNA 3S2CA 4DF2A 3SY1A 4D6HA 3BLOA 3DYMA 4K8EA 2WW5A 4GINA 3NPWA 2ZTKA 2YBVA 5BMWA 1H7OA 1RAKA 1RLCL 1XP3A 4XV0A 2BBFA 2YDAA 4PEEA 4UTMA 4PUUA 1Y65A 1KV5A 3L4YA 4NI3A 2PU0A 1C7TA 2A7NA 2XFWA 4XG1A 3FHQA 3MMTA 3DKLA 3V75A 3VDBA 3GYEA 2OZ0A 3UR7A 2Z2UA 3FVMA 3P81A 4Z1CA 1KCLA 2ZX6A 3EDJA 3TCSA 5J5RA 1F73A 4DZAA 3KRSA 3IGXA 3AXKA 4H9YA 4LS1A 1WO2A 3QKZA 1K8YA 1GKRA 1LG2A 1V5XA 1W3HA 3REQA 3ITYA 3STEA 2WV8A 3H54A 3VGHA 1NEYA 3L21A 2XG9A 2Z6JA 5JXQA 1PEZA 1W5NA 5LKYA 4GI6A 5I02A 2TYSA 1WZMA 4JN6A 1A5OC 1O5RA 3UQNA 4W8AA 3QQ1A 1S5TA 3BCDA 3VUSA 1C90A 1BF2A 4TMCA 3KP1A 3IIOA 4HJFA 4PMQA 4Z2JA 4XK2A 2ODOA 3BLLA 3QW3A 3IUHA 4I7WA 5GJNA 1W56A 5CGTA 4IP7A 4RE3A 2J7GA 1ZJAA 2OO0A 1BWVA 4CNUA 3ARRA 3KTSA 5FAGA 3AROA 4JNYA 4YTUA 1XINA 4DO7A 1LL7A 3EBVA 3WQEA 1KB3A 4D8AA 1ODZA 1C9DA 1K7XA 2DVTA 3TTYA 1ZFJA 4P2VA 3VOJA 2GWNA 3GW3A 6PTDA 5KSWA 1I45A 3W1UA 2V5LA 3M46A 4F9JA 1E4LA 2EJAA 3EB3A 1DJYA 4JTHA 4J4KA 2WSKA 4IJCA 2D73A 1VB9A 2DZSA 1EA9C 2DZAA 3POCA 3INPA 2IXVA 1WPCA 3LENA 3B0PA 5PTDA 1FH9A 4QJ5B 2W9MA 2PE4A 3MP5A 1MYRA 2E9LA 1ITCA 1XIMA 1AMKA 4HK6A 3E9AA 4NJHA 1OADA 3ZJKA 3UWYA 2CLPA 5KZMA 3DECA 3KZSA 3LZ3A 3M5YA 1TB3A 3VNYA 5H91A 3G18A 2AKMA 4HB7A 1KTBA 4DWDA 1JGMA 3LXCA 3UPBA 5HDRA 4YMZA 4GQ0A 5CAKA 2A6NA 3NSXA 1EJRC 1B3XA 3CV7A 3MZNA 3FJ6A 1PPIA 3R10A 3N6QA 4UTKA 3PANA 3C2RA 3DU0A 5LIXX 1HJVA 4RNFA 4JTKA 3KCOA 3PWIA 4H3DA 4D6DA 4W85A 5A8QA 2ADAA 1KBLA 3CAQA 5BXPA 1JDFA 5CXPA 1O68A 2VC5A 4PUWA 3GVVA 3M0ZA 3W1QA 5IBXA 2HE8A 3RX4A 2OWWA 4Y2WA 3OB8A 5IFPA 5G5IA 5GJMA 1VIZA 2Y85A 3OBAA 3VFLA 3UJRA 3T81A 1XYMA 3I10A 3N34A 1N7KA 1PYMA 3RK8A 1ZJHA 4FIQA 4PCTA 2GQ3A 3WNMA 1MEHA 1NH6A 4ZO8A 3WDJA 2VFHA 1LJYA 1H5YA 4N9CA 3V16A 3P6LA 2WQDA 1EF3A 4Z1BA 4KEVA 3ITXA 4BEUA 1UC4A 3DC8A 1XIHA 3AISA 4DELA 4Z2KA 3AMKA 4NP7A 2WXDM 3CWHA 4GY1A 3N18A 1O60A 1BHGA 4Y9OA 3R58A 1NARA 2WBKA 1M1BA 5CSRA 1TV4A 4WF7A 3WH9A 2NV9A 4MWAD 3TCEA 4PMRA 1JCJA 2J8FA 3MC5A 2WMJA 2ISFA 1UR0A 3BC9A 2AKZA 4XBSA 1KXHA 5TNVA 2HS8A 5HUOA 4WXYA 2VRJA 3LCHA 4UBPC 4AZCB 3GHRA 1GG0A 2WHJA 3OP2A 3DGRA 4A05A 4GYFA 4EE9A 4R9OA 3LSCA 4XIMA 1RQBA 2QULA 1XKYA 3PG8A 1CXFA 3W7KA 2X05A 1OX5A 1JUKA 4AZ7A 1Q8JA 4JAWA 4A3UA 2YIHA 2CBVA 4J3ZA 3DC0A 2PWGA 4R88A 2CPUA 4FNRA 4UQBA 5ENLA 1TWSA 4LC8A 1US0A 4K36A 3W29A 5KEZA 3A5VA 2J78A 1IT0A 3SB0A 2WOQA 3RMEA 4DZ5A 1J0KA 4O52A 4EAYA 3E2SA 3WX7A 1TPUA 3BVJA 1WYIA 3AHXA 1XW8A 3CHDA 1V3MA 4FALA 4HYWA 1B4EA 3H55A 5EMUA 1XIGA 3KL5A 3F5JA 4ZQNA 2AL2A 1K6WA 4U2ZA 4MY9A 3KBWA 1QWGA 1FWSA 1LLZA 3IJQA 4EF8A 4DBDA 3GRIA 4LUSA 1I60A 2J24A 3O16A 3CPUA 2EHHA 1PCKA 1LL6A 2DVXA 2GJRA 2YDRA 3KUMA 1XI3A 2XVKA 2NUYA 4PA8A 1J96A 4O57A 1CYGA 1WCGA 3WLRA 1SR9A 3RCNA 2QDEA 1YPFA 3GH7A 4D1IA 4JX4A 1OG0A 1TV8A 1XDLA 4CLMA 2IXUA 2NX9A 2J75A 4V1XA 4IQJA 4Z1AA 5F2GA 4AQLA 2OXNA 4CD7A 2F38A 2FDSA 1V4YA 2GQAA 3LUTA 1M7XA 1OYAA 1ODUA 2D2JA 1UKQA 3R2GA 4B4FA 1KW1A 3L0KA 1E73M 4GQGA 2QJMA 2YB1A 1KM5A 3UJFA 4M1BA 1L8PA 4P7OA 4HQVA 1O5QA 4Y9MA 1W54A 2ZZ2A 2Z7KA 1EOKA 2Q3RA 3G1DA 3N2TA 1OFQA 1I2OA 3ZVHA 5EU9A 4R7OA 3UFYA 5AKQA 5K2ZA 4UNKA 3QR1A 4PMDA 2X40A 2V67A 1P0NA 1XYFA 4NZ4A 3LHVA 2WZEA 2GSEA 1XCFA 1US2A 1TWDA 2YA1A 4HT3A 4OVXA 5D4YA 2VD8A 3BLIA 2P8CA 1R87A 3CLMA 4PTXA 2FGZA 2G0WA 3EWDA 3B04A 3EA1A 4ZB5A 3RLUA 1F3TA 4WUIA 3DAQA 3B9EA 1OYCA 2PDXA 3AJ7A 3PPCA 4WOZA 4GRSA 3GUGA 2Z1VA 1RBAA 2A85A 4TU1A 3KRBA 3E0WA 3P0XA 3PUOA 3WLOA 3W83A 3EEZA 1TWIA 1HKKA 2CBJA 2J8GA 1E6XM 3DFPA 3R8GA 1F3XA 1GHSA 4Q4OA 2NW0A 5CPQA 3IVTA 1SZGA 3R7MA 1GORA 4MLRA 1W5PA 2BZNA 4O4VA 1S38A 3PUEA 1VJSA 2E9MA 3RN6A 4O0ZA 1G67A 1R3QA 5CG0A 5T8GA 2ZE3A 3CH9A 3SQMA 3KBNA 4LNCA 1HKWA 3F03K 1YNPA 2V3GA 2Y5JA 1Z8AA 4X3ZA 1XFCA 1FWIC 3UW6A 4JX5A 4UQCA 3VCNA 3TOPA 2EGZA 1ISVA 1CCWB 4N9DA 2QLYA 3Q58A 2Q01A 3AIUA 4UTIA 1XIBA 4BFAA 5LNUA 3FJNA 3PBMA 3WMLA 5LNWA 4ROPA 4FI4A 1W3KA 2UWFA 4CCCA 1D8CA 4JNMA 5FJOA 3AS3A 3ES8A 3U2CA 4X61A 1FCVA 4E3TA 3HQ1A 1GVRA 3PJXA 1EIBA 2OB3A 3RHGA 2QCFA 2PDKA 3UEQA 2G8ZA 5FSEC 4O1FA 3APTA 2PDMA 4GNJA 1QW9A 3LRLA 4KFOA 4QFUA 3EZ4A 2CZFA 4LBRA 5A6TC 4POCA 3GTFA 5CZ0A 2VR4A 1UA7A 4ERAA 4A3RA 3STPA 3W7PA 3PZ9A 1BKSA 2OOGA 3KE0A 3K5XA 3QF0A 5I6SA 3EWWA 2I1OA 4D6CA 2ZADA 1NF7A 4GUHA 4C6CA 1TUFA 3O15A 3WBWA 2V5JA 1ISWA 4PMJA 2YL5A 1J0YA 4RZ5A 4K39A 1IEWA 1DKWA 3LBCA 1VYSX 4KMQA 1EP1A 3T0BA 1RQHA 3CU2A 1RK5A 5BRPA 2AOSA 2DJXA 3SURA 4GQRA 4H1ZA 4WSKA 1UMYA 2REQB 4E2BA 4CD5A 1JVNA 1YNQA 3ZT6A 1PHQA 2BDQA 2VEGA 1GNXA 4LCQA 4AIEA 4H04A 1TVPA 3C61A 5IOBA 2ZYFA 5JBDA 1ZRQA 3AWNA 3GTHA 1XICA 3DXIA 4QXIA 4HU4A 3VK5A 1UBPC 1B5TA 1TYGA 2DIEA 1VBGA 1PIGA 1G94A 4MUZA 3W2NA 3BH4A 4FR1A 2FH8A 2ZE0A 1ADSA 1LORA 1AH0A 2Y7GA 3TC3A 1LM1A 4IH3A 1K6AA 3BJFA 2VOMA 1RA0A 2R1NA 2E25A 2GOKA 2QYGA 1QPNA 3GE7A 4NZJA 1OGSA 1QBBA 4KGLA 3N6HA 1AJZA 3PZQA 2P5NA 3VU2A 2OVLA 4XKMA 2AQVA 1UR1A 4FOUA 3BOFA 3FA5A 4CCZA 2DZPA 4NRRA 3NCOA 3NGJA 4JKKA 2NWRA 1SJCA 5F2LA 4LBSA 1YTDA 1HJUA 2B7NA 3T7VA 1E0XA 2PDYA 2VX5A 1UCWA 5CAHA 2BWGA 2X1TA 3MANA 1B3VA 2OWXA 3AOFA 1E9YB 5BCAA 4ENLA 2CESA 1Q3NA 4XQ6A 1V6XA 1J5SA 2X1SA 4HD5A 3WNNA 1L6SA 1UH2A 4H19A 1KGUA 4ICNA 5CPTA 2OYLA 3O0KA 5H2ZA 2OEJA 3UG8A 3EXRA 3STGA 1GQIA 1LWHA 1E4MM 2GFTA 3VKAA 5GPRA 3TTQA 3TXVA 1G4PA 2NQJA 4DEFA 2X2GA 1FA2A 3C2OA 1J5TA 4JTFA 2BODX 4Q8NA 4ORMA 2CLKA 4FXSA 4IIBA 4BA0A 1K9EA 5ABEA 1SMAA 3TSMA 3UA3A 4DY1A 1PYFA 3LHYA 2PLMA 4IISA 1OIFA 2DT2A 1KO0A 1F8IA 4IJRA 3AJXA 3VO0A 3WJWA 3P82A 4R7JA 1HZYA 4B5TA 3MPGA 2HE5A 3TYAA 1KM0A 4NJJA 2BY3A 4I3GA 4H7CA 2OSXA 2NSOA 2KX9A 1YXDA 6TAAA 3OW1A 4WLCA 2DT3A 4PMYA 4NNAA 3RUBL 1YADA 4CKQA 4DAIA 4AHQA 3NNTA 2IS7A 4RJEA 1UWTA 1W2PA 2NLIA 2Y0FA 2DUZA 1NF0A 4UFIA 1G5AA 1OFDA 3UY8A 3LI1A 1R85A 5HMFA 4XZLX 2I17A 2XIQA 4S2CA 3GB6A 1XKJA 4GYKA 3IWPA 4DUWA 1P0BA 4ICMA 3A64A 4I6VA 4GY7A 1P6WA 1JZ4A 3EYPA 3D47A 3ARTA 2ACRA 3CB8A 1JZ8A 1FX6A 1PUDA 4L80A 1IZCA 2R9RA 3V0TA 3V1HA 3BV7A 4ZBCA 5D32A 4B3LA 4O11A 3P62A 5C2CA 3RM4A 3EWBX 3BAJA 3STFA 2PDNA 3W7EA 4G7FA 4MZ8A 5AYBA 2UY3A 1EYWA 1TJRA 2I14A 1E15A 3I68A 1AD1A 2DJLA 1SPQA 3LNMA 1J6PA 5DLCA 2HXTA 4HOZA 4H6RA 4M19A 4O0KA 1HKVA 5EKYA 3H7RA 2W3ZA 3BW2A 5DY3A 1T5AA 2J9YA 5C7VA 3E38A 2I7GA 3QPYA 4GABA 1MDLA 1I6NA 5AYXA 3ZR6A 1UZHA 2YA2A 1XLFA 1Z3NA 3VFCA 3KHJA 1SM9A 4PMZA 3M44A 3MV11 1DPMA 3C2VA 1TPVA 1XRSA 3BGJA 2DU2A 1UP0A 2F6XA 5LIKX 3OTRA 3SQLA 3M07A 1JXKA 5I03A 5T9BG 3B97A 3S46A 1FDJA 3F5KA 3MWCA 3TYCA 2WZHA 3PZTA 1TFVA 4LRSA 1SW7A 1M9HA 2PDJA 3A4AA 3L9CA 5F1VA 5LNSA 1EBHA 1BPLB 1AA1B 1EBGA 4DM1A 4Z1YA 1J01A 3QW4B 1MO0A 2WLYA 5A6KA 4O1AA 3V36A 1A50A 2C14A 4V28A 4UQAA 3MJYA 1ADDA 4C6JA 1VHNA 1Z41A 4XBJA 3TJXA 2ZX9A 3QZEA 1R8LA 2PTDA 3DN5A 5G2IA 3WF3A 1Q6DA 3EWXA 3R79A 3WNPA 3IARA 4A3HA 3NZQA 3URBA 1KFBA 3CC1A 1KM3A 3NM1A 2BMBA 4H83A 5L6UA 1SFSA 2NQ9A 1UR2A 2J79A 3EXSA 2CLOA 3C8NA 3EXTA 3CGTA 3F4WA 2HQAA 2CYGA 2P3ZA 3KRZA 4GVFA 1EC8A 3GWQA 4OUIA 2VFIA 1YTEA 3AZSA 1Q5MA 2GWGA 4AD5A 3VOGA 3A24A 3T2OA 3PNUA 5KMYA 4I5XA 4GMEA 3M6YA 4U5IA 1HXJA 1ZS2A 2G37A 3UZ5A 4TVDA 3PTQA 3PC0A 2WAGA 2CLLA 1AZ1A 3RU6A 3FDGA 1OFBA 4Q8OA 1EQCA 1S2AA 1YDVA 3NQ8A 1ZJIA 3FAWA 4MTVA 3N17A 1B57A 1CGXA 2QPSA 1ZL1A 3MMUA 2VZOA 3NZRA 4MWAB 1B54A 1RHCA 3CAVA 1WBHA 3A3HA 1M7OA 1JL8A 4LYPA 2PTZA 4PBEA 1E0WA 4HNCA 1DL3A 3K8MA 4WY0B 3DCPA 1JZ6A 3ABXA 3R43A 1AH4A 4IM4A 1QNRA 3VKCA 3MMDA 2WO5A 3WUGA 2V82A 1JUBA 1Y8BA 5CC5A 1C8QA 3N4EA 2GVJA 1H3GA 3MKVA 2RDXA 5C55A 2WMIB 1JI2A 3E2QA 1C7SA 1E1FA 2L5HA 2A3BA 1XLDA 1R2SA 1E6QM 4L6OA 4DJFC 3UESA 2G3MA 2XISA 3QLLA 3TVAA 3GO2A 2Y70A 4XAZA 1TX0A 1UIPA 4XAPA 3VM5A 2OZTA 5FACA 3USZA 3OVRA 3B8TA 4OV4A 3A4XA 4DUXA 3WNLA 3DG7A 1BRLB 3H2OA 5LZLA 1F74A 2Z29A 5ABGA 3OOQA 1FQ0A 3GDMA 2YJQA 2QT3A 3QM3A 4C91A 3XISA 3PAJA 2QIWA 2WKJA 1QPRA 5AHIA 1V0KA 1EF2A 2WHKA 3S1VA 2XPKA 6XIAA 3UXKA 3K4DA 1XIDA 2W63A 3KFTA 3MV01 1QASA 4LAOA 1FWWA 1VEOA 2FHBA 4LJ3A 2YW3A 4GOAA 4F0LA 5TF0A 3WD3A 4MHBA 3LHUA 4DF1A 4DJED 4L4LA 2FZNA 4E8CA 3UG4A 1HL9A 4Q7BA 1GVQA 2YZ5A 4RDVA 2GGEA 4B5UA 3CAWA 1J0ZA 2QCLA 2OT1A 1IE7C 2GQ8A 1DHKA 2NWSA 4GZ7A 4XSMA 1IQ8A 3WK0A 4ZL1A 1RCQA 1GG1A 2CNCA 2AMXA 3VX0A 3WH8A 5HWMA 1CB7B 4F48A 3E0FA 2VUYA 4ZR8A 3TLQA 3N3MA 2OEMA 3FIGA 3W7JA 4EPEC 3DI1A 2PSNA 4TQTA 4UTJA 1G0CA 5HWNA 3KL3A 4AZCA 4Z42C 4LUYA 1A3XA 4UC5A 2DZVA 3M5XA 1MDRA 1XYAA 3DX5A 3QMSA 2I5QA 4KFPA 5KZ6A 2CZ5A 2HK1A 1OD8A 1EWEA 2BB0A 3O3RA 2OR2A 1NVMA 1ZJBA 1S2VA 4PBGA 1RUSA 2EPOA 1K8ZA 3N9RA 2D69A 3W1LA 3WYZA 5FOOA 1U1HA 2R14A 3GZ3A 1WXZA 3XIMA 1FWHC 5BU6A 3WLNA 3E0LA 1OFRA 2VGGA 2F8QA 1SYTA 3P93A 1U2YA 4XIAA 5J04A 4GIRA 1X6LA 3AYTA 3MVTA 3CZLA 4LVBA 3OZMA 1XSKA 3LCLA 1GQJA 1Q8AA 4UFMA 1BFNA 3UR2A 1I0DA 2OLSA 1KCXA 4L65A 5CPSA 1EDTA 4C6MA 1GHRA 2YOCA 1Y0EA 2JE8A 3DH7A 4MDPA 4JTGA 1E9ZB 4N4QA 3LGGA 1US3A 4ZB2A 1R86A 4EIVA 4DWSA 1D7FA 3HGJA 3B4UA 3S47A 3VGGA 2VCAA 1LRQA 5HINA 1D2KA 2ISDA 3KVJA 1POKA 2Y4SA 2XN1A 1Q4NX 2ALDA 4JTAA 4KCUA 1ICQA 4AMCA 4RPPA 3W37A 2VQUA 4JZ5A 1E4IA 5CGMA 3EX1A 3BLKA 3HGOA 3DFYA 1KGXA 2PDWA 4IIHA 2NUWA 4TOQA 1ZZMA 3MCOA 4Q4PA 2H9AA 4GYPC 5E9AA 3G1YA 3QOMA 1MXSA 3W6YA 1ME7A 3O6AA 3H2AA 4JIQA 4RX0A 4FNSA 3KHDA 2XFRA 2XVPA 3MI6A 4N4PA 1XISA 3DG6A 5I7GA 3UVAA 2TMDA 3TZNA 2EPMX 1KV8A 2XUCA 2B7QA 4BQ3A 3O05A 4K1GA 2V9DA 4IUOA 1KCKA 3ARZA 3GKFA 3R89A 4LNYA 4Q8WA 4YHEA 2PU1A 3HPZA 3TK7A 5F2MA 4HPXA 4E2OA 2PDFA 4GISA 4RDWA 3RPMA 1LOQA 2OO6A 2PCEA 3OVPA 2QMJA 3T0TA 5FJUA 3WFZA 1WKFA 2INZA 3KAOA 1PX3A 4AF0B 2O9PA 2F6KA 4TVUA 1QK2A 1KR1A 5HXMA 1VYPX 3IIXA 2HPMA 4MB5A 3M7WA 1RCXB 1TJPA 4NSBA 1LT8A 4DBSA 1IGWA 2YYTA 1W17A 4M0XA 4MWAC 2VWTA 3BQ5A 2QR6A 3GYCA 4OGZA 1M41A 3WJZA 2WC4A 2WNWA 1VCVA 2C19A 1OFOA 4CQDA 1XXXA 5HR7A 1AQFA 3PJTA 1AH3A 2NVAA 2GGIA 3W00A 1GOIA 4U10A 4MPKA 2XDFA 3BMVA 1QNVA 1HNYA 3EDFA 1TPB1 4L4OA 3WF1A 1LF1A 3W70A 4LEFA 4C1NB 6REQB 3W86A 2PDLA 2EF9A 2TPSA 1UUMA 3SIMA 1HIZA 4S3CA 1RQEA 2X0HA 4NAFB 2RDTA 3E5BA 2R1MA 1NIUA 1MQPA 3ZQ9A 4MZ1A 1P6BA 3AZRA 2ZOXA 3I7SA 1ME8A 4U5KA 2GJNA 1V51A 2YCEA 1PKNA 2WJFA 1Q6OA 3AALA 1QW8A 3VKKA 2X0SA 4MJZA 2H90A 3O7UA 1MFUA 1F05A 5DX7A 4LY4A 4F4RA 3BAIA 2FTWA 5A8PA 1XGDA 4GBUA 1UH4A 1E6ZA 3HURA 5ABFA 1E72M 3HFTA 3K4AA 1XLLA 3VCRA 3EAUA 3WN6A 1JPKA 1WDSA 2IPGA 3BCJA 3GM8A 4TX6A 1X8CA 1RPKA 3M0KA 4M7SA 3TWAA 2F9RA 3PZIA 4ZQPA 3W72A 4AY8A 4H8UA 2J88A 1VKFA 1NOFA 1ITUA 1VS1A 5CPLA 4ERGA 3RCMA 2HS6A 1RP9A 2V30A 5I00A 3QV8A 1QMLA 4NAEA 3UXAA 3UYCA 3G24A 2Z6IA 1HP5A 1UUQA 4WXZA 4PUNA 2IPJA 4PFMA 3ITCA 4AXNA 4DNMA 4B2DA 4J27A 1HKMA 4A3YA 4ZB0A 3UZWA 1GVYA 1ZP4A 4F2TA 3GNDA 3KOFA 3M41A 4R33A 3OYZA 3HMCA 2REQA 3CB3A 2FGLA 4J5NA 2V81A 4KWVA 4W86A 4A35A 1WXYA 4ZE4A 3S2LA 4PGLA 3H6OA 5HANA 3PZUA 4K8GA 4WDWA 2HBVA 4DUOA 4WSJA 1BWKA 3CBWA 3MP4A 2OQYA 1E5JA 2NUXA 5I23A 3HQOA 4IMFA 2C0HA 3FHAA 4EP8C 2MANA 3I65A 3GIQA 3W75A 4H8VA 1V3LA 3MHUA 1X6NA 3CHCA 2RH9A 2EXOA 3ZJ8A 2CERA 1LUCB 2XSBA 4LX4A 3IJ8A 4XD4A 3GK0A 1CGUA 1GOMA 2WCAA 1B3WA 4NJIA 3FOKA 3P8JA 3ZJ7A 3WH5A 3MSDA 1EEPA 4NF7A 5FL0A 4GGBA 3UZZA 1CXEA 4REQA 3LPGA 1ZPTA 2VYOA 3BW3A 3U8GA 4N0RA 3UA4A 2A7RA 1Q7QA 2XH2A 2HROA 4GC4A 3W01A 3NQMA 4ZOBA 1A0DA 4QJ4B 1KA9F 2QCCA 4N6FA 2VFDA 2GK1B 1NDZA 1RALA 1JPHA 1V6VA 4DI8A 4GVGA 1YDOA 2PTWA 1UJPA 2OKTA 3LU2A 2ZA2A 1HP4A 2E6DA 3HQPA 2GJPA 4F2UA 2WJEA 1FFQA 3C2EA 4LVFA 4R9XA 3AMGA 4PCNA 4ZQCA 4MY1A 3G77A 4P8XA 3ZLGA 3APGA 1PKLA 2OSWA 3TLLA 3ITGA 4EXAA 4A2SA 1ZUAX 2XIJA 3TTOA 5LYRA 2DSVA 5RUBA 1XH2A 1JCXA 1M5WA 3NURA 1X96A 1UKPA 1V02E 1JAEA 3HMJG 3EPNA 2D1ZA 6CGTA 3NQBA 3MW7A 2FPVA 1V79A 4BWLA 4DJFA 2ZFAA 3RIKA 4HA1A 2JF6A 4YJ5A 3ZWSA 3NQ2A 4YIWA 3SQSA 3E96A 3D3FA 2QUVA 3GXTA 4WJEA 3WF4A 1PX4A 1PSCA 3AXHA 3CQJA 3H22A 1JNEA 3LLFA 3TEVA 3D46A 3SI9A 2YR1A 4P8WA 2V68A 2O56A 3PS7A 1H4PA 1YLVA 4CGTA 3CUJA 2Y6ZA 4JXCA 1A4MA 2E1DA 4C60A 4AXKA 3R12A 3WDPP 2WSPA 3HG3A 1TMHA 1G7UA 1ZY9A 4AYGA 1WUFA 3T1GA 3SUWA 3UCCA 5CBJA 3RU8X 2X7WA 3W1RA 2G95A 3KVLA 3WD1A 2VVSA 3CH0A 5G4EA 1AW5A 2J7BA 5DXYA 1EFZA 3HM7A 4BF5A 5D2VA 3JUGA 3GSMA 5D8ZA 3KEHA 3N29A 1ECEA 1VHCA 3CO4A 1A5NC 4AY7A 3TROA 1DWHM 3AXXA 2VEPA 1HF6A 1G4EA 5DT5A 3AS0A 4MAZA 5LIUX 2RJHA 3OODA 3ARSA 1PO9A 4AD0A 3WLJA 3RO6A 1DQWA 4DXKA 2OYMA 4Q4KA 1HKJA 3LM7A 3ARXA 2VRQA 3SW6A 1KFEA 4C7DA 2VX7A 3IJDA 1V6UA 3NQAA 1W1TA 2XTKA 3FJLA 1X8FA 2V6AA 4IX2A 3DFOA 4DPQA 1ZLPA 2E5DA 1Z7AA 1VIWA 3ID7A 1K8CA 3TN6A 5A8GA 1DJNA 3F2CA 3FVDA 1KFCA 3WF2A 4ADTA 4MM1A 1WKEA 4LB4A 1F6PA 2DH2A 4ONVA 1K77A 4X9SA 5IFTA 1G6CA 4OWGA 3SAZA 4ZQRA 1T41A 2Y88A 1DQUA 2R6OA 4JIHA 3B9OA 2ICSA 5CJMA 4W87A 2XZ7A 3CUIA 3KP0A 1CX9A 4DI9A 1C3FA 2BGQA 1OBAA 1FWRA 5KZDA 1UC5A 3RLGA 1VC4A 3VXGA 1EQPA 3H2NA 2P10A 3VIFA 1L2UA 1ZENA 2AAAA 2VZSA 5AYZA 2FVLA 1TREA 1DV7A 1Q6EA 2X16A 2WSYA 1HL2A 1UD2A 4DPPA 3S2JA 4IMGA 4US6A 4ZA0A 1BVZA 1RK6A 5ABTA 1RD6A 4W7WA 4PCPA 5HJYA 4FAMA 2E68A 1ZCOA 3MP3A 4QJ3B 4N6EA 4JIEA 4X2PA 3B0UX 1YE4A 1ENUA 4V2XA 3M4HA 3T09A 4V1YA 1KR0A 3W7MA 1CBGA 2QCGA 3BWWA 1POJA 2E7FA 4DAFA 5SWUA 1TX2A 2JKEA 1UASA 4PL1A 4S38A 4E2DA 1OG6A 4Q8TA 3UJEA 2Y1HA 1N8FA 3S3GA 4GI4A 2HMCA 2JKPA 1VCGA 4ATDA 5DF0A 3O63A 2QCNA 1AW1A 4A21A 4E0CA 1J12A 3PULA 4C6OA 5C54A 4RL3A 1R9XA 5KITA 2VFGA 1TZZA 1JG9A 3F1QA 4MB1A 1WUEA 3AMDA 3KWXA 1EJXC 4OZOA 4UTWC 4F79A 3SY5A 2ZIDA 3GBDA 1ISXA 4GYPA 2X8RA 3UJ2A 5HATA 4O53A 2CHOA 1TZ9A 1VR6A 3MTWA 4IGHA 4CNSA 2QUMA 5K9XA 3WK2A 3BLPX 3GG0A 2NX3A 4PB4A 3W2KA 2VFFA 3R25A 4DQWA 3PFRA 3SRDA 5GJPA 8TIMA 4QG9A 4PMOA 3G8RA 4QS5A 1T99A 2WKLA 4FS9A 4RPQA 4U28A 5HK4A 4DF0A 4UZUA 3M0MA 2ESCA 3IJ9A 1EKOA 2CEQA 4HBKA 3TE9A 3SADA 1ZU8A 2QGHA 3PAOA 1E43A 2EPNA 3GG8A 4ADSA 4XZBA 4BQ2A 1NOWA 1Z48A 2GZXA 4EAMA 3GG7A 4YTTA 1VFSA 3EOSA 4UFLA 3GDRA 3VD9A 1OFPA 4PCFA 4CD4A 5A69A 4RV8A 1KKRA 3TN5A 2WPGA 3QFEA 5KETA 3LBMA 1YPXA 2QV4A 3B9DA 3LGDA 3NIYA 4NVTA 1IWPA 3AAMA 3WUBA 3OZOA 4KERA 5I3FA 2VGFA 2H3DA 5K4XA 1JYVA 2E8YA 4TVCA 2AL2B 4HOWA 1QU4A 2ACUA 1VFMA 5LNVA 1KFKA 1GT8A 1RXOB 1ONRA 3ONCA 3W0KA 4HN4A 1KGWA 2D2OA 2J25A 3NYDA 4IL0A 3DFNA 1IIHA 1ISZA 4Q8VA 2OLAA 5MHBA 1SJBA 2OU4A 4Y8EA 5EFFA 1P0DA 3W2UA 1XUUA 2OG9A 1BTCA 4K8HA 3V7PA 5JH2A 4BF9A 1DIKA 2O55A 3VZYA 3O6CA 4FNUA 1G1YA 3L7RA 1WAUA 2ZZ4A 3NPUA 3SGUA 1IR1A 3TAKA 4P8UA 4X22A 1XC4A 1W1IE 4XVEA 3HA1A 1EDQA 4QQ3A 5CGQA 3WH6A 1JXJA 1E4NA 4ZCWA 3EWYA 4LV9A 4GGHA 3KWSA 2XSXA 4GNVA 4PEKA 4U33A 1MNSA 3NQFA 3W27A 2ZICA 3IGUA 5D2XA 3HF3A 3I3DA 4PUDA 3ZVHB 3E6EA 2I9UA 3M0LA 5DO8A 3UWEA 4JTCA 3OPSA 1OQFA 1IEVA 1Q7ZA 3B40A 2FTYA 5A6SA 4C5ZA 3DI0A 2Y63A 4LVGA 3NFUA 3ITLA 2PS2A 3NTYA 3E2VA 2Y89A 2WZMA 1TPWA 2WVTA 1JPDX 4AEFA 1KM1A 2AGTA 4WVXA 1JFHA 4GUIA 3G0XA 1I2NA 4WCJA 4R34A 2BY0A 2DGAA 5BWAA 4W5ZA 5BXRA 1J9YA 1G7VA 3WELA 1HO1A 3TP4A 5DRCA 3LGEA 4GJ1A 4CU6A 1O1HA 1WOAA 2CETA 4O17A 4DN1A 4YTSA 4KWSA 3VD4A 1BD0A 3W88A 4IGMA 3CEPA 8XIMA 3M0IA 3S8HA 4F0MA 3RRXA 4UCGA 3CIXA 1YHTA 2PRLA 1VEPA 4DWSD 3CHFA 1JDEA 3QY7A 1UB3A 1ELSA 2CKRA 1NJJA 4YU1A 5HNTA 4ZXOA 4AIUA 3THDA 4MYXA 2O7QA 2PWEA 3VGEA 1QJWA 3Q94A 2GUYA 2WHMA 4UNLA 1G01A 4HK7A 4AVFA 3LN3A 3ZM8A 2VZUA 3LLXA 4M5PA 4MFDA 3W24A 1MWOA 5D2YA 4BY3A 4G7EA 1UR8A 1NFPA 2VZVA 4GWEA 1U83A 3TYDA 4C6EA 4XO6A 4PUEA 2V63A 1ITXA 4ZO9A 4F40A 4RE2A 2PDBA 1JCLA 2R1KA 1AZ2A 2Y7FA 3I6RA 1N2VA 4AEOA 2VMFA 2E6FA 1L6GA 1XCXA 2XIMA 5DBTA 5ABHA 1TPH1 5I5RA 3TJ4A 2I5IA 4K37A 3DIPA 5FF7A 4F2BA 1LRNA 3KOXA 4HSHA 2W67A 2BG5A 1M03A 3G5EA 3TSBA 1KFWA 3ZJ6A 3F2BA 2TODA 4Z2LA 1XFBA 4MLJA 1ESWA 3W26A 4UOQA 3D6NA 4Z0SA 1JCNA 5IDIA 2XIOA 3UJSA 2Q8LA 3UWUA 2GJXA 1KBBA 4P7QA 4R7WA 2C13A 1E0UA 2Z1WA 4HCDA 3HB9A 4JDYA 3S83A 4JYEA 4MAVA 1PB0A 3T4WA 2CC0A 4WJXA 4LYQA 4YYCA 3FEMA 1SZFA 4JTTA 1SW0A 1S39A 5H8MA 3L2LA 4QS6A 4CN1A 1B3ZA 1NWUA 1NSJA 1UP2A 4NNBA 2PB1A 3GU2A 3VDGA 1GUVA 1ZAHA 1M53A 5AC5A 1RR2A 3H2EA 2ZUSA 4JDBA 4A4AA 2CXEA 4MVAA 3MUZ1 4H9TA 2EEXA 4GLEA 2NXIA 4LQ1A 4PTWA 2WJDA 1JRBA 2D0GA 3HPSA 3NOYA 1KLYA 2Q02A 4DJEC 3G6MA 4S3DA 3MJMA 5CZKA 5DCDA 2QXWA 3A3XA 1XGEA 3WBEA 4QG8A 1H50A 3WLTA 1PDZA 5H6HA 2W0UA 2RHGA 2ACSA 2XVLA 1RJRA 2BY2A 1O7AA 4J3SA 3CK5A 1PWMA 4XX6A 1FHUA 3WEMA 4M82A 2OX1A 3GTIA 1OZQA 5BMXA 5KTLA 5FA5A 5I78A 2GJLA 1O12A 2VRKA 3GW0A 4NHVA 4FEZA 4FLOA 2I57A 4W8BA 2X2YA 5JMUA 3HG4A 1QBAA 4GNKB 1ALDA 2A3EA 1CENA 3P61A 2HJPA 4IQLA 2OQLA 4ZENA 4O54A 3HFYA 1WZLA 1EGVA 3L2IA 3T9PA 2V5DA 3DFTA 2Z28A 1XV8A 4LEQA 1A80A 3L67A 3OG2A 4MJMA 3UP8A 2BV9A 2WCGA 1OABA 1XSJA 2BLEA 2EKGA 2IKHA 2EPLX 2GQ9A 2HSAA 2FH6A 3N2BA 1XBVA 4KCTA 3M43A 2GDVA 4C1NA 5F4WA 6REQA 3NSNA 4M24A 1YNYA 5LIYX 5HMDA 4FOJA 7CGTA 1BF6A 4NAFA 1TVNA 3O0FA 3CZKA 5FCZA 2BVWA 1CPUA 3UY7A 2XH0A 2WZIA 4O16A 1V3JA 3NL5A 5JQ9A 3AHTA 3P74A 4LF2A 3AFBA 1FWJC 3TH6A 3UCQA 1MEWA 1E1EA 1V6YA 2FZBA 7REQB 2JIWA 5HQMA 5GNYA 1M3UA 3NQVA 1UG6A 4B2DD 4ZEPA 1R7AA 1MFVA 1VAHA 3CMFA 4Q4MA 5IXEA 1BXBA 4RDYA 2IPWA 5E0CA 3JVAA 3RAOA 4XAGA 4Z1DA 1GGOA 3B9AA 1F61A 1NOUA 2VCBA 4NT0A 9XIMA 1PKYA 3THAA 4QE4A 3DYOA 3N4FA 3VIKA 1A0EA 4O18A 1X6UA 2GVYA 4GIAA 4IL2A 2VNCA 3TTSA 2VO5A 1K4GA 2JKAA 2PLJA 4OBSA 4ZZ9A 2PC4A 3PWGA 2E77A 1XM3A 4FOKA 3GHTA 1OGGA 1P5BA 2FVMA 4W9TA 2FPYA 1EPXA 1S2TA 4KFNA 2O7SA 4KGJA 2O9RA 3WSUA 1GQKA 4AX7A 2PZ0A 2VX4A 1BSIA 4QEHA 1GJUA 2FQIA 4DIAA 1HGYA 4UTTC 4NUWA 3RX2A 3C0LA 2HVMA 3LERA 4D9PA 1QI5A 1XQKA 4R53A 3ZFHA 3ANUA 1CW2A 1GQLA 3F4CA 1WDRA 2DW7A 2QDHA 3ARQA 2I5GA 1XDMA 5BU9A 2QGYA 4ZO6A 3LXAA 2NZLA 3GDKA 1ZSXA 3V0SA 2WM0A 3UXIA 3W4RA 4X63A 1W9VA 1KXTA 4L6HA 2FZDA 3U2ZA 2FIQA 3WLIA 4PC8A 2JF7A 4O0QA 4Q32A 1AK5A 1V3HA 4LGXA 1OC7A 3PZVA 4PMUA 4H9UA 3T55A 4MFEA 1K9FA 3MWAA 2R91A 4WIWA 2GVEA 1W2VA 1W8SA 3EKZA 4Y8FA 4FB7A 1UPMB 2R1LA 3HJZA 1XIJA 3E12A 2PDUA 4DVOA 3R8RA 2YLLA 1SR0A 1I2QA 5A6LA 1H1YA 1L6WA 1HO4A 1C9WA 3I4EA 1Q4WA 1W5MA 3AS1A 3CZEA 1XLJA 5E5CA 3N2CA 3IJ7A 1UD8A 4KWOA 4ZOAA 1FTXA 2ZA3A 4DJFD 5E1QA 4LOCA 1B31A 1FWDC 2DIKA 2OPJA 3W1TA 3N2OA 3GU9A 4NJKA 2GK1A 1K4HA 1KFLA 3MI3A 1GZJA 2JFEX 2Y8VA 1Q2RA 1O1ZA 3V18A 1NQKA 1NU5A 1TELA 2BXYA 5DCBA 5E6YA 1ZB5A 2HWGA 4MJ4A 2R94A 5DMLA 3RJXA 2ZVIA 2OJPA 3M64A 5A5WA 1DIEA 4QRNA 4A8IA 1P1MA 3SECA 4H9XA 2D2GA 3POHA 1LLOA 3AIRA 4YWSA 4CQ8A 3CLWA 5FJIA 3B0VC 4LAKA 1HW6A 2QEZA 2ZC1A 3SY8A 3HPAA 1R0MA 4Y96A 7XIMA 1VFOA 5AVHA 3M47A 4C6DA 1YXCA 4BR1A 2A3HA 2PAJA 4DM2A 3E1F1 1QI3A 4L1WA 4DHGA 3NVTA 3NQCA 1KQZA 4WKHA 1Z44A 2C3ZA 4R85A 3RYSA 1RJPA 4OQVA 2Y2WA 2FB3A 4C6BA 3V5OA 5I3GA 1E56A 1AUSL 4NX0A 1E55A 2BGNE 4L5ZA 3LNPA 1E6PA 4F0HA 4LT9A 1JF5A 3IACA 4HCLA 4ZXLA 3N9KA 4Q4SA 1KWGA 4W7UA 3WJYA 4JCMA 2G97A 3NYZA 3RITA 2DP3A 5TBOA 2J47A 4AZ6A 4QIUA 1KQYA 4EPKA 1NFBA 4RE0A 3T0CA 4EOUA 2RJGA 4AZIA 1ZALA 4ATWA 1C8VA 4L7ZA 4M6PA 1GVEA 4W89A 3B0YA 4HA4A 4OBTA 4WY0F 1QHPA 1XLMA 3HGRA 3BSGA 4OBRA 4DXXA 3ITVA 4CD6A 3BARA 1P1XA 2PODA 3QHMA 1QUMA 1BYBA 4JS3A 4UTHA 7PTDA 1TWZA 2Y7EA 1EGZA 1XHGA 2VVNA 1IEIA 2OSYA 3RR4A 5I3IA 1SZNA 1ICPA 1ADOA 5A2AA 1ONEA 1VZWA 2WSQA 2E0PA 3SIZA 1B4KA 2VTFA 5CPNA 2ZTJA 1UQZA 3L4UA 2NT1A 3P0WA 3U4AA 4YXGA 1S46A 1TV5A 5A6AA 2IKGA 4L9XA 3M9YA 3T05A 4EANA 4Q4RA 2DPEA 8RUCA 1X38A 4US5A 2D22A 2V5BA 1GW9A 2ZXBA 4PUMA 1HUVA 1IV8A 7A3HA 1SO6A 2XIBA 3U6WA 1Z9AA 4ERIA 2J4GA 1BTMA 1B2YA 4UXDA 4ZTYA 4YNGA 4OE7A 4C90A 3N9SA 1O95A 2FHFA 1R38A 3P2VA 1SSDA 3OA5A 4W8LA 5FF3A 3W7RA 1FWNA 3MUAA 1K8XA 3NO3A 1V6WA 1W8GA 5EY5A 4JFSA 3SUSA 3NO1A 5EMMA 5AECA 2QQ6A 1D9EA 4WDXA 3IUIA 2FJUB 3IK2A 5XIMA 1ITQA 3S1UA 1YDNA 3VDAA 5A95A 2A79A 3ABSA 1MRAA 2C8NA 2PTXA 1JYWA 2QPUA 2ZQ0A 4G5DA 3AHYA 4G8TA 3B8VA 1I8JA 4QBXA 4BI6A 5GNZA 3AYVA 1FWCC 1JDAA 4JHZA 3W7LA 3GC2A 1TJ0A 3TN4A 3TNBA 3T07A 3F2DA 1S5WA 1EC7A 5BZAA 3K1DA 1XLAA 2VGIA 1W1B1 3G2GA 4MNJA 4ZOCA 4J40A 5AYYA 4JQ3A 3AU6A 1QT1A 4K2SA 1W1A1 3VIJA 1E1CA 5A6MA 5AFDA 3NM3A 4YVPA 2QPXA 1JJKA 5CKSA 4WK9A 4HYVA 4G2DA 1EDGA 4P5UA 3GC5A 3EOOA 4P7NA 4QLJA 3L66A 4J3VA 3FS2A 3RX3A 2Z00A 2GGHA 1A5SA 4AHOA 3UBPC 3VIPA 4W88A 1DWFM 1AQ0A 3G1VA 4UR9A 1DWAM 5L9FA 2FVKA 1K02A 3PZGA 4JEJA 3TU9A 1A5UA 5HPCA 4INFA 2JQXA 3BLFA 2ZVRA 4QSHA 1XIIA 1ZP3A 4XAFA 4JPGA 1X7FA 4HZMA 4MUPA 3ITTA 1B0IA 1PL9A 4DO4A 4YTRA 3ZR5A 1OHLA 4DB7A 4DJEA 1IXOA 3L65A 1MW2A 3AIEA 5G2WA 1JQXA 2BOEX 2PWUA 1QWKA 3WG6A 4KETA 4AU0A 2G5WA 4TR9A 1GQNA 2ZCGA 2OX4A 4DYEA 1XBZA 2OELA 2ISVA 3NUKA 1SQ7A 2XVGA 1GKQA 4RNIA 4BS0A 5D09A 1YYAA 2V5CA 1HG3A 4PSPA 2IPFA 1HGWA 3H23A 4NIRA 4IXHA 5CLTA 3FN9A 3QBUA 2YW4A 4LUJA 3L4TA 2W79A 3TXZA 4CUCA 2I16A 3SCSA 3QEZA 2QJHA 4LAMA 5HNRA 1J0HA 3U57A 3T0AA 3NDZA 3IIPA 3VC5A 2J8TA 3OU8A 1TV3A 4DWSB 1AG1O 3CJPA 2XN0A 3C52A 1QTWA 1W31A 2GSJA 1U5HA 1CGTA 1UZ4A 4UQ9A 4I7UA 1UBSA 3WEZA 1DJWA 4EX4A 4FLSA 4IIGA 3TC7A 1PXGA 1QR7A 2W6RA 3NA8A 4KRUA 1WKYA 4AG0A 3N25A 1EZ2A 1N8WA 1JULA 2XGBA 1RVGA 1JZ2A 2GGJA 1TV7A 2P88A 1HJSA 4J35A 1EYEA 1UIOA 2H9AB 4JTDA 3BL3A 4O14A 4U31A 4GI9A 2V69A 3WD4A 4L4PA 1TIMA 4HHLA 2OODA 3LRMA 4H41A 3W7CA 4Q8QA 1LQAA 1LZOA 3T42A 3GVWA 3BICA 3MUY1 2NV1A 3H70A 3HOJA 1FWAC 1FH7A 4IPJA 1N8IA 1E40A 5AYIA 3F7JA 1JFXA 2J9XA 3ALGA 3HTWA 3GTNA 2QNEA 1XIFA 3OGRA 5FEWA 2CXGA 1V03A 1IXNA 4XZNX 3TUUA 3IGSA 1PBGA 5CZSA 3GDTA 1VRXA 2C7FA 1UWIA 2V2HA 1WBJA 1TSIA 4PB5A 3LRKA 2EPHA 2ZKMX 1H11A 4HPHA 3PBGA 2Z2AA 1V7YA 1VEMA 2EO7A 2QW5A 5G2HA 4LRTA 4NNCA 2BSLA 4LVDA 3NPVA 3IAPA 3JS3A 2F7FA 4ZFMA 5HR6A 2HZGA 3CIWA 4Q8PA 5CLWA 3VNKA 4XTIA 3RDKA 1RPXA 1BSLA 1A5AA 4G6CA 1TKKA 5AC6A 4ROQA 3U5YA 3IRDA 3R0DA 1ECQA 1EIXA 2Y62A 4OHQA 3QZ6A 4UTTA 1B9ZA 1VD6A 2A4AA 3B4YA 3SCWA 3TJIA 3CXOA 4I8DA 4CQAA 1AFSA 2E67A 1P0EA 1SJAA 4OKDA 3L0NA 3CMGA 2PLKA 3PTKA 5F4SA 3DHFA 4J3WA 2WCSA 1KC7A 2PFHA 1F7BA 2AAMA 2R8WA 5A8OA 4J3XA 4IQEA 4PTMA 4IFKB 4PTNA 4LU0A 3VOCA 3WQ5A 1PZ2A 4ZOEA 2FFCA 3BCFA 2VQTA 4M29A 3AIQA 4PYSA 2YCJA 3WMSA 3C86A 3H4XA 3QC3A 1A5LC 3QOKA 1V77A 3ANVA 2JGQA 1BGAA 3FAXA 2J6XA 4RCXA 5CC7A 4B3KA 3H4GA 1TTJA 3KBVA 5TD4A 5LGXA 2DY3A 3DDMA 3AUJA 4D1JA 3P3BA 2OGJA 1FWBC 4F0KA 4HVXA 3TYEA 4A8RA 4D8LA 3GAYA 1SUXA 1MI3A 3UERA 4IMCA 5D9NA 2I56A 5ABFB 1K70A 2GUBA 3EKLA 3R8HA 3U2EA 4UR7A 1KXVA 1XRTA 2YGYA 4GJIA 3MT1A 3TQ0A 4H6EA 5CSYA 1QFEA 3TYBA 3VMNA 3U9IA 1GOWA 3EMZA 3QPZA 3BO9A 2VEMA 3VAVA 4DYKA 3E02A 4FLRA 3VTRA 3MKKA 1AD4A 3H7UA 2WVSA 2VENA 1VLWA 4NAEB 1GJWA 1QDSA 2VELA 1JDCA 1R9ZA 1Q2SA 3VIMA 2QS8A 4UOJA 4Z2HA 3NL6A 3EPOA 4MF4A 1UZDA 4XZ9A 1BKHA 1BYAA 1XG4A 3N73A 1K03A 4JIPA 4WOQA 1PX8A 5I3DA 4ADUA 4JYDA 4JOMA 2DZXA 1KM6A 2V2DA 1IWBA 4S3BA 2WNNA 2DW6A 1PZ0A 4NRSA 2UY4A 4XZHA 3D0CA 3Q65A 3Q37A 4I7VA 2H6RA 2Q8ZA 3T0DA 4FF7A 2W27A 3W7NA 2WMFA 1K7FA 4ML4A 3WBXA 3CL8A 3VC6A 5H8PA 3BANA 4AH7A 2EQDA 4LUTA 1FWGC 2E1WA 5TQLA 1E6NA 2P53A 2XFYA 4FPSA 4I5UA 3NOEA 3EX4A 4GZJA 3WIJA 5IHRA 2DT0A 3RM9A 1IT7A 1VCFA 2SFPA 3J7HA 4REQB 3WFAA 1CGYA 1GOXA 3FNDA 1CI1A 4MNMA 3VINA 4M3PA 4M6UA 1NY1A 1PJ9A 3ARYA 4B3ZA 4GCAA 3CAKA 3T8QA 5B80A 2DZTA 3LCXA 1YW1A 3WLLA 1QNQA 4CQBA 4DWSC 1M68A 5LA2A 4IXXA 4H7ZA 1QI4A 3W25A 1W9UA 3KBSA 3EA3A 4URIA 4RNJA 1LP6A 4KIRA 3CQIA 3FXYA 1BG9A 5EYWA 5FF0A 3AIVA 1ZQ5A 3HIJA 1OSEA 1UR3M 1RY8A 3O9NA 1V08A 4HU8A 4QSFA 3CYVA 2CBUA 3ZXWA 4LS2A 2W5FA 3O1NA 3LD5A 3HG5A 1EJVC 2C0AA 4Q6JA 3TC6A 3AIBA 4MG4A 4W4QA 3BUVA 3PB0A 4H9MA 3U48A 3LYEA 3SJNA 4UQDA 5AOUA 2ZBTA 3LEPA 1R5YA 1H2JA 3FYOA 1LBFA 4N42A 4NZCA 1BYDA 5BNKA 1DIDA 2IW0A 2P1FA 3UNTA 3C6CA 3BJTA 5K3VA 7REQA 3VYLA 4CCEA 2PC8A 1DWIM 5EGRA 4GXWA 3UCDA 3UF9A 3ARPA 3DBNA 5DN1A 5I09A 1W9BM 3S42A 3N14A 4ACZA 1I2RA 3MKCA 2ZC8A 1V0MA 3W02A 3ARVA 1PZ3A 3VKDA 4AZBA 1W3JA 4LBUA 4XZMX 1WX0A 3AIWA 5F7UA 1TPDA 4JFUA 4XVDA 1GWJA 1R3YA 1HQTA 4FNQA 5CG7A 3LV6A 3S1XA 3SJ3A 3IK4A 5FJJA 3C2YA 1EXBA 1RBOB 2ZUWA 4G9PA 4ZSUA 5E0FA 5C2XA 4AB4A 4GPNA 1H7WA 3UT0A 1Q63A 1XPYA 4S1FA 3LPPA 4B90A 2HVNA 2PTYA 1AL7A 3DBPA 1FWFC 3S5ZA 3BDKA 4JL2A 5FEPA 3W53A 4WJ8A 1QRQA 3WENA 3LTSA 3N3TA 4HU0A 4WKFA 5KZEA 4RUBA 4MMWA 3AXMA 4IG2B 3G1AA 4Z2GA 3GXMA 3T2QA 2DV0A 4JKMA 4GUGA 1GYNA 2OTDA 3VGDA 4IGNA 1S2CA 3DUGA 2EG7A 1R9YA 4HNOA 1NP0A 5REQA 2J7CA 2P8BA 3VNMA 4L4MA 3FSUA 4AMAA 1OX4B 3W28A 2NVDA 4PBFA 1LOSA 3AQUA 2WMHA 4Y90A 4NG3A 3B8WA 1GK8A 1CXLA 1IEXA 3OQEA 4K7YA 4Q8MA 2W62A 3N6JA 4WRHA 4P61A 1M7PA 3KTXA 4AY1A 2A5HA 5DT7A 4JFTA 1K9DA 1OYBA 1QCWA 4KWWA 3GY1A 4DBWA 3T8LA 3L12A 5A2BA 1DXFA 1ZCCA 3SUUA 5A1AA 3CWNA 1GTHA 1AVAA 2Z26A 3CT7A 5HWJA 4BI7A 3M0YA 3CUXA 1JZ5A 4AD1A 2C1HA 5LHEA 1F3EA 3NWRA 3QV9A 2DVUA 1K9TA 2ACQA 5G1MA 3SGGA 3UWZA 2Z1SA 4KBXA 1XBYA 4NZ3A 2VJXA 3EWZA 2EPKX 4I90A 1P48A 1IXPA 1AJ0A 6ALDA 1OVDA 5T91A 1QVBA 4ILSA 3QGKC 1UA3A 2F2KA 2NXHA 1UYQA 3GU1A 5AC4A 4D2JA 1VFHA 4R5EA 2VC9A 4PCSA 2POTA 3IAQA 2OGYA 4M6VA 1YXYA 3N15A 5CPMA 4P7RA 5FSDC 3WLMA 3NXFA 3MBDA 4CQ9A 4KCWA 1P7TB 3QYSA 3P84A 3VMOA 2CCRA 2WPBA 2CBIA 3UWWA 3WK3A 1PAMA 4NYUA 3GVGA 1C8XA 4OJYA 4Q7NA 1W5OA 1MW1A 3OQ8A 1FXQA 1W1YA 2FMOA 3TSDA 2OQHA 1VLIA 4WZHA 1XCWA 3URNA 2H3BA 5BRBA 4CNTA 1A5BA 2A3AA 3QHNA 1YRRA 3AXIA 4US5D 3MCNA 4JN8A 1XS2A 3N1AA 5BROA 4FX8A 1D3HA 1U30A 3W3OA 4FX6M 3C0SA 2JEPA 3QV7A 2BTMA 5HMSA 2ABAA 2D20A 2QAFA 5CZJA 4I9JA 1W1VA 1FWTA 3SRFA 2WQPA 4RV3A 1KCZA 1FHLA 3CEUA 1TIWA 1TZ7A 2CLFA 3D5HA 3BOLA 3VDCA 5HNUA 3UPMA 3H2FA 4GFSA 5HUPA 1EXPA 3EOUA 3H2CA 1QO5A 2UV8G 4LCRA 4W7VA 2D24A 1WV2A 3SRKA 2CZDA 2V2CA 2X41A 3W76A 3GDBA 1XLCA 4HMDA 2V5KA 4O28A 1ML1A 3EWUA 3O07A 4UWMA 1CIUA 3UWVA 5FL1A 4G1KA 1F07A 2F84A 4S3AA 1E51A 1NELA 3H4WA 4GIYA 3I3BA 1YDYA 4QQUA 4PR4A 2PDPA 2NX1A 3BSMA 3EPMA 1S5MA 3LG3A 4XD5A 1YPIA 4DO5A 3F4NA 2HBXA 2CLMA 2QMKA 3CO8A 3TW7A 2QUUA 1MUCA 4KRTA 1EZWA 2TAAA 4PRWA 5GQBA 5D04C 3EX2A 4F66A 2BXVA 3CUFA 3GLCA 4C6QA 3PPGA 1HT6A 3N19B 3IVSA 1E71M 1KXQA 2YL9A 4B9YA 4MOZA 1NWTA 2VC6A 1NTHA 3CV6A 5M2FX 3RF9A 3UYIA 4BWLC 4YN5A 2OMAA 4DJDA 2BP1A 4GXMA 5I06A 1E3ZA 4Q7IA 4BK9A 1FCQA 4HSOA 6ENLA 3A23A 1TPC1 5D2TA 5J8LA 1JZ3A 1JD9A 3W85A 5D9OA 5JIPA 3A21A 1CGWA 1RLDA 4MNKA 3MHGA 5T26A 3II1A 4AWEA 5D9PA 3H24A 3VVGA 1CXKA 4RR4A 4C5YA 4JL1A 2X1RA 4B4HA 1EO5A 1Q6CA 1QOQA 4K6AA 2J7HA 1ZBVA 4H7VA 4FMVA 5LIWX 1W9DM 3I6TA 4QGCA 4YTQA 1E6SM 1Y5VA 4IJBA 3KZPA 2CLEA 1VBJA 2VL4A 4AX6A 3PZOA 2ZUUA 3HGSA 1B1YA 2G4FA 4A2RA 4RDZA 2BOGX 4M7TA 1F6KA 3CV2A 3OLIA 2IQTA 2PWVA 4HMNA 2E40A 3PM6A 1S5VA 5A8MA 3PP7A 2PP0A 2G4JA 1FCBA 1OK4A 1Z32X 3CL6A 4NKCA 2FYMA 3R5EA 4UZSA 3NZPA 2RKXA 3W1NA 5JIWA 4U3CA 3R94A 1A3HA 3OA3A 4HMCA 5HOSA 4JIIX 3WCZA 2XU2A 2VXNA 1MEIA 5B7ZA 4YLWA 3O8AA 5FF2A 5DMYA 4IFRA 3VZZA 3W1PA 1H61A 3MDUA 4UR8A 1QW7A 3GVQA 1EX1A 3O2LA 3LTYA 3S1WA 4FF5A 4C6PA 2QDDA 2YDSA 3Q4DA 3EB4A 4MGGA 4JNZA 1XYZA 2G3JA 2VR2A 1QOXA 1NM9A 1TCMA 1XBXA 4QDPA 3WQGA 1TWWA 5IHSA 5A94A 3ZWTA 3PUDA 2E9BA 3UXLA 3BXWA 1UWSA 5E70A 2QV5A 6TIMA 3H53A 3QR3A 5HMEA 4F9DA 4E8GA 4XZWA 3HG2A 3UG3A 1XWYA 2BHYA 2VEIA 5C8BB 2ZZ3A 3OIXA 4G7EB 4AISA 3U4FA 1PE1A 3AYRA 4FK9A 2WMGA 3THUA 4TX8A 2C18A 1TTPA 5JBFA 2Z0IA 4LCSA 4PE8A 2F61A 2W4XA 1L8NA 4B5VA 1Q6LA 3AUOA 1DOSA 3W2MA 4YYFA 4M51A 2WVVB 1OD0A 4FSAA 2PGFA 2PBGA 3EB2A 3PBWA 4BHYA 4F0SA 1JAKA 3RM8A 2J7FA 2DZWA 4K68A 2YBTA 3CWOX 1CLVA 3RRAA 1X98A 1R2TA 5FEXA 3UZXA 4FHAA 1DORA 4AD3A 4ZGYA 3HU7A 4OTKA 1HTIA 2Q3OA 1T40A 6XIMA 3MS8A 2Z1BA 3AS2A 4C1LA 2YA0A 2J77A 4LH8A 1CWYA 2IUZA 5C71A 4MB4A 1JF6A 2DQWA 3UD6A 3HPXA 1SJDA 4C6FA 4F8XA 3AMCA 2GJXB 4GG9A 1FH8A 4QISA 4QE5A 1FDZA 3LMYA 3VMPA 4J1OA 1LCOA 4NZFA 1RBLA 3EOEA 3KW3A 4ECLA 3TMQA 4UIOA 1D3GA 1SU5A 2EKCA 5DFAA 1Q45A 2OWCA 2CHNA 1A47A 3RLVA 3DG3A 3G0UA 4Z08A 3DGBA 3K1GA 2OZ3A 4FXFA 3LQGA 3VUPA 1DJGA 3GTXA 5C70A 2EBNA 1A4LA 2NV2A 1MQQA 2VUNA 3GBEA 3DESA 1X1NA 3RMJA 1V8EA 3N13A 3KVMA 4JR5A 3DHPA 3V0UA 2WWCA 3G22A 3UGVA 1SO3A 2DEPA 5HA7A 2DDXA 3A47A 3C0JA 2HNEA 4DO6A 1DJXA 4E4FA 4GZIA 3KOWA 3LBOA 1MXGA 2CU0A 4K3ZA 1FHDA 3CQHA 3WO8A 1M65A 4YWIA 1H5VA 4EK7A 3PG9A 2J7DA 4IGSA 1OB0A 3O6YX 3Q2DA 1DJIA 1OCJA 4IP4A 1O6IA 1NDYA 1Y7VA 3APYA 3STCA 1H63A 2JEQA 2DSZA 1B9BA 4K7VA 2TRSA 2D0HA 2QDGA 3WQ8A 1WAWA 4KCVA 4KWUA 3C2FA 1EUNA 1VFFA 2YXOA 1OGBA 3H26A 2D3NA 2ATSA 3TYZA 3CT2A 5B7YA 3KRUA 1LTDA 2P3EA 1NDWA 2RUSA 2KAUC 3NEVA 2DSKA 2LLEA 3MI2A 4S3KA 5J5DA 3KOZA 3F4DA 1D3CA 3TV8A 3T6CA 5CEWA 4HNLA 1S2WA 1J93A 3GXFA 4IFKA 4QAWA 1VPYA 1IYXA 4XUGA 5XIAA 1A3WA 3KCJA 5AHEA 4HNUA 3CNYA 3N12A 1G4SA 1LWIA 1N82A 4GA8A 5D30A 4Y7EA 1EJUC 3QR0A 1D7KA 1R3RA 3LMZA 1V3IA 3NR0A 3IIVA 4JFVA 1XL9A 1RZMA 3ABRA 4E4UA 2X42A 3ORWA 3N04A 1FWEC 3IPWA 2AGKA 2PWFA 4NILA 4BI5A 2WWDA 3HQNA 2G3IA 1LL4A 4K1WA 1JPMA 3SN4A 4H6QA 3NO5A 4RK8A 4JTQA 4HA0A 2XHYA 3SO7A 1FFRA 5D05A 2H8XA 2WSRA 3GQYA 4UTFA 3K8LA 1J2WA 2HNHA 4H00A 2X1IA 4HMEA 2XH4A 2XZ9A 3TAOA 4Z17A 3QQ0A 2WC3A 1QOPA 1U5JA 3QXBA 4GK8A 4XAYA 2YX0A 1Q7MA 1VBHA 4RW5A 2C6QA 3G1XA 3SZ8A 1JUEA 1S1RA 4GKTA 1EB3A 4IMDA 3RFAA 2X30A 3KDOA 5EMJA 1GVOA 1H09A 1NFGA 4HNNA 3MBFA 4JQ2A 2BASA 1FKWA 4HGXA 1NWRA 1NDVA 1TG7A 3S6OA 1FCUA 4OECA 4YPJA 1CXHA 1GKPA 2PZNA 6A3HA 4AD2A 5BOEA 2P76A 3HV9A 2VT0A 3RXZA 3F5LA 3EX6A 5IDZA 3PR2A 3EEGA 2CZVA 1W1PA 3NSMA 1T0OA 4ORIA 3VNDA 5CSUA 4TTGA 4UCFA 3NG3A 3I7RA 4AFYA 3ERPA 4CN4A 1W32A 3R1ZA 5FEZA 1PZ1A 4QLKA 4JBRA 4IF2A 5A3HA 3CQ0A 1GEHA 3UG5A 4QITA 4N02A 1KBKA 3S9IA 4P8VA 3ZOAA 3HO8A 2QUTA 1IF2A 2QF8A 3EDKA 1XX1A 4NZ1A 4V33A 1V0NA 4AWTA 5H8UA 4LS0A 1X1OA 5HAOA 3PPHA 2POZA 3ABOA 3WBAA 3EDDA 3DZ1A 3TOYA 3LHWA 2Y8UA 3VCCA 1F4AA 1LRTA 3I4KA 4QNWA 2G3NA 2ON3A 3K2GA 1DWJM 1UUOA 1YKWA 4KEMA 5MKGA 4KS0A 2D2HA 1JQVA 4HK5A 1DEDA 3CMJA 5AB3A 1R30A 3LDVA 1DYSA 3DHDA 1RY0A 2A2IA 3BW4A 3COTA 1IZJA 5I3HA 2C71A 2XIIA 1F9CA 1HL8A 1EOMA 2QCDA 3CPRA 3DFHA 3EOLA 4CU8A 1DJQA 1R46A 2Z4GA 3BURA 4HKPA 1IT8A 3LK6A 1Y5WA 2Q8XA 1XF0A 2CKSA 3VGBA 5K4ZA 2Y8KA 1LT7A 2QKFA 3OIHA 1I75A 3VGFA 1DWGM 4B92A 4CEUC 5FESA 2BOFX 1G69A 2FZMA 4QG6A 3S6TA 5G4HC 4TMBA 2AQWA 4CQCA 4Q6XA 3FSTA 3QVQA 3OLDA 3WZ0E 4N9EA 4D6GA 3LA4A 3G1FA 1OF8A 1PKMA 4ML9A 4NXKA 2WYSA 1W0MA 5M1TA 3T2PA 3GAKA 1I0BA 1TRDA 1AQMA 3NPXA 3CL7A 4HZ8A 1PHWA 1UWRA 1DBTA 3GNNA 3OGVA 4J3TA 1J0JA 4DLMA 3QN3A 4AC7C 3T40A 3QJAA 1XD0A 3P14A 1K1DA 3RR1A 2OFJA 1R3VA 4JTLA 1WOBA 1VRDA 5F4XA 5IRPA 1VFLA 4DX3A 3EMCA 2F6UA 2X7VA 4IX0A 2B31A 4MYAA 1UZ1A 4G1NA 4RXGA 3UVIA 4LTSA 3IRSA 4HHPA 3CV1A 1ZBKA 3JZUA 2B7PA 4F0RA 1JYXA 4DUVA 4UTUA 3MQTA 2XYLA 4MADA 1R6WA 5HULA 4AYSA 4EWJA 5C5YA 1SZEA 3K4WA 4KKXA 2HVOA 3A5FA 1CGVA 2QCHA 3WD0A 3BV4A 2VEFA 4LW7A 4MZYA 5D33A 3B06A 1ZTVA 1PDYA 1SZRA 4EPBC 3KS6A 3PVFA 3FX4A 1KM2A 1KWKA 1L9WA 2XN2A 3GXPA 5TIMA 4PMXA 4DXVA 4KPLA 1YBQB 3MDWA 4X2RA 1BXNA 3CASA 3ONBA 1QHOA 1FKXA 1UPPA 4IG2A 4JHOA 4FZIA 1T7LA 1H60A 2VWSA 3GXDA 3CTLA 3P80A 3WK1A 4FO4A 1T6MA 3NQ7A 3F4VA 3WQPA 4AZGA 4JY8A 3ABZA 3MY9A 3E74A 1JR1A 1W3NA 3M1ZA 2PPGA 1H0IA 5I0DA 1S2UA 3B3DA 2WBGA 5AC8A 1OX4A 2V3DA 2FGBA 4K38A 4PMNA 2NQZA 1GTEA 4WQ6A 1IEQA 5T9CE 3WJSA 3LCGA 4CD8A 2Y61A 3QY8A 4QE1A 2NXGA 2DORA 2RGLA 4TTUA 3W07A 1F76A 1TMQA 4XO7A 3QC0A 3ALFA 1PIIA 4XTDA 2J27A 3PK7A 3KLKA 3ME3A 4B91A 4IOTA 3WUEA 3DHUA 1OZMA 3NXLA 4HNVA 1DVJA 2VDIA 3W23A 1L0PA 4HU3A 1X39A 3IIZA 5FF4A 3QGAC 3WY1A 4PRTA 4C6NA 3L5AA 4JTJA 1J79A 2OZ8A 5BOFA 3OZYA 2ZRVA 3E2RA 1RCOB 4LF1A 1EUAA 1I1WA 2VGBA 1O5KA 3P7YA 1JCYA 2CW6A 5I3KA 3EGJA 4IZGA 3THQA 3OHIA 3VNLA 3G0SA 4GH1A 3E3HA 2CITA 2O4MA 1KTNA 1TMLA 2O9TA 1ZNNA 4AZ5A 5LXXA 4HHHA 3ABQA 4RLIA 1PTAA 2BVTA 3QV6A 2NQHA 4BEQA 5DELA 4QR6A 5BOOA 3GFXA 5BRQA 5GNXA 2PWDA 1TJ2A 3IJ6A 4A8NA 4OOUA 1AL8A 3Q67A 4EPDC 2OKOA 4AVNA 5E6ZA 4JYFA 1J0IA 1QI2A 2NT0A 2AL1A 1GYMA 2XGIA 3UR5A 3W7DA 1NAL1 2DUAA 5D02A 2GYIA 3URAA 4A6GA 4HN8A 4O4WA 2RDUA 1P7TA 5G1YA 4HYRA 3ELFA 1E1CB 4J28A 3PSWA 1FRBA 3QRHA 4NX5A 2GOUA 1Q6GA 2FHCA 1WKDA 2HTMA 2V3FA