3LBOA

Human aldose reductase mutant t113c complexed with idd594
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
314
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPCGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 314
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lboA00
4Q3MA 4GQGA 2PDMA 3VXGA 1ZSXA 3NTYA 4YVXA 2IKIA 1VBJA 1S2AA 5LIWX 4JTAA 3UFYA 5JH2A 1UR3M 1X97A 2FZBA 4JTCA 4XO6A 1RY8A 2HEJA 1AH3A 2IKHA 4YS1A 1LWIA 2I17A 1A80A 1VP5A 4XZMX 1LQAA 4LBRA 4PUWA 3D3FA 3CMFA 5LIUX 4DBWA 2IQ0A 2IPFA 3P2VA 4RPQA 3N6QA 4FZIA 3WBXA 3M0IA 1Z89A 1US0A 3R7MA 2WZTA 4FAMA 3UZXA 1EF3A 1YE4A 3WCZA 4DZ5A 2PDIA 3EB4A 4JQ4A 3UP8A 4XVDA 3N2TA 3RX3A 2IQDA 2FZ8A 2PDFA 2IPWA 1Z9AA 1EKOA 1J96A 2IS7A 1AZ2A 2PDWA 1RALA 2FGBA 5LIYX 1AH4A 3H7RA 3LN3A 4FA3A 3G5EA 5AZ0A 3BV7A 5C7HA 2PZNA 3H7UA 2HV5A 1YNPA 1MZRA 2ACUA 2PF8A 5AZ1A 2ACQA 2VDGA 2PDXA 2PD5A 3M4HA 2BGSA 1Z8AA 1S1RA 3WBWA 1XJBA 4ZFCA 4XZHA 4EXBA 2HE5A 1FRBA 4JTQA 2PDGA 3S3GA 2R24A 3UZYA 2HDJA 2PFHA 4JQ1A 4QX4A 3V35A 4GA8A 3CAQA 1AH0A 2QXWA 4PRRA 2R9RA 4QR6A 4JIIX 3LZ5A 2FZDA 1C9WA 1PWLA 3GUGA 4HMNA 3F7JA 3UYIA 2WZMA 2ISFA 3CASA 4WEVX 2PDYA 2J8TA 4WDWA 4JIHA 2DV0A 3LNMA 3U2CA 3GHTA 3WBYA 1K8CA 1ZUAX 1EL3A 2F2KA 1PWMA 4IJCA 5DANA 1HW6A 3R8GA 2PDNA 4R9OA 3GHRA 2P5NA 1PYFA 2PD9A 4LB4A 2C91A 2PDBA 4AUBA 2ACSA 3CAVA 3BURA 4QBXA 1IEIA 3UWEA 2PDQA 2BP1A 4XVEA 1MRQA 2HVNA 3RX2A 3CV7A 2FZ9A 3R6IA 4IGSA 1XF0A 2PDHA 3LEPA 4PUUA 5HNUA 2IKJA 5HA7A 1YE6A 2HE8A 4L1WA 3UZZA 2PEVA 4WDXA 4NKCA 2PDCA 5KETA 3Q65A 4YVVA 2IKGA 3M64A 1HQTA 4Q7BA 2PDUA 4WRHA 3LQLA 4GQ0A 4EXAA 3V0TA 1S2CA 1SM9A 4WGHA 3UGRA 4LAZA 4XO7A 2DUZA 4PMJA 3O0KA 1ZQ5A 3FJNA 4PR4A 4OTKA 4LBSA 1ZGDA 4XAPA 1GVEA 1ADSA 4GCAA 2AGTA 1PZ0A 4GIEA 4JTRA 5HNTA 4DBSA 4XK2A 3CV6A 3LZ3A 1Z3NA 5M2FX 3ERPA 1Q5MA 1RY0A 2A79A 1T41A 1Q13A 2ACRA 3BCJA 4PRTA 3T42A 2PDLA 1EXBA 3ONCA 4YVPA 4H7CA 2PDJA 3R94A 2I16A 1MI3A 4ICCX 4QXIA 3R58A 2FVLA 3DOPA 1R38A 3LUTA 3H4GA 1PZ1A 4IJRA 4DBUA 2ALRA 4HBKA 3GHSA 3RX4A 4GABA 1X98A 1AFSA 4I5XA 3COTA 5LIXX 2NVCA 1IHIA 3G1RA 1XGDA 3KRBA 4WDUA 3WG6A 3LENA 4JIRA 3DN5A 4GACA 1JEZA 2INEA 2IPJA 3LQGA 3R43A 1QWKA 4LB3A 1QRQA 4H8NA 1S1PA 2F38A 3MB9A 2HVOA 4MHBA 1YNQA 2CLPA 3EAUA 3UZWA 2BGQA 5LIKX 4JQ2A 4XZIA 2PDKA 3C3UA 2NVDA 1OG6A 4XZNX 3V0UA 4FALA 3R8HA 4F40A 2IPGA 5JH1A 3B3DA 2INZA 3EB3A 3QKZA 4ASTA 3ONBA 4JTDA 1T40A 4G5DA 3GHUA 4JQAA 2PDPA 3V0SA 4WDTA 3LBOA 1X96A 3MC5A 1AZ1A 3V36A 2DUXA 3O3RA 4LAUA 4L1XA 3LD5A 4JQ3A 4XZLX 3FX4A 3Q67A 3UG8A 4YU1A 3BUVA 1M9HA
chains in the Genus database with same CATH superfamily
1C92A 1XDJA 4E3VA 1E3ZA 3CZLA 4HA0A 1ZSXA 4GYKA 2WLYA 4HKPA 3KDNA 5MHBA 5E9AA 1FH8A 3BE7A 3SJ3A 2CERA 1IR2A 3KX6A 3W2NA 2YDSA 4QDWA 1OD8A 2HCVA 2HRWA 1RA5A 1X1NA 1LP6A 1MVYA 1JYXA 1H0IA 1RY8A 3WLQA 4DUOA 4YS1A 3G1FA 3QMRA 1XBVA 1VP5A 4UTLA 3QFEA 4DJFC 1V3MA 4PUWA 3RLVA 2VOTA 2IQ0A 3L66A 2O55A 3R0DA 2I57A 4HZ6A 2UY5A 1VAHA 1IWBA 3CIVA 1PAMA 4GI8A 1FHUA 4DZ5A 1TPB1 3N29A 2VD9A 4GBDA 5CGMA 2PDFA 3ARTA 3MHUA 1IV8A 1TV5A 4YHGA 1KTBA 4GISA 4PMVA 1B4EA 3W2LA 4GGBA 2GOKA 3U0HA 2DGAA 3DG3A 1OFAA 1E51A 3IIZA 1P0NA 1XLCA 3MW7A 2WSYA 1NDVA 5ENLA 3EWUA 5LIYX 4JTHA 3M0JA 3VNMA 7PTDA 1TE6A 3FK4A 1L2QA 2RDXA 1F76A 3H22A 1I2RA 3XIMA 1KGWA 1RPXA 1EO7A 3O6DA 3DI1A 2DZSA 2Z25A 2B0MA 3S2MA 1OY0A 1ZU8A 2VDGA 1ITUA 3BSMA 4S3GA 1D7KA 4PMXA 2H8XA 4WKHA 4P5UA 1ZL1A 4AEEA 1Z32X 1CGYA 2ZXAA 4EXBA 1EJVC 2G4FA 3GTXA 4D1JA 3VIKA 2PP0A 3EMQA 4S3JA 2ZZ7A 1JCLA 5CLWA 2BOGX 2CZ5A 1ZHAA 4LS2A 3SR7A 1JZ6A 5T9BG 2OOFA 1U1JA 4CQ8A 3UETA 1ZJAA 2QXWA 1I0DA 5A8NA 2XN0A 2R9RA 4QR6A 3U48A 2ZTKA 3BW2A 3GUGA 3G1XA 5B7YA 4JTTA 4WXYA 5E9XA 4Z2IA 4XBJA 1R3TA 5HDRA 1TJRA 1KWGA 1KXQA 2OYMA 3N2XA 4XKMA 5RUBA 5DCBA 3ATYA 3UPMA 1O4UA 3FA3A 3CUHA 4ZL1A 3LLDA 3WBYA 1YQ2A 4Q4QA 1Q6DA 1K8CA 3EMZA 1ZAIA 2W66A 2NQZA 2HNHA 3JZEA 1NFBA 4GLEA 3M0LA 4TMBA 3XINA 1K6AA 2D3NA 1GORA 4I9AA 4IT1A 3UD6A 5LHEA 2VGBA 1HKVA 5C71A 3AU2A 3TJXA 3R13A 3VCRA 1GQKA 2ACSA 2H6RA 1LRNA 3IGSA 4Y9AA 5D04C 3TZFA 1GKRA 1TCDA 1BQGA 3LRKA 2A6LA 3NXFA 3N1AA 2D0FA 4ZO8A 2XSXA 4I6KA 3TSMA 3WLPA 1W1VA 3D46A 3LLFA 3MV11 4JHZA 4RZ4A 2E3ZA 4S39A 1OFDA 2CKRA 4CCZA 3TDFA 2HE8A 2PRLA 1OWQA 3GKFA 1V0MA 3LTYA 4GQQA 2Z4GA 1Q7MA 2PGRA 4I5RA 3M5XA 4OZOA 2CZDA 1PJ9A 4Z42C 3NL5A 1TR1A 2FPVA 3KOFA 4QE1A 1OB0A 2WVUA 3LHVA 2NQHA 3VMPA 4HGXA 4HA4A 3CHDA 2JGQA 1TG7A 2Y7FA 1PZ0A 2C16A 2PP3A 4DBSA 1E5NA 2X16A 4EK7A 3VMOA 4AIEA 4L6DA 2YW4A 4KPLA 3PAJA 4AY8A 2MNRA 5C9RA 4FXJA 3VIHA 3RRXA 4CN1A 3MUXA 1W54A 2QAFA 1AQMA 3WH6A 3VKBA 4IFKA 1OINA 1C8QA 1EXBA 1E0XA 1RP9A 3ARYA 2DT0A 3AMGA 3SW6A 4AZHA 4ZFMA 1LYXA 5E1QA 1C7SA 3PPFA 4B5TA 1UD2A 4NVTA 3K1DA 2VC9A 3GBDA 5HR7A 1CGUA 1QAPA 2XVPA 3PVFA 3ARXA 4LF1A 3LUTA 4I7VA 4AXNA 3H4GA 4EPDC 1Q2SA 3LGDA 4EPEC 3N11A 4J9JA 1RSCA 4HBKA 1TQJA 4F0LA 4GABA 4MPKA 2F7FA 3O8AA 1AFSA 3RF9A 1B3VA 3EA2A 2EGZA 2KZHA 3W7QA 2VR5A 1JXKA 3CUXA 4WDUA 4CU6A 1SMAA 4JIRA 4A6GA 3OB8A 2F6UA 1TR9A 4BJHA 3DN5A 4PH6A 3RCMA 4OWGA 5A6SA 2CITA 1N8IA 4A8NA 4L9XA 3LB0A 1QRQA 4H8NA 3KZPA 2WSRA 4IFKB 3UXKA 2PTDA 1YNQA 1PL9A 3RLGA 4MY1A 3TU9A 4QLLA 3HQPA 2VX4A 3SECA 3BV4A 3O9NA 4X22A 2ZCGA 1EO5A 1T5AA 3ONBA 4DAIA 2WSKA 4JQAA 2ZUMA 3QC0A 3E96A 4IMFA 4Z1YA 4YNGA 2EO7A 1R87A 1XKYA 4D6JA 3BAWA 1UWUA 3PANA 3CLWA 1UD4A 3VDGA 1CZ1A 5HBFA 2G5WA 1QI5A 1OCBA 3NL3A 5FF3A 2BG5A 2O9RA 4GO9A 2DJXA 4H6RA 3IIOA 4K6AA 4A05A 1G9HA 4L6HA 3IJDA 3OHIA 1BYDA 1P0EA 2QVNA 4I5UA 3ZR5A 4ZB2A 1WQ5A 1VCVA 3RCNA 2C1HA 1VBJA 3QFWA 2QCDA 3GU2A 5EB8A 4JTAA 3F4DA 2XH7A 3MYOA 3UXAA 3T2PA 4FNUA 1XPYA 1NDZA 2Y89A 4HA1A 1FA2A 2ZQ0A 4HOZA 1GPWA 3R2GA 4CQBA 4GKLA 4ATDA 2QCEA 4JL2A 3T07A 5BRBA 2Q3RA 1OABA 1DE5A 2WKJA 4OVXA 2VURA 1R2SA 3W6LA 4EPBC 3NPWA 7REQA 4GJ1A 1W9DM 4JFWA 3M7WA 3Q4DA 4BK9A 4HNUA 1OQFA 3PY2A 3UZXA 4L4PA 1XR2A 3TR9A 4M1RA 3KOWA 4D6GA 3NURA 1S2TA 2XSBA 3S2LA 1V02A 3ZQ9A 1KFWA 1ZALA 1I9CB 3K30A 1PO9A 4GIYA 1G1YA 4IMAA 2QNEA 4B2DA 4L4OA 3K13A 1G67A 2PDWA 3W87A 4I6VA 1I45A 4XAGA 2HXTA 1DJGA 3CO8A 3H2FA 4HZ8A 1V08A 1PCWA 3WQ5A 4PTVA 1VPXA 3WQOA 4FO4A 3UJ2A 2A7NA 1SJCA 1EGVA 3EX6A 3S1XA 3CV1A 5K4ZA 2O9PA 1P6WA 1EQCA 3S5SA 3SCTA 3VOIA 2OKTA 1EX1A 1ALDA 3UA4A 3UVIA 2G37A 1GK8A 1QPOA 3RMEA 4H41A 4Q4PA 4B5NA 1WDQA 3RGTA 3A13A 1A5MC 3L0NA 2FZMA 4BI6A 4U2ZA 1FWHC 4A3YA 3LNPA 3V1PA 1US3A 3FVMA 5D05A 2I14A 2JF6A 2QF8A 4JFSA 1EJSC 1QK0A 4I9TA 2PURA 1DIOA 1VEMA 1I2OA 3TXZA 4L56A 3LZ5A 3T08A 3AQUA 3HO8A 3AWOA 3B9NA 3W4RA 4QISA 3LMYA 4QJ3B 2J6XA 2Z00A 4UR8A 4M7TA 1PKMA 4K3ZA 2VENA 1RP8A 3HG5A 3NQBA 3T0BA 5G4EA 1MXGA 3MU7A 3P61A 1UR0A 3H6OA 1CEOA 3VOCA 1DORA 5D2TA 3SFWA 1HUVA 3NL6A 5D9PA 3AXIA 2C91A 3GFXA 4UQEA 5E6YA 3P14A 1I8JA 4ACYA 1WDRA 3OEXA 4B2DD 3GAKA 1NOUA 4JYFA 1RJQA 2EPKX 2VX6A 3N4EA 3AROA 2QIWA 1EUAA 4K39A 3ZLHA 4OU1A 3B4YA 4LAMA 5REQA 3VK5A 5D09A 4P7QA 3WK0A 1IT0A 2QPUA 2PEVA 1LRTA 1UD5A 1LLZA 5CJNA 1LL7A 5AHNA 2OX1A 1AK5A 3W29A 2PTYA 1G4PA 4MJ4A 3NQCA 4TIMA 4TUFA 3GNOA 3W1UA 5DO8A 3NVDA 3WF0A 4GPNA 3VGGA 4L61A 2HWGA 3LCHA 2VGFA 4LUTB 4OJYA 3VX1A 2ZUWA 2ZRUA 1VBGA 2XSAA 2V5LA 5JBDA 1F3WA 4JY8A 3P5YA 1SUXA 1AJZA 1DV7A 2ZZ4A 1Z7AA 1UQZA 1E0VA 3TAOA 1XV8A 4LUIA 4BI7A 1GTHA 4IMEA 1VBHA 4C6FA 4U28A 4OECA 5LNUA 4AFYA 1HZYA 3STCA 1Q5MA 1RY0A 4D6FA 3EWBX 1T41A 4CNTA 1DXFA 2ZX5A 1OYBA 2GQ9A 4IXXA 4FIRA 1DQWA 2NZLA 1DL3A 4YVPA 3SCOA 3GXNA 5FF0A 1MQRA 3OQ8A 4HU0A 1UR8A 3TLLA 3AHVA 1YXCA 5EFDA 1G01A 3O05A 4ONVA 3GXPA 4OFCA 1V93A 2BX7A 2ZE0A 4Y9PA 1J18A 1G94A 1JL8A 3VIIA 2JKPA 4RL3A 4QTGA 2GK1A 4AZ5A 5CBBA 1R3QA 3M7SA 1X98A 3L4WA 3NO1A 3GDRA 3VIJA 3QR3A 3R8RA 5AOUA 2NVCA 3E2QA 4UTTA 4XZBA 3BAYA 3LENA 3WDHA 1LJYA 1S5MA 4GACA 1WB0A 2YPIA 1J93A 2VEMA 3HPSA 2IPJA 3U6WA 4E8DA 2Z1KA 4DZHA 1UIPA 1G7UA 3V16A 2D1ZA 1M01A 3GUWA 3WMLA 2NV9A 2X40A 3NYZA 2PZ0A 3W71A 3VOHA 3UJSA 3JR2A 4RX0A 3UPBA 2ZDSA 3VD3A 3C86A 4V1YA 5JH1A 3B3DA 1SPQA 1UWRA 5A8QA 4NT0A 3GHUA 3QLLA 2QUMA 2WXDM 3CHEA 5EY5A 5AYBA 2A3HA 5D9NA 3NPVA 4L1XA 1SZEA 1JD7A 3TYEA 4DUXA 1DE6A 1A49A 3G3MA 3VM5A 4IUGA 3VD5A 4MUZA 4ZQRA 3KVMA 3VKJA 4FNSA 5DMNA 1XL9A 3QOMA 3VKAA 3NQVA 4LC8A 2IKIA 3ANYA 1LTDA 1WYIA 4FS9A 3U2ZA 4CN6A 3VOJA 3TLQA 5BXSA 1TREA 5LIWX 2CLOA 3UFYA 5CZKA 5AHEA 2D2GA 1NQKA 1RQEA 1Y5XA 2WQPA 4X2RA 4ZGYA 2V81A 1IT7A 1GONA 3M0YA 1LL6A 2BVWA 4YN5A 4AYSA 1E0UA 1N7KA 2Y88A 3ABZA 2DZPA 1YTDA 3ECQA 3MDUA 4RR4A 1UIOA 2WC4A 3AZTA 2J7HA 1A5OC 4EWND 1CLKA 1J4EA 3MSGA 1K8YA 1US0A 3BOLA 4LAOA 3VC6A 4BWLA 2QCGA 2Z0IA 3VNKA 3FHAA 5G5IA 4UTTC 3SUWA 3M6DA 6ALDA 4PL1A 1V7AA 1QPRA 3O1NA 4CGTA 3M43A 4BQ3A 2QHAA 1ISWA 1W3IA 3WH8A 3MVTA 3TFXA 1ZZMA 4NZ3A 2ZZ3A 1NY1A 2PRMA 3TW6A 1L2UA 1BKHA 5B7ZA 3W72A 2EXOA 1WDSA 4FLOA 2W92A 1BQCA 3L7RA 3G5EA 3N04A 5CSSA 3OYZA 1H62A 2ACUA 4MOZA 4X3ZA 2F61A 1BYAA 1I2PA 2EPLX 2G95A 1R85A 1OG0A 5A8OA 4NG3A 2OWWA 1J12A 1XWYA 3IEBA 1K03A 2FHFA 1LWJA 4HQVA 1FH7A 1G0CA 4O53A 1KM3A 4YCPA 4J3UA 2OWXA 4G1NA 2YDAA 5LKYA 3UWWA 2PDGA 1ISYA 3UZYA 1QJWA 5H8UA 1X7FA 4BQ2A 2AGKA 1QPNA 3HJZA 4FLRA 3B8VA 2NX3A 3PJUA 7ENLA 4W87A 1HG3A 4B5XA 3W74A 2HK1A 2XJ7A 5FSEC 1ME7A 3UVAA 3NZQA 3AUJA 4ZR8A 2YB4A 2BFGA 2PMQA 5HWMA 4TX8A 4K8EA 4O17A 3VM7A 3VX0A 4MZ8A 4D72A 3IVTA 2A3BA 4JIIX 1W1B1 3BSGA 4GY0A 1IGSA 2XWEA 2WZMA 2Y8KA 3RR4A 4KCWA 3FVDA 3B8UA 3CASA 3WY1A 1W1A1 1TPFA 1LRQA 3OG2A 2Y0FA 4GXMA 3BG5A 4YL2A 3F2DA 3E0LA 3PR2A 1MZHA 4PTMA 2Z24A 5CAKA 3ME3A 2ZUSA 5BOFA 2NWRA 3C2RA 4LVGA 2JIWA 3QYSA 1KM4A 5A6BA 4C6NA 2CKSA 1S3TC 1POKA 2E6FA 3MKCA 1DWGM 3ARUA 3V5FA 2BXVA 4BWLC 2ZXDA 4ZSTA 2Z1XA 1JCXA 3N2OA 1IT8A 1KC7A 4A3HA 1O6IA 3IGHX 1VHCA 4KGJA 2XZ7A 3R6IA 1E6QM 4AWEA 4ZO6A 3P93A 2IKJA 2AKMA 1X38A 1ML1A 4QSFA 3ZVHB 4GXPA 5IFPA 2VZTA 1TPEA 1PUDA 5AC7A 4UQDA 2GQ8A 4B3LA 1TCMA 4Q4RA 4GY1A 1FOBA 4Q6JA 3EWWA 3NQ7A 1RBAA 1N8WA 1ONEA 1SM9A 4WGHA 4C7GA 3UGRA 2ZVRA 3A6OA 2YL9A 1TZ7A 1TTQA 4U3AA 5FJOA 1DOSA 5ABFA 2DVXA 4JFTA 3UT0A 4TVUA 3LHWA 4AX7A 3AYVA 1AJ0A 2BLEA 4Y7EA 4PN2A 6TIMA 4WJEA 3RJYA 1RXOB 1XIDA 2BXZA 3LDVA 2NUWA 1LBFA 3VC5A 4LNCA 3BCJA 1KNWA 5H8PA 1FWWA 3NPXA 2Y70A 3M46A 4PMNA 4DZIA 3PJXA 1A3XA 4RE4A 3E12A 3CEPA 3WF2A 2QDHA 4XBKA 2PGFA 5ABTA 1W31A 1EXPA 4LYPA 1GUVA 1OD0A 3H2AA 1IWAA 4JICA 1R38A 1O94A 3W53A 1BXNA 4HT3A 2PTZA 2VOMA 5FF4A 1V8EA 3W7PA 3BMWA 1W3JA 3RO8A 3IVSA 1TJ1A 3C2VA 1YTEA 1QOQA 5FJIA 5F7UA 3H2MA 3S46A 3WLSA 1ZS2A 4B5WA 3QTGA 4HB7A 5IOBA 3QTPA 2VGGA 1KXVA 3LSCA 5IM51 1V3HA 1CLXA 2DZAA 1E73M 4LX4A 2NVAA 3T40A 2V0TA 1C8XA 3SUUA 1OM0A 4Q8PA 4AC7C 1XGEA 3TYDA 3TOPA 3N4FA 3APTA 1QI4A 4FSAA 3KCLA 5LIKX 3P0WA 3UU0A 1TTIA 1XINA 1XLKA 4N9CA 3PUGA 1FQ0A 2GDVA 5AYXA 3SN1A 4MIMA 1RK5A 4HOWA 3VKDA 5D37A 3NOYA 3T4WA 1XRSA 4WOQA 5HQLA 1FWCC 3EB3A 5A8PA 4KWOA 2V69A 3W7OA 1GHRA 3A4JA 4WDTA 2VCCA 1VFUA 3W7RA 4OHQA 2DT3A 2PI6A 3IJIA 2F6KA 4IP7A 3MDWA 3RITA 4LAUA 4O13A 2VDIA 3LD5A 4C6CA 5HUPA 5TD4A 3MT1A 1P0BA 4M80A 2ZX6A 2OYKA 3W76A 2VFIA 4UFMA 4WD0A 1R9ZA 1JFXA 3GDMA 1IEQA 4TV5A 1WBHA 5I3JA 3E0FA 4S23A 1FUYA 4NQ1A 3H70A 4F66A 1AMKA 1NF7A 1S2AA 3PF3A 1GNXA 3H2EA 5FEWA 3I7RA 1HXJA 2VC6A 5CPQA 3VGBA 4UTWA 1PV8A 2Y4SA 2RGMA 3BICA 4S3AA 2IKHA 1V0LA 1G4SA 5XIAA 4IIHA 4X2PA 1M41A 2CLEA 4R7WA 4WY0F 3O2LA 1BSLA 1A0CA 4YYFA 2EKCA 4J3XA 1R7AA 2A0NA 2TMDA 1LWHA 3AIRA 3WCZA 4CNPA 2PDIA 3EB4A 3UA3A 3GX9A 3MSYA 3J7HA 4QRNA 3KL3A 2IXVA 4OUIA 2VZSA 3KOXA 2WVSA 2W5FA 4D8ZA 8CGTA 2FPTA 1RALA 2W63A 4L5ZA 2CLFA 4DN1A 1TIWA 1VHNA 1LOSA 3H7RA 3TYZA 3BOXA 3KRSA 1SFLA 1TWWA 8XIAA 3IUIA 4XKYA 3OG3A 2CZVA 3CHCA 4N9DA 5FJPA 4UMAA 3W86A 3WQVA 2V3FA 4IISA 1HF6A 1KBKA 2PDXA 1MNSA 2ZWYA 3CQJA 1YIXA 3ZJ8A 5D30A 1S1RA 1J0JA 3HQ1A 5K7JA 1WDDA 3STEA 2QS8A 3VUPA 3BJTA 2QT3A 2XIMA 1M6JA 3PTDA 4LS0A 2HDJA 1Q6LA 3T4CA 4CD6A 2PFHA 1XG3A 3URNA 2ZRXA 2VT0A 4RV8A 1S46A 3BJSA 1C3FA 2Y61A 3V35A 3EPNA 4MM1A 5AC4A 3E1F1 1DTNA 3PFMA 3I6TA 2YBUA 1KGXA 1NF0A 4P8UA 3HMJG 5BMWA 3QF0A 3WFAA 1Q66A 3UG4A 3WUEA 2QJJA 1FHLA 1V6VA 2Z7GA 5DN1A 3QW3A 3C0JA 4XKYB 4JIHA 1QI2A 4LALA 1Z48A 1OFPA 3BARA 3LNMA 1PEZA 3FSTA 4UTWC 1EL3A 4CNUA 2YYUA 3O6CA 4U4MA 1T96A 1PWMA 4UZSA 2ISVA 2J27A 4GCXA 5AC8A 4UMBA 1W2PA 3KP1A 2XM2A 2A3AA 4J3SA 3CC1A 1ZNNA 1B2YA 3M1ZA 2NXHA 1VKFA 1IEIA 3S42A 4DUVA 3UPWA 1BWKA 4UTKA 1T99A 4TXEA 3EMCA 2PDQA 4B4HA 1ICPA 2XUCA 2ZA1A 4I9MA 2OMAA 2D69A 3MMWA 4FOKA 3W1LA 1TYGA 2D22A 5FACA 2J74A 4WIWA 1GZ1A 1B9ZA 4WDXA 2PDCA 5XINA 3PZ9A 4GKTA 3BGAA 3CM4A 4GINA 4R9XA 5HR6A 1BVNP 1K8ZA 4I8YA 5F2MA 3GNRA 2C0HA 1M03A 3ZWTA 2VD8A 2B81A 4XO7A 1KWKA 4NASA 3QMSA 1J2BA 2OJPA 3LGEA 3Q37A 1WAUA 3H26A 2YA1A 4R33A 1L8NA 4JL1A 5FCZA 2YOCA 3SSJA 3FJNA 3AJXA 3E0VA 2YL6A 4S2CA 4K1WA 4PR4A 2ZKMX 3R4IA 4Y8EA 2PWDA 2X1UA 1S5WA 1DWHM 3PJWA 1U22A 4XK2A 1OGSA 2BBFA 1H50A 1ME9A 1I60A 3CMJA 1OX4A 2CHNA 2VUYA 3EOSA 1K70A 4P8VA 4O54A 2GPTA 4CCCA 3B40A 4GC4A 2RUSA 3DZ1A 2QR6A 3LM3A 3Q58A 5AYYA 2AAAA 1TV7A 3BVJA 3WFZA 1FY6A 3DHFA 3WLTA 4PB3A 3T8QA 4TOQA 3VGHA 4M51A 2KAUC 4EAMA 4GVHA 4Y9NA 1AD1A 4H1ZA 3MKVA 1PZ1A 2BY3A 3MI6A 1UQYA 5ABGA 1OFQA 2O56A 4P7OA 3QSRA 4RDZA 3TJ4A 3DBNA 1Q45A 3H2NA 3RO6A 4WSJA 2PU1A 3W9ZA 2OQHA 1GQJA 2WNQA 1F7BA 3PZNA 1FTXA 5A6LA 1R0MA 4KFPA 5AYZA 1OX4B 1M3UA 4G56A 3UCDA 2DQWA 1M7PA 2F38A 4K1GA 3TK7A 3B0XA 1EOMA 6REQA 3VMNA 4N4QA 1W1TA 5FAGA 3TR2A 1YPFA 3L4ZA 5GJPA 1ZP3A 4XZIA 4U5IA 1OT2A 1REQA 3C3UA 2NVDA 3DFSA 3AXMA 4TMCA 3DECA 3RXZA 1J10A 4D6IA 1DWJM 2BZNA 1VPQA 1DJNA 2P1FA 5DT5A 1DXEA 3W84A 3M41A 3BH4A 5A6TC 4A2RA 3ABXA 1OC7A 3EDFA 5ABEA 1H5YA 5HPOA 2VEIA 3NQMA 3NYDA 1OCJA 1MEWA 4LYQA 4HYWA 1S39A 2G3IA 5CCZA 1U5HA 3UG8A 1BSIA 3S47A 1ZPTA 3VZZA 1X39A 2FIQA 5CJMA 3IUDA 2Q3OA 2J79A 4JDYA 2HS6A 3NA8A 1OJXA 1W2VA 3EOOA 2YCIX 1XLLA 4BA0A 2FH6A 3PK7A 3LRMA 4M3PA 5JH2A 4KIRA 1CDGA 2AKZA 4HHMA 3VNYA 1REQB 2NV2A 1KRBC 4IFOA 4J4KA 3G3DA 1BWLA 3G6LA 2J13A 1TVLA 1XIHA 4XZMX 1SR9A 3CMFA 4DBWA 4JKMA 1X8FA 4GGHA 4NJHA 4CCDA 5KZ6A 4ADSA 3NQEA 1AQHA 5D8WA 1A4LA 1HP4A 3SN4A 3W75A 3AISA 2WWDA 4GFSA 1RH9A 4AF0B 2VVNA 3AS0A 4CU8A 1TFVA 3T81A 3C0QA 2IQDA 5DRIA 2WMGA 4NAFA 4M24A 4Y9OA 1CW2A 4LAKA 2CLIA 4FNRA 4BF5A 1XIEA 1FCBA 3CLMA 3CGTA 4RXFA 5JIPA 3S1GA 2YIHA 4QEEA 3HG2A 3ALGA 1GQIA 2FGBA 4C90A 4RZ5A 1YPIA 3CNYA 3CIWA 2OGJA 3TWBA 4FA3A 4UTMA 3NEVA 5C7HA 4NYYA 4Q8UA 4V2XA 2GVGA 3T2OA 1O1HA 2I56A 1EA0A 3HN3A 3CB8A 4GI9A 3M4HA 2X42A 5BOEA 2PS2A 3SUTA 3E02A 2E9MA 3VVGA 3BLKA 3LTSA 1XFCA 3GNNA 3KRZA 4POCA 1XIMA 3W6YA 4HMDA 4YTTA 4YJ5A 4JBRA 2RDUA 2C1IA 1VJIA 4IOTA 4HCDA 5KEZA 3OIXA 4GBUA 3DYPA 2FTYA 4LNYA 5G1YA 1DYSA 3BLDA 3IPWA 3CTTA 1V3KA 1K6WA 4RE0A 3N6HA 3VE7A 4DO6A 3GDTA 1QHPA 2AOSA 4UBPC 5DLCA 1P4CA 1VLIA 4PCTA 2XDFA 4HMNA 4JX6A 5FD0A 1EP2A 3F5JA 4CD7A 2FDMA 4DPQA 3FN9A 3BLPX 3M0XA 3MTWA 4JTUA 4W7VA 2VC5A 2FQIA 3GHTA 3WUGA 5BRPA 5DMMA 3LHTA 4B5SA 4AZCB 3NO3A 1E55A 3DENA 1ZUAX 4ADTA 4XD4A 1LT8A 2Y24A 1GVIA 2J75A 2F9RA 1O66A 2J62A 3SM0A 1Q4NX 4LY4A 3OVPA 3V1HA 5CGQA 1XYFA 4JKKA 1OFBA 1K7XA 3MI2A 1OZQA 3W2UA 1O5QA 4GQBA 4QBXA 1JZ5A 4NNAA 4LXFA 2ESCA 2V9DA 1DHKA 3TIMA 2NSOA 1XLIA 5LZLA 3PTMA 3C8FA 4AY7A 2PWHA 3E0IA 3ANVA 1EPXA 2FZ9A 2GYIA 3WX7A 4PMDA 3E38A 4GFIA 3W22A 5JBEA 1GEQA 4C5YA 2UY4A 5H1WA 1D7FA 2XINA 2QDDA 2XHYA 1HKWA 1R2TA 2XH2A 3VKCA 2FKPA 1HJUA 1F8IA 4PSRA 3A47A 1RCQA 3P6LA 2WJEA 4W7WA 5HULA 3WO8A 2WJFA 3OO2A 3B9AA 1GVYA 3NZ1A 1UD3A 1MUWA 3GK0A 1E1FA 3LHZA 4YHEA 3GW0A 4H7ZA 4IM4A 1NIUA 3UCCA 1QXLA 3BW4A 4K68A 3TYUA 2VYOA 3KTSA 1TVNA 4JTRA 4KW2A 2GWNA 1W9VA 4AD4A 5EMKA 5DBTA 1NVMA 1CXHA 5CC7A 2ZXBA 2ADAA 5CZ0A 1MDRA 3S5ZA 4JFVA 2Z6IA 3MPGA 2PWFA 2ACRA 1ME8A 2PRHA 1EYWA 2JFEX 3OLIA 3ZFHA 4X61A 3NDZA 1Y5VA 5I09A 4IMCA 4G7FA 1L6FA 3VYLA 5FEZA 3OQEA 3CWOX 5FI8A 2D0GA 5JQ9A 3MP5A 2JIEA 3B8IA 2PU0A 3LU2A 5D32A 4ZXOA 3DOPA 1DKWA 3CL6A 1O7AA 1KM5A 2IUZA 3ZSSA 1GJPA 2R8WA 3OVQA 5A95A 3KTCA 3HGRA 3PWGA 3UW6A 2H8ZA 2DU2A 2NQ5A 5LIXX 4QDMA 4JN8A 2V5BA 3L23A 3M0MA 4PUDA 1AG1O 1UH4A 1GOWA 4BZYA 3WMBA 4F4RA 3OGRA 2INEA 3LQGA 2POTA 3PUEA 1GVSA 4ORMA 5K2ZA 4CCEA 3MQTA 1LL4A 3TTYA 2OU4A 4QROA 2YX0A 5F4SA 4QCEA 2QLYA 2PWEA 2QDGA 3KL5A 4Q8WA 2B7NA 3NG3A 3GNPA 3N9SA 4FALA 4RJEA 5K4XA 3HPXA 3RG6A 4LANA 5A69A 1QPKA 3AWNA 4F9JA 1XUZA 3PPGA 1K4GA 1BGAA 5KZMA 4ERGA 3VIOA 1Z69A 3OVRA 4O50A 5TNVA 3HGOA 1A5UA 3CQKA 4R85A 4OBRA 3ABOA 5IHRA 3W1RA 3KS5A 2GDUA 3TZNA 3BQ5A 2PTXA 1DJIA 4S3KA 5HUOA 1GOKA 5FL0A 4YU1A 3R11A 4FPSA 2OKOA 1TUXA 5AVNA 3E9AA 1A5AA 1TPH1 1FWDC 1FHVA 1J0ZA 4QJ1A 3KWSA 3EWZA 5I3GA 1T8XA 2ZOXA 4ENLA 1UP2A 3DDMA 3S1WA 3THQA 2DP3A 2VJXA 3ITLA 1S2WA 2VEGA 3SO7A 2IPFA 3WBAA 3O16A 4GUIA 3KHJA 2GVYA 3N34A 1EIXA 3V75A 2QJNA 3VCCA 3AMLA 2FZ8A 3B03A 3W1XA 3AZRA 3PWAA 1ICQA 2GJXB 4G1KA 1FWIC 2X7VA 4JY9A 4P8WA 1QO5A 4FF5A 5MKGA 3D3AA 4HHLA 4IQDA 3N3MA 1J79A 3WNNA 1H41A 4KFOA 3ID7A 1X1ZA 1AH4A 3P80A 2VDHA 2CU0A 5E5CA 2G3JA 4B4FA 4PCPA 2QV5A 5K9CA 4A3QA 4JTFA 3S6OA 4O52A 2FB2A 2WVVA 5DCEA 4UMCA 2ACQA 3O06A 2J88A 3CZGA 5I2UA 4JCMA 4X0VA 2PD5A 1VS1A 2CHRA 2WMHA 1BXBA 4F0MA 3WBWA 1XDMA 4W88A 4XBSA 1K1DA 2OR2A 4XZHA 2Q71A 2VX7A 3SQMA 2GJRA 5AB3A 2CWXA 4GJIA 2DSVA 3EX3A 1ZBKA 2X1TA 4V27A 3VILA 3KDOA 1SW0A 2DZWA 1FWGC 4KEZA 1QVBA 2J7GA 5MKGB 2CZEA 4GXWA 3WLLA 3B04A 1IXOA 1PWLA 4EOUA 2Q8LA 3NVTA 4JTIA 2D3LA 2V82A 3OOQA 4WEVX 1PZ2A 1L6WA 4JTJA 1LBMA 4D1IA 3ARRA 2OB3A 3GFZA 4GUJA 2VFHA 1EDQA 5G2HA 2WVVB 1W5MA 5IXEA 1UKTA 5CSUA 2ZTJA 2IXUA 3OZMA 5GNXA 1H7RA 3REQA 2R1NA 1JJKA 4GRSA 2PDBA 3QV8A 5KTLA 2BHZA 3HOJA 1GW1A 4O11A 4AYGA 2X09A 3TYAA 1PS9A 3LI0A 4DYJA 3ZVIA 3VGEA 2ZADA 4KMQA 1WX0A 2W91A 3K4AA 1MRQA 3Q94A 1FXPA 2DIJA 2VEPA 3TWAA 2NQLA 3RX2A 3CT2A 4DWSA 5AC5A 1E6SM 4MWAA 1A5BA 3WQCA 1WXZA 3K2GA 3AMKA 3SCSA 1XYLA 3NUKA 4L1WA 2D0HA 2FYMA 2OLSA 2OQLA 1XM3A 1RJRA 3A22A 2NT0A 2CXEA 1EFZA 1RVGA 4IPJA 4YVVA 4NL1A 4Q7BA 2X1RA 2R1KA 3GD6A 3V0TA 3BPWA 1WZMA 2BWGA 4BS0A 3O6AA 2J6VA 2OEMA 5A6KA 3REQB 5CC6A 5HJLA 3FV9A 4AZ7A 1UUOA 3CMGA 1GYNA 3WYZA 1F6PA 1RZMA 1CXEA 1IXQA 5I24A 1DJZA 1FWTA 4PEKA 1LG2A 1SZRA 4FR1A 4ZVJA 3QR1A 1OK4A 2UWFA 1QPQA 1UZHA 4JTEA 5ECUA 2QYGA 3T7VA 4ICNA 3VCNA 3HPFA 3PUOA 3GC4A 5LXEA 4MKSA 3ABRA 2A5HA 1UG6A 3GWQA 1QW8A 4H6EA 1Z44A 4ZQNA 4QP0A 4ORIA 4KS0A 4QXIA 3S1VA 2D23A 3UY8A 3R58A 1GVRA 1JPHA 4F0SA 2E67A 4UNKA 4DBDA 4DELA 1UJQA 2RAGA 1AJ2A 3VNJA 5FF7A 2WCSA 1ZENA 1VD6A 1WKFA 4O1FA 5IRPA 2NUYA 2I7GA 3VPLA 1NTHA 1D3GA 2J47A 2P88A 5EMMA 1MUCA 4BKNA 2P10A 1UA3A 3I7QA 3VKKA 1JYWA 3UY7A 4DWSD 4CNSA 3ES8A 3O07A 4MWAD 4HA3A 5FESA 2GWGA 4KWWA 4WSKA 1H61A 3DYOA 4M0XA 4UZUA 3KZSA 1DJXA 2QCLA 4IGNA 4DWSC 3GXTA 1QTWA 4MWAC 1QNQA 4XAZA 3FW6A 4Q8MA 3R12A 2PGWA 1GOXA 2Y8UA 3P62A 4AHPA 2JQXA 2BXYA 3W25A 4KQNA 1H09A 2GGIA 1W3TA 2VELA 4R34A 3G1SA 7ODCA 2NW0A 3KBJA 3LGGA 4LEQA 4AY1A 1KM0A 2G96A 2FZNA 3T6CA 4DEFA 1TWDA 3EPMA 3OYXA 4YWIA 3BAXA 2C19A 3NWRA 1AD4A 1TELA 1XLEA 1TPUA 4DF1A 1CB7B 2POZA 3RN6A 4TX9A 2B31A 4MAZA 3U5YA 1W9UA 1W0MA 4JAWA 3QPZA 1R30A 4OIFA 1SW3A 2EBNA 2GZXA 3DC0A 1PPIA 4HOXA 4L6OA 1T0OA 3F2CA 2OVLA 1J0YA 1H1ZA 4DHGA 2BY1A 4J3ZA 1HJVA 3ZT7A 3MO4A 1P0DA 2ZX9A 4W7UA 3N6JA 4RXGA 5D38A 1VC4A 1V6UA 5HQMA 2WPGA 1QR7A 2FZBA 2FHCA 4U2YA 3QM3A 1KCXA 4MNKA 2PWUA 3W1NA 4TQTA 1TZZA 3W85A 1LWIA 5BXRA 3LG3A 1H2JA 3MKKA 3G18A 2Y5EA 3TN4A 2VTFA 4W5UA 1B30A 1VJSA 3M0IA 3L5MA 4R7JA 4FAMA 1B1YA 2GJPA 3WELA 2Z1SA 1QFEA 1W17A 4NILA 4JS3A 3RX3A 5SWUA 2ICSA 4HK5A 3AAMA 1VENA 3LXBA 3NAVA 2OZ3A 4UCFA 1UJPA 3GXFA 2W6RA 4K8HA 1JPKA 3VNZA 4AWUA 2C15A 3TMQA 1WCGA 5CPLA 4Q32A 1MO0A 1HN1A 4Q4MA 3W23A 3FA4A 4AB4A 3NQ2A 2E5BA 5LHFA 2C14A 2Q8XA 1UHVA 3GRIA 3W88A 3I3DA 4PMYA 4HU3A 3W2JA 1E6RA 4K36A 4BFAA 5A94A 1PB0A 4JFUA 1ZCOA 1YNPA 2W61A 4CQ9A 3IWPA 2Y85A 4EIVA 1DIEA 2YDRA 3PBWA 1RQBA 2C79A 4YTUA 1WUFA 3U8GA 3TEVA 2PP1A 3AXXA 1K8XA 5M5DA 4DLFA 4A3UA 2I5IA 2SFPA 2BS9A 3WN6A 2INFA 4O18A 3IJ6A 4UQAA 1EJTC 2J24A 1UWIA 1I4NA 3RRAA 1JVNA 1AA1B 1OEPA 2H3DA 4CUCA 4PB5A 3RK8A 5AHMA 4L9YA 3A24A 2D20A 3LPFA 3N14A 3L2MA 4LYKA 4U31A 4Z1AA 4LUYA 3S2CA 4AD0A 5E0KA 5E6ZA 1NWUA 5I3FA 2PDYA 1MFVA 2DEPA 2Q6ZA 4QLJA 4C6KA 2OEKA 1J6PA 4GC3A 1YYAA 5BROA 2QCNA 3O7UA 5FL1A 1VYSX 3K1GA 1ZY9A 4ZOBA 3LPGA 1SMDA 3N9RA 1IF2A 4ZO7A 2OTDA 5H91A 4GVFA 2BY0A 1HW6A 3CEUA 3W73A 4KKXA 1V5XA 4L64A 1QHZA 3S0CA 1UKOA 5CZTA 3U7BA 1TV3A 3HURA 4IIGA 3EYPA 4D6HA 3ES7A 1X1OA 2XN1A 4UFIA 3AI0A 2NQ9A 2VFEA 3MP3A 1LQ0A 1T7LA 3LM7A 3G0UA 2HVNA 1S5NA 4A21A 3H12A 5EGRA 2D2OA 3S5NA 1ITQA 4IGSA 3VNIA 4UFJA 4ZZ9A 3VZXA 3ZJ6A 1OSEA 1EGZA 4XZWA 3GLCA 5AYIA 4JIEA 4PB4A 3WLNA 1RA0A 2JGYA 2GOUA 2ZX7A 4OE7A 2BTMA 2PBGA 1HQTA 3ABQA 4I7WA 4AEOA 5G1MA 3UR8A 2OWCA 3EOEA 3MANA 2GSJA 4PMJA 3FKRA 1FHDA 1IXNA 4QQUA 3POHA 4H9UA 3VGDA 4Y96A 5BWAA 2HS8A 4ZQOA 2VL4A 3CUZA 2DORA 2X7WA 3IV8A 3ERPA 3GXIA 4GYJA 1Q6CA 1OC6A 2UY2A 4AHQA 3URQA 2Y2WA 4QE4A 3LV6A 3NGFA 3GZ3A 1UP3A 2WANA 1E43A 1OBAA 1HJQA 3R94A 3P8JA 3W7DA 2FJUB 5DCDA 2O7SA 1TUFA 4AD1A 4CEUC 3QC3A 3TKFA 5BXPA 3ITGA 3NOEA 1KKOA 4ZB5A 1TJ0A 3TYBA 3C56A 3MO7A 4NI3A 5LA2A 3W1QA 3POCA 1JPMA 1JGIA 3HA1A 1KFBA 4ZXLA 3U4AA 4P7LA 1QCWA 3LOTA 1JF6A 2ALRA 4H04A 3NL2A 2O4MA 2IQTA 1DTUA 3MHFA 5FF2A 3VNDA 2ZRVA 1AQ0A 4MG4A 3ARQA 1BYCA 1QNOA 1PBGA 3HV8A 3UXIA 1XLJA 3V4BA 3V5OA 3RNDA 3AMCA 2VR2A 3E2SA 3STFA 5PTDA 1NH6A 4GVGA 1QWKA 4EP8C 4TV6A 1KFEA 1XH1A 5GNZA 5CPNA 1XIJA 2OSXA 1JDCA 4K7YA 3UZJA 2P3ZA 4P2VA 2W9MA 4UFLA 4ECLA 4Q22A 4NNCA 3RM4A 4L4LA 4XZNX 2WMFA 3N19B 4P61A 3JVAA 4IPLA 4RNHA 3NQ6A 1F4HA 4PTDA 1AW1A 2Y5JA 5D33A 3VDCA 1FDZA 3C5QA 3W00A 1ZTVA 2XIIA 2ATSA 5D2VA 1CB2A 1CXKA 1HKJA 2PTWA 5M3WA 1IQ8A 5D9OA 1W5QA 1CI1A 3TX9A 3PZQA 1C7TA 2BY2A 3TH6A 3PC0A 4B5UA 4F3HA 4M6VA 3EXSA 1R46A 3LHUA 4W5ZA 4PC8A 1H7WA 4E38A 2RKXA 4IQEA 2YBTA 3KUMA 2DVTA 5LA0A 2QDEA 1P5BA 1A5KC 4L7ZA 1WA3A 1OC5A 3QJAA 2ZIDA 3GIQA 4ROPA 3AXHA 4MLJA 1IIGA 1LOQA 2GUYA 2J7CA 4AXKA 5AHIA 5HJXA 1XCFA 2QZRA 3PBMA 4TVDA 4GO8A 5LIUX 3NR0A 2G3NA 2Z6JA 4YIWA 2XPKA 1EA9C 1SW7A 5F2LA 2AMGA 1BRLA 3G24A 1AW5A 3GH7A 4UR7A 4Y6GA 3W82A 2E6YA 4Z1DA 1W9BM 3DG6A 1B0IA 2CEQA 2WWCA 3QPEA 7TIMA 4E5TA 1C8YA 3H8AA 2IPWA 3MUCA 1UKQA 1C8VA 3IK4A 5IDZA 4PUMA 1W1IE 4IP5A 2DIKA 1KR1A 2P0OA 3I7SA 2O4QA 1JZ8A 4D9PA 3VIFA 5I5RA 3OZPA 3DEQA 4L65A 3QZAA 3QEZA 3G0XA 2Z1BA 5U4NA 2A3CA 2A4AA 1J6OA 5I6SA 2C8NA 4OV9A 2I9EA 2FVMA 2CZFA 2C3ZA 4GNKB 3H7UA 3A5FA 4A8LA 1E71M 4OBTA 2V3GA 2HXUA 1ECEA 3NEHA 1E1EA 3MZ2A 4F2TA 1QO2A 3P8IA 3AICA 4C60A 1KFLA 1ZLPA 3E2RA 1BTMA 3VFCA 2FTWA 1VFOA 4Z1CA 3LY0A 1BRLB 3L2IA 5EKYA 4KGLA 4G8TA 3MCOA 3BOFA 1GKPA 3GXDA 3KFTA 4O14A 2XIQA 4JEQA 5I23A 4GYPA 4HMCA 3MY9A 4Q8TA 4GH3A 2QIIA 1IYXA 4MFDA 1UR4A 1KTNA 3MVIA 1O1ZA 1R47A 1TWZA 5AHLA 1J0IA 4YLWA 5BYWA 1XS2A 3DFYA 2XFYA 2XVNA 3WKZA 4HPGA 1RUSA 2ZE3A 5GNYA 3W7LA 1U1UA 2QAPA 1VQTA 3W7IA 3B4UA 3QHNA 4QIUA 3TAKA 4S2BA 2DV0A 3CWNA 4EE9A 2HNEA 3P84A 4Y9MA 4Z1BA 2VWSA 1NQ6A 1P6CA 4MJMA 7TAAA 2BOEX 1PDYA 2PDNA 4DF2A 4BF7A 1OYCA 1RK6A 4O0KA 5CGTA 5F4WA 2Z2UA 3HPAA 4FP1A 3N4AA 1JI2A 2YA2A 1EEPA 5GJMA 4CKQA 3BL3A 3T1GA 2ZBTA 3LPOA 2BP1A 1KB3A 4RW3A 3HM7A 2VCBA 3C2FA 2XIBA 3BWWA 4IIFA 1OGGA 1E3XA 1E6XM 3NO5A 5DX7A 3WLHA 1OHLA 3SN0A 4DXVA 2PODA 3OVGA 2XGIA 3TV8A 4UWMA 4PUUA 2GLKA 1TIMA 2CLKA 3DG7A 3HG3A 3PBUA 4QG8A 3Q2DA 4Z0JA 4PCFA 4NKCA 3HB9A 4Z2JA 3RAOA 4RNIA 2GVJA 4JIPA 4E8GA 3TXVA 3M64A 3HG4A 3V5CA 2HK0A 1TQXA 5AHFA 3W24A 4UC5A 2A1YA 2QPSA 1GGOA 4LAZA 3ARPA 1HJXA 4I3GA 4PEEA 1ZQ5A 3T44A 3B8WA 1UKSA 3ZT6A 3VFLA 1M68A 1JDAA 1ODUA 1TPDA 2E8YA 1GCYA 1WKEA 4FXSA 4ZQMA 2O7QA 1A5SA 2MUCA 4IX0A 5H2ZA 4GYPC 2ISWA 2Y1HA 4Q8NA 5EMYA 1J0HA 1F3XA 1F9CA 2DQXA 1L6YA 1MNZA 2VFDA 2PC8A 3BLIA 3C3NA 3T2QA 1NU5A 1UZ4A 1Q13A 3PZIA 1F2JA 4PRTA 2OFJA 4UTJA 3VTRA 4GHRA 1R6WA 2EF9A 3GR7A 4WK9A 1EBGA 4F2UA 1XLAA 5KSWA 2EJAA 3WK1A 1KV5A 1UC4A 1MI3A 2VQTA 3P60A 4WF7A 4HHHA 2QMJA 2PGEA 2OQYA 3QQ1A 2WM1A 4H9XA 3ARZA 3CYVA 3FJ6A 3M16A 2GJLA 3NQ8A 3EA3A 1G5AA 1O12A 1LZOA 3COTA 1YXDA 1XGDA 4WCJA 3HGJA 1VF8A 4XB3A 2V68A 4FXRA 4MJZA 3KEHA 1BXCA 3W37A 3F4NA 4UQ9A 1DIKA 3HQOA 3ITVA 4LB3A 1XIFA 1WOAA 3MB9A 5AKQA 3PN8A 4I90A 7XIMA 2Q09A 4ERIA 4JN7A 1TE1A 3ZMRA 1RQHA 4REQA 3L9CA 3G1YA 1XSJA 1AL7A 3RILA 2QUUA 1QBBA 4D8LA 3SURA 1QMLA 4Q33A 2CW6A 1KM2A 5FOOA 3R0UA 2IPGA 1US2A 3BTNA 4N6EA 3QKZA 3DH7A 3CL8A 5FA5A 3M0VA 4JOMA 3BCDA 1JZ7A 3WEMA 1XG4A 2J8FA 3MC5A 2R1MA 2DUXA 3PG9A 1PHWA 5HMDA 1UBSA 3KCJA 4HTYA 1E0TA 3Q67A 1GTEA 3SBFA 3V18A 3C61A 2WHLA 2X1IA 3UNTA 3R25A 3QHMA 1EP3A 1XW8A 5I79A 1EZWA 3ARWA 2CESA 4F0KA 1HKIA 4C6OA 3PZUA 2FJKA 4LSBA 4R5EA 4IQJA 3FAWA 1KM6A 4UCGA 3NQAA 3K8MA 4B15A 4REQB 4C1KA 2ZC8A 1YNYA 4HU8A 1VFLA 5EMUA 4ZE4A 4PZVA 4KBXA 3GS6A 2I17A 3LCFA 1FWBC 2XM1A 3B05A 3M6YA 4LUTA 3SIMA 3A4AA 3EDKA 5T9CE 2ZUNA 3EOLA 4RW5A 3TUUA 2J78A 4H9MA 2DZTA 1SO5A 3GU9A 4ATLA 1JRCA 4NNBA 4DF0A 1AODA 3FDKA 4J2MA 1JQXA 1TX2A 3EXTA 3STPA 2Z26A 1UKPA 3QGVA 6TAAA 1SU5A 1JDFA 5J5DA 3UF9A 1TJPA 1NM9A 1E6ZA 1QHOA 3B0UX 4QGCA 3RHGA 4S3EA 3H21A 2AL1A 4OT7A 4PULA 3WD4A 3FLUA 1XQLA 4O0QA 3R1ZA 3AC0A 4GG9A 3IJQA 4S3DA 1MSSA 5HQEA 4L4MA 4MAVA 5CPMA 3AIQA 1F07A 4JR5A 4H00A 3DUGA 3T0AA 3PAOA 1XJBA 1OF6A 1UZ1A 2ALDA 1Y65A 2NV1A 4LVFA 3L12A 4WJ8A 5C55A 3PZMA 2DPEA 4JQ1A 5TIMA 3IV3A 4JHMA 3TQ0A 4RZBA 4GA8A 4M82A 4TTUA 3QV7A 3FS2A 3F4VA 1UPPA 3TTSA 3FY1A 4NY2A 4PYSA 3WJWA 3FAXA 4QE5A 2P8BA 1FCQA 1WAWA 1MQQA 2CXGA 3ZOAA 2J4GA 2OT0A 3B0VC 2WO5A 1A5LC 1R8LA 3A4XA 3MZNA 5G4WA 4O1AA 2PF0A 1XLBA 1FWSA 3G6MA 5AECA 2QCMA 2F2KA 1Q6GA 3FEQA 1VFMA 3K5XA 1VFHA 4MUPA 3R8GA 4K37A 2JE8A 1OIMA 4UFKA 2ZDRA 2PD9A 4EXQA 1TRIA 1XBXA 4AD3A 3AS1A 2A2IA 3PZOA 1R7OA 2WM0A 1KBIA 3UWEA 5HJYA 2D2JA 3NIYA 3CQHA 3HU7A 3KOZA 2VHLA 1IIHA 4E3TA 3P81A 2GGEA 3U57A 3QVQA 1A5CA 3FIGA 4JYEA 4FX7A 5HA7A 3OP2A 2PSNA 1S2UA 2P53A 1XH2A 4KCVA 1H51A 1RR2A 4X9YA 3DFTA 3CL7A 4MNLA 4QSHA 4NZCA 1I1XA 5A1AA 2OLAA 2JBMA 4Q8QA 1MRAA 1VB9A 5I00A 2G8ZA 4D8AA 1DJWA 2OO6A 4U5KA 1BYBA 1KBJA 3THUA 1KBLA 1NARA 2ZC1A 3N12A 1JI1A 4DNHA 2V5DA 5EYWA 1V51A 2A7PA 4F8XA 1GW9A 1R9XA 2GVEA 2XYLA 1KFCA 3S2NA 2GVLA 5HNTA 2G4JA 4JTGA 5C9WA 1LLOA 4HN4A 3RMJA 4TO8A 1Z3NA 2RJHA 4KH2A 3ITTA 4MDPA 4XSLA 5CXPA 5HMSA 3GVGA 2H3BA 4QLKA 1UB3A 3MJMA 8TIMA 4FX8A 3FYPA 3GZAA 1GYLA 3T42A 2ZXQA 3WJXA 3T0TA 2XN2A 4NP7A 3W1MA 4H4IA 5A6AA 3PM6A 4HPXA 4QNWA 4D6EA 1EJXC 5DRCA 3VOFA 2EQDA 3HPZA 4FK9A 1KFJA 3QR0A 4DAFA 1FWNA 3DU0A 3GO2A 2OGYA 2Q02A 3ABSA 2WLZA 4N2YA 4PMUA 1W3NA 1HL2A 4DRSA 3TSBA 4YMZA 3CH9A 4MNJA 2G3MA 3VUSA 2X05A 3LA4A 4BR1A 3QV6A 3EX4A 3DHDA 3SUSA 1UCWA 2ZVIA 3RLUA 3F4CA 3VA8A 4WQ6A 3IAQA 1J2WA 4A22A 3LTPA 1LLWA 4PUJA 2O9TA 5L9FA 3MWAA 3F5KA 2HVOA 4MHBA 2HPIA 3KP0A 2XFFA 3AHXA 3C0LA 1MWOA 3DFPA 5D2YA 1E9LA 1FH9A 4JQ2A 3HF3A 4KFNA 2W27A 3VAVA 1B90A 1OK6A 3BSHA 1OG6A 3MYPA 3N2BA 3PB2A 2RFGA 4QQ3A 4BCEA 2QMKA 2VP8A 1EPVA 3T05A 4ASTA 3GKAA 4HHPA 4A2SA 5K9DA 5JUVA 3Q45A 4GD0A 3BQ6A 1H0GA 1YTKA 4IG2A 2KX9A 3S5OA 1ICSA 2Z1WA 1HGWA 3ITOA 1X96A 4CN4A 1GG1A 1W3KA 3BMVA 3SGGA 1L6SA 3EWDA 3FX4A 4IQLA 1O95A 1UH3A 2PWGA 1XCXA 1TWIA 4V1XA 1YPXA 3BLLA 4C7DA 1M9HA 1DWFM 1W9PA 2YSWA 4Q3MA 1W56A 4GUFA 3WIJA 1XSKA 2PCEA 1FCUA 4IJBA 3VXGA 4EF8A 2QQ6A 4XQ6A 4JYDA 4H2CA 1RHCA 1R9YA 3SCNA 3BG3A 2GQAA 1YX1A 2BSLA 1QUMA 2PLKA 4RDWA 3ZVHA 3AO0A 4UTIA 1TMQA 2FGLA 4AAJA 3CT7A 4DJFA 4RKAA 4K38A 3G77A 3CPRA 4BEQA 3EGJA 1V6WA 4GY7A 1MW2A 3S5YA 4NIRA 3ZIZA 3D3FA 4LCQA 2QCHA 3A4WA 1UH2A 5A2BA 1GPFA 3GTNA 4IG2B 4X0NA 4IZGA 3NZPA 1SZGA 4US6A 3AS3A 2ZFAA 1Q7ZA 1SR0A 3AHYA 4UQCA 2E1WA 4GH1A 4EANA 2O92A 4WOZA 4NZ4A 3VINA 3W2MA 4W8BA 3UG5A 4UNLA 1XQKA 4ROQA 4LTSA 1U30A 2PE4A 3GE7A 3GYEA 1B3OA 1C9DA 3NNTA 4N9EA 2YFOA 1DBTA 2ZZ2A 4IH3A 1EKOA 4UB9A 5HATA 1V4YA 1Y8BA 3LS9A 4UUIA 3PUDA 3CUIA 3O63A 5LA1A 5FJTA 2REQA 3S6DA 4H3DA 5I77A 2X41A 4XUGA 4DO4A 1GZGA 3QW4B 4IL2A 5C54A 1PX4A 4WKFA 2BGNE 2ISSA 4R53A 3LERA 3C0SA 1EC8A 2E09A 1UMLA 3AIBA 4JX5A 1E4LA 1ESWA 4O8RA 2VC7A 1EOKA 2GJNA 3A3WA 2JF7A 4QDPA 1BKSA 2Y62A 4JTQA 2ZX8A 3KWXA 2R24A 3WLKX 3FXYA 4W9TA 4GIAA 4IL0A 1GZJA 4IMGA 3TTQA 3H54A 1O60A 3WQPA 4FR6A 1HL8A 2OZ0A 3A3XA 4HK6A 4QX4A 5KZEA 1FKWA 1H1YA 4IGHA 5D2WA 3CAQA 4DI9A 4ALDA 3WDIA 1ITCA 2WJZA 3DX5A 1BWVA 1FX6A 4DJFD 5BOOA 2ISFA 2HBVA 3M5YA 5DBUA 3WF1A 3WZ0E 3XISA 1YW1A 2REQB 2V5CA 1JZ2A 3S8HA 3OHMB 3T0CA 4HMEA 2YCEA 4IGMA 2P0IA 1Q63A 3H7VA 3UERA 3QYQA 2GDQA 3SADA 4MZYA 1KCLA 1ONXA 4DJDA 1XICA 5B80A 1JFHA 4S1FA 3W38A 4DY1A 1JR1A 1U83A 2P5NA 2WOQA 2UY3A 4MKNA 1THFD 2B7OA 5JVLA 3I65A 3H4WA 3TN6A 5J5RA 5A6MA 4KF1A 5FJRA 3WD0A 3L4UA 2FFCA 1A5NC 3EWCA 4JXCA 3CV7A 1A3WA 1XGZA 3PNZA 3QZ6A 1XF0A 2YXOA 2J9YA 1XIBA 2DFAA 3QMTA 1BF6A 4AIUA 2VRKA 3WJZA 3OLGA 1LORA 4GZ7A 3UWYA 3CPUA 2HSAA 1CGTA 4KRUA 3GB6A 5DXXA 3B9EA 4FIQA 2IKGA 4AVNA 4N9BA 2ZUTA 1QOXA 1E6NA 5FJUA 2VVSA 3I68A 4RCXA 3UR7A 2XIJA 2DUZA 3BO9A 1RVKA 3FEMA 4O28A 4KERA 2HMCA 3ISIX 4LBSA 3SZ8A 2QJGA 3VABA 1VH7A 1OVDA 3RPDA 1RD5A 3TYCA 2CBJA 1V02E 1EEXA 3CWHA 3CZJA 3LZ3A 3P67A 4O1EA 3T78A 1JNEA 3GTHA 1OF8A 1TO3A 3IRDA 1FFRA 1OFRA 3T8LA 2CLLA 2G97A 3MP4A 5F1VA 1OYAA 3DHUA 3MS8A 1JCNA 3B9OA 4AMCA 1LROA 1K9DA 1TPC1 1UWQA 1SQ7A 3KHDA 4H7CA 2FTPA 2JKAA 4XD6A 3IANA 3OW1A 3T09A 4UTFA 4DJDD 4XZ9A 1HT6A 3N3TA 1HFBA 3IIXA 3AUOA 1MYRA 4ZODA 4C6LA 2CPUA 2HZGA 1Q6QA 2E4TA 3E5PA 3WQEA 2TSYA 3T55A 4DJDC 5CEWA 4E4FA 4HNCA 3GHSA 1PKNA 3AU6A 5BW6A 1VYPX 1J9YA 4I5XA 1LM1A 1ZBWA 3MJYA 3KRBA 3SCPA 1QNSA 9RUBA 4M8UA 1ZB5A 1BEUA 3N18A 3T9PA 4INFA 5HWNA 2C7FA 1NFGA 5HMEA 3THDA 4KRTA 3IVUA 1JEZA 4DYKA 4E0CA 1QNRA 9XIMA 3PTKA 2VFGA 3USZA 2XGBA 5A3HA 3MSDA 1I2NA 2CLMA 4QNEA 1H63A 2XFWA 2PWVA 5CZSA 4RNJA 4PUKA 1UA7A 4LH8A 2A21A 4G6CA 1TJ2A 3CZ8A 2BVYA 3TC7A 3S9IA 3NXLA 3BMXA 2QJHA 3PPHA 1CCWB 3GNDA 4F40A 6XIAA 1SSDA 3TSDA 2RH9A 1F61A 3S9YA 3KAOA 4Z2KA 3SIZA 1RLDA 3ENLA 3BGGA 3QV9A 2Y7EA 3EWXA 4CD8A 3W83A 3QPYA 5EMJA 2HBXA 3YPIA 1AZ1A 4AH7A 2EG7A 1LF1A 5HXMA 2H90A 4IIBA 4TVCA 4CEXC 3JS3A 4FHAA 4NYUA 3VIGA 5JIWA 3LV5A 3VO0A 5GJNA 1J11A 4IP4A 1TSIA 2PDMA 1W32A 4QCFA 1A50A 4GNVA 3AFBA 4YVXA 1UD8A 2OZ8A 3JU2A 1A0EA 4BQ4A 4W85A 1UYQA 3ZYZA 4O16A 4XSMA 3KBSA 2AMXA 3ICJA 3TQPA 4XO6A 4NF7A 2OCZA 3MUZ1 1W3LA 5LSMA 3G1VA 3B8DA 1B3YA 4RE2A 1KXHA 3GH4A 3L65A 3O6YX 3N6QA 3WBXA 3K4WA 4NXKA 3UJRA 3AZSA 4V33A 4DBEA 3W0KA 5DT7A 5CC5A 5HPCA 4HD5A 3K4DA 2NWSA 2DY3A 1JCMP 3UXDA 4HNOA 4UTHA 1CENA 4OBSA 1XC6A 4A4AA 1JYVA 1JNDA 1PTAA 3ANUA 3SCWA 2Z2BA 4URIA 1AZ2A 4F2BA 1XRFA 3GH5A 3INPA 1QATA 4AWSA 3W01A 3L4XA 1PIFA 1F05A 3NPUA 4DM1A 3SRFA 3AIVA 4W4QA 4H8UA 5JU6A 1T6MA 4MMWA 3CV2A 3JRKA 1B9BA 2E68A 1F3EA 3IIVA 3EKZA 1YLVA 3C6CA 1NSJA 4N6FA 1YDNA 1YKWA 2DDXA 4XTDA 4WLCA 3V7PA 1L0PA 3GG7A 1B5TA 3SRDA 4LRTA 3OA5A 2A3LA 3DFHA 4IICA 3CBWA 4P7RA 3GDBA 1TV2A 3IJ9A 4Q7NA 4CU7A 4G7EA 1A3HA 4US5A 4UR9A 3BAJA 3WNPA 4DVOA 1BVWA 1AH0A 1G4TA 2QVHA 1L6GA 3F7JA 2E9LA 2UZ9A 2XISA 1K7EA 4LVAA 4MTVA 3IACA 5C70A 1TPWA 1KLYA 1NFPA 4UOZA 3W7JA 2J7FA 5DF0A 4OKDA 3UYCA 3K8LA 3MUIA 5CPSA 3AJ7A 4CD5A 1MQPA 3U2CA 3GU1A 1XISA 3OGSA 1Q3NA 3QY8A 4AG0A 5GVJA 3QBUA 4N02A 1OX5A 4KEVA 2R6OA 2ON3A 1ZCCA 1VYRA 3L5LA 1F4AA 4E4PA 3DBPA 1KTCA 2YCKX 4MPQA 1RD6A 5LNWA 1W8SA 3HV9A 4X9SA 4AIBA 1AL8A 3F03K 1J0KA 1ADDA 2Z7KA 5A5WA 4N7QA 4G7EB 4DB7A 4ZMGA 3OA3A 4H9VA 4C7FA 5CG7A 2H9AA 4B9ZA 4HYRA 2QCDB 1DQUA 3L21A 5G1TA 1Q6OA 4B3ZA 1YE6A 3SB0A 3BZGA 4TX6A 4MB3A 1JUBA 2ABBA 2WMKA 3D0CA 3VIPA 2AQVA 5EMLA 5KETA 4MJ2A 2G50A 4J5NA 1P6BA 1JUKA 1SVDA 5CSRA 3TTOA 2FB3A 4XUYA 3Q65A 5D03A 1W91A 1F5ZA 3WMCA 2R82A 3FJLA 2ANUA 1W1PA 1FVPA 3SCUA 3CJPA 8A3HA 3WH9A 1S2CA 3WL1A 3T0DA 4AU0A 7REQB 1Y7VA 1JRBA 4ZO9A 4GZJA 1CWYA 3P74A 4ZCWA 5EBUA 4QJ4B 3DESA 2I5QA 4OTKA 3MMDA 1GVEA 1ADSA 3KRUA 1E40A 1Q7QA 4Y8FA 4US5D 1E4IA 1WZAA 2VZOA 3CV6A 4AF0A 5H6HA 4WX2A 5G2IA 5M2FX 4IMDA 3A12A 1V6XA 5DEZA 1M04A 3C52A 1VLWA 1VR6A 4HIBA 1MXSA 1YXYA 4W84A 2V2DA 2H9AB 3ZO9A 2W79A 4FMVA 2V30A 4QG6A 4KEMA 1KD0A 4Q8VA 3ONCA 4PFMA 1KCKA 3O15A 1XUUA 4GQRA 4J35A 3DERA 3TFCA 4L1GA 2QCCA 2NLIA 1AW2A 4UFHA 4EKJA 4J40A 3NM1A 5HANA 4KRZA 3ITXA 1VRXA 3G1DA 3MBDA 3SAZA 3KVJA 1LOLA 3W1TA 2YB1A 2BDQA 1JXJA 4IJRA 4KCTA 4DBUA 4E6MA 4S3BA 2FPYA 2X0HA 3B0PA 5DMLA 2WAGA 3SEPA 3W27A 1H7XA 4U33A 3IJ8A 4ML9A 3PBVA 2VRJA 5DELA 3G22A 3AS2A 5D8ZA 3URAA 3OODA 3G1RA 3S9ZA 2DVUA 3A9BA 3WG6A 3U3HA 3HTWA 3FSUA 2PBOA 4FX6M 4ICMA 3KLKA 4F79A 3MV01 4JN6A 3RCYA 1DP0A 3RIKA 5TBOA 1A4MA 1DVJA 2E5CA 3R43A 3LCGA 2V63A 4DM2A 4GOAA 1KCZA 4S38A 5DY3A 1OCQA 4O0ZA 3I4KA 2J66A 4XIAA 1XX1A 2VRQA 2ZICA 3W7HA 3OPSA 3HJEA 4IPNB 3AIWA 4TR9A 4R88A 1V79A 1NOWA 3NZGA 1W9XA 1UOZA 4RNFA 3GW3A 5CG0A 3EPOA 3PULA 4AZCA 5I78A 1T40A 4G5DA 4PMRA 3WUFA 2HJPA 3P0XA 3LBOA 2QUNA 4JNYA 3W07A 1S3HA 1GJWA 3GFYA 3N2CA 2C71A 2Z27A 3S4TA 1TTPA 4PMZA 4HVXA 1LT7A 4XD5A 2E0PA 4KCUA 5L6UA 1QASA 1JUEA 3DYMA 4JQ3A 1PCKA 3N15A 3PTQA 2QKFA 2YBVA 2ZRYA 5REQB 4HPHA 3L0GA 2WZIA 1EX5A 1NP0A 4NXSA 5CLTA 3LCXA 1W37A 4XG1A 1ONRA 3SGUA 2X1SA 1JYNA 4J2PA 1GVQA 1ZBVA 5E93A 1GKQA 1W5PA 3FJ4A 4OV4A 4JTCA 4P7NA 2HEJA 2YZ5A 4HNNA 4H8VA 4HTBA 3NQDA 4ZOEA 2WW5A 3FDGA 3AYSA 3DGBA 5FSDC 3TCSA 4GX8A 3P2VA 1EDTA 2AQWA 1EIBA 2VMFA 3KL0A 2WZTA 3TA6A 2OYLA 3UESA 1YE4A 1IZKA 4ZTXA 4AISA 4MLRA 4DWDA 1K4HA 3GDLA 1KM1A 1ONWA 4LVBA 3H53A 2XGZA 1R3WA 3CUGA 1ITXA 4LVDA 2EPMX 1R5YA 4EF9A 1FP9A 1J96A 5LGXA 3ZT5A 5ABHA 3W1PA 3WF4A 4QJ5B 1GQLA 5J04A 3IAPA 1RV8A 4E2DA 3NSMA 5EPDA 1PX3A 1RJPA 3FYOA 3CS2A 2PZNA 3JZUA 1MW3A 3SQSA 5AZ1A 1UUMA 4IXHA 4NZFA 1HTIA 1Z8AA 2GK1B 3DHPA 3BZJA 3M44A 1XSIA 5G2WA 4A3RA 4GNJA 3NSXA 4Z0SA 2J77A 6XIMA 4AQLA 5HINA 3TC3A 2QCFA 4LJ3A 3EBVA 3WMSA 5M03A 3A3HA 4IF2A 4V15A 1QU4A 2C18A 3RUBL 1NJJA 4M29A 4HCLA 1D3HA 2GGHA 1PTGA 3W7NA 1S2VA 4A8IA 2A3EA 3A23A 9CGTA 4PRRA 2XU2A 3GVVA 3THAA 3OIHA 3DFQA 1TMHA 3GR4A 3I4EA 5JBFA 1DPMA 2G0WA 1NWTA 2YLAA 3GR8A 4WY0A 1NELA 2YFNA 2Z1VA 4CNOA 3ZJKA 4MYAA 3M0HA 3STGA 1E15A 1E0WA 1E1CA 1BTCA 5FEXA 2BHYA 4LPCA 3NZRA 1UPMB 1BPLB 1LUCA 4DXXA 2I1OA 4IJCA 4PGLA 4KESA 3ATZA 1K02A 4F48A 3LCIA 1PYFA 1IZCA 3GC2A 4ZE5A 3CAVA 3BURA 3C4UA 3LSBA 4AEFA 4Z2HA 3VD7A 1XLMA 4XVEA 2XWDA 2WQDA 4LCSA 1Z6KA 2DW7A 2V67A 1X6UA 1MW1A 4NUWA 3A5VA 4C6IA 6ENLA 4AC1X 3ITYA 4O1CA 1B54A 2E77A 4MZ1A 4WY0B 3IGXA 2O0TA 1ECQA 1EZ2A 1YDOA 1UP0A 1Z41A 1E1CB 3DFOA 3UG3A 4CQDA 4GQ0A 1ZRQA 1UUQA 2YXGA 4EXAA 1M7XA 1Z42A 1LUCB 2BOFX 2FH8A 1Q6EA 3SRHA 3TN3A 4HZ7A 1VZWA 1WE5A 2E25A 1CGVA 3WF3A 1S38A 4I8DA 3PBGA 1PKLA 4WJXA 2RJGA 3FYYA 3ALFA 1TB3A 5G4HC 4C1NA 2AGTA 4MVAA 3W7KA 3TW9A 1F3TA 4EVZA 3FA5A 2B4GA 1XDLA 4Y2WA 2OEJA 2R1LA 1HKMA 4B9YA 3PWIA 4GVIA 3CQ0A 4GIRA 4UQBA 3H2CA 4NJGA 1M1BA 2GJXA 4JTLA 1EH9A 2FVKA 4DNMA 2JKEA 2ZA3A 1PTDA 1GOIA 7A3HA 4NX0A 1ISVA 3OGVA 5A6JA 3MBFA 1R3VA 2E1DA 5BCAA 1UWSA 1M5WA 2CBVA 1Q65A 2ZYFA 5C9XA 1H7OA 4HNLA 2FVLA 4WKAA 4B3KA 2ISDA 4DYEA 3MSRA 4MGGA 4ZTYA 1UROA 3DFNA 2E5DA 2X2GA 1G4EA 1VIZA 2VKZG 4C1NB 1JAEA 4NSBA 2ZZ1A 3WQDA 1J8VA 3OLEA 3WLRA 1NOFA 4MDOA 5C0QA 1E70M 1PVNA 3SY1A 2RHGA 3MCNA 1EF2A 8RUCA 2VZVA 3O0FA 4DPPA 3CHVA 4PODA 2CLPA 3TP4A 1EJUC 2W3ZA 4AWTA 5DFAA 3GYCA 1VFTA 3WDJA 1HNYA 4E2VA 5CC3A 1VCFA 4N0RA 4GX9A 1G7VA 3P82A 4QG9A 5CSYA 2E7FA 4O4VA 2DT2A 2D73A 5AY7A 5E0FA 2NLYA 4MF4A 4YXGA 5C7VA 1DJYA 3TW7A 4MY9A 3BK0A 1XYMA 4IFRA 4HP5A 3WDQA 1XLHA 4JKLA 2ZUUA 4NRRA 4XZLX 4CLMA 5F4XA 3BUVA 1CXLA 4ZQCA 1CGXA 2XIOA 3LCWA 2GQ3A 1RCOB 3LCLA 1OZMA 1HP5A 2XH4A 1SJDA 5KITA 1EHAA 1JCYA 5LYRA 4O4WA 2E40A 2DZVA 3W70A 3N9KA 3E49A 5A6BD 4UNIA 3WL0A 4Q4OA 3TJIA 1W5OA 3PNUA 3EKGA 1DEDA 3TOYA 2OOGA 4O57A 3PB0A 3SDOA 1SFSA 3VDAA 2WVTA 5ABFB 2Z2AA 2EHHA 1NDWA 2ZRZA 1G69A 3RU6A 3R7MA 3SRKA 1HKKA 4AVOA 2WHMA 3UP8A 4XVDA 3L0KA 2VXNA 3QY6A 1VEOA 2YL5A 3NSNA 1RBLA 3W2KA 3H24A 3W7EA 3SY8A 4HNVA 4LW7A 4LFYA 4XWUA 2MANA 1GQNA 1QW9A 4HK7A 3EEZA 1E9YB 3WSUA 4AX6A 3M9YA 4PCNA 4ZOAA 3VZYA 2VFFA 4DO7A 1EBHA 4NJIA 1JDDA 3WJSA 2QJIA 2XVKA 3BV7A 4J28A 1XP3A 4H6QA 5EFFA 3KXQA 2PC4A 2QGHA 3VOGA 3MWCA 1OFEA 3LRLA 1EJRC 1ZFJA 4KIEA 1W6TA 2EEXA 1K9TA 4HN8A 3PS7A 2BV9A 3ZS4A 4GUHA 1HO4A 1V0KA 1IGWA 2Y7DA 4WSHA 5BMXA 2IW0A 2HE5A 3N25A 1VBUA 5IFTA 3S3GA 5TAOA 1KO0A 4HPJA 1PZ3A 1X6NA 2BVDA 2P8CA 1KKRA 3PFRA 4HJFA 1P1MA 1SGJA 3ZM8A 3JUGA 1EP1A 3EKLA 3WLOA 1WKYA 3LBMA 1YDYA 4YPJA 3AYTA 1NWSA 1EJ7L 3PZVA 3QKEA 3QH2A 2Y63A 4N42A 5I0DA 3TVAA 1WUEA 4KEUA 1W5NA 4FB7A 1TWSA 3M5ZA 1XYZA 4WDWA 5I3DA 4K8GA 3SCVA 3R0KA 1F74A 2TYSA 1C90A 5I7GA 2WNNA 1GOOA 3DGRA 1ELSA 4J3WA 4GWEA 4JZ5A 3DKJA 3ARVA 1Q8JA 3P5ZA 1NEYA 1EC9A 1UOKA 3QY7A 3WENA 1B4KA 4LRSA 4W8LA 5I02A 1TPVA 3VDBA 2DZBA 4AUBA 3TTEA 1UZDA 2YW3A 3CU2A 5AC6A 5A2AA 3UGVA 1DWIM 1UWTA 1EJWC 4J1OA 3L4VA 4LQ1A 4RZ6A 3UWUA 4DZAA 3F2BA 4OGZA 4O12A 2C13A 1MDLA 2QGYA 3KM8A 3MI3A 4NHVA 5HNUA 1H4PA 3THCA 4MYXA 3UZZA 1IXPA 2GUUA 3R89A 5H8MA 4LS1A 2Y5SA 3IGUA 4V28A 2JK2A 3GVRA 2GL5A 2V38A 1PIIA 3UR5A 3UNDA 1ZBCA 3G0SA 1XBZA 4YYCA 5EA9A 2VX5A 3TMLA 5EBAA 3FXGA 5K3VA 1Q85A 1V3JA 1YBQA 3TC6A 1LBLA 2UV8G 3WDRA 4XV0A 9XIAA 4GIEA 4R3UA 1QDSA 3U4FA 1ADOA 2OG9A 2LLEA 4F9DA 3GBEA 4JNMA 1H7NA 2VM8A 4ML4A 5JMUA 4HZMA 3B9DA 4LY8A 1F6KA 1V3LA 5DY2A 1GT8A 4PCSA 3QZEA 4ZQPA 2WCAA 1YEYA 3II1A 4PUNA 3GIYA 2WJDA 3M0ZA 4AZGA 2WC7A 1J01A 1EDGA 2DH2A 2FMNA 2FGZA 3L5AA 3RPMA 3G8EA 4G9PA 2FFIA 1M65A 1YBQB 2WZEA 1IHIA 4U3CA 3SSZA 3C8NA 1FDJA 3GY1A 4NAEA 2J25A 3WD1A 2EPHA 4O8AA 4W89A 2E28A 3TE9A 3WK3A 4NX5A 3APYA 1TTJA 3KBNA 4ADUA 1UWAA 2NX1A 3RU8X 3CB3A 1S1PA 2WSQA 1SJAA 1U1HA 3CTLA 1VJZA 1UASA 3EAUA 1KW1A 3RJXA 4RE3A 3UZWA 2BGQA 4B92A 1TX0A 4NZJA 2CBIA 2PDKA 1W1ZA 3HMCA 4GI4A 3UXLA 1ZAJA 1B3XA 1XBYA 1JAKA 5LNVA 2FLIA 4J7RA 2PB1A 2TODA 2FDSA 3NGJA 4HJWA 3ZZ1A 4EPKA 3V0SA 3EX2A 3WEZA 4O1DA 3A64A 3ITCA 3PJTA 2OT1A 1GOQA 3V36A 1SYTA 3TROA 3BDKA 2NT1A 1A0DA 4CQCA 2WHKA 2DSWA 4NAEB 2VCAA 4QEHA 4LV4A 1WP6A 4Q6XA 3BXWA 3ZLFA 4GQGA 4DJEA 1BVZA 4M5PA 4RDVA 4M6PA 1MW0A 2Y8VA 3S2JA 2CBUA 3GVQA 2GGGA 5M1TA 1BHGA 2X30A 4FLQA 1XRTA 5CPTA 2VEFA 2VWTA 3VIMA 3W28A 1CTNA 2CFFA 2HVMA 2YA0A 1N2VA 5C9ZA 3C2OA 4ZENA 1GG0A 2G41A 1V0NA 2XFRA 4D2JA 3NFUA 3GQYA 1P7TA 4IPPA 3UWQA 2WMIA 1VBRA 4FZIA 4PFHA 1Z89A 4C91A 1PKYA 1EF3A 1HX0A 2V3DA 4HU4A 3GG0A 4BI5A 3VU2A 3ZXWA 1MEIA 1D8CA 2QJMA 4YTRA 3CAWA 1BLIA 8XIMA 1N82A 3GVWA 2R14A 2YLLA 1Z9AA 3IJ7A 4DI8A 2WYSA 1N55A 4NJJA 2WCGA 3SY5A 4H9TA 3PP7A 3IS4A 4W8AA 3A21A 3F1QA 3LXCA 4B90A 1EWDA 2O9OA 4CD4A 4PUEA 2X0YA 1K7FA 3L68A 3LN3A 3SGZA 7CGTA 5AZ0A 3W7MA 3IUHA 2G3FA 3BLFA 3AALA 3VI2A 1MZRA 2PF8A 4R27A 1FFQA 1BAGA 4PTWA 1BG4A 3E6EA 4TU1A 1PSCA 3PBYA 3QQ0A 1P7TB 2WMIB 4LOCA 2I9UA 1IEVA 3GTFA 1AQFA 3BANA 6A3HA 3OZOA 2B7QA 1N8FA 1KRCC 4DJED 4R7OA 4NZ5A 5BZAA 4P8XA 2RGLA 3W26A 1XIIA 2OSYA 1O5XA 2F2HA 3R10A 3W6MA 3NDOA 6REQB 4OUEA 1FKXA 1TRDA 4J27A 4DJEC 4LEFA 3TQKA 1XD1A 1KGUA 3AYRA 1VGAA 3PSWA 1C9WA 4PE8A 1T8QA 1EQPA 4FF7A 3CH0A 4BEUA 2X0SA 4MB1A 4M7SA 2Q8ZA 3DCPA 1EHNA 2QUVA 4Q8OA 1O5KA 1OCNA 4NZ1A 1HVQA 2V5KA 3C2EA 1XD0A 3C2YA 3N17A 1H5VA 3CXOA 4H19A 4JTKA 3RM9A 2C6QA 1LCOA 3AIUA 1EB3A 1XFBA 3I6EA 3OJGA 2J7EA 1SJBA 3FHQA 1C29A 4R9OA 2YXXA 1XRVA 3UCQA 3LHYA 5FAJA 2W0UA 4MY8A 4LB4A 1TV8A 3M07A 2F6XA 3GG8A 2RDTA 2BASA 2XVLA 4NRSA 4C6EA 1SFTA 4B16A 1HL9A 3TNBA 2WBKA 1DJQA 1JIBA 2BNJA 2DZXA 4LUJA 1WNOA 1GVFA 1SZFA 2C0AA 2CC0A 4AW7A 1B3WA 4LUSA 4C65A 3SCRA 4FLSA 1E9ZB 3CHFA 4YWSA 3H2OA 3GDKA 3KCOA 3LEPA 4A8RA 1W3HA 3R5EA 3EXRA 1E9IA 3SI9A 4DQWA 4XD3A 1WO2A 2A7RA 2BODX 1ZJIA 1EYEA 1V6YA 5C9UA 1KRMA 2DSUA 1MXDA 2VR4A 1CLVA 3UQNA 2Y6ZA 4IPIA 4QAWA 3VNLA 3KBWA 4WRHA 1H49A 1XLDA 1GEHA 4PRWA 1MFUA 4WHBA 4WGXA 1KXTA 4GI6A 1Q6RA 1G6CA 3TN5A 2Q01A 1CPUA 1UR9A 1I1WA 2YCLA 4NAFB 1E56A 4FXFA 3H4XA 3GSMA 1A53A 4UOJA 5U7SA 4CVWA 1NDYA 2QULA 5CAHA 4KWUA 3GM8A 4LUSB 2TAAA 4XX6A 2OLHA 2W67A 2A79A 3OLDA 2NSXA 1FWAC 3KBVA 3WNOA 4EAYA 1QOPA 4BY3A 1JCJA 2PDLA 1BG9A 1WDPA 1XYBA 4AD5A 2VUNA 4IX2A 2V6AA 2ZRWA 1XPGA 3KVLA 4PMQA 1FXQA 2E9BA 1D3CA 2J7BA 1JPDX 3HBLA 1E5JA 3TJLA 3NQFA 3HZ3A 1Y5WA 4UOQA 3PHAA 1WXJA 1YDVA 4D71A 1Q4WA 5F2GA 3TNOA 2R94A 1IEXA 3ZR6A 1VCGA 3QN3A 4QAIA 5AFDA 5GPRA 4GK8A 1K9EA 2YCLB 3NCOA 2W62A 1RCXB 5CBJA 2JEPA 2WBGA 3BAKA 1OT1A 1H3GA 3CUFA 3WQWA 2OZTA 1LG1A 1SO3A 1MEHA 1CYGA 3RR1A 3SJNA 3LYEA 2PLMA 5A8GA 3ARSA 1U5JA 2VZUA 4DXKA 1KLZA 1TKKA 3S6TA 1JDEA 5C2GA 1FP8A 4K2SA 3WQ6A 4GZIA 3CK5A 1B31A 2V3EA 5A8MA 1PDZA 3VD4A 4LYRA 3V0UA 3NDYA 1H60A 3UR2A 4FEZA 5I3HA 3VDHA 5IBXA 4I7UA 5LNRA 5AVHA 4Z2LA 5I07A 3N73A 3GAYA 1FCVA 5T26A 3WQ8A 4A29A 2GUBA 2DJLA 2DSZA 1D2KA 2WKLA 5I3KA 2QF7A 1ENUA 3P3BA 3O3RA 2P3EA 3W02A 3CQIA 2VNCA 1NP2A 4QS5A 4C6DA 4TTGA 5DQPA 5C2XA 1IZJA 4LF2A 4MWAE 3U7VA 4H6KA 4QS6A 4Z2GA 1V3IA 2A85A 3PZGA 5CPOA 3OBAA 3WH7A 1RLCL 1XXXA 1UW9A 4LV9A 4LT9A 1LQ2A 1UR3M 1U33A 1AH3A 1WKDA 1DXIA 4JTSA 1A80A 1PXGA 3B8SA 3EZ4A 1QI0A 3GNXA 4RPQA 1VFFA 1AMYA 1DWAM 2BVTA 3ELFA 1CNVA 5CBIA 1UD6A 5FIPA 5BXTA 4O10A 1KQYA 4HYVA 4ZA0A 5HWJA 3IRSA 4JQ4A 5CZJA 4RLIA 1FWEC 3N2TA 5TF0A 3R79A 1GVOA 4PMOA 1V7YA 2WSPA 1XLFA 4WVXA