1AZ1A

Alrestatin bound to c298a/w219y mutant human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
314
structure length
314
Chain Sequence
b'SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az1A00
3CV7A 3R6IA 1EXBA 4XZMX 3CASA 1AZ1A 4G5DA 4FAMA 1Z9AA 4GABA 1HW6A 2ACSA 2HDJA 3DN5A 3N6QA 1PZ1A 3RX4A 3M0IA 3GHUA 4WDTA 1S1RA 3VXGA 1UR3M 1M9HA 4JIHA 3BUVA 2J8TA 2HVOA 3LNMA 5HNTA 3R7MA 4JTAA 3UGRA 4YVVA 4EXBA 2PDHA 3H4GA 1Z89A 1T41A 4DBWA 4JTRA 1AZ2A 4OTKA 3EB3A 2HEJA 4JTCA 4FALA 1AH4A 3U2CA 3UYIA 4GIEA 2QXWA 4H8NA 4NKCA 4WDXA 3G5EA 1Q13A 4XAPA 1ZSXA 3GHTA 4DZ5A 4JTQA 1SM9A 4IJRA 3MC5A 3N2TA 1ZGDA 2INZA 2CLPA 3EAUA 1OG6A 4JQ4A 3G1RA 5KETA 4WEVX 2R24A 3CAQA 4ICCX 1HQTA 1S2CA 1EL3A 1XF0A 2F2KA 4GQGA 1JEZA 4XO6A 2NVDA 4GA8A 2IKIA 1MZRA 3R58A 1X97A 4XZHA 3COTA 4JQ2A 3D3FA 3LZ5A 4H7CA 2FZ8A 1EF3A 2PDYA 4YS1A 2PZNA 4GCAA 3RX2A 1RALA 2BGSA 2PDUA 2PDKA 3CAVA 4XZIA 3UZXA 2FGBA 4LAZA 3CMFA 4PMJA 4WDUA 4XZNX 2HVNA 4GACA 4QXIA 2IQDA 5AZ1A 1FRBA 2R9RA 2PDMA 4IGSA 4HBKA 2PF8A 3WBWA 4I5XA 2NVCA 3LN3A 1S2AA 5JH1A 2PDBA 3B3DA 1Q5MA 1AH0A 3F7JA 3UFYA 4JQ3A 3BV7A 3M64A 3H7RA 4LB4A 4LBRA 5DANA 4AUBA 3V36A 3LZ3A 3UZWA 4L1XA 3V0UA 1LWIA 5LIKX 1AFSA 3QKZA 5JH2A 1PWLA 1ADSA 5LIXX 3M4HA 1S1PA 1Z8AA 2PD5A 3ONBA 2IQ0A 2PDQA 2DUZA 1RY8A 3NTYA 4XZLX 3LEPA 1R38A 2IKGA 4JIIX 1PWMA 2IKJA 4JQAA 3ONCA 3O0KA 2I17A 1EKOA 5HA7A 2ACUA 3GHSA 1YNPA 3WG6A 2PD9A 3WCZA 4LAUA 3Q67A 1LQAA 3GHRA 1VP5A 4ZFCA 4XK2A 2A79A 4EXAA 3R43A 4F40A 3EB4A 1QRQA 3O3RA 5C7HA 2PDXA 2PDLA 2PDPA 4XVDA 2I16A 1J96A 3ERPA 3KRBA 3WBXA 4JIRA 3LUTA 4DBSA 3LQLA 1AH3A 1VBJA 2ALRA 4FZIA 2FZBA 2VDGA 4MHBA 4Q3MA 4Q7BA 3WBYA 4YVPA 3MB9A 2PDWA 3S3GA 4QR6A 4JQ1A 2C91A 1YE6A 1X98A 3UG8A 3R94A 5HNUA 3UWEA 1QWKA 2IPWA 4PUUA 1Z3NA 4L1WA 2WZTA 2IPGA 4QX4A 3LBOA 3H7UA 4IJCA 5LIYX 1US0A 4YU1A 3R8GA 2PFHA 1PYFA 3FJNA 4WDWA 4PRTA 4GQ0A 2IS7A 4XVEA 2AGTA 2PDCA 1MRQA 4PR4A 1C9WA 4WGHA 3P2VA 2PDIA 3Q65A 5M2FX 1XGDA 3RX3A 1GVEA 1XJBA 3BURA 3CV6A 4RPQA 4JTDA 1PZ0A 2HV5A 1YNQA 1RY0A 3UZZA 3C3UA 2FZDA 2BP1A 1YE4A 2BGQA 1IEIA 4DBUA 2HE8A 5LIUX 2FZ9A 3GUGA 4HMNA 2FVLA 1MI3A 2IPFA 3BCJA 2ACRA 3LQGA 3R8HA 2WZMA 3FX4A 3LD5A 4WRHA 4ASTA 4YVXA 3LENA 2PDFA 4LBSA 4PRRA 4PUWA 5LIWX 2HE5A 1ZUAX 3V35A 2INEA 2IKHA 1ZQ5A 4R9OA 5AZ0A 3UZYA 4LB3A 4FA3A 4XO7A 2PDJA 2DUXA 2PEVA 3V0TA 3UP8A 1A80A 2ACQA 4QBXA 3DOPA 2PDGA 2P5NA 1T40A 2IPJA 3V0SA 1IHIA 2PDNA 1K8CA 2F38A 2DV0A 3T42A 1X96A 2ISFA
chains in the Genus database with same CATH superfamily
4AD4A 4B5WA 1XD1A 1ZU8A 2ODOA 3UG4A 4ZA0A 1XQLA 3AIRA 1TV4A 2BY3A 4BEUA 2ZA2A 4MWAA 3L2LA 2VC7A 4X2RA 2DSKA 5AC5A 1VFMA 1MQPA 3AHVA 1QU4A 2FTYA 4X60A 1TUFA 5D02A 4WDTA 4CEUC 1E6NA 5I5RA 4N4PA 3I7RA 5HNTA 4F9DA 1A5LC 2GJNA 4AVNA 1OINA 1US2A 2A7PA 3WY1A 1U1UA 3VCCA 1TPUA 4IGMA 3EX2A 1PSCA 4KETA 2CIPA 3TNBA 2QCLA 3B0PA 1LL4A 3SCSA 5BW6A 2ZZ3A 4DUXA 4CLMA 4MIMA 2J8FA 4IJBA 1FDJA 3PANA 1NU5A 2QCMA 1Q13A 3GHTA 4PBEA 1C8VA 4LRTA 3BO9A 4J40A 1O5KA 1AQMA 3WQVA 2QCGA 1HKJA 2Y2WA 3QBUA 4K68A 3LOTA 3LY0A 4BQ3A 4F3HA 2YCJA 5CPOA 5LHFA 1FWDC 3FSTA 5KTLA 4KRZA 3EX4A 2NXIA 2BVWA 2D22A 3WUEA 3PZTA 5D4YA 3PUEA 1J5TA 4LY8A 5CC3A 5C9RA 5LNRA 1XF0A 1WBHA 4OV4A 3F1QA 4QP0A 5DMNA 3QQ1A 1XRTA 4GJIA 2VGFA 3GS6A 1U33A 2QPUA 2Z2AA 1UQYA 3WDHA 1B5TA 1YBQB 4L6DA 3H4WA 3NZGA 1JZ6A 3LGEA 3IJLA 2FZ8A 2FLIA 4M29A 3HQNA 5A2BA 1XS2A 1MW3A 5FA5A 1MUCA 2YDSA 3B04A 4D1IA 5AZ1A 1OIFA 1EC9A 4UZUA 4C1NB 2PDMA 3A6OA 2PZ0A 1RBAA 1TR9A 2G37A 2BDQA 2D0FA 2Y88A 4L80A 4AZHA 2G3MA 3GTFA 5BROA 1NOWA 3TR2A 5HNNA 3B9OA 1LL7A 3F5JA 2X1SA 1NWTA 4IZGA 1OHLA 3PTDA 1DHPA 1IXOA 3BV7A 1JPHA 3NQBA 4MNMA 1Q6EA 3AC0A 4E3TA 4U3AA 5T26A 4MPKA 2DDXA 1UWIA 3DYPA 3L68A 5HWNA 3KBJA 3CUHA 2WMJA 3TAKA 3WK3A 4S3EA 3IJ6A 1Q45A 5HPOA 2R1MA 2B7QA 2GGIA 3SURA 4WSKA 1UUQA 2FTPA 4ERGA 2OKOA 4C7GA 1W1TA 3S0CA 1WNOA 4GK8A 3HPZA 4QISA 1IWPA 2R1LA 2EEXA 3VX1A 2CITA 5F1UA 1AD1A 1RVGA 1UWAA 2XM2A 1YNPA 3TSMA 2YFOA 3W1NA 1YIXA 3VI2A 3T0AA 1MNZA 4LAUA 3MSGA 3B8DA 4GI4A 2WZIA 3BSMA 1GK8A 3MO7A 4UOZA 4F40A 2VHLA 5H8PA 5K2ZA 3GNDA 5G1YA 4DUWA 4R34A 2WSPA 2NSXA 5C54A 4RJEA 1TWWA 1MZHA 4POCA 3IUHA 2QHAA 3G1HA 4Q22A 1HJVA 1RQHA 1QPRA 4XUGA 4DF2A 4B3LA 4H6EA 4WY0B 1EZ2A 3AJXA 1LBMA 1FCBA 2PS2A 2GUYA 2EG6A 3LCHA 1E15A 3WEOA 4Z1CA 1HFBA 4YHEA 4BWLC 2J75A 3ARYA 3CO4A 2AKMA 1JDFA 1X98A 5I6SA 3E0LA 2ESCA 4PSRA 3REQA 1EJWC 4ZO8A 3A22A 3TQPA 3SCVA 4JCMA 1YTKA 4PUUA 1R87A 3EGJA 4P7QA 3L0NA 3NFUA 4QX4A 1H61A 3MV11 1WZMA 4H1ZA 4CKQA 3NM1A 3QW3A 1MWOA 4ZENA 5LIYX 3QLDA 1XGEA 2UBPC 2PWDA 1I2PA 4XD5A 3VE7A 1PYFA 4LEFA 2XM1A 1ZS2A 1TR1A 1ZP4A 3N13A 2A3HA 3ZR4A 1V6XA 4G7EA 1ZP3A 1DWGM 4AZIA 1EX5A 3L2MA 2BOFX 1YPFA 1E6QM 1XXXA 1LLWA 4BI7A 2V8ZA 2V5LA 1A5NC 1VF8A 3T2OA 1TRIA 4JYFA 4V1XA 2GDVA 1HF6A 4ACYA 5I77A 3UXIA 4MG4A 1YQ2A 4IMAA 1P6WA 2VELA 1L6GA 5D2WA 4J35A 3AROA 3WSUA 1IEIA 1GW1A 2FZNA 5GNZA 3RITA 1EJVC 3C86A 1UWQA 3M0HA 3VIFA 3FVMA 3L2IA 1C9DA 4NZ5A 3SUTA 1H60A 1REQB 5A6BD 3C8NA 4Z2IA 2ZC8A 3TIMA 2JGYA 3BW3A 3OLEA 5E9XA 1K03A 4PUWA 1FDZA 3AS0A 4HSNA 5CH9A 1FWBC 4IMCA 2OFJA 3UQNA 4WJEA 4FNRA 2BSLA 3T7VA 4WD0A 4HNUA 1HKWA 1BF2A 2FMNA 4OFCA 1Z6KA 1UIPA 3UYCA 2HXUA 3N29A 4AZBA 3LM7A 4ZSUA 1XC6A 1O5QA 3OJGA 3E3HA 1J01A 4LUSB 2WAGA 3GTIA 3LCWA 3H22A 3O7UA 1HO1A 3AO0A 5LYRA 1RPKA 3QGKC 1C7SA 1EGZA 2OODA 3FYOA 4K36A 2GGHA 4JTUA 3TMQA 2JF7A 3SRKA 3LSCA 5FJTA 4J3SA 1EBHA 1O4UA 5E09A 3K8KA 2OR2A 3TJ4A 4GQQA 3EWXA 1F7BA 3BK0A 2A3AA 5A2AA 1H7WA 4Z2LA 1O66A 3ZS4A 3ANUA 3JU2A 3TV8A 4GQRA 3EPMA 3H6OA 1BSIA 1ECQA 3TW6A 3L4XA 1CBGA 1R0MA 4IG2B 1C29A 4U2ZA 1B90A 3IGXA 3P67A 3PZUA 1CGVA 1K9DA 2OX1A 4F4RA 3W6YA 5I3IA 4PMUA 3CXOA 3RGTA 4JS3A 5GVJA 4EPEC 1P6CA 1AL8A 2J74A 3WBEA 3VD4A 3UETA 4MJ4A 1TB3A 1EQCA 3H2CA 1FKXA 3EDEA 3CPGA 2Q3RA 2PGFA 3NDYA 4FXJA 2Y1HA 4AEFA 3GYEA 1QK0A 3ZVIA 1SYTA 2R24A 1UW9A 3NQFA 3ZR5A 2O9PA 3VIGA 1PZ2A 3AXMA 5EPDA 1V5XA 4BA0A 1I75A 3BL3A 3WLQA 4YTRA 2FFCA 3B8UA 3HA1A 4JX5A 3VKAA 4DNMA 3PWGA 4AEEA 3DUGA 4Q4RA 3WL0A 1ZZMA 3EMZA 1KFWA 1W3KA 4UIOA 1FFRA 1XL9A 2NT1A 3B4YA 5D9NA 1KW1A 4GZJA 2PWEA 3TYCA 2J9XA 2E40A 3DU0A 1PKMA 2FGZA 2HVNA 1RQEA 2V38A 3IGHX 3HO8A 3EDKA 3XISA 2Q8XA 3PBUA 3WNOA 5A3HA 2R9RA 4C91A 3WF4A 3WBWA 4I5XA 2NVCA 1PV8A 1FWHC 4ATLA 4RLIA 1MXDA 2QZRA 1I1WA 2VI0A 2OX4A 2AGKA 1MDRA 4MNKA 3GIYA 4KQNA 4AIUA 3ATYA 4LYKA 1V51A 3OHMB 3DZ1A 4I90A 1DWIM 3MY9A 5JH2A 1GGOA 3IIOA 3QHNA 3TQKA 4AC1X 4HYWA 3B4UA 4DJDD 3BTNA 5I24A 4ZTYA 4X3ZA 1NVMA 4AXNA 1HG3A 3IIXA 1OFDA 3ZQ9A 1UWTA 4EXQA 3W1LA 1K6AA 4UMCA 1VBGA 4LJ3A 4J3UA 2VFEA 1L2UA 1XCWA 3O0KA 1X39A 1FWCC 3NGFA 3W1TA 4BEQA 4B92A 1JUKA 4HSOA 4JTGA 5BNKA 3AYVA 4IP7A 4LUTB 1JI2A 1W1PA 5LGZA 4DO4A 3FXYA 4HTYA 4AZ5A 2A3EA 1QRQA 1R8LA 3WLLA 1J18A 2ZKMX 1P0EA 1SR0A 3WNPA 4PMOA 3N15A 3LDVA 4CEXC 2V0TA 4IH3A 1R3SA 3M0XA 4PTXA 5TQLA 3CIWA 2CZVA 4E2OA 4M1BA 1BVWA 1T0OA 4O15A 4G6CA 2MANA 2QV4A 5F2GA 2VOMA 2OO0A 3IPWA 1M01A 4HB7A 1HIZA 3WO8A 5C0QA 4DPPA 3LX9A 2VM8A 5FAGA 3O15A 3URAA 1F6YA 3G6MA 3SADA 3KOWA 1A0EA 4LBUA 1Z3NA 1IXQA 1J0HA 2ON3A 2QLYA 4O1DA 2BHYA 3LMYA 3MV01 1FFQA 4Y7EA 4AZCA 3UPMA 1US0A 5C55A 2QCCA 1R2RA 3FN9A 4RX0A 1WOAA 2G0WA 1BXBA 1FBAA 3W83A 2VD8A 3NL2A 2TMDA 3BGAA 1A5UA 3UXAA 4O4WA 3DFPA 5DLCA 2IS7A 4EACA 5EMUA 4XVEA 4LH8A 2PDCA 1R3WA 3NO5A 3ZJ6A 3L4YA 4MTVA 1QVBA 4IPNB 3WZ0E 3ITXA 3L21A 2H90A 4HN8A 1VGAA 2YCLB 2P53A 3RAOA 1M68A 2ZUUA 4H8UA 3CIVA 3EZ4A 3OZMA 2OTDA 4H7VA 4QRNA 4EVZA 1PZ0A 3VIKA 1PS9A 1JZ4A 4CU6A 1K9FA 3B0YA 7TIMA 3DHPA 3PC0A 1RY0A 3SCQA 3DX5A 4K38A 3A4JA 5CAHA 1J6OA 2O9RA 4UMBA 2PUZA 4EANA 4B3ZA 3AHZA 3W6LA 5D2TA 3LLDA 3BAKA 3LPPA 4FNSA 1MSSA 2Y62A 2QULA 4YVXA 2WVUA 1DXFA 3SCWA 3W3OA 2ZFAA 4HA0A 3Q58A 4PMZA 1GQNA 2VEGA 3GNXA 3UZYA 2PAJA 4KF1A 1CGWA 3AU2A 3VD3A 2J7EA 3RR4A 4HN4A 1TX0A 2LLEA 4INFA 1GJPA 3T09A 4IMDA 4A22A 1EOKA 1W3NA 4GC4A 1NARA 1SFJA 4NJHA 4QBXA 1W2VA 1FY6A 2BY0A 3KXQA 4ZO6A 4OGZA 1E56A 3NJ3A 4YTTA 2ZUSA 3C0QA 1TJ1A 2GQ8A 3TN4A 2ZXBA 3VOIA 3T42A 3HU7A 4A3UA 2OJPA 2XGIA 2WJDA 2WM1A 4XAFA 3THAA 3DGRA 4ZXLA 1GORA 3LBMA 1R30A 5CC5A 3QV7A 3BLIA 3LCLA 4KWWA 2E77A 4M51A 1V3HA 2JIWA 3IGUA 3VCNA 4RE2A 4LYRA 5BXRA 5TAOA 3NIYA 1ICQA 5A8QA 3HBLA 3BMVA 3W88A 3LRKA 3C2OA 3SECA 3ES8A 3GQYA 1TE1A 3E1F1 5REQB 2CKSA 4HNOA 4JTCA 3LTSA 5FEPA 3CPRA 1QI4A 2GK1A 2ZUWA 2WC3A 3LMZA 1WOBA 4NP7A 2QXWA 1W1B1 2CLIA 1W3HA 2AAMA 3GFZA 5IM51 4GVIA 5EA9A 3OGSA 2ZYFA 1J8VA 2WWCA 1OX6A 5LA0A 2WSRA 1NTHA 1QATA 3ICJA 4JTIA 1JYVA 9CGTA 2V5KA 2CLFA 2Y7FA 4DO6A 3NO3A 4MKSA 3GR4A 3A4AA 4AW7A 3K8LA 1GOOA 2WHMA 4GZIA 1V3MA 3KCOA 3WJYA 1V3KA 4UTFA 1VD6A 4TU1A 5T9BG 3N9KA 1YDNA 1RJPA 3GY1A 2NVDA 1V6VA 4HU8A 2MUCA 5GJMA 1U1JA 1HTIA 3R58A 5G2WA 1VCGA 4PTNA 2PZNA 2YCIX 3INPA 3ZM8A 4AYGA 1SMDA 2VYOA 3BOFA 4LAZA 2EJAA 1OFEA 5T8GA 5LXXA 4L4OA 4GACA 3BOXA 1U30A 2O7QA 3W23A 4LWWA 1LL6A 4DEFA 2PF8A 5I3FA 3E0FA 5G2IA 3UR7A 5K9CA 1EJ7L 3N4EA 1ZALA 3N3TA 1GEQA 2FPYA 3PPFA 2AMXA 3EXRA 4U3CA 4BJHA 2ZTKA 1LWIA 4E8CA 3W02A 3KCJA 3O07A 1MQQA 1XCFA 4H3DA 1TELA 1B54A 1OGGA 4RXGA 5A6AA 5C70A 1XDMA 2PDQA 4W8AA 3N25A 3B03A 1W56A 3GX9A 3VOHA 3NTYA 3VFCA 5RUBA 3EOUA 3MVIA 2IMRA 3WLMA 4GQBA 1HKMA 4IIDA 3L12A 1OD8A 2E8ZA 4R33A 3ONCA 1A3XA 1J0YA 3R0KA 2VR4A 1W5OA 2WVTA 4DY1A 3TN6A 1BYCA 4XISA 3WL1A 1F3XA 3UW6A 1GQJA 3MWCA 1HGWA 4KPLA 4LC6A 1S39A 3K4AA 4XK2A 3CUXA 4IIHA 1XCXA 5IDZA 3B05A 3PR2A 2CESA 1TPC1 2WBKA 1BRLB 4D6DA 3PWIA 1CW2A 4PC8A 1UR2A 4JTLA 3QOKA 3TVAA 3WK0A 5C2GA 3ERPA 3PZQA 2V69A 1W8SA 1EGVA 4TX6A 4HA3A 5DMLA 1BQCA 3LHZA 4P7NA 5KZMA 2YDAA 2FDSA 1VFHA 2GGGA 4WXYA 3VCRA 3KL0A 3QOMA 1SZRA 1VYSX 4D6CA 3RUBL 1R7OA 4X9YA 2IPWA 5D9OA 3H7VA 5AHNA 3KCLA 2HMCA 1I0BA 1Y7VA 4YCOA 3WLRA 3LBOA 1ZENA 3HFYA 2QVHA 4RDZA 3SGGA 1WDRA 4PE8A 3MO4A 3MUY1 4TX9A 3NQGA 1M41A 4PRTA 4GQ0A 3HGJA 1H09A 4JFWA 4AHQA 2OWXA 3ZO9A 1SFLA 3NNTA 3KL5A 1UD3A 3VIMA 1W5MA 3V5FA 4R27A 3W1AA 2DFAA 3R4IA 3MUIA 3FCPA 2R1NA 4QCFA 3DENA 1PCKA 1XLMA 4IIFA 4CD6A 1QW7A 1EP2A 3C3UA 2OLSA 2Z1SA 4N6FA 3VDCA 4GBDA 1B3WA 1XBVA 1Y5WA 1WV2A 1Z32X 4MYXA 4EPKA 2ZA1A 1RP9A 1SGJA 3C2YA 2WZMA 5F2IA 5D09A 3BLFA 2C79A 1KWKA 3OIHA 1V6YA 5KZ6A 1SSGA 3CQ0A 3GH5A 3W1QA 3PVFA 3FA5A 4IPLA 4W8LA 2B7OA 3O6AA 1ZBKA 3MKVA 4IOTA 4UFLA 1W0MA 2OSYA 3K5XA 3GFYA 3RPTA 3S4TA 4R9OA 5BOEA 2DP3A 3DYOA 5CPSA 3VC6A 3SY1A 3AMLA 2PEVA 4A6GA 3PB2A 4NZ4A 3AXXA 2V3GA 4HHLA 1T40A 5HMEA 3F4WA 2PRHA 1V0LA 5A69A 5CGMA 3MT1A 1PO9A 1RH9A 3DBPA 4KEUA 1YYAA 1YXDA 2WZEA 4XIAA 3OG2A 2AQOA 3KLLA 2WJZA 5CG7A 1K9EA 3H2NA 2PCEA 3IAQA 2CYGA 1WZLA 2Z00A 4XTIA 3SAZA 3WF0A 3TXVA 4NZ1A 3BQ5A 6ALDA 4FAMA 3A9BA 1KM4A 2YXOA 1RD6A 3MMUA 1W9PA 1E0WA 3I68A 1ITXA 3M0IA 3AMKA 3HG2A 2ALDA 2HWGA 3FEMA 2XWEA 1O60A 5I06A 3QV9A 3IVSA 3OTRA 2JIEA 1DIDA 3TLLA 5FL1A 1TVPA 1H11A 4DNHA 2P76A 2HEJA 2DZXA 3ORWA 5AVNA 3TSBA 5B7ZA 2FZMA 1F61A 4BF5A 3G3MA 1D7FA 1XBYA 4JHOA 2DORA 3EA2A 1P0NA 3VIJA 2XIQA 3G5EA 1HUVA 2PURA 1V3IA 2GSJA 1KLZA 2P0IA 5HNRA 1BG9A 2INZA 3GDBA 1AQFA 1AD4A 3G1VA 2V82A 4ZQCA 3KBWA 2PB1A 4H4IA 4ATDA 3AUJA 1JRBA 3AZSA 9XIMA 4KGLA 5JUVA 3DFHA 3QN3A 3HURA 4I9TA 4JFTA 4M6UA 4C6IA 3KBNA 3M47A 2JF6A 4HOZA 1EA0A 1TJ0A 5KEZA 1XYAA 3R5EA 5C7VA 4NYYA 2WPGA 4PFHA 1XC4A 2ZUVA 2A4AA 3G1AA 3VUPA 1EPVA 4JL1A 1G4TA 1H4PA 3CAVA 4Q8MA 4RNHA 4KBXA 1JDCA 3UR8A 4IXXA 4HVXA 5M5DA 1QR7A 3P80A 1GTEA 4C5YA 3KBMA 1XIEA 1XM3A 3BLDA 4BKNA 4HBKA 5HOSA 3TK7A 1O1ZA 1IR2A 4LUJA 2DJLA 1Q5MA 2WQDA 1VLWA 1LLZA 2X1TA 1IV8A 3EXTA 2AAAA 2Y8VA 4U10A 1BG4A 2PSNA 3I7QA 3WDQA 4RZBA 3LZ3A 3UZWA 4M6PA 3PBMA 2HNEA 4L5ZA 5LIKX 2R1KA 3GG7A 4UQDA 3ES7A 1S1PA 4WZHA 3FXGA 2IXUA 6PTDA 1SMAA 1EIXA 2Y0FA 5D05A 3PZIA 3CWHA 3NR0A 3P5ZA 3POHA 1CB2A 2RKXA 3MQTA 2QQ6A 3ZZ1A 3CQKA 2CLMA 1KM6A 3LEPA 5IXEA 4GUGA 2V3DA 2ZBTA 1IZCA 2ZZ7A 3ITTA 4LAKA 1XQKA 1Q6QA 2TRSA 2V5BA 1XIHA 1XFCA 2BODX 3GFXA 4ZGYA 3CBWA 3E9AA 1LT8A 5DCBA 4Z2GA 1X6LA 3GHRA 2G97A 3S5SA 4Z08A 2UY2A 2DPEA 2E7FA 6TAAA 4PUMA 3SDOA 5KZEA 2ICSA 5HMDA 2WMKA 5GJNA 2VRQA 2I14A 4B5VA 1ADDA 1B0IA 4JR5A 2HBXA 5JVLA 2DT2A 2EPNA 3LNPA 4HD5A 2O56A 1GKQA 2QGHA 5A8OA 3LI0A 3W24A 2H8ZA 3V3WA 1GQKA 3RU8X 3LQLA 3PHAA 1SO3A 4W93A 5C5YA 1AUSL 2ALRA 2W67A 4LRSA 1IT0A 4HMCA 3N3MA 3WLIA 2QJHA 3I6TA 2FHCA 3CHCA 4QSFA 4OBRA 2XN1A 2FDMA 1V4YA 3DFQA 1SUXA 1OT1A 4JNMA 1OB0A 9XIAA 1RQBA 1TQXA 2E6YA 1TMLA 1GVRA 2G5WA 4L9XA 5EGRA 5FJIA 1IF2A 4MOZA 1KGWA 3E12A 3THCA 5ECUA 1I8JA 1Q8JA 4LUIA 2XH2A 3CJPA 1V7YA 1LJYA 4FIRA 4M24A 3S1UA 4B9ZA 3R8GA 1C93A 4IICA 2PWFA 2ZC1A 4O28A 4DWSD 3HZ3A 1QNSA 3BW4A 4EIVA 3ABOA 3M0LA 5EMMA 4LCQA 1CNVA 4LGXA 4DWSB 2GGEA 3W27A 1G4PA 3L0GA 1E6RA 2E9LA 2JBMA 2J62A 3P74A 6XIAA 1NY1A 2V5CA 3VZXA 3DG3A 3QMTA 2A2IA 4KWUA 2H9AA 4X0VA 3ARRA 3CTLA 1X7IA 5LIUX 3WF1A 3QLLA 5H2ZA 4U5IA 1IXNA 4WLCA 1UKTA 3U7BA 4IXHA 4ASTA 3U7VA 3QYQA 3ZJ8A 3VD9A 1W8GA 1B4EA 3C0SA 2HE5A 5A8GA 4GI6A 2W92A 3QKEA 4IQEA 4O52A 1RA5A 2CLLA 3N73A 5AVHA 1DJZA 3PZNA 2V6AA 5DFAA 2ZX8A 4LB3A 3CH9A 4IMEA 3CIXA 3NQ2A 4UR9A 1V93A 2WCGA 3RM9A 2XSAA 5FL0A 4Q8NA 4RW5A 1H51A 1F6PA 1FP8A 1LM1A 2XN0A 4RV8A 4B4HA 1BGGA 1XLJA 2F6XA 3W7RA 3SIMA 4FO4A 1P7TB 1KCXA 1OC6A 4ZE4A 3RR1A 4QS5A 3H8AA 3H26A 2O4QA 1YTDA 1WP6A 1GHRA 3A64A 4ZE5A 2Q09A 4RE0A 1XH0A 3FOKA 1MFVA 4HMDA 2V2HA 5H1WA 3WF2A 1ELSA 1GKPA 4ZR8A 3VZZA 3UNTA 5KMYA 2L5HA 3B9EA 2WNZA 3FK4A 2E6FA 4JIHA 3GIQA 1KGXA 4AX6A 5MF5A 2CBVA 1TPDA 2H3BA 2O92A 4DBWA 5GNXA 1PUDA 3R0UA 2X8RA 4B5TA 3FJ6A 5ABEA 3PZ9A 3GDKA 3VIIA 2CBUA 5L9FA 1XLCA 4XZ9A 4JNZA 4H9XA 4LPCA 3VFLA 3I3BA 3U5UA 2OZ0A 1QW8A 4BR1A 2YXXA 4OUIA 3GDRA 3TTOA 2WV8A 3HF3A 1JCYA 5CBIA 1MMFA 3PN8A 2VURA 1ICPA 1U83A 4E4UA 3E2QA 1ITQA 4UOJA 3KUMA 4ZXOA 2BLEA 4OIFA 2REQB 3S2MA 1TV8A 3OODA 1HO4A 1RSCA 3WIJA 2F61A 1TPH1 3ZVHA 4DYKA 5EU9A 3BG5A 2OKTA 5HJLA 1TVNA 1KB3A 2QUMA 3AALA 3MUZ1 1QAPA 4GCAA 2VZUA 4XD6A 5LNVA 2WHJA 1GOIA 1GUVA 5U7SA 4REQA 4XUYA 5D8ZA 3B9NA 1O12A 3CHVA 4G1NA 4MPQA 2OSWA 5K4XA 1ITUA 5C9UA 1LOSA 1BGAA 3THDA 2QUTA 2HK0A 3BDKA 2W91A 2VX5A 2YSWA 3L65A 5MHBA 1RHCA 3QY8A 3IIPA 3D0CA 4IX2A 1E40A 3MHFA 4FX7A 5CPLA 3Q2DA 1EJTC 1VFTA 3H23A 1QDSA 3APGA 1OFQA 4IL2A 1AFSA 3GH7A 4DUVA 4E4FA 2WNQA 1PTAA 4MGGA 1YW1A 1H7RA 2OZ3A 4PB5A 1NQ6A 4DHGA 2W79A 5AHIA 3M46A 3ELFA 3GSMA 4KW2A 1H0IA 1BXCA 3AOFA 1KFJA 1ISWA 3OQEA 1HP5A 3CEUA 3GNNA 4UCFA 1DE5A 1WCGA 2Y61A 3L67A 3URNA 1EO7A 1QHOA 2PODA 1NP2A 2DSZA 6ENLA 3DCPA 4GI9A 3EOOA 3XINA 5A6LA 1RAKA 5FESA 3WUFA 3WG6A 3DFNA 3U9IA 5G1TA 4RNIA 1LQAA 1JL8A 4GPNA 1JCNA 2I57A 3M7WA 3WQEA 4BQ2A 2Z29A 4JFVA 1NFGA 2XPKA 1J93A 4LF2A 1W9XA 2PDXA 3FHAA 3UJ2A 2QV5A 4QFUA 3HTWA 1E3ZA 4P8WA 1T8XA 4LT9A 5CSSA 3KDOA 1DVJA 2A6NA 3VKDA 4XB3A 1VFFA 4FNQA 5KZDA 4TXEA 4KFNA 4OV9A 3VDAA 1QI2A 4J1OA 1N8WA 3MKCA 3AWOA 3STEA 1KRMA 1E0VA 1E6ZA 2VQTA 2P1FA 2E25A 3DBNA 1GOWA 3S5ZA 3VMOA 5BXSA 1OYCA 4HJFA 3P8IA 1LQ0A 1KBIA 2FHBA 2Z6JA 1EH9A 4WKAA 3U0HA 1RK5A 1QI0A 3PY2A 4Q8TA 1BVZA 4LNYA 4GYKA 3ALFA 3GXPA 5BXTA 3NXFA 3VOGA 1UZ4A 1Q6CA 5AKQA 3NAVA 4TVUA 1B4KA 4MWAE 1M03A 2FH8A 2J6VA 1EUAA 2YZ5A 3SIZA 4C6EA 1S38A 4WDWA 4UXDA 1UH2A 4F0HA 1TZ7A 2XSBA 3TN3A 3KEHA 1OFBA 4GH3A 2BS9A 1VR6A 2FFIA 3E96A 2BXYA 4HYVA 6REQB 2C0HA 3PF3A 1GVEA 5U4NA 1KXQA 5LZLA 5AB3A 2BFGA 1TJ2A 5A95A 2ZZ2A 1HL9A 3EX1A 1GG1A 4KWOA 2X2YA 3Q37A 3WJXA 4DB7A 2PLKA 3PBYA 3K4WA 4W5ZA 1MEIA 3FDGA 3PTKA 4M80A 1I2NA 5J04A 2HE8A 1H7NA 3EOSA 3IV8A 4P2VA 2YKKA 3GZAA 4ML4A 3GTNA 4H6RA 4QNEA 2VD9A 3MHGA 1KNWA 4U28A 1XWYA 2ZX5A 2B7PA 5HK4A 2V2DA 4B5UA 1FUYA 1JXKA 3I7SA 2QVNA 1W3JA 4LEQA 4MUZA 3M1ZA 4LBSA 4XAZA 1NJJA 2OO6A 1THFD 2CETA 3IANA 3H12A 4PUJA 2W6RA 5CBJA 3QH2A 5BRQA 1PYMA 3R11A 4HA1A 5DX7A 2WNWA 3SW6A 4KIEA 1WUEA 3ZSTA 2G3IA 1PX8A 1OADA 4QIUA 3GG1A 1RJRA 3RDKA 4ENLA 3V0TA 2PP3A 3QTGA 4PEKA 1WDDA 2J7DA 4LAOA 3ARXA 2FGLA 4WIWA 4JZ5A 1KBLA 5FIPA 2HS6A 1QWGA 2WSQA 4ICNA 1HT6A 1PCWA 1ME7A 1DWJM 2JEQA 4L6OA 2QJIA 3ABZA 2GWNA 4ZB5A 3TJLA 3WFLA 4KESA 1IE7C 1XBZA 3QZ6A 3SY5A 2TPSA 2DU2A 2AL2B 4MYAA 1ISVA 1M6JA 3HGSA 2OQHA 3QEZA 3IJIA 3HG3A 4FHAA 3OBAA 3CAKA 3VKBA 3WH7A 1UR3M 2D2GA 4W85A 3SCPA 1G67A 4M8UA 4JTAA 1KV5A 3O1NA 4XZWA 4YVVA 4H19A 2BVTA 4WQ6A 1HXJA 5CSYA 2QCDA 3G0SA 2VCAA 1R3VA 3EWUA 3BLKA 2ADAA 1O5XA 1EIBA 1QFEA 2VX7A 2J8GA 3FW6A 2VGGA 3QPYA 4B2DD 5CG0A 3MJMA 4KH2A 3I4KA 4GIEA 1JCXA 2J7BA 3GVWA 1OC7A 3P8JA 5HATA 3UY7A 1V3JA 1NF0A 3NURA 4QJ4B 1BYDA 5D04C 5DO8A 4UMAA 3D6NA 4P8VA 1OG6A 4UTWC 4UUIA 2NUXA 3P6LA 4KCWA 3O63A 4QNWA 5DQPA 3G1RA 2X41A 4FLOA 4WEVX 4WX2A 1E72M 1VBUA 4LQ1A 3TTYA 3SN0A 1XYFA 1FA2A 4O0ZA 4HCLA 1X1OA 5A6SA 3CGTA 5TF0A 2J7CA 5AHFA 1ML1A 1EL3A 4LVDA 3CK5A 4G1KA 2NWSA 1RCQA 1SPQA 1OF6A 2O9OA 2ATSA 2X0SA 4S39A 2OYKA 3COTA 3ANYA 2BY1A 2HCVA 1DIEA 1V6WA 3SM0A 2OOFA 1TKKA 2EKCA 3UBPC 2ISWA 2BGSA 4JTEA 4CN4A 4QE4A 2PE4A 3QGAC 5DELA 4XZNX 1B3VA 1UQZA 2YB4A 4JKMA 2JKEA 1MFUA 2YB1A 4C6PA 1EZWA 2R94A 1D2KA 3KDNA 5DRCA 4AHOA 2PDBA 1JGIA 2NX1A 3URBA 4B3KA 4AY8A 4JQ3A 1P0DA 1EC8A 3M64A 4MFDA 3VGDA 3E2SA 4EX4A 4UTKA 3PZVA 4NHVA 1W9VA 3DC8A 1PWLA 1D3CA 2V2CA 3QPZA 4XTDA 2P3ZA 1A5AA 1BYAA 2OXNA 2X40A 5I07A 5D38A 3EPOA 3K1DA 2PD5A 4DBEA 3W84A 3UJRA 5AN7A 2D23A 1X6NA 1H7OA 4HYRA 4J3TA 1CGUA 4JPGA 3AUOA 3TAOA 3LPGA 3BOLA 2WJEA 4JIIX 2ZRVA 3AAMA 2Y7EA 1A5SA 4NAFB 1FWEC 3M5VA 1ZHAA 1AG1O 4JBRA 3NSNA 2C16A 5DXXA 1XSIA 4O1CA 4NJGA 4LAMA 2Y7DA 3KVMA 3IVTA 4L65A 2YJQA 5F4WA 1FH7A 1D3GA 3W2LA 4QG6A 1EEPA 1M65A 4GLEA 2WYSA 4HT3A 3BANA 4Q6JA 4H9MA 2DZPA 4UC5A 2QMKA 4ROQA 5HMSA 3UGVA 4MB3A 1QNPA 1R9YA 1ZLPA 2VEFA 3C2EA 4JIRA 1UPMB 3IGSA 2GVGA 1SFTA 3OZOA 1V02A 3MSYA 1EPXA 3E0IA 1X8CA 3BARA 2PTDA 1Q7MA 2JE8A 1TV5A 4U2YA 1MEHA 1OVDA 3A3WA 4Q3MA 4MHBA 4Q7BA 4LCSA 2VT0A 1V79A 1V0NA 1JDDA 5FCZA 2RDTA 4WGXA 1ZCOA 3BAIA 1SJCA 4NASA 4OU1A 3HV9A 2VUYA 2NX3A 3W7KA 3KOYA 1Z7AA 2XN2A 1NDZA 1BKHA 4FXSA 1PX4A 4BY3A 2OU4A 2XISA 1A0DA 2ISSA 1A5BA 1WXJA 4RZ6A 4PUDA 1OFAA 2YYTA 3PJUA 3A23A 3FJNA 1Q6OA 3SN1A 2PCQA 1O95A 5G2HA 3UD6A 3BAJA 4XKMA 5D8WA 2CXEA 2DSVA 2XSXA 4M82A 3VKKA 3QHMA 4FX6M 1DV7A 5JBFA 3TLQA 1OT2A 2GJXB 3T0DA 1A3HA 4OHQA 4WKFA 2HV5A 4O57A 3BMXA 2TODA 4IQLA 2XFRA 1NQKA 3LB0A 2RGMA 5C6MA 3ECQA 1UP0A 2RJGA 3JS3A 2BP1A 3W00A 1UG6A 2FPTA 4OT7A 4W8BA 3F03K 4DJFA 4E6MA 1PKNA 3CS2A 3IWPA 4R53A 3OEXA 4I7VA 1ONEA 2NXHA 2OLHA 3DFOA 1OFRA 1EUNA 3F5KA 1UC5A 2WWDA 3TX9A 1F07A 2ZTJA 1JDEA 5BZAA 3SO7A 4PYSA 1QI3A 3W87A 2GJLA 3BXWA 3KLKA 1UMYA 2O7SA 1KCKA 3FYYA 4FA3A 1YKWA 4DQWA 4B91A 1WZKA 5HJYA 5E0FA 3G1SA 4YWIA 2ZRZA 2DUXA 3DHUA 4O8RA 3M5XA 3W86A 1C8XA 1L6WA 4IL0A 1XKYA 1T99A 1H1YA 1HJQA 3BICA 3NQDA 4C6MA 1VIZA 4HOXA 5EMJA 1BPLB 2VVSA 1EXBA 1ZJAA 3EMQA 3GG0A 5DT5A 3TZFA 2PU0A 3KOZA 1M7OA 4S23A 2I9EA 1OIMA 5BMWA 3QMRA 1Q2SA 2F7FA 1NDYA 3WQPA 2EKGA 1SO4A 3CUFA 3NCOA 4U5KA 3N6QA 1E9IA 1Q4NX 1FWRA 1IEVA 3CPUA 1KM1A 3P84A 2VEKA 4D6EA 2DW7A 3AYTA 3FJ4A 2EPKX 5ABFB 3NO1A 3GAYA 1CT5A 1R3QA 1S2WA 4JDBA 2POTA 2QIIA 1IYXA 3EB3A 3GC5A 3VD7A 2F6KA 2ZDSA 2BASA 4KS0A 4TV6A 3GDMA 2J6XA 2HISA 5LXEA 1SJAA 3ZXWA 1W1A1 2CCRA 4O12A 4YWSA 3KE0A 3NZ1A 4DZ5A 1CGTA 2XGZA 1WA3A 3U4FA 4IJRA 4B5NA 4QDMA 5K9XA 3DXIA 4CQCA 3LXCA 1KFCA 4MJ2A 3TSDA 1K8XA 1MYRA 4AB4A 4QHRA 1ZAHA 2GL5A 2XFWA 3FAWA 5BWFA 1A50A 2ZXDA 1HJUA 4KRTA 4K8HA 1X8FA 3P60A 1W17A 2IQTA 1IEQA 2CXGA 3LSBA 3W7JA 4AF0A 1R5YA 5CKSA 1T96A 3AMGA 4YTQA 1CI1A 1J0IA 4MZ1A 4JN6A 1FX6A 2QJJA 3QW4B 1BVNP 3IRDA 1X97A 3NOEA 3OBEA 4WR3A 4GGBA 5AYXA 1KM5A 3MMTA 2GVEA 4QJ1A 1WYIA 3N4AA 4IMGA 4J5NA 2VZVA 3AICA 1TG7A 5A2CA 1VEOA 3W7GA 1YLVA 4NZCA 4V15A 3DC0A 4GY7A 3M9YA 2ABAA 2Y7GA 4JFSA 4K6AA 2YLAA 4N9DA 3SUUA 4CCZA 4I5RA 1YRRA 4GCXA 2C0AA 1L9WA 1HL8A 1KBJA 4E5TA 3T8QA 4OVXA 2NLYA 3W2KA 4IIEA 1BF6A 3I3EA 4MUPA 5CZTA 4W4QA 1TA3B 3W4RA 3EX3A 2W63A 2ZIDA 1JPDX 4HZ6A 3H7RA 4LBRA 1PZ3A 4N9EA 4AUBA 4TVCA 4PMYA 3PSWA 5JMUA 1E9LA 1GNXA 3U5YA 3TUUA 3TFXA 3QKZA 3BC9A 2JKPA 1W3TA 1TSIA 4UTTC 4OBTA 4PCTA 1X7FA 2J9ZA 2ZICA 3EPNA 2NUWA 3GKAA 3HGRA 3FKRA 4QLKA 4C6JA 1SJBA 1IZKA 4GI8A 1MW2A 1AL7A 4JD4A 2CZEA 4KKXA 3N2OA 3TNOA 3GXTA 1TPVA 2O0TA 2X7WA 1JJKA 4AIBA 3SQSA 2XZ7A 3B9DA 3OQ8A 3QY6A 1E73M 4S3GA 1VP5A 5FJPA 4OOZA 1JD9A 2J77A 4EXAA 2QKFA 5T9CE 3BCFA 4R9XA 3ZFHA 3GAKA 4LVFA 1YX1A 3W7CA 4B90A 5E6ZA 3W01A 2VZOA 4R85A 3OBKA 3WLOA 3WD4A 1QPQA 4DJEC 3QZAA 1BKSA 3MUAA 4RKAA 1OQFA 4AY1A 1EWEA 1R46A 2OCZA 3G22A 5AC7A 3KW3A 1HJWA 2EAWA 3DIPA 4P5UA 2ZRWA 3CAWA 1PX3A 4KRUA 4YVPA 1JCMP 2A5HA 2ZX7A 4WF7A 1UD6A 1N55A 1LROA 1JNEA 3F4DA 3TA9A 3ZJKA 2NWRA 1JF5A 3PJWA 3WX7A 3W70A 3C61A 4ACZB 1HGYA 3QPEA 4HHHA 3GW0A 3UWEA 3V4BA 2WVVB 5AOUA 3LXAA 5F4XA 2DSWA 1A53A 3Q45A 3YPIA 2QUVA 2YXGA 1XYMA 4DI8A 5FEXA 2V9DA 3N14A 3POCA 2WMHA 4AIEA 1XYZA 1F8IA 3GXNA 3W7DA 4J27A 2RH9A 4GH1A 4MFEA 3WNNA 2DQWA 3ALGA 1KRBC 2QPXA 3RM8A 2YPIA 3ABXA 1A4LA 3S42A 4RXFA 5CZSA 4GBUA 4HNLA 1NWUA 1GTHA 2PDIA 4ZSTA 3EEGA 2C3ZA 5TNVA 3A4WA 1B9ZA 1XJBA 3OG3A 1Q6RA 1LDCA 1FCQA 2ZWZA 5DBUA 4C6CA 2BBFA 8XIMA 3F2DA 5CPTA 2V30A 3WYZA 4JEJA 4GUHA 4E2BA 4MWAB 3VOJA 4M6VA 3TEVA 3TTSA 3LTPA 3ID7A 2FIQA 1NH6A 2FZDA 3IRSA 4H00A 4E38A 4N2YA 2GUUA 2E9BA 3FX4A 5SWUA 3WQ8A 1LTDA 3FV9A 3OVQA 2P0OA 4V2XA 1OWQA 3PAOA 3UCCA 4HK5A 4PCPA 2Y8KA 4PRRA 2Y5EA 3V35A 4YXGA 1EF2A 2EPLX 3HM7A 4ADTA 1DORA 3L4WA 3R1ZA 4KCTA 5AZ0A 3C52A 3TYZA 4GIYA 3L5AA 3M16A 2FPVA 3IK2A 4QSHA 2PDJA 3P61A 3Q94A 2I7GA 1KR1A 4JFUA 4ALDA 5F2MA 1I60A 2PDGA 1KV8A 1MEWA 5M1TA 3KL3A 3MU7A 1UUMA 3TZNA 1DOSA 1MQRA 3N1AA 3V0SA 2Y6ZA 1IHIA 3STCA 1E43A 3I6RA 5IDIA 2JKAA 4Y9NA 4YYFA 4GUFA 1J0KA 2EXOA 4Y90A 1HZYA 4E3VA 4XZMX 1UIOA 5HWMA 3CASA 4MZYA 4HGXA 1HVQA 4FOJA 1RCOB 3HIJA 5DF0A 1OCNA 2J7GA 4I9MA 4G5DA 4BWLA 4YTSA 4FEZA 3RN6A 1ZBCA 2YL8A 1E3XA 2YOCA 3BAYA 1ALDA 5EBUA 3GHUA 4HNTA 3MS8A 1TTJA 1POKA 1QNOA 4CN6A 1VB9A 1M9HA 2J8TA 2VFDA 2QF7A 4AMCA 1VEPA 4EF9A 4CCDA 1VFOA 5AECA 3B8TA 3GLCA 3W26A 2J78A 4NILA 4ZO9A 1GZ1A 5AYZA 2Z6IA 3DESA 1ZBWA 5I78A 2NQ5A 1E55A 4LSBA 3IEBA 2VVNA 3BCDA 3G24A 2CHOA 1E71M 4C5ZA 4W87A 3S47A 2PGEA 4QAWA 1UR0A 1GEHA 3N2TA 4HA4A 1G5AA 1T5AA 3IIZA 3B8IA 3EAUA 3KBVA 4F2BA 1EA9C 3CUZA 5KETA 1E0UA 1K7EA 5AYBA 1TPEA 3C8FA 4FNTA 1WAUA 3MANA 4TTGA 3GR8A 5DY2A 1ODZA 3RNDA 4UB9A 2V67A 3PZOA 4AFYA 4CD4A 3G0XA 1XP3A 1R7AA 2SFPA 5EMKA 2P3EA 3G8EA 4ERAA 4K37A 3BSGA 4GQGA 4GVFA 2H3DA 1YTEA 2XFYA 3LHUA 4NL1A 4EPBC 4CNUA 3LLXA 3NQ8A 1E9YB 3T07A 4Q7IA 3KZPA 1QT1A 1BLIA 4LW7A 4F2TA 3OGVA 4HP5A 2WK2A 1JCJA 2OLAA 5LNWA 2PDYA 1BQGA 3UR2A 4KCUA 4D8ZA 2VUNA 2ZRUA 4DN1A 3EBVA 2WW5A 3CMFA 1JF6A 2IQDA 4AISA 5LGXA 1Z44A 2OQYA 1TV2A 5EYWA 2CBIA 1QPKA 1A5MC 3C2VA 1ICSA 1UHVA 2J7HA 2DJXA 5CPQA 3OPSA 2D0GA 3UA4A 5IHSA 1E6SM 1PBGA 1Q85A 1OJXA 5IOBA 3HPFA 3F7JA 5I3HA 1HP4A 3WH5A 2HROA 3OVGA 5DANA 1TV7A 2NQLA 4WCJA 3UXKA 2NT0A 4FXFA 3SI9A 3WUGA 2GOKA 2O55A 3KTCA 4NU7A 1VS1A 3TW7A 1EYEA 1YHTA 3REQB 4K8GA 3TOYA 2ATMA 4DI9A 1GVFA 3UWUA 3VNDA 4EPDC 4S3DA 5HJXA 4D6HA 4XZLX 4ZB2A 1EJSC 3SY8A 1TTIA 3ITVA 3L0KA 3RU6A 4NI8A 3NG3A 4GVHA 2G4JA 1PWMA 3HMJG 3W7HA 1EKOA 1DEDA 3U3HA 3BLLA 4S3FA 1GYNA 4QJ5B 1EBGA 2WLYA 5CZKA 3GTHA 3JW7A 4J2PA 4IQDA 3SCOA 4PH6A 2RHGA 1TQJA 3VIPA 3KRZA 4IHCA 1FCVA 3RJXA 4G7EB 5C71A 2A79A 3MI6A 4BI6A 1ZAJA 4AD2A 1NWSA 2D24A 4D8LA 3KP0A 1CXFA 1KM0A 4ILSA 5I0DA 3EB2A 3PS7A 2ZX6A 4CVWA 4F79A 5CSUA 4GUJA 1DXIA 2E09A 4M3PA 4XVDA 3R89A 3AI0A 3WNMA 3ATZA 3WBXA 3NQMA 2WJFA 3MUXA 4CGTA 1Q6GA 1E4IA 3VTRA 3S1WA 4DBSA 4IMFA 4OWGA 3P7YA 3EA1A 3CV2A 4YNGA 5CAKA 1D3HA 1XDLA 5E70A 2CZDA 3EDJA 2A0NA 3OGRA 3WBYA 1EP3A 4PGLA 3PPGA 2VNCA 2I5GA 1CXEA 1ZNNA 3LBCA 4UNIA 1SW3A 3W7IA 4KEMA 1MXSA 1J6PA 3BGJA 3WQCA 3QHOA 3MSDA 5EL1A 3N04A 3BG9A 1ME8A 1QWKA 4B2DA 1YEYA 2FH6A 4RR4A 4C6QA 3W7OA 2HTMA 1OD0A 3VGHA 1FHUA 3SCNA 3WEMA 2YFNA 1JFHA 4O13A 4O18A 2HPMA 4QDPA 4PUEA 2XINA 3CYJA 4ZQOA 3N2XA 2C6QA 4S38A 3MDUA 3OB8A 1M1BA 2WOQA 3GTXA 3CV6A 1VCFA 1LG2A 3SUWA 1L8PA 1H62A 3B8VA 2NX9A 2WC4A 3CHFA 5I3JA 2E5DA 4PA8A 4NXKA 3FA3A 4MM1A 3UWQA 1ENUA 3NQ6A 3PZMA 1J10A 3TWBA 3FNDA 4DBUA 8RUCA 1MW1A 4HMNA 1Z69A 3ARSA 4O0QA 3SGUA 3LQGA 4JN8A 3BLPX 3E5BA 4QEEA 4LY4A 4HK7A 2Z2UA 4S3CA 5A6TC 1EJUC 1SO6A 1WX0A 3KAOA 3DERA 4KFPA 3II1A 4ZTXA 2VR5A 1R2SA 3PWAA 3OHIA 4A2RA 3GU2A 4MKNA 1NEYA 1VBRA 4XO7A 2TAAA 3OOQA 1UR1A 1KBKA 3A47A 5HQLA 2DZAA 4XWUA 3RK8A 1I9CB 1AW5A 3WQGA 2IW0A 2OGJA 5AHLA 1IT7A 3PBWA 2XVKA 2XTKA 1P43A 2IPJA 1LUCA 2XIJA 3AIWA 3TYBA 1VKFA 2J7FA 5M03A 4MAZA 4K1GA 4DF0A 3UY8A 4MVAA 3C5QA 3L7RA 1AW1A 1OX4A 1Q65A 3T08A 4H6KA 5EB8A 3VDBA 4NUWA 5I23A 3V1HA 2QNEA 3GUWA 3QVQA 4C6BA 3AYRA 4ZVJA 3FGCA 3FHQA 1X6UA 2ACSA 1R2TA 1QBBA 3QR3A 3KRUA 3O0FA 2F9RA 3QJAA 2YLLA 1ITCA 3OYXA 4P8UA 5D33A 1VHCA 3BLOA 3P81A 1HNYA 3S1XA 1S5VA 3V16A 4AVFA 2UY3A 2VTFA 2GVLA 1CCWB 1OX5A 1Z89A 3E02A 1G69A 3U8GA 4JTRA 2QDHA 3AIVA 4CNOA 5CQ1A 1JG9A 3NYDA 5I3KA 3GG8A 3WNLA 1C91A 1KXTA 4FALA 3APTA 3L9CA 3MSRA 3U2CA 3V18A 4X9SA 3VA8A 2VZTA 3SZ8A 4GY1A 3WD3A 4RZ5A 2J13A 3HQPA 3PTQA 2PBOA 4D6JA 2A7NA 4PTMA 4AD5A 3UWYA 1ZTVA 1IGSA 3ARTA 5AHMA 1OBAA 1H41A 3N2MA 2YBUA 1QNVA 2QT3A 3CAQA 4CUCA 2A7RA 3HJZA 1S46A 2W0UA 3TN5A 4DAFA 4P8XA 5K3VA 3PFRA 2TYSA 2AL1A 5DMMA 4QAIA 1HN1A 2XFFA 3S6OA 3HN3A 1MZRA 3A12A 2OELA 3E74A 4EAMA 2Y5SA 1LF1A 3RCNA 4DBDA 1CXLA 1JPIA 4US5D 1PKLA 3OVPA 4UQAA 5J5RA 1EQPA 3RX2A 2PDUA 1SZNA 1G9HA 2WM0A 3W0KA 2FGBA 2FJUB 5I00A 3PFMA 1VPXA 1XIBA 2Y70A 3NL3A 3AMCA 1DYSA 1UD8A 3PJTA 4C6NA 1MUMA 4JX4A 2YL6A 1KFEA 5AYIA 3W1MA 2JQXA 1RXOB 4KERA 2DZVA 3IUDA 2OWWA 3W9ZA 2UV8G 3VM7A 3LCIA 3TE9A 4LV4A 1W3LA 2E5BA 3USBA 2EG8A 1POJA 1VRXA 4X22A 4DZIA 4EKJA 3KZSA 1KBBA 1FP9A 6A3HA 1ODUA 4ADUA 2KAUC 1NSJA 1W3IA 4KIRA 2C15A 4FNUA 2YL5A 1UOZA 2WSKA 1ADSA 3EMCA 3VMNA 4E8DA 3T2QA 1R9ZA 1OF8A 3LHVA 3NWRA 2J47A 3B0UX 1EJRC 2IQ0A 3VVGA 3RYSA 1PJ9A 4KWSA 2NW0A 2DUZA 2WKLA 1EWDA 5EMLA 3ZIZA 2PP1A 1R38A 2KX9A 3OO2A 4QE1A 2OSXA 2FB3A 4QEHA 4AZCB 3N6HA 2F2HA 4D6IA 5HA7A 1DBTA 2PTXA 4C6LA 1FWGC 2XIBA 2PD9A 2XH4A 4N9BA 1XD0A 4ZFCA 4V27A 5XINA 4LS2A 3R43A 4X63A 3FEQA 3S9IA 1E5NA 1XISA 2WCAA 5CSRA 4ZMGA 1FHVA 4I8YA 2PDPA 1RV8A 1GZGA 3C4UA 2Z25A 3KRBA 2PLCA 3VGFA 1XIFA 3S6TA 3ZR6A 1W5QA 5BU9A 5D2XA 4FZIA 4AG0A 1R86A 3B0VC 2ZWYA 3CEPA 1KTCA 3P0WA 1UP3A 2ANUA 1BWVA 4UNLA 1DJHA 1D9EA 5B7YA 1K4HA 4O4VA 4PB3A 4D1JA 3ISIX 3S2JA 1EFZA 3VNYA 4J4KA 2YDQA 1X1NA 4HSHA 4U4MA 3VPLA 5HMFA 4GJ1A 3IUIA 4PCFA 5ENLA 3ITCA 4WJ8A 2NUYA 1HKIA 3DGBA 4XBKA 1BYBA 3P14A 4JYEA 3TYEA 1XLHA 1VBHA 2ZZ5A 2D2OA 1VYRA 4QCEA 3W7NA 4O53A 5ECVA 2VX6A 1MRQA 3S6DA 4MLJA 1DPMA 2YZRA 4DJFC 4OECA 2VCCA 4YIWA 4LXFA 1UROA 4QLJA 1Q3NA 1ZJBA 3C2FA 3GYCA 3M44A 4YYCA 2HSAA 2Q02A 1XLLA 4O17A 4TVDA 2CWNA 4RPQA 3NPXA 3T4CA 4QQUA 5LKYA 2E0PA 7REQA 4AY7A 4Y9MA 3MP4A 1YE4A 3UEQA 3AXKA 4HHPA 4XIMA 2XZ9A 9RUBA 5FKYA 4GXPA 4XKYA 3CMJA 2B31A 3CB3A 5HR7A 1TRDA 1RBLA 2G96A 1RK6A 4IFRA 3M5YA 1GPWA 3GC4A 1OK4A 2PLMA 1H7PA 3VNJA 3MW7A 2E67A 3T0TA 3ZLFA 3N9RA 1N82A 1UC4A 2GK1B 3BJFA 1IT8A 3GB6A 5I02A 1W1YA 5D9MA 4CD5A 1B1YA 2ZVIA 4A4AA 3ZSSA 5HUPA 2ASHA 4O16A 1G7UA 5MKGA 2HJPA 1DJGA 4NX0A 5HINA 3USZA 2INFA 1P5BA 2VEPA 4AD1A 3VE9A 3NDZA 5J5DA 1TZZA 4Z2HA 4NI3A 2RDUA 1LOQA 4J3ZA 4XAGA 1DJWA 3D46A 3G1YA 4AYSA 2X09A 1UD2A 4XG1A 2DV0A 4B16A 3CV7A 2D0HA 1A5CA 3VZYA 2DVXA 4Q8QA 3CZLA 4NAEA 4CU7A 4Q8PA 3CO8A 1EB3A 1WXZA 2PLJA 1Z9AA 2DW6A 3QR1A 2VOTA 1HW6A 2Z1WA 3PPHA 4ZQRA 2OB3A 1PZ1A 1VZWA 3RX4A 5BXPA 1EHAA 1PHQA 3UJEA 1GZJA 1TTPA 4GO9A 2J66A 2B81A 3MWAA 4OQVA 1E51A 3UGRA 5DN1A 1UASA 1EXPA 3CB8A 4MJZA 1KQZA 1XIDA 4OTKA 1S2TA 1NDWA 2I1OA 3IAPA 3B8WA 4F0LA 1H3GA 4ZQNA 1ECEA 1AH4A 1FH9A 2V81A 3PP7A 4O1EA 4NZFA 3ABQA 4X61A 4GE8A 2WMGA 4I9JA 4AXKA 4ZQMA 1TPWA 1JRCA 2ZA3A 1QMLA 3CUJA 2DIKA 2QUNA 1LLOA 4UFIA 1QOPA 4RDYA 1XPGA 3E0VA 3U2EA 3LU2A 1UZHA 3WFZA 2C18A 4GNVA 5KITA 4ZEPA 1WDWA 2Q71A 4G9PA 1W9DM 2VXNA 4R88A 3CMGA 3RCYA 1YNYA 1GYLA 3QFEA 1IIGA 1M53A 2EQDA 1NELA 4GRSA 1LWHA 4FB7A 1S5WA 3UZJA 4R3UA 3KFTA 4LANA 4W7WA 3M41A 3AIBA 1XBXA 4L56A 5AHEA 4DELA 4HZ7A 4BK9A 3LCXA 5B80A 1Q66A 5K4ZA 3HMCA 1HL2A 1OSEA 4PCNA 3WJZA 4D72A 5E5CA 1WKYA 2PU1A 4HQVA 2R6OA 1O68A 1V3LA 3CLMA 4G8TA 1FQ0A 3GRIA 1K6WA 4P7RA 1UBSA 4AWSA 3NGJA 3AQUA 1FRBA 3H2FA 2UY4A 4XX6A 1LRTA 1V77A 2Y63A 1JFXA 1S2AA 5G4WA 1C90A 5A8MA 4P7LA 4XBJA 1AH0A 1VENA 3S8HA 1L6YA 3G1XA 4JEQA 3W82A 2YBTA 4Q4SA 3D3AA 1UD4A 5FI8A 1CEOA 3SFKA 4Q6XA 4GYFA 3LI1A 3WK1A 3RRXA 2VGIA 1W31A 1E0XA 1IQ8A 1NF7A 1JPMA 1P1XA 2BOEX 2WSYA 4JN7A 1ISYA 2W66A 3GVVA 4N42A 3L23A 2G4FA 2PPGA 2ABBA 2X0HA 2Z2BA 4GWEA 1FWNA 4PTWA 3W1PA 2Z28A 3N19B 1E6XM 4JTTA 3PG8A 3U6WA 3VNIA 4YHGA 3DFTA 1JAKA 1LOLA 3QXBA 1YBQA 3LERA 1EJXC 3W7PA 1Y5XA 4OOUA 3WCZA 4QG9A 3T8LA 2XVLA 3TC3A 1PXGA 2GPTA 3W71A 1OG0A 3HQOA 3A5FA 2G50A 1FWWA 4JKKA 1WBJA 3AHYA 4JIQA 2WXDM 1AJZA 4C1NA 3QTPA 1Y5VA 1F6KA 1XIGA 1XINA 3L4ZA 4AQLA 1QNQA 4A3RA 3EWWA 4GC3A 3TXZA 5JQ9A 2F6UA 1IGWA 4CNTA 1XUZA 5FF7A 2OQLA 5A6MA 1A3WA 2FZBA 1S5TA 2DZTA 3TTQA 5DEZA 4MWAC 3MI2A 2YR1A 1S5NA 1XSKA 2C91A 3G1FA 1YE6A 3O05A 3WLKX 4Y6GA 1GT8A 3VAVA 3UG8A 3L4TA 3KOXA 1SO5A 4OJYA 2QDDA 4D71A 2YA1A 3RJYA 3GE7A 1UR9A 1R3RA 3WH9A 1EP1A 1HJSA 4DRSA 4HPGA 2PRMA 4EK7A 5JU6A 2GQ3A 3N11A 2PFHA 3EKZA 2DH3A 4DYEA 1J0ZA 1KC7A 3UXDA 3SRFA 1JZ8A 3M6DA 4PR4A 1C9WA 4FXRA 3P2VA 5FF0A 3RX3A 2IXVA 3H4XA 1TYGA 4FPSA 5AC4A 5FAJA 2QAPA 2VMFA 3P0XA 4LYPA 1IWBA 4PB4A 5FEZA 5D2YA 1RP8A 1JYXA 1ONWA 4ZOBA 1TWDA 4S2CA 4FI4A 3C0LA 3P62A 1B3YA 4WY0A 2EPMX 3TCEA 3UPWA 3EWCA 3GNRA 4ZO7A 1C8YA 3AYSA 3WMLA 1CTNA 1I1XA 3UU0A 3T6CA 1DJQA 4NX5A 4JCLA 1U22A 3DG7A 5H6HA 2V3FA 1H1ZA 2A85A 2KZHA 3LD5A 1N2VA 2D3LA 3JUGA 1DP0A 1N8IA 2HS8A 4ZZ9A 4WRHA 4H2CA 2RJHA 4HTBA 4JL2A 1W9UA 1XLAA 4NJJA 3W2UA 1YDVA 2WHLA 3BSHA 3WF3A 3NQCA 2GSEA 1MRAA 3UJFA 1EEXA 1G4EA 1A80A 1K3UA 4C1KA 4QDWA 1FWJC 1ONXA 2WMIA 3S5YA 3GXIA 4HNNA 3MHUA 4O19A 3UESA 1CXIA 4HCDA 5A1AA 4XAYA 2CHNA 3EKLA 3O6YX 1QBAA 1H5VA 3HJEA 3HB9A 1WXYA 3VGBA 4AU0A 3ARWA 4MLRA 4JAWA 1XICA 1KD0A 3W07A 5AY7A 3NVTA 4IUGA 1UZDA 4TOQA 2CFFA 2WMIB 4IGHA 3TR9A 1AQ0A 3PB0A 3FAXA 5A6JA 3LNMA 3KM8A 5HR6A 4GUIA 1Q6FA 1REQA 1E4NA 1T41A 1K02A 4L7ZA 3LCGA 5A6BA 4MY1A 1IEXA 3M0JA 4Q33A 5I7GA 1Q7ZA 4NRRA 2W27A 1G94A 3M0MA 4GZEA 1P0KA 3UYIA 3MZ2A 4QM1A 2NLIA 4H8NA 3UF9A 4BQ5A 1F2JA 4MDPA 4UTLA 4LU0A 4O0KA 3NL6A 3F5LA 4LUSA 5GJPA 3K8MA 2A6LA 2E8YA 4RUBA 1KO0A 3CL7A 3QRHA 2GDUA 2QDGA 1SFSA 1BD0A 5H8MA 4NRSA 3EX6A 2XIOA 4L4LA 3WQ4A 1W5PA 1S2CA 3LPFA 1E1CA 1LBLA 1UP2A 1FH8A 3EWBX 2E6DA 3KWSA 4JQ2A 5BOFA 3D3FA 1ZL1A 5ABTA 3BPWA 1V02E 3L66A 1WKFA 1JD7A 4H8VA 4GNKB 5LA1A 3P5YA 4YS1A 4TQTA 4QGCA 3GXFA 4EOUA 4IG2A 1KTBA 2DQXA 4WDUA 4JX6A 2YCKX 2NVAA 4GXMA 4UTHA 1VLIA 2FKPA 3NPUA 4MDOA 1E1CB 2DT3A 1RR2A 3R13A 4ES4A 3T4WA 2OG9A 3LN3A 1MNSA 3EXSA 5JIWA 2BWGA 2J24A 4UTIA 4CQDA 3CZGA 3H2MA 8A3HA 4DO5A 3UFYA 3PPCA 1V7AA 2QEZA 1XLEA 1Q6DA 1UH3A 1FWTA 2WNNA 3V36A 3ZWSA 2NQ9A 3EEZA 1A4MA 3M4HA 4WSJA 1ZFJA 4IF2A 1MXGA 1JR1A 4O1BA 1F74A 3MTWA 4DJED 4EF8A 3FA4A 1PIFA 3N2CA 1PTDA 2CU0A 4OBSA 3W75A 2ZZ4A 4MNLA 5T91A 2IKJA 1H50A 5DT7A 4AAJA 4FNPA 3GHSA 1BEUA 2NQHA 3N9SA 3VOFA 3Q67A 3CQIA 3FIGA 2VENA 4ROPA 4KWVA 3E6EA 2YL9A 1GVIA 3TYAA 2Z0IA 2RAGA 3WH8A 3FDKA 1D7KA 3NZQA 4R7WA 4W9TA 5BRPA 2DSUA 4EWJA 3K4DA 5C7HA 3W81A 3NSXA 1VHNA 1H7XA 3AMDA 3S5NA 1TMQA 3SCRA 1KCLA 4ICMA 5F2LA 4ADSA 3EWYA 1RUSA 4WK9A 4AHPA 4DLMA 2Q3OA 1YMYA 2XUCA 3WMSA 3NPWA 2WVSA 4JY9A 2H9AB 3APYA 1EDQA 2PI6A 2WKGA 4CD8A 4PMDA 1A49A 2C1HA 1QNRA 2G41A 4JOMA 4M1RA 2MNRA 1KA9F 4QR6A 4JQ1A 3EDDA 1EOMA 2GGJA 1KKRA 3WEZA 3TW9A 3IJQA 4CQ9A 2ONEA 1W1IE 3V5OA 5A5WA 4DJDA 3OZPA 3T05A 4HHMA 3SJ3A 4DLFA 3G3DA 7PTDA 3DYMA 1UMLA 1B31A 4PODA 3FY1A 1J9YA 1CX9A 3N2BA 3HV8A 3WQDA 4BS0A 2PP0A 2OEMA 4RDVA 4A21A 3PUOA 1NWRA 3VNKA 3V5CA 5CPMA 2D73A 2XVGA 4LUTA 2QDEA 5ABHA 1XGDA 4L1GA 5D03A 1UKPA 2J4GA 4JDYA 1G7VA 3W1XA 1CENA 3K46A 1ZB5A 7ODCA 1XLGA 3M43A 4UFKA 3ZLHA 1PL9A 2Q8LA 1JVNA 4HU0A 3R79A 4M56A 1RA0A 4JNYA 1VIWA 1CLXA 1Y65A 4F0RA 4US5A 1DQUA 3BAWA 4B5SA 1HVXA 4S3AA 2FVLA 3BCJA 2HRWA 2DGAA 1TJPA 3VKJA 4UFHA 5LA2A 4I6VA 1K7FA 2FVKA 1JIBA 1QASA 2D2JA 4RCXA 3SCTA 2D2HA 4D2JA 3ZMRA 1ZQ5A 3KWXA 5DRIA 4FMVA 4X0NA 1FOBA 3RLHA 3S2LA 1BWLA 1UJQA 1JZ5A 3RLGA 1CGXA 4J9JA 1U1HA 2Z24A 3HQ1A 3DOPA 3E2RA 1P6BA 4I7UA 1GOMA 1DWFM 2PBGA 5HBFA 1TIWA 2YCLA 3BGGA 5FJJA 4M7SA 2PF0A 4F8XA 1IXPA 1GOKA 1OYAA 5I2UA 3WDRA 1WDSA 4MB5A 4HPXA 3BE7A 4Q4PA 4TX8A 1AZ1A 2HVMA 3NXLA 4V1YA 3AFBA 4TR9A 3ZVHB 4AMAA 2ISVA 4IPIA 1VYPX 1XSJA 4CN1A 1C92A 3P82A 4MNJA 1FHLA 3BZJA 1K9TA 4RE4A 5C2CA 4IPJA 3DN5A 4XZBA 1W9BM 2NQJA 3ABSA 3DEQA 4GFIA 5CJ5A 4REQB 1F5ZA 3QV8A 3H4GA 1AZ2A 4ONVA 1TUXA 2PWVA 2J88A 1CZ1A 3W28A 4CU8A 4DX3A 3QSRA 4MSSA 4V33A 1XFBA 3ITLA 4AWEA 2P8BA 1F9CA 1FXQA 5DCEA 2VCBA 4DWDA 3LGDA 1KXHA 1ZRQA 4NF7A 1OGBA 4QLLA 1F76A 1IEWA 4KEVA 4W89A 3MC5A 4KCVA 1ZGDA 5CZ0A 2GQ9A 3TJXA 4EE9A 4I8DA 4UR8A 3AISA 3O8AA 5D30A 2Z1KA 3PNZA 4QJ3B 3MKKA 1KKOA 1EYWA 1L2QA 1RCXB 1FXPA 2VFGA 3T9PA 4G56A 3CLWA 3QMSA 3G0UA 4DZHA 4JHMA 1WDPA 4FR6A 3S2NA 1A5KC 5KSWA 2ZQ0A 3STFA 3ENLA 3H70A 1UKQA 3CT7A 2Z4GA 3XIMA 3GXMA 3NL5A 3KVJA 4FR1A 5DY3A 1UB3A 4H7CA 4I6KA 4PTVA 1I45A 4W7UA 1RALA 4GYPA 4IM4A 4JYDA 5CJMA 4X2PA 1O6IA 3NM3A 4XD3A 5REQA 1R6WA 4IGSA 2HNHA 1V6TA 1DXEA 3O9NA 1KWGA 2VL4A 2OEKA 5FF4A 3CC1A 3R2GA 2C1IA 3UG3A 5J8LA 5GNYA 3MA8A 1TJRA 4Z1BA 3VDHA 2ZXAA 4Z42C 4GYJA 2H6RA 2R8WA 3O06A 4FF5A 4BI5A 3UPBA 3SB0A 5F7UA 2OPJA 2VJXA 4UOQA 2UWFA 3ONBA 1RD5A 3H53A 3H2OA 1S2UA 4PL1A 3A24A 2GYIA 4ERIA 3TU9A 1TPB1 3UVAA 4FIQA 3ABRA 1XPYA 3JR2A 1CIUA 1UA7A 2I17A 1W1VA 1OM0A 3A9IA 3K2GA 3UA3A 4KFOA 3WDPP 3SN4A 4E8GA 3V75A 5AFDA 1VPQA 2CBJA 1KGUA 4A29A 5CEWA 3W29A 4WOZA 4I5UA 1GG0A 2Z26A 4BHYA 1OEPA 3O2LA 1JZ2A 3LK6A 2QJGA 1ZBVA 2G95A 1DHKA 4ML9A 2X1UA 3GBEA 4MMWA 4IX0A 3QZEA 1PIGA 2WC7A 4Y9PA 4UTWA 2QW5A 3IV3A 3M0ZA 3C3NA 4HU3A 1XR2A 4A3QA 3ZT6A 2YDRA 4ZBCA 1PEZA 4N6EA 3MB9A 5L6UA 4Q8VA 4LVBA 4CNNA 5EFFA 3VK5A 3LS9A 4UFMA 1YADA 3CV1A 4OUEA 2C13A 4FF7A 5GPRA 8XIAA 3W25A 4DIAA 3B8SA 1GWJA 1B3ZA 3CL8A 2CLHA 3F4NA 3TWAA 6TIMA 1X1ZA 4LOCA 4MB4A 3VDGA 1XGZA 3R94A 3UG5A 2A3LA 2X1RA 2C7FA 2C71A 2IPGA 5FD0A 3MVTA 4PCSA 3KBSA 4AIOA 1TPFA 2AMGA 3AIEA 3SBFA 1GVSA 1R47A 4IJCA 3FYPA 4IIGA 2VC5A 2PTZA 3NSMA 2E5CA 2P10A 1F8MA 4QROA 3F2BA 2I9UA 5A6KA 4M19A 4G2DA 1NM9A 1KFLA 3D5HA 3VNLA 1XW8A 2PWUA 3IARA 3OA3A 1N7KA 1BTCA 5CGQA 4UQCA 3WLHA 1BRLA 3M5ZA 1EGMA 3G2GA 4FLRA 3W2JA 5AC8A 4NNAA 2BV9A 2OT0A 4Z0JA 4PBFA 2R1PA 3VX0A 3UZZA 2RUSA 4PMNA 2D3NA 3E38A 1JYWA 2G3NA 2GVYA 1D8WA 4O1AA 1RPXA 3T40A 4FX8A 3DG6A 1D8CA 3QSTA 2FZ9A 3V7PA 2J27A 4IFOA 4IP5A 1RZMA 3LHTA 3M0YA 3VIOA 4Z17A 3DFYA 2Z1BA 3QV6A 2R91A 1AODA 1G6CA 1PDYA 3LENA 2QCDB 1JDAA 2XGBA 1BWKA 2OYLA 2E1DA 2ZADA 2O4MA 3RFAA 1JAEA 1UUOA 3MUCA 2IKHA 1QHZA 3ZLGA 1VFSA 2GWGA 1Z48A 3TOPA 1J0JA 3DDMA 2XH0A 3DHDA 2B7NA 2UZ9A 3PAJA 4YCPA 3DAQA 4XQ6A 2X42A 5CXPA 3T0CA 5JBEA 2DVUA 1QW9A 2EO7A 5HWJA 1J4EA 3LG3A 2A3CA 2ZUMA 1OFPA 3VILA 3ZJ7A 1K8CA 3M6YA 5ABGA 1LT7A 3F4VA 2DVTA 2ISFA 1DIOA 3UXLA 4FS9A 1TO3A 3M07A 3R6IA 1C3FA 1W1ZA 3LRMA 3NQVA 1DQWA 3F2CA 3DFSA 3KX6A 1UWUA 3RG6A 5JIPA 1SZGA 3BV4A 2A1YA 2X0YA 2Y5JA 2ZE0A 3R8RA 4GABA 2OYMA 3ZOAA 2Y4SA 2QUUA 3UR5A 4WKHA 2Z27A 1S1RA 4HOWA 3A3HA 2HVOA 4ZFMA 1Q7QA 3FVDA 1FWIC 1WDQA 1TE6A 4JICA 1KRCC 2POZA 3W74A 4IGNA 3W76A 3KS5A 1S3TC 2W4XA 5HAOA 4Q8OA 1NFBA 4L4PA 2BNJA 3GIPA 4LS1A 3MZNA 2B0MA 3D47A 3SQMA 4YLWA 3NQ7A 4RV3A 3AS3A 1S2VA 3MDWA 1C7TA 1JZ3A 3SRDA 1E4LA 5DBTA 3FKKA 4XAPA 3GNPA 3CZEA 3CU2A 3P93A 1PE1A 4PMVA 2J25A 4K7YA 2Y85A 1I2QA 1V03A 1NDVA 2CLPA 5HDRA 3URQA 4H9VA 4RNJA 2WLZA 3VC5A 2AKZA 1LP6A 3G8RA 1AMKA 1S3HA 1TWIA 3G77A 2C14A 3IACA 4MZ8A 5XIAA 3G18A 2RGLA 1DJXA 1W91A 1VFLA 1NOFA 3NOYA 5I79A 1VJZA 2P88A 2VGBA 1Z41A 3LRLA 1J2WA 4XO6A 1XH1A 3RMEA 1XLDA 4HKPA 2VFIA 3AS2A 4GD0A 2XDFA 4XZHA 5H91A 1CECA 3NZRA 4URIA 1O94A 2R14A 3LZ5A 2QGYA 5FJUA 4K7VA 4JTSA 1ISXA 1YXCA 3EYPA 5I09A 4MADA 2QJMA 1E4MM 4DO7A 4HZMA 3W38A 4L4MA 5HULA 1P4CA 1R9XA 1PAMA 2DZSA 4NJKA 1QI5A 3I4EA 1B30A 1QHPA 4UNKA 3EOEA 2ZOXA 4JTKA 1TWZA 3AWNA 1B3OA 3PJXA 3WLNA 3VNMA 4R7OA 3WLTA 1A5OC 2B4GA 3GWQA 4UCGA 5JH1A 1H49A 2PWGA 4I9AA 4DYJA 4NVTA 2BG5A 1CXKA 4C6DA 3AZRA 4LB4A 2QIWA 4WHBA 2PTWA 4HPHA 3E0WA 3WK2A 3MI3A 3T78A 1Z8AA 3WENA 5EY5A 1HKVA 2CNCA 4D6GA 4J28A 3TTEA 4H9UA 5FF2A 3GNOA 3QQ0A 3TROA 3W7QA 3PTMA 2HZGA 4L9YA 1RY8A 4BF7A 4JTJA 1WQ5A 2OEJA 5IBXA 1TV3A 3H2EA 4GG9A 4O54A 4U31A 3RCMA 3PNUA 1RLDA 3CWOX 4W88A 4DPQA 4OE7A 1SJDA 5FEWA 3IS4A 1J5SA 2Z7GA 5M17A 3BG3A 3W72A 1UKSA 3KRSA 2QMJA 2NV1A 3LHYA 5IHRA 1QOXA 5DXYA 4FK9A 2QYGA 4J3XA 3ME3A 3HPSA 3H54A 3WELA 3CZ8A 1XLFA 1K8ZA 4DXXA 1QOQA 2ZXQA 1M3UA 1AW2A 2O9TA 4O50A 4AH7A 1WZAA 1K77A 5CLWA 3KHJA 2I16A 1J96A 4C6OA 4GISA 3HG4A 3N6JA 1WE5A 4O8AA 3SSJA 3W85A 3CQJA 1L0PA 4PMRA 1DQXA 3SJNA 2OGYA 5FJRA 1ZJHA 2WB5A 1FTXA 3MBFA 2NZLA 3SR7A 3TQVA 3JZEA 4DJFD 2E3ZA 3K13A 3BJTA 3EWZA 2Y24A 3AU6A 4KMQA 2CERA 2FJKA 5JBDA 1NFPA 3GO2A 1W54A 1RBOB 4FP1A 1JZ7A 1T8QA 2WZTA 8CGTA 4GVGA 3VNZA 2G3FA 4P7OA 5G5IA 2NXGA 1F3WA 5DCDA 3VM5A 4E2VA 5CPNA 3G6LA 1UH4A 1PDZA 4YU1A 2QF8A 4R7JA 4K1WA 3PK7A 1FWAC 2GJPA 2WBGA 4GGHA 2C19A 4NXSA 3S1VA 3WD0A 3JVAA 7XIMA 5M2FX 3A21A 1HX0A 4J2MA 1SQ7A 3BURA 3GBDA 3DECA 2CWXA 2GOUA 1QO2A 4Q8WA 4HK6A 4UQBA 5A8NA 1A0CA 3S9YA 1G01A 4WY0F 3IK4A 1JQVA 1XHGA 3G1DA 2V3EA 4LS0A 3AXHA 1NIUA 5FOOA 4K8EA 2WPBA 4Z1AA 1WAWA 2A21A 4UTTA 1SZFA 4XBSA 3KTSA 2HPIA 7CGTA 1KFBA 1MI3A 1OCBA 3LTYA 1XRFA 1VC4A 1KFKA 1TCDA 3PSVA 1K7XA 4GINA 3A13A 3CUGA 2PDFA 3OA5A 4ZODA 5K7JA 1NAL1 4A8LA 1PIIA 4J3WA 5C9ZA 1EO5A 4TMBA 1DE6A 1TMHA 5TD4A 2BVYA 4C65A 2X1IA 3ARUA 2CPUA 3PZGA 1ZCCA 4UTUA 4QQ3A 5XIMA 3LV5A 1X38A 1JCTA 4UZSA 2V5DA 2BXVA 3MBDA 4S1FA 3UP8A 4LVAA 4NNCA 1TVLA 3EOLA 1OK6A 4JIEA 2VR2A 4H04A 3LHWA 4DWSA 3TA6A 1KRAC 1GQLA 5TIMA 1SW7A 1W6TA 4PUKA 1VJIA 4JY8A 1M04A 4DJEA 1X96A 3H24A 3EA3A 1OCJA 3WFAA 4AF0B 5EFDA 5A94A 2ZRYA 1EX1A 2ZDRA 3GVRA 5E0CA 1J12A 4C6KA 1UPPA 1F73A 1KM3A 3W22A 3GH4A 1FDYA 2Q6ZA 1P0BA 1AJ2A 3OP2A 3L5LA 3SQLA 4V28A 3VABA 4KGJA 4BZYA 3QYSA 1H2JA 1XV8A 3R7MA 3N34A 1FKWA 1B57A 4IPPA 4N7QA 1NP0A 5E0KA 4EXBA 3ARVA 3OYZA 1Q4WA 2ZZ6A 2EHHA 7A3HA 3BZGA 4GIRA 3BWWA 4L64A 4H41A 1DTUA 3WQ5A 5BCAA 1F3EA 3I6EA 2OVLA 3C56A 3WLJA 1TREA 2PC8A 1C8QA 2IUZA 1BAGA 3NYZA 1GOXA 2JFEX 2PC4A 4JTQA 1P48A 3NZPA 3WMBA 4LCRA 2FQIA 1UJPA 3VMPA 5FSDC 4JHZA 3AXIA 4IUOA 4RW3A 1O5RA 4OZOA 5AYYA 3VGEA 1LZOA 1UOKA 4UQ9A 1P7TA 1XYBA 1HQTA 4O11A 3KOFA 3I65A 4N0RA 1XYCA 1KCZA 2E68A 3NUKA 3QFWA 1PPIA 4DAIA 2F2KA 3WJSA 4GA8A 4M6QA 1J2BA 4ZOEA 3SSZA 4Q8UA 3GVQA 4BF9A 1JYNA 1YPXA 4FSAA 3K30A 4PBGA 2XVNA 3CZKA 1EF3A 5BYWA 3UJSA 1ESWA 2GZXA 5CBBA 4C7FA 2ZX9A 2PDKA 3WNKA 3FS2A 3QC0A 2VFFA 3LPOA 4W86A 4MY8A 1GVOA 3BLEA 4HNVA 1XLKA 5C8BB 4FLQA 3IVUA 4MJMA 4LX4A 3U48A 3UVIA 3THQA 1I4NA 4P61A 4F0KA 3N12A 2FMOA 2BZNA 4N02A 4HPNA 2YA2A 2QCEA 2EGZA 1QO5A 5FACA 4ZCWA 3KS6A 3TC6A 4LV9A 3DKLA 2DT0A 2V63A 2ZVRA 5I3DA 3NA8A 5K9DA 3S1GA 3RIKA 4DM2A 3VD5A 1TX2A 2DIJA 1OYBA 4Q4OA 1BFNA 2OOGA 1HJXA 4S3JA 4UFJA 2REQA 1LRNA 2Z1XA 5I3GA 1VCVA 3MMDA 4LYQA 4DUOA 5EKYA 2IKGA 1QPOA 3FSUA 3NPVA 4JQAA 4MWAD 2I56A 4EAYA 2BVDA 4RNFA 2ACUA 3BQ6A 3GM8A 2VC6A 3QY7A 2VWSA 1XRVA 2I5QA 3DHFA 4GZ7A 1XDJA 5D32A 2YBVA 4PL2A 4Q32A 4B5XA 1CYGA 1FWFC 4IWWA 3TDFA 1Q8AA 4A3HA 2RFGA 3W73A 1V6UA 3EB4A 2VC9A 4G7FA 1BTMA 1CPUA 3WDJA 2ZZ1A 5C9XA 4IFKA 1GKRA 1O7AA 3VYLA 3PULA 4DJDC 3P3BA 4AZ7A 1K8YA 3LUTA 3OW1A 3HFTA 3EKGA 1CLVA 5CC6A 3RLUA 5EBAA 1AQHA 1K4GA 4I3GA 1UBPC 2D69A 1WO2A 2PGWA 3GD6A 2RDWA 2VDGA 4UTMA 3VIHA 2X2GA 1ZAIA 1XKJA 5C2XA 2PDWA 4DF1A 5F4SA 1Z42A 4H9TA 5I03A 2XWDA 1O1HA 2F84A 1SSDA 2GVJA 1Q2RA 1JPKA 3PBVA 2HBVA 5G4EA 4IFKB 3CWNA 5HNUA 3LYEA 4Q4MA 1U5HA 1N8FA 2DZWA 3CM4A 2FVMA 4D9PA 2OWCA 1VH7A 2C1GA 3TH6A 3WQOA 1JNDA 4H6QA 3GZ3A 3FFSA 3W7LA 1EDGA 5LHEA 3VOCA 3WUBA 3ARPA 1YDYA 1P1MA 2QAFA 1JGMA 3TYDA 5IFTA 3Q65A 2X30A 4Z2KA 1UA3A 2DUAA 2HQAA 4NJIA 1KR0A 3STPA 3WH6A 2I5IA 1JCLA 4LF1A 1AA1B 2GDQA 4ZL1A 4JTDA 1WKEA 1W5NA 3T44A 3IIVA 3ZT5A 2QCFA 1GJWA 1RLCL 1DL3A 3ANVA 3TC7A 4HJWA 1LYXA 1GVQA 1J79A 3WMCA 2VRKA 1UR4A 3MP3A 5CC7A 5H8UA 4AWTA 2XJ7A 3A3XA 2XG9A 3E2VA 2YW4A 4AD0A 3WBAA 4KEZA 3GUGA 1VJSA 2VRJA 1VRDA 5E9AA 4B15A 4RL3A 1A47A 4GNJA 2GSHA 2CEQA 3Q4DA 4IISA 4JKLA 4QITA 3EDFA 4HU4A 2VO5A 2QCNA 3KP1A 3W53A 1FCUA 4S3KA 3WKZA 2CZFA 1ZUAX 3VGGA 1G4SA 3TCSA 4GMEA 4PN2A 2INEA 4DXKA 1DIKA 2QPSA 2XU2A 3IJ9A 3R25A 2AOSA 4UR7A 4B4FA 1M7XA 1L6SA 1LCOA 4A35A 1DTNA 4PMQA 2W62A 1YDOA 2VP8A 2OMAA 2VDHA 1RJQA 3B06A 3IJ7A 2J9YA 3U4AA 6REQA 1JULA 3MYPA 4TO8A 5CGTA 1Y8BA 2DIEA 1PB0A 3S46A 3GXDA 1TZ9A 3TQ0A 2DT1A 1GPFA 1ZJIA 1VAHA 6XIMA 4L6HA 1U2YA 4CQ8A 3UNDA 1R3TA 3U2OA 1Q6LA 1NOUA 1DKWA 1QJWA 3CTTA 4FOUA 3RMJA 4C6FA 1OZQA 3IJDA