1AZ1A

Alrestatin bound to c298a/w219y mutant human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az1A00
1Q5MA 2ACRA 4PUWA 4XZNX 4JQ3A 4DBUA 5JH2A 2PDHA 3M64A 3QKZA 2IPJA 2PDLA 3UGRA 4HBKA 3LQGA 1UR3M 3UZYA 4PUUA 2ACQA 1PYFA 1YE4A 2FVLA 5DANA 4JTRA 2PD5A 4JQAA 2ACUA 4DZ5A 4WGHA 2DV0A 3WG6A 4GACA 4H7CA 1PWMA 1IEIA 2PDKA 3R58A 4XAPA 4JTDA 2PDYA 2IPGA 4WDXA 4JTAA 2BGSA 4R9OA 1OG6A 2F38A 4FA3A 5M2FX 2ALRA 5HNUA 1ZGDA 2FZ8A 1EKOA 2FZ9A 2HVNA 3MC5A 3O0KA 4L1WA 1X97A 3MB9A 3T42A 4YVXA 1PWLA 1HQTA 2DUXA 4WDWA 2PDUA 2PD9A 5HNTA 4XVEA 1GVEA 4JQ2A 4IJRA 1XF0A 3BURA 3KRBA 1K8CA 3V36A 4FAMA 4IGSA 4H8NA 1MRQA 3LN3A 2PDPA 4YS1A 4EXAA 2PDXA 4HMNA 5JH1A 1IHIA 3WBXA 1Z8AA 3CV6A 3O3RA 3CAVA 3R94A 4XVDA 4GQGA 4MHBA 4ASTA 4JIIX 4PRTA 2C91A 4JTQA 4XO6A 4XZHA 3H7UA 1VBJA 3WBWA 1EXBA 2INEA 4QBXA 1AH3A 3F7JA 1YNPA 3UG8A 3DOPA 1R38A 3G1RA 1S1PA 3BCJA 4JIRA 1Q13A 2IKJA 4FALA 2WZMA 4F40A 3CASA 2J8TA 2IPWA 1RY0A 3ONBA 3CMFA 3R7MA 2INZA 3ONCA 3GHSA 2IKGA 3WCZA 2HV5A 2I16A 4LBRA 3UFYA 2PZNA 1S2AA 2IS7A 3H7RA 4RPQA 1QRQA 5LIKX 1LQAA 2HDJA 3LNMA 1X96A 2R24A 2F2KA 4JTCA 4OTKA 1X98A 3VXGA 2IKIA 4LAUA 2PDMA 3EAUA 1PZ0A 4WDUA 3V0UA 1YE6A 2PDBA 2PFHA 3LD5A 2IKHA 1AZ2A 1ZUAX 2PDGA 1FRBA 1T41A 4DBSA 4Q3MA 1C9WA 1JEZA 2DUZA 3LZ3A 4ICCX 4LAZA 4ZFCA 2PDCA 2WZTA 4GA8A 4GABA 3GUGA 1AFSA 2PDWA 1VP5A 1S1RA 3C3UA 3CAQA 2PDFA 1US0A 2BGQA 4JIHA 4LB4A 1EF3A 2IPFA 4LB3A 4XZMX 3N2TA 4PR4A 2AGTA 5LIYX 1Z89A 3LBOA 4EXBA 2PF8A 2ACSA 3FX4A 3V0SA 3COTA 4XZIA 4PRRA 2HVOA 2FZDA 4XO7A 3RX2A 4I5XA 3LUTA 4NKCA 2P5NA 3G5EA 3H4GA 1MI3A 2A79A 2PDQA 4AUBA 2HEJA 3GHUA 3LZ5A 3WBYA 3RX4A 3M0IA 4GCAA 4DBWA 4WDTA 1EL3A 2PDJA 2VDGA 5C7HA 3Q67A 1XGDA 4WEVX 3U2CA 3DN5A 3B3DA 3Q65A 2NVDA 1HW6A 2NVCA 1XJBA 4LBSA 3UZWA 1ADSA 3UZZA 5KETA 2CLPA 3EB3A 2BP1A 2QXWA 3R6IA 4FZIA 3M4HA 3LQLA 4GQ0A 3S3GA 2HE8A 4Q7BA 1YNQA 1M9HA 1Z3NA 5AZ1A 3LEPA 3V0TA 3UZXA 4L1XA 3P2VA 3UP8A 1AH0A 2HE5A 2IQDA 4IJCA 3UYIA 2FZBA 2I17A 3FJNA 4G5DA 1RALA 2IQ0A 1AZ1A 3BUVA 2ISFA 2PEVA 3BV7A 5AZ0A 1J96A 3EB4A 3UWEA 5HA7A 5LIXX 4JQ4A 4PMJA 4YU1A 2PDNA 4XK2A 3CV7A 4QR6A 1PZ1A 1LWIA 4YVVA 1S2CA 5LIWX 3ERPA 3N6QA 1T40A 2PDIA 3GHTA 1AH4A 4WRHA 1RY8A 3R8HA 1MZRA 1SM9A 3R8GA 3V35A 1QWKA 3GHRA 1Z9AA 4XZLX 1A80A 4QX4A 2FGBA 3NTYA 3R43A 2R9RA 4GIEA 3D3FA 1ZQ5A 5LIUX 4YVPA 4JQ1A 4QXIA 1ZSXA 3RX3A 3LENA
chains in the Genus database with same CATH superfamily
2QULA 1VFLA 4JIEA 1O95A 4D9PA 1H2JA 1I8JA 2QVHA 3WENA 1JUKA 2IPJA 3F5KA 3ZJ6A 3MDWA 2RUSA 1FWNA 3NO3A 4RUBA 1J9YA 3TJIA 4LYRA 1UD8A 5EFDA 4LS0A 2ACUA 4OVXA 4AEOA 3RDKA 3LBCA 4NF7A 2YA2A 4LRSA 4Y9NA 2RDUA 2GGIA 3DGBA 4EF8A 3ELFA 4L9XA 3GYCA 3HG3A 4NJHA 4PL1A 3W29A 3WD3A 4AZCA 5I3DA 1FUYA 4ORMA 5TQLA 1ZHAA 4C7DA 2TAAA 2ABBA 1A49A 3VCRA 5A8MA 3V7PA 1DQXA 3GH5A 2V5CA 5HBFA 4L1WA 3T42A 1FVPA 4YVXA 2PUZA 4LTSA 5ENLA 3W86A 1VEOA 3NZGA 4H04A 4QTGA 4RDZA 3VIFA 3GZAA 4UR8A 1KLYA 1OADA 4W93A 3I6RA 5DX7A 4LUYA 3C2RA 1QPNA 2AKZA 3IJLA 3HPSA 4JN8A 1EIXA 1V3JA 2NX1A 4RNFA 1ENUA 1KBIA 1M03A 1ZBCA 3NDYA 2GQ3A 3QTPA 1QAPA 3S1WA 4BI7A 3PJTA 5D30A 3WQOA 3ZLHA 3TX9A 4D2JA 2VD9A 1P6BA 3DHFA 1ZENA 2OFJA 2GK1A 1IR2A 1XD1A 3O3RA 5HOSA 4LWWA 2DVTA 1LL7A 3DZ1A 4AB4A 2WJDA 5D8ZA 4EK7A 4I9MA 5C2CA 5T8GA 3RJXA 2Z26A 3PPFA 5FI8A 5CSRA 2ZRZA 4QE1A 2INEA 4QBXA 4QITA 2WB5A 3ZT5A 2XWDA 1PV8A 5D03A 4D72A 1S5VA 3LK6A 4OV9A 3RU8X 4UFJA 1VGAA 2VO5A 3BH4A 4GI6A 1DQWA 3BCJA 1SUXA 3SCNA 5C0QA 2EG6A 2J25A 3OBEA 4GZJA 1U5VA 3QLDA 3ABQA 1DJNA 4Q4KA 7CGTA 2AMXA 4AW7A 1ZB5A 3SUTA 1VBRA 3HO8A 4XV0A 1AUSL 3R2GA 2IS7A 2R94A 1REQB 1EUNA 5HUOA 4P8UA 3H21A 3SRFA 1X6LA 3CUJA 2GWGA 5DY3A 1IXPA 1X96A 2R24A 2P76A 5E6ZA 3W53A 5A8OA 1IEXA 2YL8A 2WVUA 1D8WA 1JCNA 3L66A 4B90A 4DWSA 4ZXOA 4GKTA 1DWAM 4CD7A 4D8LA 1WXZA 3SGGA 3NYDA 1JDDA 3QSTA 2PU1A 3SUUA 1CT5A 4H19A 1C9WA 3H4WA 4O54A 4TMCA 3LM7A 1CYGA 3FGCA 5DMYA 4JL2A 5A6TC 2GJRA 5CPOA 2YL9A 2XFYA 1OC6A 1EF3A 1QPQA 3KFTA 2HNEA 1J01A 2BVWA 2F6UA 2XU2A 1N8FA 3MS8A 5IXEA 4OECA 1F3WA 1IE7C 5EB8A 4HA1A 3MKVA 1L0PA 3QEZA 4H01A 1XL9A 1XSJA 3LHTA 2GDVA 1HL2A 3C61A 3PBVA 3M47A 3DERA 1UC4A 4GQBA 5FIPA 2QDEA 1FXPA 3WJWA 4E6MA 4L6DA 5KZMA 4UTHA 3W38A 1XLLA 3RMJA 1OX4B 1MQRA 2QEZA 5CAKA 1OY0A 4QS5A 5DQPA 2OEKA 4M24A 3TYCA 3FEMA 2JEPA 2HEJA 3DEQA 3LX9A 3GWQA 4FX8A 4FX7A 4TQTA 3RX4A 1KXQA 4KETA 1TPEA 5CXPA 1I75A 1RAKA 4OKDA 4H8VA 1U22A 1JULA 1ZCOA 4RW3A 3W26A 1HZYA 3TTSA 1UZ1A 5E70A 1E72M 3H4XA 4K7YA 4ZENA 3MWCA 3GDTA 4C6OA 2Z1KA 4NZ3A 3UZZA 4R7JA 4BY3A 3PTKA 4A3QA 1EHAA 2J24A 2NV1A 3VIGA 2XYLA 1G4TA 1EB3A 2W62A 5AY7A 3CQIA 3U48A 3DFQA 4IGMA 1FHVA 3V0TA 1W3IA 3G1VA 3KOZA 3W23A 1ICQA 3OA3A 3UBPC 3ARYA 3MVTA 1KCLA 4R27A 4S3BA 1ELSA 7PTDA 3AC0A 2VD8A 3WH6A 4XAYA 3W87A 3CT7A 4CN4A 4XSMA 1R46A 5TNVA 2RKXA 1AW1A 2GDUA 2KX9A 3MCMA 4O57A 3G6MA 4GUJA 1UW9A 4IXHA 1W8SA 3W7KA 3IGXA 3PZ9A 3BARA 5DEZA 3CIXA 1W1VA 5REQB 4N9BA 3WQEA 1WXYA 1YHTA 3EDEA 4EKJA 3GVGA 2DY3A 3TZNA 4N4QA 3QYQA 3T8LA 1BD0A 2OZ0A 3EX4A 1VFOA 2J7GA 2YCEA 3QMSA 3OHIA 3BVJA 3GFZA 3TCSA 2XGIA 3FN9A 5HANA 4XB3A 3NZRA 3P0WA 1V3IA 3WD2A 3HG2A 1WPCA 1H5YA 1HGYA 2BX7A 5EMYA 3M07A 3CZLA 2PP1A 1VYRA 5AC4A 4XZNX 3CB8A 3EA1A 1XYBA 3QW3A 4AIUA 3WK0A 1R6WA 4J9JA 4KCVA 3LBMA 3UZYA 3WQGA 3TE9A 3MA8A 3NVTA 3BPWA 2CERA 1ZU8A 3E2RA 4UTJA 3LV5A 4H9UA 1ZJAA 1H7RA 1LWHA 3WG6A 4JHZA 4FNPA 4E8GA 3W1TA 4M80A 3KVJA 3KL0A 2P0OA 3E3HA 3SCOA 2J74A 1PHWA 2IPGA 1KRAC 2OWXA 2DVXA 2BGSA 2DZWA 4FXJA 5D8WA 2WW5A 2DT3A 2F38A 4ZSTA 1DE6A 2BVYA 4BQ3A 2HS6A 4HNCA 4KWSA 1XRSA 2CFFA 4CNSA 3BANA 4C6CA 4CVWA 3A21A 1TMQA 1AW2A 2VFHA 5EGRA 1R5YA 1TIMA 2BY0A 2OWCA 2ISVA 3FSUA 1QI3A 4HSHA 2PGFA 4ZSUA 3K2GA 4E3TA 1WQ5A 4C1NB 3ENLA 3V36A 4H8NA 3NZQA 1M1BA 1JRCA 2E1WA 1I6NA 2FYMA 3OLIA 4HPHA 1OX5A 2PSNA 1GYNA 4EXAA 1P6CA 3WF0A 2OXNA 3H23A 1OCBA 4GUHA 2JIEA 4MHBA 2W63A 4JTJA 1E5JA 1V08A 2QLYA 2ZE3A 3LI1A 4MTVA 4PMQA 2WNQA 4XZHA 5BXRA 2B0MA 4TVUA 1RBOB 5CPNA 3EX2A 1NSJA 1TJ0A 3TW9A 3U7BA 1B1YA 2INFA 2QGHA 2ATMA 1XLCA 1J8VA 4ZB5A 1L8PA 4G6CA 1HO4A 3ANUA 4LQ1A 4LFYA 3RYSA 4R5EA 1UPMB 2FB3A 1JFHA 3G1DA 3HG5A 3VUPA 3AI0A 3ZVHB 3AYSA 2I16A 3BLEA 1V6YA 5LIKX 4K1GA 2HDJA 1QO5A 6TIMA 2C1IA 1QPOA 2C14A 3QGVA 2XH2A 3RM8A 1TTPA 2Y5JA 2DZPA 1QVBA 1PKMA 2R82A 3PUGA 3M43A 4XTIA 2FJKA 1PE1A 1LORA 3MZNA 1JXJA 3STPA 4ENLA 4YXGA 3N73A 1XPGA 3WBEA 1XHGA 2Q8ZA 2TODA 1BQGA 3PBUA 1G4SA 3SM0A 3NQMA 2D2GA 3WK1A 2Q3OA 2PLMA 3M5YA 1XBVA 4W8LA 4K36A 3NWRA 3GY1A 4ONVA 4GJIA 4KEMA 4XISA 2VC9A 4PRWA 4J3ZA 3PHAA 2ZQ0A 4N7QA 1MXSA 1GJPA 3MI6A 3WQ5A 1ITCA 2WVVB 3LGEA 5LXEA 4HNOA 4WZHA 8RUCA 3NA8A 1S2WA 2XN2A 4IIEA 4JNZA 4ZO8A 4UTUA 2WSPA 2WMFA 2P5NA 3EWZA 4MG4A 3M0VA 4V1XA 1M68A 3SAZA 3TN6A 1TJPA 4E38A 4UQCA 4Z2HA 4H6EA 3E96A 2DT1A 4J3XA 4FLOA 4AU0A 1TIWA 5FAJA 1EJUC 5A2AA 1PUDA 3E38A 1MFUA 2UY5A 3QC0A 2G3IA 1KTBA 2PS2A 3VKAA 4ZGYA 4XG1A 5LNVA 4JFTA 1CGYA 3WK2A 3BLIA 1V6VA 3NQGA 2VOTA 3P82A 4HMEA 2PAJA 2XVNA 5BRBA 3HV9A 1VRXA 2ZBTA 1GGOA 1FP8A 5BU6A 1BTMA 3QR1A 1CTNA 2PC8A 4PL2A 1C7TA 3BOXA 4XQ6A 1I1XA 4CVUA 3ABXA 1Z6KA 3WJSA 5I3JA 1YNQA 3W02A 2ZWYA 3HV8A 4JTIA 4PUNA 3UP8A 2CLFA 1J0ZA 1AH0A 4K1WA 4AZ7A 4PMNA 1TPVA 3KCJA 3AROA 4IJCA 4DYKA 1W1B1 1YXDA 3QW4B 2I17A 2Z2AA 1JF5A 4RKAA 1EJSC 2IQ0A 3DHDA 3HQNA 4QRNA 1GOQA 2CPUA 3T9PA 2VFGA 4Z2GA 5CJNA 4FIRA 4MGGA 1F8MA 2G3JA 3HG4A 1KR1A 1UD4A 5HWMA 3ARTA 3PUOA 1JXKA 1V3LA 2VENA 4HTBA 1B3VA 3ZO9A 2QDGA 3MO7A 3FYOA 4PSRA 1P1XA 3VNLA 1MFVA 2J4GA 3ERPA 1QI2A 4HTYA 3VCNA 5BCAA 3BGJA 3TYUA 3EKGA 2WPBA 4G7EA 2WMKA 3W7HA 5C8BB 3BG5A 1FH9A 3P5YA 1JPMA 1XM3A 1FWCC 3A3HA 1NWUA 3JW7A 4B5VA 4AZ6A 3CPRA 4AZCB 2V81A 1V0MA 1M01A 1ITXA 3WLHA 2X1TA 4N42A 1NVMA 4XZLX 4Q8PA 2FGBA 4QDWA 1IWAA 4JTGA 1IWBA 3EWYA 3M0KA 1UCWA 3EOEA 3UVAA 3TLQA 1E9IA 1I1WA 4CD4A 3UU0A 1F76A 2YBUA 1NQ6A 2VFIA 4LGXA 1K8XA 3HQPA 3MT1A 4BCEA 1ZBKA 4ADUA 3LSBA 4F8XA 4QAIA 1MQQA 1VJIA 3QHMA 3PZUA 1P1MA 3QKZA 2QR6A 3W27A 4NJJA 1IT8A 3RCMA 3N14A 3RPDA 1ZALA 2ACQA 4K39A 4F0SA 4GD0A 4L4LA 2J8GA 1PKLA 2Y5SA 2C8NA 1B3YA 3DYMA 2DV0A 3TYDA 2KAUC 5IHRA 2GK1B 1YLVA 4F48A 5GQBA 3E0LA 2Y5EA 1TVPA 5BOOA 1BSLA 3MVIA 2CW6A 3LRLA 3ZMRA 4WDXA 3DBPA 1V3HA 3JUGA 1HNYA 1PKYA 3NCOA 4H7VA 2OZ3A 4N4PA 4OV4A 3D46A 5TD4A 1P0NA 1YPFA 1XYLA 3BW2A 3PN8A 3W81A 4ZXLA 4D71A 1TPWA 4JL1A 4F0RA 4GISA 2PF0A 3E2SA 3IJDA 6CGTA 5F4XA 1V03A 2A3LA 2J6VA 4QG6A 2ALDA 3M7SA 1OIMA 4FAMA 3FKKA 1UWSA 2HWGA 1UKOA 3LGDA 3RU6A 4O10A 3LN3A 4BEUA 1UG6A 4ACZA 3QPYA 3F4DA 3VX0A 3VKDA 2A3EA 1W3NA 4L4OA 2PDXA 1PX8A 3CV6A 3BAKA 2E25A 4PFMA 1RP8A 2WOQA 4X61A 2AAAA 3MI2A 3GVVA 1XKYA 3RF9A 3C6CA 4G7FA 4XZBA 4DWSB 2Y2WA 3RJYA 1EXPA 4BFAA 3PFRA 3WNMA 4DZHA 3KOXA 4TV6A 3CAKA 4NYUA 2C7FA 3TR2A 3KRZA 3TYEA 2CESA 3FGCB 4FLQA 4GHRA 5A6MA 1Q13A 2DP3A 3XISA 1H3GA 2J7DA 1HFBA 4Q4SA 4INFA 3AXKA 1JI1A 2QUMA 3LHWA 2EAWA 1W5NA 3R7MA 3W2NA 1ZPTA 2DEPA 2ZVIA 3GG1A 2JQXA 1UR0A 1W5QA 4Z1DA 3GIYA 5EKYA 3ZLGA 1OFEA 1NFGA 3WJZA 4GKLA 1QRQA 3AMDA 1V3KA 1U1JA 3IVUA 2GL5A 3CUXA 1UB3A 4U2ZA 5M17A 2C16A 1UQZA 4B4HA 2VQUA 5J04A 1JD7A 5I77A 5CGQA 5AYIA 1OGSA 3BZJA 2Q3RA 2J9ZA 5I7GA 3DG6A 1XUZA 3KUMA 4KWUA 3MDUA 2PFHA 1GYMA 3LD5A 1OF8A 8XIAA 2IKHA 1AMYA 4X22A 1GVSA 4C6QA 2V5JA 4DXKA 3UPBA 3AWNA 4AEFA 3O63A 5EMLA 5BRPA 1CLKA 3UJRA 2V2HA 4B5TA 2QPUA 1SGJA 1VP5A 5HJYA 1KRBC 3URQA 4PCPA 4Z2LA 2BHZA 1OEPA 3TC7A 1EC7A 3WF3A 2ZXDA 3QOKA 3MSYA 2E5CA 1JJKA 1CNVA 1JCXA 4A05A 5F2LA 2A5HA 4ZR8A 2BMBA 4FF7A 1YIXA 2Y0FA 5LXXA 3CU2A 3CUFA 4UTFA 5LA2A 4EWND 5G4EA 1XIHA 1RUSA 1S38A 1TV7A 5C54A 4NYYA 2B81A 4W7VA 3CT2A 3THUA 4WJ8A 5G1YA 3WFZA 3UETA 4ML4A 5AKQA 4RL3A 1KFCA 3EDJA 2W27A 1UD3A 1EO5A 2XSAA 1J0HA 4DO7A 4CCDA 4DWSC 2P50A 4XAGA 1RCOB 5E93A 1KR0A 2W66A 4HU8A 1ICPA 1MDRA 2D0HA 1W3HA 1A5SA 3N19B 3DIPA 4J4KA 2Y24A 3V1HA 4TOQA 2JALA 5A69A 3S42A 3WLNA 1EX5A 2I56A 4DAIA 4NSBA 1WKFA 2XZ9A 3KTCA 2Y7DA 5C7HA 3KP0A 3ZIZA 3KBVA 3TOYA 1O4UA 1UP2A 3B9DA 5EPDA 1ZBWA 5CPTA 4S3KA 4E4FA 1KWKA 2DSVA 1OFBA 5HDRA 4PTXA 3GRIA 4LAOA 4E2DA 5I23A 3EYPA 4ROQA 2VEMA 5FESA 1ZAHA 3H53A 1TWWA 1IZCA 5A6BA 1A5NC 1XQKA 2HE8A 2R1PA 4Y8EA 3DAQA 1HJVA 3R10A 2GYIA 4KERA 2O4QA 3SY5A 4Q8NA 2VWSA 4NY2A 2EKCA 4DLFA 3EGJA 1ME7A 1Z44A 1W6TA 2NQJA 1D3HA 1VLIA 2OG9A 4UOQA 4E2BA 1ALDA 3W2JA 3FAWA 2VP8A 4Q4PA 4Q6JA 4G5DA 3S5SA 2XG9A 5ABGA 2JKPA 1UR2A 1J12A 4RK8A 1KFBA 4C91A 1K3UA 3ABRA 1XFBA 2UY2A 4UR9A 3IAPA 4MF4A 2PCQA 5CH9A 1O66A 4YU1A 2TRSA 4HOXA 2HJPA 3IS4A 2NQHA 2V6AA 5IOBA 1BWVA 3CUZA 2HXUA 2OZTA 1TYGA 4DYEA 1HX0A 4NRSA 3WLKX 1K77A 3QV9A 4RZ6A 1UUOA 3IUDA 2KZHA 4UZSA 3WNKA 1CGTA 1F6KA 3ID7A 3LA4A 3DFSA 3VABA 5K3VA 1P5BA 1GW1A 3T0AA 1E4MM 3M0YA 3V1PA 3E74A 3W0KA 1J6PA 4JQ1A 1XSKA 5ECVA 1MNSA 3OZPA 4C90A 4NU7A 5FOOA 4GNKB 2PRLA 4KCUA 4FB7A 3AHZA 3AYRA 4LVBA 1R0MA 3NQFA 5F4WA 1EDQA 4I3GA 4MY1A 3SR7A 1H5VA 4WUIA 2Y70A 3W7LA 1R7AA 3WK3A 1UR3M 1KNWA 4R7OA 3WBAA 3QC3A 2XFFA 1V6XA 4PA8A 3LG3A 3C52A 3USZA 2YL5A 3WDHA 4HK6A 1FDYA 4JQAA 3QH2A 4NAEA 2DSWA 3VNKA 2Q09A 5K4XA 1FHLA 3AS0A 4H7CA 3C3NA 3IJ7A 1JG9A 1PWMA 4G2DA 4D6GA 5JBDA 3ANYA 1WZLA 2VHLA 4MMWA 4LVDA 2QF8A 3OGVA 4FA3A 3MMDA 5BNKA 5HJXA 2HPIA 2BV9A 1DHKA 2D73A 4M6VA 2VEIA 4DJFA 5DLCA 2A7RA 1TV2A 1WUEA 3TROA 5D05A 1XLMA 1TR1A 3IJQA 1RSCA 4P2VA 3S1UA 4ZOEA 5IFTA 4MOZA 4PTVA 4S38A 1EPVA 4QAWA 2CXGA 2Z1XA 3PBYA 4MY9A 4U33A 3L2MA 1DXIA 1N7KA 1TPUA 4JTHA 3VE9A 4QCFA 5FF3A 3H22A 4OIFA 1LLOA 1ITUA 4Z2IA 4O11A 4GQGA 3WNLA 4MAVA 4GY1A 1OGGA 5FSEC 4JAWA 1SSDA 4FLSA 1GW9A 3HQ1A 4ZFMA 3VGBA 4I5UA 4R53A 4F9DA 4MWAA 1UP0A 3G1FA 3NPVA 3QFWA 1SFJA 2QCFA 2PC4A 2CKRA 3T0CA 4FS9A 4W86A 4DO4A 2E6AA 5H8MA 3UG5A 1JQVA 3G1RA 5AHFA 1YYAA 4XSLA 2V82A 3R4IA 1FWDC 4PGLA 4HYRA 3BW4A 2QCNA 3HJZA 4XBKA 1SW3A 2X1IA 2WSQA 2GJPA 4Z2JA 2HVMA 3DESA 3OVPA 3HM7A 1U5HA 2PZNA 4BF7A 2FJUB 1VLWA 3HOJA 2BXVA 2WLZA 1PX4A 1I0BA 4LT9A 1VZWA 3O9NA 3PZMA 3D47A 1F3XA 2QPSA 1PTGA 1UJQA 4EOUA 4AAJA 2ZIDA 1GCYA 3OJGA 4A8LA 2PDBA 3WKZA 3PTMA 3G1SA 3MP3A 4BS0A 2POTA 3P74A 4UQ9A 4WOZA 1AL8A 4UQEA 4ECLA 1E6PA 2G0WA 4LAZA 4ZFCA 3MSGA 4KEVA 3AHXA 3DG7A 4WY0A 5HK4A 1UKQA 5GJPA 1H63A 4LOCA 4YTTA 4FI4A 5AVNA 4H4IA 3WD1A 1RZMA 1GORA 1XIMA 1ECQA 2QDDA 2ZUSA 2QMKA 1E3XA 3GO2A 5CEWA 4O0QA 2ACSA 2WHLA 4UNLA 3U8GA 3K46A 3KDNA 4DIAA 1Q6LA 3U9IA 3W73A 4QDMA 4AIOA 5FAGA 3T40A 3O6YX 4P7OA 5B7YA 3KHJA 3I65A 3S83A 3S6DA 1VEPA 2OT1A 3W9ZA 2XTKA 4P7NA 3NIYA 3SBFA 1DORA 1X7IA 4DJEA 3QMRA 1C29A 3K30A 4V2XA 2RHGA 1VF8A 2PTXA 4G56A 1BYCA 4L9YA 4UFHA 1H62A 4Z1YA 1ZP4A 1IZKA 1SMDA 2C13A 3DFOA 1Q6RA 3BLPX 4GZ7A 2WMIA 4OQVA 4O4WA 1E0WA 4POCA 1R86A 4PCTA 5JXQA 3B8IA 3L4ZA 4CN1A 2P10A 1LL4A 4B5SA 1Q65A 4DUVA 1DWJM 1RPKA 5CG0A 5HQEA 5H8PA 1KBJA 4G7EB 4ERIA 1IGSA 4H00A 1QDSA 2DPEA 3NQEA 2OKOA 2PTYA 3CWOX 1WKYA 4LYKA 5BROA 4MUZA 1DBTA 1DWHM 1L8NA 3ARXA 5I79A 3SO7A 1W1YA 3R89A 4DUOA 2JF6A 2PWUA 4TVCA 4JTLA 2QUUA 3EPOA 3CZKA 3W7GA 4OBTA 1UA3A 4QEEA 1DV7A 2YXXA 2I57A 1AZ1A 1B30A 4PB4A 1GZ1A 3HZ3A 5DT5A 1FWGC 4JQ4A 2W4XA 1G5AA 3KEHA 4J3UA 3WMLA 4JFWA 4WXZA 1UZDA 1KFKA 1WV2A 2WQDA 1BTCA 1XLGA 1ITQA 3WMCA 2J77A 5FJUA 2QAFA 3ITGA 1F8IA 5KSWA 3TN3A 5BMWA 1X39A 3SZ8A 3GKAA 3I68A 2BTMA 3LPGA 1HKMA 2Y6ZA 3WLJA 1VBGA 5BZAA 4NZ1A 3GHRA 4IMCA 3LCXA 3D0CA 1ODUA 4AIBA 4DI8A 6REQA 3NEVA 4ZB0A 3NTYA 3M9YA 1K6AA 4UFIA 1V8EA 1Q6EA 4IPJA 3MJYA 1JYNA 2DZTA 2A85A 1C91A 3KM8A 4HA3A 1BYBA 2D20A 2WK2A 1TKKA 3T4CA 2QYGA 1P48A 3WEOA 4O12A 4IX0A 1OD8A 1VAHA 1CB7B 1XIEA 1A4LA 4RV3A 2WMGA 1OCNA 2PWVA 1GVYA 1ME9A 4GVGA 1UIOA 4Q8TA 3AWOA 3ZXWA 4ZE5A 4HMDA 4ACZB 4N9DA 1TTIA 3INPA 4Z17A 3QFEA 4B15A 3G24A 4R33A 3VI2A 2VWTA 1VEMA 3N15A 3VDBA 3A9BA 3ALGA 3NL5A 1OCQA 2E3ZA 4N9CA 1Q7ZA 4CU7A 2DW6A 3FCPA 3OLEA 1LBMA 2WQPA 1OG6A 3KVLA 4TXEA 1S3TC 2XISA 3PJXA 3VNMA 3QHOA 2OMAA 1K7EA 3WQVA 2BFGA 1IEWA 4AQLA 3N4EA 3EMQA 1Z32X 2AAMA 2V3GA 1YNYA 5CJMA 2WNNA 4IIDA 4PMZA 4LJ3A 2V2DA 3W6MA 4AY8A 3E0IA 1R9ZA 1IIGA 1Q7QA 3TQ0A 1JFXA 1AJZA 3SY8A 5AYBA 3KRBA 4HCHA 1K8CA 3REQA 3ZR6A 1X7FA 3L4TA 3AMKA 3LCIA 3WMSA 1W9XA 1XG3A 3P7YA 5CGTA 2I14A 3BLLA 3AIVA 2C79A 3WUFA 3BOFA 2OZ8A 4HMNA 4F3HA 2A3AA 5JH1A 2FHBA 1WO2A 4B5XA 1ZZMA 3VD9A 4L6OA 1WCGA 2YCIX 3U2EA 1F3TA 4LUIA 1DYSA 3VNZA 2EO7A 2RGMA 1W9DM 1RD6A 1JYXA 2OYKA 3MUCA 1AH3A 3EEGA 4L7ZA 1YNPA 1OYBA 1I2OA 1R38A 4AYSA 2OQLA 2D23A 1L6GA 4K3ZA 4WOQA 4KT2A 1DIKA 1GG0A 4Q22A 3VE7A 4NL1A 4MLRA 3FJ6A 1SO5A 2JE8A 3C56A 2XPKA 4MJMA 2WWCA 4U2YA 2WC4A 3W83A 4JFVA 3RNDA 5GVJA 3E0VA 1MRAA 4C6LA 4O28A 1KB3A 4HNTA 3VDGA 2O55A 3PK7A 5IRPA 1F74A 1YXCA 2XFRA 3JZUA 3IPWA 3W82A 1AK5A 1BVZA 1S2TA 2QW5A 5U4NA 5EY5A 4WLCA 1KFWA 1LBFA 2XIBA 2Q8LA 1OVDA 1Q3NA 3WNOA 5I6SA 1B54A 4LAUA 4MZYA 3W1LA 4WDUA 3R5EA 3URAA 1F61A 2HQAA 3AMLA 2XH0A 4EPBC 4BWLC 3DKJA 2QCGA 8CGTA 3R13A 3IK2A 4Q3MA 3MHGA 2EPOA 4MJ4A 1PIFA 3WQDA 4XBSA 3GUGA 5HPOA 2Z28A 4AWEA 4CNTA 4MNKA 3RM9A 3CAQA 9CGTA 2OWWA 3W7CA 1L6FA 4JIHA 1WOBA 3ME3A 1ISZA 5C9RA 3U4AA 1E9LA 2BOFX 3W7PA 3TXZA 4XD4A 4XUGA 1GYLA 3TTOA 5T9CE 4I9JA 4XX6A 5A6AA 4EXBA 3P5ZA 4UFLA 1KM6A 2MUCA 4ILSA 5AB3A 3NXLA 1EJVC 5I02A 2REQA 3GG8A 3GVWA 1UP3A 1V7AA 1GJUA 2ZRWA 5EFFA 2OEJA 3AYTA 1HN1A 1H1ZA 1MEIA 5K2ZA 3WQCA 3LUTA 4O8RA 1JQXA 1JPIA 4E2VA 4I6KA 3VOHA 4Q32A 2FZNA 4NIRA 4YWSA 4R88A 2DORA 1HO1A 2HZGA 2NW0A 4HU3A 2A2IA 5C9UA 4WVXA 3PZOA 5HR7A 4R7WA 1NF7A 4HN4A 2O9RA 3M6YA 3NQBA 3RPTA 5JVLA 1TO3A 1UKTA 1JIBA 3APTA 3W1AA 4B2DA 3AUOA 4NZ5A 3CB3A 1ZP3A 2NVDA 5JIPA 3MCNA 4H9XA 4QJ4B 4ZOCA 1Q7MA 3AIUA 3A64A 2Y88A 1EDTA 3KZPA 5D9MA 3A3XA 4NZ4A 1A5BA 4HPNA 3PAJA 5AFDA 5BMXA 1X1ZA 4AVFA 1GVFA 4CEUC 3T05A 4K7VA 4GQ0A 3RLVA 2PE4A 2XIMA 1EX1A 2HK0A 2J62A 3W70A 3HQOA 4AXKA 5G2WA 1UZ4A 3UPMA 4C5YA 2J78A 1EDGA 5I3IA 1KWGA 2OCZA 2QCMA 3M0JA 3P62A 3LRKA 3BK0A 5D33A 3LCFA 2E77A 2GUUA 1Q63A 2BGNE 3CGTA 1B9ZA 3H12A 4BHYA 4B5WA 3CM4A 2FB2A 2XJ7A 5MKGA 3K4DA 1AA1B 2V3EA 4K68A 3EKLA 1BVNP 1KCXA 3TSMA 1H50A 2I5QA 3CIVA 3WDPP 3WSUA 4J40A 5CBIA 2YW3A 2GSJA 4UQAA 2WHMA 3TWAA 1C8QA 1AL7A 4RDYA 4K8EA 3S8HA 3TW7A 4NAEB 3QZEA 2ZZ4A 3GTHA 1LRQA 1XWYA 4D6DA 2VX4A 3UZJA 4AD2A 1JDEA 2V67A 4GX9A 3ABZA 1XI3A 1SM9A 4X0VA 3V35A 2W5FA 3W75A 3VYLA 1T5AA 4I7WA 5I3FA 3M0XA 3M5ZA 5LA1A 5TIMA 4CLMA 4IP4A 4ZQMA 4NVTA 3VFCA 3U2OA 4RXFA 2G50A 3VM5A 3UESA 1RQHA 3UR7A 1CWYA 5CG7A 4O1BA 2DIKA 2ZZ1A 3DENA 3DHUA 3W2MA 1NJJA 1UUQA 4DYJA 3QOMA 4O4VA 1OT1A 3QM3A 2OLHA 1H1YA 1A5AA 3H24A 2W0UA 3IGSA 1T7LA 1NU5A 3HFTA 1WE5A 2A3BA 2X30A 3MUZ1 4V27A 5KZEA 1YRRA 2XVKA 5J5RA 3T08A 4KS0A 1WBHA 1XICA 4JTRA 2BVDA 1W5MA 2D2JA 4BQ2A 4Q4MA 5CPLA 2CZFA 2AGKA 3WLPA 1RVKA 3B97A 1TE1A 3WJXA 1Y0EA 2BDQA 3OQ8A 1R3QA 3STEA 1YW1A 5CKSA 1LP6A 3EB2A 1G4EA 2QGYA 4S3AA 4MWAB 4GZEA 3GAYA 1C8VA 1EKOA 3QY6A 3QPEA 3R11A 3N04A 3O0KA 4OE7A 4ZQPA 3PR2A 3W2LA 1XC4A 1O12A 3M0ZA 3U6WA 4NX5A 4RNIA 3F5JA 3OZMA 1HQTA 9XIMA 4TO8A 1BXNA 1HKKA 4XVEA 5G5IA 1YTDA 3THCA 3APGA 3BJSA 4L1GA 4DNHA 2BVTA 3GBEA 1VFMA 4UXDA 5CSUA 4ML9A 4WGXA 3NXFA 4Y7EA 1DWIM 4YS1A 1FDZA 1V6TA 3S2JA 3OIXA 2X8RA 4ES4A 2I5IA 2DQWA 5DMNA 1E4LA 3L7RA 2PTWA 4X3ZA 4ASTA 2QIIA 4PRTA 3AUJA 1TQXA 1BFNA 4YIWA 2VNCA 2GWNA 1KO0A 2O0TA 3GG0A 3G1XA 4WY0F 3OODA 2E9BA 1A50A 3OVGA 4YHGA 3UCQA 1GOOA 2JK2A 4IF2A 2E5DA 3OVQA 2IKJA 1VQTA 3K8MA 1HXJA 3JVAA 1MEWA 5FEXA 4RDWA 2J8TA 1VC4A 4NXKA 3PBWA 1EUAA 3CMFA 1A0DA 3GHSA 5C9WA 4O16A 1LQAA 2CLOA 2Z1SA 1W3LA 4RE3A 3N9RA 1EBHA 2Y89A 1PPIA 1AD1A 4LV9A 4JXCA 2X40A 4GNVA 1XRVA 3RG6A 5HULA 4IWWA 2VZUA 4MWAC 2UY4A 3EA2A 4AFYA 2XUCA 1N55A 3DDMA 3PBGA 3LI0A 5HMDA 1OSEA 3RN6A 3WX7A 2DUZA 3F4NA 4HPJA 3N3TA 1BF2A 2OB3A 2XSXA 4YHEA 1V0NA 4IZGA 1W17A 3IJ9A 4LBUA 1VR6A 4GLEA 1V51A 2ZDRA 3W28A 2WMIB 5DY2A 4EPEC 2H3DA 4OBSA 1VCVA 2VL4A 4EANA 2GVLA 3E6EA 2VC5A 4HJWA 2Z24A 2X2GA 2ZZ5A 4DJDD 1K1DA 1O60A 1NH6A 3OLGA 3G1YA 4XZIA 5D2WA 2HVOA 3GK0A 4CNUA 2FZDA 3I3EA 4K38A 1OM0A 1P7TA 4KH2A 3WF1A 1XGEA 2GUYA 4JZ5A 2WJZA 2H9AA 3EDFA 3OGSA 2FTYA 1EC8A 1SSGA 3FJ4A 3LS9A 2CC0A 2QS8A 3L4WA 1JZ5A 3LZ5A 4W8BA 3NM1A 3NQ7A 2G95A 4QP0A 1KXVA 3SURA 2BSLA 3A4WA 1UWRA 4NASA 1OZQA 1XD0A 2D0FA 2O9TA 1EL3A 3SRDA 3RCNA 4LEQA 1SVDA 3QV8A 2ZA1A 2WAGA 3W6LA 4NNBA 4Z1AA 4AVNA 4HKPA 4AZBA 3LCGA 3BJTA 2XIJA 1LOQA 1FX6A 4YNGA 3UA3A 5I07A 1MWOA 1IXQA 3TQVA 2W9MA 1TPC1 1P43A 2CITA 4IMFA 3LQLA 3EXTA 4E8CA 3WUBA 4NI3A 4FF5A 2YJQA 1E70M 3CZ8A 3FY1A 5LGZA 1V5XA 4GFIA 1QU4A 3TYZA 3N2BA 2VZSA 1B3XA 4FMVA 2FTWA 2QPXA 3L0NA 3QR3A 6REQB 3NQVA 3W37A 1H11A 4KEUA 4KWWA 4DJEC 2V5BA 2AL1A 5AECA 3PJWA 3OBAA 3GE7A 1E71M 1Q85A 3B9NA 1QK0A 1POJA 1H49A 1R2SA 5CAHA 3JRKA 4G1NA 4DPQA 2ZX9A 4UFMA 3JZEA 1OCJA 3T8QA 1UD6A 4HHPA 3W7MA 3PPGA 2EQDA 3LXCA 1FWRA 3NURA 4LNCA 3ITOA 3HBLA 1T8XA 3GXPA 3R8GA 4FNTA 2JBMA 3J7HA 1QWKA 5C6MA 2EJAA 3HGSA 1B31A 5AOUA 5XIMA 3VTRA 1UH2A 3WUEA 3MHUA 3R43A 2R9RA 2ZDSA 4GIEA 3A4AA 5A8QA 1ZQ5A 3TK7A 5XINA 5AC5A 3O7UA 3G22A 1GG1A 4EPDC 5DCDA 1F9CA 4JS3A 4A3RA 1W5PA 2X7VA 2I5GA 4AC1X 4RZ5A 2YXGA 3VIJA 2OLSA 2VDHA 3GB6A 2ZUVA 1K03A 1OFPA 5DRIA 2OJPA 2PP0A 3UXKA 2ZXAA 2EJ1A 4MJ2A 4HBKA 1I9CB 3KX6A 4NHVA 1RJRA 3REQB 1WXJA 4JYFA 1NP2A 3SCSA 3WH9A 1F7BA 1JCTA 1IQ8A 4KFPA 4WSHA 4LVAA 1EJ7L 3NFUA 4XIAA 4WKHA 3W84A 2XIQA 3W22A 4C65A 2V3DA 1QBBA 3R58A 4XAPA 4XD6A 1RLCL 5DT7A 3NNTA 4LANA 2DSZA 2X41A 1UKSA 3W6YA 1HG3A 3QQ1A 1E1CA 4X2RA 4URIA 2VVNA 1SFSA 3NSNA 1PCKA 3G0SA 1QR7A 4H7ZA 1CI1A 2JIWA 4QJ3B 3VINA 3RXZA 3FEQA 4QDPA 3HF3A 1CPUA 2FFIA 3W4RA 1O1ZA 1I60A 1DOSA 1QK2A 4ERGA 1ZJHA 2V3FA 1DP0A 3S1VA 3DXIA 3QY7A 2D3NA 2GPTA 3PNZA 5E9AA 2VKZG 3AIQA 1SZRA 3NQ2A 4XIMA 3DYOA 5L9FA 1Y65A 1OWQA 2ZYFA 3H6OA 2W61A 3DFYA 5EYWA 3ZM8A 3IUIA 3LMZA 3P8IA 2Q02A 4JNYA 5A8NA 1VYSX 2PDPA 1MXGA 4D6JA 4HP5A 1GNXA 5DFAA 2O9PA 1E1EA 5FJOA 5FF2A 1DXEA 3PSWA 4ZL1A 3B9EA 2WSYA 2VEFA 1JZ7A 3URBA 4HCLA 1GHSA 1W9VA 3TAOA 4ZODA 3AIRA 3VOCA 2YYUA 1VBJA 1O5RA 4M51A 3CQKA 4MNMA 1Z7AA 3WY1A 2E9LA 1UUMA 3UG8A 4Q33A 3AZSA 3IGHX 2VDIA 4I5RA 3P93A 1R3RA 1R9XA 5KMYA 4Q8QA 4XD5A 4S3CA 2J7FA 4JIRA 5E5CA 1FBAA 3CASA 4GUFA 2QUTA 4P8XA 4HSOA 4EVZA 1IWPA 3CC1A 4D1IA 1JI2A 1MMFA 1L2UA 3QGAC 4ZE4A 5I0DA 5E1QA 1US2A 4A2SA 3W2UA 3MTWA 3LB0A 4F0HA 4GRSA 3E12A 3C8FA 1GQJA 2REQB 4JTCA 1GOIA 2V69A 5GPRA 3LTSA 1CGUA 1H7WA 4GO8A 4QLJA 2VEPA 1Z48A 5A8PA 4M8UA 5DF0A 3I10A 3CZJA 4UTTA 3SDOA 5JIWA 1FRBA 4AX7A 3ZSTA 3TQKA 2G4FA 1OC7A 3BAYA 3ARQA 4GA8A 4H9TA 3LY0A 2R8WA 1S1RA 3V3WA 2JFEX 2CLKA 2PDFA 1HUVA 3GVQA 4LB4A 3TOPA 4XZMX 3DU0A 2GOKA 5G1MA 3S2MA 1V77A 1P6WA 4OUEA 4CU8A 3D6NA 4JCLA 1R30A 3SCWA 3GW3A 2JGQA 2YIHA 5GNYA 1G4PA 3FIGA 2J27A 1OJXA 4J2PA 1PIIA 3AU6A 1SW0A 2BG5A 3HPFA 3MV11 3EZ4A 2PRMA 5A6KA 3TC3A 3B0UX 3L12A 3W85A 1GVIA 5A6SA 4M6PA 1TCDA 3VGHA 1B3ZA 1RLDA 3GHUA 2ANUA 1E6SM 3TN5A 5C70A 4DBWA 4IMGA 4FNUA 3THDA 5MKGB 4C1LA 1TV3A 1K7FA 5GNXA 3CHFA 4DHGA 2XVLA 4CCZA 2JF7A 1ZRQA 4GG9A 5CSSA 3DKLA 3GR4A 3AOFA 1M65A 3KHDA 3WH7A 3VCCA 5D04C 3LPOA 1HW6A 3CH0A 1VFTA 4LSBA 1XIDA 2O56A 1R47A 2CLPA 4JICA 5HMSA 1HJUA 4DUWA 2MANA 4C6BA 2OODA 3R6IA 4MB1A 3G3DA 4ZQRA 4YPJA 1EGVA 3M4HA 4HMCA 5IBXA 3BE7A 4AISA 1KFJA 2Y4SA 2Z00A 4M56A 7TAAA 1S46A 1V79A 1HKVA 3RRAA 2GQ8A 4H9MA 4KQNA 4HD5A 3AHYA 2HE5A 4JD4A 4HZ7A 2VRJA 2XIIA 3VX1A 1JCMP 1WDWA 2CYGA 2FZBA 1SZEA 4HHHA 3FVMA 4KRTA 4YTQA 2G37A 2VCAA 3BUVA 2V5KA 2PEVA 4M19A 5MF5A 4EAMA 3G1AA 4AYGA 3UWEA 4HCDA 4KIRA 3PFMA 3VDHA 1WDRA 3CWHA 3KBMA 3WQ6A 4HIBA 4UIOA 5CGMA 5BXSA 5C2GA 4C6KA 4CCCA 3VA8A 3S4TA 4QIUA 1LRNA 3AU2A 1BPLB 1G94A 2QUVA 4Y2WA 2DZUA 4TVDA 1TQJA 1XBZA 2WJFA 3KP1A 4O13A 2DDXA 2YW4A 4QLLA 5E0FA 4BQ5A 2CWXA 3Q58A 5LIUX 3TJXA 4XTDA 1YMYA 2X1RA 3UXDA 4BA0A 3CMJA 1FCBA 5D9NA 5K9CA 1OC5A 3ATYA 1JDCA 2GLKA 2OX1A 3SCPA 5LNSA 3TU9A 3SUSA 4JQ3A 4JBRA 1LUCA 3C4UA 1M41A 3ARSA 1LOLA 3A13A 3MY9A 1E6XM 1M7JA 3DBNA 3ZOAA 2JKAA 3STGA 1VFUA 2PD5A 4WHBA 1Y5WA 4DZ5A 1CLVA 2VC6A 2YL6A 3L2LA 4TIMA 3S0CA 1U5JA 1UJPA 3LPFA 1IR1A 3P81A 3IJ6A 4AX6A 3H2NA 2QNEA 3QQWA 1PDZA 3V5CA 1XISA 1YX1A 2D0GA 3NOYA 2D2HA 4MKVA 1TMHA 4R9OA 2V38A 1T0OA 3BV4A 4OT7A 5M2FX 1FA2A 3C2FA 2EPLX 2ZX7A 1C8XA 3B8SA 3T0BA 3UZ5A 3S5YA 1MNZA 5FA5A 3F4VA 1KM0A 4WX2A 1B90A 2Q71A 3QV7A 4HA4A 5H1WA 1TPH1 5CSYA 1LZOA 2FPTA 4A22A 3CLMA 1XH1A 4YCOA 1R2RA 3TP4A 1RJQA 4QE5A 1F3EA 1SJCA 3H54A 2PP3A 3KS5A 4N02A 4IFRA 3S46A 3A4JA 3CPGA 3UJFA 1KTCA 1TR9A 1GZGA 3VUSA 4O15A 4W9TA 2YSWA 1VYPX 4DX3A 2HMCA 1VFFA 5I3KA 3UR2A 1T99A 1YEYA 4F66A 3UQNA 3PBMA 1DIOA 3LCHA 3P0XA 5LZLA 1BAGA 2J47A 4B3ZA 2WMHA 4PBGA 4XO6A 1JAKA 1NP0A 5CLTA 3UJSA 3CL6A 2VFFA 1XLHA 1Q6QA 5AN7A 3GKFA 4S3GA 2XFWA 1TREA 1OFAA 5HUPA 4AZ5A 1M3UA 3CK5A 4J2MA 4NILA 4E3VA 2J13A 3IANA 2VR2A 1GTHA 2WYSA 1DWFM 3S1XA 1GEQA 3ITTA 4LALA 5M1TA 3BAIA 4NT0A 4O0KA 2ISWA 5GNZA 3VU2A 1IF2A 4NI8A 3GNXA 3CYJA 3LLDA 2F61A 4D6FA 2PTDA 5JMUA 2CU0A 3SCVA 2O92A 1L6YA 4WK9A 1OYAA 2O7SA 3AHTA 1XBYA 3B9OA 3IV8A 4JFSA 2UZ9A 4WCJA 1JZ6A 2QMJA 3TONA 1XDMA 5FEWA 3F03K 3S9IA 4DF2A 2OYLA 3JS3A 4OTKA 1P7TB 3EKZA 1X98A 2X0SA 2YDAA 2HRWA 3KTSA 1H7PA 1VENA 2H9AB 3V0UA 4PTNA 4E4UA 1YE6A 4B4FA 4I9TA 2DU2A 3GW0A 1XUUA 1FWIC 4GIYA 1DQUA 1GQNA 3KCLA 4MVAA 2DJXA 4PUEA 4GZIA 3F1QA 4FNQA 2WZTA 2F7FA 4GI8A 4GQQA 1PS9A 2QJIA 3KL3A 1UOKA 4ZQOA 1PIGA 4G9PA 2IPFA 3WLIA 1CEOA 3GNNA 2VX7A 4WR3A 2TYSA 4R3UA 4O1EA 1EYWA 2PURA 4P8WA 2V30A 4JDBA 3WF4A 1FP9A 1H7XA 4GXPA 1NTHA 2Y8UA 1YDNA 2PF8A 3FYPA 1KKOA 2PRHA 1F6YA 4PRRA 3KTXA 4H6RA 4UNIA 5KINA 4I5XA 1E0UA 2YPIA 4EIVA 4RXGA 4V15A 4NKCA 4LY4A 3Q94A 3MPGA 2X0YA 3P84A 1MI3A 2DZVA 4UTLA 3BZGA 3GUWA 4PMRA 1M7PA 4AUBA 3FA3A 5EBAA 3TTQA 2XH4A 4M82A 1GWJA 4AIEA 4LVFA 4GCAA 2CBIA 4REQA 1VFHA 3HGJA 3ZYZA 1PB0A 4OU1A 4MPKA 3WMBA 5AC8A 2E68A 4BF9A 1DVJA 2IMRA 4UBPC 3OYZA 4A35A 1TJRA 3P60A 2L5HA 2VURA 1ADSA 2VGIA 1M5WA 3I7RA 5A3HA 4TTUA 5T9BG 1R8LA 2DZSA 2WHKA 4LC8A 4GXWA 4O50A 4L64A 3UZXA 1HKIA 2PPGA 3IK4A 2WPGA 4C7GA 3KVMA 3SQSA 3NSMA 1TX0A 5HWJA 1MZHA 2GGHA 4WXYA 1JAEA 1CXLA 4W85A 1PCWA 5U7SA 3H2AA 1SZFA 1MXDA 1J2WA 4OJYA 4FIQA 3BG9A 3CQJA 3W7JA 1HL9A 2GVGA 1F4AA 5FJTA 3MKKA 5HA7A 2J75A 1AJ0A 4F2UA 1M6JA 3IGUA 4QCEA 2YOCA 2NXGA 3WQPA 3FAXA 3CHVA 2C3ZA 2B7QA 1QOXA 4BKNA 1WUFA 2PDIA 3W7DA 5TF0A 4GPNA 2B4GA 2QVNA 4TUFA 4AWUA 5I78A 3K1DA 4PMUA 3VKJA 3WEMA 1BYAA 3LV6A 1D8CA 3VDAA 3E2QA 1YBQA 3QHNA 2GFTA 2FQIA 3AAMA 1E1CB 3E5PA 2EHHA 2NSOA 4GC4A 3HB9A 3WFLA 4GIAA 4LUJA 3CBWA 2WC7A 2DT0A 5FF0A 1XV8A 1QO2A 1UMYA 4AF0A 3UG3A 3NGJA 5FEPA 4WKAA 3LCLA 3CO4A 4YLWA 1PJ9A 2PWDA 3WD4A 4LUSA 2HPMA 3ITLA 3CXOA 2PDLA 2WV8A 1E4IA 2HROA 7TIMA 2GJXA 2W3ZA 2VUYA 5G1TA 3A24A 1KM4A 3T0DA 3M1ZA 3WLQA 4C5ZA 1V7YA 3P3BA 4QQ3A 2P1FA 4Y9AA 4UR7A 2VMFA 5LNWA 3TR9A 4C6JA 1J11A 2ZTKA 1RQEA 1G7VA 4ZO9A 1E43A 4U10A 3TTEA 5FJPA 3TA9A 3W1UA 2ADAA 4JTFA 4UMBA 1U83A 2XIOA 1H51A 4Q8WA 1OB0A 3UWVA 1W3KA 1W2VA 3G0UA 3FV9A 3PUEA 4S1FA 3A12A 4GINA 3C2EA 1X97A 2FH8A 1C8YA 1TE6A 1WDQA 1VCFA 2PODA 3TNBA 5FF7A 2WLYA 3DX5A 4JKMA 1WB0A 2BWGA 3UXLA 3EOLA 1ONWA 2PGWA 4BZYA 2EBNA 1VH7A 4IGSA 2V2CA 1QW7A 3KWXA 3YPIA 3WH8A 1GOKA 3LERA 3UCDA 1LYXA 1LJYA 3T09A 4PEKA 1UR4A 3GDKA 2O7QA 1K7XA 1FWAC 1LRTA 2VR5A 1QBAA 4FX6M 3A47A 4XVDA 4Y6GA 4PMOA 5M03A 5I00A 2TSYA 1UPPA 2VELA 4AH7A 3OPSA 5I24A 3L5MA 4MDOA 1TX2A 6ALDA 1S5WA 3QQ0A 1NARA 1BG9A 3PSVA 3DOPA 1JCYA 1MSSA 4WSKA 2OSWA 3TA6A 2ZA3A 3CIWA 7ODCA 1V0KA 3GU2A 3IIXA 2YZ5A 2DZBA 1L6WA 2QCDA 2QF7A 2SFPA 1OD0A 2VFDA 2CXEA 3TSDA 2WO5A 3WD0A 3TJ4A 2INZA 3LNPA 3NM3A 4OBRA 3SIZA 4GXMA 5JUVA 3PC0A 1GUVA 2X16A 1HIZA 2Y8VA 1KCZA 5RUBA 1VBHA 4LYPA 3CHDA 3LNMA 1CIUA 3Q45A 2G3FA 4EE9A 3WLOA 3MP4A 3N12A 1OK6A 4PC8A 4RE0A 3CQ0A 3WLMA 1E0VA 2X09A 1C7SA 3F2CA 3KVKA 3EAUA 1TTQA 1Q6DA 3WH5A 2GDQA 1QTWA 3QZ6A 4IGHA 4HSNA 1H61A 4DBSA 1J6OA 1HTIA 3FDGA 3PWAA 3UT0A 3CUIA 3BMVA 1XYAA 3S5NA 4W89A 2C1GA 1OBAA 3E0FA 2AQWA 3PZQA 4CD6A 3MUIA 2NWSA 3SQLA 2WCGA 2ZC8A 1GQIA 4AY1A 3PPCA 1G69A 4ACYA 4FXRA 3EDDA 3DCPA 4IL2A 4J5NA 1DEDA 3AISA 3RLUA 4ZBCA 3OW1A 2E6YA 1Q6FA 4M1RA 4KF1A 3RX2A 4MZ8A 1XIGA 4D6IA 2E6DA 1OFDA 3M16A 2FMNA 3KWSA 3E02A 3DI1A 5CZKA 3GIPA 2YLAA 2EG8A 5HR6A 3NPXA 4FLRA 3S47A 4JKKA 2OU4A 3N25A 4HPXA 3W7QA 1QI5A 4ZTXA 1YADA 1WYIA 5HMEA 3CV1A 3R79A 3F4CA 1A0EA 5E0KA 3UR5A 1Q4WA 2PDJA 2CKSA 4D6EA 5BYWA 3ZVIA 1XGDA 4WEVX 1XPYA 2VOMA 4ZVJA 3GVRA 3VIOA 4QE4A 3EWUA 2EF9A 2C15A 3LLFA 1UASA 3QGKC 1EEPA 4MFEA 1TELA 2WNWA 4J7RA 1AG1O 1TFVA 3BLDA 3GR7A 3S3GA 4Q7BA 4HK5A 3F5LA 2XN0A 3SRHA 5PTDA 5FJIA 3LEPA 1DTNA 2CLMA 1X1NA 3IAQA 4TX8A 3ZR4A 3RPMA 3LLXA 3M0HA 4BJHA 4LEFA 1XLJA 4BI5A 3MZ2A 4KPLA 3UY8A 1ICSA 3TDFA 1F4HA 2ZX6A 2Y63A 3O0FA 1UD5A 3HFYA 2ZCGA 5AZ0A 5SWUA 1ZNNA 4H6KA 2E7FA 4PMJA 1LUCB 4LAKA 3O06A 1W1IE 4LX4A 3W1QA 1XC6A 2Y85A 5LHEA 1PZ1A 4H41A 2E40A 3CQHA 3PWIA 3ITYA 1ZL1A 3RGTA 4JHMA 5D2XA 3TXVA 1AH4A 4LCRA 6TAAA 4CQAA 2NVAA 4TU1A 4BI6A 5IBXC 2J88A 3GU1A 2GJLA 2WCAA 5E09A 3GTXA 1MZRA 4S3DA 3GH7A 3S1GA 4X60A 3ATZA 4S3JA 5HATA 3GD6A 2VTFA 1A5LC 1BGAA 3CL8A 3UY7A 4DNMA 1MEHA 4QX4A 1TJ1A 2ZVRA 3N17A 4CD8A 3PB2A 1J4EA 4ZA0A 1XDLA 1ZY9A 4GO9A 4JCMA 1Q6CA 1LT8A 2BOGX 2VGFA 3AZTA 2V5LA 3Q2DA 1S3HA 5AYXA 3HIJA 2H6RA 2R1LA 4RW5A 2PA6A 2IW0A 2PDHA 1VB9A 4PULA 1YKWA 4ICNA 5CC6A 4DN1A 2Q6ZA 4UTMA 3ZJ7A 1OFOA 5F2MA 1DHPA 4JX4A 3AXHA 1XH0A 4FPSA 4GK8A 5G2IA 3OU8A 1EO7A 2VYOA 1IEIA 1QCWA 4DF0A 2P8CA 4LCQA 3VD5A 5E6YA 4JTAA 2ISSA 1UWIA 1ZJIA 2WBKA 3FXYA 6PTDA 3PUDA 3B8VA 1K8ZA 2ZRYA 2YXOA 3O2LA 4E0CA 5FCZA 5D02A 1PWLA 3V4BA 3WO8A 5D2YA 4YCPA 3IJIA 1FDJA 2PD9A 3OZOA 2DUAA 4AD4A 4L6HA 3SI9A 3FNDA 2QV5A 3QKEA 5M3WA 3VD4A 2ZC1A 7ENLA 1J0KA 1XYMA 7REQA 3KBSA 1MW3A 5CCZA 3GX9A 2FHFA 2RAGA 2AKMA 1X1OA 5D32A 3Q37A 3BG3A 1KC7A 3UA4A 3WQFA 1YQ2A 2QAPA 1TZZA 2R1NA 1GVRA 3BGAA 3CAWA 1S2UA 1M7XA 1P0DA 3NDOA 2ZICA 3NO1A 3FVDA 1EJTC 1Y8BA 1NDZA 3S2CA 2A4AA 2WZHA 1C9DA 2R6OA 3NPWA 5H8UA 5J8LA 3FHAA 2B7OA 2ODOA 3PZGA 1RK5A 2XVGA 5CC5A 5EMMA 3TIMA 4QROA 1XLEA 4DELA 2BY3A 2WXDM 3OTRA 1LQ0A 4XAFA 1W1A1 2ESCA 4IPLA 3BSMA 1MW1A 3IIZA 4KMQA 4UTWA 3WCZA 3W1RA 4LV4A 4E8DA 1V02A 1W9UA 4D1JA 3PTQA 4IQEA 3IRDA 3W7IA 1UQYA 1OINA 3L0KA 3MW7A 1NEYA 5EMKA 1TVNA 5KTLA 3EMCA 4GH1A 4AZIA 3V18A 1VIWA 5F7UA 3EEZA 1WDSA 1EJWC 5HNNA 2R91A 5B7ZA 2Z1BA 1PZ0A 3IIOA 4QG8A 2QCHA 5A95A 4CN6A 3VGDA 4HA0A 4Z0SA 2OGYA 3SJNA 1E40A 4O0ZA 5G4WA 1V02E 1ONXA 4RX0A 1W1PA 3MUY1 4H9YA 1IIHA 2D2OA 2GSHA 2BGQA 1K6WA 4ATDA 4REQB 2XM2A 1MW0A 3LHVA 2ZUWA 3HPAA 1L9WA 2EPNA 4JPGA 4GWEA 5A2BA 1V93A 4UTIA 1ZJBA 1TA3A 1JZ4A 4CQDA 2AGTA 2VRKA 1QNSA 4US5D 1KXHA 2D1ZA 2A3HA 1BYDA 1WOAA 2VGBA 3COTA 2WSKA 5KEZA 3CWNA 4HOZA 5FSDC 1F6PA 3ZWTA 4CEXC 1TPDA 3B0YA 2VZOA 2EEXA 4UTKA 4W84A 2OYMA 4B91A 3C2VA 5L6UA 5CPMA 4FSAA 1FWBC 5CZSA 5AC6A 5HWNA 3IIPA 2YLLA 1JL8A 3M0MA 3USBA 1EGMA 5IDIA 2BB0A 3WBYA 4QSHA 3ZT6A 3IVTA 2FIQA 4EWJA 4M3PA 1NWSA 2WMJA 4CNPA 3B04A 2F9RA 3IJ8A 1W91A 2BBFA 2VDGA 4PZVA 2XSBA 3F2DA 1KKRA 5C2XA 5G2HA 2GVYA 1EP2A 2YBVA 1S5NA 2X7WA 1YTEA 3UZWA 2YCJA 1QNRA 1FCVA 3T0TA 1CECA 3EX3A 4D8ZA 1P4CA 3L67A 1LLWA 3GU9A 2CCRA 4DQWA 4RJEA 4KRUA 3P14A 1XBXA 1LROA 1UWAA 4L4MA 3GZ3A 1XYZA 1YBQB 4JEJA 5IHSA 3CNYA 2Y7FA 3WZ0E 1I2NA 2Z7GA 3K8LA 3F2BA 2G97A 1FOBA 3CEUA 3GM8A 5AVHA 3LTYA 2CBJA 5I09A 3AO0A 3EX6A 3T2PA 3NZPA 2Z1VA 4AF0B 3K8KA 1VRDA 4GYPA 2DT2A 3PJUA 1G01A 4PUMA 5LIXX 4GMEA 4LUSB 1OQFA 1YDYA 5FF4A 2OPJA 4Y96A 5EL1A 3UERA 3T78A 3SN1A 1J2BA 1JD9A 2GJXB 1UR9A 1H0GA 3ZJ8A 1LWIA 5DRCA 3VGGA 3OLDA 1HVXA 3WLLA 4PODA 1JR1A 4WKFA 3VIIA 2NT1A 1QHOA 3CZGA 1GKRA 3OBKA 1VKFA 2FPVA 4PYSA 4QQUA 2PLJA 2J66A 1GJWA 4FXFA 1PZ2A 3SCUA 1A80A 4HGXA 4QHRA 3LU2A 5K9XA 1X8CA 3GTIA 5EU9A 1ZAJA 4OZOA 3DFNA 2E4TA 3GDLA 4IQLA 1NF0A 3CJPA 3TQPA 4NJKA 2MNRA 4MIMA 3GXFA 1VJSA 2HBXA 1QOQA 2ACRA 3EWDA 4PUWA 8TIMA 4CNNA 3B06A 3VGFA 1TCMA 5TBOA 5JH2A 3MMWA 4O52A 3PULA 2WHJA 1XIIA 1J5TA 3L4VA 3WDQA 4Q8OA 4V1YA 4A4AA 4IPIA 5GJMA 1PYFA 3BLOA 2NV9A 3VD7A 3BSHA 3WQWA 2Z29A 1FCUA 2W79A 2F2HA 2Z0IA 4O1AA 3IEBA 3RITA 2DH2A 4FEZA 3S6OA 3EBVA 4GJ1A 3PNUA 1NDVA 3BLKA 4L80A 4PMXA 4C6EA 3W2KA 1W54A 4U28A 1FWWA 4MB3A 1XG4A 3UWWA 2QJNA 4JTKA 4DXXA 1DJXA 2QDHA 5LYRA 3UWQA 4D8AA 4B9YA 3IRSA 4W5UA 5DMLA 1L2QA 1GHRA 4HQVA 4DXVA 2AMGA 5EMUA 2ZX8A 1OF6A 1W56A 1FKWA 3HGRA 4RPPA 3RMEA 2DUXA 3RHGA 3LHZA 2QCDB 3I6TA 3L5LA 1EJXC 4IOTA 1XF0A 3POCA 4O1FA 5DMMA 4GGBA 5CBJA 2X42A 4QNWA 4Z42C 4IM4A 1KGWA 5A6JA 4CUCA 4UOZA 1KV8A 3NDZA 2F6XA 4Y8FA 3TVAA 4W4QA 4KRZA 4CGTA 1S5TA 1Q4NX 2ZUTA 3RM4A 5BU9A 2FKPA 3WYZA 3R94A 3AIBA 1HJWA 4U3CA 4PCNA 3B8DA 4JIIX 2C91A 3EWBX 3G0XA 4L56A 4C6FA 3WBWA 1KW1A 1EPXA 2ZX5A 1PDYA 1X38A 1R3YA 1UOZA 5D2VA 2E6FA 4IQJA 2P88A 3TN4A 4YTSA 1XR2A 3VVGA 4DWSD 5J5DA 1G67A 3FFSA 4B3KA 3A3WA 4OFCA 1RA0A 3VKCA 2GZXA 4JY9A 1KBKA 2Q01A 3UG4A 1W32A 1E5NA 4AHPA 3H55A 3GLCA 3KXQA 1A53A 4Q4QA 3H2OA 5CC3A 4DLMA 3UYCA 4DM1A 3PAOA 3THAA 2Y1HA 5AC7A 2ZE0A 4P7LA 4GCXA 4P8VA 2F2KA 4DUXA 3G6LA 4DPPA 4DY1A 2J6XA 1QATA 5FKYA 2OO6A 1VHCA 2YCLA 3L4XA 4P61A 3VAVA 1WDDA 1H1NA 5GJNA 4AZGA 2XGZA 1RQBA 3BQ5A 4QJ1A 5JBEA 4ZB2A 3SCQA 4KFNA 3MUXA 2VQTA 5HXMA 2AL2A 4ICCX 1F5ZA 5HPCA 3BDKA 2B7PA 1UH4A 3PANA 2E09A 4Z1BA 1W0MA 1GQLA 5AHMA 3E2VA 5C5YA 3L23A 4D6HA 1ZS2A 2ICSA 1G0CA 1SFLA 4DB7A 3B03A 3WELA 2VT0A 1THFD 2XWEA 1TVLA 1J79A 3G77A 1W1ZA 4UMCA 1E73M 2CLIA 4XUYA 2C6QA 4O8AA 3DFPA 2WKJA 2CHOA 3ZWSA 1RPXA 2C1HA 3I4EA 3UVIA 3EOSA 2OTDA 4M0XA 3G5EA 3H4GA 3NG3A 3MJMA 2HBVA 3GDRA 3C0QA 1AQMA 4JFUA 1XLDA 1FHDA 4QGCA 2ASHA 3ZR5A 1WZAA 4IJBA 4YTRA 3PM6A 1ZAIA 2ZUMA 3P6LA 1RBAA 2J9YA 1JF6A 1SJDA 3OYXA 1ML1A 3KRSA 3LXBA 3S9YA 2F6KA 2DZAA 3QTGA 4A8IA 5IDZA 2NUYA 3Q4DA 1KV5A 3N18A 1DJHA 4W7WA 1NAL1 1B4KA 2Z27A 1K9FA 3GR8A 4IISA 4HPGA 1FY6A 1XJBA 1H7OA 1BQCA 2NQ5A 4GY0A 1RR2A 3NQ8A 1TZ9A 3T55A 5A6LA 4U31A 2E8ZA 3SSJA 1O7AA 4L4PA 5FEZA 4GUIA 1XCXA 1D9EA 5AZ1A 1PVNA 3E0WA 2W91A 4BR1A 3RLGA 5BXPA 1KQYA 3TWBA 2O4MA 4HNNA 3STFA 2H90A 3P2VA 1KRCC 1DIEA 5EMJA 3SB0A 2GOUA 2QCLA 1BXBA 3PZVA 3O16A 1UZHA 3NL2A 2E9MA 1QASA 4AVOA 4ZMGA 3UF9A 2FMOA 4MM1A 4XAZA 1CLXA 1SW7A 4EP8C 3OQEA 3MP5A 2IXVA 4F79A 4B16A 1UROA 2XM1A 3DG3A 2WC3A 3STCA 1H60A 3LYEA 1QNQA 1OFQA 3VC6A 1I45A 4IH3A 3AJXA 4ALDA 3W7RA 1F07A 1B5TA 4UB9A 3R8HA 1KM5A 4AD3A 2ZZ2A 3K4WA 4PUKA 2DSUA 4IMAA 1ME8A 1GKQA 2FGLA 3BMWA 1QNPA 3GFXA 1MUCA 1SU5A 3VIKA 1Q2RA 5HQLA 4IMDA 4Q7IA 2NXIA 4N2YA 1VJZA 3EOOA 2ZXQA 4C6MA 3O6CA 3FHQA 3B05A 1RP9A 2E8YA 4TR9A 3NQCA 4UNKA 5I3HA 4S2CA 3QZAA 2QCEA 4ZCWA 4TMBA 3N2MA 1U33A 4V28A 3T2QA 4CQ8A 2QCCA 4S23A 1UWTA 4C6DA 1VD6A 4LY8A 5FJJA 4J3TA 5B80A 1YE4A 3H2MA 4HN8A 4DO5A 1R2TA 1R85A 7REQB 4HZ6A 1FH8A 4IX2A 4QJ5B 3VFLA 1XS2A 6ENLA 4H3DA 2G41A 2F84A 4KESA 1BKSA 1A3HA 3CUHA 2VCBA 1I2RA 4GOAA 1F05A 2PDYA 3TC6A 1IV8A 3TV8A 1ODZA 4XZ9A 4Q4OA 2EPHA 1N8IA 2WBGA 2QQ6A 3ARVA 3ICJA 2VXNA 1LM1A 1EZ2A 2A7PA 2Z6IA 3UNDA 1XX1A 3VKBA 3ALFA 5DELA 3UR8A 1BF6A 2W6RA 4I9AA 1XW8A 1TWDA 4UUIA 4O19A 1AQHA 2PZ0A 4JEQA 5HINA 3VZZA 3L4YA 1BVWA 4FOKA 4DVOA 4JQ2A 5KZ6A 1DJQA 3LRMA 1US3A 5FACA 3GYEA 4WJXA 4XD3A 3IWPA 1DTUA 3QN3A 2VZTA 2BY2A 1NOUA 1XLFA 1NDWA 1XP3A 2YA1A 3M5XA 4FNRA 4GI9A 2QJHA 1IHIA 2QIWA 2VR4A 3W24A 4YWIA 4US6A 1G6CA 3VNIA 4F0MA 3KZSA 3MU7A 4PMDA 1EWEA 1UR1A 1Y5XA 5TAOA 2GVJA 1EXBA 4UCFA 3F7JA 1G7UA 4N6FA 3RILA 3V5FA 4PMVA 4PBEA 4YYCA 1R7OA 4WD0A 2JEQA 1HL8A 1YPIA 1CXEA 4KWOA 2HTMA 1TPB1 5E9XA 3AALA 3R0UA 1R3TA 1XCFA 1GVOA 4GYKA 4NZJA 2IPWA 4GUGA 1V0LA 3VDCA 3W7OA 4AMAA 1PYMA 2AOSA 2Z4GA 1RH9A 2HV5A 2GGGA 1TA3B 2CZDA 3CZEA 3SY1A 3H7RA 2ISDA 1PL9A 2PCEA 3M46A 1G9HA 1LLZA 4LC6A 4A21A 1A0CA 3UNTA 1E55A 1UIPA 3OG2A 5H2ZA 4UQDA 3IACA 1BWLA 5A8GA 3UJEA 4MZ1A 2IKIA 1ISVA 5LHFA 2BZNA 5F4SA 1GT8A 3V16A 1C90A 3M44A 2A6LA 2YX0A 3WL1A 3OEXA 1KM3A 2YR1A 4IGNA 4V33A 1JDAA 1SR9A 4X9SA 3A6OA 1U2YA 1DWGM 3NVDA 1UMLA 2X05A 4AC7C 4DM2A 2X2YA 3EX1A 4CQCA 3RUBL 3BL3A 1US0A 3T44A 2FDSA 3KOFA 1CGXA 4MAZA 1RVGA 3N2TA 1KQZA 3RR1A 4PR4A 1QPRA 3RFAA 1ECEA 4HU4A 4UTWC 3VNJA 1X6NA 2EG7A 3B8WA 1Z89A 3ABSA 1Y7VA 2FH6A 4DBEA 1RD5A 4JX5A 2PLCA 2PWFA 2J7EA 3FX4A 2XHYA 3PZIA 5ABFA 1UWUA 2YFNA 4K6AA 2DQXA 5FJRA 5CC7A 5CPSA 5C9XA 3OOQA 1XKJA 2VRQA 4LNYA 1CCWB 2CWNA 2OKTA 1O6IA 1ESWA 4BWLA 3V75A 1V3MA 3S9ZA 1H7NA 1FKXA 2DGAA 2YB1A 2OQHA 3CHEA 3W00A 1RV8A 3MBFA 5LNUA 4H6QA 3EXSA 4NP7A 3KCOA 3FKRA 1VIZA 3W1XA 4WDTA 1LF1A 4QSFA 3GXMA 3GNOA 3UCCA 2FDMA 4DJDA 4WSJA 1B57A 2BS9A 3K4AA 4UWMA 1H09A 3Q65A 2OX4A 3WN6A 4B5NA 1DL3A 3MSRA 1Q45A 5H91A 4IMEA 3EMZA 1EZWA 4LBSA 2V8ZA 4GH3A 3POHA 1KM1A 5MHBA 4H8UA 2X1UA 2QHAA 1E3ZA 5K9DA 3L21A 1K9DA 1DKWA 1IEVA 3AJ7A 3ES8A 3HMCA 3ANVA 3RIKA 1W31A 3CS2A 5EA9A 3VIPA 3EWWA 5AHEA 1JZ3A 1I2PA 3IUHA 1TG7A 3LDVA 1LL6A 3L9CA 4H83A 4LF2A 3W76A 2UBPC 2ZFAA 1TZ7A 1NM9A 2NUWA 1HT6A 1RALA 4TX6A 5HJLA 4OUIA 4JOMA 3ISIX 1K4HA 1XRFA 1GONA 2NQ9A 4IIBA 4QG9A 2NUXA 3BV7A 1BRLA 1K02A 1XYFA 3EB4A 1R3VA 2WKLA 3AMCA 3P67A 1SZGA 4CU6A 4HK7A 3WLSA 3L5AA 2PDNA 1EJRC 2ZKMX 4U3AA 3VNYA 1FCQA 3GNPA 1OABA 3VGEA 3W1NA 3GHTA 4NZCA 4WRHA 1EQPA 1ISXA 4DAFA 2AQVA 5CZJA 2V9DA 3OO2A 1W8GA 2RDTA 1FWEC 1CX9A 3CUGA 2EPMX 1KFEA 1CXFA 4U5KA 2CIPA 3CO8A 4LYQA 3TFXA 1Z9AA 3ZZ1A 1TJ2A 3DC0A 3FOKA 4W8AA 1E6NA 4FOUA 2Z25A 1R3SA 3RX3A 5F1VA 3KLLA 1KBLA 4DJFC 4GYPC 4Q4RA 2RH9A 4KGJA 1J0JA 3FW6A 1JGIA 2IXUA 2DJLA 3ARPA 4WY0B 1SPQA 4R34A 3UGRA 1C93A 5DN1A 3DUGA 1E15A 1AJ2A 1EEXA 4KIEA 1OYCA 4XZWA 3WIJA 4A3YA 3GSMA 1K8YA 3UXAA 1YDOA 1GEHA 1O5XA 4Z0JA 2BOEX 3CV2A 4AMCA 4GNJA 1SFTA 4WF7A 2QT3A 3PZTA 1ZTVA 1HKJA 4YN5A 3KE0A 1O68A 1P0KA 1WZKA 2PGRA 3R8RA 3OB8A 1EP1A 4GVHA 3I4KA 3FA5A 4A6GA 4MLJA 2G96A 3M5VA 4CNOA 4NXSA 3TMLA 2OSYA 5DBTA 4MNJA 3L65A 2WSRA 1W1TA 4Y9OA 3VIMA 1LBLA 1BKHA 1AMKA 5HMFA 3BURA 2A21A 3U0HA 2Z2UA 3WEZA 1MRQA 4HU0A 1BGGA 2CBUA 3NO5A 3QRHA 1VPXA 3D5HA 9RUBA 3L0GA 3AXMA 4JYEA 2HSAA 3SGUA 4LW7A 3EPNA 4JX6A 3B0VC 2EKGA 4GY7A 2Y7EA 1U30A 1GOMA 1Z8AA 4J35A 4FHAA 3BLFA 3CYVA 3NQDA 3F4WA 4OGZA 3EA3A 2PGEA 3DECA 3I6EA 4I8DA 4NQ1A 2YCLB 1XINA 4JTQA 1ZBVA 1X6UA 5LGXA 1GPWA 5BWAA 2ATSA 3QV6A 1KD0A 2YA0A 5CQ1A 4PCFA 1RA5A 4S2BA 3NAVA 2W67A 3CEPA 3KW3A 2VX5A 2AL2B 3PTDA 1Z41A 2CZEA 2WZMA 4F40A 4HB7A 1KTNA 4I7VA 3ONBA 4ZQNA 3W71A 3ONCA 4M6QA 2QJGA 2PBOA 1EHNA 3WFAA 1J0IA 1IXNA 1BSIA 4A2RA 3S6TA 3GAKA 4I8YA 3W72A 3HURA 1RCXB 3B8UA 1YPXA 3N34A 2CZ5A 1OG0A 1MUWA 3TEVA 1R3WA 1GQKA 3C0LA 4GIRA 3MCOA 4H2HA 1XH2A 1JPKA 3ARWA 3FLUA 1NWTA 4HNLA 2YGYA 3HPZA 1Q66A 2WM1A 1UHVA 3B8TA 1JEZA 4RCXA 3SCRA 1S2VA 1XLBA 2PDWA 3O1NA 1F2JA 2OGJA 2JKEA 1O1HA 4LB3A 4XKMA 3KRUA 3PVFA 1PO9A 3SRKA 1DIDA 2JGYA 3GNDA 3UEQA 3EXRA 1NOWA 1JVNA 1EGZA 4F4RA 1CXIA 5ABEA 4IXXA 1TTJA 4NJGA 1AQFA 3MO4A 2GQ9A 3LXAA 3MMTA 3V0SA 1D2KA 1LT7A 1AVAA 2NT0A 4HYWA 4GYJA 4XO7A 2Z2BA 3DGRA 4X63A 2V5DA 4PEEA 3HA1A 2WVSA 4C6PA 4F2TA 1A47A 4YMZA 2E1DA 2FLIA 2HNHA 5A6BD 1BWKA 4PN2A 1XYCA 4UMAA 2DZXA 3LSCA 1Z69A 4IFOA 3RO6A 4D6CA 1ADOA 2CEQA 3CMGA 5C7VA 2R1KA 2IQTA 3U4FA 4FO4A 3TLLA 1J10A 3SEPA 1HP5A 4DI9A 4JHOA 3DN5A 2FZMA 1XIBA 1TWZA 1FXQA 3H8AA 1RCQA 4PTMA 4YL2A 3O07A 4MWAE 3H26A 1K9EA 1S39A 2D3LA 3TH6A 3A9IA 1NY1A 2PWHA 5ECUA 5F2IA 3E9AA 2BP1A 4C1KA 3GNRA 3DHPA 3ITCA 3W01A 2YCKX 4W7UA 2B31A 3FDKA 4PBFA 1XGZA 3M6DA 2VGGA 3IVSA 3MHFA 4AXNA 3S5OA 1SO3A 3T6CA 3RR4A 3C5QA 3C2YA 1WAWA 3WL0A 1JGMA 4KCWA 4ROPA 3TMQA 1DJZA 2XN1A 3BAJA 2RFGA 1AODA 2ZZ3A 4F0LA 3GBDA 2HCVA 2OELA 1NDYA 1Q2SA 2ZRUA 2PU0A 4A29A 3ABOA 4A3UA 1MYRA 4JIPA 5M5DA 3BAWA 4MYXA 4Z1CA 3XIMA 4AG0A 4RE4A 3KLKA 4XK2A 4RV8A 4QR6A 2YYTA 3BAXA 4HNUA 3AXXA 3R25A 3N6QA 4O14A 3GTFA 3OP2A 5AHIA 4JTTA 3TNOA 1QT1A 3MV01 4IG2A 4MB5A 5ABHA 4AWSA 3KAOA 5HNRA 5BW6A 3FS2A 1GKPA 1DXFA 3QJAA 3QVQA 4EPKA 3MUAA 3HPXA 2CHNA 3HN3A 3T7VA 1H0IA 1D7KA 4GBDA 1LG1A 2CLEA 4S39A 3TZFA 4ADSA 1ZLPA 2H3BA 3M0LA 4CQ9A 3D3FA 1O5KA 4HVXA 2FPYA 4Y90A 1TWIA 1UR8A 4QXIA 1QXLA 2F8QA 1Q5MA 4MPQA 4W88A 3EWCA 4DBUA 3RRXA 2WJEA 3H70A 4Y9PA 3PY2A 2XDFA 4DJFD 4TTGA 3AIWA 1W3JA 4AHOA 2WKGA 1VPQA 3LQGA 4M7TA 1MDLA 1JUBA 1MQPA 2E67A 1LQ2A 2FVLA 3MBDA 5DANA 1NIUA 3O05A 3WLTA 4NZFA 4B9ZA 4AHQA 4JN6A 3CTTA 1D3CA 1AW5A 1JZ2A 4GACA 4O1CA 2VC7A 3B4UA 1S5MA 2R1MA 2Q8XA 1WZMA 2OT0A 3LPPA 3ZLFA 5LSMA 3OHMB 4IFKA 5H6HA 2O9OA 3HMJG 3VC5A 4IQDA 4NNCA 4GFSA 4KKXA 5HNUA 2BLEA 2J9XA 4HHLA 3N9KA 1CB2A 3JR2A 3NUKA 3VILA 3DYPA 1KXTA 1XLIA 4H2CA 2XVPA 3K1GA 3MB9A 2Y7GA 4K37A 4MWAD 1XCWA 3B0PA 3IV3A 1QNOA 3PP7A 2PDUA 3GXIA 4ZOAA 4IJRA 4J27A 3JU2A 2GGEA 1OX6A 4M7SA 1IXOA 4Q8MA 1E6ZA 1ISWA 1K70A 1E6RA 4MFDA 4OOZA 2EXOA 2Y62A 3S2LA 3BSGA 3N3MA 4X0NA 1FWFC 1SR0A 2OLAA 1H4PA 3FJLA 4MADA 4HHMA 3LTPA 1VS1A 3W88A 1W5OA 2QZRA 2ZUNA 2A1YA 2EGZA 2C18A 3PB0A 3H7UA 5I06A 1NQKA 1WP6A 4J3WA 4BK9A 1GOXA 4N6EA 4PUJA 4N0RA 1UA7A 2HK1A 1U1HA 4JTUA 1BEUA 4IUGA 3QLLA 2OR2A 1Q8JA 3MSDA 3KDOA 1EF2A 3BGGA 2D69A 3O6AA 3U7VA 1RXOB 3AHVA 5LA0A 2G5WA 3H7VA 1W2PA 4GQRA 1R9YA 1QI0A 4H1ZA 5A1AA 1VHNA 4RNJA 1ONEA 4U5IA 3BC9A 5ABFB 1Q6OA 4H8HA 4EXQA 4XKYA 1QW8A 1HF6A 1TMLA 4KBXA 3G1HA 3PS7A 3HGOA 4FK9A 3SFWA 3T2OA 3C0JA 2DSKA 1B0IA 4M1BA 3G8EA 3W1MA 4ATLA 5CJ5A 2PDGA 3K5XA 1WDPA 4MYAA 2W92A 1UC5A 2WNZA 2QJMA 1W37A 4GABA 2VI0A 1TV4A 3C86A 3M7WA 4CCEA 4E4PA 2PMQA 4DJED 1LOSA 2FVMA 3GXNA 1CXKA 1SZNA 3WQ4A 2ZRVA 4DZAA 4E2OA 3RAOA 1FFQA 1M7OA 1POKA 2Z7KA 5K4ZA 5A5WA 3WDJA 3A23A 1M04A 1N2VA 1A5OC 2D22A 1BHGA 4NUWA 1SMAA 4KFOA 4AD0A 5IM51 3M41A 5E0CA 1DJWA 5DXYA 2P0IA 5LNRA 1EOKA 3TJLA 3QY8A 1ISYA 2HISA 1FFRA 2DIJA 5CZTA 2UY3A 2PWEA 1SYTA 4QISA 2A79A 2V0TA 2XZ7A 3VZYA 2P3ZA 4PCSA 4MKSA 4IUOA 3AICA 3W7NA 4FNSA 2YBTA 1UWQA 1I4NA 1PTDA 4GBUA 2WANA 4DEFA 3GDBA 4RR4A 1E1FA 3GFYA 4Q8UA 3TCEA 1WBJA 1BRLB 2DVUA 4P7RA 3N6HA 3U2CA 4QNEA 4Q7NA 3B3DA 3ECQA 4DWDA 5A2CA 3ITXA 1QI4A 3E49A 4IPPA 2ABAA 1BG4A 1Q6GA 4M6UA 4OOUA 4C6NA 3GXTA 4MY8A 4FZIA 3XINA 1EQCA 3RCYA 1M9HA 3QMTA 4YJ5A 5BXTA 5FL0A 2A0NA 4LCSA 3KOWA 4AEEA 1B3WA 4L1XA 3RLHA 1A5KC 1P0BA 3DI0A 2DW7A 4IIFA 2BASA 1TRDA 2CETA 2OOFA 2RJHA 2VZVA 3H2FA 3N2OA 5DO8A 5D37A 1JNDA 2NLIA 4IICA 4IIHA 1M53A 3TTYA 5KITA 3HU7A 5D9OA 4LH8A 1FWHC 3K13A 1J96A 1LTDA 3UW6A 4DJDC 1DPMA 1FWSA 3NPUA 1EOMA 3CV7A 3VO0A 1E0TA 1CW2A 3PG8A 1J93A 4IT1A 1L6SA 4B92A 3TYBA 1HGWA 2J7CA 5LIWX 1NFPA 3ZFHA 4RNHA 4ZOBA 1E0XA 1XIFA 3NOEA 1RY8A 2POZA 4ZO6A 4G8TA 5BOFA 4Z2KA 4GVIA 4MJZA 2YDQA 3DH7A 2P53A 2DH3A 1XXXA 1PEZA 1IYXA 3ZT7A 3FXGA 4J28A 5D2TA 4A3HA 4Q8VA 2WVTA 2NX3A 3WLRA 1EA9C 1WKDA 1IT7A 4LUTA 9XIAA 2BXYA 4IIGA 3SCTA 4BEQA 1EWDA 4MNLA 2UV8G 4GX8A 3VMNA 3VMPA 3SJ3A 3VOJA 1KA9F 4N9EA 2VUNA 1JCJA 4W5ZA 2GGJA 4RDVA 3A22A 3QYSA 4LF1A 1C92A 1NELA 2X1SA 3N9SA 3ARZA 1W9BM 3P8JA 2HS8A 4DO6A 3O8AA 5T26A 2VJXA 4NAFA 1B9BA 3AFBA 4MKNA 3AYVA 3R0DA 4WGHA 4UC5A 4P5UA 2G3NA 5AYYA 5XIAA 1XIJA 3BXWA 2LLEA 2A6NA 5LKYA 3L4UA 3W3OA 2NWRA 5FL1A 3N11A 4A8NA 4IP5A 5C9ZA 3TKFA 2PTZA 1EC9A 4PUDA 1ZGDA 4FR6A 2ZOXA 3WNNA