1AZ1A

Alrestatin bound to c298a/w219y mutant human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 98
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az1A00
2PDCA 2J8TA 4LBRA 4Q7BA 4YU1A 5HNTA 4FALA 4JTDA 1QWKA 3V0SA 5KETA 3CV7A 4ZFCA 3UZYA 3BV7A 3LUTA 4GACA 2F2KA 2R24A 1S1PA 2IQDA 4LAZA 1HQTA 2DUXA 1MI3A 1AZ2A 3DOPA 1ZGDA 4DBSA 2PDIA 3N6QA 4JIIX 2A79A 3LENA 3UFYA 3N2TA 2ACQA 1J96A 5C7HA 1UR3M 4YS1A 3RX2A 4IJRA 2F38A 1T40A 3V36A 2ACSA 5M2FX 2IQ0A 2HVOA 3CV6A 1YE4A 2HDJA 4XZNX 3BUVA 5LIUX 3DN5A 1JEZA 3UZZA 4EXAA 2PDBA 2IPFA 2DUZA 2PDNA 4LB4A 4JQAA 1QRQA 4OTKA 1LQAA 1US0A 2INEA 2INZA 4L1XA 2PD9A 1GVEA 3R58A 3B3DA 3LBOA 2QXWA 1RY0A 4F40A 3FX4A 4IJCA 2PF8A 4ICCX 1AH3A 3V0TA 4ASTA 4WDWA 4PMJA 3M64A 2PDWA 4R9OA 3LQLA 2FVLA 5HNUA 3CAVA 2FZ8A 3MC5A 3S3GA 4JQ4A 1S1RA 5LIYX 4XAPA 4JTRA 2PDFA 1YNPA 2PZNA 4JIHA 1T41A 3V35A 3BCJA 2BGQA 2BP1A 3WBXA 3WG6A 4MHBA 4XVEA 4XO6A 4JQ1A 3G1RA 4AUBA 4YVXA 3Q67A 1YNQA 3H7UA 2HE8A 2ALRA 3M0IA 3LZ3A 3BURA 1XGDA 1FRBA 4I5XA 3UYIA 1Q13A 3UZXA 1VBJA 2IPGA 3H7RA 4GCAA 2HE5A 2NVCA 2PDGA 4DBUA 1PWMA 4QR6A 5DANA 1IHIA 4GQGA 2ACUA 3LQGA 1X98A 4HMNA 3CAQA 1EF3A 3EB4A 4RPQA 1X96A 2HEJA 3O0KA 4XZIA 1OG6A 2WZMA 1MZRA 1MRQA 2P5NA 3V0UA 4EXBA 3Q65A 4DZ5A 5HA7A 3COTA 3UG8A 1Z3NA 3GHSA 4GABA 2NVDA 4XO7A 2C91A 4LB3A 2IKJA 4JTQA 3VXGA 3QKZA 3UWEA 1ZQ5A 3FJNA 3MB9A 3LN3A 3C3UA 3LZ5A 2ACRA 2PD5A 1ZUAX 2PDLA 3GHTA 1SM9A 1XJBA 3R6IA 4FZIA 2PDJA 4PR4A 4JTAA 2R9RA 4XZMX 2FGBA 5AZ1A 4PUWA 1EL3A 4HBKA 3UGRA 4XZLX 2ISFA 2PDMA 4XVDA 4PRRA 4QX4A 3CMFA 3GHUA 3R94A 3R7MA 3GUGA 3G5EA 1AH4A 4H7CA 2FZ9A 3WBWA 3KRBA 1R38A 2PDQA 2PDKA 2AGTA 4IGSA 1S2AA 1Z9AA 4WEVX 4PRTA 2IKIA 1M9HA 4DBWA 5LIKX 5JH2A 3LEPA 3WBYA 2PEVA 5AZ0A 1RALA 3RX4A 4PUUA 5LIWX 4JTCA 3U2CA 3LD5A 3D3FA 1IEIA 4JQ3A 2PDHA 2BGSA 3UP8A 2IPJA 1YE6A 2HV5A 2PDXA 2WZTA 3GHRA 3R8GA 4NKCA 2FZBA 3NTYA 2I16A 1EXBA 4YVVA 4XK2A 1A80A 1PZ1A 4QXIA 4WDTA 2IKHA 1RY8A 4JIRA 2PDPA 3P2VA 4FAMA 4WGHA 3H4GA 4H8NA 3R43A 3F7JA 4QBXA 2CLPA 2HVNA 3EB3A 3O3RA 4WDUA 1ZSXA 4Q3MA 1HW6A 3ERPA 4WRHA 4GA8A 1PWLA 2DV0A 2IS7A 3CASA 3EAUA 3T42A 1ADSA 1LWIA 5LIXX 1Z89A 3WCZA 2PDYA 5JH1A 1AH0A 3ONBA 3R8HA 1VP5A 1PZ0A 3UZWA 1X97A 3M4HA 4FA3A 2VDGA 2IPWA 1K8CA 4G5DA 1EKOA 1AZ1A 2FZDA 4LAUA 4GIEA 1Z8AA 4JQ2A 1PYFA 3LNMA 3RX3A 1Q5MA 4GQ0A 1S2CA 4L1WA 2IKGA 2PFHA 2I17A 4WDXA 1AFSA 2PDUA 1XF0A 3ONCA 1C9WA 4LBSA 4XZHA 4YVPA
chains in the Genus database with same CATH superfamily
3RITA 1JDFA 3WQVA 3H2MA 4AXKA 2X42A 4E4FA 3UG5A 3V0SA 4PMOA 1F2JA 2FVMA 5A6JA 3SN4A 1UIPA 2F61A 3KTXA 2G4JA 1ZGDA 3M0XA 4INFA 2YDQA 4QIUA 1EHNA 3DFYA 4XG1A 2VUYA 2YPIA 3UERA 1YX1A 5EMMA 3IAPA 3KVLA 1JI1A 3DAQA 3QQWA 1VQTA 3B97A 4HNNA 3R4IA 8A3HA 4HPGA 1OFAA 2DUZA 3QH2A 1GQLA 2WPBA 4GNJA 4NAEB 4NXKA 3GIQA 3ITVA 1TIWA 1ZCCA 3CMGA 4KCVA 4B9YA 2YYUA 4V28A 1OF6A 5C71A 4QSFA 3VNDA 1KRAC 3B3DA 2Y5JA 2CHRA 2E7FA 3EPNA 4I6VA 3OBKA 3RCMA 1HP4A 2QZRA 2GSHA 3WK2A 2QV5A 5I7GA 1R7OA 1LLZA 3RM8A 2FVLA 2PWEA 3GDRA 3W7QA 2J75A 3CIXA 5XIMA 3AS2A 2V81A 3IGUA 4O17A 2FGLA 3S3GA 3NDYA 4AG0A 4P7LA 4M5PA 4PUDA 2WC3A 3O6CA 4KGJA 4DJEC 1KRMA 2PDFA 1ZALA 2CLHA 5A8MA 3G1VA 1SJAA 2JE8A 3KL0A 2HROA 3WN6A 4A3RA 1EGZA 1MQQA 3SUVA 1YTEA 4AQLA 2V30A 1D7KA 4DXKA 1TSIA 3S2NA 2Y85A 3UCQA 1FCVA 4W84A 3WD0A 4ZEPA 1P7TB 2HE8A 3P81A 4OWGA 1TPB1 6CGTA 4IIDA 4IMAA 2QULA 4LNCA 3G1SA 3LYEA 1AJZA 2RGLA 4PTNA 4QISA 3UZXA 4S3FA 1VPQA 3HPZA 2OLSA 1E0TA 3B40A 3M41A 1VKFA 3KL3A 3SCNA 2X05A 3LRLA 1GW1A 3HFYA 3S2JA 5IHSA 1RQBA 4UMCA 3BO9A 1CLKA 3AJXA 2XIJA 1RH9A 1WXYA 2OOGA 3O9NA 4QG8A 2DT3A 2XTKA 4GX9A 2QMKA 4JR5A 1UR0A 3F2BA 1GNXA 2H9AA 4YHGA 4IZGA 1Q8AA 3B03A 6PTDA 1RBLA 2FB3A 1TCMA 1AW2A 2EPLX 1EP3A 5IBXC 3ELFA 4QLKA 4BS0A 2FMNA 3XINA 4BEQA 2VX4A 4AEEA 1ZCOA 5A94A 1XLEA 3QKEA 1WPCA 2ZA2A 3GDTA 1F9CA 4L4LA 3GVRA 2IMRA 1AL8A 1YXDA 3F4DA 3PBVA 4ICNA 4X3ZA 3PZUA 2REQB 2XH7A 2QUTA 1G94A 3CQHA 1QPQA 3BAYA 2C71A 5BXRA 4JFTA 5EPDA 4LOCA 3PWGA 4HK5A 5LNWA 1PTDA 4K8EA 4G6CA 2X1SA 2DVTA 5C8BB 2VRJA 2E25A 3OGVA 4PB5A 1J0KA 1ZY9A 3AU2A 3FK4A 4GI4A 3CMFA 2QIWA 2X1TA 2HNEA 3G5EA 1GZ1A 1SR0A 3W2MA 3MW7A 3RG6A 4Z17A 5K4XA 2D23A 3D5HA 4IG2B 4B15A 3TMQA 4GKLA 3PC0A 4DZIA 3UWZA 2ZFAA 1TFVA 4IPJA 1OCBA 5LIKX 4LCRA 1NP0A 4B92A 1ZS2A 4IPPA 3ARWA 3CUZA 2C13A 1VGAA 1LP6A 3RX4A 4N02A 3DHPA 4KIRA 1TA3B 3U2CA 2D0HA 3ZYZA 3TVAA 4HJWA 1E9YB 2BDQA 3DFNA 1V3IA 3AIEA 3STPA 3G8RA 1IXNA 3NL2A 2DZPA 3FGCA 1LTDA 1TJ1A 5DCBA 3R8GA 1IEQA 5I78A 3BCFA 1EDQA 5HNRA 4H9MA 4QP0A 3O63A 5GNXA 4KEUA 3CQIA 1Z42A 3BZGA 1B0IA 1M01A 1VFSA 1W2VA 4HD5A 4E2VA 1FY6A 5FF0A 2EPNA 1JPIA 2F6XA 3F7JA 1O5RA 3QHNA 4F2UA 1I1XA 1Q6QA 2CLPA 2VTFA 5HOSA 4ORIA 3S42A 4IF2A 2JIWA 2GVGA 2QCNA 4NZ4A 2ZWYA 3M47A 2FDMA 1VBHA 1IXQA 1XYLA 2OPJA 2FJKA 3MBFA 2PLMA 1UD4A 1E72M 4IISA 2VGGA 3M4HA 1JQXA 3I10A 4GJJA 4Q4MA 4CD4A 1IWAA 2RDXA 1UCWA 1P1MA 5AHMA 3DZ1A 2QPUA 2DZXA 3LNMA 4D6FA 1FKXA 3A64A 4JTTA 3J7HA 1F74A 4HU4A 4K8GA 2ZZ4A 4XUYA 1AW5A 1KA9F 3C4UA 1OX4B 3G3DA 3INPA 4PB4A 4ZQMA 2WM1A 2ZE0A 3T8QA 4ZB2A 4AZ7A 4KCUA 1UWRA 1ITXA 2DSVA 3SADA 2ABBA 1RD5A 1BWKA 3FIGA 4JTDA 1QWKA 1GK8A 2HPIA 3WNNA 3UZYA 7ODCA 4W5ZA 4GACA 1EC7A 1RXOB 1TPC1 2CXEA 3DYOA 2DUXA 2NQJA 3OZOA 1XQLA 2PBGA 3A4XA 3LHWA 2WSKA 2ZRVA 3VOHA 4GO8A 5A8OA 1J96A 2HWGA 4URIA 3NOEA 1UQYA 3CZLA 1LRNA 2ZUNA 1F4HA 1RR2A 5EFFA 2Z0IA 4N6FA 1XIEA 3G24A 1BSLA 3PFMA 3ZR5A 2NV1A 5F2MA 4LB4A 5I79A 3HMJG 1UKPA 1K1DA 2QPXA 1PB0A 3MO4A 1MXSA 1MWOA 3BSMA 3LCGA 4GXPA 4BZYA 2W67A 4G7FA 4L1XA 1XD1A 1GHRA 1GVEA 4Z1YA 3Q2DA 4U3AA 2Z24A 3SN1A 5M3WA 4R88A 1YTDA 3UESA 2PF8A 2PB1A 4JTIA 1EDTA 4E2OA 2DSUA 1ALDA 4R9OA 3CTLA 3JR2A 3WDJA 3TJ4A 3T8LA 4JFSA 3R0DA 2DZSA 3FEQA 4CNOA 5I6SA 1NSJA 4ZOAA 1S38A 1QW8A 2OLAA 1DQUA 3W28A 4O8AA 2W63A 2OWCA 1MW3A 2RGMA 1XYFA 1EQCA 4DQWA 4GRSA 3BCJA 1G7UA 3BOFA 1BXCA 3L66A 2J8FA 2OYKA 1TB3A 4UUIA 2ZADA 5T9CE 1UR9A 2FGZA 1TVLA 1PSCA 3G18A 3OOQA 1OFBA 3GZAA 1RJRA 3VNYA 3F2CA 1VIZA 3WENA 1V4YA 3LA4A 1U30A 1EXPA 2CBJA 1XIGA 2WMFA 1VBJA 2PGEA 2KAUC 5EFDA 5KZ6A 2XIBA 2CXGA 1DP0A 2NLIA 3B8DA 4JTSA 5E70A 4ZFMA 3E0VA 3T4WA 4PZVA 2EG6A 1XSIA 4MNKA 1EOKA 3LPOA 3KRSA 3PZMA 3BLEA 5LA2A 2WW5A 3CHFA 4BA0A 4FR6A 2YOCA 2NLYA 4KFOA 1BAGA 1J6OA 1H1YA 3V0UA 1G5AA 5M03A 1UBSA 3V16A 1BF6A 2WVVB 4LAMA 1U2YA 3IGSA 4BQ5A 3VOIA 1YXYA 1YPIA 2ZZ5A 4RW3A 3SEPA 3KLKA 2IUZA 5LXEA 4JTQA 2C1IA 3OLGA 2WPGA 2PP0A 5K7JA 2J88A 3L4YA 4HA1A 4Y8FA 3W4RA 4CVUA 1UMLA 3LRMA 3N18A 3E1F1 2CBVA 1VHNA 3N73A 4WOQA 4GJ1A 3ATYA 3LN3A 4LCSA 2WC4A 4OOUA 2OODA 2V5CA 2PD5A 4F9DA 5EY5A 3VGDA 3CT7A 3OQEA 1SM9A 4MJZA 5CPOA 1DXIA 3MMTA 1MZHA 2CPUA 1XJBA 2UV8G 3N3TA 4B5SA 1PXGA 1WB0A 1GOIA 4H8UA 4F8XA 2VR5A 4M3PA 4FXSA 1AQMA 1U1JA 1UH4A 2P1FA 2E8YA 4WJ8A 3CEPA 1F61A 2ISFA 3KWXA 5HMFA 4QX4A 2Y5SA 3I3BA 4PBFA 2ALDA 1L2QA 2D22A 3G2GA 3T81A 5XINA 2AGTA 1VYSX 2AQWA 2BSLA 1GTHA 2GZXA 2PBOA 3VAVA 3W74A 2QDHA 4IJBA 1BQCA 1S39A 1R3WA 1M6JA 2CWNA 3G3MA 1KFCA 3H6OA 1XYZA 3PPHA 3TC6A 4JCMA 3LHUA 3PN8A 4PUUA 3PPFA 4C7DA 1R9XA 1F05A 3PZ9A 3MUXA 4J40A 1C29A 3WH5A 4JFWA 1XWYA 2WSQA 2DVXA 2BMBA 2D20A 3SY5A 1QUMA 4H7ZA 1JCMP 4ADTA 2A3EA 1EA9C 2Z6IA 2AL2A 2PWDA 2WZTA 1LOQA 3AYSA 5BOEA 4DLFA 2WQPA 3TYAA 4XSLA 3ARSA 1ODZA 2NQHA 2OR2A 5HK4A 1QOXA 2B7NA 2OX1A 4Z2HA 4H9UA 2Z7KA 3TLLA 4PMRA 4WGHA 5I77A 5DX7A 4ZENA 4IIGA 3ITCA 3A47A 2J79A 2QCHA 2HNHA 1Z48A 4AYSA 5AYBA 4ZOBA 4DEFA 2WLYA 3H12A 4M51A 2PE4A 3JW7A 4RUBA 4UB9A 1XCFA 3VKAA 1XG4A 4H3DA 1L2UA 3A5FA 3SBFA 1W6TA 2H9AB 3HZ3A 3VUSA 4N9DA 4MJ2A 3BJFA 2QEZA 3KFTA 4R9XA 5HPCA 2G3MA 4G5DA 3GRIA 1QWGA 4CNNA 1V6XA 3PZQA 4BJHA 3H54A 5GJPA 1RCQA 4EKJA 3NVTA 3I6TA 4WIWA 4JPGA 1S2CA 4IFOA 1KXHA 2IKGA 4JDYA 4DBDA 3GXTA 1N8IA 1JUBA 4LRTA 4GVGA 5GNYA 3WNKA 1W5QA 1OHLA 4PN2A 3VIHA 1J12A 1JDEA 1E9ZB 2W5FA 2W4XA 3B04A 1OX4A 3H7VA 1MNZA 3AXHA 2QKFA 1FA2A 5HATA 1EC8A 1TV8A 1W9BM 1C8QA 4L1GA 8XIAA 5CPNA 1S1PA 3E5PA 5F1VA 4LAZA 2GQ3A 3MP3A 1W3TA 1WV2A 1OK6A 3FCPA 1ISYA 4GQRA 3NQ8A 1E6SM 4HZMA 1TPVA 3ZFHA 1IT8A 1B9ZA 1LBMA 3B8SA 1XDJA 3GG8A 4Y96A 4K7VA 4MAVA 5CZSA 4B9ZA 3W37A 2WB5A 5F4WA 2ACSA 3CV6A 1BVWA 1GYLA 3EOUA 4GQQA 4GUJA 5FEPA 3ARPA 3CH0A 1UWTA 4GK8A 1JUEA 2WBKA 1W5OA 5LNVA 1MMFA 1VFFA 1YDYA 4Q7NA 2VWSA 2VEKA 1US0A 4D1JA 2INEA 2BOFX 3GR8A 3VD9A 3AHZA 1XRTA 4JN8A 3W9ZA 4AB4A 2Y1HA 3C0JA 3KTCA 4E6MA 4UQCA 2WLZA 3FX4A 5FJIA 5E5CA 4ZXLA 4FSAA 1J0IA 1A47A 1P6CA 1GVIA 1W1A1 4FXFA 3WH8A 1UG6A 2VENA 1V0LA 1LL6A 3V1HA 4OHQA 3W0KA 1XM3A 2VEFA 2J77A 3RPTA 4D8ZA 1DWJM 4JQ4A 1TQJA 1XCWA 1GVYA 3T2PA 2QPSA 2E4TA 4C6PA 4C1NA 2O9TA 2Y8VA 5CG7A 9CGTA 3WG6A 4QDPA 3LCWA 4XO6A 4ROPA 3VX0A 1HZYA 2GPTA 3RUBL 1OQFA 3L4VA 5I3KA 2ZUTA 1WKEA 4XSMA 1X8CA 2ESCA 3UWVA 5DBUA 4ZR8A 4GI6A 4JZ5A 8XIMA 4HPJA 4HU8A 4YMZA 1GOQA 1XLMA 4H83A 4I5XA 3S1VA 3SCQA 1HVXA 3JZUA 5D30A 1LQ0A 2J8GA 3EMQA 3WIJA 4JTHA 1QNRA 1XH1A 4LV9A 3WUFA 1T99A 5AHFA 3STEA 1V79A 2WO5A 1H1ZA 1KFEA 1ML1A 3D6NA 1Y5WA 3S5OA 3IS4A 4PMQA 3M6YA 5LNUA 2HEJA 1MRAA 4P8WA 1B4KA 5T26A 1XRFA 1ONWA 4C6OA 3HPXA 1MRQA 3GTNA 3SCWA 3OZPA 4S3JA 4EXBA 1HGYA 3I4EA 1JZ5A 4B4FA 2QF7A 3FEMA 1B30A 2GGEA 3ID7A 3NM1A 3WLIA 2JIEA 1MO0A 1GT8A 4GFSA 2NVDA 3DCPA 3MCOA 3VIOA 1F6PA 3CQ0A 5FKYA 4C1KA 1FH8A 4TO8A 1GVRA 3FSTA 1KCKA 1BG9A 1ZRQA 4ZQPA 3O07A 4AWUA 1W5NA 3VMOA 4NJHA 1S5NA 1P0BA 4KESA 1HKIA 1KWKA 1RSCA 1WZKA 5EGRA 3VIJA 3R6IA 3OA5A 1J2WA 2Y7FA 1JAKA 1NQKA 3W7DA 4HQVA 3WLJA 3W6MA 3VFLA 1W3LA 5AZ1A 3HG3A 5DXXA 1PIFA 2PTDA 4ZMGA 3T0DA 2X8RA 1V03A 4H7CA 5G1YA 2V5BA 3KP1A 2KX9A 1BRLB 2C6QA 3LSCA 7A3HA 3N12A 4AZCA 3R12A 2GGHA 3T05A 5U7SA 1KXQA 1WKFA 3DI1A 3GW3A 5HMEA 1HGWA 4DBWA 4RW5A 1HNYA 3GKAA 3W01A 2DORA 4RE3A 4ZZ9A 3QYSA 3FNDA 1M1BA 1THFD 4KMQA 1B31A 4UR9A 5HR6A 5LIWX 3P0XA 4H19A 1BKSA 4AWTA 3PJUA 5BYWA 5ABFA 1R3QA 4NRSA 4PTDA 3UY7A 4G1NA 3OGRA 3KRUA 5G1TA 5KINA 3UP8A 3TEVA 3GIPA 1NTHA 4QLLA 1D8CA 3QR3A 3IUDA 1LDCA 3UJFA 3ZJ8A 3QC3A 1R46A 1LBFA 4NKCA 2I16A 4ZTXA 4IMFA 2I5GA 2R14A 4HVXA 4YCPA 1W3KA 3M0ZA 2WAGA 4WD0A 1CEOA 4JKKA 5DRCA 4B3KA 3H23A 4HPHA 4O1BA 1QK0A 1GPFA 3SCVA 3R43A 4Y9NA 2QHAA 5DF0A 3MHGA 4N7QA 3AZTA 2OSYA 3VDGA 1PIIA 1I0DA 3ME3A 4LUTA 4CUCA 1VRDA 3ERPA 3OLEA 1ONXA 3WMCA 1UD3A 3GFXA 2OMAA 3FHAA 3S5SA 2XJ7A 4IMEA 1TV5A 5JU6A 1Y8BA 3W7OA 1XBYA 3P8IA 4ZO6A 1LRTA 5XIAA 5HBFA 3W70A 3K13A 2WM0A 2VDGA 3XISA 3BMVA 3NDOA 1F07A 3GXMA 3U57A 2JKPA 4H6QA 4LUTB 2F6UA 4ICMA 2FZDA 4MKVA 1KXTA 2J9ZA 5HJLA 1NFPA 4U2YA 2CLFA 4JDBA 4MNLA 4RCXA 4MUZA 4IG2A 1KW1A 3WLRA 4POCA 1TUFA 4PUMA 2PZ0A 3E5BA 5B7ZA 4L1WA 9RUBA 2W92A 3HU7A 2PURA 4FMVA 1QK2A 2ADAA 2YL5A 4P61A 2CZVA 2QIIA 3AZRA 2PDCA 2J8TA 3W07A 4JXCA 3S6TA 2V2CA 4LBRA 3I6EA 1H7PA 2E40A 2QAPA 1JYVA 1UH3A 3RPDA 3W7HA 3WFZA 1VEMA 3USZA 3VCCA 5HULA 2P0OA 2YJQA 2CWXA 3NQDA 5EMLA 4S3AA 2J13A 3DOPA 2CW6A 3EA1A 4DYJA 3N6QA 3WLTA 1XIBA 4IXHA 2JBMA 4PODA 3UFYA 3B05A 1X39A 1U22A 1UD2A 1L8PA 1TMHA 3WMSA 2E6FA 4PMDA 3HFTA 4C6MA 1QNPA 4MNJA 3TOPA 1I2RA 3A9IA 4DWSC 3TQ0A 1ICPA 3V7PA 3K2GA 1CIUA 4PULA 3FYPA 2IXUA 4A35A 4IFKB 3N17A 3URAA 3PTDA 5HWNA 3OA3A 3N2OA 4M6PA 5D8ZA 1P43A 4H2CA 2PF0A 2DPEA 2PP1A 3S83A 3TN6A 4DLMA 4J7RA 3EDEA 4JS3A 3LQLA 1XR2A 1V5XA 5A2BA 2OLHA 4JFVA 4LUIA 2A2IA 2O7QA 1F8IA 4K36A 4DUVA 1Q7QA 4UTKA 2GGIA 1H2JA 1G4TA 3WZ0E 2V5KA 1JZ8A 1OFEA 5AYZA 3WMBA 3QSTA 1OC6A 3W6LA 4AHOA 4B90A 1Q4WA 1JL8A 1OBAA 1O95A 3OBEA 2F84A 2WMGA 1KRBC 3TOYA 1FWWA 1A5MC 3GYCA 4A8RA 2W79A 4H4IA 2C79A 3GO2A 4AVNA 1YNQA 2D24A 3CJPA 3W1PA 3BURA 1XLJA 4DF2A 4IIBA 4K7YA 3ES8A 4QGCA 4JY8A 2W0UA 1OYBA 3AIRA 4KEZA 1JI2A 4V27A 5LNRA 1CT5A 2GJNA 2C18A 1J9YA 3KZSA 3VNLA 3GNNA 4JD4A 4DO5A 1RPKA 4H9VA 3PG8A 1PWMA 3QQ0A 1IWBA 3TJLA 4IM4A 4EE9A 3HB9A 3NVDA 1GHSA 2BVTA 4M81A 1Q85A 4RPQA 1B9BA 5I3HA 3R2GA 2WKGA 3DFQA 3CHEA 4AH7A 3AAMA 1PV8A 1KWGA 4Y2WA 1JNEA 3CXOA 1BRLA 4JTLA 4DI9A 4WGXA 3GR4A 3HURA 1M3UA 4GUIA 2XG9A 3IPWA 3UXKA 2NT0A 1OCQA 4IP4A 3OLIA 4KEMA 4O53A 2EPHA 4GWEA 7TIMA 3BARA 3MI2A 1GQKA 1OCNA 3QZAA 3W72A 3LHVA 1KGWA 3WF1A 1E0XA 2ZUMA 3GHSA 1QMLA 5MKGA 1KBIA 1UW9A 2R1NA 1GJUA 3WLNA 3GW0A 1KBLA 3W7CA 2WCAA 1RAKA 3NXFA 4TV5A 4W87A 3BGAA 5H8MA 4JTFA 4F79A 2V82A 4XBKA 5KTLA 2X2GA 5D33A 1RLCL 3U9IA 2ACRA 1HJWA 2PDLA 3QBUA 2EF9A 3VIMA 1Q6OA 5D2YA 3VD7A 2YLAA 2W66A 3SCPA 2WV8A 4Q8OA 2PTYA 1POJA 3TZFA 3B9EA 3N15A 3NZQA 4YHEA 4TU1A 1X8FA 1OD0A 4C6LA 4AZIA 1A3WA 4DUXA 4XAZA 4PUWA 5EKYA 3DHFA 3L68A 2Y70A 2OYMA 4XVDA 3M0JA 5JBDA 1AG1O 1A0DA 3H70A 4NG3A 2XDFA 2Y61A 1PX4A 2VZSA 4TTUA 3M0MA 3MY9A 1TTPA 1XIDA 5M17A 2VD8A 3UGVA 5I3IA 3PUEA 1CYGA 2ZZ1A 1SJCA 4WEVX 3RNDA 1FOBA 4ACZA 4LVBA 1XKJA 3DENA 4F0SA 4XAFA 2WCSA 3FJ6A 2EHHA 5CSSA 1F6YA 1EJUC 4X9YA 3UXAA 1NVMA 1L6GA 4MLJA 3A3WA 3VI2A 4DJDC 3KUMA 3TUUA 2GDVA 1D3GA 4BF9A 3W25A 3ITTA 3BMXA 2OVLA 2XVGA 3EOEA 3CK5A 1NM9A 5AHIA 5C7VA 4MKNA 3L2IA 3CQKA 3CO8A 4ZE5A 2VJXA 2D1ZA 1A80A 1B2YA 2BGNE 1B3WA 5LKYA 3L23A 4W93A 4GJIA 1KCZA 3ITLA 3MUAA 4D6CA 2LLEA 2BXZA 2XSAA 1WXJA 4LYKA 2DEPA 4JN7A 4KW2A 3MVIA 5HAOA 2XM2A 3G1XA 2PC8A 4F0KA 1HL8A 2C15A 5FAGA 4K1GA 1EO7A 2GOKA 1SZGA 2Z26A 2QT3A 1TWSA 4FNSA 3CASA 2J9YA 3EAUA 1E56A 3GH7A 3DFOA 3N4EA 1AD4A 5BXTA 2HJPA 5LIXX 5CBIA 3WKZA 4MKSA 4D9PA 1VP5A 3PBYA 2J66A 3GVWA 1K8CA 1OSEA 1HKMA 4G7EA 1C8XA 2RFGA 4EVZA 5CZTA 3C0LA 2VEPA 4D6JA 1KQZA 3WH7A 1LLOA 1XH0A 3WLKX 3ATZA 3B0PA 1FWJC 2J78A 1NWSA 3VNIA 1TTIA 1BPLB 2CESA 3KDNA 1X1ZA 5CXPA 2PTZA 3CBWA 3S47A 5FL1A 1YADA 3PFRA 1KM1A 5I3JA 4DELA 1KCLA 3WK1A 3EWDA 3W1UA 4REQB 1KBKA 3VKBA 1QVBA 1K77A 4DVOA 1GKQA 2CLMA 3AHXA 3PZNA 3S1GA 1Q4NX 1BGAA 4W8LA 3OVPA 3WJZA 1J93A 2YCKX 1PX8A 1XG3A 5C2CA 3AYVA 3R13A 5CGQA 4HOWA 3WQDA 2ZBTA 2JEQA 3PM6A 3TYDA 3LUTA 2H90A 5JVLA 1UC4A 3A6OA 3UETA 4LAOA 4AZ6A 1UROA 4LV4A 1J0HA 4M6QA 4H41A 3DFSA 3RMEA 2PDIA 1HKJA 5DN1A 1DL3A 1TJ2A 2BODX 4ALDA 3B8TA 1WDPA 2ACQA 3CWNA 3JU2A 2ZDRA 3NURA 1BKHA 4RJEA 3PTQA 1IGWA 4I7VA 4IQEA 5FEZA 1W9VA 2ZC8A 1BF2A 3QLLA 3I6RA 3NQFA 3BSGA 4GG9A 4H04A 1GOKA 4O4WA 3KOYA 1W9XA 5CZKA 2INZA 3EA2A 1CTNA 3PAJA 2XVKA 1LT7A 4BI6A 5BWFA 3AFBA 1DJGA 4IJCA 2HVMA 4QE4A 4NAFA 3SURA 3MZ2A 4CQ8A 3AXMA 2YL8A 5HR7A 1TJ0A 2PODA 3MC5A 4CN1A 2VFHA 4XTIA 1V08A 1K7FA 1DE5A 3KOFA 4B5WA 3MANA 4W8AA 4KQNA 4XAPA 1OZMA 2VRKA 3AWOA 4Z2KA 3SRHA 4UMAA 2X0YA 4YYCA 1LWHA 3ABQA 3IRSA 4PBEA 1KV5A 2I9EA 5JUVA 4M1RA 3WUBA 3CQJA 3HO8A 1EX1A 3EWZA 4GGHA 1BVNP 3L7RA 3CB8A 4Z42C 1HJVA 2JEPA 1UKOA 2ALRA 2X7WA 3FLUA 4WY0A 3QTPA 1E0WA 5FA5A 3V3WA 5SWUA 3URBA 3MVTA 3ITGA 3LV5A 1M65A 3UYIA 1MW0A 5H91A 8TIMA 2WSYA 2YX0A 4EP8C 1UZ1A 4RDZA 4OV4A 4MFDA 3WQEA 3HPAA 5G1MA 4X9SA 2ACUA 4R85A 4J28A 1MFVA 3CAQA 3W7MA 4A2SA 1UH2A 3VZYA 1X96A 4I5RA 5ABGA 3SQSA 3TYUA 3M0VA 5CG0A 1LLWA 3OYXA 4AD0A 4ZSTA 1EJ7L 2A1YA 4XV0A 3QQ1A 3U3HA 4MWAE 4QS6A 4A05A 1IE7C 3VO0A 3MYOA 1I2QA 1P0DA 2QF8A 4C5ZA 3UCCA 1IYXA 1PX3A 3LCIA 2QYGA 2WANA 3NNTA 4LS0A 4O4VA 1R3YA 1F6KA 2VCBA 4O0KA 1F4AA 2VGFA 4WF7A 3WF2A 1XRSA 5D38A 3P8JA 1H3GA 2OO6A 1EDGA 5D9MA 3TFCA 3UQNA 4BI5A 2X1RA 4BQ2A 2Y8KA 4ZQCA 4F48A 2D3LA 8CGTA 1IZKA 4HYVA 3V5CA 4O1AA 1G4PA 1WQ5A 2DGAA 3BQ6A 1UWQA 3ABRA 4PR4A 6REQB 2R9RA 3N04A 4MG4A 5D03A 1YHTA 3BVJA 4D8AA 1PIGA 2ZYFA 3HMCA 3QZEA 2FVKA 3MJYA 3G22A 2JKAA 3N34A 1CECA 4UTWC 1K9DA 1VYRA 1Z44A 4DHGA 5BRBA 4U2ZA 3L0KA 3R94A 1DIEA 2J74A 1VFOA 2OG9A 3P80A 3WBWA 3GG0A 1GJPA 2FH6A 5FEWA 3AIQA 3H2NA 3DFHA 3AIVA 2P8BA 1OFQA 2X7VA 1CXIA 2QJGA 2QNEA 2PA6A 2Y62A 5TBOA 3F5KA 5LNSA 3R5EA 2PSNA 3LBCA 3M9YA 1YKWA 4JTCA 2VZVA 3CAKA 1E5NA 3E0LA 5BU9A 3POCA 3GTHA 2VKZG 3GTFA 4JIPA 3WX7A 2Q71A 5G2HA 2ZUWA 3A4AA 3W7NA 1X1OA 1ONEA 1H49A 2HV5A 1VJIA 2ABAA 1HF6A 2BY2A 5BWAA 3AMLA 4F66A 2RKXA 4JEJA 3Q45A 5FJRA 1Q6CA 3NL3A 3SCOA 1W31A 4NQ1A 4O1DA 2J7DA 4DXXA 3I7QA 1QNSA 4EPKA 1TMQA 3DG7A 5CC5A 4PRWA 4H8NA 1NDZA 4ENLA 4TMBA 5G4EA 5I5RA 3LM7A 4R33A 4QBXA 1QBBA 3O3RA 3C2OA 4X0NA 1CXKA 1IIGA 3DI0A 3URNA 4OBTA 2IS7A 2VP8A 3LXAA 4ECLA 5T8GA 3M0HA 4WSJA 4NSBA 2NV9A 2WNQA 3CIWA 3I68A 1T5AA 3AIWA 4WKAA 3PSWA 3VKKA 1J4EA 4Q6XA 3L0NA 1XLLA 2BHYA 1BTCA 1JNDA 2VZOA 1Z8AA 1CLXA 3QVQA 4PBGA 4J3ZA 1QPRA 4AHPA 3GNOA 2QUVA 4RNHA 4HHLA 1GVSA 1K3UA 3IAQA 1Q65A 4L61A 1NP2A 1R3SA 1W8GA 1NOWA 4AX6A 4MB5A 3ZJ6A 1K03A 1UC5A 2XIMA 4GHRA 2D0GA 5AHNA 5C9ZA 4MB4A 3P82A 3H4WA 3BV7A 3HGSA 1UP2A 3TYCA 3TTEA 4KT2A 1EA0A 1JVNA 2E6DA 3FDGA 4W88A 4UFJA 1YRRA 3TJXA 3UU0A 2XSBA 5EA9A 3MV11 4UMBA 1AVAA 1EWDA 2CBIA 3BAIA 5A3HA 3WQ6A 2L5HA 3STCA 3IIXA 2ZTKA 1EH9A 4JY9A 1YDOA 2F38A 2H3BA 1YE4A 1V3HA 1K4GA 2GGJA 3BUVA 3C61A 2QCMA 4WR3A 1GVOA 3P7YA 3SSJA 1EB3A 4M24A 4MWAC 2BVDA 1ZJBA 4M7TA 3VKJA 1I6NA 1ZENA 1TPH1 3T1GA 3IK4A 1PDZA 1XIFA 3LK6A 5J04A 2Z25A 4MWAB 1FDZA 3VPLA 4E2DA 4O1FA 4QQUA 3K8KA 3W2NA 5JXQA 2PDWA 1ZU8A 4BWLC 4K37A 1V6UA 3BPWA 2F6KA 1V3MA 2OGYA 3WQWA 4M56A 3RLGA 3NZ1A 4GUHA 4LJ3A 3IJ8A 1XUUA 1LCOA 4RZBA 3UYCA 5I2UA 3WBXA 3SFWA 4ZQRA 4MJMA 2PWHA 1KNWA 3TYZA 3BAWA 3G1RA 2NWRA 4AUBA 3I7SA 2P88A 4HSHA 4AZBA 4GQBA 2CU0A 1AMKA 2NSXA 1XSKA 4KH2A 3WQGA 1I2OA 4PMUA 5MHBA 3KVMA 3UXIA 3U5UA 2BWGA 3MMWA 1UUMA 3W83A 1P6WA 3BC9A 1FWSA 4X63A 2ZKMX 1V6TA 3PZIA 1XRVA 3CS2A 4JTGA 2VT0A 5CAKA 3NIYA 3WJYA 4IMGA 3II1A 3UW6A 5AC8A 4LVDA 1OGBA 2OELA 4L9XA 4ORMA 4U28A 1SVDA 1XISA 4N9BA 1EF3A 2PWFA 5E6ZA 3O0KA 1SGJA 4L80A 3L5LA 3QN3A 4UIOA 3WDQA 1JCJA 1UD8A 4HSOA 2P5NA 3WLOA 2PS2A 3E2RA 3BZJA 2PGWA 3UNDA 1Q2SA 3KOZA 5CEWA 3AYRA 3U6WA 3GWQA 5CKSA 3BL3A 3VOFA 4J3VA 2HK1A 2QJMA 2W61A 1JFHA 1OYCA 2VEIA 1VS1A 1F3WA 3QC0A 5BU6A 3GG7A 2YGYA 3SJNA 2AAAA 1BGGA 4WVXA 2FLIA 3QKZA 2CLLA 1OWQA 3OHIA 3NZRA 1S46A 3AJ7A 1M5WA 3OODA 1OK4A 1XH2A 4DWDA 1CGWA 4HU0A 5BRPA 4XZWA 2RHGA 1E4MM 6TIMA 3KP0A 2Q8LA 3NQGA 2I57A 1BVZA 4PEKA 5FACA 2R1KA 4PUKA 1E51A 3W3OA 4XKMA 3N29A 1P6BA 3VOGA 4JTAA 2NV2A 1JCLA 1NDYA 5CZJA 4XZMX 2FGBA 5A6TC 4RDWA 1R5YA 1VBRA 2QR6A 2HRWA 2EPMX 4GY0A 2C1HA 3GHUA 1KB3A 3HBLA 3PWIA 3SRKA 5E6YA 5F1UA 3DHDA 2QJIA 4HPNA 3B0XA 3ABOA 3MP4A 5AYIA 2E5CA 3DBNA 3GY1A 1WZAA 1CGUA 4V1YA 3QPZA 3TTOA 1E6XM 4PSPA 2D3NA 5B80A 2VEMA 1N8FA 4B3LA 1VCGA 1I0BA 3DEQA 1VH7A 1QO2A 5I06A 2OQHA 2ASHA 4GNVA 2DW7A 2ZA3A 3N9KA 1G4SA 4IFKA 1VPXA 3ALGA 4GVFA 1EJVC 1TV2A 3D3FA 4XD4A 1SO6A 1UZDA 1V3LA 2QS8A 4JTKA 2VOMA 3NR0A 4X61A 4B3ZA 3NWRA 3C2VA 3PBUA 4GYPC 3CTTA 3E49A 1OB0A 4JIQA 4AC7C 1YQ2A 5DQPA 3QM3A 3WMLA 2HS8A 1XQKA 1NFGA 5KZMA 2VRQA 1GZJA 2V9DA 1XLBA 2E09A 5JIWA 3PS7A 3W1LA 4WJXA 4CQDA 4QFUA 4CNUA 4AD3A 3ZT6A 3FS2A 3VMNA 4HA4A 1G69A 1PYMA 1E6RA 1CZ1A 2YZ5A 1KC7A 1JCYA 1HX0A 3OO2A 3VNKA 1H0GA 2W9MA 4LUSA 2JFEX 2DV0A 3LV6A 2EGZA 1XFCA 2QCLA 1MDLA 3N4AA 1Z89A 3LGEA 4HHHA 4EIVA 1N7KA 3SIMA 3WLPA 1M68A 1DJQA 4PH6A 3M1ZA 3TYBA 2VFDA 1S5VA 2FFCA 1WDRA 1ME7A 1H5VA 1R47A 3UG4A 2GQAA 3OG3A 5DLCA 1A5SA 2NX1A 4YLWA 1OX5A 2FIQA 6XIAA 2XN0A 1TWWA 4WXZA 3TDFA 4N9CA 5LGZA 4OBRA 4TUFA 4AIUA 5KSWA 3GNXA 2CZEA 1LOSA 1J0YA 3LHZA 1RQEA 1SFTA 2Y5EA 3QHOA 3NJ3A 2ZUSA 4FI4A 5HNTA 3L12A 3UPMA 1UKTA 3NG3A 4HCHA 2GL5A 3WH9A 4J2MA 4FXRA 4M8UA 1EOMA 1NWRA 1QI5A 3PK7A 3ABSA 2Z6JA 3A22A 4FB7A 4NYYA 3VFCA 1DYSA 1OGGA 2O9OA 3WLSA 5A6MA 3LPGA 3QMRA 3E2SA 3HGRA 4UOZA 1UYQA 1GOOA 3EOOA 3CZJA 3NSMA 3WQPA 2WHKA 2WVSA 2KZHA 1T40A 1M41A 5M2FX 3L9CA 2CYGA 2X1UA 3M5VA 3GVGA 1XYCA 3ARYA 4CU6A 1ICQA 4M82A 1EJWC 3SO7A 4ZGYA 1XBXA 1DJYA 3M5YA 3TU9A 2NW0A 2A3BA 4E38A 1DVJA 2HXUA 3KS5A 1PO9A 5D32A 4BY3A 2HMCA 4AD4A 2V5LA 4O19A 1RY0A 4ACYA 3BLOA 3UWYA 1FWBC 4F40A 2XINA 1DKWA 3OVQA 4Z08A 3KWSA 2J7GA 2O4MA 4MM1A 2XYLA 4S3EA 1UWAA 1GQNA 1W1TA 1IT7A 1H7OA 1W54A 3WEMA 1CNVA 1FWFC 3UG3A 4KBXA 1FCUA 4MF4A 1OZQA 2YCLA 3N25A 3QY7A 1K70A 4AC1X 1MEWA 2BGQA 3QRHA 2BP1A 2H3DA 3N2XA 3GVQA 3H2EA 4XVEA 3RFAA 4W5UA 1XUZA 4QITA 3VC5A 4UFMA 4ZB5A 2XIOA 3ITXA 4GPNA 4D6EA 3T0TA 4MB3A 3Q67A 3CC1A 4ZOEA 4XKYB 1XHGA 1B90A 1KM3A 3KL5A 1QW7A 2E6YA 4P7NA 4US6A 1OJXA 2OCZA 1ZZMA 3P61A 3GBEA 4IX0A 1R3VA 1MQPA 3MKCA 4YTSA 3L4UA 4L65A 3O06A 3BDKA 3NSXA 3WDRA 5G2WA 4S39A 2YYTA 1OABA 4HB7A 2G3JA 1X7FA 1X6UA 1DTUA 3TIMA 1KV8A 4C6CA 1Z69A 1ME9A 1A0EA 5AECA 3HA1A 2E9MA 1VRXA 3G1DA 4A6GA 1DEDA 4DM2A 3Q37A 5EBAA 4TX9A 3NGFA 1JRCA 1JR1A 3REQB 1SFSA 3PZOA 4HYWA 4NI3A 3E6EA 2Z1BA 3NPWA 2F9RA 4Z1CA 4PMZA 2NUXA 1X6NA 4JAWA 3UWEA 4AIBA 3QTGA 3TN4A 1BYDA 2YXOA 1VD6A 5IXEA 1DORA 3MB9A 1QNQA 4M1BA 4CU7A 5ENLA 1H0IA 1XINA 2J7EA 2QUMA 3VCRA 3W26A 1LT8A 1RK6A 1WBJA 3MSGA 1RLDA 2G5WA 2GJLA 2OZ0A 2VGBA 3BAJA 1V51A 3W1XA 3LSBA 4CN6A 5GPRA 3KHDA 1GYNA 4HJFA 3CHVA 4NNBA 3VIFA 2R8WA 3TSDA 1HXJA 4AZHA 3EGJA 3WDIA 2WMJA 4OUIA 1VJSA 4OQVA 3RYSA 1V6WA 2QDGA 2GVJA 4S2CA 1YYAA 3S1UA 3A12A 3LM3A 1UUOA 5CC7A 4XAYA 1BEUA 4D8LA 1EF2A 3BGJA 3FYOA 2QGHA 3NPUA 3NQ6A 3AISA 4UTUA 3BLLA 4NZ5A 3THCA 3W82A 2I14A 4O54A 4Q4PA 2ANUA 3A23A 2YKKA 2DT2A 4JTUA 4KWUA 1P5BA 4HK6A 2A0NA 1H60A 3OIXA 2R94A 5AVHA 5C70A 4ZL1A 4ONVA 1RALA 4H9TA 3EX1A 1KLYA 5H8UA 4B5VA 3V5FA 5HPOA 3AALA 4KPLA 3W84A 1BD0A 5K4ZA 2BGSA 4MZ8A 3GTIA 4B16A 2MUCA 4O1CA 1YE6A 1KXVA 4GZEA 4KRUA 3EYPA 2INFA 3CM4A 2WKJA 1VAHA 3QV9A 4LBUA 5F2LA 2GLKA 1T6MA 1ISZA 1TTJA 1EXBA 4CQ9A 5A6BD 1QTWA 1S5WA 2PGFA 3L4TA 2IKHA 1WOAA 1WO2A 3ARZA 1IF2A 4HNLA 4AW7A 5F2GA 4TXEA 2PCQA 3QXBA 3QSRA 5H8PA 5EMJA 1ITCA 5A6LA 1PKMA 3VINA 1TJRA 4BK9A 2PGRA 2AGKA 5AYYA 2FHBA 3O0FA 1YTKA 2PC4A 3LPFA 4Q3MA 1A4LA 3WL0A 4GA8A 1UB3A 2G96A 2OTDA 1FWNA 2WKLA 3BAXA 2IXVA 3KBWA 2PDYA 4LS1A 2I56A 1EX5A 3G8EA 3VU2A 3ONBA 4MDPA 1TZ7A 3FW6A 2UBPC 3SQMA 1SZFA 4WSKA 3HM7A 4DN1A 4HIBA 5LZLA 1E43A 4UTMA 4GIEA 3CWOX 3LG3A 3UR5A 4JQ2A 2CHNA 3KBMA 2JGYA 3GTXA 4IIFA 1KRCC 3TW6A 2Z1XA 4GINA 3A21A 5T9BG 2EJ1A 1LF1A 2Q8XA 3K8LA 4S3BA 5AOUA 5E09A 3K1GA 2CLOA 3KS6A 1XS2A 3MHFA 3RAOA 4JHOA 3BJTA 4OZOA 3BTNA 2DZUA 1FWTA 3B8IA 3Q4DA 2ZVRA 3MA8A 4RZ6A 3VTRA 3KHJA 4N0RA 4R7OA 3GKFA 1KKRA 3UXLA 5AKQA 4N6EA 3CV1A 3GM8A 1IGSA 4OT7A 4WY0F 1UWUA 3OBAA 2CIPA 3PJWA 2NXGA 4DXVA 3S9IA 3N2TA 4LWWA 3QY6A 5DMLA 4YS1A 3SCRA 5LGXA 1K7EA 4R3UA 2H8XA 3CZEA 1E1EA 2HVOA 2YR1A 1TPUA 4XZNX 1WYIA 1HUVA 4RXGA 1TE6A 3PHAA 4QQ3A 4XUGA 2WSRA 4EXAA 1W3IA 2EO7A 2IPFA 4E0CA 4L6HA 5FF4A 1JZ6A 3SUTA 1XBVA 4Y7EA 3G1AA 1Q63A 4Y90A 3WQFA 3E38A 4K6AA 1JZ7A 2Z1VA 3E02A 1XIHA 3SUUA 1GTEA 2P0IA 1CBGA 1BXNA 1P0NA 1ZBWA 3RGTA 1WCGA 4LVGA 1C93A 4PUEA 2ISVA 5IBXA 3VDCA 3CAVA 1AQFA 2RDTA 1JIBA 1O5XA 2VM8A 3AIUA 4IQDA 4W7UA 3OIHA 4GX8A 1PDYA 4O15A 2Z28A 1YNPA 1XLAA 5REQA 4PUNA 1E6ZA 5BZAA 1M04A 1C90A 4HMCA 3JUGA 4MHBA 3RN6A 1SR9A 2WJFA 4MZ1A 5AFDA 5CPLA 5CBJA 4FF7A 1DIDA 4CQCA 4I7UA 3VGBA 4Z2LA 2HS6A 3GYEA 5MF5A 3MKVA 3BXWA 3SGZA 2BV9A 3H7UA 3E96A 1JPMA 1WKDA 2YFNA 1W3JA 3S2MA 3AU6A 1GGOA 3LZ3A 3U2EA 5FI8A 1DV7A 4RZ5A 4E3TA 4I8YA 2VO5A 1B5TA 2B7OA 2VDHA 2VC5A 3ARUA 3OG2A 2XVLA 1CGTA 1HJUA 4OUEA 2V0TA 1UR4A 2VVSA 3C56A 4RDYA 2J25A 2Z2BA 4GOAA 4DBUA 4NJIA 4A8IA 5BXSA 3WFLA 4G1KA 4GQGA 3MI3A 1X98A 1XLGA 1PTGA 1U1UA 2QCGA 4LW7A 2R6OA 4TX6A 3TQPA 1V0MA 3SCTA 2DSZA 1MZRA 3IGXA 1J11A 1VZWA 3EXSA 3TROA 2A7RA 4YJ5A 3N9RA 3P67A 1XL9A 2J27A 1PKYA 5HA7A 1C3FA 2O4QA 3AROA 3SY1A 1VHCA 4X22A 4XX6A 3RO6A 3IEBA 3NPVA 3EDJA 1BYBA 5GJNA 1K9EA 4W85A 4NL1A 3VOJA 4P5UA 4QLJA 2C19A 3WF0A 3E74A 4LALA 3NDZA 3LCFA 3VC6A 4HSNA 2X16A 3THQA 3T55A 4UZSA 2NQ9A 4GVIA 1LROA 4CCEA 3TQKA 1TE1A 3IJ9A 4TVUA 3WQOA 4OE7A 3CEUA 3R0KA 3LZ5A 2SFPA 1ZUAX 4EAMA 1V02E 3W87A 4W86A 2BFGA 4PTVA 4AD1A 1Z41A 2A6LA 5AC4A 1ECEA 3IVUA 2CERA 4HNVA 4S3GA 4AZGA 3L65A 4J3SA 3GXPA 3PF3A 3N1AA 1WUFA 1W3HA 4H7VA 4REQA 1EJSC 3VNMA 4LF1A 2PDMA 3KCLA 2ZC1A 4F9JA 3CWHA 1NDWA 1FWCC 2BX7A 5BCAA 3W29A 2WHMA 1XBZA 1DXFA 3T40A 3ZO9A 3FXGA 5I00A 2PDKA 2V3GA 4UXDA 3GNDA 4HN4A 2E6AA 4N9EA 1GQJA 1V7YA 2DY3A 3P60A 1C8YA 1UPPA 4PFMA 1JF6A 1HKKA 1FHDA 4B5UA 3MI6A 4Q4QA 5AZ0A 2VNCA 3R11A 4LPCA 4QE1A 1SW7A 1C7TA 2DJLA 4AZCB 4NT0A 3SIZA 3BAKA 3EX4A 2VI0A 4TVCA 1IEIA 1CW2A 1E9IA 1XYBA 2XUCA 2WOQA 4NIRA 2VVNA 4GUGA 1E1CB 1EZWA 2FZBA 3NTYA 4IH3A 3SB0A 3MBDA 2DU2A 4DF0A 3H4XA 3EWBX 3T9PA 3VKCA 2VEGA 2WZHA 1RY8A 4U10A 2O0TA 4FAMA 4J3WA 2CZ5A 4CD6A 2Y24A 4MY1A 1H5YA 2G3FA 2DT1A 3M16A 2G37A 3W1RA 4NJKA 2VQTA 2VX7A 1ZBVA 3P14A 1FCBA 1BYCA 4LYQA 3VCNA 2VWTA 3SUWA 3CO4A 3W7GA 4JGDA 1DIKA 3QW4B 2WBGA 4ZODA 1OC7A 1NF7A 3LXCA 1XLCA 3B0YA 3TTSA 1AH0A 4DJDD 2PRMA 2OQLA 1RV8A 5DMMA 3DX5A 4FK9A 2PWVA 2IPWA 3C6CA 1A0CA 4EXQA 5ABTA 1Q45A 1AZ1A 2VX6A 4LAUA 3T2OA 3C2FA 4FF5A 1AUSL 2XU2A 2XPKA 3O2LA 3W7IA 4GQ0A 1EGMA 1S2VA 2YSWA 4M80A 3KDOA 3FSUA 3M0KA 2WHLA 4A3QA 3PANA 3A24A 1WAWA 2PDUA 3V18A 5PTDA 3GXDA 1PTAA 4NVTA 3GR7A 3S1XA 1SZEA 3GC5A 3C0QA 3GG1A 3E9AA 1I2PA 3CT2A 3UVAA 1Y0EA 1I4NA 4L4OA 1TUXA 5T91A 4Q7BA 4FALA 3K1DA 5E9AA 5TF0A 1EEXA 3LS9A 3CL8A 3IIOA 3UZJA 5BROA 2PCEA 2C0AA 2Q02A 2ZXQA 3C8FA 4MPKA 4DBSA 1DWIM 3N14A 1ZFJA 1FFQA 4NP7A 2RAGA 3LENA 4W7WA 1QNVA 3CUGA 4WCJA 3ZJKA 3KBNA 2F8QA 4EPEC 4PTXA 1FWHC 4IJRA 1QPNA 4KF1A 1EFZA 1GKRA 2GJPA 3ANVA 1E1FA 1US2A 3LHTA 3SDOA 3W53A 2BY3A 5E0CA 1N82A 3NL6A 5KEZA 1DBTA 3I3EA 2A85A 4Z2IA 5CC3A 2VCAA 1GEHA 5G4WA 4MY8A 4IP5A 2OWWA 5CPQA 3WDPP 4Q7IA 2YA0A 1PVNA 2ZUVA 4PMXA 4GGBA 3DKLA 1JCXA 4I7WA 1IV8A 1HFBA 3VOCA 4K2SA 3EWCA 4QCEA 1TV7A 4H6KA 4PMJA 3O6DA 2D0FA 2B7QA 1JCTA 5I03A 5DT7A 2ZDSA 1UASA 4AAJA 4FIRA 3V75A 1HT6A 2BVWA 3C8NA 4S3KA 2ON3A 3ORWA 2QCEA 4JIHA 1T41A 5CJ5A 2XFFA 4WUIA 1WDWA 1H1NA 3GX9A 4QJ4B 1LBLA 1J01A 5FCZA 4LNYA 1NJJA 1BWVA 4KWWA 1R9YA 2DQXA 1ZPTA 1DIOA 1ITQA 3H26A 4IHCA 3AZSA 4Z1AA 5CJNA 4GLEA 4QAIA 4F2TA 3P6LA 2YA1A 5TIMA 2BVYA 4JCLA 1SYTA 2R82A 2J7HA 3DESA 4H9ZA 1LG2A 1OF8A 4IFRA 1LOLA 1POKA 2J7CA 3RU8X 1JPKA 4L5ZA 5ABHA 3LQGA 1AODA 4CVWA 4MVAA 3WJXA 1BFNA 1W37A 2ZCGA 3TK7A 4YPJA 4GNKB 3C2YA 2D2OA 3RDKA 3EX3A 2GK1B 3UCDA 1KTBA 3AS3A 3TA9A 5DBTA 1E3ZA 1V0NA 5DRIA 4BWLA 2CFFA 3A4JA 4GFIA 2DZWA 1V02A 2BY1A 5C5YA 3N4FA 2POTA 2OT1A 2ZRUA 4F2BA 3F5LA 1V77A 4JX6A 2A3HA 3W76A 4DIAA 2GVLA 1R2RA 1ZAHA 2YL6A 3REQA 4XBSA 3W71A 2HQAA 1OYAA 1ZQ5A 4NYUA 1GONA 1FWGC 3S2LA 1QI4A 2QUNA 3ZWTA 5C9UA 3LMYA 3WNLA 2Y8UA 3SY8A 3TW7A 3MS8A 3OU8A 4A8LA 1ESWA 1BQGA 2O55A 1YBQA 3GFYA 1A5LC 5LSMA 2B0MA 4AY7A 4A21A 1TELA 3EWWA 4M0XA 4WX2A 1W1PA 5JIPA 4XZLX 3R1ZA 3UWQA 4S3CA 4LS2A 4LUJA 1AW1A 2OOFA 3A3XA 3ZLGA 1EYWA 1OEPA 3R7MA 3GUGA 6XIMA 1DXEA 1GUVA 2J6XA 4PE8A 5FJUA 3LNPA 3THAA 4QM1A 1RCXB 1S2AA 2XWEA 2AOSA 1Q6RA 3KBVA 3QW3A 1M9HA 3CL7A 1F3EA 1K6WA 1OFDA 1KFWA 3WBEA 3K8MA 4ZA0A 1VR6A 4AIEA 4TX8A 4O12A 3GXIA 5FF3A 4B5XA 4PSRA 4AEOA 4AY1A 3AIBA 2QV4A 4G9PA 4KETA 3LD5A 3S1WA 4NJJA 1FFRA 4P8VA 3TX9A 2IPJA 3DFTA 2ZA1A 2GOUA 1AJ2A 4DUOA 4N42A 2PDXA 1EJRC 1W5PA 5FL0A 5GVJA 2ZX6A 4PCPA 4EANA 2OKTA 1W2PA 4ADUA 4H2HA 5AHLA 2PP3A 1WZLA 4IWWA 4WDTA 1G4EA 1O94A 3NA8A 2HCVA 1T8QA 2JKEA 1GEQA 1XPGA 3OYZA 4AYGA 3PPGA 3GC2A 3PBWA 4Q8UA 4JYDA 5LA0A 2X0SA 4NZCA 1NARA 3AHTA 3TWBA 3ZLHA 1ZJIA 3HN3A 3L21A 4FX7A 1A5NC 1T0OA 2FH8A 3HF3A 4D6GA 4DO6A 2WZEA 2OU4A 1ISWA 1HO1A 1UWIA 4N2YA 1SSDA 1O12A 4NU7A 1LG1A 1PKNA 5JH1A 4DBEA 3IV3A 1O7AA 4WKHA 3TFXA 3B0UX 3FFSA 2OZTA 3TONA 4Q33A 2OX4A 4CQAA 2NZLA 4RZ4A 1HIZA 3UD6A 3LXBA 4NXSA 4WK9A 1EKOA 3QMSA 2ZXBA 2FTYA 3BH4A 3CUXA 1OIFA 1VFTA 4QE5A 1W1B1 4HNOA 2W62A 1JUKA 2Q3OA 2OGJA 1G6CA 1DWFM 1E71M 3TC3A 3ARTA 4I9TA 3CYJA 2EBNA 1UKQA 6ALDA 1EBGA 4WDXA 1VFHA 4GO9A 3UJ2A 4J3XA 3PNZA 1C8VA 4LT9A 4UFIA 3HGJA 4UQBA 1ZHAA 4E4UA 4H00A 3FA5A 3RF9A 4K68A 3PP7A 3AS0A 2OZ3A 2E9LA 2HTMA 2CZDA 4Q32A 4O10A 2I9UA 2I5QA 2AKMA 3EEZA 5DY2A 1F8MA 3FAXA 1LUCB 4LAKA 1C9DA 5C2XA 3S5NA 4ATWA 3IGHX 1G7VA 1OD8A 3WNOA 3M5XA 5HDRA 7REQA 4BF5A 2PI6A 3DGRA 2NXHA 5CSUA 2X0HA 3W7LA 3ALFA 3TWAA 4BI7A 1S5MA 3DXIA 5I3DA 4HZ6A 4OECA 2OJPA 3WLQA 5EMUA 2DDXA 4K3ZA 3AUJA 4IP7A 4P8XA 3BLFA 5FSDC 4AX7A 3GZ3A 5A2AA 3ITOA 2V68A 2QDDA 3I65A 3G6MA 1NELA 2DSWA 4KIEA 4QHRA 4BQ3A 2DJXA 3TC7A 4WZHA 1EGVA 1PUDA 2QXWA 1ECQA 1KM0A 1FH9A 4ICCX 1EC9A 4NF7A 5A2CA 3O8AA 3AICA 1JXJA 5HNUA 1DOSA 1E15A 2WMIB 1TVPA 3MUIA 1GVQA 3POHA 2ZX9A 3WSUA 4ZO7A 5F4XA 3N3MA 3SECA 5CQ1A 1S1RA 4ML9A 4RKAA 1ZTVA 3RM9A 4MNMA 2ISSA 3EBVA 4DWSA 3O15A 3EB2A 3G1HA 2Y7DA 4GI9A 3MKKA 1TPDA 3MHUA 1IT0A 4HYRA 1GJWA 3RRXA 1QOPA 4DNHA 4ZSUA 2V3FA 1D8WA 5B7YA 4MWAD 2QJNA 4UNKA 2GK1A 1HTIA 4H1ZA 4ZCWA 3GAYA 3L67A 3FOKA 4FLOA 2G3IA 4C5YA 2CHOA 3AMCA 3V5OA 1A50A 4GCAA 1AA1B 5D2WA 3WEOA 4KERA 2PDGA 2Q8ZA 1UUQA 3NSNA 4QJ5B 2O9RA 5CSYA 4QR6A 4UFLA 5CBBA 1IHIA 3ARQA 2VMFA 3VDBA 5F4SA 1OFPA 2QDEA 3EB4A 1OC5A 3HQPA 7CGTA 2OEKA 5C55A 2CEQA 4MJ4A 3MU7A 1LYXA 4WY0B 1YIXA 3EKLA 1XYAA 3E3HA 3IIPA 2QCCA 3M07A 1BYAA 3USBA 2RDWA 3MUZ1 3PVFA 4NNAA 3WQ4A 3R25A 2PLKA 4FR1A 5IFPA 3PTKA 3GBDA 2VC7A 1W1IE 1ZJAA 1P1XA 5A6AA 1FVPA 4EWJA 2IKJA 2VHLA 5ABEA 2ZRWA 3M0YA 4NX0A 1MXDA 1XX1A 1SUXA 2AL2B 4DB7A 3LLFA 2JQXA 1GG0A 5IM51 4HHMA 1NF0A 4XBJA 3NFUA 1FWAC 2CKSA 5G5IA 3ZR4A 4DRSA 2NWSA 4C7FA 3LY0A 1H7NA 3QMTA 3IVSA 1CDGA 2GDQA 4O14A 3W7RA 4YTRA 3EDKA 1PKLA 5HINA 3WJSA 2AQOA 1PL9A 1YLVA 2Q09A 4PYSA 3PNUA 1QU4A 1P4CA 4U31A 3UGRA 3UR7A 2WJZA 3UR2A 1QDSA 3LTYA 1WA3A 5ECUA 3KVJA 1V6YA 3CYVA 2P50A 1OG0A 3EDFA 4MYAA 3OVGA 3L2MA 1F3XA 2V5JA 1IWPA 3HG2A 2ZOXA 3EX6A 4BFAA 1R30A 1OX6A 3LEPA 1U5JA 2QCDA 1S2TA 3MUY1 3WBYA 2YFOA 5H1WA 2DFAA 3APTA 5C54A 3CUIA 4W4QA 3NQCA 1M03A 1OINA 3LBMA 4UTIA 4UFHA 4EPDC 1CLVA 1R0MA 3VE7A 1WKYA 1O60A 1X1NA 2ISWA 2ZXAA 4LUSB 4MYXA 1A5BA 4HMDA 5FJTA 3MYPA 1JYXA 1VB9A 2FZNA 1M53A 1UA7A 2WMIA 2CNCA 2Z1WA 3GE7A 2HBXA 3C86A 4L9ZA 3WF4A 1KTCA 2A7NA 3QOKA 4O52A 1MUCA 2B7PA 3WFAA 4MWAA 4D72A 2VURA 3W2KA 3P2VA 3ZVHA 3O6AA 2XFYA 3T4CA 2E8ZA 3M0LA 3OQ8A 3GNRA 2WNZA 1V0KA 3QGAC 3OB8A 5TQLA 4NZFA 5U4NA 2DSKA 3T42A 3BOLA 2J47A 4XISA 1E5JA 4C1LA 1ADSA 1XIIA 3W86A 3WCZA 4HZ8A 3P84A 1V3KA 3H2FA 3FY1A 1TZ9A 1I60A 1KFJA 1A49A 3IV8A 1FDYA 2X41A 1O1ZA 3HG4A 3W81A 4JBRA 1UBPC 4U3CA 5G2IA 1CX9A 3R0UA 1MVYA 3QF0A 5D9OA 5CGTA 2Z1KA 2ZX5A 4ZE4A 2EKGA 4JTJA 3S46A 1O5KA 4Z0JA 4K38A 5AC7A 3CPGA 2R1MA 1D7FA 2ZIDA 4ILSA 1ZNNA 2J9XA 3NQVA 1UOKA 4QNEA 3IK2A 3PBMA 2E5DA 4AMAA 2C0HA 1JG9A 3K4DA 4DPPA 3KXQA 1PEZA 1HQTA 2EQDA 1AZ2A 1DHKA 1L8NA 3V1PA 3O6YX 1XGZA 1KFLA 4TQTA 3WELA 3N2BA 3SSZA 3K5XA 2Y0FA 2BBFA 4B4HA 5C7HA 1UR3M 3JVAA 2Y7EA 3KRZA 3TH6A 1FXPA 1OVDA 2C1GA 2DIEA 1XYMA 2O92A 3ZVIA 3B8UA 4DAFA 1JEZA 1RJPA 3UZZA 3ZS4A 3STFA 3H53A 2YBUA 1HP5A 3MCMA 2CZFA 3GDMA 1FH7A 1QRQA 4OTKA 1E6PA 4ROQA 3IWPA 3OPSA 1BG4A 1ISXA 1K6AA 2OXNA 1ELSA 1FHVA 4H6EA 3UWWA 5FF7A 2NVAA 3P74A 3LBOA 2G97A 4LC6A 3WL1A 3BLKA 4LTSA 4D1IA 4NAEA 2R1PA 4M19A 3UVIA 3VUPA 3GUWA 3Q94A 1DWAM 2QAFA 1EQPA 1E55A 2BXVA 2E1DA 2HISA 2VC6A 1YPXA 3AHVA 4LUYA 4A3HA 4CEUC 4DO7A 2VOTA 5LIYX 1H50A 1AK5A 4BKNA 3GB6A 3WD4A 2R1LA 4UTFA 5E1QA 3V35A 4PMNA 4MFEA 2V38A 5A8QA 4DJEA 4DX3A 3IIZA 3UT0A 4GC4A 4GYPA 1ADOA 4JQ1A 2TPSA 4O50A 2EPOA 4L4PA 4Q4OA 1XXXA 4OV9A 3NPXA 3W2LA 3PULA 1XKYA 1UIOA 1EBHA 2OSXA 4S1FA 1XGDA 3I4KA 2WYSA 3AXIA 2FYMA 1C92A 5I09A 3PB2A 1CGVA 1XCXA 3RLVA 1XPYA 4O18A 2ODOA 4S23A 1O1HA 1S2WA 2C14A 2OEJA 5DANA 4AD2A 4CD5A 1XDLA 4U5IA 2WJEA 5D9PA 3H55A 2I1OA 3WLMA 3RCNA 3UJRA 4XZIA 4E8DA 3TCSA 2D69A 2REQA 3BANA 3F4VA 4UBPC 1WP6A 4Q8VA 4DZ5A 3VKDA 1EWEA 1RP9A 3ZIZA 4FNRA 2FQIA 3COTA 1KR1A 1ZBKA 5LHEA 3VGEA 3VM5A 3DGBA 1Z3NA 3UG8A 4CD8A 5J5DA 1JGIA 4US5D 4DAIA 3QZ6A 5LA1A 3MMUA 5D4YA 4LB3A 4V15A 1BHGA 2UWFA 4I3GA 4W9TA 4RNFA 1V8EA 4L9YA 4S3DA 4GZJA 4CKQA 3DUGA 1A4MA 4RL3A 1U5VA 3CIVA 2E77A 2Z00A 3WD2A 4ZTYA 1EZ2A 1TA3A 4LC8A 2F7FA 4FZIA 1W8SA 2WXDM 4GBDA 2ZX8A 3TLQA 4P8UA 4UNLA 2PUZA 1Q6LA 1EUNA 4E8GA 2E3ZA 4RDVA 1A3HA 2GJRA 1EL3A 2Y4SA 3N9SA 1KLZA 4LYPA 3QYQA 4MMWA 1UMYA 4HOZA 1XDMA 4G56A 3RLHA 3R8RA 3QPEA 1OM0A 1R38A 5AN7A 2PDQA 4I9AA 3EOSA 1U83A 1Q2RA 3PTMA 2XM1A 2G41A 1P48A 1P7TA 1KM4A 2Y2WA 3H8AA 1E40A 6REQA 2YBVA 2ISDA 2PEVA 1D9EA 3VVGA 4F0RA 2JF7A 3MQTA 3UNTA 4Y6GA 4LVFA 2AKZA 4JX5A 4GIRA 5DMYA 3D47A 3TV8A 2EXOA 2BNJA 2YCEA 4J9JA 1UP3A 1H63A 2Q01A 3IJ7A 5RUBA 4DNMA 2E9BA 3BSHA 3AMGA 1O66A 1SQ7A 1Z6KA 3DDMA 2CLEA 1WX0A 1K7XA 4XD3A 2ZUUA 1EPVA 1Q6GA 3BICA 5DELA 4KRZA 2C7FA 3W1MA 1W91A 4PUJA 3KOWA 1I2NA 3DHUA 2OT0A 1GWJA 3H4GA 3F4CA 4FNPA 2DH3A 4MPQA 2P53A 1G0CA 4DJDA 3F1QA 1HL2A 3FGCB 1GYMA 4QAWA 3M7WA 4UOQA 3EB3A 4GH1A 1HW6A 1W1VA 3UA3A 4L6DA 3VD3A 1IEWA 1SJDA 3B4UA 3AO0A 1UZHA 4A3UA 4NASA 4JN6A 3BMWA 3QGVA 5I23A 3PPCA 3RPMA 5GNZA 5CJMA 1OT2A 2OEMA 3ARRA 3MTWA 1JZ4A 4GE8A 4ZBCA 3HJZA 2TMDA 1IXPA 4P2VA 3LHYA 5FSEC 3DFPA 3E2QA 3W7JA 3UZ5A 3DYMA 1ENUA 1TYGA 3DIPA 3BLDA 2P3EA 2QJHA 4KWVA 3MSYA 1O68A 1PZ2A 1F76A 1ZBCA 3LGGA 1RZMA 1UJQA 4GCXA 4GVHA 1CI1A 1HVQA 1HG3A 1UQZA 2VELA 3BLIA 7TAAA 1JYWA 2PU0A 3BQ5A 1XF0A 3ONCA 3P93A 1SMAA 4BCEA 5HMDA 4YVPA 3SCSA 1DTNA 1HO4A 2EG8A 5DT5A 1HJXA 1T8XA 3QY8A 2X30A 1F3TA 2A7PA 2D2JA 4ZFCA 3MWAA 3SM0A 4OVXA 1MUMA 4RNIA 4TR9A 2POZA 4QRNA 2AQVA 1E6NA 2YZRA 1JF5A 3UF9A 4W8BA 3JS3A 1US3A 1TX2A 2A4AA 4WKFA 2OB3A 4RE2A 4EWND 3QOMA 1P0EA 2HZGA 4CD7A 3A4WA 1JDAA 3E12A 6A3HA 1WXZA 4C7GA 2XHYA 5HQLA 3W7PA 3FJ4A 3LMZA 1BWLA 3WNPA 1GORA 4ZB0A 3V36A 4AIOA 2IQ0A 2OSWA 3AYTA 3EXTA 4O8RA 2NSOA 3IIVA 3FVMA 4MY9A 5A8GA 1LZOA 2DZBA 1LRQA 2HPMA 4JYEA 1EJTC 2P8CA 4BR1A 4JQAA 2VZUA 3QPYA 1XC6A 2MNRA 4PB3A 1E0VA 1O6IA 2QLYA 4LFYA 3R58A 4MGGA 3B9AA 3W85A 1IXOA 1VF8A 4B5NA 3IACA 3OP2A 4NZ3A 3E2VA 5DMNA 4ASTA 3VGGA 3FHQA 5E0FA 1R85A 1OT1A 2GFTA 3HV9A 4DPQA 3T0CA 5BMXA 3FA3A 2XGIA 1I75A 1NWUA 3ZLFA 1RVGA 2V3DA 3VILA 1MW2A 3GDKA 3ENLA 2QVNA 1R9ZA 1Q8JA 3W7EA 3ZR6A 3ZSSA 1EP2A 4V1XA 1QI0A 2A6NA 1B4EA 3QEZA 3GLCA 4JX4A 3LCXA 4KS0A 3LX9A 3UPWA 1W3NA 1E4IA 4BHYA 3SQLA 1Q6FA 2V8ZA 3EXRA 1CXFA 3WY1A 5C9XA 2EG7A 3N2MA 3W88A 2J7FA 4G7EB 2NQLA 4XAGA 2AAMA 3ZM8A 3BLPX 1H4PA 3H7RA 1ADDA 1ZAJA 1TO3A 3SW6A 4NJGA 4QDWA 1PHWA 1QHZA 4OBSA 3T78A 4Q8QA 1SO3A 4UTTA 2V5DA 4A4AA 1R6WA 2GUUA 4R7JA 3LERA 7XIMA 4GBUA 1E3XA 2PWGA 3ZQ9A 3F2DA 3DERA 2E68A 1PBGA 4ERGA 1E0UA 3E0FA 1QOQA 4HK7A 4CNSA 2ZVIA 1V6VA 3P0WA 1F73A 3SR7A 3TTYA 5I0DA 4YCOA 4NZ1A 1UP0A 5D8WA 2WMKA 3GH4A 4NZJA 2C91A 2VGIA 1VFUA 3M43A 5D09A 3NZPA 4L7ZA 4C6BA 3T08A 3CPRA 5IRPA 4HCLA 3HPSA 1Y5XA 5CGMA 3BK0A 4C6KA 3C5QA 3LOTA 3LLXA 3KM8A 1XLIA 4JL1A 4IGHA 5CSRA 3P5YA 3GHTA 3H21A 2DW6A 3WO8A 4UQEA 3RIKA 3WJWA 4ML4A 3SGGA 4AY8A 3A9BA 2J4GA 4R7WA 1KBJA 4R5EA 1KO0A 3GQYA 5FJPA 1YPFA 3DBPA 1R7AA 4IX2A 5A8PA 1CENA 2NUWA 3KTSA 3PR2A 1FXQA 3NYZA 2YCIX 4L6OA 1LQ2A 3BOXA 3E0WA 3GS6A 1H7RA 2EJAA 1I9CB 5DFAA 4AXNA 3KRBA 4UQAA 3DU0A 1SO5A 1EJXC 5I07A 4KKXA 3U2ZA 2DH2A 2GYIA 4IGSA 3APGA 3JRKA 4E2BA 1PS9A 3ZWSA 3W23A 2X40A 3CUHA 4JEQA 2XH2A 4HCDA 3JZEA 3S8HA 4I90A 3RR1A 2NQ5A 3S6OA 1MUWA 4D6DA 3QV6A 5BW6A 1YDNA 1ZB5A 2G50A 2A3LA 2WWDA 2BB0A 1FBAA 2PDHA 3BW2A 5AYXA 2Z29A 3NO5A 1QR7A 1R2TA 1VC4A 2HBVA 3SRDA 1K02A 4GIAA 5C2GA 3MMDA 4HT3A 2Q6ZA 1E9LA 3G0SA 2HK0A 4YVVA 1Q6EA 3LI0A 3ARXA 4XK2A 1XIJA 3E0IA 1J10A 4LYRA 2W27A 1TTQA 4HU3A 5D04C 3UJEA 1KCXA 3CNYA 2PDPA 4LX4A 1EIXA 3ZXWA 4FNQA 2V67A 5DXYA 5C6MA 4V2XA 4YWSA 4B2DA 1E6QM 2PAJA 1HJSA 2XIQA 3W02A 1A3XA 4N4PA 3HJEA 3IJ6A 1NDVA 5I3FA 3BV4A 1RA0A 5I02A 3EWXA 4WDUA 2P76A 2OYLA 4Z1BA 4K8HA 2FTPA 2PRHA 2TYSA 4UFKA 2XSXA 3M5ZA 4GIYA 1AJ0A 2XZ9A 3GSMA 3K4WA 3S0CA 1DWHM 2WC7A 1TG7A 3S9ZA 1PZ0A 3CZGA 3PUGA 5HWJA 4YYFA 4FP1A 4UCGA 5TD4A 1TV4A 1QPOA 3N2CA 1PYFA 5H2ZA 4AISA 1ME8A 4RV8A 3S9YA 3CV2A 1NQ6A 4LY4A 2VFIA 3BCDA 5A69A 2ZZ3A 2QMJA 1ZL1A 3KZPA 4QEEA 1W9UA 1J8VA 4DJFC 4PGLA 3NQBA 4PFHA 3U48A 1KR0A 3GXNA 2DZAA 4GMEA 2GDUA 1Q66A 1R3RA 4J27A 2CLKA 5D2VA 5KETA 4JKLA 1JRBA 4EAYA 2E1WA 2PTWA 4CNPA 1VEPA 4Q8MA 2R24A 1J0ZA 3EWYA 4FX6M 3RK8A 4FS9A 4F0MA 3MDWA 2Y88A 4ZQOA 5EYWA 4Q6JA 1SFJA 4X0VA 4I8DA 4UNIA 4JIIX 2A79A 3MWCA 3NQ2A 3LB0A 2DZVA 2VCCA 4FX8A 1PPIA 4HZ7A 4IL0A 4PCNA 2YCLB 3WUEA 4LRSA 4PCTA 3B0VC 3NXLA 1GQIA 1XI3A 3RX2A 3QGKC 3BW4A 1Q3NA 4RPPA 2QJJA 2XVPA 1OFOA 1UKSA 2PDBA 3U8GA 3EMCA 1TRDA 3A3HA 3TQVA 5EB8A 4G8TA 3ECQA 3TP4A 3WLLA 2EKCA 4BF7A 3PZTA 1O4UA 4K1WA 3RMJA 3ABXA 3K30A 1UD6A 1H7XA 5F2IA 1AQ0A 2FPTA 1EPXA 2ZTJA 2NXIA 4DYKA 1QI3A 3DYPA 3EEGA 3GK0A 3UWUA 3PY2A 3GU2A 4CCCA 3LCLA 4OKDA 1J5SA 2WWCA 4GYFA 4AMCA 1VJZA 5HQMA 2DIJA 2ONEA 2FZ8A 2G3NA 3BGGA 4IQLA 2FKPA 4HN8A 1TZZA 4GKTA 3TR2A 5DEZA 5AVNA 4X60A 3VABA 2V69A 5ABFB 2GWNA 1A5UA 3W27A 1FX6A 4B2DD 2WJDA 2ZRYA 3VE9A 5HWMA 2UY3A 3RCYA 3AXXA 4AF0B 3L4WA 2DQWA 2BZNA 3RJYA 1NU5A 3KBSA 4Y9AA 3M0IA 4UTWA 4NI8A 2QUUA 3DC0A 4JIEA 4YTQA 3ICJA 6ENLA 3I3DA 1Q13A 1V7AA 1UOZA 1VIWA 4J2PA 2ZZ2A 4UCFA 1VYPX 4TIMA 4LH8A 3U2OA 1PE1A 4Q8TA 5HXMA 1TKKA 3N11A 4Q22A 4HTYA 2DVUA 1EO5A 3BG3A 3BJSA 1MEIA 5CPMA 1GOWA 1TQXA 3WD1A 1DPMA 4JNZA 1TCDA 3FKKA 4F3HA 3RJXA 4QEHA 1M7PA 3WEZA 4OJYA 3OEXA 2WSPA 3LRKA 3Q65A 4LGXA 1IZJA 1XV8A 2B4GA 5DY3A 2MANA 4DM1A 3A5VA 2EPKX 3PUDA 1U1HA 3CZKA 1Y7VA 1TJPA 2FTWA 3U4AA 4XO7A 5D02A 4NY2A 2Z4GA 4R27A 1QCWA 2VYOA 4LANA 3STGA 1N55A 1GOXA 1NFBA 3FJNA 3PSVA 1JFXA 1DQXA 1K9TA 4YN5A 3DG3A 3VIKA 1KFKA 4Q8WA 4FIQA 1OIMA 4MADA 4F0HA 2PDJA 2ZZ7A 4QSHA 1TX0A 2O7SA 1UR1A 4HHPA 4O11A 4RXFA 2YA2A 1LL4A 4JNYA 1MFUA 3L5AA 2A5HA 1YMYA 1GW9A 4PRRA 4MTVA 3TNBA 5D9NA 1AH4A 1WDDA 4KWOA 3CUJA 3VK5A 5LXXA 4XTDA 4WOZA 3W22A 5ECVA 3CGTA 5HJXA 3W7KA 1LWJA 3BW3A 4EK7A 3RRAA 3Q58A 4C65A 4PTMA 4YTTA 1XC4A 1Z9AA 4R53A 3SCUA 2IKIA 1VBGA 3BG5A 4RK8A 4XKYA 1G01A 1RBOB 1ODUA 3NEVA 3WDHA 4AVFA 3MDUA 4N4QA 1H09A 4Q8NA 4O0QA 5BMWA 3T7VA 1TV3A 2NUYA 3WD3A 4E5TA 3GDLA 4EF9A 9XIMA 1KD0A 1J0JA 3ZJ7A 4C91A 2Z2UA 5CPTA 1ZJHA 3M44A 4GYJA 4H9XA 1UJPA 3MV01 3TTQA 3NO1A 3L5MA 2DZTA 1SMDA 3AOFA 4IPLA 4C90A 4U33A 1IR1A 2GVYA 4O0ZA 2AMXA 1R3TA 4FO4A 4C6NA 4A29A 4AWEA 4JIRA 3KOXA 1RHCA 4BQ4A 1K9FA 5CH9A 4B91A 1E70M 3AS1A 3PB0A 1I45A 3G1FA 3MJMA 1ZSXA 1QAPA 5G4HC 3TJIA 4X2PA 1W17A 4YNGA 1W9DM 3QFEA 1XLFA 4IUGA 3APYA 3OJGA 3NM3A 4PC8A 1QASA 3MCNA 3T6CA 4FLQA 1JAEA 3NQMA 2NT1A 4ZVJA 3R8HA 2ICSA 4UTLA 3UZWA 2PLCA 2YXXA 4FA3A 3VZXA 1ZLPA 2E67A 3VGHA 4JICA 2CCRA 3L4XA 2AMGA 3FA4A 3SAZA 2VR4A 2PLJA 3CUFA 4IOTA 3OGSA 1RJQA 1UR8A 1IIHA 2EEXA 2ZRXA 3S5ZA 2PTXA 6TAAA 3S5YA 1JPHA 2FHFA 5EL1A 3NEHA 1B3OA 7REQB 4C1NB 4LBSA 3H24A 1PJ9A 5LYRA 4FNTA 4PCSA 4IPIA 4UTTC 4XZ9A 5AHEA 3OTRA 4RLIA 4YU1A 2VZTA 5LHFA 1TR9A 1FUYA 2A21A 3TYEA 3ZSTA 3ISIX 5D2TA 5JMUA 4RX0A 1JDCA 2F2KA 5JQ9A 1UPMB 4FXJA 1SSGA 3K46A 1P0KA 1MI3A 3HIJA 4OU1A 1C7SA 5KZEA 1EEPA 4DWSB 5FJOA 8RUCA 2C8NA 1QT1A 1VLWA 2Y7GA 1TRIA 1FCQA 3W1QA 1E4LA 1Y65A 3PJXA 1B3ZA 4DUWA 4FNUA 3CLMA 4GUFA 2ZXDA 3W75A 2RJHA 2HDJA 3TW9A 4ERAA 1VENA 3LLDA 3NQAA 1QJWA 1FQ0A 5KITA 1C91A 4KCWA 4HP5A 5M1TA 2PD9A 1JYNA 3VD4A 3TN3A 1JJKA 5CPSA 1CGXA 3KVKA 4H6RA 4FLRA 1S5TA 2VC9A 1QFEA 3VIGA 2QQ6A 1AH3A 1FP9A 4HGXA 9XIAA 1HJQA 3AC0A 4MIMA 2PWUA 4MUPA 3RXZA 3WQ5A 3H2AA 3SZ8A 3ANUA 4OGZA 3HTWA 1H51A 4I9JA 2OFJA 2OWXA 1B3YA 2ZE3A 5FF2A 5DCDA 3THDA 3NOYA 1E73M 2PZNA 1Q6DA 4R34A 1W56A 1R2SA 1F7BA 3WBAA 1IEVA 1HN1A 3FN9A 4IIHA 1JD9A 4FOJA 4UQ9A 3IJDA 2QW5A 3VDHA 1SZNA 1N8WA 1NAL1 4GI8A 1XLHA 4YVXA 1DJWA 3RHGA 2H8ZA 3W73A 7ENLA 4H8VA 3TSMA 5KZDA 1NEYA 2TAAA 2X09A 2V2DA 2Y89A 2WK2A 1R86A 4ES4A 4YIWA 4WSHA 2C3ZA 1HKWA 1FWIC 3TAOA 2XFRA 1QBAA 4XD5A 3SJ3A 1GVFA 2O9PA 3IUHA 4FEZA 1SZRA 1RQHA 4YWIA 3W1NA 1BLIA 3W6YA 1LJYA 1OG6A 4GISA 5IFTA 1OCJA 1M7XA 3V4BA 4AF0A 3C2RA 1A5KC 4ZXOA 4D2JA 2XH4A 5D37A 3FV9A 4IT1A 1S2UA 1B1YA 1SPQA 4EX4A 3DC8A 2G0WA 3AHYA 4CN4A 4ZO8A 3NAVA 4HMEA 3CU2A 2W91A 1E4NA 2WNNA 4GZ7A 4C6DA 3VXGA 3B9NA 4NHVA 4L4MA 4IUOA 2WVVA 2OO0A 4DO4A 4GH3A 3LDVA 2YCJA 3CHCA 4CCDA 4NNCA 2BHZA 3C3UA 2Z7GA 1KBBA 3SRFA 3O1NA 1H11A 4DJED 3C2EA 3HQNA 1H61A 4KEVA 3QFWA 5IOBA 3TE9A 4QDMA 3TNOA 1J18A 2QCDB 3T2QA 2UY2A 4J3TA 1VCVA 1KGXA 3TA6A 3QR0A 1FHUA 3DECA 3EPMA 1DJZA 4JYFA 3IJLA 5HANA 4C60A 7PTDA 1RA5A 2XWDA 1V3JA 3D3AA 2TODA 2VQUA 3ITYA 5FIPA 4MDOA 2GJXA 4OFCA 4CEXC 1R8LA 2BXYA 3NYDA 4IICA 5L9FA 3FAWA 2YW3A 4P7RA 3WK0A 2HSAA 5TNVA 1X38A 3FYYA 3U4FA 5JH2A 1WNOA 4TV6A 3TKFA 4S2BA 2V2HA 1JQVA 1A5CA 5FD0A 2XISA 1FWDC 2WQDA 1TR1A 2VL4A 4DWSD 1JGMA 3NQEA 2VFEA 1L0PA 2AL1A 3NCOA 4LY8A 4JQ3A 1QHPA 2YBTA 1JXKA 2ZX7A 1NOUA 3GHRA 1LM1A 4IMDA 3LTPA 4HNUA 1UWSA 4DJFD 4H9YA 1XLKA 3L0GA 1PZ1A 3F4NA 1A53A 4IQJA 2TRSA 2HXTA 5CCZA 2PPGA 1D2KA 3C52A 3PWAA 1UA3A 3T0AA 1QXLA 2UY5A 3U5YA 4M6UA 2VX5A 5FOOA 1F5ZA 3WNMA 2HVNA 4HKPA 1W9PA 4ZOCA 3CLWA 3DG6A 2BOEX 3MSRA 4WRHA 4PTWA 4CU8A 1XGEA 3ZZ1A 2XFWA 3LTSA 4XWUA 5L6UA 2BS9A 2D2HA 4YXGA 3LU2A 5EMYA 4NAFB 1UR2A 1BTMA 3GXFA 3UR8A 2WVTA 5F7UA 1UZ4A 4LF2A 3GD6A 3R89A 1Y5VA 3KE0A 1X97A 2F2HA 2YLLA 1XICA 2GUYA 4W89A 3W24A 1KQYA 3KX6A 4HNTA 2FB2A 4LQ1A 1MXGA 1TWDA 1WDQA 4H8HA 3TAKA 1IZCA 2FDSA 3U7VA 3XIMA 4H01A 2YW4A 5GJMA 3ES7A 4QTGA 5A95A 2WZIA 1YXCA 2ZZ6A 2B31A 3EPOA 1MW1A 2C16A 2XZ7A 2PFHA 3HPFA 1U5HA 1TREA 1Q7ZA 2A3CA 4GYKA 1KFBA 1L6FA 2I17A 4QCFA 3EA3A 2IW0A 4O13A 1C9WA 1W0MA 4FHAA 1RVKA 4QJ1A 1K8ZA 4JNMA 4HA3A 1NOFA 2J24A 1CWYA 3EOLA </