1AZ1A

Alrestatin bound to c298a/w219y mutant human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az1A00
2BGSA 1M9HA 1AZ2A 1A80A 1IEIA 2IKHA 3R58A 4GA8A 1AH4A 4L1WA 3BUVA 2A79A 3M64A 2HVOA 2P5NA 1PZ0A 3WBXA 2FVLA 4JQ4A 1ZSXA 1EL3A 1PWLA 1YNQA 3H4GA 5C7HA 3R43A 4QR6A 4XZNX 1ADSA 3GHTA 2WZMA 3DOPA 4DZ5A 3UZXA 2AGTA 3NTYA 2IPGA 4JTQA 3Q67A 3LQGA 2IS7A 4JQ3A 2BP1A 3LQLA 2WZTA 3LZ3A 2I16A 5HA7A 4GACA 1RY0A 1PWMA 2PDGA 4YVXA 3LN3A 3EB3A 2PDQA 4LBSA 3FJNA 5LIXX 5DANA 2R9RA 2PDJA 3UWEA 1Z3NA 2IPFA 2PDBA 2FZDA 3UYIA 3BURA 4JIHA 3T42A 2PEVA 3U2CA 3LBOA 1ZUAX 4AUBA 1VBJA 2ALRA 3R94A 4QX4A 4JQ1A 2PDLA 4WDTA 2NVCA 5JH1A 2HE5A 2FGBA 3CASA 4PUWA 2ACRA 1S1RA 1ZQ5A 3B3DA 4QXIA 2C91A 3UZYA 3D3FA 1Q5MA 3GHUA 4I5XA 4WDXA 4XAPA 2IKIA 2PD5A 1XGDA 5JH2A 4Q3MA 1HQTA 1Z89A 4FA3A 5M2FX 3GHRA 2IPJA 4G5DA 3UZWA 4WDWA 2BGQA 1AH3A 2INEA 3CMFA 4JQAA 2ACSA 3EAUA 1SM9A 4YVVA 4NKCA 4JQ2A 3UP8A 4LB4A 4F40A 4YU1A 2HV5A 4PMJA 1OG6A 4DBSA 3KRBA 1K8CA 1S2AA 1AFSA 4EXBA 4XZIA 1EKOA 3M4HA 4R9OA 1GVEA 4XO7A 3V0SA 2IKJA 3O3RA 2PFHA 3LENA 2INZA 3LUTA 2FZ9A 3P2VA 1UR3M 3BV7A 3UGRA 2DV0A 5LIUX 2FZBA 3R6IA 1YE4A 2HE8A 4GCAA 4WDUA 1HW6A 4Q7BA 3WBYA 2F2KA 3R8HA 1FRBA 3V36A 2PDYA 3CAVA 4GQ0A 1ZGDA 3M0IA 4MHBA 4XZHA 2PZNA 1YNPA 3H7UA 3BCJA 3EB4A 1MZRA 4LAUA 1YE6A 1EXBA 4LAZA 1XJBA 3LD5A 1MRQA 3VXGA 4JTAA 2PDUA 1X97A 4L1XA 1T40A 5AZ1A 5LIKX 1MI3A 4EXAA 4GIEA 1QWKA 5HNUA 4YS1A 1EF3A 3ONBA 2PDIA 2IKGA 3H7RA 3N2TA 4FAMA 4OTKA 4FZIA 3V0UA 3CV7A 2IQ0A 4HMNA 1XF0A 2PDFA 1US0A 3O0KA 4WEVX 1C9WA 3F7JA 4RPQA 2NVDA 1T41A 3UZZA 1Z9AA 2PDXA 2PD9A 4H7CA 1LWIA 2PDNA 5KETA 4JTRA 4XK2A 4XVEA 3LNMA 1RALA 3G1RA 4IGSA 3V35A 1R38A 4YVPA 4H8NA 3MB9A 1S2CA 4XVDA 4HBKA 1X96A 3ERPA 4JTDA 2IQDA 2J8TA 1Z8AA 3COTA 3CAQA 3G5EA 1LQAA 3RX4A 4LBRA 4WRHA 1X98A 4ICCX 1VP5A 1Q13A 4PRRA 1QRQA 4LB3A 4IJRA 1RY8A 3RX3A 1AZ1A 2ACQA 5LIWX 2PF8A 2IPWA 4GABA 3N6QA 1PYFA 4DBUA 3RX2A 5HNTA 3WBWA 3C3UA 4XO6A 2DUZA 3WG6A 4WGHA 2HVNA 2QXWA 4PUUA 2PDMA 4GQGA 1S1PA 3ONCA 2FZ8A 3FX4A 4PRTA 3GUGA 2CLPA 3V0TA 3LEPA 3QKZA 1PZ1A 4IJCA 3R7MA 3GHSA 2DUXA 4FALA 1JEZA 1J96A 3MC5A 3LZ5A 4PR4A 2PDPA 2PDWA 1IHIA 2PDCA 5AZ0A 2VDGA 3CV6A 4QBXA 2I17A 4XZLX 3UFYA 4DBWA 1AH0A 4JTCA 5LIYX 2HDJA 2PDKA 2PDHA 4JIIX 2R24A 4ASTA 4ZFCA 2ISFA 3Q65A 2F38A 3R8GA 3WCZA 3DN5A 2ACUA 2HEJA 3UG8A 3S3GA 4XZMX 4JIRA
chains in the Genus database with same CATH superfamily
1VEMA 1XP3A 3G0UA 2BGSA 4URIA 1XKYA 2CKRA 2F6XA 3MSDA 4OUEA 1AZ2A 3VDCA 4F2TA 2CCRA 5LA1A 2R6OA 5M5DA 4QS5A 4DI9A 1JUBA 3KLKA 1EPVA 1XBVA 2ADAA 1C3FA 2VDIA 3W70A 2HQAA 2ZADA 4Y6GA 6A3HA 4H41A 3IIZA 1GVOA 2I9EA 3GW3A 4UMCA 1QAPA 3F2BA 4BQ3A 3BG3A 2G4JA 1EL3A 5D02A 2V82A 3M0MA 1YNQA 1ECEA 1UD8A 1XYZA 3MV11 3MS8A 4A22A 1R5YA 5AHMA 4JEQA 2DEPA 3EGJA 1U1HA 1XGEA 2DSUA 5CZ0A 4MZ8A 4A3YA 3LYEA 1POJA 4MNMA 2CHOA 2I5IA 3AIEA 4MPKA 4MUZA 3FYYA 4IIDA 2CXGA 2ZRYA 3S1XA 5BW6A 1MUWA 4G8TA 4UNIA 3CYJA 2OLAA 2ZC1A 4FHAA 2WCGA 4LT9A 2Y6ZA 9RUBA 2FFIA 3VYLA 2C6QA 1BKHA 1GW9A 1UZHA 3DHFA 3OLEA 5ECUA 3IVTA 4LBSA 1MXSA 4QNWA 1V3HA 3WQCA 2V5JA 5HWNA 4B15A 1H0IA 3TYZA 1UWAA 3EX3A 5FF2A 2FZDA 2WNQA 3QLDA 2QJIA 5D9MA 1GHRA 3UD6A 5EMUA 3QZEA 1UOKA 3H2CA 5DFAA 4OFCA 2BZNA 3P14A 5FL1A 1N2VA 2GQAA 2Z1WA 4XBKA 1WZMA 1L6GA 1Q5MA 1TPUA 2JKAA 3EWCA 4CEXC 3QW4B 4JY9A 4RW5A 1UZDA 1C7TA 5JMUA 3QQ1A 3TW9A 3FK4A 3QYSA 3LV5A 3CUJA 4M82A 3LXBA 4ZO7A 2YFOA 1NF7A 4LEQA 1EJTC 3IPWA 3AMDA 3HO8A 1E4IA 1IWBA 3KWSA 4QISA 3HQNA 5DCBA 2GJPA 3TDFA 1BG9A 2NXIA 2VQUA 2QGHA 1AFSA 4EXBA 2OZ3A 4HJWA 4XKYB 3VKBA 2CWNA 4NX0A 1DJYA 4UTTA 1W9XA 1H50A 1K7FA 2G37A 1EGVA 3A12A 4GUGA 3UY8A 2XPKA 2JF7A 1CEOA 1A5LC 1P0EA 3CZKA 3WD2A 4AX7A 2FKPA 4R85A 4KCWA 4PTNA 2E6AA 5D38A 4MLRA 3GVRA 4HU0A 2OQYA 5BXPA 1JNDA 4QG9A 1GOKA 3TQ0A 4LPCA 4YL2A 3STFA 1RVGA 3T0DA 1HJVA 4L1GA 1QHZA 3TTEA 4R33A 3LXCA 1TZZA 1ZY9A 4N6EA 4IP5A 2PE4A 2V9DA 1A49A 3T78A 2YA1A 4LFYA 4J3ZA 1X97A 1FWGC 1AA1B 9CGTA 1QI2A 1KFEA 2EG6A 2Z6JA 4GMEA 1B57A 3CTLA 1SVDA 1GVSA 1KFCA 5CEWA 3AROA 3OIXA 1Z69A 3SCTA 4F3HA 2XH7A 3EX6A 4AC7C 3UXDA 1L8PA 2WMJA 4Q4PA 5DF0A 4YTUA 4PZVA 1I45A 4MM1A 4EVZA 4W84A 4N9EA 3V5FA 5JXQA 4FIRA 4Q4SA 3KOXA 2WANA 3WQ4A 2YIHA 4PMYA 2X30A 4EPKA 4Y9PA 2V69A 3HPAA 3SCWA 1TMLA 4WZHA 3E2VA 2PD9A 4D8AA 1ISWA 5DMYA 1NFGA 4G1KA 1ZAJA 3E9AA 2NUXA 4FXFA 3HF3A 2BTMA 3KL5A 4AWTA 4AXKA 3L21A 1WXZA 4ATLA 4UNLA 2VR5A 3S46A 4QLKA 3CZJA 1FDYA 4YHEA 1A5OC 3HBLA 4F0LA 1DHPA 5LXEA 4I90A 1MW2A 1ZJIA 5HQMA 3I10A 3RXZA 4N9DA 3TJXA 1Q66A 1U2YA 2DU2A 3W26A 4A35A 3ABQA 4J3XA 1NQKA 3E2RA 3MPGA 1TA3A 1JL8A 3TAKA 1LJYA 3DKJA 1HXJA 4IJRA 4P7LA 3ZR5A 4EAYA 2XG9A 4WSHA 1Q6LA 3UG4A 3NQVA 3TA6A 3BCFA 2P1FA 1IIGA 3NQ7A 1E4LA 4L5ZA 2Y2WA 2KZHA 2O9PA 1HTIA 4WGHA 2E6DA 2EJ1A 3AAMA 4GQGA 1JYWA 4HVXA 1R7OA 1UR9A 1XSIA 2GVEA 3DFSA 4QP0A 1UOZA 4YIWA 4HCHA 1UD2A 2OKTA 4TOQA 2I7GA 3FIGA 1XIIA 1RJPA 4OU1A 1IHIA 1QI4A 3E2SA 3R13A 1RA5A 4DN1A 6TAAA 4JS3A 2OYLA 2EQDA 1VHCA 1XIGA 2BSLA 3ME3A 3SQMA 3ZJ7A 3W87A 2Y61A 2XN0A 2F38A 3G0XA 3WQFA 3WJXA 2EEXA 1VFLA 1UH3A 4O1DA 5A95A 5A6TC 1Q6FA 1US2A 4JX5A 4US5A 5JQ9A 2NQJA 1UHVA 4IIHA 2QUMA 2YBVA 1CXFA 4C6BA 1IEIA 2QCCA 5C2CA 2GJLA 3S2JA 3WX7A 2WMHA 3N15A 4MPQA 3UF9A 2V68A 2J7EA 3L12A 4QNEA 1HP4A 5F2GA 3ARXA 2J6VA 1R2TA 2HZGA 1AQHA 3S1GA 4IT1A 2VRJA 1SR9A 2XSXA 4LY8A 1WNOA 3WH5A 3PP7A 1KXHA 1IEVA 4JX6A 1SO4A 3W38A 4PCNA 2QR6A 3S5YA 4WKHA 3HM7A 1CXLA 2VZUA 4MY8A 1OIFA 1OSEA 3FY1A 3ITTA 4PSPA 4J35A 2XIQA 1QVBA 4LY4A 2PPGA 2WZTA 1GYLA 1F74A 1K7XA 4H8UA 5A8QA 1RY0A 1UR4A 4C6CA 3UG5A 3AHZA 5BXRA 2CLIA 4YTQA 2WVUA 2VNCA 4DAFA 4EOUA 3PBMA 3JZUA 3GTHA 4F4RA 1FWIC 5EU9A 3VOFA 1SPQA 4ICNA 1UKTA 2VGIA 2ABAA 3FOKA 1VFTA 1XSJA 4IM4A 3GH4A 3V1HA 4P8XA 3ELFA 1XICA 2Z7GA 2C7FA 3WIJA 1XKJA 3HMCA 3R89A 1ZQ5A 1EIXA 1ZAHA 1WXYA 4C6OA 1ONRA 1EP3A 4ZFMA 1AJ2A 4HQVA 5JH2A 2FFCA 2WHLA 1MEHA 4Q8QA 1JZ6A 4MDPA 5B7ZA 3S42A 4G5DA 1YDNA 4FI4A 1TELA 4YCOA 2ZUUA 3LCIA 3M5XA 1NWTA 3CQHA 2POTA 1AUSL 2PTDA 4JKLA 2VFDA 5BU9A 7PTDA 5HXMA 3AIVA 3CT7A 2Y8UA 1X8CA 3WLLA 1UJPA 3FHAA 3T7VA 3KRBA 4XX6A 1WOAA 4PGLA 3F03K 1EKOA 1PTAA 1CXHA 1FH7A 4GNJA 4I9AA 4Z0SA 1W31A 1NWUA 5A8MA 4FMVA 1JCMP 4HK5A 2XTKA 3ZLGA 2RJHA 4U5KA 3QMRA 5TD4A 4H7ZA 1WAUA 2PFHA 4PE8A 3KW3A 4B3KA 1FWAC 3TR9A 1GVQA 3LB0A 7ENLA 1A5KC 3GWQA 3H22A 5D8WA 1VJZA 4HK6A 1BWLA 2V6AA 4ROQA 1SR0A 2Y24A 3MUAA 3AYRA 2HE8A 2V8ZA 4DYKA 4EACA 3EMZA 5AVHA 4S3AA 1JDCA 2YCIX 1MNSA 4NXSA 4Z1BA 2PDYA 2ZA3A 3AU6A 1WKFA 3LHYA 4GVHA 4W93A 3WQ6A 4HHPA 1Q85A 4KPLA 4DWSC 1Q2SA 1VC4A 3ISIX 1UH4A 1EOKA 4IMCA 4OOZA 4LAUA 1EXBA 4CQ9A 4HCLA 1XJBA 4GZIA 4DX3A 4WOQA 2XN2A 4NZ4A 1U5HA 4NAFB 1K4HA 3GD6A 4S3CA 3CNYA 1YDYA 4Z1YA 1D9EA 4O4VA 1PAMA 4Y7EA 1KBJA 4FLOA 4UC5A 1AW1A 1HZYA 1V93A 1XLJA 3TONA 5C9XA 2Y7EA 1O12A 1EC8A 2P3EA 4R7OA 2P0OA 1QMLA 3RCMA 3RM9A 3TSBA 1P6CA 1UBSA 1X6UA 5EB8A 3N18A 4AMAA 5HDRA 2ON3A 2H8XA 4DPQA 3O0KA 3SBFA 7CGTA 3QZ6A 5XINA 3GVGA 1IEXA 3CQKA 3DHDA 1B4KA 3CU2A 3ZYZA 5AHLA 4MJ2A 1K8YA 3WL1A 1TPWA 5JVLA 1DXFA 2P8BA 3PK7A 3DAQA 2HMCA 3QW3A 2VR2A 1H2JA 2WO5A 3W2UA 4IMFA 1EXPA 2PDXA 1J0YA 1EFZA 1PKYA 4AU0A 3MP5A 4E4FA 3ZLFA 2NT1A 4DEFA 1V0MA 4NAFA 3OU8A 4F0KA 1TTQA 1SW0A 2PRHA 1MXGA 5F7UA 1LL6A 3ERPA 1JQVA 3R0DA 1UJQA 2Y7DA 4IIBA 1OFBA 1H7RA 2FB2A 3GDTA 1S3HA 3SY5A 2R14A 3DENA 1VP5A 2A7PA 1QRQA 1UWTA 4P7OA 3QR1A 3WLTA 1DJXA 1JD7A 1K3UA 1W32A 3TMLA 8A3HA 1NOUA 4E2DA 3ES7A 4EWJA 3C2OA 4DBUA 2QUVA 9XIAA 4XO6A 3N1AA 1CXEA 1DL3A 4DNMA 4LV9A 1MUCA 4GJ1A 5I00A 1JDEA 2HJPA 2ZUNA 3UNTA 1ELSA 3M44A 4JX4A 2UBPC 4JFWA 4H83A 2J7CA 3GZAA 4B9YA 1EEXA 3BICA 1U5VA 3V0TA 5IOBA 3BAYA 2FMOA 2VEIA 1PHQA 2SFPA 4M56A 1G6CA 1X7IA 2DY3A 3TZNA 2YZRA 4GC4A 5EBUA 4D1JA 5CJMA 3LZ5A 1W3IA 1F73A 4I9JA 2R1NA 4QBXA 2GL5A 1R2RA 1R85A 4EAMA 2D0FA 4JTCA 2PDKA 3DYPA 2R24A 4ZFCA 1KBBA 1WKEA 3W6LA 1UWIA 3L5AA 4KFPA 1XLHA 2WNZA 1JNEA 3P61A 3UWQA 1DXEA 1O5RA 2HEJA 3AO0A 3QY8A 4RDZA 4JTIA 2F8QA 3G24A 3S6TA 4JIRA 3W71A 1VEPA 2ZRXA 4F0SA 1B54A 4HOWA 5J5DA 1SZRA 2DSVA 2WCAA 1A80A 2O9OA 4WCJA 3Q45A 3C0QA 4C1NB 2NUWA 1EUNA 4IXHA 1UIOA 2IQTA 4AISA 4GVFA 3FSTA 2A79A 4RK8A 3N9RA 4D6FA 1K7EA 1PZ0A 3DC8A 3GO2A 1D8CA 4US6A 3BSHA 4INFA 5I02A 3OP2A 4IIFA 4C6DA 5KMYA 3AMCA 2V38A 3SCSA 2VZOA 2OX4A 3ARPA 3EBVA 3H2EA 4EWND 1FVPA 1ADSA 2DQXA 3UR5A 1SZFA 1VLIA 2PWGA 2Z7KA 3GHTA 1JXJA 4NJJA 1TUXA 2FVKA 1N8WA 1BSLA 1E1EA 1S2WA 2DZBA 4LANA 3N25A 2FHCA 4JTQA 1H4PA 2NWRA 4C1NA 2GSJA 3GNOA 2CBUA 1X7FA 4GVIA 3SGGA 2PDGA 3BLLA 4MJZA 1IXQA 2CZFA 3GIYA 1EPXA 1RK5A 2E7FA 3LGDA 4UOZA 3LCLA 2FMNA 4XD3A 3C5QA 2CLOA 4ZOCA 2X2GA 4RDYA 3P93A 4W8BA 3CWOX 4CD6A 2BXYA 3TV8A 4GHRA 1QO2A 2DSWA 2HCVA 3DI0A 2WSYA 3LS9A 4GBUA 2XZ7A 3UJRA 4KIEA 2GVJA 1AQFA 1EJ7L 1ZJHA 3PZOA 1OCQA 4GI9A 4PUWA 4I5UA 3IV3A 1EDQA 3W7EA 1LP6A 4OBRA 1FWSA 2DVTA 4DUOA 5LGZA 3KBVA 2POZA 4FP1A 3MUZ1 1NM9A 3GZ3A 3A9IA 3ZWTA 3UZWA 4E8DA 5FIPA 3OZOA 2B31A 3P8JA 1EJVC 4JQAA 3M43A 4S3BA 3LOTA 3WUBA 4LCQA 4AYSA 5CC6A 4CKQA 4BQ5A 2HPIA 4DM1A 1R9ZA 3GFYA 1GYNA 4TX9A 2UY2A 1GPFA 3LLXA 3GG1A 3PG9A 1CTNA 1UZ4A 1NDWA 1A53A 3KLLA 1O66A 1E6QM 3ZVHB 1BRLB 3TOPA 2UWFA 4YTRA 2VFEA 4IISA 1GVEA 4M6PA 3U4FA 3TFCA 1D7KA 3L2MA 3SUUA 1KBKA 4U2ZA 1J2BA 4DBDA 5TQLA 4GI6A 5BZAA 2X41A 5KTLA 5I79A 5AYIA 5D2YA 1PPIA 3RO8A 2FZBA 3G8EA 3NXFA 3HN3A 4B92A 2Y63A 1W56A 1NAL1 4U28A 3VA8A 4NYUA 2VWSA 4C6NA 4EE9A 4GQ0A 3S2LA 3T0TA 3VNKA 1GTHA 5E09A 4XISA 3T9PA 3G1VA 1RUSA 4G9PA 5FAGA 1CZ1A 3NPVA 2WK2A 3PM6A 1B2YA 3ZVHA 3UXKA 2R1MA 3VXGA 2YA0A 3SRKA 4RZ4A 3ATZA 5GNYA 1EBHA 2CZ5A 4U2YA 3WFLA 3CPUA 3HG3A 3UYCA 2A21A 4A8NA 1QO5A 2DVXA 2XN1A 3K4WA 2ISSA 2IKGA 3H7RA 4E2VA 1V6UA 2H3BA 4OTKA 3RITA 1PO9A 2XUCA 4QE4A 1WDSA 1Y8BA 1XF0A 2OZ0A 2X42A 2CETA 1YQ2A 1QATA 5GPRA 2GYIA 3QRHA 2X7WA 4YWSA 1V6YA 1FOBA 2FZMA 3F4DA 3KVMA 1KR1A 1P0BA 4LV4A 3THCA 3BCDA 2V81A 1OD0A 5E70A 2ZWZA 3U0HA 3VIIA 3UZZA 4NZCA 3FDKA 5M1TA 5CPLA 2VMFA 3HPXA 8XIMA 1LWIA 2GK1B 3UG3A 2DQWA 3ARQA 1XX1A 2QCGA 3FN9A 2X1IA 2GQ3A 4H8NA 1KGXA 3I6EA 5LA2A 4A8LA 4GPNA 4R53A 1TTIA 3IIOA 1ICQA 1THFD 3G1XA 1LL7A 1W1VA 3N14A 4Q22A 4ES4A 2D2GA 3TK7A 4UTFA 5E6ZA 4PMQA 1KCLA 1OGBA 1KXVA 1ME9A 3HU7A 2PP3A 1C8VA 1V03A 3FW6A 2BS9A 3GFZA 1E3ZA 3VNDA 3AMKA 2XSAA 2VEPA 4BFAA 1K9EA 4NP7A 3PHAA 3VILA 1JFXA 3PAOA 1J0HA 2ZXAA 4TIMA 4BK9A 1QK2A 4UZSA 2GK1A 4A2RA 1RD5A 2WMKA 1JCJA 3RR1A 2TPSA 3TFXA 4LYQA 1NEYA 4XZBA 3QN3A 2P3ZA 4G7EB 1V6XA 3WK0A 1Q7QA 4D2JA 4RXFA 1KFJA 3PZMA 1TWSA 4CD5A 2NSOA 3OZPA 4NL1A 2OEMA 3CWHA 2WWCA 2WW5A 3QPEA 4JTSA 3KDNA 3VGGA 1G4TA 3OG2A 1FXQA 1R7AA 3K46A 2GUUA 3M07A 4BEUA 1UUQA 3RK8A 4AZGA 3HV9A 3DN5A 4N9BA 5AECA 1E3XA 4GGBA 5T26A 4J5NA 4MAVA 4GOAA 2BOFX 4L64A 3IS4A 2W5FA 4E6MA 1DIKA 1UR2A 4QTGA 4QLJA 3BPWA 4P5UA 1AQ0A 3GIPA 3AWOA 3V18A 2VWTA 4A3QA 3BW4A 4H6RA 3RLGA 2BBFA 5M03A 2OZTA 2P5NA 4Q4KA 4XIAA 1MDRA 3WBXA 3WNNA 5DO8A 3JRKA 3W02A 4GD0A 3I3BA 4CNPA 3PFMA 1BAGA 5HPOA 3I3EA 3OHIA 4MAZA 2G41A 1B3ZA 3I7QA 2XVLA 1EJRC 3H4GA 3B03A 2AMGA 2AQVA 4GYPC 7TAAA 4LTSA 3GC4A 4TMBA 3SI9A 3WD1A 3R12A 5CSYA 4O14A 4O1CA 3U57A 1XLEA 3URAA 3ZR6A 4B91A 5AY7A 1Q6QA 1ML1A 1WO2A 5G2IA 4G2DA 3TKFA 3ARZA 5FJTA 2BP1A 2JBMA 4C91A 4GI8A 3LZ3A 3QMTA 2VOTA 4B5XA 2ZUTA 5DY3A 2PTYA 3QBUA 3DUGA 1HGYA 3VC5A 2DORA 3WH9A 5DT5A 3W82A 3N9KA 5ENLA 3M46A 3WJSA 3AMGA 5CPNA 5D2WA 5DCEA 1SZEA 1BXNA 1EYWA 4HZ6A 1Y5WA 3LBOA 3FS2A 4AUBA 2VEGA 1V5XA 1J2WA 3OVGA 3W1TA 1E73M 2ZRVA 2E77A 3W7CA 3OLDA 2OGYA 1FP9A 2FGZA 4EF8A 1C29A 1FCQA 3KTSA 4K8GA 4I5XA 2GLKA 4GCXA 1TPH1 2V3DA 3WLOA 4DO5A 2PWHA 4IPPA 1E4NA 1GORA 2ZXDA 1E9YB 1L2UA 4UB9A 5BXSA 3C52A 3CIVA 3OLIA 2OSWA 5BWAA 1ONEA 3DHPA 4LF2A 3U9IA 2YDSA 4JKMA 2PLJA 4NZFA 2CZVA 4DXKA 4P8UA 4X61A 4FNQA 1XUUA 3TQVA 1J79A 4AC1X 2J47A 1PX8A 3IVSA 3W29A 4XZIA 3CHDA 2EF9A 4TXEA 2W92A 4IMAA 4IG2B 3GX9A 1UUOA 4X9YA 3ZQ9A 2BX7A 4JTJA 4DWSB 1KKRA 3V0SA 2DZTA 3GXDA 3A3HA 1NWRA 1CXKA 1KFWA 5LKYA 4LBUA 1YRRA 2WSQA 4QS6A 4W88A 3TUUA 1S3TC 1ZL1A 2DV0A 2G4FA 4NUWA 4O12A 4QJ5B 1FFRA 5GJNA 4NJGA 4B5TA 4WDUA 1HJSA 3SURA 4YWIA 3WENA 5DN1A 5AVNA 3O9NA 3T40A 4XIMA 4P8WA 2Y8VA 1J93A 4XZHA 1VJSA 2W0UA 3PF3A 4PTVA 1MZRA 4B90A 3WK3A 4IG2A 1KFLA 1Q45A 1XC6A 1C7SA 2GGGA 4RZ5A 4KRUA 4L4MA 3HQOA 4P7NA 3VKKA 4DWSA 4CD4A 1AL7A 3E0WA 3GC5A 2I9UA 4NIRA 5A94A 1JDAA 5DXYA 3CV7A 3KDOA 2E8ZA 2DH2A 1TMQA 2X40A 4MB5A 3WUFA 4DYJA 1QNPA 3APGA 1SO3A 3CL8A 3W7HA 3L4XA 4XWUA 1D7FA 1T41A 4V1XA 1H3GA 3UXAA 4GIRA 4NNBA 4F9DA 2XJ7A 4GI4A 3RU6A 3NQ8A 1XIDA 2YDAA 1F6YA 4H7CA 3RMEA 1H7XA 3RM8A 4Z0JA 4XK2A 2PB1A 1KCKA 3S8HA 4M6VA 4IF2A 3GR7A 4DJFC 4IGSA 1POKA 2P8CA 4RJEA 1DYSA 4PB3A 4AZIA 3RM4A 2H3DA 3QZAA 1DXIA 2Y0FA 1S2CA 2XISA 4HBKA 2DPEA 2WMGA 4PCTA 3I68A 5KZ6A 1UWQA 3CLMA 3M7WA 1NDZA 1E55A 2QZRA 3KL0A 3RX4A 3OZYA 1X98A 3OVQA 1J8VA 4B4FA 2QCLA 3LBCA 1V02E 2NQ9A 4ZR8A 2E1WA 3CLWA 1AZ1A 3EPNA 4UUIA 5LIWX 1QBBA 5E9XA 4GX8A 1VFMA 8CGTA 3O6DA 3B4UA 3IANA 2G97A 3EXTA 3C2RA 2BY0A 3M0YA 3E02A 5E5CA 5FEPA 2QXWA 4O50A 1ONWA 4CNTA 3ONCA 3DZ1A 3GUGA 4GO9A 3ANYA 2FIQA 4LYPA 2JALA 3BLPX 4N4QA 3EA2A 4JIQA 1W6TA 1QNVA 3ITVA 1EHNA 1WXJA 1RV8A 5GNZA 1R9YA 5E9AA 3RPTA 2PBOA 1EO7A 2PDWA 3AZTA 1W5PA 5FAJA 3B8TA 1JCYA 4O15A 1H51A 1KBIA 2HDJA 3TH6A 3S4TA 3AXMA 3NO5A 4J1OA 1V8EA 4DO4A 2P10A 2YOCA 1JAEA 2AL2B 2HTMA 3VKDA 4KBXA 1WCGA 2ZDRA 3THDA 1YKWA 3SZ8A 1H1ZA 3VUSA 2G3IA 3NQEA 3P3BA 1HL2A 3ALGA 1RP9A 2J7HA 3GR8A 1XIEA 1TX0A 1DTUA 2CBJA 4KW2A 1XLKA 3PPGA 2VFIA 1RPXA 3TLQA 1K77A 3R2GA 3VIGA 5K4XA 2Y88A 3L5LA 1NSJA 2J74A 1OGSA 4HPJA 1YNYA 2YCKX 5I3FA 1TTPA 2QCDB 1WPCA 2PWDA 4UZUA 3T6CA 3UVIA 1YADA 2DIJA 1RCXB 2Z0IA 3DH7A 5DEZA 2OKOA 3M0KA 1JPKA 2ZRUA 1BHGA 3H6OA 4KCVA 4ZE5A 3WMSA 3KOFA 1QI0A 2AL2A 4QROA 1QK0A 1LQ0A 2QGYA 2XIIA 2J9YA 2CIPA 2Z29A 3N12A 2RDTA 1H7WA 2Y8KA 3WUEA 3NQGA 2W62A 4AZCA 4LW7A 3SW6A 2GWGA 1EJUC 2P0IA 3GTFA 2PA6A 1A5CA 3W81A 1XLBA 1FWTA 2I16A 4O53A 3KAOA 2B7QA 3MUIA 4DJEC 3PBGA 1FWDC 3W28A 3UBPC 1XD0A 2E4TA 2BY2A 4PCSA 4PBEA 2FHBA 1JZ8A 4ERGA 4LQ1A 2R9RA 3ITXA 1XV8A 4PODA 1K8ZA 5CG0A 4JIHA 3VNMA 3MI2A 2CFFA 3I7SA 1UR0A 1SZGA 3BGJA 4V1YA 1GOMA 2Z27A 1FWWA 4L4LA 4ZXLA 3OGRA 1FDZA 3OJGA 3LI1A 2ISDA 3VMNA 1D8WA 3PTDA 3N13A 1DQUA 3GU2A 1NJJA 4AD2A 4JTHA 1JUKA 2C1IA 4O13A 1F9CA 4I7WA 1EC9A 1Q63A 4UIOA 4MUPA 2IMRA 3IIXA 1I4NA 3WEOA 3I6TA 1V0KA 3MYOA 1FWBC 1UP0A 2OX1A 2XIOA 4NHVA 4JICA 4BI5A 2ZVIA 2TAAA 3EXSA 1B3WA 4PMNA 4WIWA 1NP0A 4FLSA 3QV8A 1HNYA 3T55A 1YXYA 4DBSA 1VIWA 4EXQA 4ERIA 2GSEA 2F7FA 5CJ5A 2QT3A 2H6RA 3IVUA 4B2DA 2VCBA 1TVPA 1DJIA 4E5TA 1UP2A 4Q8PA 3WQGA 1QOXA 2VHLA 4NF7A 1YTDA 3BDKA 2V3EA 3W4RA 5A6LA 2J25A 3OBAA 4NVTA 3RGTA 5HOSA 2FB3A 1K4GA 3W7DA 4Q8VA 4Q7BA 1TJ1A 3IRDA 1SMAA 5HWJA 1MW3A 4ZSUA 3AXXA 3CAVA 1ZGDA 2BOEX 3OYXA 1SO6A 3ITGA 3CUIA 3L0NA 1PIGA 4ACYA 2QVHA 3G22A 1GKRA 4BF9A 2Z2AA 1GJWA 2C0HA 1YLVA 3VOJA 2ZX6A 3EOEA 3FHQA 1JUEA 4IWWA 1B31A 5LIKX 2J8FA 1VF8A 4YS1A 4QM1A 3UWUA 3TCEA 3MVIA 4CQAA 3S5ZA 1NIUA 2FYMA 1EZ2A 3P5YA 3FA3A 2J8GA 3R8RA 5D2XA 3VE9A 1MMFA 3KZSA 3QTGA 5HQLA 1OYCA 2Z1SA 4W7UA 1G4SA 4K68A 3G1YA 2OJPA 3P8IA 1VPQA 2J75A 4MNLA 1MYRA 2INFA 2NX3A 4JHMA 1YDOA 4CU8A 2AAAA 3OGVA 4LUYA 1AD4A 1GVIA 2HS8A 4AEOA 4GUHA 4LUSB 1VS1A 2YPIA 3LI0A 5KINA 4X63A 3QHMA 2TYSA 1RQEA 1O1ZA 3W53A 1PJ9A 4KGJA 1XIBA 1T6MA 3TU9A 5D32A 3S1UA 4OGZA 4L6HA 4MJMA 2J8TA 3EKGA 3U5UA 1V4YA 5LNWA 3N3MA 2R1PA 4HHMA 1Q13A 1QNQA 1X1NA 3BQ6A 3GXFA 3G3MA 3TC6A 1RY8A 3M0LA 3CO4A 5AKQA 3ZWSA 1H1YA 4OKDA 1ITXA 2IPWA 2J9XA 3N29A 4WVXA 3B0PA 4TV6A 3M9YA 1XPYA 4UFHA 1I9CB 1Q6CA 4QQUA 4W87A 5DCDA 4WHBA 2OEKA 4LUSA 3L67A 4PEKA 1OZQA 4P61A 3KBSA 3F2DA 3CMGA 2VM8A 3S2NA 3OG3A 5EGRA 4XAFA 3MZNA 4B4HA 1F6PA 3ITYA 4IJCA 4MGGA 1EWDA 4UCGA 1O5QA 3IJ7A 1V02A 5AC7A 1PBGA 4W9TA 3WNOA 3U4AA 2WKGA 1EOMA 3EWWA 4PR4A 1W9PA 3PSVA 5HAOA 2PAJA 3WQOA 3PJXA 5BYWA 2I17A 4K7YA 4ZL1A 5C9RA 1B90A 4UTLA 3F5LA 4S38A 2VUNA 1SJAA 4X2RA 1ZAIA 1Y7VA 2G8ZA 5G2HA 2BY3A 4B5NA 4PMOA 1ZALA 1BWKA 2JKEA 4HZ8A 3GAKA 2QUTA 4AZBA 2W27A 2NQLA 2Q3OA 2Q8XA 2H9AB 5CAHA 2PS2A 1Q7ZA 4JNYA 4OT7A 3ZR4A 2WM0A 1V7YA 5C9WA 4HKPA 2VRKA 3TC3A 3UWWA 4LJ3A 4RNHA 5AOUA 1TZ9A 1J0JA 2OT0A 4PBGA 1S5MA 3LSBA 1SQ7A 1HG3A 1UD4A 4WJ8A 4J9JA 4GFSA 3WF0A 5DMLA 3F5KA 3NL2A 3L4TA 2O55A 2C0AA 4DO6A 2ZX8A 1FHLA 1WYIA 2DZWA 4IZGA 5C7HA 4OQVA 2XGZA 2EXOA 3PY2A 5CGQA 3K13A 1WV2A 1R47A 1P4CA 3GG0A 4FSAA 3T8LA 2A7NA 5C70A 1QPOA 4JY8A 1JCLA 4LS1A 3B0XA 4L9ZA 3H2OA 4GYPA 2A0NA 1X8FA 4KEZA 2H9AA 4J3SA 5CPQA 3LQGA 4V33A 2VC7A 3LQLA 1LOQA 2ZFAA 2VC6A 4H9YA 2O56A 3CS2A 1TVNA 1XISA 5HA7A 3CEUA 4J27A 4DI8A 4Y9MA 5D9OA 4LNCA 3S83A 4PULA 1OX4B 3CHFA 1TRDA 1RHCA 5EMYA 1EBGA 1BQGA 1QPKA 2OEJA 4QQ3A 2A85A 3BXWA 2NSXA 5HJYA 4JTLA 4D6DA 4NYYA 3VCCA 3EWXA 3B8SA 5C9ZA 4FX7A 4LS2A 4ZMGA 1HKIA 5KZEA 3FKKA 4Y90A 4JYDA 3KXQA 5E1QA 5CBBA 1JPHA 1BF2A 4S3KA 4JQ1A 1P7TA 3H55A 1UKOA 2WMIB 3KCJA 1M03A 2R94A 1LG2A 2QEZA 1LBLA 3GIQA 4UNKA 1EWEA 4QXIA 2C91A 3ARSA 1XBZA 4J2PA 4KEUA 3WDJA 4ML9A 3TP4A 4E8CA 4S39A 4BA0A 4AEFA 2NW0A 1KFBA 1KKOA 3W7PA 2BGQA 3QQWA 2INEA 3OQEA 4UFMA 2AL1A 2EKGA 2ISVA 4WF7A 1OX4A 1XLMA 2Y5JA 1HKMA 3MCMA 1O60A 2ZXBA 2P50A 3WLHA 5J8LA 4Y9OA 4H6QA 3GH7A 1F8IA 4M19A 1Z41A 3QM3A 3W2JA 3NIYA 4K6AA 4K7VA 1UP3A 3EPMA 1YTKA 5FJIA 1GCYA 5BROA 2WMIA 4S3JA 1VB9A 3ARWA 1SMDA 1OHLA 4GWEA 3TIMA 1CBGA 5TIMA 2QMKA 3TTOA 3R4IA 1H49A 3K30A 3THAA 3LMZA 3AMLA 5CG7A 1JI1A 4NRRA 3VGHA 1W3JA 2QPUA 3R10A 3ABSA 4QSFA 3VNJA 1LUCB 4PMDA 5LNUA 2X1TA 4Q7IA 2D73A 3GBEA 3UCCA 2YW3A 3II1A 1UH2A 1KRBC 1PX4A 5I06A 1LYXA 1W37A 3MHGA 3AXHA 3GY1A 1H11A 3GDRA 3EX1A 4H9XA 3FJ6A 3HA1A 3MSGA 3WLRA 4DM2A 3OBEA 1PYMA 1Q6EA 1IE7C 1W1TA 4JTAA 4NILA 3WY1A 1CI1A 1OF6A 1T40A 5HJLA 2ZZ1A 3RCYA 5K9CA 1KTCA 4AIOA 3B8UA 1SJBA 4JNZA 2ANUA 1VJIA 4HMNA 4NNAA 3ITCA 3EDJA 4ZQRA 3PFRA 1W1B1 1WBJA 1UPPA 1LUCA 3IK4A 1EDTA 3HZ3A 1O1HA 4DZAA 4XD5A 4U3CA 3OA5A 4DUXA 1OFQA 1E1FA 3GG8A 1TPFA 1OCBA 1TV3A 1TV5A 3B40A 1IGWA 3K5XA 2CLEA 1G01A 5BXTA 1XLFA 2EPHA 3GNNA 1PEZA 4H19A 3UT0A 4M7SA 1AODA 3Q2DA 5G2WA 3FJ4A 1H7OA 6XIMA 2DP3A 3WQWA 3GS6A 2WPGA 3HFTA 3RIKA 2WB5A 4QSHA 2QCFA 4FF7A 5H2ZA 3RHGA 2PTWA 5KEZA 4RE0A 3W6YA 4DJFA 4HZ7A 1YBQB 3G1DA 2G3FA 3BH4A 3EWYA 3B8IA 4GZJA 3VOHA 1WZAA 3IV8A 5DRIA 3VDGA 1PDZA 1RVKA 4FPSA 3BMXA 4MKVA 4JFTA 4L80A 1OM0A 2J7FA 3IIVA 5FOOA 2HSAA 4HSOA 3OA3A 4DUWA 1L6FA 3AIBA 1M5WA 4FR6A 4MOZA 2QULA 4HNOA 1VH7A 3O6YX 2JQXA 1K9TA 1S2TA 2Y5EA 4H7VA 4ZTYA 3L4WA 2DSZA 4CCDA 1VCVA 2DZPA 3OBKA 4XAYA 5I0DA 3W6MA 5C55A 1B4EA 1O94A 4L4OA 2ALDA 4DO7A 1MQRA 2NUYA 2CZDA 4L56A 4MWAC 1EA9C 1WAWA 2VXNA 1YBQA 4PMRA 3WQ8A 4GY0A 5AZ0A 1EX1A 2PODA 2I5GA 3NPWA 2EHHA 4IXXA 4GRSA 4ZSTA 4RE3A 2ZDSA 3KM8A 2DVUA 2EPMX 3GFXA 1ZHAA 2GGEA 3SY8A 3PNZA 4XD6A 1XL9A 1KD0A 3WNLA 4UQEA 1KO0A 1H62A 3KHDA 1H41A 1XLGA 2Y85A 3S3GA 1A5NC 3CYVA 5M17A 4QHRA 3W7GA 3WO8A 3MT1A 4GZEA 1WOBA 3WLKX 3R58A 4C6PA 1E5JA 4UOJA 4LC6A 5HULA 4M7TA 1GVFA 3PB0A 1ICSA 1NP2A 3REQB 1EA0A 3WLSA 5FF3A 4MZ1A 5HK4A 3AJ7A 2IXVA 2GQ8A 1ZSXA 3G6MA 1GOOA 5D33A 4PUNA 3MUY1 1H5VA 3AIQA 6TIMA 3EX2A 1KV5A 4GG9A 3ARRA 4RV3A 4Z1AA 4QCFA 1KRMA 3GXIA 3H12A 2REQA 3UZ5A 3UZXA 4KCTA 3L0KA 1W17A 3G1SA 2IPGA 3B06A 5H8UA 5AFDA 4LVGA 1IWPA 2XM2A 1BYBA 1MNZA 2YL6A 3H2NA 2ZIDA 3W27A 3HPZA 4QJ1A 3UA3A 1CIUA 1YHTA 4M5PA 4IQEA 3CWNA 2FDMA 3BARA 5A2AA 3URNA 3BANA 3REQA 1XDMA 1ADDA 4DJEA 4H00A 4TQTA 1WDPA 3ZOAA 5ECVA 1GOIA 2VI0A 3CIWA 4QG8A 4C6KA 4AAJA 1I60A 3T4CA 3N6HA 2FGBA 2B7NA 3CHVA 2QAFA 2PGEA 3UGVA 3LGGA 4W7WA 1J01A 3GDMA 3N4FA 1ONXA 2V5CA 4XAPA 1A50A 3DFQA 1S39A 2DZVA 1PX3A 2D20A 1CLXA 4Z2HA 4KT2A 1HP5A 1P48A 3NQAA 1A0EA 3GNDA 3B9EA 4GLEA 3G77A 3BL3A 5AC8A 1VYSX 2VZSA 3A13A 4JTGA 1KRAC 4GQQA 4UTIA 4NKCA 3L4VA 1JYVA 3NVTA 3T2QA 2WZEA 5JUVA 2HV5A 1H60A 2ZRWA 5C6MA 1B30A 1EYEA 1E71M 3ZMRA 1XLLA 1AJZA 4NZ3A 2PMQA 4QDPA 3E3HA 1XR2A 4UTWC 2WBGA 5U7SA 4IX0A 1TWWA 4CD7A 5AN7A 3ABRA 3U2OA 3ANVA 4N4PA 4KWWA 2VR4A 2YR1A 4YNGA 2DUAA 4FLQA 4HA3A 2CYGA 3MCNA 3EOOA 5EYWA 4HA1A 4Z42C 1G69A 1MEIA 1JG9A 1R3SA 1YE4A 4NJHA 3MHFA 4MWAD 1O95A 3T8QA 1XYMA 3L7RA 4IPLA 1EUAA 3K8MA 5T91A 2CPUA 3RNDA 3R1ZA 2VX5A 1F05A 4TV5A 5CPOA 2Q09A 4EKJA 1CLVA 1PKLA 2GOKA 1B0IA 2QLYA 2JE8A 1XRVA 3EA3A 4R7JA 4ZB0A 3UJSA 1RSCA 2HROA 2VD8A 2ATMA 2ZTJA 1TUFA 3IGSA 1UQYA 3FEQA 1K8XA 3G1AA 4EXAA 2V2CA 4JL1A 5DBTA 2PDIA 3W76A 3NEVA 1QW8A 4AZ7A 3ALFA 3VOGA 2VC9A 1QUMA 5FF0A 1GONA 5AHIA 3QC3A 3W7KA 1QPNA 1U83A 4RPQA 4Y8EA 2FQIA 4KS0A 3V5OA 5EY5A 3ECQA 4NX5A 5EA9A 4EPDC 5SWUA 2D24A 2EBNA 1TO3A 4IFKB 5I77A 1P6WA 3WBEA 1MQQA 1JZ2A 2ZOXA 3W01A 2YBUA 1CDGA 4JTRA 1I1WA 5F2IA 2WMFA 5GVJA 1A5BA 1FUYA 3WF1A 3NSNA 3LTPA 1W8GA 4RDWA 2JIWA 3UR8A 1X96A 1SJDA 4JTDA 4KH2A 3DXIA 2BG5A 9XIMA 3AHYA 5CC7A 1TE1A 5DQPA 1CPUA 2GUYA 4HYWA 3TYUA 3GE7A 4PRRA 1UWSA 2NV1A 4FNRA 2Z2UA 2YBTA 3CHEA 5G4EA 4B5UA 4W8LA 4PCFA 1NF0A 1E51A 2Z00A 4JBRA 3HPSA 1N8IA 3DG3A 4A6GA 3SCNA 3BLOA 2CITA 4IFKA 1CYGA 1A3XA 2RDWA 3NJ3A 4L65A 4MWAE 4HA0A 3I4EA 5E93A 3T44A 4O8AA 1LM1A 4MADA 1XPGA 3MTWA 2AKZA 1DJNA 4ZGYA 3FX4A 1WDRA 4ZENA 2TODA 1K03A 1OYAA 3RCNA 2GWNA 5HATA 1Q2RA 4JPGA 2JK2A 5GQBA 3S6OA 4DHGA 3LCHA 4FK9A 4PTXA 2Z1XA 3U5YA 1QI5A 1VQTA 4CU6A 5DMNA 2OO6A 1ZB5A 2HK0A 1OY0A 2GVGA 3JZEA 5LIYX 1OFRA 3VC6A 2DZXA 1UD5A 3QC0A 3TMQA 1V3IA 1XYFA 1QW7A 1MWOA 4JTFA 1W1IE 1Z7AA 4BJHA 3N2MA 4UMAA 2A6LA 3C3NA 1XLDA 2YCLB 1VFUA 1B3XA 1BSIA 4IIEA 4AZ6A 1DV7A 3H70A 2ZKMX 5DRCA 3W2NA 4LAKA 4X9SA 2DJLA 3U6WA 3BUVA 3M6DA 3WBAA 5ABHA 3CV2A 1F3WA 3AOFA 1UWRA 2CESA 3L66A 3FNDA 1ODUA 4TUFA 3QSRA 5HMDA 1W3LA 2FDSA 4Y8FA 2WHJA 3KZPA 4BQ2A 2B7OA 3ZLHA 3FVDA 3AC0A 1DQWA 5FJRA 3ZSTA 2NQ5A 5H8PA 3IACA 3F1QA 3LCXA 2WZMA 3VNYA 3RR4A 1OT2A 2A3LA 3XIMA 4ERAA 1OCNA 3LTSA 4RLIA 1RK6A 2YCLA 3WSUA 3KP1A 1KM3A 3NYDA 3M0VA 2XFYA 4FXJA 2F6KA 2V0TA 3WDPP 3DBNA 1RBAA 3VIHA 4N2YA 3CUHA 1HO4A 4JAWA 1O68A 4IFOA 4O10A 4XAGA 1M65A 1RAKA 1DE5A 1PB0A 4LSBA 5BRBA 3W37A 2OZ8A 3WLMA 4AY8A 1ZTVA 3WDIA 1L6SA 3WKZA 2PSNA 4O52A 1L6WA 4C7GA 3P82A 4TR9A 1NWSA 1ZJAA 3T42A 2J4GA 4QGCA 3SN0A 4ZVJA 2VP8A 1XC4A 1H7NA 1MZHA 3OVRA 1A0DA 3WQEA 3LCWA 3QMSA 4AXNA 1OADA 1GOWA 1W5MA 3C6CA 3LNPA 1CCWB 5BWFA 4Q7NA 3ES8A 4OECA 1TA3B 4E4UA 3QF0A 5K3VA 1DIOA 5T9CE 4GE8A 4K3ZA 1SFSA 4F0HA 1GZ1A 2G5WA 4WXYA 4XSMA 1RCQA 3ATYA 3TOYA 5LNSA 3VGBA 1XD1A 5EMLA 4XTDA 3UESA 1OG6A 3R79A 1K8CA 1S2AA 3O1NA 3EWDA 4R9OA 3DDMA 3NQMA 3VCNA 1HVXA 4S2BA 4P8VA 2Y1HA 4AZHA 4MSSA 2AQOA 4AB4A 3HV8A 1ZLPA 3PBYA 2BVDA 4AD3A 3STEA 5AHNA 5A8NA 3P2VA 4LALA 1F3XA 3TAOA 1HT6A 2CW6A 2J13A 5TF0A 4CQDA 1TPVA 3W7MA 2HRWA 2PTXA 3E38A 2CKSA 1NTHA 3ZJ6A 1OVDA 1HW6A 1A3HA 1OWQA 2WVSA 4Q6JA 1B9BA 4JHZA 1XW8A 2F2KA 1QNOA 2NT0A 3PBUA 3SEPA 4GVGA 3LCGA 5C2XA 3MDWA 2GZXA 2VEFA 4IUGA 5CLWA 2VURA 4HNNA 4PA8A 2OWCA 4HPXA 3IWPA 3DBPA 2ZC8A 3O6AA 2XGIA 3LD5A 3WL0A 4JTKA 4NNCA 1MRQA 1DWGM 3EKLA 2H90A 3KOZA 2PLMA 4BR1A 1ZFJA 4ATDA 4XKMA 3EMQA 4C6JA 5IFPA 3SCQA 3WD3A 3T0BA 3ONBA 5BMWA 4LWWA 1EGZA 1H1NA 3EDFA 4YTSA 1XCWA 2YXGA 3EWBX 2FTWA 3BQ5A 3PWGA 4Z2KA 1QDSA 2WJEA 2WHKA 1TCDA 1US0A 1XIHA 1PV8A 2QV4A 3OO2A 4QFUA 4AHOA 2C16A 3DKLA 3VFLA 2Y70A 3PN8A 4UFJA 4WXZA 1P5BA 1TE6A 1LL4A 1Y65A 4GYFA 1ICPA 1S5VA 2E5DA 2A3BA 1T8XA 4P2VA 1Z48A 3MY9A 3QV7A 3LU2A 3WK1A 3ZJKA 5KETA 3TVAA 3MUCA 1LWHA 1KA9F 2Q6ZA 2YJQA 4ECLA 4KWVA 3KL3A 2OODA 3QFEA 4CN1A 1J6PA 3WJZA 4LRSA 2YCJA 1RP8A 2ZRZA 3M5VA 3GUWA 4ZBCA 3JUGA 3BLKA 5IFTA 1FWEC 4WRHA 3AIWA 1TQXA 3W7IA 4ICCX 5DT7A 3FAWA 1TR1A 3CZGA 4I3GA 3USBA 1GZJA 1LRQA 4W86A 4WY0B 1QHPA 1ISZA 2ACQA 4O17A 2C8NA 3DFTA 3EKZA 2NQZA 4GNVA 3DYMA 4CU7A 3S9ZA 1A5AA 1F3TA 3FXGA 3U2ZA 1IWAA 3AS0A 1UD6A 2XIJA 3VE7A 4XQ6A 3FDGA 1ZBWA 2J79A 2O9RA 1KWGA 4XTIA 3PZGA 1ISVA 3GKAA 1IZJA 3TWAA 1MRAA 1GNXA 4PCPA 1WX0A 3KBJA 3GHSA 3KWXA 5CJNA 4IGMA 3LBMA 3W1MA 4ATWA 2A6NA 3RAOA 3W1XA 1ZJBA 1GGOA 4HSHA 2XH4A 3LTYA 3NZGA 3KHJA 4MWAA 3G1HA 4WY0A 1NFBA 2RGMA 3GXMA 1TREA 1PVNA 3H54A 1OF8A 3UR7A 1NQ6A 1DORA 1K6AA 3IGHX 1TPC1 3IJ8A 1G4EA 3IUHA 4D71A 2BHUA 2OGJA 6XIAA 3POHA 5HR7A 4MDOA 5HPCA 5A8GA 4UOQA 3PZQA 4M1BA 4L1WA 5HWMA 3OHMB 4EANA 3HFYA 4AIEA 3V7PA 3N73A 3RLUA 4IHCA 4UQ9A 8TIMA 2WVVA 3W86A 3AYVA 1A0CA 4TVDA 4JHOA 3CGTA 1O6IA 1V3JA 4Z17A 4K1GA 3HJZA 4Q4OA 2WV8A 3P6LA 4GUFA 1DJGA 3P74A 4Y96A 2J77A 1A4LA 4ZQOA 2V2DA 4H8VA 4QR6A 3IAPA 4Q6XA 1OJXA 3KRZA 5BCAA 4N7QA 4HB7A 5AYYA 3DHUA 3A64A 1HIZA 1FWHC 1VPYA 3UJ2A 2GGJA 4C65A 1JRBA 1OC6A 5ABGA 1W8SA 3E49A 1CT5A 1XS2A 2VKZG 4GO8A 3MDUA 4KWOA 2GGIA 3NZPA 1TWIA 4TMCA 1MUMA 3SCVA 5U4NA 4AVFA 3CPRA 4WKAA 5AYZA 2BODX 3KE0A 5FJJA 3A22A 3QR0A 4U5IA 1SGJA 4JTUA 3AALA 4YXGA 2C1GA 3EA1A 2X16A 4N9CA 3HJEA 4J7RA 1UD3A 2CXEA 4LYRA 3PAJA 2GDVA 4NAEB 1VIZA 1BYAA 1W3NA 2VZTA 2VGFA 2IUZA 4GNKB 2PDLA 2OT1A 3T0CA 3A21A 3PC0A 4FO4A 4UCFA 3MP3A 3UA4A 4LS0A 3BG5A 2VX6A 4WJXA 1PL9A 4IPIA 1K70A 5I09A 1J5SA 2CLHA 1BLIA 3VMOA 2RKXA 4MMWA 4XSLA 5I78A 3IK2A 1Q3NA 1TJRA 1DEDA 3V4BA 4BEQA 2VVSA 3CH0A 1GQJA 5CZSA 2ACSA 5A6KA 1SM9A 5CCZA 1VBGA 5BOEA 3F4NA 3FV9A 3IJ6A 3DFHA 3UP8A 1FHDA 3O6CA 1JGMA 2YXXA 4AG0A 1D2KA 2OQHA 3N19B 1NELA 1XXXA 4NAEA 1E1CA 3C86A 2EJAA 1Q4NX 1WP6A 3SDOA 5CGTA 1AW5A 2FTYA 5F4XA 4WGXA 1E0WA 4E2OA 1ME8A 5C7VA 3O0FA 5CAKA 5D30A 2PGRA 2BASA 4R27A 1TV8A 3CJPA 5HMFA 4UTWA 1HN1A 2FZ9A 3DFNA 3VGEA 1YPFA 4JYFA 2QJNA 3DGBA 2E5CA 4LXFA 3GK0A 3W7NA 7A3HA 4W5UA 3GU1A 4GJJA 3R8HA 1VD6A 3P67A 2XHYA 3QHOA 1GW1A 2Q3RA 1F2JA 3RF9A 3VNZA 5C5YA 3PZUA 2YDRA 3LG3A 4O1BA 3CQIA 3G0SA 3GRIA 4HTBA 1YNPA 4LUTA 4Q32A 1UG6A 1KGWA 3W2MA 3S6DA 4QCEA 2XVKA 3JVAA 3NPXA 1OFOA 2PDUA 1QWGA 5CPMA 1KW1A 3YPIA 1RCOB 5A3HA 5HNUA 3NQBA 3PJUA 1GHSA 3AZSA 2WKLA 4GQRA 3LRMA 3HGRA 2GJRA 1WE5A 2BXZA 1R3TA 4OBSA 4IL2A 3KTCA 1PDYA 2JF6A 7TIMA 3LHUA 2QAPA 1T96A 5C2GA 1SSDA 3NM3A 1E15A 3WNMA 3VGDA 3A4JA 4KFOA 3DGRA 3UETA 2ZYFA 4HTYA 4IJBA 1DJWA 3NWRA 3DFPA 3WLPA 1IT7A 1O7AA 4J3TA 5I3HA 2OTDA 3N04A 2O7SA 3N17A 4Q8WA 1IT0A 2D1ZA 2VGGA 1HF6A 4DF2A 2OYMA 4M80A 3W24A 3T05A 1RALA 5C71A 3D3AA 2XVPA 3H4WA 3MB9A 1ZBCA 1HFBA 1U33A 1GT8A 5FJUA 3K8LA 3UU0A 3Q4DA 1H09A 3W00A 1CNVA 4HD5A 2OOGA 3UXLA 3QYQA 1Z32X 1LQAA 3UQNA 3KP0A 3QOKA 1HUVA 1FXPA 4FXRA 3QKEA 1KM4A 1E6XM 3WEMA 4LYKA 3KS6A 2VL4A 1F6KA 1JYNA 3IGUA 3S9IA 2PZ0A 1UYQA 1DIDA 3RU8X 1W1ZA 3N6QA 1NDVA 3W75A 5B7YA 3WBWA 2VFHA 1PZ2A 1QJWA 3NZ1A 3MBFA 2UV8G 5I7GA 1B3OA 4OV9A 4FLRA 4CVUA 1GOQA 3QY7A 5K9DA 3QVQA 3WEZA 1TQJA 1KC7A 3VABA 3ABZA 4DVOA 1F4AA 5FEWA 2GJXB 4MF4A 2PWUA 2A3HA 4GIYA 2BXVA 3SCUA 2PP0A 3WLIA 2VCCA 3MZ2A 2CWXA 5I24A 1S38A 1F8MA 2DZAA 2R91A 3AZRA 3N3TA 3BO9A 2XFFA 4IP4A 2DT1A 2GSHA 2VDGA 1G5AA 4XZLX 5CSRA 3SSZA 2Z2BA 2E9MA 4UFIA 1Q8AA 1B3VA 2QW5A 4Q8NA 2D23A 2ISFA 3P0WA 3EZ4A 4UQBA 4DYEA 2YLAA 4ORIA 5CGMA 3SIZA 1P1MA 4ZOEA 1QBAA 1RXOB 1TPDA 5I23A 5AB3A 1GVRA 1W3TA 4L7ZA 5D4YA 3ZT6A 5D04C 2ZE0A 1VFOA 1XDJA 1BG4A 1OT1A 5HJXA 1G7UA 1GWJA 4Z2GA 1DWHM 2C14A 4REQB 2XFWA 1IGSA 1KQZA 2GJXA 1W2PA 2QNEA 1R46A 5BMXA 1J11A 1FKXA 2KAUC 3PJWA 4U10A 1DTNA 2O4MA 1BTCA 3C56A 3AHXA 4JQ4A 4S3GA 4XV0A 3VOIA 3P81A 5EFFA 1T7LA 3MSRA 4C90A 3IGXA 4G56A 1YX1A 4ZQCA 1MEWA 2J88A 2FVMA 3LV6A 5A1AA 1E6RA 3R43A 4J40A 3VKAA 4AF0B 3MO7A 1HL9A 5FEZA 1E72M 4AD4A 2D0GA 4IUOA 3BGGA 5BNKA 2YCEA 1XQLA 3VM5A 2E9LA 2X8RA 3AUJA 5LGXA 4IX2A 3PPFA 2Z26A 1XH1A 1OFEA 2PLKA 3ARTA 2HVMA 5HQEA 1XH2A 1E6SM 4REQA 4GY1A 2PCEA 3K8KA 2FPTA 4QITA 3LMYA 2ZZ2A 1EGMA 4GACA 2DIKA 2RAGA 3CUFA 1CW2A 3LN3A 2ATSA 3BOXA 2CC0A 1ZENA 1KTBA 3IUIA 3W3OA 1BVWA 3GC2A 4O18A 2PDJA 4RNJA 3UWYA 1KM5A 5AHFA 1UQZA 4EPEC 5D03A 5H8MA 2PDBA 1CGVA 3BWWA 2BGNE 3VIJA 4A3HA 4HHHA 3UEQA 4AF0A 1R30A 1J0IA 1W3HA 3QOMA 2X0SA 4DRSA 4DIAA 3GNRA 3APTA 1E0XA 2ZZ3A 3LM7A 4LCSA 4AQLA 3A3WA 3GXPA 1XYLA 4WSKA 1Q7MA 2IKIA 4PUMA 3GDLA 1HQTA 3GHRA 1V77A 3GDBA 2UY4A 1JXKA 3APYA 4PFMA 1KCZA 3CMFA 1AMYA 4KEMA 3SJ3A 1P0KA 3BW2A 1DJHA 2GUBA 3BE7A 1O5KA 3P62A 4LOCA 3TQPA 3MWAA 4XG1A 1IYXA 3B9NA 5AC5A 5K7JA 2VEMA 4DF0A 2VO5A 4HN8A 4NJIA 1UMYA 3GKFA 3UCQA 3LXAA 3BAXA 2VVNA 3V5CA 4PSRA 3MWCA 3HURA 1JF5A 5L9FA 4OJYA 1EF2A 3EDEA 3KCLA 2OQLA 1OFPA 4XO7A 5T8GA 2YLLA 3UW6A 2CLMA 1VENA 1G1YA 5G1TA 3H24A 4LU0A 4ZOAA 2C15A 1VZWA 5IHRA 3GVWA 2NQHA 1VYRA 4BWLC 4MB3A 1I6NA 5ABEA 2RJGA 3LDVA 3I6RA 1F07A 3TJLA 1V0NA 1IEQA 5LIUX 3BK0A 1VHNA 1ZZMA 1ALDA 3L4UA 2EO7A 3ZT7A 1F4HA 3KVJA 3ZIZA 4A2SA 4CUCA 3S9YA 4WOZA 1JRCA 2HNHA 4PMVA 3PWAA 5F2LA 2V67A 2I5QA 1JCXA 2PUZA 2A2IA 3TNOA 2E3ZA 3PZVA 4PRWA 4CNSA 4N6FA 1OK4A 2PGWA 3CPGA 1J6OA 1LRTA 3ZXWA 3EWZA 4B3ZA 1KWKA 2QF8A 2NX1A 1JQXA 3JS3A 2OCZA 1KB3A 3GTNA 4RUBA 4GIEA 1QWKA 2J62A 1EF3A 3FCPA 4CN6A 3EB2A 3A5VA 1BTMA 1REQB 1TRIA 3NNTA 2PC4A 4FZIA 4E4PA 1A5UA 4FXSA 3AQUA 1RZMA 4GXWA 1XIFA 3CTTA 5IDIA 1V7AA 1TB3A 4WEVX 1C9WA 3BW3A 3F7JA 2OVLA 4WY0F 3LK6A 3OIHA 5FACA 3R11A 7ODCA 5D37A 2E25A 3R0UA 4BCEA 1SU5A 4GH3A 5KZDA 2YL8A 3ENLA 4ILSA 2DH3A 1HKJA 2H8ZA 3GXTA 4PUEA 5LXXA 4S3FA 1P6BA 4AVNA 3ZFHA 1GJPA 3O07A 3NQCA 3OB8A 5CZKA 1BD0A 4HA4A 1V6WA 1UPMB 1G0CA 4RR4A 2VELA 1M7XA 2W66A 4XVDA 2YGYA 1X6NA 2VRQA 1T5AA 1OG0A 1KNWA 1XHGA 1REQA 2PWVA 3STGA 3BVJA 3G5EA 3BMWA 3QSTA 4HU3A 1E0UA 1XQKA 2DW7A 2OB3A 4ALDA 3LA4A 5G4WA 5I2UA 3OVPA 5I3DA 4CCEA 4GINA 3M0HA 3M16A 5E0FA 1XCFA 5A6MA 2YB4A 1QI3A 1EQPA 4FIQA 2PU1A 3INPA 1JIBA 1GEHA 3MP4A 2ZUMA 4MZYA 3CV1A 3RX2A 5HNTA 1TWDA 1C8QA 4OE7A 1QT1A 1E40A 1K6WA 3BJSA 1H5YA 4OUIA 3VM7A 4U31A 3TTYA 4XKYA 2AMXA 3JR2A 2E6YA 1UKQA 2YDQA 4CN4A 2V3FA 2E40A 2WSPA 4LVFA 2ZUWA 4RNIA 1E6NA 1C8XA 1TJ2A 3MC5A 7XIMA 2G50A 2PDPA 1GG0A 3VMPA 2PDCA 3TXZA 3K2GA 4YN5A 3KVKA 3CV6A 3UPBA 1E9IA 1DIEA 2X1UA 4HHLA 4NZJA 4D6IA 3BAIA 2ZWYA 4H3DA 3T07A 3LHVA 4HN4A 3W85A 4AYGA 4RW3A 3OOQA 4A3RA 2O4QA 2PI6A 4MB4A 3IRSA 4ZA0A 4K37A 4HPGA 1LDCA 4J2MA 5D9NA 3PUDA 1FCBA 1I2OA 2VUYA 4IICA 4RDVA 3VNIA 2VFGA 4PTMA 2BV9A 4J28A 4F79A 4XZ9A 2HVOA 2C3ZA 3VZYA 2J24A 2OSXA 2UY5A 4PH6A 3BAKA 3RN6A 4AH7A 1GVYA 4R9XA 1R86A 1V79A 3W25A 4LVBA 5BOOA 3W1UA 2WJZA 3KBNA 4IL0A 5CH9A 1ZS2A 2ZBTA 4ZO9A 1CGWA 3ZT5A 1I1XA 1VGAA 3FVMA 2Q8LA 4QE5A 4DF1A 2E5BA 2RHGA 1VR6A 4FS9A 4BS0A 4NSBA 1R3YA 1UA7A 3NTYA 3A5FA 1DWIM 2QVNA 4JDBA 1DKWA 2DW6A 3NSMA 1Z6KA 3SR7A 4UFLA 2Z28A 3SIMA 4N02A 1IXNA 2G3MA 1BXCA 3H23A 4A21A 3BGAA 4M3PA 2WJDA 1G7VA 3AI0A 2QIIA 1UB3A 5H91A 4K8EA 1XFBA 4YVXA 3DIPA 3GBDA 3THUA 3FJNA 3NO1A 1PKNA 3TA9A 4H9UA 1OK6A 4LX4A 5HNRA 2JGYA 3E5BA 5CSUA 3SGUA 4JZ5A 3BC9A 5J04A 1NARA 3AUOA 2C71A 3BURA 3B97A 3N4AA 3SO7A 5CBIA 4R7WA 4J3VA 3SQSA 2ALRA 1B5TA 2CU0A 2TMDA 2F84A 3SN4A 3MUXA 1JDDA 1L2QA 4BI7A 2HE5A 4D6GA 3R25A 3CASA 3PPCA 1UMLA 3NXLA 5D09A 5ABFB 3FGCB 4DJDC 3V1PA 1V6VA 1ZCOA 1FWFC 3PULA 3B3DA 3MJMA 3DFYA 3D0CA 3D3FA 3D46A 3BLFA 4ADTA 3GHUA 2MNRA 3OPSA 1DWAM 3QXBA 1LT7A 1WZLA 2PU0A 3LHZA 4Q3MA 1TTJA 1LZOA 3VZXA 3E96A 3BSGA 1I0BA 2J9ZA 1XYAA 4KF1A 4KKXA 3H2FA 1XG4A 3RO6A 1AH3A 2B4GA 2EPLX 4B16A 2ZA2A 1ECQA 3VUPA 2PRLA 4DZHA 3EAUA 3F4CA 1GKPA 1D3GA 4PUDA 3CL7A 1ME7A 2Z4GA 1YEYA 4LF1A 2QV5A 4PMJA 3QTPA 3TNBA 1E43A 4PB4A 1OX6A 5EMJA 4GKTA 3NDYA 3O7UA 5HUOA 3M4HA 3M0JA 1PCWA 5ABFA 3FGCA 2BLEA 2IXUA 3W7RA 3L4YA 1J10A 1LQ2A 3WQVA 3E0FA 4HYVA 2J7BA 5CC5A 1X38A 4EK7A 3GYEA 1FWNA 4ROPA 3VDAA 4RXGA 3IJQA 4ZCWA 2J78A 3E0IA 4KETA 1KFKA 1KV8A 1OINA 3BV7A 3HGJA 3CXOA 3UXIA 1VRXA 3I4KA 1L8NA 3MKKA 3C2FA 1QR7A 4GCAA 4H9TA 4I8YA 3QPZA 4FNPA 3DG7A 1W9DM 4UR8A 3VO0A 1SSGA 2B0MA 2V63A 2V3GA 2ABBA 1E5NA 3FJLA 2ONEA 2QUNA 1M7JA 3KS5A 2VOMA 2NLIA 2JIEA 4F2BA 1FWJC 4XBJA 4FNTA 1W5OA 3NDZA 2ZX5A 3OW1A 3NR0A 1ZBKA 4B5VA 1OFAA 4CCCA 4RNFA 5FESA 5I3IA 1K02A 2ISWA 3AS2A 3CZ8A 5AZ1A 4JXCA 1LLOA 4C5YA 4ZXOA 5F4WA 5F1VA 2CNCA 3M1ZA 1Y5VA 1JJKA 4QLLA 4IH3A 3TN3A 3AS1A 4DBEA 1RR2A 4C6QA 1VCGA 2VC5A 2EKCA 5A6JA 4IGHA 1TV4A 1G67A 4UXDA 3AYSA 4IQJA 1QTWA 3AISA 4A29A 2CHRA 4F2UA 3NL5A 3TX9A 1BVZA 2O0TA 1KM1A 2G3JA 4KRTA 3WLQA 1OABA 1TZ7A 3WD4A 1FCUA 4AZCB 3MU7A 3HPFA 1M68A 4XVEA 1LT8A 1RBOB 1BFNA 3S1WA 3RUBL 3V35A 4DLFA 1B1YA 1GYMA 1QU4A 3LPOA 3OGSA 1R38A 3KFTA 2BDQA 1W9UA 1GQIA 3WDQA 5A8OA 5A6BD 2RGLA 2E6FA 1FCVA 3COTA 3SJNA 1JR1A 5HNNA 4MFEA 4I6VA 2OR2A 2GJNA 3BAWA 4F0RA 3PNUA 2ZICA 3AS3A 1O4UA 3K1GA 1R8LA 4MG4A 1PYFA 1LOLA 5GJPA 4EP8C 1YXCA 2DUZA 4TTUA 4LAOA 3S47A 2YYUA 4J4KA 3CAWA 3DFOA 1IEWA 4JOMA 2VGBA 3T2OA 1JAKA 4BQ4A 3LLDA 3KRSA 4DJDD 4MY9A 1PZ1A 2XM1A 4JN6A 4CNOA 3MMTA 1QFEA 1JCTA 1J96A 4AIBA 4O8RA 5HANA 3CB8A 3L68A 4RL3A 1JCNA 5D2TA 1R3RA 3E1F1 4XB3A 1TG7A 5AC6A 3RMJA 3M7SA 5FF7A 1EDGA 4F0MA 1AH0A 2Q02A 2W6RA 4OV4A 1ESWA 5FL0A 3EXRA 1TFVA 1PKMA 3SRDA 1CECA 3R8GA 2JFEX 3WCZA 1L6YA 4DQWA 3WK2A 3NZQA 1RJRA 4N42A 1AQMA 4C5ZA 1HL8A 1KGUA 2VX4A 4XZMX 4DUVA 1CXIA 1XLIA 4A3UA 4E3TA 4GA8A 1OZMA 3UJFA 4TVUA 4TX8A 4IFRA 3ZS4A 3URBA 3SY1A 2FVLA 4O0QA 1GTEA 4W85A 1U22A 3C2EA 5C0QA 4EIVA 3HB9A 5I07A 2Y7GA 4M29A 4NI3A 3CB3A 3FAXA 1W54A 4CQ8A 1HJUA 3VD3A 2ZCGA 3NYZA 3P7YA 4E0CA 5F1UA 5LHEA 5DX7A 1WDQA 3VX0A 1PTDA 3TYEA 1C92A 1RA0A 4Y9NA 1PS9A 2QPSA 2WM1A 5FD0A 4RE2A 2AGTA 2QYGA 1XSKA 1XG3A 1XIMA 5E6YA 2HPMA 4PMZA 3MKVA 4HMCA 3OQ8A 2ZZ6A 2D0HA 1XUZA 3U7BA 3HG2A 5XIMA 4NQ1A 2EPKX 1TYGA 4I8DA 2PBGA 2NVAA 2AAMA 4UFKA 2A3CA 5K2ZA 2OSYA 5I3JA 2OELA 3KBMA 2VQTA 2YYTA 1L0PA 1PWMA 3DECA 3GG7A 3L4ZA 1E9ZB 4M6QA 3W7LA 1VBRA 3EB3A 4LAMA 3BJFA 4AHPA 2A5HA 3UWEA 4OOUA 5CC3A 1Z3NA 1BPLB 1TPEA 1W91A 2GPTA 1M3UA 3T2PA 1U5JA 3P80A 1S2VA 3PVFA 1JGIA 6CGTA 1ZUAX 2DFAA 4HJFA 3O06A 2AQWA 1YW1A 4X0VA 1OCJA 2DJXA 3W83A 3I65A 4GH1A 5IBXC 1XCXA 2ACRA 3CUZA 4LVAA 4LGXA 3IJLA 1MDLA 6PTDA 2WHMA 3AIRA 4PEEA 1BKSA 1CGUA 1EIBA 2W3ZA 3CK5A 1UUMA 3SADA 1G94A 1FFQA 4QAIA 3WLJA 2I56A 1CLKA 4B5WA 3VAVA 3PR2A 2DDXA 1LORA 3AFBA 4WD0A 1KM6A 1RQHA 3PUOA 4F8XA 4MY1A 2B7PA 5GJMA 4JEJA 1P0DA 2Q71A 2DT0A 3PZTA 4IOTA 4PC8A 3P60A 3GM8A 3AYTA 4CVWA 5J5RA 1OFDA 2QQ6A 1UR1A 4ZQNA 8XIAA 1ZNNA 3WMLA 3N2BA 3BAJA 4H9VA 1UC4A 3A3XA 3QQ0A 4DWSD 2V30A 3VPLA 3WMBA 1TV7A 3VD5A 3W9ZA 3U48A 4BWLA 1XYCA 4O28A 3CQ0A 2ZZ7A 3DI1A 4K2SA 2ZE3A 4HNVA 2J6XA 4FOUA 5TAOA 3WBYA 3FLUA 3ABXA 4IP7A 4UQDA 3CO8A 5FI8A 1ZP3A 3AICA 4BF5A 1FQ0A 4D6HA 1BGAA 2XINA 2QKFA 3HG5A 3O15A 4I5RA 4IQDA 4WSJA 5KZMA 4ADSA 3FA4A 1V3LA 5DY2A 3GR4A 4AEEA 1YE6A 4TTGA 2V5DA 1WB0A 1IR2A 3SRFA 4M8UA 1Y5XA 1H63A 4XZWA 3BV4A 4JTEA 3L0GA 4L9YA 4GC3A 2PLCA 4GYKA 4M1RA 5FEXA 4DXVA 1RLDA 3IEBA 4FAMA 3USZA 5LA0A 4RE4A 4JFSA 4O11A 5A8PA 6REQB 2Y89A 2ZX9A 2NXGA 3CAKA 3H4XA 4O57A 1Y0EA 4CEUC 4XD4A 3HG4A 4H6EA 2VTFA 3PWIA 2GVYA 3HGSA 1Q6GA 3ICJA 5K4ZA 3LSCA 3EEGA 4PMXA 4PUKA 3G1RA 4TX6A 2ZTKA 5CZJA 2OWXA 1WKYA 2AOSA 4S2CA 4PTWA 1DWFM 1PSCA 3TN5A 2BFGA 1W1PA 3WNKA 3CZEA 3VFCA 3EOLA 4R34A 2IQDA 3F4WA 1TX2A 3NM1A 4KESA 3RJYA 4BKNA 3KOYA 1ADOA 4LBRA 3WZ0E 4WK9A 3CT2A 1LF1A 4J3WA 1C90A 3IIPA 3SM0A 3OEXA 3MV01 3W1AA 2YSWA 1S46A 2GOUA 6REQA 3AXKA 4L4PA 3GTIA 1P7TB 2RDUA 3QY6A 2YL9A 4GABA 4E2BA 3LPPA 2FH6A 3TYBA 4HOZA 4MNJA 3TLLA 4NZ1A 1W2VA 4O54A 3KCOA 1YTEA 3QGAC 5EBAA 1D3CA 4PUUA 3W72A 1RLCL 3GVQA 4G1NA 4JN7A 4FR1A 1HJQA 2ZVRA 1W5QA 4P7RA 5BRPA 4Z08A 1BRLA 4GXMA 3ZZ1A 2QCNA 4L61A 4DPPA 4EPBC 2QJMA 2I57A 4KRZA 4TO8A 4I7UA 1IR1A 2DUXA 4UMBA 3BSMA 3PJTA 1IQ8A 3BJTA 1WZKA 3QH2A 1QNSA 1J4EA 3NOYA 3RRXA 4AHQA 1KTNA 3JW7A 3VI2A 2PURA 3S2CA 5H6HA 3EX4A 4DBWA 3UFYA 3MANA 2J66A 5JBFA 4JL2A 3BZGA 2BMBA 1M7PA 2P53A 3WQPA 2Y7FA 1RD6A 3R5EA 5T9BG 1QOQA 1QCWA 1M6JA 1R3WA 3A4AA 2HK1A 1W9VA 2NWSA 4Q8TA 2VZVA 3PZIA 3STPA 3PTKA 2WAGA 3W23A 3UPWA 1I8JA 2C1HA 4W5ZA 3PUEA 4ZTXA 2IKHA 2VD9A 4V27A 8RUCA 4X2PA 4KFNA 1XFCA 2L5HA 2V5KA 3SGZA 2DT3A 3TN6A 1XRTA 4HOXA 4BZYA 3BLIA 1E70M 2GDUA 3IUDA 1JPDX 1TVLA 3TW6A 2OMAA 3ARYA 1TSIA 3N9SA 1AD1A 1OX5A 1M7OA 3NUKA 3SCRA 1OBAA 4QIUA 4UTKA 2BNJA 1I2NA 2XVNA 3VD7A 2VT0A 3QJAA 1NOFA 5IM51 1E9LA 1KLYA 2QDHA 4PN2A 3NQ6A 3E0VA 5EPDA 3LPFA 4MYAA 3VCRA 2WSRA 3CQJA 3L9CA 2FH8A 1E56A 3C4UA 2BVTA 1EEPA 1ZU8A 1DWJM 4WQ6A 4LC8A 4KERA 1JULA 3L65A 4A8IA 4ONVA 3C8FA 1LLZA 3A4XA 2PRMA 2CLLA 2RH9A 1W9BM 3KEHA 3W0KA 4KIRA 5A6BA 1P1XA 4OHQA 4O1FA 3WUGA 3ABOA 2QCMA 4NY2A 4ZB2A 2PDQA 1RJQA 2JEQA 2X0YA 1LTDA 1GQLA 5DANA 2PCQA 4M24A 4KCUA 1FHUA 3H7VA 4A4AA 3W07A 4KMQA 5F4SA 4AFYA 4S3EA 5HR6A 4YCPA 2DZSA 5A69A 4FF5A 4KEVA 3PB2A 3GNPA 3HIJA 3F2CA 3KX6A 2WXDM 5AHEA 4ZO8A 1KM0A 3GTXA 1UZ1A 3R94A 4C6FA 4IMDA 4QX4A 5DBUA 2YA2A 2CLKA 4C6LA 5C54A 3NSXA 1PHWA 2QMJA 5JH1A 3PS7A 4MNKA 3SFWA 1HVQA 2OLHA 3TSDA 1XI3A 3IJIA 3C61A 3M5YA 4YYFA 4GZ7A 2W61A 4KQNA 1PXGA 2WLZA 5ABTA 4B2DD 4UTJA 4WDXA 3MMDA 3S5SA 4H6KA 4S3DA 4DJDA 2EAWA 4H2HA 1J12A 1EX5A 1VAHA 4IIGA 1TWZA 3A24A 4MVAA 5I6SA 1ZP4A 4LUIA 3OLGA 4UWMA 4C6IA 3GQYA 3M5ZA 4NJKA 1KXQA 1YYAA 3FYOA 4G7EA 1GQKA 4PBFA 2HBXA 4AD0A 4DELA 3FSUA 3Q58A 3VIPA 2QJJA 2NX9A 1CGYA 3NPUA 4LB4A 4F40A 3VD9A 1BGGA 3VIMA 2W91A 1PTGA 1E0TA 1PE1A 3SB0A 3CH9A 1QNRA 3T1GA 4W89A 3WLNA 4AW7A 4JYEA 1W1YA 5MF5A 1HGWA 4Q4MA 1KRCC 2O9TA 3O3RA 3WELA 5FF4A 3WH6A 2HISA 3LENA 2INZA 1VKFA 5A6SA 2W63A 1UBPC 3W73A 4LNYA 1Q6OA 3CC1A 4IQLA 2ODOA 1L9WA 3LY0A 3P0XA 5D9PA 5TBOA 4WUIA 5CBJA 1YPXA 3V36A 3B0VC 2E67A 2P88A 5FJPA 3RRAA 5GNXA 1ISYA 3W2KA 3GVVA 3EOSA 5DXXA 2A3AA 1MFUA 2CLFA 4LAZA 2XYLA 4ML4A 3VNLA 1UW9A 2VCAA 3C2VA 3DYOA 2X2YA 3AWNA 2FHFA 4L1XA 3MA8A 3DERA 3CUGA 4PL2A 3GU9A 3MVTA 1KLZA 4C60A 1BQCA 3V0UA 2ZUVA 5A2BA 4PMUA 3W1PA 3WN6A 5KSWA 1VLWA 1FBAA 1OB0A 3VU2A 3L2LA 2REQB 2W79A 3HTWA 4KGLA 2DT2A 3SCOA 4IMGA 3UWVA 1NFPA 3STCA 4DXXA 4ENLA 1VEOA 2X1RA 2QJGA 4YMZA 1XLCA 1FHVA 3E74A 3ANUA 4I6KA 2XZ9A 5TNVA 4L6OA 4KWUA 2D2JA 2WC7A 3A6OA 4O19A 1VFSA 5HUPA 3ID7A 3M41A 4L9XA 5CQ1A 4CNNA 3CAQA 2OG9A 1WQ5A 3PPHA 2JKPA 4KWSA 5IDZA 3OODA 3DC0A 4HU8A 4PTDA 4H9ZA 4S1FA 3RPDA 3RX3A 3NQFA 3NO3A 4XAZA 3NEHA 4UBPC 1LBMA 3B04A 1FWCC 2R1KA 2CERA 1MFVA 3MHUA 3G18A 4WJEA 1FP8A 4K38A 4ZODA 3WG6A 5IXEA 1R87A 5D05A 2BWGA 4NZ5A 1V08A 2FZ8A 3FEMA 4PRTA 3T81A 4UTHA 3W7QA 3A4WA 1EC7A 4Q8MA 4G6CA 1AW2A 5FA5A 2XIMA 2QDGA 2HNEA 3E0LA 2OOFA 4NI8A 4ZO6A 3SUTA 2O92A 2MANA 3UERA 5C9UA 2X7VA 3NA8A 1FY6A 2WPBA 5HBFA 3DU0A 3O63A 1CWYA 3SRHA 2PDHA 1Q8JA 1RBLA 3ZO9A 4P7QA 3CM4A 1N55A 3GYCA 3NDOA 6ALDA 1YMYA 3ITLA 2R82A 3HQ1A 1NY1A 2R1LA 4GX9A 1VFHA 3N2CA 3SUSA 4O1AA 1H7PA 3FYPA 1T8QA 4C7DA 1QOPA 2PWEA 1UR8A 1U1UA 2ZQ0A 4WLCA 5HMSA 3RYSA 1JPIA 3SUWA 1N82A 2BB0A 3VK5A 3O05A 2FTPA 5CXPA 4YTTA 1RQBA 1E4MM 5JBDA 4HMDA 2NV2A 1F5ZA 2AGKA 4IGNA 1ZPTA 1HKVA 2C19A 2ZX7A 1PWLA 1A4MA 1W0MA 4FNUA 4RZ6A 4XZNX 3S5OA 3TTQA 1VPXA 2GQ9A 3H2AA 1QHOA 2WQPA 2YL5A 3ZSSA 4D6EA 3FXYA 4OZOA 1J5TA 4MKSA 4H8HA 3K4AA 2BY1A 4AVOA 4HPHA 2IS7A 2OLSA 2C18A 2VDHA 4F48A 4Z2JA 1P43A 2D3LA 3B9OA 3PANA 1IZCA 3PG8A 3DCPA 2EG7A 1ODZA 1RPKA 2Z24A 4Z2IA 4R3UA 3TJ4A 1VYPX 2G0WA 3KUMA 2Z1BA 3WFAA 3ARUA 2Z25A 3E5PA 4RZBA 3VIOA 1LRNA 2XU2A 2FZNA 1GEQA 2UY3A 1R9XA 3XINA 5IHSA 1UKPA 5IRPA 3DEQA 3NGJA 4HNLA 4GK8A 3TYAA 1S1RA 4YYCA 1S2UA 1TPB1 3ZVIA 2HXTA 1EO5A 3GDKA 4HU4A 3AHVA 4FNSA 2XDFA 5CSSA 5IBXA 2YKKA 4FA3A 3LHWA 2Y4SA 3UY7A 2B81A 3J7HA 4NT0A 2IPJA 4H01A 3PSWA 1AMKA 3CEPA 4ZZ9A 3WJWA 2I1OA 4E3VA 4C6MA 3A23A 5BRQA 2ZA1A 3QEZA 1QASA 3H2MA 3M47A 2J27A 2CBIA 2ESCA 3BLEA 3PTQA 5G4HC 3H53A 2EPOA 2Q8ZA 4GISA 2XIBA 4BY3A 3S1VA 1C93A 4FB7A 1I2RA 1YDVA 1JD9A 1K9DA 4HSNA 5E0CA 1DHKA 1OC7A 2WC4A 1SW7A 4FX8A 4UTUA 1IV8A 2CHNA 4C7FA 2IKJA 3C0SA 1SFLA 1M1BA 4BF7A 3W1QA 5XIAA 2NLYA 2WZIA 1EZWA 3B8DA 3UGRA 1RH9A 3EOUA 3WF2A 3BOLA 3NOEA 4WX2A 3H26A 1TIMA 3W7JA 1F76A 1YIXA 3D6NA 4UTMA 3U7VA 5LSMA 2FPYA 3NG3A 3LPGA 1JYXA 2QCDA 3N6JA 1I2QA 2LLEA 3LRKA 4QDWA 3H7UA 3BCJA 3EB4A 3QPYA 5G1MA 2HBVA 2F9RA 1BVNP 3M0ZA 2BHYA 4NXKA 1SW3A 3NQ2A 3BZJA 3V75A 3TEVA 4H9MA 3UZJA 3NVDA 3ORWA 1TCMA 1UA3A 3N2OA 4D9PA 1DVJA 2PTZA 3WH7A 4HK7A 1KCXA 3GLCA 4K36A 4DJFD 1D3HA 2E1DA 2WZHA 1PZ3A 1DOSA 3AJXA 1AG1O 1Q6DA 3L2IA 2NVDA 4JR5A 2HWGA 3IJDA 4Q4QA 4OIFA 4Z1CA 4DWDA 1XLAA 4JIEA 3GSMA 1Z9AA 5BU6A 4C1LA 4DY1A 1IXPA 1LCOA 1NOWA 2QUUA 1EH9A 4CD8A 3V3WA 4MIMA 4B5SA 3RLVA 3AU2A 3LNMA 3KOWA 3RG6A 1OQFA 2QCHA 1R3VA 3RDKA 3TYDA 5DLCA 3EDKA 1G4PA 2QPXA 3ZM8A 1Z42A 2OYKA 1XBYA 1DPMA 3W22A 2F2HA 1EQCA 1FDJA 3CUXA 2XWEA 2TRSA 1R2SA 3I3DA 2E0PA 3AXIA 5K9XA 5LNRA 2WNWA 3T0AA 4AY7A 2PF8A 3WQDA 7REQB 4JGDA 3MCOA 3TW7A 1ENUA 2E68A 2JGQA 3IJ9A 4I9TA 4JKKA 3MBDA 3FA5A 3C0JA 4E8GA 4HP5A 5FSEC 1MXDA 3CHCA 4IMEA 2YB1A 5FJOA 1FH9A 2PDMA 4GJIA 4JN8A 1AVAA 5F2MA 4Q8OA 1CGXA 5MKGB 1US3A 4ZEPA 4JIPA 5JIPA 1M04A 3QKZA 4ZOBA 3QGVA 1VRDA 2J7DA 1JFHA 2G96A 2GDQA 2YW4A 4MTVA 4CLMA 5E0KA 3N11A 1EP1A 3W88A 1ITCA 1HKWA 2DZUA 3VOCA 4DAIA 4ASTA 3PTMA 4ACZB 7REQA 3MJYA 3Q65A 2YX0A 3TSMA 5REQB 4L6DA 2ACUA 1S5TA 3QHNA 2ZZ4A 5M3WA 3U2EA 5A5WA 4V15A 3CL6A 2WJFA 3RLHA 3TJIA 2R8WA 2O7QA 4PYSA 2A7RA 3BLDA 1M9HA 1FTXA 4I7VA 5MKGA 3WJYA 4HCDA 1QW9A