2QJHA

M. jannaschii adh synthase covalently bound to dihydroxyacetone phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 88
structure length 264
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjhA00
3ATYA 4N9CA 3QYQA 4UUIA 3B05A 3C4UA 3O6YX 1H7OA 1QOQA 1TSIA 1NFBA 1FWSA 2C15A 4QIUA 1MEIA 1JRCA 4OWGA 1F6PA 1SZFA 1ZNNA 1UB3A 3EWBX 3NEVA 3S1UA 5ABTA 1QPRA 2C13A 4M6PA 3A5FA 3T7VA 1ME7A 2EHHA 3PUEA 5D2VA 4TIMA 3LHYA 4LOCA 3S5NA 1ZCOA 3CEUA 4NT0A 1GVFA 5AC8A 4A3UA 2PRHA 3NQCA 1AL7A 3I68A 1TPFA 1T96A 3W75A 4IX0A 1TQJA 3IVSA 3M44A 1L6WA 2O7SA 3F4NA 3FIGA 3NL5A 3TJXA 4MZ8A 3CTLA 2GVJA 1T8XA 4JTLA 3O06A 1RQHA 3E0IA 3CM4A 1XBYA 5DXYA 2Y62A 3UWWA 5I3KA 5C54A 2R94A 3FLUA 3MBDA 3PG9A 4CQAA 4BWLA 4A2RA 2VC6A 4JS3A 4NX0A 5F2LA 2R8WA 3GIYA 5AFDA 1O5KA 2BTMA 2PRMA 4LC6A 3LHTA 4OU1A 3A5VA 3EX3A 1HG3A 2WPBA 4UMAA 3B0PA 1J4EA 2E6FA 1FY6A 4RV8A 1LZOA 1ME9A 4CCEA 3DHFA 4HKPA 4CQ8A 5SWUA 2NV2A 3SZ8A 3FJLA 2H3DA 4ML9A 4AEOA 1H7XA 2C6QA 3HGOA 1DV7A 1YDVA 2WNNA 3S0CA 5AN7A 3THAA 1R47A 3W7LA 5K7JA 1PIIA 1SO4A 3HJZA 3NM1A 2ZRXA 3KVLA 1FWWA 4ZQPA 4HPXA 1S3HA 1GZGA 2J27A 1F7BA 1DORA 2QAPA 3LTYA 1W54A 4ZQOA 1CW2A 3NL3A 1BEUA 3OVRA 3LXAA 2A6NA 4PEKA 2QCHA 3H53A 1Q6OA 3HF3A 6TIMA 4WUIA 5KZMA 5EL1A 1AG1O 1KFCA 3OBKA 1FDYA 3HMJG 1TV8A 3QEZA 1EPXA 4AHPA 1Z42A 4Y9AA 4NUWA 3P5YA 2ZZ7A 1R2RA 4FB7A 2ZZ2A 4DO4A 2X2GA 4LS0A 1LOQA 1FCQA 1H7PA 3DFQA 3DKJA 1H51A 1JR1A 3UWUA 4JYEA 1H7NA 5C55A 2Y7GA 3MYPA 3W1NA 1OYCA 3DGRA 3V75A 4O18A 3TK7A 2XN1A 3KVJA 3W84A 5LNVA 3DAQA 1X6UA 3WFAA 3T40A 2RDWA 2AAMA 3LBCA 2VFIA 5LSMA 8TIMA 4O17A 1B57A 2E1DA 3NQFA 1B3OA 3WJSA 1PHQA 4H6KA 2ZTJA 3W2MA 4MY9A 1IXNA 3G1DA 3W7PA 4GUIA 1G7VA 4IMEA 1RPXA 1W3TA 4UFJA 3EX2A 1F76A 5E1QA 3EXSA 1FBAA 1CI1A 1KM2A 1OFOA 2NZLA 2E5BA 3W7NA 1M7PA 3BGJA 1TV7A 3GB6A 3TE9A 3O6DA 1TPDA 1W0MA 2YZRA 3GX9A 3NDOA 4TMCA 2BX7A 2A1YA 1Q6RA 3KXQA 4ONVA 3IIVA 4FX7A 1LROA 1NEYA 3HOJA 3L0GA 5D33A 2E5DA 3VNDA 5D2XA 4Q32A 3PBVA 1O60A 1KV8A 2ZRUA 1K3UA 2P10A 2NUWA 5H91A 3PS7A 3N19B 1OF8A 3W1RA 3S9YA 1UJPA 3ABOA 1WAUA 1AMKA 5HWJA 2XN0A 3JS3A 5L9FA 3LXCA 3S5YA 3HGJA 3QSRA 4A21A 3TDFA 5DBUA 3M6YA 1R2TA 2YDAA 2FTPA 1PVNA 1UASA 3G8EA 2YPIA 3EWZA 4UTTA 3PBUA 2Y85A 4FNUA 3S5OA 4TMBA 3GVGA 5AHMA 2QDHA 4IJBA 5CG7A 3P74A 4LUIA 4LVFA 5KINA 1L6YA 2QCLA 3EKLA 5D2WA 5LNRA 5EBUA 5F1VA 3S42A 1TRIA 1ALDA 5IBXA 1SU5A 3LCIA 1M7OA 5HR6A 2CLHA 2QJHA 3LXBA 4WY0B 4N9EA 4JTGA 3STEA 3SFKA 5I3GA 3L65A 2Q3OA 2NX1A 1KM3A 1VR6A 4MFDA 2H90A 4GUGA 1BWKA 2E6AA 3Q58A 3W2NA 3S1WA 3LHWA 3O16A 4N6EA 4WOZA 1Q6QA 3W71A 4QAIA 1A5SA 1UCWA 1IF2A 3W7EA 1O95A 4RX0A 3M16A 2QCNA 2RHGA 1XCFA 2ZQ0A 4HHPA 1Z41A 1ZFJA 5FF2A 4JTEA 4S1FA 3O1NA 1FDJA 5KSWA 4O14A 1H7WA 1TB3A 3NQ7A 3O07A 5G2HA 4JTTA 3W1UA 2WJZA 5LNWA 1JULA 4C1LA 5LHEA 1RR2A 2VELA 3L66A 1H60A 3LCFA 1VCVA 2ZRZA 1B4KA 3HPSA 3DENA 4LUJA 1SR9A 4WY0A 3W7IA 3AO0A 2YSWA 2FLIA 3MHFA 3C8FA 3U8GA 4HNTA 5CPOA 4JICA 4UTUA 5D03A 3LLDA 5F2GA 5LZLA 3A9IA 1JUBA 3W07A 1DQXA 1QPNA 2O7QA 1SFJA 2VFGA 5F4XA 1GT8A 1OVDA 1LYXA 3W1PA 3W7DA 3KHJA 2RDUA 3PUOA 2E5CA 4BI5A 1KTCA 1K8YA 2FIQA 3MP5A 1EA0A 3PC0A 4N4QA 2PCQA 2C3ZA 2C14A 2ISSA 2LLEA 3G1AA 5LGZA 4IMDA 1W5MA 5CGQA 4YXGA 3SGZA 4K6AA 3STFA 4DBEA 5L6UA 3DKLA 1WBHA 4FNQA 4R7JA 2QCMA 1W37A 3EWYA 2VFEA 3LV6A 5FF0A 1TPUA 1VC4A 4UNLA 1EUAA 4GC4A 5FEZA 1NAL1 5F1UA 3WJZA 1BKSA 4JX6A 3TJLA 4N4PA 2GQ9A 2CLKA 3UXAA 1FCBA 3CWNA 1G69A 1W1ZA 2A2IA 3IGUA 2ZA2A 2NUXA 3TQVA 3V1PA 5D32A 4AHOA 1LLZA 4JDYA 4PCFA 3O6CA 4NJHA 4NNAA 2GQAA 4KFNA 5HINA 1SW3A 2V2HA 2TMDA 2BSLA 4ZMGA 3W7CA 1JCNA 1HL2A 1EWDA 2NWSA 1T0OA 3W2LA 4ZL1A 4P2VA 2ZA1A 3QFEA 3TC6A 1H61A 1HUVA 1VPXA 3PULA 4O8RA 2OJPA 2YX0A 1GVOA 2A7RA 4FHAA 3LCHA 3OVQA 2VOMA 2V2CA 5F2IA 4ZZ9A 2CZDA 1TPB1 3IVTA 4L4LA 5LHFA 5I3JA 2CLOA 1YXDA 4B5NA 1QNVA 3KX6A 3RLVA 3NZRA 4EF9A 3W76A 3M5VA 4FO4A 3B0VC 5BMWA 2VENA 4PL1A 2FJKA 2QCFA 1TTIA 1OFQA 1FWNA 1KM5A 1KM1A 2EPHA 1YTDA 5J5RA 4U28A 4AH7A 1W8SA 2VEKA 3EWUA 1KM4A 4K8EA 4OE7A 3VCRA 1UUMA 3NQEA 4I7UA 5D30A 3EWWA 3TFXA 2E6YA 4JYFA 1F6KA 1M5WA 3B03A 4MYXA 4BI6A 6ALDA 2WO5A 4LTSA 4AVFA 5MHBA 2WSYA 3DHDA 1EX5A 2WQPA 3TCEA 3PY2A 3OHIA 3BG9A 5HQEA 2ABBA 4TR9A 3SECA 4NZFA 3DZ1A 4CCCA 3STGA 1K7XA 2X1RA 4LT9A 2ZTKA 5AYYA 4NXKA 1LRQA 1JQXA 4JY8A 1GYNA 1KTBA 1QCWA 2WSQA 1P4CA 1V5XA 3MJYA 5BW6A 1QO5A 3TAKA 4NNBA 5FF4A 5LGXA 3T55A 1TTQA 2AGKA 3M7WA 2WNZA 2JKEA 3CIXA 1A5CA 1LBMA 4N6FA 3WK0A 2DZVA 4AHQA 2QF7A 3P8JA 1P1XA 5EY5A 3G1HA 1WOAA 4RJEA 5CZTA 2QCDB 2FPTA 4OBTA 5CPMA 1P0KA 4JN6A 4L4MA 3SI9A 5HNRA 4Z1BA 2QCCA 2J9YA 5I3IA 4KFPA 1FQ0A 3KOFA 5F2MA 3BW2A 2CZFA 2FB2A 3W87A 3OG3A 3MWAA 4DPQA 2V5LA 2WOQA 2HSAA 4AXKA 2ZA3A 1ZY9A 3TNOA 3T78A 3QM3A 1SO3A 3RF9A 1P5BA 4UMBA 4ALDA 2ZFAA 1WXJA 3B4UA 2CLMA 2RH9A 2VFFA 1F05A 2X1TA 1KTNA 2CLLA 3M5ZA 3ZFHA 3RMJA 3P8IA 4TU1A 4EOUA 4GBUA 2GQ8A 3NM3A 4UFLA 1L2UA 3NOEA 1C9DA 3B8DA 4M6VA 3G1XA 3L0NA 1OFEA 3QMSA 5BRBA 5G1TA 4IQLA 1TTJA 4JNMA 4MFEA 1RD5A 1MXSA 4WD0A 4E0CA 4N02A 3C6CA 4H3DA 4GUJA 3DFNA 1I2PA 3G0XA 2TRSA 2Y88A 3LTSA 3S8HA 3NGJA 3CB8A 3N9RA 1GG1A 4RKAA 1TTPA 4W9TA 3N14A 2Y70A 3PB0A 1QR7A 1WYIA 2QCDA 3CPRA 4WX2A 2V81A 4BI7A 3NYZA 1AK5A 4DPPA 3L2IA 4PTNA 3EX6A 1VYRA 2QJGA 4XKYB 3M5XA 1G6CA 3TC7A 2H8XA 1A53A 5G2IA 5D38A 4O4WA 4GNJA 3NQVA 1PCKA 3NQDA 3U6WA 4M7TA 2V5BA 5AHEA 3D0CA 5DCEA 4LC8A 1D9EA 3H55A 4RZ4A 3L67A 1TRDA 3P61A 1KM0A 1XBZA 1W5NA 3Q37A 4UMCA 3W7GA 3OA3A 4MJMA 3BK0A 4CNPA 1MEWA 3LTPA 4QM1A 3ZWTA 5AC7A 3NQ6A 3B0UX 1G7UA 3NZ1A 5DY3A 4LW7A 4WZHA 3QRHA 4CNOA 1OFDA 3QJAA 3W85A 3HGRA 3CLMA 5I3HA 3LGEA 1VHCA 1N7KA 1EB3A 2W79A 2H8ZA 4A2SA 4LWWA 3FOKA 2D73A 3S5ZA 4NQ1A 1TPEA 3RLUA 2CZ5A 3W86A 2Z6JA 1X1OA 5GVJA 4JDBA 3INPA 4MIMA 1IIGA 2Z1BA 3C2RA 1GVQA 4K37A 1MO0A 2V30A 2WNQA 4AWSA 1OG0A 4XUGA 4PODA 4E2DA 1JRBA 4MLRA 2C0AA 4XKYA 5EA9A 2ISWA 5U7SA 5FEXA 2FPYA 4E2BA 2VKZG 1VYSX 1HO1A 3WK3A 3WK1A 3GK0A 3CHVA 4FIRA 3FJ6A 3PF3A 5CSSA 1QOPA 3STCA 5EMUA 4HT3A 3R12A 4FNSA 4ZQCA 4KKXA 4QISA 1SPQA 1A50A 1GQNA 1LBLA 5TIMA 3NR0A 1WOBA 1O94A 3T4CA 4UFMA 1H63A 1PL9A 2YW3A 3MBFA 3N9SA 5CKSA 1DOSA 4I7VA 1DKWA 2VEMA 4Z0SA 1M6JA 3GDRA 1NSJA 5DY2A 3ATZA 3I65A 4H4IA 3U2OA 4O57A 3CQ0A 2NLIA 1J5TA 4CNNA 4NX5A 1YPFA 1LRTA 1RV8A 3M43A 2DZUA 4DO6A 3MO7A 2ZDRA 3MYOA 1NVMA 5AC6A 3E9AA 2DZTA 1TQXA 4JX5A 3HIJA 3QPZA 2OCZA 2CFFA 5D05A 3G1SA 4EWND 1DHPA 5EPDA 3NL2A 3NPUA 3NPWA 3W1AA 1RQBA 3M9YA 3FYOA 3VE7A 2BXVA 1LM1A 3TAOA 2ZYFA 4DELA 3MHUA 1C29A 3ANYA 5D37A 3TIMA 4OV9A 3NA8A 1G4PA 4K38A 3C2VA 4AWUA 3LI1A 1F73A 1AW5A 3L5AA 3TROA 4M7SA 5C2XA 3R13A 2A4AA 3USBA 3LHUA 2IQTA 4O28A 4WOQA 1FCVA 1OK4A 4ZQNA 3VE9A 2VEIA 3G1YA 3TMQA 2DZSA 2WV8A 3PG8A 4MVAA 3CEPA 1LRNA 5FEPA 2A5HA 3CU2A 2I9EA 3W2KA 1VGAA 3ABQA 3T44A 3R2GA 5DLCA 1KFLA 1LBFA 3HBLA 3GAYA 3KRUA 2I1OA 1DL3A 4GRSA 5KZDA 4ADSA 5EKYA 4LY8A 5E93A 1TJRA 4RR4A 3EKZA 3DBPA 1K8ZA 3G0SA 4UR7A 1I2OA 2QUUA 3OVPA 3LB0A 2YCEA 3O63A 4Y90A 3NVTA 3UYCA 1N55A 4JTIA 2QAFA 5CSRA 3ZR4A 1QAPA 4NVTA 3QC3A 1KFBA 3TQKA 1BWLA 1K02A 1JVNA 5CZ0A 1GVRA 4IOTA 3IIPA 3N3MA 3M1ZA 3NQ8A 3I7SA 4XWUA 2Q8LA 2G96A 3IV3A 2ZBTA 3UZJA 1P0NA 5FEWA 2EF9A 3DH7A 4X22A 4IX2A 3UPBA 4Y6GA 1VH7A 3M41A 1W56A 1EIXA 4ZQMA 1TCDA 4OHQA 4UCGA 4MZ1A 3W23A 1W31A 4RCXA 4JIPA 1OHLA 1U5JA 1Z48A 4UFKA 3SW6A 2OZ0A 4UTMA 4Y8FA 3GDKA 1G67A 3O8AA 4ZQRA 2DZXA 2NXIA 4RK8A 1T99A 3A22A 2Y7FA 3IGSA 1H7RA 2RFGA 4MY1A 3UXDA 4LV9A 3W7MA 3TH6A 3TR2A 1EP2A 1GTEA 1Y0EA 1TO3A 2HTMA 3THQA 2VFDA 3NQ2A 5AYXA 1D3GA 3RFAA 4HNUA 2DP3A 4FIQA 2JGQA 4IPIA 3HPZA 3BLFA 4JTSA 1GTHA 1O5XA 1ZHAA 2Z0IA 4LS2A 2F84A 2NX9A 3C2FA 2XFWA 2ATMA 3MHGA 4FX8A 1DVJA 4AAJA 3UWVA 4AB4A 3DFSA 7TIMA 1OABA 1N8FA 2ZRYA 5TQLA 4YCPA 3GDLA 1I2QA 1GEQA 4NNCA 3FYPA 4K7VA 4DXVA 3NL6A 1JCJA 2JBMA 4JTJA 3MP3A 4EIVA 1K03A 3BLEA 1QO2A 3C2OA 1LDCA 1ML1A 4DF0A 2Y7EA 4AF0B 4Z1DA 5A8GA 5J5DA 1SW0A 4XTDA 2Q8ZA 2FQIA 4FNTA 5DCDA 1X7FA 4PC8A 4MZYA 1VZWA 1XXXA 4WXYA 2Y61A 2GJNA 5G4EA 1AW1A 3F4WA 2V0TA 4NJIA 5IM51 3QMRA 4LU0A 1XDMA 2CW6A 4O1DA 1X1ZA 4X3ZA 3JRKA 1LLWA 4HSNA 3ABSA 3LLFA 5U4NA 2G95A 3MI3A 5BMXA 1TV5A 4MLJA 4HPJA 2ATSA 2EKCA 3TU9A 3LRKA 3HG2A 2CZEA 1YYAA 4WXZA 2NWRA 2QUTA 1S5TA 1I8JA 1KFJA 1THFD 4KWWA 3W7HA 2QUVA 1KLYA 3DI0A 3FKRA 3OIXA 1SO5A 2GVGA 1FWTA 2DU2A 1HO4A 3QQ1A 3MI6A 2WSRA 4ICNA 4HN4A 1ONRA 3GNNA 4NJKA 3N2MA 3H54A 4O0KA 1UUOA 4O1AA 5AYZA 3G22A 3MW7A 4JXCA 4Y96A 3C2EA 4FNRA 1F2JA 1VCFA 2A21A 3A23A 2B7QA 5K9CA 3C61A 3KVKA 1YDNA 2A6LA 3WJXA 1VCGA 5KZEA 3BARA 4Q4KA 4AF0A 1VYPX 3HO8A 2ZZ6A 3RU6A 1QPQA 3W7JA 5K4XA 3PBWA 1NF7A 2EGZA 1SFLA 2FPVA 1F5ZA 1H1YA 1PV8A 2J9ZA 4MUZA 3PM6A 1KBJA 3EXTA 2FDSA 3FS2A 4LNYA 1OYAA 2RKXA 5G4WA 2Q3RA 4UFIA 2XN2A 4HNVA 3BW4A 4RLIA 4HNNA 2H6RA 5CZJA 5HUPA 1W5QA 1FXPA 3SSJA 5A5WA 2JKAA 4LVAA 2X1UA 1JUEA 4FNPA 5AHFA 4QSHA 3CWOX 3W7OA 4JX4A 2TPSA 2NUYA 3LBMA 2JKPA 2YW4A 5HWNA 3FEMA 1DJQA 1JCXA 3QSTA 4D2JA 2QEZA 1I4NA 2HS8A 3W1XA 1DJNA 1V7YA 5D2YA 3GLCA 3GYEA 3SY5A 1LOLA 1YXYA 3YPIA 3MI2A 3EXRA 1LCOA 1H62A 4DF2A 1IGSA 3PWAA 3VKJA 3BG3A 1KV5A 4OGZA 1B4EA 3UY7A 3DFOA 3AJXA 1TYGA 1SSGA 2X30A 3FA5A 2I14A 3HB9A 1U83A 2KZHA 4U4MA 4DBDA 4N9BA 1XM3A 1W5PA 3LCLA 1ZJIA 3PSWA 2P1FA 2YFOA 3NPVA 1L9WA 5C5YA 3RNDA 2E09A 1TPH1 3BVJA 4JTKA 3HQ1A 4LVBA 3W22A 5K2ZA 2QCGA 4CQ9A 5KTLA 4R34A 3C0JA 1OFAA 2OT0A 2CLFA 1MSSA 4S2BA 3CC1A 4WQ6A 1IXQA 2G97A 2HMCA 3DI1A 2ZZ5A 4JR5A 5F4WA 3UWZA 4IXXA 4TO8A 3R89A 1OYBA 4X2RA 1ZENA 5G2WA 3P82A 4J9JA 1VLWA 1QDSA 4O10A 1AW2A 5K9DA 1K7EA 4QITA 5BNKA 3LOTA 3LHZA 1WQ5A 2VFHA 2QKFA 4ADTA 2B7OA 4DO5A 1TPC1 4GWEA 3PVFA 3BPWA 3TSBA 3N34A 1EEPA 3TX9A 5DBTA 3LDVA 4ZVJA 5HUOA 3LRMA 2YFNA 4WJEA 1A5BA 2B4GA 3GR8A 4NJGA 1XFBA 5FF7A 1YTEA 3W73A 3SJ3A 2PE4A 5HULA 3W72A 3EEGA 2YXGA 3A24A 4O0ZA 4IPJA 1UBSA 4NZJA 3P60A 2PRLA 3NQMA 2GUUA 3DU0A 4FEZA 2ZZ4A 4UTIA 3TUUA 1H50A 2OX1A 4O19A 1WX0A 4O52A 3PUDA 2Y7DA 2QJIA 4O12A 1XKYA 4QNWA 4PL2A 3KRZA 4UFHA 1WA3A 3E12A 1PS9A 3GAKA 1IIHA 2ZRVA 3LHVA 3LRLA 3DFPA 3B06A 1F74A 2R14A 1YXCA 3UNDA 3UD6A 1XI3A 4N2YA 4XQ6A 4OT7A 1B9BA 1GYLA 2NXGA 1KFKA 3JR2A 3W7KA 4O50A 4IMGA 2H3BA 1PE1A 2C16A 1GOXA 2V2DA 2P0OA 1JCMP 3DFTA 3TXZA 3WJYA 1LTDA 3TXVA 3KRSA 4I7WA 4KWVA 4KFOA 5DELA 1KFEA 3NG3A 4IXHA 1OFRA 1SZNA 1QWGA 1VHNA 1VRDA 1SSDA 2B7NA 2JK2A 4GJ1A 4BWLC 3W1LA 2A85A 2B7PA 1ZAJA 4P61A 2YYTA 1XBVA 1H5YA 4EVZA 3UZ5A 1G4TA 3G0UA 3QZEA 2FFCA 2X16A 3O05A 5I3FA 2PURA 5LNUA 1ZALA 3LCWA 3C52A 3NAVA 5LNSA 3IRDA 3E96A 4UIOA 3W70A 1YADA 4WY0F 4NJJA 4YCOA 5F4SA 1SQ7A 3EX4A 4XTIA 4LRSA 1HTIA 2A7PA 3ELFA 4XBKA 3N73A 4GXMA 4O13A 1JQVA 4MKNA 4XZ9A 1VJIA 1KBIA 3PR2A 3TMLA 1SZEA 2CU0A 2V82A 1VQTA 3ZWSA 2NX3A 3TQ0A 1FX6A 5CPLA 1OFBA 3BG5A 3F03K 3QPYA 1SO6A 1JUKA 4JYDA 3EX1A 4Q33A 4LV4A 3VI2A 3LCGA 1K7FA 5AHLA 1W5OA 3R5EA 2YR1A 2FB3A 2W0UA 4YLWA 4QJ1A 3UWYA 3ZS4A 4UTKA 1OJXA 5K4ZA 2BWGA 5DN1A 2C1HA 3QW4B 5T26A 1TPWA 3E02A 5K9XA 4OV4A 1Q3NA 4GUFA 1I45A 3BW3A 3M0ZA 3NPXA 3W7QA 4A22A 4UTLA 4MY8A 2CLEA 1GG0A 3N2XA 2PC4A 4S2CA 3W1MA 3IVUA 3QH2A 1R30A 1A5AA 3W6YA 4YL2A 3G1VA 1JCLA 3W1TA 1IXOA 2ZCGA 4JEQA 4LRTA 2ZZ3A 1XL9A 4K7YA 4R33A 4GE8A 1KLZA 1SUXA 3W2JA 4JGDA 3A21A 1WBJA 1ICPA 3KVMA 4O54A 1YTKA 4ORIA 1GPWA 1LOSA 5FF3A 3B04A 4QNEA 1OFPA 4DQWA 3LX9A 1MEHA 3C3NA 4IMCA 2E77A 3UY8A 3O15A 4POCA 3RK8A 3W3OA 5AB3A 4JIQA 5HJLA 3WJWA 1ICQA 3FKKA 1VLIA 4I9AA 4UTWA 4JD4A 1KA9F 4LVGA 4G1KA 3G3DA 4MJZA 5D04C 1K8XA 1PCWA 3LM7A 3G1FA 3L68A 3MP4A 1R2SA 4RXFA 3I6RA 3P84A 3P80A 4HSOA 4O15A 1H1ZA 4AMAA 5EYWA 3W88A 3MUXA 4IMFA 3VFLA 5DCBA 3PAJA 3TA6A 1AL8A 4JTUA 4O11A 2ALDA 1KM6A 4NU7A 3ABRA 1I2RA 2C19A 2QCEA 1TMHA 1ICSA 4GFSA 1GVSA 4TX9A 1YLVA 4R53A 5FI8A 4GUHA 1QPOA 2W6RA 4JY9A 3GR7A 3NO5A 3QQ0A 3UQNA 2VXNA 3HGSA 3IIOA 4K8HA 3TKFA 5LKYA 2DZWA 2YYUA 4BF9A 4O1BA 5AHNA 3DXIA 1X8FA 1LP6A 4ADUA 3TW6A 3GKFA 2A7NA 5D09A 4LVDA 3UPWA 3GXPA 3HG5A 2J24A 5G5IA 2J88A 4UTTC 3NXFA 1XBXA 2BZNA 5AHIA 5DXXA 4UTJA 5E0KA 1MZHA 3M5YA 3KAOA 1OX4B 1TIMA 1OF6A 3SIZA 3G24A 4NXSA 4C1KA 4BR1A 3W2UA 3I7RA 3LV5A 5HMSA 2A0NA 4CLMA 4CCDA 1XUUA 2GJLA 4PA8A 4UTWC 3P5ZA 1O4UA 4X9SA 5IBXC 4MPQA 1ZAHA 3LCXA 3TW7A 3LERA 1XUZA 4DF1A 1QMLA 4M19A 4Z08A 1L6SA 4IGHA 2Z6IA 5FESA 3GXTA 1ME8A 3PSVA 2JGYA 1W3NA 4AWTA 1EP1A 1S5VA 2QR6A 2ZRWA 2WKJA 1FXQA 5AOUA 4N9DA 1S5WA 3IEBA 2C18A 2Y6ZA 4FXRA 5HR7A 2J6XA 4DEFA 3L5MA 3OEXA 5BOOA 3HG3A 2RDTA 3BGGA 3IIZA 3EB2A 1BTMA 4LS1A 1VS1A 3W7RA 3W74A 3L21A 1IXPA 3GDMA 1SZGA 3IIXA 3R8RA 4OQVA 1GWJA 2TYSA 3G18A 2R91A 5KMYA 4O16A 2UV8G 2EAWA 3GXNA 2BLEA 2OT1A 1HFBA 1RQEA 4HIBA 1Q45A 4RZ6A 3G8RA 1EWEA 1SW7A 2CWNA 4UC5A 4JTHA 4K36A 3PBYA 1OX4A 2GOUA 1TPVA 4XBSA 3BO9A 2ZZ1A 3NQGA 3K30A 1WDWA 4UNKA 3BV4A 3F1QA 5C6MA 1DQWA 3EWXA 1J2WA 4UXDA 1Q6LA 3QW3A 1QFEA 3FFSA 4RZ5A 1E51A 5HWMA 2OMAA 4FXSA 2DJLA 3G3MA 3NQAA 5D2TA 2TSYA 3SGUA 4YWIA 2QDGA 4BFAA 3Q94A 4O4VA 2HS6A 1OX5A 3W83A 4UTHA 3E49A 4IWWA 1KW1A 2G5WA 4M6QA 3L0KA 4K39A 4FX6M 2Y89A 1ADOA 2B0MA 1CX9A 3HG4A 1EP3A 4IUOA 3MMTA 4O53A 3PB2A 3GKAA 4ORMA 2NV1A 3Q2DA 1FWRA 3SR7A 3W9ZA 4QQ3A 4BK9A 2Y63A 4O1CA 4Z1AA 1XDLA 1GJPA 2X1SA 4UR8A 2Z2UA 3UWQA 3C56A 3S6DA 1JJKA 3QMTA 3TSDA 1R46A 1WV2A 2ISVA 2J9XA 3NNTA 3TSMA 1D3HA 1JCYA 3L9CA 4YMZA 4RXGA 1YDOA 2E6DA 2CLIA 2AQWA 3L5LA 3IGXA 1DBTA 2NXHA 2GVLA 3S1XA 4M5PA 4EF8A 1FUYA 5D02A 4A29A 1TJPA 3LI0A 3P81A 5CZSA 4Z0JA 5TBOA 2DZPA 2E68A 2V9DA 3I7QA 1FCUA 3P67A 3CT7A 1PHWA 1W3IA 1YPIA 5G1YA 2V8ZA 3HPXA 1OK6A 1G4SA 4MOZA 4MYAA 1LORA 3WK2A 5K3VA 1EUNA 1C8VA 3P7YA 3W1QA 3BLIA 3CIWA 1XC4A 5KITA 3M47A 2GPTA 4JTFA 2DJXA 2YGYA 3GNDA 3QF0A 4Z1CA 5CPNA 4E38A 3TFCA 1RVGA 1RZMA 4PFMA 4FF7A 1I2NA 2DORA 5H2ZA 2VEPA 3GZ3A 1OX6A 1NF0A 2F7FA 1TREA 2ABAA 1Z44A 4PH6A 3P62A 3TV8A 3KFTA 3GDTA 3S1VA 1G4EA 1FDZA 1ZAIA
chains in the Genus database with same CATH superfamily
1OCNA 2GVEA 1JI1A 4N9CA 2CBUA 2I7GA 1FWSA 2NQJA 1IEIA 1JRCA 4XZIA 1MQQA 1SJBA 1SZFA 1Y5WA 3FXYA 1UB3A 3OBEA 5ABTA 1XIDA 2PWVA 2BV9A 1ME7A 1HKMA 1PYFA 7A3HA 3PUEA 5D2VA 5BROA 4LOCA 2F2KA 5CC7A 1ZCOA 3TZFA 5LIKX 4L61A 4KGJA 3VNZA 3OYZA 4L6HA 2W61A 3R58A 1AL7A 4O0QA 3W75A 3DBNA 1ITXA 1DWAM 3GD6A 3W00A 1L6WA 3TJXA 3KRBA 1C8QA 1QASA 1S46A 3WBXA 4PMQA 3RN6A 4GQ0A 3O06A 5DXYA 3UWWA 4HK5A 3FLUA 2ZXDA 1E73M 3CPUA 4XISA 2WZIA 4NX0A 2PP3A 3UFYA 3ZLFA 3GIYA 1BYCA 1TV4A 3C0SA 3QR1A 4PUUA 3Q45A 4HPNA 3LHTA 2NSOA 3A5VA 1HG3A 4L9YA 3VINA 3UF9A 1GONA 2DT2A 1VPQA 3AMGA 1UH3A 2PDJA 1Z3NA 2PZNA 1ME9A 4XZLX 2I5QA 3OU8A 3SZ8A 4AEOA 3NO1A 2B31A 3HGOA 1YDVA 3VD9A 4H8UA 4TXEA 3T05A 3GXDA 5FCZA 3LK6A 3KVLA 1FWWA 4Q8NA 1ZS2A 4ZQPA 4S3EA 2OFJA 4H9MA 1S3HA 1TWDA 3QGVA 1UR9A 1K77A 2J75A 1VFHA 1W54A 1TIWA 3OVRA 3GTNA 3NL3A 3WNLA 3LXAA 1XDJA 3GXMA 3H53A 3KOYA 5EL1A 3UJSA 1FDYA 2XHYA 3HMJG 4E3VA 2QNEA 2X09A 3FVMA 4AHPA 4I9MA 4E4FA 4Y9AA 1VFTA 3P5YA 3ZR6A 1R2RA 4L6OA 4LS0A 3DFQA 3DKJA 3QY7A 3UWUA 1MUWA 4JYEA 4XAZA 5C55A 3KTXA 1HP4A 3W1NA 1H49A 3DGRA 5GNYA 1X96A 3U2EA 1P6CA 3TK7A 3HPAA 1EKOA 7CGTA 3B3DA 2F61A 1EPVA 2D24A 8TIMA 5D9NA 2DSKA 4AISA 3WF0A 1XQLA 4JCMA 2PGFA 2OLSA 4C7GA 1UWIA 5M17A 4LANA 4AMCA 3BXWA 1UMYA 1G7VA 1EZWA 3EX2A 2HRWA 3EXSA 5KEZA 1KM2A 1OFOA 4C6KA 3BGJA 1EJ7L 1CXIA 1LQ0A 3TE9A 3WLKX 4JZ5A 1TPDA 3NDOA 4OZOA 3KBMA 2VDHA 4H9UA 1Q6RA 3KXQA 5LYRA 3W37A 3B9DA 3PPGA 1DQUA 2VUNA 3LGGA 2QS8A 3HOJA 2E5DA 3L4WA 2P50A 2ZRUA 4W7UA 2NUWA 3E0WA 3N19B 3VIMA 1RCXB 3N4EA 1V7AA 1UJPA 3VIGA 1AMKA 3V35A 2XN0A 3JS3A 4U31A 4XK2A 5L9FA 3LXCA 3S5YA 5RUBA 3HV8A 2FYMA 5CH9A 1CZ1A 5DBUA 3M6YA 2VGBA 1KR1A 1PVNA 3G8EA 3H2FA 2ZUVA 1UPMB 1QHPA 1RP8A 1HP5A 1SFSA 2QYGA 2ZX9A 2VUYA 2EPNA 1MVYA 1YRRA 4IJBA 4D8LA 2D3LA 4LUIA 4LVFA 1WPCA 3WF3A 3FXGA 2WVTA 3QKZA 4F0MA 2HVNA 4DLMA 1QK0A 2YBTA 1U1UA 2WMHA 2QF8A 5HMDA 1RJQA 4ZTXA 1SU5A 2AMXA 3GW0A 5HR6A 1Z32X 3WD4A 1O6IA 2XVPA 3AI0A 1RY8A 3LXBA 3KCJA 1FFRA 4DI8A 5B7YA 4MGGA 1JD7A 3OLIA 1A5NC 4GISA 4ROQA 1VR6A 4GZIA 1W1TA 4MFDA 2H90A 3TWAA 1KXTA 4FP1A 4S3KA 4LAUA 3GFXA 2XIOA 3BDKA 3LHWA 4FMVA 4QXIA 4N6EA 4WOZA 4HA3A 3W71A 3GW3A 3CPGA 1UCWA 4Z1YA 3RCYA 3KS6A 4B9YA 4IL2A 3VGFA 4LYQA 3QTPA 3CZ8A 1V3HA 1S1RA 4DI9A 5FF2A 4CQDA 1FDJA 4O14A 1K4GA 3B8VA 3AJ7A 3H6OA 1QNRA 2O9RA 3RRAA 2PB1A 5G2HA 4JTTA 1B2YA 2CKSA 5M03A 2Z00A 4H8HA 1AVAA 1AH3A 5LHEA 1F6YA 1R85A 1H60A 1B4KA 4WKHA 1GGOA 3DENA 4LUJA 3PZ9A 4UQBA 6PTDA 5IRPA 3K1DA 3GTIA 4WDTA 3AISA 3LLDA 4U2ZA 5F2GA 2PBGA 5LZLA 3TTOA 2PA6A 3A9IA 1JUBA 5D9MA 2J25A 4G1NA 1XLEA 3S2LA 1LYXA 3W1PA 2PWEA 2PDPA 1N82A 3ZT7A 3TTQA 4DO7A 3AHVA 2UZ9A 3E3HA 1GOQA 2XVKA 4F3HA 2AKMA 4FS9A 3DGBA 4K1GA 3CHCA 4DBEA 3PZIA 4FOKA 4R7JA 2EJAA 1W37A 3VKDA 2DUAA 4KCVA 4CQBA 1VC4A 1E0WA 4AZIA 1FRBA 4YU1A 4UNLA 4DJFA 1K9TA 4OVXA 4CD6A 4F4RA 1JFXA 4JQAA 1EA9C 1M01A 4MG4A 3UXAA 2HWGA 5D32A 3BQ6A 4GNVA 1LLZA 4JDYA 3ZIZA 1ZL1A 4LAZA 5BWAA 3CUJA 2GQAA 1SW3A 4AZHA 1KFWA 3LYEA 1XHGA 2DSUA 3W2LA 3QFEA 3TC6A 4KCTA 1VPXA 4HNCA 3GTXA 3PULA 5CJNA 3GU2A 3ZO9A 1XH1A 3LCHA 3MSRA 4ZZ9A 1CGYA 1TPB1 2CHRA 3EB3A 4L4LA 5I3JA 2CLOA 4DUOA 4CD5A 1EXBA 3KX6A 3S47A 1WZKA 2VENA 1K6WA 2FJKA 1XPYA 2QZRA 2ZX5A 4PCTA 1T41A 1WZMA 2EPHA 4W85A 3SRDA 5AC5A 1JPMA 2RDXA 4AH7A 3DC8A 1KM4A 1UUMA 4ATDA 3VGHA 1W3KA 5HAOA 3GHUA 8XIMA 3VKCA 4LX4A 1L0PA 1V6VA 1KRCC 1LUCB 4MB5A 6ALDA 2WO5A 4AVFA 5TNVA 4GA8A 3DHDA 2WQPA 3J7HA 2OELA 3PY2A 1GW9A 1X8CA 3EZ4A 2X41A 4LFYA 3CH9A 1AQFA 4NZFA 3DZ1A 4CCCA 3UWEA 2Y0FA 1K7XA 4IHCA 2ZTKA 2WBGA 1PUDA 3PBGA 1LLOA 4JY8A 1GYNA 1KTBA 1QCWA 4X9YA 2WSQA 4JKMA 4AYGA 1V5XA 3B8SA 5LGXA 5GNXA 3EBVA 2JKEA 2RJHA 1A5CA 2A3CA 4N6FA 4BHYA 2DZVA 4AHQA 3BTNA 3P8JA 5BXSA 1P1XA 4RJEA 3T0CA 2RAGA 5CPMA 4JN6A 2NW0A 2V63A 1E1CB 3BCFA 5HNRA 4Z1BA 1M7XA 2J9YA 5I3IA 1FQ0A 2XSAA 4EKJA 1XICA 1HT6A 2CZFA 1V6XA 2XGZA 2Y1HA 1PSCA 2YCIX 3OZMA 4GQQA 3VD4A 4YIWA 5LIUX 1ZY9A 3QM3A 4UMBA 3W24A 1PZ0A 1WXJA 1WZAA 2BVDA 1LUCA 4QJ4B 4LH8A 1BYBA 2GL5A 3RMJA 3PAOA 4TU1A 4EANA 3B8DA 1AQ0A 3G1XA 3L0NA 1OFEA 5FAJA 2P5NA 2RGLA 3ALFA 3TYDA 1RD5A 3CO8A 4N02A 4Q7IA 3C6CA 4IH3A 1EJXC 1I2PA 2WK2A 1JGMA 3S8HA 4RNJA 1MUCA 4RKAA 3GUWA 3VIPA 1TTPA 4W9TA 3SBFA 3TR9A 1FH7A 3CPRA 2V81A 1E1CA 4PTNA 2XWDA 4Q4MA 4D6HA 1LT7A 1ADSA 2QJGA 4C5ZA 1A53A 5D38A 4GNJA 3NQVA 3NQDA 4M7TA 3WLSA 5DCEA 5AY7A 1J0HA 3SN1A 3VAVA 4ZENA 3QGKC 2PU1A 1BF6A 5M5DA 1C7TA 1XIGA 3Q37A 3SCTA 3W7GA 4H41A 4RPPA 4PMUA 3BL3A 4D1JA 1XGZA 4CEUC 1MEWA 3W81A 3ID7A 4QM1A 5A69A 2A3EA 2QDEA 4WZHA 4L64A 4H04A 4S38A 4M1BA 3W85A 3HGRA 3CLMA 4MADA 1NH6A 3H4XA 3GC4A 4S3JA 2DSWA 2FHBA 5D9PA 2ZUSA 2W79A 2NVAA 1JG9A 3SJNA 1E1FA 2WM0A 3M0JA 3RLUA 1VFUA 1U30A 3W53A 3W86A 1JDCA 1NOFA 2VO5A 2UY4A 3LGDA 5GVJA 4JDBA 3N12A 4NKCA 1FHLA 1IIGA 3VTRA 4CEXC 3AS2A 3C2RA 1Y5XA 3AIUA 1BHGA 2WNQA 3V5FA 4XUGA 1OCQA 4E2DA 1IGWA 4GY0A 2ISWA 5FEXA 4B5VA 5FACA 1Q2SA 1HO1A 2E67A 3MT1A 5EMUA 2BBFA 1MNSA 4WF7A 3VD7A 3V0TA 4QS5A 3MWCA 1JI2A 3AYTA 4KKXA 1KNWA 1HJVA 4G7EA 3VM7A 1XIHA 3LEPA 4FR6A 3T4CA 4F2TA 3PZUA 1J5SA 4IIGA 4JEJA 1J9YA 4LNCA 1XG3A 2E8YA 1PAMA 2VEMA 3GRIA 2WHJA 4L1WA 4FOJA 3S6TA 4KEMA 4IZGA 1JXKA 4RW3A 4H4IA 4TQTA 3QTGA 1VFSA 1NDWA 4CNNA 4MAZA 3EYPA 4RL3A 4UOZA 4IJCA 2VC5A 1JPKA 1RV8A 4AIUA 3M43A 1JEZA 2DZUA 3AIBA 4L4PA 1MQPA 4F48A 4BF5A 3LMZA 1NVMA 2AKZA 1R6WA 3QHMA 1GHRA 3OBAA 3G1SA 3NZQA 4MSSA 5EPDA 3UXLA 3EDEA 3IS4A 2QXWA 3FYOA 1BVWA 2I5GA 3LY0A 3VPLA 3ANYA 5D37A 4GO8A 4AWUA 3LI1A 3KWSA 2PDHA 4M7SA 3R13A 4GJIA 1IZKA 4WOQA 4A8LA 3PUGA 3TMQA 3FK4A 4IGMA 1IT0A 2WV8A 4GBDA 3CUZA 4D8ZA 1LRNA 5JUVA 5HQLA 2E7FA 2I9EA 3ERPA 1V02E 1VGAA 3F4CA 3T44A 3CMFA 1LBFA 3HBLA 3KRUA 1WUFA 1DTUA 3V1HA 4N42A 4MM1A 1DL3A 3FA4A 2XVLA 2V5KA 1ZQ5A 3EKZA 1K8ZA 3G0SA 3UERA 4F66A 1H1NA 3LB0A 2YCEA 4P7RA 2B81A 3RM8A 2XFFA 2QAFA 3DDMA 3EGJA 2RJGA 4M51A 4DJDD 5EGRA 3F4DA 3QC3A 3W6MA 4M24A 3W25A 1K02A 1A3XA 1FWGC 4DM2A 3M1ZA 3GO2A 5J8LA 1B3ZA 4L1XA 2Q8LA 2G96A 3IV3A 4NYUA 5FEWA 4D71A 2EF9A 1PKYA 4X22A 4OKDA 4N0RA 4Y6GA 1VH7A 1WNOA 3R0KA 1W56A 3CHEA 3H24A 4IFRA 4ZQMA 2YXXA 2NVCA 4OHQA 1E6PA 3CZKA 3WBYA 1IEQA 1EC7A 1Z48A 2X2YA 2OZ0A 1OSEA 4UTMA 4Y8FA 1F07A 3KUMA 4J3UA 4ZQRA 5C71A 1OT2A 1GUVA 3TN3A 2Y7FA 4XD6A 1FWEC 4TVDA 3PFRA 3TH6A 3SB0A 1XD1A 2QLYA 1GORA 1TO3A 2PEVA 2PAJA 5AYXA 1D3GA 3AOFA 3RFAA 1AZ2A 2WANA 3TONA 4XSLA 2JGQA 3OZPA 3M4HA 1AH0A 1W2VA 3RUBL 4NI3A 5DANA 4RUBA 3FNDA 3ZJKA 1NJJA 3WUGA 2NX9A 3VGDA 3GIPA 2ATMA 3MHGA 4FX8A 1DHKA 1KWGA 4AB4A 4BQ3A 3U4FA 4F9JA 1SJDA 2FZDA 1EJTC 4YHEA 2WPGA 4C6FA 1MYRA 3GDLA 3LD5A 2C1GA 4K7VA 3FYPA 2WBKA 1BYAA 5XINA 2JBMA 3MSGA 4EIVA 1QO2A 3N6HA 5AVHA 3RLHA 2Y7EA 4KGLA 3E2SA 5A8QA 1OGBA 4IFKB 1W1B1 2ZOXA 3WUFA 4FNTA 1X7FA 4B91A 2BVYA 4PC8A 3WEOA 1VZWA 4WCJA 1XXXA 3RO8A 2GJNA 2CEQA 2XTKA 5FKYA 1V4YA 1NM9A 3KZSA 3QMRA 1BSIA 4LU0A 1XDMA 1UR3M 4O1DA 2CETA 3VCNA 2PFHA 1W9XA 5CAKA 4PMOA 3OOQA 5BMXA 1SMAA 3UZYA 2EKCA 3GBDA 5A6BA 3BANA 1JZ4A 5A8OA 1I8JA 4PULA 3WQ5A 1LQAA 3LSBA 1T40A 4NASA 1KLYA 4L7ZA 4GACA 3DI0A 3UETA 1FWTA 1HO4A 2VR5A 3GH4A 1PWMA 1ITQA 2PDBA 4PMDA 4HN4A 3GNNA 2D2JA 3PJUA 1W1IE 3TTYA 2VZTA 3G22A 1Q7QA 1BAGA 4Y96A 1F2JA 1RCOB 1D8WA 3ZJ8A 3N3TA 4DWSA 1UC4A 2D20A 2PTDA 4BJHA 3BARA 3GDBA 3GUGA 3RU6A 4FLQA 3W7JA 4IFKA 1NF7A 1UUQA 2EGZA 3CJPA 3PM6A 3LNPA 1D8CA 1Q2RA 3N4AA 4B5UA 2XFRA 4MDOA 5G4WA 2XN2A 1CECA 4HNNA 5CZJA 9RUBA 2J4GA 4I6VA 3APTA 5A5WA 2JKAA 1Q85A 3P2VA 2GFTA 4FNPA 1LL4A 4HVXA 2G8ZA 1CCWB 2TPSA 3LBMA 4GYPC 4M1RA 1DJYA 3FEMA 2GGEA 3OLDA 4LUTB 2GGIA 2QEZA 1DJNA 4AD5A 4NAFA 3SY5A 1LCOA 4DF2A 1GOOA 1VJSA 1C8YA 1R8LA 4M82A 4PSRA 1TYGA 5FJRA 4HU8A 2CBIA 4U4MA 4DBDA 3W27A 2P1FA 3NPVA 1C91A 3BVJA 2HEJA 3HQ1A 4B2DA 2XIQA 4LUSB 5DMMA 4K68A 2IXVA 4BQ2A 3MUZ1 3ZSTA 5KTLA 3PFMA 2NT1A 4S2BA 2CLFA 1MSSA 4B5TA 3VUPA 3LLXA 2Y24A 2AQVA 5JXQA 3U2CA 2QW5A 1NFGA 4J2MA 3DI1A 4GCAA 4FLSA 4GX8A 1ZB5A 4PMJA 1ZENA 1KO0A 1NOUA 1XLGA 1US2A 3LPGA 4O10A 1AW2A 3MMWA 4B5SA 1NELA 4L65A 4RDWA 5K9DA 1HNYA 5FJTA 2J7DA 2VDGA 2Z1KA 3LHZA 2Y5JA 4JQ3A 2VFHA 2VRKA 1IT7A 4LUTA 1GKQA 4IIDA 4GWEA 4B5WA 4AYSA 3TX9A 1YMYA 2GUBA 2PDUA 4CU8A 1HJXA 3LDVA 5HUOA 3T0AA 3QOKA 3IV8A 4EAMA 1Z7AA 4HU3A 1A5BA 2B4GA 4C6QA 1RK5A 3W73A 4IM4A 3GH7A 1UH2A 4O0ZA 3MCMA 4LAOA 2HISA 1ZTVA 2D23A 3WDHA 5I6SA 1JF5A 2OX1A 4O19A 1IYXA 4HMEA 1MFUA 4O12A 5A3HA 4QNWA 2ZIDA 4M29A 1V6YA 1XIIA 3GAKA 1UR2A 1IIHA 4GY7A 3EPMA 3L2LA 3B06A 4XVDA 3PTMA 2OYMA 5A2BA 2YB1A 3UD6A 2DIKA 4OT7A 4AX6A 5G1MA 3PZQA 2PDKA 1GOXA 1JCMP 3TXZA 3WJYA 5C7HA 4GKLA 3W01A 3TXVA 1A0CA 4KFOA 3NDYA 5DELA 5C9ZA 4DZ5A 1OFRA 1VHNA 1NDYA 1VRDA 3WMBA 4GMEA 1I1WA 1QK2A 3SRHA 2PCEA 2IW0A 4JFTA 3UZ5A 1GQKA 3H2OA 3SCOA 1UW9A 2FFCA 1S2CA 2X16A 3O05A 5JH2A 1HF6A 3FGCB 2YL5A 5LNSA 1TWSA 1PX8A 4KT2A 4WY0F 4NJJA 2CXGA 4YCOA 3D47A 3MV11 2BHYA 4LRSA 1HTIA 3AHZA 4PB3A 4IJRA 4FLOA 3PR2A 3S1GA 3H2CA 1ONXA 1XGDA 3T08A 1WKEA 4UQAA 4NZ4A 4H9XA 5CPLA 3TQPA 1OFBA 3F03K 1GJWA 4JYDA 3EX1A 4LV4A 4V2XA 1K7FA 5GNZA 2W0UA 5JVLA 4KWUA 5K4ZA 1XIJA 3QW4B 4JKKA 5T26A 3OIHA 1HXJA 3F7JA 1Q3NA 1W17A 3AWOA 4H19A 4IIEA 4UTLA 3L4UA 4S2CA 1A0EA 1M7JA 3QH2A 1R30A 2HPMA 1EF2A 1ITCA 1R3VA 4JEQA 2J7HA 1XL9A 4K7YA 1TCMA 4R33A 1EO7A 3VABA 1VEPA 1ZRQA 4MWAC 1MWOA 1UWRA 1UA3A 5FAGA 3KVMA 3UR5A 1IZCA 1YTKA 1KR0A 1JDFA 3VMNA 4QNEA 1BLIA 4WGHA 1JXJA 3UBPC 4MNLA 4MMWA 5AB3A 4GOAA 3FGCA 4KEUA 4P7QA 4JIQA 2FDMA 3ZSSA 3AUJA 1V77A 3CL7A 2V5CA 5GJPA 3UCDA 4EXAA 2OB3A 4JD4A 3OYXA 4NY2A 3CIVA 1UROA 1R2SA 1E56A 3I6RA 1RAKA 3P84A 5B80A 2VRQA 4O15A 1XWYA 5EYWA 4U3AA 2R1KA 3MUXA 3VFLA 3PAJA 2OQHA 4O11A 1V3JA 2ALDA 1KM6A 3ABRA 2C19A 2QCEA 4GFSA 4TX9A 3C0QA 1YLVA 2QDDA 2TAAA 4GUHA 2W6RA 4D6DA 2BY0A 1S5NA 3NO5A 1WKFA 3HGSA 4K8HA 3TW9A 3AHYA 3N04A 3WQEA 4XAFA 3WLMA 4YNGA 4LEQA 3IWPA 4DVOA 3AXKA 2BB0A 3QY8A 3RLGA 4LVDA 3UPWA 3GXPA 3N6JA 4QFUA 4X0NA 5HBFA 3P0WA 2J24A 5AYBA 1B3YA 1GHSA 2EJ1A 2CC0A 1DEDA 3AZTA 1PO9A 3QV8A 5I7GA 4W5ZA 3KAOA 1TE6A 5EMKA 1JDAA 4C1KA 3ALGA 5DRCA 1ADDA 1M1BA 7TAAA 4CCDA 1XUUA 1F3EA 2FFIA 4UTWC 1O4UA 1UR0A 2PTWA 1NWTA 3VIIA 4Z08A 2VEGA 2WVVA 1EDTA 5FESA 4MHBA 2VNCA 3PPFA 2ZRWA 1VJZA 2GK1B 3CV1A 3ARRA 4WSHA 3AUOA 3WQOA 3AROA 1XYLA 3OEXA 5JH1A 3BGGA 1CT5A 2CERA 3ARTA 4LS1A 1GQJA 1IXPA 1SZGA 3IIXA 3R8RA 1GWJA 2C71A 5KMYA 1DIEA 1H0GA 4E4PA 1HFBA 1RQEA 1C8XA 4ES4A 4RZ6A 3WD2A 4IICA 3CYVA 4H2HA 1EWEA 2HE5A 4ZODA 3TN5A 3P0XA 1XISA 4R5EA 2GOUA 1QWKA 2ZZ1A 2PF8A 1DP0A 1YDYA 3F1QA 1V6UA 5C6MA 3ZJ7A 1DQWA 1VFOA 3IJ7A 1DIKA 1MI3A 1E51A 5HWMA 2OMAA 4FXSA 5D4YA 2R1MA 3WDPP 1BGAA 3G3MA 3N11A 4K2SA 4O4VA 2QPUA 2IPFA 3ARWA 1W1A1 3FX4A 1OX5A 3W83A 4UTHA 1KW1A 2G5WA 1B3XA 4PYSA 4MKSA 4AZBA 1GKPA 3EMQA 1A3WA 3T42A 1P6WA 4FX6M 2GK1A 3U9IA 3OGRA 3HG4A 3C8NA 4D9PA 2XSXA 4O53A 6A3HA 4ORMA 5BU9A 8XIAA 4GYKA 2XGIA 7PTDA 1FWRA 2CZVA 2VZSA 4Z1AA 4EPEC 3S6DA 1CXEA 2ISVA 3KW3A 1JCYA 1XYZA 4Y9PA 3TVAA 4DRSA 1YDOA 1R7OA 4XVEA 3SCPA 3WFLA 2E6DA 5IDZA 2CLIA 3LQLA 2E25A 3L5LA 4S3AA 1VIWA 1JF6A 1DBTA 4U10A 2XWEA 2CBJA 3LI0A 1A5OC 5CZSA 2JALA 4ML4A 2V67A 3KL0A 4I9JA 5TBOA 4RZBA 3BAJA 4G9PA 1MRQA 4QS6A 3GG7A 3P67A 1B1YA 3CT7A 4PFHA 1E4NA 1W3IA 6XIAA 1LWIA 3KOXA 4XAPA 1WZLA 3HPXA 4H7VA 1KQZA 1EZ2A 4JNZA 1LORA 2IKGA 4PBFA 3WH9A 3F5LA 1C8VA 3BLPX 3BLIA 1QNSA 3CIWA 4WDWA 2HK1A 4R7WA 3QF0A 4E38A 1TMLA 3HM7A 2G3FA 1RCQA 4FSAA 3GFZA 3E6EA 5BXPA 3S3GA 3WQ4A 1EEXA 1NF0A 1TREA 3PJTA 3O0FA 4PH6A 3V4BA 3NWRA 4IP5A 5MKGA 1KKOA 2HXTA 3BMWA 4JPGA 1V08A 4NI8A 1FDZA 1RK6A 2WJDA 2G4FA 3T8LA 3GM8A 5CLTA 1QOQA 3KL3A 3OA5A 3M46A 4C7DA 1EC9A 4QIUA 1MEIA 4OWGA 4QBXA 2AL1A 3T7VA 1WDQA 3S5NA 4XSMA 2O9OA 4NT0A 5AC8A 3R4IA 2PRHA 5JBFA 2PDFA 3I68A 1T96A 3OLGA 4GI9A 3IANA 3A4XA 3OPSA 1US3A 3NL5A 3FIGA 4CKQA 4JQ1A 3W6LA 4XV0A 3CTLA 3W02A 1SMDA 1T8XA 4NSBA 1DIDA 3W38A 1EC8A 5EMYA 4JTLA 5H8UA 4GYFA 3MBDA 5C54A 3B9OA 4QTGA 4IPPA 4JS3A 4CGTA 5F2LA 1EJUC 3HURA 4HJWA 4GGBA 1O5KA 4NAEB 3NYDA 3CZJA 2QIIA 3THDA 1CLXA 4LC6A 3UYIA 4OU1A 4C6CA 3AYRA 1JDEA 4Y8EA 2VHLA 5HPOA 2EBNA 3EDJA 4YVXA 3ZVIA 2W91A 3DHFA 4HKPA 2WW5A 1XIFA 4CQ8A 3WBWA 5SWUA 3FJLA 1H7XA 2C6QA 4XZBA 1DV7A 2WNNA 5I3DA 3WBEA 4ZB2A 1SO4A 3C2YA 3AYVA 5FA5A 1TVNA 1VFMA 3WQWA 1JFHA 2ZICA 4DUVA 3SUUA 2X40A 6TIMA 4WUIA 4H9ZA 5I06A 3BZGA 4IQEA 3WLPA 4MAVA 4NRRA 3QEZA 4GI6A 2BHZA 2ZZ7A 2ZZ2A 4DO4A 2X2GA 3GNOA 1H7PA 1H51A 4TOQA 4JFSA 1VAHA 4CD8A 2Y7GA 4RE2A 3BZJA 1OG6A 4O18A 4M81A 2PDXA 4NAEA 2AAMA 5LSMA 3E2VA 2XG9A 4AIEA 2ANUA 3NQFA 3WJSA 2CCRA 2Y4SA 2E1WA 4WJ8A 2TODA 3I10A 4F40A 3W7PA 4DNMA 3WH6A 5M2FX 1S2VA 2IQDA 3AIVA 2OPJA 2PUZA 5E1QA 1FBAA 1CI1A 2W4XA 2E5BA 3PTKA 1J2BA 1QHOA 3G6MA 3WQ8A 2I16A 2YZRA 4UCFA 3NCOA 3B8WA 2BX7A 3I6TA 2BXZA 3IIVA 3ZJ6A 3M0LA 1LROA 1NEYA 1VIZA 3L0GA 5D33A 3VNDA 4MB4A 4Q32A 1UP3A 1W1YA 1K3UA 2P10A 2W67A 5H91A 2H9AA 1UZHA 4QE1A 5H1WA 2C8NA 3ABOA 3AFBA 3FSTA 4AIBA 4TTGA 4Q4QA 2PMQA 1AJZA 3EB4A 4M0XA 1YPXA 1R2TA 2FTPA 3QR0A 2YPIA 1CXFA 3EWZA 3KLLA 3PBUA 2REQB 3S5OA 4IPLA 5AHMA 2QDHA 3IK2A 4H01A 1GEHA 3RAOA 2WMIB 4GLEA 1L6YA 4BEUA 3V7PA 5D2WA 5LNRA 1BYDA 5F1VA 2A3AA 3QKEA 1AODA 3I6EA 3GIQA 4PEEA 4C6NA 1IZJA 1S2TA 3K46A 2DT0A 3COTA 2PP1A 4FPSA 2ZDSA 2QJHA 1AUSL 3IJQA 5HDRA 4N9EA 3UESA 4YHGA 3N29A 2Q3OA 2NX1A 3H2MA 1KM3A 3IGHX 4BQ5A 5A6JA 2HROA 3S2NA 3W2NA 3S1WA 1PKNA 5B7ZA 2D2HA 1Q6QA 4S3BA 2WAGA 3M07A 4QAIA 2DZAA 5C2CA 3L4TA 4HP5A 3PNZA 1OINA 3ITLA 4OTKA 2REQA 1ONEA 4JTEA 4QCEA 4NZ3A 5LXEA 1C3FA 3FV9A 1IT8A 5I02A 1OQFA 2KX9A 1H2JA 2WMIA 4ERIA 3VILA 4QEEA 3NURA 2KAUC 1MZRA 3K13A 1RR2A 1R38A 3L66A 1XLFA 1VCVA 3T2PA 1GOMA 1ZCCA 2BY2A 4DZHA 4DYKA 2OZ3A 4JIHA 1QW7A 5DMYA 2GWNA 3DERA 4EP8C 3AO0A 3MHFA 4HNTA 4UTUA 1LG1A 4LEFA 3IK4A 3PJWA 1AJ0A 1EJWC 3WLJA 2ADAA 2X1IA 4C6JA 1I60A 1TZZA 1QPNA 4X61A 4AWEA 3KHJA 2E5CA 4BI5A 4YTSA 1K8YA 4JIEA 5DT7A 3GNRA 4DJFD 3BSMA 4C6DA 1W5MA 3VNLA 3MDUA 1RP9A 3IJ9A 3UA3A 3DKLA 2I56A 3EWYA 5CGMA 2VFEA 4W87A 1E15A 5HNUA 1TPUA 4C6IA 2PDGA 3MSYA 4BS0A 1TG7A 1M03A 1UZ1A 1EUAA 1CNVA 3BJFA 5CSUA 2OKOA 1TUFA 4XZNX 3WJZA 2D69A 1J11A 2J79A 3BAYA 4N4PA 4QDPA 3EDKA 4KBXA 1CGTA 7ENLA 3RX3A 1G69A 1WDPA 2NUXA 3REQA 3V1PA 4M56A 3WLQA 3N2BA 3ARVA 2RGMA 5LIYX 4GNKB 1GW1A 2TMDA 3VVGA 2BSLA 3VZXA 1JNDA 3KCOA 1EWDA 4W8LA 3RPMA 1CGVA 2DDXA 4R85A 3KE0A 1T5AA 2OJPA 4O8RA 1GVOA 4HPHA 1FFQA 4FHAA 3UZWA 1CIUA 4ERGA 3OVQA 4PZVA 3VMPA 2CZDA 2Q71A 4L5ZA 2W27A 3NZRA 3W76A 4FO4A 3B0VC 1PTDA 4WEVX 1KM1A 1ZJAA 3CQHA 1YTDA 2I57A 2OG9A 2XH7A 2PI6A 4U28A 4M80A 3EWUA 4K8EA 3M0XA 4OE7A 1UHVA 3AXHA 3N2TA 2VWSA 2IMRA 3NQEA 1MXDA 5DRIA 3TFXA 2E6YA 3WDIA 2WMGA 2J7BA 4JYFA 1PX4A 1M5WA 2HJPA 4ZA0A 3CZGA 4FALA 4LTSA 3KTCA 3P93A 3GTFA 2VOTA 3OZYA 3O9NA 1QXLA 1XSIA 3SECA 2HPIA 3TLQA 3TYEA 1MQRA 4R3UA 5AYYA 1EGZA 1M65A 3TOPA 4V15A 1LRQA 1JQXA 4JHOA 2CHOA 4QGCA 1P4CA 5I03A 1PTAA 3MJYA 1QO5A 4NNBA 4X2PA 1TTQA 3KBNA 4LBRA 2AGKA 3M7WA 2INZA 2WNZA 1NP0A 2Y8VA 3RPTA 3WK0A 3GYCA 5EY5A 4B16A 3G1HA 1CEOA 1KXQA 5C8BB 3I3DA 1JL8A 3AMCA 4I5RA 4Z2LA 1JYNA 3KOFA 5F2MA 1EJSC 3BW2A 4RNHA 1WAWA 3BICA 3OG3A 2ZA3A 4ZO8A 3TNOA 3RF9A 4W8BA 1P5BA 2ZFAA 3CH0A 1NQKA 3WF4A 3B4UA 2VFFA 2X1TA 3VOGA 1KTNA 2QJNA 2CLLA 3P8IA 5EMJA 1E9YB 4E8GA 3TLLA 4UFLA 1CGWA 3NOEA 4PBEA 1G1YA 4JL1A 4XB3A 5C7VA 3CAVA 1SYTA 2OODA 1TTJA 4JNMA 3BOLA 1EIBA 4H3DA 3F5KA 2V5JA 4GUJA 2W3ZA 1J93A 2TRSA 4KWSA 1US0A 4CD4A 1O5QA 1POJA 4HTBA 2Y70A 2YCJA 1WDSA 4DZAA 3L4VA 1WYIA 4IQDA 3B8UA 5HMFA 3UGVA 1E0UA 4PUMA 2ZX6A 3L2IA 3EX6A 3M64A 1JAEA 1G6CA 2FZ9A 5F7UA 2H8XA 3N9KA 4O4WA 1PCKA 2PC8A 3U6WA 4XUYA 1UA7A 2V5BA 4JBRA 1ITUA 2EPKX 1D9EA 1F8MA 2VVNA 2VZOA 3L67A 3U5UA 4CNPA 2V5DA 1SZRA 3ZWTA 1GVYA 3NZ1A 5FJPA 3QRHA 1OFDA 5JBEA 3QJAA 3E74A 4BA0A 3OJGA 2QQ6A 5I3HA 1HVQA 1N7KA 3SCWA 3EMCA 1EB3A 4A2SA 5C9UA 1NY1A 4HCDA 4NQ1A 1E4LA 2CZ5A 4LF1A 3INPA 4MIMA 3D5HA 4P7NA 3GG8A 2PGEA 4PE8A 3WLHA 4WK9A 2D0HA 2C0HA 2HVOA 2AOSA 3T9PA 4E2OA 2A3LA 1XCXA 2EPMX 2R9RA 1E71M 4RV3A 1J12A 2VC9A 1W3HA 4NF7A 3WK1A 4YVPA 5CSSA 4XZHA 3GVWA 3STCA 7ODCA 1DXIA 3H70A 3R12A 1NIUA 1W9PA 4LYPA 3VC5A 4FNSA 4ZQCA 2Z7KA 3N18A 3TYAA 1IE7C 4B92A 1LBLA 2JEQA 3NEHA 3AU2A 3NR0A 1O94A 4UFMA 1EO5A 1H63A 3N9SA 3DYPA 2GVYA 4J3ZA 4Z0SA 1XS2A 1XLDA 5DY2A 3ATZA 4O57A 4OJYA 3CQ0A 2NLIA 4WKAA 4AZGA 4NX5A 4J4KA 1AQHA 3AS3A 1XSJA 3WQ6A 1FWHC 5A8NA 2ZDRA 5ECUA 1DE5A 4F0LA 4FXFA 3IAQA 5AC6A 3K4WA 3E9AA 5I5RA 3I3EA 2OCZA 4Q8OA 4KEVA 4EWND 1DHPA 1QPKA 3CV6A 1UKPA 3P14A 2ZVRA 3NPWA 3M9YA 1BSLA 2XISA 3HFTA 1XIBA 4DWDA 1LM1A 5A6SA 2FKPA 4DAIA 1G4PA 1CGXA 4K38A 1R9YA 2QUMA 1B3VA 2FVMA 1AW5A 3L5AA 3LENA 2YL9A 3LHUA 2IQTA 1FCVA 4PUJA 2YZ5A 4Y2WA 2VEIA 3L12A 4JN7A 4P7OA 3W29A 3DIPA 3CZLA 1JPDX 1IHIA 3CEPA 4AXNA 2A5HA 1U22A 3W2KA 1H5VA 4C6LA 5IHSA 5BOEA 3CAQA 5DLCA 1KFLA 3E0LA 4ZOBA 2XZ9A 4YJ5A 3SADA 5KZDA 3KZPA 1VBHA 4I5UA 2WLZA 3OW1A 3CHFA 4RR4A 2SFPA 5FJOA 4LQ1A 3EWDA 1KWKA 3OVPA 5AKQA 3R8GA 4C60A 1WB0A 5CSRA 1YHTA 3LPPA 3ZR4A 1QAPA 4CNTA 1UD6A 2FMNA 1AJ2A 1PIGA 4KS0A 1BWLA 1JVNA 3PZOA 5CZ0A 4A3QA 4IOTA 3IIPA 1XLJA 2Z1XA 2ZBTA 1P0NA 1YE6A 4F79A 2PD9A 1R3RA 4IX2A 3UPBA 3D3FA 2AQOA 4ZB5A 3VX0A 1TE1A 3UT0A 4TV6A 3G77A 1RSCA 3W23A 4ECLA 4RCXA 1OHLA 1U5JA 4CVWA 5CJMA 4EACA 2YDSA 4QR6A 4UFKA 2Z29A 1D2KA 2CYGA 3FJNA 3HJEA 1G67A 3UG4A 3VOCA 1T99A 4E2VA 1H7RA 2DVXA 4LV9A 3VFCA 2WJEA 1GTEA 3GHSA 1QW8A 1O68A 2VFDA 3NQ2A 2OVLA 4XO6A 4W84A 1SJAA 2PTYA 2DP3A 3L7RA 1QUMA 4IGNA 3BLFA 2PDYA 5EU9A 1ZHAA 4ZXOA 4GABA 3IARA 3CS2A 2V3EA 2F84A 4AFYA 4GVHA 3XISA 4JNYA 2OWXA 3UWVA 1TMQA 1XLAA 4LCRA 1E6RA 4QQUA 2QV4A 1TWZA 4YCPA 3THCA 1I2QA 4LJ3A 1E4MM 4DXVA 1M41A 2WC4A 3NL6A 3SUWA 4J27A 3VO0A 3ITGA 3CAKA 4JTJA 3MP3A 3C2OA 1LDCA 1ML1A 4DF0A 4AF0B 4JTAA 1JZ5A 3WD3A 4Z1DA 5A8GA 5J5DA 1EF3A 4XTDA 3WSUA 5DCDA 1R3SA 3ES7A 4DJDC 1EH9A 2Z1VA 2WWDA 1T7LA 1QTWA 1E4IA 4D6FA 5G4EA 1K9EA 2JF6A 5A6BD 4KF1A 3F4WA 2BY1A 4V28A 3C86A 4KRZA 2CW6A 3U5YA 1YBQB 1LLWA 3ABZA 4DJEC 4HPJA 2ATSA 2NWRA 1R3TA 4V1XA 2CITA 1KFJA 3FAWA 4KWWA 1U1JA 1JYXA 3MU7A 1Q13A 1CLKA 2WNWA 3HFYA 2XU2A 3QQ1A 3MI6A 2DQWA 2WSRA 2BOFX 2XVGA 4DWSD 5CC3A 5A8PA 3WO8A 1ECQA 4NJKA 4O0KA 1UUOA 4D1IA 1W1VA 3WD0A 2E9LA 3SIMA 1MUMA 1QT1A 4JXCA 4REQB 3TEVA 4UZUA 4C6MA 2EO7A 3C2EA 4FNRA 1VCFA 2A21A 2PP0A 4DB7A 2B7QA 3KM8A 1PX3A 1LQ2A 5CQ1A 3R43A 1UR8A 1YDNA 2PWDA 3WJXA 4L1GA 1VCGA 1XG4A 4AF0A 1VYPX 3HO8A 1QPQA 3BOXA 2FPVA 4R27A 2J9ZA 4MUZA 1ENUA 3S4TA 2FDSA 4LNYA 3L23A 3A47A 4MTVA 2RKXA 3GVVA 4UFIA 3ENLA 4HNVA 2QGYA 5HUPA 1W5QA 3F5JA 4NRSA 4PCPA 2X1UA 3FEQA 3M6DA 2J77A 1JUEA 1V0KA 5AHFA 4QSHA 1YBQA 2XUCA 2XGBA 2CXEA 4D8AA 4NIRA 1FHDA 2Z4GA 1JCXA 7REQB 3QSTA 2HS8A 1UWTA 1V7YA 5D9OA 4YYCA 1HIZA 3YPIA 3LM3A 4XO7A 3MI2A 1IGSA 3VKJA 3BG3A 2J8TA 1QI4A 4GCXA 4GH3A 3AJXA 3ARZA 2V3DA 2X30A 1BGGA 1E72M 3ANUA 2I14A 3AIQA 2KZHA 3MV01 3U7VA 1DXEA 3LCLA 2YFOA 4REQA 5BCAA 4JTKA 4LVBA 4DN1A 3ITVA 5K2ZA 2ZE3A 3SN4A 3GZAA 4R34A 3C0JA 2OT0A 2QV5A 4WQ6A 1V0LA 3GS6A 1GZ1A 1A47A 1EYWA 3S6OA 4IXXA 1TJ0A 3OLEA 3HZ3A 4CNUA 3VYLA 4LALA 1I9CB 3URAA 4U5KA 1QDSA 1QI2A 4C7FA 3UVAA 1K7EA 1BRLB 1MMFA 5BNKA 1R9ZA 3LOTA 5LA2A 4JHZA 3B0YA 2YBVA 2V69A 3BSHA 1GYMA 2QKFA 1UR4A 1KCXA 7REQA 3SCSA 1L6FA 1XYFA 4DO5A 1TPC1 3FY1A 5E70A 3TSBA 2POTA 1HN1A 1V6WA 2Y8KA 3N34A 2VURA 4Q8VA 2XH0A 3VNYA 1TR9A 4ZVJA 2DSVA 3DUGA 5T9CE 3CGTA 2MUCA 3EEGA 1H09A 5FOOA 3OO2A 1J0KA 4IPJA 1WKYA 1CPUA 5CAHA 3P60A 3M0MA 2GUUA 3DU0A 1OZMA 4FEZA 2ZZ4A 4B3KA 1H50A 1Z8AA 1XKYA 4EXQA 3D3AA 1WA3A 3E12A 4JIRA 2PDQA 3LRLA 3RJYA 3ARSA 4GJJA 4DY1A 3EWCA 3C3UA 2GUYA 4KIEA 2R14A 1YXCA 2P3ZA 3UNDA 2BP1A 4IFOA 1QI0A 4FK9A 4XQ6A 1B9BA 3RM9A 2Y5SA 2NXGA 1KFKA 4UQCA 3W7KA 3WEMA 4Q6JA 3KRSA 4OUEA 4CVUA 1TELA 3H2NA 1KFEA 3NG3A 1BRLA 1WP6A 1QWGA 4EPBC 2PGWA 2HBXA 2JK2A 4BWLC 1OC5A 4Q8WA 1ZAJA 4LAMA 4P61A 1YNQA 2YYTA 3NSXA 2J6VA 1TZ7A 1G4TA 2R24A 3A9BA 2VL4A 4ICCX 5I3FA 2FJUB 2XVNA 3GBEA 5HJXA 1A4LA 4UIOA 4HMDA 1YADA 1TUXA 5GQBA 5F4SA 3EX4A 3MQTA 4ZOAA 3ELFA 4XBKA 1PXGA 4GXMA 1XYCA 4O13A 4MKNA 1N8WA 3GC5A 4XZ9A 3TMLA 3UW6A 1SZEA 2CU0A 2GWGA 1ZBCA 3R10A 1VQTA 3ZWSA 1FX6A 4Q33A 2F6KA 1NQ6A 3LA4A 3VI2A 3LCGA 3H7RA 3S2MA 3BLLA 2YR1A 2FB3A 1L8NA 3ZS4A 4UTKA 2VJXA 5DN1A 3SDOA 1TPWA 2OTDA 3W7QA 3EPNA 4MY8A 3N2XA 1VB9A 1YNPA 2PC4A 5PTDA 4AW7A 4W8AA 1O5RA 2A3BA 3A3HA 5FSEC 4FLRA 4GE8A 4B3LA 3KHDA 1PZ2A 1H41A 1WBJA 1HKJA 3VMOA 1OFPA 4U3CA 4DQWA 3PHAA 3QPEA 3TTSA 4LVGA 2OQYA 1UD2A 3SRKA 1K8XA 3LM7A 1R5YA 1FWIC 3MP4A 5CPTA 1C90A 2YDRA 2AGTA 5A95A 4UOQA 1AL8A 3P6LA 2FZMA 5BZAA 4Q3MA 4JTUA 2ACSA 4H9TA 2BG5A 1I2RA 4GIRA 1TMHA 1ICSA 4Y9NA 4R53A 3APGA 1QPOA 3BH4A 3DYOA 3PZVA 3WMSA 5LKYA 4O1BA 2PS2A 1ZJBA 1LP6A 3K1GA 5C9XA 1HGWA 2V6AA 5FJJA 4S3GA 2OQLA 1GQLA 4NZCA 4PUDA 5TAOA 2JEPA 5G5IA 1ISVA 1XBXA 4JFUA 5AHIA 5DXXA 1B9ZA 4UTJA 1R0MA 1A5KC 4ACYA 5HA7A 3BUVA 1OX4B 3GR4A 4A3RA 1XX1A 3SIZA 4NXSA 3W2UA 1XLMA 1CLVA 3LV5A 5HMSA 4CLMA 2ZXAA 4GG9A 1Q66A 1VKFA 2OLAA 3OB8A 4X9SA 4MPQA 1XLHA 2BVWA 1P48A 3S2CA 1XUZA 1QMLA 1I75A 3GXFA 4DJEA 9XIMA 1B30A 1HGYA 3GXTA 5E09A 1ME8A 3PSVA 1W3NA 1EP1A 1S5VA 2WKJA 2OEKA 3WQCA 4N9DA 3IEBA 4KEZA 1E55A 3IUIA 3BSGA 2Y6ZA 3SCRA 4J28A 2ZXBA 2J6XA 1CENA 1VFLA 5BOOA 3HG3A 4EX4A 1ZU8A 3W7RA 4A35A 2XZ7A 1H0IA 3GHRA 2R91A 1BXBA 2UV8G 4AC7C 2XSBA 4PRWA 1UWUA 2IPWA 3RPDA 3C5QA 1SW7A 2W92A 5REQB 1V6TA 2ICSA 4K36A 3PBYA 1OX4A 4QHRA 3ZM8A 2X42A 1DWFM 3NQGA 1GNXA 1GOIA 3THUA 3HTWA 1S5MA 3BV4A 3RR4A 5BXRA 3VKBA 2YLLA 3FFSA 5FSDC 3DEQA 5HXMA 3SQMA 3SGUA 2UBPC 1GPFA 3LZ5A 2GJRA 4RE0A 1RH9A 5JQ9A 4QDMA 3L0KA 1HJUA 2ZUMA 3V5OA 3I4EA 1KCLA 2B0MA 1EP3A 1I0DA 4IUOA 3MMTA 3VIHA 4QLLA 4HGXA 3QFWA 1GJPA 3UWQA 2PLCA 3QMTA 3M0YA 3TSDA 1R46A 3NNTA 3ITOA 4Z2JA 2J78A 3HQNA 4LF2A 2AQWA 3MANA 3IGXA 4QJ3B 1HJWA 4AIOA 1UPPA 2ZXQA 1DWJM 4HZ8A 5REQA 5FL0A 3RMEA 3WDJA 2VR4A 4WDXA 2ODOA 1YPIA 3CYJA 2GGJA 2V8ZA 2EG7A 1OK6A 2BHUA 4MYAA 2EG8A 5K3VA 3W1QA 1JYWA 1WCGA 1A4MA 1XC4A 5KITA 3WNPA 3M47A 2YGYA 4Z1CA 3TFCA 4PFMA 4FF7A 1I2NA 2GZXA 1A5UA 4LCSA 3FCPA 4KWOA 3ZVHB 2NVDA 2ABAA 5BRPA 2NQHA 2Y8UA 3QHNA 2EQDA 4RNIA 1DJZA 1ZAIA 3NGFA 3ATYA 1U33A 4UUIA 3L4XA 3C4UA 3O6YX 4ZXLA 4MB1A 1TSIA 1WO2A 2PWFA 1NFBA 2C15A 4NG3A 3ZYZA 3NSNA 3NEVA 3A5FA 5HJYA 3LHYA 3CEUA 1S1PA 4M6UA 1GVFA 1YKWA 4A3UA 3LNMA 3NQCA 1TPFA 2GSEA 3IVSA 4NYYA 2PPGA 3PZGA 3F4NA 4B4FA 2YKKA 4H7ZA 4MZ8A 3UG5A 2WHMA 3WH5A 1RQHA 1N8IA 1XBYA 2R94A 3MCOA 3PG9A 4BWLA 4A2RA 2VC6A 4J40A 4GQBA 3KL5A 2R8WA 3PTDA 4BF7A 5AFDA 2BTMA 3ZVHA 3PZNA 2YL6A 3CV2A 1O12A 4B15A 1ELSA 3CMJA 3WMLA 1FY6A 4RV8A 4L56A 3AIEA 2GLKA 4CCEA 2ZWZA 3QOMA 2NV9A 2H3DA 1BQGA 2ACQA 4MNKA 3S0CA 5AN7A 4OOZA 4RPQA 5K7JA 1PIIA 3ARXA 5ENLA 3NM1A 4YTQA 4HPXA 2J7FA 1GZGA 4BZYA 4I8YA 1DORA 5ABHA 4Z42C 4ZQOA 5C70A 4WDUA 2A6NA 3KCLA 2QCHA 4FR1A 1Q6OA 3HF3A 3M0HA 4F8XA 1KFCA 3OBKA 4ZSUA 1TV8A 2WZEA 1EPXA 4F2BA 1Z42A 4NUWA 2NQLA 3VOIA 3MO4A 1JNEA 1AFSA 4O1FA 1FCQA 4PN2A 2VCCA 1R87A 1JR1A 1H7NA 1ESWA 1FWBC 3EDDA 2RUSA 1HVXA 3ARPA 1OYCA 3VKKA 3T4WA 1W9UA 2HE8A 2XN1A 3KVJA 3W84A 5LNVA 3DAQA 2YBUA 4ZSTA 3WFAA 1J79A 3LBCA 4Q4PA 1B57A 4Z2GA 1PHQA 2AL2B 2ZTJA 3WCZA 4MY9A 1HL9A 4W93A 1C9WA 4NL1A 1FTXA 3TTEA 2HXUA 4IMEA 4ASTA 1IWAA 4UFJA 3SQSA 1SFTA 1XLLA 4U2YA 2NZLA 3W7NA 1TV7A 3O6DA 1W0MA 4RW5A 4TMCA 1LT8A 1ZLPA 4ONVA 3A6OA 3ZT6A 3N6QA 3SEPA 3DECA 2PTZA 4KH2A 5D2XA 4UQDA 1O60A 1KV8A 4K1WA 1MRAA 3AS0A 3FHQA 1LWHA 3PS7A 4ATLA 3ANVA 3W1RA 4S39A 2AMGA 4LCQA 3S9YA 3O2LA 1UKTA 1WAUA 1P7TB 2WZTA 4ILSA 1XSKA 5EFDA 2YDAA 2WM1A 4W7VA 1UASA 4WSKA 1TWIA 1KCKA 1FA2A 1BG9A 4TMBA 3S2JA 2AL2A 2VI0A 1CB7B 3ARQA 3P74A 3IRSA 2PDLA 3EEZA 2MNRA 3OVGA 1V3MA 3WELA 5KINA 2QCLA 3EKLA 1GQIA 5I2UA 3V0UA 3RHGA 1FWFC 1ALDA 1TR1A 5CJ5A 1E9ZB 1TJ2A 4HNLA 1E6QM 3OQEA 3DOPA 4YWSA 1PDZA 2GQ3A 3STEA 2PDNA 1NOWA 3SFKA 1JZ6A 5I3GA 4GVGA 1KGXA 2Q02A 1FVPA 3GQYA 3PPCA 1J0IA 1VEOA 2VX4A 2R1PA 2E6AA 4Q4OA 4AD3A 2QPSA 3VU2A 3Q58A 5BOFA 1F3XA 2VGFA 3WD1A 2BGNE 3UJFA 1P7TA 2O92A 3UXKA 2VCAA 1KBKA 1JCTA 4PUWA 1Q7ZA 3M16A 2QCNA 4IGSA 3V5CA 4FZIA 1YX1A 1XCFA 1ZJHA 1Z41A 1ZFJA 2BFGA 3MUAA 4S1FA 1RD6A 1YEYA 5KSWA 2DT1A 1H7WA 2F6XA 4C1NB 1EXPA 1LL7A 3O07A 1W1PA 3W1UA 2Q8XA 1FHUA 2WJZA 3WUBA 3VOJA 1YIXA 4C1LA 2VELA 2F9RA 1XIEA 3DHPA 1IR1A 2ZRZA 3LCFA 4YPJA 1I0BA 1P43A 3NO3A 1U5VA 3U4AA 3VIOA 4US5A 4F2UA 4D6GA 2YSWA 4GHRA 2FLIA 3C8FA 1WE5A 4JICA 5CPOA 5D03A 3SCNA 4AUBA 1V3LA 4OBSA 4UB9A 1LJYA 1NWRA 4YTUA 4H83A 2O7QA 2YA2A 5F4XA 2OR2A 1GT8A 1OVDA 1F61A 1R3WA 5LIWX 3PUOA 1KTCA 2FIQA 4WVXA 3PC0A 4WSJA 4GIAA 4OIFA 4N4QA 1PJ9A 4DXKA 2C3ZA 2C14A 3CL6A 3EKGA 3E1F1 2LLEA 3G1AA 1V0NA 5LGZA 4YXGA 3H22A 4K6AA 3STFA 3G6LA 1XFCA 2QCMA 3EA3A 1E0XA 3LV6A 5FF0A 1UIOA 3H4GA 2YCKX 1E43A 1XYBA 1ISXA 1ZSXA 4GC4A 5FEZA 2R6OA 4AQLA 2WHLA 5CBJA 1Y7VA 1NAL1 4JIIX 2UY5A 3K5XA 4S3FA 1K4HA 3S46A 4C1NA 2FTWA 3G5EA 3NFUA 3KBJA 5BRQA 1FCBA 2A2IA 1W1ZA 3KOWA 3TQVA 4B3ZA 3NTYA 4P8UA 3CB3A 4PCFA 3O6CA 4NJHA 4NNAA 4XX6A 5HINA 5E9XA 4J35A 3UP8A 1FWDC 1JCNA 1Y8BA 2NWSA 1T0OA 4D72A 3RJXA 4P2VA 1X6LA 1H61A 3HA1A 4ZTYA 5CG0A 3UA4A 2YX0A 1Z89A 3PNUA 5A6AA 3AMKA 5LHFA 1YXDA 4B5NA 1BXCA 2Z1WA 3M5VA 5BMWA 1TA3B 3IJ8A 1OFQA 4CD7A 3UG8A 5TF0A 1CGUA 3VC6A 1W8SA 4IUGA 2L5HA 3WNOA 3WEZA 3VCRA 5I09A 1EJVC 4I7UA 4LPCA 5D30A 3CUXA 3B03A 4DJFC 4BI6A 4IPNB 5MHBA 3JZEA 3MZ2A 3ITTA 2C79A 2OOGA 3H4WA 1EX5A 5EBAA 3V36A 4HU0A 3OHIA 2P8CA 3BG9A 5HQEA 4TR9A 2WKLA 2G41A 2X1RA 1W9DM 4NXKA 4I6KA 5A6LA 5CGTA 1IEXA 5FF4A 3T55A 4ATWA 1H4PA 4D6IA 4W7WA 3CIXA 1J6PA 2NQ9A 1LBMA 2WMJA 1WOAA 2GGGA 2FPTA 1P0KA 3QC0A 4DAFA 4F0RA 3SI9A 2OO6A 2ONEA 2QCCA 1R9XA 4DM1A 2CIPA 2D22A 3CLWA 2FB2A 3OP2A 3QGAC 3AHTA 4NZ5A 2IKJA 4DPQA 3MWAA 2V5LA 3SN0A 2HSAA 3U48A 5JIWA 4IP4A 3TYCA 2CESA 4GQRA 1XLCA 1XV8A 3T78A 1SO3A 1GVIA 3ONCA 4ALDA 3AMLA 4GVFA 2CLMA 2RH9A 3GU9A 5HOSA 1F05A 4F0KA 1VPYA 3DYMA 3M5ZA 4F9DA 3FAXA 1RJRA 4GBUA 1J0ZA 3B8TA 1P0DA 2J66A 1C9DA 1HW6A 1BF2A 1FWCC 5BRBA 4IQLA 3CWHA 3WLNA 2PDIA 4WJXA 1MXSA 2PDMA 1XPGA 1V93A 1TX2A 5CCZA 4H6QA 4FXJA 1ZBKA 2A79A 3DFNA 3G0XA 2BGQA 1W2PA 3LTSA 3CB8A 4HTYA 3N9RA 2FZNA 2E8ZA 5E5CA 5J04A 2VTFA 1XYAA 5A8MA 3PB0A 4TTUA 2XM1A 3KBWA 3OGVA 1ZP4A 4BI7A 3T0DA 1AK5A 3WMCA 4B5XA 3L4ZA 4DPPA 4C6EA 1YW1A 3CV7A 4IT1A 4E6MA 4AZ7A 2G3NA 2I5IA 2V3FA 1FP9A 1VYRA 4XKYB 3M5XA 5EFFA 3DFHA 4N7QA 3TC7A 3NIYA 1HZYA 2GDUA 2OSXA 4LC8A 3WY1A 3DFYA 1UWQA 1F8IA 2WLYA 3P61A 1P0BA 1XBZA 4Y7EA 2GDQA 4ZB0A 1K6AA 4DBSA 3OA3A 2QVNA 3MMUA 3BK0A 5IHRA 1XQKA 3IUHA 4S23A 4ZOCA 1X1NA 5DY3A 4LUSA 4LW7A 5HNTA 4LB4A 3C0LA 2NT0A 3IJ6A 1A0DA 4A8IA 1RA5A 3LGEA 5ABEA 3NQBA 2XIIA 2H8ZA 3FOKA 2D73A 3S5ZA 2VMFA 4V1YA 5HMEA 3UJ2A 1GVEA 4DZIA 2Z6JA 1X1OA 3DN5A 4AZCB 3SM0A 1IWPA 1EHAA 1KKRA 1UWSA 3AALA 2HNHA 1XKJA 2Z1BA 1MO0A 5CEWA 1V79A 3B0XA 4PODA 1JRBA 4MLRA 2C0AA 4XKYA 1V3KA 5U7SA 4MJ2A 4ROPA 2CKRA 1WKDA 3VD3A 3XIMA 3G1RA 1UD8A 3WK3A 3GK0A 3ZXWA 3FJ6A 3PF3A 1G9HA 3GG1A 3VGEA 4CU6A 2BASA 4DYJA 2FGBA 3Q67A 4WLCA 1GKRA 3CBWA 1SPQA 2EEXA 1A50A 1J96A 5TIMA