2QJHA

M. jannaschii adh synthase covalently bound to dihydroxyacetone phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
b'ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 88
structure length 264
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjhA00
4K38A 4RZ5A 2XN2A 4JY8A 4PEKA 5FF7A 5D2XA 4RR4A 5FEWA 2ZTKA 3FYPA 2E5CA 3UWZA 1BWKA 4MJZA 3M9YA 1T8XA 4ADUA 3SR7A 4AWSA 1LLZA 4LS1A 3C2EA 2ZYFA 3NGJA 4UFJA 3QPZA 4JNMA 3SW6A 1PCKA 3W88A 3V1PA 3P60A 3VFLA 3W76A 2X1UA 3THQA 5DN1A 3LV5A 1PE1A 1G7VA 5U7SA 4O17A 1TV5A 1O94A 4AWUA 3W2NA 5TIMA 1D9EA 3C2FA 3LCXA 5AHEA 1K8YA 1OFAA 4BR1A 3U2OA 3S1VA 1TSIA 3QPYA 1S3HA 1YTKA 3L65A 2A21A 2A4AA 3NQ2A 1K02A 3LCIA 4PL2A 5G1YA 4XTDA 1VS1A 5FF3A 5LKYA 3NXFA 3KX6A 3W3OA 5AC7A 4DF0A 1X8FA 2AAMA 3TJLA 3LCWA 3CPRA 2WSYA 4DBDA 5CGQA 1CX9A 4FNQA 1JUKA 3L0NA 4O4WA 4OWGA 3IV3A 5FESA 3STCA 3CEUA 3ABSA 3FFSA 5J5RA 3L5AA 4JYDA 1OF8A 4LT9A 4PH6A 4GXMA 3TIMA 2BTMA 1H7NA 3W75A 2H6RA 3TE9A 1HL2A 2CLFA 2R14A 5F4SA 2ISVA 1M7OA 3LB0A 2R8WA 1TJRA 1W5QA 3W72A 3G1DA 4BF9A 3SIZA 1I2QA 3A21A 3P8JA 2RHGA 4Z1BA 4LU0A 4CNPA 3UXAA 3T4CA 1BWLA 3EWUA 3IIZA 4UMAA 1DJNA 3I68A 1QWGA 3GXNA 2QUVA 1KFKA 5F4WA 2PE4A 4E2DA 3SGZA 3WFAA 5H2ZA 3NNTA 2V2HA 4OBTA 1XUUA 3W22A 1ZFJA 3MJYA 3A9IA 3SJ3A 3LI1A 4JXCA 5U4NA 4LUJA 3GYEA 5EMUA 1B4KA 2PURA 4QIUA 1C29A 4UFHA 2YXGA 3MHFA 4GBUA 2NWSA 4JTJA 1J4EA 5AC8A 2E5DA 3P8IA 3EX4A 1HO4A 1E51A 1FX6A 2GJLA 4JY9A 1I4NA 4L4LA 3DH7A 1S5WA 3M5ZA 2X2GA 3MI3A 2QAFA 2F84A 3TDFA 1P4CA 3NZRA 1F74A 1LOSA 2A5HA 5BMWA 1VHCA 2O7QA 3OIXA 2WNNA 4HKPA 1T99A 4M6QA 1PL9A 1IXPA 2VFHA 3GNDA 3UXDA 2Y89A 1GQNA 2H3DA 2X1SA 3G1VA 2ABAA 1WA3A 3T7VA 2Y85A 4MLRA 4NJIA 3W7IA 1P5BA 3M1ZA 1KM1A 1SZEA 4CLMA 2WSQA 3BVJA 3C2OA 2ALDA 1TTIA 4ADTA 1TTPA 3C0JA 3HG3A 3DFNA 1VHNA 3DXIA 4JTSA 4E38A 5HULA 3I7SA 4OQVA 1RVGA 4R33A 1YYAA 4Z1AA 3CT7A 3KOFA 2GJNA 4NJKA 4FX7A 3NVTA 4FO4A 5K2ZA 3WJWA 2NV2A 4MPQA 5ABTA 3NL5A 6TIMA 3NA8A 2Y88A 2FPTA 5HR6A 3PSWA 5HWMA 3H54A 2WV8A 2NUYA 3EB2A 1MSSA 4U28A 3G1XA 1YXDA 1OX4A 4M19A 1M6JA 5AB3A 3ZWSA 3OHIA 1TB3A 5D37A 4XUGA 1LBLA 3HIJA 1YPFA 4UUIA 4O1BA 2P10A 1SW7A 2W79A 1D3GA 3FYOA 4QJ1A 5K3VA 3ZS4A 1DV7A 4BFAA 4JD4A 3I7QA 3W1LA 3TKFA 2HS6A 5DELA 1Q6QA 3OVQA 4ML9A 1KFLA 3L5MA 3NL3A 1IF2A 2QJGA 1Q6LA 2WSRA 3W7QA 1XL9A 3WJYA 1OF6A 2FPYA 4WQ6A 3T78A 3PUDA 5HUOA 3UWWA 4PTNA 3TAOA 5KITA 3MP4A 2ZFAA 3HGJA 4RX0A 5E1QA 4LWWA 4UTWC 2DJLA 1DBTA 2YCEA 4ORIA 4Q4KA 1C9DA 4X3ZA 3QH2A 3GDTA 4AF0A 1JUEA 1F05A 1FCBA 1RPXA 3G3DA 1SSDA 2LLEA 5KMYA 3BGGA 3O6YX 1KTBA 5DCDA 1L6YA 1HFBA 4CQ9A 1J5TA 3GKFA 3IVUA 1OFOA 1C8VA 1IIGA 2YPIA 2GQAA 1OFRA 2QJHA 1PHQA 4MY9A 3RLVA 4L4MA 5FEPA 1FXPA 5A8GA 3O07A 3QFEA 4IQLA 3IEBA 1PVNA 1SZNA 5LHFA 1OHLA 4ALDA 2BSLA 3LERA 1F76A 1ZALA 4AF0B 3N14A 2Y70A 1ZAIA 5F2LA 1GYNA 2ZRXA 2FB2A 2V5BA 1LM1A 5AOUA 3WK3A 3PULA 3LHTA 4O1AA 1SFJA 4ZZ9A 1N8FA 3IVSA 2X30A 4JEQA 5D05A 3TU9A 4DQWA 1G69A 1YDNA 3W7PA 3G0XA 3ELFA 1G4EA 3FOKA 1TREA 3GX9A 2A6LA 2E09A 3M5VA 3HPSA 4A2RA 4O14A 4JS3A 5IBXA 5AHMA 4ZMGA 4Z1DA 3O06A 4AVFA 4A2SA 4MVAA 2BZNA 3R12A 1LDCA 1K8ZA 2QDHA 5CPLA 2VFEA 3HBLA 3H53A 1B3OA 1QO5A 3BGJA 3T40A 4UTTC 4M7TA 4AXKA 4O13A 3WJXA 2V5LA 4GWEA 4FIQA 4HSNA 4UTLA 4AH7A 1UBSA 1JJKA 3G1AA 4NXKA 4NVTA 3W2UA 5BW6A 2DJXA 1OFQA 3TC6A 3T55A 2ZZ6A 3LLDA 4R53A 3DU0A 5HR7A 3UWQA 2ABBA 1XUZA 3FA5A 3WK2A 1V5XA 1R30A 1ZY9A 4KWWA 4PC8A 2C0AA 2YX0A 5F1UA 1NVMA 4P61A 3R8RA 1QR7A 3L5LA 3FKRA 1JCXA 2E6DA 1FCUA 2VENA 2Z2UA 2NV1A 1B57A 4FEZA 4O53A 3NM3A 3S5OA 3LOTA 4HNUA 2EF9A 5GVJA 1W3NA 3TC7A 2CLHA 2ZRUA 5CZTA 4OE7A 5D04C 1W56A 2QCGA 2ZCGA 1JVNA 3W1RA 3W1QA 3WK0A 5D2VA 3KRSA 3MW7A 3QQ1A 3WK1A 3W1NA 1N7KA 3B0VC 4FNSA 4MOZA 3FLUA 5LNRA 4FIRA 1EIXA 3DBPA 1TCDA 2VEKA 1A5CA 1NAL1 4S2BA 4IMCA 4PFMA 2RKXA 1SW3A 3KVKA 3FS2A 3NQ8A 3PG8A 4XBKA 3NOEA 1G4SA 2OT0A 2YSWA 4RZ4A 4KFNA 4N2YA 3L68A 4OGZA 2A1YA 3C4UA 1PS9A 4PA8A 4U4MA 4LNYA 3G0SA 2JK2A 4LVDA 3CWNA 4O57A 3SY5A 3W84A 4MYAA 5G2HA 4WY0B 5F2IA 3NL2A 1GVFA 2CLIA 3MP5A 3TSDA 4D2JA 3C2RA 3RMJA 4IMGA 1KM3A 4UTJA 3HGSA 3NPVA 1K7FA 3CEPA 2F7FA 3P5ZA 3N2MA 1VH7A 2DORA 4ZQOA 5F2GA 1TTQA 5BOOA 3RNDA 4BWLA 1A5SA 5I3GA 5FF0A 2CLMA 2DP3A 3VE9A 3THAA 1TO3A 1QOPA 1YADA 3LHUA 4ZQCA 1UASA 3TH6A 4IXXA 4M6PA 2ZBTA 1EP1A 4XKYB 5AC6A 1S5TA 4MJMA 4EF9A 1H50A 5AN7A 5G4WA 2B7QA 3DFQA 3VKJA 4HNNA 3P5YA 5H91A 3OA3A 2TPSA 1XBXA 2Y6ZA 5HJLA 4YCOA 3TCEA 5CPOA 1IGSA 1EUNA 4NU7A 3E0IA 3BW3A 2FFCA 1ME7A 1SO3A 4JX4A 2C14A 1K8XA 5F2MA 1XBYA 5D30A 1M7PA 3WJZA 3USBA 4JTKA 4O18A 4JTLA 3ATYA 2Y7GA 2VKZG 4FXRA 2X16A 4K7YA 4DEFA 1JCJA 4K6AA 3SZ8A 1V7YA 5G1TA 1F5ZA 3UQNA 2ISWA 2VEMA 3UWUA 4KFOA 1FY6A 1LRNA 4IXHA 4A3UA 1RQHA 1U83A 4QQ3A 1TQJA 1OJXA 3NQDA 4LVAA 3TFXA 1KV8A 3UY8A 1ICPA 2V82A 2J88A 3M5XA 3UZ5A 4ICNA 3LM7A 4JX6A 4M6VA 4K39A 2DZWA 4N9EA 2PRHA 4AWTA 3NQ6A 1HO1A 1KFCA 3LDVA 3QF0A 5F1VA 1SZFA 3LTYA 1JUBA 2UV8G 4JICA 3UYCA 3P7YA 4AHQA 2YGYA 4JYFA 4GFSA 3RLUA 6ALDA 2C18A 4QNWA 1IIHA 3W2KA 1RQBA 3NEVA 3TJXA 4IX0A 4FHAA 3W9ZA 3QC3A 3MHGA 3GDLA 4LS2A 2H8XA 5D32A 4CQ8A 3SI9A 2NWRA 4GUGA 3P81A 1OABA 1ZAJA 3QW4B 4MZ8A 3UWYA 1R47A 2Z0IA 1YTEA 1FDZA 3QJAA 4TO8A 5AFDA 3G24A 3GB6A 2ZA2A 4AMAA 5AHNA 4JTIA 2VELA 5DY3A 1WX0A 5AHFA 3NM1A 1QFEA 3EWZA 3LTPA 3S1XA 2QCDA 4RXFA 3S5ZA 4N4PA 1JCYA 3DZ1A 1KM6A 3W7RA 1WBHA 3EXTA 1VCVA 2WNQA 4QM1A 1GTHA 4YMZA 2OJPA 3CU2A 2CU0A 5D2YA 5LNWA 2TYSA 2Y61A 5AYYA 3MUXA 3E9AA 2B0MA 2YR1A 3CC1A 3STEA 1O60A 1WOAA 3PS7A 4XBSA 5DLCA 3TAKA 3LXBA 4UC5A 1KTCA 4MYXA 3NZ1A 3LBMA 2H3BA 4N6FA 3GDRA 4TIMA 4GUJA 3N2XA 2CFFA 5LGZA 2E68A 1TRDA 3W71A 4JTTA 3WJSA 5HQEA 3TUUA 3TK7A 2H8ZA 1LYXA 1T0OA 3BO9A 2YW3A 3EKZA 2PC4A 3DHDA 3UY7A 3NQAA 1GEQA 5KSWA 3H55A 3W1AA 1LBMA 1OYBA 8TIMA 1VLIA 1GTEA 3SSJA 3OEXA 2Q3RA 4KFPA 5D38A 5D33A 5T26A 4FX6M 4Y90A 4RLIA 3LX9A 1NSJA 2QUUA 4H6KA 2QCHA 2E6YA 1GVOA 4UFKA 2EKCA 2DZTA 4X9SA 4K7VA 2Y62A 1TPWA 1LORA 3Q58A 3QZEA 1DQXA 2J24A 3W7LA 4RCXA 3R89A 1WBJA 1ICQA 4DO5A 5LGXA 3LRLA 4LY8A 3F4NA 4N4QA 1JQXA 3INPA 4DF1A 1TRIA 2HMCA 2C15A 2OT1A 4JTEA 1YDVA 1OFEA 3W7KA 3MBDA 1EX5A 1SQ7A 1Q6RA 1N55A 4NZFA 1PIIA 1VQTA 4RV8A 1XKYA 5HWJA 2V30A 4DXVA 5HWNA 3M43A 2CLKA 3N73A 2G95A 4UTHA 1KFJA 1NEYA 3QMRA 4JDBA 4EWND 3U6WA 5G4EA 1KFEA 4EOUA 3W2MA 3P80A 1TMHA 4C1KA 5I3IA 2E1DA 4CCCA 3C2VA 2RDUA 4R7JA 4ZVJA 3O1NA 4ZQPA 1JQVA 3JS3A 2QAPA 4GE8A 3R5EA 3A22A 3E02A 3TMQA 2QCMA 2ZZ5A 4ZL1A 2B4GA 5LNVA 3CWOX 4TU1A 2EHHA 3CIWA 1QPQA 3NQ7A 3NQVA 1GG0A 1GJPA 1KA9F 4MKNA 4AHOA 4A21A 4DBEA 3NL6A 4TMBA 2RDWA 3EWBX 4DO6A 2FLIA 3QEZA 3L2IA 5EYWA 3JRKA 2VEIA 2HS8A 1TPEA 3C56A 4GUIA 1YXYA 3W2LA 1ZJIA 2NXIA 1F6PA 2E5BA 3OVPA 5CG7A 4MZ1A 3HO8A 3HG4A 4MFDA 1TPB1 1O5XA 4CCDA 5F4XA 3MYPA 1W5NA 1DJQA 1OX4B 3G1SA 2QCNA 4K8HA 1DORA 2A85A 4JIQA 3GAKA 4K37A 3BW4A 3GKAA 2CLEA 1W5OA 3LCFA 3L66A 4LVGA 3M16A 4NNCA 4JR5A 3W7NA 1MZHA 3NQFA 5E93A 1W3TA 1MEWA 4UTIA 1SO6A 3EXSA 4RZ6A 1ADOA 4O28A 2A7NA 4IPIA 4O1CA 1ZHAA 2QCCA 3W1UA 3NQEA 4AB4A 1THFD 4UIOA 1KM2A 1VCFA 4UFMA 1VYPX 3A24A 5DCBA 2ZDRA 3NPXA 3N19B 1YPIA 3A5VA 1H1ZA 2CWNA 3O16A 1JCNA 2JGQA 2ATMA 2I1OA 2QUTA 4WOZA 2WQPA 1MO0A 2WO5A 2E6FA 3BV4A 4Y9AA 1EUAA 1Q3NA 3UZJA 1JRCA 2WOQA 1WV2A 4O0ZA 1WQ5A 4RXGA 1H60A 4GC4A 4OT7A 4S1FA 3STGA 5FEZA 1QMLA 3CLMA 5D02A 1DQWA 1UUOA 1LCOA 2YDAA 4MZYA 5D03A 3EWXA 1RQEA 1GPWA 1TPC1 3F03K 3B4UA 2ZZ4A 1TV8A 3LHYA 1FXQA 1P1XA 3KHJA 3P67A 4IOTA 1QOQA 1JR1A 2GPTA 2P1FA 3LXCA 1SZGA 1TJPA 3DKJA 2EPHA 3W7CA 1ZAHA 1KTNA 1LTDA 3ABQA 3IIOA 4NJHA 1TQXA 3UD6A 4DELA 4LC8A 2WPBA 1X6UA 1AL8A 3I6RA 4O10A 3QMTA 5I3FA 1LLWA 1SPQA 3PBUA 3W7DA 5K7JA 4J9JA 3BG9A 1F2JA 4AAJA 2Z6IA 4LTSA 3G8RA 1H1YA 1YTDA 2QEZA 1GG1A 1A50A 1OFPA 3C8FA 2GOUA 5KINA 4HPXA 4HPJA 3VCRA 4FNPA 3TR2A 4ZQNA 4I7UA 3B8DA 2CZDA 5HMSA 2DZUA 4IX2A 4O1DA 4NT0A 3N3MA 3LLFA 4UR8A 3MP3A 1WOBA 4WD0A 3L67A 5DCEA 4EVZA 4WUIA 2DZXA 4IUOA 1G4PA 1TPUA 2GVLA 4MFEA 4GNJA 3KFTA 2O7SA 1Q45A 1QNVA 2DZVA 1AW1A 3KRUA 3PVFA 2C16A 3NAVA 2ZRVA 3W1XA 3JR2A 3P74A 1W0MA 3TROA 2A6NA 4OV4A 3LHVA 4ORMA 4KKXA 3OVRA 3T44A 3GLCA 2QR6A 1PHWA 3UPBA 1DKWA 3R13A 3TSMA 4NUWA 1UJPA 2I9EA 3PBYA 4ADSA 3EX6A 1ME8A 2YW4A 3W1MA 1IXQA 3C6CA 4O54A 3GVGA 3ABRA 1R46A 3KXQA 1W1ZA 1VYSX 2CZEA 5DBUA 2TRSA 4O19A 4O11A 3E96A 1G4TA 1MXSA 1GT8A 4OHQA 1WAUA 2RFGA 2V2DA 3BG5A 4ZQRA 5E0KA 3B03A 3TQKA 3W1PA 1A5AA 1XC4A 5G2IA 3ABOA 4CNNA 1RV8A 3GDKA 5D09A 1I2NA 1W37A 3LCHA 3G1HA 3D0CA 3CIXA 2C1HA 3EXRA 4JGDA 3KVMA 3IGUA 3M47A 4N6EA 2Q8ZA 1DL3A 1WDWA 1VGAA 4JX5A 3S0CA 1AG1O 3TSBA 3UNDA 3HPZA 1VC4A 5CSSA 1ZCOA 2DU2A 2NXGA 2VC6A 1KM5A 4UR7A 2FIQA 4BK9A 4UNKA 4XZ9A 4FNUA 3PB2A 3MYOA 1CW2A 1KM4A 1W31A 1XM3A 3B0PA 1FWWA 3L0GA 3DFOA 5EPDA 1UB3A 1TTJA 2PRLA 2J9ZA 1RD5A 1XBVA 3PAJA 2V2CA 3VE7A 4FNRA 5C5YA 1KM0A 1GVRA 3LBCA 3BPWA 4QAIA 4Z08A 4N9DA 2FPVA 3W73A 3Q94A 1ZNNA 4RK8A 1K7XA 3TQ0A 2Y7EA 3PG9A 4XQ6A 2NUXA 1X1ZA 4G1KA 3W86A 2IQTA 1QPNA 1F73A 1JULA 4FX8A 4I7WA 3P84A 3W87A 5MHBA 2WNZA 4M7SA 4LRTA 3MI2A 1P0NA 1XDLA 5DXXA 3W7MA 1VYRA 3S9YA 4UTMA 2G97A 4O12A 2I14A 4ONVA 5TBOA 4WJEA 1KBJA 2X1RA 3E49A 1XBZA 4FF7A 3GK0A 2PRMA 5CZSA 2C3ZA 1I45A 1I2RA 1Z48A 3C52A 5DBTA 2CZFA 4LW7A 2JKAA 3LGEA 1H7RA 5I3KA 2R94A 1VZWA 3L0KA 4RKAA 3Q2DA 3TNOA 4IGHA 3DENA 3S8HA 1KW1A 2W6RA 2NX9A 4A29A 4LV4A 4PCFA 5AHIA 5K4XA 5IBXC 3LRKA 1B4EA 4HHPA 4N02A 3NQCA 1TV7A 4LRSA 2ATSA 5K4ZA 1Q6OA 4TX9A 1LOLA 4P2VA 5IM51 3NO5A 4S2CA 4E2BA 2HTMA 1ALDA 2V9DA 3MHUA 3PR2A 1FWNA 2YYTA 3CTLA 3NPWA 3KVJA 2R91A 3CHVA 2C13A 4HSOA 1VRDA 4MIMA 4O0KA 5HNRA 1H63A 4NJJA 1VLWA 4W9TA 3QMSA 2JBMA 5TQLA 2QCEA 1AW2A 4H3DA 3G22A 5HUPA 1TPDA 3DFTA 1W5MA 1A5BA 2NX1A 3BLIA 3KAOA 4QISA 1L9WA 1GVSA 1JCLA 1KBIA 4K36A 1XXXA 1YXCA 3MWAA 3TFCA 3GZ3A 4UMBA 4Z1CA 4Y96A 1L2UA 2BX7A 3BK0A 2G5WA 1BEUA 2GQ8A 3BLEA 3W2JA 5LZLA 5G5IA 1H7PA 2WKJA 4AEOA 4LV9A 1LP6A 2AGKA 1EB3A 2GUUA 2NUWA 4UTWA 3IIPA 3O6DA 3FJ6A 5I3JA 1B9BA 1QO2A 1FWSA 4NZJA 3TW6A 3W7GA 1OFDA 4XWUA 1IXOA 2Y7FA 1SU5A 3C61A 4N9CA 1OX5A 3HJZA 4HNVA 4LUIA 1O4UA 1GVQA 4NX0A 3PBVA 3PUOA 4UFLA 4YCPA 2ZRWA 4NJGA 2VFDA 3PC0A 1J2WA 1PV8A 3NG3A 5SWUA 4HNTA 3FIGA 4HN4A 1DOSA 3TV8A 5AYZA 1HUVA 2NX3A 1SO5A 2QCDB 4IMDA 3IRDA 4DPPA 1W8SA 4WX2A 4X22A 1OVDA 3HQ1A 2PCQA 2QDGA 4BI5A 2Z6JA 1HTIA 3CB8A 4UNLA 1ME9A 4EIVA 3OBKA 3RU6A 2VXNA 1SSGA 1S5VA 3BG3A 4Z0SA 2QKFA 4I9AA 2BLEA 1TIMA 4FB7A 3DI0A 1OK4A 3KVLA 1FBAA 3DKLA 3TA6A 4TR9A 2CZ5A 2X1TA 2VOMA 5EBUA 3P82A 3QQ0A 3YPIA 2FQIA 3PSVA 4BI7A 3NDOA 4X2RA 3IGSA 4DPQA 1Y0EA 1F7BA 4UXDA 4NX5A 3HF3A 2FDSA 5D2WA 1XDMA 3LCLA 2J9YA 3M0ZA 1LROA 5CPNA 3GAYA 4UCGA 1MEHA 2TMDA 3QSRA 1D3HA 3MI6A 2OMAA 1H5YA 3DFPA 4BWLC 3W7OA 1LOQA 3A23A 1BKSA 3HB9A 2XFWA 1NFBA 5EKYA 1M5WA 4JN6A 1FCQA 4DF2A 4UTTA 4LC6A 1OG0A 2BXVA 4OU1A 2ZZ7A 4Y6GA 1SFLA 4WXYA 1EP2A 1OX6A 4YL2A 4UTUA 1OYCA 1SUXA 4N9BA 2A0NA 4CCEA 1I2PA 1G7UA 1YLVA 2ZZ2A 2XN0A 3GR8A 1X7FA 4IPJA 3M44A 5L6UA 5C54A 3P61A 3C3NA 2QJIA 4ZQMA 1H7OA 2H90A 3ZFHA 4JTGA 4KWVA 3HPXA 1H7WA 5L9FA 1K7EA 3DFSA 3LXAA 3LRMA 1EP3A 2EGZA 3O63A 1SW0A 1UUMA 5DXYA 4GUFA 3G0UA 4QSHA 4MY8A 3BARA 4R34A 1WXJA 3MBFA 2ZRZA 3O6CA 2GVGA 4JTFA 4MY1A 4MUZA 4WZHA 3S5YA 3GIYA 2JKEA 4FNTA 3LHZA 1EWDA 1Z44A 2C6QA 4BI6A 4E0CA 3IIVA 4LVBA 5EA9A 1ZENA 3N9SA 3LCGA 1L6WA 3W6YA 1O5KA 3W7JA 3S42A 3ZR4A 3LV6A 1W3IA 4NXSA 4JYEA 3BLFA 1OFBA 3B0UX 3I7RA 5K9DA 4IWWA 4Y8FA 3KRZA 3L9CA 1LZOA 4PODA 5FI8A 2GVJA 1GOXA 1L6SA 3A5FA 3FKKA 5A5WA 2G96A 4I7VA 2Y7DA 4WXZA 4POCA 1AMKA 5FF2A 2FB3A 1K3UA 3ZWTA 1VPXA 2CLOA 1QPRA 1KV5A 1XI3A 2ZA3A 4LS0A 4O15A 3EKLA 5HINA 3TX9A 5FF4A 3PBWA 1JCMP 2ISSA 3G1FA 4GUHA 3RFAA 5G2WA 5LSMA 3GXPA 3GR7A 3B05A 4IMFA 1DVJA 3W23A 3BW2A 1I8JA 2FJKA 3EX1A 4FXSA 3SFKA 3S6DA 2NLIA 3PM6A 4LOCA 4M5PA 4UMCA 3R2GA 4C1LA 2DZPA 2ZA1A 5LHEA 3SECA 5KZEA 2NXHA 1Z41A 3UPWA 4XTIA 4UFIA 4GRSA 1TPH1 1PCWA 4QITA 4DO4A 1X1OA 3MMTA 4WOQA 5AYXA 3GDMA 2E6AA 2A2IA 3NPUA 4CQAA 1GYLA 3S1UA 3FJLA 3W85A 3VNDA 3PUEA 3M6YA 2OCZA 4IMEA 1FQ0A 3IGXA 1CI1A 1P0KA 2P0OA 1QDSA 2C19A 1LRQA 2CW6A 1R2SA 4JIPA 1GWJA 5D2TA 1W54A 3K30A 3MO7A 4NNBA 1IXNA 3HOJA 1SR9A 1ICSA 1I2OA 5I3HA 3EX2A 4O52A 2CLLA 5FEXA 1ML1A 3O15A 3W7HA 5CPMA 2Q8LA 3S5NA 4O50A 3N34A 5K9CA 1VR6A 2B7NA 5K9XA 4B5NA 4MLJA 3DHFA 2V81A 2QF7A 1F6KA 4O8RA 1FWTA 2XN1A 4TMCA 2JKPA 4YLWA 2QCFA 2A7PA 4YWIA 2FTPA 1EEPA 1EPXA 3G3MA 2BWGA 1MEIA 1BTMA 5CSRA 1FDYA 3W83A 2ZQ0A 3F1QA 3HG5A 2J6XA 1K03A 4JDYA 5CZ0A 2VEPA 2ZZ3A 3SGUA 3AO0A 3QW3A 3UWVA 2RH9A 3B06A 1KFBA 4UTKA 2V8ZA 3EWYA 3HGRA 3CQ0A 3GNNA 3B04A 4Q33A 1KLYA 4O16A 3LTSA 4WY0F 1O95A 1LBFA 3EWWA 2GQ9A 5KZDA 2HSAA 3W70A 3G1YA 4PL1A 5KZMA 3CM4A 3PWAA 1H51A 3TXVA 1W5PA 2VFIA 2B7PA 4K8EA 1LRTA 2Y63A 4RJEA 2YFNA 3W07A 1RR2A 3QSTA 4AHPA 4Z0JA 2NZLA 3W7EA 1QAPA 3QM3A 1G6CA 3E12A 5BMXA 1A53A 1AK5A 3TQVA 2ZZ1A 2V0TA 3V75A 5J5DA 2OZ0A 1R2TA 4OV9A 2YZRA 4NQ1A 3NR0A 5BNKA 1VJIA 3TXZA 2VFGA 2JGYA 4JTUA 1XCFA 1H62A 2VFFA 1R2RA 3PF3A 5EY5A 3S1WA 5DY2A 1AW5A 3HMJG 3W74A 1H61A 5KTLA 3DI1A 3IVTA 2RDTA 3L21A 2AQWA 3PY2A 3I65A 3M5YA 3G8EA 7TIMA 2J27A 1UCWA 5CKSA 4IJBA 5EL1A 5CZJA 3NYZA 2ZRYA 3NQGA 3EEGA 5LNSA 3HG2A 4WY0A 4JTHA 2EAWA 3RF9A 2TSYA 2QCLA 1SO4A 3QYQA 3STFA 4A22A 1T96A 4CNOA 3DAQA 4NNAA 4QNEA 1QCWA 3LHWA 3O05A 3QRHA 4LVFA 1NF0A 1JRBA 5AHLA 3U8GA 5C2XA 1GZGA 3OG3A 4GJ1A 4O4VA 1FWRA 1TPVA 2A7RA 5C55A 1FDJA 4XKYA 1QPOA 2DZSA 1ONRA 1WYIA 2Z1BA 3FEMA 3M41A 4H4IA 1KLZA 2YFOA 1TYGA 3IIXA 1TPFA 1YDOA 1U5JA 2E77A 3M7WA 4HT3A 3TMLA 1H7XA 4EF8A 3GXTA 1Z42A 1AL7A 2W0UA 2OX1A 2WJZA 3AJXA 1EWEA 1G67A 1HG3A 3ANYA 1FCVA 5LNUA 3LI0A 1NF7A 1XFBA 3PB0A 1EA0A 2B7OA 1FUYA 1OK6A 4YXGA 2D73A 3TW7A 2YYUA 3EX3A 3HGOA 1RZMA 3Q37A 5BRBA 2KZHA 4Q32A 1DHPA 3VI2A 3N9RA 2J9XA 3NQMA 4HIBA 1VCGA 3DGRA 3O8AA 2ZTJA 3P62A 2Q3OA 3RK8A 5C6MA 3G18A 3ATZA 1OYAA 3F4WA 3W1TA
chains in the Genus database with same CATH superfamily
2XFFA 2UY3A 3BSGA 4K38A 3VIFA 3H2FA 4S39A 4MAZA 5D2XA 4QGCA 2ZTKA 3UWZA 3TTYA 1BWKA 5I02A 1M41A 4MJZA 2CKRA 4ADUA 3AOFA 3NXLA 3B40A 3SR7A 1NM9A 2PDIA 2GGGA 3VNMA 4LS1A 2GK1B 2WC4A 4LH8A 4G7FA 2R9RA 3SN4A 2Z7KA 2ZX9A 3VFLA 3P60A 5BXPA 3AJ7A 4FR1A 5DN1A 3UR5A 1P48A 3WNLA 1PE1A 3GUWA 2GDQA 5C2GA 1DIDA 1TV5A 2DEPA 1NARA 5B80A 5TIMA 3DDMA 3K2GA 1D9EA 3C2FA 2QXWA 4BR1A 7A3HA 1JL8A 2A3LA 1YTKA 1PKLA 2A21A 4PL2A 3GSMA 1S5MA 3ERPA 4YYCA 3DUGA 3TJLA 4US5D 2Q02A 3LCWA 1W9XA 2Z1XA 4OKDA 3H12A 3UJ2A 1MW1A 3R1ZA 3VABA 4FNQA 4H6EA 3IV3A 2OB3A 3CEUA 2GYIA 4P5UA 1OF8A 2CCRA 3O6AA 3TIMA 2VGGA 1DXIA 3W75A 4DAFA 2D3LA 2H6RA 5IXEA 3A4WA 4JNZA 2BVYA 2IS7A 2OEMA 4NI8A 3PJWA 3C0LA 2V3GA 1K6WA 3OYXA 2E4TA 4H2HA 3QXBA 3W72A 3G1DA 4BF9A 3SGGA 3WO8A 2C91A 3P8JA 4E8DA 2DSKA 3VCCA 1FFRA 4MUPA 3KP0A 3T4CA 4UMAA 9CGTA 3GD6A 2F61A 3AAMA 3GHTA 3MSDA 1W3HA 1QWGA 2QUVA 3AIQA 3WL0A 4OOZA 3OBAA 5F4WA 1XLGA 3OZYA 1RH9A 1NQ6A 3KOXA 1TX2A 3CHEA 3ZM8A 4DJDD 3UA4A 1UD5A 4E8CA 3A64A 3W22A 3C5QA 3MJYA 2D3NA 3A9IA 3SADA 3SJ3A 5EMUA 1C29A 2D24A 2YCLB 3NSNA 4JTJA 4GBUA 3ITGA 1J4EA 4P7QA 1E51A 4F40A 3S6OA 4QHRA 3PTKA 1A5OC 4UZUA 5C9ZA 1OD8A 2X2GA 3MI3A 3TDFA 1LOSA 4EPKA 3LEPA 2VZVA 2WNNA 4HKPA 4H1ZA 1T99A 1X96A 2EG6A 2VFHA 3GNDA 3N6QA 4O8AA 5BOFA 3T7VA 3AWOA 2AL2A 1V0LA 4NJIA 4NAFA 3C2OA 1X38A 2OGYA 2J66A 1ZLPA 1E70M 3K4WA 1JF6A 3I6TA 3WH9A 1GQLA 3SY1A 3DFNA 5BWFA 3VNZA 4AY1A 4E38A 1ZBKA 3CIVA 3K13A 3ZVHB 1QJWA 4AQLA 1QNQA 3ES8A 5H1WA 5CPQA 1KCLA 1W1IE 3WJWA 1XSIA 2Y88A 4YVPA 3FSUA 5HR6A 1VRXA 4B5UA 2NQ9A 2PTXA 2ZIDA 1MSSA 5A8OA 4MM1A 1WUFA 4PUMA 4R7OA 3ZWSA 1MYRA 2YJQA 1L8NA 4AZCB 2BY1A 1V3LA 1BVZA 2P10A 1DV7A 4A8NA 4JD4A 3I7QA 1EO5A 3D3FA 3W1LA 4ML9A 1RK6A 2PAJA 3GFYA 3WLHA 3WIJA 3WD3A 1IF2A 5JBFA 5ABFB 3EWDA 4KW2A 1XL9A 3WJYA 1OF6A 4R5EA 2GUBA 3T78A 4PTNA 2WJFA 5A94A 1CTNA 4HA0A 3MP4A 4CVWA 5A6SA 2ISDA 4L6DA 2HDJA 2DJLA 3OBEA 2PDHA 3B9EA 4DBSA 4JTQA 1XW8A 1FCBA 1RPXA 1OB0A 4RPPA 3E74A 4DRSA 4GGBA 3BICA 3ZOAA 3WELA 1K8CA 3CK5A 4HZ7A 3U5UA 4QEHA 3O6YX 5DCDA 3TYAA 4CQ9A 1J5TA 1A5NC 2J7DA 2YBTA 2G50A 1PIGA 3VAVA 1OFRA 3VIGA 1PHQA 3H2OA 1FXPA 3GS6A 3AIRA 4IQLA 4C7GA 4YTRA 1PVNA 3ZJ6A 4ALDA 1XIIA 4KCUA 3LERA 1F76A 4AF0B 4GFIA 1E1FA 1EYEA 2Y70A 2O9RA 4V1XA 2EG8A 1RLDA 1GQIA 1R3VA 2ZRXA 4GNKB 2V5BA 5AOUA 3WK3A 1JYXA 2IKIA 3ZQ9A 1HT6A 3PULA 1GZ1A 4O1AA 2ZICA 2DFAA 3RR4A 3TU9A 1YDNA 2CIPA 4TX6A 1G4EA 3TEVA 1TREA 1R0MA 1GKQA 4RDYA 2FDMA 2E09A 1YEYA 2YKKA 4PMDA 3BOXA 1BKHA 4O14A 4EXQA 5HQLA 5AHMA 1T40A 4AIEA 4X0NA 4KBXA 1LDCA 2BODX 1K8ZA 4HA1A 2VFEA 3H53A 3LM3A 1AZ1A 5B7ZA 4HPHA 3BGJA 4AXKA 3ICJA 1E0UA 4FIQA 4NYYA 2YB4A 4AH7A 1UBSA 3B8TA 3G1AA 1Q2SA 2FKPA 3FK4A 3I6EA 3GNXA 4PFHA 3F4CA 4DIAA 2XZ9A 4E4UA 2FHFA 2VYOA 4AISA 1BYCA 3MANA 1BF6A 4DN1A 3BSHA 1ZUAX 3ARTA 4Z2KA 3WK2A 1V5XA 2VVSA 9RUBA 3SB0A 4TV6A 4BY3A 4KWWA 2C0AA 3MDWA 5AC5A 4C90A 1CZ1A 4A3YA 3BTNA 1VFUA 4FEZA 2BOGX 5FJPA 3NYDA 4B15A 4MHBA 3LOTA 4LAKA 2CLHA 5CZTA 4Z2GA 4OE7A 3H4GA 3WLRA 3DHPA 5D04C 2QCGA 1JVNA 1XQLA 1RK5A 3WK0A 4CVUA 3KRSA 3QQ1A 4PE8A 3W1NA 1N7KA 3RLHA 2ZXBA 3B0VC 5AKQA 2ZUSA 4FIRA 2R1LA 4PUWA 4CD5A 1A5CA 4S2BA 4MB3A 2V6AA 2WB5A 2O0TA 1C8XA 3NOEA 3OVGA 5DO8A 1L6GA 1D7KA 2BFGA 4N2YA 2HNHA 3C4UA 1M7XA 3ONBA 4LNYA 4C6NA 3IS4A 3G0SA 1IEWA 4LVDA 3W84A 4WY0B 3KBWA 2Y8VA 3MP5A 4KF1A 3U2ZA 4IMGA 4XB3A 3ZZ1A 1KM3A 3TN4A 3HGSA 3UZWA 1BRLB 4JQ2A 1XLLA 3B9DA 4DI9A 5DMLA 1TTQA 3B4YA 4C1NA 1A5SA 3QLLA 1OG6A 4WSHA 1XISA 5E0CA 5FF0A 1KCXA 2BHZA 2CLMA 3H4WA 3BL3A 4TX8A 3THAA 5ABEA 4S3AA 1XS2A 2ZBTA 1EP1A 5AC6A 4EF9A 1H50A 3WLKX 3SUSA 4FLOA 2B7QA 4IG2B 4JOMA 1VBGA 4HNNA 1KC7A 2NVCA 3VZYA 4LGXA 1EUNA 2CXGA 4NU7A 1UROA 4HMCA 1ME7A 4JX4A 4P7OA 1S2TA 5EMJA 1XBYA 5D30A 3SRHA 2QVNA 4JTKA 3T81A 2Y7GA 5CJ5A 3PNUA 2X16A 3GR4A 1UPPA 4KGJA 4RNHA 1QTWA 4F0MA 1F5ZA 3MUIA 4ATLA 2WVTA 3WMCA 1RQHA 1HGWA 1U83A 4QQ3A 1TQJA 3NQDA 4LVAA 4Q8QA 3SCSA 1UWAA 2J88A 3M5XA 4JKMA 3LM7A 4MMWA 2OGJA 4JX6A 4H00A 4YPJA 3WQGA 4M6VA 1ENUA 2PRHA 3VNKA 1BWVA 3NQ6A 1UIOA 1KFCA 3BOFA 3VILA 3ITVA 3QV6A 3W38A 2ASHA 2XUCA 4UQBA 1SZFA 3UYCA 3RLUA 3POCA 6ALDA 3GBEA 4QNWA 3SO7A 1GUVA 3NEVA 1EQPA 4HNLA 3GDLA 2X1IA 3TYBA 4P7NA 2H8XA 3AU2A 3SI9A 4GUGA 4LY4A 4MTVA 3T8LA 1XYMA 4CQCA 1YQ2A 3KDOA 4MZ8A 2WKGA 1PYFA 1DIEA 1DIOA 4TO8A 3CZ8A 4KESA 4GG9A 2VELA 5DY3A 4GZJA 1R3YA 3NM1A 4JHZA 2QCDA 4RXFA 3WBYA 4N4PA 1O6IA 3W7RA 1B9ZA 3LA4A 1VCVA 4QM1A 1KFWA 1GTHA 4YMZA 4HU3A 4HZ8A 1UC4A 2Y5EA 5AYYA 2B0MA 2YR1A 3STEA 1WOAA 3CAQA 3C3UA 1CYGA 3LXBA 1SVDA 3NZ1A 4MYXA 2H3BA 3U57A 4F66A 1XRVA 1POJA 2PLKA 2BXYA 1VFFA 4GUJA 6REQA 1TRDA 2VOTA 4F0LA 2BP1A 5HQEA 3TUUA 3ANUA 4IJCA 1R38A 1T0OA 3AXMA 3LS9A 4MNLA 1PAMA 2YW3A 1K70A 4GNVA 4FR6A 4B9ZA 3W37A 1E0TA 3H55A 1LBMA 1OYBA 1TKKA 2G3FA 2OYKA 4A6GA 1C90A 3VMOA 3GQYA 1C7SA 3WBWA 4K7VA 2Y62A 3N2TA 3RCYA 1LORA 2YDSA 2ACRA 5A6LA 2JEPA 4EE9A 1IZJA 1EJVC 3WF1A 2CXEA 4P8UA 3GXFA 4RCXA 4DNMA 4DO5A 3LRLA 3WD4A 1TWIA 2QDEA 4DF1A 5PTDA 1LWHA 1OT2A 1V8EA 3GH4A 3NTYA 1N2VA 3W7KA 1PWLA 4ZEPA 3B9AA 4OUEA 1Q6RA 4NZFA 4JAWA 1Q13A 1PIIA 1T6MA 2FZMA 5FKYA 4GY0A 4RV8A 4EKJA 1XKYA 4DXVA 4REQA 3VGDA 2FFIA 3VM7A 1HJVA 4UTHA 3RG6A 5G4EA 2JE8A 1JDFA 4YYFA 4C1KA 2RDUA 4R7JA 1LG2A 2WSPA 2QYGA 1JNDA 4PTXA 1KO0A 2QAPA 4GE8A 5D8ZA 2QCMA 3SCTA 4D6HA 4ZL1A 3IJ8A 2EHHA 4IP7A 4UQEA 1KA9F 3MCNA 2JF7A 4AHOA 5F7UA 5HPCA 2J7CA 3QEZA 3GVRA 2WVVA 5EYWA 4YN5A 1TPEA 4GUIA 1Y5XA 1FWJC 2NXIA 3ARUA 3P6LA 3V36A 4MFDA 4S3JA 1ZSXA 3DIPA 4WGHA 3MYPA 1W5NA 4KCWA 3QGKC 1S39A 1PUDA 1OX4B 2QCNA 2V3DA 4XISA 4TQTA 2Z1VA 4LBUA 1J5SA 1CXLA 2P3ZA 4PBGA 4LUTA 1W5OA 3L66A 4NNCA 1MZHA 5E93A 4H9UA 2ZC8A 4XZWA 4UTIA 2EJ1A 3EXSA 1TJ0A 4C6EA 2ANUA 3EGJA 4O28A 2VD8A 4IPIA 4IISA 4AB4A 1THFD 1E55A 4QEEA 1KM2A 4N42A 1KGUA 3QR3A 4UFMA 4PMRA 1NWSA 2C71A 2BS9A 2ZDRA 1MW0A 3NPXA 3N19B 2XVPA 1UA7A 3O16A 1GNXA 2QUTA 3M0XA 1EQCA 2Z2BA 3WQVA 1VBUA 2WO5A 3PTDA 3KDNA 1ZTVA 3LU2A 1IHIA 3BV4A 3UG3A 3UZJA 5C7VA 4RXGA 3CV6A 4OT7A 4S1FA 5D02A 8RUCA 1JYVA 1TV3A 2VQUA 3B4UA 3ANVA 4J35A 1TV8A 1P1XA 2GDUA 1EJTC 1Q8AA 4C6MA 3WLOA 1IGWA 3CQJA 2YZ5A 1V03A 2P1FA 3LXCA 3O2LA 1LF1A 4ZTXA 4PUUA 3CPUA 1LTDA 2E8ZA 4PR4A 4LC8A 1X6UA 2PP3A 1E4LA 3PTQA 2CITA 3I10A 4DJFA 2VDHA 5I3FA 5I03A 3BANA 1OC7A 2NQZA 3QR1A 4HD5A 7ODCA 4GI9A 2FZ8A 5KINA 1EIBA 4HPXA 2WAGA 4HPJA 1QWKA 1KXHA 1X98A 4ZQNA 3B8DA 4GVHA 3BLKA 4IX2A 1P7TA 3IAQA 3N3MA 3LLFA 1WOBA 4HYVA 3AMDA 1MNZA 4MFEA 4GNJA 1HGYA 3KFTA 4ZO7A 4ERGA 1Q45A 4M29A 3KRUA 3UW6A 1OCBA 3IWPA 1J8VA 3QHMA 1M9HA 3ZT5A 2GWNA 4Y7EA 1CT5A 4X0VA 4ZTYA 4HCDA 5HNTA 4YHGA 4S3DA 4B90A 1G0CA 3K1GA 3PBYA 1ME8A 2QIIA 3C6CA 1VBJA 5LXEA 3ABRA 3R79A 2NV9A 3NZQA 1EKOA 1M1BA 4HCLA 3E96A 4XVEA 2RFGA 1RXOB 5E0KA 1VBRA 2Y4SA 1DTUA 3ABOA 3G6LA 2HZGA 3PANA 3ABXA 5D09A 3LENA 4HSHA 2BY3A 3EXRA 1VJSA 1EZWA 2XPKA 1ZJHA 1QI3A 1AG1O 4JTRA 1VC4A 1ZCOA 1UWQA 4UNKA 3KW3A 4XZ9A 1ESWA 1CW2A 1T41A 4H9MA 3MV11 5EPDA 3U3HA 4IMAA 1UB3A 5HANA 4RV3A 4FNRA 4JN7A 4US6A 4GINA 3LBCA 3I4KA 4Z17A 4E4PA 2QULA 2FPVA 1PZ3A 1Q6FA 1K7XA 2NLYA 3LLXA 3POHA 2JQXA 2P0IA 2NUXA 1X1ZA 2YXOA 3W86A 3KCOA 1QPNA 1TR9A 3FW6A 3HFYA 4J28A 1PKYA 3LBOA 3W87A 4BQ2A 5C7HA 2WNZA 5C9WA 2DH2A 3MI2A 1P0NA 5DXXA 3BZJA 3S9YA 4UTMA 3IUHA 2I14A 2VM8A 3JVAA 2HV5A 5FD0A 2R6OA 1UG6A 2X1RA 4Q8TA 3WLTA 1O12A 3GK0A 4JQ4A 3F4DA 5CZSA 2VR4A 1I45A 3MUY1 1Z48A 3G5EA 5DBTA 3OO2A 1CGUA 2CZFA 3LGEA 2R94A 1VZWA 4RKAA 3Q2DA 4IGHA 4LXFA 4JQ1A 4QTGA 4PEEA 3U2EA 4OJYA 3SQSA 3LRKA 1B4EA 3FA3A 4UQDA 1UJQA 1YNYA 3VYLA 4LRSA 1Q6OA 3TJIA 1LOLA 1M3UA 2HTMA 1ALDA 2ZUWA 4NRRA 3UZXA 1JNEA 3EOEA 3MHUA 3CTLA 4GZEA 4O0KA 1P6CA 3HQPA 4E3TA 3BDKA 3QMSA 5TQLA 2OLHA 3MMUA 4KETA 3KAOA 3QV9A 1W2VA 1W1PA 2C0HA 2FH8A 1E3ZA 1GVSA 4K36A 1IT7A 1L0PA 3A9BA 5A6TC 3TFCA 1PX4A 3GZ3A 3UWEA 4GQQA 1TFVA 2BX7A 3PJTA 2ZUNA 3UVIA 1H7PA 3AMKA 5I3JA 4C6JA 1PZ0A 4WDWA 1MWOA 4GMEA 3A4JA 3A13A 4C6FA 5A2CA 1SGJA 3ZSSA 5HK4A 1WKFA 2Y7FA 5AYBA 4N9CA 1OX5A 1RBAA 4M6UA 4B2DA 1UH3A 5CGTA 4JNYA 1WZLA 2PDGA 1GVQA 2PP0A 3PUOA 4NJGA 1XYFA 3PC0A 3NG3A 1X39A 5AYZA 3VX1A 3HM7A 3N6HA 3U7VA 2JIEA 4FOKA 4IMDA 3MCMA 4X22A 2DT1A 4EWJA 2QDGA 4XKMA 4EIVA 1FHDA 3BG3A 1C3FA 1TIMA 3KVLA 1UHVA 1FBAA 3GU9A 1LT8A 2VOMA 5EBUA 1JD9A 3VD7A 1E40A 3NDOA 4X2RA 1EGVA 2FDSA 3O0FA 3LCLA 2J9YA 3ALFA 1RP8A 1KXQA 4H01A 3TC3A 1RP9A 4UCGA 1MEHA 3E2QA 4CD6A 2O92A 4XO6A 5KEZA 3E5PA 1FP8A 2OMAA 1H5YA 3DFPA 5HJYA 4AIOA 4D6FA 4CN1A 2XFWA 4QJ4B 3PZ9A 4JN6A 1Q5MA 4J3SA 4LC6A 4Y6GA 2BXVA 2ZZ7A 1SFLA 4WXYA 1EP2A 1LQ2A 3UR7A 3KM8A 4YL2A 4YU1A 4ZCWA 1SUXA 4CCEA 4DYJA 1G7UA 3ZVHA 2ZZ2A 4HBKA 3QHNA 2AQVA 3WKZA 1MNSA 4Z2LA 4IGSA 4BQ3A 3C3NA 1H7OA 4W7UA 2H90A 3WLQA 1H7WA 1M03A 3P0WA 5L9FA 3UR2A 4XVDA 3IK2A 3FA4A 1UPMB 1UUMA 1Z89A 4C60A 4AD2A 4AZCA 1UWTA 3WENA 2GVGA 4MY1A 4WZHA 5IDZA 4GI8A 1B3XA 1J93A 1AQMA 4E0CA 4LVBA 3ZLFA 1ZENA 4GCXA 4PRTA 2AMGA 4PULA 1JYNA 4IP5A 4EAYA 3MVIA 3T2QA 1JXJA 3O7UA 4Q7NA 3MDUA 2QLYA 2QMKA 5JMUA 2D2GA 4KCVA 1XLIA 3KL5A 5FI8A 4CEXC 3QY7A 1VFOA 2Y7DA 2C7FA 4WXZA 1AMKA 4RL3A 3OYZA 1BVWA 1KV5A 1XI3A 3PNZA 2OZTA 4RE2A 1KCKA 2DSUA 4BF5A 3G1FA 3ZYZA 1BPLB 3GTIA 3RFAA 3LNPA 5CZKA 5LSMA 1WCGA 2PDNA 4MWAA 4JFSA 2WCAA 3SFKA 1NOWA 4BHYA 4P8XA 4JHMA 2ZX8A 1MXGA 4WCJA 5LHEA 2HJPA 3TZFA 3AS3A 4D6GA 3F2DA 4XTIA 4QDMA 4QG9A 4DWDA 3KZSA 3UZYA 1OCNA 4B92A 6CGTA 4WOQA 3GDMA 4EPEC 3NPUA 4LF2A 4CQAA 1GYLA 4LAZA 3W85A 3VNDA 3M6YA 2HE5A 1P0KA 3LPPA 2P0OA 1QDSA 3EDKA 4GOAA 1WE5A 1GWJA 2IW0A 5D2TA 2R1PA 1XH0A 1FHUA 4NNBA 1MRQA 2VP8A 2HBXA 1W2PA 1W1B1 5FEXA 5XINA 1XLCA 4LCRA 3O15A 1JI1A 1ITUA 3MVTA 3S5NA 3N34A 3ZO9A 4QE1A 5K9CA 1DWHM 2B7NA 5K9XA 4LAOA 3DHFA 3H4XA 1M65A 3RJYA 3SURA 4TMCA 4YLWA 3QY6A 2OZ3A 1QXLA 3VIJA 2FTPA 3EYPA 1CGTA 1EEPA 5C9RA 1XC6A 1XLFA 1Q7ZA 4K8GA 2R82A 3L4XA 5CZ0A 3UCQA 5GPRA 2VGFA 3P14A 1CXFA 3GVWA 3B06A 1KFBA 1US3A 2OEKA 2QPUA 3CQ0A 4W8LA 2FMOA 3DERA 3M0HA 2X09A 3IK4A 3W70A 1ZQ5A 4MKVA 2QW5A 2VJXA 1H51A 2FH6A 1XG3A 3VFCA 1W5PA 1F4HA 4K8EA 2Y63A 1XIFA 2YFNA 4AHPA 3IARA 3WEMA 1DHKA 1G6CA 2WQDA 3E12A 5BMXA 1YE4A 1R85A 2V0TA 4D6EA 2E3ZA 4LB4A 2EJAA 1D8WA 1UWRA 4S3FA 2G8ZA 3TXZA 7REQA 1GKPA 3W24A 2WMFA 2Z29A 2VFFA 1ZP4A 1ZRQA 2CC0A 3WBXA 2F6KA 3AUJA 1QNRA 3IVTA 2RDTA 1QATA 5T9BG 2AQWA 3I65A 1MMFA 2PWHA 7TIMA 1VJZA 3UCCA 3VKCA 2ZRYA 3EEGA 3WUBA 4PBFA 4WY0A 1UIPA 4HK6A 2FTYA 4GCAA 4QJ5B 3M0IA 4NI3A 2DT0A 1HIZA 3QYQA 3ZVIA 4A22A 1T96A 4QNEA 4JFVA 3DEQA 1QCWA 1I60A 1UMYA 3U8GA 5REQB 1GZGA 3OG3A 4GJ1A 4IQEA 1FWRA 1TPVA 4M8UA 5JH1A 2R1MA 1FDJA 1CIUA 1UD4A 4LYQA 3FEMA 3WN6A 3M41A 4IG2A 1KLZA 1TYGA 3IIXA 1TPFA 2FZDA 3SBFA 1YDOA 2E77A 1JYWA 3RU8X 2CBJA 4JEJA 4S3CA 2XIJA 4EF8A 3S9ZA 4OECA 2OX1A 2PP1A 3O0KA 1FCVA 1AQ0A 2INZA 1OGGA 2XHYA 3C0SA 5LNUA 3AU6A 2DT2A 3PB0A 1W1A1 3L12A 1S2VA 1Q7QA 2B7OA 4GVIA 3TOPA 4I6KA 3BAXA 2INFA 4KIEA 1CXKA 4E3VA 1LL4A 3FGCB 1QT1A 1ONEA 2EPNA 4PUEA 3CQKA 3QY8A 1AJZA 4QFUA 2VT0A 1UQYA 3NQMA 4AZ7A 4GX8A 3UFYA 3DGRA 4ZO8A 3SRFA 3RK8A 3G18A 3PZUA 3EWCA 4HHLA 3PZMA 3W1TA 1PX8A 1GVYA 4RZ5A 4BEQA 4PEKA 2PPGA 4TUFA 3FYPA 5HNUA 2W9MA 1JZ5A 4AWSA 1LLZA 4GXPA 2ZYFA 3NGJA 3DX5A 3QPZA 4DJFC 3SW6A 3FXGA 1PCKA 1CPUA 2DVTA 3THQA 1FH7A 4QR6A 4QAWA 4JFWA 3LV5A 4ZB2A 1G7VA 4HB7A 4L1XA 1CB2A 4O17A 2V69A 1FH8A 4AWUA 4ZODA 3V5OA 1HKVA 5A6BA 3LGGA 3DYOA 5AHEA 2D0GA 2J13A 1K8YA 3APGA 4JBRA 5FCZA 2A4AA 3F7JA 1OZQA 3LCIA 2P50A 5FF3A 2WMJA 4B5WA 5LKYA 1DWFM 3KX6A 1J0ZA 3UZZA 2Z24A 7TAAA 3CAVA 1M53A 2WSYA 3AXXA 1GJUA 1TWWA 3KEHA 4C6DA 4RNFA 5FESA 5J5RA 4JYDA 4QSFA 3S4TA 2E9MA 2G3MA 2BTMA 2ZUUA 3RILA 1Z3NA 2R14A 2ISVA 4UWMA 4DAIA 5HMDA 1PDZA 1TJRA 4LNCA 7ENLA 2WM1A 2XJ7A 1A5LC 4AZBA 3SIZA 1I2QA 1EJWC 1EGZA 4KQNA 1QBBA 3AHZA 1BWLA 4X60A 1RVKA 3VIHA 1DJNA 4IPNB 3I68A 2ACQA 3GY1A 1J01A 1XX1A 3EPMA 1V51A 1WDQA 3SGZA 3WFAA 5FJOA 2EG7A 2Y2WA 4LCQA 4ICCX 2H9AB 1UWUA 3MWCA 1PPIA 1XUUA 1ZFJA 1EDGA 3LI1A 3AHVA 4JXCA 2ZUVA 4J40A 7CGTA 4DUVA 2BY0A 2NWSA 4J2MA 5AC8A 1H0GA 1JXKA 2ZE0A 3F5JA 3SM0A 1FX6A 3QR0A 1DJGA 4JY9A 4O0QA 3ARSA 2E9LA 1CBGA 4L4LA 3T0BA 4BF7A 2D2HA 4Q4MA 3M5ZA 3BAYA 4KS0A 3H2CA 4QDPA 1F74A 3TYEA 4F9JA 1VHCA 2QNEA 1BTCA 2Y8UA 4M6QA 1IXPA 3UXDA 1GQNA 2X1SA 4DJEC 1FHVA 3W29A 5FACA 1XCWA 4WF7A 2ABAA 4U31A 4H19A 2Y85A 3M1ZA 1KM1A 2XSBA 2WSQA 1Q7MA 1R7AA 1U5HA 1XLEA 1HJQA 3RPDA 1TTPA 3C0JA 1VPQA 1EXPA 1VD6A 2W5FA 2WHKA 1I0BA 1OINA 1VHNA 2VUNA 1H3GA 5FL1A 3LQLA 2UZ9A 4OQVA 1RVGA 3LNMA 1YYAA 1TV2A 4DBUA 1B30A 2NT1A 3CT7A 3RRXA 1PZ1A 4FO4A 5K2ZA 4W8AA 3EDFA 4RW3A 4UQCA 5ABTA 4NAFB 3R0UA 3TWAA 2FPTA 5HWMA 3H54A 3KBVA 4A8RA 4U28A 1OX4A 4PB3A 2PWGA 1M6JA 3EOUA 5AB3A 1TB3A 5D37A 3IV8A 2DPEA 3CT2A 1YPFA 4KRZA 1SW7A 3DGBA 4R9OA 1D3GA 3FYOA 4QJ1A 4UQAA 3IJ9A 3ZS4A 3TW9A 4QLKA 3CV1A 3UXIA 1Q6QA 3OVQA 3NL3A 1ISYA 3HFTA 2WSRA 2ZE3A 6XIMA 2Z00A 5FL0A 2WHMA 5HUOA 3BE7A 2AKMA 1H4PA 2ZFAA 4RX0A 1NELA 4LWWA 1JDEA 2GVEA 4X3ZA 1JUEA 2EPMX 1F05A 3DN5A 4PB4A 4RDWA 4Z2JA 2OFJA 4Y9MA 1B3VA 4L61A 1FRBA 3AROA 2VVNA 2LLEA 3BGGA 2ACSA 1D3CA 3UGVA 3IVUA 1OFOA 2Z2AA 2YPIA 2GQAA 4C6QA 4WVXA 4KEUA 3RLVA 5BROA 5FEPA 5EMMA 3KL3A 2J25A 5LHFA 2PTYA 3H26A 1ZBCA 1VFSA 3OGRA 1ZAIA 1DWAM 4FXJA 1FWAC 2I57A 3LHTA 4QP0A 1N8FA 3IVSA 2X30A 1V3HA 4W86A 3BURA 4DQWA 3ELFA 3FOKA 3WNKA 5XIMA 3CJPA 3CO4A 2A6LA 1UH2A 1I9CB 1F9CA 2J7FA 3CLWA 3VZZA 3QOMA 1IZKA 1H41A 4JS3A 1PXGA 4AVFA 3CZLA 4ZB5A 5GNZA 4WR3A 3HBLA 3GHSA 2G37A 3M0LA 2PGRA 1E56A 4KRUA 3T40A 1GOWA 3RCNA 2GGJA 3WJXA 1B3ZA 2E28A 4UQ9A 2J7EA 4Q4RA 1V6TA 3ZJ7A 2V5KA 4NXKA 1AQHA 2R24A 4AFYA 3AZSA 3W2UA 3S47A 1OFQA 1E15A 3CS2A 3T55A 1HW6A 1JDCA 1RCQA 4TVUA 1RUSA 1UUQA 4F9DA 3UWQA 4QCFA 2WXDM 2A79A 3L4WA 3FSTA 1R30A 1GQJA 3ITYA 2OKTA 4PC8A 2XISA 5F1UA 4IPPA 1QR7A 3L5LA 3W00A 1B0IA 3FKRA 3KBMA 1JCXA 1FCUA 2VZTA 4GVFA 4Z2IA 5CLTA 4YHEA 3O3RA 1JEZA 4GI6A 4UCFA 2EKGA 3KWSA 5CXPA 2EF9A 1W3NA 4ZO9A 3UJEA 5DT7A 3QPEA 3WDJA 2AMXA 3G77A 2YBUA 3C2YA 4NL1A 3WUEA 3W1RA 2GSJA 4MADA 4IICA 3W1QA 2CWXA 3MW7A 2VEGA 4CQBA 4FNSA 3L4YA 3FLUA 3R10A 5LNRA 1EIXA 1J79A 4DZ5A 2VEKA 4XSLA 2XZ7A 4R3UA 4IMCA 1I0DA 1SW3A 3FS2A 1G4SA 1OWQA 2OT0A 2YSWA 4KFNA 3WUGA 4JQAA 3NDYA 3UESA 5LIYX 4U4MA 4MWAC 3SY5A 4LJ3A 1Q66A 2CLIA 3RMJA 4UTJA 5FSEC 1W91A 2F7FA 3B97A 1VH7A 3WF0A 2IPWA 5CC6A 2DP3A 3VE9A 5FJRA 1JCTA 3IJIA 4PRRA 2VR2A 5LXXA 1O1ZA 5H91A 3NDZA 2TPSA 1XBXA 2WZTA 3NOYA 3VD4A 3TCEA 3H6OA 1QPKA 2ZDSA 3WQPA 4C1NB 2C14A 2EBNA 5C9XA 2R1NA 1M7PA 4MNMA 4MJ4A 4UOQA 3USBA 4O18A 1JF5A 4A35A 3UGRA 2MUCA 2G3JA 5TF0A 2WJDA 1JPHA 4K7YA 4DEFA 4PUJA 4D6IA 4RNJA 1HJWA 2WYSA 1QNOA 3ZJKA 5G1TA 1EHNA 3UWUA 1WDSA 1LRNA 2VD9A 1XLKA 4H6RA 1VF8A 3PPFA 3A6OA 2CERA 3R7MA 3CYVA 3TFXA 3CUHA 2V82A 1MQPA 1E4NA 2PDCA 2DZWA 3DECA 1V6XA 1JPMA 2YCIX 3ARXA 3PFMA 3QF0A 3BAWA 3NSXA 1QBAA 4JICA 2W61A 4B5SA 2YGYA 4JYFA 4IIGA 2J78A 4GFSA 2OZ8A 1XSJA 1ONXA 2F8QA 1FWIC 1JI2A 3W9ZA 5DT5A 4FXFA 5AC4A 3P81A 4CNSA 3M0KA 3NEHA 1ZAJA 3SN1A 4M82A 4FK9A 1YTEA 1FDZA 1A49A 5AFDA 4PMZA 4AMAA 5AHNA 1CLKA 1W6TA 1XLJA 4JTIA 2E40A 1WP6A 3LTPA 1HNYA 1JCYA 4H9VA 3DZ1A 4MB4A 4INFA 1WBHA 4S3GA 3EPNA 3ARQA 3DG3A 3CU2A 1US0A 3H22A 4KRTA 5LNWA 4NAEB 3E9AA 1O60A 4XBSA 2OOGA 3TAKA 1W3LA 3LBMA 4XD5A 2D69A 1U1HA 1SJAA 4TIMA 5LGZA 3TYZA 2IPGA 3RR1A 3ZLGA 1R87A 3AS0A 4HOXA 3WJSA 1EF3A 1OC6A 4NRSA 1DIKA 3R6IA 1PX3A 3WZ0E 2WC7A 4V28A 3EKZA 2PC4A 1A0EA 4CD8A 5LIWX 1ISXA 5KSWA 2OLSA 3W1AA 1W9DM 1RJRA 1VLIA 3TWBA 3SSJA 3BJTA 5D38A 2BOEX 5T26A 3FVMA 3LX9A 4H6KA 1BXNA 3VKAA 3EOOA 1K9EA 4UFKA 3RJXA 1YX1A 2VO5A 3Q58A 3TQPA 1VB9A 2J24A 4K1GA 1WZKA 3OB8A 3R89A 1YNPA 5LGXA 1J0KA 1LQAA 1MQQA 3F4NA 3INPA 3R25A 2PBOA 2DV0A 3MBDA 2X05A 2HROA 1EX5A 1OIMA 1SQ7A 5BXRA 4FOJA 4L64A 4DJDA 2NT0A 1X97A 4QBXA 4H9YA 2V30A 3TOYA 4ML4A 3GTXA 5CBBA 1ZP3A 1OEPA 5JQ9A 2J8TA 3UF9A 3U6WA 1FHLA 4AY8A 1NWTA 1QU4A 5J8LA 1TMHA 3JUGA 2DQXA 3SCPA 3SCRA 3OA5A 3P2VA 3O1NA 4J1OA 2XSXA 4FZIA 3FDGA 3A22A 3TMQA 2ZZ5A 3QZ6A 3EAUA 3CWOX 3CNYA 3CIWA 3GXIA 2XINA 4A21A 4GKLA 3NL6A 4TMBA 3WYZA 4L7ZA 4DO6A 4NILA 2BVTA 4DUXA 2UY4A 4PMNA 6TAAA 2HS8A 1SFTA 1Z9AA 3W2LA 3VGBA 3M7SA 2OSYA 4DHGA 1F6PA 3TCSA 1AMYA 5CG7A 2ON3A 1TPB1 3WDQA 3L23A 4GACA 2D1ZA 4HHHA 2IPFA 3MA8A 1DJQA 5GNXA 1W3KA 1EBHA 2A85A 4KMQA 1AJ2A 2WLYA 3CUFA 4JIQA 5HJXA 1G1YA 1V79A 4K37A 3GKAA 5M5DA 3LCFA 1W3TA 1S5NA 4DM1A 1MEWA 4XBJA 4RZ6A 1PBGA 3WLNA 1XLAA 1ZHAA 2A3CA 2GJRA 4F0SA 5G1MA 4Y9NA 4AU0A 1CXIA 3A24A 2RDXA 1MZRA 2VC5A 1XIGA 2CNCA 3TONA 1XQKA 2JGQA 1S1RA 4WOZA 2WQPA 2DW6A 4GZIA 4RE3A 1NFGA 1JRCA 2I7GA 4O0ZA 4NZ4A 3WQ8A 5FEZA 1QMLA 3CLMA 4XAGA 1UUOA 3BQ5A 5D9MA 2YDAA 1EYWA 1VFHA 2Y1HA 3H7UA 2PLMA 1TPC1 2GGIA 3WNMA 4ECLA 3KHJA 3CB3A 5I7GA 1QOQA 3ZT6A 4XAYA 3EB3A 3AIWA 1MW3A 3QKEA 1SZGA 1TJPA 3WBEA 1ZAHA 3ABQA 4NJHA 1HP4A 1TQXA 3U0HA 2ZADA 2O9OA 1VFMA 3QMTA 5M1TA 1W17A 3VMNA 4YS1A 1SPQA 2OEJA 5K7JA 1XPGA 5T8GA 5XIAA 3E3HA 3BG9A 4AAJA 1V3IA 2Z6IA 2DZAA 1H1YA 1YTDA 3SQLA 1OFPA 4NZ1A 3C8FA 3GNPA 4GI4A 2PDJA 5BRQA 3VCRA 1X8CA 2NVAA 3RM8A 4GZ7A 2CZDA 4LQ1A 4WKAA 4EPDC 4EVZA 4IUOA 1TPUA 2GVLA 4LEFA 5EFFA 2O7SA 3DC8A 3P74A 4OV4A 3S83A 2F6UA 3OVRA 4L9XA 3BJFA 2QR6A 3CL8A 1PHWA 2NSOA 3UPBA 4AZIA 1QW8A 4HU8A 3FAWA 4RDZA 2A3HA 3PZQA 2OQHA 4NUWA 1UJPA 1KR1A 4OBSA 5C2CA 1RSCA 2F2HA 2XIQA 5JU6A 5HATA 3W1MA 1IXQA 3W02A 3GVGA 1R46A 2ODOA 1W1ZA 5MKGA 2CZEA 4KWUA 4OHQA 4AWEA 2V2DA 1A5AA 4DJED 1QOXA 4BZYA 3LCHA 3CIXA 4M1BA 5TNVA 2C1HA 1JAEA 4C6IA 5M03A 3M07A 1JZ7A 3TSBA 3HPZA 4FLQA 3EBVA 4OZOA 4I3GA 1KM5A 3WQFA 1J11A 2PI6A 4FNUA 2CBUA 1TZ9A 3B0PA 3OLGA 3MSYA 2V3EA 5M17A 3TTSA 3D6NA 2PRLA 1RD5A 1MFUA 1VAHA 3PAJA 2PDLA 1KM0A 4QAIA 3RX3A 4FF5A 4UOJA 1ZNNA 4RK8A 2XU2A 2PZ0A 3L4VA 3PG9A 4XQ6A 1LUCA 4LALA 3MUAA 2QJNA 4U3CA 4WGXA 1F73A 5AVNA 1JULA 3MKVA 3P84A 4H9ZA 3I3BA 1GHRA 4M7SA 2G4FA 2YL8A 1XDLA 4Y9PA 4RZBA 4U2YA 1R3QA 4GBDA 3CH0A 3P93A 1KBJA 1V93A 1ITQA 4ZE4A 4MGGA 4PUKA 1CENA 4GYJA 1V6UA 4LW7A 1H7RA 3B8IA 3PFRA 4JTAA 3ARVA 2W6RA 5AHIA 5K4XA 3CO8A 1BHGA 4HZ6A 4K3ZA 1EBGA 3VKKA 4N02A 4ZSUA 3HZ3A 1TV7A 5D9PA 3VNLA 5I2UA 5K4ZA 2YLLA 4TX9A 7PTDA 3NO5A 4B2DD 4E2BA 3OZMA 1CWYA 4QROA 1BGGA 2D0FA 3RHGA 2V9DA 1DWJM 3DG7A 4PMOA 1EFZA 3GC5A 4KIRA 3NPWA 2C13A 4HSOA 4M0XA 4NJJA 3SCUA 4W9TA 3H70A 4GLEA 2JBMA 3EA1A 1AW2A 1RHCA 1KNWA 3G22A 5HUPA 1W5MA 1A5BA 2VZOA 2QHAA 4ZO6A 1R3TA 3CUJA 1JCLA 3TTOA 1XXXA 4UMBA 2G3IA 4Z1CA 1L2UA 1BEUA 2GQ8A 3BLEA 3RDKA 2PB1A 3WDRA 5G5IA 2WKJA 4AEOA 1LP6A 2AGKA 1EB3A 1UP0A 1CLVA 1P0DA 3O6DA 4GQRA 1EO7A 4G8TA 1FWSA 1RD6A 4NZJA 3TW6A 3W7GA 1UR9A 1OFDA 5J04A 1O5RA 4C65A 3CHCA 3ES7A 4LAUA 4YTUA 2VC9A 5FJJA 3CWHA 4LUIA 3M64A 1H5VA 3BLPX 1XIDA 3THDA 4NX0A 2H9AA 3MB9A 3PBVA 2V68A 4HMDA 4UFLA 2XGZA 1NOFA 1DOSA 3TV8A 3CL6A 3UPMA 1HUVA 3QVQA 3VIKA 3GRIA 3IRDA 3KBSA 1BD0A 1KBBA 1OVDA 2WSKA 2PSNA 2PCQA 2WHJA 1HTIA 2FVLA 4NHVA 2WLZA 1U2YA 1ME9A 3RU6A 2J8GA 2VXNA 1OY0A 4W93A 1E9IA 1A3WA 3W6MA 2BLEA 2J77A 4GABA 1WUEA 4UB9A 1J12A 4TR9A 2CZ5A 3APYA 1SYTA 1Q4WA 4B3LA 1VKFA 3ME3A 1E6QM 3PSVA 4BI7A 4DPQA 2GSEA 4NX5A 1XDMA 3QFWA 2OPJA 4ZB0A 3GAYA 3Q45A 1QK2A 1DXEA 1YBQB 1RCXB 4XAZA 3MI6A 3UR8A 3OG2A 4S3KA 4Q8NA 4J5NA 4I8YA 3A23A 1WKDA 2VGIA 5EKYA 8A3HA 3R4IA 1FCQA 4DF2A 3UCDA 3WD2A 3HA1A 1OG0A 4OU1A 3R8HA 1YMYA 4TOQA 3N15A 3QV7A 4N9BA 2A0NA 3CZJA 1YLVA 1BG9A 5C54A 3K5XA 4PUNA 3IUIA 4JTGA 3HPXA 3MY9A 2ISFA 3LXAA 3O63A 4HOWA 4KH2A 5DXYA 3G0UA 4QSHA 4H83A 3H7VA 1CGYA 4W84A 2PF8A 3TN6A 1REQA 1EJXC 3VMPA 1YKWA 4MUZA 1GW1A 1EWDA 3PWIA 2C6QA 4G2DA 4BI6A 1ZBVA 1YRRA 3LCGA 1L6WA 4LUYA 4AEFA 3CMFA 1WXZA 3VOIA 3GW0A 5FSDC 2Q01A 4F79A 4IIFA 3W82A 3I7RA 4I5XA 5I0DA 5E70A 1SJCA 4IWWA 3NZGA 4PODA 1E5NA 2GVJA 4ZBCA 1GOXA 4XX6A 3FKKA 4O1EA 1DQUA 2X40A 5AZ0A 4POCA 5FF2A 2FB3A 1K3UA 4Q7IA 1QPRA 3MS8A 5CSUA 4XIMA 3SCOA 3EKLA 4K2SA 1H2JA 2VWSA 3TX9A 3WMBA 3E0WA 2YCJA 1JCMP 4B91A 5G2WA 4NF7A 3S2MA 1EC9A 4CD7A 3GR7A 3IJ6A 3B05A 4GISA 2HK0A 3MV01 3BW2A 3EX1A 4Q7BA 2IUZA 1UKPA 1PTDA 2PWFA 3E2SA 2XDFA 4LOCA 4GYFA 3E2VA 5DQPA 2DZPA 2ZA1A 4DVOA 3UU0A 3I3DA 3UXLA 1IR1A 4GY1A 4GRSA 4QITA 3PZNA 2HPIA 4H8UA 1L2QA 3LPGA 3THCA 1HN1A 4MWAB 1YNQA 3SCNA 4Q3MA 1TE6A 1CI1A 1F07A 3LUTA 2C19A 1LRQA 1R2SA 2QZRA 1QW9A 2G4JA 4JIPA 1IXNA 2VCCA 2W4XA 1GVIA 1SR9A 3R94A 1S2CA 1ICSA 1I2OA 2CLLA 3A4AA 2ZWZA 4F2TA 3EMZA 1BXBA 3VUSA 4S38A 2OO6A 1NY1A 5CJMA 2YA1A 3M0JA 1A80A 2PDPA 4PCTA 3KE0A 3O9NA 2VC7A 2QF7A 2QCFA 2PU1A 4YWIA 3TYDA 3VNJA 5CAHA 3G3MA 3T9PA 3GC4A 2ZQ0A 2PDWA 1MRAA 2OU4A 1WKEA 2VEPA 2NQJA 3QW3A 4DLMA 1XH1A 1MVYA 1NP2A 3LMYA 3URQA 3CAKA 1ZJAA 3CZGA 4UTKA 1G5AA 3HGRA 3B04A 1KLYA 3LTSA 1VBHA 3EWWA 3WX7A 1XYAA 2GQ9A 2BBFA 4HK5A 1IZCA 4DJDC 3G1YA 4PL1A 3OZOA 2P8CA 2CZVA 1ISZA 2PUZA 3CM4A 3TXVA 4NZ5A 3RM9A 2B7PA 1LRTA 2PDXA 5CLWA 3W07A 1RR2A 4J3XA 2I5QA 5I24A 4GKTA 4Z0JA 4EK7A 2NZLA 3V0TA 4CUCA 1AJ0A 3QM3A 1UKTA 1AK5A 2OZ0A 2YZRA 4NQ1A 4PTMA 1VJIA 3NVDA 1LLOA 3F2CA 1TJ2A 1A5UA 3II1A 2DUXA 4AZHA 4JTUA 2OG9A 2DIJA 1H62A 3WQ4A 2VRKA 3PF3A 4FLRA 3T8QA 1UZ4A 1AFSA 3OLDA 3P0XA 3SEPA 3HMJG 1XLMA 2XIOA 1Z32X 3DI1A 2PGWA 4AW7A 3FAXA 4G7EA 4QS5A 3BAJA 5CKSA 3HURA 4IJBA 3NYZA 3NQGA 3EDJA 4YJ5A 5T91A 1EHAA 2PWDA 3HG2A 5CC7A 4JTHA 7XIMA 7REQB 1ECEA 2TSYA 4ZOEA 1SO4A 2QJJA 1ISVA 3B9NA 4HYWA 5DFAA 3STFA 3KZPA 1CEOA 5JBDA 2FTWA 4CNOA 3GIQA 2FMNA 4LVFA 4JIEA 5AHLA 3TTEA 1POKA 1NH6A 2J47A 2FYMA 5C55A 4LCSA 1HL8A 4RDVA 1ONRA 2Z1BA 4H4IA 2YDQA 2YFOA 1U5JA 1UWIA 3TMLA 1H7XA 1EDQA 3GXTA 1Z42A 3F5LA 3T08A 4HZMA 3AJXA 1S46A 3AYSA 2QGYA 1HG3A 3S46A 3WQOA 1D2KA 4QE5A 4GIEA 3T0DA 2PEVA 3E2RA 1UR1A 3FN9A 4ZSTA 1RJQA 1V0NA 3H21A 4HPGA 1RZMA 4PMUA 3AICA 1JPDX 3P3BA 1E1CB 3IJDA 4Y9OA 4HIBA 2OQYA 4LSBA 3RYSA 1KGXA 3GBDA 1W1YA 4XIAA 5DX7A 2PDUA 1OYAA 3ZJ8A 5HXMA 1DTNA 1RPKA 5B7YA 2XN2A 4JY8A 4RR4A 1SM9A 3GTHA 2E5CA 1TA3A 3UJRA 3M9YA 2CHNA 3AYVA 3GUGA 2QV4A 4HJFA 3W88A 3V1PA 1PIFA 5A6KA 2I5IA 3FY1A 1JDDA 2CHRA 4CNTA 1NDZA 3NURA 3EMCA 3N4AA 4XAFA 1DJIA 3W2NA 3AIVA 3LCXA 2F6XA 3SCWA 3SUVA 3ISIX 1QUMA 1OFAA 1UOKA 2HPMA 3S1VA 1S3HA 1D8CA 3UG8A 3ORWA 3L65A 1UOZA 5G1YA 1TR1A 5CGMA 3VOHA 3W3OA 4D6JA 2WCSA 4F0HA 5AC7A 1C8YA 1X8FA 2AAMA 1YPXA 2VHLA 4NAEA 2VQTA 4GJJA 4DBDA 1R8LA 4AX7A 3R11A 5CBIA 1IYXA 2ZWYA 4OOUA 3L0NA 3NJ3A 4O4WA 4LT9A 4GXMA 3VDBA 1H7NA 3AXHA 4BQ4A 1FKXA 1RA0A 4L5ZA 3GC2A 2P3EA 4EX4A 1HL2A 2CLFA 1UZDA 1M7OA 2R8WA 3T42A 5GJMA 2GL5A 3WLPA 3A21A 2XFYA 4LU0A 4XZIA 3KOZA 3WH5A 4CNPA 3UXAA 3EWUA 3IIZA 1UD2A 1TG7A 1KRMA 2PTZA 1EGMA 1S2WA 3GXNA 5BCAA 1KFKA 2PE4A 1XLDA 4E2DA 1FA2A 5BXTA 1OZMA 2PODA 1AZ2A 4OBTA 2VDGA 4NP7A 5U4NA 3GYEA 3Q67A 4QIUA 2VX6A 3WDPP 3TYCA 2RGMA 3MHFA 3CHFA 5IDIA 2OQLA 2W67A 5CBJA 3P8IA 4A3QA 3EX4A 1Q63A 1XYBA 4GQGA 1I4NA 2WMGA 2QAFA 2F84A 1G9HA 1P4CA 3NZRA 4KERA 2IMRA 2XH7A 5HOSA 1QNSA 2A5HA 5BMWA 4DM2A 2YBVA 1E0XA 3OIXA 2Z26A 2Y89A 1K9DA 1OGBA 3G1VA 4W4QA 1R5YA 1WA3A 2V5CA 4M1RA 4ZENA 1P43A 1SZEA 1F3TA 4HMEA 4CLMA 3BVJA 2ALDA 1J0JA 4ADTA 3K1DA 1U30A 2PLJA 4H9XA 1BYAA 3DXIA 3QTPA 5HULA 4AD1A 4HYRA 4R33A 1EJ7L 4Z1AA 3W6LA 1O68A 3KOFA 4NJKA 4DYKA 2NV2A 4B4HA 3L4UA 3NA8A 1OBAA 1LJYA 1FKWA 3N13A 1ZBWA 3PSWA 2BHYA 2HISA 1PJ9A 4A3HA 5E0FA 2NQ5A 1DE6A 4HPNA 3G1XA 1V02A 1YXDA 2GWGA 4M19A 3A3WA 2E7FA 3OHIA 2XH2A 4L4PA 4XUGA 1JGMA 3HIJA 3LYEA 3VD9A 4O1BA 5C70A 3A3HA 2IQ0A 2ZX5A 3TKFA 2JIWA 1XIBA 1Q6LA 4YTQA 1GJWA 3MMWA 4B5VA 2YXXA 4F2UA 3W7QA 2VTFA 4U2ZA 2FPYA 4WQ6A 1NWUA 1I75A 3PUDA 5G4HC 4QLLA 3TAOA 3PZIA 1KWGA 3HGJA 1DBTA 2YCEA 4ORIA 4Q4KA 2HNEA 3EOSA 4BS0A 3ARPA 3G3DA 3CPGA 3CQHA 1SSDA 3RMEA 3UJSA 4LAMA 5KMYA 1KTBA 4PMXA 3U48A 1C8VA 1XLHA 1IIGA 1OCQA 4AYGA 2QJHA 4L4MA 3VTRA 3LY0A 5EB8A 2FVKA 5A8GA 3QFEA 1OHLA 5EMKA 1ISWA 1F3WA 3N14A 1DE5A 2JEQA 5F2LA 1GYNA 2PDFA 2FB2A 1UR2A 2XWDA 3A47A 4Q8MA 1KB3A 1MDLA 1HKJA 1SFSA 4B4FA 5D05A 4E2VA 2RUSA 4TTUA 1G69A 3W7PA 4YIWA 4RUBA 4QX4A 4DI8A 1LWIA 3V5CA 1AUSL 1W3JA 3GX9A 4A2RA 1PB0A 2F38A 3QV8A 1S2UA 5FA5A 2Z1WA 4ZMGA 4HU0A 5MF5A 4A2SA 5BYWA 3OIHA 2BZNA 3VD5A 4V2XA 2VNCA 3RO6A 2QDHA 5DRCA 1XHGA 2YIHA 5CPLA 2GJXA 4IIEA 3IACA 1B3OA 1HJUA 1WB0A 1XFCA 4D6CA 4M7TA 4O13A 3PZGA 2V5LA 3MC5A 3RLGA 3F2BA 1XJBA 3N17A 4HA4A 3LD5A 4LANA 3PPGA 3CH9A 1LT7A 2J7HA 1JJKA 3MJMA 3FXYA 5I77A 1EOKA 1VEPA 2VMFA 3N12A 5BW6A 2DJXA 3TC6A 1GOQA 3PJUA 3MO4A 2UY5A 2OYMA 2ZZ6A 3LLDA 2YA0A 3DU0A 1ITCA 5HR7A 4JZ5A 1J6PA 4DWSB 4HMNA 5I23A 1XUZA 1HP5A 4Q6XA 3GXDA 2CESA 2I17A 4EXAA 4QDWA 4U5IA 2OWCA 2OSXA 3BCDA 4WRHA 1MFVA 3ABZA 1V0KA 1JPIA 5I79A 1H1NA 2Z2UA 2NV1A 4O53A 3NM3A 2J8FA 3VOJA 1QHPA 5HA7A 3E1F1 4HNUA 4G9PA 5GVJA 3TC7A 3LGDA 2ZRUA 3BAIA 5CEWA 1S1PA 2ZVIA 3THUA 4MDOA 1W56A 1GOOA 3CBWA 1XD0A 1IEQA 1XIMA 5D2VA 3WK1A 1KQZA 4MPKA 3K8LA 1TZ7A 4MOZA 1YDYA 4Q4SA 3H2AA 4U33A 1IEVA 3DBPA 4GQ0A 3RM4A 1TCDA 4PFMA 5FJIA 2RKXA 4XBKA 3CYJA 4RZ4A 1Q2RA 3REQB 5TAOA 3K4AA 4PA8A 3VO0A 1XRSA 3DG6A 1XDJA 2JK2A 3CWNA 4EANA 4O57A 3ENLA 1FWCC 5G2HA 5DF0A 3KWXA 5F2IA 1GVFA 4D2JA 3CGTA 3QYSA 3QQWA 1FWDC 1YW1A 3NPVA 1K7FA 3CEPA 2DY3A 3MSRA 2XVGA 4ZOAA 4CU7A 3N2MA 2DORA 4ZQOA 5F2GA 3RNDA 2EQDA 4O1FA 5I3GA 3GG0A 4L9ZA 4CKQA 4ZA0A 1UKQA 4XZMX 1TO3A 4FPSA 1K9TA 3HQOA 1PZ2A 1YADA 3LHUA 4ZQCA 3TH6A 4IXXA 1KGWA 4XKYB 1S5TA 4M81A 3CL7A 2BG5A 1CNVA 2QS8A 2W92A 3USZA 5G4WA 3DFQA 3P5YA 3OA3A 5RUBA 3VUPA 5HJLA 4YCOA 2CBVA 5CPOA 1AQFA 1IGSA 3VIPA 2FFCA 1WO2A 3MCOA 1SO3A 5JXQA 1K8XA 1UZ1A 5F2MA 4H41A 3WJZA 1CECA 1EJUC 2A3AA 3AFBA 3MZ2A 3ATYA 1RCOB 3S2JA 1JCJA 4K6AA 1K9FA 2D23A 3E6EA 2VEMA 4Q8UA 1FY6A 4IXHA 4A3UA 3TA9A 2PDYA 1TELA 1XPYA 4G56A 1ICPA 5IFTA 4GJIA 4DZHA 4ICNA 1GOMA 4IUGA 2P5NA 4K39A 4N9EA 2HXUA 1NFPA 3IGHX 1ONWA 1NIUA 3UETA 3LTYA 3QHOA 1JUBA 1VPYA 2UV8G 4AZGA 3P7YA 2E9BA 2EO7A 3VGGA 2VL4A 5E9XA 2C18A 3DYMA 1IIHA 1RQBA 4IX0A 4JKKA 3QC3A 3MHGA 2OTDA 1V02E 5C0QA 2DUZA 5D32A 1HVXA 3OPSA 1EXBA 3OQEA 1NU5A 2GGHA 3BAKA 3QW4B 6ENLA 4F2BA 2PLCA 3ONCA 4KT2A 2Z0IA 4Q4OA 3QJAA 1SMDA 3GB6A 4DUWA 1N8IA 3KLKA 2ICSA 1WX0A 5AHFA 1QFEA 3S1XA 3S5ZA 4QQUA 3OP2A 1ECQA 4U10A 5AECA 1KM6A 5GJNA 5D2YA 4GY7A 1BVNP 2Y61A 3B9OA 4NY2A 1C9WA 5BXSA 3W25A 5DLCA 4AYSA 1JFHA 4UC5A 1KTCA 1GW9A 3FNDA 4N6FA 3GDRA 1QI5A 3N2XA 2CFFA 2E68A 1OQFA 3OOQA 3W71A 3TK7A 4Q8VA 3BO9A 1YBQA 2Z27A 3VXGA 1Q65A 3NQAA 1M68A 2XGBA 4W7VA 4X63A 3RAOA 2GZXA 8TIMA 1GTEA 3ALGA 3OEXA 3R8GA 4KFPA 1IEXA 2XM2A 3PBGA 3I3EA 1OIFA 2QUUA 3TJ4A 1HJSA 4FOUA 2DZTA 1ITXA 4GXWA 1TPWA 4J27A 1J96A 3WD0A 5HDRA 3QZEA 3W7LA 2F9RA 3RIKA 1XCXA 1ICQA 3TLLA 2W66A 4A3RA 2BGSA 1JQXA 2HMCA 2C15A 2OT1A 1YDVA 1OFEA 2IQDA 3AALA 5DMYA 4ZE5A 4I9TA 1VQTA 4LPCA 5HWJA 5HWNA 3M43A 4MB1A 5A2BA 4UR9A 3N73A 1WDPA 1KFJA 1NEYA 3QMRA 4JDBA 4EWND 3CMJA 3TNBA 2XYLA 2W27A 3DCPA 3P80A 3T07A 2E1DA 3H7RA 4CCCA 3WQ6A 4S23A 1JAKA 1KXVA 4ZVJA 1WZMA 1W1VA 2GLKA 4L1WA 4ZQPA 3JS3A 4PCSA 3EB4A 2B4GA 3MZNA 4YWSA 5LNVA 3W27A 4HGXA 3TLQA 1KRBC 2HK1A 3NQ7A 1JZ2A 4WK9A 2REQB 1GJPA 1ZPTA 3WDHA 4MKNA 4IIBA 4NG3A 4PMYA 1Z8AA 3W4RA 2C1GA 5HMFA 2J7BA 1SJDA 2KAUC 1BFNA 1XV8A 4I8DA 2E5BA 3OVPA 3JU2A