2QJHA

M. jannaschii adh synthase covalently bound to dihydroxyacetone phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPIKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGDVGLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVGITRAVCKIVHENADVEEALKEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative aldolase MJ0400
publication title Structure of 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase, a catalyst in the archaeal pathway for the biosynthesis of aromatic amino acids.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Lyase
total genus 88
structure length 264
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature ec 2.2.1.10: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase.
pdb deposition date 2007-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qjhA00
4NQ1A 1OYCA 1F7BA 3PY2A 1CW2A 3M9YA 1WAUA 4UUIA 3G1VA 5I3IA 2C14A 1NFBA 3EWBX 5LNSA 5HNRA 3HBLA 4UXDA 3E49A 4ICNA 4LRTA 2A21A 2WSYA 4JTGA 3STGA 3S5OA 1KFJA 4YWIA 4C1KA 1K7FA 4H3DA 4RZ6A 4JICA 3TFCA 3W85A 4O54A 1EX5A 2DP3A 4UIOA 1EIXA 3RMJA 2JGYA 3GIYA 2ZZ7A 2QKFA 4AF0B 1IXPA 2YPIA 1HUVA 3M6YA 3N9RA 2FB3A 3MHFA 4JX6A 3LHYA 3FIGA 3SECA 1VH7A 3NPXA 5LKYA 5D2YA 2QEZA 4IXHA 4MY8A 1HG3A 3W22A 4GWEA 3LDVA 4I7WA 2NUWA 2WO5A 3W1NA 3SI9A 5FF0A 1YDOA 3IVTA 4LVGA 1ZNNA 4JYEA 5F2MA 2HMCA 1IIHA 4IPIA 5D03A 1ICSA 1EWDA 3NO5A 5G1YA 5D32A 4MFEA 2EAWA 1VS1A 2KZHA 4MLJA 3LXBA 4M5PA 3PUDA 1GEQA 2YFNA 4O1DA 2QCMA 3QPZA 2A5HA 4EF8A 4LNYA 1KBJA 4BF9A 2I9EA 3PS7A 2QF7A 3P84A 2GJLA 4AAJA 5DXXA 4TU1A 5D09A 3GVGA 2YYTA 2FB2A 1FUYA 3HGJA 4K8EA 1OK6A 4MLRA 2CLMA 3HO8A 1W37A 3ZWTA 3NZ1A 1Q6OA 1KBIA 1VCVA 2VFHA 4JD4A 1PHWA 2EGZA 1VHNA 3GR7A 3S5ZA 3MI3A 2ZDRA 3E0IA 3W84A 2O7QA 3YPIA 1FWTA 2E6YA 4JTHA 1KTNA 2OCZA 1WOAA 1YTDA 1GG1A 1W54A 3KVLA 3OA3A 3W7NA 1OVDA 2I1OA 2YDAA 4GUIA 3C2OA 5D2XA 4BR1A 4Y9AA 3B8DA 1XBVA 1KLZA 1S5WA 3UWZA 2A2IA 2V2CA 3DKJA 3P61A 2B4GA 3PBYA 3G1YA 3TXZA 1G67A 3OVRA 5E0KA 3ABQA 3TSBA 3BG5A 3KRZA 4LW7A 4LVFA 3BK0A 1LROA 4LS0A 5CSSA 3EXSA 3G1DA 5F2IA 5IBXC 3IGXA 4CNOA 4FNSA 4FX6M 1PS9A 1ADOA 3NXFA 5DCEA 3LRLA 1AL8A 3BW2A 2H3BA 3CPRA 4GUJA 4O1BA 2ZBTA 1R30A 4OBTA 4OGZA 4GXMA 1FDYA 3UWUA 1YDVA 3DI1A 3BO9A 3NNTA 3L9CA 4HHPA 3W7MA 4R53A 1X1ZA 2XN0A 4DPPA 3C2RA 1S3HA 3NQ6A 2CU0A 5C55A 4XWUA 2C6QA 3PB2A 4PC8A 2H90A 1PL9A 3S1WA 1Z48A 1H51A 4YL2A 4DF0A 3P8IA 4ZMGA 5K9XA 5G5IA 1FWWA 5EYWA 2CFFA 1H7XA 1TPH1 1W3TA 5C6MA 1OFOA 5KITA 4JTTA 3PAJA 2V5BA 1ZAIA 3W75A 3G0UA 4A2RA 1H63A 1NF0A 1JQXA 1W1ZA 5IM51 3O07A 1P4CA 4UR8A 4NXSA 4YCOA 1QPRA 3O6YX 1EP3A 4HKPA 3CLMA 3M0ZA 4M6PA 3QEZA 1SUXA 2C19A 3STEA 4OU1A 5K9CA 3VNDA 2DZTA 1YDNA 3FFSA 1JCLA 2P0OA 5F1UA 3N2XA 1EWEA 2G96A 4HNVA 2QAPA 1Y0EA 1TRIA 2R91A 3KAOA 1XBXA 3BPWA 4M7SA 4W9TA 2VFDA 1RZMA 3W74A 1TJPA 1XDLA 2A7PA 4NNBA 4PTNA 4Q32A 1G69A 1GWJA 3CIXA 1A53A 3LBMA 3MBFA 3NL6A 3PULA 4AEOA 3GNNA 3NL5A 2Z0IA 3CB8A 3PVFA 5DBTA 2W79A 4TMCA 3GB6A 3NQMA 3MW7A 1SFJA 4IJBA 1EA0A 4XTIA 4MIMA 1SZEA 1VLWA 1IGSA 3PUOA 2GQ9A 5AYXA 1WOBA 2RHGA 2Y7FA 4X22A 2EHHA 1I2OA 1LTDA 3DAQA 4ORIA 1KFBA 1ALDA 3QQ1A 1UJPA 2JK2A 4NJGA 3UD6A 5LSMA 4A3UA 1DORA 3HG4A 3Q2DA 2JKEA 3O05A 3IIPA 1N55A 6TIMA 1KLYA 1L2UA 1H7RA 1P5BA 3RF9A 1H5YA 4HPXA 1LBLA 1EPXA 4NJHA 4JGDA 1WYIA 4DF2A 3VCRA 3W7EA 2X1SA 1PVNA 1TV8A 5GVJA 3P74A 3LTPA 3GK0A 2H8ZA 2AQWA 2GJNA 4K7YA 2IQTA 5K3VA 1LBMA 2ZZ6A 1GZGA 2H3DA 5K4XA 2P10A 2V0TA 1GTHA 4Q4KA 1KTBA 1OFAA 3P60A 1I2QA 5TIMA 2BWGA 3VI2A 1JQVA 1T8XA 2RH9A 3LTSA 1W5QA 3F4NA 2FDSA 4DO6A 1SW7A 1RQEA 1OF6A 2QCGA 3FA5A 3NPVA 1VRDA 1FDJA 2GQ8A 4N9CA 2ZZ3A 5FEZA 5HWJA 1O94A 2QUUA 4KKXA 1B4EA 4BI5A 1ICPA 4O28A 2ATSA 4Z1CA 3STCA 1R2RA 3MWAA 3TW7A 3IEBA 2Z1BA 3M7WA 1NVMA 2ZZ4A 3LI1A 4CLMA 4XZ9A 2HTMA 4I7UA 1F74A 1OG0A 3W7OA 4QM1A 4HNTA 3NQCA 3BGJA 3KVMA 3LCLA 3P5YA 3W7LA 4H4IA 4JX5A 1AL7A 5C5YA 1VYRA 2VENA 3IVUA 5AHLA 5DELA 1LDCA 5A8GA 2Y7DA 3HMJG 3L5MA 3W7RA 4DXVA 1OK4A 1XDMA 4N6FA 5DY3A 3TAOA 4H6KA 2GOUA 1X8FA 2VEKA 4TR9A 2WQPA 1ONRA 1YXDA 5ABTA 1EB3A 3L21A 3MYOA 4O52A 2R94A 1KV5A 2Y7GA 4Z1BA 2NX9A 4WY0A 2V81A 3C4UA 5K7JA 1DHPA 5HR6A 2V9DA 2YW4A 1FCQA 1FWRA 3N73A 3TFXA 4Z0SA 2Q8ZA 4POCA 4D2JA 4G1KA 1RV8A 1KFLA 1F05A 4BI6A 2E6FA 1I45A 2GQAA 3OBKA 1TPWA 5D2WA 1Q6LA 3O6DA 1ML1A 3LHVA 3LRKA 2Y62A 3L0GA 3M16A 1WBJA 1OFQA 2ZZ5A 4JY9A 1HO1A 3AO0A 1SZNA 3S42A 3QMSA 2FQIA 3NR0A 5I3FA 4XTDA 2W0UA 1UASA 5IBXA 5BRBA 4JYDA 1VZWA 1W31A 1DVJA 1QNVA 2YZRA 3FKKA 1SU5A 4WJEA 3CT7A 4FNTA 2Z6IA 4GUGA 5EPDA 3QPYA 4LRSA 5F4WA 2DORA 3P82A 3HJZA 3LI0A 4YMZA 4JS3A 3W1UA 3MBDA 2G5WA 1O5KA 3QSTA 4MOZA 4DQWA 4FHAA 3TW6A 3EKLA 1W5OA 1IXQA 3N2MA 1THFD 3ATZA 3IIXA 4LV4A 1GYLA 1KW1A 4K36A 1VCGA 5FEPA 3PSVA 3NZRA 3NQEA 3S1UA 2FFCA 1LLWA 3CEPA 3EWZA 4NU7A 2QUVA 3LCIA 3HF3A 1LOLA 3GYEA 4XBSA 4AWUA 3NQAA 4NJKA 4DO5A 1FXPA 3DZ1A 4E0CA 5DY2A 2WNZA 3NDOA 4QAIA 1D3GA 4NT0A 2X30A 3FS2A 1TPFA 1FCUA 4FNPA 3S8HA 1SW3A 4DPQA 1VJIA 1OHLA 1K3UA 5D30A 3O6CA 3B04A 1F6KA 1QOQA 5I3KA 3W7CA 3V1PA 4PEKA 2X1RA 4FXSA 4ZQRA 1ZENA 3MI2A 1G4PA 4M6QA 1GOXA 2B7PA 1GT8A 1Q6QA 4UFHA 2QCDA 3TJXA 1I2RA 4MPQA 3W9ZA 2ZFAA 4XQ6A 3CHVA 4O14A 1ME7A 3UWWA 1KA9F 3C0JA 3NQ7A 4AF0A 1DL3A 2VXNA 3DHDA 3WK0A 1TPB1 1QPQA 2NXIA 5CSRA 1JCMP 2V82A 3B0VC 1QDSA 1GPWA 3NQFA 3EX3A 1P1XA 4ADTA 3G3DA 1MEIA 3KOFA 1AMKA 3E9AA 3ZR4A 3HPXA 3HG5A 3W73A 3TQKA 2Y61A 3SGZA 5AOUA 4ALDA 4FX8A 4AHQA 4PL1A 3EWUA 1JRCA 3MUXA 3TU9A 1G4SA 3USBA 4CCCA 3TX9A 4JN6A 2QCDB 1UB3A 4UFIA 1FDZA 3BARA 3LCGA 1YPFA 4S2CA 3WK3A 5KTLA 3ABSA 2DZPA 4GE8A 4M19A 4MUZA 5H91A 7TIMA 2C3ZA 3LOTA 1XXXA 1C8VA 1QR7A 3EEGA 3TROA 3UY8A 3QFEA 1U5JA 4O12A 3TC6A 3QJAA 2WJZA 5CPMA 4JTSA 2EKCA 1E51A 2OT0A 2WKJA 4NJIA 2VEMA 1OABA 3T44A 3G8RA 2Y63A 3P67A 1AW5A 3PB0A 4U4MA 4O1AA 2D73A 3RFAA 5LGZA 1SPQA 1SW0A 1XI3A 3L66A 4IMDA 3VE7A 1W3NA 1XM3A 3THAA 1W3IA 2OMAA 5K9DA 2EPHA 3MI6A 3G1XA 4JTLA 3EB2A 2FPVA 1IIGA 3A22A 3W7JA 4CCEA 3UPWA 4AHOA 1T0OA 1V7YA 4IGHA 3HGRA 3TA6A 2YSWA 5F1VA 3AJXA 4UTHA 5E93A 3G3MA 1VHCA 3RNDA 3M5VA 2ZRXA 4UMAA 1AK5A 1HO4A 5LNUA 5AYYA 3TCEA 3NQ8A 3W2UA 1X1OA 2CLIA 4Z1DA 2ISWA 1SFLA 2R14A 3NG3A 1H60A 2J24A 1DOSA 3Q37A 5BMWA 4HT3A 4FNUA 3DKLA 4QNEA 2NZLA 4NX5A 2TSYA 1F6PA 4DBDA 3BLFA 3W2MA 3LV5A 5EL1A 3N3MA 4UNLA 3B4UA 1F5ZA 4JIQA 4UFKA 1FY6A 3GX9A 3S1XA 2NWSA 4X3ZA 4LU0A 4PA8A 1H7WA 4ADSA 3SJ3A 5HWMA 3MJYA 3NQVA 1GVOA 2CLKA 1ZALA 1JUEA 4UC5A 3NQGA 3DFPA 2BXVA 1JUKA 1FWSA 1ZJIA 5L9FA 4JIPA 3UY7A 2TPSA 3U8GA 2YXGA 3HGOA 3KRSA 3NPWA 2JKAA 3W72A 3NVTA 2NXHA 3PWAA 1JCNA 1KTCA 2V2DA 2ZA2A 2VFIA 1HL2A 1H7OA 3R89A 3TUUA 4WXZA 5FF4A 5DXYA 3P7YA 4UTIA 3JR2A 3QF0A 2BTMA 1XKYA 3GKAA 5LNWA 2NV1A 1QOPA 4DEFA 5HUOA 4YLWA 3MO7A 2QUTA 3NPUA 1FQ0A 4WQ6A 4I7VA 3A5FA 1SSDA 4PL2A 3S1VA 3W1LA 3W2NA 5TBOA 4B5NA 1W5PA 2ABBA 3DXIA 5DN1A 4AHPA 4QITA 4LY8A 4IWWA 3PUEA 4AB4A 2E68A 5CG7A 1U83A 5D2TA 1DQWA 5HWNA 2HS6A 4IOTA 2FPTA 2WPBA 3MHGA 4RCXA 5I3HA 2ZZ1A 1WXJA 2NWRA 4QNWA 4FIRA 5G2HA 1X7FA 4LTSA 1DKWA 5EY5A 4N2YA 4MJMA 4E2DA 1L6WA 4LVAA 2GVGA 1P0KA 3EKZA 4IMCA 1TTQA 5D2VA 3TH6A 4ZZ9A 3M5YA 3NAVA 1BWKA 1L6SA 1V5XA 1LRQA 1PV8A 1BTMA 1OFDA 3A23A 1I2NA 2QCLA 3VKJA 3WJSA 4QSHA 1D3HA 4A21A 3SSJA 2A7NA 1H61A 2FIQA 1TSIA 2Y88A 3G22A 2Y70A 4RX0A 5U7SA 1K7EA 1G7UA 3EXTA 4NXKA 5F2LA 3HB9A 3SR7A 3R2GA 1TPEA 3U2OA 2CZFA 3GDTA 1BEUA 4JDYA 4ZQPA 3CWOX 3DU0A 1ZAHA 3GNDA 3IRDA 4OHQA 1Z42A 4HSOA 1QFEA 2C13A 3LBCA 3NQDA 4EWND 2B7NA 5CZ0A 3I7RA 4C1LA 3KVKA 4LC8A 4UR7A 1NSJA 3KVJA 2UV8G 4UFLA 4O13A 2WNQA 2PC4A 3KHJA 3S6DA 1JCYA 3O8AA 2WSQA 3IGSA 5G1TA 2J9YA 2E1DA 4XUGA 1S5TA 3Q94A 4O19A 4EVZA 3KFTA 2NX1A 1Z44A 3W7DA 2ZCGA 1WBHA 5AC6A 3H53A 1UCWA 1LOSA 2ZRYA 5D37A 3B06A 4NX0A 3BW4A 3C8FA 2XN2A 1KFEA 2PRMA 4WUIA 4IMFA 3HGSA 3OVQA 5FEWA 4R33A 1F73A 5KZMA 3ZWSA 3DFQA 1K02A 2BX7A 3DHFA 3UXDA 3RU6A 3C2FA 1KM2A 3GAYA 4OWGA 2VEIA 1GYNA 4I9AA 2LLEA 3LX9A 2YFOA 3TMQA 3INPA 3CC1A 1GG0A 4K6AA 1KV8A 5LNRA 4UMCA 5E1QA 1GVRA 1ZCOA 4LS1A 1A5AA 3W1AA 5U4NA 1TREA 1B9BA 4NNAA 4XBKA 1LP6A 1YTEA 4UNKA 1A5CA 1RPXA 3RLVA 2CWNA 3PSWA 3TJLA 1H7NA 3BLIA 3M5ZA 5LNVA 3TXVA 2NX3A 5SWUA 3GKFA 3R12A 4UTMA 2A1YA 4UMBA 3G24A 4LVBA 1PIIA 2A85A 2WV8A 3W7QA 1GVQA 3O15A 3KX6A 3EX2A 4UTUA 2QDGA 3E96A 2G95A 1FBAA 1YPIA 2BLEA 1N7KA 3W7PA 3DFSA 1OYBA 3LV6A 4XKYB 2ISSA 3P81A 4JTIA 4ORMA 2Q3OA 4O4VA 3BG9A 1H7PA 3RLUA 4HNUA 2WOQA 1XCFA 1VCFA 1J2WA 3N9SA 2CZ5A 4MJZA 5AC8A 1LYXA 2ZA3A 1UUMA 1W5NA 3FLUA 2F7FA 3G1HA 4BFAA 3R5EA 3C61A 3M43A 2DZXA 4K38A 4ADUA 1GTEA 3EWWA 1WA3A 1OFEA 4JR5A 4ZQCA 3MP4A 3IIVA 2WSRA 5LHFA 4GJ1A 5HINA 2WNNA 4NZFA 4FXRA 4CQAA 1HFBA 5KINA 4JXCA 3LB0A 3DBPA 1BKSA 1T99A 1D9EA 3SZ8A 1LRNA 5HMSA 5G4WA 4RK8A 5D33A 5K2ZA 1OFBA 5HUPA 3W1RA 2E09A 3W86A 1BWLA 4UFMA 4RZ4A 1KM3A 1MEHA 1FCBA 1XL9A 3TSMA 3T4CA 2CZEA 4IMGA 2VC6A 1KFCA 4RZ5A 1YYAA 4HPJA 2XN1A 1GVFA 4BWLC 4M6VA 4AWSA 2Y7EA 3O63A 3PBUA 3NA8A 2QR6A 2W6RA 2DZVA 2FLIA 3W2JA 3KRUA 2ZTKA 3CQ0A 3HG3A 2V5LA 4Y8FA 1MO0A 2NXGA 3T55A 1M7PA 4NNCA 4AWTA 3TR2A 3CM4A 4Y6GA 2AAMA 1T96A 4UFJA 3C6CA 4UTTA 4TMBA 1IF2A 3LXCA 2PRLA 3WK1A 1XBZA 3H55A 4TIMA 1JCJA 5AHEA 3TIMA 2ZRVA 1WDWA 3DGRA 4MYXA 4BK9A 1WX0A 4ONVA 2GVLA 2QJGA 2JBMA 4CNNA 2QCFA 4IMEA 3L5AA 2Y85A 3GDRA 1OFPA 3NL2A 5F2GA 3L0KA 1O60A 5FF2A 4MYAA 2GUUA 2I14A 4HSNA 6ALDA 3CIWA 3E02A 3SIZA 2B7OA 4GBUA 3ELFA 2J9XA 2GVJA 1F76A 3BV4A 1SR9A 1UUOA 3L68A 3TDFA 2ISVA 5F4XA 1VR6A 5A5WA 3W7IA 4U28A 3EX6A 2QCNA 3IVSA 3FKRA 3G1FA 3F1QA 3LRMA 2DU2A 4TX9A 1M6JA 5KZEA 1LZOA 1JJKA 4LOCA 3W88A 3BGGA 4GC4A 1J5TA 3MP5A 4MZYA 4FB7A 3O1NA 3C2VA 2XFWA 3EWXA 3OIXA 1QMLA 3EWYA 4NUWA 2NLIA 3GXPA 1RR2A 3QYQA 3WJWA 4ZQOA 1PCKA 1YTKA 4MZ8A 2J6XA 1RD5A 1H50A 3NGJA 5AHNA 2C16A 3FEMA 2O7SA 4KWVA 2YGYA 1B3OA 2ZRUA 4N02A 3SFKA 5D38A 3UNDA 4AH7A 1G4TA 2E6AA 1GJPA 3TC7A 1AG1O 5BNKA 2X2GA 2A0NA 4FNRA 1ZAJA 2RDWA 1X6UA 5EKYA 3W7GA 4JEQA 4GRSA 3BG3A 1TPUA 3B0UX 2C18A 4FF7A 1OX6A 1MEWA 3PF3A 4OT7A 1LORA 1S5VA 3I7SA 5DCBA 1EP1A 5AHIA 3W07A 1LCOA 1O4UA 2FJKA 2VEPA 3NOEA 3P8JA 3P5ZA 3A9IA 3L0NA 5EBUA 5T26A 3W2KA 5AB3A 1R46A 5HQEA 4MKNA 2EF9A 1IXOA 3W1MA 2ZTJA 4OV4A 1IXNA 1K7XA 3V75A 3OHIA 2J27A 1K8XA 4JTEA 5CZJA 1XFBA 3R8RA 4NVTA 3HOJA 3T7VA 2CZDA 1NAL1 4LV9A 1VLIA 3OVPA 3T78A 4WY0F 3LCHA 5HULA 3F4WA 2RKXA 4N4QA 2QJHA 4MY9A 4OV9A 1EUNA 3HG2A 1SZGA 4JX4A 5DBUA 3N19B 1YLVA 3LCWA 4IPJA 3ZS4A 1TRDA 2DJLA 3S0CA 2OJPA 5D02A 1F2JA 4HNNA 5LZLA 1WQ5A 4CCDA 2Q8LA 2VFGA 1JR1A 4A2SA 4BI7A 2BZNA 3Q58A 2VKZG 3NYZA 2C1HA 2X16A 4YXGA 4Z1AA 3M5XA 4Z0JA 3W1XA 3C2EA 3PM6A 1VYPX 3SY5A 2C15A 4O11A 2E5DA 4K8HA 3IGUA 1Z41A 1FX6A 2HS8A 1KM1A 3W6YA 2E5BA 1FWNA 1LRTA 3A21A 4JTFA 3TNOA 4EOUA 1VGAA 4OQVA 5AHMA 2OX1A 2ZRWA 3QMRA 1VC4A 4L4MA 5D04C 4ZQNA 1W8SA 2RFGA 3U6WA 3I65A 1XUUA 5AFDA 1DQXA 3T40A 1I2PA 3LHWA 3BLEA 5J5DA 2YX0A 4NJJA 3W70A 5D05A 1QCWA 3VFLA 1XUZA 1TQJA 1G4EA 1RQHA 3MMTA 4N4PA 2JGQA 4PCFA 2ATMA 5K4ZA 1QPOA 3IV3A 1OF8A 1LOQA 2QDHA 5KZDA 4O18A 5G2WA 2YW3A 2VELA 3ZFHA 3FOKA 3G18A 4DF1A 5HR7A 3LLFA 3OG3A 3RK8A 3W7KA 3QRHA 2E77A 5CPLA 3UYCA 4EF9A 1JUBA 4WXYA 4X9SA 2E6DA 2OZ0A 1AW1A 1QO2A 3M47A 4O1CA 1TB3A 3LHZA 2VFFA 1LM1A 1OFRA 2H8XA 3D0CA 4AVFA 3GR8A 1R47A 5I3GA 3W87A 1H1YA 4LWWA 1TPDA 3GZ3A 4WOZA 1VPXA 4O10A 3DFTA 4KFPA 5C2XA 3THQA 4OE7A 4PODA 1ZY9A 1TPVA 4UTWA 3W71A 4JTKA 2VOMA 1AW2A 5J5RA 1A5BA 4BWLA 3G8EA 4FO4A 3NEVA 2ZZ2A 4P2VA 3S5YA 4HN4A 5H2ZA 3ATYA 1SO6A 4Z08A 2A4AA 1DJNA 4IXXA 3S5NA 3LTYA 1XC4A 1TTPA 3CEUA 1TO3A 4PFMA 3PG8A 4LUJA 4UTTC 1LLZA 5CPNA 4S2BA 1GQNA 3W3OA 1W56A 4O15A 4O0KA 1K03A 2CLFA 2DZSA 3I6RA 3N34A 4O16A 4PH6A 5BW6A 1DV7A 5I3JA 1C29A 1P0NA 2V30A 4LUIA 4X2RA 2X1UA 3TMLA 4RJEA 4KFOA 5HJLA 3HQ1A 2Y89A 3PBWA 4EIVA 5AC7A 2A7RA 2NV2A 3HIJA 1PE1A 4MFDA 2CLEA 2YYUA 3IIZA 3DH7A 3FYOA 4JTUA 2B0MA 4N6EA 4K37A 3B0PA 3WJZA 4Y96A 4O53A 3EXRA 3TSDA 3LM7A 1DJQA 3L65A 1TV7A 2A6NA 4QIUA 4E2BA 2A6LA 2DJXA 2QCEA 2YCEA 1KM4A 3QM3A 4O4WA 1I4NA 5BMXA 4JTJA 5FI8A 4CQ9A 1PCWA 1SO3A 4K7VA 3UWQA 4N9DA 5BOOA 3QSRA 1CX9A 3LERA 4NZJA 4O17A 5AYZA 5EMUA 5FESA 2X1TA 1M7OA 5CPOA 3UZ5A 4FEZA 2PRHA 1SO5A 3EX1A 3UZJA 2ZYFA 1H1ZA 4J9JA 1NEYA 2B7QA 4K39A 2CW6A 1MZHA 3ABRA 3P62A 3QQ0A 1QWGA 3G0SA 3E12A 3GAKA 3BVJA 1TTJA 5DLCA 4UTKA 2HSAA 4ML9A 1ZFJA 1SSGA 1TCDA 3MHUA 3QW4B 3HPZA 1RVGA 1L9WA 5MHBA 2GPTA 3O16A 3C52A 1A5SA 3DFOA 3NM1A 3L67A 5KMYA 3ABOA 3QH2A 3TKFA 3S9YA 1QAPA 4S1FA 4JYFA 1UBSA 2F84A 1RQBA 2CLHA 5CGQA 3MP3A 1KFKA 2ALDA 5TQLA 3G0XA 4XKYA 4O8RA 2CLOA 4GNJA 2DZWA 4O50A 1B4KA 3N14A 1JVNA 4UTLA 3LGEA 1TV5A 2TYSA 1YXCA 1MSSA 4IX0A 4R34A 4QJ1A 4IUOA 1WV2A 1QPNA 2DZUA 3W23A 3FJLA 3WK2A 3G1AA 3JS3A 4O57A 1W0MA 2ZRZA 1ZHAA 1EUAA 2JKPA 4TO8A 3M1ZA 3GDMA 1TJRA 4QQ3A 2RDUA 2PURA 3CU2A 4Q33A 3H54A 1J4EA 3FJ6A 3L2IA 1O5XA 2TMDA 4WX2A 8TIMA 1Q3NA 1N8FA 3EX4A 4ZQMA 3W1TA 2QAFA 2NUYA 2R8WA 3DENA 1NF7A 5FEXA 3GXTA 3W1PA 2PCQA 4P61A 4JDBA 5G4EA 4MZ1A 1DBTA 1TYGA 4LT9A 3SGUA 4KWWA 4HIBA 3W76A 2RDTA 2TRSA 1EP2A 4RXFA 4QISA 1KM0A 1YADA 3TV8A 3BW3A 1ME8A 2NUXA 1OX4A 3PC0A 2PE4A 3O06A 4N9BA 3LHUA 3I7QA 1KM5A 4CNPA 1TMHA 3JRKA 4RLIA 3W7HA 3A24A 1M5WA 5DCDA 1R2TA 3LCXA 4DBEA 5LGXA 3DI0A 4ZVJA 3SW6A 4GFSA 3UWYA 1TPC1 1FXQA 1B57A 1SO4A 3UXAA 1R2SA 2J88A 4KFNA 4GUFA 3C3NA 2QCHA 5AHFA 1G7VA 3M44A 3TQ0A 1GVSA 3WFAA 4YCPA 1QO5A 2CLLA 3PG9A 3PBVA 3QMTA 1K8YA 3UPBA 4AXKA 5FF7A 3PR2A 4O0ZA 3MYPA 3R13A 3FYPA 2E5CA 3QC3A 3TE9A 1HTIA 3W2LA 1KM6A 2ZA1A 1EEPA 3LLDA 1OX4B 2V2HA 2OT1A 5FF3A 4FX7A 1FCVA 4AMAA 4CQ8A 4DELA 4UTWC 2Z6JA 1C9DA 1LBFA 4JY8A 3WJYA 4LC6A 4DO4A 3B05A 1TIMA 3WJXA 5KSWA 2C0AA 2ABAA 3QW3A 3W83A 4MY1A 4LVDA 1VYSX 4ZL1A 3UWVA 1Q45A 1SQ7A 4RKAA 4IQLA 4WY0B 3F03K 5LHEA 1TTIA 1OYAA 1YXYA 1OX5A 3P80A 1CI1A 3GDLA 2ZQ0A 3LCFA 2Y6ZA 3NQ2A 5CZTA 4IX2A 2V8ZA 3STFA 3C56A 4L4LA 4UTJA 2G97A 1I8JA 1JULA 3CWNA 3L5LA 5L6UA 4FIQA 4GUHA 1OJXA 2AGKA 1XBYA 4M7TA 4RR4A 3IIOA 3LXAA 4RXGA 3CTLA 4WOQA 1O95A 1A50A 1ME9A 4A22A 3LHTA 3TQVA 3I68A 4WZHA 5EA9A 5CZSA 3TK7A 1PHQA 5C54A 4MVAA 3W1QA 5CKSA 2J9ZA 4WD0A 3ANYA 3NL3A 4LS2A 2FPYA 2P1FA 1JRBA 3GDKA 3VE9A 3KXQA 4A29A 4RV8A 4R7JA 2QCCA 2H6RA 3OEXA 1G6CA 1K8ZA 2Q3RA 3A5VA 3DFNA 1H62A 3GLCA 3HPSA 3B03A 1W5MA 2Z2UA 1MXSA 4JNMA 4Y90A 1L6YA 3G1SA 2QJIA 5AN7A 1TQXA 2VFEA 4FNQA 4UCGA 4N9EA 3QZEA 2BSLA 2YR1A 3K30A 1JCXA 5F4SA 3TAKA 1SZFA 3NM3A 1Q6RA 2FTPA 3UQNA 4E38A 5G2IA 1VQTA 1ICQA 3GXNA 3M41A
chains in the Genus database with same CATH superfamily
3P0XA 4YHEA 4PUMA 4CN1A 4WSKA 1ZL1A 3EWBX 2BGSA 3F2CA 4ICNA 4JTGA 1KFJA 4YWIA 1TCMA 4AZCA 4RZ6A 4D8ZA 4O54A 1EX5A 3WDPP 4AF0B 1KD0A 3SGGA 1IXPA 1HUVA 3U48A 1MUWA 2IS7A 4HOXA 2XM1A 1RHCA 1HQTA 3SECA 3EDFA 3FX4A 1CLKA 1PZ3A 5HAOA 1EXPA 3MWCA 4W86A 1TR9A 4Z2KA 4GWEA 4I7WA 1JDCA 3VPLA 2WO5A 4AX7A 1YDOA 2WBGA 3IVTA 4NAEB 1UW9A 2WJDA 1A0DA 1EWDA 4MFEA 3MQTA 4JTQA 4QR6A 1EQPA 4QX4A 1ZBCA 4M5PA 3H24A 2QZRA 2GJXA 3QPZA 2W92A 3PJTA 2G50A 2A5HA 2D2JA 4LNYA 1OM0A 4WDXA 3WL1A 2GJLA 3E0LA 1UQYA 1C7SA 2YYTA 2FB2A 1FUYA 2PDHA 4K8EA 4MLRA 2X42A 3HO8A 2RJGA 1CXHA 4IPPA 3WN6A 4XAYA 2WVSA 1VCVA 1KCLA 5PTDA 1DXIA 3M46A 3FCPA 2ZDSA 5JBDA 1DIKA 3MI3A 3DERA 1JD9A 3TOYA 4F4RA 1HJUA 3YPIA 3BAJA 1MW2A 1KO0A 4J3TA 3APGA 1WOAA 4CD8A 4D6HA 1GG1A 3KVLA 1W9BM 4ZFCA 1OVDA 2PWHA 2YDAA 4QLKA 4YWSA 4RDZA 4Y9AA 1XBVA 1GQJA 2I17A 3RYSA 1EC9A 1OZMA 3PNZA 3P61A 3PBYA 3O3RA 4JTAA 3OVRA 3F4CA 4XV0A 1AFSA 3DYMA 1LROA 3QXBA 3OOQA 3EXSA 5F2IA 3IGXA 3UCCA 4FX6M 1M53A 1ADOA 3NXFA 5DCEA 1JGMA 4BQ2A 4O1BA 1JAKA 1R30A 3WLOA 4S3BA 3KS6A 4GXMA 3V3WA 3IK2A 3DI1A 4ZXLA 3BO9A 4EWJA 4OVXA 3W7MA 3NQ6A 2CU0A 2C6QA 4C6NA 2Z2BA 1Z48A 3K13A 5XIMA 1H7XA 3PN8A 1OFOA 1X38A 3PAJA 4GVGA 3DIPA 1H63A 1NF0A 5JMUA 1JF5A 3O07A 2VRJA 1M03A 1XS2A 4YCOA 1DE5A 1XQKA 2E40A 2XPKA 3M0ZA 1SUXA 2DW7A 2UY3A 1TV2A 2YA2A 2WXDM 4OU1A 2DZTA 1JCLA 2QAPA 4KPLA 3AXHA 4ERIA 3QR3A 3BPWA 4M7SA 1NFGA 3GS6A 5BXSA 1RZMA 1N8IA 1X1NA 1W1YA 2A7PA 1V03A 4NNBA 1TX0A 4Q32A 3TTYA 1A53A 3L4TA 3LBMA 2DW6A 2V6AA 3PULA 4D1JA 4P7RA 3VGBA 3GNNA 5DBTA 3RHGA 3TTOA 5DMLA 4IISA 1PSCA 1DJIA 5DRCA 3PUOA 4GY7A 2GQ9A 5AYXA 1WOBA 2Y7FA 1F4HA 2EHHA 1I2OA 5I78A 2QULA 1L8PA 2YL6A 4PMYA 3FNDA 2VOTA 2G4JA 1J10A 5HMDA 2JK2A 2HCVA 3U9IA 1DORA 3HG4A 3POCA 5EFFA 1HKMA 1N55A 1XRTA 2CNCA 3A64A 3AS0A 1EPXA 1WYIA 4GABA 3W7EA 1RUSA 2X1SA 3IJ9A 1LL7A 1PVNA 3PHAA 4Z2GA 4XO6A 4PMVA 5IDIA 4HYVA 1M3UA 4K7YA 2IQTA 2INEA 3ABZA 4XK2A 2X40A 1UIPA 1UUQA 3WH9A 4B92A 1GZGA 5K4XA 3XINA 2P10A 1NWSA 4J3UA 3SQLA 4U33A 2BXZA 5DO8A 1OFAA 1SMAA 5TIMA 3W25A 2BWGA 3PZVA 4GO9A 1PAMA 1JZ6A 3R8GA 5HPCA 1V6UA 1SW7A 1RQEA 1OF6A 3N12A 3GG0A 3RJXA 3PZGA 2X8RA 3B0XA 1FDJA 1VEOA 5I00A 4Q7BA 1O1HA 3M6DA 1UR9A 2ZZ3A 4RL3A 4KKXA 3QY6A 1ICPA 3VM7A 2E67A 3RU8X 4EP8C 3DGBA 5XIAA 3ARXA 3CPGA 3TW7A 1NVMA 3M7WA 5GNYA 2ZZ4A 4XZ9A 2VMFA 1OG0A 3RLGA 3FV9A 4JFSA 3TWBA 4MDPA 2VRKA 1C8XA 1QW8A 1EH9A 2YBUA 3K2GA 4JX5A 1AL7A 3CUFA 2VENA 1QW7A 4H6QA 4PB3A 2Y7DA 2WMIA 3W7RA 1S3TC 1W9PA 2VL4A 2WC3A 1ZJHA 3RRXA 2O92A 4AVNA 3WF3A 1YXDA 5ABTA 3ZMRA 4YIWA 3K1DA 1E6ZA 2NQ9A 1KV5A 4Q22A 2NVDA 4F2BA 4WY0A 2V81A 1JFHA 2QUNA 2GDUA 1CGXA 2BB0A 2V9DA 5HR6A 9XIMA 2OO0A 1J2BA 1FWRA 3V18A 1KFLA 4A8IA 4BI6A 2Z00A 1SMDA 1Q6LA 2JEPA 1ML1A 4OZOA 3LHVA 3LRKA 4FMVA 2Y62A 3L0GA 3O0FA 4MB5A 2ZZ5A 3MUAA 2OFJA 4QLLA 1QI3A 2AMGA 3DEQA 4HJFA 2WC4A 1UASA 5DQPA 1HNYA 1VZWA 1W31A 2DUAA 4R27A 4GQRA 3FKKA 3PZOA 2ISDA 4FNTA 3S9IA 4GGBA 2VZVA 3CJPA 3QPYA 4LRSA 1UZ4A 3R7MA 2DORA 3LENA 3VXGA 4YMZA 1EJWC 1F3WA 1W1IE 4P8VA 1EO5A 2Q02A 3AMCA 4DYKA 3EKLA 1QHPA 1W5OA 3N2MA 2EG6A 3NO3A 1PB0A 5FEPA 4LAMA 4AZGA 3NQEA 3S1UA 1LLWA 2PEVA 4UQCA 3LCIA 3W02A 5HQLA 4AWUA 5H1WA 1FXPA 1RBLA 3C0LA 1PWLA 1RAKA 4E0CA 3ARZA 5DY2A 2WNZA 4MG4A 3NDOA 4QAIA 4DWSC 1D3GA 1H1NA 2WMGA 1TPFA 4FNPA 2QMJA 3S8HA 1P43A 3AXKA 5D30A 3O6CA 4D6FA 1QOQA 1FHVA 4CN6A 3W7CA 3BV7A 4L7ZA 2X1RA 4AU0A 4FXSA 3EZ4A 3UEQA 3ARQA 4GBDA 3VZYA 4M6QA 1UWAA 2B7PA 1GT8A 3R0DA 3VD5A 3UJFA 4XQ6A 4PBEA 4O14A 3REQB 1C91A 1FRBA 3K8MA 5DX7A 4ACZB 2IKIA 4GOAA 2REQB 3NQ7A 4AF0A 3FVDA 2HXUA 2PDKA 1TPB1 4UQBA 1E43A 1JCMP 2DEPA 4PMUA 1US3A 1GPWA 2PC8A 3NQFA 3EX3A 1IT0A 1P1XA 3W00A 2QV4A 3MC5A 3G3DA 1AH0A 1EC8A 4JTRA 3HPXA 3TQKA 3WFZA 4PL1A 4KH2A 2Z7KA 1R3SA 3WQ5A 1G4SA 4NAEA 2WPGA 4JN6A 4V33A 2HVOA 2JFEX 2QCDB 1UB3A 2WB5A 1DTUA 3AHZA 5C9XA 4WDTA 3W82A 2V3GA 4KMQA 1R85A 4GE8A 4M19A 1OIFA 5H91A 3SRFA 2BHUA 3TROA 4AW7A 1F6YA 1AJZA 3UY8A 4O12A 4ZO9A 2WJZA 4XVDA 1LQ2A 3N2BA 4JTSA 1E51A 4QJ3B 4F48A 2PLMA 3FHAA 3P3BA 5HOSA 2D73A 1LLOA 1S2TA 3L66A 1XYFA 1IQ8A 1W3IA 5K9DA 3MI6A 1KRCC 4C5YA 3OU8A 2H9AB 4CCEA 3J7HA 1EGZA 2YCLB 1IWPA 2WSKA 1NQKA 2V63A 3HGRA 3DN5A 1TIWA 5I0DA 4UTHA 1GYMA 3G3MA 3GIPA 4I8YA 5LNUA 3TCEA 3EKGA 1X1OA 1SFLA 2O9RA 1GHSA 1H60A 1JPIA 2PP0A 4BQ4A 1DOSA 5ABFB 3MANA 4QNEA 2NZLA 4ZO8A 1F6PA 3W2MA 2XHYA 1A3WA 1FY6A 1PYMA 1UKOA 4LU0A 3GC5A 3VNIA 1H7WA 3JZUA 1BG9A 4QAWA 5HWMA 3NQVA 4DBSA 1TX2A 1JUEA 4D6CA 2XSBA 4W84A 2BXVA 1FWSA 4PB5A 3L4XA 4KGLA 3T2OA 4OECA 3WNPA 1R8LA 1GW9A 3NVTA 4GMEA 2F6KA 2NXHA 2Q09A 4IIFA 1CXIA 3GU2A 2ZA2A 4B2DA 3CMJA 3E5BA 3R89A 1JIBA 5DXYA 3EOLA 1L6FA 3PTMA 3LBOA 1XSKA 2OB3A 2BTMA 1XKYA 4DX3A 2NV1A 3VDCA 4E2VA 1XDJA 4DEFA 4YLWA 3ZLFA 4HPHA 1XC6A 2R1LA 4WQ6A 1YNPA 5TBOA 2WKGA 4AHPA 2WPBA 4RCXA 1KBLA 2ZZ1A 2NWRA 3S6OA 2HBVA 4JKKA 4FIRA 5G2HA 1X7FA 1ISYA 3AMKA 3C0SA 3FAWA 1FFQA 3SBFA 1P0KA 5D2VA 3TH6A 4PUEA 1BGGA 1E0XA 4MTVA 4H9VA 1U30A 1Y5XA 2R1MA 1LRQA 1BTMA 4EXQA 1I2NA 2GSHA 1XLMA 3UXKA 4D9PA 2VX4A 4A21A 3WSUA 2CETA 1MQRA 1R9XA 2Y70A 2G3JA 1K7EA 1BAGA 2NQ5A 3AMLA 1V3KA 3L4WA 3ID7A 3UJSA 3RCMA 4JOMA 2AAAA 1BEUA 3GDTA 5M5DA 2BOGX 3CWOX 1E4IA 3DU0A 4OHQA 3SRKA 3LBCA 2VYOA 4WSHA 3SUUA 3W37A 5ABEA 5J04A 3QBUA 5FCZA 1J0JA 4O13A 1OC5A 3MDUA 3KHJA 3FVMA 1BQGA 3VNYA 3ZT5A 3BLKA 2WSQA 1XPGA 4EVZA 2O9OA 2R1KA 3DOPA 2VWTA 4GCAA 2VC5A 4XSLA 4ZSUA 3C8FA 2XN2A 2PRMA 4WUIA 1R5YA 2X7WA 2DDXA 4INFA 3A12A 5FEWA 1F3TA 2QJJA 1LG2A 2VX6A 4H2CA 1WDRA 3DHFA 3RU6A 4CD7A 3MMWA 3OZYA 4U10A 2FH6A 4Q8PA 4PB4A 1C92A 4B5UA 2LLEA 3BAIA 3CV7A 4A3RA 2WVTA 3BGAA 2JIWA 3INPA 5REQB 2D2GA 3KCOA 1XF0A 2XZ9A 2DIJA 3VFCA 3H7RA 1A5AA 1JCTA 3KZPA 1XYBA 5U4NA 1TREA 4XBKA 4PN2A 4UNKA 1A5CA 4IIGA 3TZFA 2OO6A 3UESA 5LNVA 4HHLA 1I9CB 1K4HA 4C5ZA 5SWUA 3ZJKA 3AIBA 4UTMA 3V35A 4LVBA 4ENLA 3QHMA 2WV8A 2VURA 1GVQA 1V0NA 3EX2A 3GFYA 3IACA 1W1A1 2D22A 3SO7A 2BLEA 1ITUA 1GKPA 3W7PA 4U31A 2ISSA 5IXEA 4JTIA 3AIEA 3R6IA 1A5LC 1G94A 3BG9A 3VA8A 3VYLA 1H7PA 4L1GA 2WOQA 1XCFA 1J2WA 4AEFA 4MJZA 1LYXA 2OZTA 1UUMA 3V7PA 2BBFA 2Q8XA 4LX4A 3TYBA 4E3VA 3R5EA 1KRAC 4WKFA 4B4HA 3IAPA 4ADUA 1C9WA 3O9NA 4M3PA 4Q7NA 3EWWA 1OFEA 2IQDA 5LHFA 3VX0A 1K77A 3DBPA 4ZSTA 3GW3A 3WNLA 2GSEA 5HMSA 3FAXA 1XH2A 5HUPA 4HB7A 1EZ2A 3W1RA 2E09A 1EHAA 5CBIA 1ONEA 1XIIA 4HZ8A 4ATDA 4E8DA 2VVNA 2CIPA 1KM3A 3S2LA 5A69A 3WQDA 2CZEA 2VC6A 2VDHA 3EOEA 1X7IA 1JZ2A 3CH0A 2OWCA 1YYAA 3E2SA 1TUXA 4HPJA 3SCUA 3UZXA 4BWLC 3PZUA 3O63A 3PBUA 2QW5A 2VR5A 2QR6A 1E0VA 2DZVA 2FLIA 2XFFA 3KRUA 1H49A 2ZTKA 3CQ0A 3HG3A 3REQA 4ACZA 1XIHA 3T09A 3T55A 2REQA 3GTNA 3ZLGA 1UH3A 7ODCA 3TR2A 1WXYA 4UFJA 1QW9A 1LQAA 3GQYA 5AYIA 3T6CA 1NWRA 3R11A 4M24A 2YXOA 3H55A 4TIMA 3B40A 2ZRVA 4WKAA 3DGRA 4MNLA 4MYXA 3KTXA 4Q6XA 4AUBA 3CL8A 4PSPA 5JUVA 4QGCA 4CNNA 3L5AA 3GDRA 3NL2A 4OTKA 4KEUA 2HNHA 2I14A 1J79A 3W6LA 2OGJA 1J12A 4YU1A 3AZSA 2V3FA 1OGGA 2QCNA 4YTUA 1EOMA 3IVSA 1OD8A 3F1QA 2DU2A 4TX9A 1EF3A 2XIIA 3CAKA 3MP5A 2W67A 5I09A 3O1NA 1QMLA 4MNMA 2WZIA 4S3KA 4Y2WA 3WQ6A 4AWEA 3F5KA 2WM0A 1RR2A 2PA6A 2PWDA 1MVYA 1VENA 4MZ8A 4HZMA 3M0XA 3V0UA 5AHNA 2C16A 3UR5A 1TZZA 4FLRA 1FFRA 4LAUA 5DRIA 3MCNA 3GTFA 1OG6A 1EDGA 2WJFA 1WKFA 2H9AA 2YCLA 2BP1A 5BNKA 2X2GA 2A0NA 1NOFA 4FNRA 4KW2A 3W7GA 5E0CA 5HJYA 1QHZA 1C93A 1MUCA 1XYAA 2D23A 1MEWA 4OT7A 1DWIM 3IK4A 5AHIA 4XG1A 2FJKA 2VEPA 5BOEA 5EBUA 5T26A 5GJMA 2YJQA 3RX4A 3W2KA 1JPHA 1QASA 4LYRA 2ZUTA 5HQEA 4NY2A 2XYLA 3TW9A 2BVDA 1JZ8A 3V75A 1K7XA 5EMJA 3I4EA 3JW7A 3AIRA 5CZJA 3AI0A 3DCPA 3VIKA 3T7VA 4FOUA 1UD6A 2HNEA 4X63A 4FA3A 4QG6A 4J2MA 3T78A 3ARRA 4S23A 4NZ4A 4Z2JA 4MWAB 3N19B 4H01A 2Q8LA 2VFGA 4LSBA 1RA0A 2C1HA 4WGHA 3RO6A 5FJIA 4D6GA 2C15A 5CSUA 4K8HA 3BAYA 1FX6A 4C6BA 5CPTA 2DIKA 2VCCA 1JI2A 2E5BA 3GBDA 1LRTA 3A21A 1KBKA 1XSIA 3R8HA 2FFIA 1FWAC 4H8UA 3OW1A 1UOKA 4EAYA 2D0GA 3BSMA 2PU0A 3T40A 1GEHA 2DQWA 1YIXA 1QCWA 4DRSA 1XUZA 2D0FA 2O4MA 1RH9A 3KLLA 2WAGA 2SFPA 1OF8A 3I6TA 4KEZA 3BDKA 3BL3A 4NL1A 4I3GA 1WZLA 2PTWA 1B3XA 2VELA 4GFIA 3ZFHA 3FOKA 4LUTA 4ATWA 4WKHA 3VIGA 3W7KA 4NZ5A 2E77A 4HK5A 4LQ1A 4LF2A 4EF9A 4X9SA 4G5DA 1NJJA 2CHRA 1TB3A 2D2OA 2QQ6A 4AVFA 1XIBA 3GR8A 1MQPA 3MU7A 3VNLA 4LWWA 1TPDA 1CGTA 3FK4A 2I5IA 5C2XA 3THQA 3GW0A 3GC2A 4UTWA 1S38A 3TJIA 3VOHA 1TVLA 4JTKA 4HSHA 1A5BA 2XVPA 2HPMA 2PDQA 3QHOA 1XIFA 1IYXA 3NEVA 2ZZ2A 3ATYA 3N11A 4Z2HA 1KXTA 2A4AA 2EKGA 4IXXA 3S5NA 1PX8A 3M0IA 2G3NA 1XC4A 1TTPA 1UR8A 1KB3A 1TO3A 3GNXA 4AZ7A 5MF5A 4MWAE 4LUJA 2OVLA 4UTTC 1LLZA 5CPNA 3BMVA 2Z4GA 4O15A 4S3AA 4B15A 2CLFA 2DZSA 3I6RA 3QFWA 4M81A 4V28A 4DBWA 4IJRA 1P0BA 5I3JA 4V27A 2X1UA 2PDWA 3TMLA 3JZEA 3JVAA 4KFOA 1LWJA 2G3IA 3TC3A 3LYEA 3HIJA 2EO7A 3TTSA 3U0HA 2YYUA 1H3GA 2BODX 4JFVA 2OZ3A 4EACA 5XINA 1CGWA 4JTUA 2B0MA 4NYYA 2R1PA 1RXOB 2GDVA 2C1GA 1DJQA 1TV7A 2A6NA 4E4PA 2VI0A 2DZBA 2QCEA 5FJUA 1KM4A 2VGGA 4HTYA 1NELA 4O4WA 4IZGA 2Y8KA 1I4NA 1WP6A 3H4GA 1PCWA 3UWQA 1S2VA 2A3BA 4NZJA 3JU2A 5BOFA 3ZIZA 1M7OA 4PFHA 5CPOA 3AHTA 3SCNA 5CAKA 3UZJA 1UR0A 1H1ZA 2VEGA 1AZ2A 1NEYA 1VBUA 3WF1A 1MZHA 2OX4A 3P62A 3QQ0A 2FVLA 3RM8A 3GAKA 1XYMA 3NVDA 4DVOA 2XIJA 1SSGA 2J7BA 3MHUA 2QIIA 3UETA 3NDYA 1A5SA 4YTRA 3DECA 3DFOA 2V5DA 2PTXA 3AIQA 3S9YA 3W26A 4S1FA 1UBSA 4MB1A 2XIBA 3KOZA 1KKOA 1MXDA 5CGQA 1KFKA 1W9UA 1LJYA 5C9RA 4NHVA 4S39A 3H26A 3ZQ9A 2DZWA 2EPKX 3PUGA 3WLRA 4C6IA 4AC7C 3LGEA 2DT3A 5HBFA 5C2GA 1MSSA 1R9ZA 1O12A 1VEPA 4KCVA 3OQEA 4AFYA 3JS3A 1W0MA 2PFHA 2F6UA 1BYAA 1UWTA 2RDUA 2PURA 3CU2A 4NI3A 2UZ9A 4AZIA 1WUEA 2KAUC 3A4WA 1N8FA 4ZOBA 3AYVA 2QAFA 1XLFA 1HJWA 3DENA 1NF7A 3GXTA 2PCQA 1O5QA 1D7FA 2VCAA 4JDBA 5LA1A 1TYGA 4NILA 1XCWA 3W76A 3MKKA 3RRAA 2RDTA 2TRSA 4RXFA 1KM0A 4J2PA 1ME8A 4DY1A 1W6TA 3AHXA 3PTQA 4H00A 1GOKA 3PC0A 3O06A 3AYTA 3I7QA 1HVXA 1CGVA 2C8NA 4QE4A 5I06A 1W8GA 3QGAC 5A6BA 4JTCA 5DCDA 1P7TB 4UBPC 1R2TA 3LCXA 4MUPA 4DBEA 5LGXA 3VGEA 3UGVA 5MKGB 4OBSA 3VK5A 3S2MA 2J66A 1SO4A 5E5CA 1R2SA 2ZXQA 3UG4A 3IJ8A 2WZHA 2C91A 3ITYA 5I03A 1EXBA 4GUFA 5D9MA 3W53A 2VR4A 2QCHA 3H2NA 5AHFA 3AHVA 3FJNA 3E1F1 3WFAA 2HV5A 2CLLA 3PG9A 1XINA 4AXKA 4LY4A 1EJRC 3GTXA 4O0ZA 3CO4A 2WCAA 4MM1A 4FPSA 3O2LA 4K3ZA 1FWJC 1HTIA 2F6XA 1OGBA 2ZA1A 3STPA 4CQ8A 4DUWA 3POHA 4L80A 3XIMA 3SM0A 3S1GA 2ALRA 1MFVA 1VFUA 3F5JA 1TIMA 1V7AA 3WJXA 4EPDC 4ZL1A 1TVNA 3S6TA 1Q45A 1SQ7A 3MV01 4RKAA 1ODUA 5LHEA 1UMYA 4KERA 1YXYA 3UYIA 3P80A 1CI1A 2ZQ0A 2Y6ZA 2J8GA 4C91A 2PTDA 1FOBA 3IJIA 2G97A 3L5LA 4H9XA 5L6UA 4FIQA 5LA0A 4M7TA 1XBYA 4L4PA 4AD3A 2OQLA 1O95A 3PBGA 3QOMA 4Q8OA 2J74A 2BY1A 3TQVA 4WZHA 4RDWA 3UXLA 1VFSA 1JDAA 1DXEA 3IPWA 1CENA 3TK7A 3W1QA 5CKSA 2WNWA 2CZVA 3E0FA 2P1FA 4A8NA 3NSNA 4B5TA 3G5EA 1KC7A 3KXQA 3AISA 1ZSXA 3GLCA 3G1SA 4AYSA 3T42A 2VFEA 4UCGA 2IPFA 4N9EA 2PPGA 3UXIA 3PZTA 2ZUSA 2HZGA 4D71A 1Y5VA 3V5OA 4DWSD 3NM3A 1Q6RA 2FTPA 3LU2A 5GJNA 1W1PA 3HTWA 2PTZA 6REQA 3H2OA 1F7BA 3PY2A 3G1VA 4MWAA 5I3IA 4LB3A 1E4MM 4L9YA 1W2PA 3QC0A 3MTWA 4NRSA 3LSCA 3S5OA 2D1ZA 4H3DA 5A2BA 3W85A 1WDSA 2DP3A 5GQBA 1EIXA 2DIEA 2JGYA 2ZZ7A 2QKFA 3UR7A 2YPIA 3KTSA 1VFHA 3N9RA 3MHFA 4JX6A 3GD6A 3WBWA 3FIGA 3WQGA 1MDLA 2Y0FA 4E4FA 2QEZA 3OYXA 4IXHA 3TQPA 1HG3A 3W22A 2CBUA 4W7WA 3DYPA 1LL6A 3VNJA 4RPQA 3W1NA 1NDYA 4FLSA 5F2MA 2C79A 4PTXA 5D03A 1ELSA 1ICSA 2POTA 1FWBC 4Z2LA 2A3AA 3CASA 3WDHA 4MLJA 4V2XA 4JNZA 3NJ3A 3Q65A 3LY0A 4QCFA 3CZ8A 2P8BA 2VUNA 3BC9A 4DBUA 4MADA 4UTFA 1A4MA 3ZJ8A 5DXXA 4HA1A 3GVGA 1M9HA 1GZJA 2YKKA 3VMNA 4JNYA 3HGJA 4XISA 1R3VA 3QOKA 1Q6OA 4Q8NA 3U57A 3IANA 2VFHA 4PTVA 4HGXA 3AYSA 1VHNA 2PTYA 3GR7A 3S5ZA 2MUCA 3VD9A 3W6MA 2ZDRA 1UD4A 2OLSA 3E0IA 2O7QA 3PZIA 4JTHA 2YIHA 4M0XA 1HJSA 1ADSA 4LJ3A 3W7NA 5I24A 2QS8A 4LGXA 1XICA 2ACUA 4IP7A 4BR1A 1UKSA 2YDQA 3WD3A 1HJVA 1S5WA 4W85A 1RALA 1R3WA 1OWQA 1U2YA 5LIYX 3GHUA 1E5NA 2DH3A 3TSBA 1F3XA 3BG5A 4H6RA 3BK0A 4LS0A 5CSSA 4AZHA 3AXXA 1XLJA 5C7HA 3VKDA 1AL8A 4GUJA 4DIAA 3H70A 4X0NA 3M0MA 1X39A 3NNTA 3B8WA 4DPPA 3C2RA 2R6OA 5C55A 1IEIA 1GVYA 3KCLA 4OOUA 1EYEA 1EJ7L 3S1WA 4BCEA 3URAA 3P8IA 4ZMGA 1R3QA 1FWWA 1TPH1 4RNJA 1HKKA 4QS6A 4C6DA 1AJ0A 3SRDA 1I60A 3CUZA 3W75A 6XIAA 3H2CA 4A2RA 1ZS2A 4PCTA 3XISA 4R3UA 4EPBC 3L2MA 4GJJA 1S2UA 3O6YX 3VMPA 3CLMA 4US6A 3AZRA 3CZJA 5K9CA 3VNDA 2X09A 2GUYA 4M56A 1W1VA 5HK4A 1YDNA 4LPCA 3FFSA 2NQHA 1DWHM 5A8NA 1Y0EA 3KAOA 3RUBL 2VHLA 1W2VA 4GNKB 3W74A 4I9TA 3VC5A 1G69A 1GWJA 1TV3A 3AROA 2DGAA 4AEOA 3CB8A 2W79A 2W9MA 4TMCA 3NQMA 3W29A 1SFJA 2WSPA 1QWKA 4MIMA 1F4AA 1IGSA 3CWHA 1HP4A 1BVWA 3PJUA 1E9ZB 1XKJA 3DAQA 4ORIA 4YNGA 1ALDA 4BEQA 7PTDA 2BVTA 4P7OA 4NJGA 3UR2A 1E9LA 4IUGA 3UD6A 3UJRA 5AZ1A 3E74A 4U5IA 4JQ2A 3O05A 6TIMA 1KLYA 1CEOA 2ANUA 1IEWA 1P5BA 1H5YA 4JGDA 3VNKA 4F8XA 4QDMA 5LIWX 4Y9MA 1BLIA 5IRPA 5GVJA 4L64A 2PGWA 4QG9A 2GJNA 1EL3A 1B3WA 4C6KA 3R58A 3WQFA 4G56A 2H3DA 1MYRA 1EFZA 2PMQA 1GTHA 2VRQA 1C3FA 3BSHA 4PUJA 5CC6A 3AXIA 1B31A 1ZCCA 2RH9A 3LTSA 3WMSA 1W5QA 1U5HA 1S2AA 3HQNA 4DO6A 4ERGA 4I5RA 3PPHA 2QCGA 3NPVA 5I79A 4HP5A 4DYJA 1VRDA 3P93A 3OG2A 2F8QA 5A8MA 5FEZA 5E9XA 1B4EA 3VILA 4BI5A 4TUFA 1C90A 5MKGA 4XZIA 4TV6A 4Z1CA 3STCA 9XIAA 4JIRA 1R2RA 1XIJA 1KR0A 1CGUA 2Z1BA 4KWUA 4QE1A 4AIOA 4YTSA 2HTMA 4I7UA 1W9VA 3IJ7A 4HNTA 4JL1A 4YYFA 2JEQA 3BGJA 1Z32X 1W17A 3VIFA 1VYRA 3IVUA 1W1TA 3OPSA 4AG0A 5A8GA 4GZIA 2CESA 1XDMA 3SN4A 4E6MA 4H6KA 2GOUA 4TR9A 2WQPA 4E2OA 1L0PA 1EB3A 4O1EA 3CQHA 1GKRA 4M80A 1M04A 3RCYA 3NURA 2R94A 3VMOA 1GNXA 4L1XA 3AWNA 3IRSA 3C4UA 1DHPA 3PJXA 4CQCA 4HA0A 5HDRA 5BU6A 4HMEA 4I8DA 3KE0A 3N73A 2OKTA 3TFXA 4Z0SA 4D2JA 4G1KA 5FJTA 1RV8A 4JHMA 1F05A 1I45A 5D2WA 3BCFA 4LB4A 4C6QA 3M16A 1OFQA 1HW6A 1UA3A 3S42A 3QMSA 3NR0A 1J0YA 3CO8A 1BHGA 1ZPTA 4AD2A 4B16A 3K46A 3DG3A 1VFFA 4OUIA 3KP1A 3PNUA 1QTWA 2YZRA 1SU5A 4WJEA 1WKDA 3FDKA 4EPEC 1VJSA 1K6AA 3CT7A 1V02A 2Z6IA 1UKTA 2G37A 1WAWA 5F4WA 3R4IA 3P82A 4H6EA 3HJZA 2EJAA 2O56A 5HNNA 3W1UA 3MBDA 2G5WA 1O5KA 4DQWA 2D3NA 1NU5A 1B90A 4NG3A 4FHAA 1THFD 4RW5A 3VNZA 3IIXA 1ONXA 5C71A 2J7CA 3R94A 1GYLA 1KW1A 3BE7A 4K36A 1R86A 3PSVA 5C9UA 3U2ZA 3ZOAA 4XBSA 2VUYA 3DZ1A 4Q8UA 2VJXA 4NT0A 5CJ5A 1QOXA 1TJ0A 2DPEA 2CBIA 4KGJA 1A0CA 4DPQA 1VJIA 2OEKA 2PD9A 3QTGA 1JPDX 1F6KA 3VCCA 4KBXA 4BA0A 1GQIA 5I3KA 4M29A 2HBXA 3V1PA 4WJXA 5LXXA 2BOEX 3A4AA 4EAMA 2CCRA 3NEHA 1PIGA 2QDEA 3TJXA 4J27A 1V0KA 4MPQA 3W9ZA 3CHVA 4JHZA 3UWWA 1KA9F 3C0JA 2VQUA 3C86A 4OKDA 3UG8A 3WK0A 3VVGA 1QPQA 4FF5A 4F0KA 5CSRA 3B0VC 2V82A 1QDSA 1K70A 1PEZA 4ADTA 1XD0A 3E9AA 3BTNA 4H8VA 2Y61A 3SGZA 4DWDA 4ALDA 3WD1A 4AHQA 3EWUA 1JRCA 3MUXA 1RCXB 1E71M 3R0UA 1I1XA 3S47A 4ZCWA 1CIUA 1GORA 1S5MA 4CU6A 1BSLA 4UFIA 3LCGA 1YPFA 5KTLA 2Q71A 3ABSA 1OC6A 3R1ZA 1C8VA 2OKOA 3QFEA 3UP8A 2ESCA 1V3JA 3ZR6A 1ZTVA 3C0QA 4IL2A 3LS9A 1QU4A 4GLEA 2OT0A 2WKJA 3ZYZA 4NJIA 2VEMA 1R3YA 3UBPC 3P67A 1AW5A 1AZ1A 2KX9A 4U4MA 4O1AA 5LGZA 3ZJ6A 2XVGA 1SPQA 4L1WA 1P0DA 3ES8A 3T2PA 3KW3A 1XI3A 4IMDA 3VE7A 1UZ1A 1TWWA 1RPKA 2PS2A 4ZBCA 2EPHA 4JTLA 1NM9A 1AQMA 4XD5A 2PUZA 3BSGA 3T4WA 3L4VA 1QT1A 4IGMA 3W7JA 3UPWA 4AHOA 1T0OA 4IGSA 3TA6A 5F1VA 3AJXA 3RNDA 3M5VA 2ZRXA 3THCA 1AK5A 2J25A 1KCXA 4PUKA 5AYYA 1HT6A 2CLIA 4O0QA 1WUFA 4Z1DA 5HATA 3W0KA 1B30A 3NG3A 1PKLA 3R79A 4RDVA 5BMWA 4GQQA 3DKLA 4UOZA 4NX5A 2TSYA 3BLFA 4ATLA 1GK8A 3CAWA 5EL1A 2C0HA 1LQ0A 4GZJA 4UNLA 3FGCB 4JIQA 4UFKA 3GX9A 4F2UA 2W3ZA 1RY0A 1UR3M 4MAVA 4XD6A 2XGIA 3ORWA 3CZGA 4M51A 4UC5A 4IL0A 5L9FA 4JIPA 1FH7A 4YYCA 2W66A 2FYMA 1QJWA 1SR0A 3CT2A 3U8GA 3NPWA 4LAZA 5JVLA 3PWAA 4L65A 1JCNA 2V2DA 1DHKA 4CQBA 2VFIA 3LZ5A 1HL2A 1OGSA 3TUUA 1B3YA 2Z26A 5FF4A 3SCSA 4U2ZA 4UTIA 2QUMA 3JR2A 3QF0A 3GKAA 4W87A 5LNWA 3QN3A 1Q7MA 3VGFA 4HZ7A 5HUOA 3TYCA 3MO7A 2QUTA 3NPUA 5HANA 3A5FA 2PLKA 1SSDA 4PL2A 3TVAA 3W1LA 1KR1A 1L8NA 1W1B1 3DXIA 4JQAA 3MUZ1 4CNSA 5DN1A 3SAZA 1J93A 3UA4A 1DQUA 4QITA 2ZUMA 3PUEA 2E68A 3WX7A 5D2TA 3KHDA 3MHGA 5I3HA 4QNWA 3RPMA 4ZE5A 1CECA 1DKWA 3BZGA 2OOGA 3KBVA 2YCJA 3UZYA 5FJOA 1PZ1A 3EKZA 3GVRA 2PZ0A 4DN1A 2E9BA 5FD0A 3NAVA 4DNMA 1L6SA 1V5XA 4HMDA 1E1FA 4L5ZA 1JDFA 2GGGA 3FDGA 3WNOA 4GYKA 1K8CA 1H61A 1KKRA 3H23A 3F2DA 4J1OA 1EGMA 1WNOA 3OBAA 1B3ZA 3SR7A 5E0FA 3EA3A 4XIMA 1Y7VA 3GH5A 1KRBC 3IRDA 2QYGA 1QFEA 3SN0A 3PZNA 3NQDA 3QQWA 3VINA 2B7NA 4F0MA 5CZ0A 4AD1A 4C1LA 4MMWA 3EWCA 4N7QA 4LC8A 4UR7A 1NSJA 4B3ZA 1WCGA 2PC4A 1YKWA 1KBBA 1JCYA 4NSBA 7ENLA 5CSYA 3WLHA 2W62A 2J9YA 3Q94A 4M82A 1E3ZA 2NX1A 1GUVA 1VBJA 4I6VA 3W7DA 3CQJA 1KXHA 4QEHA 2ZCGA 1WBHA 3H53A 3VD3A 1UCWA 1I0BA 2ZRYA 1E40A 3CAVA 3GVWA 1FWHC 2VZUA 3CUHA 4KRZA 3HV8A 3WDIA 1IR2A 2O9PA 3HGSA 5FSDC 2G3MA 3OVQA 5KZMA 4Y9NA 1P6WA 1BVNP 1E72M 2GDQA 3CXOA 3GAYA 1NWTA 4OWGA 1EDTA 4MAZA 3LX9A 3BICA 4X61A 3LG3A 3GZAA 4PGLA 4Q4RA 5A6LA 2ZUWA 1XGZA 2YOCA 4NYUA 1GG0A 1N82A 4K6AA 2V3DA 4UMCA 5E1QA 1GVRA 2Z1VA 4HOZA 4HTBA 3M07A 1YTEA 3V4BA 1JF6A 1RPXA 3LN3A 2DSWA 3M5ZA 2X0SA 3NYDA 4UQEA 3TXVA 2NX3A 2QGHA 1Q85A 3GKFA 2IKHA 4DJDA 2RGLA 4US5A 4C6EA 4CU8A 4JN7A 3O15A 2QDGA 4IFOA 1FBAA 3TJ4A 3BLLA 5BRQA 3DFSA 3LV6A 4XKYB 3SSZA 4CD6A 3P81A 1KNWA 2OR2A 1JXJA 3DYOA 2Q3OA 3RO8A 3DDMA 1ONWA 2NT0A 4W8LA 1AUSL 1CXFA 1VCFA 4FK9A 1W3JA 2BY0A 4IPNB 4E4UA 2ZA3A 9CGTA 3VUPA 2F7FA 1TWDA 4BFAA 2WM1A 3C61A 2J75A 3M43A 1XYZA 4AIBA 1GTEA 4EANA 1M41A 2VWSA 5HJXA 2P50A 4JR5A 3QV8A 3IIVA 3WYZA 1US0A 3VOFA 1L2QA 2VNCA 4CQAA 2V5CA 4C7DA 1BKSA 3ZVIA 1RJRA 1LRNA 1EEXA 5G4WA 5K2ZA 4DLMA 3W38A 3PANA 1ISXA 4Q6JA 2PB1A 2ZIDA 4HBKA 2BOFX 5G4HC 4RZ4A 2E9MA 4H1ZA 1AJ2A 5CAHA 3AICA 1FP9A 1RVKA 4HA4A 4GC3A 2WC7A 1LUCB 4PEEA 1GVFA 2Y7EA 4GG9A 1RP8A 3NA8A 2W6RA 1DJGA 3N18A 1XHGA 1J0ZA 1IT7A 1IV8A 5GPRA 4AY7A 4JCMA 4U2YA 1CXKA 1M7PA 4AWTA 3CM4A 4Y6GA 2FVKA 3F2BA 4UTTA 3B4YA 1IF2A 1V6XA 3LXCA 2PDYA 1XBZA 2PP3A 2Y1HA 5AHEA 5M03A 1BGAA 1WDWA 4BK9A 4IICA 2GVLA 3QGKC 3GG8A 4IMEA 4PCNA 1O60A 1F9CA 3SUVA 3UF9A 4S3CA 3C5QA 3SIZA 5I07A 1H11A 5FA5A 1V6TA 2GVJA 3BV4A 2R82A 3L68A 4U28A 2Z29A 4PCSA 4F2TA 4LH8A 3FKRA 3G1FA 4J3ZA 1R3TA 3ISIX 1M6JA 5KZEA 3W88A 3GHTA 4EK7A 3IV8A 4FB7A 4CCZA 4W89A 3BJSA 3OIXA 4W7VA 3T1GA 1A0EA 4NUWA 1E6NA 2NLIA 3GXPA 3V1HA 2UBPC 1YTKA 3NXLA 1H50A 1WDDA 1X96A 1TZ9A 2WLYA 4TVDA 1V0LA 1B3OA 1DWJM 5RUBA 3EDDA 4PRTA 3APTA 3SFKA 4U5KA 5D38A 3UNDA 4JEJA 2E6AA 1GJPA 3SJNA 2IQ0A 2QNEA 3ZVHA 4Z17A 3UJ2A 1I6NA 2X2YA 3BG3A 1RCOB 3UFYA 3B0UX 1OX6A 1LORA 1VBGA 5C0QA 1DWAM 3I7SA 5DCBA 4BEUA 4UZUA 3W07A 1K1DA 4Y8EA 3KBNA 1ZJBA 3WDJA 3EPMA 1HJXA 5AB3A 3LM3A 4B91A 5CC5A 2EF9A 1IXOA 1XLLA 4OV4A 3OHIA 4XZMX 4JTEA 1TKKA 1XFBA 3RMEA 4NVTA 2HISA 3OIHA 1Q4WA 3FGCA 1UP0A 4C65A 5EMKA 3EOSA 3LCHA 5HULA 4N4QA 1SJDA 3GUWA 2XFYA 1UPPA 1GOIA 3G77A 4GIRA 4JX4A 2DSUA 4YJ5A 1X6LA 3S0CA 2OJPA 1XRVA 5LZLA 1VBHA 1RLCL 1WDPA 2GJPA 4A2SA 4BI7A 4GISA 2Y8UA 2VKZG 3W1XA 1YRRA 2J47A 2XIMA 3PM6A 1VYPX 4H2HA 3SY5A 4PSRA 2X41A 1Z41A 1W9XA 4G7FA 3K8LA 1FWNA 4PTWA 5IOBA 3NGFA 4EOUA 2ZRWA 1UZHA 1VC4A 2EPNA 2YL5A 4ZQNA 2RFGA 3I65A 1XUUA 4DO7A 4DI9A 5M1TA 1DQXA 1OT1A 1OCBA 1I2PA 3LHWA 2YX0A 4C6JA 5LIXX 3FHQA 7XIMA 3CL7A 1TQJA 3UZWA 1RQHA 4HQVA 3TYAA 1EYWA 4N4PA 6XIMA 3HN3A 5K4ZA 1QPOA 3CUIA 1SM9A 5IHSA 5JU6A 3G18A 2PDMA 5BXRA 4ICCX 2HK1A 4N0RA 3RK8A 3B9EA 4A3YA 1FKXA 4C7FA 1E6PA 4WXYA 2ACSA 2XH0A 4J4KA 5IDZA 4O1CA 4LAOA 1AODA 2QVHA 2H8XA 3D0CA 4QBXA 1R47A 5I3GA 3W87A 1H1YA 5DF0A 4WOZA 1VPXA 4CVWA 4O10A 3ZXWA 1S5NA 1UC4A 3UCQA 4PODA 5H8MA 2J13A 5JH1A 4AD5A 3NDZA 3MUCA 5EBAA 1MFUA 4BJHA 2VOMA 5J5RA 3GIQA 4V1YA 4W93A 2I57A 4B9ZA 4HN4A 1SO6A 3TLLA 3TTQA 4LCSA 2WQDA 4IQJA 3WNNA 1A4LA 1W56A 2X0YA 1XRSA 2IPJA 1JXKA 1TMQA 3FN9A 4CGTA 5BW6A 1WXZA 4RE2A 4BS0A 1NOUA 2V30A 4X2RA 3DBNA 3GE7A 1TUFA 4C90A 3R10A 4XKMA 4PMNA 4HVXA 5JH2A 3K4WA 3PBWA 5J8LA 1FWFC 3H7UA 1R7OA 3IIZA 2FHCA 4GQ0A 3DH7A 1EDQA 2I56A 3MZNA 1NARA 4FI4A 1TE6A 4ZB5A 3TP4A 4O53A 3EB3A 3TN3A 3LM7A 5FJPA 5CLWA 3L65A 4QIUA 4E2BA 1X8CA 1Q65A 1Z6KA 4DXXA 3AIVA 3VZXA 1KCKA 4ZOAA 4K7VA 1US2A 2GGIA 2Y24A 1UKQA 4LF1A 1XLGA 1E1CA 3HQPA 4CD4A 5DEZA 3PPCA 4KQNA 2XGZA 1CXLA 1F8IA 2B7QA 4ZODA 1HF6A 4ZTYA 3BJTA 4MWAC 1QWGA 3G0SA 2WHLA 2W61A 3HPFA 3BVJA 2HSAA 4ML9A 4DUOA 3AJ7A 2DQXA 3HPZA 3WLIA 1RVGA 3PJWA 2GPTA 2WZEA 1BRLB 4K1WA 4P8WA 1ZBWA 4WEVX 3NM1A 3L67A 2AKMA 4WHBA 1B5TA 1QAPA 2F84A 4YVXA 1RQBA 3MP3A 1PZ0A 5AVNA 1ZBVA 3GRIA 2PWGA 1LWHA 4XKYA 2CLOA 4GNJA 4DB7A 4O50A 3VC6A 5M3WA 3ITXA 4UTLA 4KF1A 2TYSA 1S46A 4R34A 6ENLA 4S3DA 3W23A 2BVWA 3FJLA 2I7GA 3WK2A 4EXAA 4O57A 4I5XA 3WQCA 1FHUA 4W5UA 1XD1A 1EUAA 4TO8A 1ADDA 3GDMA 1TJRA 4QQ3A 4Q33A 3FJ6A 3PPFA 1AQ0A 1O5XA 2WW5A 2TMDA 1Q3NA 3WLLA 3WD2A 2NUYA 5FEXA 3EA2A 1WKYA 4P61A 4R88A 7CGTA 4H9YA 3FXGA 4F0HA 4ZOCA 3B9OA 8A3HA 4KWWA 4HIBA 1EJSC 4PMRA 5FJRA 1EP2A 3RX2A 4G8TA 4QISA 2VD8A 3BAWA 1OX4A 3MSYA 2ZX6A 1QBAA 1SGJA 4CNPA 2CXEA 3K1GA 1OCQA 5EB8A 1A80A 3NOYA 2WMKA 1BPLB 3W7HA 1E0WA 3EGJA 3RGTA 3NTYA 3SW6A 3UWYA 3CUGA 4FOKA 1TPC1 2BASA 1TJ2A 4GVIA 1U1HA 3FA3A 3BQ6A 3M44A 3TQ0A 4YCPA 1QO5A 4TTUA 3QMTA 3UPBA 3B9AA 1MW1A 4IIDA 1V51A 3MKCA 5E6YA 5TAOA 2OWWA 1EEPA 5FF3A 2Z1XA 1Q5MA 1OIMA 1ISWA 2Z6JA 1O1ZA 2PODA 4H7ZA 4JY8A 3KDNA 3WJYA 4DO4A 3IJ6A 5I3DA 2W63A 1U22A 1P6BA 5KSWA 3BLPX 3QW3A 2J77A 4MY1A 3W01A 3LMYA 4IQLA 2XISA 3F03K 1TTIA 5LIKX 1V0MA 1OX5A 1JGIA 2XUCA 1T5AA 3GDLA 4IX2A 3STFA 3C56A 3R43A 3C8NA 4QHRA 2EJ1A 4AD4A 4AVOA 3GTIA 4B2DD 4HCDA 2P3EA 2OODA 4GUHA 4F0RA 3IIOA 3S83A 2GK1A 4RXGA 5T91A 3Q67A 1GVEA 4FAMA 4A22A 1CBGA 3I68A 1ODZA 1CPUA 3IJDA 4K68A 5HPOA 1Z9AA 2OPJA 4UB9A 1ZLPA 2OU4A 3ANYA 3NL3A 2FPYA 5FL1A 3PZQA 1HXJA 2I5QA 4WDWA 1GOOA 2XH7A 4RV8A 2WHKA 3OA5A 2QCCA 3OEXA 3A5VA 2PBOA 1H62A 3KWXA 1W5MA 2Z2UA 1AMYA 1TQXA 4NASA 7REQB 1E3XA 3CK5A 1IEVA 1IEXA 4IIBA 1FWDC 3K30A 3TAKA 4MKSA 2ACQA 1NTHA 3NZPA 5ENLA 1VQTA 5D09A 4NQ1A 1OYCA 1T6MA 1QK2A 1DTNA 1Z89A 4UUIA 2YXXA 1FWCC 2C14A 3ARUA 1NFBA 5LNSA 4W88A 5HNRA 4UXDA 2ZX5A 1Q6CA 2QMKA 2J7DA 3VGHA 4CNUA 3CHCA 3STGA 2GVYA 4F79A 1K7FA 4DJEA 4JICA 1R87A 2J4GA 1GKQA 3GIYA 3MSGA 1EJTC 4ICMA 4I6KA 4WF7A 2W4XA 4D6JA 4QS5A 2QJMA 1P0EA 3M6YA 1GOMA 3LHYA 1MW3A 3NPXA 3AU2A 5LKYA 5D2YA 1QI2A 4J5NA 3VIHA 3LDVA 2NUWA 1LG1A 2NVAA 2ZUVA 2VM8A 2TODA 2BGNE 3SI9A 4LVGA 1ZNNA 2YBTA 4JYEA 5FSEC 4CKQA 4IPIA 1VP5A 3NO5A 2EAWA 1VS1A 1DXFA 2KZHA 3NUKA 3LXBA 4LALA 3IUHA 1UD2A 1GEQA 4UNIA 2YFNA 5AKQA 8XIAA 4O1DA 3A4JA 1J9YA 2QCMA 2BNJA 1XLKA 2ZWYA 4WCJA 4EF8A 4MJ4A 4XIAA 2PGEA 1KBJA 2YCIX 4BF9A 2I9EA 3VCNA 2QF7A 4GYFA 1SJCA 1J18A 4AAJA 4TU1A 4NZCA 1QI4A 3URQA 3S46A 4JTDA 2CLMA 5FAGA 1W37A 2NQLA 3CV2A 4LXFA 3ZWTA 3VZZA 1OZQA 1EIBA 2V68A 4BF5A 3MKVA 5LXEA 3ZZ1A 3UG5A 4JD4A 1PHWA 2EGZA 3F4DA 4MB4A 3ARWA 3DG7A 1VBRA 1Y65A 1XYLA 2PU1A 3LQLA 3W84A 2ZOXA 2HROA 1RBAA 1J11A 1WE5A 1YTDA 1W54A 3OA3A 5D2XA 4LBUA 3U5UA 3NZGA 2FTWA 3U7BA 1DJWA 3B8DA 1KLZA 3EPOA 2RGMA 3VDBA 1UP2A 2V2CA 3DKJA 2B4GA 3ZT7A 3G1YA 2Y2WA 1G67A 4LBRA 3ABQA 3KRZA 3KZSA 3CYVA 4CEXC 2RDXA 3G1DA 4CNOA 1IE7C 4CU7A 1PS9A 3SY8A 3AMGA 3LRLA 3RITA 3BW2A 2ZBTA 1PKNA 1FDYA 2FZNA 2GVEA 1YDVA 5CJNA 4HHPA 3WLQA 2CC0A 4R53A 2XN0A 1S3HA 2XZ7A 2ZVIA 1UD3A 4XWUA 3PB2A 1GOWA 2VX7A 1G01A 2H90A 1PL9A 1RCQA 4YL2A 1JZ5A 4AD0A 1XLCA 4KETA 5K9XA 3VGDA 2CFFA 2CKRA 4UCFA 5KITA 4PTMA 3WF2A 1RP9A 4Y9OA 3G0UA 1KWKA 1JQXA 1XIDA 5IM51 4ES4A 5JBFA 3ONBA 4UR8A 4UQAA 4NXSA 4HKPA 1EP3A 3V5FA 3QEZA 4HHMA 2C19A 1N2VA 4F9DA 4XO7A 3DFYA 2Z27A 3H2MA 3N2XA 3MPGA 3KEHA 2J8FA 4HNVA 2R91A 1TRIA 4HNCA 4W9TA 2VFDA 4UR9A 1XDLA 4PTNA 3VIIA 1Q8AA 2G4FA 2VZSA 5AYBA 3E6EA 3PVFA 3RIKA 3GB6A 4C1NB 4IJBA 1K9TA 3UPMA 4D8LA 1YE6A 2XSXA 3MUIA 1VLWA 4EE9A 1VIWA 3RILA 1KFBA 2HE5A 3OB8A 3Q45A 2G8ZA 3PWIA 3QQ1A 2E25A 5LSMA 1AH3A 4A3UA 2ZX9A 4P7LA 1O66A 3OLIA 3CQKA 1L2UA 1H7RA 1Q6EA 4JZ5A 3VKAA 4NJHA 3ITTA 3VCRA 3IAQA 1ZJAA 3SCOA 1ZP3A 1TV8A 3P74A 1NY1A 1ISVA 1PDYA 5K3VA 4W7UA 2F38A 5JQ9A 4C6OA 3LPPA 4J3WA 2PWEA 1KCZA 2V0TA 2VD9A 2A3EA 3KWSA 1KTBA 3P60A 2QLYA 3ITGA 1XR2A 1T8XA 4V1XA 2RUSA 2FDSA 1XGEA 3IJQA 5D4YA 3QLDA 3LGGA 5F7UA 2D3LA 3EEZA 5HWJA 5T9CE 3L4ZA 3FSTA 1GCYA 4IG2B 4O28A 3FY1A 4C7GA 2DH2A 3NCOA 3IEBA 3DHUA 1DJXA 3O7UA 4ZO6A 3RG6A 4GJIA 4B5VA 1YBQB 3W7OA 4QM1A 2F2HA 1UKPA 1M68A 3W7LA 4H4IA 1YMYA 1QNOA 2DT1A 4RUBA 5DELA 1LDCA 3KBSA 3L5MA 1OK4A 3UCDA 5DY3A 4B90A 3QV9A 4IH3A 1ONRA 2AGTA 3L21A 1Z69A 2A79A 3KL3A 4Z1BA 2NX9A 1E6QM 1WB0A 5K7JA 1REQB 4GYPA 1DIEA 3ME3A 5C9ZA 1FCQA 3KBWA 2Q8ZA 3GH4A 4JN8A 4JIIX 2E6FA 2GQAA 3OBKA 4MB3A 1XJBA 5HA7A 2AMXA 4LCRA 1XX1A 2DVTA 4JY9A 1UWIA 1JI1A 3UERA 3AO0A 1SZNA 4CNTA 4H9UA 3WDQA 2W0UA 4GA8A 5IBXA 5BRBA 4J3VA 1GW1A 1GHRA 3OODA 1DVJA 1QNVA 4HNOA 1R0MA 4TVUA 1HP5A 2V5JA 1IWBA 2VTFA 5EPDA 1B9ZA 2BGQA 2E9LA 3IUDA 5AECA 4JS3A 1UYQA 3QSTA 2PDBA 5FL0A 4MOZA 4NRRA 4MJ2A 1KGWA 2OSYA 2QPUA 3QV7A 3TW6A 1DJZA 1JPMA 3ATZA 4GK8A 4L61A 2DVUA 4A05A 3CQIA 4QQUA 1NH6A 4YTQA 3VD4A 3PK7A 3EWZA 3SIMA 2I5GA 7REQA 2AKZA 1LOLA 4CEUC 4NJKA 2OELA 1GGOA 3CYJA 3LEPA 3A47A 1BXBA 4JCLA 2YB1A 1VFLA 4ZB2A 2X30A 1UHVA 1PDZA 1SW3A 4L6DA 5C8BB 1OHLA 1K3UA 3B04A 1A5KC 1OCNA 3CMGA 3MA8A 1VIZA 4WRHA 3WLNA 2PDNA 2J78A 3MVTA 4WK9A 4Q4SA 1G4PA 1UJQA 2QCDA 3AU6A 4M6UA 3A4XA 1Z7AA 2ZFAA 1Q7ZA 3H2AA 1ME7A 2AOSA 1J8VA 5CGMA 1EZWA 2OYLA 3T0BA 1QNPA 2VXNA 3UGRA 4R9OA 1TA3B 1PZ2A 3G1RA 1B2YA 3R25A 1Q63A 1MEIA 1OC7A 3HG5A 2ONEA 4M1RA 4DHGA 1V3IA 4FX8A 2OOFA 3BXWA 3TU9A 2CEQA 1KFWA 4CCCA 5A8PA 3TX9A 3BLDA 3FXYA 4GQBA 1FDZA 1E9YB 4ZE4A 3CUJA 5IFTA 1SZRA 2PLCA 4S2CA 5T9BG 2NSXA 4E5TA 3WNKA 2DZPA 4I90A 2C3ZA 1U33A 3LOTA 1XXXA 1QR7A 4K8GA 3EEGA 4JAWA 1V77A 4Q4MA 1C8YA 1U5JA 5BYWA 1IEQA 3QJAA 3BMXA 2EKCA 4S3EA 4ZXOA 1YW1A 1J5SA 3S4TA 2Y63A 1GZ1A 5ABFA 3G2GA 3GG1A 4E3TA 2WCGA 4F3HA 1W3NA 1XM3A 2GOKA 3THAA 2OMAA 3G1XA 3TOPA 4HU4A 4H04A 6TAAA 4G2DA 3SCTA 2Z25A 1JG9A 4GYJA 4IGHA 3OVGA 2YSWA 3T05A 4DJDC 3EMQA 4HU0A 1D3CA 1W3LA 2V67A 1HO4A 4A6GA 4QDWA 2P3ZA 1BQCA 3NQ8A 3BUVA 2ISWA 3N15A 4Q8QA 2J24A 2XVLA 2OLHA 3Q37A 4GHRA 4HT3A 5DMYA 4K1GA 3MCMA 4PZVA 4DBDA 4B3KA 3LV5A 3N3MA 2DSKA 4AIUA 1F5ZA 1ZGDA 2NWSA 4H83A 4X3ZA 5BCAA 4GIEA 1WPCA 4PA8A 2JF6A 2PAJA 4DJFA 4ADSA 5CQ1A 3QZ6A 2QIWA 1CCWB 1GVOA 1Y5WA 2CLKA 4B4FA 3A3XA 4BQ5A 4TX8A 3NQGA 3DFPA 1TZ7A 2VEFA 1ZJIA 3ABXA 5A6MA 3UY7A 3U2EA 2TPSA 3T0CA 1BTCA 1FVPA 3KRSA 3W72A 4XAGA 2WANA 1XV8A 1UP3A 3ZSTA 3MMUA 4RE3A 4W8BA 2R1NA 4KCWA 3ARVA 5BROA 3USZA 2TAAA 1M7XA 4IFKB 4ZENA 2F61A 2BG5A 3WQPA 1HN1A 3OGRA 4DXKA 3UWEA 4P5UA 2F2KA 1FQ0A 5A6BD 3S2NA 3OO2A 2FH8A 4B5NA 1W5PA 2ABBA 3ENLA 1VEMA 2OWXA 4BZYA 4B5SA 1U83A 1DQWA 2VC7A 2XIOA 2EQDA 1EGVA 3EDEA 2FPTA 3JUGA 4C1NA 1WXJA 1Q6DA 3CHEA 4EKJA 1R3RA 4LTSA 1ZUAX 3N2TA 3P0WA 4JFWA 4N2YA 3GXDA 4L9ZA 4IMCA 1TTQA 5DMNA 3SQSA 1H4PA 1BWKA 1B0IA 3H4WA 3LGDA 5I7GA 1OFDA 3A23A 2HDJA 1UROA 2QCLA 2FTYA 3VKJA 4QSHA 1D3HA 3SSJA 1TSIA 4IQEA 2Y88A 3G22A 1BYCA 3EB4A 1TWSA 4UWMA 4QEEA 5D9OA 1HX0A 3UW6A 3HB9A 2C71A 4E8GA 1Q6FA 1TPEA 1O6IA 5DANA 3U2OA 1WO2A 2CZFA 3WLTA 4ZO7A 3CNYA 3OYZA 1ZAHA 1B54A 5E9AA 3GNDA 1Z42A 3LA4A 1HKWA 2EPLX 3B9NA 2C13A 1LT8A