3VE9A

Crystal structure of orotidine 5'-monophosphate decarboxylase from metallosphaera sedula
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
MNRVILSLDSPIPEETLRKLNGKVAGIKVGWPLLLNLGKEKVKELVGLVDGIKILDLKLADIDNTMILIVDELKDITNSFIAHAFVGVEGSLASLSQRVDLFLVLSMSHPGWNDAFYPYLREVARRVNPKGFVAPATRPSMISRVKGDFPDKLVISPGVGTQGAKPGIALCHGADYEIVGRSVYQSADPVRKLEEIVRSQEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Metallosphaera sedula
rcsb
source organism Metallosphaera sedula
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ve9A00
1QPQA 4XUGA 1TREA 1DQXA 3HGRA 1G4SA 3W73A 1KV8A 1O95A 2CZEA 3EEGA 2X30A 1XBYA 3G8RA 4N9EA 2RDTA 2VFGA 1J4EA 2B4GA 3S5YA 3N9SA 2Q8LA 4FF7A 2OX1A 3LOTA 3KHJA 3ABSA 2H3BA 4ADUA 5AB3A 2XN1A 3ELFA 4RKAA 2A4AA 2ISSA 3LM7A 4WQ6A 1KFBA 3W7KA 2VFFA 3W1RA 3DH7A 5TIMA 3NQ7A 3GXTA 2CLFA 1FX6A 5HWNA 4PFMA 3NEVA 3LCHA 1XXXA 2ZRYA 4NX0A 4WXYA 4FB7A 3SY5A 2C13A 4A22A 1LORA 1PHWA 4GUGA 2DU2A 3A9IA 2NXGA 3G1YA 1ZJIA 2ZZ7A 2A85A 2C15A 1ICQA 1KM2A 3HG3A 2FQIA 3TMQA 4XBKA 1MXSA 3CQ0A 3FFSA 1ZCOA 4K36A 5CGQA 4Y96A 1W54A 2TYSA 2C18A 1VH7A 1WX0A 1PCWA 2FTPA 1VYSX 4ZQCA 4AWTA 3B05A 2RH9A 4FNTA 1ME7A 3BO9A 5KZMA 1SFLA 4FXRA 2NZLA 3NL5A 1THFD 1DL3A 3PC0A 1YDVA 3BGGA 3NNTA 3C2RA 3CWOX 2BXVA 3TC6A 1IXQA 1YDNA 4EVZA 1KW1A 5LGZA 3BG5A 4U4MA 4MJMA 1GVOA 3QMSA 1ZAJA 3B8DA 2YCEA 1N8FA 3PULA 4MPQA 4UTTC 2C3ZA 4R33A 4WUIA 5CPLA 4KKXA 2H3DA 4XTIA 1VCVA 2C19A 3UNDA 5A8GA 1SZEA 3MI3A 3A21A 3P62A 3S1UA 4C1KA 5D2YA 2GVGA 5LSMA 4MY8A 1M6JA 1TMHA 2B0MA 2JK2A 4BR1A 4K7VA 4O0KA 1LOLA 1EX5A 2QAFA 3LBCA 1GVFA 1R30A 1AMKA 4HSOA 2DZVA 3UXDA 1I8JA 2DZWA 1P1XA 1TPUA 4ZMGA 4M6VA 4UNKA 3GZ3A 5CPMA 4GUFA 3NQGA 3STGA 2QF7A 4WOZA 4E2DA 2ZZ6A 4U28A 3NYZA 3LB0A 2P1FA 3CTLA 1PIIA 3TFCA 1I2PA 2V2CA 4M6PA 3W1UA 2JKPA 1TCDA 1S5TA 2TRSA 3UWWA 3P82A 1AK5A 3TW7A 3EWZA 2YYTA 4BF9A 4I7UA 3IVUA 3CB8A 3HPSA 5DN1A 2YSWA 2QCGA 3KOFA 4EF9A 1KLZA 3MW7A 3TAOA 5EMUA 5CZ0A 4JTGA 2E5BA 2JKAA 2E77A 4E0CA 4NNCA 1FCQA 1LZOA 1EWEA 3G3DA 5H91A 5K9XA 3ZS4A 4O52A 1OVDA 2R94A 5KTLA 1K03A 3OG3A 1TV7A 3DFPA 1MEIA 4IX2A 3BLFA 1NF0A 2Y89A 4RZ6A 1F6PA 2AGKA 3FA5A 4EWND 2W79A 1FWRA 2OT1A 3MJYA 3RU6A 1OK6A 3GKAA 3USBA 1VS1A 1CW2A 2QUUA 3STFA 3GDTA 1JQVA 2A1YA 4M6QA 3RF9A 2RFGA 4MZ1A 4FX6M 1JCMP 3TROA 2TSYA 4I7WA 5EYWA 4QISA 3GR8A 3M16A 1N55A 3S8HA 4NJJA 4QQ3A 3HGJA 1OX5A 4O13A 3BG9A 1RQBA 4A21A 1GVQA 1VJIA 1TPWA 3FYPA 5CSRA 3W86A 3UWZA 3ABRA 1SZGA 4RV8A 3I7SA 3M41A 3NPWA 5D38A 3I65A 3PBVA 3KRZA 4LV4A 2NV1A 4I7VA 2QCDA 3MYOA 3GAKA 3B0VC 5AHLA 3LRMA 3GKFA 4QM1A 3L0KA 1FUYA 3W72A 1KLYA 1WAUA 1VGAA 3OEXA 4LUIA 3W23A 5BOOA 3E02A 4LVDA 2NX1A 4PC8A 3WK2A 3W7QA 1EUNA 5D05A 1XUZA 1OFDA 3LHYA 2NUXA 5K4XA 3A5FA 5BMXA 2CLHA 2F7FA 1OX4A 3QSTA 3UXAA 1W0MA 4KFOA 4MY1A 4O17A 4QNWA 5I3HA 1SPQA 5MHBA 1F7BA 2NV2A 3PVFA 5TBOA 4NJHA 1KFEA 3GNDA 2A6NA 4JTEA 4TIMA 5DCEA 4GXMA 1TPEA 3TIMA 1TTPA 4OV4A 5D2TA 3UPBA 4UR7A 4DF2A 3STEA 1QPNA 4YCOA 3MI2A 3P5ZA 4ORIA 5DY2A 2WPBA 3LHTA 1R47A 4FIRA 3HG4A 5T26A 5KITA 1WV2A 4KFPA 5F2GA 2YX0A 4Q32A 3VE7A 1ZENA 1GQNA 1DOSA 4NVTA 5DELA 2GQAA 4M7SA 5I3KA 2ZZ1A 1FXPA 3LCFA 1LP6A 1Z44A 1WDWA 4IGHA 4OGZA 1A50A 2B7OA 2O7SA 4WD0A 1V5XA 4NQ1A 2VFHA 2Y7DA 5LNSA 2J24A 3ZWTA 4Z0JA 1YTKA 5G4EA 4UTWA 1C8VA 3G1HA 5DXYA 1OFAA 3SIZA 1RPXA 1XC4A 3W1XA 1QOPA 3M1ZA 3ZWSA 4AAJA 1F5ZA 4EOUA 4HPXA 1AL7A 1KV5A 4JIQA 2ZCGA 3IIVA 4CNOA 3VNDA 1HUVA 5CSSA 3OHIA 5HUOA 1SZNA 4FIQA 2FPVA 1XFBA 3HG2A 4IJBA 1D3HA 3TJXA 1GVSA 1OX4B 3KVJA 3M5XA 3THQA 3A23A 3BARA 4TX9A 1AG1O 3OA3A 5G4WA 3GK0A 4RLIA 2QDHA 2NXIA 2ATMA 2XN2A 3QSRA 1OFEA 1BWLA 3W7IA 3IEBA 1O60A 4N6EA 4LC6A 3FS2A 2J6XA 3LTPA 4UIOA 2Y7GA 1RQHA 1JR1A 3TKFA 1CX9A 1OFBA 4MFEA 1TRDA 3V1PA 5G5IA 3G1SA 1N7KA 3NQEA 5AHIA 3IVTA 1EUAA 3RLVA 3N73A 4NJKA 3TUUA 4L4MA 3EXSA 3W2NA 1TTJA 1FQ0A 2Y6ZA 1B4KA 3IIPA 1RVGA 3BVJA 3PY2A 2ZA3A 4X22A 4JD4A 3W84A 3C8FA 4CCEA 3KAOA 4GWEA 3LI1A 1NVMA 2WJZA 5AYXA 4JN6A 2Z0IA 3K30A 1U83A 1FDJA 4RXFA 3QFEA 2QUTA 1KFJA 5HWMA 1TQJA 2A6LA 3MP5A 3MWAA 3W1MA 5DCBA 1QCWA 5AFDA 5J5DA 5BMWA 1RZMA 3HGSA 3M0ZA 1EP1A 1Z41A 2C6QA 2BTMA 3SR7A 2C16A 2Z2UA 3L5MA 3LCWA 4NJIA 2ZBTA 3UWQA 5AYZA 2DJLA 2OJPA 1TJPA 4NUWA 2E5CA 1H1YA 1VQTA 4BK9A 1PCKA 3RFAA 2ZRXA 3CEPA 3NQMA 3SGUA 4JTHA 4IWWA 4O1AA 2YW3A 5U7SA 3IIXA 4AF0A 4JR5A 4FO4A 2RKXA 4NXKA 4DXVA 5G1TA 3BV4A 2V30A 4MYXA 3WJYA 3TCEA 3LGEA 2YZRA 2QCNA 3F03K 3HGOA 3KVMA 4Y90A 4UR8A 4DO5A 1JUEA 1G6CA 2CLIA 2RDWA 3INPA 4JDYA 3N2XA 4GNJA 3W76A 5I3FA 1H7RA 4Z0SA 3PG9A 1EP3A 2ZA1A 3WJXA 4AEOA 1FBAA 5D2VA 4H4IA 3QH2A 3DFOA 4AHQA 4TR9A 1LRQA 1XDLA 4RXGA 3NQ2A 4WJEA 1KBIA 3EWWA 3G0UA 2Y61A 1OJXA 2CFFA 5K9CA 5G1YA 2A0NA 2X1SA 3TAKA 2YFNA 2Y88A 1FWTA 3M5VA 4W9TA 3GB6A 1FCUA 3BPWA 5D2XA 2HS8A 3S42A 3C3NA 2P0OA 4UFMA 1XKYA 3PF3A 4MY9A 3W83A 3LLFA 4O1CA 4LUJA 1LLZA 3TU9A 3QPYA 5LNUA 1CI1A 4IXXA 2R91A 4HPJA 4JY8A 2ZA2A 1XBXA 1JCLA 1GWJA 3L21A 4OU1A 2ISWA 2C0AA 1WXJA 5K4ZA 3L0GA 1EP2A 2A7NA 1TJRA 2V82A 2FFCA 3T4CA 1M7OA 2R14A 4MZ8A 3SZ8A 1QAPA 3G0XA 4Z1CA 2VFEA 2BX7A 3SI9A 1QWGA 4MZYA 3W1AA 1OFPA 1LDCA 3NA8A 2EKCA 4PL2A 3S5OA 4DEFA 4OBTA 3EB2A 4IMFA 1ZNNA 2EAWA 1EPXA 4FNRA 1M7PA 4Q33A 3UWUA 4N9CA 4FNSA 3SFKA 1WBJA 2PE4A 2ZRUA 2WKJA 2V5LA 2WO5A 1OHLA 1VR6A 2GJLA 3R5EA 1KBJA 1QMLA 3LHVA 4LRSA 1ICPA 1O4UA 3CIXA 3LBMA 5ABTA 1I2OA 3L5LA 3NPUA 3WK0A 4XQ6A 3NQFA 2TMDA 4ZQMA 5CPOA 2EHHA 3F4NA 2WOQA 2ZZ3A 4DF0A 2RDUA 4N9DA 3G3MA 5K7JA 3NQ6A 3E0IA 1Q6RA 1IXNA 3O05A 4J9JA 4RK8A 3W1NA 2G97A 5CZTA 4QITA 1WBHA 1UUOA 4DELA 5FEZA 3O63A 3TSBA 2UV8G 4YLWA 2H8ZA 4CQAA 1G7VA 4UMBA 3W9ZA 4Y9AA 1X7FA 4Z1DA 1QR7A 3UYCA 3NVTA 1J2WA 3NPVA 1XUUA 2EPHA 1DORA 3UY7A 4UFLA 5EKYA 4FNPA 4FHAA 3GIYA 2V9DA 3ZR4A 1KM1A 3G1DA 1VRDA 5D04C 4Z1BA 3EWXA 3HB9A 5E0KA 3PAJA 3BK0A 1GG1A 1LBLA 3GLCA 3RK8A 3DFTA 3M6YA 3TA6A 3QEZA 4PODA 2H90A 1Y0EA 4WY0A 1H60A 3C2FA 3CPRA 3GDMA 5HULA 2BLEA 5HUPA 3OBKA 2NXHA 4UTIA 1LLWA 3DHDA 5F1VA 5F1UA 2ZZ4A 1UJPA 4UTJA 3GXPA 2JGYA 3ANYA 4EF8A 3QPZA 5BW6A 1WQ5A 1VPXA 4ML9A 3I7RA 1M5WA 4WZHA 1ZAHA 1TYGA 5D33A 3QYQA 5K3VA 1FDZA 1FWNA 3JR2A 3KX6A 3LRKA 1SR9A 4GUHA 3FLUA 2J9ZA 1JRBA 1SW0A 3FOKA 5F4SA 1JULA 3L65A 5LHFA 1BWKA 4N9BA 2J27A 3EX1A 4JYEA 5LGXA 3HMJG 3G1VA 3TNOA 4D2JA 1QFEA 3PR2A 5LKYA 4WY0F 2GQ9A 2HSAA 2NWSA 3L2IA 3PBUA 2YGYA 4K7YA 3W6YA 1BKSA 4IMEA 3TH6A 3E12A 4IUOA 2FPTA 3N14A 4CNNA 5C5YA 1F73A 3VI2A 1O5XA 1G67A 1K7EA 2QJGA 2BSLA 4MOZA 4LTSA 3JS3A 5IM51 4MFDA 4UTWC 4JTSA 1TTIA 1A5BA 4MUZA 4H3DA 3QW4B 3JRKA 2OT0A 3DKLA 1FWSA 3NM3A 2B7PA 1GT8A 4S2BA 1W31A 1GZGA 3SSJA 3N9RA 2G5WA 4XZ9A 2FB3A 3FKKA 3L0NA 4UTUA 4N2YA 1YTDA 3FIGA 3MUXA 5FF2A 1OF8A 1YXDA 3P8JA 3P5YA 2QJHA 3P74A 3UD6A 3IRDA 3Q37A 4ORMA 2E6DA 4UC5A 2XN0A 4LVBA 3IV3A 3TQKA 3WJWA 4ZQNA 2E09A 4LT9A 1S3HA 3MI6A 1OYCA 1ZFJA 1TTQA 1V7YA 1U5JA 2B7QA 4RX0A 5CPNA 1C29A 4K8EA 4LY8A 3OVRA 4QAIA 3LCXA 3W7OA 3O6YX 5FF0A 4LVGA 2I9EA 3PS7A 1W3TA 3NQ8A 3W70A 5EPDA 1GJPA 3W2LA 3HG5A 2J9YA 4UFKA 1JRCA 5EY5A 2X1RA 5G2WA 4O1DA 4ZL1A 4E2BA 5LZLA 2FPYA 1MEHA 2H8XA 4A2RA 1HFBA 5AC8A 4UTLA 3LDVA 1JUBA 5AHMA 4O10A 5BNKA 1IXPA 3HOJA 3HBLA 1L6SA 3MP4A 4FNUA 1OF6A 2AAMA 3CM4A 2GUUA 2JBMA 5DXXA 2W0UA 5HINA 3G1FA 5L6UA 4JTIA 4OE7A 1F2JA 4O11A 1WOBA 4CQ8A 5J5RA 2QDGA 1TSIA 4TO8A 4R34A 1DKWA 2G95A 4ONVA 1PHQA 2X2GA 1B57A 2ZDRA 1KM5A 4GC4A 2VFDA 4RZ4A 5D2WA 3P61A 1ICSA 3LHWA 4OQVA 1T8XA 2PC4A 2A7RA 2VXNA 3CHVA 3PBYA 2H6RA 1TO3A 6TIMA 2XFWA 3OVPA 1TQXA 4UFHA 3S0CA 3BLIA 2YDAA 2CLLA 2DORA 4CLMA 1OYBA 3MMTA 1NSJA 1RD5A 3IGXA 3P8IA 2CU0A 5F2MA 4O4VA 1K8YA 3GDRA 4PH6A 3W1LA 3PWAA 1RR2A 1R2SA 3O1NA 2DJXA 3PM6A 1VLWA 1B4EA 1F74A 1H5YA 1G69A 3VFLA 4NNAA 4RJEA 1TV8A 3IGSA 1I2NA 4JTKA 4O16A 2E68A 1NAL1 5E1QA 3DI0A 1OK4A 3PB2A 1MSSA 4ADTA 1H1ZA 1SQ7A 1H7OA 1VHCA 1HTIA 3DFQA 2ZFAA 4FNQA 2QJIA 3NDOA 5SWUA 5F4WA 3G24A 1Q6OA 1WYIA 2FIQA 1MO0A 1EEPA 2JKEA 5CZSA 1KFLA 4K39A 2YFOA 3LTYA 3C52A 4JX6A 5D09A 2QCMA 4K8HA 3FKRA 1DV7A 3LRLA 3LV6A 1S5WA 4TMBA 2NX9A 3B03A 4K6AA 1Q3NA 1LROA 4R7JA 1H63A 3EX2A 4BWLC 1IF2A 1D3GA 4LS1A 4HNUA 2I1OA 3BW2A 3LCIA 3TQ0A 4H6KA 4O50A 1XBZA 3TSDA 4AHOA 2WSQA 1FCBA 1PL9A 1PS9A 3C0JA 5CKSA 5AC7A 4XKYA 3T55A 5G2HA 2QAPA 3AO0A 1G7UA 2PRMA 3W7JA 3NL3A 3SJ3A 3QMRA 4PL1A 5F2LA 3STCA 3L5AA 4ZQOA 1LOQA 1JJKA 4XWUA 2DZXA 4HSNA 3W74A 3O06A 3VCRA 1VCGA 1ZY9A 4IMGA 2W6RA 3GYEA 1UBSA 3NQVA 1I45A 1G4EA 4LW7A 2DZSA 5EA9A 4BI6A 4MLJA 3ABOA 4WOQA 4AWSA 3M44A 3LCLA 2QCDB 2RHGA 3CEUA 2QCCA 4UTTA 1OYAA 4PEKA 2V81A 1F76A 3W7PA 2A21A 2PRHA 5HJLA 3VKJA 2X16A 3SECA 1TIMA 4O19A 4N4QA 5D02A 1HO1A 1R46A 4JGDA 1P0KA 3O6DA 1OFOA 3LCGA 1MEWA 3B0UX 3W1TA 4JDBA 4P61A 5F2IA 4DO6A 5D30A 5GVJA 4CCCA 3NXFA 3BG3A 1QPOA 3C61A 3QQ0A 4AF0B 3Q58A 1LBFA 3B4UA 3IIZA 3R13A 1ADOA 1FXQA 2YPIA 3GDLA 1I2RA 1VYPX 4ZQPA 3NGJA 2TPSA 1KM3A 5AHFA 1SUXA 2Y85A 1QOQA 3H54A 4YXGA 2Y70A 4ZVJA 4IPJA 4FXSA 3SW6A 3LI0A 2ZRWA 3I7QA 4X2RA 2Q3RA 3W7HA 3IIOA 4KWWA 2WQPA 1L2UA 3W7CA 3UPWA 4O53A 2ABBA 4Z08A 1SO6A 2GVLA 4HN4A 2QKFA 3PBWA 2VENA 2Y62A 5AC6A 3DENA 2Z1BA 3L67A 1JVNA 4UMCA 3G0SA 1SW3A 3DZ1A 4X3ZA 2Y7EA 3FEMA 2ZTJA 1H62A 5I3GA 1I4NA 4BI7A 1YDOA 4M19A 5FEXA 3RMJA 4TMCA 1P0NA 3W07A 2O7QA 5A5WA 4JYFA 1GPWA 2A2IA 3GR7A 1X8FA 3FYOA 4BWLA 1QPRA 2PRLA 2FJKA 3NG3A 1F05A 3UQNA 2WSRA 5FF3A 1I2QA 4CQ9A 2VKZG 2V2DA 2ZZ2A 1K7FA 5CZJA 1Z48A 3FJ6A 3NZRA 3SGZA 3PSVA 3S5ZA 4B5NA 1Q6QA 4RZ5A 1VZWA 3N19B 1GYNA 3EWBX 1W5PA 4WX2A 4HKPA 2PCQA 4FX8A 4MVAA 3U6WA 8TIMA 5AHNA 2FDSA 3E49A 5CG7A 1K8XA 2CLKA 5HWJA 3DI1A 2YR1A 4O57A 4BI5A 1WOAA 3P60A 1JCJA 3O16A 3N2MA 3W85A 5DBTA 3H55A 1Q6LA 1X6UA 5LHEA 3A5VA 1W5MA 2PURA 3M7WA 1TPB1 2FB2A 3DU0A 3S1XA 2VEPA 3B06A 3BW4A 4Y8FA 3WJSA 3TJLA 1H7WA 3GAYA 3W2JA 1KTCA 3EX3A 4BFAA 5HR6A 3AJXA 1W1ZA 4LV9A 1FDYA 1O5KA 2OZ0A 5HR7A 3MHGA 1B9BA 3T7VA 3U2OA 4L4LA 3P67A 3EKLA 3DGRA 3ATZA 3LHUA 4ZQRA 3U8GA 1LRTA 3N3MA 5DBUA 2JGQA 1GEQA 3E96A 1KM0A 1T99A 3CT7A 1LYXA 1YLVA 4MIMA 4JS3A 3V75A 2QCHA 4A2SA 4M7TA 4ZZ9A 1A53A 1TV5A 4QNEA 2VEMA 4O18A 1P4CA 5LNWA 4JTTA 1YPFA 2VEKA 5DCDA 3W87A 5KZDA 4UFIA 3DFNA 2GPTA 1LTDA 3G18A 3TW6A 3S6DA 1W3NA 2Q3OA 4HNTA 4JX4A 4OHQA 4XBSA 3W7GA 5KSWA 1ZAIA 3PSWA 1VHNA 4NNBA 5FI8A 3NR0A 3EX4A 4JTLA 5D03A 3H53A 5BRBA 2BWGA 2B7NA 1W37A 5AHEA 4UNLA 2WNQA 3DHFA 1AL8A 3TV8A 7TIMA 3CU2A 2WSYA 4XTDA 3TR2A 3BGJA 2YW4A 4IX0A 3G1AA 4AMAA 4JEQA 3NQCA 1ML1A 4M5PA 3P81A 1ONRA 3WFAA 1DBTA 4QIUA 1TPFA 1SO5A 1TPDA 4IQLA 5HQEA 3LXAA 1DHPA 1ZALA 4Z1AA 4NU7A 2E1DA 3T44A 3FJLA 5LNRA 1HO4A 1UB3A 1KTNA 2EGZA 3LLDA 3ABQA 4MYAA 2KZHA 4OT7A 2CZFA 5D37A 1ALDA 1DVJA 4JIPA 1UCWA 4NZJA 1X1OA 2NLIA 3PG8A 2CW6A 1HG3A 2CLMA 2ISVA 1SZFA 4DQWA 3M9YA 1FY6A 1LBMA 2P10A 1SFJA 3TX9A 1XL9A 3MO7A 3Q94A 2A5HA 3W2MA 2J88A 3QMTA 1KA9F 1FWWA 2X1TA 3NL2A 5AYYA 1H7PA 4HT3A 4JX5A 4CCDA 4O0ZA 2A7PA 3DXIA 4POCA 2Z6JA 1VCFA 3VE9A 3S1WA 2Z6IA 4AB4A 3MYPA 2OCZA 2QCFA 2ALDA 3GNNA 3KXQA 5F4XA 5D32A 1IGSA 1MZHA 2EF9A 1A5SA 4A3UA 1K8ZA 4ADSA 2QCEA 3O07A 3GX9A 4IXHA 1KM6A 4GBUA 3R89A 1H7XA 3NQDA 2E6FA 2LLEA 2HMCA 1T96A 4YL2A 3LTSA 2BZNA 1DQWA 3W75A 4NXSA 2GJNA 3UZJA 3DAQA 3P80A 3UWVA 5FEWA 2YYUA 4LVFA 4HNNA 1YTEA 1B3OA 1XI3A 2WNZA 1OFRA 3TXZA 3P84A 5I3IA 3W3OA 1BEUA 1Z42A 4UTKA 4MKNA 3CLMA 3TE9A 1G4TA 3E9AA 3WK1A 2FLIA 4TU1A 5I3JA 4JTFA 3MBFA 2QCLA 2R8WA 3R12A 4ALDA 1QNVA 5FF7A 3BLEA 3LHZA 3G22A 1JCXA 4JYDA 3QQ1A 3F4WA 3C4UA 3EXRA 1KFCA 4K37A 3NL6A 3TQVA 3W1QA 4IPIA 3S9YA 2QEZA 4UTHA 3TXVA 1X1ZA 4YMZA 5C55A 1SW7A 1TRIA 5FESA 3UZ5A 4PCFA 3W22A 3MHUA 3THAA 3OIXA 3KVKA 3TK7A 4S1FA 1FCVA 4LRTA 3GVGA 1H7NA 2ZQ0A 5K2ZA 4FEZA 1GTHA 3NQAA 3NM1A 3DKJA 1H61A 5FEPA 3HJZA 4LC8A 2G96A 3HO8A 5C2XA 3QM3A 1UASA 3GXNA 1F6KA 1JQXA 5IBXC 3L9CA 5AOUA 2GVJA 4G1KA 1ME9A 3TSMA 1W8SA 1RV8A 3EKZA 3NPXA 2ZYFA 1EWDA 5IBXA 3T78A 1GYLA 5H2ZA 2OMAA 2ZRVA 1XBVA 1PE1A 5KINA 3QRHA 5C54A 3LV5A 4DO4A 1SO3A 3W7LA 4OWGA 3W2UA 1TPH1 4O8RA 1GVRA 4C1LA 3W71A 4N02A 1A5CA 4UMAA 4WXZA 2VELA 1DJNA 1TB3A 3W7MA 3C2VA 4LS0A 4JICA 3EWYA 1EA0A 1G4PA 3EX6A 4HHPA 4LOCA 2DZPA 1PVNA 4JNMA 3I68A 3NAVA 1XM3A 4RR4A 3P7YA 3R8RA 5U4NA 3O15A 2X1UA 3B0PA 4FX7A 2NWRA 3NO5A 4UCGA 4MLRA 3S5NA 2C14A 4K38A 3CWNA 3ZFHA 5AN7A 4R53A 4A29A 4GFSA 3M5ZA 3T40A 4Y6GA 1L9WA 5LNVA 1OABA 4UTMA 2VEIA 3OVQA 4LNYA 3NZ1A 5E93A 3PUDA 3UY8A 2HS6A 3B04A 4UFJA 3M43A 2CLEA 2VFIA 4KWVA 3WK3A 4YWIA 4DBDA 2Q8ZA 4X9SA 1W5OA 4O54A 3BW3A 1AW2A 1ME8A 4XKYB 4UXDA 2E6YA 3LERA 4O4WA 1IXOA 3HPXA 2E5DA 4GJ1A 4I9AA 3HQ1A 1KTBA 3QW3A 4IMDA 3W7EA 3RNDA 1IIHA 2NX3A 3TFXA 4JXCA 2NUWA 3WJZA 1P5BA 1E51A 3QZEA 4O12A 2NUYA 4HIBA 4KFNA 2Y7FA 4AXKA 3W2KA 5K9DA 1EB3A 3ATYA 1L6WA 3HPZA 2ABAA 4GE8A 2ZRZA 3L66A 4AH7A 4GRSA 2CLOA 3DBPA 3LXCA 4IOTA 4O28A 3F1QA 1HL2A 3HF3A 6ALDA 1AW5A 5KZEA 5DY3A 1EIXA 2CZDA 2HTMA 2D73A 1KFKA 4NT0A 4IMCA 1SU5A 5G2IA 3TMLA 4QJ1A 2ZZ5A 4P2VA 5EL1A 1TPC1 2CZ5A 5DLCA 5L9FA 5HMSA 4UUIA 1K02A 1UUMA 3I6RA 2VC6A 1KM4A 2GOUA 1AW1A 4AHPA 1ZHAA 4DBEA 4LVAA 1W5NA 4DPQA 1D9EA 4GUIA 4JTJA 3C2EA 1NEYA 4PA8A 3QC3A 4S2CA 1XCFA 5C6MA 3L68A 1J5TA 3N34A 1SSDA 4EIVA 1LOSA 3O8AA 3C6CA 1H50A 3S1VA 2ATSA 4RCXA 1SO4A 4WY0B 1VLIA 4N4PA 2DZTA 1A5AA 1YADA 2V5BA 5HNRA 1Q45A 1LRNA 4PTNA 2DP3A 4LS2A 3DFSA 3YPIA 3M5YA 1OG0A 3C2OA 1O94A 1H51A 3RLUA 1K3UA 3MHFA 4HNVA 3W1PA 2GQ8A 4YCPA 1NFBA 1R2TA 3HIJA 3IVSA 3W7RA 3KVLA 1R2RA 3Q2DA 2QR6A 3D0CA 4DPPA 3KRUA 4LWWA 1GTEA 1W5QA 3TDFA 1YXYA 4NZFA 4GUJA 2DZUA 1IIGA 2V0TA 2V2HA 3W7DA 2ZTKA 2Y63A 1QO2A 3GDKA 2CWNA 3LX9A 4AVFA 3G8EA 4QSHA 4MJZA 1GG0A 1W56A 1TPVA 1W3IA 3EWUA 3QJAA 1VYRA 1BTMA 1JCYA 2C1HA 1LCOA 4JTUA 1VC4A 1T0OA 3EXTA 2J9XA 3G1XA 3PUOA 4LU0A 5KMYA 2IQTA 3CC1A 3R2GA 3PUEA 2F84A 5EBUA 3O6CA 2E6AA 4AWUA 1LM1A 3UWYA 1OX6A 3KRSA 4OV9A 3NOEA 1NF7A 4E38A 3PB0A 1DJQA 1JCNA 1QDSA 4ICNA 1K7XA 3TC7A 3MBDA 1QO5A 1YPIA 4O1BA 1GOXA 1PV8A 5FF4A 3W88A 3IGUA 2WV8A 2AQWA 4N6FA 2WNNA 1C9DA 4O14A 3A22A 2QUVA 2V8ZA 1SSGA 3MP3A 3KFTA 3W7NA 3M47A 1S5VA 1YXCA 3C56A 2YXGA 1L6YA 4NX5A 3LXBA 3QF0A 1RQEA 2I14A 5TQLA 4NJGA 1XDMA 4DF1A 1OFQA 2VOMA 1YYAA 4Q4KA 4CNPA 4O15A 3A24A 3CIWA 1JUKA 1WA3A 4JY9A
chains in the Genus database with same CATH superfamily
4XUGA 3MCNA 1F9CA 1DQXA 2OGYA 3W73A 2X30A 1PKYA 2X05A 4J3WA 3JZEA 2B4GA 3QV6A 1OGGA 2NV9A 4FF7A 1Q6DA 3ABSA 5A3HA 4EAMA 2PBGA 4GGBA 4JOMA 3H2OA 4JCMA 4ZO6A 4QBXA 2NVDA 4IISA 3BAWA 5DQPA 1EDGA 3LM7A 4WQ6A 3W0KA 4BF7A 2VFFA 5TIMA 5A6KA 2W5FA 3NEVA 3VIGA 4UTFA 1PPIA 2PLCA 1R6WA 4D8AA 4R7WA 4AD0A 4XZWA 3HM7A 1SZRA 1C8QA 1XS2A 2UY2A 3FCPA 1WXYA 3G1YA 1ZJIA 2QULA 3VX1A 1ICQA 3CQ0A 1AD4A 3MDUA 4S38A 1N8IA 4QTGA 1E6QM 3EMZA 4K36A 4IPPA 4BQ5A 1J12A 1R5YA 3DGBA 4DJFC 2FTPA 4ZQCA 1E4NA 4AWTA 3B05A 1BSIA 1ME7A 4IIGA 4BKNA 1LWHA 3BO9A 3NURA 3TYCA 1EF2A 1W1IE 3NL5A 1JDDA 1THFD 3W26A 1AQMA 1BYAA 1HJSA 3NNTA 1FA2A 2BXVA 1XD1A 1V08A 5LGZA 2XHYA 4MJMA 4REQA 5A6JA 7XIMA 1RXOB 4Q8TA 1WKEA 3QMSA 1ZAJA 3B8DA 2OYKA 3SGGA 4J27A 3FK4A 1N8FA 3PULA 4BY3A 3B40A 2DZBA 2BODX 2YBTA 3VOHA 1M41A 3IGHX 4EAYA 4QLJA 3S1UA 1EIBA 2ZUTA 1PX8A 3E38A 4Z42C 1RVKA 1M6JA 1F3EA 3FNDA 3RLHA 4Z2GA 4FXFA 5HPOA 3EB4A 2OZTA 1GVFA 1AMKA 3UXDA 3NCOA 1TPUA 4H9ZA 4M6VA 4D1IA 4ZEPA 3STGA 2QF7A 2WVTA 4WOZA 1EYEA 2J79A 3UCCA 3NYZA 4H01A 3LB0A 1PIIA 2DSZA 2F61A 4M6PA 1QVBA 1W3JA 2AL1A 4H9UA 3P82A 1AK5A 3UWWA 2F38A 3UYIA 4I7UA 2GSEA 4DUXA 1XLCA 2YSWA 1NY1A 4GXWA 3H7UA 3C3UA 1E0VA 4JTGA 2JKAA 1XLAA 2E77A 3B8UA 1B3VA 1EWEA 3G3DA 1WZAA 4IIBA 2UY4A 4NZCA 1BXBA 1PB0A 4O52A 2V67A 3DFPA 4DUWA 1YQ2A 1XLKA 4ERAA 2R9RA 1VBJA 4RZ6A 1ZJBA 5ABHA 3FA5A 3THCA 3AROA 5C9ZA 3N3TA 2OT1A 3MJYA 1E1CB 2QUUA 3GDTA 4K3ZA 3EAUA 2A1YA 4C6FA 4R9OA 2RFGA 1XC6A 1JCMP 4FF5A 1K77A 1CDGA 3NZPA 3UVIA 3TROA 2TSYA 4I7WA 3RJYA 2OZ3A 3M16A 4WDTA 3HGJA 2J8GA 1MQQA 2D24A 3BG9A 4KIEA 1VJIA 3UWZA 3ARRA 1SZGA 2J66A 1AMYA 3I7SA 5M2FX 1OINA 3M41A 3NPWA 1V03A 1TIWA 3QXBA 2DSWA 1ZRQA 3T2PA 4KMQA 1V8EA 3DEQA 1C92A 2QCDA 2DW7A 3A6OA 1FUYA 3N2TA 3B8TA 1TJ1A 2XH2A 1XYMA 1U1UA 5BOOA 1F4HA 3E02A 2VQTA 4PC8A 1P7TA 3W37A 1XUZA 4B92A 4HHLA 1OFDA 3MJMA 4PMRA 1Q63A 2XUCA 2WPGA 3QSTA 1LL7A 1W0MA 5DMMA 4N7QA 3AIQA 3R11A 1F7BA 2C1GA 1CIUA 5TBOA 4NJHA 1KFEA 3GG1A 1QI5A 4JTEA 4Q8WA 5DCEA 1A0EA 4V1YA 4IT1A 2FHFA 4FOJA 1HKKA 3STEA 6REQA 3AXXA 4F9DA 5FSEC 5BU9A 2WPBA 5T26A 4KFPA 4DAIA 1XIBA 3VE7A 1VFOA 4XZBA 4JQ2A 1DOSA 4NVTA 5DELA 3AI0A 3AIEA 2ZZ1A 2PU1A 2DUXA 4ATDA 2HPIA 1WDWA 4IGHA 4KERA 2FH8A 1A50A 2B7OA 2G3NA 3BAJA 4WD0A 5CAHA 4NQ1A 1KQZA 4C6DA 1JFXA 3M6DA 2Y7DA 3KEHA 3UU0A 3UA3A 3NEHA 3W1XA 1TZZA 3VPLA 2VNCA 4LUSA 5AYIA 3ZWSA 2A3AA 2CPUA 3H2NA 3N15A 1KV5A 1VB9A 3M64A 1SZNA 3NVDA 3KBJA 3TTOA 4IJBA 1D3HA 3BC9A 1D8CA 1OX4B 4FMVA 3THQA 3BARA 1AG1O 4XVDA 3IWPA 5KZ6A 1B5TA 1RY0A 3QSRA 4E5TA 3AIUA 3EPMA 4LAUA 3W7IA 3IEBA 3OLEA 5D9PA 3CZKA 4GX9A 4KS0A 3SUSA 5GNXA 4UIOA 4QLLA 1WUFA 1XJBA 3PJTA 2GDUA 3OBEA 1XG4A 4MFEA 1TRDA 1WDRA 3G1SA 3NQEA 3PPFA 3IVTA 3T1GA 2O4QA 2PDUA 1KFWA 4MJ2A 1P6BA 2XGIA 3EXSA 1G94A 2J25A 1HKWA 4HOWA 2Y6ZA 7REQA 4X22A 3GFZA 4JD4A 1QASA 2VDHA 4CCEA 4GWEA 1OC6A 4MB5A 3SJNA 2WJZA 3EA3A 4JN6A 3K30A 1U83A 3V0TA 3AXKA 1PZ1A 1KFJA 3DG7A 4UQDA 4AX7A 2Z00A 4ZE4A 1QCWA 1UQZA 3PAOA 4GNVA 2X0YA 2Z24A 4E4UA 1DWJM 1IZJA 2G41A 2VO5A 1NOWA 1XCWA 4NJIA 2ZBTA 1KNWA 5AYZA 2PZ0A 5I7GA 1K9TA 2PDFA 2E5CA 4GO9A 3KBSA 2FDMA 4JR5A 1E5JA 2OVLA 2I57A 4MJ4A 2RKXA 4X60A 4NXKA 3DC8A 3BV4A 2E28A 3WJYA 4G1NA 4Y90A 2YZRA 3A64A 4IJRA 2RDWA 4QROA 4GACA 4W88A 3W76A 3VZZA 5D2VA 4RDWA 3EA2A 3QH2A 2WSPA 2BS9A 3GQYA 3NQ2A 4WJEA 1AODA 1MNZA 1KBIA 4U2YA 5FJIA 5H8UA 5G1YA 3VD4A 3VIOA 2JQXA 2PB1A 3TAKA 4CN4A 4A8LA 2POTA 4W9TA 3WLQA 1LL6A 5JIWA 3S6TA 1HQTA 2E9BA 4NILA 3DYMA 1FHDA 2W66A 3R8GA 5I24A 4C6LA 2ZA2A 5LIYX 1GWJA 1KBLA 2ISWA 1JZ3A 3CV6A 4AISA 1WXJA 1XIMA 1Y5XA 3BLDA 2PLMA 4MZ8A 4GYJA 4WKHA 5CGTA 3E5PA 2BX7A 3OTRA 4DBSA 3SI9A 2REQA 4MZYA 3RILA 3EB2A 2W91A 1ZNNA 4FNRA 1M7PA 4N9CA 5FOOA 2E3ZA 2XFYA 4OIFA 5FJPA 2DUZA 3R5EA 1QMLA 4GNKB 4ZOBA 3MPGA 1UP3A 3NQFA 2TMDA 4ZQMA 1B9ZA 4DF0A 3G3MA 3N2BA 1VFUA 3ZLFA 3E0IA 1KR0A 1Q6RA 5EMLA 2GVYA 1IXNA 3O05A 1E1FA 1PAMA 3FAWA 4U2ZA 1UUOA 5EBAA 4DELA 1SR0A 4LXFA 1RLDA 4CQAA 2YCIX 1HF6A 1KCZA 5HOSA 3QHOA 1FWDC 1QR7A 3NVTA 1XUUA 4ACZA 1K9DA 1UP0A 1VFLA 4WSKA 4LF1A 3VOCA 1KM1A 5HMDA 3G1DA 1XCXA 2J7CA 4X0VA 1P43A 5E0KA 5E5CA 2CBJA 3GC2A 1R86A 3BK0A 1UWUA 3R79A 5HQLA 1LBLA 3GLCA 3UJ2A 3TYDA 1BGAA 3RK8A 4BZYA 1GPFA 3TA6A 3QEZA 2QUMA 2HE5A 2H90A 1Y0EA 5LA1A 4CEXC 3GDBA 1H60A 1GJUA 3RN6A 3T0BA 4UWMA 1KXQA 1EJTC 2FTYA 3O2LA 5F1UA 1NJJA 1FRBA 2X09A 1UD2A 2EEXA 1LG2A 2ZUSA 1OG6A 2JGYA 3ANYA 3QPZA 4J3ZA 4WZHA 5D33A 4GXPA 4QE4A 3VMPA 4I90A 4GUHA 3FLUA 3FDGA 4YIWA 2O0TA 3LY0A 5BCAA 1TV4A 1IV8A 2GYIA 1T41A 3AICA 4LGXA 1DWAM 5LGXA 1UD8A 1QFEA 2BOGX 2EO7A 4V27A 2GQ9A 3VIFA 4K7YA 2WCGA 1PTGA 3TH6A 4HZ7A 1F73A 1NWTA 2IQ0A 5GJMA 1O5XA 4PUJA 1ISYA 4FOUA 2J74A 2OKTA 3PP7A 4HMDA 2YA2A 1A5BA 4MUZA 4O0QA 1FWSA 2B7PA 3APTA 1W31A 4Q4RA 1E9LA 1CGXA 3UR7A 3N9RA 5AZ1A 8XIMA 2J78A 4UTUA 3PWGA 4N2YA 1PWMA 1MRAA 2VR2A 1YTDA 3H7VA 4J5NA 4Q4MA 2BY2A 5B7YA 3E6EA 3NUKA 3E2VA 5FD0A 1G1YA 3WN6A 4HHMA 2D2GA 3Q37A 4E8CA 1DIOA 1T5AA 1QW8A 3IV3A 3WJWA 4ZQNA 1JPIA 1S3HA 1TG7A 1WAWA 1WCGA 3QHNA 2PDHA 1UWQA 1ZBWA 5T9CE 5T8GA 5EPDA 2WQDA 1GJPA 4CVUA 4AZGA 2J9YA 2Z25A 5EY5A 2VC5A 4O1DA 4ZL1A 1XH2A 4QR6A 3AS0A 4H9TA 1KCXA 1EZ2A 1DQUA 4A2RA 4Q22A 2BVWA 1EBHA 5AHMA 4B3ZA 3WLLA 5BNKA 3HOJA 4FNUA 2JBMA 4B4FA 5J04A 3G1FA 3RO6A 3OLDA 1F2JA 4XG1A 1WOBA 4CQ8A 2WZMA 4R3UA 4DJDC 2QDGA 2EQDA 4S3EA 5A2AA 4IQEA 1PHQA 2X2GA 4M3PA 4FLRA 3SY8A 4UOZA 1B57A 1UKSA 3CQIA 1KM5A 4GC4A 2VFDA 3UXLA 5D2WA 3FY1A 2GGIA 2DV0A 2FHBA 2HEJA 4P8VA 3GIPA 2A7RA 4DM2A 3CHVA 3HMCA 1V02E 4ZO7A 2R1PA 2P8CA 3H2EA 3T08A 1TKKA 2YDAA 2DORA 1OYBA 3MMTA 1RD5A 3IGXA 1J9YA 4O4VA 1TVPA 1UQYA 4PCPA 4PH6A 2VURA 3W1LA 3CAVA 3WQPA 3EKGA 1R2SA 4PBEA 2DJXA 4B5TA 3TTQA 3AIVA 1A47A 1TV8A 1I2NA 1OWQA 4JTKA 3WO8A 2E68A 4HMEA 1KXVA 4UZUA 3PZOA 4ADTA 2VHLA 3MANA 1SQ7A 1H7OA 1VHCA 3ZJKA 4FNQA 1UMYA 2VZTA 5BRPA 5F4WA 1V3KA 4GYKA 2P50A 1VJZA 1LUCB 2YLAA 4D72A 2D0GA 2PLJA 2PTYA 4US5D 3M0HA 3WLSA 1HP4A 3C52A 1TUFA 1DXEA 5D09A 3DUGA 4TMBA 3PUGA 4NF7A 5FL0A 4GVHA 4AEFA 4R7JA 1IF2A 2I1OA 4PB5A 1XD0A 2PA6A 4H6KA 4C6PA 2FMOA 1MW0A 2WWCA 3WNNA 5AYBA 5G2HA 1PX3A 3AO0A 1FHVA 3EDFA 4ACYA 1G7UA 3BCFA 5DFAA 4PEEA 3QMRA 4PL1A 1K1DA 2R24A 3L5AA 3ZT7A 3QOKA 4XWUA 2DZXA 3QYSA 2QZRA 3F4DA 5AVHA 1V6VA 1ZY9A 1LUCA 1UBSA 4AFYA 1AZ1A 1FP9A 1JG9A 1XP3A 1YRRA 4MDPA 3NQVA 4TOQA 3ABOA 1US3A 3M44A 1PZ0A 1F76A 1E56A 3W7PA 3VGDA 3R58A 3VKKA 1TIMA 4B5WA 3VIKA 4JGDA 3LCGA 1MEWA 3SFWA 2PDJA 3AS3A 3BICA 3AMLA 4DO6A 1V6WA 3WD4A 3WG6A 3MT1A 3NXFA 4KBXA 2HPMA 7A3HA 2ESCA 4XZHA 2BHYA 3B4UA 3IIZA 3R13A 1SGJA 3CZ8A 3PPCA 2FTWA 4NI3A 5MKGB 2NT0A 1I2RA 1VYPX 4J2MA 3NGJA 2TPSA 1KM3A 1XPYA 2YCJA 2Y85A 3H54A 4YXGA 1KD0A 2Y70A 3PZMA 4IPJA 4GC3A 3W7HA 3IIOA 5AC4A 3HURA 1L2UA 4O53A 4GQRA 3TNBA 1XYZA 4L9XA 4Z08A 7TAAA 1SO6A 4HN4A 3PBWA 3PTQA 3DENA 4W8AA 4ROQA 3L67A 4NZ5A 1SW3A 1R9ZA 5C7HA 1I4NA 3E74A 3RO8A 4BI7A 3RMJA 3MY9A 4TMCA 4H6QA 3R43A 3W07A 5A5WA 2OSWA 4JYFA 2HDJA 4ZFMA 1X8FA 2X41A 3FYOA 1MQRA 1XLGA 5HBFA 1F05A 3V5FA 1XRTA 1EQCA 1WP6A 4QP0A 4CQ9A 2VKZG 1K7FA 5CZJA 4GG9A 3S5ZA 4Q8OA 1VPYA 3UJSA 1US2A 3N19B 2PS2A 1A3WA 2NSOA 4PTMA 2IQDA 4WX2A 3GO2A 3VIHA 1RJPA 4IP5A 8TIMA 3E49A 1GOIA 2PDXA 1Q6GA 2NLYA 5CG7A 3T0DA 2ZADA 4C7FA 3W85A 5ECVA 5E0CA 1EO7A 1U30A 1W3LA 1DIEA 2DT3A 4V15A 4NZ3A 2Z29A 3ZVHB 2C79A 1J0HA 3GAYA 1KTCA 3EX3A 5EMMA 1EJSC 1B9BA 4P7NA 5BYWA 1G9HA 2WK2A 3VNJA 3EKLA 4RV3A 1XLEA 3MSRA 4ZQRA 3U8GA 3N3MA 1D7FA 1QI4A 3WKZA 3GNXA 3SCWA 2Y8KA 1LYXA 1NTHA 4QDPA 4MIMA 2O92A 4D8ZA 4A2SA 3TQPA 2Z1KA 2J7DA 1CLVA 1GW9A 5I79A 2ZXDA 3GH5A 2JE8A 5LNWA 1XICA 3AYTA 3GVQA 2GPTA 4O1EA 3TW6A 3Q67A 1W3NA 1AJ0A 9XIMA 1IYXA 1J0JA 2DQWA 4JFWA 1X97A 5FI8A 3EX4A 4JNZA 3JW7A 4AQLA 1M04A 3W6LA 1UMLA 5BRBA 2X0HA 4Z2JA 3QY6A 4UNLA 1FH9A 1AL8A 4WJ8A 3TV8A 5CSUA 2WSYA 3T07A 3UCDA 4IX0A 3O0KA 1NP0A 4AMAA 1C9WA 2VM8A 3V0SA 3WFAA 1TE1A 1D3CA 3WLHA 1TPDA 3LXAA 5D9MA 3WX7A 4TTGA 4YU1A 5I3DA 2PDWA 1ZJAA 4A4AA 3T44A 4D6CA 3FJLA 3TN3A 4Z17A 9RUBA 3MVTA 4C6IA 2HXUA 1EXBA 4S3BA 3ABQA 3K46A 4HA3A 4DX3A 4OT7A 1DIKA 2CZFA 1V0LA 3L7RA 5LIUX 2NSXA 1UCWA 1B30A 2CLMA 5HNNA 3RPDA 2ISVA 1T8QA 3H24A 1FY6A 1UKPA 2OLHA 1AQFA 3QGVA 3T0CA 3Q94A 4FSAA 2J7EA 1E0XA 5EFDA 3ENLA 3VD3A 1RPKA 4CCDA 4O0ZA 1KWKA 4POCA 2Z6JA 1VCFA 2JF7A 5A8NA 5CLTA 5FIPA 2Z6IA 4AB4A 4WGXA 2FZDA 3KXQA 4EKJA 3BJTA 5F4XA 3OBAA 3TCSA 2WZEA 3CHDA 2YL5A 3CASA 2EF9A 3A4WA 3FXYA 3M46A 1WDPA 1HKVA 1GQJA 2ZC1A 3KDOA 4GY0A 3WL1A 2E6FA 2FGLA 2LLEA 1T96A 3CUJA 1DQWA 3UZJA 1XFCA 3SN1A 4HNNA 1YTEA 2WNZA 1OFRA 4OUIA 5FJUA 3UT0A 3P84A 2Z1VA 3EGJA 4QCEA 3W01A 4MPKA 2YB1A 3SQMA 5BXSA 4UCFA 3WK1A 3KP1A 2FLIA 5I3JA 4P7QA 4LALA 3MZ2A 2AKMA 1FWAC 1QNVA 1XSIA 2X2YA 1ISVA 1VEOA 3U2ZA 5GPRA 3UFYA 2GWGA 3QQ1A 2J77A 4F0RA 4IPIA 3KZSA 5HMFA 1GNXA 1UH2A 4LCSA 3S9YA 3CPUA 2EJ1A 5CQ1A 1CGTA 1K6WA 1SW7A 1L0PA 4UQAA 1TRIA 5LXEA 4HCLA 4HVXA 3KVKA 5DMLA 3TK7A 1BLIA 1NELA 2I17A 2QV4A 4E3VA 5K2ZA 1GTHA 3G1RA 3TYAA 4LC8A 2VGIA 3HO8A 1WZLA 2BV9A 3GXNA 3KZPA 1LT8A 5IBXC 4M51A 3AXHA 5M03A 5IBXA 5H2ZA 1AH4A 2OMAA 3QR1A 5M17A 1UIPA 3EEZA 3UBPC 1XBVA 3DG6A 1JYXA 4ZGYA 3LUTA 5EU9A 3AYVA 4MDOA 3LV5A 1KWGA 1WZKA 3W7LA 4FA3A 5FKYA 4AMCA 1IEVA 5A8QA 1O12A 3ZT5A 1B54A 1A5CA 3MMDA 2WWDA 4ZE5A 3C2VA 3MCMA 4RDVA 2JEPA 1EA0A 3CPGA 4CN1A 2DZPA 4OECA 2C0HA 3NAVA 3AUJA 1HJVA 1WZMA 1XM3A 1V3HA 2XG9A 5ABGA 4C5ZA 3TONA 4FX7A 2EPNA 2NWRA 4GKLA 2HJPA 4MLRA 3S5NA 2C14A 3CWNA 4DO7A 4R53A 3GY1A 2WCSA 3D5HA 2EPMX 1L9WA 3G77A 3PWIA 1OABA 1DJZA 4LAMA 5E93A 3UY8A 4RZBA 1BRLA 3VX0A 3WH5A 3CYVA 1QU4A 2CLEA 4LCQA 1T7LA 2VFIA 2E8ZA 1UR1A 3WK3A 1PUDA 4LUYA 4A3QA 1W5OA 4XKYB 2E6YA 5H6HA 3CV2A 3IAPA 3WL0A 1KTBA 3RNDA 2NX3A 4H6EA 4JXCA 3NTYA 3QZEA 4YWSA 2NUYA 3XIMA 3THUA 1DJGA 4HIBA 2DW6A 4KFNA 4AXKA 4KCVA 3ATYA 3K4DA 2A3HA 4GRSA 3FHQA 2FZNA 2BMBA 3DBPA 4NI8A 1RA0A 2VC9A 5DY3A 1ESWA 3I4EA 1R85A 2HTMA 4R88A 3ISIX 1V3IA 4HNLA 5EL1A 4P2VA 2CZ5A 4JHMA 4JZ5A 1XYAA 5LYRA 1R3RA 2C8NA 1H11A 1AH3A 1H5VA 4GUIA 4NAFA 1L8NA 5CZKA 4F3HA 3FJNA 4KEMA 1K8CA 5JH2A 3OVGA 2QJNA 5XINA 3H2AA 1SSDA 4EIVA 1LOSA 3C2YA 4JQ1A 4C7DA 3O8AA 2ALRA 5BRQA 4N4PA 1Q2RA 4NP7A 4PTVA 3N4AA 8A3HA 3CZLA 3G2GA 3D3FA 3M0KA 4C6OA 4D1JA 5BWAA 3LK6A 3P14A 1C93A 3M5YA 3RR1A 3ANVA 2X7WA 3RLUA 1QT1A 2YA1A 1MQPA 5F7UA 4YCPA 3CL8A 1NFBA 3IVSA 3W7RA 1R2RA 2QR6A 1C7TA 4DPPA 3KRUA 1FHLA 2YKKA 3W6MA 4D6JA 3B9DA 1IIGA 2V2HA 3W7DA 1LL4A 1CXEA 3QY8A 3LGDA 3I6EA 3KLKA 4H8UA 3O9NA 2QF8A 1XYCA 3QJAA 4PB3A 2ZX8A 3IJ8A 4AZ7A 4OKDA 1CB7B 4XD6A 4XZNX 2IQTA 3A3XA 1BKHA 3URBA 4GABA 4K1WA 3UG4A 4HPHA 1UZ1A 3HPAA 3GSMA 1DJQA 3DBNA 4AU0A 4V2XA 1SMAA 3TC7A 1QO5A 2YL6A 3ARZA 4MB3A 4LX4A 4O1BA 1PV8A 3W88A 3IGUA 2AQWA 2YL8A 2OXNA 1A3HA 4Y2WA 1E9IA 4O14A 3A22A 1M3UA 1SSGA 4ECLA 4HMNA 5HPCA 1S5VA 4GINA 1ZCCA 1YXCA 2J7BA 2GUYA 1C3FA 4MNJA 1L6YA 3CAQA 3LXBA 3HU7A 1KBBA 2Z1WA 3RU8X 2QMJA 2EJAA 4GISA 4M24A 1UYQA 4CNPA 4O15A 3ES8A 3LBOA 1JUKA 1QPQA 5D9NA 3WNLA 1G4SA 4ERIA 3EEGA 1XBYA 3G8RA 3CMGA 4D6FA 3S5YA 5CJNA 2Q8LA 2OX1A 3ZT6A 2H3BA 1HL9A 2D69A 5J8LA 2I5QA 2V6AA 2XIBA 4ZOAA 2PWUA 3CS2A 2JIWA 4W85A 3AXMA 2ISSA 1MXGA 1R87A 1O5QA 4B90A 2E8YA 4PRRA 3W1RA 3DH7A 3NQ7A 3GXTA 1FX6A 3B97A 4PFMA 3LCHA 4GD0A 4C6NA 2Y8VA 3UCQA 1O1ZA 4RL3A 4JKKA 1AH0A 1W9UA 3ITXA 4WXYA 2F6UA 3WBYA 4GUGA 3A9IA 4B4HA 1US0A 1GOKA 3KS6A 4EPDC 4IZGA 3VGHA 2C15A 3A4AA 4WSHA 3KL3A 4J28A 2BB0A 3VM7A 3S9ZA 1ELSA 5CGQA 4HD5A 4Y96A 1W54A 3ZQ9A 3S1GA 1OIMA 1VH7A 3E2RA 1PCWA 1AJ2A 1VYSX 1RBAA 2RH9A 3HTWA 4DWDA 3DN5A 3UG3A 4FXRA 4G56A 2NZLA 1DL3A 3CUZA 3PC0A 2EKGA 3BGGA 3C2RA 4GFIA 3NIYA 1IXQA 1YDNA 2R82A 4AD5A 1W9BM 1GVOA 3FAXA 2WLYA 2XPKA 3UZWA 4MPQA 2CBVA 2ON3A 1XIJA 5CPLA 2QT3A 4XTIA 1VCVA 2C19A 3AMKA 5A8GA 2UY5A 2VZOA 4GZIA 2WHKA 4YN5A 3A21A 3K4AA 5A2CA 2XVNA 5D2YA 1WDSA 2RJGA 1OSEA 4K7VA 1LOLA 1YE4A 2WZTA 2Q6ZA 1R30A 1PYFA 1I0DA 2YXXA 4HSOA 4P7LA 5JMUA 1I8JA 2WNWA 2DZWA 1Q65A 1RJRA 4UNKA 4GUFA 2FJUB 1Q2SA 3NQGA 2GK1A 1BQGA 4E2DA 3UXKA 5ABFB 2VWTA 3A3HA 5DT5A 3VD9A 4V1XA 4FLOA 3IUHA 3FXGA 4A8RA 3WQEA 2TRSA 1BD0A 4AUBA 4FXJA 3EWZA 3QY7A 2YYTA 4BF9A 3K2GA 4AZCA 4YTRA 3CB8A 1OGBA 4G6CA 1A0DA 2OSYA 3BUVA 3MW7A 4PMVA 4IIDA 3TAOA 5EMUA 2E5BA 3J7HA 3ORWA 4QDMA 2NVAA 1PIGA 1CXKA 4HYVA 3WQWA 3PZ9A 5H91A 3KWXA 4DHGA 1YE6A 4YYCA 3BQ5A 5KTLA 3R94A 3OG3A 1MEIA 1R7OA 3BLFA 1NF0A 2Y89A 4IIFA 3QKEA 4M81A 2YDQA 3ZJ8A 1FWRA 3RU6A 4DAFA 1JZ4A 4YNGA 1IZKA 3WSUA 2GJRA 4M6QA 3RF9A 1C91A 2HQAA 3KWSA 4PMXA 1POJA 4CGTA 2DSKA 3KOWA 4JN7A 3GHRA 2E67A 5EYWA 4GIRA 3GR8A 4LB4A 1N55A 3S8HA 4QQ3A 5XIAA 5CJMA 1V3JA 1W9DM 3RUBL 3C86A 1RQBA 3A3WA 1TPWA 4PSPA 3W86A 3VDGA 3ABRA 4EPBC 1OCBA 4RV8A 3LENA 3DHUA 3I65A 3TWAA 2E9LA 1E40A 3B0VC 5CPQA 4M0XA 4MWAC 1HJUA 4AVOA 4GI4A 1WAUA 3DC0A 4HPGA 4PRWA 1LF1A 3OEXA 3URNA 3LPGA 4LAOA 2NX1A 1REQA 3W7QA 3BJFA 4PFHA 1NDVA 5K4XA 3A5FA 4L64A 5BMXA 1I6NA 1EF3A 2WAGA 4FP1A 4KCUA 3VD7A 1VJSA 4S3KA 4MY1A 4KFOA 5I3HA 1SMDA 4J1OA 1UPPA 2ZUNA 4XIAA 1EDTA 1Z3NA 4ZOEA 4OV4A 3EMQA 5D2TA 3UPBA 1RA5A 1VD6A 2OODA 1QTWA 3P5ZA 4ORIA 5DY2A 5D8ZA 1G0CA 4LANA 1WV2A 1FWJC 5F2GA 2YX0A 1TV2A 4GH1A 3BLKA 2GQAA 3SEPA 4M7SA 3B8IA 1FXPA 1JGMA 1ONXA 1LP6A 1Z44A 1HT6A 4OGZA 3MSDA 3FJ4A 5LNSA 3P93A 1NOFA 3AWNA 1FH7A 3ZWTA 4M29A 4QG6A 4UTWA 4PMNA 1C8VA 5DXYA 1W6TA 3OGSA 1RPXA 1XC4A 4OBSA 2XWEA 4PR4A 1H0GA 1W1YA 1X39A 1XR2A 3M1ZA 1J18A 1XQKA 2OEMA 4H9VA 1JDFA 2XM1A 1KKRA 4JIQA 4U3CA 5FACA 4FLSA 1LWJA 2NQ9A 3IIVA 2CESA 3AOFA 3VNDA 1JL8A 3SCQA 3HV8A 1SVDA 2FPVA 4AIEA 3U5UA 3HG2A 3WLOA 2PWVA 3MUAA 1A4LA 2PF8A 1GVSA 3AHVA 4IPNB 1QRQA 4E2OA 4Y8EA 3N9KA 4RNFA 3RHGA 3U48A 3E3HA 1JIBA 3OO2A 2RGLA 1XSKA 2NXIA 3RM4A 2VCBA 2OFJA 1BWLA 1UPMB 7PTDA 4LC6A 2J6XA 1X38A 1RQHA 2ZIDA 4FPSA 3V1PA 5G5IA 3M0MA 1N7KA 4RE2A 3W38A 5AHIA 4EK7A 5C70A 1U22A 4MNLA 5LIKX 4EP8C 1DXIA 3TUUA 3WMCA 1F8MA 3W2NA 4ZSTA 1EC9A 3QFWA 2VT0A 3IIPA 3BVJA 1FWBC 1S2TA 3WUFA 5CC3A 3TYZA 1WDDA 5GJNA 3C8FA 3KAOA 3LI1A 2C1IA 3PZQA 1NVMA 1DYSA 2XJ7A 4RXFA 3U9IA 3L2LA 4MUPA 2WMIB 2QUTA 4QG9A 3UZZA 5HWMA 3VXGA 2A6LA 3MWAA 2OEJA 4H9YA 3UGVA 5DCBA 4MG4A 2Y24A 1IQ8A 5J5DA 1RZMA 1DJIA 1EP1A 1Z41A 4LQ1A 2C6QA 3V3WA 2Z2UA 3L5MA 3WCZA 4NRRA 4YJ5A 3UWQA 4DLMA 4QQUA 2DJLA 3D46A 3QV9A 4NUWA 1W1PA 3RFAA 1B1YA 2BXZA 4LYPA 2CLPA 4WHBA 4O1AA 4ATLA 5U7SA 4LUTB 4IL2A 1LQAA 4U10A 3TA9A 1EHNA 4A3RA 3RAOA 3T8QA 3VC5A 1V4YA 4GK8A 1P1MA 3PZNA 3TCEA 3F03K 3HGOA 4BQ4A 4AZCB 1G6CA 4N0RA 2CLIA 3BOXA 4XKMA 3VZYA 1LQ2A 3DHPA 1DWGM 2VMFA 2ZA1A 4AEOA 1FBAA 4H4IA 3P6LA 1KC7A 8RUCA 1LRQA 4RXGA 1FH8A 1WKYA 3G0UA 2JEQA 4LUTA 4M56A 3TN4A 3AJ7A 1TFVA 1FCUA 3FGCA 5LIXX 3S42A 3F4VA 3CQHA 1EJWC 3PF3A 3ZSSA 2DDXA 3QPYA 2R91A 5ECUA 3WNOA 4JY8A 4IUGA 3WDHA 1XBXA 2YZ5A 3L21A 1V02A 3U2EA 3CAKA 3KP0A 2EG7A 1WNOA 2PZNA 1EP2A 3TR9A 3NSMA 1TJRA 2FFCA 4FS9A 1B3XA 3SZ8A 3G5EA 1W2VA 3VGGA 1QAPA 4HN8A 1J96A 1PO9A 3W1AA 3NA8A 4HYWA 3RM8A 3RRXA 4Q8NA 4OBTA 2KX9A 1IE7C 2MANA 4FNSA 3SFKA 3QKZA 1QBBA 2XIIA 1S1PA 2WKJA 4ERGA 1JZ7A 2IXVA 4PUNA 3LHVA 3MA8A 3CIXA 5ABTA 1I2OA 9CGTA 1E6XM 2G37A 2ADAA 4XQ6A 5D9OA 5CPOA 4DRSA 1EBGA 1PIFA 3W1NA 1W3HA 1WBHA 5LA2A 1UC5A 4QE1A 3TN6A 1X7FA 4Z1DA 2VQUA 2WXDM 2EPKX 2EPHA 3NPVA 1TWDA 2W63A 4FHAA 3GIYA 3ZR4A 1BVZA 3VA8A 4GIEA 1VRDA 3QBUA 1ZLPA 2E9MA 4P7OA 4WDXA 1GG1A 3FSUA 3CUHA 4PTWA 2X42A 4R7OA 3M6YA 2QDDA 2A3LA 3WUGA 1Q4WA 2PODA 1IEIA 3GDMA 2BLEA 1OD8A 4HJFA 1CLXA 2DIKA 1ZZMA 1LLWA 1ITQA 2YA0A 2ZZ4A 2IKHA 4ZO8A 4BF5A 3TTEA 3C0SA 5BW6A 1WQ5A 4ML9A 3I7RA 4FLQA 3IK2A 3S46A 1ZAHA 1TYGA 4Z2KA 4QLKA 3WQFA 1FDZA 4W4QA 3WENA 3LRKA 4PBFA 1PDZA 2CETA 2J9ZA 1AJZA 3FOKA 1JULA 1HVQA 2Z2AA 4A3HA 3M0LA 3LPOA 4WVXA 6TAAA 2HSAA 3L2IA 3PBUA 4S39A 1CXHA 3B9OA 1BKSA 1HW6A 4IMEA 3E12A 4TX8A 2BP1A 4W7UA 2FPTA 5CLWA 5FAGA 1NWSA 4GQ0A 2F6XA 1GJWA 2PDBA 1K7EA 2QJGA 2D20A 2IPGA 2BSLA 3F5JA 5BROA 5IM51 3ZYZA 4MFDA 1IGWA 4UTWC 4JTSA 1TTIA 4XO7A 1E3ZA 2OT0A 3NM3A 1GT8A 2ZVRA 1GZGA 2IMRA 3N17A 1ECQA 4XZ9A 3FKKA 2V68A 5DT7A 2YB4A 3OP2A 3IANA 1XH0A 5FF2A 5BXTA 3UD6A 4ZODA 3BQ6A 3DYPA 4PMJA 3ARWA 4H41A 3H6OA 2DVUA 4JFTA 4FZIA 2VR4A 2ZDSA 4LT9A 5I07A 4HZ8A 5CEWA 1NQ6A 3TOYA 1TTQA 1U5JA 1C29A 2P53A 3HN3A 4QAIA 3LCXA 4MSSA 1VEPA 3W7OA 3LQGA 1W3TA 3HQOA 3W70A 3VM5A 3W2LA 3WQ6A 5G2WA 4HJWA 2EBNA 3N2CA 4KEVA 1YW1A 5LZLA 1XWYA 2WVUA 1CGVA 1EJRC 4UTLA 1JD9A 5A94A 4PCSA 4QRNA 1XLJA 4O10A 1IXPA 4K8GA 1L6SA 4CD4A 2YJQA 3CM4A 3I4KA 2GUUA 2WVVB 4G7EA 5DXXA 2W0UA 4DBWA 3VNLA 1R7AA 3ZXWA 3S2CA 3ZMRA 1ZP4A 1TSIA 4R34A 2G95A 1B90A 4LF2A 2ZDRA 4RZ4A 6XIMA 2VUNA 1V6TA 4OQVA 1T8XA 2PC4A 3XINA 4L6HA 4ZTYA 2WANA 1TO3A 6TIMA 1IEQA 1ODZA 2AQOA 2XFWA 1TQXA 4UFHA 3BLIA 4YVPA 4I8YA 3TYEA 4L61A 2XWDA 4CLMA 5AECA 1NSJA 4U33A 2PTWA 2CU0A 1K8YA 4Q8VA 2QJJA 3GDRA 2BOEX 4Z2HA 1RR2A 3O1NA 2D22A 3BMXA 3R8HA 1VLWA 1B4EA 1H5YA 1G69A 2CHRA 1XGDA 3RYSA 4L56A 1CTNA 3E1F1 1PKNA 1M7JA 1MSSA 4GGHA 4HTBA 3OQ8A 2DT0A 1BG9A 1ONEA 1HTIA 2PTDA 3DFQA 1K70A 1PX4A 2V5CA 1EJUC 5EMJA 1MO0A 2JKEA 5E09A 2G50A 4K39A 1GEHA 1ZP3A 5B7ZA 4K8HA 1DV7A 3LV6A 1S5WA 2NX9A 2KAUC 4K6AA 1Q3NA 1LROA 2Q09A 1H63A 3EX2A 1PWLA 4BWLC 4HNUA 3VUPA 1XBZA 3ARPA 3L2MA 3TSDA 4NAFB 1PL9A 3WQDA 5CKSA 3T55A 1YHTA 3O3RA 4W7VA 3PTDA 3SCSA 3STCA 4ZQOA 1J11A 2Q8XA 4DJEA 1JJKA 4XAPA 2DQXA 4IP7A 3W74A 3O06A 4OOUA 2FZMA 3NQBA 4CNSA 4IMGA 2L5HA 3MSYA 3SUVA 1G4EA 4MLJA 1WKFA 1L6GA 2WLZA 2QCDB 2RHGA 1J0ZA 4JL1A 1OYAA 2ZUMA 3PJUA 3PPGA 4PEKA 3W82A 2V81A 3BDKA 2PRHA 3VKJA 2X16A 5C9XA 3SECA 5D02A 1R46A 3O6DA 3BLOA 1OFOA 3WD1A 3B0UX 4JDBA 5GQBA 4L1XA 5D30A 5GVJA 3WBWA 3BG3A 1M01A 1MMFA 1QPOA 1J6OA 4S23A 3SIMA 3P2VA 2Q02A 1J6PA 4ZQPA 1XIDA 3FA4A 1K9FA 5AHFA 3WMSA 2OB3A 4G9PA 1XIEA 3A4XA 3I7QA 5BZAA 3L4ZA 2BOFX 4KWWA 2WZHA 2WQPA 4DWSB 3GIQA 2J13A 5AZ0A 2GVLA 4UB9A 1E1EA 2WKLA 1JPKA 2VENA 2Y62A 4L4OA 2Z1BA 4EE9A 4CKQA 4UMCA 3DZ1A 4X3ZA 3EDEA 3FEMA 1TMLA 3FA3A 2V3DA 4G5DA 1TVLA 5I3GA 1OQFA 2A79A 5FEXA 3D47A 4TV6A 3U3HA 5H1WA 1P0NA 2W9MA 2A2IA 4J40A 3GR7A 3BANA 4BWLA 1R38A 4F0LA 1KB3A 4D8LA 2UY3A 5FF3A 4RE4A 2V2DA 2GGEA 9XIAA 3APYA 5BWFA 1Z48A 3FJ6A 1CENA 3W4RA 3PSVA 4ZSUA 1Q6QA 4Q8MA 4I5RA 3GTNA 1ZTVA 2VZUA 4JTAA 5FJTA 2PCQA 4FX8A 4MVAA 3U6WA 1EC7A 4BQ2A 1AFSA 1KR1A 1LLOA 2CLKA 4AZ5A 3DI1A 2V3GA 4I6VA 1JCJA 3MV01 3M0VA 2V69A 5LHEA 3A5VA 3ECQA 2XZ9A 1W5MA 3K5XA 2PURA 3M7WA 1TPB1 2XM2A 3V1HA 3SY1A 2VEPA 3B06A 1MWOA 4Y8FA 3H4GA 1E9YB 4H2CA 3GRIA 3ITTA 5E0FA 4PBGA 1FFQA 1GOQA 3GNOA 5FA5A 1O5KA 2OZ0A 1NP2A 2FZBA 3M07A 3OZYA 3P67A 2EPOA 3ATZA 1LRTA 4JN8A 1GEQA 1EX1A 4Z1YA 5RUBA 4JS3A 3V0UA 4GO8A 3IV8A 4NYYA 3FSTA 4X9YA 3ZM8A 1TZ9A 1NDWA 2INEA 1AZ2A 2VEMA 1YPFA 5DCDA 3W87A 1QHOA 4AZ6A 2E40A 3E0VA 1BYBA 1LTDA 3S2JA 2Q3OA 3UZXA 3WMLA 4GA8A 1U33A 3NR0A 1ITCA 5D03A 1B3YA 1M53A 1W37A 1XRVA 1GVEA 5AHEA 3CU2A 5JVLA 2YW4A 4E4FA 4IIEA 3BSHA 1ML1A 3OA5A 5C9RA 3C5QA 4YVVA 1RBLA 1ZSXA 3R4IA 1TPFA 5E6ZA 2VEGA 3CZJA 4IQLA 1GUVA 1NDYA 1ZB5A 1J01A 2VTFA 4Z1AA 1QK0A 1Z89A 3F2CA 2ZC8A 3BL3A 1HO4A 2ZX7A 3HFYA 4XD5A 3LLDA 2HNEA 2KZHA 3MDWA 3CV7A 1ALDA 1DVJA 4P8UA 1X1OA 1H41A 3WQGA 5EMYA 1NDZA 3VKAA 3M9YA 1LBMA 3KCJA 1SFJA 4WGHA 1DIDA 1OT1A 2MUCA 4AC1X 3VNKA 1W32A 3BZGA 5AYYA 1JDAA 3MQTA 1GQIA 1A4MA 4AZBA 1NU5A 5IFTA 3PNUA 4WSJA 4GZEA 2ZUUA 3VE9A 5C2GA 2ALDA 2Y5SA 4GY7A 4NHVA 1VBHA 1M65A 3GR4A 1MZHA 2NQLA 3GNRA 1A5SA 1K8ZA 1E43A 2QCEA 3O07A 3GX9A 3O6AA 2AL2A 1KM6A 2QGHA 4GBUA 3R89A 8XIAA 1OB0A 2WVVA 3NQDA 3ZJ6A 4NIRA 1JPMA 1E3XA 2HMCA 1Z69A 4YL2A 2BZNA 4IG2A 3P80A 3UWVA 5CCZA 1QI0A 2PGEA 1B3OA 1TX2A 5I3IA 1BEUA 1UWTA 3CK5A 1Y5VA 3MBFA 4LUSB 4Q8UA 2QCLA 2R8WA 3R12A 5JQ9A 5D8WA 4AIBA 5FF7A 1HN1A 3G22A 1JCXA 4MWAB 1IR2A 4JYDA 3VILA 1Z32X 4JFVA 3F4WA 1OT2A 2Z28A 2CNCA 4K37A 3W1QA 1QI3A 1E5NA 3TXVA 1X1ZA 5A6BD 5C55A 3VGFA 1UA7A 3WNMA 2TODA 4PCFA 3FN9A 3BGAA 3OIXA 1RP8A 4Y7EA 3GVGA 2ZE0A 2PLKA 1H7NA 4FEZA 5FEPA 1D7KA 3DKJA 3NM1A 3HJZA 4PMZA 1S1RA 5EB8A 2GOKA 1JQXA 2VI0A 5IHRA 4DM1A 2OSXA 4G1KA 3EKZA 2V5JA 1Q7MA 1A80A 1H49A 2PD5A 1P48A 5IFPA 2ZRVA 2OTDA 2D0HA 1DXFA 1XF0A 2YOCA 1PBGA 3VIJA 1UR3M 3D3AA 1Y7VA 4OWGA 3IJ7A 4O8RA 1GVRA 2BBFA 2DT1A 5CPSA 3OB8A 4AD2A 4CU6A 1EXPA 1H4PA 1K4HA 4HBKA 1G4PA 1E70M 4HHPA 4LOCA 4Q8QA 3QV8A 4JNMA 2D1ZA 3H70A 3R8RA 5U4NA 4WF7A 2GGJA 1I9CB 2ACRA 1Y65A 3ZFHA 5C8BB 1RALA 4ZR8A 3M5ZA 4Y6GA 3SRDA 4DLFA 1KXHA 3OVQA 3NZ1A 2E1WA 2VGBA 3UESA 3VFCA 2CYGA 4XAFA 3M43A 4P7RA 4F2TA 4ZFCA 4KWVA 4DBDA 5C2CA 1GQLA 4O54A 3EOSA 3BW3A 4UXDA 2ZVIA 1GCYA 4O4WA 3RPTA 1IXOA 3GG8A 3QGAC 2E5DA 1XW8A 3FGCB 3W7EA 5I78A 3TFXA 1T6MA 2EG8A 4XZMX 1E51A 4O12A 3NOYA 1IT8A 3VDAA 1L6WA 1QNQA 3HPZA 2XFFA 1MDLA 4JL2A 4GE8A 1ONWA 1WPCA 3AU2A 4IGNA 1P6CA 1A5OC 2CLOA 1UZ4A 1UZDA 2RGMA 3ARYA 4IOTA 1R9XA 3BWWA 1NARA 3HF3A 6ALDA 2PDMA 3PN8A 2OGJA 4X0NA 2OG9A 1GOWA 5DF0A 3AZRA 4PB4A 5IHSA 4IMCA 5G2IA 5DLCA 5L9FA 1DHKA 5DRIA 4C90A 1CECA 3HFTA 3E2QA 1ZHAA 4WDWA 4DPQA 2QXWA 3C2EA 1UR4A 1CYGA 4GI9A 4HOXA 4U5KA 2WJDA 3L68A 1J5TA 3UR8A 1IT7A 2D2OA 3NSNA 2J8TA 1CGYA 4XAZA 3UPMA 4KQNA 4RCXA 1SO4A 5TD4A 1VLIA 3A9BA 2R1LA 3BSMA 2DZTA 3LU2A 1J8VA 4LYQA 1YADA 1BFNA 2V5BA 1WUEA 1S2UA 1Q8AA 1OG0A 3IUIA 1UBPC 4J2PA 1KGWA 1CGUA 3BLPX 4I3GA 4TVCA 1XLDA 2W4XA 1H51A 1F07A 3EMCA 4LH8A 3EDKA 3W1PA 3GZAA 2GQ8A 1CXLA 5CSYA 3M0JA 3MV11 1R2TA 3KVLA 3Q2DA 3D0CA 1GTEA 3RLGA 4MWAE 3WEOA 4OVXA 2DZUA 3WELA 3RXZA 1F8IA 4XVEA 4HA4A 3H22A 2Y63A 1X98A 1QO2A 2R1KA 3GDKA 3LX9A 4AVFA 2VDGA 3G8EA 4MJZA 3EWDA 1GG0A 1W56A 1TPVA 1U5VA 3QPEA 2BVTA 2YBVA 1T0OA 1S2AA 3TJ4A 3EXTA 3R2GA 3PUEA 3PHAA 5EBUA 1GZ1A 3WF4A 3DERA 1LM1A 3MC5A 3UWYA 3SQSA 3P3BA 1GK8A 3KRSA 4E38A 2B31A 2PWFA 1GHSA 1UP2A 4REQB 3G6MA 4ICNA 3B9EA 4HA0A 4W87A 3V5CA 3MKKA 4MAVA 4EWJA 4C1NA 3MBDA 1ISWA 1YPIA 5FF4A 1GOXA 4N6FA 2WNNA 2Z4GA 3SCRA 3BH4A 1PEZA 2QUVA 2IPJA 1GVYA 2DY3A 4H2HA 4QJ5B 2YDRA 4L5ZA 4CD6A 3BZJA 3PANA 1XISA 1UZHA 2YXGA 4UR9A 3AHXA 3QF0A 4F9JA 1A5NC 1XDMA 4PSRA 3GM8A 4Q4KA 2WCAA 3S9IA 1WA3A 4IGSA 1TREA 5I03A 3HGRA 1KV8A 1TCMA 1Q66A 4HQVA 3UGRA 3BMWA 3V18A 4EXQA 2GDVA 4C6KA 5AB3A 4Q4PA 7ODCA 3PTMA 2XN1A 3D6NA 3ELFA 4CN6A 2C91A 3PBGA 4H7VA 4C91A 5HWNA 3LPPA 1S46A 3SAZA 4NX0A 4JKMA 1A5MC 1REQB 3SY5A 4AIOA 2C13A 4A22A 3KTXA 1PHWA 2DU2A 4L1WA 2NXGA 2ZZ7A 5CC7A 1R3WA 4BHYA 3Q45A 3TMQA 4D6HA 1MXSA 4C6BA 2VGGA 1DEDA 1ZCOA 2GGGA 4WLCA 2TYSA 1WX0A 2Y8UA 2FVKA 1UWIA 1EQPA 1FTXA 4FNTA 3TZNA 4BEUA 5KZMA 1YDVA 3VNMA 2QVHA 3CWOX 4TTUA 3TC6A 1KW1A 4NRSA 3RX3A 3BG5A 2Y1HA 4JAWA 3MB9A 4A3YA 5JUVA 5I23A 3N1AA 2V5DA 3LQLA 1F3WA 1ZBVA 1KQYA 2YCEA 4UTTC 2C3ZA 4R33A 3NYDA 4KKXA 2H3DA 4AD3A 3UNDA 3AYSA 1NWRA 3T8LA 4G7FA 2DGAA 3NZGA 2B0MA 1VPQA 3GW0A 2JK2A 4PUDA 4BR1A 2FMNA 4O0KA 1M68A 1EX5A 2BY0A 1XINA 1ECEA 2QAFA 5C9WA 2BXYA 3VNYA 4F48A 1FHUA 4DZ5A 3T05A 3QQWA 1P1XA 4NL1A 1FWEC 4ZMGA 5CPMA 3BE7A 3GZ3A 1KXTA 4NAEB 2GK1B 4IICA 4B2DD 3TJIA 2ZZ6A 4U28A 3VU2A 2P1FA 3CTLA 1H0IA 3ABXA 1I2PA 2V2CA 1P6WA 3W1UA 1DWIM 2JKPA 1TCDA 3QOMA 4H9XA 4PRTA 3KUMA 2V5KA 2ANUA 3HPSA 5DN1A 3K4WA 3PJWA 4ES4A 3KOFA 4HCHA 1KLZA 5CZ0A 1QNSA 5I2UA 1HNYA 3U7BA 3ITVA 4E0CA 4UQ9A 1VKFA 3H2FA 3WNKA 3ZS4A 2Y0FA 4PYSA 1K03A 2PAJA 3SCTA 4C6MA 1QI2A 3Q65A 5AY7A 4YVXA 4KT2A 2AOSA 3CO4A 3WZ0E 1OK6A 1E73M 3M4HA 3GKAA 3STFA 1JQVA 4GZ7A 3R0KA 3L4XA 1CB2A 4MZ1A 4JCLA 1NFGA 4FX6M 2XGBA 4KGLA 1RLCL 3MKCA 1AA1B 2J7HA 4QISA 4ICMA 4DWSA 4NJJA 5HAOA 2VC7A 1OX5A 3UR2A 3I3EA 4A21A 1XLIA 3JZUA 3DDMA 5CSRA 2PF0A 3OJGA 4JTQA 1FKXA 1YMYA 1JAEA 1HJWA 3ARTA 3PBVA 1IR1A 3VAVA 3GAKA 5BXRA 3LRMA 1UUQA 2WB5A 3M7SA 4IFKB 4PGLA 3W72A 1KLYA 1QBAA 1VGAA 1E55A 4LUIA 3W23A 1Q4NX 4PN2A 3WQVA 3WK2A 1EJVC 5D05A 4IJCA 3LHYA 2NUXA 4C1NB 1OX4A 4AWEA 3ALGA 4L1GA 3UXAA 3LMYA 3UP8A 2VZVA 4W7WA 2ACSA 4QS5A 1SPQA 4FR1A 5MHBA 1W9XA 2NV2A 3PVFA 3GNDA 2A6NA 4TIMA 2BNJA 3FV9A 1TPEA 4AY1A 4B5VA 1TTPA 3FVMA 4KCWA 3VTRA 4J4KA 4IH3A 4FIRA 2J8FA 5KITA 1ZPTA 3ARVA 4Q32A 1ZENA 5C0QA 3K8KA 5DRCA 5I3KA 1EEXA 2O7SA 1H09A 1JCTA 3WDQA 4HTYA 4G2DA 3H26A 5G4EA 1VF8A 3R10A 5AVNA 4LAZA 3SIZA 1RBOB 4INFA 4LNCA 2PGRA 4MM1A 1L2QA 5FJOA 3REQB 5CBBA 4AAJA 5IXEA 1F5ZA 3TW9A 3VC6A 4IP4A 3GS6A 1AL7A 4ZXOA 2Z7GA 2ZCGA 3SUWA 4CNOA 3H4XA 1HUVA 4AY8A 4DYEA 5HUOA 3CT2A 4B5XA 4FIQA 4Q4OA 2ACQA 2OYMA 3CUXA 3TJXA 4NZ1A 4W86A 1BAGA 4L65A 4TQTA 3S4TA 3OA3A 1B2YA 3NDYA 4RLIA 2QDHA 3B8VA 2ATMA 2XN2A 1JDCA 3RCMA 1O60A 4H8HA 3DFYA 3LTPA 3S2MA 1KKOA 1JR1A 5ENLA 3TKFA 1CX9A 4W8BA 4ATWA 1OFBA 3NWRA 4HZMA 4RNHA 4QJ4B 1EUAA 1XYLA 2WZIA 2ICSA 3N73A 2PP1A 1TTJA 1FQ0A 1B4KA 3IJLA 1RVGA 3PY2A 3E0FA 4B16A 1V0KA 2X8RA 4EX4A 3CH0A 3W84A 4W5ZA 3U4AA 3BCDA 2XIMA 3U2CA 4NG3A 2Z0IA 1FDJA 3CO8A 3QFEA 2O9RA 4AXNA 1TQJA 5A6LA 1MW3A 4C6EA 2E25A 3GUGA 3W1MA 5AFDA 2HK1A 5CAKA 5HMEA 5KEZA 3HGSA 1XGZA 1DTUA 1X7IA 2J47A 3WYZA 2CITA 4S3FA 2BTMA 3SR7A 1Q5MA 5JXQA 1LG1A 1W3KA 4UOQA 2Z1SA 2OJPA 2HBVA 3AQUA 1VQTA 4BK9A 1TZ7A 2HROA 3CQJA 3CEPA 3NQMA 3SGUA 4JTHA 3T09A 4IWWA 1O1HA 1X8CA 4FO4A 3GTXA 1OC7A 1GW1A 2PGWA 4DXVA 4CUCA 4MYXA 4I9MA 3KVMA 2QCNA 3EDJA 3N2OA 4DO5A 4F0KA 4UR8A 3GVWA 4JDYA 3N2XA 4GNJA 1H7RA 4Z0SA 1EP3A 3WJXA 2G8ZA 4DZHA 4PUKA 2VD9A 3DFOA 4AHQA 4TR9A 4DJFD 4O1FA 2PSNA 4X63A 2HBXA 4X61A 1XDLA 3VKCA 2Y61A 2HVOA 5K9CA 4QHRA 2WJEA 2Y88A 4OJYA 3CWHA 1TA3A 1RCXB 3EA1A 2X40A 3VKDA 3BPWA 5D2XA 2QVNA 3CZEA 3TWBA 2P0OA 3NXLA 4MY9A 5IRPA 3LLFA 1LLZA 3TU9A 1CI1A 3WEMA 4HPJA 1TV3A 3DOPA 1GORA 3VDHA 4OU1A 4R85A 2P76A 1F6YA 2I16A 3KOXA 3SRHA 1FVPA 5K4ZA 3L0GA 2OO0A 1S3TC 2TAAA 3T4CA 2R14A 2YCKX 2PDCA 1J0KA 3EOOA 4Z1CA 2VFEA 4FAMA 4PMYA 1OFPA 1LDCA 4EPEC 2UBPC 1V51A 2EAWA 1EPXA 4Q33A 4CVWA 2WO5A 2GJLA 2XISA 4MKVA 2HE8A 1O4UA 3L5LA 3NPUA 1Q7ZA 3BMVA 3WDPP 3WUEA 5HATA 4YPJA 3F4NA 4DI9A 3W27A 2WOQA 1OCQA 2AL2B 4N9DA 5K7JA 3URAA 4RK8A 3W02A 1FWIC 2INZA 2G97A 4QITA 2WMGA 4E2VA 3TSBA 4GJIA 2UV8G 2H8ZA 3W9ZA 3JUGA 2OWWA 4IM4A 2WKGA 3UYCA 1J2WA 4JTRA 1DORA 5EKYA 5BOFA 1XHGA 4BEQA 4FNPA 1N82A 3H12A 2OQYA 5D04C 4Z1BA 3EWXA 3AAMA 4W93A 4D9PA 3HQPA 3BOFA 3FHAA 3AYRA 3EBVA 4Q4QA 3AFBA 2QV5A 1F3TA 3DFTA 3HPFA 5IDIA 3WF3A 2X0SA 4WY0A 3B3DA 2HRWA 1W91A 1DP0A 3LM3A 5HUPA 4LAKA 2NXHA 5E9XA 3DHDA 2P3EA 3WLKX 1OIFA 1PTDA 3GXPA 2AKZA 3HV9A 4EF8A 3W28A 1VPXA 1M5WA 4E4PA 2XZ7A 1RAKA 3QYQA 5K3VA 2X7VA 5HDRA 3JR2A 3KX6A 4JIEA 4JBRA 1E9ZB 4XAYA 4AIUA 2OYLA 1JRBA 1SW0A 5F4SA 1X1NA 2W27A 1M7XA 3ARQA 3ONCA 5LHFA 1BWKA 1P7TB 2J27A 2DSVA 1YKWA 3ARSA 3G1VA 3H21A 4D2JA 3TOPA 2P88A 2I7GA 3SCUA 4IUOA 2POZA 3N14A 1GOOA 4CNNA 2NQ5A 1PYMA 3WLTA 2CKRA 4C6CA 1G67A 2VRJA 3CL7A 3WBAA 4V33A 3VOFA 1WKDA 3WH7A 2J62A 4H7CA 3DKLA 4S2BA 1JD7A 2GQ3A 2FB3A 2XSAA 2C7FA 4TVDA 2HWGA 2GL5A 3FIGA 3MUXA 2IXUA 2XH7A 3H4WA 5LXXA 4B3LA 3P8JA 2Q01A 2WHMA 3RGTA 4XIMA 1UKOA 4ORMA 2E6DA 4UC5A 4WK9A 3VDCA 3HQNA 1H1NA 2E09A 4AD4A 2OEKA 3XISA 3RG6A 1OYCA 1ZFJA 4RX0A 4K8EA 3VOGA 3WH8A 3OVRA 4C6JA 3VO0A 3O6YX 2ZWZA 4LVGA 3PS7A 3NQ8A 1S2VA 4WDUA 3VMNA 1E6RA 1BHGA 4UFKA 2X1RA 1IEXA 1E0UA 2DZAA 1UJQA 1PJ9A 3GG7A 4WJXA 5AC8A 1HFBA 5MF5A 3UF9A 1OADA 2I56A 3HA1