3VE9A

Crystal structure of orotidine 5'-monophosphate decarboxylase from metallosphaera sedula
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
MNRVILSLDSPIPEETLRKLNGKVAGIKVGWPLLLNLGKEKVKELVGLVDGIKILDLKLADIDNTMILIVDELKDITNSFIAHAFVGVEGSLASLSQRVDLFLVLSMSHPGWNDAFYPYLREVARRVNPKGFVAPATRPSMISRVKGDFPDKLVISPGVGTQGAKPGIALCHGADYEIVGRSVYQSADPVRKLEEIVRSQEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Metallosphaera sedula
rcsb
source organism Metallosphaera sedula
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ve9A00
4OU1A 4Q4KA 1KFCA 1H1YA 3EX6A 4JXCA 4IMCA 2Y89A 1EB3A 3W7NA 2WPBA 3NPWA 5HNRA 4JEQA 1O5KA 5A5WA 3RF9A 2PRHA 2B7NA 1XXXA 1LDCA 4UTIA 3UQNA 5A8GA 3SGZA 4O57A 3W3OA 1BTMA 3IIPA 1MEWA 4NJHA 2YGYA 4LWWA 3TAOA 5F2IA 2ISSA 5FF2A 1PVNA 1UCWA 5AYYA 1LZOA 3GK0A 1LRNA 2YR1A 1AW1A 2GVJA 3PC0A 1J4EA 5AHFA 1SUXA 1RR2A 3N9RA 2W6RA 3TC7A 3E12A 3SZ8A 1KW1A 3W87A 2VFEA 2VENA 4JD4A 5AHIA 1M7PA 2VFHA 3UD6A 1GT8A 3NZRA 1O95A 3PUDA 5CPOA 4K6AA 4DELA 3E9AA 4O4WA 1W8SA 2WQPA 1SO3A 2ABBA 1SO4A 4UTLA 2QJGA 3LHVA 3PS7A 2I9EA 4IOTA 2ZRWA 2HMCA 2J27A 3TDFA 3ABSA 3DENA 2H6RA 2VFIA 3RK8A 3NQ8A 3FOKA 5FI8A 1ICPA 1UUOA 3UWWA 1AW5A 3LOTA 3GAYA 4UTJA 2FJKA 3MJYA 1SW7A 3FKKA 1LLZA 4NZJA 2V5LA 1H7RA 1RQHA 3M16A 1KM0A 1AMKA 1SQ7A 1V7YA 1I45A 1QPOA 1EPXA 5C2XA 5LSMA 2C13A 2CLEA 3WJSA 2JKAA 1GWJA 3N3MA 4NUWA 3WK2A 4DPQA 4JX6A 1W31A 4UR7A 3SECA 1XUUA 2ZRZA 2ZA1A 4JTFA 2J88A 4WD0A 1TQXA 4BI7A 4HSNA 1ZAHA 5D2XA 3HG3A 3NQFA 2BTMA 1WA3A 2RDUA 5HUOA 4K39A 4DQWA 1TPDA 2NZLA 3LCIA 2Y62A 2NXIA 2Y61A 2DZWA 2H3BA 4ORIA 2FLIA 1F5ZA 1P4CA 4JYFA 4U4MA 4N2YA 4ZQCA 2V30A 5D33A 3VNDA 1TTPA 3KAOA 1LCOA 2A6NA 3L21A 1WV2A 3TH6A 3W7RA 1FUYA 3MI3A 3DBPA 4DBDA 1RQBA 2E6FA 3N73A 1W54A 1UBSA 1KM1A 4TR9A 1BKSA 3W85A 1ICSA 5FF3A 3QM3A 1YDOA 3SR7A 3I65A 4FNUA 1X8FA 1LROA 1YDNA 2QCDB 1JRBA 1NF7A 5FEWA 1VQTA 4X9SA 3IVTA 3BGGA 2OCZA 4ZQOA 3GDKA 1KTBA 1O94A 3L67A 3A21A 4AHQA 1YXDA 1ZY9A 5TBOA 1YYAA 2G5WA 1KV8A 2I1OA 3PVFA 3YPIA 3P5ZA 1FWTA 3OBKA 3OHIA 2Z6IA 4MY9A 1WXJA 3N19B 2QEZA 4O1CA 3RLUA 1OG0A 4NVTA 4O28A 1FCUA 4YCOA 1TPVA 3AJXA 3C2VA 4TX9A 5LNWA 3I7QA 4R33A 5T26A 3HMJG 1KM6A 2E77A 2BX7A 2V5BA 4FF7A 3STFA 3P67A 3S42A 4PODA 5ABTA 5LNRA 3MYPA 1YPIA 4JTKA 4IWWA 3EWZA 4AVFA 2FDSA 3E49A 1ADOA 5E0KA 1I4NA 4O8RA 3HGJA 2TMDA 2EAWA 4RZ5A 4GFSA 5BW6A 2XN1A 4K8HA 1L6WA 1DOSA 3SW6A 4TIMA 1XBYA 1XBZA 1I2RA 2X30A 1KM5A 5EKYA 3GLCA 2YXGA 3L0GA 2WNQA 3S1VA 3SJ3A 4DBEA 3TSBA 5DCEA 3UPWA 1KA9F 2F84A 3Q94A 3V75A 3W1LA 3RLVA 3B05A 1QOQA 5HR6A 1W5PA 1Q6OA 3W1RA 1OX6A 1OF6A 2JKPA 3GR7A 3LRKA 2G95A 2CZEA 4BR1A 4HNUA 1EWDA 1VR6A 4IGHA 1GG1A 3USBA 1T8XA 2A6LA 3EWWA 4GE8A 5K9DA 4ML9A 1WAUA 2V9DA 4AXKA 4AB4A 4CQ9A 1WQ5A 1G67A 1M5WA 5F2GA 3BV4A 3U6WA 3W7JA 5IM51 2NUXA 2ZZ1A 5KITA 3O16A 1S5VA 3C0JA 3MBFA 1DKWA 1RVGA 8TIMA 4Y8FA 3EB2A 4EF9A 1JCLA 2HS6A 5D2TA 1B9BA 4LV4A 2RDWA 1W5QA 1ICQA 5CZSA 2VOMA 4Z1AA 3GDTA 5HUPA 1SR9A 2ZYFA 4K37A 1JQVA 2NUYA 3KXQA 3F1QA 3C2RA 1GVRA 2VEKA 1NF0A 3TW7A 2ZRVA 1H1ZA 4WY0A 3EXSA 3QMRA 1W5MA 3EKLA 2CLHA 4JTLA 3CM4A 5C6MA 4XZ9A 3HG5A 1R30A 3QMSA 1F74A 3T44A 2P10A 5F4SA 4TO8A 1S3HA 2YW4A 3JS3A 4UR8A 2HTMA 3EWXA 1W0MA 2P1FA 5FEZA 1SZFA 3M41A 4B5NA 4EF8A 2WSYA 1F76A 2FPYA 3NL5A 3LCXA 1UASA 1QPRA 2CW6A 1GOXA 2FPVA 3C2FA 1FDYA 2J6XA 1VS1A 4NX0A 4PL1A 1F6KA 4CQAA 1JUBA 4BWLA 4ZL1A 4O19A 3OVQA 3GX9A 3U2OA 3W23A 2DORA 3BPWA 4CCDA 3TJXA 3GR8A 1JR1A 3CT7A 5K9XA 3NPUA 3TFCA 2CZDA 3HF3A 3ATYA 4RX0A 4RR4A 3NAVA 5I3HA 2YDAA 4WOQA 1S5WA 2WJZA 1AL8A 3HGOA 3G24A 3STCA 2P0OA 7TIMA 2CZFA 2LLEA 3LRMA 1QO5A 2RFGA 5D05A 1TPEA 3FYPA 1SSGA 3BGJA 2Y88A 3QPYA 5F2LA 2OZ0A 4O1DA 1DJNA 3NQ6A 3B4UA 4JYDA 5DLCA 1JJKA 1WBHA 1WOAA 3W7LA 1C9DA 3EEGA 5AC6A 3GDRA 1VCGA 5J5RA 3IIZA 5G1TA 1NVMA 4I9AA 3PWAA 1LM1A 1PV8A 3CIXA 4CCCA 2DZPA 3UYCA 4ADSA 4UTMA 5I3GA 1MXSA 3W6YA 3W74A 3GKFA 3HGRA 1W5NA 3ABOA 2R14A 3M43A 1KBIA 1PCKA 1U5JA 2IQTA 3CPRA 4O16A 1H63A 1MEIA 5CPNA 3PG8A 4HT3A 1KLYA 1WX0A 5D03A 4TU1A 1JULA 1QNVA 2FB2A 2QUTA 5CSSA 3M5VA 1TTQA 4CQ8A 3W2MA 4UNKA 3S9YA 4UTUA 3W1TA 3NPXA 1RPXA 3P61A 3NG3A 4K36A 5FF7A 2ZRYA 3DKLA 3GYEA 1B4EA 2QKFA 3STGA 5BMXA 5LGXA 4HN4A 3UNDA 3W70A 1PS9A 1LP6A 3I7RA 5D2WA 5D38A 1F7BA 4NJJA 4O50A 4WUIA 2GUUA 4DF1A 3N34A 2A5HA 1FXQA 1GVSA 1VH7A 1C29A 1EEPA 3IGUA 1OFAA 3W7KA 2AQWA 1UUMA 4FNSA 2V2DA 3TQ0A 3W72A 3P60A 3F4NA 1HL2A 4NJGA 5H91A 4AEOA 2YZRA 1VLWA 4H4IA 1U83A 4UTWC 4NXKA 1LOQA 1Q3NA 2TSYA 2PE4A 4A2SA 1P0KA 3TKFA 2BXVA 1MSSA 3TC6A 2ZZ6A 5E93A 3LRLA 3B0PA 5EPDA 3UWYA 2O7QA 3STEA 3JR2A 4O1BA 3CHVA 3QSTA 3DH7A 4MZ1A 4OBTA 4HSOA 3V1PA 4GJ1A 3G3DA 3HPZA 5CPMA 3HG4A 5FF4A 1IIGA 3EWBX 1E51A 4PCFA 4ZQPA 3A9IA 1EP2A 2E5CA 2A85A 2KZHA 4KWWA 2B0MA 3CLMA 5HINA 3NL6A 3SIZA 3M5ZA 1AW2A 2DJLA 3QW4B 1NEYA 4Y90A 4CNOA 5I3FA 2ZFAA 3IGXA 1IGSA 2VEIA 2Y7EA 3S6DA 4GXMA 3SY5A 3NL3A 2WOQA 2H8XA 3B03A 1FBAA 3PUEA 4MKNA 4UFHA 2HS8A 3BVJA 3O07A 1OX4A 2A7PA 4XTDA 3G8EA 3W7MA 3M9YA 4P61A 3BW2A 1XBVA 3TFXA 3GB6A 3OA3A 2G96A 3LHTA 3DI0A 3EX1A 4OWGA 3UXDA 1Z41A 2CWNA 3CWNA 3LI0A 4AH7A 4PH6A 4BK9A 3BG3A 3L5LA 1XKYA 3THAA 3G1AA 1H7XA 4X2RA 4M6QA 4H6KA 3O6YX 3T55A 4RJEA 1W5OA 5BMWA 2ZTKA 1H7WA 2QJIA 3G1HA 1LLWA 1OFRA 4I7UA 4E0CA 2Q8LA 3EWUA 2XN2A 3KFTA 1VRDA 1FXPA 3T40A 3EX2A 2Y63A 4BI5A 3MYOA 2YCEA 4DPPA 3S1XA 2GVLA 1K7XA 5F4WA 5AFDA 4MVAA 1ALDA 3M7WA 3WJWA 1BEUA 4WZHA 1R2TA 1XDLA 2YX0A 3ATZA 4N9DA 1FWWA 1PCWA 3QC3A 3TR2A 2CLLA 4HPXA 4IMDA 4Z1CA 1GVOA 4G1KA 4JIQA 4LC6A 1KM4A 1IXQA 2DZXA 2QUUA 1OFOA 1GQNA 3FJ6A 3R13A 3DFQA 4MLJA 3EKZA 3ABRA 5KSWA 5HJLA 1SFJA 4XBKA 4O14A 2OMAA 4UFIA 3C52A 3MUXA 4ICNA 3UXAA 3HPXA 4UTKA 2PCQA 2AAMA 3R2GA 1W3TA 1J5TA 3BK0A 3DZ1A 4WXYA 3W1QA 3BG5A 4QQ3A 4FNTA 3R12A 1QPNA 5F1VA 4FX8A 3GDLA 3W07A 2V8ZA 1G4TA 1OFDA 3DFNA 1LRTA 4JY8A 5D02A 5TIMA 4Y96A 2VFDA 1GYLA 4ONVA 3TNOA 3W7GA 3VI2A 3NA8A 1OX4B 3QRHA 1H7NA 3G1VA 1O60A 3W9ZA 3I7SA 2Z1BA 3W86A 5J5DA 3G22A 3LLFA 4NZFA 3RNDA 3NYZA 3DGRA 3E0IA 3WJXA 1EA0A 1FY6A 1GZGA 4O1AA 4WX2A 1OFEA 4O54A 4RKAA 3DI1A 1DQWA 5AHMA 1EIXA 1TPFA 2B7QA 3PY2A 4JTHA 4M5PA 1OFPA 1J2WA 1S5TA 4ZQMA 1DBTA 4MIMA 3PBUA 2FPTA 4AHPA 3C6CA 2E6YA 4UTTC 4XTIA 2E5DA 5KZMA 3MHFA 3MHUA 1FX6A 1QPQA 1FCQA 2GQ9A 4BF9A 4NJKA 1D3GA 2YPIA 2E68A 1LTDA 3W1MA 1C8VA 4Z1DA 1QMLA 3UY7A 1TSIA 1RZMA 1FWSA 1FQ0A 1YXYA 2C19A 4O4VA 1KFBA 1G69A 2R91A 1A5CA 4OHQA 4UTHA 1LYXA 5K7JA 4O17A 4MY8A 3LXBA 3L68A 4XWUA 3L5AA 1IXOA 1LOLA 5LHFA 5AC7A 1QOPA 4FX6M 4N9CA 2F7FA 2PURA 5C5YA 3P84A 5C54A 4BFAA 3W2UA 3S1UA 4IPJA 3GXTA 1JRCA 5CGQA 3EWYA 3G1XA 3BARA 1R2SA 5G2IA 1L6YA 2ZBTA 4WY0F 5DY3A 1XFBA 1TREA 3KOFA 4QIUA 4DF2A 2QJHA 2ZRUA 2NXGA 3BO9A 5F1UA 1KFKA 3PB0A 1ZJIA 4MFDA 3U8GA 1YTDA 3BLEA 3P81A 1XC4A 3G1SA 3TCEA 1CI1A 1ZFJA 3LERA 3QQ1A 4N4QA 4HIBA 1JCNA 3FYOA 3B04A 2JK2A 1EWEA 1KLZA 1HFBA 2RHGA 4FNQA 4O10A 1SSDA 2XFWA 3DXIA 1P0NA 3HPSA 2E6AA 5DCDA 4FXRA 3W7EA 4QM1A 1H7OA 4OV9A 4ZMGA 2RDTA 4N9EA 3O15A 5I3IA 1IXPA 2W0UA 1K7EA 3NGJA 4E2BA 5AHNA 3OG3A 4RXFA 5AN7A 1TPWA 3T78A 1Z44A 1JUEA 2G97A 1HG3A 4JIPA 2A7NA 1JCJA 4LOCA 4JTIA 2NWSA 2AGKA 4LY8A 3S5OA 3WK1A 1Q6LA 1OYAA 1XDMA 3W7QA 1P5BA 4JS3A 4LUJA 3KVMA 1GPWA 4JR5A 2GOUA 4CNNA 2TRSA 4XKYA 3LXCA 6TIMA 1GEQA 1PIIA 3B06A 4PC8A 4C1LA 3T7VA 2Z2UA 1TB3A 3HQ1A 3LTYA 4UFMA 3O63A 3W76A 3TUUA 1QDSA 3TXZA 3UY8A 5FEXA 3Q2DA 1WOBA 4MYAA 1IF2A 1JUKA 3ZWTA 4NNAA 1SZGA 3M6YA 4LS0A 3JRKA 3H54A 3VE7A 3R8RA 1LRQA 1H51A 4ADUA 3G0SA 2A0NA 1G4EA 1BWLA 1DV7A 1TRDA 2W79A 3CEUA 3S5YA 2GQAA 3W1PA 2OT1A 2Y7FA 4FO4A 5G4EA 2C6QA 1WBJA 1MEHA 4GUGA 1TJPA 3LB0A 4M7TA 4ADTA 4JTSA 2EGZA 3WJZA 3MP3A 3IGSA 2E5BA 3UWZA 4KFNA 2C16A 4O11A 3L0KA 2FQIA 5EBUA 4LVBA 4HNNA 1DVJA 3HO8A 3GXNA 3LM7A 2RKXA 2ZDRA 2ZZ7A 3IIOA 3C2EA 3R5EA 4KFPA 2DZUA 2E6DA 2R94A 4GUJA 2I14A 3PBWA 2NV1A 3QSRA 3SFKA 4HNVA 3P80A 4GRSA 4AWSA 1VYSX 1GJPA 3QYQA 5G2WA 3LV5A 1GTHA 3G18A 2ZZ4A 4XUGA 1TV7A 2DJXA 3IIXA 3NM1A 1B57A 2ZRXA 5FESA 1ML1A 3KVLA 3HB9A 2ZA2A 2GQ8A 1B4KA 2ZZ2A 3TQVA 4XBSA 2WSRA 1KV5A 5FF0A 4HHPA 1VYRA 3K30A 1AL7A 5MHBA 4PA8A 4FIQA 4HKPA 3Q58A 1DQXA 4ZQRA 3NQDA 1L9WA 2VEMA 3N9SA 3WJYA 2Y85A 2EPHA 3CQ0A 4JYEA 2DZSA 1B3OA 4DO6A 1QR7A 2NX3A 5AC8A 5F2MA 1VYPX 4PFMA 4KWVA 1TIMA 2WKJA 3NZ1A 1SFLA 2X1RA 4IXXA 4RLIA 5AB3A 3GDMA 3QFEA 4JN6A 4R7JA 4GUFA 1EP3A 2Y70A 3M44A 2B7PA 3N2XA 2UV8G 1T96A 4IPIA 3GIYA 5HWMA 3GVGA 4UMCA 4Z08A 2PC4A 4A3UA 1YTKA 3R89A 4JTGA 1G7UA 1TPH1 5SWUA 2QCLA 2VEPA 3VKJA 3RU6A 3W7DA 1D3HA 4MFEA 1ME8A 3MHGA 1XBXA 3LHWA 3OVRA 5IBXA 2OX1A 3UZJA 4DEFA 3TMQA 2VC6A 1ZAIA 5U4NA 4UTWA 4FB7A 5D09A 3MP5A 3W7CA 1N55A 3QQ0A 3DHFA 2ISVA 4A29A 3OVPA 2WSQA 3M5YA 3T4CA 4QISA 2FFCA 1TTIA 2NWRA 3HIJA 2A21A 3LCWA 2Y6ZA 3E02A 4NT0A 1DL3A 4ORMA 4CCEA 2ABAA 4AHOA 1ME7A 3CWOX 3KRSA 1LBMA 4JTEA 4Z0SA 5EMUA 4UIOA 4A21A 3FJLA 1T0OA 1VCVA 5K3VA 1Y0EA 3P8IA 3TK7A 3ANYA 1EUNA 3I68A 3QEZA 4P2VA 3G1YA 2GJNA 5CZTA 3ZR4A 5HR7A 4UCGA 1SZEA 3KRZA 1LORA 1KTNA 1JQXA 3IIVA 3HOJA 5G5IA 2ATMA 2QDHA 3MP4A 3ZS4A 3NQEA 3IV3A 3TV8A 4EOUA 4JTUA 1H62A 4MUZA 2VFGA 3PBYA 1MZHA 3OIXA 1X6UA 5HWNA 5D30A 3W1UA 3NNTA 3I6RA 1Z42A 3A22A 2ATSA 3SSJA 3TSDA 5CSRA 5KMYA 4RK8A 2QCFA 1X1ZA 3D0CA 4FHAA 1FWRA 5LHEA 1RQEA 1WDWA 5AYXA 3W71A 4ZQNA 4FNPA 4E38A 4N9BA 1H5YA 2X16A 3W83A 3H55A 5LNVA 5K4XA 3C3NA 4JICA 1K3UA 2CZ5A 2DZVA 3QJAA 5BNKA 4EWND 4S1FA 3LCFA 2RH9A 4LV9A 3W88A 1I2PA 1I2OA 3PUOA 1UJPA 4JY9A 1CW2A 4AAJA 2NX9A 4IQLA 3GXPA 1VHCA 2YFNA 4RZ4A 2OJPA 5AHLA 3O05A 1KFEA 3QZEA 2E09A 1G6CA 2NLIA 1YTEA 3DAQA 1OJXA 2CLFA 2PRMA 3BW4A 3TQKA 4QAIA 1TPC1 1PHQA 2ZA3A 4MY1A 3IVSA 1THFD 1ONRA 4Z0JA 3O6DA 4CNPA 5AYZA 4AWUA 3A5VA 4WJEA 4OGZA 1LBFA 1XM3A 4BWLC 3NQ2A 4JDYA 4ZZ9A 2VKZG 5D2VA 2QUVA 2QDGA 1ME9A 4ZVJA 2CU0A 1IIHA 4UFKA 3DKJA 3NQGA 1SU5A 4MJZA 2YYUA 3W75A 4NNCA 4U28A 2GJLA 1VGAA 1YLVA 3NQAA 1A5BA 4NNBA 2BZNA 2DU2A 1RV8A 4I7WA 3LI1A 1GVFA 4HPJA 3FS2A 1QFEA 3FIGA 2J9XA 3NL2A 5K4ZA 2PRLA 3LHZA 1PHWA 5KZDA 3TXVA 2Q3OA 5CPLA 4XKYB 3EXTA 3TJLA 5C55A 5KZEA 3TU9A 3NQCA 5HULA 3N14A 3NDOA 3UWVA 1N7KA 4MPQA 3BG9A 1DHPA 4ALDA 4DO5A 2V0TA 1KM2A 4LU0A 3W84A 2QCCA 2JGQA 3LDVA 2FTPA 1OABA 2Y7GA 4M6VA 1A53A 3QW3A 3HJZA 4JNMA 2Q3RA 1BWKA 2NV2A 4MLRA 5DY2A 1SPQA 2J9YA 2C1HA 5DN1A 3DFTA 4S2CA 1EX5A 2H3DA 3DU0A 4RV8A 4LVDA 4MZ8A 5AOUA 1OK6A 1NSJA 3P8JA 1TJRA 4LVFA 2VELA 1OFQA 3S0CA 2Q8ZA 5LKYA 1GVQA 5D2YA 1SO6A 3P7YA 1LBLA 2WO5A 4J9JA 5EY5A 1F73A 2V81A 3L0NA 4LTSA 4QSHA 4JTTA 3TW6A 1OYBA 2QCHA 5E1QA 3MMTA 1WYIA 2YFOA 3MBDA 3W7HA 3IEBA 1KFJA 1YXCA 3TMLA 5G1YA 4DF0A 3LCLA 3CEPA 5D37A 4D2JA 1AG1O 1K03A 4MYXA 1D9EA 3MO7A 1ZALA 3M5XA 4IUOA 1QAPA 2DZTA 3P74A 4JDBA 4YL2A 3C56A 3L2IA 4GBUA 3PSVA 4PEKA 3E96A 3GKAA 3G3MA 3VE9A 4A2RA 2WNZA 1TV5A 3NR0A 4K7VA 3LV6A 4PL2A 5GVJA 3F03K 4LS1A 2J24A 3AO0A 1VJIA 3MI6A 4L4MA 4GNJA 4GC4A 1IXNA 2X1TA 3LBCA 2VXNA 1VHNA 1W3IA 4OE7A 4K8EA 4POCA 3L65A 4LRTA 4HNTA 4IX2A 4LUIA 4AF0B 2Y7DA 3CB8A 2O7SA 3WK3A 4TMCA 5DBUA 3DFOA 4NU7A 3NM3A 4RCXA 5LNSA 1XUZA 4R34A 2XN0A 1QO2A 3LLDA 2VFFA 3NVTA 2NUWA 2D73A 5K9CA 1OVDA 2ALDA 1JCYA 1G7VA 3PULA 3TA6A 1H50A 2QCMA 4JGDA 2EKCA 3W2KA 3TX9A 1PE1A 1ZCOA 1MO0A 3W7OA 1DORA 1P1XA 4M7SA 2QCDA 1KM3A 2JKEA 1HO1A 5TQLA 4UMBA 1A50A 3FEMA 4NXSA 4QNWA 3S5NA 1I2NA 1L6SA 3W73A 1TMHA 1YDVA 1O5XA 1TO3A 1I8JA 4Q33A 3L5MA 3LX9A 4LRSA 2QAPA 1X7FA 1K8ZA 3LCGA 3GZ3A 3NQVA 2QCEA 1GTEA 4RZ6A 2OT0A 4AMAA 1M6JA 1GG0A 5KTLA 5K2ZA 2A1YA 3PSWA 3Q37A 3O6CA 1XCFA 4Q32A 5BRBA 4X3ZA 3WFAA 4X22A 2B4GA 3W2LA 1VC4A 4JX4A 3S5ZA 2X2GA 1QCWA 1KTCA 3FFSA 1NFBA 3H53A 4IJBA 4KFOA 3KX6A 3PM6A 3O06A 4YCPA 2Z6JA 1TRIA 1UB3A 3G0UA 5DXYA 4O53A 4LW7A 4UMAA 4LT9A 4WY0B 2NX1A 1G4SA 1YPFA 4IXHA 1NAL1 3LCHA 5I3JA 4WQ6A 3FLUA 1TQJA 1W56A 4LC8A 4S2BA 1N8FA 3W2NA 3NPVA 4MZYA 1TYGA 3MW7A 4JTJA 4YWIA 4RXGA 5EA9A 2CLIA 3W2JA 1K8XA 1SW0A 5FEPA 1G4PA 1TPUA 5AHEA 1TPB1 1H61A 3QPZA 3W22A 3EX4A 2DP3A 1I2QA 2BWGA 1W1ZA 3QF0A 4FXSA 3SGUA 4IMEA 3QMTA 3DFPA 1VZWA 3MWAA 2QCGA 3FA5A 1FDZA 5D04C 1TV8A 4O12A 4OQVA 4R53A 1JCXA 3TROA 1W37A 3GAKA 5EL1A 2ZZ3A 2B7OA 1R2RA 1F05A 3BLFA 4O0KA 4MJMA 2YYTA 3B8DA 1Z48A 3CTLA 3F4WA 5HWJA 4QITA 4BI6A 3PB2A 1FDJA 4N6EA 4LVGA 4AF0A 1R46A 3S1WA 3ZFHA 2BSLA 2C14A 2R8WA 3WK0A 3RMJA 2C0AA 1VPXA 1PL9A 4AWTA 2ZCGA 1W3NA 2QF7A 4K38A 2WNNA 4NJIA 4IMFA 3LTSA 1DJQA 2A4AA 1AK5A 3THQA 2YW3A 4FEZA 5LGZA 1QWGA 3M0ZA 4Y9AA 4TMBA 4C1KA 3IVUA 3LXAA 1O4UA 3L9CA 5G2HA 2JBMA 1CX9A 3IRDA 4KKXA 4LVAA 3QH2A 2C15A 4Y6GA 1KBJA 1YADA 4PTNA 1FCBA 5DCBA 5D32A 5U7SA 3LHUA 3W1NA 2FB3A 3DFSA 1FCVA 3M1ZA 3NQMA 1SZNA 3KVKA 4WXZA 3B0VC 2CFFA 2BLEA 3GNDA 4E2DA 3UZ5A 3C8FA 1K8YA 2ZTJA 3W1AA 4NQ1A 4UC5A 2GPTA 2H90A 1OYCA 3KRUA 3O1NA 2CLMA 3PAJA 4MOZA 2QCNA 4GUHA 3ABQA 2HSAA 5IBXC 4O18A 3NOEA 3M47A 3KHJA 4O52A 2Z0IA 3PBVA 2J9ZA 3W1XA 3MI2A 4FX7A 1Q6QA 4UFLA 3C61A 1JCMP 5L6UA 4N4PA 4OT7A 3LHYA 2ISWA 4YMZA 5CZ0A 4GUIA 1K7FA 4W9TA 3BW3A 5L9FA 3P62A 2YSWA 1Q45A 1XL9A 1R47A 5DBTA 2H8ZA 4XQ6A 1LOSA 2FIQA 1JVNA 1OX5A 5HQEA 3NXFA 4DO4A 4O15A 4NX5A 1OK4A 4IX0A 1GYNA 1XI3A 3S8HA 2TPSA 4FIRA 6ALDA 4DXVA 2JGYA 4WOZA 5F4XA 3EXRA 1SW3A 2C18A 2C3ZA 2A2IA 1HO4A 3HBLA 1V5XA 3A23A 1EP1A 4Z1BA 3NEVA 3G0XA 4N02A 3N2MA 1X1OA 4GWEA 2NXHA 1L2UA 2X1SA 3TE9A 3CC1A 4H3DA 3C4UA 5DXXA 5DELA 2CLKA 3PF3A 1SO5A 1FWNA 4M19A 3ZWSA 2WV8A 3VCRA 5CG7A 4YLWA 3KVJA 4OV4A 1TTJA 1T99A 3G1FA 1KFLA 2A7RA 1A5SA 2EHHA 3UPBA 5I3KA 4N6FA 3HGSA 1ZAJA 2EF9A 1HTIA 1OF8A 3LGEA 4L4LA 4O13A 5LZLA 3FKRA 3P5YA 4EVZA 4UTTA 5CZJA 2ZZ5A 3TAKA 5LNUA 2CLOA 1ZNNA 4CLMA 4LNYA 3P82A 4A22A 2V82A 3A5FA 1F6PA 3UWQA 3O8AA 1OHLA 3EX3A 5H2ZA 5BOOA 4M6PA 3INPA 5G4WA 3CIWA 4JX5A 2ZQ0A 3CU2A 4YXGA 3VFLA 3B0UX 3PG9A 3TIMA 4QNEA 3TSMA 1H7PA 1Q6RA 3G8RA 1HUVA 5KINA 3LTPA 4UUIA 4O0ZA 2TYSA 3BLIA 3W7IA 4UNLA 2V2CA 3PR2A 1VLIA 3GNNA 3W7PA 1H60A 1K02A 1F2JA 3C2OA 2QAFA 2GVGA 3NO5A 3LBMA 2V2HA 1TCDA 1ZENA 3HG2A 3SI9A 1EUAA 2E1DA 3L66A 3G1DA 3DHDA 3OEXA 4EIVA 1A5AA 5HMSA 3RFAA 5CKSA 1RD5A 2QR6A 3NQ7A 1ZHAA 4FNRA 1M7OA 4LS2A 4QJ1A 5EYWA 1OFBA 4K7YA 4UXDA 2X1UA 3A24A 4I7VA 1VCFA 3UWUA 3ELFA 4IMGA 4UFJA
chains in the Genus database with same CATH superfamily
2W27A 4Q4KA 1KFCA 1H1YA 2VHLA 4JXCA 4RE3A 4UWMA 4IMCA 4PTWA 3W7NA 1E9IA 4BQ5A 2XWDA 3LM3A 2HK0A 1A4MA 2PRHA 2B7NA 4UZUA 5A8GA 4Q7IA 5PTDA 3W3OA 3IIPA 2YGYA 4LWWA 2G3MA 2VGBA 1UP3A 5F2IA 2ZUTA 4DWSC 1UCWA 3GK0A 1LRNA 3KBWA 3N9RA 1Z32X 2IKGA 4IPLA 1CTNA 5LIWX 1NDWA 3WX7A 2X1IA 1FH7A 1UH4A 3GVVA 1BVZA 1TZ7A 4K6AA 4DELA 1W8SA 1E0WA 2WQPA 4LUSB 1SO4A 1NOUA 4HK6A 4UTLA 3PPHA 1XH0A 3PS7A 1SR0A 2I9EA 2HMCA 3TDFA 2I5QA 3ABSA 5FAJA 3PZNA 4GYFA 2OYLA 3RK8A 3NQ8A 5I07A 1FVPA 5FI8A 4LEFA 1RBOB 3LOTA 1T40A 4UTJA 3TJIA 4YS1A 1CXFA 1LLZA 2V5LA 1RQHA 3KTCA 3M16A 2DSVA 3E0WA 1V7YA 1H5VA 2ZUVA 3IANA 5BYWA 4NUWA 2CEQA 1XYAA 3WK2A 4RDYA 1W31A 3E38A 3DERA 1XUUA 1QNPA 2ZRZA 3D3FA 2J88A 2OWCA 1R3RA 1EO5A 3CUJA 1BYDA 1FRBA 4HSNA 5D2XA 3SJNA 3HG3A 5HUOA 3SGGA 2OODA 1TZ9A 1PKMA 3M46A 3ZLFA 4PMVA 3WD3A 2DZWA 2ZVIA 2WKLA 3COTA 2FLIA 1GONA 4LEQA 1R7OA 4Q8TA 3UZYA 4N2YA 3VKDA 1LCOA 4TOQA 1CXIA 4WSKA 1IZJA 1O1ZA 3L21A 1BF2A 4ZR8A 3DBPA 1NWRA 4DBDA 1W54A 1BKSA 3W85A 3N29A 3O0KA 3QM3A 3SY8A 1X8FA 2DIJA 1H11A 1JL8A 4GD0A 2W91A 4J3SA 3C0LA 1KTBA 2GYIA 5MKGA 1A5UA 1YXDA 1ZY9A 3KLKA 1FKWA 4PN2A 3VTRA 3WBXA 1LJYA 3J7HA 1Q5MA 2PDXA 3OHIA 4FF5A 4M0XA 5XINA 3N19B 3GU2A 3O6AA 4YCOA 3H7VA 1JNEA 4IGSA 4HZ7A 1KM6A 5FSDC 1JNDA 2V5BA 3CO4A 2ZKMX 8RUCA 1M53A 1ZUAX 2OWWA 1DJWA 3WL1A 3MYPA 4JTKA 2E40A 1XF0A 4J2MA 3EWZA 1CGYA 5DX7A 1ADOA 5E0KA 1AQMA 4O8RA 2EAWA 4I9TA 2D2JA 3QTGA 4K8HA 3ARPA 2ZDSA 1XBZA 4ZO8A 4OOZA 2YXGA 3E2QA 4AD1A 1IT0A 1H1NA 5DCEA 1U1HA 2J62A 5A6KA 1NQ6A 2X7VA 2HISA 4JOMA 2J13A 1OX6A 1OF6A 3H26A 3GR7A 4BR1A 1CBGA 1EWDA 4IGHA 4C6CA 1GG1A 1J11A 4FLSA 3ZJ6A 1WAUA 1G67A 3GVWA 5F2GA 3WD4A 3B9EA 4LUTA 3SB0A 4HNOA 1RVGA 6TAAA 3U7BA 3OLDA 4EXAA 3EDDA 1YNQA 3K8KA 2AQOA 3IV8A 4QE5A 5D2TA 5BCAA 2CKRA 1W5QA 5CZSA 1BXCA 2PMQA 3TZNA 1SR9A 4RE0A 2ZUNA 1V51A 4IP7A 1XH1A 4US5D 3F1QA 3C2RA 2AL2B 3HJEA 4JIEA 1GVRA 2GL5A 1NF0A 4KWUA 4TX8A 2GJPA 2VWSA 3QMRA 3EKLA 4JTLA 4YTQA 4XZ9A 1E3XA 4XZWA 1IZCA 2J7CA 5F4SA 4U3CA 3NTYA 3ZT7A 3EWXA 4PE8A 2E1WA 1UPPA 2WLYA 5FEZA 4DLMA 4B2DA 1YW1A 4EF8A 1MRAA 1F76A 3NYDA 3NL5A 1K70A 1UASA 2CW6A 4XD6A 1A3XA 2HROA 1E0TA 2VZUA 3NCOA 1HJVA 4QBXA 1H49A 1RCOB 3AHYA 4ZL1A 3VIJA 4V2XA 5I03A 3CT7A 4FXJA 3APTA 3NPUA 2F38A 4IPPA 3VDBA 2PLKA 3QN3A 2EO7A 4KERA 3ATYA 3MCMA 5CBBA 2IQ0A 1PB0A 5I24A 3HGOA 1BVNP 1UJQA 3STCA 2P0OA 7TIMA 1J8VA 1V7AA 4QS5A 1OINA 3FYPA 1N8IA 4CUCA 2OZ0A 3VYLA 4MMWA 4GMEA 3QZ6A 2WMJA 1FTXA 4Q8PA 1CNVA 4WKAA 1GNXA 1J93A 3EEGA 1WZKA 4AIOA 1EGZA 1UOZA 5G1TA 3PWAA 1PV8A 1MXSA 2X0SA 3W6YA 2P76A 1W5NA 2R14A 4LQ1A 2RGLA 2IQTA 4O16A 3SUUA 2WJEA 1S38A 1M04A 1XLDA 1JULA 5DMMA 3WN6A 2FJUB 4UNKA 3SADA 3W1TA 1RPXA 3NG3A 4K36A 3AXXA 3GYEA 4GIYA 1GKQA 5HDRA 3S2CA 3A4AA 5BMXA 3QLDA 3VOJA 5LGXA 3EOLA 5D2WA 3RYSA 4QG8A 1CB2A 4LYRA 1FXQA 1GVSA 4AD4A 3IGUA 3KOYA 1OFAA 2ESCA 3BOLA 4CD7A 1O1HA 3ARQA 2V2DA 3G77A 1HL2A 2HXTA 4MWAC 4AY8A 2YZRA 1VLWA 1JPMA 1MDRA 4IMAA 2J7GA 3WY1A 1U2YA 2DIKA 2XGBA 1F3TA 3LNMA 3TC6A 4M1BA 5EPDA 3WLOA 1Q4WA 1V3JA 4LCSA 4O1BA 6XIMA 1SJDA 3ABXA 3A4XA 2GZXA 3DH7A 4OBTA 1LWJA 3V1PA 3SRHA 3HG4A 3LPPA 1IIGA 4LAKA 1ZP4A 2VUYA 3P93A 4GZIA 3FGCB 2KZHA 1HKKA 1RLCL 4HQVA 3NL6A 3SIZA 6ENLA 4CNOA 4A4AA 1NARA 3EPMA 1V03A 2QJJA 2VEIA 4LYPA 4GXMA 2H8XA 3B03A 4QXIA 4MKNA 4Q6XA 1X6LA 2IUZA 3LPOA 4XTDA 3W7MA 3TFXA 4F40A 2G96A 3LHTA 1KRCC 4OWGA 1DPMA 3CWNA 4IJRA 5BXRA 4PH6A 1UZHA 4GXWA 5CC3A 1Y5VA 4EE9A 4TVCA 3U5UA 2EBNA 1WCGA 4X2RA 3T08A 3RGTA 5CPQA 3R79A 5BMWA 3S4TA 2XIOA 3CV6A 1LLWA 2Q8LA 3EWUA 4R7OA 4RNHA 3KTSA 3KFTA 3ERPA 3T40A 4YIWA 3UXLA 3ITVA 3LSBA 3T4WA 1P43A 4J40A 2J66A 1DJYA 4BKNA 2E28A 3ATZA 1NOFA 1W2PA 3PZGA 1BVWA 1IXQA 2O9TA 3MQTA 1GQNA 1XJBA 3H21A 4UB9A 4JFTA 3ZJ7A 4IISA 4UFIA 4L1WA 3C52A 4ICNA 1E56A 3HPXA 1EYEA 1W3TA 3KZPA 2O92A 1LL6A 3CPUA 2P3ZA 3IS4A 4Q8OA 1QPNA 3GSMA 3GDLA 5CZKA 3W07A 4F9DA 1Q6CA 3SRKA 1MW3A 2INZA 1LRTA 1QATA 2WHMA 1GJWA 3BAWA 1G01A 3TNOA 4YTUA 5A8MA 3QRHA 3TYBA 2A3LA 2WW5A 3W9ZA 3I7SA 5KETA 1Q13A 5J5DA 4GACA 4N7QA 3GDBA 3WLHA 3LLFA 4NZFA 3DECA 1XC6A 3DGRA 3P0WA 3E0IA 1RH9A 1GZGA 1ZTVA 1TPFA 4ROQA 4L1GA 4FI4A 4MIMA 2DVUA 1V6XA 1WB0A 5CBIA 3DOPA 3GTNA 4XTIA 1IEQA 4B5WA 3RM8A 1UWUA 3F2BA 5BOEA 4GIRA 4I8YA 1FCQA 1K6AA 4BF9A 4NJKA 2YPIA 3GH4A 4D1JA 3W1MA 1C8VA 2HDJA 1B9ZA 3VIOA 1QMLA 1EX1A 1RZMA 4MNLA 4AZIA 2PC8A 1ZBWA 4H9YA 4PMNA 4O4VA 2R91A 1SJAA 1LYXA 3VIKA 5K7JA 1KRAC 3BH4A 3L68A 4B3KA 2HJPA 4AZ5A 1IXOA 7A3HA 5LHFA 4FX6M 3ES8A 3N1AA 2ZX7A 2CBJA 3RUBL 4BFAA 4WGXA 4CQCA 2VL4A 1XIHA 4JEJA 3G1XA 4Q8WA 1K6WA 3ARUA 3TZFA 1X6NA 5DRIA 4WY0F 4BQ4A 5DY3A 2ZRUA 1BG9A 3PB0A 2VGIA 2F6XA 3EA1A 1KB3A 3P81A 1JEZA 2Z1WA 3LERA 3QQ1A 3VFCA 3FYOA 2X40A 3CV1A 4FNQA 4O10A 3SCSA 3HPSA 4F79A 2E6AA 4KRZA 5BRQA 1KC7A 5I3IA 1NU5A 3KUMA 2OTDA 3NO1A 1JYXA 1UR8A 3NGJA 3OB8A 2RDXA 3AHTA 3PBGA 1JUEA 4JIPA 3HPFA 3AMGA 4DUXA 1JCJA 2FZ9A 4LOCA 4JTIA 3S5OA 3GY1A 1EDTA 1Q63A 1UWSA 3SSZA 4L6OA 3QR1A 2AQVA 3HQPA 1P5BA 1U30A 4GQRA 4JS3A 1GVEA 4EPDC 1HW6A 2ZXAA 1GOKA 1BG4A 4D6GA 3EDKA 4DBWA 2YDRA 3LXCA 4AIEA 4BA0A 2OVLA 2P0IA 5GNXA 4HA1A 2P5NA 3IJ9A 3H2AA 3SCWA 2VO5A 3Q2DA 1JUKA 5HANA 4NNAA 3C3UA 1SZGA 1OGGA 4Q8QA 3R8RA 4ADUA 4JFSA 2QHAA 3WEZA 1DV7A 3H6OA 3MUCA 2OT1A 1JYNA 1F8MA 1TWSA 1W1IE 1Z7AA 2J74A 3TYZA 3OVGA 4KFNA 3L0KA 3HO8A 3VOGA 4DBSA 2RKXA 2GVEA 4C91A 2ZXBA 2Y5EA 2OOFA 2ZX6A 1R5YA 2XIIA 2I14A 3BCDA 3MDUA 5AZ0A 4L64A 2ZVRA 4PTDA 4GKTA 5E9XA 4Y7EA 3OQEA 2VRQA 1OCQA 1WDRA 4OZOA 3MC5A 4AD0A 4F0MA 2XISA 2VRJA 3LV5A 2ZZ4A 3GXIA 3NM1A 1B57A 4NZ3A 3UR5A 5FESA 3KE0A 1ML1A 4AUBA 4ACYA 3HB9A 2WMIA 1M65A 2BVWA 2IXUA 4AFYA 4XBSA 3POHA 1VYRA 2ADAA 3K30A 2VGGA 3R6IA 5MHBA 4B5TA 2G3NA 3Q58A 1DQXA 4ZQRA 1Q2RA 1MI3A 4EP8C 3UXIA 2EPHA 4MNMA 3MV11 2QGHA 1QR7A 2NX3A 4G9PA 1TVPA 1XLLA 4JKKA 3NZ1A 5AECA 4ZB5A 3QFEA 4DJDD 1TMQA 1EJUC 1EP3A 2Y70A 2YXXA 1T96A 3GIYA 3RR4A 1UMYA 3GVGA 4AY7A 3R10A 4GI8A 4J4KA 1M3UA 2OKOA 3CMGA 3RU6A 4MFEA 4OKDA 1GOOA 3L4UA 2VX7A 2QPSA 5IBXA 2DT0A 3AICA 3AZRA 2FHFA 3TR9A 3W7CA 1Y8BA 4D9PA 3ITXA 2CBUA 1QW7A 4LAMA 1SMAA 2W9MA 2XH2A 4Q3MA 1VD6A 3M5YA 5EFFA 3T4CA 1DJXA 4QISA 4Q8NA 4XAFA 4L61A 3WDRA 2Y6ZA 4ORMA 2ABAA 4JTEA 4U33A 4Z2IA 2J79A 1Y0EA 7REQA 1XINA 2QGYA 3TYCA 4CKQA 3PFRA 2WMFA 2D22A 4HB7A 2BV9A 1FWEC 3TWBA 1JQXA 3HOJA 2VQTA 1TJ1A 2QDHA 3FVMA 3MP4A 4M56A 3GHUA 4QP0A 1UWQA 3FJNA 1H62A 4P8UA 3CUHA 4DYJA 4HMDA 3PBYA 1MZHA 3OIXA 1Q6FA 5ECUA 1OWQA 1J6PA 3W1UA 3I6RA 1CXKA 3AXIA 3PNZA 3TYEA 4RK8A 1FWRA 1SJBA 1QNOA 2WCAA 1WDWA 1IGWA 5AYXA 3RJXA 1A5MC 5FACA 4E38A 3BLLA 2VCBA 2X16A 3OZYA 3IGHX 1O68A 3GNRA 2XM2A 5J04A 2CZ5A 4H9ZA 3BUVA 3KWSA 2RH9A 1I2PA 1I2OA 2VOTA 3MKKA 3GZAA 2P3EA 3MWCA 3ECQA 3PJTA 4RDZA 1CW2A 2CLPA 4IQLA 4L9YA 3XISA 3OJGA 3MSYA 4RZ4A 2OJPA 2VJXA 2GWGA 1YTEA 1UUQA 2B81A 2IKJA 1OCNA 1PHQA 2ZA3A 4MY1A 5AYBA 3IVSA 1THFD 3CB3A 4B9YA 3QR0A 3CMFA 4PBGA 4UOJA 1B3WA 4AWUA 4Q4RA 3WLLA 3GR4A 4BWLC 4K1GA 5CAHA 1UR4A 3LEPA 2PB1A 1XLFA 4ZVJA 5D2VA 2QDGA 1AZ1A 1IIHA 4WDWA 3R8GA 4XZIA 2ZXQA 4IL0A 3BE7A 3DKJA 4MJZA 2YYUA 4G7EA 4LPCA 2GJLA 1A5BA 4NNBA 1J5SA 3K13A 3BLDA 1RV8A 5HK4A 1DTUA 3LI1A 3AIWA 1QFEA 3FIGA 1J0KA 1UIPA 1WE5A 2J9XA 3HPAA 3N04A 2PRLA 1W8GA 3LHZA 1UW9A 4KWOA 4W4QA 3VNJA 2ACSA 4P7OA 4UZSA 3TXVA 1W1B1 1VFTA 2QJMA 2HZGA 3GNXA 3ARTA 4H01A 3QY6A 5C71A 4MWAB 3N12A 3NQCA 1UD5A 4RNIA 3UFYA 2HK1A 5DT5A 1DHPA 2OR2A 4NF7A 4GO9A 3HFYA 1KM2A 1HKVA 2INEA 2IQDA 2JGQA 2V5CA 2FTPA 1OABA 5A8NA 2BODX 2Y7GA 3RX3A 4AYGA 3VUPA 4DWSD 1XLKA 4JNMA 1ONEA 4XSLA 4AC1X 1ADDA 2PTXA 2EPNA 2H9AB 3DFTA 1TZZA 3LBOA 2MANA 3DU0A 4LVDA 3ONBA 1EDQA 2X05A 5HPCA 5D2YA 2DIEA 4NAFA 1UR1A 1E3ZA 2WO5A 3PBMA 1MUMA 4FXFA 2Z1XA 2V81A 2D23A 3SCOA 2YFOA 1UKQA 4I6KA 3W7HA 3IEBA 1KFJA 3TMLA 3DX5A 4KCTA 4DYEA 1D9EA 1P6WA 3RM4A 1EZ2A 1H0IA 2ICSA 2DZTA 3AMCA 3NO3A 1TFVA 3ARYA 3E96A 3G3MA 3MSRA 4RDVA 2WNZA 3VD4A 3NR0A 4K7VA 4HHLA 1M9HA 3FV9A 4IIDA 4LS1A 2VP8A 3UPMA 1ODZA 1VJIA 3MI6A 4GNJA 1VHNA 4OE7A 4K8EA 1EJ7L 4POCA 3L65A 2XIQA 2Y7DA 3LPFA 4TMCA 3DFOA 4AZ7A 1XUZA 2VWTA 5AVNA 5IFTA 3QGAC 1IE7C 2XN0A 1E4LA 4QJ3B 1OC5A 1J01A 4X0VA 2ALDA 3PULA 3TA6A 3QPEA 3TX9A 3ZLHA 2OYMA 2E4TA 5A6JA 4RNFA 1KM3A 2JKEA 3PZVA 1PSCA 4GPNA 1TO3A 1I8JA 2ZUWA 3L5MA 3LX9A 3TWAA 4GYPC 4XZHA 3AIRA 1R9XA 4QFUA 4BQ3A 1VEOA 1M6JA 2PDFA 5K2ZA 3Q37A 5GJPA 4K1WA 2X42A 8CGTA 4Q32A 1TX2A 4D6DA 3WQPA 4JX4A 2X2GA 4LFYA 1NFBA 3KX6A 2R6OA 2PEVA 2YLAA 1BHGA 1HNYA 3OZOA 3O06A 3G0UA 1PAMA 5DXYA 2QNEA 3CYJA 4ZO7A 1VP5A 1G4SA 1P1MA 1KRBC 2PU1A 5I3JA 3FLUA 4HYWA 4S2BA 4GGBA 4JHMA 3VUSA 1TYGA 3MW7A 3CH0A 1TPB1 2ODOA 3QPZA 3W22A 3CL8A 3EX4A 1VENA 2PDPA 3AWOA 4GKLA 2PDYA 2I17A 2FYMA 1OC6A 1GQLA 1W1ZA 4GOAA 1U33A 4IH3A 3QMTA 3USZA 1I6NA 3B8TA 2QCGA 4Q8MA 2YCLB 1FDZA 4RZBA 4C6IA 2DV0A 4R7WA 3K46A 4Q4QA 5CGTA 4ZO9A 4O0KA 2ZE3A 3CTLA 2PGRA 4H6RA 2OO6A 1R46A 3GIPA 1J18A 1XG4A 4DI8A 2BSLA 2C14A 3GHTA 1VPXA 1PL9A 3CZLA 1E1CB 4AWTA 2ZCGA 3F2CA 4K38A 2GSEA 2WNNA 5FD0A 3WYZA 4IMFA 3IPWA 3LTSA 3NIYA 4W93A 1GCYA 5CQ1A 5TNVA 2YW3A 4J3TA 4C6MA 1KCLA 1CLVA 4I9MA 4HGXA 5E0FA 5JXQA 1JAEA 2JBMA 4KKXA 2C15A 3UNTA 3W6MA 5DCBA 3M0KA 2BGQA 5JQ9A 4V1XA 4UQCA 4PFHA 1ZZMA 1IQ8A 3LD5A 1FCVA 2EKGA 3WQFA 1UP2A 2BLEA 2BOGX 1CECA 3TTSA 2RUSA 4E2DA 2VM8A 3KZSA 2ZTJA 4FOKA 1TX0A 4UC5A 3W1AA 2PDLA 2QYGA 4JL1A 3R0UA 2QCNA 4GUHA 4TV6A 2W5FA 3NOEA 2YDQA 1EJWC 1QUMA 2FGLA 3M0LA 1L6FA 4KEUA 2PTYA 3PJUA 2J9ZA 2XM1A 3CUZA 5L6UA 4FK9A 3SURA 3EMZA 5CZ0A 4GUIA 5E6ZA 3P62A 3CUFA 3IK2A 3NDZA 4LX4A 1SYTA 3B0YA 1LOSA 3BZJA 1OX5A 1HZYA 3OBEA 2GGHA 3QR3A 3MZNA 3IUHA 5EMMA 3H23A 1OK4A 4IX0A 4MAZA 1J0ZA 4B5SA 4BJHA 1JF5A 3CGTA 4TUFA 5F4XA 4CNTA 3EXRA 3HURA 1TUXA 1QPKA 2ZADA 2A2IA 3AOFA 3HBLA 1V5XA 1OB0A 4N02A 2HBVA 3W28A 2NXHA 3QHNA 4GYJA 5EBAA 3TE9A 1PEZA 3UVAA 1V77A 2EJAA 3N3TA 1YHTA 4H3DA 3V1HA 3PF3A 4F9JA 1FWNA 4M19A 3ZWSA 2UY2A 2WV8A 3FYYA 5CG7A 1WDQA 3EWCA 3FDGA 5DANA 2EEXA 4NP7A 3KVJA 3R7MA 1A5SA 1V6WA 2EHHA 2PS2A 5I3KA 3T8QA 3ZYZA 1OF8A 2DW6A 4FZIA 4UTTA 2VC9A 1W6TA 2CLOA 1E15A 3P82A 4A22A 3KDNA 1HQTA 4MG4A 2WZHA 3ZOAA 3O8AA 1B3ZA 3RPTA 3R0KA 4WR3A 3EMQA 7REQB 4YXGA 1W1VA 1K9FA 4ERAA 1DP0A 3AC0A 2V67A 4HJFA 1XRFA 4QNEA 2XVKA 1H7PA 2ZOXA 1UQZA 5KINA 3POCA 1KXHA 2TYSA 5A2CA 4AWEA 4AISA 3W7IA 4UNLA 5IXEA 3H2NA 1VLIA 3W7PA 3F4VA 1JXJA 3N2CA 5A6TC 1TV2A 3BAYA 2QAFA 1R38A 1U22A 1YRRA 4C6EA 3LBMA 3SI9A 3C8NA 4LB3A 4F2TA 3RILA 4DYKA 4NIRA 1A5AA 4CU7A 3RFAA 3RRXA 5CKSA 4FSAA 5A6LA 3VOFA 4P7LA 4QJ1A 1OFBA 3QV7A 4HHMA 1LUCB 4HZ6A 3UWUA 3ELFA 4IMGA 3WD1A 2Y89A 1HKIA 2WPBA 4ZCWA 2J7DA 4P8WA 3CHCA 1L8PA 1PIFA 1LDCA 1XXXA 3UQNA 3UU0A 4D8ZA 4H7CA 2NQLA 4QCEA 4HYVA 1MEWA 3BSMA 5FL1A 3TAOA 4TV5A 1HVQA 3DG3A 2ZUSA 5MF5A 3ZT6A 2YR1A 2GVJA 5AHFA 3MMWA 1SUXA 5HATA 4WKHA 4KS0A 2Z24A 2VFHA 1RALA 1MQRA 5DT7A 1Q7MA 3HA1A 3S47A 2QJGA 1NP2A 5CBJA 3A12A 4D6EA 5C7HA 3QVQA 3DENA 2H6RA 3F4DA 3TN5A 3GG0A 1UUOA 3TN4A 4Z2KA 3GAYA 3U7VA 3VGDA 2WC4A 1H7RA 3GU1A 1DHKA 3APGA 4MDOA 2DPEA 4H8UA 4DJFD 1I45A 1B54A 1EPXA 5C2XA 2C13A 3WNMA 1OEPA 3WJSA 2JKAA 3N3MA 2R1KA 3SN0A 4DPQA 4JX6A 3GH7A 4UR7A 3SECA 1HXJA 2P88A 2ZA1A 4IFKB 1EF2A 1ITUA 4WD0A 1XPGA 1TE6A 1TQXA 3D47A 1ZAHA 1NWUA 3KWXA 2DSUA 1CXHA 3P2VA 4L80A 1WA3A 1XRTA 3LCIA 3MJMA 2FTWA 2Y61A 4B16A 3BCFA 2BNJA 2YXOA 1GPFA 1JYWA 2G3FA 1FWHC 1TTPA 5HNUA 2CXEA 3K5XA 2QUMA 3W7RA 1FUYA 4HCLA 2XUCA 1KM1A 4DM2A 3WDQA 5M2FX 1DYSA 4FNUA 3H24A 4L56A 2PGWA 4NYYA 1LROA 1YDNA 2QCDB 5FEWA 2YCJA 3BGGA 2OCZA 4NI8A 3H2FA 3A21A 4AHQA 3GTIA 1V6TA 2XVPA 5DF0A 3JU2A 2I1OA 1KV8A 3AS2A 1E5JA 3YPIA 5JBEA 1GW9A 3P5ZA 4AU0A 3ITYA 2BFGA 4MY9A 1SFTA 3KL5A 2QEZA 3RLUA 4NVTA 3UCDA 1WKEA 4O28A 4NRRA 3TYDA 1TPVA 1X96A 2V38A 2D0FA 3C2VA 4TX9A 4F66A 3I7QA 5LNWA 4BCEA 1KXTA 4R33A 3VIIA 1H4PA 5ABTA 3MT1A 1BFNA 4IWWA 3UJFA 3F5KA 2FDSA 3E49A 1I4NA 3HGJA 3AMDA 2GVYA 2G37A 1LLOA 5H8MA 3G1RA 3NDYA 4D6JA 4PSRA 2XN1A 3N18A 3SW6A 1XBYA 3GNPA 3SM0A 2JIWA 3L0GA 3CK5A 3S1VA 4ZO6A 2D0GA 3TSBA 4M51A 2F84A 3Q94A 4GLEA 5HNNA 3WQDA 3RLVA 1QOQA 2Z25A 1W5PA 1QXLA 4MB1A 3VNLA 1U5HA 1VR6A 3RDKA 4PUNA 1E6NA 1QTWA 4H9MA 2WHJA 1T8XA 2A6LA 3OGVA 5K9DA 4CVWA 1HJUA 2V9DA 1RA0A 3UG4A 4CQ9A 4CD8A 4B15A 1V6VA 3CAWA 5D4YA 2CHOA 3FA4A 4IIEA 5KITA 3O16A 3MTWA 4XO6A 1S5VA 2PWGA 3ZR5A 2PU0A 4Y8FA 3MU7A 3EB2A 3OHMB 4D1IA 2HS6A 1UMLA 1B9BA 2O55A 4HHHA 4UCFA 1N8WA 1E6XM 4LV4A 2RDWA 1Q6DA 1R7AA 4QR6A 3LZ3A 4REQB 2VOMA 1WDDA 5HUPA 4GISA 1JQVA 3AUOA 2NUYA 4MWAE 3TN3A 4DJDA 2POTA 2CBVA 4LAUA 1MUWA 2ZRVA 4R3UA 2JEPA 4QEEA 1H1ZA 4Y9MA 3NOYA 2O4MA 3LQGA 3CM4A 5C6MA 5J8LA 3UG3A 1XD0A 1C93A 1FA2A 3QMSA 3OG2A 5AC4A 1S3HA 3P3BA 1XIEA 2YW4A 4UR8A 1W0MA 3CTTA 4OECA 2P1FA 1XCWA 2XIJA 1DXIA 3VD9A 1NDVA 3AS3A 3WBAA 1NM9A 1JCTA 1XRSA 1YKWA 4S3FA 4S39A 1K9DA 2J6XA 4DY1A 1G94A 4PL1A 3VIFA 1MQQA 4CQAA 4BWLA 3WQVA 3UR8A 3W23A 2OSXA 3TJXA 2WHLA 3PZUA 2CZDA 1US2A 3R0DA 3NAVA 5I3HA 5AZ1A 1E6PA 1RCXB 4IUGA 3G24A 1QI0A 2DUAA 2LLEA 4R9XA 2E8YA 3U4AA 2VR4A 5REQB 3KP0A 2BG5A 1SSGA 2Y88A 2BHZA 1PTAA 4EWJA 3B4UA 5DLCA 1ISXA 1RLDA 1VJSA 3E2RA 2X8RA 4I3GA 1HX0A 1WOAA 2VD9A 1C9DA 4IQJA 3VIMA 5AC6A 5E70A 4ZB2A 4AZCA 4HOWA 4CCCA 1LM1A 3CIXA 3UYCA 4MB5A 3SUSA 1XLBA 3GKFA 3PUGA 4DWSB 3M43A 4JFWA 1KBIA 3BAKA 1U5JA 1HP5A 4S3EA 1X38A 4JN7A 1MEIA 4NI3A 3PG8A 5I5RA 4TU1A 1QNVA 3M5VA 5A1AA 1MFVA 1QT1A 3DG7A 3K4DA 3AI0A 2W66A 1JZ5A 2QPXA 3DKLA 4JIIX 1B4EA 2QKFA 2VCCA 3FSTA 1TJ0A 3UNDA 4ZSUA 2QJNA 2E9LA 3VDCA 5D9MA 1EEPA 2J77A 2ASHA 2QF8A 1UWAA 2ZX5A 3W72A 2JQXA 3F4NA 3QV8A 4PMYA 5H91A 3VCNA 1LF1A 2AL1A 3KW3A 3VIGA 1XIMA 2CHNA 4H4IA 1LT7A 1WUEA 1R85A 4OBRA 2OZ8A 4GCAA 4C6QA 3WG6A 3V5OA 5I77A 4ZSTA 3QV9A 3RM9A 2WK2A 2QIWA 1TWWA 4ZTXA 1FKXA 4MZ1A 4HSOA 3E74A 1E0VA 4GJ1A 3UR7A 4REQA 4CCZA 3HPZA 3NFUA 4U5IA 4WSHA 3A9IA 1V3HA 4FLQA 1EP2A 2E5CA 4N42A 4IJCA 1US3A 4DUOA 3BXWA 4KWWA 3CLMA 1VPYA 2DJLA 1NEYA 1IGSA 3JZUA 4PR4A 4TX6A 2WOQA 3CUXA 1E1EA 3KBVA 3M0YA 4MB4A 3TYAA 4DWSA 2HS8A 8XIAA 3WD0A 4RW3A 2PF0A 4H6QA 3G8EA 1W9BM 4WDXA 3RLGA 4P61A 3BW2A 7ENLA 2VNCA 3DI0A 3KLLA 1Z41A 1H3GA 2WJFA 2C8NA 3DN5A 3BG3A 9XIMA 2MUCA 5GQBA 4BY3A 3OIHA 3G1AA 2Y8VA 2XZ9A 4NZ5A 5A2BA 1W5OA 4UQDA 2ZTKA 1H7WA 2QJIA 4J35A 4E0CA 1OFRA 2WZIA 4Q7BA 5IFPA 2PWFA 3KBSA 1QHOA 1VRDA 1MYRA 3VA8A 4BI5A 4Q6JA 3WF4A 5LA0A 2GVLA 2XFRA 2WCGA 5A69A 4KRUA 3S9ZA 3M7WA 3VGBA 4ZTYA 4JZ5A 1R2TA 1XDLA 3TR2A 3QC3A 1VBGA 4YVVA 2JFEX 4IMDA 1UZDA 3CUIA 1GVOA 4LC6A 1OFOA 3FA3A 5KSWA 1B0IA 3Q67A 5HJLA 2UWFA 5ABHA 3WMCA 4O14A 3VM5A 5C70A 1AQ0A 2PGEA 5A6AA 3QZAA 1TCMA 3R2GA 4FALA 1J5TA 4WXYA 1CDGA 4GG9A 4C6LA 3E3HA 1JZ4A 3VX0A 5HJYA 3AHVA 2V3GA 2C1IA 2DT2A 4JY8A 4XK2A 4US5A 4Y96A 5I2UA 2VFDA 4RL3A 4ONVA 5D8ZA 3CJPA 3W7GA 5FJTA 3NA8A 1OX4B 4A3YA 4RPPA 3UW6A 2Z1BA 2WYSA 1EGVA 1AH3A 2J6VA 3RNDA 3N25A 1AUSL 1WUFA 1RSCA 1S2CA 3WJXA 4WX2A 4RKAA 3DI1A 5AHMA 3WLJA 4TXEA 3CUGA 4JTHA 1QI2A 4C6FA 1S1PA 1DBTA 1G1YA 3SRFA 3UGVA 2OWXA 5KZMA 1O7AA 1OIMA 3V16A 3CQKA 1IZKA 1JI2A 2GQ9A 3NZPA 1D3GA 3E2SA 4C5YA 1LTDA 2P8CA 4JTDA 3LGGA 1CT5A 4Z1DA 3S46A 2DT1A 2D2HA 3AIEA 1FWSA 1X7IA 1YXYA 2C19A 1TA3B 3R94A 1KFBA 3U0HA 1VJZA 2WB5A 4PTXA 3ZVHB 4O17A 4NZCA 2I56A 1YBQB 3ME3A 2XSBA 4LNCA 3VZXA 4KF1A 2DW7A 1LOLA 5AC7A 2V5DA 1DWJM 1XR2A 3ITTA 3AIUA 2F7FA 2PURA 5C5YA 3URBA 4W88A 4L9XA 4O0QA 4XSMA 4YHEA 2J7HA 3GXTA 1JRCA 2GSJA 2GJXB 4W86A 2X41A 3CL7A 5I6SA 4E8DA 4G7FA 3ZXWA 3D5HA 3A13A 3UVIA 4C7FA 1KGXA 4QIUA 5I23A 2QJHA 1JDCA 5HOSA 5F1UA 1KFKA 1S2AA 3IACA 1YTDA 3BLEA 4YJ5A 4W5ZA 1ZFJA 4N4QA 2FMOA 3CZKA 3B04A 2V63A 4MB3A 4W85A 1HFBA 4Y8EA 4ZOCA 2XGIA 3VKBA 3VDAA 4W8BA 5ABFB 2XFWA 3DXIA 1LG1A 3LMZA 1CGTA 2YA2A 4FXRA 3W7EA 4QM1A 2PPGA 1KD0A 2RDTA 4AEEA 1A5NC 1YMYA 1IXPA 2W0UA 2E9MA 5M03A 2C71A 2J8GA 5AHNA 5CLWA 1BD0A 3H7RA 3THDA 1Z44A 3ENLA 3NSMA 1PO9A 1HG3A 3BOXA 4GVHA 4LY8A 3QV6A 3WK1A 3ZLGA 1R3QA 4C1NB 3OZMA 3RG6A 4LUJA 1S2VA 3VGFA 4FR1A 1S2UA 1P0DA 4CNNA 2TRSA 2BVTA 4XKYA 5HMFA 2HVMA 4AD3A 5C9ZA 3EOUA 3RIKA 3B06A 4HK7A 1K9EA 4C1LA 2Z2UA 1ITXA 4HYRA 4UFMA 3WLIA 3JUGA 2DSKA 3A6OA 1XFCA 3TUUA 3UY8A 3ZSSA 1UD3A 1RA5A 1R6WA 4JTAA 3S2LA 3DYOA 3L2MA 1IF2A 4JBRA 1XWYA 2E3ZA 3O3RA 3LUTA 1E6QM 2DEPA 3LS9A 3G0SA 2A0NA 1G4EA 2XG9A 1Y5WA 1QW8A 2W79A 3CEUA 4LYKA 2GQAA 1W3JA 2EG6A 2G50A 8A3HA 2NW0A 3W1PA 2Y7FA 1F8IA 4FO4A 5G4EA 4HCHA 1TJPA 1KNWA 2EGZA 2C16A 4O11A 2BY3A 4LVBA 4HNNA 2VR5A 3GXNA 3LM7A 3K8MA 3IIOA 3C2EA 1EZWA 3MUY1 5CJ5A 3KP1A 2DZBA 2E6DA 5BWFA 3ITGA 4GUJA 1G9HA 4WDTA 3RX2A 4B2DD 2ZWZA 2VZTA 3P80A 1GJPA 3QYQA 5G2WA 3G18A 3V5FA 4JIHA 4ZBCA 2PAJA 4DZHA 4IIGA 1X98A 4W8LA 2ZZ2A 1B4KA 3TQVA 3FHAA 3QTPA 1UH3A 2DVXA 1FWJC 3DFYA 3L12A 5FJIA 1J2BA 1SMDA 2GUBA 4HKPA 4W7WA 3T0CA 1P7TA 5CSYA 5E5CA 1C3FA 3PZ9A 3CQ0A 1F07A 1S2TA 4KWVA 2W63A 2X1RA 2EPOA 2VTFA 5AB3A 3GDMA 2VMFA 1IHIA 3M44A 2B7PA 2UV8G 4B4FA 2NLYA 2CXGA 4W89A 4IIFA 4BEUA 1BRLB 4A3UA 1YTKA 3R89A 3TJ4A 1TELA 5HQLA 1G7UA 3FY1A 5SWUA 5DQPA 4X0NA 2QUNA 3WUBA 3VILA 1D3HA 4XIAA 2HPMA 1ME8A 4EAMA 1NDZA 1F3WA 4KWSA 3GFXA 3IUDA 1WKYA 3D3AA 1JDEA 3NXLA 4IGMA 3R11A 3KL3A 3OLEA 1HJWA 4DEFA 1VIZA 3TMQA 2VC6A 1ZAIA 4UTWA 3P14A 3MP5A 4Z17A 1N55A 3QQ0A 1XLGA 2GSHA 1JZ7A 4A29A 1KGWA 2WSQA 4GVGA 4J2PA 2FFCA 4Y9NA 1EC8A 3A4WA 2A21A 4E2VA 1DL3A 1ME7A 5EMUA 4Z0SA 4UIOA 4XV0A 3A64A 3IJ7A 1JYVA 1VCVA 5K3VA 2Q71A 1TA3A 3H22A 4OUIA 1UBPC 3ALGA 3I68A 4HOXA 3ZR4A 1RY0A 3CZGA 4QLKA 3KRZA 1UIOA 4BF5A 2ATMA 5HPOA 7XIMA 3TV8A 3GG8A 4EOUA 3MPGA 3TTYA 3A3WA 1X6UA 5HWNA 3ID7A 5JMUA 3A22A 4Q4MA 3L2LA 1XH2A 2WWCA 3SSJA 1E72M 2OEKA 4R27A 4WF7A 2QCFA 1X1ZA 3AYSA 1RQEA 3W71A 4ATLA 4FNPA 2F61A 3FEQA 1OZQA 1H5YA 4GIEA 3W83A 3BANA 2PWUA 4JICA 1K3UA 1KBLA 1CGWA 5BNKA 1YE6A 1UC4A 4S1FA 9RUBA 4H9VA 4LV9A 2XTKA 1UJPA 2ISDA 3GFZA 5MKGB 3GRIA 5D9NA 1R3YA 4AAJA 3GXPA 2YFNA 2HVOA 3O05A 4PBFA 2E09A 1G6CA 3EOSA 2NLIA 4LAZA 3EB3A 1OJXA 3BW4A 2WVVA 4DIAA 4JNYA 1ZQ5A 2CERA 3O6DA 4CNPA 1CYGA 3II1A 1L6GA 3A5VA 3ORWA 2YL8A 3CH9A 2JE8A 2VKZG 1XIBA 1ME9A 1VB9A 3TN6A 1PX3A 3NQGA 2PDNA 3W75A 2X09A 1H0GA 1YLVA 1VKFA 1DXEA 2BZNA 2DU2A 4Q8VA 4I7WA 5CAKA 3S9IA 2OYKA 4XZBA 1RJRA 1VF8A 1CZ1A 2Y5SA 3TJLA 3AISA 3C5QA 5C55A 5KZEA 5HULA 4J3WA 4LBUA 3UWVA 3BG9A 3MVIA 3HN3A 4FA3A 2Z7GA 4GBDA 4E8CA 2WC3A 3WLTA 3W84A 4A8NA 3K1DA 4XAGA 1EJTC 4M6VA 4M80A 1A53A 3QW3A 1T7LA 3JVAA 2Q3RA 2XHYA 3O7UA 5CC6A 1Q66A 1EC7A 5DY2A 1EPVA 5DN1A 2GGIA 1YNYA 1EX5A 2H3DA 1OM0A 4ZXLA 4MZ8A 5AOUA 1OK6A 1NSJA 3P8JA 1W3LA 2R24A 3NQBA 3K4WA 2VELA 3FGCA 1OFQA 3VKKA 2Q8ZA 3TNBA 2UY3A 1AJ0A 3AQUA 3D6NA 2J7FA 3WNPA 1LBLA 1GUVA 3CAKA 1IYXA 4J9JA 3L0NA 4QSHA 3OODA 3K4AA 2QCHA 4IG2A 5E1QA 3VIHA 3MMTA 1GZ1A 3MBDA 2R1LA 3U3HA 3TTOA 1EHAA 2BVDA 5G1YA 3LCLA 1E9ZB 1EOMA 3MO7A 1ZALA 3WL0A 3CIVA 4QEHA 1XD1A 3C56A 3L2IA 4GBUA 3QY8A 2PGFA 1OT1A 3CASA 4A2RA 1V0LA 2OSWA 5GVJA 3LV6A 3F03K 3FHQA 3S6OA 3W82A 4PSPA 1MNSA 4A3QA 4GC4A 4J3XA 1I60A 2VXNA 3WNLA 4IX2A 4LUIA 1V6YA 3EA3A 3WK3A 1TVNA 3NM3A 1UZ4A 4R34A 1EDGA 5CPTA 2ZX9A 1ZSXA 1AD1A 1G7VA 4ACZB 2QCMA 4XZMX 4QG6A 4RPQA 1PE1A 4QX4A 3W7OA 4M81A 4CN1A 1LWIA 2CIPA 4M7SA 4EPBC 4DX3A 2WKGA 3KCLA 5TQLA 3N17A 2R1PA 4UMBA 4NXSA 4QNWA 4CD6A 1I2NA 4GI4A 4LANA 3GO2A 4LRSA 3SDOA 2QAPA 2NSXA 4DAIA 3NQVA 4L7ZA 1GTEA 3KBJA 1GG0A 4QLJA 5KTLA 2VUNA 2Z26A 5BRBA 4X3ZA 2Y24A 3WFLA 4GNKB 3W2LA 1K8CA 3S5ZA 1KTCA 3FFSA 5REQA 4XG1A 5BU9A 5CEWA 4LGXA 1GQKA 4YCPA 3VD3A 1FOBA 3CHEA 3RO8A 5BROA 3O0FA 1UB3A 1LQ2A 3AZSA 4UMAA 2ACUA 1W9UA 3TTEA 3H12A 5JIPA 1IWPA 3UZXA 1YPFA 1EJXC 4R88A 3WNNA 5CC7A 4LC8A 3AYRA 3EYPA 1N8FA 4ICMA 4MZYA 4IPNB 1POJA 2E9BA 3GTHA 2G3IA 3W2JA 1K8XA 1F3XA 4MGGA 5AHEA 1H61A 5I09A 1P6BA 1WO2A 2DP3A 4KQNA 1GVYA 1GW1A 2BWGA 3SQSA 4KBXA 3QF0A 1S2WA 1YE4A 2QLYA 3EGJA 4NYUA 3U4FA 2SFPA 4XIMA 3MWAA 1OIFA 2PWDA 3ABZA 2J47A 1TV8A 2ZE0A 4AQLA 1W37A 3GAKA 3ITCA 2ZZ3A 4ECLA 3S2JA 3NSXA 4LY4A 2GGGA 2XSXA 1E71M 2HXUA 3BLFA 3WLMA 2OEMA 5HWJA 1Z48A 3B8DA 1WKFA 3GFYA 4QITA 4CVUA 3PB2A 1FDJA 1C7SA 4LVGA 3B40A 3ZFHA 1MRQA 2R8WA 1EJRC 3RMJA 1ODUA 4GINA 4S23A 2QF7A 4EAYA 4KGJA 1OC7A 4NJIA 4F0KA 5M17A 4ZE4A 3DYPA 1QWGA 4DJDC 4C90A 4C1KA 3W4RA 1O4UA 2YCLA 2XZ7A 4M3PA 1XLAA 3FAWA 4AVOA 1HGYA 4Q22A 4LVAA 3QH2A 1J79A 4C6JA 1AQFA 4PTNA 3W1NA 1A0EA 1N82A 3VAVA 1R3WA 4F2UA 3DFSA 3MB9A 4MKSA 3KVKA 4ERIA 4WXZA 3N2BA 3B0VC 1GJUA 2CFFA 3OP2A 4MJ4A 3UZ5A 2GGEA 1OYCA 3O1NA 3PAJA 1XLHA 4O18A 2QVHA 3B97A 4O52A 1ZU8A 3WQEA 3CXOA 4PB3A 3VINA 5M3WA 1Q6QA 4UFLA 3ARWA 4OT7A 2ISWA 3ARRA 5C8BB 3WBYA 1K7FA 3AIBA 2I5IA 3T0TA 3BW3A 4KETA 3PNUA 1T6MA 4GY7A 5DBTA 3LYEA 3GC2A 4XQ6A 4ATWA 3C2YA 1KBKA 1JVNA 2YCKX 4O15A 1P7TB 4CGTA 3UESA 1YPXA 3TVAA 1RP8A 2ZX8A 1KCZA 2IW0A 4DXVA 2NT1A 2O9PA 2WM1A 3AWNA 6PTDA 4IL2A 2WVUA 1HO4A 1PDZA 3A23A 1EOKA 4Z1BA 4GWEA 3VZYA 1FWAC 2X1SA 4S3DA 1NP0A 4U2ZA 1FHUA 3W00A 1Q2SA 3RCNA 1EEXA 5DXXA 5DELA 3VOHA 4C1NA 2F2KA 2R1NA 3VNKA 1MVYA 2J7EA 4PYSA 2R82A 3VCRA 5DO8A 5IHRA 4DJFA 1TTJA 4B5VA 4HPHA 1FH8A 5GPRA 2A7RA 3VDHA 2WZMA 1O66A 3HGSA 4L6HA 4XO7A 1Y5XA 2ZZ5A 3TAKA 5LNUA 1J10A 1R9ZA 3W26A 4MHBA 4WLCA 2WANA 3W81A 3VNYA 2J8TA 4KCVA 4DO7A 1E0XA 5H2ZA 2PA6A 5BOOA 4IIHA 3E0FA 1O12A 3CT2A 2HEJA 3I10A 3CV7A 2XSAA 3B0UX 3TSMA 1Q6RA 3PFMA 3BQ5A 5LXXA 4UUIA 2OG9A 4NZ1A 4C6PA 2V2CA 1V0MA 1Z3NA 1XIDA 4AX6A 1VPQA 1F2JA 4YTRA 4CQDA 3M64A 2GVGA 5HJXA 2OXNA 1BYCA 1NELA 4GA8A 1ZENA 1EUAA 3AU2A 4IGNA 4YYCA 1EHNA 2G8ZA 3DHDA 4EACA 5LIYX 4EIVA 1ISWA 4KEMA 4PULA 1KQZA 4FNRA 7ODCA 3CBWA 5EYWA 4K7YA 4I7VA 3NQAA 4UFJA 4H9TA 4OU1A 1E40A 2GDVA 3DEQA 2ONEA 3EX6A 4DUVA 1EB3A 1VAHA 3FCPA 5HNRA 2PDJA 3BLPX 1GOIA 3G6MA 4XBJA 4JEQA 1GGOA 1O5KA 2VX6A 5A5WA 2WM0A 2VDIA 4NJHA 1V02E 4LYQA 1C7TA 1PZ0A 1PVNA 3MMUA 1LZOA 1AW1A 3PC0A 1J4EA 1RR2A 5HNTA 3ARXA 2W6RA 1BXBA 3TC7A 3E12A 3SZ8A 1PKNA 1IR2A 2VFEA 1S46A 2VENA 1DJHA 1M7PA 3ICJA 3M6DA 5AHIA 4JD4A 3UD6A 1GT8A 1O95A 3E9AA 4O4WA 1SO3A 2ABBA 1NH6A 3LHVA 2ZRWA 5CJNA 2O9OA 2WZTA 2VFIA 1B3YA 5A94A 2OO0A 1ICPA 3UWWA 3UA4A 2ZC1A 2DSWA 1ONXA 2FJKA 4JQ4A 1EFZA 1D7KA 5EGRA 3FKKA 1A4LA 1HVXA 4NZJA 5FIPA 5DEZA 4HZ8A 1OQFA 2CNCA 3STPA 1QNRA 1QPOA 2HV5A 5C0QA 5AC5A 5LSMA 1J96A 2CLEA 1FWBC 1OCBA 4QHRA 3THCA 1BGAA 3AXMA 2FZDA 4GZEA 1D3CA 4E8GA 4JTFA 4PUKA 4Y2WA 5A6BA 2FVLA 2BTMA 2RDUA 1BTCA 1TPDA 2NXIA 4MKVA 1Q6EA 3B8VA 1HP4A 5FJOA 1K4HA 1F5ZA 2YA1A 3MZ2A 1P4CA 5CJMA 4OIFA 2V3DA 2QV4A 4U4MA 4JPGA 1XGDA 4ZFMA 3VNDA 1F6YA 3KAOA 3WDHA 3ARSA 2A6NA 3SEPA 4HU3A 3AXKA 3MI3A 3T2QA 2E6FA 3V0SA 4TR9A 3SR7A 1EXBA 3I65A 3SCNA 3VZZA 1AA1B 1NF7A 3M0VA 3SCUA 3UETA 1VQTA 4X9SA 4DLFA 4DZIA 1UD6A 3IVTA 4ZQOA 5FJJA 3GDKA 3L67A 2PDUA 3B9DA 4GH3A 1H41A 3DDMA 5TBOA 5XIMA 1YYAA 2G5WA 4H7ZA 2PDIA 3MCNA 1NDYA 2YB4A 3OBKA 3PJXA 2EQDA 2Z6IA 2DVTA 3WDPP 4IQEA 1XISA 1ECQA 4LCRA 4J7RA 4AD5A 1FCUA 1QNQA 1XDJA 3HMJG 5BWAA 3GTXA 2BX7A 4FF7A 3P67A 1BQGA 3ZMRA 1XSJA 4H2HA 4PODA 5AKQA 5LNRA 3LENA 1YPIA 1GZJA 3WD2A 3VGEA 1KQYA 1UHVA 2D69A 2QMJA 4RZ5A 4GFSA 3HQOA 4IIBA 4DAFA 1L6WA 1DOSA 1BWVA 4TIMA 3SO7A 5HAOA 4GZ7A 3LY0A 4BS0A 2X30A 1KM5A 4DBEA 1EGMA 4ZFCA 1KA9F 3V75A 3EDFA 3LN3A 5HQMA 1Q6OA 2W61A 4C5ZA 2BY1A 3H4WA 4HNUA 3G6LA 5FL0A 3IUIA 3EWWA 1LG2A 4GE8A 4ML9A 4AXKA 3HV8A 2VEGA 1M5WA 3AIVA 1JZ2A 3BV4A 4PUWA 4C6KA 5IM51 2NUXA 1ADSA 4E4PA 3OO2A 1BGGA 5XIAA 3C0JA 3KM8A 8TIMA 3O9NA 3AZTA 2L5HA 2ZWYA 2NSOA 1QI3A 4HBKA 2OLHA 2VYOA 3RX4A 1KFWA 4Z1AA 3IARA 4K37A 3HU7A 2GJRA 3IJ8A 7PTDA 3SY1A 4GYKA 1FHDA 5KZ6A 3M0HA 3N6QA 4F0RA 4JHOA 1WZAA 1R3VA 1M41A 3MA8A 3TW7A 2DDXA 5E0CA 3VMOA 3N9KA 4WY0A 3EXSA 2NVDA 3PK7A 5EU9A 1W5MA 5C2CA 3BAXA 2D2GA 3HG5A 4L9ZA 4S3JA 2IKHA 3FW6A 1F74A 4S3KA 2XFYA 4XB3A 1QNSA 3T44A 2P10A 5JUVA 2VURA 4TO8A 3PPCA 4V1YA 3JS3A 2HTMA 2F8QA 2QDDA 4H6EA 1SZFA 5CC5A 3M41A 4B5NA 1XG3A 2OEJA 2WSYA 4AZBA 4HOZA 1QPRA 2FPVA 3C2FA 4GGHA 1GOQA 4Q4OA 2HE8A 1IEWA 4KPLA 3NGFA 2QDEA 1AH0A 2CWXA 1JUBA 1PTDA 4O19A 4HU8A 3OVQA 3GX9A 3U2OA 3WLNA 4F0HA 4H04A 2DFAA 1EBGA 3GR8A 5K9XA 2Z00A 1A80A 1Z69A 1XPYA 2P50A 4RX0A 4RR4A 2I9UA 4WOQA 1C8YA 3R4IA 2WJZA 3AYTA 2F6UA 3BJFA 2RAGA 3PAOA 2CZFA 4XUYA 1LL7A 2VDHA 4JL2A 3LRMA 4QQUA 3RXZA 1W9DM 3DBNA 1QO5A 2RFGA 2EPKX 1TPEA 3BGJA 1IEXA 3QPYA 4LCQA 4YVXA 5F2LA 2NQ5A 4O1DA 2OGJA 2WVVB 4ES4A 1DJNA 3SCTA 4AZ6A 4JYDA 1JJKA 2CESA 3M0MA 3KHDA 1W3HA 3EPOA 5ABFA 2NVCA 3IIZA 3MO4A 3WENA 1NVMA 1UOKA 4I9AA 2DZPA 4UTMA 4OBSA 3W74A 1Q8AA 4BHYA 4DJFC 1PCKA 2VC7A 4AX7A 4PMOA 3CPRA 5A2AA 4CN6A 5CPNA 2WMKA 2C7FA 1KLYA 1WX0A 5D03A 5CSSA 3RR1A 1UZ1A 2FZ8A 1U5VA 4URIA 2PWHA 4UTUA 2GJXA 3P61A 4IHCA 5FF7A 2C79A 1E4IA 9CGTA 4HNCA 2BB0A 3STGA 1XQLA 3W70A 1PS9A 3I7RA 2POZA 2XH0A 3BMVA 4NJJA 4O50A 4WUIA 4DF1A 2GUUA 3N34A 1V8EA 1C8XA 1C29A 1XIIA 2INFA 4M24A 2E7FA 1U1UA 4FNSA 3TQ0A 3P60A 2FHCA 3QBUA 3GUGA 3ZQ9A 1MWOA 1VIWA 4MNJA 1KGUA 5JVLA 1U83A 4UTWC 4NXKA 1LOQA 1Q3NA 2TSYA 2BXZA 2PE4A 2PODA 4A2SA 3T05A 2BXVA 1NQKA 1MSSA 2ZZ6A 5E93A 4F2BA 1KXVA 3B0PA 2O7QA 4KT2A 1M01A 3SN1A 2R1MA 1QJWA 3CHVA 4HNLA 4E3VA 3QSTA 5C9UA 1VBJA 4PEEA 4PCSA 1PKYA 1ZBKA 5IOBA 1EJSC 1Q65A 2C0HA 5DMYA 3G3DA 3MUZ1 4JFUA 5FF4A 4CNSA 1E51A 4IFOA 1UG6A 4ZQPA 4HTYA 4C6OA 1JI1A 5TD4A 4NHVA 2A85A 2BMBA 4M8UA 3OTRA 4QAWA 2B0MA 5A3HA 3T9PA 3M5ZA 3QW4B 1VFUA 4GNVA 5I3FA 2ZFAA 3IGXA 4WSJA 2Y7EA 2P53A 3SY5A 1PZ1A 3NL3A 1FBAA 4UFHA 3WUEA 2PLMA 1OX4A 4JKLA 3M9YA 4XAYA 1XBVA 4PZVA 3WF3A 4LF2A 3EX1A 1XYCA 3UXDA 1XYFA 3GYCA 3LI0A 6CGTA 4P7QA 4GQ0A 4AH7A 4BK9A 3V5CA 1UWRA 1H7XA 3R8HA 4M6QA 2Z1SA 1BLIA 3O6YX 4RJEA 4C6NA 3DGBA 3LPGA 3QXBA 3UT0A 4I7UA 1PUDA 2VI0A 1IT8A 4Q8UA 1DJGA 4KIRA 1RHCA 3EX2A 3LNPA 1W2VA 2YCEA 3MYOA 3S1XA 3VU2A 1K7XA 5F4WA 5AFDA 2PDBA 4MVAA 1ALDA 2UZ9A 5CGMA 4N9DA 5LA2A 3VC6A 2CLLA 4CEXC 2E67A 4HPXA 4Z1CA 1SZRA 4G1KA 2PP3A 1KM4A 2QUUA 1ECEA 1UWIA 5FSEC 3DFQA 4MLJA 2JIEA 3ABRA 1PJ9A 1E6ZA 2OMAA 3VOCA 2FMNA 3MUXA 2PCQA 2AAMA 1CGVA 3BK0A 3DZ1A 2OGYA 3W1QA 3BG5A 2F6KA 4HN8A 3PN8A 5G1MA 2G41A 2VD8A 2XU2A 1A3WA 1VFMA 3R12A 4FNTA 4PUUA 4FX8A 3QHMA 5IDZA 2YL9A 1WXZA 1HJXA 5JU6A 2E0PA 1G4TA 1AODA 2OPJA 5D02A 3KBNA 3OW1A 5TIMA 2I5GA 3UZWA 1H7NA 3G1VA 5I7GA 1OG6A 4WRHA 1TR1A 3W01A 4D72A 1XSIA 2PLJA 3NYZA 2OFJA 2RGMA 4US6A 2D24A 4O1AA 1OFEA 2V69A 1DQWA 1EIXA 1XGZA 3MKCA 3PY2A 1J2WA 3GHSA 1ITCA 3PWIA 4AHPA 3C6CA 2E6YA 1E9YB 2W3ZA 1MFUA 4W87A 3AMKA 3MHFA 2VZOA 1I0DA 3AXHA 3MHUA 1FX6A 2HE5A 2VT0A 3R58A 2E68A 4X63A 4HA0A 2R9RA 3MUAA 4B92A 4GVFA 3WMSA 5JBDA 4HD5A 4F48A 3BTNA 4U31A 4MNKA 5FJUA 1FHVA 4DNHA 1G69A 1PYFA 6XIAA 3WH5A 4AIBA 4OHQA 3BJSA 4UTHA 3JW7A 2OU4A 1RXOB 2V5JA 5C9RA 3PJWA 4MPKA 3N4FA 3LXBA 3C86A 6REQB 4JQ1A 4J3UA 3VC5A 4BZYA 3M0JA 1BSIA 4C6DA 4GX9A 2O0TA 1E5NA 4HU0A 2BBFA 1K77A 1V4YA 2Z7KA 3DC8A 3UBPC 5C54A 3S1UA 2WHKA 4FPSA 1AFSA 2D3NA 3BARA 3ARVA 1L6YA 4DJEC 4D8LA 1XFBA 4YU1A 1TREA 3KOFA 4DF2A 3RHGA 2XINA 2IKIA 4GABA 2NXGA 1Q7QA 4N0RA 2CZVA 3U8GA 3ZJKA 1JPDX 3TCEA 5LIXX 1JCNA 4MDPA 1SM9A 1KLZA 4IM4A 2GDQA 1YDYA 5AYIA 1SSDA 4F0LA 1P0NA 3TP4A 1GORA 1HKWA 3VX1A 4XAPA 3MDWA 3CS2A 4ZMGA 3GG1A 3O15A 1QVBA 1K7EA 4E2B