3VE9A

Crystal structure of orotidine 5'-monophosphate decarboxylase from metallosphaera sedula
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
MNRVILSLDSPIPEETLRKLNGKVAGIKVGWPLLLNLGKEKVKELVGLVDGIKILDLKLADIDNTMILIVDELKDITNSFIAHAFVGVEGSLASLSQRVDLFLVLSMSHPGWNDAFYPYLREVARRVNPKGFVAPATRPSMISRVKGDFPDKLVISPGVGTQGAKPGIALCHGADYEIVGRSVYQSADPVRKLEEIVRSQEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Metallosphaera sedula
rcsb
source organism Metallosphaera sedula
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ve9A00
2VEMA 1TPB1 3HGOA 3CU2A 2TPSA 1P4CA 3DU0A 3P84A 4K7YA 1W3IA 2J88A 3UWZA 4O50A 1IIHA 1I2PA 2Z0IA 1SZGA 3KVKA 4UXDA 3MJYA 5BNKA 3W76A 5DXXA 2R8WA 1MEIA 3DENA 1WOAA 1I45A 4R53A 1QO5A 3THQA 1LZOA 4O11A 1GJPA 3UWYA 4JTUA 5EYWA 1XCFA 3PUOA 5AYYA 3NQ8A 3STCA 5AB3A 2ZA1A 4UTUA 4A3UA 4PL2A 1W1ZA 3BO9A 3GXNA 1EPXA 2KZHA 2ZZ7A 2EGZA 2EKCA 3VKJA 1TTQA 3LTPA 5CZJA 2GQ8A 3LI0A 5HMSA 3L65A 3EX4A 2QJHA 4HNVA 3L5MA 3TJXA 4PH6A 3S42A 3MWAA 2ABAA 2ALDA 2WSRA 4R7JA 3C8FA 3BK0A 2C3ZA 2VEKA 1FXQA 4JEQA 3IGXA 3W1PA 1OFBA 3I65A 2YW3A 4IQLA 3F4WA 2C1HA 4M19A 2ZZ6A 2EPHA 3W7CA 3KRSA 3W2KA 4FF7A 3LCFA 1J4EA 1QPOA 5U4NA 1F05A 3DKJA 1JVNA 3NNTA 3NQDA 4DBEA 1ADOA 2YX0A 1OFOA 1ZJIA 3PBYA 3SI9A 4WXYA 1OJXA 2ZTJA 5FF2A 1XDMA 4O4VA 3RMJA 2X1TA 3CHVA 2DZWA 3GR8A 3E0IA 1VCGA 3T7VA 1A5AA 1I2OA 1KTBA 2QCGA 4N4QA 3GNNA 3OEXA 1X6UA 1L6YA 3EWXA 3NEVA 1O4UA 3G1XA 5D30A 2ZFAA 2V2DA 4O54A 2QUUA 4A2RA 3NA8A 3IIVA 2X30A 3TV8A 1W3TA 1V7YA 3L0NA 4MZYA 4QSHA 5FF4A 2Y7FA 3TMQA 3BGGA 1GWJA 4K38A 2JGYA 1YDOA 5BW6A 1GG0A 3LV6A 1JULA 1TV5A 1JCXA 3BLIA 1K7FA 1YTDA 3Q37A 4LS2A 4OHQA 1CX9A 2YFNA 4QISA 3MBFA 4LWWA 2TRSA 4JTHA 1OYCA 4HHPA 2Y88A 4AF0A 3M44A 1YTKA 2C13A 4HKPA 5DXYA 2GOUA 5C54A 1KM1A 3M47A 2R91A 3IIOA 4PFMA 4KFPA 3CIXA 1JQVA 3RF9A 2FTPA 3HG4A 4Y9AA 5G1YA 4TU1A 4AF0B 4HSNA 1ZAHA 4G1KA 2VC6A 2QAPA 3IGSA 4J9JA 4IXHA 3G18A 2ZRVA 3SSJA 4CNOA 2DU2A 2ZZ1A 5AFDA 1L9WA 5GVJA 3BW3A 3NL6A 4RKAA 4O4WA 5A8GA 4RV8A 2H90A 2B7QA 5DBTA 1PS9A 3QPZA 4YLWA 4UTLA 1IXPA 1GQNA 2XN0A 2YFOA 3FLUA 4CCEA 3M5VA 2A4AA 1YPFA 2JGQA 1KFJA 1C29A 1SO4A 5AN7A 3EXSA 2QDHA 5F1UA 1AW5A 1QR7A 2C15A 3SIZA 4BI7A 3M5YA 5FI8A 1KV5A 5G1TA 1PCKA 3SECA 1DKWA 1JUKA 1VLWA 3M9YA 3MO7A 4XUGA 3W85A 4LS1A 1PL9A 4M6PA 2ABBA 1KBJA 4X22A 2F7FA 5AYZA 2W0UA 3TW6A 3PSWA 4UTIA 4IX0A 4XKYB 2JKEA 3GLCA 3W1MA 1JJKA 1F2JA 3LHVA 4KFOA 2V82A 3OG3A 4LVDA 3PAJA 3R2GA 4W9TA 1GEQA 2YYTA 4FNUA 4O13A 4QAIA 1H61A 3FIGA 3SW6A 3S8HA 5LNWA 3Q94A 1MEWA 1UB3A 3STFA 3TQ0A 4WZHA 4Y96A 4CCCA 4S2CA 3EKZA 2Z6IA 1R46A 1UCWA 3NPUA 4MOZA 1D3GA 2PRMA 3PG9A 4PCFA 1DBTA 4NUWA 4O8RA 1KM3A 1DQWA 1FWRA 3LX9A 2H3DA 1I2RA 3R13A 6TIMA 2D73A 4WQ6A 5HUOA 4UTTA 2H6RA 1VPXA 1GTHA 3GKAA 3W7IA 3LTYA 2C18A 3MP3A 1TIMA 3W1TA 1AL8A 2CU0A 1YTEA 5CKSA 1KFBA 4JD4A 3FJ6A 2VFIA 4NXKA 1XL9A 3B06A 1TPWA 2ZZ2A 1IXNA 4ZL1A 5HR7A 3G1FA 4LVGA 4RLIA 2ZZ4A 1X1OA 3W7MA 4CQAA 4LS0A 3O6CA 5FESA 1K7EA 5E93A 4WJEA 1DVJA 4RR4A 3H55A 1R2RA 1SW0A 1KBIA 3LHUA 3TE9A 3N14A 2XN1A 3KVMA 2CLKA 3IRDA 3UQNA 4HNTA 3NR0A 3L21A 3UPBA 1JRBA 1LTDA 3TAOA 1PVNA 3DHFA 3WJSA 4IPJA 1HO4A 3EXRA 5EBUA 4R33A 5LGXA 4JTJA 5F4SA 1Z44A 3KXQA 4WOQA 3C2FA 3SY5A 3B03A 2GVGA 3N19B 5E0KA 4MJZA 2ZA2A 1GPWA 1XBXA 1Q6OA 3W7HA 2FJKA 2R94A 4TMBA 4MYXA 3OIXA 2UV8G 5F2GA 3S5YA 3W7RA 3D0CA 3W87A 1TSIA 1IIGA 3LCHA 1WBJA 5LSMA 3C4UA 2YW4A 2Y61A 2QUVA 5HULA 2G96A 5AC8A 4Q33A 3NL2A 2Q3RA 3RLVA 1ICSA 2ISWA 3BV4A 5HJLA 4JYFA 3W2JA 1GOXA 1XBYA 4UMAA 5G2WA 1CW2A 4UTTC 1W0MA 5LNSA 1RZMA 3NQAA 4JDYA 3UYCA 4H6KA 4O14A 3I7QA 4I7VA 2RH9A 3LHYA 4LV4A 3LCGA 1O5XA 2YGYA 3GYEA 3BLFA 1ONRA 5FF0A 3TC6A 2VFDA 1QO2A 2GQAA 1O94A 1MXSA 1N55A 4A22A 5F1VA 1S5WA 3CIWA 2CLLA 2J9XA 4DO4A 3W9ZA 3P62A 1O5KA 3WK1A 1CI1A 3JR2A 2V2HA 2GVLA 1PV8A 3UXAA 3LLFA 4K6AA 5LNRA 4O52A 3O05A 3Q2DA 1F74A 2BTMA 3LXAA 5DN1A 1VYPX 4DEFA 3GDTA 2JK2A 4YWIA 2VFFA 4KFNA 3ZS4A 2DZXA 3WJZA 1WDWA 4S1FA 3RK8A 2QEZA 1SFLA 1SUXA 2X16A 5TQLA 4X2RA 1DQXA 3W3OA 3O06A 3C52A 3JRKA 2QJGA 3P82A 1AL7A 1U83A 3BLEA 5IBXA 2A2IA 4U4MA 1OX6A 4UFIA 3IVTA 4FNPA 3EX1A 5KZMA 1FCBA 1X8FA 4NNAA 1VRDA 1YDVA 1LDCA 4AWSA 1SU5A 1XM3A 5ABTA 4UR8A 1VGAA 3NO5A 4JGDA 4POCA 2AQWA 3C2OA 1TPFA 3BPWA 1JCJA 4AVFA 3W7OA 3S5OA 1H60A 3G22A 4E0CA 2X1RA 2E5DA 3GZ3A 3NQMA 4GUGA 4ML9A 3VCRA 1HTIA 1L2UA 2W6RA 3QM3A 4HSOA 5K9XA 3W1LA 1QPNA 3W1NA 4FNRA 5K2ZA 3E9AA 4NNCA 5HWJA 4ORMA 4LT9A 3S1VA 3QQ0A 4O28A 1UASA 3QW4B 5TBOA 4Z08A 2B7PA 3T78A 4QJ1A 3P74A 4RK8A 3EXTA 3KVJA 3NGJA 1GYLA 3F03K 2DZVA 4N2YA 2QAFA 3BG5A 2ISSA 3U6WA 3FYPA 1SW3A 4NU7A 1QAPA 5AYXA 2ZRUA 2GQ9A 4MKNA 1QCWA 4NT0A 1I4NA 3DI1A 2VENA 3TJLA 5DCBA 2BX7A 1TCDA 4FO4A 5F4XA 2FLIA 3WJYA 2ISVA 3TSDA 3V1PA 1TTPA 2E6DA 3INPA 2RKXA 3KX6A 1LBFA 4UTMA 3LHZA 1EUAA 4OWGA 4LC6A 3PG8A 4KWWA 3G8EA 4UTJA 5IBXC 1OYAA 1JCYA 3HIJA 1V5XA 5BRBA 3PULA 3SGUA 3DFSA 1G69A 3L5AA 3BGJA 4IMEA 3ABOA 3QZEA 2DJLA 3GDKA 3A23A 3MI2A 3TSBA 1H1YA 1ZFJA 5C6MA 1MO0A 4GNJA 4O57A 3TNOA 2WKJA 3TA6A 4Y90A 1F73A 3P8JA 3TU9A 4C1KA 2V2CA 2NWRA 1AW1A 5K9CA 3CPRA 5FEXA 4CLMA 4IMGA 1F6KA 4FEZA 3ATYA 2G97A 2NX9A 3PY2A 4M7SA 2OCZA 4LY8A 2DZUA 3DFOA 3WJXA 3P67A 1OX4A 1SSDA 2QCEA 2QR6A 3G0XA 3QYQA 3PB2A 4Z1CA 2ZDRA 2J27A 2PRLA 2H8ZA 3R8RA 4MZ1A 2QCNA 4PODA 3TROA 3EWWA 4N9BA 2GPTA 2NV2A 3NDOA 4LV9A 4N6FA 3W7KA 1ZAJA 2YCEA 2V30A 4LOCA 4UTWA 4GUIA 5HINA 3ZWSA 4DF2A 3NPWA 2E6FA 4JXCA 2YDAA 2X1UA 2V0TA 3GDMA 3LTSA 2A5HA 1YDNA 3OHIA 2OJPA 3CWOX 1K03A 3NZ1A 1TYGA 3W84A 1LORA 3C56A 1LLWA 4LUIA 5EKYA 4IUOA 2FPYA 5LHFA 3W86A 3GKFA 4YMZA 3B05A 4A2SA 4HPXA 3NZRA 3IV3A 2WNZA 5CG7A 5FEZA 3LM7A 4M5PA 1UBSA 1TV7A 3N9SA 1TPUA 3M7WA 4O15A 2HMCA 4YCOA 1E51A 2BWGA 2CZEA 3NM3A 1EX5A 3HBLA 3MHGA 4EOUA 4O1CA 3LOTA 3W7EA 3EEGA 5DCEA 1OF8A 1ZENA 3S1XA 2Y7EA 3ZR4A 4UMCA 1L6WA 4ADSA 5HUPA 3EKLA 2WOQA 4IWWA 1WQ5A 4JYEA 5MHBA 4FHAA 3G3MA 4X9SA 3A5FA 3QQ1A 3M0ZA 1PCWA 3HJZA 3FYOA 2NX3A 5CGQA 1JR1A 1F6PA 4ALDA 2CLFA 3SJ3A 4I9AA 3NQ6A 5DY3A 3WFAA 4LVAA 3Q58A 2C14A 3O8AA 5CPLA 3W83A 1YXYA 1K7XA 3G0SA 2DZSA 2ATMA 4UTWC 4O18A 1VHCA 1X1ZA 5FF3A 5LGZA 4LW7A 5D2TA 1EP2A 2V9DA 3MUXA 1KV8A 4UFMA 1GYNA 3P7YA 1ML1A 2YPIA 3H54A 1R47A 2ZZ5A 5K4ZA 1SZNA 4I7WA 1WBHA 3UWVA 2WSYA 1WX0A 5KITA 3G1AA 1XDLA 3IIPA 4HNUA 1RR2A 2J9ZA 3O63A 3CB8A 1DOSA 2VEIA 3A21A 1QOQA 4LRTA 1J5TA 1EUNA 4DPQA 1HG3A 3ZWTA 2CLMA 1RD5A 3LV5A 5D38A 3L66A 3STGA 2LLEA 1NF0A 4MFDA 4BI6A 4NQ1A 1ZAIA 3ABSA 4FNSA 5FEPA 5G4EA 2NUWA 4CCDA 3DH7A 3W2NA 3O6DA 4DF0A 1OG0A 3HB9A 3N73A 5BOOA 3B8DA 2PRHA 3LLDA 3NVTA 5IM51 2PC4A 2E5BA 3H53A 3IVUA 3LRKA 2VFEA 1VJIA 4OT7A 2V5BA 4UMBA 1NSJA 5EMUA 4IOTA 2FQIA 3ABRA 4Y6GA 4Q4KA 4JTEA 2O7QA 3PSVA 1LBMA 1LOSA 4FNTA 1LYXA 1MZHA 3O16A 4L4LA 3NAVA 4L4MA 1FDJA 3V75A 3BW2A 4UUIA 2FIQA 3MI3A 4WX2A 2DP3A 4GUHA 3NXFA 5HWNA 5E1QA 3TAKA 4XBKA 2BSLA 3LGEA 4M6VA 3DAQA 3W72A 2Z1BA 2ZBTA 1T96A 3PB0A 3N34A 3NM1A 3CWNA 1ZCOA 2XFWA 3G1HA 2EAWA 4OGZA 5KINA 3HG5A 1GVRA 2CFFA 5DBUA 1RQBA 1A53A 3B4UA 5D05A 3TIMA 3P61A 3GAKA 2QCLA 4JR5A 2OT0A 4JIQA 1DHPA 1UJPA 1M7OA 2CZ5A 3PWAA 1TPC1 1SPQA 1FUYA 4NX5A 1AMKA 3S0CA 4MY9A 3DZ1A 1AG1O 1B4KA 4ZQMA 3SFKA 3TFCA 2ZZ3A 1QOPA 4TIMA 4IGHA 1KTNA 3I7RA 1S3HA 1KFCA 2W79A 2H8XA 3W7DA 1UUOA 3QMRA 1M6JA 3CTLA 3K30A 5AC6A 4JNMA 4AMAA 1W5QA 4FIRA 4DELA 4Z1BA 1C8VA 3C2EA 1I8JA 1Q6RA 5D02A 2A0NA 5FF7A 1DV7A 3CT7A 1GVSA 1VH7A 5J5RA 3MYPA 4JN6A 4GFSA 5U7SA 3GXTA 2QCDA 2ZA3A 3IEBA 1H7PA 5H2ZA 3QRHA 4DO5A 1VCFA 1A5CA 4ADUA 3UWWA 3W7JA 3E12A 1JCLA 4AH7A 3KAOA 1KM5A 1Q6QA 2FFCA 2O7SA 4K8HA 1FCUA 5G2IA 1TPDA 2ZTKA 5CPNA 2C6QA 2QKFA 3W7GA 1TJRA 1Y0EA 3MHFA 4JIPA 3DFPA 4JTTA 4UFJA 4RZ6A 1EEPA 1WOBA 4NJJA 3UXDA 4DXVA 4QNEA 4XWUA 2E6YA 4N9CA 3B0PA 1GG1A 4NJKA 4QIUA 5LNUA 3W70A 2A7PA 2Y62A 3KOFA 5CSSA 1EA0A 4JX4A 2B7NA 5I3IA 4E2BA 1EWEA 1JCNA 3HGJA 4UR7A 1OFQA 1G4EA 3LHTA 3T40A 2QCCA 1TPH1 3N3MA 3BG9A 2J24A 1OFPA 3O15A 5EY5A 2DJXA 3U8GA 1W3NA 1NEYA 1LBLA 1TRIA 1RVGA 2NXHA 1H1ZA 5BMWA 4IX2A 4DQWA 1EP3A 3F1QA 4XQ6A 4LVFA 4O10A 1YYAA 3TC7A 1PE1A 2EHHA 1W5OA 3BVJA 3STEA 4EF8A 4WOZA 3C0JA 2QUTA 3TUUA 4OQVA 3M5ZA 4PC8A 1JQXA 2HTMA 3QC3A 2WPBA 3W1AA 3CLMA 1VS1A 4GC4A 2OX1A 3O6YX 4NJGA 4H3DA 2NX1A 2WNNA 1IXOA 3W73A 5AHFA 3TDFA 2C19A 3PF3A 4EWND 1SQ7A 1OX5A 4HPJA 4K37A 5AHNA 2B4GA 3LRMA 5CSRA 1LRNA 4PEKA 1OFRA 4OV4A 2E68A 1F5ZA 2G95A 4NZFA 3EB2A 2DORA 4CQ8A 4EVZA 3L5LA 5F2LA 2CZDA 3W1UA 1YLVA 2C16A 3C2RA 3W07A 2ZQ0A 3DFNA 2JKPA 3W1RA 1MSSA 1C9DA 2CLEA 3CM4A 5KTLA 1S5VA 2XN2A 4AHQA 3USBA 2A7NA 3W75A 2FDSA 4DF1A 1HO1A 3PS7A 4RX0A 2CLIA 4MLRA 4AWUA 1KM2A 2TSYA 4IJBA 5AC7A 3S1WA 7TIMA 2OT1A 1P0KA 2A7RA 5T26A 3UNDA 4AHOA 5AHIA 3MP4A 1TQJA 5BMXA 5G5IA 3TFXA 2WJZA 1Q3NA 4JTSA 3QF0A 2Q3OA 2VEPA 1ICPA 1ALDA 1TTJA 5SWUA 1H5YA 1KW1A 4JX5A 3C3NA 4IPIA 3UY8A 2NUYA 4O0KA 1VC4A 3QMSA 3LBMA 3VE9A 1XUUA 4AHPA 4O12A 5H91A 4BR1A 2GJLA 3NPXA 3UPWA 4M6QA 1W5PA 3RNDA 4K36A 3HOJA 1TREA 3NL5A 2HSAA 3EX6A 3T4CA 3EWYA 3PM6A 1H7XA 1SO6A 2X2GA 3MBDA 4ICNA 3W23A 3L9CA 2VKZG 1Z42A 2V81A 2Y7GA 1G67A 3UWUA 4LRSA 1QFEA 4UFHA 3TSMA 3ZFHA 4JTIA 1LM1A 3R12A 4FIQA 1GTEA 2B0MA 1F76A 3P8IA 4LVBA 2Z6JA 4EIVA 4JTFA 3L0KA 1QPQA 3CEPA 3P60A 4ZQCA 5LKYA 1NF7A 1OK6A 3RLUA 2Y7DA 4LC8A 4AEOA 3C6CA 4ZZ9A 4ZQOA 3UWQA 1XXXA 2E5CA 1LLZA 3PBWA 1OK4A 2QF7A 3R89A 5HQEA 1ZALA 4ADTA 4JX6A 1ME9A 3TQKA 1B9BA 5I3FA 3PBVA 3GIYA 2PE4A 2FB2A 5HWMA 3P80A 4O0ZA 2AAMA 4Z1AA 3P81A 3C61A 3VI2A 3THAA 2CLHA 1JUEA 2WNQA 4QITA 3HG3A 1MEHA 1OX4B 3HF3A 3HGRA 1GT8A 2Y70A 1OABA 2A1YA 3S5NA 1G7UA 2VELA 1SZEA 3LXBA 2RHGA 3MYOA 1W8SA 2G5WA 3TR2A 1T8XA 4WXZA 5CZTA 2Z2UA 1B4EA 3PBUA 1THFD 1WXJA 3GAYA 1DJNA 3HG2A 4AXKA 2FB3A 2J6XA 2YR1A 3GK0A 2ZRWA 3W74A 5A5WA 1GVOA 4LUJA 3AJXA 3LHWA 5LZLA 1JCMP 4Z1DA 4YCPA 4UFKA 1QPRA 1K02A 4JYDA 4GRSA 1OHLA 3G24A 4P61A 2JKAA 4UTHA 2NV1A 2JBMA 4BWLA 2GJNA 1RQEA 3W2MA 1Q45A 4HN4A 3OVQA 4IMDA 3HMJG 3SZ8A 2NXIA 1HFBA 3NL3A 1I2QA 3S1UA 4JDBA 3W88A 4S2BA 3OA3A 4B5NA 1FWTA 1UUMA 3ATZA 1Z41A 4Y8FA 1OFDA 4JICA 2ZYFA 4LTSA 3NQ2A 4RJEA 3C2VA 2J9YA 3R5EA 1TRDA 3CQ0A 4MYAA 4RCXA 2YZRA 5HR6A 1B3OA 4Q32A 4OU1A 4N9EA 2VOMA 3M5XA 5J5DA 2A6NA 1Z48A 2QJIA 3GR7A 3TX9A 3FJLA 1P5BA 1KA9F 5AHMA 1SO3A 3LBCA 3LCWA 4AAJA 1M5WA 3B04A 1BKSA 4JTLA 1KLZA 4CNPA 5I3HA 5C55A 4A21A 2X1SA 3GDRA 4NJIA 2WSQA 5AHEA 1J2WA 3M16A 1A5BA 3HO8A 1FWWA 3IIXA 2WQPA 5CPOA 3RU6A 4FNQA 3LXCA 1X7FA 1XUZA 3AO0A 4KKXA 3E49A 3W7NA 3HPSA 1FDYA 3PC0A 1SW7A 1VR6A 3M43A 1LP6A 4UTKA 5F4WA 1A5SA 3TW7A 1IGSA 1KLYA 1B57A 4WD0A 3GXPA 1P1XA 4AWTA 2P0OA 2I1OA 4A29A 4BWLC 5D2YA 3G0UA 4QNWA 5KZEA 2E6AA 4OBTA 1PHQA 3O1NA 3QMTA 3W71A 2AGKA 4JS3A 1WYIA 4ZVJA 3PVFA 1PHWA 3FEMA 4UFLA 1H7WA 3NPVA 3KVLA 3B0VC 4PTNA 3OBKA 1OFAA 3P5ZA 2NLIA 1W54A 3NOEA 4ZMGA 1TPVA 2QCMA 4UCGA 1ICQA 1G4TA 2ZRYA 3CEUA 2HS6A 4N4PA 1SSGA 3IIZA 1R30A 1LROA 1RQHA 3FA5A 4FB7A 1H62A 5D09A 4TX9A 3OVPA 2V5LA 2RDUA 3LCXA 1IXQA 1TTIA 1FBAA 4FX6M 1BTMA 5D2XA 5CZSA 3DXIA 1W31A 1JRCA 4EF9A 5I3KA 3IGUA 4OV9A 4MZ8A 2ZRXA 4BK9A 4NXSA 3OVRA 1W5MA 1EB3A 2IQTA 4WY0A 1SO5A 4ORIA 1D3HA 2H3BA 4KWVA 3TMLA 3MI6A 3E02A 4GUJA 4O53A 2PURA 1H51A 4HIBA 4XKYA 4MY8A 3W6YA 4WY0B 4N6EA 4MIMA 1PIIA 3DBPA 4DO6A 5L9FA 3L68A 3LRLA 4MFEA 3I68A 3GB6A 1O95A 4FX7A 1GZGA 1NAL1 5D32A 2BXVA 4X3ZA 3TXVA 4RZ4A 4R34A 1H50A 1ZNNA 1G4SA 3MP5A 3DGRA 3L0GA 4FX8A 3NQVA 1XBVA 3W7PA 3GVGA 5K7JA 1LCOA 3TQVA 3W2UA 2ZCGA 1AW2A 5D04C 4DPPA 2VFGA 3TCEA 4IMCA 2CZFA 1G4PA 2YYUA 1OF6A 3NQCA 5C5YA 1EP1A 1Q6LA 2EF9A 2B7OA 1ZHAA 2YSWA 3O07A 1ME8A 4H4IA 3EWBX 4MJMA 5KSWA 2I9EA 1DORA 2VFHA 3HPZA 1VHNA 5EL1A 2E09A 5AHLA 1VLIA 2GUUA 4OE7A 2Y85A 3I6RA 4N02A 3LDVA 5D33A 4QQ3A 1TPEA 3GNDA 3QFEA 1G6CA 5HNRA 6ALDA 5AOUA 2F84A 3A5VA 3QH2A 2ZRZA 4MUZA 2WO5A 5DCDA 4JY8A 4GXMA 1H63A 1FX6A 3F4NA 1FY6A 2OMAA 1SR9A 3CC1A 1L6SA 4O19A 1D9EA 3S9YA 1KM4A 3NQEA 4TR9A 5L6UA 4ZQRA 1NVMA 2BLEA 3MMTA 4E38A 3WK3A 1FDZA 1T99A 1KFLA 3UD6A 2QCDB 4E2DA 3HPXA 3ANYA 1FCQA 1EWDA 2OZ0A 3NQ7A 1LOLA 1HL2A 3UZJA 2NUXA 1WAUA 3M41A 3W7QA 2BZNA 1KTCA 3EWUA 1YXDA 1HUVA 3QJAA 1F7BA 1VYRA 2Y63A 1GVFA 4YXGA 2NXGA 1DL3A 4GE8A 4RXFA 4BF9A 1W5NA 5G2HA 3JS3A 1KM6A 4YL2A 4RXGA 4I7UA 3KHJA 3NQGA 1XC4A 3LB0A 1ME7A 3PUEA 5K9DA 3QPYA 3VFLA 4CQ9A 1XKYA 3M1ZA 3QSRA 1YPIA 1VQTA 3M6YA 3UZ5A 4MPQA 2C0AA 2TYSA 1QWGA 2CW6A 3G1DA 5D03A 3SR7A 1K8ZA 4U28A 3DFTA 3I7SA 4GWEA 3PUDA 4K7VA 4XBSA 4FXRA 5K3VA 3KFTA 3TXZA 3WK0A 3L2IA 1U5JA 1SZFA 4PL1A 3P5YA 4TMCA 3WK2A 3B0UX 5I3JA 4IMFA 1OVDA 2Y6ZA 3A24A 2GVJA 1RPXA 3QEZA 4K8EA 4O17A 5DLCA 1QDSA 1K3UA 1WV2A 1XI3A 4O1AA 1H7NA 1QNVA 5EPDA 5FEWA 2YXGA 3G1YA 3N2MA 1A50A 3DFQA 1OYBA 4RZ5A 5D37A 1OFEA 4JY9A 5CZ0A 3QW3A 1FCVA 3NG3A 4ONVA 1LRTA 3WJWA 1I2NA 1YXCA 3HQ1A 4UC5A 4TO8A 1R2TA 3LCIA 2DZTA 3EX2A 4BI5A 1S5TA 2A21A 3MW7A 3FKRA 3FS2A 5EA9A 3DKLA 3NQFA 1LOQA 1BEUA 1TMHA 3QSTA 3L67A 5LHEA 4UNLA 1BWKA 2P1FA 3ELFA 2ATSA 1H7RA 3A22A 1KFKA 3W2LA 3N2XA 5KMYA 4O1DA 4BFAA 4GJ1A 5K4XA 2FPTA 1YADA 1W56A 2VXNA 2WV8A 3G8RA 4LU0A 1NFBA 8TIMA 1W37A 4XTIA 3IVSA 2P10A 3A9IA 4C1LA 2HS8A 1TB3A 5G4WA 5LNVA 4MVAA 5TIMA 5I3GA 2QCHA 1EIXA 1XBZA 1T0OA 3UY7A 2E77A 1K8YA 2QCFA 3BW4A 2Q8LA 4DBDA 4UIOA 1VYSX 3KRUA 3S5ZA 1R2SA 4CNNA 3E96A 1FQ0A 2NZLA 1TO3A 3FOKA 4JTGA 4O1BA 3MHUA 1IF2A 4XZ9A 4WY0F 5KZDA 3G3DA 3DI0A 4NZJA 3T44A 1H7OA 3BARA 3BG3A 1ZY9A 3ABQA 4N9DA 5C2XA 2V8ZA 1KM0A 3TH6A 3TK7A 3NYZA 1TQXA 3HGSA 4FXSA 1K8XA 4JTKA 2A6LA 3FKKA 5DY2A 4XTDA 1FWSA 1N8FA 1P0NA 4NNBA 3PR2A 1FXPA 4MY1A 5D2VA 4Z0SA 2RFGA 3LCLA 1QMLA 2TMDA 1VZWA 3SGZA 1O60A 2A85A 4GUFA 1KFEA 3VNDA 1N7KA 2Q8ZA 4O16A 3GDLA 4LNYA 3T55A 3GX9A 4M7TA 2I14A 2PCQA 3G1SA 4GBUA 4PA8A 2RDTA 1XFBA 2QDGA 1WA3A 4NX0A 2NWSA 1TV8A 4D2JA 3LERA 1JUBA 4AB4A 4Z0JA 1GVQA 3G1VA 5D2WA 2FPVA 2R14A 2Y89A 3KRZA 4NJHA 4NVTA 1AK5A 3W1XA 2RDWA 1RV8A 2E1DA 1LRQA 1BWLA 2CLOA 3DHDA 4HNNA 3FFSA 3LI1A 4HT3A 3N9RA 4P2VA 4ZQPA 3W22A 5CPMA 4IXXA 4K39A 3EX3A 3W1QA 3EWZA 3YPIA 3W7LA 5F2IA 3VE7A 2CWNA 3TKFA 3U2OA 1SFJA 1DJQA 1VCVA 4QM1A 1TJPA 5F2MA 1M7PA 4ZQNA 4WUIA 3RFAA 3S6DA 4MLJA 1FWNA 2DZPA 1G7VA 4UNKA 5DELA
chains in the Genus database with same CATH superfamily
1JDCA 2VEMA 2R24A 4UQBA 3CU2A 3QOMA 3VGGA 4XAFA 2YXXA 1B54A 3KCLA 3CV2A 2Z0IA 3GO2A 5JBDA 3PN8A 1WZLA 2ESCA 1KRCC 2I7GA 3VINA 1LZOA 1WDQA 4DM1A 3CQKA 3GH4A 5EYWA 3STCA 1YIXA 2KZHA 1A4MA 4FLRA 1ISVA 3LTPA 2GQ8A 3ZJ8A 1XYMA 3EX4A 4HNVA 2NV9A 1GUVA 4PH6A 1XSKA 3W6MA 3GRIA 6ENLA 2GOKA 3BK0A 2VEKA 3V5CA 4J7RA 4JEQA 4CGTA 3W1PA 3W25A 1OFBA 3I65A 2YW3A 3H2MA 4IQLA 3F4WA 2XVNA 3UESA 4KCWA 3P0WA 2NQJA 2ZZ6A 3R8HA 4MJ4A 5FSEC 3N18A 3W7CA 3UF9A 1QPOA 3ICJA 4GIRA 3THDA 4EANA 1OCNA 3NQDA 4A3HA 4PTXA 2WZIA 4H41A 3SI9A 1XIHA 1P0DA 3RMJA 4YTSA 1CWYA 2X1TA 2XGIA 1XGEA 3PAOA 2CITA 4MKVA 1I2OA 3I4KA 3TEVA 1KTBA 1X96A 1Q66A 3OEXA 1A4LA 1L6YA 1Q7ZA 3NEVA 3REQA 2ZFAA 4A2RA 1UR8A 2J7CA 2HISA 2X30A 3AHTA 3G77A 3BGGA 1GWJA 2JGYA 2PI6A 4AYGA 3S2CA 5BW6A 5I09A 4GISA 2PF0A 4HCLA 4RDZA 4EXBA 3SURA 4LS2A 5D9MA 2PS2A 4W7UA 4YHGA 1UOZA 3LQLA 1O1HA 3PPGA 1QRQA 3PZNA 4JTHA 3TTSA 5A6JA 3VABA 3M44A 4PRRA 3DESA 2C13A 3PZTA 3M47A 5AC4A 4F0RA 2R91A 3IIOA 4PFMA 1ZRQA 1JQVA 3RF9A 3WBYA 3JVAA 4U5IA 3SQSA 4UZSA 4G1KA 3ARZA 1V51A 2QAPA 3ARSA 3IGSA 4R7OA 3G18A 3M6DA 3A47A 3BICA 5AY7A 4GHRA 5AFDA 4RKAA 5A8GA 1ZGDA 4YLWA 3EB4A 2YFOA 3ALGA 3T2PA 3CWHA 3COTA 4KWSA 4ML4A 3QYSA 2C71A 5F1UA 1QR7A 3W38A 3M5YA 5FI8A 1EX1A 8XIAA 1PCKA 3OHMB 2VZOA 2Y5SA 2QUMA 1IZCA 1ZPTA 1JUKA 1VLWA 4XSLA 3V18A 1BF6A 4LS1A 3VC6A 1PL9A 1KBJA 1OB0A 4X22A 2W0UA 4K8GA 3C5QA 5DFAA 1PXGA 1UZHA 2W92A 3GLCA 4GG9A 5FJRA 4C6NA 4W9TA 4HOZA 3MCNA 4B9ZA 5BWAA 4GY1A 5I3DA 1XIIA 1QHOA 3UR8A 3Q94A 3A13A 3STFA 1FH9A 2GGHA 4FPSA 4AZBA 5G1MA 3GXDA 2CXEA 1IT8A 2PRMA 3CL8A 1NP0A 2XFYA 4NUWA 1DQWA 3VAVA 2H3DA 4F0LA 1VD6A 2PDWA 3N2TA 1E6RA 3LTYA 2DT3A 2E1WA 4GYPC 4EPDC 1VBRA 1UWUA 1YTEA 4NZ4A 5CKSA 1WE5A 5CC3A 4WSKA 3FJ6A 4NXKA 2OO6A 6REQA 3MSDA 3SCUA 1IGWA 1IXNA 3U5YA 1OM0A 4ZL1A 1O5QA 3G1FA 4LVGA 4RLIA 1X1OA 3W7MA 5ABGA 2ONEA 1KR1A 4FOJA 1WP6A 3H55A 3TE9A 2XN1A 2J8GA 2VC9A 2O0TA 3UPBA 1LTDA 5JVLA 2QPSA 4JL1A 1UWRA 1HO4A 2VR2A 1ZSXA 1UR3M 2ZADA 1X8CA 3SY5A 3B03A 1W17A 1XLIA 1IZKA 5E0KA 1GPWA 1GVYA 2OSWA 4HYVA 4Q7IA 1PKMA 4QBXA 2HDJA 2UY4A 2FJKA 3DC0A 2BVTA 8XIMA 1MUMA 3S5YA 1C8QA 3D0CA 3W7RA 2WZTA 3LS9A 2O4QA 1DIKA 1QI4A 1JFXA 2Y61A 5AC8A 4Q33A 3NL2A 4PTWA 1ICSA 3BV4A 3DYMA 4HPGA 4MB1A 1Q6FA 3VUPA 1GOXA 5G2WA 1CW2A 4N42A 2ACUA 1W0MA 2E9MA 1RZMA 5MKGA 3NQAA 3ZM8A 5ABFA 4K3ZA 3K8LA 4H6KA 4O14A 4BCEA 2VR5A 3LHYA 3ENLA 4IP7A 2VC7A 1RCOB 3AMLA 1QO2A 4XX6A 1Q6EA 4A8LA 5F1VA 3CIWA 2J9XA 1KFWA 3P62A 4JAWA 3W24A 3KOXA 1CI1A 3RGTA 1FP9A 1UPMB 4LAMA 3OU8A 2GVLA 1HJQA 1VPQA 4AQLA 5LNRA 1W3LA 1J10A 3VGDA 2BTMA 1EF2A 2FVKA 3LXAA 1A80A 1VYPX 5I06A 2WANA 3GDTA 4B2DA 2VFFA 4C6OA 3HPAA 3L4VA 3ZS4A 1QK2A 4S1FA 4CEXC 2BG5A 1CGVA 1SFLA 2HK0A 2X16A 5TQLA 3O06A 2QJGA 3P82A 3TOPA 1V0NA 4JL2A 3BLEA 4QRNA 2A2IA 5D8ZA 5B7YA 5DT5A 4RUBA 4UFIA 4FNPA 2AL2A 3UZWA 1C8YA 3WEMA 3EX1A 2PTYA 4P5UA 2C8NA 4NNAA 1KXTA 1YEYA 4E8GA 2XTKA 2PDXA 3T6CA 1VGAA 2CKSA 1IEIA 4JGDA 3QLLA 2AQWA 4POCA 4UTFA 2R6OA 3WQPA 4KGLA 2X1RA 3VCRA 5I03A 5K9XA 3G6MA 3W1NA 4RDWA 4KETA 1O5RA 2RJGA 5K2ZA 3U7VA 4O28A 1D3CA 1UASA 1UA3A 1G1YA 2ACQA 1QHZA 5TBOA 1Y5WA 4HCDA 4Z08A 4CD8A 1R38A 3LA4A 3H26A 1VIWA 3TYDA 1CXLA 4N2YA 2QAFA 1V8EA 2UZ9A 1SW3A 4MAVA 1XC6A 2XH7A 4C6EA 1EJTC 2PTDA 5DCBA 1J2BA 2BX7A 1TCDA 3WJYA 1VBJA 4G8TA 3WQ4A 2REQA 3AU6A 4C1NB 3KX6A 1LBFA 4ZOBA 1EUAA 2ZWYA 5AVNA 4OWGA 2XDFA 3NIYA 3G8EA 4HA1A 5IBXC 1XH0A 1OYAA 1A5LC 5AZ0A 1G69A 4Y9NA 1E6PA 3UG8A 2DJLA 3SM0A 3USZA 3A23A 3MI2A 1ZFJA 1BXCA 1UZDA 4DJFA 1R3VA 2WKJA 4ACZA 4V1YA 3H2AA 4NZ1A 5K9CA 4CD6A 1BRLB 3CTTA 4G56A 1WKYA 4HA4A 3CUGA 5HANA 2NX9A 4AC1X 3EDKA 4M7SA 2IKJA 3TTOA 2OCZA 4KCVA 3VMPA 4JTCA 2QCEA 3G0XA 4D72A 2FVMA 1KRBC 1KRAC 2ZDRA 2J27A 3VD4A 4MZ1A 3Q65A 4OKDA 3TROA 4N9BA 2GPTA 1NIUA 3M0XA 2QW5A 4N6FA 4LOCA 4UTWA 1JPIA 1HL8A 2VRQA 5HINA 3ZWSA 4DF2A 1BKHA 3XIMA 4W4QA 4P8VA 3CWOX 4GI6A 3NZ1A 2GJRA 3W84A 1QHPA 3IWPA 3C56A 3N2OA 2ICSA 3DDMA 4IUOA 3EYPA 4KQNA 5LHFA 1CLKA 1BAGA 4YMZA 3LGDA 3GH7A 3VGFA 1DJIA 4I9TA 1MRAA 5HK4A 1B5TA 1V0KA 4S39A 2E25A 2JF7A 1ZLPA 4HQVA 4H7CA 3VILA 1E43A 1YE4A 1V6WA 2CZEA 3NM3A 1DWHM 4H2CA 1W1TA 3GM8A 1GOOA 4JCLA 3LOTA 1RY0A 3SAZA 4JNYA 1AFSA 5CLTA 1ZENA 4ADSA 1GZ1A 3EKLA 1R87A 2W91A 1WQ5A 4JYEA 1A49A 4C6KA 3AUJA 4HD5A 3HJZA 2VZSA 2INFA 1X6NA 1ENUA 4I9AA 1W1VA 5DY3A 1ZU8A 4TVUA 2ZXDA 3B40A 2BVWA 2J79A 4DAFA 1UG6A 3WQGA 3RHGA 5IHSA 4V2XA 4FAMA 4AD2A 1V3HA 5FF3A 5D2TA 1F3EA 1XW8A 2V9DA 3N29A 1BVNP 1R47A 2ZZ5A 2ZE0A 4L64A 1UH4A 4PTMA 1UWTA 1QXLA 3JU2A 5DRIA 2I5QA 3G1AA 1RR2A 2YBVA 2RGMA 2J9ZA 1JPKA 1UR1A 3B8VA 3CHEA 2VEIA 1CB7B 3HMCA 5CEWA 3ZWTA 2CLMA 2F2KA 2FZMA 8RUCA 1CGUA 3TLLA 2XPKA 2VR4A 3VKCA 4HZ8A 5FL0A 4C7DA 3QVQA 3SIMA 1E6XM 2NUWA 4CCDA 3DH7A 2W3ZA 3W2NA 4DF0A 4RW5A 3N73A 4D6JA 3NVTA 4KEUA 2PC4A 3TP4A 4O0QA 3H53A 3IVUA 4AZCA 1U2YA 3VKDA 1Z6KA 1WZMA 1NSJA 3NO1A 1FTXA 3GU1A 5EMUA 1F8IA 1C7TA 1EO5A 5IFPA 4IOTA 1DWIM 4W5UA 4FNTA 2INZA 4S3KA 1MZHA 2WVSA 4L4LA 2FIQA 3QHNA 3TAKA 3PJTA 1GOWA 3UZYA 1MMFA 4M6VA 3W72A 1J93A 1VBGA 4IJCA 3NM1A 3O9NA 3TOYA 4Q8OA 3SBFA 5GNXA 3G1HA 1XIJA 2AQVA 2VTFA 1EQCA 5KINA 1U5HA 3CUJA 5D05A 2ACRA 4KRZA 3P61A 2QCLA 4JR5A 5BRPA 2Z1KA 4C7FA 2X7VA 4LCRA 3ORWA 4V33A 2CZ5A 5CSYA 1TPC1 1XDJA 2KX9A 1FUYA 3WUGA 3S0CA 3LMYA 3T4WA 4O1FA 3CLWA 1AG1O 3MMWA 5GJPA 2XHYA 3TFCA 3CZGA 3K4AA 2VZTA 4L80A 1C93A 2H8XA 3W7DA 5TNVA 3I3BA 3CZJA 3CTLA 5AC6A 5JH2A 1H3GA 2WHLA 3WN6A 4Z1BA 3C2EA 1I8JA 1Q6RA 2A0NA 2OXNA 1W32A 1DV7A 4AIUA 1VH7A 3MYPA 2PP1A 2ZA3A 3GG0A 3AYTA 1JCLA 2ZUNA 1NFPA 4ZO8A 4E8CA 4P8XA 1EYEA 2OEKA 4DHGA 5LIKX 2FFCA 4PUNA 4V28A 3DG3A 2DV0A 4IQDA 5DQPA 3ARQA 3RLHA 1TJRA 4GXPA 1Y0EA 3MHFA 3DFPA 2DT2A 1PX3A 4UFJA 3CJPA 2AQOA 1P7TB 4MNMA 1WOBA 4E3TA 3UXDA 1EC8A 2J8FA 1BVZA 5ENLA 3VX0A 4QNEA 3UU0A 3L4ZA 3B0PA 4M24A 2MNRA 3O3RA 3FN9A 2EEXA 2QIWA 2VVSA 4KT2A 1EWEA 1E6SM 4JFTA 3VVGA 3GYCA 4EX4A 1OFQA 3T40A 2QCCA 1TPH1 3N3MA 3EBVA 5LA2A 6XIMA 2DJXA 5IFTA 4GH3A 4GIEA 4JIRA 4JHOA 4IX2A 3C0LA 1EP3A 4LVFA 3GDBA 4O10A 1H0IA 1PE1A 1PSCA 1W8GA 4IQEA 5JU6A 2QUTA 2PWUA 4MWAE 3JZUA 3AXKA 2DEPA 4UQDA 3IJQA 3SFWA 3M64A 5EFDA 1PAMA 2VD9A 2PDMA 1SYTA 1ISZA 2NX1A 4ICMA 5AHFA 2BV9A 1HF6A 4EWND 4HPJA 1UW9A 3LRMA 5AVHA 2HZGA 3MQTA 1LRNA 1GKPA 3MS8A 2E68A 1V4YA 3EB2A 5FL1A 1Z32X 3I6TA 1US2A 4CCZA 3L5LA 3A3WA 5H8PA 1NOFA 5HA7A 3W1UA 4JKMA 2C1GA 4DRSA 3W82A 1EGZA 2ZQ0A 3W1RA 2I5GA 3E2RA 3RN6A 2A7NA 5I7GA 2YLAA 1KR0A 3PS7A 5C71A 3XISA 4MLRA 4AWUA 1KM2A 3AS0A 7TIMA 4C5YA 2Y5JA 4F48A 3UNDA 3LEPA 5G5IA 3TFXA 4LXFA 1Q3NA 2VGGA 3QF0A 3ZT7A 4DUXA 1NFGA 1ALDA 1TTJA 1L8PA 1K77A 3K4DA 5ECUA 2NUYA 4O0KA 1VC4A 3QMSA 4D6GA 4XD5A 5FJOA 2GJLA 1XKJA 3UPWA 4GZ7A 4HOXA 1JI1A 3NL5A 1US3A 2BP1A 4C6JA 3T4CA 3EWYA 3W23A 1DE5A 2ZVIA 3W37A 4L61A 3UGVA 3CAWA 1OGSA 5CXPA 3TYBA 2B81A 4JTIA 1MYRA 3CAVA 3P8IA 2Z6JA 1EJUC 2VD8A 1ISYA 3CEPA 5GNZA 3PZUA 2AMXA 3VKBA 4CU8A 3WQOA 3GC2A 4ZZ9A 3RCMA 3UWQA 1XXXA 1AODA 1DJWA 3MC5A 1OK4A 2QF7A 1XIMA 4Q4MA 3R89A 2P88A 3SCSA 1ZALA 3TWAA 1D7KA 1ME9A 3CYVA 1B9BA 3P81A 2AOSA 3THAA 1U5VA 2CLHA 3HG3A 3L2LA 1OX4B 5I5RA 3OGRA 2FZNA 2Y70A 1MW0A 4DWSA 3LPGA 1TUXA 2CLPA 3S9IA 2G5WA 1T8XA 5AKQA 5CZTA 4GVIA 4CD5A 1D8WA 3N6HA 2FB3A 2V3FA 3UA3A 1V02A 4LUJA 4F40A 3LHWA 3N13A 2R1MA 3N25A 2D69A 3VDGA 2VWTA 3E6EA 4NYYA 1OHLA 2Z7GA 3VC5A 1GVEA 2JBMA 1RQEA 1LUCB 2FH6A 3LUTA 4XBJA 4IMDA 2IW0A 3PZMA 5A6BA 4UOJA 3CASA 5E9AA 3GS6A 4AD1A 1OC7A 5I77A 2OQHA 4FR6A 1Z41A 1OFDA 4JICA 3QY8A 1CXKA 4RJEA 5HMFA 2QLYA 3NQBA 5GPRA 3R5EA 4RCXA 4JQ1A 2YZRA 4LF1A 4YIWA 3U3HA 4LB4A 2D2HA 4OU1A 2F2HA 1M65A 3WMLA 5J5DA 4Z2KA 4PUUA 1E4MM 4R27A 4QCFA 3LCWA 5HQLA 3WQVA 3MCOA 4JTLA 1KLZA 1JYWA 1TA3B 4A21A 4NJIA 2Z1WA 5A3HA 5AHEA 2E3ZA 3GXMA 1A5BA 3IIXA 5CPOA 4HPNA 3TYUA 1XUZA 3AO0A 4KKXA 3W7NA 3M0VA 3ARUA 2OLAA 5E09A 1LL4A 1WUFA 2Z2AA 2G3FA 3PZGA 4C5ZA 5F4WA 1ECEA 1IGSA 1VFFA 2FYMA 4QE4A 1OIMA 3TN4A 8A3HA 2I1OA 4A29A 4MNLA 2GGJA 1UWSA 1OCJA 1PHQA 4JS3A 1PHWA 4UFLA 3LZ3A 3ITTA 3ZJ6A 1E4LA 4PTNA 3DFYA 4DI9A 2NLIA 1BF2A 4MB3A 4JPGA 3WLPA 3PWGA 1ICQA 2OSXA 5ABEA 1ZBVA 2C91A 4N4PA 1EGMA 1H62A 4TX9A 4XZWA 3OVPA 2V5LA 3M0MA 1IEVA 1FBAA 4CU7A 1EOMA 3NZGA 5A8QA 1JRCA 4X63A 3BOLA 4BK9A 1A47A 4IH3A 1Q13A 3OVRA 2IQTA 4H9YA 1SO5A 1V6UA 3VCCA 3IANA 4PGLA 1D3HA 4YPJA 3OTRA 3WSUA 1E70M 4GUJA 4IF2A 4WY0B 5FSDC 1A5MC 3WQDA 3I68A 2ODOA 2Q71A 4GK8A 1GZGA 1NAL1 3BCFA 2BXVA 4HBKA 5AECA 4R34A 2W61A 3WF3A 1DJYA 2IPFA 3CT2A 4GY7A 4FLQA 3CZLA 3L0GA 1FWGC 1LT7A 3MSRA 3LU2A 4F0KA 2Z1XA 3FNDA 4GI9A 3WLQA 2PA6A 2AGTA 1L6FA 1QK0A 1T5AA 2EF9A 1ZHAA 2YSWA 3O07A 1ME8A 4J2PA 3WQ5A 4GBDA 3WENA 2VFHA 4RE2A 5MF5A 3M07A 4QE5A 2ZVRA 1VLIA 1DIEA 5HNRA 3RILA 4IIGA 4JCMA 4BF7A 2ZRZA 3BZJA 4BQ5A 3QV7A 2PWFA 4JY8A 2GYIA 1FX6A 3F4NA 3HZ3A 1SR9A 1IEQA 1B90A 1D9EA 1P0BA 1RP8A 4IG2A 3V16A 3MMTA 4K1GA 3RYSA 1FDZA 5EMMA 3H4WA 3PZQA 3RPMA 2KAUC 2FGZA 3UD6A 2QCDB 3ANYA 2O9TA 2OZ8A 2X41A 3VIMA 1WAUA 1EHAA 1JZ6A 1GJWA 1CYGA 3QJAA 1F7BA 2Y63A 1TZ7A 1S46A 2HBXA 1DL3A 4GE8A 3QBUA 2QMKA 4DNHA 3JS3A 3EDDA 4UOZA 3QFWA 1BYCA 3T9PA 4KERA 3KHDA 4WKHA 4S3BA 4MSSA 3GTFA 3VFCA 5HNNA 5D03A 3D3AA 2E9LA 1GONA 1FKWA 4GWEA 4XBSA 1AJ2A 2JALA 4GA8A 3UYIA 3E2QA 3L2IA 1B3XA 2JE8A 1CIUA 2NSXA 6TAAA 5I3JA 4IMFA 5LXXA 4YTUA 3A24A 1RPXA 1B31A 2Q09A 5DLCA 3MB9A 1K3UA 2J62A 1UD6A 4AYSA 2V67A 1XI3A 4O1AA 1A3HA 1QNVA 4HMEA 5HOSA 5FEWA 2BOFX 2TODA 4ROQA 3GTHA 3WNNA 1ADSA 3DFQA 3K2GA 4JY9A 3RMEA 3MUZ1 4HOWA 1EEXA 3WJWA 3MUY1 3DBNA 1YXCA 1XLMA 4UC5A 1GPFA 1R2TA 2DZTA 1T8QA 3GVWA 2PLJA 4PMNA 3EMCA 1NJJA 1EL3A 2R1KA 3T81A 3A22A 3W2LA 4IM4A 4H7VA 4BFAA 3EOSA 2FPTA 3N6QA 1YADA 1WXZA 2WV8A 1KRMA 4H01A 1TX2A 3CPGA 3IVSA 1NARA 4GQQA 1MVYA 1DJZA 5TIMA 5I3GA 2QCHA 2O9RA 1EIXA 3C0QA 1T0OA 4DJEA 1AJ0A 1BYDA 4YVXA 3VX1A 2CBJA 4UIOA 3SUTA 4LBUA 4KEVA 1C7SA 3AMGA 1MW3A 4D1IA 3E96A 1K1DA 4WRHA 2E9BA 2NZLA 4XZ9A 4BQ3A 3CUXA 4WY0F 1MNSA 4W7WA 5CC7A 1R86A 3BG3A 3W00A 3ABQA 2OVLA 1IT7A 2C7FA 3OZYA 4N9DA 5C2XA 3U4AA 3EOLA 1KM0A 3NYZA 2E28A 1Y5VA 2WLZA 3RX3A 1R9XA 5DMYA 3AYRA 5C2CA 2DSUA 4FXSA 4CQBA 4OFCA 2PP3A 4JTKA 4GFIA 4XTDA 4WDWA 3F4VA 3T0CA 1U1UA 4KRTA 4M7TA 1GHSA 4WDXA 2I14A 2PCQA 1QASA 4GBUA 4PA8A 4F0SA 3N4AA 3PTDA 3B9OA 4G7EA 2OWXA 3LERA 2XM2A 4AEEA 4AWEA 2BOGX 3FVDA 1AK5A 4QG8A 4JFSA 1LRQA 3BURA 2PDYA 5FJUA 4CU6A 5HNUA 4AIBA 4DXXA 3W22A 4IXXA 1OIFA 2OGYA 4K39A 3EX3A 3EWZA 3YPIA 3OOQA 4E6MA 3W7LA 5F2IA 2RJHA 3BSMA 4IZGA 1OZMA 3ONCA 2PWGA 4HZ6A 3AQUA 3PZIA 1LF1A 4QM1A 2XVLA 1TJPA 3LK6A 1M7PA 4WUIA 4US5A 2AKZA 2DZPA 1QBAA 1WUEA 2VX5A 3DYOA 2E8ZA 3UP8A 2ACSA 4GO9A 1JZ4A 3P84A 1E40A 4K7YA 1GEHA 1W3IA 3V35A 1PPIA 5LIUX 3KVKA 4QLKA 3W76A 2R8WA 4LUSB 3DENA 7A3HA 3FEQA 1FP8A 4AISA 1I45A 1QO5A 1CGYA 3VIPA 1MW1A 4HYRA 2Z27A 3KOZA 5AB3A 1OINA 2ZA1A 4UTUA 4A3UA 3W26A 3GXNA 1EPXA 3VKJA 1REQB 4WKAA 3GVVA 1TTQA 3EA2A 2WHMA 1MFUA 3LI0A 3BDKA 5HMSA 3L65A 5CC6A 3D5HA 3TLQA 4ZO9A 3MWAA 1B3VA 3C8FA 2C3ZA 3R0UA 2JIEA 3ZSSA 2C1HA 4HJWA 2EPHA 6XIAA 2EKGA 4FF7A 1KC7A 3OBAA 1J4EA 2PGWA 2Z7KA 1JVNA 1D8CA 1ADOA 1VB9A 2PBOA 2VZUA 4WXYA 1OJXA 3FX4A 4QX4A 3QKZA 3W02A 1XDMA 4GCAA 1XS2A 3GR8A 5XIMA 1VCGA 3AMDA 3IACA 3P0XA 1A5AA 2WXDM 3SRKA 4N4QA 1X6UA 2WQDA 4H04A 2V2DA 1PZ3A 1YE6A 2ZX8A 4TXEA 1V7YA 4W8BA 1MFVA 2UY2A 5JIPA 2I56A 3WBAA 1MI3A 1C92A 3AIEA 1YDOA 1TUFA 1GG0A 2BVDA 3OG2A 1JULA 4GZJA 3SCOA 1E0UA 3EDFA 1YTDA 4E4PA 5T91A 3CUHA 4OHQA 1ZJAA 3UXLA 4J27A 2TRSA 2DVTA 4HA3A 1YTKA 3AYVA 4HKPA 1UJQA 2GOUA 5C54A 4KFPA 3MTWA 1CBGA 4Q4RA 1UD2A 4Y9AA 5E5CA 5G1YA 4TU1A 4AF0B 1ZAHA 1N8WA 3QGAC 2JEPA 3VDBA 1YBQB 4IXHA 4ERGA 1GGOA 2FDMA 3SSJA 4CNOA 2DU2A 2ZZ1A 3WQEA 4OBRA 3BW3A 1NQKA 3KWXA 2CC0A 2RDXA 4RV8A 2H90A 3VDCA 5DBTA 4XK2A 5HNTA 1MZRA 1E4IA 2XN0A 3NURA 4QHRA 2C0HA 4FOKA 1ZCCA 1YPFA 5HXMA 3QR1A 1AW5A 2VC5A 3KTXA 4J3ZA 3FAWA 4BI7A 1XLLA 1M03A 2G50A 1OEPA 3UJRA 1NQ6A 3UJEA 5LXEA 2QZRA 3W85A 4M6PA 3V36A 4IFOA 3TW6A 3BJFA 3PSWA 1U1JA 4IX0A 1MQQA 1V3LA 1FWFC 3OLDA 4XKYB 1JNDA 2JKEA 4IGNA 4MGGA 1F2JA 2V82A 2YCLA 3OG3A 1GEQA 4ZO6A 2QIIA 2YYTA 1S38A 2W62A 1RBLA 3S5SA 5LNWA 1XLCA 3LBOA 4XAPA 3TQ0A 3URBA 4WZHA 5FJPA 4PB4A 2VX7A 4Y96A 4IT1A 3W28A 1R46A 2YXOA 4FR1A 1GHRA 4MOZA 1D3GA 1L2QA 2UWFA 3RJYA 1BFNA 3RU8X 3R13A 3WUBA 5HUOA 1L6GA 1VPXA 1GTHA 1PBGA 3IK2A 5FKYA 1V6YA 4LB3A 1TIMA 4EK7A 2CU0A 2PZNA 1O68A 3ZVHA 4JD4A 4HK7A 4ATLA 2ZZ2A 3BCJA 2PPGA 1JXKA 4X9YA 4L6OA 5HR7A 1TWIA 3O6CA 4WJEA 2GGEA 4RR4A 1R2RA 3LHUA 4MWAD 5IRPA 3N14A 3WLRA 2EG6A 4A8NA 4DIAA 5A6MA 2CLKA 3FXYA 3IRDA 1J0JA 3UQNA 1JRBA 3WBXA 4H6QA 3WMCA 3A3XA 2WBGA 3VYLA 3EXRA 2VUYA 5LGXA 2G3IA 4W89A 5F4SA 1Z44A 1ZJHA 2BODX 2GVGA 4KPLA 2ZA2A 2PDJA 1XBXA 4H2HA 1HJXA 1ODUA 2QF8A 3SY8A 3GG8A 4AZ6A 4W8LA 2O92A 2R94A 3CQJA 4MYXA 3OIXA 2NQ9A 3QR3A 2FGBA 1TSIA 3LCHA 3E5PA 4HU8A 3C4UA 5LSMA 5M03A 3K13A 4YWSA 5I23A 2ISWA 3IUHA 7REQA 3AS3A 1W91A 4UMAA 2V5JA 2ZXBA 3LD5A 2PDNA 4JDYA 4W88A 2YJQA 4I7VA 4NRSA 4F9JA 5FF0A 4IFRA 1O94A 1N55A 4Q8NA 1CB2A 3UR2A 1O5KA 4Q8UA 3WK1A 2XIMA 3JR2A 1PV8A 3LLFA 4K6AA 3FA4A 3SCPA 3Q2DA 1F74A 3UG3A 1XSIA 4H8NA 4B3KA 4M1BA 2Z24A 3WBEA 5REQB 3GTNA 4YWIA 3KW3A 4GMEA 4KFNA 2DZXA 3WJZA 1NDVA 1SUXA 1XD0A 3W3OA 5A6SA 3UVAA 1AL7A 2PWHA 2BVYA 3B8UA 4S3AA 3WELA 2EBNA 1JPMA 3IVTA 4JTQA 5KZMA 4J5NA 5JBFA 4LX4A 9RUBA 1SU5A 4UR8A 2WVUA 1NWTA 3WNPA 2R1PA 4AVFA 3F2BA 2F6UA 4E4FA 4XZHA 2PSNA 3BSGA 1XLAA 2E5DA 1WO2A 4ML9A 4AMCA 1HTIA 2W6RA 3QM3A 3ID7A 2YIHA 2EXOA 3W1LA 3RR4A 4FNRA 3OB8A 3E9AA 4LT9A 1JGIA 2ZWZA 3QQ0A 3RRXA 3LPFA 4AEFA 4QDPA 4Q8QA 4NAFB 2WB5A 4QJ1A 3VIGA 3EXTA 1EPVA 2DVXA 4DLMA 2Y2WA 2DZVA 3BG5A 2ISSA 2CZVA 4NI3A 1KBBA 1QAPA 4XUYA 3OYXA 3WNLA 2ZRUA 4A8IA 4MKNA 1BSIA 1I4NA 1X39A 4XAYA 5I78A 1DYSA 4U3CA 3TJLA 4F2UA 3P14A 5C9WA 1Z3NA 4RPPA 3TWBA 3F5LA 1S2TA 3INPA 3VOCA 3H7UA 1JEZA 1TG7A 5HPOA 4CUCA 5M3WA 1JCYA 1V5XA 1B2YA 4RE0A 4W87A 2PDLA 3L5AA 1HT6A 3BGJA 4PCNA 4WK9A 3GDKA 2YL8A 3TSBA 2D22A 1GJUA 3T0DA 4L6HA 4D6DA 1BRLA 1MO0A 2PF8A 3VK5A 3TNOA 1C90A 3ARTA 4FXFA 4Y90A 3TU9A 2V2CA 4ZEPA 1AW1A 5A6AA 1EBGA 3TTYA 4IMGA 4YVPA 3NSNA 4HN8A 4O1EA 1DXEA 2HCVA 2RAGA 2VGBA 5KZ6A 3GW3A 2DZUA 4OIFA 3WJXA 4PMJA 4DZ5A 1TJ2A 2CETA 3K8KA 3QYQA 3DCPA 3N2BA 4Z1CA 3R8RA 2QCNA 3EWWA 2RGLA 2NV2A 1UA7A 4U5KA 1F9CA 3IJIA 2Z28A 3LY0A 1ZAJA 1YMYA 2DGAA 4MWAC 3NPWA 4JXCA 2OU4A 2V0TA 4BF5A 2EPKX 6PTDA 4QLJA 4V27A 2OJPA 1K03A 1V79A 1TYGA 2POZA 1XLHA 8CGTA 3GWQA 3UERA 1LLWA 2Y8UA 4QS6A 1RLDA 3BLDA 5EKYA 3URAA 2P3EA 1K9DA 1XRTA 3NZRA 3UXKA 5BXPA 3TR9A 4NILA 3LM7A 1UBSA 4PUMA 2PWEA 2DY3A 3N9SA 4O15A 1TPUA 3BCDA 3TYEA 2HMCA 3GFXA 2VDIA 2CWXA 3VZXA 1E51A 4YCOA 2BWGA 3F4CA 4O1CA 4DJFC 1D2KA 3NGFA 3W7EA 2J7GA 2PDQA 3P6LA 3S1XA 2XU2A 4UMCA 2WOQA 2XIBA 3CBWA 4FHAA 3R7MA 2WWDA 3R58A 4HZMA 4X60A 3FYOA 2NX3A 2OYLA 2EPOA 4MB5A 1X7IA 2CLFA 4ALDA 3KEHA 3P93A 4WJ8A 3S2JA 4PMDA 4OJYA 4LVAA 4GCXA 2C14A 1SVDA 2CCRA 3H4XA 2CHOA 3GNRA 5CPLA 5I79A 1YXYA 5F7UA 1ITCA 3CV1A 4UTWC 2P50A 1VHCA 1X1ZA 4LW7A 4C6LA 1EP2A 3REQB 4UFMA 1ML1A 4WF7A 5K4ZA 1M01A 4I7WA 3UWVA 2WSYA 1WX0A 3VNYA 3G2GA 4PEEA 1XDLA 4XD4A 4HNUA 4Y7EA 3TYAA 2E7FA 1PZ1A 3CB8A 3OBEA 1DOSA 4LRTA 1HG3A 1RD5A 2XVPA 2W67A 1EJXC 1NF0A 4LBRA 4BI6A 4AD5A 4MB4A 4P7QA 4LAZA 3ARWA 1V6VA 4ZR8A 3CUFA 2ZUSA 4L9YA 1XCWA 3Q4DA 2XISA 3B8DA 3AROA 3C2YA 4JHMA 2VJXA 3WO8A 5IM51 3WH6A 2A3LA 3AS2A 4ZTXA 2VFEA 4OT7A 1DTNA 1TWWA 1SGJA 2DDXA 3AHYA 2FH8A 4HK6A 1O7AA 3B8TA 2HVMA 3IAPA 3PSVA 5BROA 1LBMA 4IUGA 3O16A 3M46A 4LQ1A 4GYKA 3V75A 3BW2A 3FSUA 3MI3A 1IT0A 4WX2A 2DP3A 4GUHA 3NXFA 5HWNA 5E1QA 2WSPA 3A6OA 4XBKA 3DAQA 2Z00A 2Z1BA 3T05A 2ZBTA 2Y0FA 3AZRA 1T96A 3N34A 4XZIA 3CWNA 4CKQA 2EAWA 2WZHA 2R1LA 3RM4A 1GVRA 3TTQA 2A3CA 3B4UA 3H24A 4QAWA 1WXYA 4GZEA 1Z8AA 1FHDA 1QATA 3TJ4A 4JIQA 1IWPA 4EXQA 4TVCA 1TWDA 4DNMA 4P7NA 2WPGA 3UFYA 4NX5A 1AMKA 3IJ9A 4MY9A 1JDAA 1B4KA 3IGHX 4AY1A 1E6ZA 2ZZ3A 3CO8A 2WMJA 4H9XA 3NYDA 1UUOA 1VPYA 1W5QA 4FIRA 4YU1A 6REQB 1WDSA 5I00A 1C8VA 4C6FA 3UZZA 1E71M 5J5RA 3WNKA 4GFSA 4HSHA 3H4GA 3IEBA 3QRHA 3R1ZA 2XZ9A 1CEOA 3S6TA 2Y1HA 1KKRA 4J3VA 3BLOA 4B15A 3OZPA 4S3CA 1XFCA 1FCUA 5A6TC 1TPDA 1AD4A 2OKTA 2W9MA 2DIKA 2C6QA 3W7GA 4QS5A 2HNHA 3VXGA 4JTTA 4WR3A 4RZ6A 3ZIZA 1EEPA 1F3TA 4DXVA 4TV6A 3WFLA 4RV3A 1R3QA 3E38A 1NP2A 2Y24A 4NJKA 4QIUA 5LNUA 1E3XA 2OSYA 3KOFA 5CSSA 2WBKA 5I3IA 4IP4A 5MKGB 4UR7A 5CPTA 3BG9A 1OFPA 3U8GA 2GUYA 1LBLA 3DN5A 5BMWA 4DWSD 3F1QA 5AYBA 4TQTA 2PB1A 2VO5A 5FJIA 1A5NC 3WMBA 1E0VA 4EF8A 4FALA 4C7GA 3VD5A 3AIRA 4DM2A 3TUUA 4QG6A 3WCZA 2HTMA 2F61A 2WPBA 1BXNA 4LCSA 4AZIA 4A3QA 1AVAA 4Q8MA 4H3DA 1HJWA 5LIWX 3M0IA 1UKPA 2C19A 5CSRA 4PEKA 2VDHA 4M1RA 3KLKA 2WMIA 4GXWA 1F5ZA 4C6CA 2G95A 3BAXA 4AD0A 2ZX5A 2AL2B 2DORA 4EVZA 3LQGA 1QT1A 1EFZA 1TKKA 4W86A 1DWAM 2PDGA 3HU7A 3CHCA 1OCBA 2XIQA 2QULA 3C2RA 3NZPA 2HXTA 1MSSA 1C9DA 2PC8A 2PTXA 7XIMA 5KTLA 4AHQA 3USBA 3WNOA 4IPPA 3CAQA 3W75A 1POJA 3G6LA 1OSEA 2CLIA 4INFA 4BQ4A 3N4EA 4IFKA 4PCTA 1UR0A 1DXIA 1O1ZA 4L65A 2OT1A 1P0KA 2A7RA 3RM8A 5BMXA 1XLDA 1HNYA 1ICPA 2QYGA 1LQ2A 1KW1A 1V0LA 4H19A 1XYLA 3UW6A 1XUUA 1VEPA 4O12A 2OEJA 1AQHA 3NPXA 3VD3A 5IDZA 4B5TA 3MCMA 3RNDA 4K36A 3HOJA 4MWAB 5D9NA 3EX6A 3PM6A 3POHA 3WQFA 1H7XA 2X2GA 1Q2SA 2WYSA 5FAJA 2EPMX 4BY3A 2REQB 1XIGA 4B3ZA 3SUUA 2VKZG 3UWUA 1PYMA 4UFHA 2QGYA 1LM1A 4FIQA 4UQCA 3SCNA 1E6QM 2VGFA 3L0KA 3CMJA 4A4AA 2GSJA 3P60A 2J8TA 4LC8A 4GNKB 5PTDA 1Q85A 1R9YA 1BYAA 2E8YA 1IR1A 4ADTA 1CXIA 3LLXA 5H8UA 4G2DA 2FB2A 9XIMA 3ONBA 4U10A 1RY8A 2VL4A 1JUEA 2R9RA 1MEHA 1AD1A 2OGJA 2HWGA 1TE1A 3AXMA 1OABA 2PBGA 1F07A 2HVNA 4Z42C 4J1OA 1M68A 3IJ7A 1RJPA 4WXZA 3PBUA 1THFD 1WXJA 2PDBA 1XGZA 3GAYA 3WEOA 2XSAA 1A3WA 2WCAA 5RUBA 5A5WA 1XINA 4ILSA 2R1NA 5BZAA 1JCMP 5LZLA 2XZ7A 3AXIA 1LUCA 1K02A 4JYDA 3QHOA 4HJFA 5IXEA 5AC5A 2NV1A 3OQ8A 3GNPA 1V3KA 2GJNA 3V5OA 3W2MA 1Q45A 3T8LA 3OVQA 1PKYA 2NXIA 1HFBA 1FHLA 1I2QA 4JDBA 3SO7A 3GG7A 4BJHA 1G5AA 1E0TA 4HTBA 3N3TA 1TMQA 3QN3A 3DECA 2G0WA 5FA5A 1LL6A 4JZ5A 3CQ0A 4MYAA 5IHRA 2Q6ZA 1S2VA 4N9EA 2VOMA 1F3XA 2D2GA 3BV7A 3WUFA 3GTIA 2A6NA 1NWRA 3GR7A 3TX9A 4JQAA 3FJLA 2PZ0A 1TA3A 5AHMA 3R25A 1KCKA 1EJVC 4UNIA 3WL1A 3BZGA 3BGAA 1M41A 1QNOA 4DWSC 5BOFA 4CNPA 5C55A 1V77A 3CGTA 3K5XA 1J2WA 3R94A 3FCPA 4Q8PA 3HO8A 4QCEA 5CJNA 1FWWA 2WQPA 1CCWB 2ZICA 3N6JA 1X7FA 3CL7A 1VR6A 3TN3A 1A0CA 3M0YA 1A5SA 1JZ5A 2X1IA 3QY6A 1B57A 4WDTA 3S4TA 3CS2A 3UETA 4AWTA 4XSMA 5D2YA 4RE3A 2E6AA 1T7LA 3O1NA 5EMKA 3BH4A 1WYIA 3PVFA 3KCJA 3FK4A 4F4RA 2XWEA 3B0VC 3WH8A 1UP3A 1TR9A 3C0SA 3WDJA 3OBKA 4EPBC 1JD7A 2BFGA 1W54A 3NOEA 3RXZA 1EIBA 1QW7A 1TPVA 3H2CA 4UCGA 2PLMA 1P6WA 3VOGA 3BANA 2HS6A 1MRQA 4BA0A 4TTUA 4AX6A 4Y9MA 2CNCA 3KDNA 3HM7A 3BLLA 3BOFA 4DYJA 5HJYA 5EMLA 1FWEC 5D2XA 5BXSA 1Q8JA 2NT0A 5CZSA 4AZCB 2YB1A 4HZ7A 3ZVIA 5I3KA 3IGUA 2ZRXA 3WLOA 1JFHA 4FS9A 4WY0A 5GJNA 2X09A 1RBOB 4ORIA 2QPUA 2V5CA 3HFYA 3FY1A 2PURA 2J47A 1H51A 2WKLA 3N17A 4DO6A 4MIMA 1PIIA 3WEZA 2AKMA 3F2DA 5A2BA 1UIOA 1H0GA 3MZ2A 2WVVA 1K9FA 2IQDA 1O95A 5DMLA 3TXVA 5D32A 1XRSA 3P3BA 3KDOA 1W1IE 3WDHA 1GQKA 1Z7AA 3A4JA 1RLCL 4M0XA 4QROA 3W7PA 2PCEA 3AICA 1LL7A 1BD0A 3TCEA 2CPUA 4LYKA 2YLLA 1YDYA 1G4PA 2ALRA 2YYUA 1OF6A 4PMYA 4E2OA 5C5YA 1EP1A 2NVCA 1Q6LA 2G3NA 1ITQA 2B7OA 4H4IA 2R82A 4S3EA 3HPZA 4NI8A 1PDYA 2GUUA 3KP1A 3OGSA 1H41A 2Y85A 4N02A 1YPXA 5D33A 1UQZA 1A3XA 4ZE5A 2OWWA 4YYCA 4ZFMA 1EXPA 3A5VA 2VCCA 3I10A 4BS0A 3PPCA 2YDQA 4CVWA 4GXMA 1H63A 1G9HA 5A95A 1FY6A 3IUDA 3SRHA 4O19A 5M5DA 4GGHA 3ERPA 3S9YA 1KM4A 4TR9A 4LUTA 2BY3A 3FW6A 4LAUA 1DP0A 2VNCA 4X0NA 2GGGA 4REQB 1KFLA 1M3UA 1VFLA 1SJDA 4ZSUA 3VOFA 2CYGA 3HPXA 4I6KA 4CD7A 1FCQA 5XINA 3NQ7A 3NXLA 2PLCA 1HL2A 2AL1A 1ZBCA 3EEZA 3KRBA 1E1EA 1KTCA 3EWUA 2YL6A 2D0FA 1HUVA 2V3GA 1OGGA 4BF9A 1W5NA 1I0BA 3AI0A 4RXGA 2JIWA 1HJUA 3CK5A 1XC4A 4NIRA 2Z2BA 4CQ9A 4B4HA 3M1ZA 1YPIA 1VQTA 3M6YA 3UZ5A 4MPQA 2C0AA 3RITA 1J79A 1J5SA 1FWJC 1UHVA 4Y9PA 3DFTA 3I7SA 3PUDA 2QUNA 5K3VA 4LEQA 2PDKA 1SZFA 1RK6A 3FHAA 1KGWA 3WK2A 4TMCA 1ITXA 1E5JA 1OVDA 4GIAA 2OODA 2GVJA 1GQJA 3UR7A 4K8EA 3MO4A 3NSMA 2OZ3A 4US5D 1H7NA 3BUVA 1VFSA 2C79A 2YXGA 4PCPA 3N2MA 3STPA 4B5XA 1OYBA 4RZ5A 5D37A 1OFEA 5CZ0A 3LZ5A 4HHHA 3TW9A 3IJ6A 3E2SA 1R3WA 3LCIA 5DANA 1JPDX 3EX2A 4DUWA 4OECA 5EA9A 3AHVA 5KEZA 1NU5A 3AXHA 3QSTA 1SR0A 5LHEA 5EBAA 3ELFA 3TNBA 3HPFA 2DW7A 4O1DA 4L1XA 4A3YA 4NSBA 3JW7A 1RP9A 3G8RA 2DIJA 3CAKA 4BEUA 4LU0A 3W4RA 1H09A 3HQOA 4C1LA 2HS8A 1TB3A 1KBKA 3MJMA 5G4WA 4MVAA 4H8UA 5FJJA 5I24A 3AXXA 3WKZA 3VOIA 4HU3A 2E77A 2QCFA 3LMZA 1R8LA 1VYSX 3HQPA 1PEZA 3LSCA 2GZXA 3QTGA 4CNNA 1VF8A 3FOKA 4O1BA 4X61A 5CBBA 1PWLA 5KZDA 3G3DA 1V6TA 2VI0A 3T44A 1H7OA 3BARA 4D8AA 3CYJA 3T2OA 1MDLA 1Z89A 3TK7A 3VIHA 4W7VA 2XM1A 3AMKA 3GHTA 1EF3A 4NAEA 4JIIX 1XIBA 3ZXWA 4DJDA 1UR2A 3BL3A 4NNBA 1BGAA 2W66A 4MY1A 4Z0SA 2RFGA 3LCLA 3RRAA 1VZWA 3SGZA 4GACA 1O60A 5EGRA 4DB7A 4GUFA 5H8MA 2QDDA 3LNMA 5A8NA 3GDLA 3GC4A 4LNYA 3GX9A 3OPSA 1CNVA 5I6SA 1KNWA 3G1SA 2QDGA 2J25A 2V5DA 4KIRA 1TJ1A 3EPOA 3ZZ1A 1JUBA 3VOJA 4AB4A 4K1WA 3G1VA 2XH2A 4HHMA 5A6KA 2R14A 3KRZA 2RDWA 1RV8A 4DJEC 2VQUA 2ZIDA 3V5FA 2CLOA 2WWCA 2Z25A 5LA0A 1Q63A 3FFSA 3SCVA 3J7HA 4LBSA 5FACA 4P2VA 4ZQPA 5CPMA 4AIOA 1G94A 4MPKA 2GK1B 3W1QA 5FCZA 1VCVA 2PGRA 3ECQA 4ERIA 2MUCA 4GPNA 5IDIA 3SADA 2OQLA 3U5UA 1FWNA 4HNCA 3ES7A 1G7VA 3SB0A 1QUMA 3QGVA 4DWSB 3IUIA 5DELA 1DQUA 4RPQA 4DLFA 3HGOA 2J88A 1FKXA 5D4YA 3UWZA 4O50A 1IIHA 1I2PA 1SZGA 4UXDA 3MJYA 2QMJA 1XRFA 5EMJA 1E9ZB 2DVUA 4UZUA 1PTGA 4O11A 2PTWA 3AISA 1W1ZA 3BO9A 2EKCA 1W1PA 3B8WA 2HPMA 1HXJA 3C8NA 3L5MA 3DG7A 1UOKA 1GOQA 3WF4A 4A6GA 1J12A 4F79A 3APTA 1FXQA 3CV6A 4CNSA 4ATWA 2HBVA 1E73M 3GQYA 2PWVA 3WYZA 1EDGA 3PZ9A 1W9DM 1RJQA 4I5XA 3KRSA 3W2KA 4MUPA 3LCFA 1MUWA 1F05A 2CESA 3NNTA 3AAMA 1EA9C 4DBEA 1TIWA 4WLCA 2YX0A 4WKFA 5HJXA 3PBYA 2ZTJA 5FF2A 1ISXA 4O4VA 2BGQA 1KXVA 2XG9A 5TAOA 1C9WA 3T7VA 3ZLHA 1JAKA 1ZJBA 1FWHC 1UUQA 1RUSA 3H70A 4C6PA 1JZ8A 1XH2A 1O4UA 1CT5A 3IIVA 3TV8A 1LQ0A 4MZYA 4QSHA 1QWKA 5FF4A 1XQKA 5JIWA 1I1WA 4K38A 4RNJA 2QNEA 2WW5A 4ZENA 3BLIA 4XVEA 1K7FA 3Q37A 4ZBCA 3KTSA 1CX9A 3VIJA 4IIDA 3CO4A 1XG4A 1FVPA 2FJUB 3MBFA 1XIEA 1Q4WA 3UJSA 4ZSTA 2Y88A 4AF0A 3CMGA 3LG3A 5DXYA 1FH8A 3NOYA 4KCUA 3CIXA 1ZL1A 3HG4A 4PUWA 3GBEA 1PIGA 4HSNA 2VC6A 4ZFCA 4J9JA 1PDZA 4OBSA 3AS1A 3KTCA 5HDRA 1B9ZA 4O4WA 2YB4A 2GGIA 2FHCA 3MT1A 2B7QA 3QPZA 2ZX6A 1BXBA 4U33A 4FK9A 1AZ2A 1IXPA 1GQNA 4ZB2A 6CGTA 3M5VA 3SCWA 2A4AA 1KFJA 2X7WA 4LFYA 2QDHA 5I07A 4QLLA 1PX4A 1KV5A 4G1NA 4M3PA 3SECA 2XFRA 2D2OA 2J7HA 4XUGA 2ABBA 1UH2A 4G5DA 3AZTA 2F7FA 2YA2A 3OVGA 4UTIA 1NY1A 1NELA 3EOUA 1ZZMA 3W1MA 1JJKA 2AMGA 3DGBA 3GTXA 3LHVA 4KFOA 3OLEA 4LVDA 4IIFA 3PAJA 3R2GA 3HQNA 4QAIA 1H61A 3SW6A 3R11A 4UCFA 1UB3A 1VFTA 2QJJA 3URNA 1MUCA 2VOTA 4CCCA 3MU7A 1UCWA 3NPUA 4PE8A 3PG9A 1J11A 2YBTA 3WH9A 1DBTA 4XISA 4O8RA 1FWRA 9XIAA 3MV11 3K1GA 1I2RA 1H5VA 2GSHA 1XYCA 2D73A 4WQ6A 4UTTA 3GKAA 4GH1A 2YA0A 1DJHA 2XINA 3KZSA 3W1TA 1AL8A 4EP8C 4F2TA 2DZAA 4W85A 1YNPA 1XL9A 3VMOA 2NQ5A 4PMRA 4R5EA 3HA1A 3O0KA 1HKMA 4FSAA 2VEGA 1K7EA 5E93A 1DVJA 3VPLA 1SW0A 1KBIA 1XYAA 5ABHA 4DN1A 4DXKA 3KVMA 1CXFA 4IG2B 1VIZA 4HNTA 3BQ6A 3L21A 4C65A 5E6ZA 4F2BA 2FZ8A 3TAOA 2X8RA 1XSJA 3F7JA 4GVHA 4OVXA 1PVNA 3DHFA 3WJSA 4IPJA 4M8UA 4XVDA 5EBUA 3D46A 1R7OA 3KXQA 1AH4A 2PDFA 3HV8A 3C2FA 3BWWA 1HQTA 2DW6A 1Q6OA 1B3YA 4TMBA 2J77A 1KQZA 5F2GA 3MKVA 4U3AA 4LANA 2QV4A 4FA3A 3H23A 1IIGA 2G8ZA 1WBJA 2YW4A 2QUVA 2G96A 2X0SA 1WKDA 1TE6A 2BHUA 4DZHA 1R0MA 1OQFA 1W9BM 2WHKA 1RA0A 4B90A 4B91A 3CNYA 3W2JA 3R79A 1XBYA 2DQWA 1FWCC 1WNOA 2J7DA 4ZB0A 4IQJA 5LNSA 3UYCA 1K4GA 2OWCA 2A79A 3AUOA 4IIBA 4LV4A 3LCGA 2GFTA 2YGYA 4DBSA 3PFRA 3HFTA 3WLHA 1XPGA 2VFDA 3TC6A 2GQAA 4R9XA 4A22A 4GINA 3FHQA 1S2AA 1NTHA 2CLLA 4YYFA 4DO4A 3W9ZA 3TZNA 4GVFA 1AUSL 2P76A 3R4IA 4LYRA 4XIMA 3UXAA 3SUVA 4O52A 3VKKA 5HPCA 3O05A 2H9AA 4HMCA 3A4WA 3B4YA 4DEFA 1V7AA 2FFIA 2XIJA 3W6LA 3GHRA 2DZBA 2QEZA 1PX8A 4HP5A 1AJZA 4E4UA 2OO0A 4D6IA 4PSPA 4U4MA 2D3NA 3T0BA 3MUCA 3KM8A 3VOHA 1X8FA 4QJ3B 3VIKA 1VRDA 1YDVA 1VENA 4C60A 4AWSA 2QQ6A 1XM3A 1CZ1A 1M53A 3HN3A 2YL5A 1IWAA 1JCJA 2PP0A 3EOEA 3S5OA 3G22A 4GUGA 1L2UA 3B3DA 4MDPA 1QPNA 3WQ6A 1XLGA 2Q8XA 1HN1A 4NNCA 3MPGA 4HU0A 3S1VA 4LAOA 2GLKA 5DT7A 5A8PA 3QW4B 1B3ZA 4XZNX 2NSOA 4YTRA 1GYLA 2PMQA 4L9ZA 3U6WA 2D23A 4LH8A 4W5ZA 1UC5A 2GQ9A 1QCWA 2VRJA 3DI1A 2VENA 2CHRA 3TYZA 1R3YA 1TX0A 5D8WA 3NFUA 5F4XA 2XSXA 3F2CA 2DSVA 4GABA 3CZEA 3V1PA 4OOUA 3P2VA 1GKQA 1TV2A 2CXGA 1E3ZA 2RKXA 1XGDA 4UTMA 3LHZA 4CN4A 4LC6A 5GJMA 4UTJA 3O6AA 3HIJA 5BRBA 3RG6A 4TTGA 2FTWA 4MTVA 3DFSA 1JDFA 3WQWA 3WLLA 2WSKA 3ARPA 2VCAA 4IMEA 3ABOA 3QZEA 4M51A 1MNZA 1X97A 4J28A 5C6MA 2DT0A 3KE0A 4XZMX 1F73A 2F38A 3P8JA 3EGJA 2NWRA 2D0GA 1H1NA 5FEXA 5D9PA 3CZ8A 1W3KA 4IGSA 3B97A 2VX6A 1AMYA 1H2JA 4QQUA 1F6KA 1UD5A 3ATYA 4DBUA 3VUSA 2BXZA 1Y8BA 3GR4A 3K4WA 5KETA 3UR5A 1XLBA 1SSDA 4D6HA 3O0FA 4HCHA 4XD6A 2H8ZA 4JFVA 4GJIA 3WLKX 1GKRA 4JFWA 3NDOA 1EO7A 2YDSA 3QPEA 4LV9A 2XGZA 1OADA 4KCTA 2CBUA 3NCOA 3W7KA 2YCEA 2VT0A 1JG9A 2JFEX 4EXAA 1JGMA 4M82A 4GUIA 2FVLA 5A2CA 1F4AA 2YDAA 1CENA 4NYUA 3LTSA 2A5HA 2CEQA 5DRCA 3CHFA 4GC3A 1YQ2A 2D20A 4W93A 5C2GA 1IE7C 2FPYA 3W86A 3B05A 2G4JA 2OFJA 1ZB5A 3IAQA 3ABXA 3BMVA 3IV3A 1LWJA 3S2NA 5FEZA 4M5PA 1J0IA 3SCRA 3AOFA 3M7WA 1EYWA 1KWKA 3AIBA 1E1CA 2ZX9A 3CV7A 1IZJA 3DX5A 1EQPA 3KBJA 1XIFA 4JKLA 3EEGA 1OCQA 2IXUA 3MKCA 1OF8A 1EH9A 3ZR4A 1L6WA 4CNTA 4IWWA 4RL3A 5MHBA 2P8BA 3G3MA 3A5FA 3QQ1A 3SN1A 3M0ZA 3U0HA 1PCWA 3GIQA 5CGQA 2D3LA 1F6PA 4HA0A 3Q45A 3NQ6A 4YHEA 2I9UA 4KW2A 3Q58A 3UVIA 2I17A 4UB9A 2HNEA 4JQ3A 1YHTA 2JQXA 3H2FA 3G0SA 4JEJA 2BXYA 4GI8A 4BQ2A 2ATMA 4AD4A 5A2AA 3H21A 1W9PA 3WY1A 4FLOA 2NQHA 3GE7A 3CMFA 3P7YA 1VP5A 4QFUA 2YPIA 2V38A 3HJEA 4HYWA 4URIA 1SZNA 2O56A 2W4XA 4Q3MA 4WSHA 3A4XA 3IIPA 3WLNA 1YNQA 1VAHA 1QI0A 1XX1A 3BOXA 2ISFA 2HJPA 4FF5A 4S23A 4DPQA 3I3DA 3PUGA 3LV5A 5D38A 4ZE4A 3STGA 1VEMA 2LLEA 3EPNA 3E5BA 4MFDA 1GVIA 1ZAIA 5ECVA 3ABSA 1O12A 3KL0A 3RDKA 3SRDA 4J4KA 2WCSA 3LPOA 3EB3A 3O6DA 1OG0A 3UT0A 1FFQA 3T8QA 1RHCA 5BOOA 4KIEA 1DTUA 1E9LA 1EOKA 5BU6A 1IEXA 1TV4A 2IPGA 3E0VA 4MM1A 3LRKA 2DUAA 1DJGA 1VJIA 2FGLA 2V68A 2PDPA 2NW0A 1JF5A 4R7WA 4B5VA 2QV5A 3OW1A 1ZP4A 2FQIA 4PYSA 1K9EA 1V08A 4Y6GA 1Q2RA 1UWQA 4JTEA 2O7QA 4IISA 1POKA 4EE9A 2J66A 1XLEA 3VIOA 3LN3A 2XFFA 1W2PA 4IJRA 3D47A 2BSLA 1RVKA 1SZRA 3PB0A 1LT8A 4ZOAA 2YCLB 1ZCOA 4JHZA 3T0AA 1P43A 4H7ZA 4OGZA 4B92A 3ITVA 5DBUA 3U2ZA 1RQBA 1A53A 3FDGA 2J7EA 1VFMA 3CH9A 7CGTA 3GAKA 2WZMA 1U33A 1J18A 1B3WA 5XIAA 1DHPA 1VBUA 1W1YA 1UJPA 1SPQA 1OD0A 4ZQMA 1QOPA 4TIMA 4IGHA 3I7RA 2IKIA 1S3HA 3ZVHB 2W79A 5I2UA 1M9HA 3QMRA 1PTAA 4M29A 3UGRA 4JNMA 4AMAA 3OA5A 4DELA 1IQ8A 1XWYA 3U7BA 3SGGA 5CGTA 5FF7A 3UCCA 1GVSA 2PDIA 4JN6A 4TOQA 2GJXB 1Q65A 5U7SA 5H2ZA 1H7PA 3R6IA 1VCFA 3W7JA 5TD4A 4LYQA 4JN8A 3S1GA 4UWMA 1BQGA 2V69A 3E12A 3HTWA 4AH7A 3KAOA 3KS5A 2I57A 5IOBA 1KM5A