3VE9A

Crystal structure of orotidine 5'-monophosphate decarboxylase from metallosphaera sedula
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
204
structure length
204
Chain Sequence
MNRVILSLDSPIPEETLRKLNGKVAGIKVGWPLLLNLGKEKVKELVGLVDGIKILDLKLADIDNTMILIVDELKDITNSFIAHAFVGVEGSLASLSQRVDLFLVLSMSHPGWNDAFYPYLREVARRVNPKGFVAPATRPSMISRVKGDFPDKLVISPGVGTQGAKPGIALCHGADYEIVGRSVYQSADPVRKLEEIVRSQEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Metallosphaera sedula
rcsb
source organism Metallosphaera sedula
molecule tags Lyase
total genus 77
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ve9A00
2EHHA 1A5BA 4P2VA 3G1AA 3IVUA 4UMBA 4XTDA 3FIGA 3DFOA 3WK1A 1SFLA 5CZTA 3HGOA 3S5NA 3FJ6A 1G7UA 3R2GA 4O1DA 1H5YA 3LTPA 1BWKA 5LZLA 3RF9A 5G4WA 3EWYA 4JYEA 4AWUA 2E5DA 3I6RA 2DZSA 3TX9A 3UY7A 4LVDA 3UZJA 2P1FA 3LCFA 4BR1A 4I7UA 3WJZA 2J9ZA 1JUEA 3TK7A 1GVSA 2Y89A 5H2ZA 4X9SA 3WK3A 3UWUA 2C19A 4HNUA 4FXRA 3IGUA 3FYOA 4Z0SA 1VYSX 1LORA 2W6RA 3EWUA 5KZEA 3ATYA 2GQ8A 4NJGA 4MIMA 3C3NA 5C5YA 4FX7A 4CNPA 4Y9AA 1M7PA 3NAVA 4NZFA 5C6MA 1GYLA 1X1OA 4XWUA 4MOZA 2YFOA 3EWBX 4RJEA 1T96A 5D2WA 4DEFA 1ZJIA 2I1OA 4XQ6A 1IXNA 2A5HA 3IIVA 3QPYA 2VFHA 4KFOA 1MXSA 1KFBA 1EUAA 1X8FA 4RZ4A 2PRHA 3F1QA 5D32A 3C2FA 5KMYA 3LHWA 3NQCA 4BWLA 4LUIA 1ICSA 1A50A 3EXTA 2JK2A 3CC1A 1ICPA 3EX6A 4UNLA 1GVQA 4JEQA 4A3UA 3S9YA 2ZDRA 4N4QA 3BLIA 2ZRYA 2H8XA 4UTHA 1EX5A 1PHQA 1N8FA 4CCEA 4UTTC 4GNJA 3NQEA 1V5XA 3P82A 1LBFA 1RQEA 1X1ZA 5LNSA 3TMQA 4DQWA 2CU0A 4NT0A 1F74A 4NXSA 2VFEA 2QF7A 3Q37A 3THQA 3L5LA 1GG1A 3MYPA 1LP6A 5F4XA 1AL7A 3RFAA 3NQDA 1YDNA 2PRMA 1XDMA 1I45A 4UFIA 4LW7A 2QJGA 3CIXA 5D33A 5EA9A 1ZHAA 2BXVA 3O6YX 3GDTA 3P8IA 4WD0A 1LLZA 2CLEA 4Y8FA 3G1FA 2RFGA 4E38A 2A7PA 3NEVA 3JRKA 2ZA3A 3GNNA 2YSWA 5LNRA 2GQ9A 3NZRA 1K3UA 1ZFJA 3OG3A 5D30A 4UTUA 1N7KA 3HOJA 1QWGA 3NR0A 2GVGA 2WSRA 2DU2A 2Y7FA 7TIMA 2BTMA 3KOFA 1IIGA 2XN0A 3E9AA 3ZFHA 2X2GA 4ML9A 4TU1A 1VRDA 1M5WA 1SFJA 2I9EA 3PB2A 4GUFA 5DLCA 2QCNA 4FNPA 5D05A 4UUIA 4UTMA 2VFFA 1F5ZA 3LXAA 4OT7A 3DXIA 1H63A 4IMCA 2DZVA 3ABQA 1Q6RA 5C2XA 3TUUA 1SO6A 1NVMA 1VR6A 4WJEA 1OG0A 4TX9A 1EP3A 4RX0A 5EYWA 2QCCA 1KM1A 1LBMA 3VCRA 4O17A 5AHLA 1FXPA 4CCDA 4K38A 3WJSA 1JCNA 4K6AA 1OYBA 3W86A 4U4MA 2O7SA 2JBMA 4AHPA 5BOOA 4JYDA 4DO5A 3LCGA 2ISSA 3GK0A 4YCOA 4FIQA 4UIOA 3G1DA 2GJNA 1XDLA 3UXDA 5FEXA 1EEPA 5CPOA 1LOSA 4OU1A 1R30A 2CWNA 4RR4A 2VFDA 5G2HA 1FWNA 3A9IA 1LDCA 3G1XA 4O15A 1TYGA 4FHAA 4OE7A 1WOBA 5G2WA 5LSMA 1RZMA 5K3VA 2AQWA 1TV8A 1QPOA 3M41A 1RVGA 2NLIA 4YLWA 4M6QA 4NJHA 5FEZA 1Z48A 2JKAA 3BLFA 4UFMA 5HNRA 4LOCA 3CPRA 4HPJA 3W1RA 1W5NA 3VNDA 4UC5A 1B3OA 4AMAA 3HGRA 3IRDA 2BWGA 1KFJA 4O1BA 3TW7A 1TREA 4ZMGA 4LT9A 4AXKA 5EPDA 4QNWA 5BNKA 1AW1A 1SW3A 1BTMA 4HIBA 3C61A 3L68A 2PCQA 1OX4A 1G6CA 3AO0A 4FEZA 3GAYA 3TCEA 2CLMA 1AL8A 4LS2A 3LLFA 1L6WA 2QJIA 3O06A 3LRLA 1HG3A 2ZA2A 2TRSA 3EX4A 1G69A 3WFAA 1NSJA 3W1XA 2ALDA 1G7VA 1B57A 1OYCA 1QCWA 3SR7A 3PBVA 2YGYA 2FDSA 3L2IA 1PCKA 1QO2A 2WJZA 3OBKA 4DXVA 2VEMA 2ZTKA 4O19A 1ME7A 1QR7A 5BW6A 2P0OA 4M5PA 1XL9A 3CTLA 1EB3A 3W2UA 1WYIA 3HG3A 1FDZA 1TRIA 1O95A 3M44A 2ZRWA 4JR5A 5D2XA 4ZQMA 1OK4A 4JTLA 1ZAHA 2NUWA 2QCHA 4JTJA 1SQ7A 3TFXA 3NQVA 5HJLA 3TROA 3O15A 4OWGA 3LOTA 2WNNA 4LVGA 4RZ5A 1DQXA 4AHOA 3QMTA 1H7WA 3SGUA 1LRTA 3BG5A 2C15A 3FKKA 3PVFA 3PWAA 4AVFA 2Y6ZA 2QCDA 3BVJA 2FB3A 3S0CA 1VQTA 3GDMA 1KFEA 4RLIA 2NX1A 4HHPA 2Z6JA 4MUZA 4DBDA 3KXQA 1XXXA 5A8GA 4DF2A 1SZEA 3N2XA 3E02A 3SGZA 2VXNA 2C13A 4N4PA 4QNEA 3W7IA 3ATZA 3A24A 4AF0A 4ORIA 4PEKA 2YCEA 2VC6A 3MI6A 3S1XA 3P74A 2CZEA 4LVAA 1UCWA 3N9RA 5DELA 3MBFA 2QDGA 5LNUA 2GJLA 3GKAA 4CNNA 1JVNA 4HT3A 3OVQA 1K7EA 2DZXA 3FFSA 3QPZA 3MJYA 4XKYB 3UWZA 4NZJA 4FNTA 2CW6A 3QEZA 3W2LA 3BGJA 3EX2A 4JS3A 3GZ3A 3PM6A 3VE7A 1OVDA 1R2TA 2NXIA 4LTSA 3S8HA 4E2BA 1DJNA 4O14A 4A21A 3TAKA 2X1RA 2V2CA 5F4WA 1I8JA 3W1LA 4JTUA 2RHGA 1WAUA 2Y63A 4UXDA 1VCVA 3UY8A 3LCIA 1LZOA 2NUYA 1LM1A 2C3ZA 2C6QA 1PIIA 1LCOA 3GIYA 2PE4A 2WNQA 3NQ8A 1XBYA 5GVJA 5D2TA 3PBWA 3NQAA 3IGSA 1EP2A 4ADUA 3QQ0A 3QSRA 2XN1A 3N9SA 5IBXC 3U6WA 1ZENA 2E6AA 1G4TA 4PFMA 3MP5A 5HR7A 2CLOA 4JGDA 3WJYA 3NPWA 3N34A 2DP3A 4FNUA 1KTBA 2NV1A 2V81A 1L6YA 3LCWA 4RZ6A 3B06A 4D2JA 1X6UA 4LWWA 1DBTA 5KINA 2E6FA 3VI2A 1XKYA 5D04C 5ABTA 4MYAA 3DGRA 1MEHA 1HO4A 3C56A 3DKLA 4FX6M 4FO4A 3M43A 2QCEA 3LB0A 1OX5A 1FDYA 5HWJA 3L0NA 3PBYA 5CPMA 2R14A 4N2YA 3W7LA 2FJKA 3CB8A 2Y61A 4H3DA 4S2CA 3W84A 1XI3A 3M5YA 3HJZA 3W75A 2YDAA 3KRUA 1VHCA 5AC7A 3QM3A 4JDBA 3BG3A 2ZYFA 3T44A 4S2BA 1L9WA 1ICQA 1O5XA 3GR7A 1R2SA 1VC4A 4P61A 1TTJA 1Z42A 3W1UA 3WJXA 1Y0EA 1VS1A 4JN6A 3RMJA 4GC4A 2PC4A 4GWEA 4K8EA 4ZQOA 3O6CA 1MEWA 4YMZA 3L0KA 3UWWA 4ZQNA 4UTKA 3QFEA 3NQFA 2JKPA 3B03A 1J5TA 1JCYA 3FKRA 1F7BA 4WQ6A 4E0CA 1OFBA 3JS3A 3EWXA 2ZZ5A 3CWOX 3B0UX 3A5FA 2O7QA 2YXGA 3ABRA 4Z1CA 2CZFA 3NL2A 3LRKA 2YW4A 1Q6QA 2DJXA 5K9XA 1OYAA 2GPTA 1O5KA 4ORMA 3L0GA 1J4EA 3W2NA 4NX0A 3W1AA 5AHNA 2Q8LA 2QAFA 2R94A 4X3ZA 1XBZA 4JTFA 4NX5A 2NWSA 1W5QA 2A1YA 2RH9A 3S1VA 3GAKA 3CQ0A 3GXTA 3W3OA 1K8YA 3MP4A 3STFA 2GUUA 3M5VA 1W54A 2C0AA 3L67A 3MHGA 3STEA 3LI0A 2BSLA 3SECA 3DFQA 1FCUA 1JCLA 4FNRA 1W5MA 4HNTA 2J24A 1VJIA 2QUVA 3W71A 2YX0A 2G5WA 2Z2UA 2ISWA 3DKJA 5BMXA 5EMUA 1GPWA 4R33A 1OFQA 2WO5A 2ZFAA 3DZ1A 3M5XA 3SFKA 2B4GA 4MLRA 3LGEA 5F2LA 4JD4A 4UR8A 2QAPA 5TBOA 1P4CA 3QRHA 4O16A 4L4LA 3NXFA 1GVRA 3UPWA 1TMHA 1ME8A 2NUXA 2OX1A 4RKAA 3QMSA 3G1SA 3CWNA 1ZAJA 4CLMA 3NG3A 1TPUA 3D0CA 1SSGA 3HPXA 5CZ0A 3F4NA 4UTTA 1TPH1 5K4ZA 4K36A 4CCCA 5AN7A 1KM0A 4PA8A 2WSYA 2FPTA 3BPWA 3NL3A 1O60A 3W9ZA 3TAOA 1JJKA 1TJRA 4IX0A 3PSVA 3DI1A 3L66A 4BI6A 1LOLA 2ZZ1A 4RV8A 3LHYA 1GOXA 3S6DA 1IXQA 1YPFA 3UZ5A 3WK2A 3QW3A 3THAA 5DBTA 3UQNA 1TTPA 3W7GA 3CIWA 3P81A 3F03K 2B7PA 2F7FA 5G2IA 5D2YA 3FEMA 3TFCA 3LTSA 2R91A 1B4KA 1FQ0A 4O8RA 1B9BA 1M7OA 2G96A 2B7QA 4H4IA 5DCDA 4PL1A 4NVTA 3TIMA 3TXZA 1PCWA 4PCFA 2Q3OA 1ADOA 2W0UA 5HUPA 1WDWA 3PB0A 2ZA1A 4UCGA 2D73A 2TSYA 3LV5A 3SIZA 4O52A 3R8RA 4NXKA 3P80A 4WXYA 3TSBA 5AC8A 1P5BA 3G3MA 2J9YA 4DO4A 3LI1A 1PHWA 1BKSA 2BX7A 3CU2A 1IXPA 3I7SA 5F4SA 2F84A 3SY5A 2Z1BA 1GVOA 2NV2A 1OFAA 3W7CA 3S5ZA 3HIJA 5F2GA 2WOQA 3LX9A 4OV4A 3YPIA 2HTMA 1ZALA 4YWIA 4JIQA 2C14A 3C4UA 1HFBA 5C54A 1SU5A 4TMCA 4TR9A 3GXPA 1PS9A 3L9CA 5A5WA 1OFPA 4E2DA 2DZWA 3JR2A 3P84A 3LCLA 1VLWA 4JTSA 3Q94A 4K7YA 4HNNA 4JIPA 3TC7A 2JGYA 4NUWA 3O63A 3TMLA 4ICNA 1PV8A 1H62A 3HO8A 1A5SA 5AHIA 1OF6A 3ZWTA 2A7NA 4LVBA 2GOUA 3LHUA 4JNMA 1KA9F 3MP3A 5D02A 3OIXA 1A5AA 1KV5A 3NYZA 4TO8A 2ABBA 1A53A 1DQWA 2VEKA 5CSRA 1S3HA 1SUXA 1SPQA 1SR9A 3I7QA 1QFEA 1DKWA 2VFIA 2Z0IA 3HF3A 1VGAA 3MHFA 4N9BA 2EF9A 4Z08A 3BG9A 2VFGA 3MMTA 1JCMP 5K2ZA 3CEPA 3BW3A 1I2QA 2OJPA 3KRZA 3N3MA 3KX6A 1YTEA 1H1YA 4FNQA 3QYQA 5CPLA 1GWJA 1KM5A 3PG8A 2ZCGA 3DHFA 4O11A 3G8EA 1F76A 1NEYA 3P60A 1GEQA 3H54A 5CKSA 3LXBA 4FF7A 5KTLA 4OBTA 1JRCA 3DFTA 3HG4A 3NPUA 3T7VA 4Z1AA 1GYNA 3W7RA 3IGXA 1UUMA 4ZQRA 3USBA 4ZQPA 2FTPA 2TYSA 2Y7GA 1AG1O 1QPNA 3I7RA 5HQEA 2XN2A 1J2WA 3MI2A 3OA3A 1KFKA 3TQKA 3E49A 4MJMA 3OEXA 4M19A 1PE1A 2NZLA 1SZFA 1TPC1 5U4NA 1Q6OA 1TV7A 2Q8ZA 4C1KA 2VEIA 1K7FA 2V2DA 2QKFA 1KBIA 3G24A 1FY6A 4QJ1A 1FCQA 5LKYA 3IIPA 2ZZ2A 3GDRA 1YPIA 4Y90A 3QSTA 4AWSA 3E12A 3H53A 4NU7A 3DAQA 4UNKA 2NX3A 1MEIA 2WKJA 3IIXA 4WZHA 1VZWA 3LM7A 2EPHA 4DPQA 2TMDA 3O05A 1WV2A 5DXYA 4O18A 5LNWA 4NJJA 1THFD 1IF2A 5AHEA 4AAJA 3GLCA 1U5JA 1TB3A 3BGGA 1FWSA 3NA8A 4IPIA 1TPVA 1O94A 3U8GA 4N02A 1DOSA 2BZNA 5FF3A 3W7HA 4GUGA 1FWRA 4LRTA 3STCA 2AAMA 3G3DA 3TKFA 3EKZA 3G1HA 4JDYA 3M5ZA 1MO0A 2FB2A 2QUUA 3S1UA 2Y7EA 3BLEA 2ZRVA 4KFNA 5KZMA 2OMAA 2ZZ7A 4BI5A 4R7JA 5J5RA 1XBXA 4N6FA 4Q4KA 1T99A 3GDLA 3C6CA 1MSSA 2A6LA 4MZYA 2VEPA 4XUGA 3A5VA 3K30A 3PBUA 3EB2A 3LRMA 1HTIA 1YXDA 3P5YA 5E0KA 1KFCA 3VE9A 4JICA 4MY9A 4PH6A 1BEUA 4AH7A 4GUJA 1DHPA 3GDKA 1TQXA 5AYZA 1NF0A 2NXHA 2Y88A 2P10A 1D3GA 3TSMA 4BF9A 1K8XA 4O57A 4DF0A 4NQ1A 3TU9A 1N55A 3OVRA 1DL3A 1GQNA 4UTJA 5FF2A 3MI3A 4UTIA 4LU0A 5AYYA 1OK6A 4GRSA 3PF3A 1YTKA 1W3TA 5HULA 2WV8A 1A5CA 1GVFA 2H3BA 3T40A 5BMWA 3QQ1A 1H7RA 1C9DA 5IM51 4X2RA 2VOMA 3QW4B 3NPVA 1CI1A 3NOEA 4NNAA 2WSQA 4BK9A 3TC6A 3S1WA 2E77A 3M7WA 1OX6A 3KFTA 5HINA 3PY2A 3NGJA 1ONRA 1K02A 3E0IA 4Y96A 4LS0A 5LGZA 1ZAIA 2FPYA 2OT1A 5EKYA 4DBEA 3FLUA 3GNDA 3W7NA 3EXSA 4UMCA 2YR1A 2A6NA 4QITA 3NQ6A 2ABAA 3KAOA 4WUIA 4JX4A 4CQAA 2C18A 1WBJA 2ZRZA 2CZ5A 4MY8A 1L6SA 3QZEA 4MYXA 1TPDA 2GVLA 3VFLA 1IIHA 4QSHA 5L9FA 3HPSA 5DY3A 5DN1A 1BWLA 2CLHA 1KLZA 1SZNA 4MY1A 1C29A 5IBXA 4ADSA 1YADA 2A0NA 2W79A 3HG5A 3IVSA 4JYFA 5G5IA 3W1MA 4IMEA 4MVAA 3BW4A 1WOAA 1VYPX 4NJIA 1Q45A 4RCXA 1W5PA 1X7FA 5LGXA 5AHFA 4TMBA 3R5EA 1EPXA 5CZSA 2WNZA 1DJQA 3T4CA 1XC4A 4EWND 1RQBA 4I9AA 3QH2A 3W07A 3HG2A 4XKYA 3OVPA 1FWWA 4WX2A 3LCHA 3CLMA 1LOQA 4JTIA 1QAPA 2QCGA 3W7OA 1VPXA 2EGZA 1E51A 1YDOA 2RDWA 1KM4A 2C16A 2ZQ0A 1S5WA 4K39A 4ADTA 2G97A 3BW2A 4QISA 4XZ9A 3SI9A 3CEUA 4JTGA 4N9CA 4L4MA 5CSSA 4G1KA 1EA0A 1JULA 2J9XA 1CW2A 3IVTA 3O6DA 3WJWA 1JQVA 3C0JA 3IEBA 2X1TA 3B8DA 2G95A 5G1YA 1VCFA 1FBAA 3W7MA 4OGZA 3NQ2A 1WXJA 4OHQA 3W83A 1FXQA 4XBSA 3LHVA 2JKEA 2VELA 4JTKA 5F1VA 3I65A 3PAJA 3ZR4A 1DORA 1OFOA 3TNOA 2VENA 3T55A 2X1SA 5I3HA 2ZZ3A 2I14A 3UD6A 4O54A 2E1DA 2BLEA 5I3FA 3W7JA 3IIOA 2A21A 1XUUA 4O50A 5I3GA 5K9DA 3ELFA 3EWWA 3DH7A 5D2VA 1O4UA 1B4EA 4FX8A 1I2NA 2Q3RA 5H91A 3W73A 4EVZA 1TTIA 1K03A 5AC6A 2ZTJA 3G1VA 3W7DA 1UUOA 1NAL1 2NWRA 1GT8A 2FQIA 4FNSA 3SZ8A 3DFSA 3S42A 1JUKA 1TSIA 3PULA 2WQPA 2B0MA 5TQLA 4JXCA 3FJLA 2KZHA 3W85A 3FA5A 3HPZA 3C8FA 2V5LA 4ALDA 3V1PA 3DFPA 2A2IA 5C55A 2A85A 5HMSA 1H51A 3TQ0A 1R47A 2E68A 5LHFA 1ME9A 5LHEA 3O07A 4JY9A 3GKFA 4GBUA 2YW3A 1G67A 3L65A 1LYXA 3PS7A 3M1ZA 1JRBA 2H6RA 3TA6A 4MZ1A 1OF8A 4AHQA 1W3IA 1Z41A 3UNDA 3KVKA 5DXXA 5K4XA 1QNVA 3P5ZA 2E09A 5FESA 1KLYA 4PTNA 4TIMA 3M0ZA 3NNTA 1F2JA 1TPFA 1P0NA 3KRSA 5G1TA 1FCBA 1RR2A 4AWTA 4IWWA 1SW0A 1I4NA 1K7XA 1EWEA 3TH6A 4ZVJA 2ZZ4A 4MFEA 4JX5A 3N73A 2E6YA 4Z0JA 3V75A 2R8WA 1I2OA 4XBKA 1EUNA 2V0TA 3CT7A 4UFJA 1JQXA 3RLUA 4R34A 1LROA 1H50A 1IXOA 4O4VA 1CX9A 4MZ8A 4UMAA 4WXZA 1G4PA 1WBHA 4WY0B 1C8VA 4I7VA 2YYTA 3O8AA 5EBUA 2CLIA 1KM2A 5J5DA 1KBJA 4PC8A 1WQ5A 1W56A 4O1CA 3P8JA 3QC3A 3VKJA 3TE9A 3UPBA 2E6DA 1L2UA 2QEZA 2ZRUA 3W7PA 3TJXA 4K8HA 4O4WA 1QMLA 4JTHA 1KTNA 5AOUA 4M7TA 4O1AA 3N2MA 3PR2A 3NO5A 1HL2A 4BWLC 4R53A 5T26A 2A4AA 4CQ8A 4FB7A 3GYEA 5I3KA 3W1QA 3ABOA 4AB4A 5AHMA 1NF7A 1UB3A 3UYCA 4EF9A 3EWZA 4LS1A 1Q6LA 4IX2A 1D9EA 2GQAA 4NNBA 4POCA 3B4UA 1XFBA 1M6JA 4HNVA 2ATMA 3Q58A 3UXAA 3QF0A 4KWVA 3FOKA 2HMCA 4A2SA 4GJ1A 4U28A 3HB9A 3T78A 3FYPA 1YYAA 4IPJA 1OJXA 3B05A 3NM3A 2GVJA 3W87A 1YDVA 1QOQA 3C2OA 3L21A 5FI8A 1H60A 4Z1BA 4A22A 5L6UA 1TIMA 3HBLA 1W1ZA 3Q2DA 4WY0A 5DCBA 3L5MA 3ABSA 1H7OA 1EIXA 2Y70A 2Y85A 1RV8A 4LV4A 2X1UA 3KHJA 3P7YA 6TIMA 2EAWA 1FCVA 2Y62A 4WY0F 2V2HA 1YXYA 2LLEA 3BO9A 1ZY9A 4Y6GA 3WK0A 1F6KA 4J9JA 2NXGA 4EOUA 1H7XA 1TCDA 3W2MA 1FWTA 3HMJG 2ATSA 3W70A 3G22A 4UFHA 2FPVA 4FXSA 1ALDA 4GXMA 1FUYA 1XUZA 2Y7DA 5LNVA 1KW1A 3EXRA 5KSWA 1D3HA 4DO6A 3TV8A 3HQ1A 4QQ3A 2V82A 3TSDA 4UR7A 3NQGA 4IXXA 1AW5A 1RD5A 3SJ3A 2RDTA 3MO7A 1H1ZA 3EKLA 4EF8A 4HN4A 3G8RA 4PL2A 4DPPA 1FDJA 4KWWA 3NL6A 4ZZ9A 2OT0A 1AW2A 1S5VA 5DBUA 1JUBA 2QJHA 2DJLA 4QIUA 4B5NA 5BRBA 1TPEA 4FIRA 4HKPA 4RXFA 4X22A 1SO3A 3R12A 1OX4B 1V7YA 1IGSA 1U83A 2FIQA 3DBPA 3W22A 2B7NA 4LVFA 4CNOA 1MZHA 4XTIA 3MWAA 1SO4A 2QR6A 2ZRXA 3GVGA 1AK5A 2CLKA 4ZL1A 1RQHA 3BV4A 3M47A 1SW7A 1TRDA 3TJLA 3C2EA 1Z44A 2ZBTA 4O12A 3PSWA 3UWVA 2RDUA 1QDSA 1G4EA 2UV8G 4GE8A 2V30A 4S1FA 2XFWA 5CZJA 1LRQA 1F6PA 1QO5A 4Q32A 3NQ7A 5DY2A 1KFLA 3RLVA 3GXNA 5FF4A 3LHTA 4GUIA 4O0ZA 3G0UA 3HGJA 4WOQA 4JY8A 3LDVA 3A22A 2J6XA 3UWYA 4MLJA 1TJPA 2OZ0A 3P67A 5EL1A 3MYOA 3W76A 3PC0A 1F73A 1YLVA 5I3JA 4W9TA 3GR8A 3MW7A 5AYXA 1Q3NA 3TQVA 2FLIA 2H90A 2IQTA 4BI7A 3A23A 5TIMA 4MJZA 4PODA 2QCLA 4M6VA 5F2IA 1LRNA 1UBSA 2PURA 5HR6A 2TPSA 1ZNNA 1LTDA 1XM3A 3M9YA 1SSDA 2QDHA 5EY5A 4IMFA 1YTDA 1EP1A 3EX3A 5K7JA 1W5OA 5KITA 3DFNA 4MFDA 5F2MA 3LHZA 2HSAA 3IV3A 2HS6A 1I2PA 5I3IA 3G0XA 3MBDA 4IUOA 4N6EA 3NVTA 3QJAA 2QCDB 2CLLA 2QUTA 1QPRA 4MKNA 2WPBA 1T8XA 5U7SA 3M16A 3NDOA 4HSOA 1ZCOA 4JTTA 4O53A 3W7KA 1KV8A 2V8ZA 5D03A 4O0KA 1WA3A 1XBVA 2A7RA 1KTCA 1HO1A 4M7SA 3SSJA 3F4WA 3H55A 4AF0B 1YXCA 1KM6A 1PL9A 2V9DA 4LC6A 1TPB1 2DZTA 3P62A 3I68A 3NZ1A 4I7WA 5FF0A 2PRLA 1S5TA 3A21A 3U2OA 5F1UA 4O28A 3W1PA 1QOPA 4A2RA 1P1XA 3PUOA 3MUXA 3HGSA 1TV5A 1RPXA 5E93A 4LY8A 1R46A 2CZDA 2JGQA 4EIVA 1F05A 3BK0A 4YXGA 4YL2A 4IMGA 5CGQA 4UFLA 4NJKA 1HUVA 3G1YA 1W31A 4NNCA 3TXVA 1VCGA 3BARA 4HSNA 1UJPA 1SZGA 1W8SA 3B0PA 3ZS4A 3FS2A 4YCPA 4GUHA 1XCFA 1W37A 2EKCA 1JCXA 3LBCA 2CLFA 1GJPA 1H7PA 3G18A 3MHUA 3W23A 4N9EA 3DI0A 4O13A 1LBLA 1ML1A 5HWNA 2ISVA 3B0VC 1JR1A 4LRSA 3LERA 3E96A 1AMKA 1KM3A 3G0SA 3KVMA 5AB3A 4KFPA 3W72A 2C1HA 1EWDA 2E5CA 3PUEA 4MPQA 4IOTA 2QCFA 3NPXA 4IQLA 3LTYA 1H7NA 4Q33A 2QCMA 4O10A 2YZRA 3ANYA 2HS8A 3O16A 6ALDA 4QAIA 3EX1A 3UWQA 4C1LA 5DCEA 5CG7A 5SWUA 4M6PA 4ONVA 1OABA 2V5BA 3GX9A 1VYRA 3LXCA 4DF1A 5FEWA 3NM1A 4IMDA 4ZQCA 3B04A 4CQ9A 1OFRA 8TIMA 1VH7A 3QMRA 3TDFA 1SO5A 3R13A 1TQJA 5KZDA 2FFCA 1GTEA 1NFBA 1FX6A 5D09A 2RKXA 3R89A 1OFDA 3P61A 3O1NA 2E5BA 3STGA 3TR2A 3LV6A 3RK8A 4H6KA 3LCXA 2OCZA 3DENA 1WX0A 4LC8A 4QM1A 5HWMA 4RK8A 1VLIA 3W2JA 3DU0A 2H8ZA 3C52A 3W1TA 1W0MA 3PG9A 4K37A 2VKZG 4AEOA 3W7QA 1DVJA 4IJBA 1H61A 1T0OA 4OQVA 2Z6IA 3C2VA 5D37A 1TPWA 3W7EA 1LLWA 4GFSA 5HUOA 3W6YA 1UASA 1TO3A 5E1QA 3LBMA 4IGHA 3TW6A 3NQMA 4LUJA 2YFNA 3OHIA 1OHLA 3GB6A 1W3NA 1VHNA 1P0KA 2NX9A 3ZWSA 4UFKA 3KVLA 3N19B 1DV7A 3SW6A 1TTQA 2ZZ6A 2DZPA 4DELA 2J27A 5MHBA 1GTHA 3PUDA 5FF7A 1OFEA 3NL5A 3W1NA 1I2RA 4RXGA 3IIZA 4K7VA 2YPIA 5D38A 3C2RA 2AGKA 4UTWA 4A29A 3EEGA 4OV9A 1R2RA 5G4EA 4KKXA 4IXHA 2J88A 4UTWC 2DORA 3RNDA 3KVJA 2YYUA 4UTLA 3DHDA 3S5OA 4BFAA 1PVNA 3CM4A 4JTEA 3S5YA 1GG0A 4HPXA 2CFFA 1JCJA 3W2KA 1GZGA 4N9DA 2X16A 5K9CA 4Z1DA 1QPQA 4LNYA 3M6YA 3W74A 2H3DA 3INPA 1G4SA 4JX6A 5CPNA 2X30A 5AFDA 3N14A 3W88A 2DZUA 5FEPA 1K8ZA 3RU6A 2B7OA 4WOZA 3L5AA 3AJXA 3LLDA 3CHVA 4LV9A
chains in the Genus database with same CATH superfamily
2EHHA 4UQCA 4UMBA 3IVUA 4GVFA 1HJVA 3FIGA 5LYRA 3DFOA 5CZTA 3S5NA 3FJ6A 4O1DA 1CXFA 1H5YA 3LTPA 4RE3A 5G4WA 1B3XA 3I6RA 1E9ZB 4KCTA 3TX9A 4AY1A 4GVGA 3UZJA 4J3SA 4MAVA 3WJZA 5A2BA 3TK7A 3CK5A 2C19A 4FXRA 3CL7A 4Z0SA 2OGYA 1VYSX 3F5KA 3RU8X 2W6RA 1MNSA 3ATYA 1AODA 3BDKA 4FX7A 4CNPA 1VD6A 1M7PA 1R6WA 5H8UA 1X1OA 4DEFA 2I1OA 1TMLA 5AC4A 2A5HA 3IIVA 5A2AA 4DWSA 2YCLB 3QPYA 4IG2B 2VFHA 3VOHA 1MXSA 1QK0A 2GK1A 5HPOA 1X8FA 3F1QA 1Z7AA 3C2FA 5KMYA 3CQKA 1UOKA 1QTWA 3EOLA 1A80A 4LUIA 2X0YA 3IGHX 4HHHA 1ICPA 3BAWA 1GVQA 3RRXA 2PGEA 3I4KA 3N6QA 3KTCA 3WCZA 2Y4SA 2VRJA 1B3ZA 2ZRYA 1LT8A 4UTHA 1EX5A 4WKHA 3H26A 1N8FA 4UTTC 3NQEA 4LYKA 1T8QA 4EAMA 1XLBA 4AYGA 1U5HA 4ROQA 1V5XA 4MNKA 2A3EA 3U5YA 5LNSA 4DQWA 4MHBA 1F74A 4NXSA 3Q37A 3THQA 2UY2A 3L5LA 2PA6A 4TOQA 3OA5A 3RFAA 4DBSA 4WDTA 1XDMA 5EA9A 1XYAA 3O6YX 3P8IA 3C2YA 4D6CA 5JBDA 4I5XA 3NEVA 4ATLA 3JRKA 2R9RA 2OO0A 2YCLA 2O55A 3ARTA 4QDWA 1V7AA 4Z2JA 1DTNA 4IG2A 3C86A 4FI4A 1SGJA 5D30A 7A3HA 3MSRA 3NR0A 1EEXA 2GVGA 2DU2A 2Y7FA 3K8MA 7TIMA 3WD0A 1W1VA 1IIGA 2XN0A 3JZEA 5DMMA 2X2GA 4GMEA 3LENA 1VRDA 3WH8A 3CMJA 3BUVA 3KRBA 5DLCA 5M3WA 5D05A 4GD0A 4UTMA 4C6QA 1KBLA 4B91A 1BQCA 3VX0A 4EXQA 4ZA0A 4OT7A 1JZ8A 2WMKA 5JH1A 2Y8VA 5I06A 2V3EA 4NHVA 4X61A 5EYWA 3VCRA 3DHPA 2XH0A 3N17A 5AHLA 1E5JA 1FXPA 3OLDA 3VD3A 1T41A 3H12A 2PLCA 4K6AA 3DBNA 3M0MA 4U4MA 5JU6A 2O7SA 3VD7A 5BOOA 3LCGA 2F6UA 1GW1A 3CXOA 4UIOA 1TZ7A 4O1EA 4ATWA 1OT1A 4AYSA 5CPOA 1ZJBA 4OU1A 3RM4A 3A9IA 1H49A 3E6EA 3SQSA 2J47A 1UR1A 1JFHA 1RZMA 2AQWA 5CAHA 1QPOA 3M41A 1RVGA 4ZE5A 5C7VA 4D8LA 1XQLA 5FEZA 1R7AA 2A3CA 3C0QA 3CPRA 4HPJA 4H7VA 1R86A 2J8FA 3CB3A 3VDCA 3WEMA 4Y9PA 3WQ4A 1V4YA 2YBUA 3TW7A 1TREA 4JHOA 2VJXA 4AXKA 5EPDA 2IXUA 5FOOA 1AW1A 2Y1HA 1IZKA 3C61A 4V33A 4QBXA 2PCQA 4H9UA 2QQ6A 2X7VA 3W82A 3NCOA 1J18A 3GAYA 3O2LA 1R7OA 1AL8A 4CUCA 4LS2A 5DF0A 5HDRA 1KKRA 1A0EA 4WKFA 1CXEA 3T2QA 1NELA 2HEJA 4IIGA 3SCTA 2ZA2A 2TRSA 1VPQA 1GVIA 3CBWA 1EQPA 3R4IA 3MDUA 2ALDA 1W2PA 1RBAA 1G7VA 4M8UA 2VVNA 3K2GA 1ELSA 4A3YA 4S3DA 4ACZB 2FDSA 2WJZA 5DO8A 1UKQA 1EJXC 4O19A 1ME7A 1VRXA 2OOGA 4Q8VA 3U2EA 3WLPA 3AHVA 1E6ZA 4G7EB 3TC3A 3T42A 1CXLA 2VCCA 1UYQA 1WYIA 1LG2A 1O95A 3ZVHA 1EJ7L 2DZBA 1MYRA 1QW8A 5TD4A 1S39A 1SQ7A 1UQZA 2O9RA 3ZLGA 1FOBA 3H4WA 3LZ3A 8XIAA 3TROA 1FWBC 4DYEA 2WNNA 2VX6A 4RW5A 1R5YA 4FPSA 3B8VA 3KZPA 4L6HA 4XZMX 1DQXA 4AHOA 4MADA 4PSPA 4K68A 3QLLA 4FLQA 2FZ8A 2BXYA 2NX1A 2VC5A 2Z6JA 3MUZ1 5A8GA 3N2XA 2P8CA 3SGZA 4N4PA 1BF6A 4WGHA 2HBVA 1QNPA 2PGWA 3QKZA 4PUNA 3WQGA 3HFTA 4GQ0A 5MKGB 3V16A 5AZ0A 3P74A 4Q8TA 4LVAA 3CZ8A 1P0EA 1UCWA 4W5ZA 2WPGA 4EK7A 3W02A 3PK7A 1M41A 4CNNA 4FR6A 3FCPA 1M53A 5JQ9A 4XKYB 1RAKA 1FHUA 1CB7B 4NZJA 4FNTA 3NEHA 2PDCA 1CGWA 1E73M 2SFPA 2ZUUA 4LPCA 3IJLA 3WUGA 3PM6A 3VE7A 1DEDA 3WNOA 1WKYA 1R2TA 4LTSA 1DJNA 4ECLA 1ZZMA 3TAKA 5F4WA 4W86A 4DZ5A 3V3WA 5C70A 1VBGA 1LM1A 4LSBA 4G6CA 1J10A 3GIYA 3UBPC 3K1GA 5D2TA 2OZ3A 3PBWA 3EBVA 3IGSA 2DT1A 3QSRA 2V68A 4X9YA 5IBXC 1ZENA 3MP5A 3AXMA 2D2GA 4JGDA 3L4UA 2QZRA 2G4FA 2E8ZA 4C7FA 1KTBA 5I02A 1Z32X 2V81A 3CL8A 1L6YA 2OEJA 4RNJA 4NASA 2E6FA 1V3LA 3OVGA 4B5XA 4FX6M 1CLVA 1JAKA 3M43A 2QCEA 1EDGA 4WSJA 2QNEA 5HWJA 3A4JA 2AL2A 3PBYA 5CPMA 2R14A 3CB8A 2EPKX 4H3DA 2F2HA 3RPMA 3T6CA 1ITXA 5AC7A 4RPQA 3PZTA 5JMUA 5A6MA 4QJ4B 1ICQA 3GR7A 1UR3M 1VC4A 3W1UA 1VS1A 3D47A 3RMJA 2HE8A 3CZJA 1PTAA 5A94A 5BXTA 3GNOA 1QNSA 3IJ7A 1FWEC 3VMPA 4YMZA 2OODA 3UWWA 1PKYA 4ZQNA 3I3DA 4MG4A 2C8NA 2JKPA 4P8VA 4RNFA 4XVDA 2HK0A 3FKRA 3ARWA 4WQ6A 1S1PA 1WKFA 2ZZ5A 3GXIA 1E6NA 1J01A 2DFAA 1K4GA 2YW4A 4U2YA 3F7JA 2FMOA 4H9XA 2XYLA 4L9ZA 4ZO6A 4JZ5A 3N2BA 3L0GA 1J4EA 3W2NA 1A5OC 3PPCA 2Q8LA 3U2CA 4X3ZA 4HP5A 1UKPA 4JTFA 1RUSA 5TAOA 1V3MA 3MKVA 2BP1A 1W5QA 3EKGA 3QFWA 1EQCA 1RY0A 4DLFA 1UD2A 2W61A 1U22A 3GXTA 1K8YA 3STFA 3WMCA 5LA0A 4F79A 3M5VA 5D8WA 4IPPA 4M56A 1LLOA 3FHQA 1OCNA 1JGIA 3LI0A 2BSLA 3DFQA 1W5MA 4JBRA 4HNTA 2DVTA 4YVVA 3W71A 5EFFA 4Q6JA 2YX0A 4C6EA 2VWTA 3DKJA 1Q63A 1GPWA 4AVNA 1W9VA 2QXWA 1Q66A 2ZFAA 1B1YA 3SO7A 3M5XA 1KRCC 4MLRA 1EFZA 3LGEA 5F2LA 4UR8A 4Q3MA 2QAPA 2GGHA 1P4CA 4QXIA 4DM2A 4Y7EA 1O66A 4JFUA 2D2JA 2I57A 3S9IA 3WLKX 3N11A 1NOWA 1PZ3A 3UPWA 2PDBA 3UA3A 1ME8A 2OX1A 2VEGA 4QAWA 3SRDA 4F0MA 2X7WA 1CPUA 1QI0A 4CLMA 3NG3A 3URBA 5HMFA 2XFYA 3E0LA 3KBVA 2PEVA 4UTTA 4XIAA 2CERA 4AZBA 5JBFA 5AN7A 1KM0A 4PA8A 2FYMA 9XIMA 3NL3A 3E2RA 1O60A 2WJEA 3TAOA 1JJKA 1TJRA 2E1WA 4UB9A 3DI1A 1UKOA 3STPA 4KPLA 5C0QA 4L6DA 4NZCA 2DVXA 3S6DA 4NRSA 1IXQA 3E0VA 4TX8A 3R7MA 3PZGA 3W7GA 1EC8A 3CIWA 1V3JA 2D3NA 2PDYA 1CT5A 5G2IA 3WNNA 2GDQA 4JHMA 4O8RA 1B4KA 3WNPA 4WKAA 2G96A 1UWAA 3MCMA 1JYXA 3N12A 1O7AA 4Z1YA 4RE0A 4PCFA 2Z1WA 4AZ6A 4GQBA 2C71A 5HUPA 1WDWA 3PB0A 2R1NA 3LV5A 3H8AA 4LCRA 1MXDA 1H2JA 3UXKA 3U4AA 1UH4A 1RCOB 4Q4OA 2ONEA 1ADSA 1DWHM 4DO4A 4UZSA 3MV11 2P76A 4ILSA 3COTA 3EEZA 3RXZA 4IQDA 4Z17A 1Q6EA 2ZVRA 1GVOA 4IT1A 1W2VA 3PPGA 1S5NA 1OFAA 3OQ8A 3W7CA 1TVPA 4OV4A 4QP0A 4YWIA 3C4UA 4R27A 1SU5A 3A4WA 2HXTA 3WLNA 4E2OA 2PGRA 3MB9A 2PFHA 4C6LA 1PS9A 4O8AA 4YU1A 4R9OA 2DZWA 2ZE0A 3JR2A 3P84A 2F6XA 4C5ZA 4K7YA 4UQBA 4HNNA 4JIPA 3TC7A 2J62A 3LUTA 3BJSA 4GKTA 3VXGA 2PTDA 4JIRA 3HURA 2BVYA 1H62A 1A5SA 5AHIA 1OF6A 1EKOA 3V0UA 3ZWTA 2I7GA 2A7NA 1BXNA 4JNMA 2JE8A 1A5AA 1A53A 3THUA 1W1A1 1DPMA 1SUXA 2RAGA 2Z2AA 5EMYA 2XUCA 3MQTA 3HF3A 2IKHA 1AJ0A 3EOEA 4Z08A 4JFSA 1IT8A 3BG9A 3P0XA 4EXBA 3VILA 3BLPX 1RSCA 1MFUA 4IL2A 3OZYA 4I90A 3FK4A 3CEPA 3BW3A 1UZDA 2OJPA 4BA0A 3KRZA 3L4YA 3LLXA 1GWJA 1KM5A 2ZCGA 2Z4GA 3DHFA 4O11A 1VBHA 4KEUA 1JRCA 3AFBA 3DFTA 3QY7A 3NPUA 5M17A 3W7RA 1ISZA 2GGIA 2HROA 2FTPA 1GZ1A 1AQMA 1CENA 4IJCA 1QXLA 3I7RA 3DN5A 1NWUA 1OBAA 2WVTA 4MSSA 3OEXA 4M19A 2YBVA 2EPNA 1SZFA 2IPJA 1Q6OA 4C1KA 2PTXA 2OLAA 2OWXA 4QJ1A 1FWHC 3GSMA 3QY6A 4JL1A 1R9ZA 3QSTA 2AMXA 1US2A 3E12A 1HJQA 3CAKA 2WWCA 4NU7A 5I03A 3EA1A 4ICCX 4UNKA 1MEIA 1TX0A 3VMOA 3QR1A 3IIXA 1VZWA 3WLLA 1B9ZA 3QGKC 2TMDA 1W1YA 4OBSA 5ABHA 2DSZA 1THFD 5AHEA 1KCKA 2QW5A 1U5JA 1VP5A 2ZXBA 3WL0A 3OLGA 3B8WA 4JN8A 4IFKB 4QDMA 4LRTA 4LGXA 1DE6A 1N2VA 3TKFA 3EKZA 3APGA 3M5ZA 5FL0A 5KEZA 4TVCA 2FB2A 4AY8A 3BCJA 2QUUA 1V03A 3S1UA 2ZRVA 2V63A 4JTQA 1XBXA 4HK7A 1OCJA 3GD6A 4MZYA 4EXAA 2CKRA 3PBUA 3ARQA 3GVWA 5E0KA 4Q8WA 4HTYA 3VK5A 4HMNA 2WBKA 4JPGA 3GDKA 1UP2A 3ZR5A 1D3GA 3MUAA 4Y8EA 1UG6A 3RCYA 3OVRA 2VQTA 1GQNA 3MI3A 4UTIA 2YL9A 1M7JA 3PF3A 5I5RA 4K1WA 3AHXA 4G2DA 1RP9A 3KBJA 3F5JA 1IZCA 3QW4B 5TNVA 2J66A 3NPVA 1CI1A 2PDMA 3NOEA 2WHMA 2FJUB 4IFKA 1CECA 1OX6A 3NGJA 3DC8A 1TZZA 2R6OA 3I6TA 1ZAIA 3TW9A 2Y5EA 3GNDA 2WVVB 3W7NA 6REQB 3EB3A 4UMCA 4JOMA 2VDHA 3TLLA 4KQNA 1JZ6A 3D46A 3KAOA 5FA5A 1D8WA 1WBJA 2J78A 3QZEA 5L9FA 2NQHA 4NKCA 1KRAC 4MY1A 4DM1A 4J2MA 5IBXA 4ADSA 1Q8AA 2W79A 3HG5A 1XIDA 3EZ4A 1OIMA 4IMEA 4U2ZA 4MVAA 4S3AA 3WH6A 2ODOA 2V5CA 2YA2A 2VDIA 2CHRA 5BU9A 2W3ZA 1VEPA 1L6GA 5C2CA 4H6QA 4LAMA 3UP8A 1DJQA 4PUEA 3ARUA 2XINA 4I9AA 1S2UA 1LL7A 4U33A 3HG2A 6CGTA 1VKFA 3THDA 2FHBA 3SY1A 2B31A 3NOYA 1WNOA 3CLMA 3WD4A 6REQA 4FSAA 5JXQA 4A35A 3GO2A 2RDWA 4WJXA 4ADTA 5A6TC 3ITXA 2VCBA 4JTGA 1D7KA 3VIIA 1CLKA 1A5UA 2J9XA 3WJWA 1NWRA 1DXIA 4E8DA 1E4NA 4FAMA 2HPIA 2HBXA 1L6FA 3F2BA 2PZNA 3HA1A 2O4MA 3MKCA 4XBSA 3B9OA 3LHVA 4B5UA 4WSKA 4J3VA 2YDSA 4YHEA 2AMGA 2ZZ3A 2OFJA 2HRWA 4MUPA 2E1DA 1V6TA 2FGBA 1XUUA 4O50A 5I3GA 5K9DA 5I7GA 3ELFA 3DH7A 3S2JA 3WBWA 4FX8A 3HV8A 3W73A 3KTXA 4MPKA 1TTIA 4KH2A 1UD6A 1NAL1 2OU4A 1GT8A 4FNSA 1TSIA 3PULA 3AYVA 2WQPA 4JKMA 5TQLA 3WEOA 1T5AA 3FJLA 1W3LA 3DFPA 2A85A 3AIRA 3RO6A 5ABFA 3TQ0A 4HOXA 1PB0A 2E68A 2E9LA 4JY9A 3GKFA 2YW3A 3U7VA 2QDEA 2DDXA 4C91A 1OF8A 3F4CA 3OYZA 1G9HA 1EL3A 1CGUA 3T1GA 5K4XA 1QNVA 4KCWA 2BG5A 1C91A 3RCMA 3M0ZA 3LD5A 4I9JA 1RR2A 4AWTA 1GGOA 2J8GA 4IWWA 1SW0A 4JCMA 1E1CA 1K7XA 3OGSA 5IDZA 3VIGA 4Z0JA 3QV7A 3UG5A 3ARPA 4XBKA 1EUNA 3CT7A 1HQTA 1EC7A 2X42A 3QN3A 4QR6A 3RLUA 3GW0A 2YKKA 3BAKA 1DWFM 4O4VA 2BDQA 4MKVA 1CX9A 3I4EA 3KDNA 4MWAD 1TG7A 1EDQA 3OIHA 3NTYA 3O8AA 1I9CB 2FFIA 1I6NA 5J5DA 1U2YA 4U3AA 1W56A 2GJXB 3TE9A 3UPBA 5CC3A 2E6DA 2QEZA 3W7PA 1A3HA 2ZX5A 1EHAA 3TJXA 3ZLHA 4O4WA 2VYOA 3WF4A 2I5QA 5H6HA 4ZB5A 4M7TA 1TWWA 3DG6A 2P50A 3BOFA 3PR2A 1HL2A 1XIMA 4BWLC 3DERA 2P8BA 4IGNA 1MQRA 4CQ8A 4OFCA 3OLIA 2HNEA 2WLYA 3W1QA 3BWWA 3OZOA 3KLLA 5FSDC 1JNDA 1OGGA 1NF7A 2P0IA 3UYCA 1V02E 2IQDA 3L4XA 1PYMA 3EWZA 3TOYA 3VDGA 5CBBA 4IX2A 3B4UA 1XFBA 2ATMA 1E9IA 4GJIA 1UMYA 3WQDA 3CHEA 3TYEA 1MWOA 4GJ1A 3M4HA 3FYPA 3GVQA 5BCAA 2PC8A 4BKNA 3W87A 2IS7A 1H60A 1VFTA 2V5JA 1TIMA 3HBLA 1QOXA 1W1ZA 1X39A 1EIXA 2AL1A 3UZXA 4Q8PA 3KWSA 3UA4A 5A8PA 3KHJA 3P7YA 1FCVA 4PMYA 3VC6A 2V2HA 3WK0A 4J9JA 4GHRA 2NXGA 3MWCA 1H7XA 1TCDA 2CEQA 4DJDA 3MY9A 4BCEA 3W2MA 3HMJG 2ATSA 3UNTA 3EMCA 4LUYA 1R9YA 1BYDA 1YKWA 4GXMA 1FUYA 3ARSA 1KW1A 2XIJA 1C7SA 4MTVA 3VX1A 5PTDA 3TSDA 2OG9A 4UR7A 3NQGA 2KX9A 1AW5A 4FK9A 4IXXA 3BSMA 1LWJA 4HN4A 3U9IA 1OGBA 2VGIA 3ZLFA 3TYUA 1S5VA 4WR3A 3RCNA 5LA2A 2WW5A 2DJLA 4AIEA 1TPEA 4FIRA 4HKPA 4X22A 1SO3A 3R12A 3WLSA 1L8PA 1CWYA 2BB0A 1V7YA 2FIQA 2WKGA 1V3IA 2B7NA 4HYVA 1OZMA 3PZIA 3A4XA 4WJ8A 2CLKA 4ZL1A 3BV4A 1ENUA 3GH7A 4B15A 1Z44A 2ZBTA 3TJ4A 4NAEB 2YCIX 3WY1A 4UBPC 4DBUA 5CGMA 3CO4A 1ZTVA 2W67A 2PDQA 3VKDA 2XFWA 1JAEA 1QO5A 4Q32A 5XIAA 3T4WA 2VUYA 3PTKA 4L61A 5G1MA 3RLVA 4N42A 1BFNA 4E3TA 3WMSA 2VR4A 3A22A 1TJPA 3P67A 5EL1A 1UZ1A 1H1NA 1WDDA 2IPWA 4MB1A 4GBDA 1QHPA 2H90A 4GFIA 5TIMA 3CT2A 3UEQA 1W17A 3N18A 4GZJA 3M0VA 5F2IA 3GZAA 5HR6A 3UXLA 4WLCA 3LPPA 1SSDA 1W9DM 2BVTA 4KCVA 1B54A 3AIBA 5BXSA 2G3NA 4GPNA 4GY0A 3GU1A 1P6CA 6ENLA 2DIJA 2HSAA 3ARVA 1I2PA 2PDNA 3VC5A 1UROA 3G0XA 4IUOA 3NVTA 1X97A 4I9MA 4MKNA 2WMJA 1OINA 3BLOA 3LQLA 3M16A 4DYKA 1ZCOA 3W7KA 1DQUA 4AIUA 4JQ2A 2XGBA 4PBFA 2A3AA 2A7RA 5EFDA 3UCDA 3WLOA 5C9RA 2HVOA 1KM6A 1PL9A 3HQOA 1TPB1 3BOXA 4AZCA 3VU2A 3P62A 2BY2A 3I68A 5FF0A 1GJWA 2PRLA 3Q67A 5CZKA 5AZ1A 3W1PA 1QOPA 4A2RA 1XR2A 1P1XA 1ZU8A 1TV5A 5E93A 2CZDA 1E43A 1JG9A 4YXGA 1RA5A 4EPDC 3O0FA 2DW7A 3GDBA 4ICMA 4MKSA 1MUWA 5HAOA 1E0TA 1LWIA 1SZGA 2PTWA 3ZS4A 3UGRA 3IS4A 4YCPA 3FVMA 4RW3A 1TJ0A 3EB4A 1GPFA 1EYEA 1QJWA 2HVMA 4Q7NA 3A9BA 2AKZA 3PZ9A 2D2OA 2XJ7A 3VD5A 3W23A 4K2SA 4K8GA 4O13A 3CYVA 3AZSA 4AG0A 3VNIA 4IGMA 5DMYA 1TCMA 4YHGA 4JAWA 5CEWA 3GU2A 3LSBA 1CLXA 4MB3A 2PGFA 1Y5VA 2QCMA 2YZRA 3O16A 1L0PA 1V02A 2DQXA 3EX1A 2VD9A 4C1LA 5DCEA 1ZRQA 1EO7A 4ONVA 1RA0A 3BANA 1OABA 5I09A 3GX9A 4KGJA 1VYRA 3LXCA 1AA1B 4V28A 1H0GA 4DF1A 2EO7A 1ZSXA 1J11A 4E6MA 2NSOA 4CQ9A 3S2MA 8TIMA 1VH7A 1Q2RA 3PZQA 1OY0A 1A0DA 1FX6A 1M3UA 3S3GA 1OZQA 1XYCA 3H2MA 2RKXA 4QSFA 1OFDA 2E5BA 1BRLA 3STGA 1XIFA 1E9LA 3WDIA 4NG3A 1B3WA 4IPLA 3PWGA 2ICSA 4Z2IA 5JVLA 3W2JA 4KS0A 1W0MA 1WDRA 3WO8A 2VKZG 1DVJA 3FW6A 3WN6A 3N6JA 1XRFA 1T0OA 2WQDA 3KOZA 1YHTA 3SUUA 1LLWA 3FY1A 2V38A 1X8CA 4GY1A 3PAOA 5DQPA 2PDIA 3OHIA 4IFOA 4F0KA 1VHNA 4UFKA 3QY8A 3N19B 4DELA 2J27A 1CXHA 1F6YA 4A3HA 4P5UA 4P7OA 3GTNA 3BMXA 3NL5A 2Z1KA 2NVAA 3RRAA 3IIZA 4AD4A 2YPIA 3ZT6A 3A6OA 1VIWA 4HMDA 4FLRA 4UTWA 1XYLA 5H8MA 4IJRA 1TVLA 5G4EA 2J88A 4GIAA 3RNDA 4UTLA 2PU0A 2BOEX 2ZKMX 2OOFA 4BFAA 3NYDA 1PVNA 1X96A 3CM4A 1GG0A 2ZDSA 1I0BA 3R79A 1YIXA 1QNRA 7XIMA 4XAZA 4HTBA 2OX4A 4LNYA 1EF2A 1G4SA 1WDPA 1XYMA 2X30A 4MWAE 3VGDA 1PYFA 2XPKA 3UR8A 3L5AA 3K5XA 3CHVA 1A5BA 2VGBA 1SFLA 5KZ6A 3HGOA 3HTWA 4QG6A 5LZLA 2GVYA 1C8XA 2I5IA 1E6RA 4JYEA 2PDHA 4LVDA 2PMQA 3IANA 3C5QA 3JZUA 4P8UA 2XG9A 3UCQA 1JUEA 4ATDA 4X9SA 3UWUA 4AX6A 4DUWA 1KCZA 3IGUA 1TA3B 2JEQA 1KGXA 3W6LA 1DJYA 3GTXA 4RZBA 2RGMA 5KZEA 4HSHA 3NQBA 3WYZA 4NZFA 2FVLA 3UETA 2YFOA 3EWBX 4RJEA 1S2TA 1ZJIA 1MW1A 2CHNA 4NIRA 2XIBA 2WMHA 4KFOA 3VTRA 4D6HA 2PRHA 3NGFA 2VC9A 4BWLA 1WXYA 1WB0A 1A50A 1U1HA 4R85A 3CC1A 4WHBA 4C5YA 1CYGA 1MDLA 3S9YA 2ZDRA 1REQA 2BHYA 4Y9OA 4M29A 4D6IA 1UH2A 1XSIA 4IHCA 4M81A 1WZMA 2MANA 3PWIA 4XZBA 3TMQA 5CCZA 1TA3A 3ZMRA 2VFEA 2PDLA 3DIPA 1EZWA 1GG1A 4I3GA 1LP6A 4HZ7A 4QS6A 4HA4A 1NJJA 1I45A 1X6NA 3CIXA 5D33A 3CWHA 2BXVA 4EAYA 2J74A 4JIIX 4GZIA 1B3YA 2CLEA 4LYQA 3WUFA 4E38A 3B0YA 3RILA 3B8SA 5LA1A 3GNNA 3R0KA 4DBWA 5CPTA 1ZFJA 3M0XA 1CZ1A 2BTMA 2E9BA 3IWPA 3KOFA 2JF6A 4ML9A 4TU1A 5EMJA 4YVPA 2I9EA 3PB2A 2PDXA 1R87A 4JNZA 3LXAA 3T2OA 1XGZA 2YDQA 1S5MA 3DXIA 1H63A 4IMCA 5DMLA 1GKRA 3TUUA 3WD1A 1E0XA 3SCNA 2VM8A 1LBMA 4GQGA 2CXGA 3RDKA 1EJWC 4K38A 3ONCA 2WVSA 1O5QA 1JCNA 4IPNB 3LSCA 4BY3A 4JFVA 4CNUA 3GQYA 3V5CA 5FJOA 3VNJA 3MVTA 1XLGA 2JBMA 1JZ2A 1PZ2A 4DO5A 4H04A 2Q02A 2DZAA 2BODX 2ISSA 2X2YA 2GOKA 4D1IA 5LIKX 3GW3A 2VR2A 3G1DA 5HJYA 2ZADA 3T2PA 1VBJA 3D3AA 3UXDA 1OD0A 1EEPA 4H1ZA 1KNWA 3W00A 2CWNA 3VIPA 2O4QA 2QIWA 1TYGA 4H9MA 3S4TA 4A6GA 4YLWA 3ISIX 3TEVA 1UWTA 3FN9A 4V2XA 4TTGA 4LOCA 1ONEA 3CGTA 4NYUA 1PTGA 3W1RA 3DFYA 1DIDA 1NFGA 2OELA 1B3OA 4AMAA 3IRDA 3QQWA 2WHLA 2BWGA 4ZMGA 4J3TA 1V6UA 3V4BA 3WFLA 4JTRA 4H8NA 1GOOA 2Y5SA 1BTMA 1DJWA 2WMIB 1IWBA 2J77A 3AIEA 1OX4A 4XO6A 4QCFA 1G6CA 2XSAA 3AO0A 4REQA 2WB5A 2CLMA 3HQPA 5A8OA 2VDGA 3LLFA 1L6WA 1HKMA 2QJIA 5BOFA 2X0SA 1GOMA 1M1BA 3TZFA 3QTGA 3RPTA 4OBRA 4QJ5B 3LRLA 1HG3A 1RJPA 3SAZA 2BY1A 1GOQA 3ERPA 4MWAA 1A3WA 3EGJA 4D6DA 1NSJA 4PCTA 3AYTA 2V6AA 4XVEA 4NZ5A 3WQ5A 3GXFA 3PBVA 3POHA 3L2IA 1QO2A 2NW0A 2VEMA 4LY4A 2ZTKA 5BXPA 2VCAA 1E4IA 5BW6A 3M0KA 3AWOA 4Q4QA 4IQEA 2QVNA 1XRTA 2W4XA 4AD2A 1TIWA 4IICA 3WDPP 4KF1A 1EB3A 2G3MA 2WC4A 3W2UA 5BZAA 3WELA 1AH3A 3H2CA 3M44A 2ZRWA 5D2XA 2NUWA 2QCHA 1Q7QA 1V0MA 1Q6FA 3IRSA 3NQVA 5HJLA 1PDZA 3DG3A 3UZYA 3R1ZA 4IH3A 4LVGA 1MQPA 5G4HC 2CIPA 4AU0A 5IFPA 2HE5A 3BAJA 1H7WA 1LRTA 3BG5A 3ID7A 5FAGA 3PVFA 2F61A 2Y6ZA 2GSJA 2QCDA 3BVJA 2FB3A 3GDMA 1KFEA 3BMVA 4HHPA 1UC5A 3KXQA 4F40A 1RHCA 1XF0A 3ARZA 1QASA 3TYDA 2VURA 5CSYA 2ACUA 3T9PA 4QNEA 3ATZA 2CCRA 2GLKA 5I78A 3WLQA 1PZ0A 2VC6A 3MI6A 9CGTA 2QT3A 2CZEA 3K4WA 4Z2HA 1BXBA 3MBFA 2QDGA 1U1JA 2GJLA 4HU4A 2VC7A 4US6A 3ICJA 1C7TA 3T09A 4RV3A 2WSPA 2CW6A 3R11A 1XLDA 4RPPA 3BGJA 3DESA 3EX2A 4IIBA 1FHVA 1XV8A 4HNOA 2Z1SA 2Z7GA 1HL8A 2X1RA 2R1KA 4LF1A 2NQ5A 2RHGA 3UY8A 1VFUA 1LZOA 2CC0A 3LCIA 4GOAA 1PIIA 1XLCA 3H23A 4MDOA 3S2LA 2W66A 3QQ0A 2XN1A 3N9SA 1JI1A 4HPNA 1XWYA 4GINA 1G4TA 3N2TA 4UR9A 4ZXOA 2VEFA 4H9ZA 3NPWA 4XD4A 4GX9A 3WD2A 3WF2A 2NV1A 3ARYA 4TXEA 3LCWA 4RZ6A 3B06A 1X6UA 1QHZA 4QG8A 4CNTA 5KINA 3VI2A 3PJUA 1XKYA 3HZ3A 5ABTA 3LPGA 4US5A 3C56A 3DKLA 1PKLA 1EPVA 3WUBA 3R8GA 1YE4A 3L0NA 5AVNA 1QPKA 1XLHA 3UZWA 3BG3A 1LT7A 2PBGA 3SY8A 3T44A 4ZO7A 1O5XA 1NWSA 1MI3A 4MMWA 2PBOA 5A6LA 4LAZA 1YBQB 3AMDA 3LA4A 1TZ9A 1V6VA 4GC4A 4S3CA 2PC4A 2VRKA 4GWEA 4ZQOA 5BRPA 3PZUA 3TYZA 3G6LA 3VDBA 4J27A 3B03A 1OT2A 3BICA 1F7BA 4E0CA 4E3VA 3WLMA 1YRRA 2VZUA 4MGGA 1TVNA 4GI4A 3B0UX 4DNMA 2O7QA 3I3EA 3ABRA 4Z1CA 2CZFA 1S2AA 4OVXA 3LRKA 3GFZA 1B31A 4RE2A 1QI4A 5BWAA 1UQYA 2IQ0A 1A5NC 4W84A 1C90A 1JXJA 2WM0A 4NX0A 4M3PA 2BGQA 3HPAA 3W1AA 1PKMA 2QAFA 1XBZA 4I8DA 3JVAA 2VVSA 4NX5A 1XKJA 5FSEC 5LIXX 4PFHA 2RH9A 3W3OA 1TMQA 3OU8A 4GXWA 2GUUA 3CZLA 3WEZA 1W54A 1YBQA 4NZ3A 7ENLA 2ZX7A 1LUCB 3SM0A 2EQDA 1JCLA 1KRBC 4FNRA 2BS9A 4UOJA 4Q7IA 4QRNA 2QUVA 1BVNP 4YTQA 1PJ9A 2Z2UA 2ISWA 5EMUA 4W8BA 2J8TA 1OFQA 4XSMA 3DZ1A 3SFKA 3QVQA 4JD4A 3SGGA 1Q5MA 1UWRA 4O16A 3R8HA 1D7FA 4DZIA 2RJGA 3WQOA 3MU7A 5CAKA 2NUXA 3ZQ9A 1J5SA 4RKAA 3GVVA 3QMSA 1M9HA 1A47A 4CEUC 1TPUA 3S83A 3F2CA 3W28A 1SSGA 2BGNE 3Q4DA 1YNQA 3KBWA 3F4NA 3WMLA 3MA8A 4E5TA 4CCCA 1VFMA 3QXBA 3BPWA 3IK4A 3W9ZA 2MUCA 3PBMA 3PSVA 7ODCA 1LOLA 4RV8A 2XM1A 4NILA 2PU1A 3FHAA 4ZBCA 3KCOA 5D9PA 5BYWA 1L8NA 1TTPA 4L1XA 3EOSA 4X0NA 5DRCA 2F7FA 5D8ZA 3V1HA 8CGTA 3TFCA 3FEMA 1LWHA 2R91A 3GTFA 1XCWA 2B7QA 5HQMA 3DEQA 4F8XA 1ITCA 2YXOA 4NVTA 3TXZA 2IW0A 3GG8A 2W0UA 2ZA1A 3F4VA 4UCGA 1X38A 2D73A 1KC7A 4O52A 3R8RA 3PANA 2J79A 2ZC1A 1P5BA 4AX7A 3G3MA 2J9YA 1V3HA 3H6OA 3BV7A 1LG1A 5C7HA 1KD0A 1PHWA 1M68A 1BKSA 3CHCA 1BG4A 5A69A 3R0UA 4OZOA 2Z1BA 4DXKA 1XPYA 1X98A 2NV2A 2CZVA 1XRVA 4GG9A 4OJYA 4B3KA 3E38A 2FKPA 3YPIA 2WXDM 2HTMA 2R82A 1RK6A 2VUNA 2W27A 1AMYA 1HFBA 4IGSA 1O1ZA 3T0CA 2JF7A 3MO4A 1UKSA 3AXKA 4E2DA 4JTSA 1M7XA 3O63A 4RDYA 4L80A 2EBNA 4NAFB 1E3XA 2X40A 1FWGC 3RLHA 3AMGA 3MMDA 4BQ3A 7CGTA 3CASA 4LVBA 3QGAC 2NT0A 3URAA 3OIXA 4XZHA 4HMEA 3NYZA 4TO8A 2ABBA 5CSRA 3W6MA 1SR9A 2Z0IA 1VGAA 4N9BA 2EF9A 4NL1A 3VKKA 4AUBA 3N6HA 2VFGA 3WNMA 2OSXA 5K2ZA 2V3DA 3N3MA 4HHMA 3LN3A 3V7PA 4MM1A 4FNQA 5CPLA 1MW3A 3P3BA 3WBAA 1HJSA 1GEQA 3H54A 5I07A 1R3YA 3V36A 3VABA 2WCSA 4J3XA 4HCHA 3T7VA 2DIKA 3ITYA 5CPSA 4BQ2A 4AWEA 3U5UA 1IT7A 3DECA 3PJTA 2XN2A 1KFKA 2Q09A 2YLAA 4S23A 3ES8A 3KEHA 2NZLA 3PHAA 5C8BB 2IMRA 4S3GA 1CXKA 2IUZA 2V2DA 3N9KA 2FGLA 1KBIA 2ZZ2A 3GDRA 1YPIA 3PPHA 4Y90A 1S2WA 4AWSA 3H53A 4F2BA 3DAQA 1UD3A 2WKJA 4WZHA 5C9WA 2J13A 4BEQA 1V3KA 1JEZA 1UWSA 1A0CA 2OZ8A 2EPHA 3L23A 4BZYA 1GHSA 1WV2A 4WK9A 2IKIA 4GA8A 5LNWA 1IF2A 1TB3A 3BGGA 1FTXA 3NA8A 3TZNA 3PZMA 4A05A 2R1MA 2EG8A 3U8GA 4N02A 2BZNA 2PP1A 1FWRA 3STCA 2AAMA 3G3DA 1XFCA 2CYGA 3DG7A 3V35A 2EPLX 4PE8A 2XWEA 2Y7EA 3BLEA 3GS6A 2OMAA 3TN6A 5J5RA 2FHFA 3H24A 3HQNA 4N6FA 4YTUA 3SBFA 1MSSA 2A6LA 1NFPA 4GIEA 4J4KA 5GJMA 3K30A 3TA9A 3AIUA 1BF2A 4B3LA 1HTIA 1IV8A 1YXDA 4YPJA 2OEKA 3ALGA 2DSWA 1VF8A 1TQXA 3FDGA 4WRHA 3SJNA 4HA3A 1I0DA 3TSMA 1K8XA 1ZBKA 3TU9A 1N55A 5FF2A 1JZ5A 3NFUA 4LU0A 1XX1A 1A5CA 1Y8BA 2DQWA 3UESA 2PCEA 5IHSA 1UD4A 1PWMA 2X8RA 1QU4A 2G3IA 4LB4A 4NNAA 3TC6A 3S1WA 2C7FA 1UH3A 3KFTA 3PY2A 1S1RA 1K02A 2Z27A 3E0IA 2VRQA 3QKEA 5LGZA 4G56A 3LBOA 5EKYA 3N2OA 4PYSA 4M0XA 4H9VA 3IPWA 2RUSA 2YR1A 3BLLA 3NQ6A 3UWEA 4WUIA 2E7FA 4YYCA 2PWFA 4MY8A 1L6SA 3WNKA 1Z8AA 3UJSA 4QS5A 4PCSA 3QPEA 5C9XA 4LCSA 5DN1A 4KESA 4M6UA 3SUVA 2CLHA 3A3HA 3EMQA 2XVLA 2VMFA 3D5HA 1YADA 2A0NA 4W7UA 3W1MA 1R9XA 3ABZA 1WOAA 4EPBC 4PMRA 4LUTB 4NJIA 3OGRA 1XIHA 4RCXA 1GEHA 1W5PA 4XV0A 5AHFA 3R5EA 1P6WA 2WNZA 1CGVA 2D23A 4YNGA 4GXPA 1XC4A 2V5DA 1Q7MA 4EWND 1R3WA 4QQUA 3QH2A 3W07A 4FP1A 2XZ9A 1UIOA 3OVPA 3BOLA 2GUYA 3LCHA 1EJSC 4JTIA 1QAPA 2ZWYA 3W7OA 3K46A 4HPGA 1NDWA 2VZSA 4HZMA 5HMEA 3HPFA 1KM4A 2C16A 2CESA 3B9EA 1PIFA 1RH9A 1S5WA 3VM7A 3ES7A 2G97A 3BW2A 4QISA 3SI9A 3CEUA 4L4MA 3VVGA 4G1KA 4XD6A 1JQVA 3VIOA 2GGGA 5GNYA 4WDUA 2VHLA 2G95A 1RK5A 5FJRA 2QUMA 1QI2A 3W7MA 3OJGA 4DLMA 4H7ZA 4DJFD 5HNTA 1BYAA 2Q8XA 3FJNA 1PKNA 3W83A 4F0SA 3CPGA 4S3FA 2JKEA 4JTKA 2CBUA 3I65A 3D3FA 4LANA 3T55A 5I3HA 3UD6A 5I3FA 3W7JA 2A21A 2GSHA 3VINA 3AZRA 3EWWA 2DT2A 3GNXA 1B4EA 3PNZA 1V6XA 2Q3RA 4EVZA 3S1GA 1TR9A 4CQDA 3G1VA 3W7DA 3N29A 3QTPA 4Q22A 4WDXA 3S42A 4DX3A 4P7NA 1TFVA 2B0MA 5E09A 4JXCA 3W85A 4DWSB 1G5AA 4Q8OA 1J93A 3C8FA 2V5LA 3XINA 4E4PA 2OQYA 2GK1B 5HMSA 1R85A 2HV5A 3ITLA 3FV9A 1K9FA 5CJMA 3MUY1 1Z3NA 3UJFA 4FS9A 4MZ1A 1W3IA 3UNDA 3CV2A 4O1FA 4ERAA 3W0KA 2BV9A 5A6AA 5FIPA 4TIMA 1K70A 2WANA 3KRSA 4PMOA 3CQIA 2O0TA 2YOCA 1I4NA 9XIAA 4HK6A 1Q6CA 3LMYA 3SQLA 1HX0A 2X0HA 5KETA 2E6YA 1EHNA 4G7FA 4EPEC 1I2OA 4K1GA 3A3XA 1LROA 1IXOA 4MZ8A 4UMAA 1WBHA 4WY0B 1C8VA 3KS5A 1F3WA 1L2UA 2ZRUA 3VPLA 1GZJA 2GJRA 2GJPA 4MNMA 1KXTA 3WLHA 1QMLA 2YA1A 4W7VA 3K1DA 1QNOA 1W91A 3IARA 4B9ZA 1F3TA 3N2MA 3UVAA 2I16A 3NO5A 5T26A 1EJVC 2A4AA 2YBTA 4DB7A 4FB7A 4J3UA 1XYFA 3ABOA 1XYBA 4WDWA 5AHMA 2UY5A 4EF9A 4DUOA 1SMDA 3D6NA 4HOZA 2VNCA 1Q6LA 1D9EA 4FLOA 1M6JA 3TN4A 3M6DA 4HNVA 3IJDA 2QVHA 4KWVA 4J40A 2HMCA 1KWKA 1UR4A 3B4YA 4ERIA 4S3KA 1OJXA 3NM3A 1HL9A 2DUZA 4CVUA 2REQA 1A5MC 1QOQA 5HPCA 3C2OA 3R94A 1GK8A 4ZO9A 4Z1BA 1FP8A 1CEOA 1QW9A 5L6UA 4WY0A 2ACQA 1ODZA 3WSUA 2QF8A 4PUWA 5DCBA 1JDCA 3AICA 3ABSA 1H7OA 5A8MA 3HU7A 4LV4A 2X1UA 3KBMA 1VFOA 3AS2A 2EAWA 2Y62A 5CBJA 4WY0F 2LLEA 1UZ4A 3BO9A 1ZY9A 4Y6GA 4ZB0A 1J12A 2Q71A 1QW7A 3G22A 3S9ZA 2VX4A 4MNJA 3WF3A 3MCOA 1D3HA 2YZ5A 4LX4A 4AFYA 1ISXA 2G41A 4IP5A 5DT7A 1RD5A 2E8YA 3SJ3A 2RDTA 4EF8A 1WP6A 3G8RA 1FWJC 3NL6A 4QE5A 4ZZ9A 1TV3A 1AW2A 4GACA 5DBUA 4DJFC 4QIUA 4RXFA 3IUDA 3URQA 4CD7A 3CV1A 3C0LA 3DBPA 1IGSA 1KCLA 2XVGA 2DSVA 4JIEA 1MZHA 4XTIA 1NWTA 1AK5A 4C6FA 1TRDA 4BS0A 3TJLA 3ZT5A 4GGHA 4GO9A 3BCFA 4M51A 3PSWA 4PMNA 3UWVA 2RDUA 2Y5JA 3SCSA 4GE8A 2E9MA 4JHZA 3MMWA 1ZPTA 4TX6A 5EU9A 4I5RA 4S1FA 4L64A 1LRQA 2XDFA 1J79A 3LY0A 3V0TA 5DY2A 2EG7A 3RM8A 4GUIA 2JIWA 4FOUA 4M24A 5BROA 3TOPA 2XM2A 3PC0A 5I3JA 2UBPC 4W9TA 3GR8A 3ZVHB 3KS6A 1KFWA 1ESWA 2J75A 4Q4PA 2IQTA 4BI7A 4MJZA 3NO1A 1VIZA 2QCLA 1J96A 4UNIA 2TPSA 3ITGA 3APYA 1VAHA 2QDHA 4IMFA 1YTDA 4EACA 3EX3A 1K9EA 5K7JA 3JW7A 2HS6A 5I3IA 2VI0A 3MBDA 4FOJA 3VNKA 2YL6A 3KTSA 2D0GA 1GVEA 1K6AA 2WPBA 1HNYA 4YIWA 1KV8A 3UJ2A 4O0KA 3LG3A 4JFTA 1TJ1A 2DVUA 1XBVA 1MMFA 3LS9A 1GOIA 2PLJA 3H21A 2W5FA 4Q4SA 2DZTA 2QIIA 4FMVA 1S5TA 4ES4A 2FVKA 3U2OA 2GZXA 4Q4MA 1FWAC 3H22A 1RPXA 2WHKA 5LXEA 3BK0A 4LFYA 3CZKA 2AOSA 4UFLA 5C2GA 4EP8C 1HUVA 4ZODA 3TXVA 1VCGA 4HSNA 2WMGA 2PDGA 3ORWA 1UJPA 1KWGA 2DUAA 3FS2A 1SM9A 3WBEA 3K8KA 4JQAA 2ZOXA 1XCFA 2ZICA 2CKSA 1UA7A 4C6PA 4XIMA 3LBCA 3AUOA 1BPLB 1H7PA 1E6QM 3G18A 3MHUA 4OOUA 5A6JA 2I5GA 3DI0A 1LBLA 1JR1A 1X1NA 3OHMB 1WAWA 3ZSSA 1DJIA 1HP5A 3P93A 5AB3A 3FA3A 2QPUA 3W72A 3KL3A 3FEQA 3PUEA 4LNCA 1E6PA 3DOPA 3CO8A 1A49A 2QCFA 4HPHA 1PX4A 3C0SA 1IWPA 1JPIA 4Q33A 1XD0A 5ECUA 5SWUA 3WQVA 5A6BD 1K8CA 1GW9A 3NWRA 4X0VA 3F4DA 2AL2B 3GYCA 3CHDA 2BGSA 3NM1A 4U5KA 4IMDA 2J7HA 1OFRA 2ZVIA 3QMRA 1XH2A 1CDGA 3LGGA 1O1HA 1EOMA 3N13A 3OP2A 1FRBA 4TV6A 3KOXA 3OTRA 3LEPA 1PUDA 4JNYA 3R89A 2V3FA 3KOWA 3O1NA 3T0DA 4PN2A 1BTCA 2WNWA 2CXEA 3R0DA 4Q8UA 4HOWA 4RK8A 4QEEA 2OB3A 2WZMA 3DU0A 3C52A 1CB2A 2BOFX 4K37A 2D3LA 2DEPA 3W7QA 1H61A 1F07A 3ZXWA 1EJUC 4U3CA 3RR4A 4F9JA 3RUBL 4GFSA 4D8AA 1K9TA 4IGHA 4H7CA 4J28A 4JQ3A 4LUJA 3NQMA 2YFNA 3TW6A 1W3NA 3LNPA 1P0KA 2NX9A 3ZWSA 3KVLA 3SW6A 1TTQA 2ZZ6A 2DZPA 1P48A 1GTHA 1VFSA 1UR0A 1KQYA 1DIEA 3C2RA 3IJIA 2AGKA 5I6SA 3MPGA 4KKXA 4IXHA 4HU8A 2HPMA 2YLLA 2DORA 2YYUA 3G5EA 2QUNA 3L4WA 4PRWA 1QWKA 3GR4A 1O5RA 2CBIA 3S5YA 5C9ZA 3EWDA 1T6MA 1GZGA 4GYJA 5K9CA 4Z1DA 1HKKA 2QHAA 2BMBA 3OG2A 5GQBA 1UD5A 3WG6A 5CPNA 5AFDA 3W88A 1K8ZA 2B7OA 1A3XA 2ZC8A 3LLDA 1WZLA 4LV9A 1UWUA 4PR4A 4P2VA 4XTDA 4KRTA 4G5DA 1W3JA 1V0LA 5M03A 1G7UA 3R2GA 1E9YB 1BWKA 3R6IA 4QDPA 1ISYA 3N4AA 3RX2A 4AWUA 1CBGA 1J6OA 2PUZA 2J7CA 4IF2A 3UY7A 3WBXA 3LCFA 3W24A 4I7UA 1GYMA 1GVSA 4P8XA 1GKQA 5H2ZA 3FYOA 3VDHA 2PTYA 1DYSA 2ESCA 3WF0A 3UYIA 3CMFA 3VOFA 1HJUA 2XWDA 2GQ8A 4NJGA 4W5UA 4PB4A 3S5SA 1W1IE 3AJ7A 2WCGA 4Y9AA 3TTQA 3NAVA 1R3TA 3CH9A 1GYLA 4AVOA 5B7ZA 4C6BA 1VBUA 2J7EA 2AAAA 3WDQA 2H9AA 1IXNA 1PX3A 4KMQA 1EJRC 1UJQA 1KFBA 2XH2A 1KR0A 4RZ4A 4M82A 3LHWA 1ICSA 2YDRA 4W8AA 4P7QA 4NZ1A 3SSZA 3EX6A 4UNLA 2AKMA 5HANA 4A3UA 1CIUA 3MS8A 1PHQA 1NQKA 4CCEA 3RX4A 3JUGA 4EE9A 1JYNA 4ROPA 2FH8A 3AZTA 1HP4A 2OEMA 3P82A 4GK8A 1RQEA 2OSWA 2CU0A 4L56A 4NT0A 1XIJA 3V18A 3VKBA 3MYPA 5F4XA 1AL7A 1KBKA 4DXXA 1YDNA 3NJ3A 4V1YA 3GDTA 4J5NA 4WD0A 4GNVA 4Y8FA 1P6BA 3TN5A 4E4FA 1XSKA 5J8LA 4HJFA 1PEZA 4D72A 2YSWA 2VWSA 2GQ9A 4PGLA 3WQ6A 2J4GA 1PIGA 1UZHA 3OG3A 3BLKA 1QWGA 1W6TA 3CV6A 2WSRA 3RM9A 1EX1A 1IR1A 3T07A 3ZFHA 5HQLA 1M5WA 2P53A 3W4RA 1JI2A 4P8WA 4FNPA 3B8IA 4UUIA 2BY0A 3ABQA 2HWGA 5C2XA 1SO6A 1UBPC 2WJDA 1VR6A 4LYRA 4WJEA 1OG0A 1EP3A 2QCCA 2YIHA 4OECA 3SCUA 1K9DA 2G4JA 2XFFA 1TUFA 4M80A 3T05A 1OYBA 3RJYA 3S47A 2Z25A 4XAYA 1Q6DA 1MDRA 4GISA 4AHPA 2D24A 5E70A 4RDWA 4YCOA 3EPNA 2GJNA 3PPFA 1R0MA 1NTHA 3SEPA 1JPKA 1Q4NX 5G2HA 3OO2A 3G1XA 3AIWA 1F61A 1TE6A 1XLEA 4FHAA 5LSMA 1WOBA 5G2WA 5K3VA 1TV8A 2NLIA 4FA3A 4NJHA 3W81A 2WZTA 1AD1A 4UFMA 5HOSA 3VNDA 4UC5A 3THCA 5A95A 3A4AA 3AU2A 3EOUA 4QNWA 5A3HA 1DJGA 5BNKA 3PFMA 1F4HA 3KCLA 3K13A 3FGCA 4DZHA 4HN8A 2HDJA 2VZOA 1G0CA 1SW3A 1UKTA 1IQ8A 3L68A 1CNVA 3TNBA 1TJ2A 2C0HA 5FACA 2PD9A 3O06A 2ZUNA 2DH3A 1OWQA 2VZTA 4KW2A 4QE1A 3B9NA 1HKIA 1N8IA 1I1WA 4F0HA 4DYJA 3NURA 3WQFA 3W1XA 1XDJA 1OYCA 2XGZA 2WK2A 5CG0A 1J8VA 3U48A 1XLKA 1QR7A 4HJWA 3R25A 4M5PA 1XL9A 3N25A 1EC9A 1RJQA 1XW8A 2BHUA 4C6DA 3HG3A 1OEPA 1TRIA 2XGIA 1W3KA 1OK4A 4JTLA 2VO5A 4MB5A 4LUSA 3TFXA 1QNQA 3RYSA 2WZEA 4AZIA 3REQA 3E2VA 4HVXA 4OWGA 2G0WA 4I6VA 3QHNA 3LOTA 3M7SA 2C1IA 3B9DA 2ASHA 3QMTA 3SGUA 1GORA 3NSXA 3PWAA 1TX2A 4HYRA 1AQ0A 8XIMA 4S38A 3S0CA 5E0FA 4Q8MA 1XXXA 2WZIA 2E0PA 5D9NA 3E02A 4TV5A 2C13A 1WZKA 3T8QA 3A24A 4AF0A 4ORIA 4PEKA 2R24A 4GJJA 3S1XA 3GG7A 1ECQA 5DELA 2TODA 3ANVA 1P0DA 3GKAA 4B2DD 5AYIA 4HT3A 3OVQA 1K7EA 3QPZA 1QRQA 3UFYA 3UWZA 3CAWA 3QEZA 4H00A 3W2LA 3BXWA 3HJEA 4JS3A 1JNEA 3GZ3A 1AFSA 1OVDA 3BH4A 4A21A 2OLSA 1E15A 3SFWA 1JZ7A 3W1LA 1JL8A 4UXDA 4DJED 4ZOCA 3EPMA 4ZO8A 2C3ZA 3NQ8A 2PE4A 1QI3A 1UA3A 3IACA 4BJHA 3QC0A 1XP3A 5GVJA 4GCXA 3B0XA 3NQAA 5BXRA 3FVDA 3PTDA 4ZFCA 1M04A 4J7RA 4W7WA 2TAAA 4PFMA 4PMQA 1JFXA 3WJYA 1XPGA 3N34A 2FZNA 4XD5A 2EKGA 4D2JA 3M0IA 3H7UA 4JQ4A 3QOMA 1DBTA 5MF5A 2GDVA 5D04C 3KP1A 4MYAA 2CBVA 1HO4A 2JFEX 5REQB 4HHLA 2BVDA 3ZM8A 1OX5A 3S2NA 4GVHA 1P1MA 1S2VA 2FJKA 2PZ0A 3W84A 3W37A 3M5YA 3HJZA 3N1AA 1VHCA 2WZHA 3QM3A 4JKLA 4ZCWA 4JDBA 5ABFB 4S2BA 4PUMA 1IR2A 1L9WA 2QLYA 1R2SA 2GGEA 4ZFMA 5CJ5A 4P61A 1AH0A 3GTIA 1TTJA 4LEFA 4WEVX 1Z42A 1Y0EA 3MMUA 3XIMA 1XSJA 3B8UA 4GZ7A 4K8EA 3O6CA 3L0KA 2Z2BA 2ZX6A 4XAGA 2OSYA 4UTKA 3QFEA 1YEYA 2RJHA 2NQ9A 4JFWA 3B97A 1V6YA 1OFBA 3JS3A 1E1CB 3A13A 3A5FA 2YXGA 5GJPA 1G1YA 3KZSA 2DJXA 1AH4A 1R3SA 3UF9A 1O5KA 4LXFA 4ORMA 5REQA 4PMXA 1NDZA 4L7ZA 4HU0A 1I75A 3ZJ7A 5AY7A 1QVBA 2WM1A 3T81A 5FKYA 1YPXA 1RBLA 2R94A 2ZUVA 2P3EA 1OB0A 3AQUA 5GJNA 4DY1A 4Q8NA 5CH9A 5DMNA 3GU9A 2WAGA 2ZXDA 1HVQA 1B5TA 3GAKA 1QATA 2JEPA 3MP4A 1TV4A 4Y2WA 4R9XA 4XK2A 3L67A 3MHGA 4JQ1A 2RDXA 5BMXA 5CSUA 4CQBA 3QGVA 4R33A 1EYWA 1GCYA 2WO5A 2Z7KA 2B4GA 2QGHA 3WENA 5TBOA 3ITTA 4LJ3A 3SRKA 5BWFA 4LYPA 2INEA 1OC7A 1OQFA 5I2UA 3LK6A 3VYLA 3G1SA 1ZAJA 1S46A 4FXFA 4W87A 3D0CA 3HPXA 3UZZA 1VENA 4MAZA 3T0AA 1TPH1 3AXHA 4K36A 4XKMA 2FZMA 2WSYA 5I79A 5A6BA 2FPTA 2XIMA 4D9PA 4IX0A 2DW6A 2ZZ1A 3WZ0E 3ZVIA 4H9TA 4QROA 4A8IA 1V0NA 1YPFA 2OKOA 4DUVA 2ACSA 3QW3A 3S46A 3THAA 3EWCA 5DBTA 3B3DA 1WXZA 3P81A 3PTMA 5IDIA 2B7PA 4E8CA 2R1PA 4QEHA 3WH9A 5D2YA 1FQ0A 3VGHA 4H4IA 3VD4A 3RIKA 5DCDA 4X60A 1GONA 1PDYA 2DSKA 1PCWA 2Q3OA 4DJEC 1HT6A 1V79A 1ADOA 4AC1X 5T9CE 2TSYA 1VPYA 4NXKA 3P80A 4WXYA 1NQ6A 3TSBA 5AC8A 4PMDA 5XINA 3AMCA 1SMAA 3I6EA 2Z00A 3LI1A 5D9OA 5FJTA 3PZNA 3CU2A 3I7SA 5F4SA 3DYMA 4KIRA 2XSBA 1EXBA 4XZIA 3HIJA 4QG9A 4BEUA 4C6CA 1WUFA 3MJMA 2C14A 1UP0A 3ABXA 2AQOA 2PI6A 4IISA 4TMCA 1F8IA 3L9CA 1OFPA 5HMDA 3ITCA 5I0DA 3LCLA 1SFSA 1VLWA 3N04A 3Q94A 1E72M 2Z1VA 3O0KA 2JGYA 4NUWA 2WVUA 3TMLA 4ICNA 2VZVA 3HO8A 3QBUA 1X6LA 1E0UA 1AQFA 3EOOA 3QV8A 2GOUA 3LHUA 3TJIA 3MP3A 1KV5A 3BURA 3ZOAA 4H41A 4GC3A 1OCBA 3NXLA 3LM3A 1ISVA 3N15A 1SPQA 1F4AA 3ZJ8A 1QFEA 2VFIA 2G37A 4GI8A 5GNXA 2XVNA 1J0KA 4UQ9A 2F38A 3MMTA 3BAYA 4LF2A 1XLAA 4PSRA 1I2QA 4QLJA 4BF5A 3KX6A 4HA0A 1H1YA 1VJZA 4KEZA 3FSTA 3G8EA 3FX4A 3P60A 5CKSA 2FH6A 5KTLA 2PSNA 5GNZA 4OBTA 4IZGA 3HG4A 5H8PA 7TAAA 1TR1A 3AS3A 1GYNA 4KCUA