1YDNA

Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
283
structure length
283
Chain Sequence
AEHVEIVEMAARDGLQNEKRFVPTADKIALINRLSDCGYARIEATSFVSPKWVPQLADSREVMAGIRRADGVRYSVLVPNMKGYEAAAAAHADEIAVFISASEGFSKANINCTIAESIERLSPVIGAAINDGLAIRGYVSCVVECPYDGPVTPQAVASVTEQLFSLGCHEVSLGDTIGRGTPDTVAAMLDAVLAIAPAHSLAGHYHDTGGRALDNIRVSLEKGLRVFDASVGGLGGCPFAPGAKGNVDTVAVVEMLHEMGFETGLDLDRLRSAGLFTQALRQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords HYDROXYMETHYLGLUTARYL-COA LYASE
publication title Crystal structures of two bacterial 3-hydroxy-3-methylglutaryl-CoA lyases suggest a common catalytic mechanism among a family of TIM barrel metalloenzymes cleaving carbon-carbon bonds.
pubmed doi rcsb
source organism Brucella melitensis
total genus 89
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.4: Hydroxymethylglutaryl-CoA lyase.
pdb deposition date 2004-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ydnA00
5A5WA 3C2FA 4N4QA 3W9ZA 1QAPA 1NEYA 3BG5A 1UUMA 3LRMA 4KWWA 3CM4A 4JTLA 3EWWA 1I45A 1WDWA 3P5ZA 2C13A 3NA8A 1EA0A 1BEUA 4TIMA 3ZS4A 1K8YA 1XCFA 2E68A 3FS2A 4POCA 4X9SA 1SSDA 3THQA 3T4CA 1VCGA 5K9CA 4OT7A 4LTSA 4W9TA 3W84A 1TIMA 2PRHA 3W2UA 3PSVA 1F76A 3FIGA 1LBMA 4M6QA 3R12A 3GVGA 1MEIA 4MVAA 2HMCA 1B3OA 3NQ2A 3M1ZA 3NL2A 3DFOA 3STEA 3L0KA 1H7PA 4IMEA 1EWEA 2O7QA 4KWVA 2FPTA 2JK2A 3T44A 1NAL1 3DI1A 4LRTA 3UWZA 1BKSA 4X22A 4NQ1A 3QQ1A 4FHAA 2C1HA 1W5PA 2QUTA 2NV2A 1KV5A 3OVRA 4UFLA 1MSSA 1XBXA 3BG3A 5G1YA 3KFTA 3G0XA 4JICA 3IIOA 3NPWA 3DENA 4JN6A 3W72A 3B0UX 1MZHA 3EX3A 5U7SA 2C16A 1TO3A 4O14A 3W71A 3QQ0A 3OBKA 2V82A 3N2MA 3JRKA 1IGSA 3UWUA 4FB7A 3GKFA 1EPXA 4JTIA 3B0VC 3BGGA 5LSMA 2DZUA 1ZAIA 4OHQA 5DCBA 1KM4A 4XBKA 3ZR4A 2BSLA 4O0ZA 2YPIA 1S3HA 2ZRWA 5HWMA 4BWLA 4O28A 1JJKA 3TXVA 4IMCA 3P60A 3TFXA 3C56A 2VOMA 5MHBA 2GQ8A 4KFPA 4NX0A 5EPDA 4RCXA 3M5VA 2WKJA 2NXHA 3W86A 4XWUA 3W70A 1VCFA 2D73A 4M7TA 1MO0A 1TREA 4NZJA 2DU2A 1QR7A 2Y70A 1W5NA 2QJIA 1YPFA 2DZXA 2E09A 1TTJA 4JTTA 4OE7A 5AB3A 1NF0A 3RLVA 1H7OA 4UNLA 1GOXA 2X1TA 2NWRA 3A23A 3FYOA 3OG3A 1VZWA 2ZZ4A 4Q32A 4WXZA 2X16A 1KFLA 1XBYA 2CZ5A 3QJAA 1C9DA 4CCCA 3HIJA 5BMWA 1LOLA 1OYBA 3L66A 3LXAA 3NM1A 5L6UA 1R47A 4LU0A 1CW2A 3S1XA 3W1MA 2PE4A 4O8RA 2ZFAA 3O1NA 2P0OA 3QC3A 3CIWA 3W2LA 4N02A 1TYGA 4N9EA 4HNVA 2HSAA 2H90A 1JRCA 3O8AA 4JTSA 4X2RA 1ZAHA 3U6WA 4MKNA 1GJPA 1G7VA 3U2OA 2CU0A 3QPYA 4S2BA 3DHFA 2FDSA 1W3IA 2RFGA 2CFFA 1RZMA 1XDMA 1LOQA 4MIMA 1FUYA 1XC4A 2ZZ2A 4NZFA 1TTPA 1KW1A 2FTPA 2ATMA 2Y7FA 1LORA 2VEPA 1F6KA 1BWKA 2GVJA 4OU1A 3S1VA 2PRMA 3LCWA 4YLWA 1EB3A 1H5YA 5LNVA 2B7OA 3E49A 3S1UA 4I9AA 3O05A 5CKSA 4JS3A 2ZYFA 4O50A 3O6DA 2A1YA 5EMUA 1I8JA 2VFIA 1JVNA 1Q6OA 6ALDA 3G1AA 3NPXA 3W7RA 3C8FA 1O94A 2YW3A 4HIBA 3T40A 3KVMA 4JXCA 3W23A 4LVFA 2G96A 1AW2A 2A7PA 3MI6A 3Q37A 2BXVA 1A5CA 4ADTA 3LCIA 3UNDA 4B5NA 2HS8A 4AB4A 4UTWC 4I7UA 1SZNA 4Q4KA 3LHYA 3HPSA 4Y9AA 3STGA 1X7FA 2BLEA 5HUPA 1SQ7A 1ZHAA 2B7QA 1K03A 3CLMA 3W22A 4CQAA 2BZNA 5DXYA 1F6PA 3UWVA 3CIXA 3G18A 1XUZA 3W1QA 2A4AA 3S42A 3P61A 3FKRA 1F74A 3EWBX 2TSYA 1YDVA 3GDMA 2VEMA 3PM6A 4IX2A 2J9ZA 3MJYA 3NDOA 4CQ8A 3TQ0A 1EP3A 5KINA 2JKEA 4DPQA 3QSTA 5D05A 3HB9A 4N6FA 2AGKA 4UTJA 1IXNA 4EVZA 1S5WA 1RD5A 1F05A 2XN2A 5K9XA 4CNPA 3PBUA 2QUVA 1EUAA 1UASA 1XKYA 2DZVA 2Y7EA 3UQNA 2WOQA 5C55A 4OV9A 4U28A 2F7FA 1JULA 1ME9A 1PCWA 3PF3A 4LS2A 4PEKA 5HULA 4DO4A 4CCDA 1SUXA 4MZYA 3W7QA 1V5XA 2EAWA 2WQPA 3B0PA 5CG7A 4A29A 1HG3A 4DELA 5IM51 1XDLA 3HG3A 1SZFA 2YSWA 3TFCA 4G1KA 1FQ0A 3QMTA 3OVPA 2F84A 4K39A 5LNSA 2NXIA 4CNNA 3DZ1A 3VNDA 1N55A 1GG1A 2GJLA 4GC4A 2ISVA 3P80A 4ZZ9A 3N19B 4UTTA 3O6CA 2BWGA 3M6YA 1QCWA 3TSBA 4UCGA 1VYSX 4PTNA 4DPPA 1IXPA 1OABA 2ZRVA 3P5YA 4FF7A 2RDTA 3IIPA 3LERA 4LS1A 5DCDA 1VH7A 4QISA 2QCCA 4RXGA 1KM6A 3PY2A 2I14A 5U4NA 2VELA 5G5IA 3QEZA 4O19A 1OFQA 1H63A 3CHVA 4JIQA 4WOQA 3P74A 4YMZA 3ABRA 1Z44A 1LDCA 4MPQA 4IGHA 4JTJA 4NVTA 4BI6A 1X6UA 3E96A 3TW7A 3Q2DA 4NJGA 4O1DA 5CSRA 3SJ3A 3TJXA 5AOUA 3LTSA 3IIVA 3OIXA 4UFIA 5CGQA 5CPOA 1E51A 1A5BA 4MY8A 4Z1BA 2GVGA 3PULA 1GT8A 1LRQA 2YFOA 5AYXA 1KFKA 3VE7A 5HR6A 2BTMA 4RK8A 1AW5A 1LLZA 3G0UA 1L2UA 4J9JA 4LV9A 1A53A 4PODA 4YWIA 5IBXA 1YXDA 1M5WA 4JX5A 4ONVA 5GVJA 3CT7A 3HGOA 1Z42A 1DKWA 2CLEA 3R8RA 4O1CA 3KOFA 2VC6A 4GUGA 4RZ4A 5G1TA 4UR7A 3W2JA 1P4CA 4UMCA 4JNMA 3W1PA 4EWND 4CQ9A 1TPC1 1YTKA 1TQXA 5I3JA 1J5TA 3G24A 3PG8A 3DFNA 1VLWA 2ZDRA 1JCMP 1W54A 1O95A 3W7CA 3BGJA 3NQDA 3W85A 4O53A 3GXNA 2NX9A 3NQVA 3MYPA 1I2RA 1EUNA 1ME7A 1XM3A 3KVKA 4X3ZA 1GEQA 3SR7A 5BOOA 4ZVJA 3FLUA 4IUOA 1XI3A 1YXCA 1LLWA 3FA5A 4A3UA 2H8ZA 3N34A 1P0NA 1TPEA 1T0OA 2EHHA 1OK4A 5KMYA 5LNWA 3W7GA 1LTDA 3GIYA 3LI0A 3W7LA 2G95A 4N9CA 3P84A 1X1OA 1TJPA 3DXIA 4IPIA 4JYDA 5C6MA 4LC8A 1GYNA 3GXPA 4QNWA 1GZGA 1LOSA 4ZMGA 5CZSA 3PS7A 1XUUA 3LLFA 3M41A 1G4SA 4O52A 4ZQOA 3WJYA 5H2ZA 1ZAJA 3KRSA 3W07A 4D2JA 4N4PA 5J5DA 3HQ1A 1G4PA 2A5HA 3DBPA 1QWGA 3CB8A 3NQCA 3MBDA 1K7EA 1I2QA 4N9DA 4GUJA 3WJXA 4JTHA 2ZA3A 3TH6A 2B0MA 3ABSA 1G4EA 1H1YA 1QMLA 3U8GA 3BLEA 4IMDA 2TRSA 4P61A 4HT3A 1A5SA 1WX0A 3TMLA 4UC5A 5HMSA 4XTDA 4E2BA 4AH7A 1ADOA 1OYAA 2PRLA 2Y63A 3WJZA 1H7RA 1KM5A 3FJLA 2YYUA 3W1TA 3EX4A 2Q3OA 3LGEA 2Y89A 4ML9A 3KXQA 2CZDA 4DF0A 2A2IA 2ATSA 5FI8A 2Y62A 1GG0A 1OK6A 1WA3A 2G5WA 4Y90A 5KSWA 4I7WA 4OWGA 1ZJIA 3PB2A 3PVFA 4O12A 4PC8A 3MP5A 1RQHA 4EOUA 3B4UA 4QM1A 4GUIA 3CWNA 4C1KA 1I4NA 1QDSA 2ZCGA 5CPLA 2QCLA 2A6LA 3IIXA 1FCUA 4MYAA 1FDZA 3KVJA 3N9RA 5FEXA 3NNTA 1L9WA 3GYEA 3TR2A 3LRKA 4TO8A 1YYAA 3T78A 1THFD 2FQIA 4Z0SA 4PH6A 1OFOA 3L21A 3TC6A 5F4WA 1PHQA 4UIOA 5KZDA 5AC6A 1TB3A 1QOQA 3C2OA 2NUXA 3W2KA 2WV8A 1FDJA 2I1OA 4O0KA 4JTEA 2QF7A 5HNRA 1G7UA 1BTMA 4AHOA 3LOTA 3G1DA 1JCLA 3W83A 2Y6ZA 2G97A 2R91A 1W8SA 4GUFA 3LHVA 5F2GA 3B04A 3NOEA 3DAQA 5AHLA 5TIMA 5EY5A 3BW3A 5F2LA 3TUUA 3GDTA 3NL5A 3QW3A 1OX6A 4R33A 1K7FA 3QM3A 1DJQA 1P1XA 5ABTA 4JDBA 4K36A 4UTKA 5C5YA 5E1QA 1FCVA 4LY8A 3GK0A 3TU9A 2C14A 1R46A 4N9BA 2Y7DA 4FNPA 3Q58A 2R8WA 1VHNA 1TTQA 5K4XA 1FCQA 2GJNA 4O4WA 1SO4A 8TIMA 1G6CA 4Y96A 1VJIA 4UTLA 3W7MA 2X1SA 2ZZ7A 4A2RA 1HFBA 1KTCA 1XBZA 4H6KA 1SU5A 2A7NA 5G4WA 4FIRA 2QCHA 5TBOA 3KRZA 3LHUA 4NXSA 2ZA1A 3NQEA 2Q8LA 4XZ9A 3T55A 1D3GA 3MW7A 2J6XA 5FF2A 1OX5A 1HO1A 3NQ8A 3NPUA 1D9EA 4UTWA 3C4UA 4IXHA 3IVTA 3ZFHA 4AHPA 3VI2A 1DOSA 3B06A 4O11A 5HJLA 4JTFA 1FXPA 2R94A 3DFSA 3LCHA 4R53A 4UFHA 3CTLA 5F1VA 5K7JA 1F2JA 4N6EA 1W3TA 3TSDA 2Y88A 4YCPA 4CNOA 1H62A 1KFEA 5HINA 5I3GA 1B4KA 2ZRUA 3QSRA 3F4WA 3P62A 4K37A 4YL2A 4XUGA 4FNRA 3KRUA 3IGXA 5DBUA 5BW6A 4MY9A 4DXVA 2ZRZA 4FIQA 4Z1DA 1VQTA 4JYFA 3PBWA 5KZEA 4AF0A 3RLUA 3GAKA 2NXGA 2NV1A 3W7PA 1OHLA 5FEPA 1W0MA 1TRIA 3TMQA 1ALDA 3NEVA 3NQGA 2Q8ZA 1TV5A 2PURA 4FNUA 4O1BA 3UWQA 3S1WA 3NQAA 3NGJA 3QMRA 2H6RA 2P1FA 1OJXA 1OX4B 1W37A 3WK2A 3TAKA 2ZZ6A 3I68A 3NR0A 1R30A 1H60A 3KVLA 4KFNA 3GLCA 5DCEA 1PCKA 3PAJA 1OFDA 4O4VA 3W3OA 3INPA 3SZ8A 1DHPA 4JTUA 1XL9A 4LUJA 3MO7A 3SSJA 4MFEA 2ABBA 5D2WA 4BF9A 2V8ZA 3L68A 4FX8A 4R34A 1X1ZA 5LGZA 5EKYA 2YYTA 3ANYA 2NX3A 3SGZA 5HWJA 3TV8A 3LCFA 4M19A 3GZ3A 3UD6A 1FCBA 4JDYA 1OFBA 1SZEA 5CZJA 3QYQA 1W56A 2VKZG 4JX4A 5H91A 4L4MA 1N7KA 3O63A 4WXYA 2QCMA 3HG2A 4UTIA 3WK0A 4RJEA 3RMJA 2DZSA 4DF1A 3A5FA 4OQVA 2E6DA 3R13A 3BG9A 3IV3A 1TPB1 5EBUA 1PVNA 3RF9A 3GKAA 2ZTJA 2W6RA 1H61A 4Y8FA 4RV8A 3O07A 3W87A 3USBA 1VCVA 5I3HA 3S5YA 2FIQA 3GAYA 2TYSA 3LRLA 3QZEA 1OFEA 3CEUA 3MUXA 4LVDA 3UYCA 2PC4A 4RXFA 3JR2A 2NUYA 1LROA 1IXOA 2ISSA 5DELA 1Z41A 3W1RA 3QPZA 1DVJA 3MYOA 1HO4A 2FB2A 2NX1A 1SO3A 3F1QA 3HPZA 1JUEA 3TKFA 1AG1O 3TIMA 3C3NA 3QH2A 4HN4A 3EX1A 3EWZA 1TPH1 3FYPA 1K02A 2QJHA 3NQMA 2P10A 4IX0A 1W5QA 3D0CA 1JUBA 3DKJA 1YADA 5D33A 3TC7A 3C52A 2QAFA 5F2MA 3HG5A 3NAVA 2ALDA 3N9SA 1ME8A 3LV6A 1G69A 3VE9A 2ZRYA 3YPIA 4ICNA 1AK5A 3S0CA 1ZCOA 2QDHA 4RKAA 4DBDA 3KX6A 1ZFJA 3NM3A 2AQWA 4NXKA 3W1UA 3IEBA 1NF7A 1DBTA 3UY7A 4RZ5A 2Q3RA 4DEFA 3LX9A 3HOJA 1S5VA 5K4ZA 1DQXA 4FEZA 1OF8A 3IVSA 1XXXA 3M43A 4AF0B 1F5ZA 2B7PA 3WJWA 4NJHA 3TXZA 1GWJA 2CLHA 2C0AA 3DFPA 2J27A 1H7WA 2NUWA 2V81A 3G8EA 3PSWA 4QAIA 2OJPA 4XKYA 2NZLA 1JCYA 3W74A 4PL1A 3BO9A 4OGZA 2QCDA 2GOUA 4LC6A 5DY3A 4FNQA 2WSRA 4FNTA 4NJJA 3CEPA 4ORIA 3DGRA 1YXYA 4NJKA 3RNDA 3PUDA 1KA9F 2AAMA 4NT0A 1VYRA 1WYIA 2WNNA 4FXSA 4Y6GA 3TROA 3PBVA 3RK8A 4UTUA 5AYZA 1H7XA 1M6JA 2V5BA 3L65A 3W7NA 3PBYA 4TMBA 3ZWTA 4GJ1A 4OBTA 1PIIA 3LCLA 5F4SA 3H54A 3E0IA 2J88A 1FWNA 2W0UA 3GB6A 1F7BA 4AWSA 5E0KA 3GNDA 1SW3A 2VXNA 1KV8A 4O13A 2CLMA 3V75A 1SSGA 4ZL1A 1SO6A 1DL3A 1WAUA 1K8XA 4MLRA 2VFFA 1UJPA 2H3DA 3IGSA 1GYLA 2HTMA 1LM1A 5AC8A 3LHTA 4HSOA 4GNJA 5G2WA 2X2GA 3DH7A 1SZGA 3NL6A 3P8IA 3UXAA 1SR9A 1TTIA 4LVBA 1W31A 4O1AA 3AO0A 3NQFA 3TK7A 4LS0A 5FF7A 5HQEA 2JKPA 4H4IA 3A24A 4QITA 3TQVA 1RPXA 5T26A 3LHZA 4IOTA 4EF8A 4ADUA 2Z6JA 1OFAA 2B4GA 2WSQA 1JR1A 3RFAA 1MEHA 1UUOA 3B03A 1KBIA 1OG0A 2ZRXA 1FX6A 5FEZA 5FEWA 3TSMA 5K2ZA 4EF9A 4FX7A 1H1ZA 3MHUA 3LLDA 3JS3A 1OVDA 1EWDA 1AL7A 5BMXA 3G1VA 3C0JA 3W6YA 3T7VA 4XQ6A 1FWWA 4M6PA 5FF4A 1GVQA 3LI1A 3GXTA 3BW4A 3THAA 4WY0F 1ICQA 1I2OA 2OT0A 3E12A 5LNUA 2R14A 4JYEA 2ZA2A 4IMFA 4ALDA 2A21A 4PA8A 1B9BA 1ML1A 4A22A 2E1DA 1C29A 4E38A 3L67A 3M0ZA 4MUZA 2CWNA 3LXCA 1KM2A 2CLLA 4AMAA 1QFEA 4UFMA 2YR1A 3LHWA 1R2TA 4AHQA 3P67A 4UMBA 3GDKA 5LHFA 3QRHA 3M16A 3NYZA 4WX2A 1XFBA 3E9AA 1KFBA 1IIHA 3HMJG 1KM1A 3I6RA 1VHCA 1QOPA 2OT1A 4JGDA 4GE8A 1LYXA 2TMDA 3RU6A 4ZQPA 4DO5A 2JBMA 2NWSA 1O5XA 4WJEA 3GR8A 3A5VA 3G1FA 4UFKA 1LRNA 2Y85A 3VCRA 4AVFA 1B4EA 3G1SA 5AFDA 4S2CA 3NVTA 2FFCA 3PC0A 2DZWA 3G1HA 2VENA 2V9DA 1NSJA 4RX0A 1Q6RA 3L5MA 1ICSA 2QCNA 3VKJA 2ZZ5A 5HR7A 3L5AA 2LLEA 1JCXA 3MHFA 2YFNA 2QCDB 3G3DA 2E6AA 1JQVA 3UZJA 3P81A 2ZQ0A 3LXBA 3NZRA 5HWNA 2YCEA 1C8VA 3N2XA 2QR6A 3ABOA 1UBSA 1OFRA 1LBLA 5CPNA 1RQEA 5E93A 4FXRA 1S5TA 4M6VA 1VYPX 2NLIA 3MP3A 1FWTA 5KITA 2VEIA 4ADSA 5D38A 3DFTA 2CLOA 1RQBA 2I9EA 5IBXC 4XBSA 1RVGA 3FEMA 4JD4A 4M5PA 3A22A 3DHDA 4UNKA 2Z6IA 3PUOA 1YDNA 4O17A 4A21A 3TX9A 3R89A 1FY6A 4K7YA 1FBAA 2GPTA 1AL8A 3EWYA 3HGSA 3O15A 2JGYA 5HUOA 1H7NA 3L2IA 1H50A 4WQ6A 3W1NA 2C18A 2CZFA 4BI5A 5D2TA 3UZ5A 3NQ7A 1NVMA 4HKPA 1KFJA 3PUEA 3LB0A 2EF9A 4QIUA 3P8JA 2C3ZA 4LNYA 3MWAA 3QW4B 4YCOA 3QFEA 4MFDA 1TJRA 5LHEA 2HS6A 1K8ZA 5D02A 1VS1A 2X1RA 1LCOA 1NFBA 1KLYA 5AHMA 3KHJA 5D37A 3TQKA 4K38A 1VR6A 3HF3A 2X30A 5D2XA 3UPWA 3ATZA 4DBEA 4BI7A 2E5DA 3P7YA 4MJMA 5D09A 2FPYA 1TPFA 5EA9A 3EWXA 4K6AA 1PS9A 3HO8A 4MJZA 1SFLA 2GQ9A 3STCA 5D32A 3B05A 5AHEA 2QJGA 2OZ0A 4LW7A 3MI2A 4RZ6A 1SPQA 1ZNNA 4LWWA 3MBFA 1FDYA 5K9DA 4BR1A 3BW2A 2CLKA 4JY9A 4HHPA 3GX9A 4MLJA 4NNCA 2RDUA 4XTIA 3TAOA 3EXTA 1FWRA 3UPBA 3LBMA 1JCNA 2C19A 3PG9A 5C2XA 4UTMA 2UV8G 3W2NA 1D3HA 5G4EA 3W1LA 4BK9A 4HPXA 4LRSA 1DJNA 2XN0A 5CZ0A 2RHGA 1EP1A 3IGUA 2BX7A 1IIGA 1VC4A 1O5KA 3CPRA 4NU7A 3FKKA 5DBTA 2C6QA 1YTEA 5A8GA 4UUIA 2V5LA 4TR9A 3EX6A 1M7OA 3W73A 3W76A 4UTHA 3M5XA 1QPOA 1AMKA 1Q45A 2CW6A 1RV8A 5F1UA 5AC7A 2V30A 3LCXA 3W7JA 2V2CA 1OYCA 1TPWA 4JEQA 2GQAA 4LUIA 1HL2A 4GXMA 5I3IA 1T8XA 3EXRA 3SFKA 2WNQA 4UR8A 4UMAA 2VFGA 1QO2A 3BLFA 4UFJA 3B8DA 1JCJA 2YDAA 1R2SA 1Y0EA 3G8RA 1KFCA 2RDWA 1MXSA 3M7WA 3FJ6A 3GR7A 1KM0A 1TQJA 4FNSA 3W2MA 2XN1A 1EIXA 1EX5A 1TCDA 3H55A 2QAPA 4O18A 1EEPA 3IIZA 3N14A 5BRBA 4Z0JA 3W75A 3LTYA 5F4XA 2ISWA 1V7YA 5J5RA 1LBFA 3CU2A 1J4EA 3ZWSA 2W79A 3M5ZA 1M7PA 1TV8A 2QEZA 3W7DA 1HUVA 2VFHA 4O15A 4PCFA 4IWWA 4HSNA 1LZOA 2JGQA 3C2RA 3UWYA 2EKCA 2Z0IA 3O6YX 3QMSA 1I2NA 1A50A 3UY8A 3R5EA 2QCEA 5KTLA 1W3NA 5CZTA 1F73A 3O06A 1SW7A 3F03K 4MZ8A 5EL1A 3W7EA 3C61A 1TSIA 1OFPA 4MZ1A 1A5AA 3WJSA 3I7SA 2B7NA 1T99A 3M47A 1PHWA 1PL9A 4MYXA 2QKFA 4KFOA 3EEGA 1L6YA 5AHNA 4H3DA 3UXDA 2J24A 4ORMA 3DKLA 2YZRA 5D2VA 1O4UA 3BK0A 4OV4A 2YW4A 4LVGA 2DZPA 3CWOX 4ZQNA 1MEWA 1SW0A 1FXQA 1LP6A 4FX6M 5FESA 4WUIA 5DXXA 2OX1A 4GRSA 4A2SA 3EB2A 5D30A 3N73A 5AYYA 5LZLA 4WZHA 3NXFA 4LOCA 5LGXA 2ZTKA 4AWUA 3OVQA 3L0NA 3DFQA 1GVFA 1QNVA 1DQWA 4JX6A 3CC1A 3C2EA 2VEKA 1R2RA 1TRDA 3SIZA 4NX5A 4BWLC 1SO5A 3LV5A 3LCGA 3M9YA 1JRBA 3DU0A 3I7RA 3MHGA 1GVSA 2WNZA 5AHIA 1KM3A 4Q33A 4S1FA 3FFSA 3NQ6A 4K8HA 3SI9A 1O60A 3TA6A 2V2HA 3AJXA 3BARA 3W1XA 4E2DA 4Z1CA 1K7XA 3DI0A 3I7QA 5D03A 5C54A 1WQ5A 4RR4A 3G22A 3NO5A 4QSHA 4WY0A 4CLMA 4IXXA 3STFA 3TJLA 1BWLA 5G2IA 5BNKA 3CQ0A 1XBVA 4NNBA 5EYWA 4IPJA 4O16A 1IF2A 4ZQRA 2DJXA 1YPIA 3SGUA 4JY8A 3MMTA 4ZQMA 5DN1A 1WOBA 1WV2A 2TPSA 3E02A 4IJBA 3SW6A 2ZBTA 5D2YA 4PL2A 1ZY9A 4AEOA 2J9XA 1DV7A 1Q6QA 3HJZA 4WD0A 5KZMA 1L6SA 2WJZA 1KTNA 1DORA 3A9IA 2DP3A 3IRDA 2E77A 4RLIA 3LTPA 2VFDA 2ZZ3A 1P0KA 1P5BA 2FPVA 2KZHA 1KBJA 4DF2A 2X1UA 3HG4A 3UWWA 1CI1A 3TW6A 3HGRA 1GVOA 1K3UA 3KAOA 4HNUA 4QQ3A 2ABAA 1ONRA 5DLCA 4Z08A 2QDGA 2V0TA 3GDRA 2CLIA 1VPXA 5LNRA 1Q3NA 2Z2UA 4JIPA 4GUHA 3TNOA 4BFAA 1GQNA 3G0SA 3A21A 5F2IA 1W5OA 4TMCA 1KLZA 4FO4A 4O57A 1QO5A 3PWAA 5K3VA 1GVRA 2WSYA 1IXQA 5FF3A 4M7SA 1ZALA 5FF0A 3H53A 2FJKA 3WK1A 1N8FA 3GDLA 4NJIA 2QCFA 4HNTA 2QUUA 4QNEA 1WBHA 2E6FA 1G4TA 3F4NA 1WXJA 3TCEA 3LDVA 4I7VA 1Z48A 3ATYA 2E5BA 3IVUA 4E0CA 1TV7A 2CZEA 3R2GA 5CPMA 4MOZA 4Z1AA 3TE9A 4JTKA 7TIMA 3M5YA 3BV4A 5DY2A 3LM7A 5AHFA 2Y7GA 1QPNA 1X8FA 3MI3A 1GTHA 2A0NA 1J2WA 1PE1A 2Y61A 2ZZ1A 2A85A 3S5NA 1YTDA 3WFAA 3S5ZA 2Z1BA 1UB3A 2DZTA 1TPVA 1VLIA 3OEXA 1JQXA 4GBUA 1G67A 4JR5A 4UXDA 4GWEA 1W5MA 5CSSA 5TQLA 3ABQA 4CCEA 2OCZA 5I3FA 4PFMA 3G3MA 2PCQA 3OA3A 1RR2A 2FB3A 2IQTA 4AWTA 2XFWA 1W1ZA 5LKYA 3W7KA 2A7RA 3N3MA 3C2VA 3W7OA 2RKXA 4WOZA 4HNNA 2OMAA 4AXKA 3WK3A 4HPJA 3C6CA 3W7IA 3FOKA 3S9YA 3EX2A 2H3BA 2H8XA 1WBJA 4NUWA 3G1XA 2E6YA 4TX9A 1U83A 3ELFA 2E5CA 1L6WA 1TPUA 3NZ1A 3GNNA 1HTIA 1SFJA 4K8EA 4IQLA 4GFSA 1GPWA 5SWUA 2V2DA 1FWSA 4WY0B 1JUKA 3M44A 3I65A 3Q94A 4MY1A 2YGYA 3EKZA 1LRTA 3L5LA 2WPBA 1U5JA 3NG3A 1T96A 3EKLA 5G2HA 1TMHA 3S6DA 1PV8A 2FLIA 3HGJA 4DO6A 2O7SA 3PR2A 4QJ1A 4R7JA 3EXSA 2RH9A 1YDOA 1QPQA 1ICPA 4U4MA 3NL3A 3SECA 2GVLA 3MP4A 4NNAA 2EGZA 2YX0A 3BVJA 2CLFA 1AW1A 3O16A 4DQWA 3W1AA 3HBLA 4N2YA 1VGAA 4UTTC 4K7VA 4LVAA 2GUUA 3L9CA 2A6NA 4JTGA 3V1PA 4ZQCA 1TPDA 1ZENA 1I2PA 2EPHA 2JKAA 2DJLA 4LT9A 4TU1A 6TIMA 1B57A 1VRDA 3VFLA 2VFEA 1CX9A 3W88A 4O10A 1WOAA 5L9FA 2C15A 4XKYB 3S8HA 4C1LA 3QF0A 4O54A 2QCGA 1EP2A 5AN7A 1GTEA 4YXGA 4IMGA 3TDFA 1QPRA 1H51A 2WO5A 4P2VA 5I3KA 3BLIA 3S5OA 4LV4A 3G1YA 3PB0A 2J9YA 4KKXA 1YLVA 1Q6LA 4EIVA 5D04C 3NPVA 1OF6A 2YXGA 3EWUA 3P82A 3LBCA 4AAJA 1OX4A 3HPXA 1UCWA 3W7HA 1KTBA 4L4LA 3SY5A 3OHIA 3BPWA 3K30A 3L0GA 2DORA
chains in the Genus database with same CATH superfamily
1T7LA 3C2FA 2AKMA 1HKVA 1CYGA 2OQLA 5GJMA 3W9ZA 1NEYA 3BG5A 2BGNE 2WC4A 1E15A 1UUMA 4KWWA 5AVHA 1CZ1A 3VXGA 1EFZA 4RV3A 5BXPA 4TIMA 4HPNA 2QMKA 5M1TA 4X9SA 1WKEA 2E1WA 1SZRA 1QW9A 3BC9A 3W2UA 3PSVA 1F76A 5HNUA 3GVGA 4OJYA 1AD1A 4MVAA 1W1YA 3UPMA 3BJTA 3P14A 4GH3A 7ENLA 2WK2A 2Y5EA 4JHMA 4C6OA 3L0KA 1H7PA 1KXVA 1XF0A 4ZOAA 1EWEA 3SCPA 1Q85A 4PMNA 1NAL1 3VD7A 4WDWA 2QUMA 5I09A 3VIPA 4E4UA 3VNIA 2E3ZA 4FHAA 1W5PA 2E9LA 2YJQA 2ZX9A 1HIZA 3OJGA 3ZOAA 1LL7A 4AQLA 3KFTA 3G0XA 2XH4A 4JICA 3IIOA 3XISA 3NPWA 1Q6CA 2BGQA 5U7SA 4O14A 4J3VA 4JPGA 1IGSA 3WQPA 3B0VC 1TE6A 3BGGA 3QQWA 4TQTA 3H7RA 3QHMA 1GOWA 1KM4A 1RPKA 3C86A 4QJ3B 2BSLA 1W6TA 2P53A 2YPIA 1S3HA 2ZRWA 4LUYA 3TXVA 4KGJA 2DSZA 2DUAA 3P60A 3MO4A 3QR0A 4DBUA 4D8LA 5MHBA 4QG9A 3AYTA 1QHPA 5AC4A 4HOZA 2Q01A 1Q2RA 3CZKA 2CC0A 2GQ8A 4KFPA 4NX0A 4ZE5A 3LGGA 2WJEA 3I3DA 2FZBA 2WKJA 2PWVA 2XG9A 3UXKA 1IT7A 2NXHA 3WQFA 2CXEA 3RUBL 4RE4A 1V51A 3CIVA 2Z1SA 4DWDA 4AU0A 4HD5A 1KC7A 3PJTA 3BXWA 3CLWA 2Y70A 4W8AA 4WJXA 1J12A 3H2OA 3MPGA 4OE7A 1ZGDA 2RGMA 2PAJA 2BODX 3ANUA 1V0MA 1GOXA 1WXZA 1UWSA 3A23A 2WVVA 3SCNA 1A49A 2X16A 1RH9A 1VEPA 1JFHA 1GQKA 3H8AA 3SRKA 1UWAA 2NQHA 4LU0A 4I8YA 1ISVA 4BQ2A 1TYGA 4N9EA 2HSAA 1XLKA 3DYPA 1EJUC 1G7VA 2CU0A 3ITCA 3WDIA 3PJWA 1GZ1A 3DN5A 2DIJA 2FDSA 1ZZMA 2P0IA 4L9XA 3WL0A 1U33A 4WGHA 2IXVA 1XFCA 4PB3A 4IIDA 4M80A 4MIMA 3UU0A 1P1MA 2NW0A 1GORA 1ENUA 1OIFA 1TTPA 2FTPA 1K9TA 1TWZA 3DYMA 3DGBA 2VX6A 4WIWA 1UKQA 2VEPA 1F6KA 3ABZA 3S1VA 4YLWA 3K8MA 1H5YA 2PLMA 3S1UA 5HK4A 3LNPA 4R88A 3GU1A 2E4TA 5CKSA 1N8IA 1H3GA 3ITOA 1UH2A 3ITYA 4O50A 1W3LA 2YCIX 3H2AA 1VEMA 3ARUA 4V27A 5FJRA 1ZP3A 3WEZA 4V1YA 1Q6OA 1JYXA 1NELA 3G1AA 1QVBA 3W7RA 2YW3A 3QTGA 3N4AA 3T40A 4HHMA 4JXCA 3W23A 1TVPA 1CTNA 2DVXA 1J93A 3CQIA 3N2CA 2OZ3A 3RPMA 3OZMA 3UXLA 5MKGA 1E6SM 3QV6A 4OUEA 4PYSA 1A5CA 4MWAC 2BHYA 2DH2A 3UNDA 3UNTA 4B5NA 4C90A 1XH0A 1XPGA 5I24A 3HPSA 4Y9AA 3WFZA 3OLDA 3NWRA 4J3UA 1ZCCA 1ZHAA 5HPCA 2BZNA 3DECA 1GONA 1F6PA 1KRMA 3UWVA 3G18A 3W27A 4LYPA 3CXOA 2W4XA 1W8GA 3VAVA 2VEMA 1WUFA 3GC4A 4IX2A 3NDOA 4CQ8A 1KBBA 3WQOA 3VA8A 2VI0A 4MAVA 5E6YA 2RDXA 4N6FA 1IXNA 3ZXWA 2XN2A 5K9XA 2QUVA 1DPMA 1UASA 1XKYA 4PE8A 2H9AA 1JULA 1ME9A 1RA5A 3PP7A 4DO4A 2PLKA 1DJWA 3W7QA 4GBDA 3M4HA 1V5XA 2W3ZA 3WELA 4A29A 2GL5A 2YSWA 3AHYA 4G1KA 3ALGA 2F84A 5LNSA 1JI2A 4CN1A 2PI6A 3CMGA 4BF7A 1C8XA 2ISVA 3P80A 4MKSA 4ZZ9A 3WX7A 1G5AA 3JZUA 4PRWA 4UCGA 4PTNA 1TX0A 2WM1A 2OWXA 4F4RA 1MUWA 1XKJA 3L12A 4QISA 3A13A 2F9RA 3UXIA 2VDHA 3CHVA 3OBEA 3BWWA 3ZYZA 3WKZA 5C70A 3LZ5A 5LA2A 1LDCA 2EG7A 3KP0A 2ACUA 1V8EA 4DBSA 4MGGA 1EDQA 2PGEA 3SCSA 3TTQA 4AWEA 1X6UA 5HA7A 2GLKA 2XM2A 3BAXA 3TJXA 5AOUA 3LTSA 2YCJA 3IIVA 4UFIA 5CGQA 5CPOA 2YFOA 5E70A 3FA3A 2JF7A 5C9ZA 3U2EA 1S3TC 1Y5VA 5IDZA 3UG8A 4J9JA 4JFVA 3JUGA 4JFUA 3T8LA 1UPMB 1YXDA 5GVJA 5REQA 1TFVA 2WHKA 4XUYA 2VJXA 1DKWA 4WRHA 2PDMA 3R79A 4GUGA 4RZ4A 3ZJ6A 1P4CA 1QI2A 4H8UA 1PSCA 2CETA 5I3JA 3G24A 3DFNA 3BGJA 3QY7A 3BLOA 1UWRA 4MPKA 2ZVRA 3MYPA 1C3FA 5EU9A 3SR7A 3ZJ8A 1K4HA 2EQDA 4JIHA 3VFCA 2VCBA 1XRSA 3TNBA 3GG7A 1TPEA 1T0OA 2EHHA 1OK4A 3EOLA 4AZBA 3NEHA 5LIXX 3NDYA 3I3EA 1ZP4A 4IG2B 2GSJA 4WLCA 1TJPA 4PBFA 4IPIA 1GYNA 3GXPA 5CZKA 4ZMGA 1XUUA 3LLFA 1GKRA 1XIFA 3AIWA 4KGLA 4D2JA 2Z26A 4AD2A 4N4PA 1RUSA 3VTRA 3HQ1A 1UA7A 2A5HA 4Z2IA 1XLEA 3NQCA 3L4ZA 4N9DA 5DMYA 2YA0A 3SUUA 4IMDA 1O68A 2TRSA 2BVTA 4P61A 2VL4A 1R0MA 3TMLA 2P8BA 1ADSA 1OYAA 2PRLA 2Q3OA 2Y89A 3KXQA 3MMWA 2I9UA 3VZYA 4ACYA 1UQZA 3W24A 1EPVA 2UY4A 4DJED 1GG0A 1WA3A 2G5WA 5KSWA 1ZJIA 3PB2A 3BLLA 4EOUA 5C71A 2BGSA 2C1GA 1I4NA 5CPLA 1J0KA 4IZGA 4HN8A 5CBBA 1FCUA 3EPMA 1TZ7A 2G8ZA 2ZWZA 4GX8A 3N9RA 3CL7A 1W91A 2QJJA 3CHEA 1PPIA 3GYEA 3WNPA 4H41A 4S3KA 5LIUX 1W1B1 1PHQA 2ZXQA 4WKHA 2IW0A 1TB3A 4UQEA 2PDHA 3C3UA 2E25A 3R7MA 1FDJA 4URIA 5C0QA 3U7VA 3HQNA 1G7UA 1Z69A 1BTMA 2XIOA 3KBJA 4GA8A 3LOTA 3G1DA 1JCLA 3W83A 2Y6ZA 2E0PA 4DNHA 2R91A 4BQ4A 4GUFA 3SAZA 2P3ZA 1P43A 3TUUA 3GDTA 4KRUA 4PUWA 3KL5A 5CC7A 5A3HA 1NJJA 5EB8A 1FKWA 1Z7AA 3B40A 3WUEA 4GGBA 3TU9A 4N9BA 3BSGA 3Q58A 1O1ZA 2ZADA 4AY7A 3OHMB 1IV8A 2CITA 1L8NA 3DHPA 4O4WA 4PTWA 8TIMA 5HMFA 1G6CA 3G77A 4XISA 4ICMA 4A2RA 4RE2A 1KTCA 1XPYA 3KEHA 1K4GA 2OGJA 2A7NA 5G4WA 2YB1A 3LPPA 1A3XA 4CKQA 3DUGA 3LHUA 4GI4A 3NQEA 2D0FA 4XZ9A 3K4DA 3MW7A 4GKTA 1OX5A 1HO1A 3NQ8A 1TWSA 5CH9A 5LA0A 1J0JA 3C4UA 4IXHA 3VI2A 1DOSA 1LLOA 2OO6A 4JKMA 4IT1A 2V63A 3DFSA 4HZ7A 5K7JA 3BGAA 3F5JA 3BURA 3HPFA 4LCRA 3S2NA 4NI8A 5DEZA 2PUZA 4CNOA 4ES4A 5CJNA 4E3TA 3QSRA 2ZRUA 3B0XA 3P62A 4NI3A 4K37A 4YL2A 4ZE4A 4FNRA 4IIHA 2GDUA 5BW6A 3VIMA 3WUGA 4JYFA 3VKDA 2PTYA 2PWUA 3PBWA 3MS8A 4LBSA 3U4FA 1MW0A 3CUJA 4C6KA 1QT1A 3NEVA 3NQGA 4O1BA 1JZ4A 1KB3A 4H2HA 3ENLA 2DUXA 2P1FA 1OX4B 4JQ4A 1IT8A 3BMXA 3NR0A 4JHOA 4KFNA 2E9MA 4O4VA 1EF2A 3NZPA 4I3GA 2VURA 3SZ8A 1DHPA 3GC2A 4JTUA 2QIIA 3VCNA 4X0NA 1YKWA 1UKPA 4M51A 4PCSA 4R34A 3EMCA 5BWAA 5LGZA 3ANYA 4AIEA 3FN9A 2WMHA 3RX3A 1K9FA 5HBFA 1RBOB 3LCFA 4M19A 3GZ3A 3WDJA 4JDYA 4JFSA 3T2OA 1SZEA 1AD4A 2XFFA 2VKZG 5CC6A 2OTDA 1V6YA 1N7KA 3M0IA 1A4LA 5CLTA 2QCMA 1BSIA 1V77A 4UTIA 1HT6A 3RAOA 3K5XA 3MKVA 3KHDA 3QLLA 2DZSA 3LENA 1MI3A 3UCQA 4GIRA 3IJLA 1QNPA 1P6CA 3ALFA 4QS5A 2DZAA 1TPB1 1H5VA 2ZTJA 1H61A 1IEVA 1NDYA 4Y8FA 4RV8A 4PBGA 1JIBA 1OCJA 3USBA 5HMEA 1VCVA 3OB8A 3S5YA 3R0UA 3WMCA 2FIQA 4UQ9A 1Q6EA 4DXXA 5KEZA 4Z42C 1S2TA 3LRLA 3P93A 2QUNA 2FTYA 4E3VA 1OFEA 4LVDA 4IL0A 3FSTA 3N12A 1E3ZA 3QPZA 1JZ7A 2WWDA 1NY1A 5M5DA 3MANA 4HGXA 1HKJA 1UR4A 1AG1O 4L6OA 3VNMA 4HN4A 3A12A 4KEZA 3EX1A 1NM9A 3GG8A 4IPLA 4UNIA 3SCTA 3GO2A 2ALDA 4XZLX 4HU8A 3ARSA 5LA1A 5TNVA 4W86A 2DSUA 1ZCOA 2QDHA 4CQBA 1OSEA 4J35A 4RKAA 5I00A 4G8TA 3IEBA 2DIKA 1CT5A 3UY7A 4IUGA 4H9TA 2CIPA 3HOJA 3DC0A 1S5VA 1OF8A 2X41A 4ZBCA 4PTXA 4AF0B 1PXGA 3SY8A 1F5ZA 3WJWA 4NJHA 1KCKA 1H7WA 2NUWA 5ABEA 2V81A 1US0A 2EBNA 4CEXC 4GG9A 4DBWA 4LC6A 1V4YA 3UEQA 1NOUA 5TF0A 3SEPA 1Q6FA 1O7AA 3BH4A 4NRRA 2UZ9A 2G37A 5HQLA 1KA9F 2WZHA 4MJ4A 3TROA 3AHZA 3PBVA 3RK8A 4UTUA 5AYZA 3BMVA 1RP9A 4AVNA 4GZJA 2V5BA 3V18A 3M64A 4TMBA 1BYDA 4GJ1A 1PIIA 3LCLA 5F4SA 4DO7A 2XVNA 3H54A 1YDYA 3LU2A 1F7BA 3GNDA 1DL3A 2VMFA 2H3DA 3IGSA 1GYLA 4OTKA 1E40A 3SRDA 3V5CA 4HU0A 1E1FA 5AC8A 1C9WA 4GNJA 4Q4SA 3ZT7A 3IK2A 2WANA 4LVBA 3WY1A 3AO0A 4IP5A 3NQFA 1Q4NX 3TK7A 2VHLA 4LS0A 5FF7A 1E5JA 2FHBA 3BAYA 3T42A 1FWGC 5T26A 4IOTA 4EF8A 3AS3A 5JMUA 2ZKMX 2B4GA 1MEHA 2EO7A 2GWNA 3B03A 1DXFA 2GVYA 3WENA 2QGHA 3SN4A 3JS3A 1V79A 1EWDA 4QG6A 1U5HA 2Y0FA 2FTWA 4E8GA 4J5NA 4HQVA 5FF4A 1GVQA 5A2CA 3BW4A 4ZOCA 3UJEA 4FP1A 1GHSA 1XLIA 2REQA 2R14A 4YWSA 4MWAE 3PFMA 1A4MA 3TYCA 2A21A 2WC7A 2E1DA 2ZE0A 1C29A 4HTYA 1R3SA 4E38A 3L67A 2CWNA 3CHDA 3E1F1 2R24A 1OM0A 1TX2A 1V3IA 4J3XA 3TYUA 4AHQA 4NP7A 2W91A 4I9TA 3P67A 3N2TA 1PKYA 3S6OA 3GDKA 3NYZA 2XISA 1CCWB 3E9AA 4LBUA 4F40A 1X1NA 3D46A 3I6RA 4LSBA 1R6WA 3ANVA 1VHCA 1QOPA 1LYXA 4MADA 4Q8QA 2NWSA 4WJEA 4IMAA 1LRNA 2Y85A 1HF6A 2XINA 1W3JA 1FP9A 3V1HA 4U5IA 3EGJA 2DZWA 2QW5A 2V9DA 3UJSA 3L5MA 2WBGA 1LQ2A 2AGTA 2OYLA 2QCDB 3EA3A 1R87A 1POKA 3HN3A 4NASA 3L4TA 2O9OA 5HWNA 3KUMA 4ZSUA 4F2UA 1VIWA 1H4PA 4AZ6A 1RQEA 1V08A 3T0DA 3SRHA 2CLOA 1RQBA 3WDPP 1ONWA 3TTOA 3EMZA 1SMAA 3DHDA 1LUCB 4MNKA 1YDNA 1XQKA 3THDA 3LMYA 3WH8A 3VDAA 3L2IA 3SDOA 1ESWA 1H50A 1UR8A 2BVDA 2CZFA 1V6WA 3UZ5A 3WDHA 3SQLA 1NVMA 3KCJA 4FAMA 1KFJA 2PLCA 3LB0A 3WLOA 2WC3A 1B3YA 2VZUA 1TR9A 3RCYA 2PDWA 4DN1A 3RILA 4RNFA 3ITGA 4C6LA 4D6GA 1DXIA 3QFEA 4GI6A 1TJRA 2Z25A 2DSKA 1CXHA 4NAFA 2X1RA 1LCOA 2VR5A 3V0UA 4X9YA 1KLYA 5AHMA 4GMEA 3KHJA 5D37A 3GUWA 4IJCA 1GGOA 3TQKA 3PANA 1I0DA 2X30A 2E5DA 3P7YA 4DWSB 1XHGA 5D09A 3MUZ1 4W8BA 5A6KA 3HO8A 3AUOA 3STCA 2HVNA 3KDOA 3B05A 3NSXA 4DUVA 1CIUA 3IARA 1W3HA 3BW2A 2CLKA 4JY9A 2HISA 4HHPA 3AAMA 4TX8A 1NFGA 3SUTA 4LY4A 2PDJA 3VKCA 1ITQA 3UPBA 1XWYA 1O6IA 3PG9A 2OU4A 1UWQA 1EC9A 1D3HA 5G4EA 2Z1KA 2ONEA 3AIVA 1O5RA 1VD6A 1HP4A 3H24A 1SFTA 2XVPA 5I02A 3WIJA 5A8GA 1QK0A 3TJ4A 4TR9A 4H9VA 3EX6A 3GW0A 4S3CA 3W76A 3GXDA 3M5XA 2CW6A 4A3HA 1XD0A 3W7JA 1ZJBA 1U2YA 3U5UA 2OYKA 1EDGA 1TPWA 4GO9A 4ZENA 1HL2A 1P0DA 3CS2A 1T8XA 2X05A 4UR8A 4UMAA 2VFGA 1MVYA 1VBGA 3NJ3A 1DWGM 2VVNA 3HFYA 2ON3A 2RDWA 2XVGA 1MXSA 3NUKA 1KM0A 4FNSA 3PZVA 3W2MA 3QV7A 4L9ZA 1TCDA 2WW5A 3H55A 4MB5A 3N14A 3OLIA 5BRBA 1B3ZA 2IQDA 4LF1A 1JDFA 2YBUA 4L1GA 4Y7EA 3M5ZA 2DW6A 2YXOA 3WLMA 2YCKX 2OG9A 3FV9A 4PTMA 2VFHA 4O15A 3UG5A 3N04A 2JGQA 3C2RA 1NU5A 3QMSA 1I2NA 3S2JA 2OX4A 2QCEA 1PB0A 3R5EA 3G2GA 3ZVHA 1SW7A 1AVAA 3ICJA 3C61A 3CHFA 4QGCA 3T81A 3GRIA 1TSIA 1FH8A 4GVGA 1TCMA 4U5KA 1N8WA 1V02A 2Y4SA 3M0JA 1VFHA 3LNMA 4C6EA 4KFOA 3EEGA 1L6YA 5AHNA 2J24A 3T05A 4RDVA 4BKNA 4XO6A 3R0DA 5D2VA 1O4UA 4WEVX 2VR4A 2DZPA 3CWOX 1TIWA 5I77A 1ELSA 4N42A 1L2QA 2CZVA 4WUIA 2WZMA 4Y9PA 4WZHA 1PIFA 4Q22A 3OVQA 4UQAA 4CD8A 4JX6A 1VAHA 3NO1A 1VKFA 4YN5A 3BSHA 4PUMA 1F8IA 4C7DA 4NX5A 1SO5A 2PMQA 4BHYA 1JRBA 3WQGA 4MWAD 5AHIA 3SURA 4S1FA 3FFSA 3NQ6A 4HZ8A 2J7DA 4K8HA 3SI9A 2Y8VA 3BARA 2NVAA 4Z1CA 1WZLA 1GOOA 3I7QA 1Z3NA 4RR4A 1EGVA 3G22A 3NO5A 4WY0A 3STFA 3U5YA 5BNKA 5FJOA 3DEQA 4V15A 5MF5A 1BKHA 5FL1A 1FVPA 3KOZA 2CLPA 1XLCA 4LAZA 1BLIA 1WB0A 2G3MA 3LPGA 1YPIA 3SGUA 2CPUA 2W61A 4HTBA 2VWTA 1WOBA 1WV2A 2C1IA 4HNCA 2F2KA 4PR4A 4K3ZA 3VD9A 1H1NA 1AJZA 5I23A 5ABFB 4WJ8A 2W66A 1DV7A 1QASA 1V3HA 1Q6QA 1A5OC 4WD0A 1U1JA 3VM5A 2WJZA 3MTWA 4AD4A 3LD5A 1DORA 2OQYA 2OGYA 4W8LA 4XZHA 2YL8A 2KZHA 5HJYA 3HG4A 4YVXA 2J75A 3MCOA 3HGRA 1ONRA 1GKPA 1H41A 2CLIA 4JIPA 4PMVA 5B80A 3T0TA 4BFAA 3A21A 3FJNA 1W5OA 3QTPA 1KLZA 3PBGA 6PTDA 2OQHA 2VRQA 2HROA 5EMJA 3WLHA 5GJPA 3WK1A 3GDLA 1R3WA 1ZBCA 2QUUA 4QNEA 3WEMA 3F4NA 3L4UA 4DAFA 2QJNA 2RJHA 4I7VA 1XW8A 3V16A 1TV7A 1HL8A 2DT0A 2WM0A 1UKTA 4JTKA 2Z7GA 4B16A 5CJ5A 5AHFA 3AYVA 3MV11 1AQFA 3QBUA 3SBFA 1J2WA 1UC4A 2Y61A 2O55A 2AOSA 4HPHA 3MMDA 1HVXA 3WFAA 2DQXA 1UB3A 1FA2A 1IYXA 2O4QA 1TPVA 3OEXA 2D1ZA 1JQXA 1KR1A 5CJMA 2XU2A 1YMYA 4UXDA 4GWEA 1W5MA 5CSSA 3ABQA 2WMFA 2OCZA 2QS8A 2IPFA 5I3FA 3N2BA 3OA3A 2C7FA 4WK9A 1BQCA 4Q6JA 2XFWA 3WQEA 5FJTA 4L1XA 4AZ5A 4C1NA 3E0LA 4HNNA 4XX6A 3B9AA 4AXKA 1E9YB 1A5LC 3C6CA 2CEQA 3S9YA 2QVNA 4NUWA 3G1XA 2E6YA 4TX9A 4ZTYA 2E5CA 4ILSA 3BV7A 4PZVA 4XD3A 1HTIA 4IQLA 4D9PA 1JNEA 1GPWA 3EEZA 6XIMA 2YA2A 4WDUA 3APGA 4J4KA 2PWFA 4HCDA 4QE1A 3L5LA 4CD4A 1TMHA 2FLIA 4DO6A 1E1CB 1FH7A 1QPQA 5A95A 2VTFA 4NNAA 1KNWA 4Q8TA 3BVJA 2CLFA 3OQ8A 3W1AA 3HBLA 1VGAA 4LCQA 3WNNA 3B8WA 4LVAA 2HK0A 4NG3A 4EAMA 5FSDC 4JKKA 2DT1A 2BHZA 2BBFA 6TIMA 3WNLA 1CGWA 4IL2A 2ZOXA 1J2BA 1KXQA 4IGNA 1E3XA 2VYOA 1K6WA 2C15A 1TA3B 3S8HA 4C1LA 3QF0A 2QCGA 1PKMA 1EKOA 1H51A 2R1MA 3W25A 5A2BA 4PMDA 1F9CA 2DT2A 3LSCA 1ECEA 5D04C 3AWOA 4Q7BA 2QNEA 4JAWA 3H2MA 2YXGA 1LL6A 4L1WA 1X8CA 2XVKA 5JQ9A 3E74A 1TR1A 1ZBVA 1BG4A 1KTBA 1XLFA 2V5CA 2YCLB 1CXEA 3K30A 3L0GA 1QUMA 5AY7A 5HNTA 1VP5A 3M0KA 4N4QA 2DGAA 1XG4A 4PRTA 4DX3A 4YU1A 3NSMA 2XH7A 3CM4A 4JTLA 3UR7A 1QRQA 3EWWA 3F4DA 1I45A 1WDWA 3P5ZA 2C13A 1EA0A 1HXJA 4Z2JA 1VCGA 1Q7MA 1TIMA 3FIGA 4UR9A 1DYSA 5AVNA 3FHQA 1XLLA 3UCCA 1MEIA 3KM8A 4GPNA 3TZFA 5FA5A 3STEA 4I6VA 3E5BA 3T44A 2JK2A 3UP8A 3DI1A 3FYYA 4LRTA 3MZNA 1UPPA 1E9LA 4ZO6A 1FOBA 1XSIA 1K9EA 2VD9A 4NQ1A 1GOQA 2C1HA 4C6QA 1KV5A 1BYAA 3OVRA 3K1DA 3H26A 1JZ8A 1XBXA 2QJMA 1IZKA 1VFTA 3HMCA 3DENA 3W72A 3B0UX 3JRKA 4AEFA 4OZOA 3KTXA 4JL1A 4S23A 1AODA 1W9DM 1RJPA 1PX3A 2PD9A 1AQHA 4XBKA 3ZR4A 3VU2A 2PFHA 2WKGA 1RK6A 1E6PA 2GVEA 2VOMA 3A6OA 1XCWA 4LYRA 3BJFA 4HPGA 2OYMA 1R38A 3RPDA 1ZL1A 5I06A 3W70A 3H70A 7PTDA 4M7TA 3AHTA 4V33A 1DIOA 4JTCA 2D2HA 3MY9A 1M01A 3GG1A 3PZOA 3MZ2A 2Z2AA 2QJIA 1Q8JA 4Z1YA 1TTJA 4JTTA 4RL3A 5AB3A 3WD3A 1NF0A 4IF2A 3RLVA 3RMEA 4LAOA 1X38A 3CAVA 2PDXA 1GOMA 3SQMA 4ZO9A 4OOZA 5EMYA 1IEQA 4Q32A 1GCYA 2CZ5A 3ITXA 2JQXA 3HIJA 1LOLA 1OYBA 3LXAA 3NM1A 5L6UA 1CW2A 4F0SA 4CD6A 3W1MA 4E2OA 3O1NA 2P0OA 3QC3A 3CIWA 3B8UA 1UP0A 2H90A 3O8AA 4W7VA 3U6WA 4MDPA 4MKNA 3QPYA 1MQPA 4B91A 6TAAA 1S2WA 3DCPA 4PMUA 4C65A 1ITXA 2NQ9A 3EOUA 3MUAA 3A9BA 3B97A 1RZMA 1FUYA 4Q4RA 2ZZ2A 4GYKA 3IJ9A 6CGTA 3GDBA 4FA3A 4QEEA 1TKKA 3TA9A 2Y7FA 1YRRA 1M1BA 3PK7A 4PUJA 3S83A 2BY2A 1MW3A 3SO7A 1EB3A 2QIWA 2UY3A 4I9AA 3O05A 1B2YA 1GOIA 1TMLA 4LAUA 1TJ2A 4EWJA 3O6DA 3PZMA 1R3YA 1UIOA 3WQCA 2VFIA 4F8XA 3IACA 2GJPA 4DLFA 3NPXA 4BCEA 2R6OA 3KVMA 4LVFA 1E0UA 1MDLA 1PTDA 3GTXA 4R9XA 4OIFA 4GJIA 4B3ZA 4P7NA 3L23A 3AXMA 3CL8A 5GPRA 1XD1A 2HS8A 4AB4A 2PF0A 3ZO9A 4I7UA 1SZNA 3STGA 4W7UA 1X7FA 2BLEA 3MVTA 1HJWA 3GFYA 1SQ7A 3FVDA 2B7QA 1K03A 2D22A 3CLMA 1ECQA 1XLMA 3TN6A 3I4KA 5HOSA 4HYWA 3FKRA 3EWBX 3UF9A 4HA0A 3I4EA 2NT1A 3PM6A 1GJWA 4M24A 3CH0A 3ARRA 1EP3A 3TQ0A 1XRFA 1VBRA 2JKEA 3QSTA 4D6IA 2WHMA 2BS9A 3HB9A 4M1BA 3V35A 1S5WA 1RD5A 1F05A 2V69A 3WFLA 2DZVA 2WOQA 5C55A 4U28A 1PCWA 1GQIA 2CHNA 2D2JA 3KBVA 1SUXA 4MZYA 2HRWA 3DOPA 4A8RA 4C7FA 4G1NA 1A80A 2WQPA 3WUBA 5CC5A 3GTHA 4PUEA 1A5KC 4HMDA 5A8MA 2I17A 3AFBA 4K39A 5J04A 1JI1A 2NXIA 4REQB 3VNDA 1N55A 1UOZA 4UZUA 1MYRA 1GG1A 3NFUA 1EXPA 1VBUA 5I78A 1EX1A 1OGSA 1F6YA 3M6YA 1EGMA 1VYSX 4DPPA 1IXPA 2ZRVA 1TVLA 3UT0A 4LS1A 5DCDA 2QCCA 4RXGA 4B92A 3GY1A 1KM6A 4S38A 3PY2A 2DIEA 2WJFA 3Q65A 4O19A 4F2BA 1HKMA 4JIQA 2WQDA 4WOQA 3P74A 4FLOA 4YMZA 3BICA 2DSVA 3TN5A 2WYSA 4XZWA 1H2JA 4KCUA 1JYVA 7XIMA 4JTJA 3U2ZA 1JFXA 2BNJA 4PBEA 1V93A 3Q2DA 3UR8A 4NJGA 4O1DA 1UR9A 4A3RA 3OIXA 2CERA 1B90A 4DJEA 4MY8A 2GVGA 5AYXA 3CMFA 3EPNA 3RCMA 2QV5A 2FH8A 4Y9NA 1AW5A 2HNEA 4LV9A 1S2VA 1A53A 5IBXA 4OBRA 3AIBA 3MKKA 1M5WA 4YVPA 1F61A 2GJRA 2PC8A 3LG3A 3MCNA 3AIEA 5G1MA 4UR7A 2FH6A 2F61A 1TPC1 4WHBA 1YTKA 1PZ0A 2YOCA 4E8CA 3PG8A 8XIMA 4RE3A 3VGBA 1UQYA 2NX9A 4GYPA 1BSLA 4GK8A 1UBPC 1I2RA 1EUNA 2ZC8A 1U1HA 3VDCA 3KE0A 3KVKA 5BOOA 3W00A 4E4FA 4P7QA 1XH2A 3M0LA 1XI3A 1LLWA 4IM4A 2H8ZA 4QEHA 4INFA 3WDRA 1P0NA 1JDEA 2GK1B 3W7GA 1LTDA 4CD7A 4KPLA 3REQB 3URBA 1U1UA 3VZXA 4XAPA 3W38A 1X1OA 2HNHA 3K2GA 1ITUA 3DXIA 5IDIA 4LC8A 1V6XA 1YQ2A 4DUOA 3PS7A 2X09A 3M41A 4GI9A 2X42A 4O52A 3BLKA 3WJYA 5H2ZA 1EJSC 1ZAJA 4CU8A 1A0DA 1AA1B 2CBVA 3EWDA 2CHOA 5J5DA 3E0WA 2PGFA 4B3KA 1KXTA 1I2QA 4GUJA 1HGWA 2ZA3A 3TH6A 3EB4A 1TMQA 1VJZA 3BLEA 4TVUA 4WVXA 1ONXA 1SYTA 2CYGA 1A5SA 5C9RA 2QF8A 4B2DD 2O4MA 1ADOA 5I3DA 1LG1A 1UZ4A 1H7RA 1KM5A 1X39A 2YYUA 3DYOA 3FJLA 3EX4A 3W1TA 3V36A 3J7HA 4AVOA 4ML9A 4IPPA 3T4WA 4ZB0A 3VOCA 1OK6A 4PC8A 3VM7A 1Z32X 1F3XA 4US6A 4QM1A 3U57A 1O12A 3WF1A 3CWNA 4C1KA 1ADDA 1JG9A 3W37A 1E73M 1E72M 2A3BA 2J7EA 2A6LA 3BAJA 2BVYA 1FDZA 4QS6A 2G3JA 3WQWA 3RJYA 3E2QA 1HW6A 2CESA 3IJIA 2ZDSA 5M03A 2CXGA 2OEKA 1XIIA 2PWHA 3NXLA 2ZUSA 1XYAA 1JPMA 3W2KA 2R1LA 2BOGX 2WCGA 2PWDA 4HBKA 5FKYA 1KFWA 3AIUA 4ERGA 1EQPA 4F9DA 1W8SA 3VDBA 3B04A 1BXCA 3WN6A 3W4RA 4IQDA 1O66A 2PP1A 3QW3A 1XIMA 4R33A 2GGIA 1A0EA 4XD6A 2UBPC 7CGTA 5E1QA 1E4IA 3GK0A 2ZUNA 1W1PA 4BEQA 2Y7DA 1IQ8A 1Q6GA 2R8WA 3V0SA 1YNPA 4HMEA 1TTQA 3T2PA 1Y65A 3FHAA 3TYAA 3GHRA 1SO4A 1VJIA 4UTLA 3W7MA 3W6LA 3AMLA 1CGYA 1XBZA 2XSAA 3VX1A 2GOKA 3BOLA 4K68A 2QCHA 2W63A 5FJIA 5EFDA 4ZEPA 1M41A 4NXSA 3BCFA 1PUDA 4RZBA 4H6RA 2CKSA 3E2VA 1YNQA 3GH4A 3CWHA 3GR4A 4G56A 3GVVA 3NPUA 1D9EA 4UTWA 3ZFHA 5FACA 4AHPA 2PU0A 3S47A 4JTFA 5CEWA 3H2NA 1FXPA 2R94A 5CQ1A 4IISA 3LSBA 3KWSA 5CSUA 3TSDA 4G5DA 2OOGA 1RVKA 5HINA 2BXZA 5I3GA 1B4KA 3F4WA 4QDPA 1OCNA 5AECA 1E4LA 2NQZA 2X2YA 5FAGA 4AF0A 4A8LA 2NXGA 3W7PA 5FEPA 1BTCA 2OOFA 3SUWA 1EBGA 1XP3A 1RALA 3R4IA 4ZO7A 2QLYA 3UWQA 3L4VA 5BOFA 3QY6A 3NQAA 3NGJA 3QMRA 4DB7A 3KTSA 4J3SA 1S1RA 1H60A 2IKGA 4AEEA 4KF1A 2V3DA 1UKOA 1XIEA 4V2XA 3PAJA 3MJMA 4QHRA 1OFDA 2AL2B 1RLDA 3GVRA 3W3OA 2JIEA 1WAWA 1XL9A 1B3XA 4MFEA 1YEYA 2ABBA 3OZPA 2DVUA 2F8QA 5BU6A 4FX8A 1WDPA 4L80A 3IPWA 2MUCA 4TVCA 3HQOA 3UD6A 4L64A 2INFA 4H01A 3H2CA 4GQQA 5CZJA 1W56A 3OOQA 5H91A 1EZWA 1B5TA 4WXYA 4H04A 5AKQA 3C8NA 3BCDA 1WUEA 1XIJA 1Q5MA 3A5FA 5D9NA 3R13A 4XAZA 4XD4A 3BG9A 5JBEA 3EDDA 5EBUA 1E43A 3PZ9A 1PVNA 4ICCX 4FPSA 4MMWA 3RF9A 2W6RA 3AS0A 3MA8A 2EPLX 3H2FA 1W2PA 3VVGA 4L5ZA 5IHSA 8RUCA 2ADAA 1PTAA 2VDGA 1CXFA 4Z2GA 3H4XA 1V3LA 1T8QA 1MWOA 2ISFA 4OBSA 3F1QA 1E1EA 3BZJA 2Z00A 3WF2A 2BXYA 2P10A 5DT7A 5D33A 1EJTC 2VRJA 4F0KA 4JFWA 3N18A 3NAVA 5TD4A 3EDKA 3LV6A 4JQ1A 2A3CA 3VE9A 4AC7C 5AYBA 2EPMX 1EIBA 4MUPA 2HWGA 3TW9A 2AQWA 3VDGA 3N17A 4JTRA 5DT5A 4NZ4A 1DBTA 9XIAA 4GGHA 1V03A 1BG9A 2Q3RA 2I5QA 4HCHA 1BF6A 3C0QA 1DQXA 3COTA 3CYJA 4UQDA 3M43A 1N2VA 4ECLA 2JALA 4BQ3A 5A6SA 4AXNA 2CLHA 4BA0A 3WH9A 1AZ1A 2C0AA 1XISA 4FZIA 3W26A 3G8EA 1JAEA 4XKYA 2NZLA 4PL1A 1WKYA 3BO9A 3BZGA 4OGZA 2QCDA 4TXEA 1QJWA 2WSRA 3PZTA 1XGDA 2CBUA 3TYZA 1JD9A 3VKBA 3CZEA 1A5UA 3RLGA 3OGSA 1KCLA 1TUFA 3S1GA 1ZPTA 4B5SA 1KD0A 3GB6A 1QHZA 4AWSA 1E6NA 2CLMA 3LPOA 3N11A 3GZAA 4G9PA 3TR9A 2VFFA 1CENA 1DJHA 2HTMA 1LM1A 2UY5A 2D0GA 3LHTA 4HSOA 4RW5A 4EPDC 4AFYA 1UZ1A 2PA6A 3UXAA 3XINA 2GJXB 4QJ4B 4QSFA 4ERAA 2JKPA 3EDEA 3PTDA 4H4IA 4QITA 3TQVA 2VT0A 2XIJA 3Q45A 4F9JA 3VNKA 1OG0A 1FX6A 4FX7A 1H1ZA 3LLDA 2JE8A 1OVDA 5EGRA 1AL7A 2DQWA 4DWSA 5BMXA 3EPOA 3AJ7A 3CUFA 4A3QA 3W6YA 3T7VA 3N6HA 2WBKA 4HJWA 1CLKA 1ZBWA 2W27A 1M04A 4C91A 1HJSA 4ZGYA 4Q8NA 4WY0F 1I2OA 3E12A 3HV8A 1PYMA 4JYEA 1KRBC 2ZA2A 4IMFA 4ALDA 4GQRA 1XJBA 1PX8A 1WP6A 3KS6A 1OADA 5XIMA 3T09A 2ZIDA 3LXCA 2CLLA 1PDYA 3QGAC 4MNJA 3ZJKA 4UFMA 3M0VA 2OB3A 4NF7A 5AZ0A 3KBMA 2XH2A 4EACA 1OQFA 1F3EA 1KFBA 2W5FA 3QV8A 2VC7A 4KWOA 4GE8A 4DO5A 2VC5A 3CO8A 3URNA 3A5VA 2BY1A 3CV6A 4AVFA 4L9YA 5AFDA 4S2CA 3NVTA 4HCLA 4QCEA 2FFCA 2BOEX 3G1HA 3HA1A 4HA1A 2OSXA 2QCNA 1OCQA 2FGLA 2C0HA 5BRPA 1HX0A 2ZZ5A 3OU8A 1W9XA 4L61A 2LLEA 3MHFA 3G3DA 3BAIA 5CPQA 1H11A 1JQVA 3UZJA 3QLDA 2ZQ0A 2XJ7A 4PEEA 3M0YA 4GXPA 4KETA 3ABOA 1LBLA 3KL3A 3CAQA 3RPTA 2J6VA 4IGSA 5DX7A 2O0TA 4CU6A 4FXRA 1VYPX 1JCTA 1FWCC 5KITA 4S3GA 5D38A 2HQAA 1LWJA 2I9EA 3UJRA 2WPGA 1RVGA 3FEMA 4JD4A 4NL1A 1YE6A 4Y9MA 4M5PA 3A4JA 2Z6IA 1WO2A 2WMKA 1GYMA 1VFMA 4A21A 1WE5A 2CBIA 1K1DA 1EJVC 1FY6A 1FBAA 1HVQA 3EWYA 3UZWA 4HNOA 3W28A 4B15A 3W1NA 3WF3A 4BI5A 1P7TB 2Q6ZA 2PGRA 1XYFA 3H12A 3PUEA 2EF9A 2QXWA 5I5RA 2A79A 3K4WA 3QW4B 4Q8WA 5LXEA 3AZRA 5LHEA 2HS6A 4IIGA 4P7OA 2PU1A 3QOKA 2WKLA 1XS2A 2E28A 3LUTA 4K38A 3HF3A 4BI7A 1NDVA 4HA4A 4BF5A 2OLAA 4CNSA 4MJZA 1SFLA 4LNCA 3UJ2A 4LW7A 2VZVA 2AL1A 4LWWA 5CCZA 2YLAA 3K8KA 4BR1A 2QV4A 2ICSA 3GTNA 1XLAA 2VGGA 3I10A 4NNCA 3EXTA 1H0GA 1JCNA 2J74A 3L2MA 4UTMA 1YNYA 3W1LA 4U3CA 4DVOA 2PDGA 2XH0A 1DJNA 2XN0A 1FWHC 3AROA 2RHGA 1EP1A 3PAOA 2BX7A 4D8ZA 4WKAA 4GI8A 3S5SA 3GHTA 3UETA 5DMNA 2OWWA 3CPRA 5DBTA 2C6QA 1YTEA 2V5LA 1FWIC 1XLJA 1JXKA 5F1UA 1QPOA 1Q45A 1RV8A 2Z2BA 5AC7A 2V30A 5ABFA 3CUGA 2V2CA 1IHIA 1KQZA 3THCA 4ZXLA 4ZO8A 4AZGA 3BLFA 3B8DA 3F4CA 4PULA 5CXPA 1GVYA 3WLJA 1R2SA 1AQ0A 3KWXA 3FJ6A 3GR7A 4PFHA 4RNJA 2XN1A 1EIXA 2XYLA 3N6QA 2BB0A 1EX5A 5A6TC 3IIZA 1P48A 3VDHA 5F4XA 3GXMA 3CU2A 1J4EA 2BASA 3VD4A 4GY0A 1QXLA 2XWDA 1TV8A 3KLKA 3W7DA 2QULA 2G0WA 4PCFA 1A50A 3VNYA 3UY8A 5CZTA 1FWFC 3O06A 1J9YA 1US2A 3KBSA 3PPFA 3F03K 3ERPA 2DEPA 1OFPA 3R1ZA 3LMZA 3PZNA 1ODUA 2VNCA 1QNOA 4LUSB 1PL9A 4MYXA 2YZRA 5FCZA 3BK0A 4ZR8A 3ABXA 2XWEA 1UUQA 3KRBA 3RCNA 4ZQNA 1FXQA 4XD5A 1LP6A 5FESA 4B5TA 4K8GA 5IXEA 3EB2A 1V6VA 4X60A 4B5WA 1FRBA 4LOCA 4O0QA 4AWUA 3L0NA 3DFQA 1DQWA 5BOEA 3CC1A 1T6MA 5HAOA 1Y8BA 1JAKA 4AD1A 4C6FA 3SIZA 3LV5A 4GQGA 4XZMX 1FWEC 3I7RA 3MHGA 4OKDA 2GDQA 2GUYA 1XYMA 3TEVA 2VEGA 3EZ4A 1O60A 2ASHA 2V2HA 2XIBA 4QG8A 4I6KA 1FHUA 3W1XA 4E2DA 4JZ5A 5D03A 5C54A 3UVAA 4QSHA 3OZYA 2OPJA 2YDRA 3TJLA 1UR2A 5M2FX 5G2IA 2WJDA 1MXDA 3CQ0A 5CSYA 5EYWA 2ZUTA 1D8CA 1EOKA 1YIXA 2ZICA 4IP4A 4AY1A 1R3VA 1E1CA 3AIRA 3KW3A 1EJWC 4P8XA 2QGYA 4JY8A 4ZQMA 5DN1A 1MQRA 3K4AA 1AUSL 3DESA 5H6HA 3ARYA 2ZBTA 1E6ZA 4GJJA 5D2YA 3PPCA 4XZBA 5CGMA 3OGRA 1KCZA 1ZY9A 3ZMRA 3HJZA 4B4FA 3H6OA 4W88A 1KTNA 4FR1A 3WUFA 5BCAA 4EPKA 5XIAA 3IRDA 2F6XA 2E77A 3FEQA 4PMYA 3VGHA 3HURA 3GVWA 3CK5A 4PN2A 1KBJA 4DF2A 1TA3A 2X1UA 3UWWA 3WH5A 1CI1A 3TW6A 3KAOA 4HNUA 2ABAA 4GQBA 4Z08A 2V0TA 3GDRA 2O9RA 4LF2A 1QTWA 1OC7A 1O5QA 1JF5A 1JD7A 1KBKA 1VPXA 1CXIA 2Z2UA 1E55A 3TNOA 4YHGA 1CGVA 2ZE3A 3CAKA 3R6IA 5K3VA 1GVRA 2YDSA 5FF0A 1PBGA 3H53A 1KQYA 1J0IA 3TCEA 1XYZA 4Z1AA 4WDTA 2Q02A 4WSHA 3VKAA 3M5YA 1Q65A 2Y7GA 1MRQA 3MI3A 1GTHA 2R82A 1PE1A 1W1VA 2ZZ1A 3CZLA 2DPEA 3VGEA 3T08A 4DJFA 3ITVA 1BQGA 1FWAC 5GNXA 4LBRA 1E4MM 2Z1BA 4ZB2A 2DZTA 5T91A 1VLIA 5D9PA 2GGHA 4AZCB 2XIMA 3GG0A 5I03A 4JR5A 2VVSA 4U10A 1OINA 3LBOA 4PFMA 4M6UA 1VPQA 3OYXA 1UYQA 2IQTA 4AWTA 2ACSA 4KIRA 3IK4A 3N3MA 3C2VA 4CQCA 4Q4PA 3WK3A 4B90A 2VX4A 1YX1A 3BCJA 4LGXA 1L8PA 2H3BA 2H8XA 3AXXA 1I75A 1U83A 3KLLA 2PDYA 1UD5A 3KS5A 3KCLA 3AMGA 3VC5A 4Q8VA 1EHAA 4K8EA 3GIPA 2V2DA 1FWSA 1JUKA 2YGYA 3VINA 2BMBA 1RBAA 4M0XA 2ZXDA 4S39A 1T96A 1MRAA 5G2HA 1XSJA 3HGJA 4QJ1A 3W02A 1V6UA 2J66A 3MKCA 1OG6A 1UD3A 4KWSA 3ITTA 3B0YA 3SECA 2GVLA 5FSEC 5E09A 1JNDA 3GVQA 4HP5A 1AW1A 3CZ8A 4DQWA 3BE7A 3PFRA 2HPMA 3B3DA 4G2DA 3HTWA 3UYIA 2EPKX 1BVZA 4ROQA 1KGWA 1ZENA 4B3LA 1I2PA 3LZ3A 2DJLA 1QW8A 5DANA 4AYGA 1VRDA 4CD5A 5DMLA 3CQJA 4V28A 4EXQA 1WOAA 2JIWA 1SJDA 1UKSA 1J0ZA 3UJFA 4E2VA 4YXGA 4IMGA 3GTFA 4LALA 3TDFA 2DV0A 4A8NA 1GOKA 3SRFA 3BLIA 3LPFA 3G1YA 3GFXA 2JFEX 3QR3A 3CT2A 2J9YA 2PZNA 3B4YA 3FXYA 4EP8C 4C6NA 3IRSA 3OG2A 1UW9A 3WQ4A 1HJXA 4AAJA 2P8CA 3MWCA 4KCWA 1L6FA 3GFZA 3W7HA 4L4LA 2DORA 5A5WA 4EPBC 4RE0A 4LANA 1E9ZB 5CLWA 1QAPA 5AC5A 3RXZA 3ZIZA 1V02E 1NFPA 4QXIA 3NA8A 3R25A 1KXHA 1K8YA 1XCFA 1R3RA 3FS2A 4POCA 1SSDA 3THQA 4KQNA 1QNQA 3FDGA 4W9TA 3DX5A 3N13A 4CVWA 3A4WA 1DJGA 1B3OA 2R1PA 3NQ2A 3M1ZA 3NGFA 4QQUA 4IIFA 2FPTA 1TWWA 3KOWA 4C6CA 1BKSA 3STPA 3QQ1A 4UOJA 2QUTA 5E6ZA 4GVHA 1ISXA 1MSSA 3AC0A 3BG3A 3W01A 3AMDA 4W93A 3DG7A 4JN6A 3W71A 2C16A 3ZSTA 3QQ0A 3OBKA 2TAAA 3DFYA 1PAMA 4FB7A 1EOMA 3GKFA 3ONCA 4HZ6A 4L7ZA 2REQB 2DZUA 3N4EA 2ANUA 4OHQA 5DCBA 2NV9A 5A69A 3F2BA 1NQ6A 1VPYA 1U5VA 1MUCA 4KW2A 3N6JA 4MKVA 5HWMA 4DY1A 3B8IA 1W1IE 2IPJA 4O28A 4IMCA 4ENLA 3TFXA 3F2CA 1XLGA 1WKDA 3CZGA 1OIMA 1J0HA 1GEHA 1M03A 3WLTA 3RJXA 3K8LA 4RCXA 3M5VA 2VRKA 5EMKA 2V5JA 3Q67A 3W86A 2XUCA 1DIDA 1XIGA 1WDQA 4I8DA 2D73A 2WZTA 3WBEA 5FD0A 1TREA 4NZJA 1QR7A 3MUY1 4DUXA 2Q71A 2ALRA 1HL9A 1VFLA 2D2OA 2OZTA 4KBXA 4UNLA 3VGDA 4BZYA 2JF6A 2J25A 3VIHA 1VZWA 2ZZ4A 4WXZA 4HMCA 3K1GA 5FJPA 3AWNA 4REQA 1C9DA 5BMWA 3L66A 4A05A 3VOIA 1R47A 1UWIA 4H8NA 3S1XA 1OD8A 4MAZA 5JIPA 2PE4A 4O8RA 2CCRA 4N7QA 3W2LA 4GIYA 1JRCA 1R7AA 4H9YA 1ZAHA 5HATA 1MW1A 1YBQB 3PPHA 4HZMA 1W2VA 3RX4A 3U2OA 1CBGA 3DHFA 4Q3MA 2RFGA 3HZ3A 2CFFA 1LT8A 4ZA0A 4YTSA 1R9XA 3FX4A 3OIHA 3UGRA 2OVLA 1ZUAX 1EC8A 2WVTA 1XDMA 2Q8XA 4NZFA 1XC4A 4IFKB 4NAEB 4QROA 1IWBA 3W0KA 3SQSA 1KW1A 1DIEA 1Z89A 4JN8A 1W17A 4LCSA 1WXYA 3N3TA 4C5YA 4BEUA 1X97A 2GVJA 4OU1A 4DYJA 4DNMA 2QMJA 2XM1A 4ZOEA 2PRMA 1EH9A 4AZIA 3LCWA 2WHLA 2B7OA 4TX6A 3E49A 1IT0A 1WDDA 2VZTA 4JS3A 2ZYFA 1CDGA 4L6HA 1D8WA 2CKRA 1JVNA 3BL3A 2Z27A 6ALDA 3KL0A 4MB1A 2HE5A 3C8FA 4HIBA 2V3FA 4GYFA 1AW2A 5C8BB 1EGZA 6REQB 3EOEA 3MI6A 3Q37A 3BLPX 4IICA 3U48A 3WBWA 1PWLA 2VQUA 2D24A 3BOXA 3BQ6A 3EWCA 4GNVA 2QPUA 4UTWC 1NQKA 3POHA 4AX6A 4QE4A 3IV8A 2IPGA 3AS1A 3G1RA 3IJDA 1CXKA 3W22A 4CQAA 5DXYA 3CIXA 1XUZA 3S42A 3CHCA 3W6MA 3P61A 4KESA 3UW6A 1F74A 2TSYA 1YDVA 2KAUC 3GNRA 4XO7A 3WD1A 2GK1A 1FTXA 3C0LA 2FYMA 1B3WA 3ZJ7A 2BP1A 2J9ZA 3MJYA 1BGGA 3REQA 2DZBA 3FW6A 1TJ0A 4DPQA 5D05A 4TUFA 3CV1A 2AGKA 4CNPA 1EUAA 3UQNA 3CAWA 5HULA 4PB5A 4BY3A 3DERA 1QBBA 1F3WA 3BAWA 2VP8A 1MFVA 2EAWA 4NYUA 3NSNA 4FMVA 1HG3A 1XDLA 3HG3A 2OEJA 4YJ5A 2G3IA 4DI8A 3TFCA 2J78A 2D0HA 3OVPA 2Y2WA 4CNNA 3DZ1A 4I90A 1AMYA 2GJLA 3FJ4A 3II1A 1G0CA 1LWIA 4L56A 2DUZA 3N19B 4UTTA 3O6CA 2BWGA 3TSBA 4PCPA 3SCVA 1OABA 3QV9A 2PDBA 4FF7A 3BSMA 2RDTA 3IIPA 4PUDA 3RM4A 3WO8A 1VH7A 4JOMA 3OW1A 1XGEA 2I14A 3HU7A 1QNSA 1XRVA 2PDLA 3RGTA 4H8VA 4JCLA 1AH0A 2JEPA 4QAWA 2VD8A 3CB3A 4R85A 4BI6A 4ZB5A 1RHCA 3E96A 5RUBA 2VUNA 2UY2A 3SJ3A 2DFAA 5C9UA 1E51A 1A5BA 2V6AA 3SN1A 1GUVA 3PULA 1GT8A 4ZOBA 1KFKA 3VE7A 5HR6A 1R3QA 2V38A 4CQDA 1LLZA 5LIKX 1L2UA 2ESCA 4P8VA 2BY0A 1H49A 3U0HA 4LXFA 2EPOA 4JX5A 4TOQA 3MUIA 3BANA 2YXXA 4O8AA 3U9IA 1Z42A 1S2CA 4CN6A 3H7VA 3V5FA 2CLEA 3PZUA 4O1CA 2BDQA 4RPQA 2VC6A 3T1GA 5G1TA 1BYCA 5XINA 3W2JA 3B9EA 2IMRA 4JNMA 3W1PA 2VX5A 4EWND 1UR0A 2FGBA 1M7JA 5CGTA 4JTAA 3N25A 4FOJA 1O95A 2E9BA 3W7CA 3W85A 1PTGA 4F48A 3NQVA 1ME7A 3TWAA 4X3ZA 1GEQA 3WG6A 2FHCA 3W53A 2XDFA 1CXLA 1UWUA 3B9NA 3FLUA 1EA9C 4RNIA 3N34A 1J11A 2E7FA 1MW2A 3AICA 2PZ0A 1E0TA 5KMYA 5LNWA 3MB9A 5I0DA 3AHVA 4OECA 2G95A 2HCVA 5IFPA 3WQVA 5C6MA 4D6JA 3GS6A 4QNWA 1GZGA 1FHVA 1LOSA 5CZSA 3C5QA 1G4SA 3CMJA 3PJUA 3WYZA 3WLKX 1E0VA 4F0HA 4J3WA 1G4PA 4ASTA 4X61A 1QWGA 3CB8A 3PUGA 3MBDA 3WLSA 3SADA 2ZC1A 4ATDA 3WJXA 3B8VA 2B0MA 3ABSA 3TLQA 1QMLA 3OYZA 5C7HA 4E4PA 4IGMA 4HT3A 5HMSA 3OGVA 2Y63A 3U7BA 3WJZA 3GTIA 4HMNA 2A2IA 2ATSA 4J40A 2WMIA 2Y62A 1TV2A 4Y90A 4OWGA 4FI4A 2BVWA 4O12A 3MP5A 3THUA 1RQHA 2EG8A 3B4UA 1W32A 4GUIA 2ZUMA 1QDSA 2AL2A 4J3TA 4R3UA 2WB5A 3IIXA 1DJXA 1KKRA 2MANA 5DRIA 1RCXB 3NNTA 5M3WA 4XZIA 3ZT6A 2DVTA 3TR2A 4PGLA 3M07A 5GQBA 3VX0A 4JNZA 1THFD 4HOXA 4PH6A 1OFOA 5BWFA 3TC6A 1ZB5A 4IQJA 5F4WA 4GY1A 4HB7A 2PBOA 1BRLB 4GISA 4B9ZA 2WV8A 2I1OA 4O0KA 5C2CA 2QF7A 4DWSC 5HNRA 4NZ1A 3EA2A 3WBYA 2G97A 3ES8A 5A6MA 3S3GA 4C1NB 3CTTA 5F2GA 5AHLA 3DAQA 5TIMA 3T8QA 3BW3A 5E0FA 5F2LA 1E5NA 1C8QA 4DM2A 2PD5A 3JZEA 2FZDA 1K7FA 3T9PA 3URQA 2VEFA 3QM3A 1VEOA 1P1XA 1EQCA 4K36A 4DJDC 1PZ3A 4UTKA 5C5YA 2A3AA 4GY7A 1FCVA 1NARA 3RG6A 4GFIA 3W81A 2C14A 2GQ3A 2XSBA 4FNPA 3TTEA 1DIKA 4PMOA 2HBVA 1XICA 1VHNA 4GH1A 4LUTB 1I0BA 1FCQA 1PKNA 2GJNA 1SMDA 3OTRA 4WCJA 4XIAA 3W82A 4QRNA 3GUGA 2YL5A 4RPPA 4RUBA 4Y96A 2IXUA 3QFWA 9CGTA 4H6KA 1JL8A 4H83A 4F2TA 1J96A 1DE6A 3KRZA 4S3DA 3DG6A 2Q8LA 3T55A 2V5KA 2FGZA 4UTFA 1C8YA 5ABHA 2J6XA 1E6XM 5FF2A 3ZQ9A 4B5XA 1S5MA 2OWCA 1VBJA 1KWKA 2W9MA 3S9ZA 3OODA 4Z2LA 1UG6A 5HJLA 3CUXA 3H2EA 1I1XA 4UFHA 5F1VA 2AQVA 3MDWA 4N6EA 2FDMA 2KX9A 2Y88A 1PEZA 3E5PA 1KFEA 2ZUVA 3AYRA 4D6HA 4WR3A 3L7RA 3EDFA 5BROA 2XGIA 4J7RA 4XUGA 2YA1A 2BV9A 1V6TA 2J8GA 4A4AA 4LYKA 4DXVA 3UBPC 2ZRZA 4FIQA 4Z1DA 3TTYA 1VQTA 5A6AA 4G7EB 3RLUA 3ZT5A 4R7OA 1OHLA 4QDMA 3NO3A 2Y5JA 6ENLA 4L4OA 9RUBA 2NLYA 4KERA 5A6BD 2PURA 1KR0A 1GJUA 3S1WA 1OJXA 2INEA 3ARWA 3WK2A 2GUBA 3TAKA 2ZZ6A 1G94A 4AUBA 1R30A 8CGTA 3E2RA 3KVLA 3V3WA 1GW1A 4US5A 5CG0A 4LH8A 5DCEA 1PCKA 2X1IA 7A3HA 4GOAA 1YW1A 3INPA 1EHNA 3LYEA 3TTSA 4LUJA 3MO7A 5A8PA 3SSJA 4U2ZA 1S46A 1QBAA 3SIMA 3UG3A 2ZUWA 4GZIA 4BF9A 3PN8A 2V8ZA 3VOJA 4L6DA 1REQB 2Z29A 2P5NA 2OSWA 2VQTA 3U4AA 5C7VA 5HWJA 3TV8A 1EEXA 1FCBA 1OFBA 3QYQA 4YHEA 4JX4A 1BGAA 3QGVA 2YBVA 3O63A 1RCOB 1OZMA 3M0HA 3O9NA 4DZAA 3HG2A 3WK0A 4RJEA 2GJXA 1V7AA 4LPCA 2VC9A 3WMLA 4DYKA 4DF1A 1VBHA 2J7BA 3TOYA 4OQVA 2E6DA 3VYLA 3IV3A 3G5EA 2FZMA 4M81A 4Q6XA 2HZGA 5E9XA