4HT3A

The crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
total genus 102
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ht3A00
5D32A 4PH6A 1Q3NA 1EB3A 1UASA 1XUZA 1VCGA 3B0PA 3RLUA 4OV4A 1TB3A 3ZS4A 1EP2A 1TV8A 1RVGA 1S5VA 4MYAA 1LOSA 3S42A 1H1YA 2A6NA 3P84A 3UWYA 3L9CA 4O19A 1K3UA 1FCUA 4RZ6A 2NX3A 3KVKA 5KZDA 3W7PA 4K8EA 4JTEA 2C13A 4U28A 3LBCA 1HO1A 1TTQA 4KKXA 3EB2A 4LS1A 5D09A 2VFGA 4FNSA 3FFSA 1YLVA 1L6SA 1QMLA 4YXGA 3G24A 2QCGA 3W7MA 1HG3A 3NOEA 4KFNA 1I4NA 3N9RA 2Q8ZA 2VFEA 3PBUA 2ZRXA 5F2MA 2VFDA 2FIQA 2NUWA 3WJZA 2ZA3A 5CSSA 1RPXA 2TMDA 3QM3A 2VFHA 4LC8A 4S2BA 1B4EA 3L67A 4XBSA 3N19B 3JRKA 1AL8A 1VQTA 3W23A 4JTKA 1P0NA 4EVZA 4LT9A 2X2GA 1FWWA 3DAQA 4PODA 4Z1DA 1H7PA 1G4TA 2EAWA 2BTMA 3GDKA 4XQ6A 4ADSA 2A5HA 4AMAA 4DQWA 3GNDA 5KSWA 1NSJA 1R47A 5HWNA 1R30A 5C5YA 3GDMA 1OK6A 1ZY9A 4UNLA 2YFNA 3BGGA 3EX4A 4NXSA 3LRLA 4M6VA 1L2UA 1OFOA 1KM4A 1TTJA 2Y70A 3NNTA 3PG8A 3EWZA 2DZSA 3DFQA 5F4WA 4ZQRA 4MY9A 1YXYA 3HG2A 3DZ1A 4QM1A 4JDBA 4LRTA 3TX9A 3OVPA 1QDSA 3S5OA 4AH7A 3GXPA 1FBAA 2VXNA 1GVRA 2Y63A 2CLIA 3W76A 3KRZA 5HR6A 3ABSA 3ANYA 2B7OA 1X6UA 3B4UA 3HMJG 1FQ0A 3Q58A 3GDLA 2FJKA 3MBDA 3TMQA 2QDGA 3T78A 1JULA 1K7FA 2C16A 5FF3A 2IQTA 4O52A 5CKSA 1G7UA 3TAOA 5BRBA 2OCZA 3MHUA 4ZQCA 5EMUA 4FXSA 4O14A 3A5VA 3QFEA 2FB3A 4DBDA 3W7QA 1GTEA 3R8RA 1TRIA 4K39A 1OFRA 1T96A 5HINA 3O07A 1B4KA 2GJLA 3IIPA 2ZYFA 3NDOA 1RD5A 5DELA 1VR6A 1W5PA 4WD0A 3ATZA 1DHPA 3I7RA 4ZQOA 3E9AA 3HJZA 3S1XA 1NVMA 1ML1A 1YADA 1EEPA 3R89A 1OFDA 4NJGA 1KTBA 2R14A 2ATMA 1IIHA 4OQVA 5FF4A 3W6YA 4A29A 1YYAA 3E12A 3GXNA 4JNMA 2ISSA 2DZXA 2H6RA 1OFBA 3P82A 4BF9A 1G4PA 3L5LA 1TMHA 1A53A 3T4CA 3L68A 3M47A 1EP1A 3P74A 4AVFA 3BG3A 5BOOA 2YYTA 4ORMA 2DZVA 2WNNA 5KMYA 4WJEA 1GG0A 3P5YA 1LCOA 3DHDA 4XWUA 2A7PA 4O53A 5G2IA 1JUEA 1SZGA 1TIMA 1GPWA 2QCFA 3LTYA 2FPYA 2QJGA 1D3HA 2LLEA 4OE7A 4O18A 1TYGA 3PBYA 3K30A 2ZZ3A 4GC4A 4UC5A 3M6YA 1BWLA 4IX2A 5CZJA 2PCQA 3AJXA 1FWTA 2H8XA 4HNVA 1X7FA 3M5XA 3NA8A 2ZTJA 3W2MA 5CG7A 2J27A 1Q6OA 3UPBA 2I14A 5TQLA 3IVSA 3IVTA 2ZRVA 4FNQA 4POCA 1W1ZA 1PS9A 3BO9A 4QIUA 1S5TA 2TYSA 5HNRA 3GX9A 5K9XA 3DFOA 1XM3A 4WXYA 1AW5A 1J5TA 1K7EA 2DP3A 1NF0A 2I9EA 4O1DA 2NV2A 1F6PA 3P60A 3MW7A 1TSIA 1LDCA 1SZNA 1Q6LA 5DXXA 1YTDA 2NXIA 5F4XA 3N2XA 5DCDA 5TIMA 1VH7A 2CLHA 3G1YA 1KFJA 4GUIA 3O15A 4DF2A 4LVBA 2UV8G 3W1QA 1AG1O 2J6XA 5L6UA 5KZEA 3C2RA 4FO4A 2H8ZA 4ONVA 3GR8A 5CZ0A 1O5KA 4QJ1A 1DL3A 2WJZA 5AHLA 4ICNA 3ZR4A 3OVRA 3OBKA 4JY9A 1PHQA 5EY5A 5AHNA 5C6MA 1W3TA 1LBFA 2Y88A 3IGXA 2ZQ0A 4XUGA 2E5DA 4IMCA 3MYOA 3W2KA 3R5EA 3TSMA 4PL2A 1K7XA 4R7JA 3IRDA 1LP6A 1WAUA 5C55A 1LORA 1JCXA 3N73A 5DXYA 1KV5A 4S1FA 3QPZA 3ABRA 3P62A 4WQ6A 3V75A 1JUKA 4GUHA 4LV4A 4NNCA 1ME8A 1VPXA 2QDHA 4JGDA 2V5LA 5L9FA 3TCEA 3BW3A 1GVOA 3BG5A 2XN1A 1KFKA 1OVDA 3L5AA 2JK2A 2QCHA 4MFDA 4R53A 2YX0A 2BLEA 1K8YA 2NWRA 1RV8A 4IOTA 1QWGA 4LRSA 1LBLA 1SO5A 1ZALA 4W9TA 3S0CA 2ZRWA 1PIIA 3Q37A 2G95A 3UWVA 1KBIA 1DVJA 3A9IA 2E6YA 1X8FA 3TV8A 2QAFA 4LTSA 2GOUA 3W1PA 3KX6A 4CCCA 1ZHAA 2AAMA 3F1QA 2OZ0A 3QZEA 4LS0A 2GUUA 1KLYA 2NX9A 1W56A 3P67A 3FYOA 2HTMA 3W84A 1OJXA 1V5XA 3JR2A 4UR8A 4UTHA 3B03A 3W1NA 3P61A 4ORIA 1Y0EA 5EA9A 4I7UA 3S5YA 3B0UX 3M1ZA 5HMSA 2CZ5A 1P1XA 2RDWA 3DFTA 3TC7A 4MIMA 1VHCA 5SWUA 4UFMA 1UJPA 3TMLA 3I65A 3TQKA 2YSWA 3WK3A 2QJHA 2H3BA 2B7PA 3LM7A 3HIJA 3C3NA 5D04C 4AB4A 5LNSA 3N34A 3NZ1A 2ABBA 4IPJA 3EWUA 5CZTA 1AW1A 3A22A 2J88A 1HTIA 1EA0A 1IIGA 5AHMA 5K3VA 5HWMA 4JX4A 3EX1A 3E0IA 4X9SA 5DCBA 3HG3A 1DV7A 4NJKA 3TIMA 4GUGA 2X30A 2Y89A 4UMAA 2FQIA 2G5WA 4NJJA 4Z0SA 5AC7A 3W72A 3R13A 1SU5A 1N55A 4PA8A 5KINA 3TXZA 3QW4B 2J9ZA 4UUIA 1YXDA 2PRLA 3EKLA 1H7XA 5A8GA 3OG3A 3EWYA 4LVFA 1PCKA 3W7KA 2ZTKA 4N4QA 3H55A 4Z1CA 2GVGA 3GKFA 1WV2A 4RCXA 3GLCA 1AL7A 1DQXA 3QRHA 4M6PA 3C6CA 3HF3A 3USBA 4LVGA 1YTKA 1NAL1 2CZDA 3TNOA 8TIMA 1SUXA 1UB3A 1W0MA 1J4EA 1M7PA 2C0AA 1WBJA 3O6CA 3UXDA 5K9DA 1LM1A 1OX4A 1TV7A 2Z0IA 3DHFA 3CEPA 3B0VC 4O1AA 2Y62A 1MEIA 3N3MA 3TQVA 1R46A 1EP3A 4JX6A 4PCFA 1GOXA 5I3HA 4IX0A 1R2SA 3LERA 3W7EA 1SR9A 3FA5A 4PL1A 2Q8LA 4L4LA 3GIYA 3PSVA 3GAKA 1YDNA 2JKAA 1A5SA 1RQBA 2A7NA 4LNYA 3W7LA 1W3NA 2DZUA 1I45A 3B04A 3DGRA 1LRTA 3TUUA 3L0KA 1W54A 2WNZA 1FWSA 5EL1A 3PVFA 5AOUA 5I3KA 3TW7A 1M5WA 5DBTA 3O06A 4XBKA 1YPFA 3LHUA 1OF6A 3G3DA 5AHIA 2EPHA 4ML9A 1KM0A 1FCVA 2Z6JA 2V8ZA 3TJLA 3T44A 5FESA 2V0TA 4UTTA 3N2MA 2VEMA 4IUOA 1EUAA 3RMJA 1SSGA 2GVJA 3NYZA 1VCFA 1W3IA 2EKCA 4O57A 3RU6A 4HT3A 2YGYA 3NXFA 4AF0A 3QC3A 1PVNA 4O4VA 1DORA 4HN4A 4ZMGA 2CZEA 4QNWA 5D2WA 2A4AA 1O95A 1P0KA 2JGYA 3G18A 2A1YA 2E6FA 4D2JA 2ZCGA 4UMCA 4OWGA 5J5RA 3LI0A 5FEPA 5IBXA 1VLWA 3W88A 1L9WA 3WJSA 4OU1A 2ZBTA 3WJWA 4MOZA 1U5JA 4MKNA 2BWGA 3IIXA 3QYQA 4UFKA 1H51A 3DENA 1X1ZA 5D38A 2QCEA 3I68A 1TPDA 4NNAA 5CPLA 2CLOA 3C2EA 2RDTA 3SW6A 1ZAIA 3AO0A 1VJIA 4WZHA 1SQ7A 1G67A 5FF2A 4MZYA 2Q3OA 5I3GA 4DO4A 3UQNA 3LGEA 4Q4KA 3W70A 1SFJA 3CPRA 2DJXA 2CLFA 4IMFA 3M5YA 3ELFA 3NQ2A 1A50A 2ZZ7A 1KLZA 4IJBA 3EEGA 5J5DA 4HNUA 3UXAA 3HOJA 1BWKA 3E49A 5LGZA 4MY8A 3KFTA 1KTNA 1TV5A 1SZFA 3ZWSA 1LRQA 1SO3A 4KWWA 2E6AA 3INPA 3MBFA 1OYCA 1YDOA 2PRHA 4RX0A 1JCJA 2R8WA 3HG5A 5H2ZA 2V2HA 3GVGA 4AEOA 1C29A 1NFBA 3UZ5A 2XFWA 3A21A 2GQ9A 3EXRA 3NQ8A 5AB3A 2ZZ1A 3W7DA 2PRMA 1NF7A 1K03A 2E5BA 3CLMA 1BTMA 5MHBA 1TJPA 3P81A 1IXNA 3TA6A 2P10A 2PURA 3IV3A 1TQXA 4AHQA 2RFGA 4HSOA 3W73A 3PB2A 1NEYA 3TSDA 1F74A 2E1DA 1QOQA 4O15A 3LTPA 3B05A 1K8XA 4JYEA 1H7WA 4TMCA 4UFIA 1Q6QA 2VKZG 4CNOA 5G1YA 3BW4A 1TPC1 4RKAA 2P0OA 2NXGA 1MO0A 3FEMA 4Y96A 4EWND 2WSQA 5AN7A 1S3HA 1FDYA 3BV4A 1ZJIA 2XN2A 3W1UA 3MMTA 4MVAA 5AYXA 2VEKA 4CNPA 1Q45A 3LX9A 3HO8A 4FB7A 5FF0A 4JTHA 3O6YX 4XTDA 2V2CA 2QKFA 3ATYA 4MYXA 5AFDA 2ZA2A 5HUOA 1H63A 1MXSA 5I3FA 3R12A 1FWNA 2Y7DA 3P5ZA 1FDZA 3G22A 4HKPA 1TPEA 1B9BA 3NPXA 4WXZA 2E6DA 1W37A 3KAOA 2A6LA 3G1XA 3KOFA 2YYUA 5G4WA 2EGZA 4Z1BA 1R2RA 5K9CA 2FTPA 1OX5A 3CM4A 4FIQA 2YCEA 2JKPA 1JUBA 4UNKA 3SIZA 3KVMA 3PS7A 1WX0A 2R94A 1R2TA 4WUIA 4DEFA 4N9DA 5LKYA 2YDAA 5LHEA 4UR7A 3T55A 2E5CA 4QSHA 5DBUA 3FJLA 3G1HA 3MHGA 3LXAA 3QMRA 4RXGA 2Y61A 1DBTA 4M5PA 1CX9A 3NVTA 4QITA 3G0UA 1VZWA 4HNTA 1AMKA 5BW6A 1S5WA 2P1FA 1H5YA 5DY2A 3A24A 4EF9A 3H53A 2NLIA 1KM1A 2GJNA 2QUTA 5LGXA 1IXQA 4KFPA 5CZSA 3THQA 3CT7A 1IGSA 4K36A 3LRMA 1XI3A 4JTSA 1SW0A 4U4MA 3SI9A 3TXVA 1QFEA 4Q33A 5EYWA 1HO4A 3P8IA 4JD4A 2NWSA 1T8XA 2TRSA 1JCNA 1CW2A 4N02A 2J24A 1ZAHA 2QEZA 1TPB1 4WOQA 3G0XA 3W2JA 5K2ZA 4AWUA 3W71A 2ZDRA 3PUEA 4O17A 4O54A 1MSSA 3NL5A 3LHWA 4DBEA 1EIXA 3PY2A 4RLIA 4CCDA 1WXJA 4BI7A 1KM5A 1SPQA 2X1SA 3C56A 2DZWA 1I2OA 2C1HA 3D0CA 4JICA 5FEZA 2HSAA 3FS2A 1RQEA 3FOKA 3L0GA 2W0UA 2NV1A 4UTWC 1LOQA 3BPWA 3N9SA 3NM3A 2QCCA 2J9YA 4K7YA 4QISA 1CI1A 3O16A 1K02A 2V9DA 3CWNA 3NL2A 4BK9A 5D03A 5HR7A 4WOZA 2NXHA 4Q32A 1ICPA 2Z2UA 3DKLA 2A85A 4NUWA 3LHYA 2QF7A 4Y6GA 5LZLA 3DH7A 1UUMA 5E0KA 3PR2A 5LNUA 3IEBA 1XKYA 1Q6RA 2CLEA 2E09A 3U8GA 4O0KA 3S9YA 3PC0A 4FHAA 1C8VA 2RHGA 4AAJA 2C19A 3W83A 4CNNA 2W6RA 2QCMA 1QPOA 1KM6A 1W8SA 3OVQA 3QMTA 1OABA 4BI6A 3SJ3A 5G2WA 1VYPX 3KHJA 2AGKA 4O16A 3VKJA 2GQAA 3NPUA 4IPIA 2OT0A 4GNJA 2YZRA 2NZLA 3GR7A 3OHIA 3CQ0A 2CLLA 2A21A 5LNRA 3HGOA 1QPQA 4FNUA 3QPYA 3TK7A 1IF2A 4JN6A 2DJLA 2ZZ4A 3EX3A 3CEUA 4OHQA 5FEXA 2Q3RA 3TAKA 4X3ZA 2Y7GA 1AK5A 2ISWA 3UPWA 3PWAA 4MFEA 3WFAA 4Z08A 1SW3A 1EX5A 1FY6A 3MWAA 1JQVA 3N14A 1H61A 1O4UA 3WK0A 1VLIA 3QEZA 1AW2A 1P5BA 1XL9A 3HB9A 1A5AA 2ATSA 2FB2A 3L0NA 4K7VA 4JTGA 3W85A 3W7GA 3CIXA 1BKSA 3I7SA 2BZNA 4Z1AA 3CHVA 4AHPA 3LV5A 4X22A 3L21A 4JEQA 4FIRA 2QUUA 3WJYA 3UWUA 3VNDA 1VC4A 2DORA 1ZAJA 4IMGA 4NZFA 1F2JA 2ZA1A 3E96A 1OX6A 1PE1A 3LOTA 2WOQA 1JR1A 4Y9AA 3M0ZA 4IQLA 4RV8A 1YPIA 3NQ7A 5D30A 3W1TA 1B57A 4A21A 6TIMA 3MO7A 4MJZA 4XKYB 2V30A 2A2IA 3C0JA 3TQ0A 3W7HA 1TPUA 1FXQA 2WSRA 5TBOA 4NJHA 1OFAA 1W5NA 3BLIA 1VGAA 4ADTA 3JS3A 2V5BA 4JTLA 1F6KA 3EX6A 3MP4A 2A0NA 2WPBA 2ABAA 4CQ8A 2HS8A 2I1OA 4MY1A 2PE4A 1YTEA 2C6QA 4RK8A 3MI6A 3NQGA 4R33A 1JVNA 1JRCA 4O28A 3TE9A 3QW3A 3M41A 3KRUA 1XC4A 3GYEA 1QOPA 1G4SA 1LLWA 3GDRA 3KXQA 1VCVA 4EF8A 5CGQA 1Z48A 4E2DA 3MP3A 3STCA 1VYSX 1KFBA 1ME7A 3W3OA 3TC6A 1OHLA 3GKAA 4FX8A 5IBXC 5F1UA 3RF9A 4EIVA 4LY8A 1H1ZA 2VEIA 3UZJA 3LXCA 1FCQA 3STGA 1I2RA 1XBXA 3PAJA 3RFAA 3LLFA 3NQAA 2YPIA 3DFSA 3TR2A 3LCIA 3BLFA 2WSYA 4XZ9A 3GK0A 2CW6A 2YW4A 2RH9A 3EWXA 3EXSA 4UCGA 4NNBA 5E93A 1LLZA 5DLCA 1B3OA 1VS1A 1TJRA 3NZRA 1H7NA 4HIBA 1WOAA 2H3DA 3PSWA 2X1UA 2OX1A 2VENA 3LCWA 4HSNA 3P8JA 4DELA 2YFOA 1XDLA 3MUXA 4RJEA 4H4IA 3S1VA 3DU0A 3KVLA 3E02A 2ALDA 4UTIA 2GPTA 1X1OA 3W9ZA 3FLUA 4O4WA 1QO5A 4UTWA 5F4SA 4RR4A 1HUVA 3L2IA 5KITA 2J9XA 1RQHA 4TMBA 3M5VA 1EWDA 3LRKA 4MUZA 4OGZA 3LBMA 3PBWA 5DY3A 4RZ4A 3PUOA 3EWBX 4JR5A 1ONRA 3W07A 3O1NA 4N6EA 3W7IA 1H50A 4JYFA 3W87A 3WK2A 4C1KA 5AC6A 3M7WA 3NQFA 4K38A 7TIMA 1KM2A 1ME9A 3DFPA 3NR0A 3C52A 3IGUA 1G4EA 4NX5A 1XUUA 2VC6A 3QJAA 3M9YA 1QPNA 4LUIA 2CZFA 2Y85A 3G8EA 3NPWA 4UMBA 2VFFA 2ZZ2A 4EOUA 4FX6M 3V1PA 3MJYA 1TPWA 4O10A 3W86A 2ZRYA 3F4NA 5KZMA 3STEA 3B8DA 1L6WA 4MPQA 4PC8A 1XCFA 2WO5A 1F05A 1TTIA 2Y6ZA 3W7NA 4DF0A 1FDJA 4TR9A 3VE9A 2VOMA 3BG9A 5KTLA 5FF7A 2B7QA 1G69A 1GVSA 2EF9A 5K7JA 2GVLA 2AQWA 2DU2A 3LCFA 1PV8A 1KA9F 3UWQA 3CC1A 1H60A 5AHEA 2PC4A 4JX5A 4IMEA 1HL2A 1O60A 3PULA 1VHNA 4NU7A 4CQ9A 3M44A 3C2VA 1I2NA 5CSRA 4QNEA 3LHTA 1A5BA 3G1AA 3TW6A 3L5MA 3LLDA 1WDWA 3UWZA 4UTKA 5D37A 4TO8A 3W75A 1OFPA 2ZZ5A 1G7VA 5CPMA 5GVJA 2V81A 2JKEA 5D2TA 3PM6A 3SGUA 5FEWA 3QMSA 4CQAA 5G5IA 1LZOA 1Z44A 4N4PA 4FNRA 1KFLA 2TSYA 2C3ZA 3C2FA 2C18A 1KFEA 4NJIA 2CWNA 1VYRA 2F84A 3TDFA 4DPPA 4O13A 3GNNA 2QUVA 1PHWA 4JS3A 3C4UA 4NVTA 4ZZ9A 1WBHA 3L66A 4AF0B 4E38A 4RZ5A 1TREA 3BW2A 4TIMA 1TPH1 3L65A 3LHZA 3THAA 2RKXA 4NQ1A 3DI1A 3DBPA 2V2DA 4YCPA 5I3JA 2NUXA 3ZFHA 3F4WA 1SO6A 5EPDA 4FEZA 1LTDA 3MYPA 3UNDA 4GUFA 1O94A 1XDMA 1IXPA 3IIVA 2YXGA 3LCGA 1GEQA 2QJIA 5HWJA 4JTUA 1Z41A 4KFOA 3S8HA 3SECA 4YWIA 4HPXA 3QF0A 1FXPA 2VELA 1ICSA 3G1DA 2OMAA 3O63A 2H90A 4IMDA 5I3IA 1KW1A 3EKZA 1D9EA 2G97A 3T40A 4UTUA 5K4ZA 3C2OA 2WQPA 4N9CA 3CIWA 3W2LA 1J2WA 2FPVA 1N7KA 4M7TA 2CFFA 3TU9A 1ZFJA 1WOBA 3FJ6A 3M16A 2GQ8A 3TH6A 1I8JA 4JYDA 3SFKA 3S1UA 3GXTA 1EPXA 3W74A 3LDVA 4ADUA 2Z6IA 2JBMA 3GAYA 4WX2A 3Q2DA 4O11A 5LHFA 5FI8A 2ZRUA 1GTHA 3W7OA 4N9BA 4E2BA 5A5WA 1E51A 1LRNA 1UUOA 3EX2A 3IIZA 2VFIA 3OEXA 1TPFA 3R2GA 3PBVA 4ZVJA 4P2VA 3SR7A 3P80A 5U7SA 4ZL1A 3TROA 3B06A 3SY5A 4GE8A 3NAVA 3G1VA 2CLKA 4C1LA 3SGZA 5LNVA 5F2LA 3TJXA 2E68A 4BWLA 4GBUA 3GZ3A 4GWEA 3NQEA 3LV6A 4Y8FA 3QSTA 4AWTA 3NQMA 4NX0A 2ZZ6A 3HPSA 3BVJA 3U2OA 1WA3A 4ALDA 1LROA 1W31A 5AYYA 3ABOA 3HQ1A 1XBVA 4BR1A 2Z1BA 4MZ1A 1GQNA 3BGJA 4O12A 1DOSA 4GRSA 1SSDA 5ABTA 4OV9A 3FKRA 3M43A 1C9DA 4MLRA 4O1CA 3DI0A 4A3UA 4JIPA 3LCXA 3I7QA 4LS2A 2FPTA 1W5MA 5BNKA 2DZPA 4FX7A 4IWWA 3S5NA 1HFBA 3NQVA 4GXMA 3FIGA 3MHFA 2BXVA 4ZQMA 1H7RA 1SW7A 4OBTA 1LYXA 1OFEA 2QCNA 1UCWA 5K4XA 4LC6A 1GVFA 4GFSA 5EBUA 3G1SA 1SZEA 5CPOA 1KFCA 3U6WA 1P4CA 1JCLA 4JTIA 1ZNNA 4FF7A 3CB8A 5D05A 1H62A 4XKYA 5HUPA 4UFLA 2WNQA 3G8RA 4K8HA 2X16A 3QSRA 2FFCA 1GYLA 2OT1A 1K8ZA 4M6QA 1JCYA 3LHVA 3YPIA 1FUYA 3QH2A 1TO3A 3W7JA 4UTMA 2W79A 4O0ZA 4LVDA 4A2RA 3TFCA 5AHFA 1MEWA 4WY0A 4L4MA 1QNVA 2FDSA 3LXBA 4AWSA 4YLWA 4RXFA 1QPRA 5C54A 4Y90A 1KBJA 4JTJA 3S1WA 1JCMP 2O7SA 5F2IA 1JJKA 1FWRA 1GVQA 3OA3A 3PF3A 5D02A 2F7FA 5T26A 3VE7A 3CTLA 5D33A 1RZMA 3NQCA 4YCOA 3CU2A 4JDYA 3EWWA 4P61A 4NZJA 3QQ1A 1TPVA 1OYBA 2TPSA 1W5QA 1A5CA 1XFBA 3W7CA 1EWEA 1F7BA 3S6DA 4JY8A 1FX6A 3O6DA 4KWVA 3TFXA 1GG1A 1OFQA 3VFLA 1SFLA 1XXXA 4UFJA 4I7VA 2B0MA 2D73A 4BI5A 2C15A 3TSBA 1UBSA 1ADOA 1I2QA 3DXIA 5G4EA 4QAIA 1O5XA 4G1KA 1M6JA 2DZTA 2QCDB 1OG0A 4CCEA 3W7RA 5HJLA 1F73A 3G0SA 3NPVA 3MI3A 3I6RA 3SZ8A 4B5NA 4AHOA 2CLMA 4DO5A 2O7QA 1OK4A 4N2YA 4QQ3A 4OT7A 1LBMA 4FXRA 4I9AA 4NT0A 1WQ5A 3NQ6A 3EXTA 1I2PA 3WK1A 4CLMA 1L6YA 3A5FA 3WJXA 2B4GA 3UYCA 3W1MA 3LCLA 2X1RA 2NUYA 1GZGA 1QAPA 4UTJA 5D2VA 4M19A 3O8AA 1F5ZA 3NQDA 1ZENA 3IVUA 5IM51 3GDTA 2QCDA 3G3MA 2ZRZA 4YL2A 1Z42A 4M7SA 3LCHA 5BMXA 2Y7FA 4PFMA 3QQ0A 4O50A 4LOCA 3PUDA 3OIXA 3RNDA 1IXOA 4UIOA 1OF8A 3BARA 3NL6A 4I7WA 2YW3A 2R91A 1YXCA 1T0OA 2NX1A 4UXDA 3HBLA 3W1AA 5HQEA 3HGRA 1THFD 1ZCOA 3NEVA 3C8FA 4MLJA 3W1XA 1TRDA 3STFA 3NO5A 1QCWA 4LWWA 3F03K 4GUJA 4BFAA 3UD6A 2BX7A 1QO2A 3C61A 4H3DA 6ALDA 1WYIA 1W5OA 3SSJA 1H7OA 3NL3A 1YDVA 4TX9A 4AXKA 1PL9A 2JGQA 4HHPA 3W1RA 4ZQNA 3UY8A 1D3GA 2WKJA 1TCDA 5G2HA 4Z0JA 4JXCA 4FNTA 3O05A 3ABQA 3DFNA 1MZHA 4HNNA 3PB0A 3DKJA 2VEPA 3LB0A 2EHHA 5AYZA 3A23A 3IIOA 4FNPA 1DKWA 1KTCA 1XBZA 1LOLA 4PEKA 1GWJA 2KZHA 3TKFA 3HGSA 5F1VA 1V7YA 3NG3A 1GJPA 3MI2A 1VRDA 3KRSA 3PG9A 5EKYA 3S5ZA 2FLIA 3HG4A 2E77A 1QR7A 2XN0A 3LTSA 4LUJA 1EUNA 4K6AA 3W2NA 1GT8A 4JTTA 1GYNA 5DCEA 4IXHA 5LSMA 2Y7EA 4JTFA 4O8RA 4UTTC 1FCBA 3VCRA 1N8FA 1ICQA 2ISVA 3FKKA 3H54A 4DXVA 5BMWA 3HGJA 4JIQA 3BLEA 2RDUA 1TQJA 2C14A 5G1TA 3BK0A 3NGJA 1F76A 1DQWA 3UWWA 3KVJA 1DJQA 4DPQA 3MP5A 4HPJA 4IXXA 1G6CA 3GB6A 1MEHA 4N6FA 2OJPA 3W2UA 2ZFAA 4MJMA 5H91A 3W22A 5DN1A 3IGSA 4GJ1A 4LV9A 2WV8A 4WY0F 2B7NA 3T7VA 1U83A 1T99A 1DJNA 5D2XA 5AC8A 4LW7A 2CU0A 2X1TA 4J9JA 4X2RA 3ZWTA 1M7OA 4LU0A 5U4NA 1BEUA 4R34A 1JQXA 4UTLA 2QCLA 4BWLC 3NM1A 3UY7A 3W1LA 4IGHA 2QR6A 5E1QA 4PTNA 2YR1A 1SO4A 2BSLA 1OX4B 1XBYA 4UFHA 4A2SA 4S2CA 5F2GA 3P7YA 4E0CA 4XTIA 3FYPA 4ZQPA 4YMZA 4O1BA 4H6KA 3RLVA 2HMCA 3M5ZA 4LVAA 3HPZA 1RR2A 2QAPA 2HS6A 3RK8A 4N9EA 3CWOX 2V82A 4K37A 2A7RA 4A22A 1JRBA 1OYAA 1KV8A 5C2XA 3VI2A 3LI1A 4WY0B 5LNWA 3HPXA 1TTPA 4TU1A 1PCWA 4DF1A 1KM3A 4NXKA 3G1FA 5CPNA 5HULA 2G96A 5D2YA 1ALDA 3Q94A 4MZ8A 4DO6A
chains in the Genus database with same CATH superfamily
4JNZA 5D32A 5B7ZA 5AVNA 1K9DA 2XDFA 1TB3A 4IJCA 1BWVA 1Q8AA 1H1YA 1ECEA 2A6NA 5EMKA 3P84A 3L7RA 3UWYA 2GOKA 3GU1A 4XAYA 2NX3A 1FFQA 3ITTA 4K8EA 1NFGA 4JTEA 1K4HA 1TTQA 1QHPA 1UD2A 4LS1A 2VFGA 2PPGA 3KBNA 4BY3A 1UKQA 2YKKA 4L64A 3G24A 3RILA 4QHRA 2QCGA 1WDQA 3AXKA 1HG3A 3PTQA 1KRBC 1O68A 4KFNA 1I4NA 2EJ1A 3H4GA 1EBGA 5F2MA 4PN2A 1UKTA 2FIQA 2VEFA 2ZA3A 4HGXA 4MKSA 3QLDA 3QM3A 4C6CA 4LC8A 4S2BA 3CUHA 1B4EA 2VL4A 3JRKA 1P0NA 1OC5A 3AQUA 1NQ6A 4Z1DA 5EU9A 4UOJA 2BTMA 1A4LA 4CU8A 4AMAA 4DQWA 3GNDA 2P76A 4J3ZA 5HWNA 1R30A 1OK6A 4UNLA 3MVIA 4Q8WA 4NXSA 4M6VA 5AC5A 4DWDA 4AC7C 1KM4A 2DUZA 2WVTA 2A3EA 3VNKA 4XAFA 2DZSA 3DFQA 2OWXA 4ZQRA 3ZXWA 4LAKA 1K6AA 1YBQB 1K4GA 2Z1XA 1NH6A 1ZLPA 3S5OA 2TODA 2OYLA 2VXNA 2F2HA 4DJFA 3W76A 4L56A 2B7OA 4PCTA 3AMGA 4AEEA 3HMJG 3GC2A 5CC3A 2FJKA 4BA0A 3BZGA 2C16A 5BRBA 1G7UA 3TAOA 4QAWA 4DZIA 3MHUA 3AIEA 3L4WA 4B91A 1IWBA 4D72A 2XVLA 3O07A 2G3IA 2CERA 3OLGA 2ISDA 2C79A 1RD5A 5HMDA 2WJFA 4ZQOA 1NVMA 4Z2LA 3NZGA 5C7HA 1YADA 3TA9A 4GH3A 3R89A 2R14A 2QIIA 1IIHA 2VMFA 3CMGA 4A29A 2OO6A 3E12A 3VCNA 4DNMA 3POHA 2QV5A 1AH0A 2DZXA 3WF3A 1XD1A 1TWIA 3B9OA 4GVGA 1OFBA 3TYEA 4P8WA 2G8ZA 3P74A 2XG9A 5BOOA 2YYTA 8XIAA 5KMYA 2W27A 3P5YA 3DHDA 2A7PA 4O53A 4FAMA 2YIHA 1E4LA 3WBAA 4N42A 2QJGA 3WF0A 1CWYA 4NZ3A 3WF2A 2ZZ3A 2PA6A 4UC5A 1BWLA 5CZJA 4FF5A 4CEXC 2OOFA 1H0GA 1ZP3A 2PCQA 2BHUA 4HNVA 1X7FA 2D22A 3NA8A 3MTWA 1BG4A 2ZWZA 3OTRA 1VFLA 2I14A 1S1PA 3UZZA 5TQLA 4A3RA 3SRDA 3IVTA 4FNQA 3PHAA 4POCA 3UU0A 4WSKA 4DJEC 4FK9A 3VM7A 4GJIA 3VX1A 3DFOA 2PTWA 1AW5A 5JXQA 1J5TA 1K7EA 4JEJA 3M46A 4LYKA 4O1DA 2NV2A 1F6PA 3ZLHA 3UR2A 2WKLA 1EGMA 1LDCA 3V1HA 1UR0A 5DXXA 3OPSA 3TJIA 5DCDA 4GZ7A 4CNUA 3R10A 4L9XA 2JALA 2J8GA 4HCDA 1V02E 1E0VA 3JVAA 3ARRA 5L6UA 3BOXA 4FO4A 2IUZA 2H8ZA 1ZBVA 5CZ0A 2NV9A 4AMCA 1YNPA 1UP0A 4QJ1A 3FSTA 1TZZA 3ORWA 3VKBA 4ICNA 5CPSA 1CZ1A 3OVRA 1FFRA 4AFYA 5DMYA 4JNYA 1V0NA 2VI0A 4UR9A 2E5DA 3MYOA 2X7WA 3TSMA 4EPEC 4FOJA 2BHYA 4PL2A 3T42A 1LP6A 1W1A1 1XLFA 1EOMA 1GYMA 1ZTVA 5DRIA 3HQOA 4S1FA 1XP3A 4QE1A 5FAJA 4PMRA 4IIEA 3LSBA 2NQLA 1GVOA 3UETA 5J04A 3K4WA 2QCHA 2YX0A 2BLEA 4AZCA 4IOTA 3RCMA 4GFIA 4LRSA 2J6VA 1ONXA 2G95A 1ITXA 1KFWA 1DVJA 1DE5A 1IEXA 3PTDA 3SRKA 3F1QA 1EJ7L 3H8AA 4GCXA 3QZEA 4LS0A 5IFTA 2A79A 5M3WA 1S46A 3GG7A 2NX9A 3FYOA 4PUKA 1TR9A 4ORIA 2Y8UA 1Y0EA 5EA9A 4NG3A 4PB5A 2RDWA 4HCLA 2G37A 3ANUA 3TLLA 1PKMA 3I65A 1AQHA 3AXIA 2QULA 4AB4A 5LNSA 3NZ1A 2ONEA 4IPJA 3EWUA 5CZTA 1HTIA 3C5QA 1NWRA 3CZJA 4C6FA 5I6SA 4O0QA 1FWHC 2X30A 4Z0SA 4NJJA 5AC7A 4Q4OA 2XWDA 1SU5A 4G56A 1N55A 3OHMB 3U5UA 4F2BA 5KINA 2WVVA 3CV7A 1Z6KA 2J9ZA 2KAUC 1TZ7A 3AUOA 3OG3A 3EWYA 3UZYA 4LVFA 1PCKA 4N4QA 4DIAA 4J35A 2YCIX 3NDYA 1MDLA 4BKNA 3OZPA 3QRHA 1QNPA 1B9ZA 1RCQA 1NAL1 2CZDA 4A3HA 8TIMA 1SUXA 2PZ0A 1YQ2A 2BOFX 1R3SA 3CYVA 1AMYA 5K9DA 4UOZA 4HU0A 3DHFA 3GYCA 1PZ1A 4WHBA 2CKRA 2Y62A 2AKZA 1XYBA 3W25A 3N3MA 1EP3A 4U5IA 4XZHA 4PCFA 4D6IA 1GW1A 1R2SA 1OG6A 4JTAA 5E5CA 4L4LA 4GA8A 3GAKA 1HJUA 2JKAA 1A5SA 3B04A 3TUUA 3L0KA 4MF4A 1YE6A 2VVSA 3S2MA 5EL1A 5AOUA 2HE5A 3BJTA 3TW7A 1Q4WA 5DBTA 2PWVA 1V3JA 4XBKA 3LHUA 4Q8TA 2POTA 3G3DA 3EAUA 2GJPA 5FESA 3OGSA 3B9DA 3KS5A 3TTQA 1M68A 2R1PA 2PGWA 1CYGA 4WLCA 3NYZA 1VCFA 4O57A 3SUSA 4BF7A 3WQ5A 4B16A 1PVNA 3M0HA 4ZMGA 1M9HA 3CQKA 3R79A 2CZEA 4UQCA 1O95A 2JGYA 3GXIA 1XIJA 1QRQA 4PCNA 2PDJA 4OBSA 4JQ1A 5CAHA 2I5QA 1B90A 3LS9A 3B9AA 1JL8A 1VLWA 4ZENA 2GVEA 3NXLA 1L9WA 1CTNA 3FSUA 4B3KA 4OU1A 1K70A 3VD5A 3L23A 3QYQA 4UFKA 2QCEA 3I68A 5CPLA 2VRQA 2WMKA 1VJIA 3QTGA 4WZHA 4MZYA 5GPRA 5CBBA 2DQWA 4Q4KA 4QDMA 3W70A 5HDRA 2VNCA 3NQ2A 5MF5A 3BE7A 4JQ4A 3EEGA 5J5DA 4TX6A 3UXAA 3V5OA 1BWKA 3E49A 1VENA 1FWDC 1TV5A 1SZFA 4IQJA 1F4AA 1HJQA 1KXQA 1R3RA 3INPA 3WEMA 2PRHA 3H2FA 4GI4A 5FL1A 1OCJA 4BEQA 1JYWA 2GUYA 3GG1A 3H12A 2F38A 2ZZ1A 3RAOA 3W7DA 2PDXA 3W6MA 2D1ZA 3K5XA 3CLMA 4P7OA 4GH1A 3TA6A 2WMIB 1JZ7A 2JF7A 2WM0A 2PURA 3IV3A 1TQXA 4CQBA 2RFGA 4K8GA 2E9MA 4HSOA 1F74A 1HKMA 2JE8A 3LTPA 1H7WA 4GNVA 4TMCA 4F79A 1XYLA 2YXXA 5G1YA 3BW4A 1TPC1 2NXGA 4MUPA 3EOSA 4YYCA 3Q4DA 4GO9A 3GH5A 3AJ7A 2CBIA 2G0WA 5HA7A 2VEKA 4PTWA 5DANA 1JI1A 1HNYA 3GNRA 3EB3A 4MPKA 4GHRA 2EPLX 2PUZA 1H63A 5I3FA 3P5ZA 3ARPA 2BDQA 1W37A 2A6LA 4ZB2A 3ZSTA 1G01A 5D4YA 5G4WA 4E4UA 4C6PA 2D69A 3K4AA 1R2RA 1S1RA 3M0YA 4W7WA 3KVMA 1WX0A 1R2TA 3BTNA 3CB3A 1PIGA 1NWSA 4BS0A 3L2LA 2VEGA 2YDAA 3V0UA 3QC0A 2GDQA 4P8XA 4YNGA 3T55A 3N18A 2WBGA 2Z1SA 5DBUA 4B2DA 5HBFA 1JIBA 1IEIA 3QQWA 1Y5XA 3LXAA 4C6BA 2Y61A 1CX9A 3NVTA 3NSNA 5DF0A 4EXQA 5B80A 4V2XA 2VR2A 1VP5A 3A24A 3QV6A 2NLIA 1KM1A 4HMDA 1XSJA 5GQBA 2WVSA 3IWPA 1IGSA 3LRMA 1V0MA 3SI9A 4HK7A 1AD1A 5CGMA 4Q33A 3L4XA 1QASA 3QFWA 4N02A 1ZAHA 4WOQA 4TV5A 4AWUA 3W71A 4HU3A 3KCLA 2OKOA 3PUEA 3WFZA 1A0EA 4XV0A 1JZ8A 2F2KA 3LPFA 4AZ7A 2DSWA 2HXUA 3FGCB 4RLIA 1K1DA 1MXDA 4BI7A 4U3CA 2KX9A 1I2OA 1EO5A 3CUZA 5CJNA 2HCVA 3V0SA 1RQEA 5C9WA 1O1ZA 4UTWC 2YLAA 1LOQA 3N9SA 3NM3A 4DWSC 3E2VA 1XISA 4GJJA 3CWNA 2QUNA 1VFFA 1ICPA 2Z2UA 4NUWA 2QF7A 3O0KA 1FOBA 3RXZA 3IEBA 4IUGA 2E09A 4O0KA 3S9YA 2RHGA 3OLDA 4P8VA 1W6TA 4TVDA 1DJYA 2XSAA 1KM6A 3LMYA 4IIBA 3UW6A 1YNYA 4KW2A 4ASTA 3AIBA 3PJXA 4KWUA 3KHJA 1ZQ5A 3PZNA 3NPUA 5LNRA 4E8GA 4DWSD 4L1GA 1DWHM 4TQTA 1UH2A 3CEUA 5J8LA 3MVTA 4Q4QA 3WQ4A 2Q09A 3PWAA 4X0VA 2NVDA 3UPWA 4HPGA 4FLOA 3GHUA 3RJYA 2VDHA 2Z29A 3AIUA 3MWAA 4YVPA 4QBXA 3H4WA 4GLEA 3I4KA 3QEZA 3ZT6A 4EE9A 5BXTA 2J78A 4WDXA 4BJHA 2J4GA 1TV2A 3HB9A 3WEOA 3L0NA 3H6OA 1QNSA 3W7GA 1V6VA 3LV5A 3WJYA 3URQA 1ONEA 2CBJA 1ZAJA 1V79A 4KBXA 3CIVA 3VOFA 1YE4A 1OT1A 3MKVA 5C2GA 5CGTA 2WOQA 1JR1A 4Y9AA 3M0ZA 4IQLA 3R0DA 3CAVA 3UT0A 2VGIA 3W1TA 3SGGA 1D3CA 3ZZ1A 1GK8A 1Y65A 4XKYB 3W82A 1W9VA 3W7HA 2WSRA 2QGHA 4C6NA 4A8RA 4CGTA 4ZOEA 1RY0A 2W63A 3QGVA 3KTSA 4CEUC 3IJ6A 4JTLA 4K68A 2WPBA 1Q66A 2ABAA 4CQ8A 4CN1A 1UWAA 3WBXA 4XZNX 5ENLA 2C6QA 4RK8A 3MI6A 1E9YB 2E3ZA 3H24A 4R33A 1JVNA 1IR1A 4ZE5A 1EC9A 4OTKA 4W88A 3SUTA 4O28A 5CLTA 3TE9A 4AIEA 1XC4A 3GYEA 4HD5A 5D9MA 1LG1A 5CGQA 4E2DA 4A6GA 2C8NA 4ZSTA 4DJDA 1N82A 1HL8A 4EIVA 4LY8A 1FHVA 3GD6A 3B97A 2XFFA 3EKGA 1M41A 4ROPA 3QBUA 4DXKA 4NNBA 4GG9A 1LLZA 4RE3A 1B3OA 3PFRA 4RPQA 3NCOA 2X7VA 1DIOA 4HIBA 1MNSA 2G3JA 4HSNA 1X7IA 4HCHA 4AZ5A 3P8JA 3GUGA 1XDLA 1VEPA 4W7UA 4JIIX 2MNRA 5LIWX 3WMSA 1LT8A 2PS2A 2WHMA 3E02A 4F9DA 4JKMA 4IGNA 3L4VA 3CXOA 4LH8A 1QO5A 5F4SA 1HUVA 2PDNA 5KITA 2J9XA 4GKTA 4FSAA 1EWDA 3LRKA 4MUZA 2PD5A 3LBMA 1XJBA 5DY3A 1KC7A 4CD7A 4CCZA 4OOUA 4QGCA 3W07A 1MZRA 3O1NA 4ICCX 5GJNA 4N6EA 4NYUA 4JYFA 3W87A 4C1KA 3FGCA 3BAIA 4KMQA 3M7WA 2QVNA 1C91A 3ARTA 3OODA 2OXNA 1VRXA 3CTTA 2Z27A 2QUMA 2UBPC 2OODA 1V6UA 3ITLA 4TOQA 1OD8A 4Y8EA 4NX5A 3BCDA 3VYLA 1XFCA 1A0DA 9XIMA 4PULA 2CZFA 1Q7ZA 2R1LA 1CNVA 4QLKA 2DVXA 1E3ZA 2VFFA 4PTXA 2ZZ2A 1MW2A 2BBFA 2EPKX 5KZMA 1CGVA 3B8DA 2Y6ZA 3ES7A 1V0KA 2WXDM 4MB4A 5C9XA 3VE9A 3OGRA 2VOMA 3LNPA 2B7QA 1D8WA 2V5KA 3TR9A 1S5NA 3NZQA 4AY7A 4B5TA 1PV8A 1ECQA 3ARYA 2RJHA 1FWAC 5AHEA 4F0KA 3PTKA 4JX5A 2DEPA 1I75A 3IAQA 4CQ9A 1BRLA 3C2VA 3PJWA 4J1OA 4JAWA 3K8MA 1A5BA 3WY1A 3CL6A 3GQYA 3L5MA 4PUWA 5D9OA 1SVDA 4M1BA 4DVOA 2ZZ5A 1QXLA 1G7VA 1CPUA 2V81A 2JKEA 5JU6A 3PM6A 3EPOA 1L8NA 3QMSA 3GTIA 4CQAA 5G5IA 2D23A 4N4PA 4FNRA 2XSXA 5EGRA 2NQHA 5HOSA 3QR1A 3TDFA 3LQLA 5HXMA 7ENLA 1NWTA 3U2ZA 4DB7A 2A3LA 1K77A 2TAAA 4ZZ9A 5CLWA 3L66A 4AF0B 4KESA 4ZR8A 4E38A 4XISA 4IP5A 2QXWA 4WDUA 2HZGA 2WC7A 6ENLA 3L65A 5FOOA 4M3PA 4NQ1A 5GJPA 3DBPA 1CGYA 4FEZA 3TYZA 4ERGA 1LTDA 1MQQA 4ZSUA 2HV5A 4G7EB 1O94A 1IXPA 2YXGA 2HVMA 4JTUA 1Z41A 3MSDA 4LNCA 4DAIA 2VQTA 4HPXA 3QF0A 3URBA 1FXPA 2ZX9A 1XYCA 3O63A 4W93A 4IMDA 1FH8A 3LUTA 2O0TA 3MS8A 1DJXA 5IOBA 3V7PA 5XIMA 3DHUA 3TU9A 4Z2IA 3TH6A 3SFKA 3S1UA 3T4WA 3LDVA 1K9FA 1JDCA 4O11A 5FCZA 1NDYA 4AVOA 1GORA 2ZRUA 1F61A 3W7OA 3WO8A 2ZUTA 4UCFA 4RNIA 5C8BB 1PB0A 3TYBA 4ZVJA 4Z2JA 3SR7A 3BICA 4QDWA 4N7QA 3NYDA 5U7SA 3AZRA 4G2DA 2EG8A 1RSCA 1VJZA 4PUDA 3NAVA 3G1VA 4HTYA 2WZIA 5F2LA 3TJXA 1E6NA 1VBGA 1HF6A 2ZZ6A 3WF1A 3CGTA 3A13A 3HPSA 3MMDA 3BVJA 4J28A 3H2NA 1LROA 3ABOA 4H83A 2BS9A 5M17A 1O12A 2Z1BA 3XISA 4V28A 1ZCCA 4HB7A 4O1FA 1W32A 1XC6A 2C71A 1XICA 1MMFA 3RX4A 1C9DA 4MLRA 3DI0A 4A3UA 2EO7A 5BNKA 2DZPA 4IWWA 3S5NA 1OC6A 5A3HA 4GQRA 3NQVA 3PZIA 3HTWA 3FIGA 1DJHA 2BXVA 2WPGA 1H7RA 1LL7A 1SW7A 3F2CA 2BY0A 3WMCA 1IR2A 2QCNA 1UCWA 4AD1A 3MKKA 2W3ZA 1GVFA 5EBUA 3GTXA 3QHNA 2DZAA 4CD8A 2ZE0A 5D05A 1MNZA 6REQB 2PDUA 4UFLA 2WNQA 5E6ZA 2A3HA 2FFCA 2Z7GA 5BXSA 2XZ7A 1UH4A 1AFSA 4W89A 3A64A 4P5UA 3D46A 4M6QA 3VK5A 1JCYA 1D2KA 1MI3A 1TO3A 5FJJA 4AZHA 5GJMA 4UTMA 6TAAA 3ONCA 1XLEA 2QS8A 1GOIA 3N4EA 4DYEA 1WDSA 3T0DA 4C7FA 5DO8A 3DYOA 4YLWA 1X98A 5C54A 4Y90A 4H6EA 4JTJA 1S2VA 3S1WA 1JCMP 1EJUC 1FWIC 3EZ4A 2O7SA 2Y1HA 3BOFA 4MNKA 3OA3A 3PF3A 4G7FA 4YYFA 3GFYA 3VE7A 2DUAA 3CU2A 4LYQA 4MGGA 4W5ZA 5XINA 1OD0A 4XD6A 4DLMA 2EG6A 3QQ1A 4XSLA 1TPVA 5ABFA 2TPSA 1F7BA 3S6DA 4RNFA 1S2AA 1FX6A 4J2PA 1GG1A 1X96A 3VFLA 4WR3A 4UFJA 4RE2A 3KBWA 3VGDA 2HXTA 4JOMA 1TVPA 3ICJA 1W2VA 1XLGA 4JCLA 3TSBA 4PRTA 4A8IA 4ZB5A 1I2QA 3DXIA 2QCDB 3W7RA 5HJLA 3MI3A 2IKJA 4QLLA 4Q8QA 3VTRA 1WDRA 3DOPA 2CLMA 1W9PA 5E9XA 1DIEA 1OK4A 4N2YA 1EFZA 4QQ3A 4OT7A 4FXRA 4I9AA 3N4AA 2XFRA 4NT0A 3UFYA 4H41A 2JEQA 3A5FA 3E38A 3STPA 3LCLA 2V5DA 2X1RA 2NUYA 1R85A 3QKZA 1QAPA 4UTJA 3O8AA 3EPNA 1MRAA 3BOLA 3QR3A 5IM51 2YL5A 3G3MA 2ZRZA 3B9EA 5A6KA 3R0UA 3VD9A 4DNHA 3OIXA 4GINA 3RNDA 2WM1A 1D8CA 4UIOA 3PJTA 2QZRA 4R85A 2XUCA 3IJQA 4A4AA 1PWMA 2CETA 3EOOA 4QLJA 1V6WA 4DZ5A 2WBKA 3MUCA 1JZ5A 4QJ3B 3DG7A 1XIEA 3BJFA 1G0CA 3WQGA 3HGRA 1ZCOA 3U3HA 3MO4A 2O9PA 3W1XA 3WDQA 1US3A 2CITA 3NO5A 1QCWA 4KIRA 4GUJA 4HNLA 4H3DA 3BH4A 5JBEA 1W9DM 1CIUA 4UZUA 4R27A 4RZBA 1YDVA 3E2QA 3PNUA 1CXFA 1EQPA 1AH4A 2JGQA 2PLKA 3GTHA 4ZQNA 4CD4A 1TCDA 1U30A 3M0IA 4Z0JA 5LA2A 4JXCA 3ABQA 4HNNA 4XZWA 5D8WA 3GU9A 3VDGA 5F1VA 2XH0A 3NG3A 1GJPA 4WRHA 3WENA 3MI2A 3TTSA 3LGDA 2EJAA 4JHMA 3VMPA 1NFPA 1R8LA 2XN0A 1Q7QA 1EUNA 4LUJA 1E6RA 1R3VA 1TV4A 1MWOA 3VNZA 5LSMA 2Y7EA 3LN3A 4MDPA 1DXIA 3R6IA 1N8FA 3LA4A 3FKKA 5BMWA 3HGJA 4JIQA 3OBEA 2XIMA 2PI6A 3WFLA 4S3AA 2C14A 5G1TA 3BK0A 5M2FX 3ZOAA 4CKQA 3APTA 1DQWA 3VD3A 3RR1A 4DPQA 4HPJA 4Z42C 1G6CA 3EMZA 3ZO9A 1MEHA 5G1MA 4N6FA 3R8HA 3W2UA 2OGJA 3WDHA 2Y0FA 2XPKA 5DN1A 4GJ1A 4I5UA 2WV8A 1U83A 3T09A 2WHLA 1DJNA 5D2XA 1US2A 4LPCA 3MA8A 3AS1A 3ZWTA 3LMZA 2NQ5A 1M7OA 4LU0A 5U4NA 1XSKA 4R34A 1KBKA 1E0XA 2PWFA 2X0YA 4PTNA 2PGEA 5F2GA 1TUXA 4E0CA 1PEZA 4ICMA 2BVYA 3ZSSA 4C5ZA 2FZ9A 3ARZA 3LZ3A 4MJ4A 2ZVRA 2V82A 5D9PA 5IHSA 1OYAA 2NQ9A 3VKCA 3HPXA 1TG7A 4TU1A 4HA1A 3H2MA 3N17A 4NXKA 5CPNA 5HULA 4CVUA 1X97A 1ALDA 3OQEA 1R3YA 4DO6A 3AYSA 4PH6A 1Q3NA 1VCGA 1LUCB 1AH3A 4G7EA 1NDWA 4MYAA 3S42A 2IXUA 3UJRA 3NURA 1PDZA 3L9CA 4O19A 1K3UA 3ZJ7A 1GOMA 5KZDA 3KP1A 4DZHA 4U28A 3EB2A 1IT7A 2ZOXA 3ZM8A 3WNKA 2FTYA 3PZVA 1UH3A 4MADA 1LUCA 3S2JA 3LBOA 1J6PA 1ZPTA 2V3DA 2VFDA 1JPHA 3DFYA 3PPGA 4XIAA 2VFHA 4HA4A 1J10A 2CWXA 3N19B 1AL8A 5FJOA 3W23A 2G3NA 4JTKA 3TTOA 4EVZA 1HJVA 4PODA 2VR5A 5FJTA 3KCOA 3CUFA 1ISZA 2WW5A 3TN3A 4XQ6A 1F6YA 3FVMA 4WGHA 1R47A 1ZGDA 3W02A 1RP9A 3GDMA 3QXBA 4LUSB 1TCMA 1GHRA 1P6BA 3WD2A 1UWRA 4GISA 1OFOA 4B5SA 1V3HA 2Y70A 2YBTA 2J7HA 3NNTA 3EWZA 1YXYA 3HG2A 1EH9A 4EXAA 3DZ1A 3LENA 3TX9A 2XIQA 4C60A 4S23A 2GL5A 1VFMA 4MAVA 1GVRA 2Y63A 5A2CA 5HPCA 2ZX6A 3ABSA 1HX0A 1C8QA 2ZUVA 2Z25A 5FJUA 1FQ0A 4OIFA 4CU7A 3GDLA 3AYVA 5E6YA 5FF3A 4O52A 1AUSL 3QFEA 3ZVHB 2FB3A 3CBWA 4L6DA 7REQB 2NW0A 1GTEA 2JFEX 2ZDSA 3DG6A 5HINA 3W29A 1QATA 1J0ZA 3F5LA 3NDZA 4WKFA 1VR6A 2I17A 4HPNA 4IISA 3VIKA 1CXLA 3E9AA 3HJZA 4Y9MA 3S1XA 1ML1A 1EEPA 3WBWA 3N12A 2PZNA 2DT0A 2AL1A 1V51A 3WLMA 4AEFA 2ISSA 1CLVA 4YWSA 1E40A 3L5LA 1EEXA 3N04A 4I9JA 3T4CA 1J5SA 3QYSA 1EP1A 4AVFA 3DBNA 2EG7A 2WNNA 4WJEA 4XWUA 4AU0A 1JUEA 1SZGA 4H8NA 1GPWA 3ALGA 3WH8A 4O18A 5F7UA 1OQFA 3K30A 1EGVA 1NIUA 1FWTA 3HURA 4LUTA 4GD0A 2ZTJA 2E7FA 1KD0A 3LK6A 2J27A 2D2OA 2GK1A 3AFBA 2PDFA 3NWRA 1UA3A 1RBOB 1LQAA 4NP7A 2OKTA 1J6OA 1AZ2A 1W1ZA 3GNPA 3BO9A 9CGTA 2TYSA 1KR1A 2IS7A 4WJ8A 5I02A 1EJTC 1W3JA 2DP3A 2BGSA 3P60A 2OQHA 1TSIA 3H2OA 1Q6LA 5B7YA 2ODOA 4PZVA 5TIMA 1UQZA 4Q6XA 1UC5A 4EACA 3N9KA 1KFJA 5DX7A 1E56A 3SY1A 4DF2A 2NSOA 1Z9AA 4ZEPA 4H01A 2J6XA 2QVHA 1JNDA 1IEQA 1F8IA 4ONVA 4R5EA 1FHLA 3WSUA 1DL3A 2VQUA 3BLLA 5AHLA 3N15A 4JY9A 5KZ6A 5EY5A 5AHNA 1OY0A 1W3TA 3LSCA 2Y88A 4XUGA 5HNUA 2ZIDA 4MHBA 3R5EA 3SUVA 4FXJA 4DYJA 2XIOA 1KXTA 2PLJA 1V8EA 5C2CA 2OZ3A 1WAUA 3N1AA 3SCQA 3H4XA 3QPZA 3ABRA 3E0LA 3LG3A 3V75A 4GUHA 3T6CA 2Y5SA 1ME8A 1V7AA 1J0KA 1J8VA 2V5LA 2W67A 3TN6A 3BW3A 3BG5A 2XN1A 1KFKA 1WDDA 4GQ0A 4PTVA 1W1PA 2Z1WA 4GI8A 4MFDA 4R53A 2X40A 1N8WA 3BSGA 3AIRA 1EJSC 4PYSA 2VZOA 1OADA 1K8YA 2NWRA 4H6RA 3FV9A 2I16A 4B90A 1SO5A 4W9TA 3AIQA 3S0CA 3BAXA 1TMLA 3Q37A 1TUFA 4UOQA 3RO8A 3GG0A 3H2AA 3A9IA 3TONA 1X8FA 3TV8A 4B5UA 5A6JA 1T41A 2QAFA 1BQCA 1ZHAA 3GIQA 2AAMA 1QPKA 1W3HA 1KCLA 2CZVA 1VFSA 3NUKA 3V18A 3WELA 3SRFA 2QMKA 1HW6A 2V5JA 3CV1A 4FR1A 1W56A 2AKMA 4F48A 4AD5A 1NQKA 4UTHA 3KL3A 1PWLA 5HMSA 2CZ5A 4Q7BA 4R7OA 6PTDA 2GWGA 3TC7A 4MIMA 5SWUA 2GYIA 1V03A 2QJHA 4Q3MA 2H3BA 3C3NA 3RCNA 3WYZA 2WHJA 2XGBA 2ABBA 2VX5A 4RDWA 5I23A 1AW1A 2J88A 2Z7KA 1IIGA 5AHMA 1ZU8A 3EX1A 4X9SA 5DCBA 3U7BA 1LQ0A 3EGJA 3TIMA 3SCSA 1BVZA 3MC5A 4UMAA 3OLIA 3PZUA 3R13A 2VC9A 1C3FA 1LL6A 2E67A 2NQZA 1HT6A 4IIFA 4JFVA 3TXZA 3QN3A 1LT7A 3UCCA 8A3HA 1JZ3A 5AC4A 3U0HA 1YXDA 2PF0A 3TYDA 1EKOA 1NDZA 4QG8A 3H55A 2QPSA 2ZKMX 3IPWA 3GKFA 4RCXA 2Y8KA 3H7VA 3CHFA 5FJPA 1AL7A 1DQXA 2OLSA 3WLJA 3E0WA 1YTKA 3TNOA 2X2YA 1UB3A 1W0MA 1YIXA 3GW0A 3MMWA 3TTYA 4DJFC 2Y24A 3UXDA 1TV7A 4RV3A 2Z0IA 7A3HA 1Q63A 1MEIA 3TQVA 4GZJA 4JX6A 1GOXA 2ZWYA 3APGA 3LERA 3W7EA 3FA5A 3GHSA 1X1NA 5I24A 3S9ZA 5REQB 4XSMA 2YJQA 2ZXAA 4MTVA 2A7NA 3THDA 1FP8A 3DGRA 1W3LA 2WNZA 1UR8A 1FWSA 3NFUA 3KTCA 1T8QA 3W26A 1CGXA 3MV11 5FL0A 5AHIA 1LJYA 4H7VA 2EPHA 4ML9A 1KM0A 3UJ2A 3T44A 2V0TA 3LM3A 4UTTA 4IUOA 4BQ5A 3DDMA 3RMJA 2GVJA 3RU6A 4HT3A 1H3GA 3E3HA 4PBGA 3QC3A 3VMNA 4ENLA 3VO0A 4O4VA 4AUBA 4EAYA 2XVKA 1XH0A 2XHYA 4INFA 2VM8A 2E6FA 3H23A 4OWGA 3RUBL 3LI0A 1UWUA 5FEPA 3TZFA 1F3EA 5IXEA 1WKYA 3SB0A 1CB7B 2PLMA 1B5TA 1CGWA 1P0BA 3WJSA 4M80A 2PC8A 3WJWA 1CGUA 4MOZA 1U5JA 4LUSA 4MKNA 1QBBA 4AC1X 2I5IA 1OIFA 1X1ZA 5D38A 1TPDA 3ZT5A 4QG9A 3DX5A 1DWIM 4AD3A 1SQ7A 2QDEA 2Q3OA 2XINA 2QV4A 4IFRA 3P0WA 4EXBA 3CPRA 2DJXA 2CLFA 1MW1A 4DBSA 3R8GA 3UESA 2ACQA 1A50A 4I5XA 1RALA 4D71A 4IJBA 2ADAA 4IZGA 2OB3A 1HXJA 3HOJA 1IEWA 1PDYA 4TUFA 5MKGB 3L4TA 3KFTA 1VF8A 1MW3A 1KTNA 2AOSA 4IPLA 3QKEA 2XU2A 1SO3A 4WDWA 4M56A 1OYCA 3T2QA 1P7TA 4DI9A 5HJXA 1JCJA 5H2ZA 4AEOA 1C29A 2YA2A 4CUCA 2ZVIA 2GQ9A 2Z24A 3NQ8A 7TAAA 3TP4A 1F8MA 2PRMA 1NF7A 1K03A 2E5BA 3SCVA 4R7WA 1XDJA 5MHBA 4U5KA 3VAVA 3GC4A 3ARVA 3IGHX 2P10A 1RXOB 4AHQA 5E9AA 4I8YA 1QI0A 3V3WA 2RGMA 4V1YA 1JFHA 4O15A 3B05A 4W8AA 3TLQA 1DWJM 1Q6QA 2XZ9A 2VKZG 4CNOA 1UMLA 1PZ3A 4RKAA 1W17A 4GQGA 2P0OA 3EDDA 3FEMA 1MFUA 1E6QM 4CQCA 1FDYA 4GNKB 2XN2A 3M64A 2OO0A 1R3TA 1V77A 4CNPA 1Q45A 2BGQA 4UZSA 4MWAD 4FB7A 5FF0A 5I7GA 2QKFA 3ATYA 5AFDA 5HUOA 2Y7DA 4O1EA 1R9ZA 4HKPA 1XLAA 1B9BA 3TQPA 1YDYA 2E6DA 2QLYA 3I3DA 2G4FA 3K1DA 4TVUA 2PB1A 2IKGA 3C86A 5K9CA 2GSEA 4FIQA 2YCEA 1WZLA 3SIZA 2VZTA 3KEHA 2PSNA 3S9IA 4H19A 1HZYA 2OPJA 3DC8A 1BF2A 2PTZA 3D6NA 4UR7A 2HNEA 3H7UA 4PGLA 3G1HA 3UXKA 3WD1A 2ZXQA 4MWAA 2OEMA 3FHQA 4AISA 3BQ5A 3CL8A 1J9YA 3QOKA 3EA1A 4WSHA 2WYSA 2DV0A 1S5WA 1H5YA 2OU4A 4M29A 3H53A 1VAHA 9XIAA 1CXEA 2NT0A 3ZYZA 1ZRQA 5CZSA 1BTCA 1UBPC 3CT7A 4K36A 4JTSA 2VCAA 1OIMA 3TXVA 3V5FA 2VD9A 2P0IA 3P8IA 4P7RA 1T8XA 1JCNA 1CW2A 1UD5A 1NELA 2D24A 3DFHA 1TPB1 1ITCA 1B31A 5K2ZA 1X8CA 2ZDRA 1J96A 5CBIA 4O17A 4GI9A 1BGGA 1SZRA 1EIXA 1WNOA 2R9RA 4H8HA 2OWWA 2FGZA 1XIFA 1SPQA 3C56A 2DZWA 1KKRA 2HSAA 3I4EA 1JI2A 3WDJA 4HVXA 3FOKA 3MSGA 1FH7A 4MMWA 3BPWA 2DDXA 3S46A 2GSHA 5GNZA 2W66A 2QCCA 2IQDA 3IARA 4ZO7A 1GJUA 2Z2BA 2V9DA 2E28A 4OKDA 1GZJA 2OEJA 4NAEA 3DKLA 3LHYA 4Y6GA 1CXIA 3DH7A 3DEQA 3PR2A 3F4DA 4S3EA 2CLEA 1GKPA 1E55A 3VOIA 2D3LA 4JBRA 2SFPA 4BI6A 5T9CE 1OZQA 1YHTA 4GABA 4O16A 1XD0A 4B5VA 1C8XA 1PIFA 2NZLA 3OHIA 4LB3A 5DMNA 2A21A 1D7FA 3HGOA 1QPQA 2FGLA 3AIWA 1S2UA 2AMGA 1IF2A 4JN6A 2J62A 4F8XA 2UY5A 3OP2A 3TAKA 1UD4A 2Y7GA 1HKWA 4EK7A 3AC0A 1QNRA 1EX5A 1XIHA 4GYJA 2YL8A 1VIWA 1L8PA 1H61A 1Q2RA 1VLIA 1P5BA 1GJWA 3CNYA 1BVWA 1EJVC 2FB2A 4PB3A 2XGIA 1BKSA 3WLLA 4Z1AA 4MSSA 4FIRA 3UWUA 2DIJA 3VNDA 1VC4A 4GYFA 1F2JA 1ZJHA 4AXNA 1Q6FA 2YCLA 1HKKA 2RDXA 3LOTA 1TMQA 2J13A 4PMOA 1O5QA 5D30A 1B57A 4A21A 6TIMA 3CHCA 3RMEA 4MJZA 3BMXA 4L65A 7CGTA 1X38A 1TPUA 3UA4A 4U2ZA 2J7FA 5TBOA 2ZUMA 1Q5MA 1KXVA 1OFAA 3BLIA 1XCWA 1IWPA 2D0FA 4GIRA 1OWQA 4E8CA 4PMUA 2HS8A 3W38A 1QI4A 4DHGA 3NQGA 3OGVA 1JRCA 2ZUWA 2AMXA 3MV01 3QW3A 3M41A 3GTNA 1UR4A 1LLWA 3GIPA 3KXQA 3STCA 1VYSX 1XG4A 3W3OA 3RDKA 1OHLA 3GKAA 4BQ2A 4AYGA 4KEMA 3G6MA 1H1ZA 3UZJA 3MJMA 3STGA 1IQ8A 4MB5A 4WIWA 3SY8A 4JFUA 3NQAA 2YPIA 3AU2A 3LCIA 2WSYA 4XZ9A 3GK0A 2RH9A 3EXSA 3WQWA 5DEZA 1SGJA 5AZ0A 4PMXA 1U1JA 4E3VA 5EMLA 1VS1A 5I78A 3GVVA 4OECA 1WOAA 2H3DA 3PSWA 2OX1A 2VENA 1TIWA 3BGAA 2PBGA 4ZTXA 2YFOA 3GZAA 4BQ4A 3MUXA 3K8KA 2ZX5A 4LANA 5E09A 4EX4A 1HJXA 4H4IA 3HU7A 1B3ZA 1ESWA 3DU0A 3KVLA 3CASA 2VR4A 2ALDA 3MCMA 1X1OA 2HQAA 3W9ZA 4DX3A 4QX4A 3FLUA 4UTWA 5CSYA 2XM2A 3L2IA 5CJ5A 2QJJA 3M4HA 4TMBA 4L1XA 2DH2A 1DIKA 3PUOA 3QR0A 3RLHA 3FXYA 3PZQA 3W7IA 2GFTA 1EHAA 1SM9A 4GIEA 5AC6A 2VGGA 3OO2A 1EX1A 2GUBA 4GYPA 1CT5A 3TCSA 4XVEA 2ZADA 3NR0A 1G4EA 1LF1A 4F0SA 1C9WA 4KGJA 2FDMA 4JFSA 3M9YA 1WB0A 4X0NA 2O55A 2Y85A 3MSYA 2HVNA 4NHVA 4FX6M 3UPMA 3N25A 4UQDA 7PTDA 3STEA 4MPQA 3PZGA 2CHRA 1F05A 3HMCA 1TTIA 2F9RA 3VKKA 4DF0A 3BUVA 3WLHA 2WC3A 1SFSA 1MQPA 3FA4A 2EF9A 3AS2A 2AQWA 4MG4A 2Q01A 1KA9F 3UWQA 3CC1A 3ARQA 1H60A 4KETA 4I8DA 1FWCC 2P3ZA 5CSRA 2DGAA 3LHTA 2IQ0A 3BURA 1KNWA 1HN1A 3G1AA 4W86A 3RR4A 3KBMA 4JHOA 3LLDA 1GNXA 1S3TC 1B3WA 2D3NA 3VDAA 5D37A 1QW9A 4US5D 5D2TA 3SGUA 5FEWA 2INZA 1KBLA 4JPGA 3GWQA 3ZVIA 4REQB 2BP1A 4DBUA 3C2FA 1KB3A 3PNZA 1KWGA 2F6KA 1VYRA 2HBVA 2F84A 3HV8A 1HKIA 2QUVA 1EQCA 4JS3A 2MUCA 3C4UA 4NVTA 1EC8A 3SM0A 3P2VA 4RZ5A 3BW2A 3H22A 4FLSA 1AA1B 4FMVA 1OZMA 4GX8A 4HP5A 3THAA 2F8QA 1FHUA 4HOZA 4JTCA 2VHLA 3VZXA 2JQXA 3ZFHA 1SO6A 5EPDA 4WGXA 4QP0A 4C91A 3A3WA 4GUFA 1XDMA 4HZ7A 1Q6GA 1EOKA 4MWAB 1RJRA 4JFWA 4YWIA 4ZA0A 3OZOA 3M7SA 3VOCA 4NIRA 4B9ZA 3VX0A 2HNHA 3ITYA 5I3IA 1JDEA 1V0LA 4GGBA 2E8ZA 1D9EA 2ISFA 2PWUA 4UTUA 5K4ZA 4AZBA 1XG3A 4N9CA 3W2LA 4ACZB 2B31A 2W92A 4NRRA 2DIKA 2CFFA 2FHBA 2GQ8A 1I8JA 3RM4A 1QNOA 1EPXA 2DSZA 4WX2A 2Z6IA 3GAYA 1R38A 3Q2DA 1JPDX 3B8WA 4E2BA 3VD4A 4Y2WA 4XG1A 3RJXA 3QY6A 3EX2A 3R2GA 2VFIA 2PDGA 2VYOA 3PBVA 1MDRA 1EJWC 4P2VA 1KQYA 1R0MA 1TFVA 3WCZA 1S39A 1DYSA 3B06A 3KRBA 3SY5A 3B8SA 3KBSA 3P3BA 1GZ1A 2CLKA 3G77A 2ACRA 1K9EA 3SGZA 3GVRA 2E68A 4GWEA 2HBXA 1EGZA 3NQEA 4LYRA 3QSTA 4HMCA 3NQMA 4D8LA 2GDUA 1FWJC 1XBVA 4BR1A 1YBQA 1DTUA 1SSDA 4KH2A 4OV9A 1EXBA 3M43A 3C0QA 4JIPA 3W01A 2W4XA 3ABXA 3LCXA 3BSMA 3N2CA 2WHKA 4LS2A 3V4BA 4HHHA 3MMUA 1W5MA 3VGEA 3SQSA 1POJA 4H9MA 2WQDA 3KDNA 1Q6CA 3H2CA 1V3IA 3U4FA 2J8FA 4ZQMA 3VNJA 5XIAA 1LYXA 1NOUA 1D7KA 4LC6A 3PWIA 3U6WA 1JCLA 3WQFA 2VWSA 4Z2HA 4MNMA 4MWAC 1BXCA 1H62A 4XKYA 1OM0A 3G8RA 3QSRA 3RM8A 4AWEA 1K8ZA 4W7VA 1JXKA 3QH2A 4BEUA 4JIEA 1LLOA 4LVDA 4A2RA 4L4MA 1X6LA 1JDAA 3THCA 1QPRA 3VZYA 4DJEA 1XIGA 3FEQA 2YL6A 1GHSA 3RIKA 1ELSA 3VIGA 4C6QA 1JZ4A 3KOWA 4HNCA 5D02A 2PF8A 3CTLA 2BY2A 2MANA 2BASA 4ACYA 1SJCA 2HK1A 3B0YA 3EMCA 5AZ1A 3CAKA 3L12A 1OYBA 2D2JA 1W5QA 1A5CA 3V5CA 1PAMA 3PWGA 3OYZA 2PWHA 3R1ZA 3A4XA 4JY8A 2H9AA 3TFXA 4ZCWA 1IZCA 3UWEA 1PX3A 1H49A 2D73A 4BI5A 4DJFD 2C15A 1UBSA 3NEHA 4QAIA 3TC3A 1M6JA 2DZTA 2YB1A 1OG0A 1S5MA 3FA3A 2QIWA 3U4AA 3I6RA 3SZ8A 4B5NA 2IPJA 3BC9A 3UYIA 3SRHA 4DO5A 3WEZA 1LBMA 4C6LA 3A12A 3NJ3A 1WQ5A 4S3FA 2ESCA 1UMYA 1QVBA 1X39A 1YX1A 3BXWA 3WJXA 3W1MA 1Y5VA 5LIKX 3ENLA 2WCSA 1YKWA 3WLOA 3EBVA 1F5ZA 3IJDA 1ZENA 3KHDA 3WDRA 5LA0A 3GDTA 1VEMA 3TJ4A 2PWEA 1NTHA 2PEVA 4FS9A 4M7SA 3WQVA 5BMXA 3CO8A 5FAGA 4PUUA 3BZJA 3QQ0A 4IIDA 3PUDA 3E5BA 4Q8MA 2OZTA 5CH9A 5EMMA 3DECA 2A3AA 2C7FA 4DUVA 1XQLA 5ABFB 2G3MA 3RG6A 3HBLA 4AVNA 1THFD 3MUAA 4UQAA 3IK2A 4L5ZA 1VFTA 3UG8A 3STFA 4M1RA 2JIWA 2CNCA 1ADDA 3UD6A 2JF6A 3C61A 2REQA 1H7OA 1V6YA 5HJYA 1P6WA 3B8VA 1PL9A 4W87A 2PGRA 4XAPA 3W1RA 3WQ8A 2UY3A 1PXGA 1TR1A 3ZIZA 3AHVA 1RAKA 4HOXA 4FNTA 1HIZA 1MZHA 2W91A 4IFKB 2VEPA 3T8LA 2Z2AA 1NOWA 2EHHA 3A23A 3VOGA 3IIOA 4D9PA 3QV7A 4FNPA 4F0LA 4OBRA 1R3QA 1KTCA 1A5UA 1GWJA 4BCEA 2INFA 3RITA 1PBGA 3WLPA 1J18A 2X8RA 4GVIA 5I06A 1KO0A 2FLIA 3G1RA 1BHGA 2E77A 3WQCA 3ZJ8A 4C90A 1Y8BA 1FP9A 1QR7A 3LTSA 3USZA 5D9NA 2F61A 4ZXLA 3H54A 2OWCA 1V4YA 1E0TA 5M03A 3BLEA 2J7EA 1TQJA 2YB4A 3KVJA 1KGXA 3FNDA 4J3WA 3AXMA 3RM9A 3W22A 1T6MA 4XK2A 1XIDA 1GKRA 3LLXA 3ES8A 4LV9A 4PBFA 1WAWA 2CU0A 3UXIA 4J9JA 4AZ6A 3T2PA 3A9BA 1HQTA 1BEUA 2QCLA 1P6CA 1OBAA 1UD3A 3UY7A 3W1LA 5E1QA 2J8TA 1UWQA 1OX4B 4UFHA 4A2SA 3P7YA 3FYPA 4YMZA 3CJPA 4JTRA 4N0RA 4H6KA 3F2BA 2HMCA 4R9OA 3SIMA 3ITOA 4U2YA 2VWTA 3VIHA 3RK8A 2XM1A 4N9EA 4A05A 3S2CA 3T0TA 1EXPA 3C0SA 4LBUA 3HQPA 4XAGA 4REQA 5LNWA 1TTPA 4YTTA 2AL2B 3AZTA 1TELA 1Z69A 4WKHA 2VDIA 1DXFA 1POKA 5HQLA 1EB3A 1UASA 3B0PA 4D6DA 4KEVA 1TV8A 1S5VA 1MXGA 3UR7A 4ZB0A 2VGFA 4NKCA 4MDOA 4XZMX 5H6HA 3GBDA 4RZ6A 1A80A 3RO6A 3W7PA 2C13A 2PDIA 1HO1A 2UWFA 2VZUA 2VZSA 5D09A 1REQB 1AVAA 3U9IA 1WKFA 3FFSA 4KT2A 2P50A 2VDGA 5HPOA 3W7MA 4H7CA 1TWWA 5I00A 3TYUA 3SCRA 3GTFA 4E2OA 4ZXOA 1PKLA 2YOCA 3WJZA 5CSSA 2VCCA 2TMDA 1EO7A 3WL0A 4L4OA 4QEEA 3FAXA 1VQTA 1E1CA 4LT9A 1B3VA 2WWCA 5HMEA 2X2GA 1H7PA 3GDKA 4ADSA 2A5HA 3HQNA 5CZKA 3FHAA 4CN4A 3LNMA 4OJYA 3WD3A 3AMDA 5C5YA 2YFNA 3BGGA 1QBAA 2DPEA 4ERIA 3VIFA 1L2UA 1FWEC 1TTJA 1MW0A 3WNPA 3CZLA 4C6KA 5F4WA 3FDGA 3LU2A 3IJIA 4LF1A 1E6PA 4QM1A 4JDBA 4KCVA 3OVPA 1QDSA 4DYKA 3CT2A 2WSKA 3F5JA 1GVEA 3GXPA 4PE8A 1CLKA 4GCAA 2CLIA 4WKAA 4IH3A 4R9XA 3ANYA 3GH7A 4J2MA 3WDPP 3CMFA 2W5FA 3BAYA 3B4UA 1XLJA 1UWTA 3JW7A 3Q58A 3QY8A 2QDGA 3T78A 1W1TA 3B9NA 1K7FA 4PMYA 1WUFA 2E9LA 3E2SA 4ZQCA 4LAZA 2DSUA 4U33A 3A5VA 4MM1A 3B4YA 3K13A 4DBDA 4K39A 1KWKA 2HEJA 1T96A 2O9TA 2ZYFA 4PTDA 2XSBA 2PTYA 3U57A 3FAWA 4WD0A 3I7RA 4LCQA 5HNTA 1TJ1A 5M5DA 4BHYA 1OFDA 4NJGA 1KTBA 1JYNA 5LXEA 2ATMA 2G3FA 5FF4A 4PBEA 1TA3A 1O1HA 1JF5A 2X42A 2H6RA 5PTDA 3G6LA 4BF9A 1G4PA 1TMHA 2W61A 3BLKA 2PP3A 3L68A 1EDTA 3BG3A 4IGMA 2BB0A 4ORMA 2DZVA 2PTDA 9RUBA 1GG0A 1LCOA 4D6JA 3RPTA 1TIMA 4PCPA 2QCFA 2FPYA 4F9JA 4OE7A 3VC5A 3KOZA 4LXFA 5TF0A 4GC4A 3OJGA 1JXJA 2Y5EA 3I6EA 5T8GA 1BG9A 3E74A 2DSVA 1OSEA 3W2MA 5A69A 5CG7A 4S3BA 1Q6OA 2UY4A 1VFHA 4PCSA 3IVSA 2ZRVA 3EB4A 4QIUA 2YDQA 5HNRA 4TTGA 1U5VA 1HJWA 3GX9A 5K9XA 4LSBA 3AISA 4QCEA 1NF0A 3MW7A 3QHMA 4OUIA 2NXIA 3PANA 5F4XA 2CLHA 3G1YA 3S4TA 1QW7A 4GUIA 4YU1A 1R7OA 4HZ6A 4ZOBA 2EPNA 3POCA 2C91A 2J66A 4S3DA 4DI8A 5FJRA 5KZEA 3C2RA 3BLOA 1BLIA 2OEKA 2PWGA 2V69A 3SCTA 3HN3A 2WJZA 3O7UA 3DERA 4M51A 3ONBA 3WUGA 5C6MA 1LBFA 4AZCB 3IGXA 3B40A 2ZQ0A 4Q8UA 2CESA 4S39A 3W2KA 4LFYA 4YHGA 4AY8A 4CNTA 1K7XA 1GQIA 3GW3A 1JGIA 3IRDA 1UOZA 1IZKA 3N73A 5DXYA 3NZPA 1KV5A 4WQ6A 3L2MA 1JUKA 3A6OA 4LV4A 4NNCA 1VPXA 4JGDA 5I0DA 5L9FA 3KL5A 4XZBA 3TCEA 3HZ3A 4Z1YA 2PFHA 1XYFA 1EDQA 4JKLA 3VGFA 1GOOA 3KBVA 1RV8A 4GX9A 2B81A 2QF8A 5FSDC 3ARXA 3E2RA 4P8UA 1DWGM 2GOUA 3W1PA 2Z28A 1OCNA 2GUUA 4RW3A 3P67A 1K6WA 3GFXA 3W1NA 1M65A 4I7UA 3U48A 3S5YA 3B0UX 1VJSA 3WNLA 4FI4A 3VVGA 1P1XA 4NY2A 1VHCA 1ZUAX 3TMLA 1UJPA 6XIMA 3WK3A 1E6XM 2PP1A 2WZEA 1E0UA 2VRJA 1XLCA 5K3VA 5HWMA 3PZTA 5ABEA 4GUGA 2OVLA 3TWBA 2Y89A 2BVDA 2FQIA 3L4ZA 1B0IA 4FLQA 3W72A 1L2QA 4GQBA 4PSRA 2VX7A 3O0FA 4D8AA 3QW4B 4DRSA 3C2YA 3OW1A 3CS2A 4UUIA 3AHZA 4B9YA 2PRLA 5A8GA 3EKLA 1V6TA 1L6FA 1W8GA 1UD8A 4UTFA 3CWHA 4C6OA 1IT8A 2CPUA 3CV2A 4Z1CA 2GVGA 2NSXA 4LCRA 3M0VA 3GLCA 3S47A 4XO7A 3C6CA 3HF3A 5A8NA 4F40A 4LVGA 4LUYA 5JIPA 3HFYA 1IE7C 2D0GA 1J4EA 1CLXA 1K9TA 3N4FA 2C0AA 1KCKA 1LM1A 1OX4A 3BMVA 1BPLB 2J7DA 4J40A 4QROA 4TTUA 4O1AA 1R46A 3GY1A 1JPIA 5HAOA 4LJ3A 5I3HA 1T40A 4ERAA 1SR9A 3GIYA 1ZSXA 1YDNA 1XWYA 4LNYA 3W7LA 1W3NA 3TN5A 2DZUA 4B92A 4IQEA 2FYMA 1LRTA 4Q7IA 4UQ9A 5ECUA 1H5VA 2GJXA 3PVFA 5I3KA 1DE6A 1M5WA 3NO3A 1DJZA 2WCGA 3BCFA 4W84A 4JN8A 1YPFA 4A8LA 1WXZA 4PMJA 1P1MA 3IJ8A 1FCVA 1EZWA 2Z6JA 4E8DA 5MKGA 4YIWA 3TJLA 5I5RA 3CO4A 2CC0A 2VEMA 4WK9A 1EUAA 4L1WA 4KRTA 1HP4A 2EKCA 4AG0A 1PX4A 2YGYA 3S6OA 4NF7A 3Q45A 1XIMA 1VPQA 1DORA 1E9ZB 4QNWA 3U2CA 5D2WA 1B3YA 2A4AA 1P0KA 5A6TC 4WEVX 3G18A 1GEHA 3AHXA 4V27A 4UMCA 3EDKA 1XGZA 4IF2A 2E8YA 4I9TA 5BU9A 4Y9OA 3M0LA 1P43A 5A94A 1UKOA 1DXEA 4UNIA 1M03A 1J0HA 4NI3A 2V3FA 1JAKA 3NVDA 5I77A 3IIXA 1H51A 3DENA 4NNAA 3C2EA 2RDTA 4H8VA 3SW6A 4AZGA 4AX6A 3K46A 1G67A 5LYRA 3S2LA 5FF2A 3H70A 4XAZA 5FA5A 5I3GA 3UQNA 3LGEA 4V1XA 3VNYA 4LCSA 1CGTA 4W5UA 4F0HA 4IMFA 3VPLA 1Q4NX 4DM2A 8CGTA 3M5YA 3ISIX 4R88A 4QS6A 4EANA 1ODUA 3N6QA 2ZZ7A 4ZOCA 1KLZA 3CZGA 3AXHA 4MY8A 1E4IA 3MANA 1H41A 4NAFB 1LRQA 4QJ5B 4XZIA 4KWWA 3WUBA 4AD0A 4RX0A 3GVGA 3H21A 3UZ5A 1G5AA 4AIOA 1EL3A 4IFOA 2V3GA 1PSCA 1QT1A 4F0MA 4IQDA 3VNIA 2ICSA 3P81A 1IXNA 2W9MA 3MCNA 1M3UA 3R58A 1J79A 5FKYA 3T0CA 3B3DA 3BMWA 1HP5A 1QOQA 4ML4A 2C0HA 2IPWA 1EYWA 4DLFA 2F6UA 3E6EA 4UFIA 3BV7A 2XIBA 3P93A 2VOTA 3E0VA 3NOYA 1OGSA 1J2BA 1RBLA 4EWND 5AN7A 2WSQA 1FH9A 4KGLA 2EEXA 4FOUA 3BV4A 1ZJIA 1HGWA 3AS0A 3W1UA 5H8MA 3MMTA 5JH2A 1R9YA 5AYXA 2FVMA 2FHFA 2J47A 4Y7EA 1A5MC 2XGZA 3HFTA 3O6YX 1E9LA 1Z3NA 1F3XA 1BGAA 4MYXA 2XTKA 3QHOA 2P8BA 4J5NA 3R12A 1FWNA 2J7CA 1FDZA 4H9TA 1TPEA 1BAGA 3N2OA 3NPXA 4WXZA 5AYBA 3VNLA 3KAOA 4J7RA 1JYVA 3KOFA 2YYUA 2EGZA 4Z1BA 4L4PA 3RYSA 1W1IE 1UKPA 2QYGA 3CUXA 1OGBA 2JKPA 1JUBA 2WMJA 4Q6JA 4YTQA 3PPHA 4DEFA 1ISXA 5LKYA 2CIPA 2Z1VA 5LHEA 4IL2A 3WBYA 3IS4A 2ZX7A 4NYYA 5CSUA 3CAQA 3V36A 4IJRA 2BNJA 5FD0A 4RXGA 1DBTA 4QITA 1U1HA 5BW6A 1EA9C 2FZ8A 1VFUA 1EBHA 2GJNA 1XLLA 1IXQA 5LGXA 1U1UA 2FVKA 1XLIA 2ALRA 1GOWA 4GMEA 3THQA 3WX7A 3GNXA 2WZMA 1XI3A 3ZR5A 1UG6A 4V33A 4U4MA 1O7AA 1HO4A 4JD4A 2NWSA 4FP1A 1UKSA 2TRSA 3GXMA 3M07A 1U33A 3MSRA 4MKVA 4H9VA 3G0XA 1IGWA 3VFCA 3D47A 4C5YA 4O54A 4BZYA 1MSSA 4I90A 2PWDA 3LHWA 1A0CA 4HN8A 2ASHA 3PY2A 4C6MA 3CYJA 4PMZA 1PZ2A 5AYIA 1AD4A 2X1SA 3TYCA 3WLRA 1QK0A 1RJPA 3IJ9A 2VZVA 2C1HA 3IUIA 1Z32X 3VGBA 4AY1A 4JICA 3IV8A 4F3HA 1VIZA 2VUYA 1VEOA 1VKFA 3L0GA 2W0UA 2NV1A 4XKMA 1JD7A 1PZ0A 4BQ3A 2IXVA 4DM1A 4DUOA 3KZPA 1GVYA 4M24A 1WPCA 3O16A 1K02A 4BK9A 3I6TA 5HR7A 2J77A 4Q32A 2A85A 5E0KA 1UUMA 4LQ1A 3CQJA 3KLLA 4JCMA 1GQKA 1U5HA 3FXGA 4FHAA 4AAJA 1PTDA 2C19A 3AXXA 3II1A 1UR2A 2QQ6A 2QCMA 1QPOA 5IDZA 4MNLA 3FY1A 5EMJA 3SJ3A 5G2WA 2P88A 1VYPX 3C3UA 1BRLB 4IMAA 2GQAA 4IPIA 2EPMX 2BVWA 5A6BD 4GNJA