4HT3A

The crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 102
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ht3A00
1KLYA 3LCLA 3KVJA 4JY9A 3FJLA 3WJWA 4OHQA 1Z48A 5HULA 1G4SA 2RKXA 2ZCGA 4UFLA 2FTPA 1UBSA 2HTMA 3W1XA 2A4AA 4O57A 1JCLA 1G4EA 1HO1A 1U5JA 2RHGA 5F1VA 3TC6A 3W2NA 4PFMA 3SGZA 3LBCA 1XL9A 2QJGA 3KVLA 1W1ZA 2GUUA 1AW5A 3W7JA 1J2WA 2DZXA 2YDAA 3PUDA 5CZTA 2V9DA 1T0OA 3DAQA 3NL2A 1H7WA 2V2DA 1T96A 1G7UA 1L6SA 4ADSA 2DZPA 2QF7A 3LCWA 4RCXA 3FS2A 3LLDA 4UMAA 3CWOX 5SWUA 1KTCA 3NA8A 1KM6A 3BLFA 3E12A 1QCWA 5KZDA 5DBUA 3F03K 3CU2A 5U7SA 5KZEA 5D37A 1H7NA 3LERA 4O15A 3QPYA 5IM51 3DFSA 1OFPA 4RJEA 2KZHA 2DJLA 1OJXA 1FQ0A 5CPMA 2GVJA 1BWLA 2NUWA 1OFEA 4OV4A 3LI0A 1T8XA 3A5FA 1EUAA 1WXJA 1LORA 4JYEA 3QF0A 1PE1A 3GDKA 4QIUA 3I65A 2VFDA 4ONVA 2B7NA 3W1TA 1U83A 4HN4A 1JUBA 3O05A 2C14A 3T55A 4JXCA 4K6AA 2GOUA 1P1XA 2Z1BA 1F5ZA 2G97A 1PS9A 1QPQA 2P0OA 2YXGA 3M5YA 3DKJA 2FB2A 2ZA1A 4Z1AA 5L9FA 1MEHA 3NL6A 4MJMA 3NXFA 3FEMA 4W9TA 4MY9A 2GVLA 3DFPA 3NDOA 1S5TA 3TKFA 1I2PA 3O07A 4I7WA 3GXNA 5C55A 4WZHA 3YPIA 3QSRA 3ELFA 3S5YA 4LV4A 3T4CA 4X2RA 3UPWA 1W31A 1G67A 1OFDA 3NQEA 1W5PA 1W54A 2ZRXA 4UR7A 2E6AA 1NFBA 3Q2DA 3PG8A 5TIMA 3W23A 4O53A 1Q3NA 3DFQA 4N9CA 3P8IA 2H90A 2J24A 3EX4A 1A5CA 1VH7A 4POCA 2ZFAA 1LLZA 3LTSA 4GRSA 4JNMA 4LS1A 3MW7A 3WK1A 3UWWA 5AN7A 2WQPA 3SFKA 4TIMA 4AHPA 4JEQA 3ABSA 3OG3A 1DV7A 2FFCA 3KRSA 2TSYA 1TTPA 4LVAA 1VCVA 4BWLC 5FEPA 4UUIA 2NV1A 3VE9A 2YGYA 3D0CA 3DZ1A 2B7PA 1W56A 4XUGA 2QJHA 1OYAA 1DQXA 1WOBA 3NG3A 4ORMA 5K4XA 1H60A 5L6UA 4UTWC 1X7FA 3S9YA 1VZWA 2ZBTA 5K7JA 5I3HA 2QCGA 4Z1DA 4FXSA 5G4WA 4LUIA 3W7MA 5F4XA 2DORA 3HJZA 5FESA 3EWZA 2H3BA 3G1DA 3OA3A 1DHPA 4RZ4A 4A21A 2NZLA 1GEQA 4BI5A 2Y89A 1VYRA 2BX7A 4MY1A 5DLCA 4ADUA 2CLIA 4GC4A 3CIXA 2E6YA 3K30A 4G1KA 3N9RA 1RV8A 3BK0A 1KV8A 3A22A 4IQLA 3FA5A 3IRDA 3A24A 1SO4A 2QCNA 3HQ1A 2DZTA 4GUHA 3TQKA 2VFIA 4PH6A 4UTIA 1TQXA 3GX9A 3P84A 5LZLA 1P4CA 4KKXA 3DFOA 5DCDA 3B8DA 1I8JA 3M5VA 3CWNA 3P82A 3TCEA 1VCFA 4MZ1A 3L65A 3LCIA 1RR2A 2Y85A 1RVGA 4KFNA 5F4SA 1SW7A 2CLOA 3C0JA 3W2UA 4ICNA 2BWGA 2GQAA 1RQEA 4S1FA 1KM2A 4XQ6A 2Y7GA 2HMCA 1OX4B 1JRCA 5EMUA 2AGKA 2B7OA 5EPDA 3PBVA 3QC3A 3LHZA 1JJKA 4RLIA 3EWWA 1G6CA 2ZRWA 5LHEA 2V2CA 3NQDA 5AC8A 1FXPA 2QUTA 2WOQA 4LWWA 1GQNA 4MOZA 2JKAA 3NAVA 1AW1A 4E2BA 1FUYA 3PB0A 4LC6A 4M7SA 3MO7A 3PUOA 4O19A 3IIVA 2TMDA 1Z41A 2VEPA 4GUFA 4UNKA 2V2HA 2V5BA 1YPFA 2B7QA 2Q8LA 3S1UA 1XBVA 1XUZA 5F2IA 5EY5A 3A5VA 2YCEA 4H6KA 4NJKA 4NNCA 1K7EA 2RDWA 1TRDA 4DO4A 1FCBA 3W72A 4K39A 2ZDRA 3QM3A 3IEBA 4OBTA 2QR6A 2OT0A 1SW3A 4ML9A 1RD5A 4WXZA 1DQWA 3C2FA 5IBXA 4ZVJA 4UC5A 4B5NA 4M5PA 2GQ8A 5K3VA 2VFEA 2E5BA 4Z0SA 5D38A 3SI9A 1TQJA 3F1QA 1TPC1 1HO4A 1KFJA 2QDHA 4FX6M 2Z6IA 3DHDA 5HWNA 5FF3A 3WK2A 1QPNA 4QNWA 2YPIA 3GNNA 4XKYA 3MYOA 1JCNA 5G5IA 3S1WA 1S5WA 2C16A 2C0AA 3EWXA 4YWIA 4GE8A 3TQ0A 1SZEA 1YLVA 3VFLA 3VE7A 4RZ6A 5G2WA 2J9ZA 1QMLA 5DCBA 3GVGA 1WDWA 1LRTA 3KVKA 4DPPA 1KM1A 3P74A 3KX6A 4H3DA 1DVJA 3UWQA 3STGA 3OVQA 1W37A 1C9DA 2FPTA 3L0NA 3SGUA 1GYNA 5AHMA 3LGEA 1F76A 3EX3A 3WK3A 4PC8A 3QMRA 3P61A 4HSOA 2ZA3A 3W2KA 3NM1A 4FNPA 4UR8A 3V75A 1DJQA 2PRMA 3IIPA 1QOPA 1H7XA 2VXNA 3RLVA 5KSWA 3P60A 4RR4A 1DKWA 3QYQA 3GKAA 3OHIA 1Y0EA 1F6KA 2DU2A 1IF2A 1SU5A 1VPXA 4MLJA 4ZQNA 3HPZA 3GYEA 1B9BA 3JRKA 3KAOA 2B0MA 3TSMA 2P10A 2CLKA 3EWUA 1GVQA 4UFIA 1GG1A 4FX8A 4BI6A 3OEXA 4WD0A 3FOKA 1QR7A 2ZTJA 2R91A 4XBKA 3A23A 4AB4A 1PHWA 5LSMA 4HSNA 4UTUA 2C1HA 5CZJA 4LRSA 5C54A 3ABRA 3LCFA 3QFEA 1T99A 1HFBA 3NOEA 4AEOA 3G3DA 2CZFA 1QAPA 3W75A 4PEKA 3WJYA 1A53A 3QQ1A 5EBUA 1LCOA 5HJLA 2CFFA 1R2SA 3IGXA 3TSDA 3THQA 2QEZA 2YFNA 4JYFA 2FPYA 1NF0A 3RNDA 4BK9A 3UY7A 4DPQA 3W9ZA 1WA3A 1QNVA 1W3IA 1A5BA 4JYDA 4QISA 5HWMA 2R94A 4FHAA 4ZQPA 1TV8A 2EPHA 1YYAA 2PRLA 4NZJA 2C6QA 1OABA 5J5DA 3G8RA 2VFFA 5HNRA 2QUVA 4YXGA 5HMSA 5FF0A 5H2ZA 1L6YA 3F4NA 2J9XA 1PHQA 1QO5A 5DXXA 3TW7A 4DEFA 4NXSA 3LTPA 3VCRA 1FBAA 1OVDA 3W7GA 1MEIA 3HG5A 3STFA 1W5OA 3EEGA 3STCA 4DQWA 5F2GA 5LNRA 4NJHA 3LXAA 1OYCA 2JGYA 3FKKA 4YLWA 1TPWA 4Y96A 1EP2A 2I14A 1AG1O 1EEPA 2A6LA 1WBJA 4O0KA 3LHVA 4K37A 4OQVA 3W22A 4GBUA 4I7UA 2ISVA 4IXXA 3HO8A 3O6DA 2DZSA 3QQ0A 2QAFA 1TJPA 1Q6LA 1HG3A 3G0SA 3P80A 5AHFA 2NWSA 3CC1A 4EF9A 4HNNA 3UQNA 5LNWA 1V7YA 3TMLA 3TV8A 3E02A 2JGQA 1ZENA 2IQTA 2ZRVA 4QJ1A 3JS3A 2F84A 3PB2A 1HTIA 4LOCA 1OYBA 1TPB1 4O52A 1THFD 4LUJA 1ZNNA 2X30A 3Q58A 1TPEA 2EHHA 4N9EA 2DP3A 3MI6A 2VELA 4BI7A 4MLRA 3TK7A 3A9IA 4HKPA 3TUUA 4MJZA 5AB3A 1GVRA 1MSSA 5LKYA 3G24A 1RPXA 3LB0A 3C8FA 3LCHA 3W1UA 4O10A 4WX2A 2TRSA 3HGOA 3W6YA 3NQMA 3GB6A 1FDZA 3S6DA 3IV3A 1A50A 3ABQA 1H51A 3FIGA 4TR9A 1UJPA 4UXDA 3S5ZA 4Y9AA 3W3OA 3TU9A 1SUXA 5KITA 4IPIA 3TXZA 1OHLA 1ALDA 4LS0A 2DZUA 4WY0F 4Z0JA 4NX5A 4A2RA 4M6QA 3CIWA 3O6CA 4NJIA 4A2SA 4HT3A 2CLLA 5D2TA 3TMQA 1R2RA 4ZQCA 4MZYA 1G69A 3TQVA 3UD6A 3NGJA 1TTIA 1NSJA 2X2GA 1Q6OA 3IVUA 4MKNA 4HNVA 4JX4A 1VYSX 3KHJA 3BW2A 2Y61A 1S3HA 3BVJA 2ZZ4A 1KFCA 3TC7A 3TX9A 3ZFHA 1KM0A 2VEIA 4XBSA 5I3FA 3PR2A 4TMCA 3BARA 5D2YA 4NT0A 3W7KA 1J5TA 3GK0A 1F05A 3W7DA 3W1MA 1PCKA 4DXVA 2XFWA 5KTLA 3NQ6A 3W1RA 4LV9A 1C29A 3DI1A 1F7BA 4L4MA 3GAKA 1MEWA 3R89A 3W7IA 3GXPA 1TO3A 5TBOA 3THAA 5BW6A 1LDCA 3CTLA 2YFOA 3C61A 4AWUA 5MHBA 3R13A 4GNJA 4CNOA 1A5AA 1SSGA 4JTTA 4E2DA 3B4UA 5G2HA 3AJXA 1K8ZA 4WUIA 3P7YA 5D03A 3C3NA 2J6XA 1VHCA 3LX9A 3I6RA 4ZQMA 2C19A 1O4UA 1EX5A 4FEZA 2P1FA 1DOSA 1M7PA 1SR9A 4MFDA 1H5YA 1FWSA 4OV9A 2A5HA 2DZWA 4P2VA 3E96A 4JICA 3IIOA 4HIBA 2ZQ0A 3NQVA 1SPQA 3NQFA 3M44A 2VFHA 4N9DA 3LRKA 5CSSA 5DBTA 3S5NA 3NEVA 1ZY9A 5AYYA 1VC4A 3UZ5A 5DELA 3G1SA 3UXAA 2Y7DA 3GAYA 3WK0A 1LBLA 4NU7A 1K7FA 4U4MA 2QCDB 1JRBA 1GVFA 3BG5A 1MXSA 5CKSA 4R33A 3P8JA 3E49A 3G1YA 4L4LA 2YZRA 3W2LA 5IBXC 4KFOA 1GG0A 2E6DA 2PC4A 5C6MA 4UMBA 3GIYA 5AFDA 1M7OA 2XN0A 5FF4A 1I2NA 3I68A 1BWKA 3LXBA 1X6UA 4MPQA 4LU0A 3GDTA 4O4VA 2NV2A 4NNBA 3CEPA 4S2CA 4RXFA 1SZGA 1WYIA 1IXPA 3EXSA 2J9YA 2WV8A 2E68A 2NUYA 4D2JA 2ZZ6A 1SZFA 1TV7A 3G18A 1H62A 4NZFA 3N2MA 4MY8A 4OT7A 1AMKA 3O15A 3MHGA 3L21A 1UUMA 1GTEA 4Y90A 2CZEA 2FB3A 4CLMA 1LBFA 3IGUA 3L67A 4FXRA 3W70A 1XXXA 4O8RA 3N19B 1JVNA 4FB7A 1XDLA 1D3HA 2WO5A 2EGZA 3M9YA 1IXQA 1OFAA 4O4WA 3TJXA 1ZJIA 3NZRA 1N8FA 4JTUA 2R8WA 1EUNA 2ZA2A 1AW2A 3KXQA 4CNNA 4DELA 1Q6RA 2Z6JA 4N9BA 4GUGA 5AC6A 4E0CA 2H8ZA 3MP3A 5F4WA 4R34A 3ZWSA 4OE7A 3NO5A 4C1LA 3PBUA 1PCWA 1WOAA 1I45A 1W8SA 4ALDA 5EYWA 3PY2A 3BGGA 3IIXA 4UFMA 3RLUA 3C2RA 3H53A 4XTIA 3TFXA 3O6YX 3PC0A 3S8HA 3H55A 1NF7A 3RU6A 3W7CA 3W2MA 1FWTA 1UCWA 5CGQA 3QZEA 1GPWA 2C18A 4IMGA 3T40A 1W0MA 4UMCA 4UTTA 1KFKA 3OIXA 3C6CA 3CEUA 2C13A 1Z44A 1AL8A 3B05A 1QWGA 2A2IA 4BFAA 4TX9A 4UFHA 1Q6QA 1IXNA 1BKSA 4K36A 4N2YA 5LGXA 3QH2A 1KM5A 2FQIA 5KINA 2CLFA 4LTSA 4DBDA 2YX0A 1QPOA 3EKLA 3INPA 4MYAA 3ZS4A 1JCJA 1ML1A 4LT9A 5LNSA 1K03A 3T78A 1OX4A 3TNOA 3AO0A 3M41A 1FY6A 2WNZA 3MHUA 4GJ1A 3SIZA 3HB9A 4GWEA 2W0UA 1IIHA 5GVJA 1YTEA 1JCMP 3ATZA 3L9CA 3NVTA 4OWGA 3R12A 4AF0B 1MO0A 4O14A 3W86A 2GJLA 5FEWA 2ZZ1A 2ISSA 1YXCA 1XDMA 2QCCA 1IGSA 2JKPA 3UXDA 1R47A 3M43A 1OF6A 4BF9A 1WQ5A 2A7PA 3PVFA 2QCFA 1EB3A 3CQ0A 4UFJA 2Q3RA 3KRZA 2G5WA 2JKEA 2PRHA 2V8ZA 1FDJA 3LBMA 4JTEA 3NQGA 4WOQA 3ZWTA 1VJIA 1JQVA 1AL7A 1XC4A 3B0VC 3GLCA 1QOQA 4XZ9A 1E51A 1NEYA 4JTSA 2O7SA 1GJPA 3UNDA 5LGZA 5EL1A 4UFKA 4BR1A 3W7NA 4EF8A 2WSQA 1LOQA 3DBPA 1OFBA 4CCDA 3G3MA 4JTFA 4Q33A 5CG7A 1KFLA 3H54A 3DGRA 3TROA 3NPUA 1HL2A 3KFTA 4MYXA 1O95A 2Y88A 3PSWA 1MZHA 4TU1A 5KMYA 1F2JA 3L66A 3HPXA 2PE4A 3MMTA 3VKJA 3FJ6A 3LCGA 2BZNA 1QO2A 1K3UA 1KV5A 1WAUA 2NX1A 4QNEA 1ZFJA 3HPSA 3PS7A 1OX5A 3EXRA 3UYCA 3LRLA 5CZSA 3KVMA 2YYTA 3F4WA 4JGDA 1W5NA 4N02A 4A3UA 1TPFA 5K9DA 2ISWA 3QPZA 2DJXA 3DXIA 2OMAA 1EIXA 1ZALA 3DKLA 3HGSA 3N73A 5BMWA 2ZYFA 3MYPA 1SO3A 5I3KA 3P62A 1VQTA 3S0CA 3ABOA 3G22A 3NQCA 1RZMA 4O18A 2QJIA 3BLIA 1VLIA 1SO6A 3GDRA 3S1XA 1ME8A 2E09A 2BSLA 2UV8G 3BW4A 4GXMA 4JTHA 5K4ZA 3CPRA 3W07A 3M16A 1R30A 1TB3A 1KLZA 5T26A 2OX1A 3DH7A 4ADTA 5K9CA 1UB3A 1UASA 8TIMA 2ZRZA 1EA0A 2B4GA 2CLMA 1M5WA 5EA9A 3W7OA 3I7RA 3R8RA 1LROA 3O8AA 3FKRA 2RH9A 5A5WA 4LS2A 4CQ9A 4WJEA 3W1PA 3RFAA 4QSHA 1V5XA 5U4NA 3USBA 1FCVA 1EWEA 1PVNA 3CLMA 4Y6GA 2OJPA 3MHFA 5I3GA 2XN2A 1XI3A 2QCMA 4PTNA 2OZ0A 1NAL1 1YDVA 4UTJA 2DZVA 1YTKA 5FEXA 1EP1A 3HGRA 3N3MA 3U8GA 1H7OA 1FCUA 5DCEA 3TSBA 2NUXA 3I7SA 4YCPA 2EAWA 5A8GA 5G1YA 1B4EA 3W88A 3ZR4A 1L6WA 3SSJA 5CSRA 5AYZA 3CB8A 2NX3A 4MZ8A 4AHOA 2VOMA 2XN1A 1XBZA 3TFCA 2X1RA 4Y8FA 3U6WA 4HHPA 2V82A 2WSRA 4FNQA 2CW6A 3HIJA 3SY5A 2OCZA 3BGJA 4NJJA 4O0ZA 1R2TA 2JBMA 4MFEA 3WFAA 3STEA 3WJXA 5E1QA 1F74A 4JTJA 4S2BA 1R46A 4UIOA 3LHYA 4LVDA 4AMAA 3ANYA 3DFTA 3PULA 1UUOA 2A1YA 2WJZA 1FDYA 5BRBA 4WY0B 5HR6A 3B0UX 3WJSA 4NNAA 3TR2A 1VGAA 3SW6A 1H50A 3TJLA 1JCXA 4N4QA 3P5YA 4IGHA 3I7QA 2WNNA 1O94A 5K9XA 4IMFA 3DHFA 2Q3OA 3QRHA 1H7RA 2ATSA 2FDSA 1TCDA 3C52A 2Q8ZA 4FNUA 3BG9A 3P5ZA 4EWND 3VI2A 4IOTA 2A7NA 3CT7A 1OK6A 1LM1A 3G0UA 2HS8A 4HNTA 4AVFA 1D3GA 3C4UA 3E0IA 2GPTA 1EPXA 5CPLA 5E93A 4IMDA 4O1CA 3RK8A 3KRUA 1SW0A 2YYUA 1ONRA 3HGJA 1TPH1 1GZGA 3HMJG 1XBYA 2ZRYA 2I1OA 3L2IA 2E5CA 4O12A 5G2IA 3GR8A 4IUOA 4RK8A 4QAIA 2NX9A 3TAOA 1YDOA 4LVGA 3HF3A 1DORA 1PV8A 4JTKA 3R5EA 3W1QA 4C1KA 2ABBA 2BXVA 3M0ZA 4NJGA 3UWYA 3S5OA 3U2OA 1TJRA 1ICQA 2Y70A 2Y7EA 3BW3A 4OGZA 3PWAA 4O1DA 1TTJA 4KWVA 3EX2A 2V0TA 3W7HA 3M7WA 2X1TA 3TA6A 1K02A 3PAJA 3QEZA 3RF9A 3LI1A 2GJNA 1XCFA 1OFRA 4ZQOA 1KTBA 1CW2A 1YXYA 3LHWA 4PA8A 3P67A 4UTTC 4DBEA 3G1AA 1EWDA 5D2WA 3NQ7A 5AYXA 3G0XA 5EKYA 4CQAA 1K8YA 1WBHA 4UTKA 4AH7A 4E38A 4PCFA 3EWBX 3FFSA 1TMHA 1BTMA 3B06A 4Q32A 5J5RA 2F7FA 2V30A 4NUWA 4O1AA 5D2VA 4CCEA 1O5XA 1K8XA 1WX0A 3N34A 4JD4A 3W7PA 3TIMA 3EWYA 3LHUA 4M6VA 3DFNA 4O13A 1KA9F 4NVTA 1TYGA 5D2XA 4N4PA 2QDGA 4ZMGA 4JTLA 2ZTKA 3LV6A 4KWWA 2A85A 2CLHA 1KW1A 1PL9A 3IVSA 4DF2A 5HINA 4GFSA 3NYZA 2RFGA 1OFOA 1X1ZA 2PCQA 1AK5A 2Y6ZA 3L68A 3E9AA 2CU0A 1F73A 1KBIA 5C2XA 2ZRUA 3NL5A 2FPVA 4AHQA 5AHNA 2I9EA 6ALDA 3VNDA 1TIMA 1LOLA 4TMBA 1IIGA 2C3ZA 4IPJA 4IJBA 1TV5A 2CWNA 1LBMA 3CHVA 1FX6A 4ZQRA 2QCDA 2JK2A 3C2OA 2E1DA 3EKZA 2WSYA 3MWAA 4XTDA 2QCLA 3L0KA 3C56A 2FLIA 1XM3A 2WKJA 4CQ8A 4U28A 4FX7A 5F2MA 4DF1A 3GXTA 3SJ3A 1RQHA 1SSDA 1YXDA 3QJAA 1KM4A 4O11A 1YPIA 1TTQA 4JDBA 4IMEA 4JS3A 1ME9A 4A29A 1SO5A 1JUKA 1N7KA 1ZAHA 5D30A 4YMZA 1VHNA 4HPJA 4FIRA 2G95A 3W76A 5G1TA 2VC6A 3EX6A 1H1ZA 2A21A 1G7VA 4AXKA 3P81A 1JUEA 3LLFA 3SZ8A 4YL2A 3OBKA 7TIMA 1IXOA 4ZL1A 3R2GA 1LLWA 4K7YA 3HBLA 1X1OA 2G96A 4NQ1A 1JULA 1P0NA 2VENA 3A21A 3IIZA 2J27A 1XFBA 4RV8A 4K8EA 4M7TA 2VFGA 3HG2A 1TPVA 5AOUA 3GDLA 4CNPA 3W74A 4IWWA 3BG3A 3C2VA 5D32A 4P61A 1KFEA 2GQ9A 3IGSA 4IXHA 4JTGA 4JIQA 3GZ3A 3MP5A 2W6RA 2O7QA 3M47A 5I3IA 4K7VA 4WOZA 4R7JA 3MI3A 4LVBA 5E0KA 1OF8A 3UWZA 1N55A 2LLEA 1QPRA 4QM1A 1VLWA 1FCQA 5HUOA 4GUIA 1L2UA 3BPWA 3TE9A 5CZ0A 5TQLA 1TRIA 3LDVA 1B3OA 4NXKA 4RXGA 1GOXA 3PBYA 2OT1A 3TXVA 2E77A 5KZMA 3S1VA 3DU0A 3OVPA 2ALDA 3GDMA 4JX5A 1CI1A 2R14A 1KBJA 2QCHA 4I9AA 4JR5A 5F2LA 4H4IA 2CZDA 3TDFA 5H91A 3BV4A 1RQBA 3WJZA 1HUVA 3FYOA 3QSTA 3PM6A 1SQ7A 4LRTA 3UZJA 4IX2A 5CPOA 2YSWA 1W5QA 4YCOA 5BOOA 1ME7A 4XWUA 2WPBA 4ORIA 5AHLA 3O1NA 1VRDA 1ZCOA 3V1PA 4N6EA 1ICSA 4O54A 3TW6A 2H6RA 1GYLA 3ATYA 3G1HA 3W7RA 4AF0A 2QUUA 3B0PA 4X9SA 2X16A 1X8FA 4CCCA 4UTHA 5LNVA 1JCYA 4K8HA 1H1YA 3DENA 1TREA 5FF7A 3NPWA 5D05A 3GKFA 1Z42A 4J9JA 4XKYB 3UWUA 2QAPA 4FNRA 2ZZ5A 1SFLA 3PBWA 4HNUA 3HG3A 1GVSA 4RZ5A 1GTHA 1I2QA 1GVOA 2NXIA 4Q4KA 2YW3A 2TPSA 3LOTA 2X1SA 4ZZ9A 1LYXA 2VKZG 4UNLA 1G4PA 4X22A 2FIQA 3LTYA 4JY8A 2E5DA 4GUJA 4Z1CA 4UTLA 4IX0A 1C8VA 3B03A 1VYPX 2E6FA 4M6PA 5DN1A 5DY2A 4PODA 2C15A 1DJNA 3G1XA 1O5KA 3W1NA 1J4EA 2VEMA 3FYPA 4BWLA 1S5VA 2H8XA 3T7VA 1ICPA 2V81A 4FNTA 1LRQA 4LW7A 4JX6A 4LC8A 3M5XA 5DY3A 2Y7FA 2EKCA 3L0GA 4UTWA 3W73A 5FEZA 4O28A 4FO4A 3W2JA 5AC7A 5BNKA 2J88A 3MUXA 4X3ZA 1TPUA 3LM7A 4JTIA 2FJKA 2A0NA 3SR7A 5LHFA 1SZNA 2D73A 1NVMA 2YR1A 3TAKA 3M5ZA 3MP4A 1OX6A 3MBFA 3GNDA 4DF0A 1KM3A 2CLEA 3MJYA 4UCGA 4QITA 4WQ6A 1OFQA 3NZ1A 2AAMA 3CM4A 4AWTA 1DBTA 3N9SA 1LRNA 2BTMA 4PL1A 1O60A 1D9EA 2ZZ2A 2QKFA 1W5MA 4I7VA 3RMJA 4O16A 3LV5A 3TH6A 5FI8A 1Q45A 3FLUA 1TSIA 3Q37A 1VCGA 2GVGA 4EIVA 4RKAA 5DXYA 3QW3A 1ZHAA 2X1UA 3G1VA 4O1BA 2EF9A 3O06A 2W79A 3UWVA 1LP6A 4EOUA 4K38A 3NPXA 1L9WA 3C2EA 3MI2A 3QMSA 4RX0A 2WNQA 4TO8A 5AHIA 3EXTA 3HOJA 4PL2A 4DO5A 5HR7A 4M19A 2Y62A 2ABAA 3OVRA 5K2ZA 1FXQA 2V5LA 3EB2A 3NQ8A 5HUPA 4O50A 1SFJA 1M6JA 3NL3A 3M6YA 1P0KA 2A7RA 3NNTA 5G4EA 1ZAIA 1YADA 3NPVA 4AAJA 1XUUA 3W83A 1OG0A 2NLIA 1WV2A 1LTDA 2HSAA 4JN6A 5HWJA 2Y63A 3LCXA 2TYSA 3PF3A 4IMCA 5I3JA 3N2XA 3G1FA 5HQEA 2Z0IA 1CX9A 3NR0A 1FWNA 3DI0A 1VS1A 3GR7A 3LXCA 3QW4B 2NWRA 3G8EA 4UTMA 1GWJA 1VR6A 3O16A 3LHTA 4AWSA 3B04A 3W71A 1JQXA 2AQWA 4O17A 1YDNA 5AHEA 1PIIA 1QDSA 1B4KA 2H3DA 3L5LA 3PSVA 3PG9A 5F1UA 1P5BA 2VEKA 2PURA 1BEUA 3JR2A 1YTDA 4FF7A 2BLEA 2RDUA 1I2OA 4MIMA 1OK4A 3MBDA 1G4TA 1I4NA 4LVFA 4MVAA 1KTNA 1W3NA 1XBXA 2CZ5A 3W7LA 1W3TA 3W85A 1B57A 3PUEA 5D04C 4Z08A 3L5AA 5ABTA 1ADOA 1K7XA 5D33A 4N6FA 4KFPA 3W87A 5C5YA 2RDTA 1QFEA 5D09A 5BMXA 3UY8A 1H61A 2A6NA 1H63A 1FWRA 3W1AA 3LRMA 1TPDA 3O63A 3NQ2A 3KOFA 4Z1BA 1F6PA 4MUZA 1FWWA 4R53A 4WXYA 4WY0A 2HS6A 3L5MA 3N14A 3W84A 4FNSA 5FF2A 3T44A 3HG4A 3UPBA 2ATMA 4LY8A 4FIQA 2ZZ7A 3W1LA 5D02A 2NXGA 2YW4A 3NQAA 4QQ3A 3W7EA 2Z2UA 1A5SA 4HPXA 3Q94A 3NM3A 1I2RA 3IVTA 4NX0A 6TIMA 3BLEA 3SECA 2QCEA 4A22A 2NXHA 1JR1A 4JIPA 3W7QA 4DO6A 3BO9A 3M1ZA 4OU1A 4EVZA 1XKYA 1LZOA 4LNYA 1H7PA 5LNUA 2ZZ3A 1DL3A 1GT8A 1EP3A 1LOSA 5CPNA 3S42A 1ZAJA 3EX1A 3QMTA 4JDYA 1KFBA
chains in the Genus database with same CATH superfamily
1H49A 3KVJA 4JY9A 4OHQA 3DDMA 1G4SA 2RKXA 4YN5A 2FTPA 1UBSA 2VR2A 1HO1A 2RHGA 4PMJA 4P7OA 3ITXA 4PMXA 1Y5XA 1E70M 3SGZA 1W1ZA 4KEMA 1NWTA 3WNOA 1J2WA 2YDAA 1T0OA 2FHFA 4AZCB 1E40A 4ADSA 2DZPA 3PZQA 3FS2A 3LLDA 3MC5A 5SWUA 4PRTA 5EGRA 3JU2A 1TWIA 3ITTA 2IXVA 1LLOA 6REQB 4H9UA 5KZEA 1H7NA 3BURA 3LERA 3QPYA 4O15A 1OZQA 4QLJA 2XHYA 3GVQA 4JQ1A 2GVJA 3E2RA 1C8XA 2W66A 4HCDA 1T8XA 4JYEA 3MCNA 3QF0A 1PE1A 3ARUA 2WZMA 2VFDA 4ONVA 3W1TA 4QCFA 2P3EA 2G97A 1E1FA 4KS0A 2Q09A 4B5TA 3RRXA 5FD0A 3C3UA 2GVLA 4L1WA 2E25A 3DFPA 1S5TA 3O07A 4YHEA 3LPOA 2CIPA 1R87A 5C55A 3QSRA 3KBSA 3NZQA 1DWJM 4X2RA 3K4AA 1W31A 1XGEA 4GYPC 3R58A 2WQDA 4UR7A 4LYRA 3Q2DA 5TIMA 3W23A 3EA2A 4XSMA 1A5CA 2BGSA 1LLZA 3S9ZA 4LS1A 4JNMA 3WK1A 4DB7A 1NQKA 3UWWA 4TIMA 4WDTA 4AHPA 2HRWA 3VNKA 4JN8A 4O1FA 2TSYA 1TTPA 2PPGA 4LVAA 4GIYA 2YBTA 2NV1A 3AIBA 4TVUA 3WNLA 3H2FA 4XUGA 3S6TA 3N2OA 1JYXA 1U2YA 4ORMA 2PDNA 5K4XA 1VEOA 1X7FA 3S9YA 2JQXA 2X42A 5K7JA 5I3HA 4FXSA 3W7MA 3FSTA 1XSJA 2BHYA 5FESA 2H3BA 3OA3A 4H7VA 2NZLA 1GEQA 4BI5A 2RGMA 2BX7A 4MY1A 4AIOA 2D3LA 4Q3MA 5FJIA 3M0XA 4NF7A 3IJIA 1NM9A 1RV8A 1KV8A 3A22A 1HJQA 3FA5A 1EGZA 1SO4A 2QCNA 3HQ1A 2VFIA 4PH6A 3M0LA 1TQXA 4J3WA 3M0YA 3R4IA 3CUZA 3BAXA 4EACA 3DFOA 3WH9A 3P82A 1E1CA 2ZC8A 3CWNA 4LUYA 4HHHA 3L65A 3LCIA 1RR2A 2JIEA 2VT0A 1RVGA 4KFNA 2PP0A 4MUPA 2BMBA 1RQEA 1Z9AA 4Q6JA 3G5EA 3AI0A 3VFCA 3M64A 4A8RA 4XQ6A 3V5OA 2Y7GA 2IQDA 2AGKA 3AOFA 5EPDA 1TVNA 3QC3A 3IAQA 4RLIA 3EWWA 2G3JA 3P93A 4L7ZA 2ZUNA 3DBNA 3NQDA 1RH9A 5AC8A 4LWWA 3GC5A 3N2TA 4D6EA 3PB0A 4M7SA 1UR4A 3IIVA 2OQLA 1Z41A 3F4VA 5H6HA 4UNKA 3S47A 2V5BA 3V16A 4GZJA 2B7QA 3AICA 5CH9A 4FOKA 4W7WA 3S1UA 5J04A 2PGRA 2ZOXA 3LPPA 4MB1A 4NJKA 1TJ0A 3CZKA 3W72A 2WMHA 3FX4A 1KRMA 4GJJA 1KFWA 3C2FA 8XIAA 4XKMA 2BVWA 4IUGA 2BOEX 5H1WA 3ARXA 2FMOA 1YIXA 2ASHA 3V0SA 4NZ3A 4XVEA 3M0KA 3ZJ7A 1TQJA 5H8PA 5FJOA 4H6EA 1HO4A 4FR6A 1HXJA 2Z6IA 3BZGA 3MKVA 5HWNA 1BRLB 2PDCA 3AZRA 4QNWA 2V69A 3MYOA 1P0EA 1JCNA 1A3XA 1S5WA 4GHRA 5IRPA 2C16A 3T0DA 1YLVA 2P53A 1NDWA 1D3CA 3VE7A 4RZ6A 4UB9A 1EIBA 1WDWA 2A3LA 1HW6A 1AQ0A 1PZ1A 2QZRA 4NP7A 4QS5A 3UWQA 3STGA 3H7UA 2ZWYA 2VVNA 4GKTA 2OTDA 1XLKA 5AHMA 3LGEA 3WK3A 2D3NA 4J3XA 4DVOA 2WCAA 4XIMA 3CUXA 3MUY1 3TTEA 3RYSA 4PC8A 2ZE0A 2DUAA 2EEXA 2ZA3A 5CAKA 3W2KA 4FNPA 3R6IA 4UR8A 4UBPC 3RLVA 3L7RA 4RR4A 1DKWA 2VX6A 3QYQA 1J10A 1Y0EA 2DU2A 1HQTA 1VPXA 4MLJA 3VKDA 3HPZA 2EPNA 2B0MA 2GL5A 1GVQA 4UFIA 3FHAA 4ILSA 1QR7A 1E72M 1PHWA 4FLSA 2C1HA 4YTSA 1V0KA 5CZJA 2ISDA 3QFEA 3TQPA 3V3WA 3AIEA 1A53A 3U48A 1IEXA 3FGCA 5HJLA 1BLIA 2D2JA 3IGXA 4HTYA 3THQA 3WUGA 2YFNA 2CZVA 3ARYA 1WA3A 1A5BA 4JYDA 1NU5A 1LUCA 1OCQA 2HPIA 3QBUA 2HXUA 1GYMA 3WLNA 2WHJA 4E4UA 5HNRA 3ZT5A 5H2ZA 1L6YA 3MDWA 5DXXA 2GJXB 2PF0A 1OVDA 4H04A 4J3UA 3AMGA 3W7GA 3ITGA 3R0DA 1OB0A 3STFA 3EEGA 1E3ZA 5LNRA 3K8LA 2ZX8A 1EC8A 1EEPA 2A6LA 3A12A 1UZ1A 3ZJKA 1MQRA 4UOQA 3W22A 1D7FA 2E3ZA 3SURA 4I7UA 1UKOA 1TR1A 3DFHA 4AD4A 3SDOA 1OEPA 1PDYA 4J2MA 5DMLA 3G0SA 4XD5A 3P80A 5AHFA 3CC1A 6PTDA 3CAKA 5LNWA 3KW3A 3Q4DA 1V93A 3ID7A 1KCKA 5A6MA 4JCLA 1QASA 2VDHA 1Y65A 2F61A 4N9EA 3WFZA 2DP3A 3VIFA 3TTQA 2I7GA 4LAUA 1SFTA 3RRAA 2Z2BA 3TUUA 1XLGA 3W01A 4DJFC 4MJZA 1GVRA 5FJRA 1YX1A 2AL1A 1A49A 3E2VA 4F0MA 4M1BA 5HPOA 3W38A 3LB0A 3C8FA 3RJYA 4G1NA 4FXFA 4DLFA 2BVDA 2TRSA 3K1DA 1DJZA 3IV3A 1A50A 3ITCA 3RPTA 2F9RA 4TR9A 1CDGA 3W53A 1UJPA 4UXDA 1SUXA 1SFSA 2P50A 3B9OA 2IPWA 1Q4WA 2DZUA 4WY0F 4Z0JA 4HTBA 4NX5A 4M6QA 3O6CA 1V51A 4A2SA 4LQ1A 2CLLA 3CQJA 4MB3A 5IOBA 2ZUMA 3VOFA 4J3ZA 4AZHA 4CN4A 1PXGA 3EBVA 3MKKA 3N6QA 3SN1A 1S3HA 3ZFHA 4XBSA 2XFYA 4R3UA 3BARA 3AZTA 3O9NA 3LPFA 4EAYA 4CD7A 1XPYA 3GK0A 4D6CA 3W7DA 1DE6A 4DM1A 1RCQA 3TONA 3NQ6A 3WLJA 4UQAA 2PA6A 1C29A 3DI1A 3GAKA 1MEWA 4I5UA 3VMOA 1K8CA 1B3WA 5A1AA 3BQ6A 3B3DA 3EA3A 3B9AA 1LDCA 4DJED 4HU3A 1XISA 3CTLA 1GPFA 2PTYA 1C7TA 1J8VA 1SSGA 2Y2WA 2PBGA 4AZCA 3AJXA 3RO6A 3H21A 4P7NA 3WLIA 2BODX 3C3NA 2J6XA 3I6RA 3A3WA 4CNUA 5EMJA 3K2GA 1M7PA 2FMNA 4MFDA 1H5YA 1CTNA 4KCWA 3AYSA 1CXHA 4JICA 3IIOA 6REQA 4DZAA 3F7JA 3NQFA 1S1RA 3WH5A 1UHVA 3W6MA 3BV7A 3F4CA 1ZY9A 3PZOA 1QK0A 1EJSC 3P3BA 3E6EA 5AC5A 3EPMA 2POTA 1GVFA 5CKSA 1WUFA 3P8JA 3IK4A 3NSMA 1QNPA 5IBXC 4KFOA 1K9TA 2PC4A 3BLLA 4US6A 5C6MA 1H5VA 3TYUA 3GIYA 4N42A 1M7OA 2HWGA 2E9MA 2JEQA 1MW2A 2EBNA 1BWKA 4DWSB 3VX0A 4MPQA 4LU0A 2O4MA 5A69A 3KL0A 4O4VA 2DSZA 1PUDA 1VBUA 2EXOA 3GIPA 4NNBA 3CHFA 3CZEA 4DUOA 3N04A 1RBOB 3NEHA 1SZGA 2PTWA 4B4FA 4AMCA 2PDFA 4D2JA 3EDDA 3BMVA 3G18A 2YA0A 4CCZA 3VIIA 3O15A 4D6IA 1U1HA 3MHGA 4Y90A 4PUNA 2EJ1A 2CZEA 4U10A 3L67A 3BAKA 1RLCL 3AZSA 2W61A 1EQPA 4O8RA 1P6WA 1D3HA 1OFAA 5E6ZA 1H0IA 3PTDA 3TYBA 2INFA 1JGIA 1AW2A 4FA3A 4DELA 1UKQA 1NDYA 1Q6RA 1MQPA 2H8ZA 2R6OA 5F4WA 4O1EA 1AJ0A 1XLMA 4RDWA 4C1LA 2WBKA 1UA3A 4U5KA 1PCWA 1WOAA 4B16A 3N13A 1W8SA 5EYWA 4TX8A 1VPYA 2IKIA 2PDKA 3IIXA 2OELA 3C2RA 4RE3A 1EF2A 3PC0A 1FRBA 3N1AA 4W88A 1UCWA 2QDDA 4LYPA 2AL2B 3DOPA 1GPWA 3QZEA 4LX4A 3PK7A 3T40A 4DUXA 5CC6A 4QDPA 5I23A 1QWGA 4HP5A 1U30A 1RCXB 5HQLA 1FWBC 3PWGA 2IPGA 2XWDA 1BKSA 3N4FA 4K36A 3A4AA 4O8AA 1JAKA 2VEFA 3NVDA 2GDUA 2FQIA 2G8ZA 2Y5JA 3V5CA 1CXKA 1R9ZA 4IT1A 4IP5A 1R3TA 1JCJA 1ML1A 2NQHA 1QWKA 4AU0A 3TNOA 3CHDA 3CMJA 3MA8A 1DXFA 1J18A 2W0UA 3GTHA 3KTXA 5GVJA 2J25A 1JCMP 1QBBA 3ATZA 3NVTA 4O14A 1LJYA 3ABXA 1FKWA 2ZZ1A 3O2LA 3UXDA 1WZKA 3H22A 3M43A 2CYGA 3LEPA 1OF6A 3PZNA 2PGWA 3CUGA 1EB3A 3KRZA 3UF9A 3LBMA 1WDQA 2XIMA 3BOLA 5XIMA 4HN8A 1P7TB 1BFNA 3ZWTA 1I1XA 1N8WA 1JQVA 1AL7A 1VJIA 5D9OA 3RITA 4DWSD 2BXZA 4XZ9A 2O7SA 1GJPA 1XW8A 5LGZA 2E7FA 3VZYA 2ACUA 2JIWA 4JTFA 4Q33A 1KFLA 4LAOA 3P2VA 1MZHA 4TU1A 1F2JA 1P6BA 1QI0A 3VKJA 3FJ6A 2BZNA 3NURA 1K4HA 3DIPA 2NX1A 1ZFJA 1EJWC 3PS7A 5E5CA 3FXGA 3VX1A 3EXRA 4JGDA 3MPGA 3VIKA 4G56A 2ISWA 3QPZA 2J77A 3DXIA 1R8LA 5A6SA 1YEYA 1K6WA 1F8MA 3MUIA 1H41A 3G22A 2DIKA 1RZMA 2YL5A 3BLIA 3GDRA 3S1XA 2VZUA 2UV8G 2WVSA 4JTHA 2BG5A 3CPRA 3W07A 4PCPA 1TB3A 3SQSA 2YL9A 2OX1A 3DH7A 2R9RA 3FSUA 3F2CA 8TIMA 5A2BA 4PMUA 1EA0A 2B4GA 3THCA 1UZDA 1DJYA 1CZ1A 1M5WA 4AZBA 1MNZA 3W7OA 3RCNA 3CUIA 1LROA 1WPCA 3WYZA 3FKRA 2BNJA 4LS2A 3RFAA 3U4AA 3GHUA 2GSEA 3ALFA 1BVNP 1FCVA 4LANA 1PVNA 3CLMA 2E9LA 4Y6GA 1JYVA 4GGHA 1UG6A 1TFVA 2WVTA 2OZ0A 3SCVA 4UTJA 2DZVA 1A5OC 3Q67A 1IR1A 4AD5A 4GX9A 3SY1A 2PZ0A 3GZAA 2EAWA 3SUVA 4DJEA 5G1YA 1B4EA 1Q85A 3W88A 1L6WA 2X05A 1MWOA 4E2OA 1XIFA 1XH1A 3F4DA 5CSRA 3AHTA 4R27A 4K68A 2NX3A 4XSLA 1BTCA 1OCBA 1XBZA 1GQIA 4KMQA 2X1RA 1GKPA 1W9UA 3HPFA 3PZUA 3U6WA 2Y8VA 4HHPA 4GABA 3WIJA 2WSRA 4FNQA 3SY5A 3VOGA 3TZNA 4C1NB 3STEA 2R1NA 3B8SA 4IIGA 4IM4A 4S2BA 1R46A 4L1XA 4JKKA 4HMNA 3PULA 1ADDA 1I6NA 3WQCA 4GH3A 5BRBA 1CENA 2X8RA 2CHRA 1P6CA 4PUJA 2CEQA 3KOWA 2NQJA 3WJSA 3BC9A 3TR2A 3T2OA 4WGXA 3SW6A 3ARSA 5I0DA 3WUBA 1O94A 1A80A 4GG9A 5K9XA 1RY8A 1H7RA 1UOZA 4YWSA 3MUAA 3CXOA 2A7NA 2ONEA 2YJQA 4LBSA 4HNTA 1D3GA 5CPLA 3URBA 5CLTA 4BA0A 3RK8A 2CKSA 5M5DA 5I00A 1SW0A 1TVPA 2YYUA 1ONRA 1HNYA 4LYQA 1XBYA 2ZRYA 1GCYA 4IIDA 4B9ZA 1QUMA 1CT5A 3WLQA 2X0HA 1UR3M 2PI6A 5BXRA 3GR8A 3GNOA 3EGJA 3OG2A 5IFTA 1EGMA 1XC6A 2BOGX 1ONEA 3TAOA 1EC7A 4LVGA 3TTYA 3HF3A 1DORA 1WXZA 4KETA 4JTKA 5ABGA 4WSJA 3W1QA 3UCCA 2ABBA 1V4YA 5BU9A 3LBOA 3QR3A 4NJGA 5DF0A 5M3WA 4OFCA 4H7CA 1A0DA 4OGZA 3V0TA 1POJA 2Q02A 1RD6A 4HMCA 4KGJA 3W7HA 3H2EA 1W9DM 3OZOA 4HBKA 2E1WA 3SJNA 4ZQOA 3VNIA 5AKQA 1GZ1A 2V5JA 4PA8A 1MUMA 4UTTC 3G1AA 3CT2A 4MSSA 1FA2A 2ZX9A 5AYXA 3G0XA 3BLOA 4UTKA 1M01A 2OWWA 3HQOA 5CC7A 2PFHA 3OGVA 4GCXA 3UEQA 2GGGA 3B06A 3GNPA 2G3NA 5J5RA 5DRCA 4O1AA 5D2VA 3N34A 4A05A 2CERA 3DFNA 1TYGA 4JTLA 3L12A 2ZTKA 2IPJA 3D3AA 2QNEA 1SMAA 4R5EA 2A85A 3CWHA 4DBUA 1PL9A 1W1A1 2GOKA 2WM1A 1GQKA 1X1ZA 4Z2HA 4AEFA 2IKHA 6ALDA 4X60A 1TIMA 4TMBA 3WNMA 2Z7KA 4OECA 3DG6A 1XRVA 2X0SA 4FAMA 2VCAA 3PTMA 7CGTA 4Q8PA 1ECQA 1UIPA 3A47A 3L0KA 3IJLA 2FLIA 3L4UA 2GDQA 1IZKA 2WKJA 1TELA 3PPFA 4U28A 3TZFA 5F2MA 5HPCA 4DWSA 1RQHA 2PWDA 5DRIA 3DHPA 1TTQA 4IMEA 3CL6A 1XIDA 4A29A 1Z3NA 2R24A 1UH2A 3I4EA 4QDMA 4RDVA 2VRJA 1OY0A 2VC6A 2A21A 4KEVA 2HPMA 1GZJA 4HZMA 3SZ8A 5T8GA 4UNIA 1IXOA 1FP8A 1MDLA 3POCA 1V6UA 2VD8A 3PTKA 1W91A 4GH1A 1JULA 1SJDA 1O7AA 4LF1A 4M7TA 2VFGA 4S23A 4EE9A 3GDLA 1HJWA 1QPKA 3W74A 4IWWA 3OGSA 3PZMA 1YNYA 3MMDA 4DXXA 1A5LC 3N25A 3LENA 4JTAA 3IGSA 2EO7A 4Q8VA 4B5WA 3V35A 1QVBA 1NWUA 4DAFA 5IHSA 2E40A 1M1BA 1QPRA 4QM1A 3BPWA 1TRIA 3WUFA 4CN6A 1B3OA 1LG1A 4NXKA 1W9VA 2D2OA 4GYKA 1XQKA 2C79A 2AL2A 2OT1A 3BLPX 4ATDA 3S1VA 1XRTA 1XSKA 2ZWZA 3UR8A 1KBJA 3UJFA 2QCHA 5F2LA 4J3VA 4H9MA 3TDFA 2ZUTA 5H91A 3S3GA 1HUVA 3V18A 1E9LA 1UWQA 3N6JA 4I5RA 4ERGA 1XYAA 3FDGA 4IX2A 5CPOA 4JTRA 1M68A 3WLPA 4YCOA 1ME7A 4NAFB 5DFAA 4XAYA 1XLEA 4JQ2A 3S83A 2Y0FA 3H2NA 2FH6A 1VBGA 4IJCA 1GYLA 5LIYX 4LUTB 3ATYA 2WMKA 3W7RA 3BICA 2VC9A 4TQTA 4CEXC 4X9SA 1SJCA 1RA0A 4CCCA 4F0LA 2CKRA 3NPWA 3T0AA 4EKJA 4GCAA 3GKFA 1JGMA 4S3AA 4F2TA 1XWYA 4FNRA 3SCTA 2ZZ5A 1E0VA 5ECVA 3VXGA 4ZBCA 2G3IA 2WZEA 4HA4A 2DDXA 1DJXA 3GFZA 3QY7A 3AYTA 3HM7A 7ENLA 4B5XA 3VABA 3MSDA 1TWDA 1LYXA 2VKZG 4UNLA 1G4PA 1UWAA 1E43A 4JY8A 3RCMA 4GUJA 4HB7A 4Z1CA 3S4TA 4IX0A 1C8VA 4J40A 4W86A 1P7TA 5HNNA 4GD0A 2QIWA 2VQTA 3QZ6A 1GOMA 1G0CA 4Z2KA 1PKNA 4BWLA 2PAJA 5HXMA 1JPIA 3T7VA 1ICPA 2V81A 4FNTA 1LRQA 3D3FA 4W93A 4S3FA 1QNSA 4LC8A 2Y7FA 2DV0A 3N6HA 5C7HA 2EKCA 4FLOA 4W8AA 4O28A 5FEZA 3E1F1 2J88A 2Y5SA 3LNPA 2ACRA 4AD2A 1TPUA 4L64A 4QTGA 2FJKA 3SR7A 1K77A 1W8GA 2D73A 1NVMA 3KOXA 5C2GA 3M5ZA 4US5D 3L4WA 3MP4A 3GNDA 2YL6A 4WQ6A 3DC0A 5JBDA 4AWTA 1LRNA 5JH1A 1O60A 3OQ8A 1TMLA 4D6HA 4XZNX 3S2JA 3MQTA 1AODA 4IFRA 4I7VA 3RMJA 2QW5A 4O16A 3QGKC 3FLUA 3Q37A 4HZ6A 2F38A 1EOKA 4EIVA 4RKAA 4JAWA 3ARQA 1JD9A 5FJTA 3G1VA 2QS8A 1BVWA 3O06A 2E4TA 2ZUWA 3KCOA 3E5BA 4K38A 2HISA 1X38A 3ZOAA 1L9WA 4AWEA 2PWHA 3VDHA 3ITVA 4Q4SA 1UWTA 3AWOA 1V02A 3QMSA 4RX0A 4TO8A 3WQPA 4PL2A 5AYIA 4M19A 4HU8A 3TOYA 1WXYA 1XHGA 4ZR8A 1CLKA 3PNZA 4LB3A 3NQ8A 3LYEA 1XYBA 3PJUA 3RDKA 4O50A 4KF1A 3NNTA 5G4EA 3BSMA 2QQ6A 2XSXA 3WMSA 1YADA 1EDQA 3GRIA 4LF2A 2NLIA 4KEZA 2J7DA 4JIHA 1HL9A 3LCXA 2TYSA 1OSEA 4DUWA 2CCRA 4D6FA 4CQDA 4DX3A 2IS7A 1YW1A 5I3JA 1TUXA 1HJSA 3N2XA 4JL1A 2Z0IA 1QJWA 2DIEA 5BXTA 3VZXA 3ZQ9A 1BXBA 1VEMA 3QR0A 1J6PA 3W71A 3VUPA 3U2ZA 4NL1A 5A6JA 1PKLA 3NOYA 3PG9A 2VEKA 4AIBA 2BLEA 1G4TA 1I4NA 1W3KA 1AD4A 3DG7A 1X98A 2YA2A 1ZS2A 4C1NA 2CZ5A 1CXFA 3R0KA 4Z08A 4C6FA 2XM2A 3QV7A 2O92A 3WG6A 1H61A 2A6NA 4YVPA 2EG6A 1BQGA 2AAAA 5HMDA 1TPDA 4GFIA 3NQBA 4Z1BA 4A4AA 3DERA 2PTXA 1HJXA 3N14A 3W84A 4FNSA 3HG4A 2Z26A 4IISA 2GGJA 1NWSA 1ITUA 3W1LA 5D02A 4RL3A 3TLLA 2QPSA 3H26A 3OJGA 4D8LA 3K8KA 1QBAA 1Q2SA 3S2CA 1HKWA 3D47A 3LNMA 5ENLA 4PB3A 1E0UA 3BO9A 3M1ZA 3CO4A 4LNYA 4KIRA 3ZLFA 4A8IA 2ZZ3A 3UW6A 4WGHA 1HT6A 2OWXA 1DL3A 1GT8A 1UWIA 1LOSA 3S42A 5CLWA 1VFTA 3VGBA 1ZAJA 3QMTA 2ALRA 2ZXAA 4W89A 5DO8A 1LQAA 3LCLA 3WJWA 5EBAA 5HULA 4E3TA 2HQAA 3I4KA 1ZZMA 2ZCGA 4UFLA 3R7MA 2ZADA 2I9UA 3W1XA 2A4AA 3TTSA 2VZOA 1GOKA 3GS6A 2PWVA 3TC6A 5A2CA 4BEUA 1OG6A 3KL5A 4PFMA 4LCSA 4DLMA 3B97A 1XL9A 3KVLA 3W7JA 4H9ZA 1JL8A 3HZ3A 2V9DA 3DAQA 3NL2A 2GLKA 1V03A 2V2DA 4QE1A 1G7UA 2XH4A 3AHVA 1KKRA 2QF7A 3LCWA 4NYYA 4HA3A 3PZGA 2VGIA 1KTCA 4JHMA 4Q8UA 3NA8A 3VIGA 1A4LA 1US2A 3BLFA 1QCWA 3R25A 2D0GA 2IW0A 3LD5A 3F03K 4OBSA 5EFDA 5E09A 2OODA 3BH4A 4HZ7A 5GNXA 1FQ0A 1MW3A 1BWLA 3SQLA 1MXDA 4ZGYA 4RNJA 3A5FA 1EUAA 3OP2A 1LORA 2Z28A 4QIUA 4D1IA 3VNZA 4HN4A 2C14A 4JXCA 3VNJA 4UOZA 1QPQA 5CBJA 1OT2A 1J2BA 5XIAA 3BJSA 3WQWA 1E9YB 1MEHA 3DYPA 3NL6A 4GO8A 1AUSL 1M03A 4TTGA 4PBGA 5HANA 4I7WA 3AALA 2VGBA 3I6EA 4PMDA 3RLHA 3T4CA 4HK5A 3NQEA 4GY0A 4NZCA 2OX4A 1W5PA 2R1PA 3V36A 1XYFA 3VA8A 1DWFM 1WZAA 4O53A 4N9CA 2ZXBA 4I8DA 2J24A 2FJUB 4QG8A 4POCA 1V6WA 3TN6A 1J0JA 3H24A 1HF6A 3UG8A 3SFKA 2GGHA 1E3XA 1R7AA 3ABSA 3OG3A 2ACSA 1PEZA 3UNTA 1AH0A 3ES7A 2OYLA 5FEPA 1GKRA 4UUIA 3VE9A 3WY1A 2G4JA 3QLLA 2DQXA 1FWAC 1FWJC 3KLLA 1OYAA 3W27A 3W28A 4YVXA 2WHLA 1R3QA 1VZWA 1Q7QA 3UERA 3EWZA 1DHPA 1GW1A 2PDQA 3GNRA 4JTQA 1VYRA 4A3YA 5DLCA 2WCSA 3CIXA 1ZBKA 4PMRA 3Q65A 2E6YA 4QSFA 4G1KA 4US5A 2V5DA 4FXJA 3AHZA 4BQ5A 4DBWA 4PCSA 3A24A 3OGRA 4GUHA 3LA4A 4UTIA 4H9VA 3QLDA 5LZLA 3RN6A 3GXDA 3AAMA 2PDPA 3TCEA 1BYBA 3TOPA 4U5IA 2CBJA 1WE5A 1GKQA 1SW7A 3W2UA 6XIMA 2BWGA 2W4XA 3CPGA 1Y8BA 3VGDA 1JRCA 3B8TA 3AHXA 1JJKA 3RU8X 1XLFA 1G6CA 1B3XA 1GONA 3KLKA 5LHEA 2WOQA 3F5LA 4MOZA 2INEA 2JKAA 1AW1A 5CPTA 3MV11 4DJEC 2VMFA 5FIPA 4LC6A 3PUOA 5FJPA 1EPVA 2V2HA 3I3EA 5F2IA 2YCEA 4NNCA 1K7EA 1EO5A 3L4VA 4S3EA 1D7KA 3GUGA 1GVYA 1EL3A 2GVYA 4NRRA 4NAFA 2QR6A 1SW3A 4ML9A 1RD5A 1JD7A 4WXZA 1DQWA 1PZ3A 4U3AA 1VAHA 3CH9A 4B5NA 4HYVA 4U2YA 2PDUA 3PNUA 1XR2A 3JW7A 2OU4A 4LUTA 2F8QA 4CD4A 1H4PA 1PTGA 4IQJA 4Z42C 3SI9A 4F40A 4HCLA 3O3RA 1Y7VA 3F1QA 4MDPA 1GOOA 3OOQA 4J2PA 3VD9A 4J3TA 5FF3A 1VF8A 4L9ZA 4JBRA 1XD1A 1KXVA 3RPMA 3EWXA 3TQ0A 3CZLA 4HPNA 3VFLA 1JNEA 3OB8A 2J9ZA 2VVSA 1BKHA 2WBGA 5CJNA 3KVKA 1LRTA 2XTKA 1M3UA 2HCVA 1KM1A 3KX6A 1NP2A 2AOSA 3SAZA 2DVXA 2P3ZA 4IMAA 1TZ9A 4B4HA 3ARTA 1M04A 3ICJA 2J79A 3WQVA 1K9EA 1GGOA 2J6VA 3CAVA 3OVGA 3R8HA 1PZ2A 4J28A 5LIXX 4Z1YA 3GHRA 3V75A 1DJQA 3IIPA 1QOPA 1H7XA 2VXNA 3P60A 4DJDD 3GKAA 3N15A 1G01A 3PHAA 3G6LA 4IGNA 3WO8A 3VM5A 3OHIA 5I2UA 3GYEA 2UY3A 3JRKA 3TSMA 3L4ZA 3V4BA 2P10A 2CLKA 3BAIA 1GG1A 3OEXA 3WBYA 2R91A 1L0PA 1TE1A 4J3SA 3VOJA 5C54A 4PR4A 3ABRA 1T99A 1FOBA 3HFTA 4AEOA 2CZFA 3W75A 1AJ2A 3LMZA 3WJYA 4B3LA 3QV9A 3H2MA 4RNHA 5CCZA 1T41A 2OZ8A 2F2HA 2FPYA 3RNDA 4BK9A 3W9ZA 4P7QA 4QISA 3NO3A 1TV8A 1YYAA 2WK2A 3UYIA 1HKIA 1D2KA 5J5DA 2YLAA 3G8RA 1M7JA 2QUVA 5HMSA 3RJXA 1UP2A 1KRBC 3T4WA 4NXSA 3UBPC 3SUSA 4UCFA 3VCRA 3AXHA 2XIQA 1W5OA 2WCGA 5F2GA 1E6NA 3J7HA 4ICCX 2Z1KA 4YLWA 4MMWA 1TPWA 4Y96A 2EQDA 4AYSA 1X1NA 4O0KA 3LHVA 4PUWA 4DYEA 1Z8AA 4N0RA 5EMLA 4IXXA 4UR9A 4U33A 3WNPA 3GHSA 2HK0A 3O6DA 2DZSA 4GXWA 2QAFA 4F9DA 1BG4A 1UR0A 3EDFA 1VJZA 4EF9A 1V7YA 2HVMA 3TV8A 2JGQA 2ZRVA 1JYNA 3JS3A 3T0BA 4LEFA 1HTIA 1SZRA 3FAXA 4Q4MA 3VGFA 2D1ZA 5A8NA 1VD6A 4WDWA 5DT7A 3PBGA 4QE5A 2H9AA 3MI6A 4BI7A 1IZCA 3EMQA 3PZIA 4NZ4A 3WCZA 3IUHA 5AB3A 4IG2B 4IIHA 3UA4A 4OVXA 2YDRA 4DWSC 5LKYA 3LGGA 2GVEA 2VI0A 2VQUA 4MPKA 4JFVA 5BROA 4O10A 1R9XA 1QATA 1H11A 4WX2A 2WYSA 3HGOA 1UP0A 1S46A 1SJBA 1RXOB 4UQDA 2ZUSA 1FDZA 1DIEA 5HJXA 3IJ7A 3FIGA 2V3FA 3TU9A 4IPIA 5LA0A 4RV3A 3CNYA 3AMLA 1KRAC 4YJ5A 4NKCA 2YOCA 4A2RA 2QV4A 3VGGA 4NJIA 1XLLA 2J74A 4HYRA 1OBAA 1O12A 4HT3A 4Y2WA 3TMQA 4AC7C 4ZQCA 4MZYA 1YHTA 3UD6A 1W1B1 3NGJA 1JZ4A 3MV01 4W7UA 2X2GA 1Q6OA 4XZMX 1RY0A 4HNVA 1Z7AA 4JX4A 4XD3A 1OWQA 3KWXA 3S2MA 2VEIA 4TMCA 2PUZA 3U9IA 4NT0A 4L61A 4WSKA 3I6TA 5JVLA 1PCKA 3JZUA 1V6YA 3CASA 1NELA 5KTLA 4P8VA 5E70A 3EKGA 4LV9A 1E6QM 3VD5A 3IJ6A 5EMKA 2QUNA 1OD8A 4ATWA 2PZNA 3R89A 1XCXA 2R82A 4H1ZA 3GW0A 3GBEA 3GXPA 1R3RA 2PBOA 3CQHA 4A3HA 4AWUA 3M4HA 2QVNA 3R13A 4GNJA 4HGXA 3WDQA 4JTTA 3GSMA 3B4UA 5G2HA 1FHDA 4OUEA 1K8ZA 4WUIA 4DBSA 5D03A 1TZ7A 2C19A 2P1FA 4IQDA 3UXKA 1G94A 1GJWA 3M44A 1ZBWA 4HPHA 4GQRA 3NEVA 2V38A 5I5RA 4S3JA 5AYYA 2FZ8A 3W37A 4KGLA 2FDMA 1Q7ZA 1ADSA 3GAYA 4W4QA 1K7FA 4U4MA 2WMGA 2QCDB 3BG5A 1W9BM 3E49A 3XIMA 3G1YA 3W2LA 3U5UA 1GG0A 1MUCA 4CVWA 4UMBA 5A6AA 2NQZA 1N82A 3I68A 1DTUA 3LXBA 1J0HA 2XIBA 3SB0A 3CEPA 4S2CA 2AQOA 3MU7A 1TV2A 1VFUA 3QKZA 4DM2A 1ZPTA 1XGZA 2J9YA 5IDIA 1V8EA 2NUYA 1GJUA 4DN1A 1TMQA 3ZVIA 5CG0A 1S2AA 3PZ9A 3DYMA 1H62A 4NZFA 4OT7A 1AMKA 3KRBA 2XH2A 1AZ1A 3GU9A 3TW9A 1GTEA 3CJPA 2OEKA 4CLMA 1QI4A 1LBFA 3IGUA 5E6YA 4FXRA 1XXXA 2OKTA 1ITQA 2CBVA 1JVNA 1W2VA 4RNFA 2XWEA 3M9YA 1H0GA 4KCTA 2ADAA 1WKYA 4NIRA 3CV7A 1B5TA 1EUNA 4LXFA 3QY6A 4N9BA 4F2UA 1Q8AA 4M3PA 2B81A 2FVLA 3HPAA 1LL6A 3WQ4A 4G9PA 5LIUX 1TG7A 3RLUA 3CV2A 3H53A 3TFXA 3O6YX 4IJRA 3H55A 1NF7A 3RU6A 1FWTA 5CGQA 5GJNA 4PEEA 1W0MA 3FK4A 2XH7A 5AC4A 1EZWA 2C13A 3B05A 1KO0A 4ZA0A 3VILA 4BFAA 4TX9A 3DCPA 4UFHA 3UG3A 5HNTA 1IXNA 2PD9A 3IUIA 4GZ7A 3RM4A 2YX0A 2J8GA 2DT2A 4MYAA 2C1IA 2OGJA 4LT9A 1PX8A 3VDAA 5LNSA 1K03A 4AIUA 3HU7A 2E67A 1EFZA 1ODUA 4EXQA 3M41A 1FY6A 2WNZA 2PDXA 4WIWA 3SIZA 5D4YA 3HB9A 4V15A 3S2NA 1YTEA 4OWGA 2VC7A 5M03A 1TKKA 3T08A 2CWXA 1Q13A 4C6NA 3GXFA 2QCCA 2JKPA 2YCJA 3K8MA 2Z4GA 1P0DA 1B90A 2J7GA 4WJXA 2A7PA 3UETA 2FH8A 3CQ0A 2PDBA 2Q3RA 3NFUA 4C6KA 2JKEA 2WMFA 1O68A 4RZBA 4XK2A 4JTEA 4MKVA 4REQB 2ZC1A 5BXPA 1ZB5A 1E51A 5EFFA 4NY2A 3UNDA 2WVUA 4YTTA 1WUEA 3KTCA 4BR1A 5A6BD 3DBPA 3K5XA 1W17A 4PBFA 5CG7A 4MM1A 4V2XA 1HL2A 3KFTA 2Y88A 4JFSA 2NQ9A 2GYIA 3PSWA 4JEJA 2ZVIA 3HPXA 1JPHA 2PE4A 1WZLA 5C70A 1UP3A 1QT1A 1K3UA 2VGFA 1KV5A 2JE8A 1WAUA 2YXXA 4QNEA 1T5AA 3MO4A 3D46A 3HPSA 1AQFA 1OX5A 1GOWA 3FVMA 4PUKA 2YYTA 1W5NA 4ZE4A 1V0MA 1QHPA 2OMAA 2Y8KA 4Y8EA 1ZALA 3WBAA 3ITLA 3DKLA 3JVAA 4J7RA 3I3DA 3M7SA 3R8GA 2QJIA 3S2LA 3IJQA 2ZXDA 3ITOA 2E09A 2FGBA 1TR9A 4B92A 1VEPA 1KLZA 1W3LA 1WP6A 1EYEA 4ADTA 5K9CA 2VCCA 2A79A 4LSBA 3JUGA 2ZRZA 2CLMA 5ABFB 4MG4A 3SSZA 4E4PA 3I7RA 5M17A 3O8AA 3U57A 3W1PA 3GH5A 4QSHA 3VOHA 5U4NA 4IICA 4GQQA 4LAMA 2W91A 4DHGA 1FWCC 3MHFA 2XIIA 2XN2A 2QCMA 3W0KA 3T8LA 1NAL1 4EPKA 1YDVA 3BSGA 1YTKA 1E6SM 1UD2A 3HGRA 3N3MA 3U8GA 3A4WA 3EMCA 3LK6A 1RUSA 4BCEA 1DHKA 2NUXA 1D8CA 4IL0A 1DEDA 3U0HA 4PE8A 3SSJA 3ITYA 4TX6A 3AUJA 1WKFA 3CB8A 3EOEA 4M81A 4AHOA 4ZB2A 2VHLA 3W25A 1XD0A 2NVDA 3HIJA 1FVPA 3BGJA 4NJJA 1R2TA 1FWHC 3SCWA 1UWUA 2JBMA 1CBGA 1RK5A 2ACQA 3UESA 2GUYA 2ZX5A 4UIOA 1JNDA 3VMNA 2INZA 4HNOA 4LVDA 4WVXA 2A1YA 2WJZA 5BRQA 2PODA 4WY0B 1YPXA 3B0UX 4LNCA 2XIOA 4NNAA 4GVHA 4K1GA 3AXXA 3ONBA 1JCXA 4N4QA 3P5YA 2WNNA 4V1YA 1WDDA 4IMFA 4EWJA 1A5UA 2Y8UA 2ATSA 3C52A 4FNUA 7TAAA 1RSCA 3N12A 3BCDA 3TWAA 2EJAA 4EWND 3P5ZA 1CGXA 1BGGA 3U5YA 3UA3A 4IG2A 3CT7A 2HS8A 2JF6A 3GHTA 1EPXA 3W29A 4F0RA 1L8NA 4OUIA 5E93A 3GYCA 4O1CA 2Z1SA 3KRUA 3NSNA 1TPH1 1GZGA 3TTOA 3VYLA 2I1OA 1F4HA 4H8HA 4L4PA 1LQ0A 4O12A 5G2IA 2ON3A 1CB7B 4C6PA 1SM9A 3LN3A 3UR5A 2EG7A 1WDSA 3IARA 4F8XA 1KCLA 4MWAC 3R79A 4KESA 1YDYA 3PWIA 1UC5A 4P8XA 3M0ZA 3UWYA 2XJ7A 3BOXA 1ICQA 2Y70A 2Y7EA 3BW3A 1BSIA 3PWAA 4L9YA 4O1DA 3GG1A 1TTJA 4XZLX 1NWRA 1K02A 3PAJA 2OEMA 3RF9A 4INFA 8A3HA 1XCFA 2WLZA 4GKLA 3H12A 1XF0A 3LHWA 3P67A 4C91A 4DBEA 3QHNA 4GOAA 2PLJA 5D2WA 2RUSA 4XUYA 4H00A 5C9WA 3PANA 1K8YA 1TJ2A 4AH7A 5JIWA 2VP8A 3H4WA 3S6OA 5JBFA 3FFSA 4WEVX 1TMHA 4C6CA 2V67A 1O1HA 2V30A 1HIZA 1K1DA 4CCEA 5C71A 1O5XA 1AQMA 3VDCA 1Q65A 3R94A 4JD4A 1XYZA 4KEUA 2P88A 3EWYA 1B3ZA 3UJRA 4AQLA 4PRRA 5D2XA 3CTTA 2QDGA 4ZMGA 4ZXLA 4ZO7A 2W27A 3OBEA 4F0HA 3ZR6A 5A94A 1KW1A 1ITXA 4LCRA 2ZDSA 2Y6ZA 3E9AA 4XD6A 2CU0A 2O56A 1F73A 5I06A 1MQQA 4KCUA 3HMCA 2IPFA 5DEZA 3VNDA 1VPQA 4H9XA 4IJBA 2VEGA 4LALA 1LBMA 5A8PA 3CHVA 4FMVA 1J93A 1FX6A 1BXCA 2QCDA 3OLGA 1MUWA 4ZQRA 3EKZA 3W02A 2ZKMX 3UZZA 5CPSA 3MWAA 2QCLA 4HHLA 2ICSA 4LFYA 4B91A 1R86A 4AFYA 4A8NA 3UU0A 3C56A 3KCLA 1XM3A 4CQ8A 1GW9A 1ZL1A 4GXPA 2ZE3A 1SSDA 1YPIA 4JDBA 1DJWA 1ISZA 3H6OA 4M82A 1JZ7A 3ZLGA 1JUKA 1N7KA 3BL3A 5A6BA 1ZAHA 5D30A 4HPJA 4R7OA 4B5VA 1V3IA 3W00A 2BHUA 4DZHA 4Q7NA 1V6VA 4EAMA 3R2GA 1UMLA 1X1OA 2QV5A 1DJHA 3T05A 2XVNA 3WQGA 1XFBA 4GI9A 3WLHA 3V7PA 2DW6A 3AHYA 1CXIA 4K8EA 5AOUA 5CXPA 4CNPA 5MF5A 3BG3A 5GJPA 2PDGA 2BY0A 3C2YA 4JTGA 3FN9A 5EMYA 1W32A 1UD5A 3BWWA 1W6TA 1VJSA 1N55A 2LLEA 2WC7A 2XU2A 3TA9A 1L2UA 3OZMA 3TE9A 5CZ0A 3DHUA 2AGTA 3SRDA 4IFOA 1XFCA 1QOXA 3WELA 1I60A 2OO0A 2CPUA 5I7GA 1F9CA 1V7AA 3LZ5A 1EDGA 3GFYA 1BHGA 3NZGA 4H4IA 4QAWA 4E4FA 3BV4A 3WJZA 3A4XA 1UR9A 3FYOA 3RM9A 4PB5A 1KQYA 4I6KA 4AZ6A 1W5QA 3H2AA 2WPBA 5AHLA 3CK5A 4JZ5A 1EGVA 1LL7A 3RX3A 4ERAA 4GIEA 3GH7A 5AVHA 3TW6A 1CWYA 3OIHA 5HMFA 3WLOA 1E5NA 2GJRA 2VGGA 4S39A 5B7YA 2X16A 5GNYA 6XIAA 4UTHA 5LNVA 1EJ7L 1H1YA 5FF7A 5D05A 4C65A 3OBAA 1JI2A 9RUBA 1B2YA 5JMUA 3P6LA 2XG9A 4GK8A 3PBWA 3R0UA 1T7LA 2HV5A 2V6AA 3SCSA 1KR0A 1NQ6A 1NARA 1ZTVA 1GNXA 3GXMA 2YW3A 2TPSA 2X1SA 4ZZ9A 2J7CA 4MJ4A 2FZMA 1V0LA 4X22A 4REQA 3AJ7A 4CD8A 3N2BA 1OCNA 1F3TA 3B03A 1S3TC 4AD1A 1VYPX 4M6PA 3OW1A 3TYZA 2X09A 5I6SA 4FPSA 5DY2A 4PODA 3ZO9A 2V63A 2VEMA 3VOIA 1FHLA 1S5VA 2H8XA 3IPWA 1V3JA 1YE6A 1CGYA 5DY3A 3W73A 3CL7A 5AC7A 5KZ6A 1VFLA 2PDHA 3MSRA 1ZCCA 2PDLA 2A0NA 5TD4A 2WKLA 4PB4A 2YR1A 1Y5VA 1JF5A 4H8UA 1XICA 5A95A 4DF0A 3MJYA 1QI2A 2CLEA 4GA8A 4UCGA 4QITA 2AAMA 3WLSA 1DBTA 3N9SA 3NZPA 3VMPA 2BTMA 4PL1A 3NTYA 1D9EA 2ZZ2A 3MCMA 3I3BA 3M46A 1EH9A 4QP0A 4X2PA 1QHOA 3TH6A 5FI8A 4XZIA 3BMWA 2HE5A 2Z29A 1GOQA 2GVGA 2VDIA 3RM8A 1REQB 1A47A 1ZHAA 3CV6A 2EF9A 4Q8MA 4FI4A 4EOUA 4DIAA 1NDZA 5C9UA 5ABFA 5AHIA 3HOJA 2BS9A 3N4EA 2Y62A 2ABAA 3OVRA 5K2ZA 1FXQA 1CGTA 4H7ZA 3GBDA 1XIMA 4DO7A 2WC4A 1SFJA 2GQ3A 4HU4A 3IJDA 5T91A 3NPVA 3STPA 4AAJA 1XUUA 2VWSA 1CGVA 1WV2A 2OQHA 1WNOA 3GIQA 1IT0A 1V6XA 3EDKA 4IMCA 4PGLA 1AQHA 3QHOA 3FYYA 3NR0A 1VS1A 1QI5A 3GR7A 2NWRA 3URQA 4AZ7A 1VR6A 2WMIB 2W9MA 3B04A 3QKEA 5AHEA 2PDWA 4JHZA 3PSVA 1B4KA 4KCVA 3TJ4A 5F1UA 2PURA 2RDUA 1SGJA 4ZODA 3MBDA 4ZB5A 2HBXA 1OIFA 1KTNA 3W7LA 3W85A 2F6KA 5E9XA 1B57A 3WF2A 3L5AA 1DWAM 1QFEA 4AISA 5BMXA 9XIMA 3MSYA 2VD9A 3W1AA 4C5ZA 1X6NA 1FWWA 1IZJA 3GW3A 3SM0A 3WD4A 4WXYA 3GDBA 3H4GA 4WY0A 3L4YA 1XGDA 4RE4A 3AS3A 3R10A 2G37A 1KWKA 2PMQA 4LY8A 4AY1A 3SCOA 5TF0A 4GY1A 1TIWA 2NXGA 3NQAA 1I0DA 1NOUA 1CYGA 3Q94A 6TIMA 1UD6A 1IE7C 2HXTA 1JR1A 4OU1A 4EVZA 5BWFA 4W87A 2V68A 2ESCA 5LNUA 4GVIA 3WEOA 2OLHA 4K8GA 1EP3A 5CPNA 4H01A 3EX1A 4JDYA 2FHCA 4W5UA 3SCQA 1KLYA 4L1GA 1P1MA 3FJLA 2PDJA 4DJDC 1Z48A 1FHUA 1NP0A 1TZZA 3UGVA 4IZGA 2HTMA 4O57A 1B3VA 1BQCA 1G4EA 5F1VA 1O5QA 1RAKA 5FL0A 2C0HA 3LBCA 3AYRA 3FDKA 2QJGA 2GUUA 1T6MA 5CZTA 4QFUA 1H7WA 1T96A 2OSYA 3ZXWA 4GJIA 1W3JA 3UP8A 4OKDA 1UYQA 4KPLA 2DSUA 4UZSA 1JEZA 3GQYA 5CPQA 5KEZA 3E12A 4GGBA 1D8WA 5KZDA 3CU2A 5U7SA 3ZSSA 5D37A 3CHCA 5IM51 2DJLA 1OJXA 1KXTA 3IV8A 1OFEA 4OV4A 3LI0A 3PJWA 3E38A 5FAJA 2QT3A 3WLMA 3BMXA 3I65A 1U83A 1JUBA 3O05A 4K6AA 2GOUA 1P1XA 2Z1BA 1F5ZA 1XIJA 4GNKB 1PS9A 2P0OA 3FHQA 2YXGA 3M5YA 3DKJA 1TA3B 2FB2A 1FH9A 4NZ1A 1R3YA 2PWFA 2BY1A 4MJMA 1YQ2A 2OOFA 1V3KA 4B9YA 4W9TA 1RJQA 3G1RA 1PAMA 1I2PA 4NASA 2YB1A 4KIEA 4UOJA 4WZHA 3HA1A 3ELFA 5CBIA 1L2QA 1G67A 1OFDA 4N7QA 1O5RA 1W54A 1NFBA 3PG8A 4F79A 3B40A 1Q3NA 2VOTA 4PSRA 3SGGA 1YE4A 2ZX7A 1GEHA 2VR5A 2ZFAA 2YBVA 3P0WA 3LTSA 2OPJA 3VIPA 1JI1A 3MB9A 5C9ZA 3T2PA 2WQPA 4BS0A 4JEQA 4JPGA 4DXKA 3UR7A 3KRSA 4U3CA 4UQBA 2DH2A 3LMYA 2X0YA 4JQ3A 4JIEA 2QJHA 1DQXA 1WOBA 3NG3A 3CAQA 1H60A 2IMRA 5L6UA 4UTWC 1LT8A 5CQ1A 1PO9A 5IFPA 4IP7A 4GQBA 5G4WA 4LUIA 4D8ZA 1Q6CA 3HJZA 1KCXA 3NGFA 3G1DA 4F2BA 3THUA 4RZ4A 1KBKA 4X0VA 1UKPA 4QJ4B 3CAWA 4AY8A 2CLIA 4GC4A 3DFYA 1HZYA 3BJTA 4LBUA 3BK0A 3BOFA 2DSKA 1YBQB 4IQLA 1F61A 4M56A 3O6AA 3IRDA 4Y9PA 2DZTA 2ANUA 3NJ3A 3TQKA 3LM3A 4AZGA 5A3HA 4PN2A 3TR9A 3GX9A 3ABZA 1XPGA 1TVLA 1RBAA 4KKXA 4CQCA 1I8JA 3M5VA 4Q4RA 4MZ1A 1MZRA 2Y85A 1YRRA 5F4SA 3OLIA 4Q4OA 1J6OA 1XINA 2HMCA 5EMUA 1E4IA 2B7OA 2VNCA 3PBVA 3PFRA 2I16A 2ZRWA 1CNVA 3BCFA 4M51A 4GIRA 1DPMA 2V2CA 4FLRA 2OWCA 1FXPA 2QUTA 2WNWA 1GQNA 3ZIZA 2FZNA 3RX2A 4JIRA 1FUYA 3MO7A 2ZXQA 1US0A 2VEPA 2CITA 3B9DA 2PU0A 4NYUA 4GUFA 5MKGB 7REQB 4QR6A 2X7WA 4DWDA 1PIFA 1XBVA 3AS0A 1B31A 3A5VA 2RDWA 1FCBA 3C0SA 3PZVA 4TTUA 3QM3A 3DN5A 2OT0A 1EJRC 1XCWA 3WEMA 5IBXA 4TV6A 1QW9A 4UC5A 1EF3A 4L65A 1MXGA 4M5PA 2VFEA 3AROA 4AXNA 4Z0SA 5D38A 4H2CA 4RUBA 4JNYA 3ZLHA 1F6YA 2QDHA 4FX6M 1UKTA 3V0UA 2VRKA 3WK2A 3GNNA 4ZOCA 4Q7BA 1SZEA 2YZ5A 2V3GA 3GO2A 5G2WA 1QMLA 5DCBA 4CUCA 2PWGA 3VKKA 4XO7A 5EU9A 3P74A 3CUHA 4MKSA 3BXWA 1W37A 2FPTA 1OGGA 3APYA 3L0NA 3SGUA 3SUUA 1GYNA 1F76A 3EX3A 2CLPA 3P61A 4HSOA 2X1IA 3QVQA 5KSWA 3SBFA 1IT7A 2EPMX 3TCSA 2J66A 1IF2A 4ZQNA 1BGAA 2REQB 3WH8A 3KAOA 5I03A 1ZGDA 3ISIX 4BI6A 3FOKA 4F48A 3UVAA 4XBKA 5D8ZA 4AB4A 2Y5EA 4UTUA 2WB5A 1CPUA 1FP9A 3OPSA 1J0YA 3VC5A 1HFBA 3NOEA 3G3DA 1QAPA 3GU2A 4ROQA 3TEVA 5AECA 3QQ1A 3LU2A 1LCOA 2CFFA 3KOYA 1R2SA 1DXIA 2QEZA 4JYFA 3TN5A 3UY7A 4AX7A 4RDZA 1QNVA 1W3IA 3CMGA 2R94A 4FHAA 1REQA 1WKEA 4ZQPA 3AU6A 2EPHA 2RDXA 2PRLA 4PTMA 2C6QA 1RP8A 4MNKA 2VR4A 2VFFA 1XSIA 4YYFA 1E4LA 1OGBA 3F4NA 2POZA 1EYWA 2J9XA 3TP4A 1PHQA 5HBFA 3TW7A 4DEFA 3SADA 1I0BA 1FBAA 4RDYA 1MEIA 1POKA 4WJ8A 1UOKA 3STCA 4GY7A 3A64A 2CESA 2JGYA 2DT1A 3FKKA 1PBGA 2VX5A 4ICMA 1XYCA 3H70A 3UR2A 3LSCA 2BXYA 2ISVA 3SQMA 3ME3A 1C7SA 3QQ0A 4JQAA 4XZBA 3WX7A 5JH2A 2XZ9A 1GOIA 1Q6LA 2NWSA 4I9TA 4HNNA 2WMIA 2CBUA 3UQNA 4WDUA 3TMLA 1B9ZA 1QTWA 1W1IE 2F84A 3IUDA 4LUSA 4KT2A 1OYBA 4YS1A 4DRSA 1PX4A 4KERA 4WF7A 2X30A 1TPEA 2EHHA 3A6OA 1HGWA 3F5KA 4XZHA 2OYMA 2WC3A 4MLRA 4RW3A 3TK7A 1JDDA 4HKPA 2GUBA 2QPUA 3UWEA 2FVMA 4UZUA 3LCHA 3WQOA 4P7LA 3LQGA 3W6YA 3NQMA 4V27A 2GSHA 3S6DA 2DH3A 1N2VA 2ZUUA 3S5ZA 2PTDA 3CQIA 5KITA 4BZYA 1OHLA 1Q6EA 1ALDA 4YNGA 4LS0A 3S1GA 3CIWA 4HOWA 3MS8A 1TWSA 3OYZA 1R2RA 2YKKA 4BHYA 1RK6A 4C5YA 4MAZA 2D2GA 4YVVA 1ZJAA 3IRSA 4FZIA 1IYXA 3IANA 3IVUA 4MKNA 1B1YA 1VYSX 2YDSA 3BW2A 4XD4A 2Y61A 3BVJA 2DGAA 2NW0A 3SRHA 4AG0A 2FTYA 2OXNA 3RIKA 3AS1A 2Z7GA 1VFMA 1J5TA 4ACYA 4L6DA 4PTDA 3W1MA 4DXVA 1T8QA 3W1RA 1RALA 4XAFA 1H09A 1HKJA 1C3FA 1F7BA 3QOKA 5BXSA 2Q71A 3EMZA 1RBLA 3H2OA 3OTRA 2E9BA 2ZIDA 2RJGA 4QHRA 3VDBA 1TO3A 4R85A 2VL4A 5TBOA 4FALA 4IIEA 3FCPA 2YFOA 1XLAA 4HOXA 4L6HA 4ZFMA 2BB0A 1EXPA 3EPNA 3P7YA 3LX9A 4MNMA 1EX5A 1YMYA 1MI3A 1DOSA 1SR9A 1FWSA 3E0LA 1XJBA 4P2VA 3E96A 3OODA 8XIMA 3RXZA 3NQVA 1SPQA 4ERIA 1ECEA 4H41A 4N9DA 3LRKA 3S5NA 2VUNA 3T0CA 1R0MA 1ITCA 1S2VA 1JDCA 4ZOAA 4A6GA 3UZ5A 3UXAA 5A6LA 1LBLA 5HA7A 4EXBA 1JRBA 4K3ZA 4KWSA 1DIKA 1MXSA 4R88A 3EOSA 5I77A 2YZRA 4QXIA 2E6DA 1TA3A 2RGLA 5AFDA 2C8NA 2VWTA 2XN0A 5HK4A 5FF4A 1I2NA 1X6UA 4WSHA 1QI3A 4WHBA 2PGEA 1WYIA 4PMNA 3EXSA 3W81A 2MUCA 3VD3A 2WV8A 2E68A 3GR4A 4PFHA 2WJDA 1HKKA 2XIJA 5D9NA 1SZFA 1RA5A 1TV7A 3VNYA 3N2MA 7PTDA 4S3CA 2WHMA 4AX6A 4W5ZA 1LWJA 2FB3A 2DQWA 4QG9A 1EJVC 1PYFA 4PMQA 4DUVA 5EB8A 4W7VA 3BLDA 4FB7A 1OT1A 2NQLA 4I9JA 2WO5A 2EGZA 1IXQA 3WLRA 4O4WA 4JCMA 3WNKA 3TJXA 3M0IA 3NZRA 4JTUA 1MRQA 1VFFA 3KXQA 5DANA 2Z6JA 4GUGA 5AC6A 4OE7A 3PBUA 2CBIA 3N18A 5IHRA 1VBHA 1GUVA 1FFRA 4HCHA 4ALDA 5HNUA 5LXXA 3CH0A 4JTDA 4AEEA 3LZ3A 1PTAA 4XTIA 3S8HA 3VDGA 4ACZB 3CUJA 1J96A 2WWCA 1YBQA 1OC6A 2C18A 3CGTA 4UMCA 3H7VA 4UTTA 1KFKA 3CEUA 1Z44A 1AL8A 1KGWA 1EX1A 3GG7A 1UQZA 1Q6QA 2QULA 1K9FA 3QH2A 1KM5A 4ENLA 5KINA 4DBDA 4F9JA 1S5NA 4AC1X 3INPA 3QTGA 1OZMA 2QHAA 4BQ4A 3MHUA 3KCJA 2XUCA 2KAUC 8CGTA 2X40A 1G5AA 1MO0A 1EQCA 2ISSA 1XDMA 1IGSA 4QQUA 3CQKA 4PBEA 3FW6A 1R47A 1RPKA 5MKGA 4PUDA 7REQA 3PAOA 2YCKX 4XAPA 4BF9A 1WQ5A 1NTHA 2QCFA 1GHRA 1UIOA 1FWFC 1Q2RA 1XLDA 3IAPA 1NJJA 2G5WA 5I24A 4OIFA 3P14A 3QV8A 2PRHA 2R1LA 1JZ5A 4ASTA 2I5IA 3NQGA 1KNWA 4ZB0A 4WOQA 1W1PA 5DQPA 1C9WA 2A3BA 1QOQA 4G7FA 4W85A 1JXJA 4JTSA 4JOMA 1JZ6A 3UG4A 1HL8A 2IKGA 2NVAA 5EL1A 1E6XM 4UFKA 3W7NA 4EF8A 2E28A 4L56A 4CCDA 1NY1A 4XAZA 3DGRA 3TROA 1Q66A 4MYXA 1O95A 4MDOA