4HT3A

The crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 102
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ht3A00
1I2QA 3PSWA 4GUHA 3ATZA 3DKLA 3MYPA 3HMJG 1LP6A 1TMHA 3TW6A 1AW5A 5DCDA 2GJNA 5F4SA 3GLCA 3LX9A 3LXBA 2B7PA 4IJBA 5U7SA 1THFD 4XZ9A 4NVTA 4LVGA 1GT8A 1R46A 3FLUA 4WXZA 2ZFAA 3KRZA 2A4AA 2QUTA 3GB6A 2CLHA 4N6EA 4WX2A 3OIXA 3WJXA 3VCRA 2E77A 3PC0A 4AWSA 1T0OA 4DF1A 1FBAA 4WZHA 4A22A 4JY9A 1FDYA 3NQDA 1KM1A 1WYIA 2X1SA 1PE1A 3VE7A 1YTDA 3WK0A 4G1KA 3MHGA 4IPIA 1LRQA 1R30A 3LTYA 3GR7A 3A24A 4FF7A 4JTKA 1PS9A 3NAVA 1RPXA 4UMCA 4JNMA 2WNZA 1OX5A 4N9EA 1QR7A 1F05A 2NV1A 1G67A 4MJMA 4TMBA 1ICQA 1KTNA 5D02A 3W2LA 3QQ1A 3V75A 3NXFA 4ZVJA 1HG3A 4MY9A 4RV8A 1TRIA 5FF7A 4O13A 1TTJA 1XUZA 3W7CA 3PBWA 1G4TA 1OFPA 3SSJA 1H63A 5G2IA 1AW2A 4YCOA 1GPWA 3GDRA 3NG3A 3CEPA 1F6KA 1JQXA 1TPDA 4BF9A 3W7NA 3KRUA 3P74A 1TV8A 2GJLA 1IXPA 3CIWA 1QPQA 4XBSA 4AEOA 4CCDA 4LTSA 1F74A 4ADTA 3B8DA 5DBTA 4NJJA 1WBJA 3EXTA 3UWWA 4KFOA 2PRLA 4KFPA 1QAPA 2LLEA 5FF4A 5K4XA 4MYXA 2Y7FA 2YYTA 2DORA 3S42A 1VYRA 1DJQA 2PCQA 4HPJA 2VFIA 3DBPA 2QCGA 5EPDA 3NQAA 1M5WA 3MMTA 4B5NA 1SO3A 1L6WA 3TJXA 1NF7A 3KVKA 2OCZA 1LM1A 4AHPA 2EHHA 4EVZA 3QF0A 3IVTA 1Z42A 2VFGA 3G8EA 3N19B 1TPC1 2E6AA 1RV8A 3I68A 3ABRA 1VCGA 1YDNA 1TPEA 1A50A 1VR6A 1LOSA 2NV2A 3HG2A 3DH7A 5EKYA 3AJXA 3S5NA 3S1VA 3TKFA 1JCMP 3UWZA 1KM4A 4JY8A 4CNNA 3LRKA 1C9DA 4JYDA 3LTPA 1OYBA 4UNKA 1LRNA 4X22A 3UPWA 5DN1A 1B57A 3NGJA 2X2GA 1LROA 1YTEA 5D09A 4Z08A 4R33A 2C13A 5DCBA 2WO5A 3DENA 3A5VA 4X3ZA 5FF2A 3LXAA 1H62A 4XQ6A 4E2DA 1L2UA 3L0GA 3MUXA 3WK1A 4AMAA 1JCLA 4NJKA 2CW6A 1AL7A 7TIMA 1SSGA 2VELA 4HT3A 2CFFA 4JTGA 2OT0A 4JGDA 4YLWA 3KAOA 3GX9A 2BWGA 1LYXA 2H6RA 4UTKA 1JULA 4K36A 4AF0B 3NEVA 3TMQA 4RK8A 2JKEA 1LLWA 4PC8A 2DJLA 4MFDA 3K30A 3RMJA 5KZDA 3MI6A 2QDGA 4GE8A 4Z1DA 1W5PA 1OF8A 3HGOA 2ZRVA 3VI2A 2QCDA 3S1XA 3S6DA 1NSJA 2WNNA 4O10A 3SR7A 2E5BA 3HF3A 2GVLA 5CZJA 3IV3A 4FXRA 4E2BA 1K8ZA 2TSYA 3A21A 3S8HA 3L68A 4CCCA 3M5YA 2FB2A 2EGZA 2P10A 3HBLA 3TIMA 4GUGA 1RQEA 3KOFA 4LUIA 4PODA 3E02A 2FB3A 3DFOA 3MP5A 1DJNA 4O1BA 4CNPA 3TDFA 4MZ8A 3UPBA 2QCCA 1H7NA 5F1VA 3WJYA 3LCWA 3TA6A 2J6XA 4YXGA 2FJKA 1TPFA 3LBCA 4GWEA 3EWZA 3EEGA 3TV8A 2DU2A 3NO5A 2YYUA 2I9EA 1TPB1 4L4MA 1OFDA 3W84A 3WJZA 1VLIA 4NU7A 3GKFA 4UIOA 5K9CA 3A5FA 3G1FA 5AN7A 2Y7DA 4S2BA 3NQCA 3BW4A 4XTIA 1Q6RA 4JTEA 4ZQRA 5C55A 4MZYA 1NVMA 1UUMA 5U4NA 4LV9A 4ORMA 1SU5A 1KFJA 4BR1A 5KMYA 4DELA 2RFGA 2ATSA 1JVNA 5LNUA 1JCXA 1W37A 1OG0A 2F84A 2R91A 3F4NA 1A53A 2CLOA 1KTCA 4IMGA 1FWRA 1KM6A 2NX9A 4O1AA 3TUUA 4UMBA 2C6QA 5G1TA 3U8GA 1V5XA 2BLEA 3M44A 3PSVA 2RKXA 1W0MA 4I7UA 3L2IA 3C56A 2WSQA 4NJIA 3THQA 1WXJA 3W23A 4MOZA 1P5BA 1YPIA 1YPFA 1B9BA 1GG0A 3W7HA 5AC8A 4XKYB 5LNWA 3F1QA 3O1NA 4LC8A 1SO5A 4KWVA 3A22A 3S5ZA 4WOQA 2OT1A 5AOUA 1YYAA 3M6YA 1QCWA 2ZRWA 2GVJA 2ZTKA 2GQAA 1ZHAA 1SO6A 2FIQA 4C1KA 2Y6ZA 3QJAA 2EAWA 3E96A 1GYNA 5HUOA 1XCFA 3YPIA 1LBFA 1V7YA 2CLLA 3EKLA 2RHGA 4QQ3A 1BWLA 1C29A 1N8FA 3DGRA 4D2JA 4MLRA 2HS6A 1H5YA 4RLIA 3W75A 3EX2A 2I14A 2E6FA 3L67A 2ZRUA 1GOXA 4GFSA 4Z1BA 2VEMA 4MFEA 2HMCA 3LV5A 4O12A 4O1DA 3LHVA 3PF3A 2ZCGA 3EX3A 2V2CA 1X7FA 5I3JA 3KVJA 1JCJA 4POCA 4KFNA 1DQXA 2A7RA 1PV8A 4DO4A 2E6DA 5AYYA 1SFJA 3NQFA 4AAJA 1KM0A 5HULA 1OX4B 2NXHA 5BW6A 1OFOA 3W2MA 3KVLA 3MJYA 4ALDA 4QISA 4RJEA 4AWTA 1LOLA 3PB0A 2FPVA 2B7QA 3PG9A 1LDCA 3FJ6A 1NFBA 4UFKA 1I2OA 4FXSA 4NX5A 4WY0B 2QCNA 3GZ3A 1QFEA 2X16A 3B4UA 4OV9A 3GDMA 3ABOA 4LV4A 4IPJA 1BWKA 3NYZA 3C2VA 4RX0A 2ATMA 4M6VA 4WJEA 2DJXA 3M5ZA 1I2NA 1UASA 3ABQA 4K37A 4FB7A 1KV5A 3HPXA 5EL1A 5C54A 1XC4A 3GKAA 1DHPA 2DZXA 1JCYA 2YXGA 1O5KA 1A5CA 4FNSA 1LORA 4X9SA 1MEWA 1FCUA 1W3TA 2EPHA 3EWBX 1TQJA 4IX0A 4MUZA 1DOSA 2YDAA 3E12A 1SUXA 1A5BA 5K9DA 3JS3A 3BG3A 2GUUA 5D2WA 1DV7A 2VEPA 1QMLA 1W5QA 3H54A 3PY2A 2QCMA 4Y6GA 2KZHA 3NQEA 4ORIA 3EX1A 2Z6JA 4TMCA 4IOTA 4EF9A 4IXHA 1W56A 5I3GA 2QUVA 1AW1A 1NEYA 4I7VA 2VFFA 2CLKA 4UNLA 5AHIA 1XBXA 5A5WA 1D3GA 1EP1A 1DL3A 2JK2A 3W1QA 4O0ZA 3B05A 3THAA 5GVJA 1EEPA 3BARA 3IGUA 5BOOA 2ZA3A 4N4PA 3UWQA 3T7VA 1YXYA 3IGXA 2HS8A 1QOQA 5F2LA 4JDYA 1EUNA 2YPIA 5HINA 3INPA 3B0PA 4O0KA 3W88A 4CQ8A 5KINA 4O15A 1R2SA 3P67A 4CNOA 4I7WA 3R89A 2ZBTA 1SPQA 4PA8A 4HN4A 1QOPA 1K3UA 1RQHA 4QITA 2OX1A 3M41A 4QNEA 2C15A 4ZQOA 3SFKA 3T44A 3CIXA 2WSRA 2ZRZA 4ADSA 2CLEA 1FCQA 4FO4A 4IXXA 2O7QA 3CC1A 3W3OA 2PRMA 1TJRA 3TQKA 4HSOA 4MZ1A 5I3KA 3GDKA 4BI6A 5K2ZA 3TR2A 4GC4A 3ANYA 1PL9A 1XL9A 1YLVA 3W7GA 3LCFA 1YADA 1IF2A 2H8XA 5CPOA 5FEXA 2Y70A 1U5JA 1D3HA 3DFPA 5L9FA 1I8JA 5HNRA 2WJZA 3C6CA 3QSTA 2AAMA 2GOUA 3JRKA 3PBYA 2W0UA 3CB8A 4O19A 4PCFA 4CCEA 3BLIA 4FEZA 1TRDA 3H55A 3TMLA 3QW4B 2XFWA 2NWSA 1O94A 4LU0A 1PHWA 3EWWA 3VE9A 1FWWA 3W7QA 5A8GA 1FWTA 1OFRA 2GVGA 3PUOA 1VJIA 4HIBA 2QDHA 3TW7A 3GVGA 1EP3A 5DBUA 3M5XA 3NPUA 1SZFA 4OE7A 4RR4A 1A5AA 3G24A 3BK0A 1XI3A 1SW0A 2YX0A 1WOAA 5TBOA 1IGSA 4O28A 3PR2A 4ADUA 1BKSA 4UFIA 4GNJA 2XN1A 2ZZ2A 3T40A 3NL6A 2GPTA 4U28A 3NM3A 3BV4A 4OT7A 3V1PA 4JTTA 3WJSA 2V9DA 1ZY9A 2GQ8A 4JTUA 4O17A 3R5EA 2ZZ6A 5F1UA 1HTIA 1XFBA 3QH2A 3NQGA 4JIQA 1CI1A 4UTWA 2C16A 5T26A 4H6KA 3HJZA 1O5XA 2Z0IA 4ZL1A 5EA9A 3WK2A 5LHEA 1I45A 1WDWA 4MIMA 3LI0A 3ZWSA 4LWWA 1LRTA 1W8SA 1P4CA 3NOEA 4N9CA 2QAPA 2PRHA 5TQLA 3KVMA 3W6YA 3BPWA 1BTMA 3UWUA 1TTPA 1YDVA 3HQ1A 4NNCA 3CU2A 1AG1O 2WQPA 3TFXA 3M0ZA 1M7OA 1ICSA 1SW3A 2V5LA 4IMEA 5DCEA 2H90A 3UD6A 3S0CA 1EX5A 4IMDA 1IXNA 4QSHA 3IIXA 3QMRA 3R13A 6TIMA 2PURA 3NZRA 3W2UA 2DZTA 2TMDA 2OMAA 2ZQ0A 3HG4A 4I9AA 2YW3A 3GDTA 4IWWA 4NT0A 3M5VA 1ADOA 3OHIA 2G95A 2NXIA 3RK8A 3C61A 3LCHA 2WNQA 4N6FA 4BFAA 4ZQMA 2QR6A 4ONVA 3I6RA 1VCVA 3STGA 4O57A 3NVTA 4ZQPA 1OK4A 3N9SA 3D0CA 1R2TA 4N2YA 3SGZA 1IXOA 2QJHA 4WD0A 1ME8A 4X2RA 3RNDA 4DBEA 2W6RA 3W1UA 1MSSA 4IMCA 3C2EA 3I65A 5HQEA 3LRMA 5G2WA 3UWYA 4LRTA 1UBSA 1D9EA 4UTMA 3HGJA 4WOZA 3RFAA 5KSWA 1S5WA 1SFLA 1WQ5A 4J9JA 1Z44A 1KLYA 1M6JA 3VNDA 2X1UA 3KFTA 3S1WA 3DHFA 2QCEA 2RDTA 3IEBA 2HTMA 3E49A 1AL8A 4A2SA 5KZMA 4AXKA 3DFTA 3TAKA 3W72A 5BRBA 5SWUA 1C8VA 3W76A 5I3FA 4Y96A 4DO6A 3G1VA 1SO4A 3HPSA 3P62A 2ZA1A 4MY1A 5HUPA 3TK7A 3C2OA 2Y88A 5HR6A 1GYLA 2B7NA 1TPUA 2CZEA 4HNNA 3PUDA 1S5TA 3FEMA 3ZR4A 1EUAA 1NF0A 1H61A 3OVQA 2FPYA 3LCIA 3U2OA 4QJ1A 3ABSA 4K39A 3RLUA 3SGUA 1ZJIA 2GQ9A 4UUIA 1GVSA 1H7PA 2NUYA 1K7XA 3EXSA 3FA5A 3M47A 1ZAHA 3IIVA 1W5OA 4NXSA 2Q3OA 3G1DA 3LHUA 4BI7A 1O95A 2AQWA 1EA0A 2NUWA 4Q32A 3N3MA 1K8YA 3L66A 3FKKA 5HWNA 3LBMA 4Q33A 4O4VA 5CSRA 4MLJA 1X6UA 3GYEA 3W7JA 1OK6A 2Y61A 3PVFA 5J5DA 1BEUA 1OYAA 4O8RA 4BK9A 4UTWC 3L5MA 1J5TA 1WX0A 5CPMA 4UCGA 4JS3A 3OG3A 1DBTA 3L65A 5CPNA 1RR2A 1SW7A 3P7YA 4JTFA 1ALDA 4R7JA 3DFQA 3L21A 1K03A 3EX6A 2J9ZA 3KXQA 2B0MA 5LKYA 2E6YA 1N55A 3HPZA 1EIXA 3AO0A 4GUJA 4S1FA 4M7SA 3IVSA 5DELA 2JBMA 1KFBA 2Z1BA 1AK5A 3QYQA 4CLMA 1JCNA 2ZZ4A 4DBDA 3ZS4A 4GJ1A 4LVDA 5LGXA 1H7XA 1B4KA 1OX6A 2V2HA 2DZVA 2XN2A 4YCPA 2NX3A 4FHAA 1W54A 1XDLA 2Y7GA 1XBYA 3G1XA 1FWSA 1DORA 1TV7A 3G0UA 3VKJA 2VC6A 1TREA 4Y8FA 3SW6A 3W7KA 4UFMA 2Y89A 2JKAA 2E68A 2RDUA 2I1OA 4MKNA 1Q3NA 1SQ7A 4JD4A 1QPNA 3W1AA 4A21A 4OHQA 1H1ZA 2VOMA 4N4QA 4FNTA 1Q6QA 4LW7A 4N02A 1LTDA 5CG7A 4IX2A 3DHDA 5D2TA 2ALDA 3EXRA 2WSYA 1I2RA 2Y85A 1IIGA 3I7QA 4OBTA 5D37A 4K6AA 3WK3A 1JUEA 3OEXA 3VFLA 4ML9A 1LLZA 3W70A 4GRSA 5AYXA 3P8JA 2ABAA 1KTBA 4HSNA 2FDSA 2JKPA 1R47A 3W7MA 1X8FA 3S1UA 5F2MA 3N9RA 4UTLA 4OV4A 3P81A 3KRSA 4O53A 3ZWTA 1TQXA 2X1RA 3NQMA 5AHFA 3CHVA 1FXQA 3TFCA 3QZEA 3R2GA 2ABBA 5AC7A 4NXKA 3W22A 2BSLA 4UTJA 1OHLA 4O1CA 1DVJA 4FIRA 4BWLA 1VHNA 3CWNA 3O05A 1XUUA 1GQNA 1YTKA 1Q6OA 3L0KA 3CTLA 3PBVA 1T96A 4GUIA 3FS2A 3EX4A 3QQ0A 1OF6A 4LY8A 1K8XA 3IGSA 4HNTA 4H3DA 3TE9A 1VYPX 1GWJA 3SY5A 2Y62A 3G18A 4S2CA 1HO4A 5C2XA 1OFAA 2FFCA 5K4ZA 1QO5A 3O15A 4OWGA 3MHUA 4NUWA 2C3ZA 5G5IA 4UC5A 1GZGA 3CPRA 5D32A 2TRSA 3TC6A 2AGKA 3GXTA 3TROA 1X1OA 3HGRA 4O11A 3T4CA 2DZSA 3B04A 3DAQA 4DPPA 3I7RA 4Z0JA 4LUJA 4UTUA 3NL3A 3P80A 3HG3A 5D05A 4DQWA 1F73A 2Z2UA 3S5YA 3M16A 4JR5A 1MEHA 1MEIA 2V82A 5E0KA 1H7OA 1GTHA 3C3NA 3DXIA 3ATYA 4LS2A 4DF2A 1Q6LA 4K8HA 3F4WA 1W31A 5H2ZA 3LV6A 4O4WA 5EMUA 2RDWA 4EF8A 1LZOA 1UCWA 3FOKA 4MY8A 3LI1A 2R14A 3IVUA 4DO5A 2B7OA 3LHWA 3BO9A 3M43A 3LERA 1JQVA 1KBJA 4AF0A 4FNUA 2X30A 2C1HA 4TR9A 3N14A 4OU1A 1WBHA 1P0KA 3M9YA 3EB2A 4EOUA 5FF0A 4M5PA 4O52A 4NNBA 5DLCA 3G1AA 4DEFA 4LVAA 2A7PA 1FCBA 1PCWA 1TIMA 3G22A 5HMSA 4JIPA 1VLWA 3QSRA 3STFA 5FEZA 2VEIA 1EPXA 4ZZ9A 3P84A 1IXQA 3W1TA 4PTNA 4O18A 2PC4A 3FIGA 1TTIA 1S5VA 3W87A 4JEQA 4JX6A 3SJ3A 1LBMA 3BGGA 2V5BA 3C2RA 3S5OA 3IRDA 2A21A 1XBZA 2FTPA 2QCDB 3W07A 4UXDA 3G3MA 1JR1A 2ZRXA 3S9YA 1TYGA 5HWJA 3TC7A 2QAFA 5J5RA 1H51A 2YZRA 5ABTA 3MWAA 5HR7A 2BXVA 3BLEA 1WOBA 1W3NA 1L6YA 3A23A 1YDOA 1KLZA 5D04C 4NQ1A 2VENA 3OBKA 3PWAA 3W9ZA 4JTLA 1HO1A 3P5ZA 3SECA 3TSMA 4W9TA 3KHJA 4BWLC 1PHQA 4XWUA 2R8WA 1FQ0A 4EIVA 3RU6A 3UZJA 1I2PA 2VFDA 5E93A 4N9DA 3B06A 5IBXA 4MPQA 3BLFA 3LCXA 4NNAA 3MHFA 3NQ2A 5C5YA 2WKJA 2R94A 2CWNA 1PVNA 2J88A 2XN0A 3SIZA 5K9XA 4HPXA 3LLDA 4XKYA 4O50A 1TO3A 3PBUA 3LM7A 1RD5A 5TIMA 1QNVA 2QCLA 2WV8A 1R2RA 3E0IA 5K7JA 1Y0EA 3NPVA 2VFHA 3UNDA 1SZGA 4HNUA 4LNYA 3UQNA 3LCGA 1XDMA 4AHOA 2A6NA 2VKZG 4AH7A 3ZFHA 2ZZ1A 1VGAA 1O60A 2ZZ7A 5CZSA 4Z0SA 1WA3A 4NJGA 2CZFA 3F03K 1TSIA 2VXNA 2J9YA 3LOTA 4UFHA 4JYEA 1TPH1 3MP4A 2C19A 3C8FA 3LXCA 4WQ6A 2E5DA 1UB3A 3CT7A 5EY5A 4Z1AA 3O6DA 3OVPA 5BMWA 3PUEA 4NX0A 1W3IA 5D38A 1FWNA 1KFCA 3M1ZA 3W74A 1LOQA 2EKCA 3BVJA 3IIOA 1B3OA 1ME9A 1JUKA 3NL2A 1ZCOA 1J4EA 1KM3A 3QMTA 5MHBA 2HSAA 3B03A 1L9WA 4R53A 4GUFA 3GAKA 4NZJA 3E9AA 1J2WA 2YCEA 3HGSA 3M7WA 5D30A 1TTQA 3TNOA 4RCXA 1TPVA 3NPXA 5AHNA 3DZ1A 4A2RA 1Z41A 2PE4A 1S3HA 2CLMA 5DY3A 4Q4KA 4KWWA 1ZENA 3HB9A 3PS7A 2A5HA 3MBDA 4M19A 5HJLA 3G0SA 1OX4A 4JICA 5F4XA 1LCOA 1OABA 4JYFA 2OJPA 3RLVA 2Z6IA 2E5CA 3UY7A 2E09A 1ME7A 4UFLA 3QM3A 1YXDA 3NDOA 4CQ9A 3WFAA 3SI9A 2A1YA 3BGJA 2TPSA 1VRDA 1RVGA 4WY0A 3GR8A 4RXGA 3EWYA 3DFSA 4RXFA 3OVRA 2NWRA 5IM51 1CX9A 1H50A 3STEA 3LLFA 3G0XA 2QKFA 4CQAA 4LC6A 3Q37A 1FDZA 2NX1A 4JXCA 1N7KA 3W2NA 4PL1A 3JR2A 5C6MA 1ONRA 3NQVA 1ZAIA 5FI8A 5LNRA 3STCA 1XBVA 3HIJA 1FCVA 5LNVA 2P1FA 2ISWA 4DXVA 1RZMA 2J27A 4HKPA 1QO2A 5CZTA 3TAOA 5BMXA 4UR8A 3GDLA 3TXVA 1E51A 1B4EA 2A7NA 3DU0A 4FNPA 1UJPA 1I4NA 2QJIA 2V2DA 4AHQA 2A6LA 3W1NA 3LB0A 4U4MA 1SR9A 4M6PA 2FLIA 1FY6A 5IBXC 1K7EA 1G6CA 2QCHA 5AHMA 3G1SA 3UYCA 1KM5A 4QIUA 2ZDRA 4LVFA 4P61A 3TQVA 4BI5A 2DZWA 2CLFA 1F2JA 4MJZA 2DP3A 5D33A 3C2FA 3FYOA 3U6WA 2QEZA 1XKYA 3W73A 3GNDA 3WJWA 1G4PA 3LTSA 1CW2A 2OZ0A 2QCFA 3TX9A 4N9BA 3UXAA 3W1RA 1NAL1 1Z48A 4QAIA 2P0OA 1OYCA 2VFEA 1G7VA 4AVFA 2ZRYA 3UWVA 1EB3A 3TH6A 2NZLA 5FEPA 3UY8A 2J9XA 5D03A 4O14A 5G4WA 1F7BA 3SZ8A 2BZNA 2V30A 3NQ7A 3ELFA 1VPXA 5CPLA 2ZYFA 2NUXA 3PG8A 3W85A 8TIMA 4LS0A 3P5YA 1X1ZA 2A2IA 5I3IA 6ALDA 5AHLA 1SZEA 2DZUA 3IIZA 3NL5A 1TB3A 3G8RA 1WAUA 2Y7EA 3NA8A 3W7RA 3BW3A 4YWIA 1KFKA 3LHYA 1LBLA 3G1HA 3C4UA 2A0NA 3O6YX 3LCLA 1EWEA 4JX5A 2YSWA 1JJKA 5AC6A 3L9CA 1OVDA 1PIIA 5LSMA 4UTTA 1KV8A 1YXCA 2QF7A 2FPTA 2YFOA 4C1LA 5BNKA 3FYPA 1KM2A 3W7PA 3W7IA 3HG5A 4FNRA 5LHFA 1GVRA 1QDSA 4UR7A 2ISVA 3DKJA 2O7SA 3G1YA 4TIMA 5D2XA 3TXZA 2EF9A 3NPWA 3GXNA 2YFNA 2V81A 4GXMA 4IGHA 4O16A 4WY0F 3BW2A 4ZQNA 1G7UA 5G2HA 2E1DA 1W5NA 1F6PA 3FJLA 4A3UA 1H7WA 4JTIA 1QPRA 2WOQA 3Q2DA 4UMAA 1HFBA 3W2JA 3QFEA 4LS1A 1FXPA 3W71A 4UTHA 3PM6A 5G1YA 3RF9A 5KTLA 3C0JA 5KITA 4FX8A 5L6UA 4Y9AA 3TQ0A 1GEQA 3MP3A 4JTSA 5CKSA 4TO8A 1MXSA 4ZMGA 5K3VA 4IQLA 5DXYA 2A85A 3N2MA 2ZZ3A 5F2GA 3O6CA 3NM1A 2X1TA 2ZTJA 2D73A 5D2YA 4LT9A 3TSDA 4DPQA 4O54A 3QMSA 1HL2A 4MYAA 1ZFJA 4M6QA 4WXYA 4P2VA 5F2IA 1TCDA 2F7FA 1ZALA 3MW7A 1FX6A 1G4EA 1MO0A 1QWGA 4RZ5A 1T8XA 3W1MA 1U83A 3B0VC 1TV5A 4Y90A 1RQBA 1SZNA 1AMKA 3NR0A 1FUYA 2NXGA 4A29A 1ZNNA 5CSSA 3KX6A 4KKXA 3W86A 5AFDA 2ZA2A 4JDBA 2Y63A 2CZ5A 1GVQA 4PL2A 5E1QA 2H8ZA 1F5ZA 5EYWA 4QNWA 3T55A 2CZDA 2ISSA 3MYOA 4K7YA 1JRBA 3W1XA 1QPOA 4YMZA 3L5LA 3TU9A 2C14A 3LGEA 1XM3A 3H53A 3LDVA 1P1XA 3CM4A 4PEKA 5I3HA 2NLIA 3O8AA 1GVFA 2G96A 1FDJA 5F4WA 2Q3RA 2CU0A 3QRHA 1M7PA 4GBUA 1ICPA 4OGZA 4OQVA 2TYSA 1OFEA 3A9IA 4NZFA 1PCKA 5DY2A 1P0NA 4DF0A 4Z1CA 5AB3A 3FFSA 1T99A 1KA9F 3FKRA 2Q8LA 3O07A 3NNTA 4H4IA 1TJPA 1VCFA 1GG1A 2ZZ5A 3QEZA 1K7FA 3HO8A 2QJGA 4MVAA 4JTHA 4XBKA 3T78A 4QM1A 3MBFA 3O16A 3PAJA 3QW3A 3L5AA 4PH6A 1OFBA 5LZLA 1HUVA 2FQIA 5FEWA 4UTIA 4UTTC 4HNVA 3NZ1A 4XUGA 4FX6M 5G4EA 4K7VA 1ML1A 3LHTA 1GTEA 4E0CA 1Q45A 4FIQA 3L0NA 4LOCA 4PFMA 3NQ8A 4E38A 1OFQA 1VZWA 1H60A 2RH9A 2G5WA 1K02A 3DI1A 4R34A 4UFJA 3W7LA 5EBUA 4L4LA 5H91A 4M7TA 2BX7A 4LRSA 3CEUA 1WV2A 3CWOX 1H1YA 3QC3A 3EWUA 2YGYA 4RZ6A 3MI2A 2DZPA 4K8EA 4FNQA 1SSDA 3MI3A 1VS1A 3UXDA 3W7OA 3IIPA 2YR1A 3W7EA 2BTMA 4FX7A 1VYSX 3CQ0A 4HHPA 3N2XA 3GXPA 1KW1A 2V0TA 2H3DA 4AWUA 5D2VA 3Q58A 3LHZA 1EP2A 3DFNA 3B0UX 1F76A 3TSBA 5CZ0A 4IMFA 4ZQCA 1L6SA 2G97A 1IIHA 5CGQA 3BG9A 3G3DA 1O4UA 2CLIA 3TCEA 2V8ZA 3P60A 1VC4A 4JX4A 1JRCA 3NQ6A 3R12A 5DXXA 1VHCA 3PB2A 2WPBA 4JN6A 2C0AA 3EKZA 1ZAJA 4LVBA 1GVOA 3N73A 1VQTA 2VEKA 4NJHA 1DKWA 1GJPA 2C18A 3DI0A 2J24A 4K38A 3GNNA 2UV8G 4XTDA 4JTJA 3QPYA 1A5SA 3Q94A 4ICNA 3TJLA 3CLMA 1XXXA 3O63A 5LNSA 1EWDA 3I7SA 4RZ4A 2QUUA 5KZEA 4YL2A 5FF3A 3GAYA 3GK0A 3W7DA 3EWXA 4WUIA 4IUOA 3QPZA 1JUBA 3USBA 3P8IA 3W2KA 2Q8ZA 2JGQA 4TX9A 1W5MA 1DQWA 1KFEA 1W1ZA 5LGZA 1H7RA 1G69A 2YW4A 1TPWA 1MZHA 2B4GA 4RKAA 5HWMA 1UUOA 3GIYA 4TU1A 2JGYA 3W83A 1KBIA 3N34A 2W79A 1KFLA 1G4SA 3W1LA 3BG5A 3UZ5A 1VH7A 5FESA 3HOJA 4EWND 3MO7A 3O06A 3W1PA 5AYZA 5AHEA 3PULA 1OJXA 2H3BA 3C52A 3LRLA 3OA3A 3R8RA 2IQTA 3P61A 3P82A 4AB4A
chains in the Genus database with same CATH superfamily
4TV5A 2V5JA 3KOWA 4HSHA 2VWTA 4V28A 1UMLA 3HMJG 1LP6A 1KRBC 1ZUAX 4IJBA 5U7SA 1THFD 3PJUA 3TP4A 3FV9A 4RE3A 3GB6A 2A4AA 3OGVA 1V3IA 1ONWA 4N6EA 3WJXA 4CD4A 3CUJA 2VX5A 2W63A 2WQDA 3OP2A 1PYFA 4TQTA 2WCSA 4MPKA 1E4MM 2BHUA 4WZHA 4JY9A 1Q4WA 1FDYA 2D0HA 3UG4A 4KPLA 2WM1A 1S46A 3PPGA 2X1SA 3KL0A 5HDRA 2YCJA 2ISDA 1PZ1A 2DH3A 5HANA 3A24A 2DIEA 4FAMA 2FGLA 2VGIA 2YLLA 2VQTA 1UWSA 4LALA 2YCLA 2WHLA 2NV1A 4TMBA 4W8LA 3GHSA 3LPOA 5D02A 3W2LA 1HKMA 2BGSA 4S3FA 3IS4A 1WKDA 1WKYA 1QVBA 1TVLA 2Z7KA 2RGMA 4OOUA 3ME3A 4RE2A 3WLIA 1UA3A 1JNDA 4JAWA 1VFSA 4XAFA 2ICSA 1TTJA 1YMYA 3PBWA 2XH4A 1G4TA 4BY3A 5G2IA 4AD5A 5MKGB 4YCOA 1GPWA 3RRXA 3CEPA 3MVIA 4BF9A 4NSBA 3VGEA 2GJLA 9XIMA 3CIWA 3WLSA 1GK8A 1QPQA 1VFMA 1Z32X 1F74A 4ADTA 3B8DA 5DBTA 3EXTA 2X09A 2PRLA 3CZLA 4ZCWA 3VOHA 1QAPA 5K4XA 4MYXA 3APTA 1O1ZA 2PCQA 4HPJA 4FALA 1B90A 2QCGA 3TJXA 4UCFA 1CB7B 3S4TA 2PDCA 4P7RA 4BEUA 3QF0A 4E8DA 3IVTA 3G8EA 3N19B 1TPC1 1V77A 4HMEA 5MF5A 1TPEA 1LG2A 4A3YA 1LOSA 3HG2A 5EKYA 3AJXA 3WNOA 1Z9AA 3S5NA 1W1B1 3TKFA 4CNNA 4V27A 4ZO8A 3LRKA 3T9PA 3B0XA 4S39A 1OYBA 2AGTA 4J3UA 4RPPA 4US5D 2GL5A 1MUMA 3KDOA 2VZVA 1RP8A 2V67A 1HJXA 1XLJA 2GGEA 1YTEA 2X7VA 2PZNA 3AYRA 4CNUA 2C13A 3DENA 4XQ6A 4IIGA 2PGRA 3ARSA 3PP7A 2YCKX 2VELA 2WNWA 2CFFA 1EJSC 4JTGA 4YLWA 1H1NA 2ZC1A 1QNQA 1YRRA 3CUZA 1V02E 4P7OA 4W8AA 2BWGA 4UTKA 1FP8A 4AF0B 1TJ1A 4DJFD 3UT0A 4YJ5A 1LLWA 1DPMA 3V4BA 2BXZA 2DSVA 1ADDA 3MI6A 1OF8A 3HGOA 2ZRVA 5A94A 3I3BA 2JALA 3WX7A 4OZOA 5ABHA 1JCTA 3VIHA 1E9LA 4FXRA 3QLDA 1K8ZA 1EA9C 3BJFA 3A21A 4CCCA 2FB2A 4GUGA 5I24A 2QDDA 3A4XA 4LUIA 3MKVA 4Q8WA 3DFOA 3MP5A 2D23A 4CNPA 4S3CA 1O68A 4AD3A 3K1DA 5A6AA 1FOBA 4LAOA 3K1GA 3EDEA 3VMOA 3FHQA 3KHDA 3TV8A 2YIHA 1N82A 4F4RA 3U2EA 1A5UA 3GXMA 3VTRA 2OX4A 3CAKA 2FJUB 1V7AA 4HK6A 4F66A 3EMCA 4D1IA 3P0XA 4HYWA 4L9ZA 1NVMA 5U4NA 2WCAA 4H9TA 4ORMA 3H4WA 2HK0A 3I3DA 2RFGA 1A5LC 4K1GA 2ATSA 1JVNA 2V69A 4MTVA 2F84A 3VDGA 2CLOA 1FHLA 4JL2A 1MW3A 3AXHA 1OIFA 1BRLB 5G1TA 3H2AA 1MQQA 1UD2A 2RKXA 4NI3A 4I7UA 1TFVA 3L2IA 4MWAE 4A8LA 2HISA 3THQA 1M41A 4MOZA 1P5BA 2VTFA 1E4IA 2QJNA 1NDZA 5H1WA 3O1NA 4LANA 4DO7A 3MV11 4F0RA 2OT1A 4M24A 5A6MA 5A2CA 4GX9A 1YYAA 4C6QA 2ZTKA 2GQAA 1V6YA 1ZHAA 3OLIA 3ARTA 4QFUA 4F2UA 1TX2A 1DIKA 4G7EA 1CPUA 2RHGA 1AH3A 1J2BA 2BVYA 4N42A 5BROA 4JKMA 3VNJA 4DUOA 1VFOA 3R58A 4F3HA 3GNPA 4GFSA 1W9XA 1VFTA 2VJXA 3EPMA 1JD9A 1U1UA 4W87A 2PA6A 5LXXA 2WMIA 1YE6A 5C9XA 2XH2A 1CXLA 1L2QA 4R88A 1X7FA 2V2CA 4MMWA 4E6MA 3M0MA 3PPHA 4AD2A 4KFNA 2X40A 2CITA 3GW0A 4DO4A 4C7GA 1KXTA 1Q6GA 3ZMRA 1SFJA 4GI9A 5HULA 1GUVA 4KH2A 1M04A 2DW6A 4HGXA 1YKWA 2BOGX 4FS9A 4AWTA 4Z2IA 4PMVA 5B7ZA 3QGKC 3FJ6A 2INZA 3WF2A 3W37A 4NYYA 3GZ3A 1V6VA 1E0UA 2IKJA 3ABOA 4LV4A 3H7VA 2C8NA 2J8FA 3NYZA 4I9JA 2PTXA 3QY6A 2AQVA 4DM2A 3M5ZA 3WDRA 1YBQB 4K37A 4FB7A 1Q8JA 2NVAA 4UBPC 4US6A 1ONXA 2IKIA 3GKAA 4KEMA 1W9VA 1E1EA 2VYOA 5J8LA 1PTAA 5FIPA 3ARVA 3T2PA 2GSHA 1W3TA 3EWBX 2RDXA 5C7HA 4MUZA 3PZOA 2QPSA 5CQ1A 5IXEA 4KIRA 2PGFA 5K9DA 1QW7A 4QTGA 3FSUA 2PAJA 1DV7A 2QCMA 4Y6GA 2KZHA 1RUSA 4YHEA 1TUFA 2OGJA 2VZSA 5J04A 2RGLA 4IXHA 2PSNA 3GU2A 3TR9A 3WL1A 1OC5A 4BJHA 1QATA 5A5WA 1XYBA 4S38A 2D2HA 1DL3A 4F9DA 2WHKA 3B05A 1KXHA 1UPPA 5GVJA 4D8LA 1EEPA 2OLAA 3BARA 3EPNA 2POTA 3T7VA 2FMOA 2HS8A 1JZ8A 1QOQA 5F2LA 3W28A 4AZCA 1UKOA 3CHCA 4IIBA 2D0FA 3VKCA 3VGFA 2XVPA 3N15A 4O0KA 3AXXA 2BHZA 4CQ8A 2PLMA 5KINA 2P0IA 3CYJA 4O15A 3FJ4A 4NAFA 3M0VA 4TTUA 3B9NA 2NVDA 3M41A 4JQ1A 2C15A 4PCNA 2ONEA 4Q8OA 4UOZA 5CCZA 2O7QA 3CC1A 2OLSA 3W3OA 3MDUA 2PRMA 4UOQA 1ZZMA 3TQKA 4NG3A 5FJTA 1U5HA 5K2ZA 3ANYA 4LUSB 3W7GA 2A3BA 3NCOA 1IF2A 4GXPA 5CPOA 4CNSA 4PYSA 5CXPA 5FEXA 4GI4A 2ZDSA 2Y70A 4D6CA 1I8JA 2WJZA 4F0SA 4U3AA 2L5HA 2GOUA 5I2UA 1XYMA 4S3GA 4CCEA 1R3WA 2J7EA 3OGRA 1X6NA 2PD5A 1TRDA 3H55A 3AMKA 4JFTA 2W5FA 3TMLA 1O94A 3SN1A 5IDIA 3W7QA 1BYAA 3UJ2A 3BAYA 1FWTA 4OTKA 4DJDD 2OR2A 3TW7A 3SURA 3RILA 4N7QA 4Q7BA 3M5XA 3TQPA 1A5AA 1SW0A 3E2VA 2XVKA 1K9FA 5TBOA 1BXCA 4FXFA 4LBSA 3JVAA 4L4OA 2FZ8A 1BF2A 2ZZ2A 3A4WA 3GBEA 3NL6A 2GPTA 1OC7A 1FWDC 4U28A 4OT7A 4JTUA 1W1VA 5F1UA 5E0CA 1CI1A 2C16A 3MANA 1I9CB 1P6WA 1VENA 2GQ3A 4KIEA 4JIRA 3QKZA 3UG3A 2Z0IA 3WBAA 5EA9A 3BLKA 5GJNA 3DGBA 2QAPA 1XIHA 1XLHA 3OOQA 1Q5MA 1V03A 1U1HA 4Q8TA 2I9UA 3GFZA 1MW1A 3M0ZA 1ICSA 4IMEA 1LQ2A 3UD6A 3S0CA 3AWNA 4LY4A 1B3XA 2BNJA 1PAMA 1T6MA 2PURA 3VIMA 2TMDA 1UR2A 1DWIM 3DYPA 3HU7A 4IWWA 2YCIX 3M5VA 3RM4A 2XVGA 1ADOA 4AWEA 1X97A 2G95A 3C61A 3IUIA 3LCHA 2WNQA 3PFMA 4BFAA 3ANUA 3I6RA 4HTBA 1TV3A 2PDYA 4ML4A 2PDWA 3D0CA 1R2TA 4F0HA 1PWLA 2UY3A 3SGZA 5C9WA 3NO1A 1N8WA 4KCTA 3KLLA 2D22A 4P7LA 1MSSA 3C2EA 1CENA 3UWYA 3LRMA 1UBSA 1D9EA 3HGJA 1H5VA 2VT0A 3CUIA 3ARZA 4PUJA 5PTDA 3VNDA 3E5PA 5EMMA 4O1FA 3S1WA 4A2SA 4AXKA 3DFTA 3N2TA 3WQPA 1HXJA 5I3FA 4Y96A 4Y8EA 5JXQA 5C70A 3G1VA 3L4VA 4PRWA 3HPSA 2Q71A 1FWHC 3GTIA 3QR3A 1XSIA 3AROA 4WDUA 1TPUA 2CZEA 4HNNA 3GIPA 3PUDA 1S5TA 1ZPTA 1SJAA 2OQHA 4WEVX 4Y9PA 3LNPA 2GQ9A 4F0MA 5KZ6A 2OXNA 2NUYA 3EMQA 3FA5A 3K8MA 2QIWA 1W5OA 2XH7A 2EPOA 2WSPA 1XS2A 4BI7A 1O95A 2QYGA 5HWNA 4R9XA 2HWGA 3UG8A 3WH8A 3HN3A 2B31A 3ZJ7A 2XVLA 3GYEA 4LAMA 2Y61A 3PVFA 1EJTC 5J5DA 4O8RA 4IQJA 3T0BA 3RPTA 4W93A 4Q8NA 4QEEA 1RR2A 3I4EA 4JTFA 4UOJA 3L21A 3EX6A 2WSKA 3H22A 4D6DA 3KXQA 3RR1A 3GQYA 2E67A 3OU8A 4WDWA 1GJWA 3UJSA 4GYJA 2Y5JA 1EIXA 3HPZA 1NARA 4PR4A 1W1A1 3IVSA 2JBMA 2X05A 1KFBA 3KZPA 2ZZ4A 4I5UA 4ATLA 5XIAA 4FXJA 4FR6A 1PZ0A 2WXDM 4LVDA 3GUWA 5A6JA 1B4KA 1OY0A 1OX6A 1WCGA 4IISA 3E2SA 4TVCA 4YCPA 3XINA 4K1WA 1T5AA 4LPCA 1YPXA 1FWSA 4DAFA 4Q3MA 1DORA 1TV7A 1J0KA 3G0UA 3VKJA 3VUSA 3W7KA 1V6TA 1W9UA 4UFMA 4J3ZA 4PCPA 3AZTA 4G2DA 4JD4A 2IPGA 3GM8A 2R1KA 3LD5A 1ZBWA 1TA3B 3W1AA 3WH6A 2CBJA 3VVGA 1QK2A 2J7DA 3PJXA 2XSXA 3WQWA 4N4QA 4LYPA 3SN4A 5CG7A 2HNEA 5D2TA 2D2OA 1I2RA 2Y85A 4LB4A 1ZJHA 4OBTA 3L4WA 4B91A 2WAGA 3OEXA 5AC5A 3W70A 4GRSA 3BANA 1KTBA 1X8FA 3QYSA 3I10A 5F2MA 3S1UA 3N9RA 4UTLA 3WLLA 3W02A 3VOGA 3P81A 3V35A 4JIEA 3ZWTA 1TQXA 2X1RA 1X39A 3APGA 2ABBA 4ZSTA 2I7GA 5AC7A 4NXKA 5HJYA 1K8CA 3W22A 1HJSA 1BQGA 4UTJA 1DVJA 2I16A 4FIRA 4BWLA 1VHNA 1F3TA 1YTKA 4O0QA 4MWAB 4W7VA 2J47A 4AEFA 1GQJA 3QQ0A 4LY8A 4PUMA 3MSRA 4Q8QA 3LS9A 3T1GA 1VYPX 1GWJA 3SY5A 3G18A 3VKAA 5BYWA 4DB7A 1J93A 3ARUA 2WMGA 3WEZA 2GGGA 5C2XA 2FFCA 1QO5A 3GTXA 3IJQA 3MHUA 5G5IA 1JZ6A 2DY3A 1Z8AA 1AJ2A 1F3WA 4ERIA 3GVQA 4PB4A 3VINA 3B04A 1YQ2A 3FA3A 3LGGA 6CGTA 4Z0JA 2IQDA 1A5MC 4LUJA 2ZWYA 4QG6A 4D9PA 3FCPA 3D3AA 4ZTXA 1F73A 3DFHA 5HMEA 2Z2UA 3MZNA 3RJXA 1MEIA 5CPQA 3C3NA 3DXIA 3ATYA 3TN6A 4CN6A 4DF2A 3NUKA 1Q6LA 1H4PA 1UIOA 5BRPA 4B3LA 5H2ZA 1IR1A 1WDRA 1GQLA 2PDXA 4MY8A 2DGAA 1EDQA 3BL3A 1OQFA 3WNLA 1E15A 1JQVA 2BY2A 1V8EA 4ZOCA 4FNUA 4OUEA 3GC2A 2X30A 1R9YA 4OU1A 1WBHA 1MWOA 1MDLA 2PLKA 3DFYA 4K68A 4H00A 4EOUA 5IFTA 4M5PA 4NNBA 1LWIA 3WQGA 3G1AA 2QMJA 5A8PA 3N17A 4J40A 3UW6A 1FCBA 1PCWA 1XIDA 3WBXA 3OIHA 4REQA 4J3XA 3G22A 3QSRA 2VEIA 1KKRA 2G3JA 4HP5A 1J01A 5JIWA 3KOXA 3C2YA 4WSHA 1QI3A 2O0TA 5E9AA 3W87A 2OZ3A 5EU9A 1KBLA 1AVAA 3QBUA 3H4XA 3FY1A 4GVGA 4B5VA 4XIAA 2Q01A 1VPYA 4UXDA 4HNCA 2JQXA 3DN5A 2ZRXA 1M3UA 1V3HA 4HA4A 3WEOA 2IKHA 3AMDA 1YE4A 3SCPA 1YHTA 1EQCA 5J5RA 2YZRA 3EWDA 2BXVA 3BLEA 2P53A 1CIUA 3W24A 4AD1A 2VENA 2O92A 5EFDA 3PWAA 2VD9A 3WY1A 3QZ6A 2GLKA 4JOMA 4RNHA 1EGVA 4BWLC 2R8WA 3TCSA 2FVMA 3EDDA 1I2PA 5E93A 4XAGA 1KCZA 3MY9A 4IIDA 5M03A 4XIMA 3NQ2A 3VNYA 3SQLA 2YA1A 2CWNA 3OYXA 2DEPA 3SIZA 3NURA 4HPXA 1QUMA 3LLDA 1XSJA 4J35A 4F0KA 2ODOA 3VNIA 9RUBA 2BDQA 1DE6A 2QCLA 1R2RA 3E0IA 2PP1A 4RE0A 1WO2A 3LM3A 2PGEA 4CU8A 1US3A 5ENLA 4RNIA 2A6NA 4AH7A 3ZFHA 1VGAA 4Z0SA 4NJGA 4PUUA 3F03K 1TSIA 3LOTA 2J9YA 4UFHA 1WPCA 4A3QA 4PUWA 3C8FA 3SO7A 4WQ6A 2E5DA 3CT7A 5EY5A 3ZJ6A 2PU0A 3OVPA 4DYJA 3PUEA 4LQ1A 4NX0A 2WK2A 3SUUA 1FWNA 3SJNA 4AC7C 4EE9A 2EKCA 4DYEA 4YPJA 1B3OA 2XWDA 1MRAA 3TNBA 2HSAA 1L9WA 4R53A 4JHMA 2YCEA 5DMNA 3REQB 4AYGA 3NTYA 4RCXA 3URNA 4W8BA 3N25A 1JF6A 2V6AA 3D3FA 4LAUA 4GPNA 2PE4A 4JKKA 2ALRA 1S3HA 2CLMA 4TXEA 1R3TA 3DCPA 3H2EA 1EHNA 3B9OA 2HPMA 2R1LA 3MJMA 4C6CA 4NRRA 5HJLA 4GMEA 1PIGA 1OX4A 2PDIA 1C92A 4DRSA 4W86A 4ZOEA 3CQHA 3SCVA 4B16A 1TV2A 2UZ9A 2QJJA 1E1CA 4XUYA 4F40A 3LPFA 4GVHA 3SI9A 2A1YA 1ZBKA 2OQLA 2TPSA 2DPEA 1ZLPA 3KS6A 3EWYA 1E56A 3OVRA 5BXSA 3LLFA 5BWFA 3UFYA 3ARPA 3CZ8A 4H9XA 2NX1A 4W7WA 1OB0A 3CHFA 1UR1A 5DANA 4CD8A 1ZJBA 5LNRA 1Q7QA 1C93A 1W1PA 1W3KA 5LNVA 2WZTA 2ISWA 2IPJA 2J27A 2OSXA 1M9HA 2A3CA 1KQZA 1QO2A 5CZTA 4PSPA 4C1NA 2G41A 2A7NA 4ZB5A 1A3HA 4LXFA 3OLEA 1HKIA 3VO0A 2A6LA 3LB0A 3G2GA 4QIUA 4LVFA 2DZWA 1F2JA 3TTOA 2GJPA 4X9YA 5D33A 3WN6A 4GY1A 1H0GA 3PZIA 3AIQA 2EG8A 2PF0A 3GNDA 4D6FA 3R0DA 3EZ4A 1CW2A 1V6WA 2OZ0A 4W5UA 4GG9A 3RPDA 3W1RA 1NAL1 4QAIA 3S9IA 1G7VA 3F2DA 4PB5A 2QIIA 1RA5A 4ATWA 5FEPA 5H8UA 4YTTA 5D03A 1GJUA 2TODA 3UZXA 1TUXA 3IACA 1YNQA 3VXGA 3NQ7A 2QS8A 1BLIA 2NUXA 1HVXA 3S2MA 3FDGA 3ITCA 3VZZA 3W85A 1GVIA 2GGJA 3ARWA 3GHRA 1E5JA 3S46A 5CH9A 3TVAA 4GYFA 1SZEA 2DZUA 5E70A 7A3HA 3IJ8A 3L4TA 4E2OA 4ATDA 3CLWA 3W7RA 1DJXA 1LBLA 2ZX9A 3W25A 4DJDA 3LCLA 1EWEA 3MZ2A 4JX5A 4DWSD 3WLTA 1EJ7L 4MNKA 1E6PA 4F0LA 1YXCA 1DWFM 2OQYA 1IT8A 2CC0A 4GQRA 1F6YA 2VC9A 1QHZA 3TA9A 5BNKA 2Z1XA 1HQTA 4A3HA 4UR7A 2A3HA 3G1YA 4EX4A 5A8QA 3TXZA 3NPWA 3PZUA 2YFNA 4O16A 1ODUA 1G7UA 2NQ9A 1A3WA 1OCNA 1HFBA 3W2JA 1V0LA 1FXPA 3W71A 2V3GA 4L1XA 3N3TA 5KTLA 2VX6A 5L6UA 3ARYA 4DZAA 3TQ0A 5A6BD 1UQZA 4PMXA 5CKSA 1MXSA 4ZMGA 3IUHA 4IQLA 3DHUA 1DIEA 3AMLA 4QE4A 5F2GA 3APYA 1JPDX 2FYMA 4PMRA 2Z1VA 3TC3A 4QCEA 3WELA 1A5OC 1MVYA 4WXYA 3L7RA 4P2VA 3RX3A 2YBVA 5F2IA 1TCDA 1XH2A 2AKMA 2G3MA 3W1MA 4IPLA 4HU3A 1XH1A 4KETA 1U83A 3C8NA 4H9YA 4U2ZA 1EOMA 1AMKA 1EXBA 2OWWA 4L6HA 2J66A 5CSSA 3KX6A 1E6SM 4MJ2A 1PO9A 1EC8A 3B9DA 3H2FA 3QQWA 4NY2A 2CZ5A 3WMBA 4PL2A 4QBXA 5BWAA 5EYWA 4LYRA 3RHGA 4AW7A 3NVDA 4PUEA 1JRBA 1OD0A 2J79A 3AOFA 3TU9A 2Y2WA 3H53A 4GFIA 3NSNA 3CM4A 1SFSA 3PZNA 2G96A 1FDJA 2QXWA 5F4WA 2Q3RA 2CU0A 4OGZA 1M7PA 3BZJA 4GBUA 1PCKA 2OEKA 5E0FA 4DUWA 5AB3A 2Y4SA 1GKQA 3FKRA 4D6JA 4XZLX 3NNTA 2EPNA 2E9LA 3PTMA 1RH9A 3HO8A 4JTHA 1J18A 1OGGA 1KXVA 1HKVA 4DJDC 3QW3A 4BCEA 4IICA 3M0JA 1HL8A 3TLLA 3NZ1A 4HA1A 4A6GA 3O7UA 3SRKA 4XO7A 1TKKA 4FIQA 3L0NA 2CLPA 4E38A 2HVNA 3GG0A 2VMFA 1H60A 2G5WA 3W7LA 5I00A 1ISVA 5EBUA 4M7TA 3CEUA 3CWOX 3ZLGA 1LUCB 1XCWA 2XINA 4FNQA 3MI3A 5FJJA 1VS1A 3N4FA 1Y8BA 2XM1A 3MS8A 3NEHA 1UZDA 2BTMA 3CQ0A 5A6SA 3N2XA 3WLNA 3GXPA 4E5TA 4AY1A 3H12A 3B0UX 3TSBA 1VFLA 4CVWA 3G77A 3TN5A 1IIHA 3FYYA 2V8ZA 3V16A 4MM1A 4JX4A 3EB4A 3NQ6A 3R12A 2JE8A 2WC7A 3MMWA 3FGCB 4B5TA 2H9AA 3EKZA 1GVOA 2VEKA 4NJHA 1DKWA 2TAAA 4PUDA 1KD0A 3GNNA 2UV8G 4JTQA 2W62A 3Q94A 2YBUA 3BCJA 5LNSA 3EOSA 3QOMA 3SIMA 2OOGA 4RZ4A 1F3XA 4PRRA 3B8WA 3GAYA 3LYEA 4DXXA 1K9DA 4H9ZA 3WBYA 3ABZA 4B9YA 2A3AA 2JEPA 3BDKA 2Q8ZA 5D4YA 3MMUA 4A3RA 4DJEA 2YA2A 4RKAA 4IJRA 4IJCA 4TU1A 3PZMA 1I0BA 3AMGA 1CLVA 1TWZA 3BG5A 5FAJA 2WJDA 3H26A 3QOKA 1ITQA 3UZ5A 1VH7A 3K2GA 2DZAA 3WQDA 5AYZA 3UCCA 3PULA 4W5ZA 1XLGA 4RV3A 3C52A 3R8RA 1QK0A 2HEJA 4AB4A 1W1IE 3ATZA 1TMHA 3TW6A 3EA2A 1AW5A 1OD8A 2F6KA 3LXBA 2B7PA 1CGUA 1AH0A 3EDKA 1EIBA 4NVTA 3M0KA 5DRCA 3P14A 3FLUA 1W91A 4A8IA 2DVUA 2ZFAA 3FEQA 3M0IA 3OIXA 3WQEA 3WF3A 3R43A 4FOJA 2X0HA 3VCRA 2E77A 1BAGA 4IP4A 1WDSA 2DIJA 1KM1A 4QJ4B 1PE1A 3VE7A 3HV8A 2XG9A 4IPIA 1BVNP 3QV7A 4H6QA 4NZ3A 5FJRA 4DI9A 1GHRA 1RPXA 1DJWA 4IFOA 1QR7A 1A0CA 1XIJA 4KQNA 2A3EA 1ICQA 1KTNA 3DHPA 4QRNA 2RJGA 4B92A 2WZHA 3SADA 1HG3A 3E0VA 1PZ2A 4C6IA 1ITXA 1TRIA 3VDAA 3TN3A 2WYSA 1XUZA 3H8AA 3PHAA 1ZP4A 3GDRA 4U31A 1F6KA 1HW6A 3GNOA 3W7NA 3K4WA 2PI6A 4JZ5A 1YDYA 3M0YA 4XBSA 4CCDA 5EB8A 4LTSA 2EXOA 1KC7A 1WBJA 3AQUA 2WBKA 3BLOA 1QRQA 1WZKA 3WL0A 2YYTA 2DORA 3ZIZA 5CC7A 4JNZA 3B8TA 2VFIA 3BCFA 5EMKA 4B5NA 4HYVA 1NF7A 3KVKA 1C7SA 1XFCA 2CETA 1LM1A 1TR1A 1C8XA 2VFGA 1AUSL 3URAA 1UR9A 4DJEC 1RV8A 2V5CA 4JTCA 3AHYA 3GH7A 3S1VA 4AX7A 4HCLA 1JCMP 3UWZA 4AIEA 4JY8A 4AXNA 2INFA 3LTPA 4UNKA 1LRNA 1UWIA 2PDKA 3CT2A 3UPWA 5DN1A 1MXDA 1B57A 8XIAA 3NGJA 3E0LA 4AZIA 1DEDA 4G8TA 3ARRA 3A5VA 4X3ZA 3LXAA 4M6UA 5IRPA 4AMAA 4NJKA 2CW6A 4CGTA 1J79A 1I0DA 2GK1B 3K5XA 4EAYA 3DEQA 4GIRA 4ZFMA 3VOIA 3QVQA 2BY1A 1LYXA 4UQCA 1JULA 4K36A 4IFKA 4L7ZA 3WQ5A 2OG9A 2WM0A 3K30A 3RMJA 5AZ0A 4GE8A 1MW0A 3VI2A 2QCDA 3S1XA 3ITYA 1Q65A 2ZX8A 3A12A 4O10A 3SR7A 3HF3A 2GVLA 2GDUA 4YIWA 3IV3A 5HQLA 4TVUA 1OGBA 1GVEA 4FSAA 4X0NA 4QLJA 2P10A 3TIMA 1RQEA 2DFAA 2C0HA 2BB0A 3KOFA 4C5ZA 3JU2A 5EMLA 2AOSA 2WC3A 1H3GA 4NAEA 4O1BA 4MZ8A 1PB0A 2WHMA 3UPBA 4LCRA 3AIUA 1V3MA 3WJYA 2J6XA 4H2CA 4PUNA 3RPMA 4PTDA 2W27A 3CH0A 3NO5A 4RDZA 2YYUA 1TPB1 2R1PA 4L4MA 3VDBA 3W84A 4EWJA 4UIOA 4NZ4A 1PYMA 1TCMA 1XIFA 3A5FA 3G1FA 5AN7A 5HK4A 1Q6RA 3FVDA 4ZQRA 3BMVA 2DQWA 4P7NA 1HP4A 1Q85A 1UW9A 5KMYA 4DELA 3MU7A 1Q7MA 2NQHA 1K4HA 1JCXA 1OG0A 3O3RA 1DYSA 1FWRA 4H9UA 1R7AA 3STPA 4QAWA 3SCUA 2BGNE 3TUUA 3KS5A 3M44A 1UJQA 2OFJA 3C56A 2ZICA 1TWIA 3V36A 1PX8A 3W81A 1NIUA 2O9RA 4V33A 3WFZA 1YPIA 1B9BA 2YA0A 1GG0A 3RMEA 3SCOA 5AC8A 1XGZA 4XKYB 5LNWA 1H11A 5CBBA 4C6EA 4IPPA 1GCYA 4LC8A 2J7FA 2D3NA 1XWYA 1SO5A 4KWVA 1EJVC 1VEMA 3K8KA 4WKAA 4WOQA 4AZ5A 3TYEA 4WCJA 4FZIA 2ZRWA 2GVJA 1OBAA 5DFAA 1UC4A 1BSIA 1O7AA 1VBGA 4C1KA 3C0QA 3QJAA 1VBJA 2DT1A 2EAWA 3S5SA 3E96A 1GYNA 1V7YA 1UZ4A 1GOKA 4QQ3A 1BWLA 1C29A 1A47A 4HCHA 4M1RA 3DGRA 4RZBA 4D2JA 4MLRA 1VFUA 4DYKA 2HS6A 3W75A 3WD4A 4ZE4A 1FH8A 2BG5A 3RGTA 2E6FA 3L67A 3BJSA 1GOXA 5C2CA 3AHXA 4MFEA 2CBUA 2XHYA 3N2OA 1OT2A 5FJPA 3C86A 4XV0A 2ZCGA 2WLZA 5EFFA 3HMCA 3VNMA 4POCA 5CC5A 5GJMA 3GO2A 1DQXA 2A7RA 3PANA 1E40A 3ZLHA 4Z2GA 2E6DA 2DVXA 3NQFA 1KM0A 1P1MA 4ICMA 2NXHA 3LY0A 1U22A 4AVNA 3W2MA 4Q4RA 4ALDA 1YIXA 1P0BA 3T0DA 3PB0A 1WZAA 2FPVA 1LDCA 1Q6CA 3KBVA 3TYBA 4H01A 4UFKA 2PDJA 7TAAA 4MSSA 4WY0B 3CNYA 1KO0A 3K8LA 1QFEA 2X16A 3OQEA 4OV9A 2EG7A 3MO4A 4IPJA 3OVGA 3ZXWA 4NHVA 4E4PA 4WJEA 2DJXA 2BOFX 1UASA 3KOYA 4WVXA 1YNPA 1PJ9A 1V3LA 3HPXA 3OHMB 4W84A 2DZXA 5EGRA 4TOQA 1O5KA 3UETA 4DZ5A 1LORA 5GNYA 4DWSA 1MEWA 1R7OA 3QC0A 1FCUA 2EPHA 2YL8A 4CQDA 2QULA 1A5BA 2FVKA 1M68A 3BG3A 1UWAA 1W5QA 4GZ7A 3H54A 1OWQA 3PY2A 2REQB 4HJFA 2Z6JA 1TVNA 2HROA 1ZP3A 4ECLA 2QGHA 3W27A 5CEWA 1VPQA 2BY0A 5I3GA 1FH7A 1AW1A 1NEYA 5G4HC 4JFVA 4C90A 5AHIA 3RXZA 4QDWA 3VOFA 3UA4A 2IKGA 4JQAA 5LA0A 2WZEA 4H8VA 4LCQA 3WMSA 3THAA 4MKVA 3AALA 2ZA3A 3UWQA 3NZGA 1XG4A 1YXYA 3VYLA 3NIYA 3N6HA 1ITUA 1DJHA 3F4VA 4IG2A 1XHGA 1EUNA 3BAIA 4NIRA 3AXIA 2YPIA 3QHNA 2Q09A 3B8UA 4UQEA 5LIWX 4HK7A 1Z7AA 4ERGA 3P67A 4CNOA 3N4EA 4I7WA 1NJJA 2ZBTA 1UC5A 1K3UA 2CXEA 5TAOA 4ZQOA 3T44A 2WSRA 4ADSA 2CLEA 4HMDA 4KMQA 3U0HA 3A9BA 1HIZA 1EJUC 4BI6A 2DQXA 3PPCA 3TR2A 3IRSA 1BGGA 1X8CA 1CB2A 1W32A 2GWNA 5CSYA 4PUKA 3QR1A 3L4UA 1HJVA 1M01A 1CXKA 5EBAA 1DWGM 3SB0A 3VD3A 1D3HA 1XLEA 3DFPA 2Z29A 5L9FA 1FH9A 1JYWA 1C90A 3LZ3A 1BSLA 2W92A 2DH2A 4O19A 2W0UA 2OZTA 4B3ZA 1M7XA 3R25A 3LNMA 3BLIA 4FEZA 1U30A 1IE7C 1NDVA 3QW4B 2XFWA 2VX4A 2NWSA 4QSFA 4ZOBA 1K70A 1PHWA 3VE9A 1PKYA 3ID7A 1Q13A 4L5ZA 1OFRA 2GVGA 1JAKA 3AC0A 2J7BA 3ZVHA 2VUNA 1QXLA 1UUQA 1XLBA 1IYXA 1SZFA 3WZ0E 4RR4A 1WE5A 3RX4A 5FL1A 3IJIA 3BK0A 1K1DA 3V5OA 1WOAA 3ZZ1A 5FSDC 4O28A 4PBEA 3VNLA 4CNTA 4AQLA 1UIPA 4DWSC 1DHKA 2XN1A 3VGGA 2HK1A 3GXIA 4HPNA 1SGJA 3VOCA 2HPIA 1N2VA 3URBA 3NM3A 5HOSA 2QGYA 1ZY9A 1XP3A 2GQ8A 1XYAA 2FTYA 2XFRA 3R5EA 4W88A 2OTDA 1XFBA 3OZMA 1WP6A 1D3CA 3HJZA 4D6IA 2PDQA 4HZMA 4ZL1A 2AAAA 3OTRA 1P0DA 3LI0A 4LWWA 2I56A 2GVYA 3WCZA 1W8SA 1PX3A 1PKNA 3W6YA 4F8XA 4S3DA 4NNCA 1YDVA 5JH1A 4DUVA 5REQB 1WZLA 2XISA 3ZO9A 3KM8A 1EX5A 1FA2A 4IMDA 4QSHA 1IWPA 3R13A 2C71A 6TIMA 5F7UA 2DZTA 3S9ZA 2ZQ0A 2JF7A 3HG4A 4KW2A 4ZEPA 1BFNA 4ES4A 5CLTA 2PP3A 3R94A 2NQLA 2EO7A 5JVLA 1NFGA 3OHIA 4J28A 1NQ6A 3DX5A 2QR6A 1KFWA 5A3HA 1RALA 4NASA 1VCVA 4O57A 3NVTA 3LSBA 1YNYA 1OK4A 3QY8A 3A6OA 4N2YA 4MAZA 1ME8A 4HOWA 3RNDA 4W89A 2NLYA 4IMCA 3I65A 5HQEA 3EB3A 6REQA 1NWUA 4E3TA 4UTMA 3COTA 4WOZA 3RFAA 3BSMA 5KSWA 1HGYA 1Z44A 3N1AA 3ES7A 1M6JA 3KFTA 3BXWA 4GVFA 1HF6A 3FX4A 3DHFA 2AL2B 4XZIA 5KZMA 3NOYA 2VZUA 4H83A 3JZUA 4R3UA 1AQMA 5IOBA 4R7OA 1NWRA 4DO6A 1KWGA 1VJSA 1EJXC 5HUPA 1TX0A 4D8AA 1KXQA 2VUYA 4PB3A 2INEA 1Q6DA 2FPYA 4HU4A 4HOZA 4K39A 3RLUA 4AIOA 1H7PA 2XZ7A 5JBDA 3EXSA 3M47A 3LSCA 3V1HA 1LQ0A 1IR2A 2OYLA 1S2AA 4AU0A 7REQB 3LG3A 1F07A 4LBRA 1Q66A 2GZXA 3LHUA 4E4FA 4LBUA 3B8SA 1PTDA 2NUWA 5AVHA 3AAMA 3LBMA 3LPGA 1QNRA 1A5NC 7ODCA 1B2YA 3W7JA 1NWSA 5T91A 3PNUA 3L5MA 1WX0A 3KRBA 1EZWA 3JZEA 1SW7A 2AQOA 3FAXA 4R7JA 1K03A 2DV0A 1RCOB 2YJQA 3HM7A 5LKYA 4WR3A 4S1FA 5DELA 2Z27A 3UVIA 5HATA 4GJJA 1V4YA 4HMCA 1AK5A 3QYQA 3ZS4A 1I60A 1XLLA 1RY8A 2VGFA 4GJ1A 4YVPA 3VDCA 3NZQA 5LGXA 3PBMA 2XN2A 1QOXA 2NX3A 5BXTA 4U10A 1XBYA 3G1XA 1XW8A 1Y5VA 3KL5A 1TREA 5AYIA 2Y89A 2JKAA 2E68A 5C8BB 1SQ7A 1JXKA 4H1ZA 1D8CA 4A21A 2V3FA 3WD3A 1KQYA 1H1ZA 1Q6QA 4LW7A 1LTDA 3DHDA 3KOZA 2ALDA 2QV5A 4JCMA 2PDLA 2WSYA 1XRVA 2EPKX 5D37A 2OO0A 3WK3A 5MKGA 4ML9A 5AYXA 3P8JA 5BU9A 2FDSA 1R47A 1CYGA 3VCCA 3ZR6A 3F2BA 4PTVA 4L4PA 3CUXA 5AHFA 1VJZA 4QG9A 3ALGA 4GH3A 3ZSTA 3GSMA 3WH5A 3KP0A 4O1CA 1NH6A 1GQNA 2VQUA 1V79A 1T96A 3AHVA 3FS2A 1NOWA 4PFHA 1OF6A 3POCA 2YL5A 2Y62A 3ECQA 4S2CA 1AQHA 3SRHA 1FKWA 4OWGA 2C3ZA 3Q67A 4GISA 1TR9A 1AQFA 4UC5A 3TOPA 3CPRA 4BA0A 3HURA 2TRSA 2AGKA 3GXTA 3HGRA 1CGYA 1WKEA 2XIQA 4WRHA 4C7FA 4C6NA 3P80A 1Q2RA 4DQWA 1I1XA 2Z24A 3S5YA 5JH2A 3RAOA 3F4WA 1W31A 4C7DA 4O4WA 1IZKA 1TIWA 1E0XA 1LZOA 1UCWA 1GNXA 1UP3A 3LI1A 3IVUA 2MNRA 2ANUA 4ZBCA 4DO5A 2B7OA 3LHWA 1XD1A 1T40A 3TZNA 4AF0A 1DE5A 1CGTA 7PTDA 3N14A 1E9YB 3WLQA 3MCNA 4WGHA 1B3YA 4RPQA 5FF0A 2P50A 1UROA 4IM4A 2HVOA 1XKJA 2PDGA 2QZRA 3VMPA 3WQFA 2OLHA 3MC5A 1VLWA 1WUFA 1NFPA 3QFWA 3N29A 1UKSA 1FHUA 3P84A 4KCWA 1IXQA 4XZBA 2EKGA 4O18A 1S5VA 4JX6A 1SZRA 3SJ3A 1CT5A 3BGGA 4HTYA 3C2RA 2DUAA 3IRDA 1B5TA 2A21A 4Q4PA 1HP5A 4XSLA 2WBGA 3G3MA 1KRAC 4MNMA 4V2XA 3KEHA 1LJYA 3UJFA 2GJXB 3CPGA 3WDHA 5I02A 3TC7A 3VX0A 5BU6A 4CD5A 1H51A 5HR7A 1MNSA 1W3NA 3A23A 1YDOA 1OCBA 4NQ1A 4AY8A 4J1OA 3NDYA 3U2ZA 4JTLA 3P5ZA 3UCQA 3AJ7A 3ENLA 3BLLA 2WVSA 2HZGA 3DESA 1FWGC 3KHJA 4PGLA 4JHZA 3Q45A 5E6ZA 1BRLA 5IBXA 3IK4A 3BLFA 3B97A 4DY1A 2R94A 2ASHA 1DJZA 2B81A 2XN0A 1EXPA 4WDXA 1CECA 6ENLA 4RE4A 1TO3A 4LF1A 1RD5A 5TIMA 2WV8A 3FHAA 5K7JA 3NPVA 2VFHA 3D6NA 3V0TA 4HNUA 1XDMA 1SM9A 3WUFA 2ZZ1A 2ZZ7A 1Z6KA 3AZRA 1S2VA 4KCVA 3D47A 3MP4A 1QU4A 3LXCA 3VKDA 3V3WA 2Y8KA 3F5JA 5LIYX 5BMWA 3DYMA 1GW1A 4OECA 4HYRA 3M1ZA 4GJIA 4ROPA 2V3DA 4B5WA 4EP8C 3IIOA 1JUKA 1ZCOA 1AQ0A 4EXBA 1FP9A 3B03A 4GZEA 4R9OA 1UZHA 4Q8MA 4NZJA 1GKRA 3MVTA 4RDYA 4C5YA 3L12A 4NILA 1PIFA 1O5RA 1TPVA 3NPXA 4A2RA 1Z41A 4KRUA 1WAWA 4LSBA 4B3KA 4B2DA 1K9TA 1IWAA 4Q4KA 4KWWA 2XSBA 1ZENA 3HB9A 4I6KA 3MBDA 4M19A 2E0PA 4Z2HA 4JICA 3SCWA 1OABA 4JYFA 2OJPA 1A0EA 3EWCA 2Z6IA 3SM0A 4PZVA 8CGTA 1UMYA 5EMJA 2GDVA 4CQ9A 3PTDA 3CV1A 1UD3A 1RPKA 4GI8A 4YHGA 1C7TA 4GQ0A 1DJIA 1XLCA 3DFSA 1CX9A 1H50A 3STEA 2QKFA 2A3LA 1E6RA 1FDZA 3BH4A 1YBQA 4ASTA 1CXEA 3JR2A 5C6MA 1ONRA 1BVWA 1ZAIA 2NT1A 3STCA 1XBVA 3HIJA 1FCVA 2Q6ZA 2P1FA 3OLGA 1PTGA 5HAOA 1G01A 3T2QA 5BMXA 3TAOA 4UR8A 3TXVA 4YYCA 3RRAA 1JFHA 2JF6A 1UJPA 2VCCA 3CWHA 2QJIA 5FSEC 4C60A 4AHQA 1J0ZA 4U4MA 1SR9A 5IBXC 1K7EA 1W3LA 1G6CA 2FFIA 4QE5A 3G1SA 2R9RA 2ZDRA 1JL8A 3TQVA 1FWJC 2J13A 4OFCA 5T9BG 2CHOA 5CJ5A 3FYOA 3U6WA 3TYDA 3E38A 1XKYA 1BQCA 3DC0A 3WJWA 2Y0FA 1IEIA 2NQZA 3UXAA 1EH9A 1IEXA 3CMJA 1Z48A 3WKZA 1OYCA 4AVFA 2C1GA 3WLOA 1RJRA 1EB3A 3TH6A 2FZDA 3KE0A 4BQ2A 4NZ1A 4HNOA 3WQCA 4HA3A 1VPXA 2QDEA 3PG8A 2X0YA 4S3BA 8TIMA 5BCAA 4KESA 3OPSA 1R9ZA 6ALDA 3QN3A 3CL6A 1WXZA 3NL5A 3EOEA 4YTRA 2VI0A 3NA8A 2W4XA 3G1HA 2DT3A 2A0NA 2PDMA 1IT7A 1JJKA 3IJLA 5CC6A 3LPPA 3PWGA 2QF7A 2YFOA 4LUSA 4C6FA 3FYPA 2FZ9A 2ZXBA 1R8LA 1GVRA 3DKJA 4TIMA 4JHOA 5DMYA 2EF9A 3M07A 3RCMA 2V81A 4H2HA 1JI2A 4ZQNA 2PWGA 2ZE0A 3LBOA 2E1DA 2QNEA 5G2HA 2WVVB 1W2VA 3FJLA 4A3UA 4ZR8A 4YS1A 2EJAA 3Q2DA 3ITGA 2DT2A 3M64A 4XO6A 4LS1A 2ZUMA 3WLHA 5AC4A 3UXIA 5G1YA 3L2MA 3S47A 3I6EA 1OSEA 5KITA 1RD6A 1W9DM 5LA1A 4B5SA 1JPKA 4X60A 2VOTA 1EF3A 1A80A 4M81A 3RCYA 2ZZ3A 1BYCA 3O6CA 2X1TA 3TYCA 5D2YA 1WB0A 2J74A 4LT9A 4DPQA 3UR7A 1KKOA 1ZFJA 1XGEA 4M0XA 4GHRA 4FMVA 3MW7A 3TJIA 1FX6A 3THCA 3B0VC 2I5GA 1RQBA 4CU7A 5CAKA 1CWYA 3NR0A 3HA1A 5GNZA 3IANA 4H7ZA 1PUDA 3W86A 1KCXA 4UR9A 3ZT6A 3UPMA 1ZCCA 2F38A 4IIHA 2BVDA 1QNOA 1F5ZA 4E3VA 2FGZA 3T55A 2ISSA 1JZ3A 4GIEA 5FJOA 3KCLA 3U3HA 2Z1SA 2C14A 1XM3A 1PXGA 4HVXA 3LDVA 4MF4A 3H2CA 4PEKA 2NLIA 4AX6A 3O8AA 5D9PA 1J6OA 1JAEA 3FXYA 9CGTA 2TYSA 3A9IA 4QDPA 4NZFA 5DY2A 3ICJA 1P0NA 3OG2A 1QI2A 2P3EA 2VCAA 5C7VA 1HJUA 3SQMA 3T0TA 1KA9F 2Q8LA 4H4IA 4H7CA 5A8MA 2PWUA 1UG6A 3UGVA 1RBLA 1K7FA 4XBKA 4CU6A 1RVKA 2WZIA 4LYQA 2VRKA 1HUVA 4HNVA 1VFFA 1W3HA 1FWAC 3LA4A 1GTEA 7XIMA 2Z25A 1XV8A 2G0WA 4PFMA 3NQ8A 1P48A 1VZWA 4C6MA 2RH9A 3DI1A 3N4AA 4R34A 4UFJA 2DUZA 1HKJA 4GZJA 4L4LA 4LRSA 1EOKA 1WV2A 1S2TA 4UZSA 3EWUA 2YGYA 1VIWA 2XYLA 3ITXA 3FAWA 3W7OA 5M1TA 1SVDA 3PWIA 1X6LA 4IPNB 4EACA 3WO8A 4JTAA 4MB5A 1KW1A 2YB1A 1LT8A 2H3DA 4AWUA 3V7PA 3DFNA 3VX1A 3O6AA 4G6CA 2OELA 3AS1A 3NDZA 4B5XA 5CGQA 3G3DA 3T08A 1O4UA 3WUGA 4E8GA 3O0FA 5A6KA 5CG0A 3WDJA 3UA3A 5ABGA 4DHGA 2PWFA 2D0GA 3CAVA 2C0AA 4LVBA 3N73A 1GJPA 2J24A 1XISA 4ZB0A 4JTJA 3OQ8A 2A79A 2ACQA 1CCWB 2V68A 3QPYA 4ICNA 3NO3A 2WMFA 3GUGA 5BOEA 3QTGA 2QUUA 5KZEA 3ABXA 3GK0A 3W7DA 2OEMA 3EWXA 2D20A 2FGBA 4IUOA 1UH2A 4H19A 2HNHA 3AIEA 1NP0A 2CKSA 3W2KA 1IV8A 1OINA 2JGQA 2PF8A 5JU6A 1DQWA 4C6KA 1H7RA 4A8NA 2B4GA 2RAGA 2XPKA 2PZ0A 3SSZA 3VIPA 3LQLA 1Y5WA 2QPUA 1KFLA 1G4SA 3WIJA 1V02A 5FESA 2OPJA 2E1WA 1H2JA 2HV5A 3BSGA 4UTFA 4ACZB 4WK9A 3FK4A 2H3BA 2GUBA 3OA3A 1EL3A 3P61A 2YDSA 1UR4A 4JEJA 4GUHA 1G9HA 3MYPA 4LH8A 5A2AA 4ROQA 3HTWA 5F4SA 3GLCA 3LX9A 4J27A 4HNLA 1R46A 2ZX6A 3UR8A 4ZO7A 4WXZA 1TA3A 3KBJA 3KRZA 3RLHA 4PMZA 4AMCA 3PC0A 3L4ZA 1T0OA 4DF1A 1FBAA 4ZTYA 4A22A 3FVMA 3CBWA 1YTDA 4EPDC 4QDMA 3S6TA 4G1KA 3MHGA 1LRQA 1Y65A 4JTKA 1R87A 3NAVA 2G3NA 4JNMA 3WENA 3DUGA 4N9EA 3T07A 2FVLA 4EPKA 4L9YA 5HMFA 1B0IA 3NXFA 4ZVJA 3ZJKA 1DXFA 4FOKA 2VDIA 4A8RA 5FF7A 3IJ6A 4O13A 1MDRA 3VIFA 1OFPA 1MRQA 1H63A 2DVTA 1GORA 4IHCA 4MNLA 3NG3A 1JQXA 4MWAA 3GU1A 3KRUA 3P74A 4F79A 1TV8A 1S1PA 1W8GA 4JQ3A 1XRTA 5FD0A 4KFOA 4RNJA 5FF4A 2LLEA 1NU5A 1G0CA 1DJQA 3DBPA 2DW7A 1M5WA 3MMTA 1SO3A 3B40A 4YU1A 2OCZA 1QNSA 1EJRC 4YYFA 1Z42A 2E6AA 1ZB5A 1Q63A 4A4AA 3R6IA 3D46A 3I68A 4C6DA 2OKTA 4IP7A 1VCGA 1YDNA 1A50A 1QI4A 2J7CA 3KWSA 2O56A 2NV2A 3F4CA 3QKEA 2PLCA 4EPBC 3MKCA 2DSKA 1C9DA 3Q4DA 3AUOA 3A3WA 4JYDA 1ISWA 4RW3A 3LMYA 1EC9A 5HBFA 4X22A 2BXYA 3D5HA 1JIBA 1LROA 3SUSA 4R33A 2PTZA 3MMDA 4U5IA 5FF2A 2YOCA 1H62A 4E2DA 2EPMX 1L2UA 2XFYA 2J4GA 3WK1A 4IGNA 3WQ8A 3IK2A 1AL7A 5ABEA 7TIMA 1E72M 1OIMA 1SSGA 1XJBA 4HT3A 2OT0A 4JGDA 3KAOA 3SCRA 4D72A 5CPTA 4Z2LA 3GX9A 1JI1A 1ECEA 4C6JA 2H6RA 4Q4QA 4AC1X 3NEVA 5LIUX 1XIEA 3THUA 4RK8A 1PEZA 3HQPA 4PC8A 4MFDA 4FP1A 1NP2A 5KZDA 2QDGA 5JIPA 2EJ1A 1JZ4A 4E2BA 1BYBA 2CZVA 2TSYA 4PMNA 4HA0A 3LLXA 3S8HA 3L68A 2WB5A 2EGZA 3HBLA 4LUTB 1W1YA 2G8ZA 3EDFA 3LEPA 4PODA 5XIMA 3MUZ1 3E02A 2FB3A 1CEOA 3TDFA 4M51A 2QCCA 5GQBA 1H7NA 5E6YA 1U5VA 3TA6A 3WH7A 3P3BA 1MI3A 4GWEA 3EWZA 4JTDA 1VKFA 2DU2A 1GOQA 1RBOB 2P8BA 3E0WA 4MWAC 2I9EA 3QR0A 4U5KA 1OFDA 4J2MA 3WJZA 4NU7A 3GKFA 5K9CA 2W61A 3VOJA 2Y7DA 3BW4A 3SAZA 4JTEA 4C6BA 1XQLA 4MZYA 1K9EA 1UUMA 3N04A 1PPIA 1SU5A 3LUTA 1KFJA 4Q6JA 1O12A 2AMGA 1J0YA 1W37A 2YDRA 2R91A 4MJ4A 3F4NA 1J11A 1KTCA 5HA7A 3T05A 5LA2A 1P6CA 1AMYA 1KM6A 1Z3NA 2NX9A 3GG1A 3WLRA 2ZE3A 2GSEA 4I8DA 4UMBA 2C6QA 1R86A 4UQ9A 3U8GA 3DC8A 1UKQA 4YNGA 3PSVA 1W0MA 2E3ZA 3M0HA 4HZ7A 2WSQA 4E8CA 3FJNA 3WYZA 1WXJA 1WDPA 3W23A 2VDGA 4PTWA 3LQGA 2ACUA 3H21A 3UZWA 1GOMA 3OLDA 3MSDA 1Q2SA 3XISA 3W7HA 1U1JA 3TTSA 5M3WA 4C91A 4EK7A 1DWHM 3S5ZA 1JG9A 1C8QA 3M6YA 1QCWA 1SO6A 3REQA 3B4YA 2ISFA 1QWKA 4HU0A 1AD1A 3YPIA 6A3HA 2CLLA 3EKLA 2CCRA 1N8FA 3J7HA 2DDXA 1G1YA 2ZXDA 4RW5A 4RLIA 2I14A 5FA5A 3BAKA 2ZRUA 3UR5A 3T8LA 3FSTA 4US5A 4I8YA 2VEMA 3K13A 4Z1BA 2HMCA 3GIQA 4O12A 4NRSA 4O1DA 1CZ1A 1GVYA 3PF3A 5FCZA 1US2A 3EX3A 1R3YA 4M82A 1B30A 4NP7A 1J9YA 5AVNA 3IJDA 3NQBA 3VC5A 3NYDA 3OYZA 1FWFC 4I3GA 1FHDA 5I07A 1IHIA 1G94A 2J7GA 5BW6A 1UD5A 1BD0A 1JZ5A 4QISA 4DJFA 1BPLB 4J3VA 2B7QA 5HPCA 1NFBA 1DTUA 2QUMA 1S38A 4FXSA 2QCNA 2WCGA 3B4UA 1TZ7A 1BWKA 4MB4A 3DDMA 4RX0A 2F6XA 2ATMA 3E0FA 4M6VA 4MUPA 4QROA 3ABQA 4WKHA 5HXMA 1CXIA 5C54A 3CL7A 4XAPA 1DHPA 1JCYA 2YXGA 2YXXA 3P0WA 3S1GA 3P93A 1HKWA 1TQJA 4IX0A 1DOSA 1MMFA 2MANA 5D8WA 3E12A 1SUXA 4H41A 4LAKA 2XUCA 5D2WA 3CMFA 5BRQA 2VEPA 1CGVA 3JW7A 1WXYA 1TWSA 3S2CA 1T7LA 4TMCA 4IOTA 4QLLA 4Z17A 4EF9A 3S3GA 1F3EA 1DJGA 4WDTA 4GK8A 3UGRA 3TONA 4PMUA 2VFFA 2CLKA 2ZXQA 4UNLA 3DYOA 1MXGA 2X41A 2ZUUA 4XZNX 1T8QA 1FKXA 3R0UA 2XU2A 4QE1A 3W1QA 1GPFA 2ZUNA 4XB3A 4N4PA 4W4QA 2IS7A 4OKDA 3M7SA 1ZU8A 2E9MA 2OGYA 3KCOA 3S2LA 5B80A 1PKMA 3INPA 1EBHA 3B0PA 3W88A 4P8UA 3IARA 3CQIA 3R89A 4FA3A 1ADSA 1SPQA 2VX7A 5XINA 1JNEA 4E2VA 1GEHA 4QITA 3SCSA 2OX1A 2QHAA 3ZQ9A 3SFKA 3CIXA 4MKSA 4Q7IA 1P7TB 1E0TA 1TJRA 3VDHA 5CJMA 1OCQA 5HNNA 4HSOA 4GC4A 1PL9A 4D6GA 1XLDA 5DEZA 3IWPA 4U2YA 5CZKA 3VZXA 3UG5A 1J8VA 3JUGA 1QW9A 3PTKA 3G6MA 4MB1A 1QPKA 4R5EA 1S3TC 2FKPA 3OA5A 1A5KC 3QSTA 1O5QA 3JRKA 4S3AA 3CB8A 3BICA 4DJFC 4PCFA 1EHAA 2NQJA 4S3EA 2Q8XA 2YBTA 4LU0A 4WSJA 3EWWA 1FWWA 3IGHX 4J3WA 5A8GA 2QLYA 4CCZA 4Q7NA 2RJHA 3PUOA 1K6AA 2IMRA 3UJEA 5FACA 1TE6A 1UR0A 5C0QA 4OE7A 3GNRA 2PPGA 3G24A 2YX0A 2CIPA 4ENLA 3PR2A 4ADUA 4G56A 3R7MA 4GNJA 1KNWA 3T40A 1W9PA 2YDQA 3BV4A 2CBIA 1ENUA 2EPLX 4JTTA 3WJSA 2V9DA 4OIFA 4O17A 1F4HA 1XPGA 3SUTA 2IW0A 1X7IA 3CYVA 3EOOA 1V51A 4UTWA 1L8PA 5T26A 1TMLA 3GWQA 2VVSA 1O5XA 1V0NA 3EDJA 2AMXA 3GXFA 2V38A 1I45A 1WDWA 4MIMA 2PDHA 3ZWSA 5JQ9A 1JZ7A 2GGHA 5HJXA 4N9CA 2V63A 2PRHA 4V1XA 3BPWA 1BTMA 4GY7A 3UWUA 4P8VA 1TTPA 3HQ1A 2WQPA 3TFXA 2V5LA 2HQAA 1XSKA 4I5XA 4M29A 1ZBCA 3IIXA 2VGBA 1VAHA 3H4GA 3KZSA 3W2UA 1EO5A 2X1IA 2YW3A 1UR8A 3GDTA 5H6HA 1M53A 2NXIA 3RK8A 2GVEA 2I5IA 4N6FA 3ITOA 3E1F1 2UBPC 3STGA 1LUCA 4ZQPA 3N9SA 3ARXA 3MWCA 2ZVIA 2Y1HA 1IXOA 1JYNA 5LIKX 3QZAA 1TE1A 5G2WA 4LRTA 2X2YA 1JEZA 1S5WA 1WQ5A 1KLYA 1CBGA 2X1UA 1UYQA 1Y7VA 2FDMA 2X7WA 3WQ4A 2RDTA 5ABFB 2HTMA 3FGCA 3T0CA 2WJEA 4D6EA 1REQB 5BRBA 5SWUA 2CHNA 1A0DA 4PSRA 1K4GA 4IIFA 4UZUA 1SO4A 4WHBA 1W6TA 4GBDA 4INFA 5HR6A 1NDYA 9XIAA 2B7NA 1B31A 3KTCA 3MUY1 1E0WA 4GINA 3T0AA 1EUAA 2F6UA 1H61A 2FHCA 1TVPA 3G6LA 3U2OA 4QJ1A 3ABSA 3SGUA 4TTGA 1ZJIA 1H49A 4UUIA 1GVSA 2PLJA 4FK9A 1P6BA 2V5DA 2ZUTA 1XYCA 1E5NA 1E6NA 3TJ4A 4XVDA 3IIVA 1U2YA 4JFSA 1JDAA 2Q3OA 4NYUA 1VEPA 2AQWA 1EA0A 4Q32A 4AEEA 3N3MA 4IMAA 3FKKA 2NSOA 1RLCL 1BG9A 2CKRA 3F7JA 4O4VA 4QXIA 4MLJA 2PCEA 2FZNA 1OK6A 3A3HA 1BEUA 1OYAA 4UTWC 3VNKA