4HT3A

The crystal structure of salmonella typhimurium tryptophan synthase at 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) inhibitor in the alpha site, internal aldimine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 102
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ht3A00
5D2TA 3M5YA 3DH7A 1GG0A 2EPHA 3IIOA 3M0ZA 1QFEA 4FXRA 1DKWA 1GJPA 6TIMA 5LHFA 2GQ9A 1WA3A 5EKYA 3S0CA 1TPH1 1LP6A 2C1HA 1K8YA 1W3NA 1TPEA 3BG9A 1A53A 4QAIA 1KM4A 4HT3A 4UTWA 2VOMA 1V7YA 2RDUA 4TU1A 1IGSA 4EF8A 5I3JA 4JDYA 1G4TA 4UXDA 4DBEA 4O12A 3VCRA 2YW3A 2P1FA 3LDVA 4OV9A 3TMLA 4BWLA 2LLEA 3NZRA 4FIQA 4TO8A 3TMQA 4RZ5A 2ABAA 1EWDA 2ZZ6A 1AG1O 1X7FA 5AC6A 2CZ5A 4TMBA 1T0OA 4XBKA 3L66A 5CZ0A 1OYAA 2V82A 2VFFA 3PBUA 3W7CA 1RV8A 2ZDRA 3W2UA 1EWEA 1JVNA 2QCLA 3HJZA 1KLZA 1T96A 3LV5A 3FJ6A 3P84A 1NF0A 3P82A 3M41A 4R7JA 3WK3A 1W54A 1RD5A 1RQBA 1B3OA 2V2HA 1TQXA 1RVGA 2WJZA 4G1KA 4IXXA 3KHJA 5G2WA 5H91A 3VFLA 1XKYA 2VEMA 3W85A 3L2IA 4BF9A 3TU9A 3A22A 3TE9A 4DF1A 1VLIA 2B0MA 4ZQCA 3NQCA 1ADOA 4Q33A 4N4PA 5AHIA 1ICSA 3O16A 3NM1A 3C8FA 3INPA 2NWSA 1FCVA 3HGJA 4ZQOA 3B03A 4AXKA 1KTNA 3TCEA 2CZDA 4MYAA 5EYWA 1H60A 3NOEA 2QDHA 3GAKA 2P0OA 4Z08A 1IIHA 3L0NA 1UJPA 4LY8A 5CZTA 3JS3A 3PR2A 4DF2A 5LNVA 2CZFA 1EP1A 2UV8G 4ALDA 4TMCA 3UXDA 4DO5A 4LOCA 3A23A 1EB3A 3C6CA 1GVOA 5BOOA 4UFJA 5E0KA 3TROA 1FX6A 1TREA 3LRKA 3G18A 3LLFA 1H1YA 2YCEA 3LXCA 1A5AA 4OT7A 3U8GA 1OFEA 3M7WA 3KRSA 3LCFA 4FNUA 2C13A 2H8XA 3RF9A 3RK8A 5LNUA 4FX7A 1H61A 1VPXA 5EL1A 1XDLA 1VQTA 4UTLA 5CPLA 1OG0A 5DCBA 2B7NA 3HPXA 4RLIA 4NXKA 3TXZA 4M6QA 3FEMA 3NZ1A 1CI1A 1H50A 1SW7A 2A6NA 5DCDA 5HINA 1WDWA 3UWVA 1LDCA 3W23A 1OX4A 3DAQA 4WOZA 5AC8A 4XUGA 2C6QA 3KAOA 4Y9AA 1NF7A 3W6YA 2A21A 1W5OA 2ZRXA 1FCUA 4OQVA 3O63A 4L4LA 4BI6A 4O52A 3TQVA 4O50A 4M19A 4PA8A 4K8HA 2YGYA 4RZ4A 3NGJA 2W6RA 3MHGA 1RZMA 3LCIA 3EWWA 5D37A 4DF0A 4WUIA 1OABA 1GVQA 4KFNA 5MHBA 3W7DA 3IIPA 4UFIA 3S5OA 4N9EA 3NEVA 4O53A 3S42A 4GC4A 1O4UA 1ICQA 4FEZA 4PTNA 4IJBA 4M6VA 2ZRYA 2NXGA 3S5NA 2ZTKA 3S6DA 1G4SA 1C29A 1GEQA 2ZA3A 3G1FA 1O60A 3BW2A 2RDWA 1R46A 3P61A 3M6YA 4H6KA 4JGDA 4KFOA 3P7YA 4RR4A 1EP2A 5DXXA 5I3IA 2WQPA 3WJZA 1EEPA 1SFJA 3NXFA 2ZZ5A 3R89A 4AWTA 3LI1A 4YCOA 4R53A 2PRHA 4C1LA 3KOFA 5KZMA 2J9XA 1DJNA 3SGZA 2ATMA 3G0XA 2FPTA 1SZGA 4JTFA 2X2GA 3P60A 2E6AA 4K7YA 3UZ5A 4JYDA 3TSDA 4LC6A 2W0UA 1TPVA 2QUTA 3OVPA 3Q2DA 3UY8A 3V75A 2QCEA 1I2NA 5HWJA 3S1UA 2RDTA 2RHGA 1ALDA 3BG5A 2VFGA 1M6JA 5HMSA 2X1RA 4EF9A 2OT0A 3HG5A 3TJLA 1KFEA 3IGUA 1TTIA 2NUYA 1GWJA 1SO3A 1JCNA 3QZEA 4GE8A 1TTJA 3L9CA 4LT9A 5AN7A 5I3KA 3M5XA 1TCDA 3BK0A 2ZZ7A 3U2OA 2QCHA 4BI7A 1Y0EA 4Q32A 2V2CA 4EVZA 1TPC1 1VGAA 1B4EA 2DZVA 3DZ1A 3W3OA 3TC7A 3WK2A 5D2VA 3GDMA 1HTIA 4WY0A 3R2GA 4NJGA 1K8ZA 4EIVA 1ZENA 1HO1A 3I7SA 3HO8A 4ZQPA 3M5VA 3WFAA 1LM1A 1OK6A 1QOPA 1VC4A 2CLKA 3CEUA 2F7FA 4UTTA 5AB3A 5K7JA 2FQIA 1TB3A 2C18A 3PY2A 3B06A 1WX0A 3W83A 1H7RA 4C1KA 3G8RA 3NQEA 4X3ZA 3GK0A 3I7RA 2QR6A 3N73A 3S8HA 1EX5A 2GVJA 2WV8A 4GXMA 3G3MA 3QMSA 1SSDA 3O6CA 1C8VA 3IIVA 1VHCA 3PG8A 2VFIA 5HR6A 1TTPA 3HGOA 1FDJA 4NNAA 2ISVA 3P5YA 1M7PA 3ZS4A 5HWNA 4FXSA 5DLCA 2E5DA 4NVTA 4UUIA 1FWNA 3GIYA 3V1PA 1W5MA 3NQGA 1OFDA 2E09A 3W2JA 1PE1A 2A7RA 4PFMA 1IIGA 3NAVA 3QPZA 3W1PA 1KTCA 3N9SA 3RMJA 1W3IA 4ZMGA 2H90A 1H7XA 1H7WA 2GJNA 2I1OA 4M7SA 3CWOX 2GJLA 1RQHA 5K4ZA 1FCBA 3M43A 4NJKA 1M5WA 3LXBA 4LS2A 3OHIA 3QEZA 3P74A 2G5WA 3S5YA 1AW1A 4NNBA 2JKAA 3T44A 4LRTA 3S1VA 3ZR4A 4OBTA 3WJWA 3GX9A 1OJXA 3FYPA 3EX6A 1HFBA 1F7BA 3WK1A 1KBIA 1J5TA 4UFKA 5AHEA 5DCEA 2JGQA 1LORA 3NYZA 2NX3A 2QKFA 1KM6A 4JY9A 4YWIA 2E6DA 1TTQA 4JS3A 3L5MA 3BLEA 5D2XA 3LV6A 3QSTA 2V5BA 5A8GA 3W7OA 3KX6A 4OGZA 4HPXA 1QPQA 1FDZA 1UB3A 2EAWA 3EXSA 1OK4A 5KITA 3L0KA 1AMKA 4DXVA 3DGRA 1AL7A 1V5XA 1QDSA 2Y7DA 3PBYA 3UQNA 2Z6JA 1GPWA 2X1TA 3TUUA 4M5PA 1SZEA 3DI1A 3FKRA 1X1OA 3UPBA 3W7IA 4RCXA 5F2IA 4OWGA 2C3ZA 3MMTA 3CLMA 3UWUA 3LHYA 1IXOA 1ME7A 2Z0IA 3LHTA 3W2KA 3EX2A 2B7QA 1FUYA 3PVFA 4JICA 4JX6A 2FDSA 2CLLA 1YTDA 4TR9A 5CGQA 3UWQA 3EWZA 3M9YA 4NZFA 2V9DA 3LBMA 4O54A 3HGSA 5E1QA 3W7RA 3HG3A 1PV8A 4I7UA 2V8ZA 4UTWC 3R13A 2Y61A 1OFQA 4LS0A 4NT0A 2W79A 1KV5A 2PURA 1JUKA 2E77A 1PCWA 2J88A 3BW3A 2YYUA 3H53A 2D73A 5J5RA 4XKYA 4RK8A 4HSOA 3UYCA 2BX7A 1F6PA 2H3BA 1JRBA 1AW5A 1LOLA 3TAOA 1IXPA 3S1WA 5T26A 1XUZA 2OZ0A 4U4MA 3PF3A 2Y89A 3TC6A 1FWWA 3UNDA 4O4WA 1BWLA 1VR6A 1XI3A 1Z48A 1R47A 1JCYA 4R33A 1K03A 2NV1A 3W1UA 1L6WA 5EMUA 3C56A 1J4EA 5AYZA 4MFDA 3OIXA 5FF7A 4LNYA 3W7HA 3NPVA 1OFOA 3G1AA 2WKJA 4IPJA 1QO2A 1XBZA 4HIBA 1SO5A 2OT1A 3KVLA 3QW3A 1KA9F 2Y6ZA 2E5BA 4LVFA 3LBCA 3G1XA 3VKJA 3QJAA 1GYLA 4RXGA 4NZJA 1H7OA 1QMLA 4LC8A 1PL9A 2H8ZA 3O07A 2R8WA 2X16A 4IWWA 3GNNA 2QEZA 5D38A 3UY7A 4UFMA 1KFJA 1S5VA 5U4NA 5U7SA 4NJJA 2QF7A 1OYCA 2NUWA 5L9FA 3W74A 3G0UA 2R91A 1JUBA 3OEXA 3BPWA 1TMHA 3AO0A 4XTIA 5CG7A 1BEUA 3NL6A 3TW7A 1VYRA 2XN1A 5AYYA 3CEPA 1AW2A 1TQJA 3D0CA 3LERA 4OV4A 2E1DA 5LHEA 4X9SA 5HR7A 3QQ1A 3MI2A 4JTLA 1WBJA 3W75A 4RXFA 3LCWA 5C55A 3TAKA 3W1AA 3N19B 5D32A 4JTIA 4UR7A 3QM3A 4KWVA 2NV2A 4M6PA 4Z1BA 4MPQA 2WNQA 1N55A 5F2MA 4NJIA 1OX5A 4WXZA 2HS6A 2CU0A 5LZLA 3OBKA 3QW4B 2ZRWA 1OF8A 3IGSA 3B05A 4FX6M 3H55A 5LNWA 2ZRZA 1XFBA 3N34A 4ZQRA 3F1QA 2ISWA 3L5LA 1KBJA 3LTPA 1LBMA 2VKZG 4Z1AA 1EUAA 4O16A 2OCZA 5CPNA 2R14A 3EX3A 3W84A 4H3DA 4WZHA 3TDFA 2VXNA 1OFBA 5D04C 5LGXA 3SI9A 5AC7A 5CSRA 1WYIA 1G69A 1YDNA 3P8IA 2G95A 2E6FA 4JTKA 4UR8A 3L67A 2KZHA 1OFPA 2A1YA 2G96A 1HO4A 3KVMA 3LRLA 3IIZA 5AHLA 3GXPA 2TYSA 3PS7A 1QPRA 1QNVA 1XCFA 3RFAA 2CLOA 3MW7A 2NX1A 3DENA 4I7VA 4X2RA 3EWBX 4MZYA 2A0NA 5I3FA 2BLEA 5HNRA 2A2IA 3DHFA 4AVFA 1QO5A 3LLDA 1TPWA 3IRDA 2YR1A 4YXGA 3W87A 1MEWA 3CIWA 4JXCA 1W5PA 3QF0A 1PCKA 3NQMA 3LCGA 1C9DA 4LUIA 3GDRA 2VELA 3BO9A 3BLFA 4AHOA 8TIMA 4QITA 3MP5A 2B4GA 3EWXA 1F6KA 3IVSA 4BI5A 1W37A 2NXIA 2WO5A 4Q4KA 2QCDA 3C2EA 1WV2A 4NX5A 4FNSA 3CC1A 3W7MA 4JY8A 5C5YA 4UTKA 4CNOA 2YYTA 3AJXA 2Z2UA 2NWRA 2FPYA 3CU2A 3NL5A 3SECA 2BTMA 1EIXA 2EHHA 3W7QA 4LV9A 3ANYA 1WBHA 3QH2A 4AEOA 3I6RA 4WY0B 4NQ1A 2GVLA 4CCCA 3QFEA 4XTDA 4Y96A 2C19A 3MI6A 1W5QA 3W1MA 3NQ2A 3MI3A 4FHAA 4GRSA 4PL2A 5LNSA 3SR7A 4ORMA 3NA8A 1JR1A 1VCFA 4FB7A 3MBFA 1PIIA 4UTUA 4O57A 1QCWA 2NUXA 1YADA 3BVJA 2BSLA 4IMEA 4XZ9A 4O8RA 1FBAA 2ZZ4A 3NNTA 2BWGA 1LROA 5I3GA 5CPMA 2HTMA 3IIXA 4IMCA 1OFRA 4WOQA 4S2BA 4KWWA 4O0KA 5C54A 4NU7A 3QSRA 1NEYA 4UTTC 4QIUA 4JN6A 3LXAA 4QQ3A 1VHNA 4N4QA 1WXJA 4WY0F 4LUJA 1GVSA 4MKNA 1M7OA 2Y7FA 2GPTA 1YDOA 3L0GA 3GYEA 1JULA 3MHUA 1R2SA 3TW6A 4FNTA 4ADUA 2GOUA 1ZCOA 3W73A 5E93A 3O6YX 4CNNA 1DOSA 2CWNA 3T55A 1T99A 2ZRVA 2HS8A 3WJXA 1EPXA 4LU0A 4CCEA 3YPIA 4GUJA 2X30A 5DY2A 2Q3OA 2JGYA 1G7VA 1OFAA 4UFHA 3TV8A 1SR9A 3O6DA 4OE7A 2FB3A 2JKEA 3GR8A 4U28A 5FF4A 2I14A 4MY8A 4QNEA 4DPQA 5G5IA 2GQAA 1FWTA 2HMCA 3LTYA 1OYBA 4ZL1A 5K9DA 1G4EA 1Q6RA 4JD4A 1KV8A 4JX4A 1JCXA 3NQDA 4IX2A 3DFNA 3NPUA 4RX0A 1YXCA 4K36A 2FLIA 4JTEA 5EA9A 1FY6A 1H5YA 5K3VA 3GAYA 3TX9A 1I2QA 4HSNA 1ICPA 1LYXA 3NQ6A 1KFCA 1LZOA 2V5LA 4O1AA 3DFTA 3C2RA 4LTSA 1W56A 4AAJA 1JQVA 3DXIA 5F2LA 4UTHA 4POCA 1B4KA 1EP3A 3ABSA 3MBDA 1TRDA 1HL2A 3SFKA 1MEIA 5LKYA 4IMDA 5F4SA 4JEQA 2Y7EA 3C2VA 4HHPA 2QCGA 3FKKA 1YXDA 3FS2A 5F4WA 5TIMA 3S5ZA 5J5DA 1P0KA 3GXNA 4HNNA 1KLYA 3T4CA 4O0ZA 1IXQA 3T7VA 1SO4A 3NG3A 3CPRA 3QYQA 2J27A 1F05A 2XFWA 3O15A 3VE7A 3P67A 4K7VA 2VFEA 2VFDA 3W76A 3IV3A 3ZFHA 2PRLA 3PSVA 3VNDA 4TX9A 2CLEA 3EB2A 2A4AA 5IM51 3BGGA 3M5ZA 5ABTA 3B4UA 2V30A 1F2JA 2Y7GA 2NLIA 3PUOA 3PULA 1H51A 3ABRA 4R34A 3W1NA 4AWSA 4Z0SA 4YLWA 4E2DA 4CQ8A 1F76A 1DORA 1ZAHA 3PUEA 4E38A 5AHMA 4I7WA 3DBPA 4JTTA 4DBDA 2QJIA 4FX8A 1B9BA 2PC4A 4UNKA 5HUPA 1F73A 4P61A 2YZRA 1UBSA 4O11A 1G6CA 3HF3A 3C2FA 3NR0A 2G97A 3HBLA 4IGHA 2QCFA 2V81A 1DQXA 3W1RA 1Q6OA 3HG2A 5D33A 3MHFA 1HUVA 7TIMA 4JTJA 2TPSA 2JK2A 1A50A 1S5TA 1L6SA 4MY1A 5DBTA 2QUUA 1XUUA 1R2TA 3B8DA 4HNTA 5IBXC 3B0UX 1N7KA 5K2ZA 4AWUA 1YYAA 2B7OA 4O28A 3SIZA 3OVQA 5TBOA 4LVDA 3ZWSA 4FNPA 2VFHA 3W72A 1GYNA 2NX9A 1DQWA 4K39A 3G1SA 1K3UA 4JIQA 4GFSA 2CW6A 4IOTA 4GUFA 1IF2A 1SW0A 3LB0A 5F4XA 3W2LA 3BGJA 1LRQA 4HNVA 3TJXA 2ALDA 2HSAA 1MO0A 3W1XA 4AHPA 4JTUA 3KFTA 4IMGA 3UWWA 4QNWA 3S1XA 3TNOA 3O05A 1SZFA 5D2YA 3M16A 3GVGA 5FESA 1OX6A 2X1UA 1TPFA 2ZTJA 4NUWA 3EKLA 1GVFA 3TA6A 4O4VA 3G1VA 1LLWA 3IEBA 4O1CA 2DZUA 4FO4A 3FA5A 1LRTA 4B5NA 3FFSA 3GLCA 1J2WA 1ZHAA 1MEHA 4IMFA 5F2GA 4O18A 1F5ZA 3DFPA 2V0TA 1NVMA 1TV7A 1VYSX 3NQAA 5K4XA 3ELFA 2A85A 2ATSA 1XM3A 2ZA2A 4A29A 1SQ7A 1QPOA 3NDOA 3STFA 2P10A 3G24A 3O8AA 4PCFA 1N8FA 4Y6GA 3TXVA 4IXHA 1D3GA 1XBXA 1DL3A 1A5CA 5FEZA 2FFCA 2QCNA 2C14A 3W7EA 4BWLC 1I2PA 3S9YA 1EA0A 3UWYA 3UXAA 3W1LA 2ZRUA 3SZ8A 3W22A 4ONVA 2Y70A 3W1QA 4O1BA 2PRMA 4RZ6A 2C0AA 3TQKA 3W7LA 1H62A 5HWMA 1ONRA 4LRSA 3LX9A 1KFLA 2YX0A 1YDVA 2QAFA 3W1TA 3GXTA 3W7GA 3N9RA 5BMXA 5DXYA 1TPUA 2H6RA 3C2OA 5KZDA 3QQ0A 4CCDA 1H7NA 5A5WA 3NQ8A 3OVRA 3BLIA 2B7PA 3GDKA 3PC0A 4S2CA 3SW6A 3A21A 3EEGA 3PWAA 3TSMA 3PBWA 4KFPA 1FQ0A 3CHVA 1A5BA 1T8XA 5GVJA 2GVGA 5AOUA 1O95A 4Z1DA 1EUNA 1Z44A 3HGRA 3LHWA 2AGKA 5AHFA 3OG3A 1FCQA 3GDLA 5D2WA 3SY5A 1L6YA 2ZFAA 1UCWA 4JDBA 5KINA 1ME9A 1ZNNA 2CLIA 3Q58A 4HPJA 1I2RA 4IX0A 3SGUA 2CLFA 3G0SA 5CZSA 1G67A 3THAA 4RV8A 4QISA 4MLRA 3LHVA 4WX2A 1TPB1 3OA3A 3NQ7A 2J9ZA 1W0MA 3E02A 3Q37A 3NM3A 4KKXA 4GUGA 4NJHA 2EGZA 3IGXA 3LRMA 3NPWA 3NL2A 1FXPA 3EKZA 3W7NA 5HULA 4GUIA 1DVJA 4GUHA 2QJHA 3JRKA 1OX4B 2CLHA 2ZQ0A 5DY3A 4AF0A 2JKPA 2FB2A 2Q8LA 4JYEA 1H7PA 1WOAA 5CZJA 1JCLA 3B04A 3QPYA 3HIJA 1O5KA 2ZA1A 3P80A 1TPDA 3KXQA 2AAMA 1BWKA 3ATYA 3HMJG 1QAPA 1SSGA 1GTEA 5HJLA 3W2MA 4O17A 3P62A 1MZHA 3LCHA 3THQA 5FEPA 2VEPA 4UMBA 2Q3RA 3E96A 3HPSA 2Z1BA 2VEKA 2C15A 2WSYA 4MJMA 1TJRA 2Y88A 4UC5A 3W71A 3HG4A 3JR2A 4DEFA 2VENA 4L4MA 2PCQA 1THFD 3M1ZA 1Z42A 2IQTA 3GNDA 3GKFA 2WNNA 4DELA 2O7QA 2H3DA 1QR7A 1VYPX 6ALDA 1RQEA 4MY9A 5D30A 1WOBA 4O14A 1TJPA 4FNRA 4XQ6A 3LGEA 2J24A 2QDGA 2A7PA 3E12A 1MXSA 2YFOA 1UUOA 3NQFA 3DHDA 4A2SA 2BXVA 2GQ8A 3ZWTA 1I4NA 4LW7A 3EWUA 5EPDA 4CQAA 3PSWA 1FWSA 3N2MA 1LLZA 4MZ1A 3LCLA 4WJEA 1LBFA 3NQVA 1BTMA 3NO5A 1K7XA 4PC8A 1I45A 4FNQA 3DU0A 3N14A 1PS9A 4K38A 4RKAA 2O7SA 3PG9A 4YL2A 3F4NA 4ZQNA 4GNJA 3STGA 1YXYA 3W86A 3DKJA 2OJPA 4LS1A 4OHQA 5D02A 1ZAIA 2DU2A 3I68A 5D09A 2YXGA 3QMTA 4EOUA 1JRCA 1GQNA 5C2XA 4ORIA 3TH6A 3EWYA 2QAPA 5G1TA 4GBUA 4W9TA 2EF9A 2J9YA 3RNDA 1F74A 1CX9A 1L9WA 1CW2A 4PH6A 4EWND 2QJGA 3TQ0A 2QUVA 1LOSA 4FF7A 3LI0A 5LSMA 1IXNA 1ZY9A 1KM2A 3EXTA 1YPIA 5FEXA 2Y63A 2ZZ1A 5DELA 3ABQA 1X8FA 1W3TA 4DO6A 1YTEA 1WQ5A 3QMRA 1W8SA 4HKPA 1AL8A 5EBUA 3T40A 3L65A 4FIRA 3STCA 4A3UA 1VCGA 4YMZA 4UCGA 3R5EA 3A5FA 5AHNA 2ZBTA 1GG1A 3MP3A 1GTHA 1KFKA 4MYXA 3KRZA 4ADTA 2PE4A 4ADSA 1GT8A 3NPXA 3I65A 4J9JA 3PBVA 4WD0A 4UTMA 1XBVA 1L2UA 2RH9A 4LVBA 4NX0A 1TYGA 5G4WA 2VC6A 3HQ1A 3O1NA 2ABBA 1VCVA 5FEWA 4E0CA 1JCMP 3N2XA 1TSIA 1LRNA 3LTSA 1KFBA 3CB8A 3PAJA 5FF0A 1W5NA 3LCXA 2FPVA 2Z6IA 4YCPA 4ZZ9A 3HPZA 1U5JA 1ZALA 3MJYA 2A7NA 4A21A 1H63A 3W70A 1GVRA 5K9XA 3DKLA 1KM1A 5KSWA 5G2HA 1VZWA 1G7UA 1TV8A 1K7EA 1TIMA 1SZNA 3FJLA 2E6YA 3P8JA 1SU5A 3MYOA 4E2BA 1D3HA 4K6AA 4JNMA 4DPPA 3Q94A 4ZQMA 1O5XA 5FI8A 2FJKA 3N3MA 3TKFA 1S5WA 3DFOA 5BMWA 4MLJA 4GJ1A 5G2IA 3SSJA 3WJYA 2CLMA 4JTSA 3SJ3A 3M44A 3QRHA 5D05A 3RLVA 3NVTA 1WAUA 5K9CA 5KZEA 3HB9A 4K8EA 3MO7A 4MUZA 4AMAA 1I2OA 4DO4A 3MWAA 5AFDA 1Q6LA 3ATZA 3TFXA 3W2NA 2Y62A 2YDAA 3NL3A 1PVNA 1P1XA 4S1FA 1NFBA 4WQ6A 4TIMA 3A5VA 2R94A 2RKXA 2WNZA 1Q45A 1LBLA 2Q8ZA 3LHZA 3QC3A 3L5AA 1NAL1 1VH7A 3G3DA 1D9EA 3A24A 1YLVA 1RPXA 3GB6A 4JTGA 5CKSA 4MOZA 1W1ZA 2ZYFA 3CWNA 3WK0A 3H54A 4NNCA 1G4PA 1W31A 1LCOA 5DBUA 4O19A 1RR2A 3EX1A 4LVAA 4GWEA 2ZZ3A 4MFEA 1X1ZA 5CPOA 4JTHA 4WXYA 3C3NA 1OHLA 3K30A 3B0VC 3C61A 1Q3NA 2OX1A 3PB0A 1OVDA 1UUMA 3BV4A 1Q6QA 2XN0A 2FIQA 3O06A 4XBSA 1OF6A 4M7TA 2YPIA 1XC4A 4XKYB 3W7JA 2JBMA 2DZSA 5L6UA 2E5CA 3DFQA 5LNRA 5DN1A 1DJQA 3BG3A 4UIOA 4NXSA 3R8RA 3EX4A 4ZVJA 3MYPA 4UTJA 3FYOA 3BARA 1YTKA 3CIXA 3FLUA 4I9AA 1UASA 2QCMA 1LOQA 4JX5A 1P0NA 2C16A 2DZPA 2CZEA 1X6UA 2ZZ2A 4H4IA 1SFLA 1JCJA 4N6FA 4O15A 2CFFA 1TO3A 3G8EA 3DI0A 2NZLA 3I7QA 4UMCA 2ZCGA 3W7KA 1K8XA 4AHQA 5CSSA 4UFLA 3C0JA 4LV4A 4D2JA 1SW3A 4CNPA 5G1YA 1JJKA 2DORA 4IQLA 3LHUA 3PM6A 1ZJIA 2XN2A 1KM5A 1SO6A 1R2RA 4Z1CA 3C52A 3L21A 4JR5A 1KM0A 5I3HA 2DJXA 4ICNA 3TK7A 5BW6A 2WSRA 4N6EA 1ZAJA 2DZTA 5EY5A 4DQWA 2WPBA 4Y8FA 1Z41A 3MUXA 4QSHA 3C4UA 2DZWA 2AQWA 2X1SA 5F1VA 5KMYA 3U6WA 3W9ZA 5FF2A 1QOQA 1AK5A 3UD6A 1TV5A 1MSSA 3FOKA 2DZXA 3GZ3A 3G1DA 3PUDA 4Y90A 5BRBA 4HN4A 3IVTA 1VS1A 4ML9A 1DBTA 3HOJA 1KM3A 5G4EA 1KTBA 4UTIA 4HNUA 4MVAA 2DP3A 3TIMA 1XL9A 1NSJA 3KVKA 3B0PA 1YPFA 2TSYA 2F84A 2ISSA 5BNKA 5H2ZA 1GOXA 2A6LA 3FIGA 3TR2A 3KVJA 3LOTA 2QCCA 4AF0B 3PB2A 2OMAA 2E68A 1QPNA 3EXRA 3L68A 3USBA 3GDTA 1JUEA 4BK9A 1R30A 3CT7A 2DJLA 2EKCA 3IVUA 4PODA 4JIPA 4MIMA 3KRUA 3CQ0A 4O1DA 4QM1A 4N9BA 2NXHA 2YSWA 4AH7A 3TFCA 4A2RA 3RU6A 5HUOA 1LTDA 3E49A 1KW1A 4BFAA 2GUUA 3A9IA 4K37A 4N9DA 4A22A 1A5SA 3TSBA 1SUXA 2BZNA 3VE9A 4IPIA 3W88A 1FWRA 2WOQA 3T78A 1SPQA 3G1HA 4RJEA 3VI2A 2I9EA 3F4WA 1PHQA 1XXXA 1O94A 3CM4A 2J6XA 3LM7A 3P5ZA 4X22A 5LGZA 4OU1A 2A5HA 3R12A 4LVGA 1ZFJA 3UPWA 1H1ZA 3ABOA 1VRDA 1HG3A 4O13A 4PL1A 1JQXA 2RFGA 5D03A 1BKSA 5AYXA 4N2YA 4N02A 1FXQA 1QWGA 3W07A 1P4CA 4XWUA 4MJZA 5IBXA 4P2VA 3E9AA 1U83A 2YW4A 5FF3A 4PEKA 2V2DA 3F03K 5F1UA 1E51A 4AB4A 4MZ8A 3STEA 1XBYA 4IUOA 1XDMA 3M47A 2TMDA 3G1YA 1FDYA 4Z0JA 3UZJA 1I8JA 3CTLA 1B57A 1DHPA 3P81A 3GKAA 2Y85A 3W7PA 4CLMA 2TRSA 4BR1A 5HQEA 4CQ9A 4N9CA 4JYFA 3UWZA 3BW4A 4UNLA 3DFSA 2YFNA 5KTLA 1K02A 2FTPA 3WJSA 1P5BA 2WSQA 1GZGA 1PHWA 3GR7A 2QCDB 1K7FA 4QJ1A 5C6MA 1ML1A 1VJIA 4LWWA 3G22A 1TRIA 4UMAA 1ME8A 5TQLA 1S3HA 5SWUA 1VLWA 2VEIA 1DV7A 4O10A 3MP4A 3E0IA 3RLUA
chains in the Genus database with same CATH superfamily
3OLIA 1WDDA 3BAIA 3U2ZA 1QFEA 2Z26A 3MO4A 4FXRA 3VZYA 1GJPA 2G4FA 2KAUC 6TIMA 3BLOA 1RSCA 3R8GA 1WA3A 1TPH1 4HHHA 3QR1A 1K8YA 2L5HA 3BG9A 1YX1A 4QAIA 4HT3A 4UTWA 3KZPA 1V7YA 2RDUA 3B8UA 2Z1XA 3SM0A 4OV9A 3RG6A 1BYBA 3GHRA 4LAOA 3U2CA 5AC6A 2ACRA 2CZ5A 4XBKA 1JZ7A 5DT5A 4H1ZA 5GPRA 1OYAA 4JQ3A 5FJOA 2FZ9A 1XYLA 1RV8A 3DC0A 1VRXA 1C8YA 2QCLA 3HJZA 3ITVA 4AZHA 1TWWA 3M41A 4C6KA 4D6EA 4AZIA 3SO7A 3KHJA 5G2WA 5H91A 4J2MA 3A22A 3B9DA 1J0KA 2R1PA 3QR0A 1PDYA 5AHIA 1VB9A 3O16A 4IFRA 1FCVA 4ZQOA 3B03A 4AXKA 4RE0A 4MYAA 4G2DA 1Q4NX 3CUXA 3VOIA 2R24A 3GAKA 4PMUA 2ZE0A 4Z08A 8CGTA 1Q13A 1EPVA 1UJPA 5JBDA 3JS3A 5LNVA 1EP1A 4DO5A 1OIFA 3IACA 1TREA 2YCEA 4AW7A 1ECEA 3BSGA 1V3MA 1IWAA 3LCFA 1ZBWA 5LXXA 4B4HA 1XFCA 4YYFA 2HBVA 1H61A 2AOSA 1M65A 3URNA 4QJ5B 5DCBA 1XIDA 2INFA 1E9ZB 5HQMA 3HPXA 3WQVA 1ZS2A 1NTHA 4NXKA 3TXZA 1RPKA 3SBFA 3NZ1A 1H50A 5JBEA 2A6NA 5HINA 1WDWA 2PUZA 1UR4A 5REQB 5AC8A 3M0JA 2C6QA 2VCBA 2OX4A 1FCUA 3B8WA 3O63A 3TQVA 1EH9A 9XIAA 4M19A 4PA8A 1FP9A 3NGJA 2BP1A 5D37A 4M51A 4KFNA 3KUMA 5EMMA 3ABXA 4O53A 2WMJA 4GC4A 1O4UA 1ICQA 4FEZA 4PTNA 3JW7A 4M6VA 2ZRYA 2VMFA 3S6DA 1G4SA 1MXGA 4EANA 1UD5A 1UKOA 3AALA 4IQDA 2OEKA 1ADDA 1MDRA 3ZR6A 4JGDA 4WSJA 2ZADA 5I3IA 1PTAA 1XC6A 3R89A 1E3ZA 1PPIA 2WJEA 3WNLA 4HOXA 1DJNA 1DQUA 4JTFA 1ESWA 3F5LA 3VOHA 3HU7A 3GVRA 4LCRA 1ZQ5A 4LC6A 3UF9A 1W1VA 3IJLA 2XH7A 5CJNA 3SUTA 1YBQA 4G56A 3S1UA 1ALDA 5HMSA 2XVGA 4EF9A 3GDBA 2OT0A 3AIWA 1KFEA 3KBJA 1JCNA 4IQJA 4ICCX 4I6VA 3WL0A 5AC4A 3NDYA 2YBTA 1TCDA 3BK0A 3DG7A 4BI7A 3RX4A 1NFPA 5FJUA 1OGGA 2YCJA 2E3ZA 1IT0A 3TC7A 3N6HA 4QE5A 4C91A 2OU4A 3RXZA 3QKZA 3HO8A 1LM1A 5H8UA 4DBUA 1EJXC 2BBFA 4RL3A 3VIPA 2J47A 4E4FA 5AB3A 5K7JA 1KRBC 3B06A 5EBAA 3OODA 2ZOXA 1DWJM 4WEVX 1Q85A 5GJMA 1O6IA 3W83A 2ACSA 3D5HA 3NQEA 3WUFA 4PB4A 1GHRA 4JFTA 3GK0A 5AZ1A 5FAGA 4WSHA 1KBBA 2QR6A 3S8HA 1RA0A 2GK1A 3FGCA 3DGBA 3G3MA 2VP8A 3QMSA 2PP1A 2OGYA 4F3HA 2WZIA 4OOZA 1FDJA 4NNAA 1QI3A 4FXSA 3TTYA 3GY1A 4NVTA 1FWNA 4DWSA 1FTXA 1U1UA 3AIRA 1R9YA 4GA8A 1IE7C 3W2JA 3UCCA 3RCYA 2F9RA 1DWFM 4MNMA 3N9SA 3RMJA 4GZJA 3KE0A 2H90A 2I1OA 3QXBA 1NQ6A 3OIHA 4F4RA 1NP0A 1E4IA 3S5YA 3PZUA 3GFXA 4RV3A 1V6XA 3IARA 4NNBA 4ZFCA 2VC9A 4LRTA 1OCQA 4U3CA 3IAPA 3NUKA 3T1GA 3IGHX 3OO2A 3RILA 3ZLGA 1OJXA 1HFBA 3WK1A 5AHEA 2NQ5A 2MUCA 3NYZA 1KM6A 2EEXA 5D2XA 3W27A 1MWOA 3QSTA 3SRDA 2WWCA 4BQ3A 2FH8A 3W7OA 3KX6A 4H7ZA 4OGZA 4HPXA 3AXHA 1Q6CA 1GKRA 4CNSA 5CPTA 3REQA 5B7ZA 2EAWA 1OK4A 3D46A 3MDWA 3WO8A 1E71M 4B3LA 3NCOA 3IRSA 3A9BA 1AL7A 4UQEA 1QDSA 3PZVA 3TUUA 4M5PA 2OFJA 4GX8A 3W7IA 1KKOA 3APTA 4OWGA 3RJXA 1EOMA 3MMTA 3CLMA 3IUDA 4HB7A 4NAFB 4L7ZA 1X6NA 1ME7A 2E8YA 1UR8A 2CCRA 3WBXA 3ZJKA 1I60A 4JICA 5A6TC 6TAAA 2FDSA 4AG0A 2CLLA 1YTDA 3IAQA 2J66A 4IFOA 1TIWA 1MW0A 1WUEA 2V9DA 4P7QA 1PV8A 5GJPA 2Y61A 1TWZA 2P50A 1KV5A 4IG2A 4C65A 4LXFA 4Q6XA 3H53A 2D73A 4XKYA 1PZ1A 4OKDA 1LL7A 3GXDA 3UYCA 4DZHA 2H3BA 1BYCA 1QRQA 2VHLA 3BAKA 4LUTB 4IIBA 1NWSA 3UP8A 1PDZA 1X38A 2GJXB 4E6MA 3GRIA 3PF3A 4MAVA 2QNEA 3DEQA 4JFWA 4J3VA 1FWWA 1Q5MA 4O4WA 3P6LA 1BWLA 1VR6A 3NZPA 3C0LA 1R47A 1G9HA 1S2WA 2O56A 3FA3A 2OWCA 3QY6A 5CEWA 3UJRA 5AYZA 2BVTA 1JI2A 6A3HA 3EOLA 3AI0A 3G1AA 2WKJA 1QO2A 2J7GA 1SO5A 4IGSA 3WNKA 4CD4A 2PTXA 4W87A 5CBIA 4E5TA 2E5BA 1LF1A 1JI1A 3G1XA 3VKJA 1B3ZA 4RUBA 4OUIA 3V16A 4K8GA 5LYRA 3O07A 2VZVA 2NQHA 3RHGA 3GNNA 3UY7A 4UFMA 1S5VA 5D9PA 5U7SA 3AQUA 4NI8A 4XZIA 2R9RA 5L9FA 4NAEA 2V6AA 3U4AA 1TMHA 5JVLA 1ZUAX 5E6ZA 4W7WA 3SCQA 1ZPTA 1VYRA 3I6TA 2PWEA 1VFFA 1IWBA 2E1DA 2VZOA 3QQ1A 3WG6A 2QV4A 2VOTA 3CL7A 3MY9A 3ITTA 4JQAA 2XZ7A 3QM3A 1MQPA 1WKYA 2IPJA 1XCWA 2ZX8A 3KBNA 5HA7A 5CBJA 4HNLA 2YL9A 2WNQA 1LUCA 1N55A 1BGGA 1NH6A 1XYAA 1E6RA 3F7JA 3PHAA 4KIEA 5F2MA 4US5A 2QDEA 1RALA 3MA8A 2RUSA 5LZLA 1VJZA 4ILSA 1XGZA 1UWTA 3BWWA 3H4GA 1UZHA 4WIWA 1XFBA 1XYCA 5FL1A 1KWGA 1NWUA 2ISWA 4PSPA 4Q4MA 3WMBA 3OLGA 2I5QA 2D0FA 3WNMA 2VNCA 1B30A 1SFTA 2WKLA 4O16A 2OCZA 2R14A 3EX3A 3W84A 1NQKA 4XO6A 2P76A 5C0QA 1OFBA 3H22A 5LGXA 4L56A 3SI9A 3U7BA 1K6AA 2EJAA 2Z7KA 2G95A 4BEQA 4YS1A 3IIZA 3CUIA 1KB3A 1D7KA 4UQBA 3MMDA 3PJUA 4I7VA 3EWBX 2A0NA 1TJ0A 5HNRA 1JDEA 1OWQA 1T6MA 2QVNA 2FGLA 4AVFA 1QO5A 5MKGB 3LLDA 4GO9A 3W87A 3QOKA 4ZSUA 3CIWA 2IXUA 1W5PA 2ZX6A 3QF0A 3W53A 1PCKA 4DBSA 4LUIA 2EPMX 3BO9A 3BLFA 2Z2BA 3UZWA 4AHOA 1HJXA 3MP5A 4AIUA 3EWXA 4V28A 2WO5A 4Q4KA 3C2EA 1WV2A 3WMLA 2FZMA 2YYTA 1V77A 4P8UA 3I4KA 3CZKA 3QV8A 1FH7A 3NL5A 4AX6A 2PTZA 1TJ1A 5EU9A 4NQ1A 2XIMA 1R3RA 4E3TA 2GVLA 3QGVA 4CCCA 4W93A 1LL6A 2J7CA 1XSKA 5C9RA 1W5QA 2PS2A 3NQ2A 3S47A 4FHAA 1E6SM 2BS9A 4ORMA 3MMUA 1UH2A 3MBFA 4UTUA 3E5BA 3BVJA 1XIHA 1HKWA 4IHCA 1RBOB 4XK2A 4XZ9A 1LROA 4DWSD 2WHLA 4IMCA 3SRHA 5C54A 5IHRA 4NU7A 3QSRA 3WQCA 4MWAB 4JN6A 1XJBA 4QQ3A 3RX2A 2PCEA 1AD1A 4N4QA 1WXJA 1TVLA 3TR9A 3TN5A 3GTHA 2OVLA 2ODOA 1W9BM 4MKNA 1M7OA 3L0GA 4GIYA 1TE6A 5C2CA 3JZEA 3POHA 4CEXC 4CNNA 5A6SA 2CWNA 3F2DA 3WJXA 1SMDA 1EPXA 4LU0A 4CCEA 3AFBA 2Q71A 4F2TA 4F8XA 1CLVA 1OFAA 3AAMA 3AS1A 4UFHA 1B3VA 4MY8A 4DPQA 5G5IA 1FWTA 3S6OA 5K9DA 4GD0A 4EAYA 2HCVA 3DFNA 1YXCA 1B2YA 4JTEA 5GJNA 2ZXAA 5CSYA 2IUZA 1H5YA 2PDLA 1BQGA 2HEJA 3TX9A 3TVAA 1ONXA 3OYZA 4HSNA 1ICPA 3WLHA 4CQBA 3N25A 4DB7A 1KFCA 1W3LA 3DFTA 4W84A 2PPGA 4DZ5A 1TV2A 4HHLA 1OD0A 1B4KA 4DXKA 5I02A 1CT5A 4TQTA 3UA3A 4I5UA 4S3AA 5C8BB 1Q6DA 1F3EA 3SFKA 1KQZA 1MEIA 5F4SA 3L4UA 2ZXBA 5C9ZA 2ALRA 4AC7C 3RITA 1Y65A 1YXDA 3PN8A 5TIMA 3S5ZA 4HYVA 4JCLA 4XZNX 1RVKA 4B92A 1KLYA 4O0ZA 4GACA 3T7VA 1SO4A 3NG3A 1J9YA 2XFRA 3V5FA 3W76A 3W6LA 3ZFHA 4WGHA 5DX7A 2CLEA 2YCIX 4HU8A 3B4UA 5JMUA 2YL5A 3WF2A 1H51A 3ABRA 4G6CA 4R34A 4AWSA 3P14A 2PAJA 3T0TA 3RMEA 4DBDA 3AIVA 1JZ2A 3NSNA 4FX8A 3KP0A 5HUPA 4P61A 1T8QA 2YZRA 4O11A 4L4OA 4XO7A 4XD4A 2G97A 3GE7A 3HBLA 1YMYA 2PDQA 4Q4QA 1MQRA 1H3GA 5D33A 2VVSA 3F2CA 4EKJA 3MHFA 3I3BA 3GNPA 4JTJA 2TPSA 1CNVA 5DBTA 1YE6A 3B8DA 2VX7A 3IJQA 4IISA 1MQQA 3ANVA 5TBOA 4WJ8A 1GYNA 3DN5A 1KFWA 2NX9A 3RN6A 4JIQA 4TVUA 4QDMA 4GFSA 2CW6A 1IF2A 4CKQA 3T4WA 2ALDA 3GG0A 4HPGA 4QCEA 2PSNA 4JTUA 3KFTA 9CGTA 3DX5A 3GQYA 4JBRA 4V2XA 1SZFA 8XIMA 5D2YA 1XLHA 3M16A 1QHZA 5FESA 2PDYA 3DFYA 2HXUA 3VM7A 3TA6A 2OSYA 1LLWA 1R9ZA 1UKTA 4UQAA 4FO4A 3N29A 4DJDC 5J04A 4B5NA 4PYSA 4IMFA 2DW7A 5CCZA 4O18A 4LYKA 1CCWB 3IJ7A 1B5TA 4R9XA 4XZWA 2PDHA 4J7RA 5K4XA 1XR2A 3I10A 2Y8VA 5CG0A 1N8WA 4A35A 1AH0A 1YPXA 4C90A 1D3GA 1UPMB 1W32A 2FHFA 1A5CA 4GCAA 4XAPA 2C14A 3W7EA 5E9XA 4W7VA 3GD6A 3SZ8A 3W22A 3P0XA 2BVDA 3VOGA 3W7LA 1ZLPA 4J35A 2OZ8A 4B91A 1ONRA 1KFLA 2PI6A 1SGJA 5IOBA 5A94A 3W7GA 2QIWA 3W0KA 4W7UA 3N2OA 1TPUA 4KESA 4NASA 4TV5A 1X96A 3C2OA 4CCDA 1VFOA 5A5WA 2OGJA 3BLIA 3KDOA 2B7PA 3PC0A 3E74A 3A21A 1UUQA 4FOKA 3OGVA 4KFPA 4S3EA 4KRUA 3O2LA 5HK4A 3F4DA 2F61A 2XG9A 4DUOA 4J2PA 5GVJA 2GVGA 2PMQA 5XIMA 1KD0A 1V03A 1EUNA 3LHWA 2CBIA 4QR6A 1M7JA 4IH3A 4REQA 1L6YA 2ZFAA 1UCWA 3H4WA 1ZNNA 2D24A 3G0SA 5CZSA 3NJ3A 1X39A 3THAA 4QISA 4MLRA 1XGEA 1POKA 3GNRA 3NQ7A 4NZCA 2J9ZA 4EE9A 4KCUA 4UOJA 4NJHA 2QXWA 4GUGA 3QHOA 4LALA 4ZB5A 3W7NA 1JPIA 2QPXA 5HULA 3II1A 4GUIA 2O9TA 4Y9OA 2HJPA 2UY4A 4EX4A 1EJ7L 2CLHA 2DT2A 4PMRA 3AU6A 1XQKA 3GG1A 1MRQA 2JKPA 2Q8LA 3W6MA 1BXCA 1ONWA 4Y2WA 3LZ5A 3B04A 1R8LA 1TPDA 5FSEC 1JIBA 6CGTA 1E6ZA 5HJLA 3G6MA 3W2MA 4EPDC 3J7HA 1MZHA 2ZVIA 4HMCA 3U5UA 5FEPA 2VEPA 3A47A 4IPPA 3AICA 3SN0A 2Z1BA 4AX7A 2C15A 4MJMA 3EOOA 2Y88A 2INZA 4UC5A 3W71A 1KXHA 1OEPA 1MUWA 3U4FA 2FKPA 2O7QA 4I5XA 1HL8A 1US2A 1DJYA 3WBWA 2CXGA 5HPCA 4MY9A 3NURA 4O14A 1TJPA 4MG4A 2PF8A 1DJIA 5F7UA 4DAIA 2J24A 4AY1A 2F6UA 1IWPA 2WW5A 1K77A 1MXSA 1L8PA 4D6DA 2ISFA 2X7VA 1KRAC 3GHUA 1UD6A 7TAAA 3PSWA 3L4WA 4MZ1A 3NQVA 1YBQB 1BGAA 4PC8A 1QBBA 1UWIA 4RNHA 2D2JA 4FNQA 5EB8A 4KH2A 1PS9A 5C9XA 4K38A 3RR1A 2DVUA 4MNKA 3PZMA 4MB3A 3MKCA 3STGA 4DO7A 2XFFA 4B15A 1EXBA 2NQZA 1VEPA 1ZJAA 2PDFA 2BASA 5G1TA 4GBUA 4W9TA 2EF9A 5A6MA 3KEHA 1F74A 4FR6A 2CWXA 2QJGA 1NOWA 4IT1A 1J93A 2QUVA 4FF7A 3TQ0A 5A2AA 4JTAA 5LSMA 1EC7A 3S4TA 6XIAA 3FVDA 3ALGA 4GQBA 1E9IA 3BICA 4XZBA 3FDKA 5FEXA 4NILA 4S3KA 2ZZ1A 2FDMA 4JTRA 1CWYA 3T0DA 3UR7A 1GQLA 3FSTA 4DO6A 3QMRA 1W8SA 4HKPA 1AL8A 4LY4A 2VCAA 3A4WA 5EBUA 3M7SA 3CB3A 3T40A 1OCBA 1EGZA 3VIGA 3VO0A 3A5FA 2GK1B 2ZBTA 3VIMA 2Y8KA 2I5GA 2ZUWA 2WHJA 3AMDA 1TV4A 5BOEA 3PBVA 1T5AA 1C3FA 2B81A 3FJ4A 4DWSB 1TYGA 2EG8A 3N2TA 2PD9A 4E0CA 1JCMP 1TSIA 3LTSA 3C3UA 4KETA 3VD9A 3LCXA 4NZ4A 2DEPA 4MDPA 4A21A 1H63A 3DKLA 5KSWA 1DIOA 4KWUA 1Q8JA 3HQNA 3GUGA 1VZWA 1TV8A 3L23A 3FYYA 3RX3A 1J5SA 1SZNA 5AYBA 4Q8QA 5XINA 1E3XA 3MUY1 4E2BA 3CTTA 3R25A 3CHDA 5A8QA 5CJ5A 3ARSA 3MMWA 4JNMA 3Q94A 4ZQMA 1O5XA 4IIFA 4IFKA 1E5NA 3TKFA 3WD1A 5BMWA 2V68A 2OLSA 3RGTA 4MLJA 1J0HA 5G2IA 2JQXA 2TAAA 1BF6A 2CLMA 3SJ3A 2WSPA 5D05A 4Q8MA 1B1YA 1KQYA 1WAUA 3CNYA 3HB9A 3MO7A 3WF3A 4ATDA 1FWEC 4MUZA 4AMAA 4A3QA 2X41A 1W6TA 4LAMA 3ATZA 5AFDA 3VDHA 1IEVA 5HBFA 1P1XA 3SCWA 1NFBA 5C2GA 1HN1A 3A5VA 3SCRA 1MNSA 1J6PA 1LBLA 4G5DA 1NAL1 1VH7A 2VZSA 1RPXA 1PBGA 3GB6A 5CKSA 3R58A 2ZYFA 4KGLA 4N7QA 3BXWA 1HVQA 4O19A 5BU9A 3UZZA 4GWEA 2ZZ3A 1HQTA 1X1ZA 1DJHA 3C3NA 4LEFA 2OX1A 2QJJA 3BV4A 4IG2B 3O06A 2FIQA 4XBSA 5HXMA 3VD3A 4A8RA 3OZPA 4M7TA 4XKYB 1XIEA 3CMFA 4GO8A 4EPKA 5L6UA 5DN1A 1DJQA 4PBEA 3V3WA 1AD4A 4NXSA 4UIOA 2RAGA 3KOZA 4GHRA 3ZSTA 4LF2A 3MYPA 1TR1A 3TA9A 2FZNA 3CV1A 1YTKA 3PZOA 2QCMA 4JX5A 4CNUA 4ZXOA 4E3VA 1UW9A 1SFLA 4NZ1A 4O15A 1TO3A 2NZLA 2ZCGA 3G1RA 1K8XA 2OO6A 2EQDA 2D3LA 4UFLA 4Y9NA 1OSEA 3BURA 4Q8PA 3D3AA 5G1YA 1JJKA 1ZJIA 2JEPA 3CK5A 3CL8A 1KM5A 4U3AA 5EFDA 2NT1A 3C52A 5I3HA 5BW6A 3BMVA 2DZTA 4RE4A 4Y8FA 3UETA 2QIIA 1NDYA 2D23A 3C4UA 2DZWA 2AQWA 3QTPA 4WDTA 2X1SA 2QHAA 5FJRA 4ZFMA 3U6WA 5FF2A 1DWGM 1AA1B 2DZXA 3GZ3A 3VMOA 1VKFA 1W3HA 3G1DA 3PUDA 4FZIA 1BRLA 3TQPA 5LIXX 3H7VA 3IVTA 3U9IA 1BFNA 1ECQA 2HVMA 3HOJA 5G4EA 5HNUA 1S46A 1VEOA 4X0NA 4RW5A 3WEZA 4PGLA 3UW6A 2PGEA 3SURA 5EMYA 2WAGA 1GOXA 1PZ0A 2A6LA 2H9AA 3FIGA 1KRCC 2EG6A 3TEVA 4C6EA 4AF0B 2GSJA 2ZWZA 1QPNA 3EXRA 3L68A 3N11A 5BYWA 4WCJA 4DWDA 3AMCA 3CHCA 4R88A 4BCEA 3RIKA 5A1AA 2HE8A 2E0PA 3B3DA 3KRUA 1E0XA 1JPMA 2GQ3A 4AH7A 3TFCA 4A2RA 5HUOA 1LTDA 4NRSA 4BFAA 4PB3A 2PDUA 3WUBA 2GUUA 3CV6A 4QG9A 1SUXA 2BZNA 4IPIA 2NVCA 2AKZA 2WOQA 3T78A 3G1HA 3LM3A 3VI2A 4LCQA 1PHQA 1CGXA 4P7RA 4OU1A 1ZFJA 4MPKA 3UPWA 1H1ZA 4MM1A 4O13A 3MKKA 4N0RA 4CGTA 1V02A 2RFGA 4M1BA 3OW1A 4N2YA 3KWSA 4N02A 1KBKA 4NP7A 3QN3A 2CEQA 3K4AA 4EXAA 4UB9A 2XUCA 1CLKA 1ZP3A 4WKHA 4GI6A 3UT0A 1DHPA 3P81A 4ML4A 2Z29A 1FHUA 3W7PA 4LGXA 1JAKA 2WSKA 5HQEA 5M3WA 3UCQA 4CQ9A 3AU2A 4PCNA 5KTLA 1K02A 2FTPA 1RLCL 1PHWA 5D8ZA 1HJVA 1VIZA 5C6MA 4JOMA 1VJIA 2DW6A 4KMQA 4YTTA 3BOFA 4PUDA 3SUSA 3T09A 3T0AA 4KF1A 1OFQA 2YXOA 4S23A 4DJDA 1RK6A 3NWRA 5D2TA 3DH7A 2EPHA 4GXWA 1J96A 2XJ7A 1DKWA 3FY1A 1XRTA 3MDUA 2W27A 1FWJC 1K4GA 1RBAA 2TODA 3BQ5A 1A53A 4GKLA 5TF0A 3OG2A 4TU1A 4C6NA 4EF8A 4XIAA 2DQXA 1SZRA 4JDYA 3VCRA 1XIJA 2ZUUA 3LDVA 3PZGA 3N4EA 2ABAA 3KOWA 1DXIA 1UQZA 1L6GA 3TZNA 3LQLA 4TMBA 2B31A 1T0OA 1TMQA 5CZ0A 2V82A 2IQ0A 3QZAA 3PBUA 3WCZA 1O5RA 1KLZA 2VL4A 1XRSA 4DUWA 2PB1A 1NF0A 4F2BA 1R3TA 4MKSA 3P2VA 3W37A 1B3OA 1YW1A 2V2HA 1RVGA 4IXXA 3VFLA 1XKYA 2YCKX 2DIJA 2Z24A 3WMSA 4S39A 3M0MA 3L2IA 4G8TA 4ZA0A 4N4PA 3C8FA 3INPA 3R7MA 3HGJA 4HZ8A 3HQOA 2XH4A 1KTNA 2PWGA 1VEMA 1XLDA 3HM7A 2YB4A 1NWRA 1LWIA 3VCCA 5AZ0A 3NOEA 5A95A 1FHLA 2QPUA 4XISA 4M1RA 1PZ2A 1Q2SA 2YBVA 1UR9A 3L0NA 3PR2A 4AY8A 1R87A 4H83A 3BJTA 2UV8G 3TNBA 4ALDA 4TMCA 3UXDA 3AXIA 4XD5A 4LOCA 5DT7A 3EKGA 2J79A 4JPGA 4QLJA 1JPKA 1GOIA 2ANUA 1M04A 3M7WA 3KRSA 4FNUA 3AISA 2VT0A 2VUNA 1W17A 4AMCA 1QNOA 5DFAA 2H8XA 3RF9A 5LNUA 2ZXDA 1VPXA 4Q22A 4UTLA 4WHBA 5CPLA 2NQ9A 3GTFA 1DJZA 2E25A 2VC5A 3FHAA 2BHYA 2ZX9A 3VDAA 4MADA 4M6QA 5FD0A 2YKKA 4NY2A 5A6JA 2PWDA 1DJGA 1SW7A 2R1LA 4I9MA 7REQA 2P53A 3QVQA 3DAQA 4H00A 4PCSA 4AZ7A 3KAOA 8A3HA 3W6YA 2WJDA 1OINA 2ZRXA 4OQVA 2BGNE 4ZOCA 2W9MA 4O52A 7ENLA 4O50A 3WL1A 3HPFA 3AYVA 2YGYA 4LUSA 1WZMA 1UHVA 1GEHA 2W6RA 3TC3A 3RM9A 3LA4A 3EWWA 1J0ZA 5MHBA 4QFUA 1QI2A 3IIPA 4E8DA 4UR9A 3W00A 4AZBA 2OKOA 4H7VA 3S42A 3NO1A 4IJBA 3ITGA 3PPCA 2NXGA 3DUGA 2ZTKA 3VOFA 3TYUA 3BW2A 3P61A 4B2DD 4BY3A 3M6YA 1C93A 4H6KA 4D72A 1JZ4A 4KFOA 3P7YA 4FOUA 4RR4A 4JHMA 3WJZA 2DZBA 3MUZ1 2ZZ5A 2VURA 1M53A 3L4ZA 4YCOA 2X0YA 3BAYA 3RJYA 2PRHA 4C1LA 2J9XA 4EACA 5FIPA 3VINA 1SZGA 2I7GA 1CB7B 2E6AA 4A8NA 3VMNA 7XIMA 2W0UA 1CEOA 3KBWA 3H4XA 3O6AA 1TPVA 1RUSA 5GQBA 2WLZA 3BG5A 4AZCA 2VFGA 1M6JA 1ZL1A 3E2SA 1JXKA 4ENLA 3AYSA 3FAXA 1SO3A 4FR1A 3QZEA 1TTJA 4E8GA 3L9CA 4LT9A 5AN7A 5D4YA 4W89A 3M5XA 4IP4A 3ZLHA 3U2OA 1XLIA 3EA2A 4H9TA 3ES7A 4EVZA 1B4EA 3VDGA 1XIFA 3WY1A 2GGIA 3WX7A 4AEEA 3M46A 1TX0A 2ZC1A 4WY0A 2VGIA 3LU2A 1K8ZA 3R0KA 1ZBCA 4DNHA 4P8WA 4ZQPA 1Q8AA 1QW8A 2YIHA 3R10A 1QOPA 1ZRQA 2CLKA 3IUIA 3MUAA 2YXXA 4GVFA 3CEUA 4UTTA 2QS8A 2YLAA 2C18A 3AUJA 3M64A 4MWAE 4B5XA 3WF1A 3BL3A 1H7RA 4R9OA 1JZ3A 1ZU8A 3NVDA 1IEQA 4XUYA 3N73A 2GVJA 2OQLA 2WV8A 4NG3A 3WQPA 1SSDA 1QJWA 1PJ9A 1TE1A 4PMOA 4PMYA 3O6CA 2QZRA 5JQ9A 1VHCA 2VFIA 5HR6A 3R94A 3TZFA 4DVOA 2D22A 1HJSA 1TTPA 2XWDA 4QRNA 1HNYA 1CGYA 1HJQA 1M7PA 3ZS4A 5HWNA 1WDQA 5DLCA 2WC7A 4UUIA 3GIYA 1KBLA 1W5MA 1A4LA 2J7EA 1JNDA 2PLCA 3LPGA 1OFDA 2E09A 2F38A 2A7RA 1J0YA 2YB1A 3EBVA 1H7WA 1I75A 4D8AA 2FMOA 1RQHA 5K4ZA 3M43A 3V0SA 3P74A 3URQA 1AW1A 4BJHA 3QGAC 2JKAA 3T44A 5A6AA 3BJSA 4QEHA 4DJDD 2QW5A 3DCPA 4CU6A 1F7BA 3H24A 4REQB 1J5TA 4Q4OA 4URIA 1OD8A 1JEZA 4JS3A 4M81A 3CGTA 5A8GA 1N8IA 3LD5A 4RZBA 4B90A 3MJMA 1QPQA 2I57A 1NM9A 2AGTA 1UA3A 1XD1A 1UR3M 5KITA 2XVNA 1AMKA 1V5XA 3PBYA 2Y7DA 4S3BA 3CL6A 3ZJ7A 1XH1A 4JFUA 1SJDA 1W8GA 2Y24A 3DI1A 4MB1A 1X1OA 4W5UA 4DI9A 2HQAA 3NTYA 1CGUA 4QG6A 3W2KA 4R27A 2FZ8A 2G0WA 4IPNB 2AAAA 3DG3A 1Q7ZA 1JNEA 5CGQA 5C9UA 2YCLB 5C71A 3LPFA 3EWZA 2BVYA 3M9YA 1EDGA 1HZYA 4NZFA 4O54A 1TVNA 4DN1A 4U31A 3HG3A 1L2QA 4I7UA 1ISZA 2XIQA 3PPFA 4UTWC 3S6TA 3ES8A 2WBKA 2PURA 1NY1A 5HMEA 3KCJA 2OYLA 2GSEA 3E38A 5J5RA 4RK8A 4TOQA 3V1HA 3N1AA 1F6PA 3AHZA 1GOMA 1UD2A 1LOLA 5D9OA 3KTSA 1FH8A 4XV0A 3S1WA 4JIHA 5JH1A 3UNDA 2YBUA 4ZXLA 3TTEA 1Z89A 5ABEA 3V7PA 1JCYA 4R33A 4I8DA 3GS6A 1XYZA 4I90A 3UESA 2J8GA 4DX3A 1ODZA 3SRFA 5FF7A 3FEQA 1UR1A 4MB5A 4HIBA 2OT1A 2J8TA 4I6KA 3QW3A 1DIEA 1KA9F 5KETA 4ZO8A 1RCOB 3TP4A 3R0UA 4WKAA 1XPGA 3SCPA 2HZGA 1EF3A 4B5VA 1GYLA 2CPUA 4LC8A 3CPGA 1PL9A 4NKCA 1UMLA 1DTNA 3QV9A 5D38A 5IFTA 4GNVA 3UVAA 5U4NA 4H6EA 4NJJA 5AECA 1OYCA 2PDMA 2NUWA 4GVIA 1S5NA 5I79A 2V38A 3A13A 1V0NA 4A6GA 4MKVA 1A5MC 1EKOA 3VGEA 1BEUA 3NL6A 3TW7A 3GW0A 3CEPA 3LERA 5LHEA 1UG6A 5HR7A 5E6YA 3N18A 4JTLA 1WBJA 1HIZA 5AVHA 3W75A 1KKRA 5C55A 3TAKA 4F9DA 1YQ2A 4JTIA 4GYPA 3UR2A 5FOOA 1BF2A 2Y1HA 2NV2A 1E9LA 3ALFA 1OX5A 3SQSA 4WXZA 4RPPA 2UWFA 3F4CA 2ZRWA 3T9PA 3UXIA 1NU5A 3RPDA 4Q8WA 2YL6A 2VI0A 4MNLA 3WQOA 1BPLB 2J6VA 3GIPA 3N34A 3F1QA 4ZQRA 3L4VA 6REQA 3L5LA 2PTDA 3LTPA 1LBMA 3UEQA 4DLMA 3EGJA 3VXGA 2W67A 4GBDA 1XDJA 1YNPA 4PULA 5I6SA 2VDGA 1RJPA 4MUPA 2OLAA 2WZHA 3KL0A 3P8IA 3SCVA 3IWPA 4UR8A 2QPSA 1V3IA 1Q4WA 1V0LA 2TYSA 1WPCA 1V3JA 3PS7A 1QPRA 3RFAA 2CLOA 1EEXA 2BFGA 4X2RA 4PUUA 2ON3A 2BLEA 4C6OA 3IK4A 1P0BA 5T9CE 1E72M 3HV9A 1WZLA 2A2IA 4Z2IA 5I24A 3PPGA 4B5UA 6PTDA 4YWSA 3IRDA 4YXGA 2VGGA 2C7FA 2IPGA 2CHNA 3V36A 3OBEA 3M0LA 3LCGA 3NQMA 1F3TA 4QAWA 2ASHA 2INEA 3KWXA 3IVSA 3U3HA 3W24A 4NX5A 4FNSA 3W7MA 4JY8A 3PTKA 4RDZA 1JF5A 5AYIA 2NWRA 4GYFA 4NYUA 2FPYA 3V5CA 5A8NA 1XG4A 1WCGA 1EIXA 3TJIA 3WLQA 2WC3A 3ARRA 5CBBA 4C7DA 3UVIA 4C6MA 3DERA 3QFEA 2C19A 1VF8A 1XINA 3O0KA 3MI3A 4GRSA 2GL5A 3SR7A 1JR1A 1VCFA 1RP9A 4I9JA 3L4TA 4INFA 4O57A 1OG6A 2NUXA 3PZIA 3SCTA 4H9MA 4PEEA 3HQPA 1YHTA 4L9YA 1FBAA 3VGHA 3TYDA 1IEXA 1ZBKA 3LSBA 3EMZA 3EPOA 5ABGA 2BODX 4KWWA 4O0KA 4ACZA 1HGWA 4JIRA 3H2MA 1FKXA 1EJVC 4LFYA 4JTDA 5EMJA 1VHNA 1MDLA 4GQGA 3K8LA 4DM1A 2WJFA 2F2KA 1CZ1A 1D3CA 1GVSA 4A8IA 1FWIC 3TWAA 1YDOA 1GQIA 3GYEA 4AISA 1R2SA 2WXDM 3W73A 2W66A 3NEHA 5E93A 3T8QA 4E2OA 4AEFA 1DOSA 4ZODA 3WLNA 2ZRVA 2HS8A 6ENLA 4D9PA 1C9WA 1TG7A 3LK6A 4GUJA 3CV7A 2G3JA 3LNPA 2CYGA 2G3MA 3IV8A 1XIGA 4BQ4A 2FB3A 3GR8A 4U28A 3LN3A 4GVGA 3LTYA 1OYBA 1GHSA 4HA4A 4JX4A 1AFSA 3GYCA 3MUIA 3L4YA 4RX0A 2FLIA 3L2MA 2UY3A 1FY6A 2VX6A 5K3VA 3GAYA 2D20A 3WEOA 3GHTA 2VDHA 1MRAA 1BRLB 1LYXA 3NQ6A 4O1AA 4UZSA 3C2RA 4LTSA 3RO8A 3KM8A 4F0HA 3DXIA 4HU3A 4DI8A 3T42A 5BROA 1EP3A 2XISA 4WRHA 5BZAA 2FJUB 1R5YA 5LKYA 4IMDA 4JEQA 2H9AB 3EOEA 4HHPA 5DO8A 2QCGA 3QR3A 4GLEA 2PEVA 3FS2A 2QYGA 2BHUA 3MSGA 4WGXA 2OKTA 3GXNA 2ZXQA 5JUVA 2WZMA 3AZTA 4HNNA 3VUPA 2DUAA 4TTUA 1IXQA 5A69A 1F05A 1CGTA 2XFWA 5T91A 3VE7A 4QDWA 3WYZA 3MKVA 3LBOA 2PRLA 4GKTA 2HPMA 4ZSTA 1W1PA 2A4AA 3BGGA 3M5ZA 1TUXA 4Q4SA 1F2JA 5A6KA 2NLIA 1UIPA 3PULA 1ONEA 3MCMA 2HISA 5C70A 1U22A 2G37A 4CQ8A 1F76A 3WD4A 3PUEA 3DBPA 1HP4A 3SY1A 2GJPA 1R38A 3IS4A 3UFYA 1B9BA 4GJJA 2WYSA 3C2YA 4BQ5A 1R86A 3HV8A 4E2VA 3BAJA 3WELA 4FXFA 2V81A 1DQXA 1I6NA 3ORWA 5HJYA 1Q6OA 3QV7A 3T05A 1HUVA 3XIMA 1A50A 1WKEA 3QY8A 2QUUA 1R2TA 1YYAA 4M29A 2X05A 5I77A 4XAYA 4O28A 2PTWA 1REQA 4AFYA 2VFHA 3QGKC 2D1ZA 1DQWA 3EYPA 1K3UA 3CUHA 3HN3A 1SW0A 3GG8A 4XSMA 5F4XA 3W2LA 1DIDA 2HSAA 1MO0A 3W1XA 4IMGA 4QNWA 3S1XA 4GH1A 3O05A 1MUCA 3GVGA 1OX6A 2ZUNA 2X1UA 4F0KA 1WNOA 2ZTJA 1JDDA 2HE5A 3EKLA 5I0DA 4OZOA 1TX2A 3NOYA 4O4VA 2EG7A 3IEBA 3VNMA 1K9TA 3QZ6A 3ZIZA 2GGEA 1NWTA 3A3HA 1F5ZA 3DFPA 4YVXA 4JFVA 1B31A 3M4HA 3C86A 1SM9A 3VMPA 1DP0A 3ZJ8A 3AWOA 1PTDA 1XM3A 2V3DA 2X40A 2ZA2A 3STFA 3G24A 5HDRA 2NVAA 3F2BA 3G5EA 1N8FA 3LZ3A 3GH4A 3G77A 1XBXA 3BSHA 1DL3A 4PRWA 2QCNA 4BWLC 3S9YA 4X2PA 4PMVA 1KNWA 3SJNA 2CBJA 1A0CA 2XIOA 4Q8UA 3EAUA 2PRMA 4LBSA 2C0AA 4HCDA 3TQKA 3VKBA 1QW9A 1GONA 1E1FA 3LX9A 4FSAA 4L5ZA 3B97A 1ZZMA 4OTKA 1CB2A 3WLJA 3MZ2A 3N9RA 5BMXA 5DXYA 4UBPC 1UROA 1R9XA 2OPJA 3NQ8A 3BLDA 3M0HA 1X98A 4S2CA 3KOYA 1PTGA 1FQ0A 3CHVA 1QHPA 3WUGA 4S3JA 1H41A 2ZE3A 3VKDA 1O7AA 3VZZA 3G2GA 1HJUA 1UD4A 1Z44A 5AHFA 3OG3A 1FWGC 1QUMA 1ME9A 3Q58A 4IX0A 3SGUA 1IHIA 4RV8A 1OIMA 1NARA 2J75A 2IKIA 1EZ2A 1H0GA 1W0MA 3Q37A 4I3GA 2WZEA 3NM3A 4CNTA 4MMWA 1L6FA 3IGXA 8XIAA 3QOMA 1A80A 3PJTA 2VR4A 4X63A 2ISDA 3N17A 7REQB 3AMKA 1XLMA 4TX8A 2YOCA 3BC9A 2CLPA 4E4UA 4F79A 3QHMA 3WQ4A 3WSUA 3AS2A 2MNRA 2PDKA 1O5KA 1KXQA 3JUGA 4PMDA 1QNSA 2ESCA 4A3RA 3HMJG 4KW2A 1GTEA 4R7OA 3PJXA 3ZXWA 2RJHA 5D8WA 4LUSB 3UCDA 2O55A 2BY0A 3LCHA 4UMBA 4JKLA 2Q3RA 2UZ9A 2D2HA 4B3ZA 3E96A 3V35A 4QG8A 2CKRA 1VIWA 3HPSA 1QNRA 4WK9A 3CWHA 2WSYA 1XIIA 4DEFA 4L4MA 1THFD 3M1ZA 2FGZA 2ZWYA 3GNDA 1A5OC 4PTVA 2XIBA 1ITCA 2WNNA 3OQ8A 5IFPA 1UWSA 2H3DA 3CH0A 2I9UA 1VYPX 6ALDA 3NDZA 1RQEA 1JFXA 2WMFA 3VKAA 4ZENA 1R3QA 3QY7A 3B0YA 4GOAA 4XQ6A 3LGEA 1ZBVA 1QU4A 2QDGA 2A7PA 1Q66A 2Z1WA 3FK4A 1Q65A 4HK5A 4A2SA 4D6CA 4S3CA 3EWUA 3BE7A 3G6LA 1AZ1A 4PFHA 3SQLA 5FJJA 1LLZA 3HMCA 3WNOA 1LBFA 4UWMA 4PCPA 1BTMA 4QBXA 1K7XA 5ABHA 4FK9A 1NDVA 3K8KA 1V3LA 4LUYA 3N14A 3PG9A 3F4NA 4ZQNA 1RAKA 1XLKA 5GNXA 1YXYA 3GC4A 3M0YA 3QLDA 4LS1A 2XSAA 1U30A 5BU6A 2VWSA 2QDDA 2YXGA 1MXDA 1JRCA 2ONEA 2JIWA 2D69A 1EC8A 4LNCA 4EXBA 4J3ZA 3NSXA 1L0PA 1CX9A 1VPYA 4XX6A 5BXSA 4EWND 4PUNA 1LOSA 1J0IA 1MI3A 4GX9A 1KM2A 5HAOA 1N82A 1F61A 2PDPA 4BEUA 4C6JA 2Y63A 1Q6FA 1UZDA 2WHMA 1X8FA 4CVUA 2OYKA 1YTEA 1R3WA 3DECA 3T2OA 2IMRA 3STCA 5I09A 1WE5A 1VCGA 3PUGA 3KTCA 5AHNA 3MP3A 1GG1A 3HPAA 1I9CB 4X0VA 3BV7A 1KFKA 3S1GA 1XW8A 3KRZA 4L1GA 3AS0A 4ADSA 1GT8A 3NPXA 1PEZA 2W91A 4H9VA 4IL0A 3APGA 2DIEA 5G4WA 2ABBA 1VCVA 5FEWA 3QC0A 1DXFA 1LRNA 4GH3A 3CB8A 1W2VA 3PAJA 2FGBA 4YTQA 3TYZA 1J12A 4WR3A 1ELSA 2CHRA 4K1GA 1QWKA 5T8GA 1KM1A 4ZB0A 2O4QA 3BZGA 3DOPA 4L64A 1W9DM 5G2HA 1K7EA 1TIMA 2PP0A 1EHAA 3WLPA 4F2UA 1CENA 3ECQA 3P8JA 1SU5A 4AD3A 2CZVA 3K2GA 2FVKA 3UU0A 4K6AA 4DPPA 3EDEA 1P0DA 2FJKA 5I78A 4GJ1A 2PLJA 3SSJA 3WJYA 1KWKA 4YYCA 2NSXA 1HKVA 3RLVA 1W91A 4PUEA 1J01A 3QQWA 3E3HA 4K8EA 2DPEA 4D6JA 3LGGA 3K8MA 3T0CA 3W2NA 1PYMA 3CIVA 4ERAA 3CASA 3VAVA 2IXVA 4JHOA 5M5DA 3NL3A 2G3NA 5E09A 3LENA 1D2KA 2JEQA 1UMYA 2R94A 5BWFA 1Q45A 1XHGA 4HYWA 3LHZA 1TWIA 1XV8A 2NT0A 3AS3A 2VEGA 3G3DA 3CV2A 3H70A 5CXPA 4JTGA 4YHEA 3E5PA 1UZ1A 4NNCA 4LJ3A 1W31A 1P48A 1RR2A 3EX1A 4LVAA 2VRJA 2DVXA 5CPOA 4WXYA 4H9YA 2WK2A 3K30A 1K70A 3B0VC 3C61A 3CAWA 4X61A 2BXYA 4EK7A 2YPIA 1QW7A 1XC4A 4FXJA 2J7HA 2JBMA 3TLQA 3EA1A 4CN6A 3KLLA 3BG3A 4B4FA 4OIFA 3R8RA 3VKCA 4PRRA 1V6WA 4UTJA 5EGRA 3FYOA 2VD8A 3BARA 3FLUA 4I9AA 1US3A 1LOQA 2C16A 2CZEA 2ZZ2A 3W81A 3NXLA 1JCJA 4P7NA 4N6FA 2CFFA 4NI3A 4UMCA 3LNMA 4XB3A 1UBPC 4AHQA 3D47A 1HKKA 5DQPA 3WZ0E 1OM0A 4D2JA 4CNPA 3PM6A 1QHOA 2XN2A 1E6XM 3ITXA 4Z1CA 5FL0A 1S2AA 3EWDA 2DJXA 3THDA 1UZ4A 1Z6KA 1ZAJA 4WDXA 2BOGX 2HWGA 7PTDA 1KR1A 2FTYA 2WPBA 3IJ6A 1X8CA 1Z41A 3MUXA 2WM1A 3W82A 3S83A 2VRKA 2E28A 5F1VA 2ZKMX 4EWJA 1VFHA 3W9ZA 1Y5XA 1PYFA 5I2UA 1E0TA 1RP8A 4PTWA 3ARZA 4Y90A 5BRBA 2BVWA 3BGAA 4HN4A 3ME3A 1VS1A 5FCZA 3SADA 3KL3A 2DUZA 3MS8A 3PWIA 1KTBA 4UQ9A 3V5OA 2X0SA 3IPWA 4MVAA 4DYJA 3C0QA 4IIEA 4CEUC 3KVKA 2WBGA 3FDGA 5BNKA 2V3GA 3VKKA 3WMCA 4FPSA 3DYMA 4F9JA 4DRSA 2OEMA 4HHMA 3LOTA 3LY0A 1HP5A 1P6BA 3LS9A 2GUBA 3IVUA 3T08A 3W25A 2CBUA 3CQ0A 4A8LA 4J1OA 2GVYA 1BYDA 5TNVA 5HATA 2NXHA 2YSWA 1F3XA 3O9NA 3CBWA 4C60A 1U5VA 3E49A 1KW1A 1R7AA 3CAVA 4AZ6A 2ZUMA 1UP0A 3NO3A 2BOEX 5DMMA 3W88A 2I9EA 1ZJHA 4W8LA 2J6XA 4LVGA 3V0TA 1VRDA 1HG3A 4PUWA 2WCSA 3ARTA 5AYXA 3VIKA 1P4CA 4JKMA 1XKJA 3UGVA 1QI5A 4P2VA 3E9AA 3N4FA 2QQ6A 3GTIA 1U83A 1FFQA 2YW4A 4PEKA 3F03K 1R85A 4MZ8A 3M47A 1TELA 2DY3A 4GG9A 3UZJA 1WUFA 3S2LA 1K4HA 4YVVA 3SEPA 2Y85A 1G5AA 1C7SA 4BR1A 3GU1A 2WMIB 4GYJA 3CQHA 4WDUA 4X60A 1N2VA 2X0HA 1ZSXA 4UNLA 5A3HA 3VC5A 4J40A 3WJSA 1SJAA 1EQCA 1UKPA 3H8AA 3MSRA 2VQTA 2YJQA 1ZJBA 1K7FA 1A3HA 2EPNA 2E7FA 4QJ1A 5HMFA 3G22A 3GW3A 4UMAA 4ZTYA 3MP4A 2SFPA 3KZSA 2WPGA 3ARPA 1OC7A 1Q2RA 5LHFA 2GQ9A 1LP6A 4HP5A 4NAFA 4L6OA 3N13A 3VA8A 4N42A 1QOXA 1GORA 1IGSA 5I3JA 2X2YA 3RRAA 1G4TA 3ZT5A 4UXDA 4DBEA 5A8OA 3T8LA 2YW3A 4D71A 4BWLA 3VIJA 2LLEA 3NZRA 1E6QM 4TO8A 3TMQA 2HDJA 1PIFA 2ZZ6A 4GXPA 4ACZB 2WMKA 4CU8A 1UD8A 5AY7A 4GMEA 2VFFA 1VPQA 5FJPA 1XQLA 2ZDRA 1EWEA 2AMXA 1HKMA 1JVNA 3BLKA 3AXKA 4LUTA 1T96A 3FJ6A 3P84A 4AD5A 1XYMA 3P82A 2GJXA 4R7JA 3WK3A 3Q65A 2X09A 1RQBA 3P0WA 3E0FA 4IGNA 1TQXA 2WJZA 4PTMA 2VEMA 4IIHA 3W85A 2DSKA 3L12A 4BF9A 2Y0FA 4YPJA 3TE9A 1DTUA 4ZQCA 3NQCA 1ADOA 4Q33A 4CCZA 3FA4A 3TTQA 3WDIA 3AYRA 2F6KA 5EYWA 3THUA 5H8PA 3SSZA 1O66A 2P0OA 3PP7A 1Q6GA 4AU0A 4KRTA 1UC5A 4PBGA 3W28A 3OB8A 1XLLA 3SDOA 5BWAA 2X42A 2J4GA 4HA1A 3EB3A 3VCNA 3VD4A 5BOOA 5E0KA 3TROA 4ASTA 4LANA 3LLFA 3VU2A 1H1YA 1A5AA 3U8GA 5M17A 1XF0A 2E40A 3GBDA 1VBUA 3VPLA 1A5NC 2EJ1A 4FX7A 1HJWA 2I5IA 3NQBA 1IZJA 2B7NA 3PFRA 2PD5A 2X8RA 1PAMA 3FEMA 4ZCWA 2A3AA 1KCKA 3STPA 4IIGA 4AVOA 3H2FA 2VM8A 4JN7A 1Q63A 3S2NA 1GKPA 3UWVA 1OX4A 3EA3A 3CUFA 1MVYA 1E73M 4RDYA 3WF4A 4US6A 4XUGA 1NF7A 3U7VA 2A21A 1MUMA 1W5OA 1H5VA 4RPQA 4S38A 4F0MA 4AYGA 3BLLA 2CC0A 1A47A 2HK0A 1ZB5A 4D8LA 4K8HA 3H23A 4RZ4A 1PXGA 4J3WA 1KCLA 1S39A 1RZMA 3GC5A 4G7EA 2VDIA 5AKQA 4DF0A 4WUIA 4U10A 3UXLA 4YVPA 1S38A 4QEEA 1GQKA 4UFIA 4N9EA 1EFZA 3NEVA 5DANA 1C29A 1HX0A 2ZA3A 2EPOA 3AIBA 3G1FA 2FVLA 5BCAA 3WBYA 3SY8A 4GY0A 1LL4A 4DNMA 1RJRA 5ECVA 2WQPA 1EEPA 1SFJA 3WUEA 4AWTA 1FVPA 2J8FA 3CUZA 4H8UA 1NFGA 1GVIA 3KDNA 1E4MM 3KOFA 3G0XA 2FPTA 2VO5A 2X2GA 1S2CA 5CAHA 3UZ5A 4ATWA 1CBGA 4L1XA 3TSDA 2XGZA 3S2CA 3Q2DA 3UY8A 3V75A 2VEFA 3W01A 2RDTA 1GOOA 1F8IA 1POJA 4J5NA 5RUBA 2X1RA 4FF5A 4KERA 3HG5A 3VILA 1GWJA 4D1IA 1IEIA 4LF1A 2JF6A 3O3RA 5I3KA 1K9FA 3HFYA 4GZ7A 2ZZ7A 3K46A 2QCHA 1Y0EA 2V2CA 1VGAA 1U33A 2DZVA 1VFSA 1EO7A 1PX4A 4FLOA 3W3OA 3WK2A 5D2VA 1JPDX 3AZSA 3R11A 1H2JA 1CXHA 1JYVA 2QJMA 1HO1A 4IICA 4MAZA 3I7SA 1BVNP 4H41A 3WFAA 4ES4A 4NIRA 4KWSA 1MYRA 1VP5A 2F7FA 3BMXA 5CPSA 4M0XA 3R8HA 3WDRA 3VDBA 1QK0A 4H6RA 3PY2A 3VNJA 2PDNA 4U2YA 1A4MA 1WX0A 2XDFA 4W88A 4R3UA 5CSUA 2XM2A 4PN2A 3R0DA 2V5KA 3WLSA 3BAXA 1WXZA 1C90A 1EX5A 4H19A 4GXMA 1AVAA 5D9MA 3IIVA 3FAWA 2GVEA 3WQ8A 4WVXA 3VNYA 3M6DA 1W2PA 3P5YA 4P7LA 4RNIA 4QS6A 4GI8A 2E5DA 3WBEA 2XINA 3V1PA 2POTA 1FRBA 3TYAA 1PE1A 4XVDA 3NAVA 3W1PA 3LMZA 1QNQA 1X7IA 1S2TA 2RGMA 1FWDC 1W3IA 3ZQ9A 4ZMGA 4HJWA 1H7XA 2OTDA 2GJNA 1UYQA 3VIHA 3CWOX 1FCBA 4NJKA 3LXBA 4LS2A 3OHIA 3QEZA 3VIIA 2CIPA 1AH4A 3FJNA 3ISIX 1EDQA 3S1VA 3PBGA 3WJWA 4NRRA 4HNCA 3EX6A 4UNIA 2XSXA 4Y7EA 4UFKA 5DCEA 4LYQA 1FWAC 1LORA 2NX3A 3A4JA 4JY9A 4YWIA 1A3WA 1TTQA 3L5MA 1Z32X 4KWOA 4AD0A 1RD6A 4HCLA 2NQLA 4R85A 1UB3A 3KBSA 3SB0A 2DV0A 4HU4A 2NLYA 3L0KA 2CBVA 4KPLA 4DXVA 3BTNA 3UQNA 1EL3A 1GPWA 1MW2A 1FHDA 1ZP4A 4Q4RA 5F2IA 2C3ZA 2E4TA 4LYRA 1X97A 1JD7A 1IXOA 2Z0IA 3GXFA 3LHTA 4LH8A 3PNUA 3EX2A 2B7QA 1FUYA 1HKIA 4G7FA 2GGHA 3PVFA 4JX6A 5I07A 2XH0A 2PZNA 3UR5A 2BY2A 2FFIA 1XPYA 4Q4PA 3WLMA 1O68A 3HGSA 3E6EA 3W7RA 2WVUA 3WQEA 1XLBA 4FLSA 4IJCA 3R13A 3CHEA 3PJWA 3T07A 3CUJA 2G41A 1TMLA 1E1CA 4XZHA 1V02E 2BX7A 4AY7A 2DQWA 1AW5A 4C5ZA 1JDAA 3TAOA 4JNZA 2PWHA 1XUZA 3EEZA 1CXFA 2Y89A 3TC6A 1XD0A 4LCSA 3TYBA 3ZJ6A 5EFFA 1Z48A 3TOPA 1K03A 1RBLA 2NV1A 4MTVA 3W1UA 1ZTVA 3R1ZA 3C56A 1GCYA 1JZ5A 4MFDA 4KQNA 3OIXA 4MF4A 1KCXA 4S3GA 1GQJA 3BZJA 3NPVA 4BQ2A 4IPJA 3PNZA 4OJYA 2Q8XA 1ISWA 3KVLA 2Y6ZA 4HSHA 2G4JA 3GH5A 4GZEA 5E70A 1QMLA 1WXYA 1BD0A 3A4XA 2H8ZA 1V0KA 5CC7A 4IWWA 3CO8A 2QEZA 1E43A 3RDKA 1EJTC 2O9RA 3UA4A 3G0UA 2R91A 1JUBA 3OEXA 5CQ1A 1XSIA 3A3WA 3AO0A 5I23A 4B5SA 4XZMX 4L9ZA 4LB4A 1SMAA 2XN1A 5AYYA 1E6NA 3WFZA 1AQFA 3D0CA 1CGVA 1LWJA 1GW1A 3MB9A 3MI2A 1S2UA 4RXFA 4XG1A 3W1AA 3N19B 1V93A 5D32A 4D6GA 2IS7A 3VX0A 3OOQA 1UA7A 4KWVA 3VUSA 3GXMA 4YTSA 3LLXA 3VOJA 1UP3A 1V6YA 1Y7VA 4M6PA 4J3XA 4Z1BA 2BY1A 3SQMA 4NJIA 2FTWA 1WZAA 3SUVA 2XM1A 3UNTA 4Z42C 4ICMA 3A3XA 3OBKA 1DPMA 2XHYA 1AH3A 1BVZA 3WNPA 3IGSA 3B05A 1CXIA 3ZYZA 2G8ZA 4TTGA 5LNWA 3WLOA 1XIBA 2JFEX 4J3UA 3BOXA 4Z2GA 2VKZG 4Z1AA 1EUAA 2ZX5A 4NF7A 1JDCA 2WM0A 4WZHA 1MNZA 3TDFA 5D04C 4B16A 5AC7A 5CSRA 5XIAA 5LA1A 3GNOA 4TXEA 5FA5A 3TTOA 2DZAA 4JTKA 3L67A 2KZHA 1OFPA 3EPMA 2BOFX 4P8VA 3LRLA 5AHLA 3RCMA 3GXPA 3VM5A 1XCFA 4ZO7A 1JD9A 3URAA 3DENA 4MZYA 3BOLA 3DHFA 1K6WA 2QT3A 1MEWA 4FLRA 2POZA 2OSXA 3MVTA 3H2NA 5C7HA 1XYBA 3HJEA 3GDRA 3WFLA 2VELA 4YIWA 3ARXA 4HGXA 3WDJA 4QITA 2NQJA 3FW6A 2B4GA 1F6KA 4BI5A 3QV6A 1W37A 2FVMA 2NXIA 3N12A 4DJEC 2QCDA 1WKDA 2EXOA 5A8MA 3NIYA 3AJXA 4RDWA 3VIFA 1U1JA 2OG9A 2YA1A 3SECA 2BTMA 1DE6A 1E70M 3W7QA 3ANYA 1XWYA 4GK8A 3CZJA 4MWAD 4ZE4A 2WVTA 3PZNA 1XRVA 4NZ3A 1NDWA 4Y96A 2ZC8A 1EJWC 3EMQA 5LNSA 2Z00A 4PL2A 3VNLA 5JXQA 1PIIA 4UZUA 1QCWA 1YADA 3UGRA 4IMEA 4GQQA 4J27A 2IKGA 4GC3A 5I3GA 5CPMA 2HTMA 3IIXA 1EQPA 3HTWA 4WOQA 4S2BA 1DXEA 2CITA 2CNCA 4UTTC 3S46A 3QHNA 1JXJA 4HPNA 2ZUTA 1UH4A 3Q4DA 3FGCB 3QTGA 3S9ZA 5JH2A 4LUJA 2BDQA 5KEZA 2Y7FA 3GU2A 1V0MA 1JULA 3TW6A 4ADUA 3TYCA 2W61A 3DDMA 4B3KA 4IL2A 5I7GA 2GSHA 3YPIA