4BR1A

Protease-induced heterodimer of human triosephosphate isomerase.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
228
Chain Sequence
RKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKKVVFEQTKVIADNVKDWSKVVLAYEPVWATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Differential Proteolysis in Human Triosephosphate Isomerase
rcsb
source organism Homo sapiens
total genus 87
structure length 228
sequence length 245
chains with identical sequence B
ec nomenclature ec 4.2.3.3: Methylglyoxal synthase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4br1A00
5CPNA 2NXHA 3LXBA 2E6YA 3W07A 3BW3A 1DBTA 4GUFA 1SZFA 1AMKA 3FKKA 4TMCA 2DU2A 4JTIA 1KV8A 3RFAA 3UWQA 3G18A 3MO7A 2ZDRA 4N4PA 1T99A 5D2VA 1RQBA 3CM4A 1LRNA 1KV5A 3AO0A 3OG3A 2WOQA 1NF7A 2O7QA 4HNUA 3O63A 4IXHA 3CEUA 1H50A 3G22A 4RXFA 2RHGA 2VFGA 1SQ7A 1Q6OA 2GUUA 2GQ9A 3SIZA 3A5VA 1QNVA 4UCGA 1VGAA 1J5TA 1Y0EA 4DO6A 3R2GA 1OFQA 3W9ZA 1H5YA 1JCYA 5D32A 3GLCA 3HG3A 3M0ZA 2GVJA 1YDNA 3BK0A 1DHPA 5LGXA 1YADA 5CZTA 2E1DA 3TC7A 2NUXA 2PC4A 5AHEA 3W7CA 1PVNA 4K6AA 5DY3A 1MO0A 1NAL1 4L4MA 4FXSA 1H63A 3GAKA 4O10A 2G5WA 3V75A 4ALDA 5DBUA 4DBEA 1RZMA 2E5BA 3N3MA 2OMAA 2EF9A 3B04A 3LBCA 3EWWA 2YFNA 2Z2UA 1EP3A 2GQ8A 1GVQA 2VEMA 3E12A 3ABSA 4POCA 3BG5A 1VYSX 5FF3A 1DL3A 5K4XA 1QMLA 1GT8A 2ISVA 3L5MA 3NL5A 3BGJA 2B7PA 2P10A 4JIQA 4TO8A 5T26A 4AAJA 2Y7FA 2WKJA 3PB2A 4AWSA 2YFOA 1GYNA 4BWLA 3GVGA 4HSOA 5LKYA 1LROA 4PC8A 2J6XA 2QR6A 3W74A 5C54A 1H62A 3TV8A 2P1FA 5LNWA 5DCEA 2BZNA 3BW2A 3SGZA 4RK8A 5F1UA 1XBZA 1ZY9A 4JXCA 4MZ8A 1S5TA 1DQXA 4IQLA 4UFJA 3LXCA 1OFBA 3H53A 3CIWA 4NNBA 4FO4A 1GJPA 4O1CA 4GUGA 3STFA 2JGQA 2A6LA 4IWWA 3ANYA 3NPXA 4IMFA 3O05A 2EGZA 3LRKA 1FCQA 2CLLA 5K3VA 3THAA 3SJ3A 3W7RA 4AF0A 1FWTA 3TJLA 2QAPA 5LSMA 4PL2A 5TBOA 1JQXA 4FNSA 1LYXA 1GVRA 3W7IA 4DF1A 5K2ZA 4H4IA 3WJZA 1GVOA 3LCGA 2E6DA 3A23A 3P8JA 1G69A 4UTMA 1GVFA 3W85A 5DXYA 4BFAA 5BMXA 2QCGA 4UFIA 3UZ5A 3LHZA 4TR9A 4Y96A 2G96A 4NVTA 2EPHA 1UB3A 1OF6A 3NQCA 5AYYA 1TQJA 3N2XA 3MWAA 4LOCA 3M44A 3B0UX 3TJXA 4OE7A 2WNZA 3OEXA 1M5WA 2V9DA 4YXGA 3W22A 1SO3A 4CCEA 1IXPA 5AB3A 1P0KA 2NUYA 3DHDA 3L21A 3TUUA 2VFIA 2X1UA 4YL2A 3W87A 3CQ0A 1VCGA 3O07A 4LNYA 4WUIA 1ML1A 1JUEA 1QPNA 3BGGA 4HNTA 3GX9A 4UFHA 1A5CA 1KM5A 1W5QA 3T7VA 1B57A 3LHVA 3O6YX 3TMQA 4EVZA 4MFEA 4MFDA 5CZSA 3E02A 4IX2A 1X1OA 3MI2A 4Z1BA 3G0SA 3LI0A 1BEUA 2VELA 3GYEA 1UUOA 3NQAA 2A6NA 4UTLA 1ZJIA 3T44A 2HS8A 3UWVA 5G2IA 3GDRA 5TIMA 3SY5A 3H55A 4WJEA 3ZWSA 1JCLA 4MY1A 2QCLA 3E9AA 3WFAA 4YCPA 1J4EA 3EKZA 4A3UA 4Z08A 3MHFA 1XL9A 3GZ3A 3LLFA 1YDVA 3HGSA 4JX6A 1MZHA 1R2SA 1SFLA 4O1BA 1C9DA 1F73A 1EP2A 4O12A 3DFNA 1A5AA 4PH6A 4M19A 1OX6A 3RU6A 5DXXA 3TE9A 2B7QA 1GEQA 1K7FA 1QWGA 3QPZA 3OVPA 4JTKA 3OA3A 4JY8A 4AHPA 2RDWA 3R89A 1KFLA 1LOSA 1W37A 3W2NA 3W7GA 4J9JA 5C5YA 4XUGA 2ZA1A 3B03A 4MJMA 4M7SA 4PEKA 2DJXA 2HS6A 4O14A 1TTIA 3G1SA 3SGUA 3EXTA 4TX9A 1JULA 5DELA 3KFTA 4LW7A 4QIUA 4IX0A 4R33A 1VLIA 4P61A 5C2XA 2CLMA 3F03K 3L0NA 4ONVA 2CWNA 2AAMA 2V8ZA 3B8DA 4U28A 1TV5A 2CZDA 3B0VC 3BV4A 3TH6A 1MEIA 2QCHA 3FJ6A 3LV5A 1N55A 1OX5A 1RR2A 4LWWA 2GOUA 4TU1A 1CI1A 3ZFHA 1LBMA 4MPQA 5TQLA 2A7RA 2VKZG 3LRLA 4AMAA 2V82A 3KHJA 4GFSA 4NX0A 5E93A 3EEGA 1R47A 3MHGA 2B7OA 4O18A 2QJIA 3MP4A 2PRMA 2B4GA 3WK1A 3NM1A 4DF2A 5D2YA 4WXZA 2W79A 4XZ9A 3W2UA 1I2PA 4Q33A 4Y6GA 1TB3A 4IMGA 3G0UA 2ZRZA 5HNRA 3W84A 4OT7A 2H8ZA 3L5LA 1LLWA 1GQNA 4JTTA 2X2GA 1JJKA 3W75A 3TQ0A 3DENA 3FKRA 1VJIA 1GTEA 5IBXA 1TPH1 4M6QA 5DCDA 2DZTA 3KVLA 2Y7EA 5H2ZA 4FNTA 3L68A 1TREA 1HO4A 4DO5A 3DXIA 3IIVA 3USBA 4RCXA 3SR7A 3NZ1A 4NNAA 4ADTA 2J9XA 3F4WA 3U6WA 3HB9A 4YLWA 1GWJA 4O1AA 4Q32A 5G1YA 1QOPA 3UY8A 3M16A 3ABQA 4DO4A 3PBUA 1TV8A 2ATMA 2A85A 2E5CA 3TSDA 1BWKA 2FPVA 3O15A 4UXDA 5AC6A 2Q3RA 4QM1A 5G4WA 3TCEA 1PHQA 3G8RA 2JBMA 3TAOA 5F2IA 2ZA3A 1WDWA 4NU7A 1G67A 5D38A 3NNTA 3QZEA 3UWUA 1H7PA 2PCQA 4JDYA 4UNKA 4WZHA 5LHEA 2WQPA 4B5NA 3G1AA 3GXTA 1GYLA 1H7WA 1EB3A 4O19A 4O4WA 1X6UA 1U83A 5EY5A 3IRDA 3QQ1A 3NXFA 3GK0A 1QAPA 5I3KA 5H91A 1KFKA 3P62A 3P60A 3G1YA 3Q37A 1W5OA 1W54A 3MP3A 4UTIA 3NQVA 5G4EA 1X7FA 4ZMGA 4Z0JA 5D03A 3R5EA 4N9EA 4WY0B 3N9RA 4UUIA 1KFBA 5BNKA 3G1VA 1XDLA 4AB4A 1TRDA 2O7SA 4UTKA 4X9SA 4HNVA 5CPMA 1JRCA 1T8XA 4DPQA 3NO5A 1H60A 2FDSA 5EYWA 5D02A 4JTSA 5FF4A 1VYRA 1FXPA 5AC8A 5SWUA 2A7PA 3O6CA 5K9XA 4E2BA 1OFPA 1OHLA 2FTPA 1UUMA 1KM4A 1G7UA 2BSLA 3HQ1A 1TJRA 2YYTA 3DKJA 3HIJA 3BVJA 2BTMA 3EB2A 1SSGA 4HT3A 4GRSA 3C8FA 4FX7A 4R34A 3S0CA 4EOUA 4O16A 2GQAA 1GOXA 1KTCA 1T96A 3EX1A 5EPDA 3CIXA 5D04C 2QDGA 2FQIA 4CNPA 2AQWA 3DFQA 2OCZA 4UTJA 4FIRA 1IIGA 1W5MA 3QJAA 5HWNA 2XN0A 3MP5A 1XI3A 3O16A 3G3DA 1XBVA 1T0OA 1QO2A 1NFBA 4O50A 2Z1BA 4O17A 3GR8A 2C15A 3R13A 1WXJA 3AJXA 2E68A 1VQTA 3W1QA 4LVAA 1EEPA 4IGHA 3BPWA 3NR0A 2X1RA 4S2CA 3GIYA 1FCBA 1G4TA 4TIMA 1M6JA 3C6CA 3DFSA 2ZZ5A 5KZEA 3T40A 1Q6LA 1V7YA 3HO8A 4PTNA 1OFRA 5BRBA 1SFJA 4K7VA 1LRQA 3QMSA 2GPTA 3QMRA 2J9YA 3F1QA 1HL2A 2CZEA 4R53A 3LV6A 4W9TA 3LB0A 2E77A 2TSYA 4IUOA 3MI3A 1LOLA 4A2RA 3P61A 1ICQA 4HIBA 4GUJA 4UFLA 3TFXA 2P0OA 4JTLA 2BWGA 1X8FA 4RLIA 3CTLA 1W3NA 3PBWA 1A5BA 3NEVA 2J9ZA 3CEPA 1SZNA 4Z0SA 1JR1A 1S3HA 3LHWA 4ORIA 1OFEA 2H8XA 2JKPA 1KLYA 3MYOA 4NX5A 1LCOA 2A5HA 3GDKA 3W7QA 3M47A 4PL1A 4CCDA 3L2IA 1OX4B 2QUUA 3P80A 5F4XA 5AC7A 3LTSA 3E96A 2R94A 1W5NA 1KA9F 1TPC1 3W1AA 1OYCA 1R46A 2CLEA 2C19A 2VENA 3NQ8A 3P84A 1LBFA 1YXYA 1LTDA 4ZQMA 1SSDA 3B0PA 2OT1A 4MYXA 1NEYA 4JIPA 5KZDA 5CPOA 3G24A 1QO5A 3TU9A 5AHNA 4K38A 3W2JA 4N9BA 2G97A 2QF7A 5AYZA 1VPXA 2FJKA 5EMUA 2I1OA 4NJHA 5KTLA 1A5SA 4A29A 1EA0A 3HJZA 3TQKA 1AL7A 5HJLA 1YTDA 2WJZA 2YW3A 3GB6A 5E0KA 1C29A 2AGKA 5HR7A 2FB2A 4N4QA 3CLMA 3PB0A 3E0IA 4ZQCA 4N6EA 3MUXA 4DF0A 2OT0A 1K7EA 4JY9A 4LRSA 2FFCA 1EWEA 1ME7A 3LCXA 3L0KA 2ZRUA 4O28A 1IXQA 1MXSA 1VCVA 1TSIA 4NJIA 1I2NA 1H7RA 3IVUA 3MBDA 3PR2A 3R12A 2E09A 1B4EA 4XKYA 4E0CA 5I3IA 4NUWA 3W1XA 3DFPA 4HPXA 2NUWA 1LRTA 1CX9A 1TPB1 3NGJA 5U4NA 4LS2A 3RLVA 4A22A 4CNNA 2C14A 3DH7A 3M6YA 3GXNA 3C61A 1UCWA 1DQWA 5CSRA 1XBXA 4FEZA 2ABAA 4YMZA 4K39A 4XTDA 5FF2A 1K8ZA 3W7PA 2DZWA 3DI0A 1LZOA 2V2CA 4JX5A 2VEIA 3EX3A 3GDLA 4YCOA 3N14A 4MZ1A 3TKFA 1OABA 2YSWA 4O0KA 4KWWA 1KFJA 4AHOA 2FLIA 3DGRA 1JVNA 1F5ZA 3UNDA 3PY2A 4ADSA 1RQEA 4UMCA 2QJGA 4Z1CA 4K37A 3UY7A 1KFCA 3W2MA 1E51A 1OYAA 3P7YA 3UZJA 1QDSA 1GG0A 3JRKA 4G1KA 3W72A 4BI7A 1IXOA 4JR5A 3LCHA 4OBTA 3TNOA 4K7YA 3TA6A 2CLHA 2PRLA 2QCMA 2VFFA 3KXQA 3EXRA 5F4SA 4IPIA 3O6DA 1AG1O 1ZAJA 1S5VA 3QSRA 3LCWA 3FYPA 1W3IA 1O5KA 1ALDA 4S2BA 4CQAA 1SU5A 1LLZA 2C0AA 5I3JA 4LRTA 3HGOA 1W56A 3SFKA 5F1VA 2PE4A 3OBKA 2Z6JA 1KM2A 3ZWTA 2VEKA 3TFCA 1QOQA 3UPBA 4NT0A 3W7DA 4WD0A 1G4EA 3MJYA 4ZQPA 1OK4A 4LTSA 3S8HA 3LDVA 3W1LA 3MW7A 2E6AA 1FY6A 2CLIA 3MHUA 3QSTA 1YXDA 3PM6A 2QKFA 1VS1A 1J2WA 4WY0F 2V30A 1TCDA 2NZLA 4E38A 3W70A 2Z6IA 3HGJA 4GE8A 1WBHA 2Y7DA 1IGSA 4QJ1A 1ZAHA 1W8SA 4UR8A 3M43A 3W7KA 2YPIA 3DKLA 3N9SA 5ABTA 3EXSA 3PSVA 3MBFA 1TIMA 5G2WA 1GZGA 4QITA 3HG5A 1O94A 5AFDA 4O53A 3QC3A 1VH7A 3KRUA 3T4CA 2CZFA 5CZJA 1HFBA 1FXQA 5G2HA 4MJZA 4NQ1A 2WO5A 4JDBA 1Q6QA 3K30A 3W1UA 1A53A 1ZFJA 5KZMA 3LCLA 1D3GA 1VHNA 3LTYA 4AHQA 3WJXA 5KSWA 4FX8A 3C3NA 5KMYA 3L66A 4WY0A 3SSJA 4NJJA 3BLFA 2ZBTA 2UV8G 2YDAA 1F2JA 1OJXA 2OJPA 4UFMA 3NQDA 2NWSA 2Y6ZA 1XBYA 3QMTA 2NXIA 1JCMP 1LM1A 1GVSA 2NXGA 5AYXA 1WOBA 1AL8A 3PF3A 3S6DA 1VCFA 1FCUA 1SR9A 3HG2A 8TIMA 1FUYA 2EKCA 4JTJA 5C6MA 3HG4A 3W23A 3W88A 2H90A 2TPSA 1LDCA 4JTEA 2E5DA 4LVGA 3S1WA 3S42A 1Z48A 4RXGA 3M41A 5HINA 1N8FA 2X1TA 5AOUA 3NA8A 1SO6A 2VFDA 3D0CA 1GPWA 3IVSA 1F05A 4QNWA 3NQMA 4JYDA 4HN4A 3RK8A 4HNNA 4IMEA 2TRSA 5LNSA 1AK5A 4WOQA 3ELFA 1ICSA 3W7MA 2VFEA 2QCEA 1RPXA 2D73A 3GAYA 3KVJA 3TX9A 3Q58A 4AF0B 4RZ4A 5D2XA 1VRDA 2PRHA 1P4CA 4LT9A 4XBSA 1VYPX 2R8WA 2C13A 4HKPA 2CLKA 2A1YA 1TPVA 4M5PA 3OVRA 5BW6A 3S5NA 2ZRWA 4MY9A 5AHIA 2A0NA 5FEWA 4GWEA 1JCJA 1F6PA 5FF0A 1L6SA 4O8RA 4UTTC 1JUKA 2RKXA 4UTWC 4XTIA 3BLEA 3W7OA 4IMDA 1JQVA 3PG9A 3W7HA 4FHAA 4JS3A 3N34A 3T78A 2WSRA 2NV2A 1P0NA 3NQGA 3P5ZA 1VZWA 1QR7A 5L9FA 4YWIA 3M5XA 3NVTA 4UTUA 1TPFA 1FWNA 1PCKA 3LXAA 1XDMA 3CWNA 3NL2A 4ADUA 3WJWA 3UPWA 4GUIA 5A8GA 5K4ZA 2YGYA 1TYGA 3Q94A 3WK0A 3M1ZA 3PAJA 3V1PA 4DPPA 1WQ5A 4OV9A 3OHIA 3VCRA 2A2IA 3A5FA 3EX2A 4JTUA 2Y62A 4BF9A 1SO5A 2WNQA 3O06A 3DI1A 1D3HA 1EX5A 2Q8ZA 1OVDA 1K8XA 2YCEA 1TJPA 3N73A 5J5RA 4GUHA 3QPYA 1N7KA 3SZ8A 1YPIA 3NG3A 1DJNA 3IGXA 3H54A 2V5LA 4LVBA 5C55A 3NQ6A 1XFBA 3ABOA 4A2SA 3GKFA 3C52A 4LUJA 5I3FA 1LP6A 3R8RA 5AHFA 1KM3A 1PL9A 4NNCA 1G4SA 4IOTA 4FIQA 4LC6A 3G8EA 1L6YA 3S5OA 3PSWA 4KFNA 3WJYA 4LVFA 1HG3A 2RDUA 3A22A 5CG7A 4UC5A 4O52A 2H3DA 1KLZA 3LX9A 5FESA 1WYIA 2Y88A 3W2LA 1P5BA 2QUVA 1QPRA 3GXPA 3C2RA 4IXXA 1M7OA 3KRSA 2QCDB 3BG3A 1WV2A 2WV8A 3W86A 5CGQA 4UFKA 4C1KA 3IV3A 3KVKA 3HPXA 4LY8A 2YX0A 4AH7A 3PWAA 3LCIA 3FA5A 4LC8A 3IGUA 4U4MA 3B05A 2R91A 1S5WA 2FIQA 4JTHA 5FEXA 4JYFA 4RKAA 3M7WA 3CB8A 4WX2A 1K03A 4H6KA 4MOZA 4LU0A 1FWSA 1TTQA 2RH9A 5I3GA 2C3ZA 1PIIA 2DZXA 3LCFA 2ZTKA 1KW1A 2ZZ1A 1EIXA 3S5ZA 5DBTA 2CU0A 4PODA 4X2RA 3JR2A 2Y63A 1ADOA 4CQ8A 3MMTA 4NXSA 3I7RA 2Y89A 3DFTA 1I2OA 5IM51 4ZVJA 3EWZA 4ICNA 4LS0A 1NVMA 1XUZA 3M5ZA 2V5BA 4K8EA 3RLUA 5BOOA 4L4LA 1OFDA 2ZA2A 1DOSA 3C4UA 3KRZA 1MEWA 3GDMA 5BMWA 3M9YA 4I9AA 4JEQA 1ZENA 3PVFA 4FF7A 1TPDA 4PCFA 3TIMA 2RDTA 4DXVA 4FNQA 3UXAA 5J5DA 5K9DA 2QDHA 1K02A 3MI6A 3DU0A 1K8YA 3LERA 3MYPA 3QM3A 3HPZA 4CCCA 6TIMA 4D2JA 1PS9A 3TXVA 4UMAA 1I4NA 3HBLA 4GJ1A 4M6PA 3SECA 4ML9A 4ZQOA 1MEHA 1G4PA 3CC1A 4O15A 4ORMA 2I9EA 4IJBA 1L6WA 1WAUA 3UYCA 1TO3A 3LHTA 2GVLA 3P82A 2A21A 4CQ9A 4FB7A 4JGDA 3IIXA 3NPUA 5CKSA 2ZZ2A 5KITA 3TW6A 4QNEA 4BWLC 3TSMA 1H1YA 2BXVA 1VC4A 3IGSA 2E6FA 5F4WA 3W3OA 4FNRA 4LUIA 4Y90A 3TMLA 1B3OA 1XXXA 4Z1AA 4O0ZA 3PUEA 5K7JA 3CT7A 3LTPA 3HF3A 3S1UA 3VFLA 1OYBA 1Z44A 2EHHA 3M5YA 2R14A 3CPRA 1YYAA 3LHUA 2ZYFA 2QAFA 4AWUA 2NX3A 5HULA 4H3DA 1FWWA 5LGZA 5EA9A 2YZRA 1R2TA 1KBIA 3PS7A 2X16A 1G6CA 4M6VA 3TR2A 4FNUA 4MZYA 1YTEA 3W1TA 3G1DA 2C1HA 1ME9A 4Q4KA 3W1RA 2WNNA 2WPBA 3FEMA 2C18A 2NLIA 3P8IA 3FFSA 2LLEA 3LRMA 4UMBA 5D30A 1P1XA 3VE9A 4FXRA 2I14A 1QPQA 2DORA 3W1PA 2JKAA 3G1FA 4Y9AA 5A5WA 4GXMA 1AW2A 3P5YA 1TPUA 2NX9A 1VLWA 2OX1A 4MLJA 1ZNNA 1TMHA 5U7SA 1O5XA 3N2MA 5CPLA 4AXKA 4QISA 3O8AA 2OZ0A 3BW4A 1H7NA 1YDOA 4JTGA 3EX4A 1IF2A 4LV4A 2Z0IA 1VHCA 5CSSA 3PG8A 3HMJG 1OFOA 3QH2A 1Q3NA 1SO4A 1O95A 1KM0A 1ZCOA 5D09A 4GC4A 2Y7GA 4MYAA 5HMSA 3TW7A 1XUUA 4MKNA 4HPJA 3PC0A 3O1NA 1FQ0A 4A21A 2JGYA 3TC6A 3U2OA 1KM6A 2DZVA 4RZ5A 1WOAA 2ZRYA 1AW1A 3NPWA 3VE7A 1TV7A 1NF0A 3C0JA 2F84A 1BTMA 4WQ6A 4FNPA 3RF9A 3QW4B 2RFGA 1I45A 2NV1A 1CW2A 3W7LA 4IMCA 3ATYA 1F6KA 3TAKA 4AEOA 1FX6A 3W1NA 1EPXA 3KOFA 2YR1A 2QCNA 2DZUA 5FI8A 5FEZA 1WA3A 1W5PA 1TTPA 4ZQNA 2TMDA 4WXYA 5AN7A 1FBAA 1LORA 1X1ZA 5GVJA 2CLOA 1EUAA 2DZSA 2JKEA 3W73A 2GVGA 1GG1A 3P81A 1B9BA 4K36A 4LVDA 4DEFA 4OV4A 3W7EA 2QCCA 1QCWA 4JICA 3TROA 5I3HA 1RV8A 1UJPA 5D2WA 4I7WA 4OGZA 3TK7A 3LHYA 4JX4A 3BG9A 1R2RA 2QJHA 3TSBA 4JTFA 3PUDA 2Y85A 4I7UA 3M5VA 3NOEA 2GJLA 2ZTJA 1W1ZA 3GDTA 4KFPA 2VC6A 4KWVA 4R7JA 4N9CA 1LBLA 3EKLA 3ZR4A 2ZZ4A 2BX7A 3LLDA 1RD5A 2YXGA 4O13A 3RMJA 4N9DA 2HSAA 2V81A 3QW3A 4MLRA 2TYSA 5D2TA 5FF7A 1Q6RA 3W6YA 1SW7A 3G1HA 3CWOX 1YXCA 2C6QA 2ZZ3A 5D37A 3WK2A 3NZRA 4AWTA 4QAIA 5HUPA 1AW5A 3B06A 4RR4A 2XN1A 4JN6A 3IIPA 4JD4A 4O1DA 3HOJA 1Z41A 3DHFA 4I7VA 3U8GA 1KTBA 4GBUA 2W6RA 4S1FA 1KFEA 5LZLA 2VOMA 1HO1A 1JCXA 3STCA 3ATZA 2ATSA 3UWZA 1EWDA 3LM7A 3W1MA 2V0TA 3EWUA 1DVJA 5D33A 2C16A 5EL1A 4Y8FA 1O60A 4UR7A 3OIXA 1L2UA 5DY2A 5HUOA 3S1VA 5G1TA 2KZHA 5IBXC 3W76A 1EP1A 1I2QA 1TRIA 4O11A 4NZJA 5F2GA 5DLCA 5HR6A 3THQA 4HHPA 3CHVA 4DQWA 4KKXA 1TPEA 3L9CA 2IQTA 3G3MA 3NM3A 5CZ0A 1C8VA 1ONRA 1JRBA 1Q45A 1OK6A 4MVAA 4EF9A 1H51A 1XM3A 3BARA 4XBKA 3L67A 3FYOA 3NAVA 4PFMA 1YPFA 4N2YA 4NZFA 2ABBA 2XN2A 4EWND 2G95A 2B7NA 2QCDA 2EAWA 1XCFA 3JS3A 4UIOA 3EX6A 4CLMA 1SW3A 2ZZ7A 3QF0A 3QYQA 4XKYB 2GJNA 5F2LA 3KVMA 1QPOA 3LOTA 2ALDA 2CFFA 4OHQA 4OWGA 1B4KA 4AVFA 2ZRXA 5HWMA 2B0MA 1PE1A 2ISSA 3C2FA 1OG0A 4HSNA 1PCWA 5F2MA 1DJQA 3BLIA 1RQHA 2QEZA 2DZPA 5E1QA 3S9YA 2ZFAA 2QCFA 3NQ7A 3S5YA 1W3TA 3GR7A 3I7QA 3P74A 2YW4A 2J27A 3KX6A 6ALDA 2J24A 4BI6A 3PULA 4C1LA 4MIMA 1R30A 2ZZ6A 2V2DA 2H6RA 1D9EA 3I7SA 4XWUA 4RV8A 4OU1A 3L5AA 2VFHA 1L9WA 3UD6A 3NDOA 3B4UA 4UTHA 5EKYA 1M7PA 4RZ6A 2FPYA 1H1ZA 3DAQA 4DBDA 3FLUA 4NJKA 5AHLA 3I6RA 5HQEA 2A7NA 2X1SA 1PHWA 4NJGA 1VR6A 4MY8A 5D05A 1SW0A 2PURA 4BI5A 3C2OA 4K8HA 2H3BA 4P2VA 1MSSA 3QQ0A 1IIHA 1BKSA 1OFAA 1WBJA 4X22A 4X3ZA 2ZCGA 2XFWA 4ZQRA 3LGEA 4XQ6A 1KBJA 2Y70A 4QSHA 1SUXA 3PBYA 3A21A 3W71A 1U5JA 5DN1A 2ZRVA 4M7TA 1Z42A 4BR1A 3LBMA 2Y61A 4EF8A 2F7FA 4ZZ9A 1ICPA 5HWJA 4QQ3A 2VXNA 1DKWA 5EBUA 1SZGA 3A9IA 5K9CA 3F4NA 5LNVA 3QRHA 3WJSA 2W0UA 3EWYA 1FCVA 5AHMA 3UWYA 3QFEA 2BLEA 1V5XA 2Q3OA 3DFOA 1SZEA 3TXZA 3ZS4A 3TQVA 3I68A 3GKAA 1PV8A 2NWRA 3IVTA 1OX4A 3VNDA 4TMBA 5LNUA 2CZ5A 3NQEA 2CLFA 2NX1A 3I65A 3IIZA 4IPJA 4OQVA 2Q8LA 1BWLA 1DV7A 5DCBA 2CW6A 3L65A 1I2RA 3A24A 5LNRA 3GNNA 3EWXA 1TTJA 3FS2A 4RJEA 2FPTA 3UQNA 3HGRA 1H7OA 1W31A 3E49A 1W0MA 3C2VA 3FIGA 2DP3A 1TPWA 3G1XA 4UNLA 4O54A 4DELA 3C56A 4CNOA 2V2HA 4RX0A 1I8JA 4GNJA 4E2DA 3P67A 1FDJA 1FDYA 1HTIA 1ZAIA 2VEPA 2DJLA 4UTTA 4UTWA 2J88A 1LOQA 1F7BA 3NL6A 3T55A 3RNDA 3DZ1A 3NL3A 3N19B 2A4AA 1G7VA 3NPVA 3W7JA 3PUOA 1XC4A 4JNMA 3EWBX 5G5IA 1K3UA 4O4VA 3NQ2A 3INPA 3UWWA 4N6FA 4MUZA 1H7XA 3VKJA 7TIMA 2FB3A 1SPQA 3FOKA 3NQFA 3QEZA 5KINA 1YLVA 1H61A 1HUVA 3G0XA 1RVGA 3L0GA 3S1XA 1FDZA 3NYZA 1XKYA 1KTNA 5L6UA 3WK3A 4JYEA 2HTMA 1O4UA 1EUNA 5LHFA 3STEA 4BK9A 2HMCA 4O57A 3DBPA 4EIVA 4PA8A 3VI2A 4LS1A 1JCNA 2YYUA 3BO9A 1NSJA 3W2KA 2JK2A 1OF8A 5MHBA 2QUTA 3HPSA 2WSQA 1ME8A 1F74A 1K7XA 3KAOA 4ZL1A 1IXNA 3W83A 3STGA 1QFEA 2WSYA 1TQXA 1FWRA 1YTKA 3FJLA 3C2EA 2ZQ0A 3Q2DA 1THFD 4LV9A 3IIOA 2X30A 5FEPA 1JUBA 4KFOA 4NXKA 3ABRA 1GTHA 4N02A 3UXDA 2ISWA 1ZALA 3CU2A 3TDFA 3GNDA 1UBSA 3YPIA 1WX0A 3PBVA 4Z1DA 1F76A 3SW6A 4FX6M 1DORA 1UASA 1ZHAA 4WOZA 3SI9A 3OVQA 3W7NA 1A50A 1KM1A 3LI1A 3IEBA
chains in the Genus database with same CATH superfamily
5CPNA 5C9XA 3W07A 4PB4A 1XG4A 2CLPA 1TR1A 3B9AA 1DBTA 4EKJA 4GYKA 1AFSA 4MKVA 4KRZA 1OD0A 4IUGA 4JTIA 3R8GA 3G18A 3MO7A 2ZDRA 4P8WA 3GR4A 3QR3A 1S2VA 5FAGA 1QBBA 4N7QA 1S2WA 3W26A 1LRNA 2DT2A 4Q7NA 1G0CA 4KIRA 1XINA 2ZUNA 4H9MA 2GUUA 4CU6A 1QNVA 4UCGA 3E38A 4AW7A 3UGRA 3H8AA 1JCYA 1PIGA 2XIQA 3R10A 3N9KA 2VX4A 3OA5A 3M0ZA 2FZ8A 1YDNA 3BK0A 2VP8A 3UR7A 3TC7A 1M53A 3LBOA 2OELA 1X7IA 5AHEA 3W7CA 4AXNA 1P43A 1H63A 4O10A 1NWTA 2PZ0A 2WHJA 4ZXOA 1E1EA 1FWHC 3ZYZA 3K1GA 1Z7AA 1RZMA 1XLJA 2E5BA 5FJRA 3OZMA 4FOJA 4ZXLA 4C91A 2Z2UA 4NAEA 4UB9A 4QE4A 1GVQA 3CUZA 1L8NA 3BG5A 1Q13A 4V1YA 2PBOA 5DEZA 1ZJHA 1GT8A 3L5MA 4LBRA 1GQIA 3VD9A 3CJPA 4KEVA 4GY1A 2P10A 3WNNA 4JIQA 2PDJA 4TO8A 3LPOA 1RY8A 4EWJA 2Y1HA 2XVPA 5A2BA 2Y7FA 3PB2A 5EMKA 3O9NA 4BWLA 2PDGA 2DSKA 4PC8A 5DO8A 4B9YA 1V6YA 5A8MA 1NFPA 4PMDA 3GNPA 2P1FA 1I0DA 3I10A 3M0LA 1BSLA 2BZNA 2WCGA 2YIHA 4JXCA 3GQYA 1DQXA 4UFJA 1OFBA 3H53A 2XVGA 5I5RA 4RW5A 4NNBA 4O1CA 2GLKA 3WYZA 4GUGA 2BGQA 2VD9A 4IWWA 3NPXA 3EEZA 3O05A 3WF3A 2CLLA 1RJPA 3THAA 3DG7A 2V5CA 1FWTA 2PTZA 2QAPA 1J93A 2HBVA 5LSMA 3TN5A 1LYXA 4R7OA 2V3DA 3KZSA 4LY4A 1Q65A 4HA4A 2E8YA 1XIBA 4DNMA 2HZGA 3WDPP 1G69A 4DLMA 4UTMA 1PZ2A 3ALFA 4WGXA 3EZ4A 2IMRA 4Y96A 3JUGA 3N2XA 2VOTA 2WC4A 1XWYA 4LOCA 4OE7A 1E9ZB 3H2OA 1M5WA 3GS6A 4Y9PA 3W22A 4CCEA 3WLRA 5AB3A 3DHDA 2VFIA 2NQHA 1HL9A 4YL2A 4HNCA 3HZ3A 3W87A 1VCGA 3H2NA 2PWFA 2DVTA 1JUEA 4HZ7A 2FFIA 3GX9A 3GH5A 4JPGA 1KM5A 3T7VA 2DH3A 3SCNA 4MFDA 1WXZA 3FXGA 4GQBA 4DBSA 3A4WA 4DUWA 2A6NA 4UTLA 4F0RA 1J11A 3UWVA 7A3HA 3CGTA 3H55A 2V68A 1JCLA 3SO7A 4QE5A 1CLXA 1J4EA 5CLTA 3BZJA 3AIVA 4Z08A 4F3HA 3LLFA 3DOPA 2I5GA 3SSZA 1RUSA 1EP2A 3VINA 3W01A 1OX6A 3DFHA 1XGZA 3RU6A 2GOKA 5IHRA 4PB5A 3TE9A 1VFLA 1K7FA 1QWGA 3OVPA 4JL2A 4JY8A 4NP7A 4LF2A 4A3YA 4AQLA 3EDDA 3P0XA 3M7SA 2J7DA 3H23A 4XUGA 4MJMA 3P0WA 2J7BA 5EFDA 4B5SA 4CEUC 3KFTA 1RALA 4QIUA 3C0LA 4R33A 1CLKA 1VLIA 5REQA 2CLMA 1J6OA 2NQ9A 3F03K 3L0NA 1HKVA 4WLCA 3RLHA 1TV5A 3GNXA 3KBMA 1E4MM 1L6GA 1ISZA 1A3HA 5GNZA 1N55A 1XD1A 1GOMA 1Q4WA 5GNYA 1CI1A 6TAAA 4KEMA 4H6RA 2VKZG 3LRLA 1JIBA 2F2HA 4PZVA 4PMZA 1CZ1A 5E93A 6XIAA 3EEGA 2AQOA 4DF2A 4K2SA 2X42A 4E2OA 2BY1A 4Y6GA 2BODX 1GONA 1W1A1 3WLTA 3GC4A 5HNRA 3L5LA 2DZBA 1VEPA 4JBRA 3VNKA 4M1RA 3TQ0A 1QXLA 3N6HA 5IBXA 1XPGA 2QDDA 1EQPA 4QG9A 5C2GA 5DCDA 4ZSTA 5H2ZA 4FNTA 1TREA 1UH3A 4HNOA 1TJ0A 3USBA 3QY6A 3TW9A 5CGMA 4RCXA 5CBIA 3ZSTA 3NZ1A 4CD6A 2PTWA 3CYJA 4N0RA 5HJXA 4Q32A 2GSHA 2QMJA 1QOPA 3UY8A 3BH4A 1TV8A 2QLYA 4IGNA 1B90A 1EJVC 4DXKA 2E5CA 4U10A 1EFZA 2IQDA 2Q3RA 3AIBA 2XSXA 3RG6A 2EG6A 1PHQA 2XVKA 3GXFA 3R94A 5F2IA 4LH8A 2ZA3A 4MWAB 1KQZA 2J25A 4FR6A 4GQRA 3QZEA 2J8GA 3V4BA 2ZADA 1OCJA 1WDPA 4IM4A 5LHEA 2WQPA 3PN8A 3G1AA 1GYLA 4TTUA 1H7WA 4ICMA 4LCSA 5IOBA 2AGTA 1YHTA 4HU3A 5EY5A 3FK4A 4I9TA 1PZ3A 3NXFA 1HJXA 3IK4A 3AMCA 4A05A 1GJUA 4Z2GA 1QAPA 4JN7A 5CJMA 4AIOA 2ZX9A 5H91A 5C70A 4QCFA 3P62A 1JZ4A 3G1YA 3Q37A 3WMCA 1J2BA 3GUGA 3V36A 2F6KA 3NQVA 2XFFA 4Q4MA 3R5EA 3M64A 2XINA 3MY9A 1UH4A 2DGAA 3TYZA 3TJIA 1QBAA 3VDCA 4AFYA 5CGTA 4XZNX 1E3XA 5BNKA 2MNRA 2DZAA 4UTKA 3T2OA 5BWAA 2FGBA 2PWUA 1JFXA 1JRCA 4DPQA 1H60A 1KBBA 5FF4A 3V16A 3CUJA 1VYRA 3U2EA 1FXPA 3T07A 4P5UA 2A7PA 4TXEA 4E8CA 5FJUA 5E5CA 3BVJA 3VZXA 4KPLA 3WF2A 1B0IA 2QVHA 1TWWA 1TVPA 4R34A 3S0CA 4EOUA 4NZ1A 1A0EA 4QGCA 5DMYA 1JD9A 1EJ7L 5J8LA 2AQWA 4FIRA 1IIGA 3KE0A 4HK5A 2XN0A 3VIMA 3RUBL 3VDBA 1GZ1A 1XYCA 1GEHA 4O50A 3GR8A 1WXJA 2E68A 1BF6A 4PB3A 3HA1A 4F2TA 1EEPA 4S2CA 1FCBA 3PZMA 1OGGA 3DFSA 4XAZA 1Q6LA 5CEWA 1V7YA 3HO8A 4PTNA 1XSIA 3QTGA 4K7VA 3F5KA 5LIYX 1XX1A 3QMRA 1JXJA 2XUCA 1QNOA 1ISVA 2BHUA 4R53A 4AX7A 3PTMA 1DEDA 4J27A 2DPEA 3VD5A 3MI3A 4WDXA 1LOLA 4C6PA 4A2RA 2E9BA 3OHMB 4DWSB 3WQCA 3WN6A 3RILA 2GGHA 4M8UA 1QW8A 3B8VA 3V0UA 1EXPA 1XGEA 4L6OA 4Z0SA 3R6IA 3BCDA 3TOYA 1S3HA 4NIRA 4PMJA 4BQ2A 1OFEA 2WSKA 1KLYA 3APYA 1UW9A 2A5HA 3M47A 3LN3A 1XICA 1OX4B 4PUUA 2BNJA 1UR0A 1W1YA 2OSYA 3P80A 2JEQA 4IL0A 2DSWA 5I3DA 3E96A 3LEPA 2R94A 1TPC1 5HPOA 2D2OA 1XW8A 4J5NA 2AOSA 3NQ8A 3GC2A 3P84A 1YXYA 3F4VA 4LAKA 2YCJA 2VRKA 2YXOA 3ZQ9A 5CPOA 1Z8AA 1FKXA 1EDTA 4NJHA 5H6HA 5KTLA 3UJEA 4S3KA 4HJFA 3MSGA 4WDWA 1VAHA 3GB6A 4Q8TA 2WWDA 4N4QA 3CLMA 5JVLA 1EDQA 3CZLA 4XAGA 3S3GA 3EBVA 1GOQA 4JY9A 2VRQA 1NWUA 1UOZA 2XVNA 1OWQA 4D6EA 4LRSA 4RUBA 1O6IA 2FZMA 3LCXA 5A6KA 4O28A 4YS1A 1PX4A 4FR1A 3MBDA 2E09A 1B4EA 5A6BD 1ZP3A 1LLOA 3OW1A 3A13A 4NUWA 1MDRA 3PHAA 1TPB1 3S5SA 4S3AA 2C14A 2PCEA 3CH0A 4Z2JA 1PKLA 3C61A 1JDCA 1XBXA 4FEZA 1DWIM 4XTDA 1T41A 5FF2A 5LIUX 3W7PA 1J12A 3DI0A 1LZOA 3GDLA 2PTXA 4YCOA 1K8CA 1TV4A 3FNDA 1W3LA 4LGXA 3Q67A 3GYCA 3H12A 2FLIA 2WQDA 1WNOA 4TVUA 3QZ6A 2WMFA 1JVNA 3PY2A 5FL1A 4UMCA 5H8MA 1CIUA 4BEQA 2ZX5A 4CVWA 3R43A 1AVAA 3W72A 2YL6A 4FK9A 2A3HA 3T08A 4BI7A 3LG3A 3QGVA 1UG6A 2ZXBA 2QCMA 1RA5A 2VFFA 4IPIA 3FYYA 3W4RA 1A5MC 4WCJA 1XIHA 4QR6A 3LCWA 1W3IA 2DFAA 2BHYA 2DQWA 4Q6XA 4S2BA 3L12A 1A4MA 4PCNA 5I3JA 5JMUA 3HGOA 5D9NA 1R3VA 2X41A 2PF0A 1ADSA 2W91A 3WQ5A 2VEKA 2C0HA 3AIUA 4X9YA 4WSJA 2WYSA 4YYFA 2CLIA 2ACSA 3QSTA 1YXDA 3AYTA 3PM6A 3WNOA 3MTWA 4RE2A 1J2WA 1KXTA 2V30A 4M51A 4NILA 4XX6A 1OT1A 3D3AA 1UZ4A 1WBHA 2FYMA 3B4YA 1IGSA 3NGFA 1GCYA 3S2NA 4HHHA 2UBPC 3DKLA 4AUBA 3PSVA 5HXMA 3W38A 2ZE3A 1MVYA 3THUA 4MJZA 1Q6QA 1ISWA 1A53A 2I5IA 2I17A 1V93A 4A3RA 4HNLA 1VHNA 1KBKA 2PD9A 3MUCA 5KMYA 4YTRA 1BPLB 1UQZA 2UV8G 1XRSA 3RHGA 4L6DA 3WDIA 2RUSA 4UFMA 1VD6A 3PZUA 2NWSA 1XBYA 3Q45A 3QMTA 4H9XA 4QRNA 4R9XA 2NXIA 1JCMP 3QV9A 3PWGA 2NXGA 4PGLA 3PF3A 1WB0A 3KOYA 4DAFA 8TIMA 1EF2A 4JTJA 3IPWA 2TPSA 3G77A 3A47A 3P93A 4JFTA 4UWMA 3V5FA 4LVGA 3ZR6A 3IUDA 3EA3A 4AU0A 1JYVA 5ABGA 3WQDA 1WAWA 4PRTA 2Z7KA 3OJGA 4QNWA 1Q6EA 1ODUA 3EGJA 1ZRQA 3S6OA 1EEXA 4Q6JA 4XD4A 1ICSA 1WZLA 1F8IA 3W02A 4Y2WA 4HJWA 3ZVHA 5D2XA 5HATA 2XTKA 5T9BG 1PIFA 1VYPX 1Q7QA 1XH1A 2C13A 2CLKA 3TTEA 1QHZA 1J0IA 2O55A 2ZRWA 5AHIA 4GI4A 3LENA 1JYXA 1G5AA 4ZOAA 4PMNA 1QWKA 5M3WA 4O8RA 3CNYA 3SUSA 4XTIA 3W7OA 3T0TA 3W7HA 4FHAA 1VBRA 5EMLA 3P5ZA 3BICA 4GH3A 3OP2A 4YWIA 2X8RA 4IG2B 3EMQA 3NVTA 3MCNA 1QVBA 4UTUA 3LXAA 1GOWA 5M5DA 1TYGA 4F0LA 3OYZA 1QI3A 5A6SA 3ZT6A 1HIZA 1JF5A 2A2IA 3CWHA 3A5FA 2Y62A 3FW6A 4OUEA 3ARPA 3OIHA 3E2QA 1D3HA 1EX5A 4CKQA 4GI9A 4XIAA 3NG3A 3VOGA 4EPKA 3IGXA 5AKQA 4AD4A 3H54A 1RBOB 3C52A 4IFKB 5I3FA 5HA7A 4D1JA 2G50A 1KM3A 3QZAA 3MUY1 5BU9A 2VEFA 3G8EA 4CD5A 4HOWA 4AIEA 4F9JA 2I56A 1HG3A 2BXZA 2RDUA 4IICA 4UC5A 2DUZA 1KLZA 1XLKA 2Y88A 2QUVA 2WJDA 4KWSA 4CEXC 3UR5A 4IXXA 3KRSA 1TZ7A 3N04A 3W86A 2J62A 3H7VA 3IV3A 2W67A 4LY8A 3LCIA 4NYYA 3W29A 4LC8A 1PUDA 4D6GA 2R91A 1BF2A 2G4FA 2JALA 3H7RA 4JYFA 5FJOA 4X0NA 3QKZA 2BASA 3EKGA 1XIGA 4Q22A 5I3GA 5FIPA 2KAUC 3OGSA 4S3BA 2PA6A 2ZZ1A 3RO6A 3K13A 4PODA 4X2RA 3JR2A 4R3UA 2CNCA 3KW3A 1GK8A 4GOAA 2BVTA 3MMTA 4YWSA 2JIWA 3DFTA 1YKWA 3TTOA 1HVXA 3PJUA 5FA5A 4D8ZA 3EWZA 1S2UA 4HVXA 2Z25A 5DMNA 4D72A 3M5ZA 5IDIA 1JGIA 1WZKA 5BOOA 1B5TA 2FZBA 2WZEA 5BXPA 2VL4A 1OFDA 2ZA2A 3RU8X 3C4UA 3KRZA 2Y5JA 4ZTYA 2VQTA 1TX2A 3SRFA 3PAOA 4LCRA 4E4UA 4FF7A 3PZVA 1UBPC 1TWSA 4HCLA 4WVXA 4NI3A 3BLOA 3HPAA 1POJA 2P50A 4D9PA 3ITYA 2ZUSA 1TE1A 3DU0A 4JIIX 1CDGA 3MYPA 3AWOA 3ARSA 1B3ZA 3HPZA 5FAJA 1T6MA 3MB9A 1PS9A 3VAVA 3TXVA 1BYBA 2EQDA 1I4NA 1QHOA 5CC3A 2ZKMX 2BDQA 2PDXA 2WB5A 5AECA 2WM1A 3A4XA 4IGSA 4O15A 3ISIX 2HXUA 4CQ9A 3CL6A 3GY1A 3VNYA 3WBWA 5DRCA 3TW6A 3GM8A 4M0XA 1E0WA 1IQ8A 3HQOA 3R11A 4GZJA 1JGMA 4Y90A 4UQBA 1KQYA 1E6QM 1TELA 1XXXA 4E5TA 3A4AA 3ECQA 4O0ZA 3PUEA 5K7JA 1QTWA 3CT7A 2XIIA 4G1NA 3LTPA 3VFLA 3AHXA 5AC4A 3M5YA 1YYAA 2IKJA 2XJ7A 1FP9A 2QAFA 3N2BA 3VD7A 1KBIA 3PS7A 4QFUA 4DJDA 1ZZMA 1QOXA 1DWGM 4GI6A 2VVNA 2ZVIA 3W1TA 3H6OA 3W1RA 2PGWA 5HBFA 3FEMA 2C18A 2FHBA 2YA0A 2Y24A 1P1XA 2RAGA 4FXRA 1H3GA 2I14A 2JKAA 5BWFA 3CPUA 2KX9A 4Y9AA 1B2YA 1R3WA 4XZHA 2XH4A 1MXGA 2NX9A 2OX1A 1JFHA 1O5XA 3PJWA 4PUEA 1JAKA 1K4GA 3IJIA 3NSXA 3VKBA 1E40A 4XZMX 4LV4A 2PDYA 1JAEA 6CGTA 3VO0A 1K9DA 4OECA 5DT5A 5G4HC 1KM0A 3VFCA 4GC4A 2DSZA 3TQPA 1XUUA 3PC0A 1TJ1A 3VOIA 5BXSA 2ZUWA 3GD6A 3U2OA 1KM6A 2DZVA 2PDCA 4GACA 2ZXDA 3WBXA 1UR9A 4NRRA 2VCAA 1AW1A 3NPWA 3RRAA 3RR4A 4GMEA 2J4GA 1AQFA 4KW2A 1V6XA 4FNPA 5D8ZA 2GDUA 1T40A 3PJXA 1LWJA 4AZIA 3CK5A 3W1NA 1EPXA 5M17A 3GG7A 5JQ9A 5I6SA 4S3EA 3QQWA 1WA3A 3PBGA 1HJWA 4L9YA 4ZQNA 2TMDA 4WXYA 5AN7A 4JAWA 3SCVA 4C6JA 4ZOEA 3UA4A 4KEZA 4C5ZA 3WZ0E 2GVGA 4DJFC 4NL1A 2P3ZA 2OKOA 1M68A 4ROPA 4F40A 1CB7B 2ZC8A 2FTWA 3TYBA 1R38A 2GZXA 3VOFA 4R88A 4A4AA 4LXFA 3ZM8A 3WNMA 1V79A 2YA1A 2GUYA 1KCLA 4IHCA 2WCAA 4B2DA 4JX4A 2UY3A 3K4AA 1JZ8A 4I7UA 1XLLA 1ELSA 4LBSA 1SJDA 4KWVA 1U33A 4N9CA 3ZR4A 3UJSA 1BXCA 4O13A 4G9PA 3EB4A 1DWHM 3JU2A 2HSAA 1H49A 4A8LA 5JBDA 4B5TA 4K8GA 3W6YA 1SW7A 1YXCA 2C6QA 2ZZ3A 2WMKA 1TWDA 4FLRA 4W8BA 3B06A 3QR0A 3VIHA 1HXJA 3P2VA 2EPNA 1QI2A 3M0XA 3NJ3A 3H2CA 1WE5A 3DYOA 4NI8A 1Z41A 4I7VA 4GBUA 2HCVA 4HU0A 2QJJA 1HKIA 3B3DA 1JZ6A 4ZODA 1J0JA 3GE7A 4V33A 4I9MA 3L4VA 3CO4A 2ATSA 4J1OA 3UWZA 2VC9A 3LM7A 3CHDA 1QW7A 3UG8A 3VILA 5EMMA 1L2UA 5DY2A 4ZFCA 5HUOA 1UD3A 2KZHA 3UJFA 2HE8A 4HHPA 4TX6A 3WLQA 4WEVX 3GIQA 1O5QA 1Q45A 5FOOA 4XD5A 4XBKA 3VVGA 3L67A 3POCA 4KESA 4PMUA 2VD8A 1EHAA 2B7NA 2EAWA 5GNXA 3WLSA 2IPWA 3IUIA 3QYQA 4JFVA 3AXXA 2GJNA 5F2LA 3TOPA 3LPGA 2JIEA 1B4KA 2ZRXA 1PE1A 4H8HA 3C2FA 1JI2A 1PCWA 2XH2A 5F2MA 4IT1A 2FHCA 4UQ9A 2WMGA 4LUTA 1IR1A 3GR7A 2I57A 1Q85A 3QOKA 2J27A 4PTDA 4IQJA 4BI6A 1R30A 2R1MA 3VZZA 4ZFMA 2WJEA 4JFWA 3I7SA 4XWUA 3KBWA 4ZENA 1UA3A 2HXTA 2VFHA 3NDOA 4REQB 3SRHA 4MB4A 5GPRA 1P0DA 2B31A 2FPYA 3DAQA 3FLUA 3NDZA 1SFTA 3EAUA 1PO9A 4E4FA 3UEQA 1A0DA 5HQEA 2X1SA 2BOEX 1ESWA 4X2PA 2AL2A 2PURA 5D05A 2DIEA 2NSOA 4S3JA 4J40A 1R9YA 3U7VA 2CERA 1DWFM 3MA8A 1WBJA 3PPGA 3SRKA 2ZCGA 1LG1A 1WKDA 2Y70A 4QSHA 1B54A 3A21A 3PNUA 2OOGA 1FWGC 4B5WA 3CMJA 5J04A 2PEVA 3FGCA 5HWJA 7CGTA 1DKWA 2GWGA 3EPNA 4GI8A 5EBUA 3RPDA 3ENLA 2DVUA 3AXMA 3F4NA 4G7EB 3QRHA 1UWAA 2OX4A 2W0UA 2OQYA 3QFEA 2YCIX 2ODOA 1ONXA 2BLEA 4IJRA 2E7FA 2RJGA 3I68A 3TQVA 1MZRA 3F4DA 3B8WA 3VNDA 4HHLA 5LNUA 2CLFA 5XIMA 3IIZA 4IPJA 1OC6A 4OQVA 1QI4A 2Q8LA 3SJNA 3A4JA 1DV7A 1C91A 1RCQA 1I2RA 2OVLA 3A24A 1QI5A 4JTRA 3E5PA 4H7VA 1E0VA 5KZ6A 4RJEA 2WVTA 3VNZA 5LA1A 1EF3A 3CHEA 3C2VA 3VX0A 3GVWA 3FIGA 1VKFA 1TPWA 1IHIA 1REQA 4JHOA 4O54A 3F5JA 4GGBA 4E2DA 1E9IA 3P67A 2CZVA 1ZAIA 4UTWA 3EDEA 4GYPC 1N2VA 3RNDA 4GINA 1F9CA 1NQ6A 3NPVA 3W25A 3W7JA 3UU0A 4JNMA 1Y5VA 1UIPA 4MUZA 1H7XA 3AROA 4LAOA 2OLSA 2FB3A 1SPQA 4AZCA 4PEEA 5I2UA 4QSFA 1V0MA 3MSDA 1HUVA 3AC0A 3AHYA 3NYZA 1XLBA 4S3GA 1XKYA 2GDVA 1KTNA 3U3HA 3WK3A 4JYEA 4DM1A 2HTMA 1O4UA 1P7TB 1EC8A 1IWBA 4BK9A 3PWIA 2HMCA 1OY0A 1V08A 4ML4A 3SY8A 3ID7A 1S2TA 2WSQA 1KKRA 1HP4A 3FA4A 4ZL1A 1IXNA 3W83A 3GZAA 4QJ4B 1FOBA 4MM1A 1A5OC 4Q4QA 5JH1A 4F0SA 4IF2A 3PZGA 3A3XA 3FJLA 1TFVA 4JNYA 2ZQ0A 4H41A 3DYMA 4IFOA 1XLCA 4I9JA 3DG6A 4NXKA 8CGTA 3NXLA 1GTHA 4GX9A 4N02A 3T0DA 3VCCA 3JZUA 3CU2A 3YPIA 4NRSA 5DRIA 4Z1DA 3RX3A 1F76A 4LJ3A 2INFA 1LT7A 1UASA 1RH9A 3U7BA 4WOZA 1ODZA 3OVQA 4C1NB 1QNRA 3TVAA 3MANA 1POKA 4LUSB 4NSBA 3SM0A 3H70A 3IEBA 2Z26A 2QULA 2NXHA 3LXBA 2E6YA 1TWIA 1E3ZA 4XAPA 1SZFA 1W9VA 2W63A 1R8LA 4YPJA 4TMCA 1H2JA 1X8CA 4LBUA 4I5RA 1T99A 5D2VA 3BTNA 1KV5A 2WOQA 1NF7A 3WNLA 1W9UA 1QHPA 5BXRA 4J28A 3UETA 2V5DA 3G22A 2RHGA 1SQ7A 3A5VA 1OFQA 2QNEA 4YJ5A 1H5YA 3GLCA 3WMBA 3HG3A 4FA3A 5LGXA 1YADA 2W61A 2IKHA 4W88A 3L2LA 3T2PA 1MO0A 1NAL1 4F66A 5I06A 2AQVA 3V75A 2YDQA 5DBUA 4DBEA 3C0SA 2Y8VA 4XZLX 3T2QA 5E9XA 2D2JA 1V3KA 3BAIA 2VEMA 4DM2A 1NARA 4POCA 4IP4A 3V1HA 1DL3A 1QMLA 1LUCB 3A6OA 1MQQA 4IIHA 3XIMA 4O1FA 5JIPA 1VBJA 4GPNA 1GYNA 5HOSA 5LKYA 3G6LA 4JL1A 2PDBA 4LCQA 1TJ2A 2J6XA 2YL5A 5C54A 1P0BA 1Z3NA 1H62A 3T81A 3TV8A 3VGGA 4MNMA 3SN0A 2QF8A 1TVLA 4MZ8A 2DVXA 1JCTA 3LNPA 4H01A 3QGAC 3UGVA 4FO4A 1GJPA 1XLHA 4RV3A 1MFUA 1MQRA 3STFA 1K9TA 3ANYA 4IMFA 2WPGA 3W0KA 5CSUA 3OGVA 3PK7A 1PBGA 5K3VA 4BKNA 4U33A 2O9OA 2J13A 4QLJA 1O68A 1ZGDA 1TCMA 4DF1A 2PLKA 3F4CA 2CIPA 1S2CA 4H4IA 3GXIA 1FFQA 2J7GA 1LL6A 3LCGA 3A23A 1D8CA 3W85A 1EGZA 5DXYA 1V02A 2HK1A 5HK4A 4UFIA 1SJAA 3BUVA 2EPHA 3N4FA 1TQJA 3PBMA 1E0UA 4DZIA 3B0UX 3M44A 2WNZA 1DTUA 3ZLGA 3SCSA 4YXGA 3VOJA 3GU1A 1I60A 1P0KA 3L21A 5LIKX 5A1AA 3TUUA 4KQNA 3GVRA 3U4FA 3I3DA 5PTDA 3WSUA 3QBUA 3BGGA 4LYKA 4HNTA 2OSXA 3D3FA 1W5QA 1B57A 3GW3A 4MFEA 4EVZA 4MADA 5CZSA 3L4WA 2D24A 3O2LA 4H2CA 1VFFA 2PDNA 2VELA 4OZOA 4KRTA 5CLWA 2PDQA 3KUMA 3LA4A 3N4AA 1XYZA 2JE8A 4MY1A 2YB1A 1XL9A 3GZ3A 1P48A 1X97A 3HGSA 3VIKA 2Q01A 1MZHA 4AC7C 4O1BA 4YYCA 4U2YA 3QGKC 2VTFA 3CBWA 4O12A 4PH6A 1A5AA 1QT1A 2DDXA 1AH4A 4B16A 2PLMA 4S3DA 5DXXA 1E0TA 2B7QA 3A12A 4ZBCA 2RDWA 1V0LA 1FH7A 2ANUA 1KFLA 5C5YA 2ZA1A 3B03A 2WCSA 3MVTA 4O14A 1TTIA 3G1SA 1W32A 3EXTA 3P3BA 1UWSA 4QJ3B 3HM7A 4HU4A 1JULA 3LMZA 1W3JA 4YIWA 3PZ9A 4WDUA 3WUGA 4YHEA 4P61A 1FWEC 3CASA 2GJXA 2EEXA 2AAMA 2WSPA 3UG5A 3NSMA 2FH6A 4AZ7A 4EP8C 4MF4A 3TH6A 2XISA 3LYEA 1RR2A 4XB3A 4P7RA 4LWWA 2FVKA 1D3CA 1LBMA 5TQLA 1DIEA 2A7RA 3WY1A 4AMAA 3STPA 2V82A 3KHJA 3BMVA 4GFSA 1R47A 3MHGA 3CMFA 2QJIA 3WK1A 3NM1A 4F8XA 4C90A 1BKHA 1EZ2A 4IMGA 2ZRZA 3W84A 4OT7A 3GTFA 1LLWA 3SUTA 1GQNA 4JTTA 4Q8MA 2X2GA 2HVOA 1E9YB 3FKRA 1VJIA 3URBA 3TYEA 2PDIA 4PBFA 2PTDA 3BAJA 2DZTA 3KVLA 1NIUA 1X38A 1UR1A 6REQA 1C8YA 1HO4A 4DO5A 3IIVA 1MWOA 2GDQA 4GKTA 1QPKA 3AUOA 3V7PA 2J9XA 1LG2A 2VQUA 4H6EA 3HB9A 3BAKA 3QHOA 4O1AA 4YHGA 3A9BA 1F6YA 5A2CA 5ECVA 3ABQA 5BCAA 4HA0A 1E6RA 2ATMA 1J79A 1HN1A 3TSDA 4C6QA 1BWKA 5C71A 3WKZA 4QM1A 5G4WA 1PZ0A 3CHCA 3AU6A 3ARYA 2PODA 3VM7A 4UOQA 4L1GA 3RJYA 1HJSA 3K4DA 4A8IA 3UXLA 2WZHA 1WDWA 2IXUA 4NU7A 1G67A 3I6EA 4GIYA 5T8GA 1NDVA 1H7PA 2PCQA 3F2DA 1NDZA 2ZICA 4LQ1A 4WZHA 5H8UA 1KKOA 4W85A 2I7GA 4YTUA 3GXTA 1UP0A 4C6FA 1MRQA 2D3LA 2CESA 1V77A 1JNDA 1B9ZA 3VZYA 4DZAA 3N17A 3ORWA 4DJDD 3QPEA 4PUNA 4S3CA 1KR0A 5G4EA 1OBAA 4ZMGA 4EAYA 4Z0JA 4N9EA 3UT0A 4WY0B 4UUIA 5I78A 2Z1WA 4IISA 1PKNA 4AB4A 2O7SA 4HMNA 4HNVA 4Q4PA 2V3GA 2HE5A 1CGVA 1R85A 3CAVA 4JTSA 1AQ0A 4JQ1A 3EOLA 4IZGA 5AC8A 5CXPA 3GO2A 3O6CA 5K9XA 3VGEA 2FTPA 4E3TA 2BSLA 5GJPA 1O5RA 1TJRA 3FEQA 2BTMA 4OOUA 3S2JA 3CQIA 1C7TA 1WPCA 3C8FA 4FX7A 4DZ5A 2GQAA 9XIMA 3WQ4A 1RP8A 2ASHA 5D04C 2FQIA 4CNPA 2OCZA 1W5MA 3QJAA 3QYSA 5A8QA 5HWNA 5KEZA 3OB8A 4E6MA 1QO2A 3RCMA 1NFBA 3VMNA 2DQXA 3AJXA 1VQTA 3W1QA 2Q09A 3D47A 3E1F1 2WVVB 3KWSA 2CHOA 4IGHA 3NR0A 3ZSSA 2X1RA 3O3RA 1G4TA 4TIMA 4QDWA 2ZZ5A 2ACRA 4U5KA 1E6SM 3T40A 4GG9A 1HGYA 3QTPA 3RYSA 1Z32X 3CO8A 4PCTA 1OFRA 5BRBA 4UNIA 3CZ8A 3M0IA 1CLVA 5LA0A 4IFRA 5HAOA 3ZLFA 3P6LA 3BOLA 3N6JA 3LB0A 3L4XA 3K4WA 2WNWA 2WJFA 3OZOA 3P61A 1ICQA 4GUJA 1OG6A 1VJZA 3B0XA 4B2DD 4JTLA 4RLIA 3S2CA 4ERGA 3IJ6A 5CG0A 2GFTA 1UHVA 2Q6ZA 2WBGA 4BF5A 3KM8A 4ZE4A 1V03A 3FCPA 2E0PA 4FLSA 5CJNA 1UC5A 4M80A 3ITOA 4BY3A 2YKKA 4F2UA 5E0FA 5AC7A 2CKRA 4XD3A 1EX1A 3CL8A 1VB9A 4EPBC 2E28A 1R3RA 2CBUA 3BMWA 4A8NA 3UJ2A 4UOZA 4PMYA 1R46A 2RJHA 4AZHA 2CLEA 3PZQA 3PZIA 4ZR8A 4ZQMA 3SIMA 1SSDA 3ZXWA 4W4QA 2OT1A 4JIPA 5KZDA 3UXIA 1US3A 2X0HA 1QO5A 4K38A 3W2JA 3ZJ7A 4HU8A 5D4YA 3VNIA 2FJKA 5EMUA 1A5SA 1F3XA 2YCLB 3PTQA 1PEZA 3TTSA 1EA0A 1AL7A 5A95A 2YW3A 2PDUA 5E0KA 1C29A 2AGKA 5HR7A 2FB2A 3PB0A 3MUXA 3DHPA 4DF0A 3B8UA 2OT0A 2OXNA 2IS7A 4FPSA 1FH8A 4U31A 4BHYA 4M3PA 1PWLA 3N2TA 3SCPA 4DJEA 3MU7A 1IXQA 1UKOA 2NQZA 4X61A 1KD0A 1TSIA 1I2NA 3IVUA 3PR2A 3SQMA 3WL1A 3CV6A 2OB3A 4HA3A 2G3IA 2J6VA 4L6HA 4YTQA 1UKSA 2Z2BA 4HPXA 2JF7A 3WBYA 4MWAC 3TWAA 4CNNA 3M6YA 4ZOBA 3ARXA 1UCWA 1ZQ5A 3QHNA 3BURA 1OCQA 1K77A 4LAMA 3GHUA 1F4HA 3H7UA 3W6LA 3VDHA 2VX6A 4ACZB 2C71A 2YCKX 3TKFA 1CECA 4KWWA 1HNYA 3POHA 4H04A 3DGRA 1JYNA 3NOYA 4HD5A 1F5ZA 4ADSA 3LSBA 2PWHA 5I23A 1KFCA 3ME3A 3W2MA 1GG0A 1LF1A 3LCHA 4YN5A 3TNOA 4ILSA 1V02E 4D8AA 1EZWA 2W62A 3FSUA 1T8QA 2PDKA 4D6DA 3VNLA 3QSRA 3FYPA 3MKVA 3TR9A 4LRTA 3SFKA 1CGTA 2FGLA 3B9OA 3ZWTA 3TFCA 1QOQA 4JHMA 4LB4A 3LZ3A 3MJYA 3F2BA 1HGWA 3M4HA 4PE8A 4WJ8A 2E6AA 1FY6A 4GBDA 3MHUA 4PMXA 4MKSA 1OINA 2QKFA 1YBQA 4WY0F 1HVQA 1TCDA 4E38A 2Z6IA 4GE8A 3EDKA 3MV11 4GD0A 3BLPX 4QJ1A 3UESA 1ZAHA 4FXFA 4J3SA 5MKGA 1V6WA 5C8BB 3AI0A 1Q2SA 1O94A 1MW1A 1XLEA 2Q02A 4UQEA 3QC3A 1VH7A 2HROA 2OWCA 2JQXA 1HFBA 5I07A 1ZFJA 1D3GA 1YE4A 1RJQA 3U2CA 4AHQA 4FX8A 3C3NA 3L66A 4WY0A 3SSJA 1A5KC 2QPXA 4GC3A 3BLFA 1JDDA 2GVYA 4B3KA 1BRLA 2D2HA 1GHSA 3CAQA 4NZ4A 2OJPA 4GO9A 4GX8A 2DT1A 4DWSC 4B4HA 4AD2A 2XIBA 5AYXA 1OM0A 3IJDA 1FCUA 2ADAA 5HMDA 1XH0A 1FUYA 3KOWA 4BJHA 4S3FA 3W23A 1WDQA 2H90A 3CAWA 1CXEA 3VC5A 3S1WA 3VABA 1ITQA 1Z48A 4RXGA 3BMXA 1N8FA 2X1TA 1JDEA 3GG0A 5AOUA 3T9PA 1UMLA 2VFDA 3D46A 4QQUA 3DGBA 3B0YA 3MZ2A 1UR4A 1J5SA 5I77A 2VFEA 1RPXA 3LD5A 3TX9A 1B3YA 5E6YA 4NZCA 4ES4A 5I09A 4RZ4A 4KCTA 1VP5A 1U1HA 4PBGA 1VFHA 3FY1A 4A6GA 3EOOA 4M5PA 3OVRA 4GZEA 4GZ7A 3S5NA 2A0NA 3AYVA 4GWEA 3KZPA 2D1ZA 3THCA 1JCJA 1UUQA 2RKXA 4MTVA 1P6BA 4GQ0A 3BLEA 4CCZA 1U22A 1WDDA 4JS3A 5LIWX 5D9MA 3NQGA 1VZWA 3M5XA 3MQTA 4G6CA 3CHFA 4MGGA 4L56A 3UPWA 1EHNA 2YGYA 2XDFA 2MANA 4GCXA 1E71M 2WVSA 3WK0A 1OGBA 3PAJA 3V1PA 1WQ5A 3VIJA 3FX4A 1QW9A 1Q8AA 3EX2A 1PX8A 3L4UA 5CSYA 3MSYA 4U3AA 4IIDA 4GH1A 1OVDA 3M0KA 3LPPA 3QPYA 1N7KA 1SJBA 1XCXA 4GZIA 5C55A 3RN6A 3H2EA 3NQ6A 3ABOA 4ECLA 3GU2A 1K9EA 2VC5A 4R9OA 4JIHA 2P8BA 2CHNA 3CQKA 4KCVA 1IT7A 4FIQA 1L6YA 3S5OA 2VO5A 3PSWA 4XVEA 4HOZA 4L65A 4O52A 2H3DA 3TA9A 1FTXA 1P5BA 3MO4A 3GXPA 1F8MA 1W1IE 3CXOA 2XZ7A 2QCDB 1MW0A 3EB3A 1IZKA 2WV8A 4NKCA 5CGQA 4JTQA 3KLKA 3KVKA 4HZMA 4AH7A 2BBFA 3IGUA 1S5WA 4JTHA 5FEXA 1P6CA 4RKAA 1KGXA 1UKPA 4CNUA 1K03A 4H6KA 5REQB 4X60A 1H5VA 1FWSA 1DIOA 2DZXA 1HJUA 1AJ2A 2J7EA 1KW1A 3WQFA 4NAFA 1DJXA 3S5ZA 1ZJBA 2WKLA 2CU0A 4C65A 3E0VA 3IAPA 3AMLA 4CQ8A 3ABXA 4NXSA 3OU8A 2QJMA 1QK0A 1F61A 2V5BA 4K8EA 4WKHA 4Z17A 4JCMA 1W17A 5BMWA 5AYIA 4JEQA 3PVFA 3U57A 2VJXA 4FS9A 1OIFA 4DXVA 1YE6A 4FNQA 3UXAA 2F9RA 2CWXA 5K9DA 1TR9A 4TV5A 3MI6A 3TZFA 1K8YA 1IR2A 1GJWA 3BAXA 4LANA 1EDGA 2GSJA 4UMAA 3HBLA 3BJSA 3KDOA 4F2BA 3AXIA 4ZQOA 1MEHA 4XO7A 4G5DA 4M1BA 4ORMA 1HJQA 2VR5A 3DIPA 1WAUA 1TO3A 1NELA 3LHTA 3P82A 4UQDA 1ZS2A 4B91A 2ZZ2A 3W28A 4DJEC 2ISFA 1AODA 2JFEX 3AHTA 4QNEA 3TSMA 1ZU8A 4PTWA 3V0SA 2VDIA 2A3EA 3IGSA 2E6FA 3R79A 4XSMA 3W3OA 4LUIA 4KETA 4I90A 4WF7A 3OBEA 2DH2A 1CYGA 4DWDA 2H9AA 3BLLA 4A8RA 1Z44A 4RE0A 4AD5A 3LHUA 2HNEA 4GFIA 5FACA 4AWUA 4H3DA 1GKQA 3BGAA 3MCMA 2VUNA 2X05A 4PMRA 1G6CA 3BXWA 1GGOA 4OIFA 4MZYA 1JDFA 4AVNA 1ME9A 4Q4KA 1BVNP 2WPBA 3N29A 1VEMA 4AC1X 4CD8A 5TAOA 1VENA 3GXDA 3W1PA 1QPQA 4RNIA 3S46A 5A5WA 3P5YA 2R9RA 4MLJA 1XISA 1TMHA 3N2MA 5CPLA 3AHZA 1PXGA 3O8AA 4GIAA 2BVWA 4MAVA 1H7NA 1YDOA 1OT2A 1EO5A 2Z0IA 4P7LA 1YX1A 4D1IA 1BSIA 3QH2A 2OR2A 3UZYA 5HNNA 5HMSA 2A79A 4HPJA 3B8SA 4PUWA 1GKRA 1SYTA 1XIDA 4RZ5A 1DIKA 1WOAA 1RCXB 3VE7A 1TV7A 1OSEA 2F84A 4YU1A 4AD0A 5E09A 4IMCA 3AMKA 1F6KA 5ECUA 2WW5A 3DHUA 4EPEC 1R5YA 3LQGA 3KP0A 2QCNA 2YR1A 2DZUA 1W5PA 2DIKA 3UZWA 1RHCA 4MNJA 1NOWA 1X1ZA 4F0KA 3N2CA 2JKEA 4PCPA 3CQJA 1DXEA 2D3NA 1RP9A 2J78A 1B3WA 4K36A 5ABFA 5JBFA 4DEFA 4XZBA 4AD1A 3SCRA 3VNJA 1CGWA 2QCCA 2IUZA 1QCWA 4Q7IA 4JICA 3W81A 1RV8A 2TAAA 2WMJA 4I7WA 3E74A 5DFAA 3BG9A 4W7WA 3PUDA 4BQ5A 3M5VA 3WEOA 2W4XA 3UCCA 1W1ZA 3GDTA 4KFPA 4R7JA 2NQLA 1FWFC 4LB3A 1U1JA 3NZGA 3ES7A 1S5MA 5DQPA 3KS5A 3WH9A 1JD7A 1ISXA 4NHVA 2TYSA 2RGMA 2QGYA 2V3EA 1ENUA 4AWTA 4QAIA 3V3WA 2E3ZA 2XN1A 3D6NA 4KF1A 2WKGA 4JD4A 3BJFA 3HOJA 4Q8PA 4ENLA 2W6RA 3TYDA 1W9DM 4EK7A 4S1FA 2OTDA 5LZLA 2VOMA 4ROQA 2PB1A 4L4OA 3ATZA 3CZKA 3CTTA 2V0TA 4I8YA 3U5UA 1Y5WA 5EL1A 1K6AA 1JPKA 1O60A 1PZ1A 3T8LA 3K2GA 3K8LA 1FHLA 5I02A 1XG3A 3S1VA 1PDZA 4ZTXA 4CGTA 4A35A 5AVHA 4YTSA 3THQA 4PUKA 1DJHA 4DQWA 3W37A 4HPNA 2E67A 1SMAA 3FDKA 3BQ5A 3SFWA 2GGIA 1VRXA 1JPHA 1OK6A 2CYGA 3BARA 3ARRA 3FYOA 3NAVA 3KCLA 2QYGA 2VZTA 4PUDA 4DUOA 2G95A 1UC4A 2QCDA 1UWTA 1XCFA 3JS3A 3EX6A 1W9PA 5LXXA 3EWDA 4Q8NA 1UWUA 3KVMA 1QPOA 3LOTA 2ALDA 4OHQA 4AVFA 3NCOA 2MUCA 5A8NA 1DE5A 3K8KA 1GZJA 2QEZA 5E1QA 3MKKA 2VDGA 1YQ2A 1FKWA 2ZFAA 3S5YA 1W3TA 4NF7A 3AXHA 3AJ7A 3KX6A 3DEQA 3WDQA 3PULA 3RX4A 4HMDA 5I7GA 2QHAA 4RV8A 3ZJ6A 4OU1A 4AD3A 2Z00A 1CXFA 3N15A 3VIOA 1S39A 2PUZA 3SDOA 4DBDA 4NJKA 4HSHA 5AHLA 3TONA 2WZIA 2XGIA 4YVPA 3WLOA 1OZQA 2A7NA 1PHWA 4NJGA 2QV5A 2YLAA 4BI5A 2R6OA 1SGJA 3UCDA 1PSCA 2H3BA 5RUBA 3GVQA 4L80A 1WKEA 2V38A 7REQB 1O1ZA 2WM0A 4ZQRA 4XQ6A 3AOFA 1KBJA 2VMFA 1SUXA 1Q8JA 1AD1A 4Q8VA 2G3FA 3OYXA 4BR1A 1ICPA 3KL0A 5DX7A 2YL8A 5K9CA 5XIAA 4B4FA 3UWYA 1MI3A 1WXYA 3DFOA 1A3XA 1SZEA 1US0A 3ZS4A 1CGYA 3PZOA 4KRUA 4QEEA 1PV8A 1M9HA 2GQ3A 4CN6A 1KGUA 3KBSA 4X0VA 3SQSA 3E3HA 2IW0A 1FWDC 1OQFA 4H9VA 2CW6A 2WLZA 3L65A 2YDRA 1EYEA 3WH6A 1TTJA 1BVZA 2PDMA 3J7HA 4QDMA 3ZOAA 3HGRA 4US5A 1J18A 1GUVA 3E49A 2OPJA 1W2PA 3RM4A 1V4YA 5EGRA 5CPSA 2X0SA 2D22A 3WELA 4BCEA 2OQLA 1GHRA 4RX0A 1I8JA 2UY5A 1HTIA 3DYPA 4B90A 2DJLA 4DAIA 1HX0A 4W87A 3AISA 4PYSA 3WLNA 3NFUA 2A4AA 4QROA 3H2AA 4F0MA 2J8TA 5G5IA 2PBGA 3NQ2A 3INPA 4Q3MA 1O7AA 4H19A 3KBNA 2NT1A 3FOKA 3QEZA 3WMSA 1YLVA 7PTDA 3BQ6A 1EKOA 1FDZA 4ATLA 1OIMA 5L6UA 3ZMRA 3U5YA 3AZRA 5FJPA 6A3HA 1EUNA 5LHFA 1GQKA 4PBEA 4INFA 3EYPA 3EPMA 3VKAA 1K9FA 3VI2A 3SN1A 5C9ZA 1JCNA 1QATA 3BO9A 1NSJA 2EG8A 2JK2A 2R1NA 1QK2A 4MNLA 2QIWA 1BG4A 1F74A 3Q65A 3STGA 3ZVHB 2O4MA 5E9AA 3WF0A 1SZRA 2PWVA 3ARTA 5A6JA 1FWRA 3ANVA 3B9NA 3C2EA 1RLCL 4FLOA 4H9ZA 4DVOA 3NDYA 3UCQA 4JQ4A 1SM9A 2BGNE 1U5VA 4KFOA 3AZTA 3GG1A 3ABRA 4OOZA 4RL3A 1ZALA 4HMCA 3TDFA 1UBSA 4U5IA 1Q2RA 3KOXA 1SR0A 1W9BM 2NT0A 1XYMA 3TN3A 3OLDA 1CBGA 3FV9A 1UROA 3A3WA 4R27A 4G2DA 4TUFA 2HEJA 2VEGA 5BXTA 3OODA 2A3LA 5LXEA 3UERA 1I9CB 4RNJA 1IWAA 2I9UA 2PLJA 3BW3A 4GUFA 1MMFA 3CIVA 2VRJA 2VGFA 2W9MA 3REQA 1AZ1A 3B8TA 4CN4A 3E0LA 3FKKA 1V3HA 1KV8A 3UWQA 3SRDA 2OO0A 3OG3A 2O7QA 3O63A 4QXIA 3E0WA 3CEUA 5TF0A 3WD4A 1H50A 4ASTA 4RXFA 1G94A 2VFGA 1Q6OA 2GQ9A 3SIZA 3RCYA 4WKAA 1J5TA 3LS9A 3FVMA 7TAAA 3W9ZA 5D32A 2GVJA 5CZTA 1M04A 3EA2A 5C9UA 3M46A 4K6AA 4K68A 5DY3A 4L4MA 4FXSA 1AQHA 4TX8A 3GAKA 1YRRA 1EOKA 4H2HA 2G5WA 4U3CA 4IIGA 4ALDA 1JPMA 1W2VA 3UBPC 2OMAA 2EF9A 3LMYA 3LBCA 2VZVA 2YFNA 4H8UA 3WD3A 1EP3A 2GQ8A 3ABSA 1IT8A 3RMEA 2FVMA 1V7AA 3EMCA 4O0QA 4PTMA 3NL5A 1E1CA 3BGJA 2AAAA 2B7PA 3IJQA 5T26A 5B80A 5JUVA 1VIWA 2WKJA 4F0HA 4AWSA 3GVGA 4L9XA 2VZSA 3NEHA 2QR6A 2E40A 3N18A 3BOFA 3BW2A 1NP2A 1XS2A 4RK8A 5DF0A 5F1UA 1XBZA 1ZY9A 3FJ4A 1S1PA 4C60A 3CUXA 4NY2A 3C8NA 3EA1A 3LXCA 1DJWA 2ZUVA 3CIWA 3CUHA 3H2FA 1AZ2A 3KCJA 4MDOA 4GHRA 3SBFA 2JGQA 4FF5A 2G37A 1L0PA 2EGZA 2EBNA 5A94A 4QBXA 1FCQA 1XF0A 4XVDA 3SJ3A 3W7RA 4AF0A 2PC8A 3TJLA 1UZDA 2J75A 2XIOA 4PL2A 4EE9A 4GGHA 1JQXA 4E2VA 3W7IA 4AISA 3WLIA 4KCUA 5CPQA 2J7FA 3WJZA 1GVOA 1JG9A 5HJYA 3FSTA 4JN8A 1GVFA 4GVIA 1XQLA 2OFJA 1EL3A 2FZNA 4DIAA 4CVUA 1RJRA 3IJLA 4TR9A 4W93A 4NVTA 1UB3A 1J0ZA 1TX0A 7REQA 4FAMA 3TJXA 1VPYA 1IXPA 4JZ5A 1PWMA 3GTXA 1WCGA 1GVEA 3LSCA 2X1UA 3CQ0A 4LNYA 4WUIA 4P8UA 1ML1A 1UIOA 1A80A 2G4JA 5FJTA 4HK7A 3LHVA 3O6YX 1PYMA 3AMGA 2DUAA 3E02A 4IX2A 1DXFA 3MI2A 3BZGA 3XINA 1GQJA 1K1DA 1BEUA 3LI0A 2XU2A 4P7QA 3GYEA 1UUOA 3QKEA 1P1MA 1ZJIA 1OCNA 5G2IA 3GDRA 2XSAA 3SY5A 4UQCA 4HK6A 4M82A 1JF6A 3AIWA 3B9EA 3FN9A 2QCLA 3E9AA 3WFAA 2O92A 4YCPA 3N6QA 3EKZA 2ACQA 2IPFA 2Z24A 4AYSA 4EXBA 4JX6A 1R2SA 1SFLA 1JZ5A 1C9DA 1OGSA 1F73A 4DJFA 4W5UA 3DFNA 1EA9C 2IKGA 4F9DA 4M19A 3WBEA 1ZBCA 2REQA 3DDMA 1LT8A 1Y65A 1KWGA 2ZXAA 3OA3A 1D2KA 3R89A 3PJTA 1VBUA 1LOSA 3W7GA 3W2NA 3HMCA 4J9JA 2ALRA 4HOXA 2DJXA 4C6CA 2HS6A 1R7AA 4MUPA 2IQ0A 2PTYA 1KNWA 3QV6A 4OBRA 4TX9A 3RM8A 2Y8KA 3GHRA 4LW7A 3PTDA 3MUZ1 1H09A 2PDFA 1Q5MA 5C2XA 4ONVA 1GORA 2BGSA 4U28A 2CZDA 1Z6KA 2J66A 4K3ZA 1DTNA 3BV4A 2XWEA 1MEIA 4C6OA 1OX5A 5AYBA 4S38A 3N4EA 2GOUA 4AZGA 3WLPA 3SN4A 2NW0A 4K1WA 2BY0A 3H21A 1RSCA 2B7OA 4O18A 1J96A 2PRMA 3MP4A 1IEWA 2B4GA 5D2YA 3TJ4A 2UZ9A 1I2PA 2POZA 2ZUMA 4Q33A 2XM2A 4J7RA 4B3LA 3Q4DA 3U48A 1J0HA 3CUFA 3G0UA 3UR8A 4H6QA 4HB7A 4ERIA 3O0KA 2E4TA 1JJKA 6ENLA 1UMYA 1E6NA 3W75A 3LZ5A 3AYSA 1TPH1 1AJZA 4M6QA 3WQPA 3E6EA 3WO8A 1ECQA 3UYIA 4ADTA 5E6ZA 3T4WA 2D23A 3U6WA 2RDXA 4HMEA 4YLWA 1GWJA 1UQYA 5G1YA 1TVNA 3M16A 4DO4A 2J74A 3HQPA 5CZKA 4UZUA 3IWPA 3PBUA 4Q4RA 4IPPA 2A85A 3WF4A 5AC6A 3O15A 4UXDA 1GPFA 4IGMA 4L64A 3B8IA 3TCEA 3SADA 9RUBA 3G8RA 5M1TA 1CXLA 2JBMA 3TAOA 5IRPA 3SQLA 4C6IA 5D38A 3NNTA 1DE6A 4UNKA 3NSNA 4B5NA 3F7JA 3CZGA 3II1A 3R0UA 1O1HA 4O4WA 1X6UA 1U83A 2HNHA 3M0YA 1PTGA 2YZ5A 5I3KA 3KOZA 2HVNA 1KFKA 3P60A 4D6HA 2X2YA 1W5OA 1W54A 3MP3A 4X63A 5A8PA 3OOQA 3EMZA 1XRTA 4MJ4A 3FAXA 3N9RA 1LL4A 3AUJA 1KFBA 1J0KA 4W8LA 3GSMA 5C7VA 1XDLA 2WHKA 4IJCA 2ZIDA 1UR2A 4NG3A 4X9SA 4FZIA 4N42A 2FDSA 4TV6A 4GXWA 3MMWA 1U30A 1EJSC 2YXXA 1KM4A 1G7UA 2GVEA 2YYTA 3HIJA 5M03A 1H0GA 1K4HA 3UA3A 4LUTB 4AWEA 1VFMA 4O16A 1GOXA 1KTCA 1T96A 3OZYA 1CB2A 5EPDA 1SVDA 1VFTA 1UJQA 3CIXA 3WEZA 3GVVA 4V27A 2R1PA 3QY8A 4UTJA 1U1UA 4TTGA 1ZLPA 2V3FA 3KDNA 3MP5A 4DRSA 1XI3A 5T91A 3G3DA 1HKJA 4IIBA 3ES8A 3WH8A 4QG6A 5C9RA 2C15A 4FXJA 1V0NA 4LVAA 4Z1YA 3AS3A 3BPWA 3GIYA 3C6CA 1W3HA 5KZEA 4PFHA 2AL2B 1IE7C 4B92A 1SFJA 2WC3A 1LRQA 4Q8QA 2GPTA 1G1YA 2Q71A 4NZ3A 3F1QA 4KCWA 1HL2A 1US2A 2CZEA 1GYMA 3LV6A 1J01A 4W9TA 1VIZA 3MMDA 4GNKB 4GYPA 3RGTA 4IUOA 1BYAA 2E8ZA 4HIBA 1W91A 1XH2A 4UFLA 2P0OA 3FGCB 2VGIA 4H7CA 1CCWB 1G9HA 2I16A 3CTLA 2BS9A 4XKMA 3S1GA 5JIWA 3NEVA 3K1DA 5CH9A 4ORIA 3HFTA 1X96A 2E25A 3AS2A 3D5HA 1HQTA 4JQ2A 2DEPA 3MYOA 1N82A 1LCOA 3S6TA 1FHUA 3W6MA 4C6KA 3E2VA 3L2IA 4CCDA 4D6IA 4BQ3A 4GQGA 1TA3A 5F4XA 4XAYA 4JOMA 3NTYA 1W5NA 1IEIA 2HJPA 3W1AA 1P6WA 4QP0A 3CS2A 1XSKA 1LBFA 2BY3A 4QE1A 1WDSA 3BSMA 1LTDA 3B0PA 3GTIA 3WUEA 4MYXA 1PJ9A 1NEYA 1EC7A 1OC7A 1WKFA 1EJTC 3TU9A 5AHNA 2D0HA 4NASA 1REQB 3USZA 2G97A 5AYZA 1VPXA 2G3MA 3G2GA 2VHLA 3HJZA 5BRPA 3TQKA 5HJLA 1V3MA 4FLQA 3CQHA 3WQGA 3ARWA 4YTTA 5AZ0A 4ZQCA 1R9XA 3TZNA 3KTSA 4JCLA 5M2FX 4Z2LA 4AZCB 3RLGA 3L0KA 1XIEA 2PWGA 3AZSA 3MWCA 4NJIA 4J3VA 1H7RA 1E9LA 4XKYA 4E0CA 1UWQA 5I3IA 3W1XA 3VUSA 3DFPA 3CAKA 4Y9MA 3M07A 2NUWA 1EPVA 5U4NA 3RLVA 3DH7A 1E6PA 1DWAM 4XUYA 1FA2A 1DQWA 4YMZA 4K39A 1K8ZA 2DZWA 4JX5A 4HCHA 2INEA 3ITXA 3R58A 4FOUA 4MZ1A 1OABA 4B5UA 2YSWA 4ATWA 2E1WA 1KFJA 2NLYA 1NH6A 4BA0A 4L7ZA 3SCUA 1RQEA 3CLWA 5EB8A 4K37A 3UY7A 4B5XA 2P88A 1OYAA 2XSBA 4NYUA 4G1KA 3WIJA 1YEYA 1IXOA 4JR5A 4H8NA 2CLHA 1GW9A 1EO7A 1TKKA 3EXRA 3KXQA 5F4SA 2WAGA 1ZCCA 4FMVA 1AG1O 1ZAJA 4DNHA 1MDLA 1ALDA 4MB5A 2HDJA 3H26A 4CQAA 4Q7BA 5IDZA 1LLZA 2C0AA 3OG2A 1W56A 3OVGA 5F1VA 1QNSA 1IZCA 2PWDA 1ZPTA 2PE4A 3OBKA 1R3TA 2NVDA 2FDMA 1KM2A 1CNVA 2EJAA 2EO7A 4NT0A 1KRMA 1XIMA 4ZQPA 2GGGA 1BG9A 4I5XA 1VFOA 3LDVA 3W1LA 3MW7A 3R0DA 3WFLA 2VX5A 3N1AA 4OUIA 3QLDA 4FI4A 5A69A 4GABA 1RXOB 1KWKA 2NZLA 4MPKA 1QRQA 2XFRA 3FDGA 3HGJA 1RY0A 3KEHA 2XPKA 1ONEA 4LUYA 4Q8WA 3V5CA 3W7KA 3BLDA 2ACUA 3N9SA 5ABTA 4XIMA 3EXSA 5G2WA 3QC0A 4KS0A