1GWJA

Morphinone reductase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
374
structure length
374
Chain Sequence
TSFSNPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDWIGGDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MORPHINONE REDUCTASE
publication title Crystal Structure of Bacterial Morphinone Reductase and Properties of the C191A Mutant Enzyme.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 132
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gwjA00
2ZYFA 3ATZA 3IIVA 4N6EA 1Z48A 3EWBX 1TV5A 3QF0A 1KFJA 4TMCA 2QUVA 3L5AA 3PC0A 2R94A 1RV8A 1QPQA 3W2LA 4AWSA 1ADOA 1WX0A 4POCA 2RDTA 3MBFA 1H7WA 1QMLA 3BG5A 4O28A 4AH7A 4JX4A 1JRCA 2J88A 2A6LA 5D2WA 3JRKA 2C16A 3HPZA 1X1OA 2ZA1A 2UV8G 2ZQ0A 4XZ9A 3LXAA 2W6RA 2GQ9A 4FNTA 3LCIA 4MLJA 1LZOA 4ZQPA 5U4NA 2XN1A 4O54A 4B5NA 3RFAA 3NQ8A 1H7OA 4JX5A 5BW6A 1JVNA 3KRZA 7TIMA 3S1XA 4CNOA 1FCVA 3NXFA 2VC6A 1AW5A 4OV4A 1RVGA 3NAVA 4JTLA 4HN4A 4MY9A 1YXCA 4UFIA 3T4CA 3QW4B 3W1TA 4EF9A 2YYUA 2ALDA 2PE4A 4IMGA 4RXFA 3W7HA 4KFNA 3IVTA 1JUBA 5CGQA 4A3UA 4MLRA 3B0UX 2CWNA 1JJKA 2Z1BA 1KW1A 4UTTC 2WPBA 1W5QA 4O52A 4EOUA 1SZNA 1FDZA 1QOPA 3TX9A 3KHJA 3NQGA 3RMJA 2BSLA 1BWLA 2CLLA 3W7GA 4JEQA 3W2JA 2NUWA 2CLEA 1YPFA 3W7MA 2ZZ1A 1PL9A 4CNNA 1TQXA 3D0CA 4RK8A 4A2RA 2V5BA 4IGHA 1KM6A 2CZEA 1WA3A 2QCMA 3S5NA 1FCBA 3EXRA 3GDMA 1RQBA 4JTUA 3T40A 1I2RA 4AHOA 1SFLA 1S5WA 4JD4A 1N7KA 3W7EA 3BLEA 4JTIA 1ZNNA 1TPVA 3V75A 4GUIA 1SQ7A 4RZ5A 3QMSA 3GXPA 4O53A 5D33A 4LV4A 1A5AA 2CLHA 4R7JA 4Z1BA 2PURA 1TTPA 3LHWA 4HKPA 4PA8A 6ALDA 5HR6A 2NWRA 3AO0A 3MI3A 4LVGA 1GYNA 4O50A 3W2MA 3MP5A 1TJPA 3LTPA 3UXAA 3P8JA 4HPXA 3A5VA 3I68A 4QIUA 5HUPA 3EWUA 5H91A 1LBMA 3YPIA 4RZ6A 2B7QA 1TSIA 1GTHA 3G18A 4FIQA 1DKWA 3TQ0A 3N19B 3DFPA 1B3OA 4K36A 1JRBA 1KM2A 2ZRUA 1D3HA 1X6UA 1EUNA 3NQVA 4O4VA 2ATMA 5LZLA 4GUFA 4IMEA 1TREA 3UQNA 3CEUA 1H5YA 1VS1A 2VFHA 5D2VA 4LV9A 3TQKA 1GT8A 4Q32A 1ZAIA 5I3GA 4R53A 2ZFAA 3LHUA 4ML9A 4UCGA 1GVRA 2YR1A 4WUIA 4UTTA 5KINA 1B4EA 3SZ8A 2Z2UA 3HQ1A 4HIBA 1LOLA 4NJJA 4JYFA 4N6FA 1QPNA 4DF0A 4HNTA 4NNAA 4YCPA 4HT3A 2E6DA 4O57A 3WJYA 3L65A 2BZNA 4A29A 3IRDA 1F2JA 3C52A 3G3MA 3QMRA 5FEXA 1TJRA 4RZ4A 3S8HA 4HNVA 3W7NA 1H1ZA 3C2EA 1EWDA 1YPIA 2Z6JA 1VHCA 3DKLA 3VNDA 2GPTA 1B9BA 3O15A 1Q6RA 4XBSA 4UXDA 1XCFA 2E77A 2O7SA 3DFQA 2ZRWA 4OE7A 3BO9A 2V30A 2VEKA 3MBDA 4OU1A 4RV8A 4JTEA 3KRSA 1IXPA 3E12A 3GNDA 3HGSA 1GG1A 3M9YA 1G6CA 5I3HA 3ZR4A 2Y7FA 2F84A 4Y6GA 1AW2A 3LCLA 4QAIA 4O1AA 5D2XA 4Z1AA 4GNJA 3M16A 1XBZA 1L6SA 2DJXA 1W31A 4S2CA 1PS9A 5HWMA 3PF3A 3TV8A 3QPYA 1F5ZA 3QSTA 4Z08A 5EKYA 3M43A 2BLEA 4WJEA 1KFBA 2BX7A 2FTPA 3QH2A 4O14A 2B0MA 3GXNA 2QCCA 1F76A 3W7JA 3KRUA 4GWEA 3WK1A 3GXTA 1F6KA 1FXQA 3UYCA 3LGEA 1S3HA 2V2CA 1GZGA 4UFJA 3UXDA 5G1YA 3M6YA 3V1PA 3A24A 2NUXA 3P8IA 5HJLA 3OEXA 3GX9A 2X2GA 3SGUA 5TIMA 3TKFA 3PG9A 4LT9A 1JQVA 1FWSA 1Q6LA 2IQTA 3CHVA 5HQEA 2A2IA 1LDCA 2E1DA 2WNNA 1XBYA 1B57A 1JQXA 2VOMA 3NPXA 2EGZA 3S5OA 3F1QA 4BWLC 3NL3A 1XUZA 3KVKA 1HUVA 1DVJA 3FA5A 1TPEA 1BWKA 3L66A 1QPRA 4EVZA 2YW4A 4Y90A 4NT0A 5FEWA 1R2TA 1HO1A 3L68A 3HG4A 2WKJA 1JCLA 4FX7A 2YX0A 3N14A 5CPOA 4NZJA 1TRDA 3UWUA 4E2DA 2TRSA 4R34A 1KFLA 2Y7DA 3P67A 1ME9A 4MJMA 1TYGA 3UWYA 3WJSA 4M6QA 4OQVA 3EKZA 1VJIA 2C6QA 2F7FA 3FIGA 1BEUA 1G4PA 3BW4A 3O6CA 4DEFA 1PHWA 4WY0A 3M5ZA 1SW3A 1DBTA 3M1ZA 3NL5A 2W0UA 3B04A 4QISA 4TX9A 3I65A 1OABA 3I7SA 3DGRA 5L9FA 2VEPA 1J2WA 3S5ZA 4ADSA 5FF7A 4JTHA 2QCDA 5AHMA 1PCWA 3TAKA 1TRIA 1G4SA 2E68A 3W71A 3PB2A 3TQVA 4QNEA 1GVSA 3O6YX 3P5YA 1TTIA 1B4KA 2NXGA 4CQ9A 2Z0IA 3W76A 1YDOA 3TJXA 1FWNA 5EA9A 1KLYA 5AC6A 2V0TA 2W79A 3OVRA 5CZ0A 3CIWA 3U8GA 3OIXA 4TO8A 1XI3A 3USBA 3SFKA 1KBIA 1O95A 2J27A 2JKPA 2JKEA 2YFOA 4LOCA 4XKYA 3A21A 1H51A 1NSJA 1HTIA 1DJNA 3LV5A 3WJZA 3HBLA 3CIXA 4XQ6A 3DFNA 3QQ1A 4MYXA 2WNQA 2PC4A 4LVBA 1WOBA 4M6VA 3FKRA 1OFBA 4G1KA 2WSRA 1JCJA 4X9SA 3F03K 3QJAA 3N3MA 5G2HA 5FF0A 3LBCA 2QAPA 2A5HA 4W9TA 4ZL1A 3L21A 3P62A 4PL1A 4JIQA 4K7YA 3STCA 4IWWA 3CC1A 1SUXA 2VFIA 4LS0A 3HG2A 1MEHA 4N4PA 5I3FA 3L9CA 3B03A 4GJ1A 3DFTA 2PRHA 2B4GA 4BWLA 1GG0A 3NQAA 2QCNA 2VFGA 3EX2A 4O10A 3ZFHA 4BR1A 1CW2A 3IIOA 2V81A 2A6NA 2QJHA 4LS1A 3RF9A 3TSMA 5K4XA 5AYYA 3RLUA 1X8FA 3W7DA 2R91A 3VE7A 3P7YA 3LM7A 5G1TA 4X2RA 3TH6A 5G5IA 4K39A 2ABBA 1UJPA 1EUAA 4ZQOA 2E6AA 2ZDRA 1QR7A 4LVAA 4FX6M 2J9XA 2C15A 1YXYA 1S5VA 1VCVA 3PSVA 4RCXA 4UTHA 4DBDA 1I8JA 2B7OA 1SO3A 3MP4A 4UFHA 3MYOA 4JN6A 1K03A 3LBMA 3P74A 2ZZ2A 3BG3A 3MUXA 4JYEA 4E38A 3W1MA 1W37A 4FF7A 2ZTJA 4LNYA 5FEPA 5U7SA 2NXIA 3G1DA 3PUOA 2NX9A 2YGYA 1PCKA 1VLWA 5EMUA 3G1HA 4N9CA 1HO4A 3STEA 1SFJA 4IPJA 4DQWA 1AK5A 1I2OA 3GAKA 2B7NA 4AXKA 2CZFA 2VKZG 4AB4A 1PHQA 3M47A 3BARA 3DXIA 4UNLA 1DJQA 4UNKA 4I7WA 5A8GA 4IMDA 2VEIA 4XTDA 3NZ1A 2VEMA 1WBJA 3IIZA 4MPQA 4RXGA 4DO6A 3ABOA 1TPFA 2A7RA 3GR7A 2CLOA 2OT1A 4C1KA 5EPDA 3GNNA 3NO5A 3O06A 3EX6A 4NUWA 2J24A 3L0KA 1TTQA 3C0JA 5FF2A 3LLFA 3C56A 1WYIA 3QRHA 5DY3A 2YYTA 4UTUA 5D37A 1L9WA 3RK8A 2YFNA 1KTNA 1KTBA 4JYDA 5K4ZA 2RFGA 5AOUA 2P10A 3F4WA 4MFDA 2DZPA 4M7SA 3KFTA 1RD5A 1V7YA 1SO5A 3LOTA 1XBXA 2WSQA 2DORA 1SZEA 4ZMGA 3A22A 3NQ2A 3LLDA 3R2GA 1IXOA 3LRLA 1LBFA 4UUIA 2PCQA 1EX5A 2B7PA 3L2IA 1FXPA 4JTFA 2D73A 2CLKA 5J5DA 5K7JA 1ZJIA 5F4WA 5LGXA 1OFEA 3W7RA 4GE8A 3P5ZA 3EX1A 3TC6A 3W1LA 3E02A 4J9JA 5K9CA 4NZFA 3RU6A 1OFDA 3UWWA 3LCHA 1N55A 2FIQA 3QYQA 1ML1A 3NNTA 1JCMP 2Y7GA 4K8HA 3Q94A 2TMDA 1U83A 3DI1A 1ZENA 4GRSA 1G4TA 4UTLA 5LGZA 5AHEA 1K7FA 4BFAA 4XWUA 2QUTA 1W54A 1BKSA 3W23A 3T55A 4IPIA 4UMAA 1AL8A 4PODA 3LCFA 4WZHA 2FB2A 1M7PA 4IXXA 4IX0A 4JTJA 3TK7A 1FBAA 1IF2A 3W1AA 3G1AA 3I7QA 3MW7A 3TJLA 3LTSA 4WXYA 1LP6A 1O5XA 2OMAA 2HTMA 1LLZA 4CCCA 3TROA 3FLUA 2V5LA 5KZEA 3SGZA 2A85A 4QNWA 4MKNA 1YTEA 4UC5A 1VYPX 1XL9A 3JS3A 3M5XA 5BNKA 3LCGA 3HF3A 4IMCA 2EAWA 3MHUA 1ZY9A 1MSSA 1FDYA 2WQPA 1W1ZA 1AG1O 1W56A 1FY6A 1TMHA 8TIMA 3DZ1A 4AWTA 5K2ZA 3CM4A 4K37A 4S1FA 4AHPA 1SPQA 3MJYA 2FDSA 4KFPA 1QOQA 4LRTA 5CZJA 3O1NA 4NXSA 2ZA2A 4O1BA 2DZSA 2JK2A 3EKLA 1A53A 2C18A 3NQCA 1VZWA 1EWEA 3W84A 4I7VA 1OG0A 1A5SA 1QDSA 1UASA 3M5VA 2OCZA 4CQAA 4GC4A 2CLIA 3A23A 2PRLA 3MP3A 1KM1A 1F7BA 3E9AA 1UBSA 5D03A 4L4MA 5HR7A 4PTNA 5D30A 1P0NA 3NYZA 3NL2A 4CNPA 1TV7A 5ABTA 2WOQA 1UUOA 4H3DA 2I1OA 2NZLA 1D3GA 2QR6A 1OYAA 1WBHA 1ALDA 2X1RA 3W75A 5KZMA 3TMLA 4NVTA 4OBTA 5AHNA 5F2IA 5F2LA 1NF7A 4LUIA 3ZWTA 4ZZ9A 1R46A 3IVUA 1OJXA 3STFA 4NX5A 4RX0A 2EHHA 2H90A 2FPYA 2G96A 3HO8A 3LCWA 4MYAA 4GXMA 3HOJA 4N9BA 2Y89A 1TPDA 3PM6A 1VHNA 5CSSA 1KA9F 3DFSA 2YZRA 5BRBA 1GYLA 3NG3A 4HNUA 4AHQA 3HGRA 2RDWA 4AF0A 4ICNA 2QCHA 5TBOA 3NPUA 4FIRA 3ANYA 5HMSA 1AL7A 4ADUA 4QSHA 4N2YA 3W2NA 4GUGA 2V82A 1SW7A 2C19A 1JUKA 5LHFA 4NJHA 3W86A 3EXSA 2OZ0A 4WOQA 2V2DA 3W88A 2BTMA 3OA3A 4FX8A 3CB8A 3SIZA 1QO5A 2DP3A 1YADA 2O7QA 2VELA 3A9IA 5K9XA 3VE9A 3P84A 3SY5A 2I9EA 2XFWA 2YXGA 2VXNA 1VYRA 2ZRZA 3NEVA 3S42A 1ICQA 2FJKA 1O60A 3G1VA 3W7QA 5LNVA 2X1UA 2VFEA 4MJZA 3TW7A 4YLWA 2G97A 3QSRA 4O1DA 3N9SA 4KKXA 5D32A 4KWWA 4QQ3A 1SZGA 1W5MA 3DBPA 1OX5A 1WDWA 2VENA 1Q45A 3TAOA 1SSDA 2H6RA 2R14A 1OVDA 3W85A 4Z1DA 1T96A 2FFCA 2X16A 1MO0A 2E6FA 4FXSA 2QDHA 3H53A 1M5WA 3WK2A 2E09A 4ORIA 1SU5A 3LDVA 5HULA 4HPJA 4AWUA 1QO2A 1NF0A 1K02A 5I3KA 5D2YA 5AYZA 3B4UA 3M41A 1W0MA 4OHQA 1K8ZA 1E51A 4YCOA 3IGUA 3NPWA 3QM3A 1TB3A 4JTTA 4FB7A 1Z42A 3TA6A 4CCDA 2ZRVA 4XUGA 2J9YA 3NM3A 1G7VA 2E5DA 5SWUA 1QNVA 1UB3A 4NXKA 1NEYA 4M5PA 5EY5A 3DH7A 2NXHA 1LOSA 1WQ5A 2I14A 4PEKA 4DBEA 5DCEA 1QFEA 1KM3A 4LC6A 4D2JA 4DO5A 3PG8A 1R2RA 4RKAA 2QCGA 3QC3A 4FHAA 1GWJA 1LOQA 3KXQA 3W73A 3WJXA 1I2QA 1A5BA 4PCFA 5BMXA 2ZZ7A 3W74A 1WXJA 2DZXA 3WK3A 2PRMA 1GVFA 3CU2A 3LI0A 2AQWA 2C13A 4FNSA 3E49A 3C2FA 2Y70A 3S1VA 1XUUA 4UTIA 1GJPA 5J5RA 2ZRXA 1OF8A 1RQEA 1FWRA 4P61A 5HINA 4RJEA 3NZRA 4P2VA 1OHLA 3BV4A 4HSNA 1TO3A 1MXSA 2NV2A 3IIPA 4NNCA 1N8FA 3GDLA 5CZTA 3FOKA 3W2KA 5AFDA 3SW6A 2CFFA 4RLIA 1LM1A 3B0VC 4N4QA 5I3JA 3PULA 3A5FA 3QEZA 5AHLA 5G2IA 3HIJA 3BGGA 3EX4A 4PH6A 3MMTA 1FCQA 4I7UA 3ELFA 2E6YA 4IOTA 3N9RA 4JDBA 4ZQMA 1DHPA 2ZZ5A 3NQDA 5G4WA 1XM3A 2OX1A 4UTKA 5LHEA 2NX3A 2TSYA 4C1LA 4U28A 4LC8A 1A50A 1K7XA 3JR2A 5MHBA 3B05A 3QZEA 1LRNA 1OYCA 4X3ZA 2TPSA 1R30A 1F73A 4O19A 1W5NA 3UD6A 2TYSA 3PS7A 4JR5A 3NQ6A 1I45A 3T78A 1ME8A 2QAFA 4IUOA 3DENA 4WY0B 1YTDA 3IGSA 2YCEA 1Q3NA 3L5LA 3IVSA 1H63A 4MUZA 3FEMA 1VR6A 1SZFA 1GVOA 5C55A 4O18A 1VH7A 1DOSA 1R2SA 2Y85A 4QM1A 4TIMA 4O16A 4UIOA 4X22A 5G2WA 2QCDB 3G8RA 3C4UA 5DELA 1DQWA 2WV8A 3O6DA 3PBUA 3IEBA 3P80A 4NNBA 2NLIA 3GDRA 1FWWA 3GIYA 3QW3A 1ONRA 4FEZA 5AHIA 4MZ1A 3IGXA 1DV7A 3KAOA 4XBKA 2JGQA 4ADTA 5H2ZA 4LVFA 1I4NA 3GDKA 5D38A 3TXVA 3BW2A 4UFKA 1G69A 4XKYB 1BTMA 4R33A 4KFOA 1LRTA 3EWXA 1G67A 2H8XA 1K8XA 1OFOA 4ONVA 2H8ZA 1PV8A 2C0AA 4MOZA 1KLZA 1ME7A 3P81A 2CLFA 1GEQA 3CTLA 5BOOA 3GVGA 3P82A 4Q4KA 5F1VA 3S1UA 3G1FA 1UUMA 4HSOA 3QQ0A 1NFBA 2ISWA 2P0OA 3PR2A 3TR2A 3NQFA 5F1UA 2WO5A 1WAUA 4FO4A 4Y9AA 3EWYA 1H7PA 3EB2A 1ZHAA 4ZQRA 5C2XA 3O16A 5DXXA 3R8RA 4FNRA 2ISSA 4K6AA 3Q58A 3UWQA 5BMWA 1ZCOA 4UFMA 5HUOA 5I3IA 1VRDA 1EP1A 3VFLA 3QPZA 3C3NA 1RZMA 3E96A 3KVJA 1OX4B 1XBVA 2CZ5A 1C29A 3W1RA 4PL2A 1XXXA 5TQLA 1KM0A 4WXZA 3W7KA 3PBVA 3BLIA 1W8SA 3BLFA 3B0PA 6TIMA 5CZSA 3R5EA 5AC8A 3LRKA 1JCNA 3F4NA 3M5YA 4WQ6A 3W7OA 2DZUA 3GZ3A 2A1YA 1CX9A 1IIHA 4JXCA 5E1QA 5IM51 2ZZ4A 3EXTA 3UWZA 1K8YA 1JR1A 4JTGA 2E5CA 2Y6ZA 1LBLA 2C3ZA 4UMCA 1P5BA 1TCDA 4UTMA 1MZHA 4DO4A 1DQXA 5CPNA 3W6YA 4TMBA 2EPHA 3LERA 3FFSA 1VLIA 3TU9A 5AN7A 1GOXA 1T99A 3GKFA 1TPWA 4UTJA 1PE1A 3L67A 2Y88A 2FLIA 3TNOA 5LNRA 5CKSA 5E0KA 3Q2DA 2FQIA 4AMAA 3HPSA 3LXBA 3H54A 1R47A 4O15A 1FX6A 2J9ZA 4IJBA 2QJGA 3G3DA 3WK0A 3C8FA 1Y0EA 1QWGA 4K7VA 5FF3A 4QITA 4Z1CA 2RH9A 4CLMA 1P0KA 3N34A 5HWNA 3DI0A 2CLMA 1GVQA 5HNRA 3MYPA 3OBKA 5AHFA 1L6YA 3PB0A 4S2BA 5F2GA 1OFRA 1FDJA 4TR9A 1GQNA 1H7NA 4K8EA 1QCWA 3NOEA 1C8VA 2QCFA 3PUDA 3UPBA 1H62A 1FWTA 4BI6A 2JKAA 1LROA 4ORMA 2GOUA 3WFAA 3HG3A 1O5KA 2BWGA 3TIMA 4UR8A 3W70A 4MY8A 4DELA 5K3VA 4O1CA 4GBUA 3FYOA 3W1QA 1SO6A 2QCEA 1DL3A 1PIIA 1VYSX 3KVMA 2A7NA 5A5WA 3HJZA 2A0NA 4LRSA 3KOFA 1EA0A 3C61A 3NL6A 5DLCA 4AVFA 3GK0A 4YWIA 4OT7A 3PUEA 1VC4A 4JTSA 2FPTA 1OYBA 2G5WA 4RR4A 4FNQA 3W83A 1YDVA 3SR7A 4YXGA 3E0IA 5AB3A 1TPUA 1K7EA 1DORA 1XKYA 3LHVA 3KVLA 3L0GA 2Q8ZA 2CW6A 3P60A 4M7TA 3INPA 1LRQA 1OF6A 2GQ8A 5IBXC 2Q8LA 4JX6A 3EX3A 2OT0A 2KZHA 2X1SA 3M44A 3N73A 5AYXA 1H7XA 1HG3A 2NUYA 4BF9A 2WJZA 3ABQA 3UZ5A 2AAMA 1L6WA 4GUJA 2CU0A 4MIMA 4YL2A 5FI8A 3FYPA 1I2NA 4O13A 3NR0A 4DPPA 4HHPA 2WNZA 3ABRA 3G8EA 2A4AA 1EB3A 1L2UA 4IMFA 2Y62A 2A21A 1KFCA 3W3OA 1MEWA 3SJ3A 3TCEA 3VCRA 1T8XA 3LB0A 4DXVA 1AW1A 1P1XA 1G4EA 3OG3A 5G4EA 1SW0A 2DZWA 2E5BA 3FKKA 4JIPA 3DFOA 5LNWA 5DN1A 3U6WA 1W3TA 2HS8A 2Q3RA 3LHTA 2DZTA 3MO7A 1W5OA 2NV1A 2FB3A 4JS3A 4PC8A 4XTIA 3EWZA 3GKAA 3GR8A 3NPVA 3GB6A 2JBMA 1JCYA 4DF2A 1JUEA 1V5XA 3KX6A 1EP3A 3W72A 1TPC1 2QJIA 3BK0A 3FJLA 3LCXA 3S0CA 3N2MA 3ABSA 1JULA 4O0KA 4JICA 1OFPA 1RPXA 4WX2A 5D04C 1OFAA 3EEGA 3PSWA 5L6UA 3PBWA 4JY9A 1S5TA 3L0NA 3MHGA 4OWGA 4ZVJA 4UR7A 3HMJG 4K38A 1VQTA 3SI9A 2NX1A 2Q3OA 4BK9A 5T26A 3P61A 3Q37A 3HG5A 4U4MA 3THAA 3FS2A 1YXDA 2G95A 3B06A 5FF4A 1ZFJA 4BI5A 5KITA 1LLWA 2QDGA 3N2XA 1KBJA 1RR2A 3G24A 4LUJA 3PAJA 1K3UA 1TQJA 3W1UA 5CSRA 4CCEA 2C14A 2JGYA 4LWWA 3R13A 4Y8FA 1VPXA 3G0XA 1YDNA 2RHGA 5IBXA 3IV3A 3VI2A 2ZZ3A 3TUUA 2QCLA 4LU0A 1OK4A 1F6PA 2QKFA 2ZZ6A 3MI6A 1EP2A 4JY8A 4UTWC 1JCXA 1KM5A 3LTYA 2ZBTA 3QMTA 1VCGA 2RDUA 2AGKA 3TE9A 1EEPA 4MY1A 4O0ZA 4NJIA 1H61A 4GFSA 5KTLA 2GVGA 3OVPA 4AF0B 4WOZA 3R12A 3STGA 4UFLA 4O11A 1YYAA 1GPWA 4LY8A 2ZRYA 4NJKA 3G1XA 3W1PA 1Q6OA 3C2VA 5EL1A 1ZAJA 3CEPA 1EIXA 4LS2A 3THQA 3RLVA 1YTKA 3FJ6A 3G22A 2J6XA 1TIMA 4MZ8A 4BI7A 4YMZA 4QJ1A 1LCOA 3DAQA 1NAL1 1X7FA 3GAYA 3TXZA 1I2PA 3NQ7A 4N9EA 4ALDA 5D2TA 4O8RA 3RNDA 5F2MA 3B8DA 4L4LA 3G0SA 1FCUA 1WOAA 2GVJA 3PWAA 3S5YA 4LTSA 2WSYA 4IQLA 5F4XA 2GUUA 1KV8A 3M7WA 1P4CA 3W7CA 1KFKA 2BXVA 5CPMA 2QEZA 4DPQA 3S9YA 3TFCA 1EPXA 3TSDA 2Y7EA 2Y63A 3LV6A 2V9DA 1TTJA 2OJPA 1ICPA 3PY2A 4PFMA 2QUUA 3S1WA 3HPXA 3MHFA 3S6DA 5KSWA 1H1YA 1IXNA 3LXCA 1W3NA 1H50A 5D09A 3U2OA 2ISVA 1VCFA 3CPRA 1X1ZA 4HNNA 5KMYA 4M6PA 1XC4A 3OHIA 3O63A 1ZAHA 4Z0SA 3TSBA 2Y61A 4OGZA 4JDYA 1YLVA 5LKYA 3NA8A 1O94A 5C54A 4JGDA 5CPLA 2V8ZA 2YW3A 3W2UA 4AAJA 2GJNA 2VFDA 3TFXA 5FEZA 1KTCA 3G0UA 1TV8A 4AEOA 1C9DA 4WY0F 1OX6A 1KFEA 2X30A 4A2SA 3W87A 4H6KA 3BG9A 4NU7A 3CWOX 5EBUA 3LRMA 4IX2A 3K30A 3BGJA 4IXHA 4H4IA 4UTWA 4FNPA 3GYEA 3CWNA 3MWAA 1U5JA 2LLEA 3O07A 3DHDA 1XFBA 3HGJA 2XN0A 3W9ZA 3GDTA 1FQ0A 4FXRA 4MFEA 1TPB1 2GQAA 1A5CA 3I7RA 5AC7A 5LNSA 4N9DA 4WD0A 2DJLA 1W3IA 3LHZA 3CLMA 1LTDA 3H55A 4JTKA 5DCDA 4A22A 3W7IA 3O8AA 3R89A 3DU0A 2GVLA 2EKCA 4EIVA 4ZQNA 1NVMA 4O12A 4Z0JA 2ZA3A 2H3DA 1SR9A 2V2HA 2X1TA 3LHYA 4Y96A 5FESA 1OK6A 3W07A 1CI1A 1M7OA 5E93A 3UY7A 4MZYA 3HB9A 3W7PA 3G1YA 2P1FA 3W1XA 2EF9A 4UMBA 3UZJA 2HMCA 3LI1A 1VGAA 5C6MA 5F4SA 1Q6QA 2QF7A 5D05A 4LW7A 5DBTA 2ABAA 3MI2A 1LYXA 1RQHA 4O17A 3UY8A 3EWWA 3BVJA 1LORA 1M6JA 3PBYA 4O4WA 3ATYA 1TPH1 1W5PA 2ZTKA 3TDFA 5D02A 1KM4A 2YPIA 4MVAA 4A21A 3HGOA 5HWJA 4E2BA 3NQMA 4CQ8A 3TW6A 3NQEA 1QAPA 1ZALA 3BW3A 3C2RA 3IIXA 1HFBA 1OX4A 3LX9A 1IIGA 1H7RA 4E0CA 3ZWSA 4DF1A 2HSAA 3C6CA 1QPOA 2A7PA 4JNMA 1MEIA 3UNDA 3UPWA 2GJLA 1F05A 3SECA 5LSMA 1Z41A 2DU2A 5EYWA 3TC7A 3OVQA 5C5YA 1HL2A 2CZDA 3W7LA 3BPWA 3TMQA 2Z6IA 5GVJA 3C2OA 1J5TA 1XDMA 1T0OA 5DBUA 2XN2A 1XDLA 3NDOA 5K9DA 3T7VA 4EWND 3DKJA 3M0ZA 3VKJA 4EF8A 4OV9A 5KZDA 1OFQA 3AJXA 2ZCGA 1SO4A 2DZVA 2ATSA 3G1SA 4FNUA 4KWVA 1SSGA 5LNUA 3GLCA 3DHFA 1THFD 4NJGA 5DY2A 1AMKA 4M19A 2FPVA 3NM1A 1GTEA 2HS6A 3UWVA 2YDAA 3PVFA 4ZQCA 2NWSA 2H3BA 1G7UA 4I9AA 3SSJA 3CQ0A 5DCBA 1H60A 3WJWA 5CG7A 1KV5A 1D9EA 3W22A 4Q33A 3T44A 1IGSA 1J4EA 1ICSA 3W1NA 4TU1A 1UCWA 1WV2A 4LVDA 3CT7A 3I6RA 4GUHA 4NQ1A 4N02A 3ZS4A 1IXQA 1FUYA 1O4UA 3NGJA 1PVNA 2R8WA 2RKXA 2VFFA 3O05A 1F74A 2YSWA 4NX0A 5DXYA 3QFEA 3L5MA 3NVTA 1Z44A 2C1HA
chains in the Genus database with same CATH superfamily
2ZYFA 4N6EA 4H9XA 3IJLA 1KFJA 3MQTA 4RNJA 4TMCA 1HX0A 1UJQA 3WO8A 3OLIA 5AZ0A 4G2DA 3S9ZA 2FVKA 2D2HA 4P7LA 1JDDA 2PUZA 1W32A 4EX4A 2RDTA 3BG5A 5G4HC 2DQXA 3H2CA 1OZMA 4JX4A 2J88A 4PMVA 3EGJA 5I09A 2C16A 2OQYA 2UV8G 4XZ9A 5ABHA 4GI4A 2GQ9A 1PWLA 4IMAA 4ZQPA 4RW5A 4ZOBA 4DWDA 4O54A 2ZADA 1AZ1A 3L23A 1E0TA 2NQLA 3OGRA 3RM4A 1FHLA 2HWGA 4GK8A 4ZSUA 1AW5A 4OV4A 1RVGA 3NAVA 2DT0A 3GNRA 1B1YA 2PDIA 2W92A 1YXCA 2IPGA 4EF9A 1G5AA 3OGVA 2OR2A 3UP8A 3W7HA 2V5KA 3KBJA 3RCMA 4LYQA 1P6BA 3I6EA 2VWSA 3VIOA 4O52A 1IR2A 1FDZA 3WD4A 1EQPA 2CLLA 3W7GA 2D3LA 3W2JA 4DO7A 5DO8A 2G3JA 1PO9A 2Y24A 3VO0A 3STPA 4LUTB 1XLIA 2XFYA 2VOTA 3THUA 3WEOA 4A2RA 1CLKA 1IEIA 1Z32X 2CZEA 4P8UA 4L1XA 1FCBA 1BRLB 2BOFX 1RQBA 3UT0A 2ZUWA 1CBGA 2VX6A 1I9CB 1SFLA 4JD4A 3VZYA 3WLSA 2P3ZA 4JTIA 4BCEA 2W61A 4GVFA 3SUSA 3T2QA 4E8CA 5ECUA 3OLDA 5EMYA 3QMSA 1FH9A 4RUBA 3U7VA 5CC5A 1A5AA 4LSBA 4Z1BA 1C8QA 2PURA 3BDKA 3LHWA 1YBQA 4V2XA 3VINA 5HR6A 3LNPA 3TTOA 1DE5A 2WM1A 5I00A 3ES8A 3E5BA 3U7BA 3PNZA 3LTPA 2QIIA 4URIA 1R9YA 3UXAA 3CK5A 1D8CA 2WHLA 4QIUA 4QLKA 3SY8A 1SYTA 4L9ZA 1LBMA 4ZE4A 1OC7A 4RZ6A 3DGBA 2B7QA 2W27A 1JIBA 1BF6A 1EPVA 1DKWA 3N19B 3WN6A 3VIPA 2BOGX 1KM2A 1MQPA 1CGVA 1D3HA 4HN8A 1PZ0A 3T0BA 4DXXA 2PGWA 1KXVA 1U5HA 4IMEA 3VIHA 1TREA 1TZ9A 1ADSA 3B8VA 5FJTA 3CEUA 2FZNA 1H5YA 1VS1A 2VFHA 4MWAE 1GT8A 2J66A 2XZ9A 1KKRA 5I3GA 1YHTA 1P1MA 4IGSA 3PZIA 1GVRA 3WBXA 2CPUA 1TX2A 5KINA 4XO7A 1B4EA 4PB4A 3SCPA 2ZUTA 2Z2UA 4CNTA 1LOLA 4NJJA 1TMLA 3GNPA 1W1TA 3KE0A 4N6FA 4F48A 1QPNA 3BJTA 3SQMA 4DF0A 3VNZA 4NNAA 4HT3A 2J47A 2E6DA 4O57A 4W89A 4A29A 1AH3A 1UZHA 3C52A 3GVRA 3S8HA 1NQKA 2W9MA 3QV6A 3UZXA 2Z6JA 3UWEA 3DKLA 1E6NA 1Q6RA 1B0IA 4ZBCA 2E77A 1SVDA 2NSOA 3MKKA 3LZ3A 4RV8A 2VEKA 1IZJA 3CV2A 4JTEA 3KRSA 3P0XA 4CKQA 3E12A 1W17A 3IPWA 4W4QA 2C0HA 2Y7FA 1E9YB 2OPJA 3LCLA 4W5UA 3SURA 3EA2A 4Z1AA 4GNJA 1XBZA 3EAUA 1S2CA 3PF3A 1OBAA 4W85A 3WD0A 4QROA 4IIEA 4RNHA 3W82A 1KFBA 2BX7A 3QH2A 2NW0A 1JDFA 2G3NA 2B0MA 2YCKX 3GXNA 5CJNA 1TUXA 2NVCA 1XP3A 1W9VA 2V67A 2QF8A 4UFJA 1U33A 2XVLA 1JF5A 3A24A 4PMJA 5HJLA 1O1HA 2R6OA 4EK7A 3SGUA 5TIMA 1JZ7A 1FWSA 3EOLA 4HSHA 1Q6LA 3VNJA 4HMCA 1B57A 1GORA 1ZBKA 3E74A 4C65A 3ONBA 1DVJA 4C6CA 3OBEA 3CPGA 4NT0A 2VDIA 1VIZA 3NUKA 3BV7A 3BE7A 1CLXA 1EO5A 3I6TA 3BAKA 1HJUA 1TRDA 2ICSA 1UZ4A 1XLFA 3H2MA 4MJMA 2ZXBA 3WJSA 1XRVA 3E3HA 3S4TA 4HK7A 3EKZA 4GJIA 2C6QA 2F7FA 1G4PA 1F3TA 1UH4A 3BW4A 3MC5A 2DV0A 4UR9A 3M5ZA 2F2KA 4L9XA 1SW3A 1DBTA 3K46A 3H2FA 4KBXA 3B04A 1WCGA 4L56A 3CL6A 5E9XA 1OABA 5L9FA 5HATA 2OSXA 3SCUA 3TJIA 2QCDA 4MG4A 2J8GA 4JNZA 1PCWA 3UNTA 1G4SA 2E68A 3PB2A 1KKOA 4QNEA 2Z0IA 3W76A 1XRSA 1DJGA 2YBVA 3VNKA 1FWNA 1ISYA 4X2PA 5EA9A 4E8GA 5CZ0A 3V5FA 1WDDA 3U8GA 3OIXA 2PWGA 4B3ZA 1CB7B 2JKPA 4LOCA 4M1BA 1KR0A 5A8PA 1LL4A 2PWVA 3AU2A 4LCQA 1NY1A 1KRBC 3KTCA 4MYXA 4LVBA 1WOBA 2VVSA 1OFBA 4G1KA 1E72M 3Q65A 2FJUB 1JCJA 3F03K 2UY5A 2ISFA 3QR0A 4W9TA 4HBKA 3GQYA 1J0YA 3LG3A 4PYSA 2IKHA 3QGVA 4LS0A 4G1NA 3CUFA 5GNYA 5I3FA 3L9CA 3WYZA 1TWWA 2XDFA 3HPAA 1SMAA 2OG9A 3DFTA 1QT1A 1R3WA 4BWLA 2PDHA 2HISA 2VFGA 1VJSA 4H7VA 3ZFHA 2VGFA 4E6MA 4YWSA 1FWAC 3ARSA 5AYYA 4ZOCA 3P7YA 2F6XA 2G3FA 4WEVX 5AYBA 1NDVA 1QW7A 4A8LA 2E6AA 3VZXA 2P50A 2V5JA 3IUIA 4FI4A 3REQA 3UXIA 1RP9A 1VCVA 2VDHA 2X09A 3PSVA 1DJWA 2V69A 4RCXA 5JU6A 1SO3A 5M2FX 3V5CA 1JDEA 1MMFA 3MYOA 1U1JA 5LA0A 4LAOA 4GQRA 4PUMA 5BRPA 1CXEA 4EPBC 4ZXLA 3W1MA 4FF7A 5AC5A 2XJ7A 4LNYA 2OLAA 4V33A 5FEPA 3VOIA 3G1DA 3VKAA 4HZMA 1VLWA 3OODA 4LYKA 5EMUA 1N8WA 4N9CA 2PD9A 2A3EA 1US2A 1SFJA 1HJQA 4IPJA 4AISA 8XIMA 4DQWA 3AWOA 1TV3A 5ABFA 4AXKA 1R3YA 2VKZG 3EPMA 3PZVA 4M3PA 2D0FA 4CU7A 3TJ4A 4C6IA 1LT7A 4I7WA 3GU1A 4DWSB 3NZ1A 1UR3M 4J3VA 3RG6A 1PZ3A 2CLOA 1LUCA 2OT1A 5A6SA 1SJDA 5EPDA 4XIMA 1HJVA 4A6GA 4LBUA 3O06A 4NUWA 4DVOA 2EG7A 4E2OA 5FF2A 3Q4DA 3C56A 1H4PA 2YYTA 5JQ9A 1R3RA 3KRBA 1M68A 1L9WA 4PRWA 2BBFA 1KTBA 2WB5A 4KGJA 5D9OA 3F4WA 4WF7A 4H6QA 4LY4A 4QJ5B 1XBXA 4ZMGA 4MSSA 3R2GA 4KPLA 1XHGA 4PE8A 1EX5A 1FTXA 2B7PA 2PLCA 4JTFA 1XV8A 2CLKA 1ZJIA 3B9DA 4NAEB 5F4WA 4EAYA 4GNKB 4GE8A 3P5ZA 3L2MA 3TC6A 3W1LA 3RU6A 1OFDA 1KRCC 1JNEA 4DNHA 4XSMA 2ZE3A 3S3GA 2J13A 2DFAA 3KM8A 4GRSA 4GOAA 4UTLA 4JAWA 5LGZA 5AHEA 4E3VA 3AHYA 4BFAA 4BEUA 1W54A 1BKSA 5E0CA 2GLKA 3T55A 5E09A 4PODA 2ACQA 3TW9A 2FB2A 3RM8A 3TYCA 4CN4A 4IXXA 1AJZA 5A6BD 1NWSA 3TK7A 4I90A 3UZWA 1ZPTA 2Z1SA 2FZ8A 1ZLPA 3G1AA 3SRFA 3S2MA 3LTSA 1YX1A 3QV9A 1FWDC 3DUGA 3VIGA 2OMAA 4UQEA 1TJ0A 1LLZA 2HTMA 4CCCA 3JW7A 5KZEA 4MKNA 4UC5A 1VYPX 4GZ7A 2WPGA 1DWHM 4EAMA 3JS3A 1I75A 1XRTA 3LCGA 1S2VA 4JIEA 3MUZ1 4BQ5A 5CPQA 3CV7A 1US3A 1Q6FA 5HAOA 1J01A 3RYSA 4KFPA 3O1NA 4S3BA 5E6YA 3ZVHA 4G5DA 1TWZA 2E9MA 4I7VA 1OG0A 4U5KA 1OC6A 4GYPA 1WKFA 1KM1A 5HNUA 1F7BA 3WH7A 1I1WA 3USZA 3W28A 4BKNA 4L4MA 3KDNA 4MNMA 2XVGA 4CNPA 5C7VA 1TR9A 5HOSA 4H3DA 2I1OA 4AFYA 1D3GA 3AYVA 1WBHA 1M7JA 4Z2GA 3W75A 3TMLA 4BJHA 4NVTA 5JMUA 2PF0A 4H6RA 3KBVA 1GW1A 2J77A 4LUIA 4ZZ9A 3LGDA 3WD2A 2H90A 2WJFA 2XISA 4MYAA 1GPFA 1AQHA 2Y89A 4I9JA 4V28A 5CSSA 1KA9F 1UMLA 1I6NA 2ZIDA 3MUAA 5BRBA 1GYLA 2QT3A 3TA9A 1GJUA 3SCOA 5FKYA 2KX9A 2RDWA 4HHMA 1E4IA 1AVAA 3BZJA 4GINA 4AF0A 2FZMA 3GHTA 1UC4A 6TAAA 2HE5A 3EDKA 1NP0A 3OJGA 3ANYA 2VD8A 4J2PA 4ZE5A 4QSHA 4CU8A 5IRPA 3W2NA 4G7EB 2ALRA 2VUNA 3DIPA 3SDOA 3W86A 1HP5A 1RBOB 2V2DA 3W88A 2BTMA 3PZNA 4PUNA 4RDVA 3CB8A 1IEQA 4DJEC 2P8CA 2O7QA 4QGCA 3V4BA 3SUVA 5BOEA 3RR1A 4JFTA 4ZXOA 3S42A 4L1WA 4XZHA 3H7RA 4L6DA 4AYSA 4HA3A 1ICQA 5CG0A 1O60A 3OG2A 1JAKA 4DNMA 1F6YA 4QBXA 4YLWA 4HU0A 4F66A 4KKXA 3P2VA 3GO2A 2XGIA 2QZRA 1DYSA 1W5MA 2VQTA 3PTDA 1LL6A 2VENA 1Q45A 5TD4A 1E73M 2R14A 1OVDA 4FA3A 4Z2KA 4JIRA 1Y5VA 4Z1DA 4HTBA 4IH3A 3RN6A 4AUBA 2QDHA 3BLDA 1BLIA 1JI2A 2BY1A 1E43A 1I1XA 3LDVA 5HULA 1YW1A 3H22A 5D2YA 5AYZA 4Q22A 3B4UA 3P6LA 4KF1A 4GD0A 1W0MA 4OHQA 1E51A 4YCOA 3IGUA 3NPWA 2VHLA 3QM3A 1GOKA 4QLLA 4UBPC 1Z42A 2XVPA 2YZ5A 3NM3A 1G7VA 3B8IA 4GABA 4NXKA 1RHCA 3DH7A 2EQDA 1ZJHA 4DBEA 4PEKA 5CC7A 1OCBA 2IS7A 2PD5A 1QFEA 3MMDA 4PCNA 1S38A 1V3JA 3G1RA 4MUPA 4B3KA 3OW1A 1PKNA 1R2RA 4YS1A 3AHZA 3N6HA 4FHAA 1EL3A 1GWJA 5GJPA 3SRDA 4R85A 1AODA 3MUCA 4HOZA 5A3HA 1XH0A 4EWJA 4XUYA 4XB3A 1A5BA 4CD6A 4HQVA 1BXCA 3W74A 2DZXA 1GVFA 3CU2A 3N9KA 4QAWA 1CGWA 4AZ7A 5HJYA 1IWBA 2Y70A 4DUVA 1Q6GA 4QDWA 1U22A 5J5RA 1OF8A 3U0HA 4P61A 3FXYA 5CEWA 3WNPA 1OC5A 3HU7A 1TO3A 2BVDA 3IIPA 3GDLA 3UR8A 5CZTA 3FOKA 3MKVA 2PBOA 2ZICA 5AFDA 2Y1HA 3QBUA 4GNVA 5LIWX 3WMLA 5G2IA 4LANA 1UIOA 1P43A 2E6YA 5A1AA 1DHPA 1PWMA 2ZZ5A 5JH1A 2OX1A 5LHEA 3QHOA 2Z25A 4LC8A 1A50A 4DB7A 2ISDA 1GOIA 3GS6A 4DLFA 4X3ZA 3RCNA 3BSHA 3GIPA 1MDRA 8CGTA 1W9XA 4AX7A 3UJ2A 2IPJA 2QAFA 2P53A 4WY0B 1YQ2A 2UBPC 1KFWA 4IUGA 4IP5A 3L5LA 4DI8A 2HEJA 1QW8A 5GPRA 2Y85A 4O16A 4REQA 3G8RA 2HK0A 2WV8A 3O6DA 4F0SA 1IQ8A 1UD4A 4FALA 2NLIA 3GDRA 1FWWA 3KCJA 3VYLA 3QW3A 1HXJA 3MDWA 2WAGA 2YJQA 3FCPA 4CGTA 4MZ1A 2E67A 3IGXA 2JGQA 4LVFA 5HPCA 4MJ2A 3GDKA 2FZBA 4KFOA 3WLQA 3CUGA 1E56A 1OFOA 1GQLA 4GO8A 4WKFA 3CH9A 2MNRA 1KLZA 1X8CA 5BOOA 1MFVA 4E2VA 2D2GA 1TZZA 3TN4A 3WNNA 1SJBA 1WP6A 3PR2A 1X98A 3NQFA 5F1UA 1G94A 2WO5A 1WAUA 1WDSA 3EMCA 5HDRA 5DXXA 1OM0A 3R8RA 3URAA 2Z1VA 3Q58A 2PTXA 5I3IA 1IZKA 3VFLA 4GGBA 3E96A 3QC0A 2D2JA 3T09A 5TQLA 4WXZA 1UD2A 3MDUA 1FFRA 3MV11 4RZBA 6TIMA 3TOPA 2DH2A 4WQ6A 3T0DA 3W7OA 2DZUA 1TVPA 3WLHA 3GZ3A 2XSBA 3N4EA 1FWEC 4B2DA 1Z6KA 1V6UA 2ZZ4A 3EXTA 1VEOA 3V3WA 3GHUA 4JTGA 5IXEA 2Y6ZA 5I2UA 2C3ZA 3LS9A 3VU2A 1TCDA 4UTMA 3W6YA 3BL3A 4NY2A 8A3HA 2OU4A 4HZ7A 5LA2A 1ECEA 4Z17A 3KBNA 2XM1A 1TPWA 2UZ9A 2GGHA 2Y88A 4KEVA 5FJPA 4HA1A 4GI8A 3TNOA 5CKSA 2FQIA 3ZMRA 4CN6A 3N2BA 2PPGA 1XH2A 3LXBA 1V79A 4IJBA 1BXBA 4S3DA 3CUXA 1H3GA 1GCYA 5A8MA 3VZZA 1A0CA 2RH9A 1RY0A 1GVQA 5HNRA 5DEZA 4AX6A 2Z4GA 1OD0A 3OBKA 5AHFA 1L6YA 5F2GA 1ISXA 1FDJA 4TR9A 3NDYA 1J12A 1FWFC 3NZPA 1C8VA 1R7AA 3UPBA 2J75A 1JPHA 1FWTA 4BI6A 4ORMA 4QE5A 5FJOA 3WFAA 4KCUA 4UR8A 3W70A 3ITGA 5K3VA 4V15A 1Z7AA 3UA3A 4GYFA 3W1QA 4Z42C 1KGWA 3TTQA 2VCCA 3VNIA 4H41A 3UJRA 3TWBA 3TN5A 3KUMA 4RPPA 5AVNA 2RAGA 1NDYA 2HE8A 2VGBA 3S2JA 4Q4PA 1U5VA 4JTSA 4RR4A 4FNQA 4H7ZA 1XKYA 2QYGA 3KVLA 1AA1B 1FVPA 4G56A 4IIFA 4M6UA 1KC7A 2XH7A 3P60A 3INPA 4AYGA 5IBXC 3MUIA 4NP7A 2OOFA 1CXFA 3CV1A 4EPKA 3JUGA 4NSBA 4PMUA 4DYJA 1W9UA 2R1NA 2NT1A 4BY3A 3DHUA 2BHYA 2A79A 4GUJA 4MIMA 1JD7A 3ARXA 3FYPA 1I2NA 3AYSA 4O13A 1E1FA 4DPPA 4HHPA 3GD6A 1L2UA 1S1PA 1P0BA 2Y62A 2YB1A 5A6MA 1OD8A 5XINA 2J7GA 3W3OA 4A3QA 3APGA 3TCEA 4CUCA 4DXVA 4FZIA 1P1XA 4GY7A 3LZ5A 4L4PA 3VXGA 4F40A 2WZEA 3VGHA 4PZVA 5CLTA 4ZSTA 2E5BA 2X0SA 2HROA 2WMJA 5DN1A 2WMHA 1E9IA 3U6WA 4F0LA 1UWQA 2DT2A 1V6XA 2I57A 3MO7A 3SCVA 3UG4A 1W5OA 2O9TA 2FB3A 3HFYA 3PTQA 3F2CA 4GHRA 1YBQB 3VIFA 7REQA 3LMZA 3QV7A 1OINA 1DJHA 4W8AA 3GFZA 1HNYA 2X0HA 4UZUA 4JY9A 1S5TA 3MHGA 4QHRA 4UR7A 1P0DA 3KOWA 2Q3OA 4BK9A 3LGGA 1XH1A 4S3AA 3Q37A 4U4MA 3THAA 1D3CA 3FS2A 1B3WA 3B06A 4CVUA 5LA1A 4BI5A 5KITA 3WNLA 1LLWA 1KBJA 5D8ZA 2JE8A 4LUJA 4NRSA 1TQJA 3LD5A 4PMDA 1ZJAA 3R13A 3OYZA 1XPYA 1VPXA 3RDKA 4KEUA 1W1PA 1V03A 3IV3A 1G9HA 4LU0A 1OK4A 3H2EA 4PSRA 5CJ5A 4UTWC 1KM5A 3LTYA 2ZBTA 1V3MA 1KR1A 1U1HA 1VCGA 2Z1WA 2RDUA 4MY1A 3BQ6A 3BANA 2OWCA 4XD4A 1DWJM 4WJ8A 4UFLA 1GPWA 2ACRA 2ZRYA 3TYUA 1Q6OA 5EL1A 3CEPA 3RLVA 1TIMA 3BMXA 4YPJA 4ZTXA 2QMKA 3K13A 3TXZA 4N9EA 4U33A 4W7WA 4ALDA 3VNYA 4ICCX 5DT7A 1B5TA 1E40A 1C93A 1GZ1A 2YCLB 1J79A 3UXKA 2WSYA 2Q01A 4GG9A 2GUUA 1JXJA 3AHVA 3M7WA 3W7CA 1XLMA 4X0NA 3S9YA 1ITXA 4QJ3B 3TSDA 2Y7EA 2V9DA 3PY2A 4YHGA 2ANUA 1IXNA 1W3NA 2OYKA 5D09A 2G3IA 1CWYA 1QATA 4JTQA 4E5TA 2XIOA 3RAOA 1A49A 3GNXA 5KMYA 4M6PA 4Z0SA 3F2DA 4S3EA 5LKYA 5CPLA 1L8PA 2C1IA 1K1DA 3N1AA 4D6GA 3TFXA 3G0UA 3IJ8A 1KFEA 4U2YA 3NSMA 1MNZA 1EJRC 2X30A 4A2SA 4US5A 4H9ZA 2VJXA 4IX2A 2A3HA 1EF2A 3G5EA 4H4IA 2LLEA 3DHDA 3SCRA 1BQCA 1RUSA 2XH4A 1TPB1 1PX4A 4WD0A 4XD5A 3H55A 1B3YA 4JTKA 4R88A 3W7IA 3DU0A 4X9YA 4O12A 3EDEA 3GXMA 4Z0JA 2ZA3A 1CLVA 2V2HA 3L7RA 4LX4A 3V5OA 4AY8A 3W07A 1RBLA 2FVLA 3DN5A 4LAZA 2XH0A 4DUXA 3W37A 3ZSSA 3G1YA 3W1XA 2I16A 4UMBA 1V6WA 1F3EA 3SY1A 5E6ZA 2DW7A 3BMWA 2QNEA 2WC3A 4H6EA 1RQHA 2EPOA 2IXUA 3L4YA 3LPOA 4E4FA 4O4WA 2DUZA 3ATYA 4TV6A 2PBGA 4BZYA 5D02A 2V6AA 4MVAA 3HGOA 4OFCA 4Q8NA 2XPKA 5JIPA 3DYMA 1A5OC 3C2RA 4C6DA 1OX4A 1A3HA 2WWDA 3QYSA 4YNGA 4J27A 6REQB 2BVYA 4DF1A 4W88A 4V27A 4ZA0A 1QPOA 4B3LA 1MEIA 2GJLA 4W8BA 3HQPA 5LSMA 3CNYA 3TC7A 3OVQA 1TWSA 3W7LA 3OQ8A 3WUGA 3TMQA 1E4MM 5GVJA 3OZOA 3M0MA 1B54A 5DBUA 3NDOA 3T7VA 2EXOA 3VK5A 3AJXA 3UEQA 2ZCGA 2ATSA 3E0WA 4KWVA 3EOOA 2GGJA 3GLCA 3M0YA 2FPVA 1POKA 3REQB 2NWSA 2YL8A 3WH5A 3SSJA 2Z7KA 3PWIA 5FIPA 1H60A 2YL6A 1AQFA 2I9UA 2PP3A 3T44A 2WVUA 3EB3A 4C60A 3B9OA 2VX5A 2W63A 3I6RA 3GSMA 4XZLX 2BHUA 2IXVA 3WMBA 2B31A 1FUYA 2PGFA 3VKCA 1PVNA 3UETA 2RKXA 3UA4A 4NX0A 4PB3A 1F3WA 1V51A 3L5MA 1Z44A 3M46A 3ATZA 1VENA 4G7FA 2QUVA 1MRAA 2OKTA 1GQIA 3L5AA 3EDJA 4Q8PA 2ZOXA 5EU9A 2GUYA 3RIKA 1WX0A 3FEQA 1C91A 2FTYA 1QMLA 1RY8A 4O28A 1KWKA 2ZQ0A 4X63A 2Z7GA 3LCIA 4AG0A 1LZOA 3ERPA 3H24A 4LF2A 2XN1A 3MB9A 3WQ4A 1H7OA 1CXIA 5BW6A 4QFUA 2D0HA 3GBEA 3KRZA 1BXNA 3CQIA 7TIMA 3F4DA 4QCEA 1W1YA 3GC5A 4U5IA 1JNDA 5D4YA 1K4HA 4QQUA 4D8AA 3VAVA 3I3DA 5T9CE 4HN4A 4MY9A 4HHHA 4UFIA 3T4CA 3QW4B 1IZCA 3TCSA 3IUDA 9CGTA 4W93A 2PP1A 2EG8A 1REQA 2PLMA 1JUBA 3AZRA 5REQA 3WNMA 1PZ2A 2BGQA 3MANA 3PPCA 1UIPA 4MLRA 2ZC1A 2Z1BA 4LBSA 1KW1A 2I56A 2WPBA 1W5QA 1CNVA 1SZNA 3AYTA 3NQGA 1H49A 1BWLA 1E6SM 4JEQA 3LA4A 5MKGA 2CLEA 1YPFA 3TQPA 3W7MA 2ZZ1A 1T40A 3DG3A 4PTXA 4C7GA 4WIWA 4H04A 3PPGA 4IGHA 4AZ6A 5HNTA 1KM6A 4NAFB 1XIHA 3WH8A 1WA3A 1E1CB 3DDMA 2QCMA 3S5NA 5AZ1A 3TN6A 1J2BA 3EXRA 1D7KA 2ZX7A 1IV8A 4C6MA 1I2RA 4CU6A 1QHPA 4LJ3A 1L8NA 3W7EA 1AQMA 3BLEA 3MY9A 1T7LA 3V75A 3BJSA 3PPHA 3MZNA 4QS6A 4RZ5A 4MB1A 4O53A 5D33A 1TA3A 4H8NA 4GQ0A 4R7JA 1TTPA 2CIPA 3DCPA 4DJFC 4QEHA 3V0TA 3MTWA 6ALDA 2WMFA 3MI3A 4LVGA 4IISA 1UPPA 5XIMA 2VYOA 3ARUA 1Q8JA 3P8JA 1UWRA 4PMRA 5JH2A 2FH8A 3I68A 3M0LA 4FK9A 3YPIA 2FVMA 4G8TA 3TOYA 4H8UA 3W00A 4IGNA 1VIWA 2MUCA 1KXHA 1LF1A 4K36A 4B90A 1EUNA 5LZLA 5C0QA 2XIIA 4Z2HA 1A47A 3OHMB 1O5QA 2D3NA 3E2VA 3VNLA 1GVYA 1OWQA 3GTFA 2VCAA 1Y5XA 1VRXA 3UJFA 4ERIA 1NM9A 4H19A 3LHUA 1EZWA 4UCGA 4UTTA 2R9RA 4F9JA 3HQ1A 3QR1A 3TYAA 2O56A 2C91A 2ONEA 4BF7A 1YIXA 1WKYA 3MCMA 3L65A 2BZNA 1V02E 2QUMA 2WZTA 4RZ4A 2CZVA 4B92A 1KB3A 1XW8A 4HNVA 5A69A 1X39A 3VVGA 3GUGA 3WQPA 1A4LA 3O15A 2ZVIA 1XLHA 4OE7A 4WGHA 3BO9A 3SM0A 4OU1A 1FH8A 1Q13A 2PWUA 4PRTA 1YKWA 1IXPA 2CNCA 3VABA 4Q3MA 2VMFA 4YTQA 3M9YA 1I60A 2F84A 4QAIA 4O1AA 4C6EA 1CYGA 3M16A 2DJXA 4S2CA 1PS9A 3QSTA 4Z08A 3MO4A 4WJEA 4MHBA 2QCCA 3OOQA 3WK1A 3GXTA 3QTGA 4FOUA 1GZGA 3AQUA 3UXDA 4NHVA 3M6YA 4C6LA 4FF5A 4MWAA 3P8IA 2NUXA 2X2GA 1MFUA 3QOMA 3TKFA 2ZX9A 1X6LA 3PG9A 2PWHA 4LT9A 3GH4A 1Z89A 4CD7A 1EO7A 1QW9A 2Z26A 3GZAA 2IQTA 3CHVA 5HQEA 4PBFA 1LDCA 2WNNA 1JQXA 2VOMA 3NPXA 3ZLGA 1AMYA 1XUZA 3KVKA 1HUVA 3PAOA 4AD1A 1TPEA 1BWKA 1XLLA 1QPRA 1G1YA 4Y90A 1HO1A 1OGBA 3L68A 4M51A 4FX7A 1M41A 1MUMA 3N14A 3V16A 3UWUA 2TRSA 4HNOA 4R34A 4WSHA 3P67A 4D6IA 1YEYA 3A4XA 3GYCA 4CD8A 3RM9A 1VJIA 3HFTA 3FIGA 1J0JA 1EFZA 1OIMA 5IDZA 3G6LA 2PDBA 1YNQA 2OEJA 1EJ7L 3LPFA 4B5TA 2GQ3A 3FA3A 4YN5A 3PN8A 2W0UA 3SEPA 4B2DD 1VFFA 1K6WA 3I65A 3WLOA 2VEPA 4ADSA 1R0MA 5FF7A 3UJEA 3OYXA 3GR4A 1TRIA 4D72A 1YRRA 3O6YX 4CQ9A 1EDGA 4DXKA 1YDOA 4GVIA 1KLYA 2DEPA 2W79A 2PS2A 3CIWA 3OU8A 5JUVA 4F79A 3SFKA 1XD1A 1O95A 2HV5A 2YFOA 4XKYA 3A21A 3LV5A 4Y8EA 3QQ1A 4M6VA 4IFOA 3UXLA 2J4GA 4X9SA 3QJAA 3PZTA 1KRMA 2HJPA 3N3MA 3FY1A 5G2HA 2CBJA 5CC6A 4PCTA 2QAPA 5FJUA 3ME3A 3P62A 4W7VA 4JIQA 3STCA 4HCDA 1Q2RA 3CC1A 4NRRA 4D1IA 4BQ4A 2IQ0A 5FD0A 1E71M 2QCNA 3EX2A 1UH3A 4BR1A 2PTDA 1VFUA 1HVXA 2QJHA 3RF9A 5K4XA 4MF4A 1X8FA 4C7DA 5G5IA 2PTWA 4XZMX 4ZQOA 5HA7A 3TYBA 4LVAA 3BMVA 1YXYA 1SZRA 4KW2A 3OIHA 1UD6A 3D5HA 5MF5A 2J78A 3MSDA 3MCOA 1TUFA 4L4OA 4JN6A 4HYVA 1XS2A 1K03A 4LUYA 3RGTA 4G6CA 3V18A 3K2GA 4MJ4A 1XGDA 2BASA 1RA5A 1KCKA 4QG6A 4E38A 1WB0A 5U7SA 3URNA 1QRQA 3R8HA 5GNXA 2BMBA 2ACSA 2NX9A 2FHCA 4LCRA 1PCKA 1R3VA 3G1HA 1H41A 1HO4A 4P7QA 4XZNX 3GAKA 2CHRA 1L6FA 3GC2A 4XAZA 2B7NA 1PEZA 3PBMA 3QN3A 4OBSA 2IW0A 5E5CA 1PHQA 5FSEC 5FCZA 3M47A 3RR4A 3DXIA 2YA1A 4UNLA 1DJQA 2VEIA 4XTDA 2YBUA 3IIZA 4MPQA 1XIEA 3HZ3A 2VX7A 3T05A 1HL8A 3ABOA 3GR7A 3WUFA 3IJIA 3B3DA 4I5UA 3SADA 4MAZA 2P8BA 3GNNA 3NO5A 2GJRA 4DN1A 4NF7A 3KS5A 1GVEA 2F6KA 5AYIA 1EX1A 3LLFA 1WYIA 1JPKA 1PUDA 4JHOA 1QNPA 5LYRA 4XD6A 1ONWA 2GK1B 2JEQA 4H9YA 5K4ZA 4NYYA 3KWXA 2RFGA 2P10A 1A4MA 4J35A 4TVDA 3DC0A 4EXAA 2OLSA 2EKGA 1WDPA 1JCTA 2FGZA 4FS9A 2EG6A 1WZAA 1LBFA 1P7TA 2XWEA 1FXPA 1V93A 3ITYA 1DTNA 1NP2A 5J5DA 1QASA 3EX1A 3E02A 1LWJA 4NZFA 3GWQA 3LCHA 1ML1A 3S6OA 4DJDA 3DI1A 1ZENA 3M7SA 1G4TA 3BAIA 3N29A 3WDQA 3PJXA 3S1GA 2OTDA 1EXBA 5D9MA 1WE5A 4PRRA 1XIGA 3FGCA 1E70M 5I5RA 3AFBA 1AL8A 4UMAA 3LCFA 1M7PA 2Y4SA 4XK2A 4R3UA 4JTJA 1XQLA 4JQ4A 3W4RA 3I7QA 3MW7A 3H8AA 1OCNA 3O9NA 4JCLA 3CYJA 3TROA 2OFJA 2V5LA 3FLUA 1XLJA 4FLRA 4QNWA 1GHRA 2DUXA 3WSUA 3CXOA 4CN1A 1JZ3A 2VT0A 3R0KA 4AD3A 3M5XA 1AD4A 4GX9A 1BSIA 2XIJA 3MHUA 3W6MA 1ZY9A 1R9ZA 4PUJA 3UG8A 1W1ZA 3DHPA 3H4XA 1W56A 3AXMA 1D2KA 4K37A 3AISA 1AQ0A 3MJYA 3H4GA 2FDSA 4RNFA 4LRTA 5CZJA 4CQDA 3WF3A 2JK2A 3BSGA 4GPNA 4KESA 1A53A 5DFAA 3G6MA 1F3XA 3NQCA 1PIFA 4LGXA 4BF5A 1UASA 4B91A 2OCZA 1QBAA 4OTKA 2GGEA 3E9AA 2GVEA 2DW6A 5HR7A 4NZ1A 4F0RA 1P0NA 3NL2A 1TV7A 2Y0FA 2QR6A 4WGXA 4ZGYA 1VKFA 5LIYX 1ALDA 4HK6A 4GKTA 2X1RA 1IT8A 5KZMA 1VF8A 5AHNA 5F2IA 5F2LA 4LNCA 4MNJA 1NF7A 1M7XA 3BTNA 4XVDA 2JALA 1YNYA 3PTKA 3DFHA 1V8EA 4NX5A 4RX0A 2EHHA 3QLLA 3HO8A 1JFXA 2X8RA 3V1HA 1UWIA 3LCWA 3T2PA 3HOJA 4LB4A 1VFTA 3AZSA 5BWFA 1QK2A 1J11A 3WMSA 1TPDA 5A6JA 2H9AA 3VC6A 4QE4A 1VHNA 3SGGA 3DFSA 5EMJA 3ZT5A 2YZRA 1DIKA 3FAWA 1UOKA 4OUIA 1DWIM 4US5D 4PMXA 2V38A 3HGRA 2WMIA 4ICNA 3WY1A 5TBOA 3NPUA 3LYEA 4FIRA 5HMSA 1AL7A 3ZJ8A 4ADUA 2ZUVA 4N2YA 3C3UA 3M0KA 1SW7A 5LHFA 2BV9A 4NJHA 4ATDA 3ABZA 2CERA 4WDUA 1DIDA 1M9HA 1EBGA 2OZ0A 3N13A 3N2OA 4YTRA 1NOUA 1QNQA 3TYDA 4FX8A 2DP3A 7REQB 1NQ6A 5K9XA 3P84A 1O7AA 1HKWA 3AMGA 4GA8A 3VCCA 2Z1XA 2ZRZA 1W91A 2FJKA 4B9YA 5M5DA 2D22A 5LNVA 1TIWA 4MJZA 3TW7A 3QSRA 3GW0A 2CLPA 4Y2WA 3IUHA 4OBRA 4ZB0A 1SZGA 1GKPA 1OX5A 1E0WA 3TAOA 4YVVA 3KWSA 2QV4A 1SSDA 3VOHA 3W85A 1JZ6A 2X16A 2E6FA 2ODOA 4FXSA 3DYOA 2FDMA 1LL7A 4P7OA 1QO2A 1NF0A 3EMQA 4M29A 1K02A 3ENLA 3NO3A 1JI1A 4C6KA 2Y8UA 1ZTVA 1HZYA 1WZMA 2J8TA 3WFZA 4L5ZA 3LBOA 4JTTA 3TA6A 4PMOA 1DTUA 1BGGA 4XUGA 1JZ4A 3OO2A 3T42A 1EDTA 2J9YA 2E5DA 4HK5A 3AIBA 5EY5A 2NXHA 1LOSA 1WQ5A 5AC4A 1E5NA 3V0UA 2VR2A 3B9NA 2UY2A 2G37A 5I02A 4RKAA 2ZE0A 2QCGA 3QC3A 3GG1A 1YE4A 4IJCA 3KXQA 3R0DA 5H8UA 1HKIA 1I2QA 1UA7A 3LLXA 5CGMA 1K9FA 2CHNA 4H9VA 1GEHA 3CUZA 3WK3A 4J2MA 2PRMA 2AQWA 5GQBA 5BWAA 3E49A 2O9RA 3APYA 3LMYA 1XUUA 2WMKA 3D6NA 1X7IA 4M0XA 2ZRXA 1FWRA 1Z69A 2QJJA 3O2LA 4D71A 4GFIA 4P2VA 4AWEA 4HSNA 1J8VA 2NV2A 1BF2A 1A80A 1S1RA 4UB9A 1TMQA 1UP2A 1XLKA 2RJHA 1X1NA 2RGMA 3NSXA 3SW6A 3T4WA 3SBFA 2INEA 2OOGA 2BY3A 3B0VC 5I3JA 3QEZA 5AHLA 5BXPA 3A3XA 1EHAA 3MMTA 4I7UA 4IOTA 2HBVA 4C90A 3NDZA 4PMQA 3ZXWA 2NX3A 5DMNA 3MZ2A 1W8GA 3AJ7A 3SN1A 3B05A 1PDYA 3ZLFA 4GLEA 1OYCA 2ADAA 2TPSA 1VBGA 1R30A 4NYUA 2F38A 3T8QA 2TYSA 4JR5A 1QI2A 3T78A 3HA1A 1OB0A 3L4XA 1YTDA 2YCEA 1VEPA 3R7MA 1Q3NA 3W27A 4ZR8A 1S46A 4IICA 1MRQA 3RO8A 4ZO8A 1H63A 2G8ZA 1SZFA 4TIMA 2JF7A 4J3WA 5G2WA 3C4UA 5DELA 1DQWA 2YKKA 2QXWA 4MB4A 7TAAA 3PBUA 3IEBA 3P80A 4HMEA 3GIYA 3WLKX 3FHQA 2AKZA 3GG8A 5H1WA 3TC3A 5AHIA 5EFFA 4XBKA 3PWGA 4HP5A 5D38A 3QKEA 2VEGA 2AKMA 2NQZA 1FP9A 2IKIA 3EWXA 2G3MA 2H8XA 4KH2A 1K8XA 1C90A 1J0KA 3T8LA 4DZHA 3FVDA 3LN3A 4Q4KA 2MANA 3G1FA 1EKOA 1NFBA 2P0OA 4W5ZA 3W02A 4Y9AA 1XIFA 1H7PA 3EB2A 3SN0A 1QK0A 2AGTA 1XICA 4RPQA 4FNRA 4GQQA 2AMGA 4K6AA 3WLIA 2BNJA 3UWQA 1VRDA 1RZMA 4LYRA 1OX4B 1EA9C 3V35A 3E2SA 1VP5A 2P5NA 2VTFA 4GQGA 4K1GA 3W7KA 3MCNA 1UR0A 4Q4OA 1W8SA 2PLJA 4DYKA 4D6HA 2YLAA 3F2BA 1JCNA 2PDMA 2UY4A 1KGXA 1UR8A 1UPMB 2A1YA 5M1TA 4AD2A 2WVVB 3BUVA 1JR1A 2OO6A 1HGWA 1NWRA 3VM7A 1LBLA 1P5BA 1DQXA 3EEZA 2X41A 4TMBA 4M80A 1D8WA 2DT1A 3AIVA 4AIOA 4HHLA 1V4YA 1GOXA 3AAMA 3E0LA 1V0NA 3WZ0E 1PE1A 1E3ZA 1BAGA 4KGLA 4AMAA 3CMGA 3H54A 3ZZ1A 3UJSA 1ISVA 2HDJA 3WK0A 1JF6A 3SFWA 1QWGA 3SAZA 4HOXA 2HCVA 4QITA 3LSBA 4CLMA 1BFNA 1P0KA 3N34A 5HWNA 3AIQA 3DI0A 3PZUA 1KO0A 4J5NA 5JBFA 3VOGA 3PB0A 4S2BA 4LUTA 1JDAA 4AVOA 3T0AA 1RSCA 3NOEA 4BQ3A 4Q8QA 1JYWA 3VDCA 4KWSA 3QOKA 2GOUA 1MW2A 3GXFA 3BICA 3PANA 2V5CA 1OT2A 3TIMA 2FZDA 4H83A 1UR2A 4GISA 2BXYA 3AXIA 2E8ZA 5KEZA 4GBDA 2QCEA 1DL3A 4ZO9A 1VYSX 1W3HA 1V3LA 2GGGA 5I6SA 1ONEA 3RPTA 5A6AA 2W66A 2A0NA 2WSPA 1EA0A 3WCZA 3CZGA 5DLCA 4HPHA 1RXOB 3IAQA 4YWIA 4JIIX 3VGDA 3PUEA 2QDDA 1P6WA 4Y7EA 3B40A 4Y9MA 4W86A 3W83A 3TWAA 3VOJA 1TPUA 3CS2A 2HNEA 3LHVA 3POCA 4H2HA 2DZBA 1FH7A 1FA2A 3N17A 4JX6A 1C9WA 2R82A 4LYPA 1VBRA 4ZFCA 1REQB 2KZHA 3OB8A 4US6A 1V3KA 5REQB 1UZ1A 4LPCA 1Q2SA 1H7XA 3FSUA 2NUYA 1ZP4A 4MWAD 3UZ5A 1WPCA 1L6WA 3AROA 3OGSA 1R3QA 4W7UA 1AH4A 3NR0A 2A4AA 3QGKC 4O0QA 4A3YA 4IMFA 4PTDA 3QKZA 3AIWA 3RU8X 4LUSB 4NZCA 2ZUMA 2WC4A 1SGJA 3PZ9A 3W53A 3KBSA 1T8XA 1G4EA 3XINA 2DZWA 1K6AA 2QV5A 2QDEA 3GTHA 2HRWA 5J8LA 4ACZA 3PFMA 2X1IA 3GG0A 2DZTA 2IKJA 1J93A 3VDAA 1KQYA 3TTSA 2WVTA 3EYPA 3NXLA 4JS3A 4PC8A 1HVQA 4XTIA 3GKAA 3GB6A 4WR3A 4M8UA 4HJFA 1JUEA 1EP3A 3W72A 3XIMA 3EKGA 3EA1A 1ZQ5A 2YDRA 1JULA 4UQ9A 4NZ5A 5LXEA 1EIBA 1KCLA 3A9BA 1OFAA 1Z9AA 5L6UA 1XYCA 4OWGA 4YVXA 4AMCA 1AJ2A 3W6LA 4XD3A 1UD5A 2R24A 2WSKA 2GDQA 1YXDA 2G95A 3UR7A 5FF4A 3H70A 1ZFJA 5A8OA 2QDGA 2OSWA 3UG3A 1RR2A 4C5ZA 1E4LA 3B8UA 4D6EA 1K3UA 2OO0A 1YE6A 4Q4SA 5CSRA 2PDGA 2JGYA 4C6FA 4LWWA 5FL0A 3G0XA 2RHGA 3N2CA 2ZZ3A 2E9LA 2WZHA 1F6PA 1R3SA 1JCXA 4DYEA 1XD0A 2POZA 3SUUA 2YA0A 2NVAA 1D7FA 5EMMA 2X7VA 4GFSA 4JQ1A 1GZJA 2GVGA 4OIFA 5KTLA 4DUOA 3OVPA 4JTCA 4KT2A 4LY8A 3DFYA 2V63A 3C2VA 1EIXA 3THQA 1FRBA 3FJ6A 1NAL1 1DJXA 3WQ6A 1UKSA 1I2PA 4Z2JA 4O8RA 3B8DA 2CBUA 4L4LA 3G0SA 1FCUA 2GVJA 2I5GA 3WQVA 5CSYA 3S5YA 2YB4A 1ODZA 4DPQA 1XYAA 2QEZA 4QG8A 1IT7A 2Y63A 3LV6A 4NZ4A 1TTJA 2OJPA 2BODX 2YCJA 3MHFA 5A94A 5KSWA 3WFLA 4I9TA 1H50A 1M03A 3CPRA 5BXRA 5CJMA 2E40A 1RAKA 3ARZA 4HNNA 1ZAHA 3TSBA 4S39A 1IT0A 4OGZA 3AMDA 3BSMA 3NA8A 1O94A 4JGDA 2ZUSA 1IHIA 2V3EA 2V8ZA 1RLDA 3BGAA 4AAJA 2VFDA 4MMWA 1KTCA 1VB9A 4AEOA 2ZC8A 1OX6A 5IFPA 4JNYA 1SFTA 3CWOX 5EBUA 3K30A 3BGJA 3GIQA 3H21A 3FA4A 2W4XA 5I24A 3MWAA 1U5JA 2PDFA 3I4EA 2XN0A 3W9ZA 3WLTA 1MWOA 1MNSA 1A5CA 3I7RA 4ZO7A 5LNSA 2DJLA 1W3IA 3CLMA 3ABXA 1RP8A 3SRKA 3EMZA 1E6QM 4TXEA 3S6TA 1LG1A 3WQCA 2EPLX 3N6QA 1NVMA 1JPIA 2X1TA 3LHYA 3BJFA 5FA5A 3IACA 4I8DA 1Q66A 3FK4A 3UY7A 4TV5A 3W7PA 1R8LA 3UZJA 2FHBA 5C6MA 4LW7A 3GNOA 2PU1A 3MI2A 3UY8A 1RJRA 3M0VA 1R87A 1W1IE 2IMRA 3WDHA 2VZOA 1W9PA 3PNUA 3NCOA 1W5PA 4P8XA 3TDFA 2YPIA 4A21A 5HWJA 4DJDD 4MADA 2GVYA 3WLJA 3AUOA 3ZYZA 3NQEA 1EYEA 5I7GA 5JIWA 1QAPA 3BW3A 1U1UA 1HFBA 1GNXA 7PTDA 1HJSA 3CZLA 4N7QA 4E0CA 3ZWSA 3ANUA 1W3KA 2YXOA 3C86A 1ADDA 5A6KA 3F7JA 4JNMA 2DVUA 4DWSA 3UPWA 3L4TA 1F05A 4MB3A 4Q8MA 5E0FA 4EXBA 2X0YA 1HL2A 2CZDA 3A4JA 3L2LA 4JIHA 1JPDX 2Z6IA 3C2OA 1XDMA 5I3DA 4EP8C 2CXGA 3VCNA 3BLPX 4EF8A 3M0ZA 2VZVA 2PDYA 2Y5JA 4OV9A 1OFQA 3M6DA 4ZB2A 2DZVA 4FNUA 1A5UA 1CZ1A 1DWFM 2EPKX 4L7ZA 3WDRA 1AMKA 4M19A 1TJ1A 1GTEA 2DSUA 3UWVA 1IEVA 3VD9A 4MAVA 1J5SA 2WKLA 1G7UA 1MQRA 3CPUA 2WJEA 3CQ0A 5DCBA 5GJNA 4IGMA 3EWDA 3DG7A 3W22A 3ANVA 3W1NA 1UCWA 1WV2A 3VFCA 1JEZA 1ZZMA 4N02A 2XFRA 1IXQA 4NAEA 1TFVA 4L64A 4HB7A 1ZSXA 3WUBA 3NGJA 1EJXC 2R8WA 2FGBA 4I5XA 1F74A 4PB5A 3N4FA 7ENLA 3R6IA 3GVQA 3IIVA 3SCSA 2C79A 2PGEA 1TV5A 1NDWA 1R38A 1JG9A 1QTWA 3NEHA 2HPIA 2FFIA 4LF1A 3OZYA 3PC0A 3KW3A 4NILA 1QPQA 2CHOA 4H01A 1ADOA 1NWUA 1OEPA 3MBFA 4AEEA 2DUAA 2WC7A 1H7WA 4IG2B 1WUEA 2I5IA 4AH7A 1JRCA 2A6LA 2PCEA 3JRKA 3HPZA 2BGNE 2E7FA 2W6RA 4FNTA 3GW3A 2ZDSA 5FOOA 5U4NA 3NQ8A 4JX5A 3VKKA 1E4NA 3S1XA 3NXFA 2HQAA 1TE6A 1DWGM 5A2CA 2OWWA 2YYUA 2ALDA 5CH9A 3SUWA 2PE4A 2Z2AA 5CGQA 2R1LA 4A3UA 3B0UX 2CWNA 1JJKA 1TE1A 1QOXA 4H8VA 4UQAA 1QOPA 3G77A 2DGAA 4NL1A 3KL5A 3OA5A 4B5SA 1XF0A 2PDNA 2WHJA 3CZKA 4WLCA 5TAOA 1CDGA 1TQXA 4RK8A 4B9ZA 3CHDA 2GJPA 3GDMA 1JDCA 1CEOA 4AHOA 4Z2LA 4FXFA 1UROA 1XYMA 1S5WA 3KP1A 1N7KA 3FXGA 1ZNNA 4ERGA 4GUIA 4GH1A 1E3XA 3UERA 2OYMA 3GXPA 4AZGA 1AZ2A 3WF2A 4LV4A 3MPGA 2NVDA 1WAWA 2O4QA 4HPNA 1F4AA 2A3BA 1VFMA 4CNSA 2NWRA 3AO0A 3GH5A 4JTAA 4QR6A 3QR3A 3ARWA 2O4MA 4O50A 3W2MA 2QGYA 3CQJA 1VFHA 4HPXA 1EDQA 2VNCA 5HUPA 3EWUA 2JQXA 1QNSA 5CXPA 2WK2A 3VX0A 4AZBA 4G7EA 1OCQA 4QEEA 1TSIA 3K5XA 3G18A 4FIQA 1ZGDA 4F2BA 1P0EA 3DFPA 1L6GA 3VD5A 3A12A 2ZRUA 4O1FA 4O4VA 2ATMA 3FDKA 2ZXAA 4GUFA 1LLOA 1SJAA 5CSUA 3UQNA 4F3HA 3EDDA 3M64A 1XGEA 2XSAA 4GI6A 5D2VA 3TQKA 1ZAIA 2CKSA 1XISA 1KCXA 4CD5A 4HU8A 4M82A 3UZZA 4H9MA 1FP8A 4WUIA 4GXPA 4HU4A 4HIBA 4Z2IA 3KZSA 4JYFA 1XIIA 4KQNA 4HNTA 3KZPA 4YCPA 3WJYA 3GU9A 4A05A 3IRDA 3V36A 1F2JA 3E38A 3BLLA 3QMRA 3PPFA 5FEXA 1TJRA 3I3BA 1BQGA 1XYZA 5DF0A 1H2JA 1H1ZA 3C2EA 4GACA 6XIMA 1O5RA 1N8IA 1EWDA 2H9AB 4TTUA 1VHCA 1PSCA 3GH7A 1EC7A 3VNDA 2GPTA 4L61A 5DQPA 3RJYA 4F2UA 4KWUA 1XLDA 1XCFA 4ILSA 3WQFA 2O7SA 3DFQA 3CAVA 3MBDA 3WH9A 2XVKA 3CMJA 3IRSA 1C92A 3VPLA 3GNDA 3HGSA 1GG1A 1BPLB 1AW2A 1RD6A 3AXKA 2VURA 1MW3A 2E8YA 2G50A 4GC3A 1EGMA 1LWHA 2OGYA 3TV8A 1ZCCA 3QPYA 4DAFA 1F5ZA 5EKYA 2VCBA 3M43A 4MGGA 2BLEA 3GE7A 2FTPA 1CGXA 2AL2B 2Z29A 1R85A 3W7JA 3FYYA 3KRUA 4GWEA 3CJPA 3AU6A 4WHBA 2VD9A 4JEJA 3UYCA 5A6LA 2REQB 3CAKA 4JQ2A 3GX9A 2EO7A 5HANA 1JQVA 2A2IA 2E1DA 3WDIA 4D1JA 1HKVA 1XINA 4BWLC 4Y9OA 3AICA 1UR9A 3VUPA 4L1GA 3L66A 3H2OA 2YW4A 3WDPP 5FEWA 1R2TA 2D23A 3HG4A 2WKJA 1JCLA 5IOBA 2YX0A 1VAHA 2WLZA 1J6OA 1AFSA 4NZJA 4E2DA 1KFLA 3AYRA 1ME9A 1XCXA 4OQVA 1DJIA 4JOMA 1UP0A 2Y5EA 3IV8A 1IWPA 3O6CA 4WY0A 3M1ZA 3TZNA 3IGHX 3F4VA 1W2PA 3DGRA 1OT1A 3S47A 4PCPA 1US0A 3W71A 1I0DA 4GJJA 1GVSA 1TTIA 5KETA 1AUSL 2GSJA 1EBHA 1KD0A 5DMLA 1MDLA 3UG5A 3THDA 3UGRA 4MKSA 3GUWA 2VP8A 4TO8A 1XI3A 3B8TA 1XSIA 3USBA 1KBIA 2J27A 2DPEA 1KCZA 1B3XA 1NSJA 1HTIA 1DJNA 4OKDA 4XQ6A 3DFNA 2PC4A 4MTVA 3J7HA 4LFYA 4FOJA 2WSRA 4RE2A 3DG6A 3HJEA 3LBCA 4AZIA 5PTDA 3GU2A 3FDGA 2VFIA 1XQKA 2PI6A 4TVCA 2J7EA 2O9PA 4ECLA 1DEDA 3B03A 3EA3A 4HPGA 3UR5A 1YMYA 3GRIA 4O10A 3SQLA 1U30A 3IIOA 4S3FA 3W7DA 2R91A 3U4AA 3SO7A 2Q6ZA 3IWPA 4HD5A 1BG9A 3WD1A 2ABBA 3MT1A 1UJPA 1R5YA 2ZDRA 1QR7A 2Q02A 2J9XA 2C15A 3E1F1 3VMOA 1S5VA 4XVEA 1S2WA 4UTHA 4IL0A 2P0IA 2B7OA 1NARA 4N42A 3P74A 4NIRA 1S3TC 3BG3A 3GG7A 1H11A 1Q85A 1CXKA 3MUXA 3TLQA 2GDVA 4UTFA 2ZTJA 3H12A 3LK6A 4AIEA 2AL1A 3E6EA 3PUOA 2RDXA 2YGYA 4QLJA 2NLYA 3RILA 3A13A 3STEA 3IANA 3BXWA 5T8GA 5CBJA 1AK5A 4R9XA 5ABEA 2J7DA 1L2QA 4AB4A 1NELA 1RK6A 5ENLA 2E28A 3BARA 2XSXA 4O8AA 5A8GA 4IMDA 1S39A 1WBJA 2GL5A 4YVPA 3ZO9A 5A2AA 4RDZA 1XLGA 4RXGA 4DO6A 3KS6A 2IUZA 3K8KA 2A7RA 2VL4A 4DZIA 3FHAA 3N4AA 3OTRA 3L0KA 3QRHA 3BAJA 3RX3A 5BZAA 1PJ9A 2VWTA 2PDLA 5D37A 3EWCA 4GYPC 4XIAA 3POHA 3T08A 3GM8A 4JYDA 2J6VA 3VMNA 4MFDA 3FX4A 4HZ8A 3KFTA 1RD5A 4X0VA 4XAYA 2WSQA 2DORA 1SZEA 4AZCA 4IJRA 3LRLA 4UUIA 3RLGA 3UCQA 2D1ZA 3L2IA 2D73A 1DIEA 3JVAA 1OFEA 4HU3A 4R5EA 3W7RA 5LGXA 4D8LA 3UWWA 3R58A 3E2QA 2FIQA 3QYQA 3NNTA 1JCMP 4K8HA 2TMDA 1U83A 4QDPA 3A3HA 1A5NC 1A5MC 1K7FA 3S2LA 4XWUA 2F61A 4P5UA 2QUTA 4LEFA 1XDJA 3UCDA 3UPMA 2YIHA 4DX3A 1MYRA 1JGIA 3R1ZA 2AMXA 1KXTA 4TX8A 5BU9A 5C2GA 4X61A 2XIQA 1FBAA 4U2ZA 5T9BG 1IF2A 2XWDA 3QLDA 2WZIA 1NIUA 1H5VA 4WXYA 1LP6A 4Q4MA 1UW9A 5CLWA 6PTDA 1YTEA 3AIRA 1XL9A 3N15A 5BNKA 1S2TA 1UHVA 3WDJA 4QJ4B 2WQPA 1FY6A 1TMHA 8TIMA 3DZ1A 5K2ZA 1OSEA 2FMOA 3PZOA 2NQJA 3CM4A 4WSJA 4S1FA 1WO2A 1SPQA 4NXSA 2ZA2A 2DZSA 4AIUA 4GCXA 1A5LC 4DY1A 4JBRA 2ZVRA 1RCXB 2BP1A 2C8NA 4ROQA 4UCFA 1RK5A 2VM8A 3VX1A 1NWTA 3W84A 3ALFA 1A5SA 1QDSA 3WQ8A 5C7HA 3M5VA 1JAEA 4CQAA 4GC4A 2CLIA 3A23A 2PRLA 2F8QA 1UBSA 2JF6A 1EZ2A 3UFYA 5D03A 4XZWA 1VBHA 2J74A 2PDCA 3QHNA 1E1EA 4OVXA 1UUOA 2L5HA 5ECVA 4WKAA 3URBA 4I6KA 3S2CA 5I06A 4X60A 1U2YA 2OEKA 4UOJA 4J3XA 4RE0A 3ZWTA 1W1B1 1R46A 3IVUA 3TYZA 3KP0A 3STFA 1V0LA 4JZ5A 6ENLA 2G96A 2WZMA 1IEXA 2PDPA 3KCOA 3MJMA 4N9BA 5FJJA 1KXQA 2HNHA 3WQDA 2VQUA 2BG5A 3H4WA 4P7RA 2XM2A 4Q8WA 3AHXA 3NG3A 1UD8A 2GWNA 2WM0A 3C2YA 1NJJA 3CB3A 4CD4A 4MB5A 3AMKA 3C0LA 3ITCA 3FJNA 3VILA 1A3WA 4GUGA 4ACZB 3WF0A 1VEMA 3NZQA 3BQ5A 1ESWA 4ZB5A 1A5KC 1HN1A 1UWUA 3KLLA 4IIGA 3OA3A 1BSLA 2QIWA 3VIJA 3EPOA 1QO5A 3WELA 1DWAM 3OLEA 4H9UA 2YCLA 1LQAA 3EOSA 3PK7A 1NOWA 3R4IA 2PEVA 5JBDA 1E9LA 2I9EA 1EJUC 1WKEA 4WCJA 4F0KA 2RJGA 1ITCA 1IGWA 3G1VA 4XKMA 2X1UA 1TCMA 3CWHA 2G97A 3DERA 2E4TA 5D32A 4KWWA 4IP7A 3VDBA 1EGVA 3GHRA 4ERAA 3DBPA 3K4AA 2WCSA 1G01A 3KCLA 2H6RA 1SM9A 2OZTA 1EF3A 3T0TA 1T96A 4DIAA 1MO0A 5I23A 3AIUA 1TR1A 2OB3A 3PTMA