1GWJA

Morphinone reductase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
374
structure length
374
Chain Sequence
TSFSNPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDWIGGDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacterial Morphinone Reductase and Properties of the C191A Mutant Enzyme.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords MORPHINONE REDUCTASE
total genus 132
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gwjA00
5F2LA 1IIHA 1XBVA 4ORIA 2C14A 2VEKA 2RKXA 3C0JA 5I3GA 4LV4A 3TAOA 4QM1A 1TRDA 3FKKA 3G1AA 3PC0A 3LV5A 3NXFA 5BOOA 1I45A 3GKAA 4FNSA 3RFAA 3KHJA 4TU1A 5K3VA 2ISWA 2CW6A 2X16A 1TQJA 4X3ZA 2R94A 3BARA 3NPXA 3P62A 3W2NA 1RQBA 3GDLA 4M7TA 3TUUA 2E5DA 2ZRWA 1SQ7A 3UNDA 4A2RA 3C2EA 3GDKA 3PVFA 4J9JA 1N7KA 2YGYA 4HNUA 4XTDA 3O15A 4FX6M 1QAPA 3O05A 3W1NA 4RCXA 4O4VA 5FESA 3BLIA 3WFAA 1GQNA 5I3KA 6ALDA 2D73A 3EX4A 3TE9A 1Q6RA 2PC4A 1M6JA 1FWRA 1ZHAA 4FNQA 1HG3A 4LRSA 3GR7A 3LGEA 2A85A 1L6YA 4Z1BA 2H3DA 3TJXA 3W7GA 3FLUA 4O14A 1WAUA 3NL3A 1EPXA 3GZ3A 2OZ0A 3EXSA 3IIPA 3UYCA 1FCUA 4ZL1A 4DF2A 8TIMA 5LNVA 1NVMA 1SR9A 3UWVA 1OFAA 5BW6A 1W5PA 2QDHA 3KAOA 1EUNA 1L6WA 3W7PA 3NVTA 2W6RA 1TTJA 2RDTA 3S1XA 4RZ6A 1WYIA 1QFEA 3BW4A 3EEGA 3BV4A 1JJKA 4AHPA 5D05A 4UTTC 3M16A 3M41A 1G4TA 2E68A 1A53A 4QAIA 1ZY9A 2QF7A 3GLCA 5CPNA 4IMEA 4UNLA 5EKYA 1GVQA 5AHNA 4UTWC 4E2BA 3TXVA 5C5YA 4WUIA 4JTHA 2I14A 5CSRA 3TW7A 3QSTA 3P67A 2EF9A 4IMCA 1Q6QA 1VLWA 2A6NA 3NPWA 3SIZA 1LORA 3PY2A 3QF0A 3M7WA 1HL2A 1I2OA 1D3HA 4Y6GA 5I3JA 4MFDA 2V2HA 3NQVA 3P81A 5IBXC 2ZZ2A 5D03A 3L68A 1YYAA 3LHWA 2DZXA 3W1MA 1N55A 4HSOA 4WD0A 4DEFA 5K2ZA 5EYWA 1HTIA 2J88A 1C8VA 1ME8A 4RX0A 1TTIA 5LNSA 1WQ5A 1DBTA 2ABBA 4NX5A 1OX6A 1I2NA 1QO5A 4TIMA 1TJPA 4RV8A 4IMGA 4TO8A 4DXVA 4IPIA 4UTKA 4CQ8A 2CLFA 3GAKA 3TK7A 1H63A 1I2QA 2VFDA 4S2BA 2BLEA 3EWWA 3TW6A 3F4WA 1HO1A 4B5NA 5K9DA 5KZEA 3W6YA 5DN1A 3G0SA 4R33A 1OFRA 3TQ0A 1LZOA 4BR1A 4GNJA 4O28A 3S1VA 5D37A 4KFOA 3LLDA 1EA0A 2Q3RA 4N9DA 4GWEA 3PULA 1JCJA 3SSJA 1SUXA 1W8SA 1LBFA 2E6DA 3IRDA 5D2TA 3V75A 2QCLA 3IIVA 3HPSA 3BGJA 4E2DA 2YYUA 3F03K 3NQ6A 5KINA 3RLUA 5HJLA 5HINA 3P84A 1FDYA 1B57A 2YSWA 1KM0A 1KV8A 4IOTA 3W7EA 1ZJIA 4ADSA 1GT8A 4UTWA 1B4EA 3CEUA 2OT1A 1JCMP 3WK2A 5LZLA 5G2WA 4DF1A 1VH7A 3W7QA 4ADTA 3QM3A 3VI2A 1X1OA 2Y88A 2GVGA 3PBUA 1A5CA 3M5ZA 5DY2A 3VKJA 1GYLA 3MI2A 1FXQA 3IIOA 1KTNA 3CPRA 3W73A 3L67A 5DBTA 5IBXA 5HR6A 1FY6A 3NGJA 3HG3A 3LCXA 3T55A 4AVFA 3S42A 3Q94A 5KTLA 3G1DA 1KFCA 4U28A 3FFSA 1XC4A 2AAMA 2P10A 2VFGA 5CPLA 1Q3NA 3NOEA 3LV6A 3TMQA 2QDGA 3W7HA 1BWLA 3C8FA 5L9FA 1JRBA 2OMAA 1TIMA 4R7JA 3KOFA 3KRSA 4M6PA 2CZEA 3W7LA 1JCYA 3IVTA 1QWGA 2F7FA 2YYTA 3G18A 3GDMA 1HFBA 5FI8A 1SU5A 2JKEA 1UJPA 5F4WA 1YTKA 4K8HA 4IXHA 4BFAA 4I7UA 3A24A 1UCWA 4R34A 5DCDA 1B9BA 3W1TA 4O15A 4JTSA 2ZZ5A 1K8YA 1JULA 5MHBA 4NX0A 1W0MA 3C2RA 2WNNA 2DZTA 2YXGA 4LTSA 1NEYA 3M47A 3P8JA 3ELFA 4EWND 2HSAA 3P8IA 3TAKA 4X2RA 3M44A 5BMWA 2H6RA 3R2GA 1VYSX 1FXPA 3TROA 3N2XA 2ISSA 1L9WA 4DBDA 3SGZA 2J24A 2NX3A 4OT7A 3O6CA 2H3BA 3LHYA 2GJLA 3SY5A 1M7PA 3BPWA 2HS8A 4FIRA 1SFJA 3MHGA 5LNUA 1Q45A 3AO0A 1W5MA 1R30A 4FNPA 4LT9A 3NL5A 4N2YA 2XN1A 1Z44A 2EPHA 1F5ZA 4MIMA 3S5NA 3W72A 4LWWA 3W2JA 4IMDA 3QJAA 1XM3A 2J9YA 2QCEA 2VKZG 3NEVA 5AFDA 3DHDA 1PL9A 1KM2A 4XTIA 5F4SA 3PAJA 3LTSA 1VCVA 1LRNA 1IXQA 1YXCA 3TC6A 3W76A 4O1AA 2QCHA 4FB7A 4LVGA 2RFGA 1K7EA 1FCQA 1FBAA 2Q8ZA 4IUOA 3VFLA 2ATMA 2ZTKA 2ZQ0A 4FX7A 3WK0A 4O1BA 4C1LA 3RNDA 1XDLA 1J4EA 3LRLA 2YX0A 3QZEA 1IXOA 3PBVA 5A8GA 3B0PA 2OX1A 1EEPA 3ZFHA 3I7SA 4XBKA 3GB6A 2FB3A 1XUZA 2BWGA 3L5LA 4O50A 4UTHA 4O53A 1UB3A 5C2XA 4JTGA 3PR2A 3NZRA 3LHTA 1Y0EA 5DY3A 4K36A 2VFHA 5FEPA 4QNWA 1SW3A 2NWSA 2WKJA 1GYNA 4NNBA 3EXTA 3N2MA 4ONVA 4BI7A 1OFDA 3UWUA 2EGZA 3G3MA 5LNRA 1VHNA 2ZZ1A 1QOQA 1Q6OA 3L5AA 1R2RA 3NNTA 1K7XA 1KLZA 4O11A 1TQXA 4Z1CA 4NJHA 1CW2A 2NUYA 1D9EA 2CZFA 1BWKA 2V2DA 2A7NA 1Z42A 1QNVA 2WO5A 2WNQA 3PB0A 3LOTA 4CQ9A 3FA5A 3NL2A 5I3FA 1TYGA 1OJXA 2H90A 3BG9A 4WQ6A 1KV5A 1WOAA 3MI6A 3MBDA 1VCGA 2NLIA 1MZHA 1A5AA 4PC8A 5AOUA 2BX7A 1ML1A 2FTPA 2CLIA 1TTQA 4TX9A 4OHQA 2ALDA 3UY8A 3I68A 3CIWA 3GR8A 5FF4A 1OYCA 4YMZA 3DU0A 3BG3A 2ABAA 2WOQA 4N9CA 5HMSA 2FQIA 2FB2A 1WDWA 1GPWA 4I7WA 1OX5A 5BMXA 1KFKA 4NNAA 1XBZA 3PUDA 1ZENA 2B7QA 3O6YX 3CWOX 2H8XA 4UCGA 1G7VA 2YZRA 3FYOA 3LCHA 5CGQA 4A21A 4CNOA 1U83A 1W54A 3PF3A 3SI9A 4TR9A 1H62A 1X1ZA 2QUVA 1FCBA 1PIIA 2AQWA 2NZLA 3TU9A 5DBUA 2I1OA 1MEWA 4TMCA 3NQ8A 1LP6A 3W22A 2HS6A 4OV9A 3HBLA 1AK5A 5CZJA 4LVBA 3PUEA 1BEUA 3MJYA 4LVAA 3MYPA 3CU2A 4Z0SA 1R2SA 3N34A 5C55A 1U5JA 2HTMA 2DZWA 1F2JA 3LCFA 2J9ZA 3Q58A 3P82A 2Z0IA 2ZBTA 3N19B 4KKXA 3EXRA 1A5SA 3HOJA 3ABOA 4GUGA 1KM4A 3EWBX 5H91A 4MLRA 3QMTA 1JUEA 2Y70A 1F73A 3O63A 3W7OA 4CQAA 1PHWA 5HUOA 1VR6A 4XBSA 3MMTA 2ZZ3A 1PS9A 7TIMA 3N73A 1YLVA 1ME7A 4CCEA 1H7XA 3S6DA 3OBKA 2QUTA 5HWJA 4UTLA 3TMLA 2Y61A 2Y63A 3SJ3A 3MWAA 3B8DA 3PSWA 2C13A 2PRHA 2VENA 3LBMA 4Z0JA 3DKLA 4ZZ9A 4QISA 4DPQA 4GE8A 3P80A 2CU0A 5D2YA 3KXQA 4UMAA 2B0MA 4UTUA 3NZ1A 3ANYA 3F4NA 3UWQA 4O0ZA 1OYBA 4P61A 2ZA3A 1YADA 3G24A 3CM4A 5F2IA 3SR7A 1SO5A 2YR1A 3DXIA 2TSYA 2QAPA 3DFOA 4GRSA 4LS1A 1H7OA 1VYRA 4FNUA 1YTDA 3NYZA 2QJGA 2YPIA 3W7IA 5ABTA 3W1QA 2DP3A 2FPVA 3LDVA 2CFFA 2QCDB 3EKLA 3ZWSA 3R5EA 2O7SA 3HB9A 4LY8A 4QQ3A 1RPXA 4FIQA 2B4GA 3IIXA 4FX8A 4QNEA 5GVJA 1DQXA 5DXXA 4MZ8A 4O10A 2A1YA 2X2GA 3GXNA 1SO3A 3PBWA 2FPTA 3MYOA 2ZZ6A 2ZRZA 2CLLA 3IIZA 3VCRA 1TV8A 1SZGA 3UY7A 3HG2A 4MY1A 3WJWA 1W5NA 3T44A 1ADOA 4UR8A 3NG3A 3JRKA 3VNDA 4O1CA 1XCFA 3UPWA 5LGXA 4MY9A 1S5VA 2P0OA 4BF9A 1RR2A 4LW7A 5I3HA 1JR1A 1XDMA 4WOQA 4DBEA 3QW4B 1ALDA 3E49A 4H6KA 4AWUA 1TPFA 3NPVA 4N9BA 3HGSA 1OVDA 1W3TA 3TCEA 4AF0B 3QSRA 1A5BA 5DELA 2OT0A 5G1YA 1H1ZA 2YDAA 4RLIA 2X30A 4YCOA 3DGRA 4IGHA 3B03A 4UFIA 3QH2A 1DQWA 2A21A 3IV3A 3I7QA 3W1UA 1L2UA 3R12A 1GVSA 3WJYA 3CEPA 2QEZA 4BI6A 1T8XA 4Y8FA 1RV8A 4PH6A 3PSVA 2Z2UA 3H55A 4O54A 1ZAIA 3O07A 1F6KA 1HO4A 4K6AA 2WSYA 3T40A 3KVKA 1DJQA 3S5OA 1KTBA 1NFBA 3DFSA 3T7VA 2V30A 3G0UA 3HGJA 4A3UA 4ALDA 1KTCA 2BSLA 3C2OA 3HPXA 5CG7A 4U4MA 2E6FA 4HN4A 1WA3A 3CIXA 4WY0F 5EL1A 1DKWA 2B7PA 1FUYA 5D09A 1LBMA 1KFJA 2GVJA 4MYAA 3UQNA 1KM1A 4NNCA 1AL7A 3Q2DA 1QPOA 1LM1A 3WJSA 2ZYFA 4ORMA 2CLHA 4Y90A 4S1FA 1AL8A 2C18A 1THFD 2V0TA 5EY5A 3LB0A 5D32A 4K7YA 2O7QA 5D30A 4JIQA 4GUHA 4AH7A 1J2WA 5D02A 2FPYA 4IJBA 3VE9A 4GBUA 1EWDA 3TSDA 1H7RA 3W7NA 2AGKA 2Y62A 2TMDA 3IVSA 1B3OA 3FJLA 4MLJA 2V2CA 3GK0A 3NPUA 3W2LA 1XL9A 1QPRA 2GQ8A 5K9CA 4QSHA 3W1RA 2I9EA 4WOZA 3L2IA 1TPDA 3W85A 4UFLA 3IVUA 2W0UA 1GWJA 2CWNA 4N4PA 3S0CA 1XXXA 5BRBA 4ICNA 1P5BA 2Y7DA 1KM3A 4O0KA 3I65A 2NXHA 3N9SA 1OX4B 1PE1A 4UTMA 2OCZA 3PBYA 4A22A 2WSRA 3BGGA 1TPUA 3UZJA 2QKFA 3NA8A 1ICSA 4FHAA 3HG5A 5KITA 5G5IA 4JTUA 3E9AA 2VC6A 2GQ9A 4HIBA 4QIUA 4K8EA 4MJZA 3CWNA 2JGQA 2ATSA 5A5WA 1Z41A 5LHFA 1P1XA 1S3HA 4PODA 4MUZA 1VC4A 3EX2A 4JXCA 1OABA 1N8FA 5LGZA 3PM6A 3W88A 2C19A 2GPTA 1H51A 3B0VC 1JQVA 1A50A 2DZVA 1TPEA 3W83A 3MW7A 3U8GA 2JK2A 3ATYA 1LTDA 1W3NA 1XI3A 4XUGA 1DL3A 4OE7A 1BKSA 4PCFA 2ZRUA 1VCFA 2JKPA 1YXYA 4IPJA 2EAWA 3ATZA 1ZALA 2WPBA 2TYSA 5F2GA 1R46A 3W1PA 3O06A 5AHLA 3LBCA 5AC7A 3STCA 1LDCA 1WBJA 3BLFA 2VXNA 1OYAA 4UTJA 4AWSA 1PHQA 4JIPA 1KLYA 3OHIA 3QW3A 1M5WA 3M1ZA 4O19A 4I9AA 2VFEA 1JUBA 4CNPA 3EX1A 3O1NA 1YDNA 4L4MA 5HWNA 5J5RA 3W7MA 3BVJA 5AN7A 4BWLA 3O8AA 1H7NA 3G1XA 5TIMA 1MEHA 1C9DA 2WV8A 1VRDA 1GVOA 1VQTA 1DV7A 2ZZ4A 4YXGA 4MJMA 1ZAJA 4JDBA 1UBSA 4JTKA 2ZRXA 3D0CA 2QCMA 3STEA 3TH6A 3UD6A 1TPWA 3W71A 3OVRA 1VPXA 2VEMA 4AMAA 5CPOA 4JTLA 5AC8A 2C6QA 1RD5A 2W79A 3C2VA 3H53A 1FDZA 5H2ZA 1NF0A 3FIGA 2E5BA 4JTIA 4RR4A 3TFXA 2JKAA 4X9SA 2G5WA 3W9ZA 1G7UA 4JYEA 1CI1A 4UTTA 1VJIA 1KBJA 4UXDA 4ZMGA 3GXPA 3N9RA 5DLCA 3PUOA 3GNDA 3S5YA 1DHPA 2E6AA 3UWWA 3JS3A 4I7VA 4OWGA 4FXRA 1I4NA 3GIYA 3LHZA 2ZRVA 3B04A 3GKFA 2G96A 3B4UA 2VEIA 1TPC1 3MI3A 1FWWA 5FF7A 5BNKA 1TB3A 2RH9A 3W07A 2BTMA 1WV2A 4NJJA 1TMHA 3HJZA 4K39A 1W3IA 2WNZA 1YPIA 2CLKA 3UWZA 2LLEA 5SWUA 2X1TA 3FEMA 3MBFA 2QCNA 4M6VA 1QPNA 1KW1A 1D3GA 2Y85A 1X7FA 3M5YA 5HULA 4HNVA 2QCGA 2A6LA 3M0ZA 4C1KA 4WJEA 4W9TA 1TRIA 3P7YA 3QEZA 4AAJA 3GXTA 2YW3A 4JY8A 3L66A 4FNRA 1I2RA 1OFOA 3LI1A 3W84A 1P0KA 2KZHA 5G4WA 3SFKA 2RDWA 1IF2A 2QJHA 1KFLA 3QRHA 4RZ4A 5F4XA 3DFQA 1SSGA 3A5VA 1FWSA 3LLFA 5FEZA 2PRMA 2ZCGA 4WXYA 3T78A 2V9DA 1IXNA 5EA9A 3RF9A 1WXJA 5D2VA 3G1SA 3VE7A 4NXKA 1EB3A 1SO4A 2R91A 1X6UA 5C54A 3W1AA 5IM51 3H54A 1KFBA 4LVDA 3YPIA 3P60A 4N9EA 4NT0A 2X1UA 1O95A 5KZMA 1JUKA 4O52A 1LLWA 3NAVA 4GJ1A 2NV2A 3A22A 2B7OA 1K03A 1OK6A 3GDRA 2DZSA 4Y96A 2VFIA 4NJGA 4Q4KA 1OFEA 3RK8A 4GC4A 2V5BA 3W2UA 5K9XA 2H8ZA 2NWRA 3G8EA 5AYZA 3KX6A 2YW4A 4JTTA 1CX9A 1OFQA 2GJNA 3R89A 2G95A 1DORA 2C16A 5D38A 3P61A 2QCDA 4JYFA 2V81A 5HWMA 3PG9A 1FX6A 4NJKA 1QPQA 3QC3A 5KZDA 4NUWA 1UUMA 2X1RA 5HNRA 3SW6A 2V5LA 1TPVA 2J6XA 3P5YA 4UFMA 5TQLA 3LCGA 1EP2A 2A7RA 1IXPA 2RDUA 4OV4A 2OJPA 1SFLA 5U4NA 3WJZA 4JR5A 4BK9A 3KVJA 1LROA 4AXKA 4KWWA 2EHHA 5TBOA 5DCEA 5LHEA 4HHPA 1G6CA 3DENA 1DVJA 1VGAA 2YCEA 1WBHA 1O60A 3NM1A 3MP3A 4M6QA 3F1QA 4OQVA 5D2WA 2WSQA 2ZA1A 3EX3A 3V1PA 3G8RA 1G67A 1H5YA 4H4IA 1F76A 2Z6JA 4MKNA 3GVGA 1H7WA 4UUIA 4LOCA 4JICA 3I6RA 1XBXA 3LXCA 1VS1A 1F6PA 3HGRA 1LRQA 1O94A 1XKYA 1UUOA 2QR6A 4O12A 1V7YA 4Q32A 2FLIA 4M7SA 3S1WA 3CTLA 4P2VA 4WY0B 1ICQA 4EF8A 1OFBA 1KM6A 3BK0A 5KSWA 2DJLA 1GVFA 2J9XA 3PWAA 4Y9AA 3WK1A 4JTFA 2NX9A 2ZRYA 2QJIA 3QPZA 5CKSA 1FWNA 5CPMA 4JDYA 1LOQA 1EIXA 1NAL1 3G0XA 3TIMA 3TXZA 2JBMA 3PB2A 3RLVA 4NZFA 4XZ9A 1S5TA 4ZVJA 4KFPA 1AW1A 3M6YA 3O6DA 1R47A 4L4LA 4AWTA 3M5XA 1PV8A 1T96A 1KBIA 3HIJA 1EP3A 3ABRA 3DKJA 4DELA 3C61A 2A4AA 3UZ5A 1IGSA 1LCOA 5J5DA 5AHFA 5DXYA 3IEBA 1G4SA 4TMBA 2JGYA 1J5TA 1W37A 2GUUA 2GQAA 2C3ZA 1H61A 3QMSA 4UNKA 3NR0A 4RXFA 3GYEA 3THQA 1LOLA 3DHFA 4LV9A 3K30A 4XKYB 5D33A 2QCCA 4UFJA 4LUJA 3STFA 3W74A 4HNNA 1QO2A 2DJXA 3IGUA 4O57A 5F2MA 4GFSA 4RJEA 3BW3A 5EMUA 1QMLA 5AB3A 3TQKA 4DO6A 4WX2A 1DJNA 1GOXA 4Z1AA 1FCVA 1V5XA 2Y7FA 4N02A 3EWYA 4X22A 2IQTA 4WY0A 1NSJA 4RKAA 4BI5A 5I3IA 3Q37A 4PA8A 1IIGA 3NL6A 3U2OA 1SSDA 3A5FA 4OU1A 4LS2A 2ZA2A 3OEXA 1W56A 3L0KA 2VELA 1L6SA 4O16A 1UASA 4PEKA 1G4EA 1F7BA 1W5QA 3ZR4A 3A9IA 4LUIA 5CSSA 4K37A 1M7OA 3LCIA 3QMRA 1PCKA 3KRZA 5K7JA 3KVMA 4O18A 2YFNA 4O4WA 1AW2A 2Y6ZA 1MEIA 2E5CA 2ISVA 5T26A 3HF3A 1PCWA 1FQ0A 5E93A 4DF0A 3R13A 2ZZ7A 4JEQA 2GVLA 2V82A 2NV1A 4UFKA 3L5MA 2CZ5A 4OBTA 5L6UA 3M9YA 1TCDA 3UPBA 1YTEA 3W7JA 1SO6A 5HUPA 4IMFA 4AHOA 2WQPA 1BTMA 2Y7GA 1JCNA 1XUUA 4K7VA 1TJRA 3TJLA 1XBYA 1YXDA 3LRKA 1F05A 3KRUA 2E77A 3QQ0A 4FO4A 5EBUA 1LYXA 3QQ1A 1QOPA 2NUXA 1O4UA 3LTPA 3LRMA 3LI0A 3ABQA 3OVQA 4CCCA 5FF0A 3O16A 4OGZA 4RK8A 1H50A 4LRTA 2ZTJA 4DPPA 1I2PA 3NQCA 1SZFA 1YDVA 4IXXA 2DZPA 1KFEA 4LU0A 3DZ1A 1LLZA 2WJZA 1GTEA 4UMCA 2ZFAA 5LKYA 4CNNA 3SZ8A 3GAYA 2FJKA 4JN6A 3BO9A 2ZDRA 2RHGA 5G4EA 4MZYA 1W31A 3KFTA 4O17A 1LOSA 2X1SA 4AB4A 4GUJA 3U6WA 1TPH1 3S9YA 3CC1A 4HT3A 5HR7A 3WK3A 4GXMA 3WJXA 2F84A 3UWYA 4AEOA 1W1ZA 2GOUA 3GNNA 1GG1A 3JR2A 1RQEA 3EKZA 1K7FA 4ZQOA 1MSSA 3TDFA 4IX2A 1H7PA 4JX5A 4A2SA 5AC6A 4RXGA 4Z1DA 2BXVA 4MY8A 1AW5A 1TV7A 5AYYA 1E51A 3DFTA 2A5HA 4E0CA 1SW7A 4IQLA 3T4CA 1XFBA 3DI0A 4CCDA 3PS7A 2EKCA 4H3DA 2DU2A 3EWUA 1OK4A 1W5OA 2Z6IA 3HQ1A 4UIOA 3CHVA 4EF9A 1I8JA 3NQ2A 4LC8A 1FDJA 4HNTA 1K02A 2R8WA 5FEXA 4PFMA 3E0IA 4PL1A 2XN0A 3E02A 4O8RA 3W7DA 4LNYA 1MXSA 3C52A 5LNWA 1EP1A 4UMBA 1GVRA 1Z48A 1H60A 1X8FA 3C6CA 4WXZA 4N4QA 2V8ZA 3W7RA 1C29A 1RZMA 3DI1A 1QCWA 1G69A 3S8HA 4E38A 3QPYA 3NQDA 3KVLA 3M43A 1SPQA 3LXAA 5G1TA 3FS2A 4D2JA 3INPA 3G1YA 1ME9A 3NQ7A 3NQGA 3ZWTA 2C0AA 1YDOA 4EVZA 4UC5A 3W2MA 5AHMA 1DOSA 1JCXA 4M19A 5F1UA 3THAA 2HMCA 4FF7A 1T0OA 3SGUA 4DQWA 3N14A 1TTPA 1RQHA 1KA9F 3IGSA 2FFCA 3RU6A 4LC6A 1TPB1 3NO5A 3S5ZA 4JYDA 1ZAHA 5HQEA 1VLIA 1SZEA 4MVAA 4AF0A 3OG3A 4EIVA 4FXSA 3FOKA 1AG1O 3W7CA 1QDSA 3HG4A 5E1QA 4RZ5A 4G1KA 1FWTA 3C2FA 3L0NA 3W70A 2YFOA 1QR7A 3MUXA 5EPDA 4JX4A 2NX1A 3CQ0A 1YPFA 4JY9A 3I7RA 2A2IA 1O5KA 4N6FA 3B0UX 3G1FA 1KM5A 2FIQA 3DFNA 4MZ1A 3NQEA 1SZNA 4M5PA 3STGA 2C15A 3C3NA 3TKFA 3UXDA 4NQ1A 4EOUA 3MP5A 1P0NA 1K8ZA 5CZ0A 4K38A 2PCQA 4NU7A 4MPQA 4Q33A 2DZUA 4ZQRA 1R2TA 3BW2A 3GX9A 2Q3OA 3MHFA 3TA6A 5D2XA 4DO5A 3SECA 3FKRA 1GZGA 3FYPA 4JS3A 3TFCA 3TC7A 4ADUA 5CZTA 4NXSA 1ZFJA 4YLWA 1JRCA 2B7NA 3R8RA 3W1XA 4MYXA 3NQAA 2R14A 2P1FA 4ML9A 3LHUA 3TSMA 3BG5A 2NXIA 3NM3A 3DH7A 3B06A 1P4CA 3HMJG 3S1UA 3QFEA 3L65A 5FF3A 3LM7A 1K3UA 3LTYA 4HSNA 3LCLA 3W1LA 3PG8A 1OHLA 2CLMA 3G1VA 4JTJA 5D04C 2QUUA 2VEPA 1OF6A 2PURA 2XN2A 3TV8A 4DO4A 3HGOA 1WX0A 5AYXA 3TSBA 4R53A 2J27A 1JVNA 2PE4A 1VZWA 4JD4A 3LX9A 2FDSA 4Z08A 2NUWA 1ICPA 4FNTA 3CB8A 3P74A 4ZQNA 4YCPA 5FF2A 3HO8A 1AMKA 2E1DA 4NJIA 1TSIA 1EX5A 1TV5A 3AJXA 1LBLA 3EWXA 5DCBA 5C6MA 3W23A 1NF7A 3NQMA 4YWIA 3DBPA 4GUIA 4GUFA 3OA3A 2CLOA 4UR7A 4MFEA 3TX9A 4XWUA 4JNMA 1ONRA 2XFWA 4S2CA 3TR2A 4PTNA 4ZQCA 2QCFA 1OX4A 2TPSA 3LXBA 3N3MA 3E12A 1OG0A 1ZCOA 2DORA 5F1VA 1VYPX 5K4XA 1K8XA 5E0KA 3W7KA 2Y89A 4NVTA 1S5WA 4YL2A 3W2KA 3L9CA 5AHIA 3OIXA 2VOMA 2CLEA 1TO3A 2C1HA 3A23A 3RMJA 4QITA 4PL2A 4UFHA 1MO0A 3C56A 4NZJA 5G2IA 1ZNNA 1G4PA 4LVFA 3ZS4A 2BZNA 3IGXA 1SW0A 1B4KA 1JQXA 2E09A 4UTIA 1GG0A 1O5XA 5U7SA 3A21A 3M5VA 1GJPA 4LS0A 1WOBA 3G1HA 3L0GA 4XQ6A 3E96A 4ZQMA 3G3DA 1H1YA 2Z1BA 2CZDA 3C4UA 1OF8A 4POCA 1EWEA 2G97A 2Y7EA 4ZQPA 1GEQA 1VHCA 2QAFA 4WZHA 1LRTA 3L21A 5KMYA 2TRSA 3MHUA 4KFNA 5CZSA 1HUVA 3CLMA 3EWZA 4HPXA 3MP4A 2NXGA 4JTEA 3EB2A 1PVNA 3W86A 3ABSA 4XKYA 4QJ1A 3OVPA 1Q6LA 5K4ZA 3FJ6A 4A29A 3LCWA 3B05A 3TNOA 2PRLA 1GTHA 1TREA 4HKPA 4IWWA 2A7PA 2E6YA 5AHEA 1F74A 4MOZA 1RVGA 2Q8LA 4O1DA 1EUAA 5G2HA 2VFFA 3UXAA 3MO7A 1JCLA 1OFPA 2UV8G 5FEWA 4BWLC 2A0NA 3TQVA 4FEZA 3EX6A 4AHQA 3LERA 3NDOA 4N6EA 3P5ZA 3W87A 3W3OA 3W75A 6TIMA 3DAQA 3LHVA 4KWVA 3QYQA 3USBA 4JGDA 3GDTA 3HPZA 5LSMA 3NQFA 4JX6A 4CLMA 4O13A 3CT7A 4IX0A 3DFPA 3G22A 3BLEA 1T99A 4HPJA
chains in the Genus database with same CATH superfamily
1CT5A 4AZCA 4ZO6A 3R0UA 4ORIA 2VEKA 5I3GA 4LV4A 1K9FA 4RW3A 3FKKA 2BGQA 1E40A 4RPPA 3PC0A 2D1ZA 2BY0A 1OADA 4FNSA 3KHJA 1K4GA 4R5EA 5DMYA 4F8XA 4BQ2A 1RJPA 1TFVA 1AFSA 5I23A 4JEJA 2OO0A 2VDGA 1W1B1 3UNDA 3CAWA 2E9LA 2J7HA 3GDKA 2OQHA 1RBAA 1B3VA 3U2CA 4J9JA 4HMNA 4C6DA 4HNUA 3O15A 3S46A 4ZO9A 2PC8A 2F2HA 3VD3A 3UJEA 4RCXA 4XD3A 3WFAA 1GQNA 2GFTA 4TVDA 3TE9A 4IIFA 4D6GA 2C1GA 2D2GA 1DJXA 4RDVA 4MSSA 3A13A 4PSPA 3MA8A 2H3DA 3CASA 1YIXA 3W7GA 3QY8A 4O0QA 1DWJM 4D1IA 5A6SA 1CNVA 3EXSA 3BLPX 3UYCA 1FCUA 3BWWA 1HF6A 4ZL1A 3WCZA 4DF2A 5C9ZA 3K8KA 1XCWA 1N8IA 3T42A 3UWVA 2DSUA 1L6WA 4ASTA 4HGXA 1KXTA 1JFXA 2GSHA 4GD0A 3VVGA 1G4TA 2E68A 1A53A 1LWJA 3VFCA 3ALFA 1BRLB 5CXPA 3IK2A 3IACA 4MWAA 3XISA 1PWLA 3ARRA 3O0FA 4R85A 2J8FA 3TXVA 2D0FA 1BVNP 2PZ0A 2R1PA 4G56A 3P67A 1Q6QA 1XYLA 3J7HA 1Q65A 3UFYA 1HL8A 4Y6GA 4AMCA 5I3JA 3U4FA 1LQAA 3V16A 3CL6A 3NQVA 3P81A 4GH1A 3WFLA 3M0MA 5D03A 1U2YA 4WDTA 3L68A 4Z1YA 3KOXA 2DZXA 3W1MA 5I5RA 4HSOA 2YZ5A 4WD0A 3AXMA 3QGKC 2J88A 1GK8A 1C8VA 1TTIA 5LNSA 4TVCA 1JG9A 1WQ5A 2J7BA 3VK5A 3H6OA 4NX5A 3SN1A 1JIBA 4XG1A 1QO5A 4TIMA 1LWHA 4PCPA 3M0YA 2DSKA 4CQ8A 1GKRA 1GJWA 2VUYA 4AQLA 4J2MA 1OWQA 1DE5A 4DBWA 2WNWA 1GQIA 2BLEA 5I2UA 3AUJA 4L4OA 4B5NA 5K9DA 4R33A 1OFRA 3AIUA 3OYZA 4O28A 3S1VA 3R25A 4KFOA 5CBJA 1VJSA 4HN8A 3BQ5A 3PULA 1FKWA 3S6TA 1SUXA 4MWAD 1LBFA 4PMJA 4PMNA 2ASHA 4DJFC 2XFYA 1ODUA 1LJYA 2EPNA 2YYUA 1DJZA 5KINA 3RLUA 5HINA 1KWKA 1JPIA 2FYMA 4IOTA 1VEMA 1ZJIA 4ZTYA 1E9YB 4ADSA 1H2JA 4UTWA 3QTGA 3NDYA 2DVUA 5LZLA 2DT1A 5G2WA 4DF1A 1VH7A 3W7QA 4ATDA 3WQ8A 1RY0A 3VI2A 2H9AA 3M5ZA 1UR0A 3E5PA 4DVOA 5JBDA 3WQFA 1XDJA 1FXQA 5M5DA 1PTAA 1P0EA 3W25A 1YX1A 1ENUA 2E9MA 1E6XM 3S42A 5ECVA 1R0MA 1E1FA 4IP5A 1DJWA 3LN3A 1JDDA 3NFUA 4AVNA 2P10A 2VFGA 1EPVA 2OSXA 5I77A 1RUSA 2PWHA 3VNKA 5L9FA 1VJZA 4M6PA 2CZEA 2YJQA 3IVTA 1QWGA 3O3RA 3GDMA 1HFBA 4KGJA 7ODCA 2JKEA 5F4WA 2XM2A 1L8PA 1YTKA 4K8HA 4ZB0A 3T0BA 4I7UA 4M1RA 5CSUA 2VR2A 1B9BA 4JTSA 2A79A 5T9CE 1YMYA 1JF5A 2ZZ5A 1K8YA 1JULA 3ES8A 1YHTA 3RHGA 3R0DA 4HVXA 1NEYA 3M47A 3P8JA 1NARA 2HSAA 3UF9A 3P8IA 2GLKA 4X2RA 1FXPA 4H8VA 2ZUMA 1L9WA 3L4ZA 4DBDA 5GJPA 2YB4A 4OT7A 1LUCA 1A4MA 3NQBA 3DYPA 2H3BA 3GIQA 3E0LA 1CZ1A 2GJLA 1JI1A 2XH4A 3HM7A 1Q45A 2VQTA 1W5MA 1R30A 1B54A 3URQA 1PKLA 4LWWA 4IMDA 4UQEA 3NEVA 4IQEA 3QBUA 1I9CB 4IT1A 5AVNA 5JXQA 4GABA 4JOMA 4TOQA 1YNQA 1S2AA 3E5BA 1VCVA 1LRNA 4EPBC 4YTRA 3FN9A 1D2KA 1DWAM 2J7EA 4HNCA 3UGRA 4CQCA 3AUOA 1K7EA 1FBAA 1IE7C 4FX7A 3GUGA 5GNXA 2ZUNA 2A3AA 3S4TA 3QZEA 1VFOA 3S9IA 4LX4A 1AQ0A 3GB6A 4V1XA 2CXEA 2YDQA 3LHTA 1Y0EA 4U2ZA 1FH9A 1GOOA 2I5GA 4NNBA 2WM0A 3ZZ1A 4BI7A 2UY3A 1K9DA 2CHRA 2XM1A 4PYSA 3L5AA 4S3EA 4F2UA 2ZX5A 2V63A 1WNOA 3CV1A 4NJHA 3SURA 3AICA 3DECA 2NUYA 1GORA 2WMIB 2A7NA 1QNVA 3PB0A 2X2YA 3FA5A 3WL1A 2XHYA 1P1MA 2IPJA 5I3FA 1TYGA 1KV5A 1WDQA 3S1GA 1VCGA 4PUWA 4AC7C 1A5AA 4I6KA 2BX7A 2WKGA 4C7FA 2JF6A 4RNFA 4KEZA 1I0DA 4J35A 3DIPA 2FTPA 1WKEA 4XKMA 4TX9A 3VUSA 2VX4A 2P88A 3CWHA 3CIWA 1OYCA 4YMZA 3LA4A 3NXLA 1GGOA 4IQJA 3W82A 1DWGM 1UPMB 2WZHA 3WQPA 2O4QA 5HMSA 2FB2A 1WDWA 1GPWA 1OD0A 3OZOA 3TYDA 4NNAA 1JYXA 3PUDA 1ZENA 2B7QA 1Q5MA 3O6YX 3CWOX 1CLKA 2H8XA 3GC2A 4UCGA 1G7VA 3UW6A 3LCHA 3W53A 4CNOA 5KETA 1PIIA 5CCZA 4EXQA 2I1OA 2DIJA 1IZCA 3VDGA 2HS6A 2DH3A 4DXXA 4LSBA 1F4AA 4S38A 3USZA 1AK5A 1BKHA 4LVAA 4YIWA 3TWBA 4IPNB 3KOYA 5C9RA 2ZE0A 2PDYA 1F2JA 3LCFA 2J9ZA 3QHNA 4LCRA 2AMGA 1PXGA 3N19B 4LBSA 4KKXA 2PDCA 1AD4A 3EXRA 2GSJA 5HMDA 1OM0A 1KM4A 5H91A 3QMTA 2AMXA 1DYSA 3T0CA 1F73A 1PHWA 2PTYA 3MUZ1 4W89A 4GY7A 4PCNA 2WZIA 4ZA0A 1YLVA 4JFTA 4CCEA 1NDWA 3QR1A 1OC7A 3PPGA 2OYMA 3B9EA 2O4MA 5FJUA 4GYPA 3CZEA 1IEWA 2Y61A 4V33A 2Y63A 3MWAA 2PDJA 4FLSA 3GNPA 3LBMA 3CPUA 3RYSA 3DKLA 3BTNA 3TYCA 1ZQ5A 1TV4A 5D2YA 4ACZB 1A4LA 2CIPA 4HU0A 3P2VA 2Y5EA 3UWQA 1YADA 1IGWA 2YR1A 3C0QA 3WNKA 4IF2A 1FWAC 3DFOA 4GRSA 2QUMA 1EDQA 4FNUA 1E56A 3WLLA 1I1WA 3H26A 1SZRA 2QJGA 2PTZA 1J01A 3MCOA 3HURA 3QHMA 2QCDB 2O7SA 4NZ1A 1RPXA 4YTQA 1OIFA 3RRAA 1E0WA 3IIXA 5LA1A 4MZ8A 3ZT6A 5EU9A 2X2GA 3PBWA 3MS8A 4G8TA 4Y9MA 1VFMA 1E73M 6ENLA 3ARZA 3LGDA 4WKFA 3VCRA 1TV8A 6CGTA 1SZGA 1DWHM 3TTYA 2OYLA 3WMCA 3AYVA 5LIYX 4O1CA 4DXKA 1XCFA 3TW9A 1S5VA 3QVQA 2ZKMX 1JR1A 2CYGA 3QW4B 1ALDA 4AWUA 4CVWA 3N6QA 4GQQA 3VNLA 3T1GA 4IGHA 3HFYA 1WKYA 2RJGA 2AQVA 2WMHA 4HYWA 2V3FA 2POZA 1Q6FA 2F61A 2E0PA 1ISXA 1IEVA 1C8YA 4DBSA 2XVKA 3T0AA 4O54A 1ZZMA 3KZSA 1ZAIA 2PDNA 1F6KA 1KCXA 2QV5A 4K6AA 2OG9A 1YW1A 5AECA 1DJQA 4A05A 1NFBA 5M3WA 1WDPA 4LGXA 1RA5A 4GACA 3C2OA 1WA3A 4IFKB 3FXYA 4J4KA 1FUYA 3KWXA 4C6EA 1LBMA 1OGGA 3UQNA 1VBRA 3Q2DA 1QPOA 3EA1A 4CQBA 3VOCA 1FTXA 4Y90A 3AMGA 1AL8A 2V0TA 4U33A 4LBRA 3WLSA 1XPGA 1EOMA 5D30A 2OGYA 4JIQA 2NVAA 4GUHA 5D4YA 4H6EA 3E2QA 1QHOA 3AHVA 4MG4A 3IRSA 1JNEA 2OPJA 5CJNA 4QLKA 1G0CA 3T0TA 1F3TA 2AGKA 2FVKA 4B2DA 2TMDA 3FJLA 4J5NA 3W2LA 5I79A 5EFFA 5K9CA 3MUAA 1W91A 3ABXA 4UFLA 2W0UA 4HSHA 2ZUWA 3AYSA 3S0CA 1XXXA 1HT6A 4ZO7A 4ICNA 4P7QA 5BRBA 3MJMA 3SO7A 2Y7DA 1KM3A 2HVOA 4O0KA 6PTDA 3S2LA 3I65A 5DANA 3KTXA 1F9CA 3ZSSA 1AJ2A 4A22A 1KXQA 3BGGA 1OQFA 2D23A 1UH4A 1ZPTA 3GTNA 2QKFA 5KITA 2XGIA 3MCMA 5G5IA 4K8EA 3CWNA 2RDXA 3CZLA 2BGSA 2QF8A 3VD4A 1W9BM 2VD9A 8XIAA 2V5JA 1NIUA 1EJSC 5LGZA 2NW0A 2GPTA 2J7GA 3B0VC 1JQVA 2ZIDA 2J78A 3U8GA 1DL3A 2NSXA 1VCFA 4FOJA 1MNSA 3KLKA 1ZALA 2WK2A 5AHLA 3KHDA 3PJWA 1DJHA 1LDCA 3JU2A 5FOOA 2CLPA 3GC4A 4UTJA 3OHIA 1V02E 4D6CA 1JUBA 3VTRA 4CNPA 4GX9A 3RLGA 1YDNA 4AX6A 3V1HA 2OKTA 4BWLA 1PDZA 5EB8A 1W3KA 1C9DA 2WC3A 1VQTA 3AISA 3SQMA 3A3WA 4YXGA 4M0XA 4MJMA 4JTKA 3DX5A 4U3CA 3D0CA 2QCMA 3TH6A 2J62A 2VRJA 4ERGA 2A3EA 1Q6DA 3CAQA 3C2VA 3H53A 3U9IA 1NF0A 4MB1A 2JKAA 1EDTA 1XH2A 1CI1A 1R3RA 4ZGYA 4GVGA 5I06A 1L0PA 2X42A 3GXPA 2QPXA 5DLCA 1U1HA 1PO9A 2OLAA 4LH8A 3GR4A 4QJ4B 2ZRVA 3GKFA 2G96A 3DESA 1TV3A 2QJNA 1BGAA 3AZSA 4WDWA 4CU8A 5A69A 4BF7A 3W07A 1WV2A 3F2BA 4R9XA 4HCDA 5D9PA 1YRRA 2P5NA 5SWUA 3K46A 1J0KA 4C6MA 1KQZA 1F8MA 3WDRA 2QCNA 1QPNA 1KW1A 2VL4A 3N6JA 4LUTB 2Y85A 1X7FA 2QCGA 4C1KA 4WJEA 3R7MA 2ZX7A 3AWOA 2OFJA 3EDFA 1XYMA 4JY8A 4JZ5A 1OC5A 3O2LA 1I2RA 2WVSA 4PMZA 4TTGA 1VFUA 5G4WA 2YA0A 2RDWA 1IF2A 3ANUA 1ONXA 2QJHA 1KFLA 3H12A 3VIMA 1M1BA 3FV9A 3LLFA 3GZAA 2PRMA 5IFPA 4QE1A 1XIDA 4V27A 2V9DA 1IXNA 3G1SA 3KDNA 1P48A 1EB3A 3UZWA 3ZOAA 4E3VA 1CB7B 1C92A 2PDQA 2JEQA 1QT1A 1B0IA 3ZJ6A 4WR3A 2XUCA 4HD5A 4R88A 3ES7A 2F38A 2WBKA 3NZQA 2D3NA 3GBDA 2X40A 4O52A 3HJEA 4INFA 4GJ1A 2NV2A 1VFFA 2VFIA 4NJGA 1E55A 1GEHA 1OFEA 4K1WA 1UA3A 4GC4A 3AZRA 4XZNX 2E25A 1Q2SA 3IJ9A 3NEHA 5K9XA 3W2UA 3LENA 2GOKA 3WLIA 1CXKA 1QW8A 3CUIA 5HPCA 2GJNA 3CS2A 2G95A 1XH1A 3PG9A 4NAEA 5M1TA 1S2TA 1FFQA 2X1RA 5HNRA 1V4YA 2F6UA 2V5LA 4YTUA 2J6XA 3ONCA 3D5HA 5E0FA 3NURA 1M03A 1IXPA 5LIKX 5U4NA 1T41A 2BP1A 3KBSA 4JR5A 2EXOA 4BK9A 4KWWA 2EHHA 1DVJA 1VGAA 4YN5A 4M6QA 5E6ZA 3C0SA 5D2WA 2OX4A 3GFZA 5AYIA 3CO4A 1JZ8A 1G67A 2Z6JA 2D24A 4QG9A 2DY3A 4M3PA 2NQJA 4CNTA 1GQKA 1EF2A 2UY5A 1EKOA 4KMQA 4O12A 1UUOA 1KCLA 3VIJA 4Q32A 4LPCA 4M7SA 4IIDA 4Y8EA 1UD3A 4P2VA 3E3HA 1OFBA 1KM6A 2ZC1A 5KSWA 2DJLA 2J9XA 1EO5A 4H7CA 4A3YA 4E8DA 5D8WA 1UZDA 2ZRYA 4KBXA 3QPZA 1FWNA 1QI5A 2I57A 2YBUA 3KBNA 3TIMA 2JBMA 1M7JA 5DEZA 2DT3A 1ZTVA 4BF5A 4NZFA 1JYVA 4QE5A 2V5DA 3EOSA 3M6YA 5MF5A 2HCVA 5FJRA 1KBIA 3DG6A 2WMFA 3ISIX 5CC3A 2A4AA 2CEQA 3UZ5A 4W85A 5J5DA 1G4SA 4TMBA 2JGYA 2GUUA 4DJFA 2VX6A 3PNUA 3NR0A 4DLFA 3H4XA 4R27A 4C6OA 5CC5A 3E2VA 3S6OA 2EPLX 3PZTA 2Y8KA 5F2MA 4RJEA 4PTWA 3TR9A 2WMIA 1XYAA 3TQKA 1DJNA 2X05A 1GOXA 3ZMRA 1UD2A 4Z1AA 4N02A 3EWYA 2O55A 2YOCA 3WDHA 1NSJA 3B8SA 4GQRA 1O66A 4UR9A 3ALGA 2QULA 2PGFA 1X98A 3LU2A 4AD3A 1IIGA 3U2OA 3K8MA 1SSDA 1CIUA 4DAIA 1CGVA 2R9RA 3HN3A 1CXFA 5GJMA 1J0HA 3OEXA 1W56A 2C71A 1GPFA 1UOZA 1UASA 3CHEA 4PEKA 1W5QA 3ZR4A 2VUNA 4KCVA 4K37A 1IZKA 3PZGA 1M7OA 2POTA 3LCIA 1R7OA 1ISVA 4H04A 3WQGA 3KVMA 1H5VA 4AY7A 4Z42C 1PCWA 1W8GA 3GH5A 4ZSTA 3AHYA 1V3KA 2IXVA 3WUBA 4PMQA 5L6UA 3ID7A 2FVLA 4GMEA 4YU1A 4OUEA 3T2QA 4IMFA 4AHOA 3IK4A 1NQ6A 4QLLA 1XFCA 1FHDA 4K7VA 3M64A 1J10A 1TJRA 1XICA 1XBYA 2WCSA 3A3XA 1FWIC 1XIJA 1S39A 2GDQA 4FO4A 3W01A 2NUXA 4IIHA 1I6NA 3LRMA 3OVQA 3COTA 1BG4A 2WVUA 3K4WA 1KB3A 1XP3A 1I2PA 2V67A 3LMZA 3PTQA 1N8WA 4IXXA 1DXFA 1WB0A 2J74A 3WLHA 3DZ1A 4DX3A 1F3WA 1KR0A 4UMCA 1IQ8A 2ZFAA 4CNNA 3ABZA 3RMEA 4PUNA 5G4EA 5A6AA 1NDVA 5I09A 1LOSA 3SBFA 3TOPA 2DGAA 1IZJA 3WLMA 4HA3A 2DIKA 2GGGA 4H2CA 3UWYA 3WJXA 2CZVA 3WD1A 1GG1A 1EGMA 1RQEA 3EKZA 1K7FA 1WZLA 3MVTA 1LL7A 5B7ZA 4DI8A 3PN8A 4DUVA 2V6AA 2VURA 1JFHA 2DH2A 4ROQA 3DFTA 1KGXA 4E0CA 3SRKA 1F3EA 4DJFD 1BYCA 3PWIA 3AXKA 5CGMA 1EJXC 4N7QA 4PE8A 4H3DA 2DU2A 5EMJA 3HQ1A 2QQ6A 3CHVA 1BXBA 4LB4A 2GWNA 3TQPA 3TN6A 2XISA 1XLLA 1RY8A 3E0IA 4PL1A 3E02A 1AA1B 4K3ZA 4O8RA 2FHFA 1IR2A 3REQA 3C52A 4HU8A 5JIPA 1JXKA 2OSYA 3ARQA 1Z48A 4QR6A 4UQBA 1H60A 4WXZA 2Z1KA 2QT3A 4WSKA 3QPYA 3GVQA 2FZNA 4JIEA 2NQ9A 1SPQA 3FJNA 4QG6A 5G1TA 3FS2A 4D2JA 3G1YA 2EQDA 4IG2B 1WUFA 4LCSA 4GVHA 2YDSA 4A6GA 3D47A 1W6TA 4UC5A 3W2MA 4HPHA 4H2HA 3GYCA 3THAA 1P0BA 2HMCA 1T0OA 5CQ1A 3JZEA 1TTPA 4O1FA 1VBGA 2FFCA 4IM4A 1TPB1 1F6YA 4JQ2A 3S5ZA 3WH7A 2QS8A 1SZEA 4AF0A 1EOKA 3QV7A 1ZBCA 4HA1A 3HG4A 2I5QA 3UWEA 1S2WA 2YFOA 1QR7A 3MUXA 4F40A 1W2VA 4UWMA 4HCLA 1VFTA 1O5KA 3KE0A 2UY4A 3QOKA 1KM5A 3DFNA 4HTBA 3NQEA 1SZNA 1GOQA 3STGA 3C3NA 2OZ3A 1UHVA 3VXGA 2WC4A 1P0NA 4K38A 2PCQA 3B4YA 2CBUA 1RBOB 4Q4MA 2PLCA 1TMQA 2OQLA 4ZQRA 3ONBA 3GX9A 3TA6A 3SECA 3FYPA 3AXIA 3MSYA 4JS3A 4BCEA 3S9ZA 4ADUA 4NXSA 4FR1A 4WVXA 4E8GA 4D9PA 3CQIA 4IG2A 4IFKA 3ZT7A 3F4DA 3VX1A 2FTWA 1A5OC 4JAWA 3S1UA 5FF3A 1WO2A 2G3FA 2IW0A 1K3UA 4HSNA 3WYZA 3LCLA 3PG8A 1FWFC 1OHLA 2HPMA 3VC6A 1AJZA 3DFYA 3IJQA 2XN2A 4GI6A 2QVHA 4OZOA 3TV8A 1Z8AA 5AYXA 5AC5A 1XG3A 1JVNA 4IISA 5HPOA 2W4XA 4Z08A 2Z28A 1ICPA 1PEZA 3P74A 4FP1A 4ERAA 4R7OA 2EG6A 3HO8A 1MQPA 5HJYA 4D8AA 3CL7A 5FIPA 5EGRA 5C6MA 1QWKA 3DBPA 4GUIA 4GUFA 3WLKX 2E8ZA 1XPYA 5CSYA 1YNPA 4JNMA 3CUJA 3ITCA 3NDZA 4PTNA 1W9DM 2VGBA 1B90A 1L2QA 5CLTA 2ACSA 2VM8A 1OG0A 1H49A 1ZCOA 1MRQA 3K1DA 3NGFA 4BA0A 3SQSA 3UP8A 3W00A 3L9CA 5AHIA 1FP8A 3EAUA 3OIXA 2PZNA 5HDRA 4GNKB 1TO3A 3A23A 1XIGA 4UFHA 4NZJA 4QEEA 4AZBA 3D6NA 2PTXA 3PZMA 2VZUA 3QZ6A 1VBJA 1SW0A 3K8LA 4UTIA 4OBRA 3T08A 3A21A 2W92A 1GJPA 1WOBA 3D3AA 3L0GA 2VZTA 3G3DA 4HOZA 3C4UA 1SJBA 1EWEA 4B5VA 3KBMA 3H7RA 3OVGA 2CHNA 4WZHA 1MFVA 3EOOA 5I07A 5TNVA 3L21A 4PN2A 5KMYA 4GI4A 1IEQA 2TRSA 3UBPC 3PP7A 2XZ9A 1UD8A 4REQB 1J93A 4US6A 3EWZA 1HKKA 1DXIA 4I9TA 3A64A 3TJIA 3CZKA 4XKYA 1G9HA 4QJ1A 3OVPA 3WEOA 3B05A 3TNOA 1XLKA 4CD4A 3NO1A 1F74A 3U2EA 4OOZA 2DEPA 2ZUUA 3VM5A 1EUAA 5G2HA 3UXAA 4OECA 4BWLC 3BQ6A 3SDOA 1K4HA 4LCQA 1XX1A 3W87A 2WJDA 3VKDA 3LHVA 4FLQA 4DJDA 1VFLA 1YBQB 3GDTA 3HPZA 3NO3A 2WJEA 4JTAA 3NSXA 4IX0A 3G22A 3LNMA 4AXNA 3GWQA 4DUWA 3OOQA 2RKXA 2DIEA 2I9UA 4QM1A 4BQ4A 2WHJA 3G1AA 2WZTA 3LV5A 3NXFA 1I45A 3RFAA 4TU1A 1MUCA 4ZR8A 4M8UA 2CW6A 4MDOA 2P76A 3PTDA 1UP3A 3NPXA 4KWSA 4L9YA 1I60A 3QYSA 1RQBA 3GDLA 5MKGA 2E5DA 3T07A 1VIZA 3FEQA 2ICSA 5CAKA 2HK1A 5IFTA 1QAPA 4B15A 1K9TA 3FDGA 3W1NA 1HP4A 1V6XA 6ALDA 4TXEA 1W9XA 3IJLA 3BMWA 2PC4A 4FNQA 3SM0A 4LRSA 3GR7A 2A85A 3BXWA 5C9XA 3QR0A 4Z1BA 2O9RA 1VEOA 3FLUA 4O14A 2OYKA 4H1ZA 4KH2A 3VU2A 3GZ3A 2VX7A 5JU6A 5JQ9A 1P6CA 1SR9A 5BW6A 1W5PA 1NWUA 2O56A 1EUNA 4BQ5A 4D8LA 2BOEX 2PGRA 1Q66A 1TJ0A 1IR1A 1QFEA 4PMOA 3BW4A 3EEGA 2GDUA 4RW5A 3W02A 1JJKA 2CBVA 2Q09A 2OOFA 4MAVA 3M16A 1QVBA 5GJNA 1UC5A 3VDCA 4QAIA 2PWGA 3SUVA 4GLEA 2QF7A 3GLCA 4QS6A 5EKYA 1GVQA 4QRNA 4UTWC 4XAZA 4W93A 4C60A 1W9PA 4XD4A 4ZBCA 2PGWA 2EO7A 1MVYA 3BZGA 1DQUA 4IMCA 3SIZA 2VWSA 3PY2A 3L23A 1ZB5A 3M07A 3M7WA 4MB4A 1SJDA 5FSDC 1OSEA 4BKNA 2V2HA 1E5JA 3MANA 5IBXC 1Q85A 1ZJAA 2ZZ2A 2F2KA 1CGUA 3L2MA 5HJXA 3IAQA 4DEFA 5EYWA 3TEVA 3UPMA 3H21A 4RX0A 5A2CA 4PSRA 4GQBA 1I2NA 5LIWX 2B31A 4LQ1A 1TJPA 4NI8A 4RV8A 4DXVA 1XCXA 2W27A 2EPOA 1BAGA 3AC0A 3ZSTA 4AEFA 4S2BA 4A35A 1E5NA 3TW6A 1A0EA 4IIEA 3V7PA 2YXOA 4WEVX 1SR0A 4BR1A 4IPPA 4GNJA 2HE5A 5D37A 3QV8A 4DWSA 5A8NA 3KL5A 1QK0A 3E2RA 2VYOA 4BJHA 1HKJA 4PMDA 4S39A 1YPXA 3CK5A 1JCJA 2VR4A 3CNYA 2BDQA 3IRDA 2XYLA 1D8WA 2HV5A 2QCLA 3E2SA 1XIEA 5E0CA 3IIVA 2Q01A 1HXJA 4NL1A 4GZEA 3ME3A 3HPSA 4E2DA 3UZYA 3NQ6A 3SEPA 3CUZA 3L12A 3LGGA 2YSWA 1KV8A 3W7EA 4HP5A 1R3VA 4JQ1A 3TLLA 1B4EA 3CEUA 3LSCA 2DUXA 2WPGA 2YXXA 5ABHA 3HZ3A 3QM3A 1X1OA 3T2PA 3KL3A 4CNUA 5DY2A 1KTNA 1X97A 1CCWB 3VKBA 3W73A 3S2CA 1V0MA 5I03A 4GFIA 5HR6A 1FY6A 4WGHA 4G7FA 4KRTA 4LJ3A 4AVFA 1KBBA 3LNPA 5FL1A 1VP5A 1KFCA 1JD7A 5T91A 2AL2A 3FFSA 1XC4A 3RX4A 1Q3NA 4YNGA 3NOEA 3LV6A 3TMQA 2PLKA 4G7EB 4QJ5B 4HMDA 1BWLA 3SJNA 4HBKA 2OMAA 4KCWA 2BVDA 1XQKA 3P0XA 3W7LA 5LXXA 1JCYA 3GNXA 4DLMA 4EXBA 5FI8A 3LD5A 3I6TA 2G50A 1UCWA 5DCDA 4HTYA 2XSXA 1OIMA 3GS6A 3GU1A 4ZO8A 3L4VA 2CETA 4UZSA 1QBBA 2CPUA 4NX0A 1W0MA 3C2RA 1ISYA 2WNNA 4OJYA 2QV4A 3V5FA 4WRHA 4Q8MA 3ELFA 5CBBA 4AY1A 2H6RA 2FDMA 4HB7A 4XIMA 2ISSA 2PGEA 5M03A 1IT8A 1NM9A 3O6CA 7REQB 3FAXA 3LHYA 4HMEA 4ZOAA 3BPWA 4FIRA 3SCQA 1SFJA 2YCKX 3MHGA 5A6BA 3OGVA 3PTMA 4PUDA 4LT9A 3A6OA 3NL5A 3SCOA 1VPQA 4B90A 4DIAA 2EPHA 3S5NA 3W72A 5E70A 1EJRC 3QJAA 1P0DA 2J9YA 4CKQA 1A5NC 2OB3A 2NT1A 3QKEA 4F66A 4XTIA 3MUY1 4OTKA 2BVWA 5F4SA 3VM7A 3HU7A 3WQEA 1YXCA 3W76A 1KRBC 2VGGA 4O1AA 2QCHA 4DM1A 1TA3B 4WLCA 2Q02A 1FCQA 4IUOA 3Q67A 4K2SA 3VFLA 2ATMA 2ZTKA 2HXTA 2ZQ0A 1ZCCA 5XIMA 5JH1A 3WK0A 4ILSA 1OCJA 1VEPA 1VKFA 1XDLA 1XIHA 1EF3A 3LY0A 4NZ3A 3HPFA 1IXOA 2BVTA 1WE5A 3I7SA 3UT0A 1TVLA 4O50A 1OCBA 1WZMA 3T8QA 3UXIA 3LYEA 1BFNA 3VOIA 4K36A 2NWSA 1XLGA 3ARSA 3EXTA 1HJUA 1C90A 3ITXA 1M01A 1OFDA 5LNRA 2EGZA 3WD0A 1VHNA 4UZUA 1QOQA 1Q6OA 2D2HA 1R2RA 1K7XA 3KBVA 3FX4A 3MSDA 2HVNA 1D9EA 2CZFA 3SUWA 4AZ6A 2WNQA 1XRSA 3TYUA 4RV3A 3LOTA 1PWMA 3RGTA 4US5A 3SUTA 2IPWA 2PWFA 1QU4A 4NRSA 3DG7A 3QR3A 4XV0A 3GO2A 1MRAA 2MNRA 3VGFA 1YQ2A 1TTQA 3B40A 3V4BA 2ALDA 1TX0A 2W5FA 3UY8A 3GR8A 5FF4A 1CEOA 4KEUA 1PBGA 3W27A 3BG3A 1ONEA 2ABAA 2WOQA 2NSOA 2FQIA 4WDUA 1KFKA 1W1TA 3FYOA 1XYBA 5CGQA 2C0HA 1W54A 3CBWA 3RLHA 3WBAA 1X1ZA 2QUVA 1MZRA 2AQWA 3TU9A 2O9PA 1OCQA 5A6JA 3MDUA 3N04A 3BLLA 4L6OA 4LVBA 3WNOA 3PUEA 1BEUA 3MMDA 3MYPA 3CU2A 5D9NA 3F2CA 1R2SA 3AS1A 4U5IA 2SFPA 4Y9OA 2RAGA 5CG0A 3WL0A 2HTMA 3OHMB 4L1XA 3BMVA 3T8LA 3PFMA 4ERIA 3QOMA 3QV9A 1X6LA 2CKSA 3IAPA 4P8VA 1D8CA 1VD6A 3HOJA 4GUGA 4MLRA 1JUEA 3W7OA 5BOEA 2A3LA 1VR6A 4XBSA 4EKJA 2ZZ3A 3N73A 4DJEC 1EIBA 1H7XA 3S6DA 5TAOA 3OBKA 2QUTA 3GRIA 1TKKA 5HWJA 4UTLA 3TMLA 2QIWA 3M0VA 4H8NA 2D22A 4W88A 3VIKA 2VENA 4LEFA 4ZZ9A 3ARVA 4GE8A 2PI6A 1DJIA 4ACYA 4AUBA 4DY1A 3A9BA 4H01A 1WCGA 3KXQA 2RUSA 3NZ1A 2Z24A 3ANYA 1J0JA 3F4NA 5A8QA 1UWQA 1OYBA 3AU2A 3SR7A 2C79A 3CM4A 1SO5A 2GQ3A 5A8PA 2QAPA 1E3ZA 5FSEC 5B7YA 5ABTA 2AKZA 2DP3A 1M68A 2FPVA 3ECQA 2CFFA 3LM3A 1NP0A 3HB9A 3MZ2A 3TYZA 4HPGA 6REQA 4D6JA 4FX8A 3UCDA 1WKDA 2VJXA 3BAWA 4QNEA 2I16A 1DQXA 4O10A 3KOZA 3SCVA 1XGZA 1G94A 1QI2A 3VMNA 2FPTA 5TF0A 5C2GA 3WDPP 4JKLA 3IUHA 3IIZA 4LAOA 4UBPC 1W5NA 1ADOA 4UR8A 1PTDA 3WUFA 4BZYA 2QZRA 4MY9A 2XG9A 2P0OA 4O1EA 4LW7A 3AALA 1BVZA 2EG8A 1W3TA 3TCEA 4CD7A 3RM9A 2QMKA 5G1YA 1OB0A 2X30A 4YCOA 1FRBA 4Z17A 1QNSA 3GTXA 2W9MA 5T9BG 1EC7A 1EHAA 4X0VA 3I7QA 3W1UA 1L2UA 5H8PA 3MCNA 3T2OA 2BMBA 2QEZA 5BRQA 4Y8FA 1RV8A 4PH6A 3UJSA 5CZKA 1SFTA 2AL2B 5DX7A 2E4TA 3POCA 3JUGA 4W86A 2P0IA 3ITVA 3S47A 3KVKA 1KTBA 4L7ZA 2XIIA 3DFSA 1E0TA 2OEMA 3BL3A 2V30A 3G0UA 3HGJA 3N15A 4A3UA 4A8LA 5CG7A 2PP0A 1TX2A 1V93A 3N2BA 2ISFA 4WY0F 4HPNA 4YVVA 5KEZA 5D09A 2GVJA 1LF1A 1AL7A 3VOHA 1HJVA 1LM1A 2ZYFA 2CLHA 4S1FA 5FA5A 4EK7A 1THFD 2ZXQA 1B9ZA 3LB0A 3OLIA 3VKKA 5T8GA 4NAFB 5D32A 2O7QA 4IJBA 2PDHA 3O9NA 3B9DA 3TSDA 4LANA 1XQLA 5HQLA 3GK0A 4FF5A 3NPUA 3EPNA 2PLJA 1FOBA 4Q8UA 1QPRA 3RG6A 4HK7A 4DM2A 1JPHA 4WOZA 1TPDA 1EA9C 4W84A 4JN7A 3UCCA 2FGZA 3SB0A 4V28A 2YA1A 1ECQA 2NXHA 4PGLA 1FHUA 1XIIA 1J0ZA 4UTMA 3XINA 2G3NA 3GBEA 3KTSA 4GZIA 1XIBA 4FHAA 4C6KA 2VC6A 3U4AA 4MJZA 3VKAA 5A5WA 1J6OA 1Z41A 1DE6A 1P1XA 3WLPA 2FH8A 4PODA 3CGTA 2HBXA 2X8RA 1VC4A 3EX2A 1OABA 1EJWC 1UH3A 3PM6A 1H51A 1E1CA 1A50A 2DZVA 3W83A 1ZRQA 3MW7A 2DUAA 2JK2A 5ECUA 2GJPA 1XI3A 3EWCA 3WD3A 1BKSA 3B8VA 2ZRUA 2R1MA 1TG7A 1WDDA 2EAWA 1U1JA 4AYGA 2WPBA 2DDXA 5F2GA 4OKDA 1EJTC 3LBCA 5AC7A 3VX0A 1JZ5A 4LY4A 3BLFA 2V68A 2VXNA 4H7ZA 4NZCA 2QDDA 1QATA 1HKIA 1KLYA 1V0LA 5EMMA 1Z69A 4O19A 1VRXA 3CJPA 2YCLB 3EX1A 1XLMA 1EHNA 2DSZA 4ZE5A 4GGHA 5HWNA 5J5RA 2VWTA 3W7MA 3BVJA 5AN7A 2J66A 2UWFA 1Z3NA 3II1A 3PZOA 1EXBA 4C6CA 2PDBA 2XIMA 2WMGA 1A3XA 1JGIA 2C8NA 2O9OA 4H19A 3H2EA 4JDBA 1UBSA 3VIHA 4KEMA 4AYSA 1M41A 3T05A 3KUMA 3UD6A 3W71A 3K4DA 3OVRA 4O8AA 2ZXBA 4QCEA 4CQDA 5CPOA 4JTLA 4N42A 3GC5A 8CGTA 2W79A 1I1XA 5H2ZA 3FIGA 5F7UA 3SRFA 3TFXA 2G5WA 3W9ZA 3AYRA 4UTTA 4ZMGA 3PUOA 2JIEA 3GNDA 3PJXA 1DHPA 1E3XA 2E6AA 4I5XA 4I7VA 4OWGA 1QTWA 2OEKA 3GIYA 2Q8XA 3FCPA 3B04A 2Q6ZA 5CAHA 1M7XA 4GI9A 5BNKA 1XLFA 2BOGX 1TB3A 2RH9A 2BTMA 4NJJA 1TMHA 1E71M 1BTCA 1W3IA 1YPIA 4DWSB 3V0SA 2LLEA 1XD1A 2X1TA 4FALA 3R10A 4TV6A 2Z29A 4QP0A 3TC3A 3U2ZA 1RP8A 1AVAA 2A6LA 2AAAA 4W9TA 3WY1A 5BRPA 4FNRA 3LI1A 3THDA 2PMQA 2Y0FA 1JZ7A 3LPFA 2D20A 1E15A 3EMZA 3DUGA 4UQDA 4RZ4A 3GTFA 1G01A 3HA1A 3DFQA 1XS2A 3SCWA 3S83A 3PJTA 4WXYA 1KO0A 5D2VA 4C6IA 3VE7A 3UR2A 2F8QA 2R91A 1X6UA 2DUZA 1S2VA 1QJWA 3YPIA 3ZLGA 2WM1A 4N9EA 1A47A 4J1OA 4NT0A 3VGBA 2X1UA 1O95A 3VZXA 1AZ2A 1UWUA 3NAVA 3A22A 1RCQA 1PKNA 3TNBA 1IWPA 4IH3A 2V3DA 4NYUA 4PRWA 4KQNA 4KCUA 2OTDA 2NWRA 4JTTA 3LLXA 1DORA 5D38A 5BU6A 2C16A 3AQUA 3P61A 2QCDA 4JYFA 3SSZA 3LQLA 4MKSA 2ZUTA 3AS3A 6REQB 4CU6A 4H83A 2XVLA 3SW6A 5FJTA 1Q6CA 3P5YA 1HJXA 3LCGA 1EP2A 3MV11 2A7RA 1V3JA 4IP4A 3CTTA 2RDUA 5AZ0A 2E8YA 4XZLX 2OWXA 3ZVIA 2V5CA 2NLYA 3KVJA 1LROA 4AXKA 3F5JA 3I4EA 5TBOA 5DCEA 4HHPA 1ADSA 1BGGA 1O60A 3B9NA 3MP3A 3WX7A 1H3GA 3N3TA 2ZA1A 1SM9A 2MUCA 3MUCA 3WH5A 1H5YA 4H4IA 1F76A 1V6UA 1PX8A 4UUIA 1EXPA 3CB3A 3GU2A 3GNOA 4QDWA 3TZNA 3I6RA 1UKTA 2R6OA 1VS1A 1U30A 1QASA 1R3WA 1XKYA 2QR6A 5ABFB 1BLIA 3CTLA 1JD9A 2G4FA 3PWAA 1GVFA 2WSPA 3VKCA 4JTFA 2NX9A 4OUIA 3IGHX 2QJIA 4MJ4A 5CKSA 3OODA 4JDYA 2NQLA 3W24A 3V18A 4XZ9A 3RJXA 3BCJA 3DOPA 2ZWZA 4JBRA 1S5TA 1JDAA 1VBUA 1EJUC 4L4LA 3HIJA 1EL3A 2QPSA 2CBIA 2ESCA 3A3HA 1CXEA 3MMUA 3IPWA 2PWEA 2GQAA 2J75A 4WSHA 5I0DA 1H61A 1LG1A 1J0YA 3GW0A 1FWDC 3K30A 4XKYB 5EBAA 4GX8A 4LUJA 1CWYA 2OU4A 3HV9A 3IGUA 4O57A 4XD5A 3MSGA 3AS2A 4WSJA 1BSLA 2XJ7A 1QMLA 5AB3A 2BVYA 4DO6A 4WX2A 5ABFA 4HQVA 5TD4A 1FCVA 1V5XA 2PDPA 3WH8A 1RCXB 1C7TA 4BI5A 3TP4A 1LL6A 3QKZA 1H41A 3Q37A 4JFWA 4PB3A 4W4QA 5HNUA 4OU1A 1Q4WA 2VELA 1L6SA 1KRAC 1F7BA 4LUIA 4AD2A 1GCYA 3KRZA 1FWJC 2PDKA 3IUDA 2YFNA 2Y6ZA 1MEIA 2E5CA 1XLJA 3E74A 1FQ0A 5E93A 2RJHA 1QW9A 1EJVC 2ZZ7A 3QV6A 1JF6A 3EBVA 1XHGA 2CZ5A 3M9YA 3LS9A 3N29A 5MKGB 3UPBA 5BWFA 1YTEA 3P14A 1EH9A 4AIUA 1KXHA 1BTMA 1UWRA 5E09A 5HANA 3UERA 4J3UA 3THUA 4MWAE 1UROA 3LRKA 3CQHA 1ZBKA 2E77A 1S46A 1LYXA 5E6YA 1QOPA 2IKJA 1O4UA 4E2OA 1NDZA 4OGZA 1TZZA 4C6PA 2ZVRA 1H50A 2ZTJA 3MKVA 3NQCA 5I02A 3B9OA 1YDVA 3MZNA 4LU0A 4B3LA 3OO2A 2WJZA 2WB5A 4FAMA 3WEMA 3L4UA 3VOJA 4DZIA 4IJRA 5C71A 2QW5A 3ARYA 1EX1A 1VBHA 4O17A 4AB4A 1UP2A 1OC6A 4P8WA 3S9YA 2BB0A 3CC1A 1R3SA 1Y5WA 3OQ8A 4AEOA 1W1ZA 3KOWA 1KKRA 1D3CA 1XYCA 3VCNA 3TDFA 5C0QA 3SRHA 1NOWA 4JX5A 4A2SA 2BXVA 1AW5A 1E51A 2X09A 2W63A 1QUMA 3APGA 3EZ4A 4HNLA 1SW7A 4IQLA 3A12A 3T4CA 1XFBA 3BAJA 3PS7A 1E1EA 3EWUA 4GBDA 3VAVA 1LG2A 4EF9A 4QDPA 4W5UA 5LXEA 1FDJA 4RE0A 4HNTA 2BXYA 4L65A 2E9BA 2R8WA 5FEXA 3WF4A 3ANVA 1BRLA 2P8BA 2XN0A 4B5UA 4MB5A 4OOUA 3W7DA 2BHYA 4UMBA 1GVRA 1E0VA 4LFYA 1X8FA 2QYGA 3VPLA 2NQZA 2V8ZA 3W7RA 1C29A 1NTHA 3PK7A 2VDIA 5BXSA 1AZ1A 1QCWA 3S8HA 4E38A 4HCHA 1OZMA 3UJFA 4CCZA 3VMOA 1ME9A 5D9MA 1YDOA 3GE7A 1E6ZA 1LT7A 5AHMA 4UOJA 2DT2A 3TYAA 1BXNA 3RITA 3ZR6A 3VZYA 1KA9F 1RQHA 4PFHA 4Z2JA 5M2FX 4JYDA 3ARTA 3TTQA 3PWGA 2WMKA 1DP0A 2QJJA 2AKMA 1EC8A 1E4LA 3R43A 4DRSA 5EPDA 2NX1A 2A2IA 4XZMX 3W38A 4M82A 4V1YA 1P6WA 3B0UX 3G5EA 2D2JA 1UWIA 3TKFA 4EOUA 5CZ0A 2XGZA 1UR8A 4Q4SA 2DZUA 4XZBA 3T09A 3EPMA 1A3HA 3RPTA 3SUUA 4LUSB 1VENA 3KTCA 3AXXA 4YLWA 3STPA 1U33A 1JRCA 4EANA 3W1XA 3CUXA 4DUOA 4BY3A 4WKHA 1QI3A 5FJJA 4H9ZA 3C3UA 1KNWA 2J47A 3IJ6A 3LHUA 5LYRA 3BG5A 3NM3A 3CMFA 2HNEA 3B06A 3IJDA 3LZ3A 3HMJG 5A6KA 3L65A 3B8UA 4ZEPA 1RLCL 3VIGA 2ISDA 3OIHA 3L2LA 4ATLA 1OF6A 1H4PA 3HGOA 4JIHA 3TCSA 3TSBA 4TVUA 4R53A 3ZT5A 3N11A 4NG3A 1Q2RA 3LX9A 4KT2A 2NUWA 1N2VA 3CB8A 3TTOA 2IUZA 3QTPA 1FH8A 3WNNA 2E1DA 3H2FA 1TSIA 5JVLA 4DYKA 3AJXA 1W1PA 2OWWA 3EWXA 3L7RA 1NF7A 4YWIA 4QHRA 4PTXA 2CHOA 1XRVA 2YLLA 4H7VA 3UR7A 4UR7A 3CV2A 2C7FA 3TX9A 5BOFA 4I9MA 4XWUA 4HHMA 2XFWA 2QCFA 4UQCA 3LXBA 2J7CA 3KS6A 3N3MA 3E12A 3LG3A 3ARPA 3HPAA 5C7VA 1UR9A 1BF6A 3FSUA 3W2KA 1XR2A 3VIIA 2FZMA 2PODA 2CLEA 4IICA 3V36A 3RMJA 5EFDA 1AH4A 1H1NA 4LVFA 2ZICA 1OBAA 2VD8A 5A3HA 3WNLA 1GJUA 3VA8A 2E09A 1GG0A 1O5XA 5U7SA 3M5VA 3BJTA 4LS0A 1MYRA 2P3ZA 3G1HA 4XQ6A 4I8YA 1H1YA 2Z1BA 4POCA 4AZCB 3CT2A 2G97A 2Y7EA 2RGMA 2QAFA 3GUWA 3SFWA 4QE4A 3BAKA 3MHUA 7REQA 3GHTA 5CZSA 4I8DA 6XIAA 2HJPA 3CLMA 5LIUX 1W1A1 4F0SA 4HPXA 1JDCA 1SMAA 3W86A 4KRZA 3ABSA 1XIFA 3CYJA 3H24A 3FJ6A 3LCWA 1FHVA 1GTHA 2R82A 3W6MA 1QHZA 5AHEA 3NJ3A 3UG4A 2Q8LA 3OLEA 4O1DA 1UMYA 3G6LA 1EYEA 2HK0A 1X8CA 2Z00A 3MO7A 5FEWA 1ISWA 3M0JA 1UD4A 4AHQA 3NDOA 3FDKA 1NFGA 3P5ZA 3QY7A 4BHYA 6TIMA 1KBLA 1UG6A 4PUJA 3DAQA 4KWVA 4XO7A 1XSKA 3NQFA 4JX6A 4CLMA 2NT0A 1GVEA 4QTGA 3DFPA 5D05A 3BLEA 1T99A 4HPJA 2G41A 1IIHA 1XBVA 2JQXA 3LQGA 4XX6A 1TRDA 3GKAA 1K6WA 3KDOA 1KRMA 1PUDA 1TQJA 2X16A 2GGEA 4OBSA 4M7TA 1DJYA 3TUUA 3S5SA 2WHLA 4Z2GA 4ZXLA 1SQ7A 4A2RA 4KIRA 3WQ4A 1RAKA 3C2EA 3PVFA 3IS4A 3EDEA 3CV6A 4XTDA 1W9UA 3O05A 5B80A 5HMEA 4O4VA 4IMAA 4XSMA 2YL6A 3RDKA 5I3KA 2D73A 3UGVA 3HFTA 1FWRA 1HJWA 3SRDA 8XIMA 4H6RA 2VNCA 2DQXA 1L6YA 3H2MA 1J9YA 3TJXA 3WDIA 2ONEA 2TODA 4OFCA 3CV7A 2XZ7A 4KETA 3VIFA 1C8QA 2OZ0A 1V0KA 2XFFA 1PX3A 2PDWA 8TIMA 5LNVA 4PMVA 4IJCA 4MGGA 3L4XA 1OFAA 5IHSA 5C2CA 2QDHA 4FLRA 3W7PA 4XAFA 3I3DA 1GOWA 5G4HC 3U5YA 1TTJA 1BYDA 2X7VA 2GL5A 4F79A 1UWSA 4RZ6A 1WYIA 3QGAC 1XLCA 4DJED 1TE1A 3BH4A 3M41A 1QPKA 1V77A 2I17A 3NYDA 1WKFA 4C7DA 4CD8A 3BURA 4IMEA 5FJPA 1TWZA 2FFIA 4QBXA 3REQB 1JGMA 5AHNA 3DHPA 1Z7AA 4GKLA 3S2JA 4IGMA 5C5YA 4WUIA 5GQBA 2I14A 4US5D 3GFYA 3LBOA 3SIMA 4JCMA 4RE4A 1RK5A 1V6YA 3QSTA 1LORA 1DEDA 1IHIA 1HL2A 3N1AA 1I2OA 1UOKA 1F07A 1VF8A 4MPKA 3OA5A 2FZBA 4GYPC 3LHWA 1M65A 2ACQA 1JDEA 1N55A 2G4JA 5K2ZA 1HTIA 4FPSA 4MTVA 1ME8A 2HQAA 4C6JA 1V8EA 2ZVIA 2O0TA 4H6QA 4NZ4A 2ABBA 3WBYA 4IMGA 3N2CA 3R1ZA 3H2AA 4UTKA 1AJ0A 1R85A 3H2NA 2P53A 4IL2A 3TK7A 3MSRA 4JFUA 3TTSA 1I2QA 2VFDA 4X60A 3EWWA 4XIAA 3KBJA 3F4WA 3FAWA 1QHPA 3ICJA 2TAAA 5KZEA 5DN1A 3G0SA 2G37A 2Z4GA 3TQ0A 4CN4A 4F0LA 3PANA 3GHRA 7TAAA 4R7WA 4MB3A 4I9JA 1T7LA 4IFOA 1OY0A 3WQOA 3ENLA 2VEGA 3LLDA 2D3LA 1R9YA 3WNPA 1EA0A 4PMUA 4N9DA 1RK6A 3K13A 2E6DA 3V75A 1EQCA 2YDRA 3VYLA 4AEEA 2D0HA 4C1NB 2PTDA 4L1GA 3F03K 1RJQA 4GO9A 4FOKA 3N17A 1FDYA 1B57A 1V79A 4LUSA 5H8MA 1WXZA 3CZJA 5IHRA 2OT1A 1W32A 1JCMP 1MUMA 2Y88A 3PBUA 3VKJA 1CECA 2VCCA 3CPRA 4U5KA 3M0IA 4XZHA 3L67A 1D7FA 1RLDA 5C8BB 3MU7A 3NGJA 5D9OA 1HW6A 3HG3A 3T55A 3CAKA 3G1DA 2ALRA 4U28A 1PSCA 2PDGA 3ZJ7A 4XSLA 1H0GA 1K1DA 2VC9A 2AAMA 1W17A 5LA2A 5CPLA 1GVYA 4FXFA 3W7HA 2YCIX 1E4IA 1JRBA 3A4XA 1TIMA 1GOIA 3KOFA 3KRSA 1PYFA 1B31A 2F7FA 2YYTA 3QLLA 4JTDA 1TJ2A 1QI0A 3AOFA 3N12A 2PBOA 3E0FA 1CB2A 4IXHA 4BFAA 1PZ2A 3HQNA 2L5HA 4J28A 4R34A 3W1TA 2OEJA 4AFYA 1TA3A 3GTIA 2QMJA 3RU8X 4NIRA 1XG4A 5AY7A 4HOWA 4X61A 4R9OA 2WXDM 3P93A 2IXUA 3O0KA 4B2DD 3TAKA 1CGTA 3Q4DA 4HZ7A 4IGSA 4Q22A 5BMWA 3BICA 3R2GA 1VYSX 1TZ7A 1F8IA 1R87A 3N2XA 3AS0A 3SGZA 2J24A 1ONWA 3WLJA 1JAKA 1E6SM 1Q6GA 3SY5A 5DF0A 2J8TA 3AZTA 2QLYA 2X7WA 4FNPA 3PUGA 2VZVA 1B3YA 3SCUA 4N2YA 1NFPA 2J7DA 1US0A 2D69A 1F5ZA 1LL4A 2PWUA 4L64A 2E40A 3VNIA 4UTFA 4JCLA 1XM3A 3B8WA 4J3XA 3BJSA 1KM2A 4Y9PA 2WMJA 1CENA 4PCTA 2VCBA 4PUEA 4YTSA 4P5UA 1HGYA 4NHVA 5JMUA 2PLMA 2OR2A 3EB4A 2RFGA 2XPKA 2Q8ZA 4DNHA 2WCGA 2EPMX 9XIMA 4QS5A 3GH4A 4PUMA 1J4EA 2FHCA 2OELA 2F9RA 1A0CA 2YX0A 2OX1A 5EMLA 3WFZA 5DQPA 3ZFHA 3DC8A 2I7GA 4FA3A 1JDFA 4UTHA 4O53A 3PPFA 4F2TA 1UB3A 5C2XA 3MDWA 4JTGA 3VGGA 2Y1HA 3AXHA 3PR2A 5DY3A 1XKJA 5FEPA 2VFHA 2HRWA 4QNWA 1SW3A 1GYNA 4ONVA 4ML4A 3WUEA 3KZPA 1V6VA 4JTQA 2ZZ1A 1E43A 1KLZA 4O11A 4Z1CA 1CW2A 2BY2A 1BWKA 2D2OA 3GH7A 3NL2A 1XH0A 3WF2A 4WJ8A 2XIJA 4WQ6A 2H90A 1B5TA 1X96A 1WOAA 4G5DA 3MI6A 5GNYA 1FKXA 2INEA 3MBDA 1MZHA 4PC8A 5AOUA 4DWSC 1ML1A 4HK5A 4S3JA 1TUFA 4XZIA 1AQFA 1WZKA 5BCAA 4W5ZA 3I68A 4OIFA 3I3BA 2G3JA 2VDHA 1US3A 1XRFA 4L5ZA 3BCDA 3V5OA 3ZO9A 2CCRA 2DSWA 4PBGA 3CAVA 5BMXA 1PAMA 2ZUSA 2YZRA 1X7IA 5C70A 1U83A 4TR9A 1H62A 4HHHA 1GHSA 2J79A 2XH2A 4QX4A 2QUNA 3W28A 4E2VA 5CPQA 1MEWA 4TMCA 1ZLPA 1LP6A 4OV9A 2XVGA 3WELA 3HBLA 5CZJA 1FWCC 3MJYA 3AIVA 2HEJA 4ECLA 4Z0SA 4LYQA 1NH6A 2Y5JA 4PMYA 2X1IA 1U5JA 3F5LA 2JFEX 2DZWA 1S1RA 1ZBWA 2FGBA 1SGJA 4GVFA 3FNDA 3N4AA 2VMFA 1J12A 2Z0IA 4GH3A 1IT0A 4PZVA 2VGFA 3ABOA 3GXIA 1ZL1A 4MWAB 3WQ5A 4CQAA 2BGNE 3MMTA 1PS9A 4M80A 3LPPA 1S2CA 1QNPA 4LYPA 2CBJA 3CUGA 1J5SA 2QJMA 3UG5A 3BAYA 4Q8OA 3B8DA 1D7KA 2DV0A 3PSWA 2C13A 4MKVA 3K4AA 2PRHA 4Z0JA 2DVTA 1QNOA 2F6KA 4DPQA 3P80A 4K1GA 1A49A 2BXZA 1EJ7L 2CU0A 4HZ6A 4UMAA 2ACRA 4UTUA 3M6DA 5CJ5A 3IUIA 4O0ZA 3THQA 1JZ2A 3W6LA 2TSYA 1WXYA 1QRQA 3ZLHA 2DPEA 1OT2A 3ITOA 3T0DA 1CGYA 1VYRA 1YTDA 3KP0A 1RVKA 3W1QA 4JTRA 4EACA 1MMFA 3ZWSA 2XWEA 3EKLA 3AAMA 3RX2A 1GZ1A 4LY8A 1RXOB 3WQDA 1ZBVA 1V3IA 3TTEA 4KEVA 3OG2A 3GXNA 1SO3A 4NZ5A 1R3QA 2ZZ6A 2ZRZA 1UZ1A 1BYBA 3UY7A 3T44A 4J3WA 4PRRA 4RNHA 3HQPA 3NG3A 5LGXA 2IQ0A 1TIWA 3T4WA 4A3QA 3AI0A 1RR2A 1XDMA 2WWDA 4RUBA 4ACZA 4YJ5A 4N9BA 1OVDA 4AF0B 3DBNA 3A4AA 3QSRA 1A5BA 4GYFA 2OT0A 3FHAA 1M53A 2YDAA 4RLIA 2G8ZA 1MW0A 3EYPA 3B03A 4UFIA 4C5ZA 3M4HA 5BWAA 4E4FA 3RR1A 3RO6A 1IYXA 5FAJA 4GINA 2JALA 2GK1B 4Y2WA 4NKCA 1AMYA 3BZJA 3R12A 1R3YA 1GVSA 5DRIA 3BCFA 3WJYA 3CEPA 4BI6A 1T8XA 4KPLA 3PSVA 3WQ6A 1W1VA 3SCRA 1E0XA 4Q7NA 4S3KA 1HO4A 1LT8A 3POHA 4HOXA 3S5OA 3V5CA 1BXCA 4E5TA 1ZS2A 2YIHA 3HPXA 4RZBA 2Z1WA 2VRQA 1OZQA 5JBEA 3CIXA 4BEUA 5EL1A 1DKWA 2B7PA 1C7SA 4RNIA 4LALA 4CEUC 4MYAA 5XINA 3DCPA 3EDJA 3WLQA 1KM1A 4NNCA 2Z26A 3WD4A 4JIRA 4ORMA 2CKRA 1T5AA 4DB7A 1O1HA 2REQB 5I3DA 4K7YA 3KL0A 4QJ3B 1UD6A 4AH7A 1J2WA 5D02A 2FPYA 5BYWA 2PU1A 4JL1A 3VE9A 1EWDA 3BSMA 3UCQA 1H7RA 4H9MA 1B3OA 3H7VA 4CNSA 4CGTA 4ZE4A 1XL9A 5FJIA 4QSHA 3W1RA 2I9EA 3L2IA 3CMJA 3GM8A 3EWDA 1GWJA 2CWNA 4N4PA 5C9WA 4L61A 4B9ZA 1P5BA 1MWOA 1FHLA 2P50A 3Q65A 3FHQA 3KBWA 2XSAA 1OX4B 3PBYA 1Q8JA 1V3LA 3UZJA 3SAZA 1G5AA 1ADDA 4AZGA 1ICSA 3HG5A 1J6PA 3E9AA 1HL9A 1R9ZA 4HIBA 4QIUA 3TYEA 3MT1A 5BXPA 2JGQA 3H8AA 2GWGA 5D8ZA 5LHFA 1CGXA 5BXRA 1RALA