1GWJA

Morphinone reductase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
374
structure length
374
Chain Sequence
TSFSNPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDWIGGDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORPHINONE REDUCTASE
publication title Crystal Structure of Bacterial Morphinone Reductase and Properties of the C191A Mutant Enzyme.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 132
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gwjA00
1ALDA 3FKRA 2ZA2A 3STEA 4LWWA 5KTLA 4PCFA 4A2SA 1H50A 2RKXA 3DBPA 3GLCA 3W74A 4DQWA 4PTNA 5ABTA 5CSRA 3GR8A 4RZ4A 2FFCA 2E5CA 1KM6A 1EWDA 2E6FA 3P5ZA 3KRZA 3WJWA 1FCQA 1L6WA 2QCHA 4R33A 4GFSA 4RJEA 1XBZA 3GNDA 3LI0A 3NOEA 2J88A 3NYZA 1EB3A 3LHZA 1FUYA 2E6AA 3SJ3A 3W1UA 5G2HA 4ZL1A 2AAMA 1K03A 1W31A 4AAJA 3BLIA 1AG1O 1GPWA 2JK2A 3D0CA 4WX2A 4ZQCA 2TSYA 4BI5A 4I7VA 1Y0EA 5EA9A 2HMCA 4A29A 2GVLA 5D33A 1JCJA 4N02A 2ZRXA 1H7XA 4JTTA 4RR4A 3GAYA 3I6RA 4FF7A 2ZZ5A 5J5DA 3W1TA 3B0PA 1OX6A 3S1VA 3PY2A 2R14A 4O8RA 3NQ6A 1EP2A 1WQ5A 3UWQA 1LZOA 2WO5A 2OT0A 1W54A 3HG3A 3KVMA 1EUNA 4WJEA 1SW0A 4PEKA 3DGRA 1XBYA 1FQ0A 3LCHA 4E2BA 3IIPA 2B4GA 1JCYA 1DKWA 3ABOA 1F05A 4OT7A 3STGA 4N9EA 2H6RA 3M5VA 2OZ0A 5DCBA 3SW6A 4UNKA 5F4WA 3DAQA 3PG9A 5KZEA 2ABBA 1Q3NA 2J27A 1ZNNA 3MYOA 4FIRA 3O07A 3DXIA 2EKCA 3C2OA 2VFHA 1N8FA 4GBUA 2Q8LA 3N2MA 1YTKA 1VYPX 4MZYA 5LGXA 1ME9A 1FWRA 2QUTA 4QSHA 4I7UA 4LC8A 1C29A 1H7NA 2ZZ6A 3HBLA 4XTDA 1AW1A 3E9AA 4P2VA 2VFIA 3NQMA 4O0ZA 2XFWA 3OVRA 2ATMA 3TSBA 3LCWA 4AMAA 3PBWA 5G1YA 3P62A 1DVJA 3PG8A 3PM6A 3E02A 3NQAA 1OYCA 3NQVA 1Z41A 3IVUA 4J9JA 3TXZA 3WJSA 4XTIA 4NX0A 3MHUA 1F5ZA 2CFFA 1TPDA 1THFD 4O54A 2A7NA 3TE9A 3CPRA 4K7VA 5I3GA 3QMTA 4ORIA 4E0CA 2A0NA 5D03A 3CM4A 1SW7A 3G3DA 2JKAA 3DFTA 1W5NA 3F4NA 1VH7A 2WQPA 2ZTJA 4JR5A 1OFQA 3MP3A 3W6YA 4POCA 3LLDA 1OFDA 2VEIA 4XWUA 3ABQA 3GKAA 5D37A 3WK1A 4UXDA 5FEWA 1R47A 2UV8G 1TJPA 3UNDA 4HN4A 5FESA 1FCUA 3CEUA 4GRSA 1JUBA 2WNNA 3O1NA 2GUUA 4HNVA 4M7TA 1GOXA 1P0KA 3MI3A 3M43A 3TW7A 2CLFA 1OF8A 3O15A 2E1DA 1VLIA 4LUIA 3W22A 4EF8A 1OYAA 4FX6M 4DBDA 1NF0A 1PVNA 3BPWA 1S3HA 3M41A 1IXOA 3ANYA 1SFLA 4AEOA 2CLKA 3G3MA 4O1AA 1HO1A 1OABA 1VRDA 3QMRA 4TIMA 1TCDA 3TQKA 1WDWA 5EPDA 2E5BA 3W2KA 5AHNA 3T40A 1I8JA 2QR6A 3EX1A 1WOBA 2G95A 4LW7A 3P81A 4EIVA 3N3MA 5DCDA 1WXJA 4H4IA 3NQGA 3STFA 3G1HA 4OQVA 3TR2A 1H1YA 1L9WA 4NU7A 3NPVA 1B9BA 3W9ZA 4BI6A 4IQLA 2DZUA 1VC4A 2Y7EA 3W1PA 1XC4A 3W83A 3LM7A 4LVBA 4A21A 4DF2A 5BMWA 1LLWA 1IGSA 4RV8A 2QCCA 3NPWA 4FNQA 3O16A 3V75A 3C2RA 3GVGA 4MJZA 3BK0A 4K37A 4DBEA 3CTLA 1FY6A 3G24A 2OJPA 4JX4A 4ZMGA 4UFKA 1D9EA 1HL2A 1K8ZA 4KFOA 2YCEA 3GXNA 3CEPA 1OYBA 1QOQA 2GJNA 4O12A 1LOSA 3P8JA 1TIMA 1VYRA 1YADA 3EX6A 1OG0A 4HNTA 5D2TA 5E0KA 1H51A 3OVQA 2A85A 1M6JA 2QCGA 3TC7A 2IQTA 1GVOA 4XBKA 4ZVJA 4IMCA 1SU5A 2E09A 1SFJA 1C9DA 4MFDA 3G1XA 1DL3A 4WD0A 5C54A 3LHUA 4FHAA 1GYLA 2TPSA 2X1TA 2CLHA 3MJYA 3G18A 5AHFA 3ATYA 1LOLA 4O1DA 5F2IA 1ZALA 2R94A 4XBSA 2Y70A 2BX7A 4HSOA 2A21A 3HO8A 4BWLC 1YDNA 5J5RA 4WZHA 2ZZ1A 5KITA 3QMSA 2W6RA 3TC6A 1SO5A 1GEQA 3DHDA 3TU9A 1P1XA 3GDRA 5CGQA 3RNDA 1QPOA 2F84A 3NL5A 2O7SA 3CIWA 4BK9A 3OIXA 4CCCA 2H90A 4LV4A 1GTHA 5F4SA 4GUFA 1K3UA 2VOMA 3BW2A 4IUOA 5EL1A 2FIQA 1PV8A 2V82A 3W76A 2VFGA 3SZ8A 4WXZA 1JRCA 3P7YA 3UXAA 4ADSA 4UTWA 2C15A 2YSWA 1P5BA 4GXMA 1QPQA 5AHEA 5K4ZA 5KZDA 1ICQA 4IMGA 1KFBA 2PRLA 1MSSA 3S5NA 3GDMA 5EKYA 3NQ2A 4FX8A 1CW2A 4LUJA 1T8XA 4K39A 3NXFA 4ZQPA 3G8EA 5HQEA 1KFKA 1LRQA 4A22A 4PA8A 3QEZA 3DFPA 1EP1A 3C8FA 1FCVA 3W86A 3RLUA 1W8SA 1LM1A 2JKEA 2XN2A 3DFNA 3TH6A 5A5WA 3M6YA 4JYFA 4W9TA 3S9YA 1E51A 2C16A 1WA3A 1AL7A 3NQEA 3G8RA 3FOKA 5K9DA 4CCDA 3IIXA 3I7SA 4DPQA 4C1KA 1LCOA 2NUXA 4LVDA 1AL8A 3JS3A 3MHGA 1ZENA 3E12A 4O18A 3VNDA 1KV5A 3M47A 1A50A 4UTUA 4LS1A 2A2IA 3BW3A 4M6PA 4MUZA 3IV3A 2QJGA 4DELA 3T7VA 4UTWC 5I3KA 1RPXA 1AW2A 1GVSA 3TX9A 4K38A 1Q6OA 1A53A 3G1FA 2J6XA 1TV8A 3STCA 5CPNA 1NVMA 4HNNA 3W7NA 3GK0A 4MKNA 4H6KA 5K7JA 3PF3A 1EUAA 4TU1A 2C0AA 2QCDA 1JCMP 1QO2A 3DHFA 3PC0A 4JN6A 4JEQA 2YXGA 3H53A 4EOUA 1G4PA 1OX4A 3NAVA 3R12A 4O4WA 8TIMA 3QRHA 2FB2A 1EIXA 3KRSA 3LCXA 4MLRA 1MXSA 4CQAA 5BMXA 3IIZA 2VFFA 3L5LA 1AW5A 2RH9A 5DBUA 3TQVA 1L2UA 3W1XA 3WJXA 5IM51 2B7PA 2V2DA 1QWGA 2QKFA 3LERA 1W1ZA 2ISVA 3P5YA 3R89A 3GDKA 3W23A 3MWAA 3MBDA 2FJKA 3MBFA 1G7VA 2B7NA 3C6CA 4LU0A 3G0UA 4Q32A 3GIYA 3L9CA 4ADTA 1YPIA 5FF7A 4UMBA 1NFBA 2I1OA 1GWJA 2DJXA 2XN0A 1FWTA 4I9AA 2Y7DA 1SZNA 2I14A 1G4TA 3VE7A 1KLZA 4BR1A 5HR6A 3L0KA 3WK2A 2ALDA 5D30A 3R2GA 3FJ6A 3L65A 1QCWA 1UUOA 5CSSA 4IMEA 2F7FA 3A9IA 4UCGA 4K8EA 5HJLA 1KM5A 4CNNA 1XBXA 4YLWA 2C6QA 4ALDA 1LBMA 1C8VA 1F7BA 4UTIA 2X1RA 3MP5A 5AHIA 2J9XA 1SSGA 3L68A 1RR2A 1GJPA 3HGOA 4HT3A 2NXHA 1JUEA 3HB9A 1I2NA 2VFEA 2Z2UA 5HWNA 4OWGA 1EX5A 3N9SA 3W7PA 2V2HA 3SFKA 4WQ6A 3DZ1A 3WFAA 3HPSA 3EKLA 4CQ9A 2VELA 1OK4A 1HFBA 1LDCA 2DZWA 2YDAA 3HG4A 2Y89A 5LNWA 2X1SA 5DBTA 2DZSA 1VHNA 4Z0SA 4HSNA 3CLMA 4RLIA 3NQFA 3TAKA 2ZZ3A 5HUOA 4UFMA 4RZ5A 3RU6A 3C52A 2NWSA 2YZRA 1LRNA 3TK7A 2DU2A 4OU1A 4AHOA 4MY1A 3E0IA 3S1WA 5AOUA 2NX3A 5FEXA 4DXVA 4Y96A 5KSWA 1FWSA 1M7PA 5EBUA 3FYOA 2X16A 1W3IA 3HF3A 4NXSA 2QDHA 4O53A 2DZTA 3QF0A 3FIGA 4UTJA 1X8FA 2GOUA 1H7WA 3BARA 1SO3A 3L5MA 2VENA 4AHQA 1KM3A 2H3DA 4BI7A 3FS2A 3P60A 3LTSA 4TMCA 5C6MA 3IRDA 3SI9A 1FXPA 1M7OA 3W07A 3NVTA 4MLJA 4MFEA 4ZQRA 4CCEA 1XKYA 4JY9A 3NQ8A 2QAFA 3WJYA 4IOTA 3SR7A 3QPZA 4WOQA 4FNSA 3JR2A 4G1KA 4ZQMA 3DI1A 4CQ8A 1MEIA 1ONRA 2V8ZA 3THAA 2ZZ4A 3S5YA 4L4MA 3L2IA 3BG5A 1EP3A 3W1QA 3LXBA 1GVFA 3A21A 1VS1A 2PRMA 3KXQA 3M5ZA 1QMLA 4PL2A 4U4MA 5LGZA 4JTFA 1W5MA 4IGHA 4RZ6A 1O95A 2WOQA 4CNOA 5DY2A 4OHQA 1LBLA 2VFDA 5D2VA 5LNSA 3S1UA 1XI3A 3GXTA 5LZLA 3H55A 4E38A 3C4UA 5CPMA 1BTMA 4M19A 2CZ5A 3QH2A 1I2RA 1LRTA 4DO4A 2CWNA 1K02A 3TDFA 3R5EA 3NL2A 2VXNA 4Y9AA 4O19A 3W1LA 3GB6A 2NWRA 2YW4A 2FTPA 3GR7A 3HIJA 1X1ZA 3PS7A 3QSRA 4Y6GA 4UUIA 3QC3A 5L9FA 3QJAA 1VYSX 4KFPA 1CX9A 1PCKA 3P67A 1SR9A 2ZRWA 5F1VA 3PWAA 3W7LA 2A7RA 4FXSA 1H1ZA 2P1FA 4K7YA 1W3NA 4AB4A 3NZ1A 1GT8A 3M5YA 3TAOA 1W56A 4R7JA 2V0TA 1I4NA 1F76A 1TYGA 3PB2A 3NZRA 2KZHA 1R2RA 2YFOA 1VJIA 4DPPA 4LC6A 1H5YA 4UTLA 5D2YA 4R53A 1Z44A 5CPLA 3W72A 1R46A 2QJIA 1TREA 1T96A 1QPRA 2TMDA 3GNNA 5HWJA 1PS9A 4OE7A 3HG5A 1VHCA 1ADOA 3LI1A 5KZMA 1XXXA 3LXCA 1JCXA 1O60A 2PE4A 3MP4A 3TQ0A 2EGZA 1UASA 3NG3A 1PL9A 1XDMA 3TKFA 3PUEA 3SY5A 2ZFAA 2C18A 2GVGA 4O15A 1W0MA 3M1ZA 2CZEA 3PVFA 4QAIA 3W7DA 1B4KA 4UFIA 3W2MA 3WJZA 1AK5A 3P82A 3G1SA 5G1TA 3W84A 1ZAHA 1XBVA 3I65A 4Z1DA 1YTDA 5AC6A 3DKLA 3RFAA 3BLEA 3G22A 4Z1CA 4PODA 4WY0A 2C13A 5FF2A 2ZA1A 4XUGA 1XL9A 5I3JA 4NT0A 1OFBA 3W71A 3WK0A 1M5WA 5FF3A 1ME7A 1TPC1 3Q94A 1I45A 4UTMA 1EA0A 2Y7GA 4JTUA 2Y62A 3TXVA 4JDYA 4LNYA 3O6YX 3EWZA 3ELFA 3A5FA 3W7HA 4BWLA 7TIMA 1RV8A 4AXKA 3TIMA 4YWIA 3FYPA 4JTKA 4YMZA 4Z1AA 4NNAA 3ABRA 1ML1A 2CLIA 4MPQA 5D2WA 5D2XA 3U6WA 2E68A 3ZS4A 4IPIA 3TMLA 1TB3A 5EY5A 3KOFA 3ZWTA 1TTPA 3CT7A 4HPJA 3B4UA 3W1MA 1VLWA 1QOPA 3HGSA 4MOZA 1FCBA 2BWGA 2P0OA 2X30A 3O8AA 1TPH1 1PIIA 1XUZA 5K4XA 2JGQA 4PFMA 2TRSA 5DN1A 1O5XA 3Q2DA 1KM2A 3TUUA 3I7RA 4EF9A 3DFOA 1H63A 4NJGA 3C56A 4A3UA 2XN1A 1GVRA 3LCFA 3TCEA 4UR7A 1W5PA 4AWTA 3UWWA 1ZHAA 4HKPA 4IXXA 1JUKA 1K7XA 3PSWA 1K7EA 1ZFJA 4JNMA 2WSQA 3L21A 1TTJA 1VCVA 5C5YA 3N34A 5LHFA 2H3BA 2TYSA 1Q6RA 1QO5A 3THQA 1PCWA 3UZJA 2A1YA 2ZTKA 1SPQA 1VZWA 4K6AA 3O6DA 1RZMA 1H7OA 2Q8ZA 3LB0A 4K8HA 2AQWA 3TW6A 4UIOA 4RXGA 3NQCA 3G1VA 4FO4A 4NVTA 2I9EA 4O1BA 3BO9A 2A5HA 4JS3A 5H2ZA 1Q45A 1DOSA 3KRUA 3U8GA 1R2SA 4GWEA 2WNZA 4JTGA 1UBSA 3OG3A 4DO5A 2WNQA 4AHPA 1FXQA 3LXAA 4S1FA 4WXYA 1VR6A 1NEYA 3T78A 1G69A 5KMYA 4OBTA 4QITA 4AF0A 4YXGA 3C2FA 2GPTA 5G4EA 1TRIA 1D3HA 4O10A 3W7OA 4N4PA 4KWWA 3PUDA 3O6CA 3MMTA 4JX6A 5LHEA 2NUYA 3EWUA 1FWNA 2NUWA 1YDVA 1LORA 4UMAA 3Q37A 5K3VA 3TV8A 1JULA 5E1QA 4IMFA 2VEPA 5D02A 3ZFHA 5C2XA 4ONVA 4MZ8A 3DU0A 3EEGA 1Z48A 1KM1A 3OA3A 3CHVA 1VCGA 3B04A 2YX0A 1VCFA 1J4EA 1DBTA 4ICNA 2A6LA 1QAPA 1DQXA 4O13A 3P8IA 4Q33A 2CLEA 3SGZA 1N55A 1TPB1 4O28A 2RDUA 3DKJA 1OX5A 4NJHA 3USBA 4L4LA 4Z0JA 3A24A 1QFEA 3V1PA 1DQWA 2ZQ0A 3NM1A 3A22A 4AH7A 3P84A 3UD6A 4JTIA 3UWZA 4LS2A 4ORMA 1K8XA 6ALDA 1K7FA 5D09A 4P61A 4CNPA 5CZJA 4N9CA 1A5BA 4RXFA 3PB0A 1J2WA 1KFEA 3ZWSA 1TQJA 5AYZA 1W5OA 2ZRVA 4ZQNA 4N2YA 2VKZG 5LKYA 1JCNA 1JR1A 3M5XA 4IJBA 2DP3A 3NDOA 5I3HA 3IVTA 5DELA 1YDOA 3EWWA 2ZCGA 5TBOA 1TPVA 4MY8A 4PH6A 4XKYA 2C14A 1P0NA 4CLMA 3LHWA 5CZTA 3W7EA 2QAPA 2ZRUA 3T55A 4UNLA 3PSVA 4UMCA 4O1CA 1MEHA 5D04C 3UPWA 4GUIA 3EXSA 3C3NA 1RQEA 4EWND 2J24A 2Y7FA 2NXGA 1WV2A 1TQXA 3MO7A 2Y63A 5DY3A 3HGJA 1RQHA 2NXIA 4GUJA 4WOZA 3CWNA 3UWYA 3IGUA 3NQ7A 3TMQA 3WK3A 4KWVA 3W7KA 3PBUA 4LVGA 2QCLA 1X1OA 2CLLA 3VE9A 2DJLA 3YPIA 2V2CA 2PCQA 4TR9A 1ZCOA 1D3GA 2OT1A 2FDSA 1V7YA 2X2GA 3CWOX 3HJZA 2OCZA 3LHYA 1WBJA 3VI2A 2W0UA 1FDJA 1KM4A 1T99A 4M6QA 1J5TA 3M16A 1L6SA 5T26A 4MYAA 4JDBA 4DEFA 4X3ZA 1O5KA 2E6YA 3GKFA 4O0KA 1UCWA 3PBYA 2GQ9A 3W75A 1JQVA 3KFTA 3DI0A 3BG9A 3LLFA 3HMJG 3IGXA 3W7GA 4NNCA 2AGKA 5HMSA 2RDWA 1YYAA 4O57A 1IF2A 5K2ZA 2FPVA 4PC8A 3NL3A 1F6KA 3A5VA 3O05A 2VEMA 2DZPA 4HHPA 5TIMA 1YTEA 5FF0A 2E6DA 4FEZA 4M6VA 3N2XA 3TFXA 3G1YA 3FFSA 4D2JA 2Z6IA 1IIHA 4IXHA 4JX5A 4NNBA 3NPXA 5DCEA 1RVGA 1UUMA 4MVAA 5BRBA 3DENA 1SZEA 3MI2A 4AF0B 2Y88A 4Z1BA 1DORA 3LHTA 1OJXA 5DLCA 4M7SA 4UR8A 2DZVA 3BVJA 5F4XA 6TIMA 3TSDA 3C0JA 4AVFA 4NJKA 4YCPA 4NJJA 5D32A 2RHGA 4ADUA 3QQ0A 1KW1A 1X7FA 5EYWA 4H3DA 5HNRA 2QCFA 5I3IA 3MW7A 1PHWA 3W2LA 5CKSA 1DV7A 1LROA 2CZDA 3L0GA 1ME8A 4QM1A 1TTQA 2CU0A 3FEMA 1GVQA 1V5XA 4GC4A 2WJZA 3GX9A 5I3FA 1ZJIA 1TTIA 2QCMA 4GNJA 1KBIA 1LBFA 1LLZA 1H62A 3C2VA 3QW4B 3PAJA 2C1HA 4NZJA 1EPXA 4IX2A 2Z1BA 1LP6A 1FDZA 3QFEA 4JTEA 3HPXA 5U7SA 1L6YA 1OFOA 2YGYA 1B3OA 2G97A 4FNPA 1S5WA 1SO6A 1SUXA 3W73A 3LTPA 4JICA 5E93A 1FX6A 2A6NA 4N6EA 1SZFA 3LRLA 2FQIA 1G6CA 2LLEA 1TPEA 2OMAA 2CLMA 5CG7A 3B05A 3LOTA 5F2MA 1WOAA 4IWWA 4BF9A 4JYDA 5F2LA 3KAOA 3QM3A 3TNOA 2QF7A 5KINA 3W7JA 4LS0A 1Q6QA 3KVKA 2Z6JA 2V5BA 3NNTA 4QNEA 4O52A 3MYPA 5GVJA 4B5NA 2QCDB 3F03K 5HUPA 3UWUA 2ZRZA 3BGJA 3M7WA 4ZQOA 1BWLA 1H7PA 1KTNA 2FPTA 2PRHA 3BLFA 3N9RA 4XKYB 1BWKA 1PHQA 1B4EA 1R30A 3H54A 4IMDA 3T4CA 1OX4B 1KLYA 3VKJA 4ML9A 1YXYA 4WY0F 3IEBA 4NX5A 1W3TA 5FEPA 1ZAJA 4LTSA 2FPYA 3P61A 1NAL1 5LNUA 3TJXA 1BKSA 2JKPA 2ISSA 2C19A 2QDGA 4MY9A 2V9DA 2Q3OA 2WKJA 5HINA 2FLIA 1ICSA 1OFAA 4QQ3A 4JD4A 1TPUA 2Y85A 3B0VC 1GQNA 2HS8A 5LSMA 3FA5A 3LDVA 4O14A 5H91A 4UTTA 1DJQA 1A5SA 2WPBA 4X9SA 3UZ5A 4GE8A 1FWWA 2Q3RA 2HTMA 1EWEA 2CW6A 4GUGA 5HR7A 4FX7A 4GJ1A 2NV2A 1HO4A 1RQBA 5G2WA 1TO3A 4S2BA 1IXQA 2RFGA 3W2NA 2D73A 3INPA 5AYXA 1TV7A 1VPXA 5IBXA 1H7RA 1KFCA 4E2DA 2YR1A 1KM0A 4XQ6A 3EXTA 2C3ZA 1XM3A 3N14A 4FNTA 4C1LA 2PURA 1OFPA 1KFLA 3KVJA 1LYXA 3PR2A 3N19B 3P80A 4JTHA 4LRSA 4JY8A 4HPXA 3NO5A 4S2CA 3CU2A 1I2QA 4O16A 1I2PA 3HPZA 3E96A 4Y90A 4JYEA 3TROA 3GDLA 1WX0A 4GUHA 5D05A 1GYNA 1H60A 3TA6A 1KTBA 3F1QA 4JIQA 3HQ1A 1R2TA 1U83A 1YLVA 2QCEA 3P74A 3DFSA 1F6PA 4TMBA 4UTTC 2WSRA 3O06A 2A4AA 3GYEA 4QJ1A 3IIVA 1GG0A 4U28A 2QUUA 3UY7A 1KA9F 1U5JA 4TX9A 3NEVA 1I2OA 3NPUA 3OEXA 3KVLA 2NLIA 3MHFA 3NM3A 5AFDA 1G67A 4WUIA 3R13A 3SECA 3ZR4A 1TPFA 3LCLA 4N6FA 4UFHA 3S1XA 1O94A 5DXYA 5AHLA 3QZEA 3UY8A 1Z42A 2BTMA 2ZRYA 3S42A 3W2JA 3EXRA 5IBXC 1XDLA 4UFJA 2E77A 2GVJA 2JBMA 4Y8FA 3K30A 4ZZ9A 3GXPA 4DF0A 2A7PA 5HWMA 3W2UA 2EF9A 4UTKA 1GZGA 4XZ9A 3S5ZA 1JJKA 3EX3A 3LGEA 5LNRA 3OHIA 3BGGA 3LTYA 4FXRA 3SSJA 2X1UA 2G96A 1AMKA 1OF6A 3ATZA 2BSLA 4OV9A 2PC4A 3RMJA 4MYXA 1QR7A 3BW4A 4O17A 1MEWA 2ATSA 4N9DA 3EWBX 3EWYA 1KFJA 4PL1A 3TJLA 2EPHA 3G1DA 5SWUA 2DORA 2GQ8A 2Y6ZA 1YXCA 4DF1A 1A5CA 1ZY9A 3VCRA 4AWUA 3TSMA 4JTJA 2P10A 4RCXA 3Q58A 1WBHA 1DJNA 4FB7A 3A23A 2H8ZA 4FNRA 3S5OA 3IVSA 1N7KA 2QUVA 1EEPA 1TJRA 1KV8A 4MZ1A 4X22A 4LT9A 3QSTA 2GJLA 3RF9A 1IXNA 4Z08A 3W70A 2Y61A 3KHJA 1Q6LA 1G7UA 3G0XA 3TFCA 2B7OA 5G4WA 3S8HA 1LTDA 3QYQA 4HIBA 1OFRA 2EAWA 3W3OA 5AHMA 4KFNA 3S0CA 3MI6A 3DH7A 5K9XA 1XUUA 4O4VA 4A2RA 1GTEA 3M44A 2CLOA 2R91A 3F4WA 1HG3A 3M9YA 3EB2A 1OHLA 4O50A 4YCOA 2R8WA 3GAKA 5CZ0A 5AB3A 3NGJA 4Q4KA 3C2EA 4M5PA 1JCLA 5CZSA 5LNVA 1KTCA 3SGUA 3W85A 2QCNA 1XFBA 2DZXA 5AYYA 3T44A 3QPYA 4AWSA 5EMUA 3LBCA 4NQ1A 1HUVA 2E5DA 1W37A 3OVPA 5BW6A 4EVZA 2BLEA 1TV5A 5C55A 5K9CA 4NZFA 1K8YA 5U4NA 1SZGA 4DO6A 2CZFA 1UJPA 3CIXA 5F2GA 3G0SA 2ZZ2A 2J9ZA 5AN7A 1OFEA 4QIUA 2V30A 3HOJA 4OV4A 5FI8A 4OGZA 5FEZA 2J9YA 4LVFA 5BNKA 1FBAA 2VEKA 3FLUA 3LV6A 3W88A 1WAUA 4HNUA 4JTLA 4RX0A 3EX4A 3FJLA 3MUXA 3VFLA 3LRMA 3I7QA 4YL2A 2O7QA 3C61A 3W87A 3B0UX 1W5QA 3S6DA 2BZNA 3RLVA 2BXVA 3L0NA 2YYUA 4UTHA 3LX9A 3LRKA 4JTSA 3E49A 3PBVA 3GDTA 4JGDA 2G5WA 1CI1A 3IIOA 4WY0B 2Z0IA 4IX0A 4FNUA 4UC5A 4N9BA 3QQ1A 2WV8A 3LCIA 4QNWA 2YFNA 3B8DA 3JRKA 1T0OA 1PE1A 3LV5A 1IIGA 1NSJA 1O4UA 2ZBTA 3UYCA 2YPIA 1F74A 3QW3A 3R8RA 4JXCA 3AJXA 2EHHA 5G2IA 3W1RA 1SO4A 3W1AA 1QNVA 2WSYA 3B06A 4NXKA 5G5IA 1B57A 1FDYA 2NX1A 4LRTA 1IXPA 1G4SA 3RK8A 3AO0A 4JIPA 2ZDRA 4QISA 1OVDA 3N73A 1WYIA 4UFLA 5DXXA 3BV4A 3CC1A 5CPOA 1GG1A 5L6UA 2OX1A 3IGSA 4LOCA 2JGYA 4FIQA 1G4EA 3O63A 4LV9A 4N4QA 1JQXA 1HTIA 3I68A 4TO8A 5AC7A 4K36A 3CB8A 1JRBA 4R34A 3L66A 3GZ3A 1SQ7A 1VGAA 2FB3A 3LBMA 3HG2A 3SIZA 3NL6A 3NQDA 1XCFA 3NA8A 2B0MA 3U2OA 4BFAA 2W79A 3W7RA 4LY8A 3UXDA 4RK8A 2NZLA 5MHBA 2RDTA 4NUWA 1QPNA 3UQNA 1SSDA 3LHVA 1BEUA 2YW3A 1RD5A 2ABAA 2VC6A 3HGRA 2B7QA 2QEZA 3UPBA 4MJMA 2ZZ7A 5TQLA 5A8GA 4O11A 2QJHA 1TMHA 3UWVA 1UB3A 1SW3A 3W7IA 1F2JA 1VQTA 2GQAA 2V5LA 1MZHA 1X6UA 3FKKA 4KKXA 4NJIA 1S5VA 3BG3A 4X2RA 4MIMA 3W7MA 2ZA3A 1A5AA 2ISWA 2YYTA 3L5AA 2NV1A 3B03A 3DFQA 1S5TA 1F73A 3LCGA 3PULA 1LOQA 3M0ZA 4RKAA 5D38A 1DHPA 3CQ0A 1H61A 2HS6A 1TRDA 3EX2A 2V81A 5F1UA 1YPFA 5HULA 2NX9A 3W7CA 3G1AA 2ZYFA 3W1NA 2H8XA 1MO0A 1JVNA 1P4CA 3NR0A 5AC8A 3OBKA 1KBJA 1TSIA 4LVAA 3EKZA 1ZAIA 4IPJA 1YXDA 1QDSA 1NF7A 5FF4A 2HSAA 3KX6A 4I7WA 1TPWA 1ICPA 1OK6A 3EWXA 3PUOA 5BOOA 3ABSA 3W7QA 3L67A
chains in the Genus database with same CATH superfamily
5IXEA 2W66A 3STEA 5KTLA 4UQBA 3DBPA 4GI6A 1TX2A 4D6FA 4DQWA 1VFOA 5ABTA 1CXKA 5T9CE 2FFCA 4QJ4B 1KM6A 1EWDA 2DUAA 2E6FA 4M82A 1AQFA 1DTNA 1L6WA 5E6YA 2J88A 1EB3A 2V67A 3QFWA 3AIBA 1AD1A 3SBFA 3SJ3A 1B3YA 3W1UA 3R11A 3W0KA 3VM7A 4JQ3A 1RBOB 3CV6A 4ZL1A 2AAMA 1K03A 3KOZA 4TV6A 1AG1O 1GPWA 1EJVC 3B3DA 1Y0EA 2HMCA 3TP4A 4A29A 2GVLA 2WZHA 1UWUA 1H7XA 2WMGA 3I6RA 3RCYA 5E5CA 4Q4RA 1P7TB 4I5XA 4KGJA 5CC6A 2R14A 1EP2A 5I00A 1B3ZA 4HB7A 1BQGA 1HKKA 2OT0A 1W54A 3D46A 1EUNA 4YHGA 1SW0A 2YBVA 1K70A 2YL9A 1XBYA 1FQ0A 1PZ0A 2B4GA 2IPJA 2HRWA 2Q01A 1DKWA 4R9OA 3RRXA 1QTWA 3ONBA 2WVUA 3SW6A 2BB0A 3PG9A 2FJUB 1Q3NA 4ASTA 5KETA 4GISA 2OYLA 1TJ0A 3URQA 3VIOA 4AVNA 2EKCA 1MW1A 5KZ6A 1N8FA 2J75A 4IIHA 4GBUA 2Q8LA 3N2MA 3IS4A 1TZ9A 1YTKA 6PTDA 2W61A 5LGXA 4QSHA 3QGAC 3ARXA 1NWUA 3U5UA 4XTDA 3RX3A 3HBLA 2CEQA 1AW1A 2F9RA 3OVRA 1ZTVA 2J25A 3OOQA 5G1YA 1DVJA 3PG8A 5A8PA 4QTGA 1RAKA 1PTGA 3NQAA 1MW3A 1OYCA 1PKYA 2ZOXA 1E3XA 1TPDA 1XH1A 3AHTA 5I3GA 3UCCA 4ZSTA 4E0CA 4GH1A 5D03A 2AL2A 3CV7A 3VMPA 3G3DA 3F4NA 4C7FA 1VH7A 1XIJA 4JR5A 1AZ1A 3LY0A 4POCA 1ITCA 2CPUA 1OFDA 3ABQA 3VABA 3WK1A 2CC0A 4W7WA 4HK6A 3DN5A 4HN4A 4D8LA 3SUVA 3ARWA 4GRSA 1JUBA 2EEXA 2WNNA 3CAVA 4M7TA 1CTNA 2QIIA 1JEZA 4GGHA 3TW7A 4BEQA 3OW1A 2XJ7A 2CLFA 1M3UA 2WJDA 3W22A 3O0KA 3STPA 1NF0A 2J13A 3BPWA 4KF1A 1CECA 5ENLA 1UH3A 3KEHA 3TJ4A 3VIFA 2GGGA 4H6RA 2RJGA 3ZJ6A 4LYPA 2XFYA 3BSHA 3EX1A 2G95A 3WNPA 1XCWA 3U0HA 3PZ9A 4CEXC 2D24A 3G1HA 4BQ2A 3TR2A 1L9WA 1XISA 3CUFA 3NDYA 3NPVA 4YS1A 1VC4A 2Y7EA 3AHXA 4MNMA 3PANA 4QXIA 1VJZA 5BMWA 1AFSA 1LLWA 2CBVA 3MVTA 3GM8A 2OSWA 1IGSA 4X61A 2QCCA 3NPWA 3O16A 3V75A 4MJZA 1FY6A 3I3DA 1LL7A 2OJPA 1HL2A 3K8KA 2PF8A 2PDXA 2D2JA 1BPLB 4C90A 1AH4A 1YADA 4LEQA 5D2TA 1GZ1A 1D7KA 1W1YA 1QHPA 2VOTA 2G4JA 3B97A 1QNRA 1GVOA 4ZVJA 1UR1A 2E09A 4MFDA 4U2ZA 2WAGA 1DL3A 4WD0A 1GYLA 1UA7A 2CLHA 3G18A 5AHFA 4X0VA 4XO7A 4NIRA 2Y70A 2I7GA 2PLCA 3H24A 3QHNA 1Z6KA 3WQ8A 3VMOA 5J5RA 4WZHA 4QROA 3TU9A 2ZXBA 3RNDA 4JL1A 3B8UA 3NL5A 2O9OA 2V68A 3QV7A 1J18A 4CCCA 4HOZA 1W9PA 1K3UA 2VOMA 4B92A 3SZ8A 1AH3A 3P7YA 4E3TA 8RUCA 2C15A 1SZRA 4H8UA 1M68A 4E3VA 1RK5A 1E6XM 1JNDA 3CZ8A 2ICSA 1KFBA 1B54A 3ARYA 2CBIA 1EHAA 2VRQA 9RUBA 2JF6A 1KBLA 3H26A 1EX1A 4LUJA 4P5UA 3G8EA 4W4QA 4ATLA 1IYXA 3QEZA 3DFPA 1EP1A 1R3VA 3CHFA 1FCVA 2PWFA 1LM1A 4GZEA 4IFKB 3WDRA 3TH6A 4EANA 5A5WA 1C93A 1ZBWA 4FF5A 3FYYA 3ARPA 3EPOA 1BRLA 1UUQA 3BH4A 3NQEA 3CUGA 3FOKA 5K9DA 4TXEA 2FGLA 4IHCA 4PFHA 4DPQA 2CCRA 3EPMA 4HNCA 1PYMA 3JS3A 3R0KA 1AQ0A 4HNOA 3KDOA 5FJIA 2PGEA 4GYPA 1SMDA 3WBWA 1A50A 3GO2A 4D6EA 3WF0A 2R1LA 4C7DA 4GI4A 4S3EA 1AJ0A 4MUZA 1S1RA 1V77A 3ARRA 1HKJA 1TWDA 4U2YA 5CSUA 6XIAA 1GVSA 2VRJA 1A53A 1J0YA 3UWEA 2WXDM 1XYZA 3W7NA 4MKNA 2GUBA 4IL2A 1US2A 4RL3A 1EUAA 3N4EA 4D9PA 3ITVA 4MG4A 1V6YA 2QCDA 1NP2A 3PC0A 4JN6A 4RDVA 2BS9A 3T1GA 1IEWA 1GQIA 3R12A 4CGTA 3W00A 3ZVHB 4MLRA 4H1ZA 3VXGA 5LXXA 3IIZA 4E2VA 2XIJA 3EOOA 3L5LA 2WJEA 2GK1A 1VEMA 3D47A 3DFHA 5E0FA 5I24A 3CAQA 5IM51 2XH4A 4MAVA 5CLWA 2V2DA 1QWGA 1IWAA 3GE7A 3P5YA 4G56A 1D8CA 5DMNA 3MBFA 3USZA 1G7VA 2B7NA 3DX5A 5AVHA 3G0UA 3UG3A 3L9CA 1R7AA 5BOFA 3SUTA 1WZLA 4Y7EA 1YPIA 2XN0A 3WQ5A 5CPQA 3WLKX 3N6QA 2I14A 3VE7A 3BICA 2G3NA 3WMCA 3L0KA 3WK2A 3DFYA 3FJ6A 2CNCA 1UBPC 4R85A 5CSSA 2F7FA 4K8EA 4HZ8A 1XBXA 4W84A 1LBMA 1BTCA 1S2TA 1EJWC 1ENUA 1VIZA 2FFIA 1RR2A 2OLHA 4MWAA 1JCTA 2VFEA 4FXJA 6REQB 2PU1A 5HWNA 4M3PA 4OWGA 1EX5A 4GK8A 4HU8A 2A3EA 4I9TA 4DBUA 3HPSA 4DJDC 3K8MA 4LAKA 4ZXOA 3UVAA 1OK4A 1HFBA 2DZWA 1E55A 3IUIA 4FP1A 4YYFA 2Y89A 2ZX5A 1F3TA 2X1SA 1GOKA 3CLMA 1HL8A 2ZZ3A 1SJCA 1Q6FA 3SADA 4RZ5A 4B15A 4MHBA 1A4LA 3KCJA 4ACYA 2MNRA 2DU2A 4OU1A 1RCXB 1BF6A 1AJ2A 4I5RA 1ZP3A 1XYMA 3E0IA 2G41A 5AOUA 2NX3A 3E74A 3VKDA 5EMMA 1M03A 4DNHA 2UZ9A 3PZUA 3THDA 3GH4A 4UTJA 1UZ4A 2PZ0A 2CKRA 3BARA 1SO3A 2ZX8A 5H8UA 4Q4SA 5C6MA 3IRDA 4C1NB 3SI9A 1Q8JA 2GZXA 5M17A 4DZIA 3NVTA 4MLJA 4AMCA 2UWFA 4Q3MA 4Z2HA 4JY9A 3VKBA 3WJYA 3QPZA 3A4JA 1X6NA 4ZQMA 2ZC8A 2NQJA 1QHZA 2FZNA 1XG3A 3L2IA 3BG5A 3AS1A 1CGUA 3LXBA 3PNUA 3ZIZA 1GVFA 3UJEA 3IJ7A 3RXZA 4ICCX 1KB3A 4PL2A 4HMEA 3WNNA 2D0FA 5XIMA 2WOQA 4OHQA 3KOWA 1LBLA 2EPOA 1XI3A 5A6SA 3APYA 2HK1A 1PX8A 4M19A 4PMUA 3WD2A 2CWNA 3NL2A 4GZJA 4TOQA 2NWRA 4Y6GA 3CS2A 1QATA 3BCJA 1MQRA 5L9FA 3QJAA 4KFPA 1CX9A 1SR9A 1HF6A 2P1FA 2D2GA 3KWSA 1E4MM 4YTTA 1QXLA 4A6GA 3NZ1A 5JBDA 4AIBA 2YCKX 1W56A 1V02A 2V0TA 3CXOA 1XR2A 1TYGA 5EU9A 2XGZA 3NZRA 1YQ2A 2X7VA 5DFAA 3THCA 1VJIA 2OB3A 2QW5A 2EPNA 5I02A 3PHAA 2J8GA 2GDUA 1Z44A 3SN0A 2ZWZA 3BGAA 1VJSA 1FTXA 3T0BA 2DSKA 3FDGA 1W1IE 4HTBA 1PS9A 5FSEC 4OE7A 3PK7A 4J1OA 1G5AA 3LI1A 5KZMA 3OB8A 3LXCA 4ZOBA 7REQB 1O60A 4RPPA 1HX0A 2EGZA 3COTA 3VNZA 5DMYA 1PL9A 1XINA 3I3BA 1AA1B 4GCAA 3KTXA 4WJ8A 3AIVA 3LZ3A 3W7DA 4QCFA 3KBMA 2YLLA 5G1TA 3UCDA 1ZAHA 4NY2A 5AC6A 1DPMA 1YTDA 2BVTA 3TW9A 4Z1CA 4PODA 1KR0A 4XUGA 5I3JA 4NT0A 4DX3A 1M5WA 1I45A 1J0IA 4JTUA 3TXVA 2VC7A 2YB1A 2OZ8A 1EDTA 1REQB 4YHEA 2FMOA 3H2OA 4BWLA 3PNZA 4LJ3A 4AXKA 3TIMA 4YWIA 4JTKA 1ONEA 1Q7ZA 1ML1A 4AZCB 5D2WA 5D2XA 5GNXA 1JYVA 4IPIA 3TMLA 5EY5A 3ZWTA 4FI4A 3F4CA 1UWTA 3HFTA 1MUMA 3CZLA 1TA3A 4OBRA 3K2GA 1QOPA 4MOZA 4DWSD 2BWGA 3GXFA 2X30A 4AD5A 2QZRA 2TRSA 1O5XA 3Q2DA 4JFVA 4MDOA 3G6MA 2ZUUA 3I7RA 4MB5A 4EF9A 3DFOA 3C56A 2XN1A 9XIMA 3TCEA 4AWTA 2XDFA 1JUKA 1K7XA 1K7EA 1OBAA 4JNMA 3L21A 2I5QA 1NIUA 1ZSXA 4F0KA 3THQA 1PCWA 3UZJA 5C70A 3S47A 3UR2A 1UD4A 2YOCA 2JALA 2Q8ZA 4K8HA 2AQWA 3TW6A 1OCNA 4RXGA 1KGXA 1GKPA 4O1BA 2OEKA 3LLXA 4JS3A 3RJXA 4J28A 4US5D 2V3DA 3GC5A 5JH1A 1R2SA 2IKHA 3CL8A 3L2LA 4LY4A 1SM9A 1UBSA 2WNQA 4AHPA 2C0HA 4AC7C 2AAAA 1GZJA 3ZT7A 2NVDA 2PDGA 3T78A 2DVUA 2YL5A 1J6PA 1WKFA 3B9EA 2PLMA 3W7OA 4N4PA 3FNDA 3MMTA 3R4IA 4M6UA 4JX6A 3S83A 2HPMA 2NUYA 1FWNA 2NUWA 3FDKA 4Q4QA 2W4XA 3TV8A 1JULA 2DT2A 3Q45A 2VEPA 5AVNA 3VK5A 3WO8A 1B3XA 3DU0A 4CQDA 2AL2B 4EPDC 2VGFA 1XS2A 3E5BA 4W88A 1E70M 2A6LA 1SGJA 4K3ZA 2ZXDA 5A6TC 3P8IA 4Q33A 4MTVA 2WB5A 2QXWA 2RDUA 4NSBA 1N8WA 2RAGA 4HK5A 4AH7A 3UD6A 1FHUA 1VBJA 4NG3A 4ORMA 1KCLA 2QDEA 4I5UA 3RRAA 1K7FA 3E6EA 1ZRQA 3RU8X 4CNPA 2IXVA 1EGVA 1OCBA 1A5BA 2XU2A 4D6GA 1J2WA 5AYZA 1W5OA 4HGXA 2YCJA 4ZQNA 4N2YA 2QVHA 3Q67A 3QOKA 4R7WA 4MSSA 4GYJA 3U3HA 2DP3A 5DELA 1PX3A 1YDOA 2EPKX 5TBOA 4MY8A 4IQEA 3BLOA 2QGYA 2XIMA 3W7EA 3T55A 1K4GA 4PUMA 3VDBA 1GK8A 4UMCA 1Q63A 4O1CA 3LNPA 5D04C 2QS8A 3UPWA 4PE8A 2D1ZA 4EWND 2Z7KA 5TAOA 2Y63A 4KEZA 3GDBA 1IR1A 3RM8A 3KBNA 4WOZA 3UWYA 3TMQA 1HJQA 2WZIA 1XSKA 4LVGA 2PCQA 3GU9A 2J77A 1U5VA 1D3GA 1DJXA 2IUZA 2WBGA 2VX5A 5AECA 4G2DA 1DWFM 3HJZA 2OCZA 3GIPA 2HE8A 1Q13A 5JXQA 2VO5A 3MVIA 2QYGA 4L4OA 1FDJA 2QPSA 1FWEC 1XWYA 1R5YA 2GQ9A 3M0KA 1QW9A 3KFTA 1VBGA 2Y1HA 3W7GA 3R8HA 1E4LA 3MKKA 3H2AA 4IJRA 4O57A 2FPVA 1IZKA 1V6TA 4KT2A 4U3AA 1B5TA 1KFWA 3BSGA 4BHYA 1OC7A 2CETA 1XRFA 1GGOA 4L6DA 4HHPA 3OZMA 1D8WA 2OO0A 4L64A 4UB9A 2PU0A 3WNOA 1IIHA 2DGAA 1W3JA 1Y8BA 4UQCA 1LG1A 3UYIA 5FSDC 1NTHA 3QGVA 4JL2A 1RVGA 5BRBA 3T42A 3DENA 3KW3A 3FY1A 3LHTA 1ODUA 5DLCA 6TIMA 3TSDA 3URNA 4AVFA 4OZOA 1QI3A 4ADUA 1MW0A 1X7FA 4HYVA 1OINA 3GW3A 3ARQA 1KD0A 2QCFA 1TELA 1LROA 2OZ3A 1W2PA 2CIPA 1ME8A 1TTQA 2WWCA 5AY7A 3FEMA 3M7SA 2WJZA 1KRMA 1U1UA 3GXMA 1BRLB 2VR5A 3QR3A 8XIMA 1TTIA 2QCMA 4GNJA 1LBFA 3C2VA 2WKGA 4TVCA 3HM7A 4NZJA 4WDWA 1PBGA 2Z1BA 1C91A 3QFEA 5HANA 3AYTA 3GIQA 3HPXA 3BOXA 4JPGA 3R43A 4DZ5A 1X96A 1UZDA 3WNLA 1RLCL 2G97A 4FNPA 1EFZA 4JICA 1FX6A 1K6WA 2X40A 2FQIA 1G6CA 3AIQA 3U7VA 3B05A 2BY0A 1WOAA 4IWWA 2HROA 3H2MA 3ARVA 4JYDA 3SCTA 3PBMA 4EAMA 3TNOA 3L4VA 2Z6JA 5HATA 2VEGA 1XIEA 1PKNA 2DQXA 3NZGA 2QCDB 5HUPA 1HJVA 5IOBA 4A8LA 3VINA 3E3HA 1Q85A 1GQJA 4XKYB 2WNWA 1BWKA 3EOEA 5DX7A 1XSIA 1BWVA 1I0DA 1W1VA 1RBAA 3T4CA 2PDJA 3IACA 2AQOA 2C1IA 4XSLA 4WY0F 2XFRA 1L8NA 3SQSA 2KAUC 4LTSA 2GK1B 4DLFA 2OQLA 1BSIA 3P61A 1NAL1 5LNUA 3TJXA 1XIFA 4Q6XA 2ISSA 3BLKA 1YPXA 2WKJA 4ZCWA 3K1GA 5CGTA 4QQ3A 3GU1A 4GH3A 2Y85A 3H4XA 2FDMA 4JKMA 4O14A 1KXVA 4INFA 2HWGA 3QLDA 3CO8A 2VUYA 4X9SA 5KEZA 2Q3RA 4J3ZA 1EWEA 1LG2A 2CW6A 1CXFA 4MF4A 1F4HA 1UD6A 4C60A 4KW2A 3ITGA 1HO4A 5ABFA 1R3TA 3N2CA 3OZYA 3W2NA 1BAGA 4KRUA 4OJYA 3M0MA 1PJ9A 5IBXA 4XZMX 1I75A 5DT7A 1RJQA 2XIQA 3MV01 1JGIA 2C3ZA 4DJFD 1G1YA 3AMLA 4C1LA 2PURA 1Q6EA 1X7IA 1M41A 1W32A 4QGCA 4IUGA 1DTUA 3NO5A 1EGZA 4M1RA 3C86A 1GONA 1I2PA 3HPZA 1OZQA 2WMFA 4L9YA 4N42A 2GWNA 4GUHA 3SRFA 3HQ1A 4YTSA 2QCEA 5AYBA 1OADA 1B0IA 1L6FA 2WSRA 1DJGA 2AOSA 4ZA0A 4P8WA 3WX7A 3UY7A 1TG7A 3AZTA 4US6A 3NEVA 1OEPA 3UBPC 2OSXA 3SCRA 1QHOA 5D9MA 3OEXA 1UWAA 1UR8A 2XWDA 2NLIA 3MHFA 4PUEA 3R13A 3SECA 4N6FA 3LCLA 2BP1A 4UFHA 3UY8A 4XISA 3I6EA 4JN8A 3W2JA 1GVEA 5IBXC 5C9ZA 3WUGA 4L1GA 2E8YA 1FKXA 3PZOA 3K30A 4ZZ9A 1XYFA 2A7PA 2Y5SA 1CGYA 1RP9A 3SCPA 4UZSA 1J5SA 1ZLPA 5LNRA 3OHIA 3LTYA 4IH3A 5HA7A 1AMKA 1VRXA 2BSLA 3OHMB 2HNEA 2ATSA 3TR9A 4QDPA 4N9DA 1W9DM 4PL1A 3MY9A 5SWUA 3CWHA 3GVQA 1A5CA 3GTHA 3VCRA 3WDHA 3N4FA 4RCXA 2HVNA 3Q58A 1WBHA 1DJNA 3A23A 3S5OA 4JIRA 1N7KA 4GVGA 3W02A 2GGEA 1Q8AA 5HDRA 4G7EA 4P8UA 5DRCA 1ZJHA 3GRIA 3CUXA 4BY3A 1M01A 5HNTA 5C9RA 4Z08A 3W70A 4Q4MA 2Y61A 1N2VA 3KHJA 1Q6LA 1WXYA 3G0XA 1LTDA 4JZ5A 4LX4A 3AXIA 3V0SA 1MQQA 3BOLA 5I7GA 3W3OA 3S0CA 3MI6A 2QUNA 3TQPA 1A4MA 2E9MA 4WSHA 3MCOA 5EFDA 3JUGA 2X1IA 2Z4GA 1GUVA 3RPDA 1HG3A 3WD0A 4LCQA 1A0EA 5FIPA 2R8WA 3GAKA 4AD0A 3PZNA 1MMFA 1NARA 4L56A 5MF5A 5HK4A 2DUXA 5AYYA 5DANA 1GOQA 4UQAA 4NQ1A 4XAYA 3IJ9A 2OO6A 5K9CA 1K8YA 5U4NA 1SZGA 4DO6A 4A3YA 2CZFA 1UJPA 2W67A 1GW9A 2GGHA 1WUEA 3EA1A 2QLYA 1QJWA 3HOJA 4GIRA 4S3GA 4Y9MA 1BG9A 4LVFA 5BNKA 2OFJA 4CVUA 4C65A 3SY8A 3FJLA 3MUXA 3VOJA 1XLJA 1A3WA 3LRMA 3WF3A 1M04A 3W87A 3B9DA 4GVFA 3REQA 3S6DA 3IANA 3QY6A 3GBEA 4KPLA 2R1PA 3LX9A 1W3KA 4JGDA 3R8GA 3IIOA 2YZ5A 3U7BA 4UC5A 4N9BA 1ISZA 4V33A 2VDHA 3LCIA 4QNWA 2YFNA 3UXIA 5ABHA 1OT1A 3BJFA 2OEJA 3WENA 3N11A 4C6PA 2YPIA 1XIDA 4JIIX 3AI0A 1XV8A 3AJXA 4NXKA 3EYPA 3L2MA 2NX1A 4PTXA 4QS6A 3AO0A 4JIPA 2ZDRA 1DHKA 2WHKA 1CXHA 5DXXA 4PMDA 4Q22A 4Z17A 1TA3B 3IGSA 4GYFA 4PULA 3NDZA 1K4HA 3AICA 3KDNA 3BZGA 4LV9A 3QHMA 2D3LA 1HTIA 1IT0A 3C5QA 5AC7A 3L66A 3GZ3A 3HG2A 3NL6A 1XCFA 3NA8A 3WQDA 1T6MA 4A8RA 2W79A 4LY8A 2GJXA 4NUWA 3W27A 2FYMA 4ZODA 5CBIA 2VC6A 1FP9A 4MJMA 5T9BG 4GQGA 4URIA 1XX1A 5I09A 4UQDA 1MXGA 1GOIA 3HV9A 1IT8A 2XM2A 4JTAA 4PUDA 3GVVA 1RCOB 4CD5A 4HU3A 2PTYA 1SMAA 4ZTYA 5H8PA 5C9XA 2F2HA 4C5YA 4CQCA 1WXZA 2ZA3A 1A5AA 1VEPA 2ISWA 1VFTA 2NV1A 3DFQA 1S5TA 4Q8TA 3CZJA 3IWPA 1GHSA 1LOQA 5D38A 1E6QM 1W91A 3CQ0A 2HS6A 2X0HA 4C5ZA 3WY1A 1FWDC 3LMZA 1XLAA 1W17A 4A35A 2ZYFA 3W1NA 3AMCA 1Z3NA 3T07A 1WE5A 1MO0A 4PBEA 1JVNA 3ZMRA 3DDMA 2GJPA 4EAYA 2ZX7A 4H01A 1LWJA 2W92A 2HE5A 2OX4A 3LSCA 1NF7A 1ADSA 2XH0A 4MNKA 1TPWA 4NF7A 3OODA 1ECEA 1ICPA 3WQCA 5FOOA 3H22A 3PUOA 3L67A 2OOGA 1CGVA 1P0EA 5C7VA 1XIIA 1Q66A 4PCFA 2RKXA 3W74A 3GR8A 4XVDA 4RZ4A 4R5EA 4US5A 2OQYA 3R79A 3KRZA 3UXKA 2OR2A 3WJWA 1FCQA 4B5VA 3VCNA 4GFSA 1TV3A 3GNDA 4DWSC 3NOEA 2E6AA 2VX4A 4AYGA 1G01A 1M7JA 1XRVA 4LQ1A 2XVPA 3GTFA 1JI2A 2ISDA 4B5SA 2JK2A 1XGZA 4OOZA 5E0CA 3QTPA 3M0JA 4C7GA 5D33A 4N02A 2ZRXA 4JTTA 2YA2A 1PUDA 4RR4A 2XUCA 3GAYA 2POZA 3ZXWA 3FJ4A 3CUHA 3BLPX 4MB3A 3W1TA 4REQA 3LD5A 3S2LA 3NQ6A 1WQ5A 3UWQA 1GVYA 1YMYA 3CBWA 2XVKA 4F9JA 5I78A 1EH9A 3GS6A 4E2BA 2BNJA 3KBSA 1EA9C 4QG9A 3ABOA 1F05A 3STGA 4F0HA 4N9EA 3M5VA 1NU5A 4CCZA 2CBUA 4JFWA 1RA0A 2ABBA 2J27A 4FIRA 1E5JA 4ZOEA 4GC3A 5I06A 1QW8A 2ALRA 2FH6A 2VFHA 4WK9A 3CAKA 3UJSA 1F8IA 1UPMB 1MFUA 1I6NA 1ME9A 2QUTA 4LC8A 1UYQA 1E0UA 4PCTA 2WLYA 2VFIA 5CJ5A 2ATMA 3TN5A 4YVXA 3TSBA 4AMAA 3AU6A 1KXHA 3DC8A 4H8HA 4V27A 4F4RA 4O8AA 3E02A 2FVMA 3IVUA 2E9BA 3WJSA 4NX0A 3MHUA 2CFFA 4ERIA 1THFD 3FXYA 4O54A 4K7VA 3S5SA 1TE6A 4JTCA 3VNJA 4J2MA 4GA8A 1EJSC 2FGZA 3B9AA 1O66A 1W5NA 2OQHA 2WQPA 2ZDSA 3OLGA 2WVVA 3W6YA 4IQJA 2VEIA 3GKAA 5D37A 4UXDA 2UV8G 3UNDA 3THUA 1BYAA 4BEUA 1UD3A 3O1NA 2GUUA 1P0KA 4JNYA 1JZ4A 3MI3A 1PSCA 3F5KA 3M43A 3AFBA 1UKPA 2E67A 1OF8A 4LUIA 2E1DA 1VLIA 4EF8A 2VZTA 2I9UA 3M41A 4QJ3B 1Y5VA 2DV0A 4RNFA 1HO1A 3EB4A 1VRDA 3I4EA 1TCDA 1R3YA 2E5BA 5AHNA 4JQ2A 1BVWA 1FWJC 2O4MA 1JYXA 5DCDA 1CGWA 1WXJA 3OYZA 4H4IA 3NQGA 3S9ZA 3LQGA 4BKNA 3DUGA 4OQVA 5E9AA 1VP5A 3CH0A 2JFEX 3F5JA 1R3QA 3TJIA 4B5WA 1VPYA 1NM9A 3W83A 3LM7A 4LVBA 4A21A 2E7FA 5I07A 2Y24A 4S23A 1O68A 4NRSA 3GH5A 4FNQA 1PDZA 2D2OA 1OIMA 3ARUA 2BOFX 5G4HC 1JDFA 4H9ZA 4AD1A 4JX4A 4WGXA 1K8ZA 4KFOA 4CNSA 4JQAA 4O12A 4MADA 1H0GA 1TIMA 1VYRA 4YPJA 1OG0A 3KP1A 1H51A 4Q4PA 3OVQA 8A3HA 2R9RA 2O9PA 1U1JA 1U22A 2IQTA 3NZPA 2XGBA 4GMEA 1UD8A 1MUWA 3WQGA 3MMDA 1V08A 3LHUA 4RE0A 4AEFA 4ZB5A 3MJYA 2YL8A 1QU4A 3ATYA 4F2UA 3K1DA 4O1DA 1ZALA 2R94A 5F2IA 4WDUA 4YIWA 1KCXA 3QGKC 4HSOA 3QR0A 2DPEA 1EQCA 1T41A 2BVWA 4IZGA 1TX0A 4HYWA 2ZZ1A 3QMSA 2W6RA 3TC6A 1SO5A 1P1XA 2IPWA 5CGQA 3EZ4A 1QPOA 3CIWA 4DZHA 2H90A 4LV4A 1UR9A 4GUFA 4IUOA 3WUBA 4B2DA 2V82A 4ML4A 3B8TA 1J6OA 1WZMA 3JU2A 1JRCA 3E2VA 3GBDA 1FWFC 4WXZA 4J3TA 2DVTA 1UHVA 4UTWA 1JD7A 4GXMA 1P5BA 3EGJA 5K4ZA 5ABFB 1ICQA 3O0FA 4IMGA 3QPEA 4DB7A 3VKKA 3S5NA 2OELA 3GDMA 4QEHA 4NKCA 5EKYA 1RP8A 4PRWA 3SN4A 3PPGA 2GVYA 3DYPA 3VIMA 4ZQPA 2VC9A 2CHOA 5HQEA 1KFKA 2QJNA 3N9KA 1VFSA 1LUCB 3AUJA 3C8FA 3CHEA 1QNPA 3F2CA 1P48A 2NVAA 3PAOA 2XVLA 1UOZA 4JYFA 4W9TA 3RMEA 1WA3A 2C71A 3FN9A 3XINA 3W26A 3MUIA 3RAOA 3PTQA 2L5HA 3G8RA 3OU8A 1QI0A 4FOJA 2NUXA 4LVDA 3WQEA 4UTFA 3WD3A 3MHGA 5FJJA 3E12A 4D6JA 1V3MA 1EXBA 3ZSSA 5CGMA 4N0RA 1TIWA 2A2IA 3C3UA 2W3ZA 1F8MA 3CL6A 3IV3A 3T7VA 4EP8C 4UTWC 1POKA 3EAUA 1RPXA 1AW2A 2J8TA 5HXMA 4V1XA 4DJFA 2J6XA 1TV8A 3STCA 2W9MA 4H6KA 3E2SA 3AMDA 4BCEA 3TYEA 3M4HA 1QBAA 2C0AA 5BCAA 2XH7A 1JCMP 8CGTA 1Q4NX 1QO2A 1MWOA 3SM0A 4C6LA 4HPNA 3VNYA 4A8NA 3PPHA 1G4PA 2FB2A 1EIXA 3KRSA 1MXSA 3OQ8A 4CQAA 4CNUA 2OLAA 4D1IA 4ZR8A 3AXXA 1FA2A 1AW5A 4N7QA 1W1PA 5J04A 3AXHA 3WLQA 2ZICA 3N2OA 4KCUA 2ISVA 4GVHA 3GDKA 5CJMA 3R89A 4WF7A 3MBDA 3RX4A 3S46A 4X9YA 3L12A 4LU0A 3W82A 3GIYA 3CQIA 3VOCA 1UKSA 3KL3A 1T5AA 4G7EB 3KLLA 4I9AA 3BV7A 4NYUA 2YLAA 4X63A 1G4TA 1VPQA 4DJFC 3C0LA 1ADDA 4LPCA 1WDPA 1W9XA 4S39A 3OJGA 1UUOA 4HZMA 3A9IA 4UCGA 3SUSA 5A6LA 2HXUA 4DY1A 4CNNA 1UH2A 4C6EA 4XAPA 2C6QA 3K13A 1OCQA 2PWHA 4FALA 3L68A 1H49A 4HT3A 3HB9A 1I2NA 3UW6A 2PS2A 1EQPA 2Z2UA 4XD3A 2WZTA 3WUFA 2V2HA 3SFKA 4WQ6A 3UGVA 1ONWA 4CQ9A 4U31A 2VELA 2VUNA 2YDAA 1XLMA 5LNWA 3CZKA 2XYLA 4Z0SA 4HSNA 1TV4A 1MZRA 3BCDA 3EMCA 3RM9A 3C52A 2NWSA 1LRNA 1SJAA 1BQCA 4AHOA 4HOWA 4W85A 4MY1A 1LT7A 4GQBA 3DYMA 3S1WA 2XVNA 5FEXA 3MT1A 4DXVA 4Y96A 1NQ6A 3MUY1 1FWSA 3URBA 1M7PA 5EBUA 3N15A 5JIWA 3RHGA 1W3IA 3HF3A 4O53A 4NASA 1OD0A 1H7WA 1ZJBA 2VENA 2OSYA 1XKJA 2XG9A 1CBGA 4TMCA 3P60A 3LTSA 3ZR6A 3REQB 3UNTA 2C8NA 1K9TA 1XLIA 1DIEA 3DHPA 2WSKA 4IISA 1U5HA 4M80A 1UP0A 4IOTA 3SR7A 3KL0A 2P3EA 3BMVA 4FNSA 3IUHA 4RNIA 3DI1A 3V18A 2Z28A 5E70A 3THAA 2W62A 2ZZ4A 4FOKA 4DM1A 3UPMA 3WNMA 4LYKA 1FWGC 2WMIA 1VS1A 3GNPA 1QRQA 3NGFA 2GFTA 5A69A 4M81A 1W5MA 3ISIX 1MW2A 3UZZA 3AMKA 3GTXA 2BOGX 4W8AA 5D2VA 2R1KA 3S1UA 3NEHA 3H55A 4E38A 1JAKA 1BTMA 4BQ4A 1I2RA 1LRTA 5C9UA 2PB1A 4OTKA 2VXNA 3W1LA 3GB6A 2G3FA 5LA1A 2YW4A 3PZGA 1Q2SA 3QSRA 2ZUTA 2Y5EA 4PCNA 3LU2A 2DSUA 2UY5A 2GJXB 1VYSX 1PCKA 3MCMA 2ZRWA 3KP0A 5F1VA 2Z7GA 2Z29A 3PWAA 1Z7AA 2I5GA 3MDUA 1K9EA 3N2TA 4D72A 4FXSA 3WSUA 3CZEA 4RE3A 5CJNA 4AB4A 2OWWA 4F0RA 1GT8A 3M5YA 3TAOA 4ZO6A 2R1NA 2VGIA 1I4NA 1F76A 3PB2A 3AROA 3GU2A 4LC6A 2XFFA 1H5YA 4UTLA 1IWBA 3OA5A 4DWSB 3ITTA 3L4UA 2QJIA 5JMUA 4J7RA 3L4ZA 4PN2A 1TREA 2CZVA 3TTYA 1XXXA 2DDXA 4LH8A 3TQ0A 5CC3A 3N13A 3RIKA 1XDMA 4NZ5A 2GVGA 1W0MA 3SQLA 4WR3A 2CZEA 3PVFA 3UJ2A 4QAIA 1B4KA 2YXOA 3W2MA 3WJZA 3G1SA 3W84A 4Z1DA 1J2BA 4YVPA 4WY0A 5FA5A 4IPPA 4Y8EA 1XRSA 3AAMA 3J7HA 1OFBA 2O9RA 3W71A 1CXEA 4WSKA 3BJTA 1A5KC 1ME7A 1NDZA 1EA0A 4H7CA 2INFA 3TWAA 2Y62A 5BXTA 4JDYA 4LNYA 3EWZA 4MWAE 1V6WA 1X97A 7TIMA 1Q6CA 1K9FA 1Z89A 2QQ6A 3VIIA 5BRPA 4GI8A 3OG2A 3N2BA 3FSTA 1H5VA 3BE7A 4Z1AA 3NWRA 2XINA 4MPQA 2CLIA 3QVQA 4R27A 3ZS4A 5GQBA 4HPHA 3HPAA 4CU8A 4I8YA 4MPKA 2BXZA 3S4TA 4HPJA 2GGIA 2ZUVA 4H83A 1SJBA 2VDIA 1Q5MA 1KRAC 3LQLA 2PC8A 3HGSA 4AZBA 1CZ1A 1LQ0A 5K4XA 4ATWA 4KWSA 1KM2A 3WH6A 4JTDA 2G3IA 4MWAD 4REQB 1W5PA 3UWWA 4IXXA 3PSWA 4GY7A 4LEFA 2NQ9A 1ZFJA 3IV8A 4D6HA 2Z2BA 3TNBA 5C5YA 4JKLA 3WMBA 2AMGA 2E1WA 4EXBA 1Q6RA 4GJIA 1GVIA 2ZTKA 1R0MA 1VZWA 3O6DA 1KNWA 1H7OA 1RZMA 3LB0A 1A80A 1WP6A 4UIOA 4CUCA 4EX4A 2VZVA 2PTWA 4HJWA 4QS5A 3BO9A 3G77A 2P8BA 5H2ZA 1Q45A 3KRUA 2QHAA 4ZSUA 4GWEA 2WNZA 1OC6A 3M0LA 3OG3A 1V0KA 2DSWA 1DWHM 3OBEA 3EDJA 4WXYA 1NEYA 2NT1A 3HMCA 1QVBA 4OBTA 2FZ9A 5EMLA 1E9IA 2GPTA 3C2FA 1C90A 5G4EA 3UR5A 1TRIA 2C91A 4O10A 3GC2A 3CH9A 3WLPA 3Q37A 4XIMA 3UR8A 5E1QA 5D02A 2EG7A 3CMGA 4YJ5A 5D8WA 2BHZA 3OA3A 1YNPA 1ZP4A 4Q4OA 3T0TA 3TYUA 5CPTA 1BXNA 4XK2A 1QAPA 5C9WA 2WMHA 3BZJA 2OPJA 4ZFCA 1EF2A 2RJHA 2REQA 4FAMA 3LM3A 3H6OA 1K8CA 4OBSA 1OD8A 2ZQ0A 3V1HA 3SRHA 4HQVA 3UWZA 2XHYA 4HMCA 1UQZA 4WEVX 5D4YA 4CEUC 2DSVA 3PTDA 5I2UA 1KFEA 3ZWSA 3WEZA 3QV8A 2ZRVA 4JHZA 1JCNA 3R94A 4DBSA 4ZO9A 1JR1A 3M5XA 4IJBA 2E25A 4RNHA 4PGLA 2ZCGA 4CNTA 4AWEA 2G3MA 1P0NA 1PIGA 2WVSA 4CLMA 3VNLA 3LHWA 2Y4SA 1OT2A 4CQBA 1XRTA 2WSPA 1UKOA 2PMQA 3SCNA 1G94A 1O6IA 3EXSA 4PB3A 1YRRA 3SURA 2FZDA 2ADAA 3UETA 2NXGA 1WV2A 1DJHA 5D9PA 3ZLFA 1SYTA 4CN1A 4NZCA 5DY3A 3HGJA 3PFMA 4GUJA 3QOMA 1PXGA 2X09A 2PFHA 2QPXA 1VIWA 1TJ2A 2BBFA 3MO4A 1X1OA 3VE9A 2DJLA 2V2CA 1CIUA 3EWCA 2VURA 2OT1A 2DIJA 2X2GA 3GYCA 4NYYA 1MDLA 3W37A 4H7VA 3AHYA 1WBJA 3LS9A 3M16A 1L6SA 5A3HA 5T26A 4ENLA 2ONEA 1SFSA 3U48A 4JDBA 4DEFA 3BQ5A 1O5KA 2PD5A 1EO5A 4GVIA 2KX9A 1JQVA 3DI0A 1FRBA 2FZ8A 2AGKA 3DESA 3WD4A 2RDWA 1E56A 1YYAA 1IF2A 2NSXA 2X42A 1J93A 3ANUA 3A4WA 1R8LA 5DMLA 2WLZA 1GJWA 1I60A 3O05A 4GG9A 1JD9A 4ROPA 4ZO7A 2J4GA 4RV3A 2DZPA 2E6DA 3ABXA 4PUJA 2PBGA 4M6VA 3HURA 5IHSA 3N17A 3EOUA 1E43A 4IXHA 4JX5A 4K1WA 1CLKA 4XAFA 1Q4WA 1UUMA 4NAFA 4E5TA 1HJWA 1SZEA 3TYAA 4AF0B 2Y88A 1KQZA 5BU6A 2R6OA 4M7SA 4S38A 4UR8A 2R24A 3ID7A 5F4XA 3FK4A 3DGBA 4ZENA 2YXXA 1H4PA 4FLQA 2WHMA 2OWXA 4GJJA 1KW1A 4C6MA 2HVOA 3TZNA 3VGBA 3WBEA 2J66A 3MW7A 4XD4A 4QM1A 1UG6A 2PD9A 2CU0A 4H9TA 1V5XA 1HKIA 3H2NA 4B3LA 3UXLA 1KBIA 4LSBA 1LLZA 1Z69A 3QW4B 3EMQA 1EDGA 3SCUA 3SCOA 4IX2A 3KBVA 4GIYA 1LP6A 2J7EA 3NZQA 4E8GA 4AXNA 4J2PA 1B3OA 1S5WA 1SUXA 3W73A 2VNCA 5E93A 1ITUA 1RUSA 3LRLA 4JQ1A 2OMAA 2CLMA 5F2MA 2JE8A 1CB2A 4QDMA 3O7UA 2QF7A 5KINA 3CO4A 4LS0A 4QE1A 3KVKA 7TAAA 4A3RA 2Y2WA 4QP0A 3F03K 3UWUA 1DXFA 1NDVA 1H7PA 2QV5A 4EKJA 1OG6A 4GFIA 2PGRA 1EPVA 1LQ2A 3VKJA 2HPIA 3N12A 2ANUA 1J8VA 3EA2A 3BSMA 1ECQA 3GXDA 4EACA 5FEPA 1ZAJA 2D22A 2VI0A 2FPYA 3O3RA 1E9LA 4TTUA 2JKPA 2VTFA 2PTXA 3V3WA 4GO9A 2V9DA 3N6JA 2Q3OA 1ICSA 4JD4A 3GFYA 1TPUA 4HA0A 3F7JA 3KBWA 5H91A 4UTTA 3T09A 3CUIA 1DJQA 2WPBA 3ERPA 2XWEA 4GXPA 1FWWA 1JYWA 1CEOA 4P7NA 3W81A 1T40A 4D8ZA 4GUGA 4XD5A 4XSMA 2IKJA 1IGWA 3AZSA 3VDGA 2O9TA 5G2WA 1TO3A 4AIOA 5HBFA 1IXQA 2FHCA 5GJPA 3TN6A 2D73A 3INPA 3WLNA 1VPXA 1H7RA 1KFCA 4RDWA 4Y9OA 2CYGA 3VDAA 3BQ6A 4QBXA 2JEQA 3EMZA 1LL6A 3KVJA 1LYXA 2VYOA 2BVDA 1P1MA 4HPXA 3B0YA 4RPQA 3CU2A 2MANA 4DAIA 1I2QA 4O16A 3G1RA 2PI6A 1J12A 1J11A 2FKPA 1WX0A 3K4DA 4IMAA 1H60A 1SFTA 3F1QA 1N8IA 1R2TA 4DHGA 3DFSA 2Q8XA 2X2YA 4XZNX 1TMLA 3WQOA 1JXKA 4DYJA 4UTTC 1UKQA 2OODA 2QF8A 3GYEA 1AMYA 4QJ1A 3IIVA 1GG0A 2QUUA 1KA9F 1U5JA 4TX9A 1UR2A 5BXSA 1KCZA 3ZJ8A 1W1A1 3NM3A 3ZR4A 1TPFA 2WCGA 5DXYA 3QZEA 4ZB0A 1Z42A 3EOLA 2ZRYA 5FD0A 5I0DA 4Q8OA 2GVJA 4Y8FA 5HQLA 1GEHA 3CB3A 3AIRA 3GXPA 4DF0A 5M1TA 4BA0A 3OGRA 3S2JA 2EF9A 4GIEA 4PMOA 1GZGA 4XZ9A 1JJKA 3KWXA 3BGGA 2X1UA 1DYSA 1OF6A 4XBJA 4OV9A 1V6UA 1XLKA 4O17A 1BYDA 1UKTA 1MEWA 1XDJA 3EWBX 4XZLX 3TJLA 1VFHA 3UGRA 1HGWA 1V79A 1B9ZA 4GY0A 2GQ8A 1BYCA 4H19A 3EOSA 4DF1A 3UEQA 3KLKA 2I17A 2BODX 3EDDA 4JTJA 1NY1A 3BWWA 4F48A 2WMIB 2FZBA 2H8ZA 4FNRA 1EEPA 1TJRA 2AQVA 4NZ3A 1MXDA 4PMXA 4JCLA 4MZ1A 2UY4A 1WKYA 2PDQA 3QSTA 1IXNA 1F3EA 1G7UA 4KWUA 4L80A 3O6AA 4RE4A 1J0ZA 3QYQA 4LYQA 4HIBA 5AHMA 4KFNA 4I90A 3DH7A 4O4VA 1QNOA 2CLOA 4H9XA 3VNMA 1V3LA 5CEWA 1HP4A 2C7FA 1QOXA 4O50A 4YCOA 1GOOA 3NGJA 4ROQA 1G0CA 3D3FA 1JCLA 5CZSA 5FAJA 3SGUA 4EXQA 1ISWA 5LA2A 3QPYA 3VGEA 4AWSA 1PYFA 1GNXA 1HUVA 3IK2A 3PJUA 1W37A 3SCSA 2BLEA 1S46A 5C55A 3S9IA 2RUSA 4PMYA 1CB7B 4YTRA 4IP7A 2DQWA 2J9ZA 1GQLA 4PMRA 1OFEA 4QIUA 2V30A 3RJYA 4EE9A 3R58A 4OV4A 1W1TA 5FI8A 1KC7A 2VGGA 1Y5WA 3W88A 3IK4A 1WAUA 4JTLA 3CPGA 4RX0A 3HA1A 3RO8A 4WSJA 1JPDX 2FH8A 3R10A 1UD5A 2O7QA 1L0PA 1E1EA 1XC6A 1JZ6A 2NSOA 3RLVA 5T8GA 4UTHA 3LRKA 3PBVA 4AZHA 1CI1A 4WY0B 2Z0IA 5A1AA 3QQ1A 1JDCA 1AQHA 5BWFA 3UZWA 1ISXA 3LV5A 3GFXA 1NSJA 4CVWA 3UYCA 3QW3A 3TYBA 3R8RA 4KWOA 3W1RA 2ASHA 1S38A 1SO4A 2E9LA 3B06A 1FDYA 1BVZA 1VFMA 3GUWA 2X7WA 1IXPA 1G4SA 3W28A 4JTRA 1JFXA 1XLFA 1TWZA 3WUEA 4ZFMA 1JF5A 5CPOA 1QBBA 1GG1A 1V6VA 4KIEA 2OX1A 1ZJAA 5LA0A 3GTNA 5HJYA 1B90A 2JGYA 5A6MA 4FIQA 1HKMA 4IL0A 2GSHA 4DAFA 3I68A 4TO8A 1XW8A 3CB8A 3LEPA 2FB3A 3SIZA 3C0SA 3A3HA 3BANA 2J47A 2ZX6A 3FXGA 4H6QA 1TKKA 2DIKA 3PTMA 3VGHA 2VL4A 4GYPC 1FFRA 1AUSL 2RDTA 3WLJA 2VJXA 3KS6A 1SSDA 4AZ6A 2P0IA 1RD5A 2ABAA 2B31A 5A8GA 1YNYA 1DXEA 2WVTA 1SW3A 3T05A 3W7IA 1TR1A 2I16A 2GQAA 4LB4A 3UG5A 5FACA 1MZHA 1X6UA 5DO8A 2Y8KA 3WDIA 3PFRA 1S5VA 4X2RA 1JGMA 1OCJA 5B7YA 3E2RA 4K1GA 1ZS2A 4RDYA 3PULA 3GQYA 4KESA 2V63A 3HFYA 1E6ZA 4XZBA 1HW6A 2A3AA 1E5NA 1YPFA 4QLKA 5HULA 1GORA 4UQEA 5HQMA 4AX6A 1F61A 4A05A 3MSYA 4U3CA 2J74A 5PTDA 2IKGA 4UCFA 3OBKA 4LVAA 3QZ6A 2EO7A 2FHFA 1YXDA 1QDSA 2PUZA 1O5RA 4S3JA 4I7WA 4ERGA 3EWXA 3WLIA 5BOOA 3W7QA 5EMKA 2VZSA 1ALDA 3FKRA 2ZA2A 4DUVA 1H50A 1I1XA 4GINA 2REQB 2WW5A 1X1NA 2E5CA 1HKWA 1RHCA 3P5ZA 4MKVA 4Q8NA 5HPCA 4YWSA 2QCHA 1NWRA 4R33A 1V03A 1RY8A 1XBZA 1R3SA 1FP8A 3A47A 3LI0A 1P6BA 2VDGA 2ZE0A 1MNZA 2J7DA 4LANA 3UZXA 4KERA 5G2HA 2DFAA 4JFSA 4AG0A 4MWAC 3KZPA 4WX2A 5M03A 4BI5A 4I7VA 1X8CA 5EA9A 3B4YA 1WDQA 4ZXLA 1JCJA 3DHUA 2ZX9A 1NDYA 3DG3A 2NW0A 2GVEA 3TYDA 1EZWA 3VNIA 3HN3A 1C7SA 3H4WA 2ZZ5A 3B0PA 1VFUA 1OX6A 3S1VA 3PY2A 1OGBA 4ZBCA 1LZOA 3EKGA 3VOFA 2WO5A 3HZ3A 3HG3A 3KVMA 4WJEA 3LZ5A 5EB8A 4B9YA 4BF5A 4PEKA 1TR9A 3AC0A 4E6MA 3LCHA 3U2CA 3IIPA 1JCYA 4OT7A 2H6RA 2OZ0A 5F4WA 2X0YA 3DAQA 1Z8AA 2VT0A 1E6PA 2HXTA 5BOEA 3C2OA 1Y65A 2WHLA 3U4FA 1VYPX 3PWGA 4MZYA 2BVYA 4I7UA 3UJFA 2AL1A 3E9AA 1A49A 3H70A 4UWMA 3LUTA 2XFWA 4IJCA 3LCWA 2RGMA 4QX4A 1V8EA 5C7HA 3PBWA 4WVXA 3P62A 1W9UA 1CDGA 5B7ZA 1Z41A 5JIPA 2QULA 4J9JA 3TXZA 3UERA 1F5ZA 1IZJA 4O1EA 3TE9A 2ZUNA 3CPRA 3GTIA 3QMTA 4ORIA 4XD6A 4IP5A 1EJUC 2A0NA 3QLLA 1SW7A 3DFTA 2ZTJA 1OFQA 2QNEA 1ITQA 4XWUA 1HZYA 3WKZA 5A6JA 1R47A 3VD9A 4I8DA 4O0QA 3CEUA 4HNVA 3NVDA 3RLGA 4B90A 3QY8A 1QUMA 3T0CA 2VMFA 1MNSA 3QXBA 1EDQA 1OYAA 3NFUA 4DBDA 4HK7A 2DVXA 2ZUSA 1PVNA 3C0QA 3M46A 1S3HA 1IXOA 3ANYA 1SFLA 2CLKA 4IICA 1PTDA 3G3MA 4O1AA 1OABA 1XH2A 4TIMA 1CYGA 4W7UA 3GZAA 3QTGA 1R9XA 4H9VA 3TQKA 2WKLA 1WDWA 3W2KA 4TVUA 4C6FA 2UY2A 4LW7A 3VCCA 4EIVA 3N3MA 3VX1A 3OO2A 3VD7A 1H1YA 4MKSA 4K2SA 1B9BA 5HMFA 4BI6A 4IQLA 2DZUA 4GCXA 3ZVHA 3M07A 3MUCA 1DP0A 1JZ2A 2BHUA 3NCOA 4AEEA 1EOKA 1U1HA 3AIUA 2PF0A 3C2RA 3L4TA 1W6TA 3CTLA 3VDHA 3M0YA 3WLMA 4WLCA 4UFKA 1D9EA 4IIEA 2A3LA 3GXNA 4WKHA 3VU2A 2PTZA 1BFNA 4LBUA 4A3QA 3EX6A 5HNNA 5E0KA 3VX0A 5C71A 5EFFA 1O1HA 2A85A 4GX8A 4W7VA 3RYSA 4W5UA 1M6JA 2QCGA 2ACUA 4AQLA 3TC7A 3E0VA 1XGEA 4XBKA 1XYCA 1OSEA 1SU5A 1C9DA 3G1XA 1JZ3A 5C54A 2X1TA 3AUOA 1LOLA 1QNSA 3U57A 1QI2A 2DT1A 2Q09A 3UA3A 3MSGA 1PKLA 4BWLC 1M53A 2WM1A 3DHDA 1GEQA 1KKRA 2OGJA 4QHRA 1WB0A 3WQFA 4S3KA 5H6HA 1JL8A 3VZZA 5EL1A 1PV8A 3W76A 4ACZA 3UXAA 4ADSA 2NVCA 2DT0A 2YSWA 1QPQA 4M56A 5KZDA 3VYLA 3N1AA 3FA4A 1MSSA 3NQ2A 4PRRA 4DIAA 1CW2A 3AS2A 1CXIA 3CASA 4G7FA 2OXNA 3NUKA 5BU9A 3WIJA 4KEVA 4QLLA 1LRQA 4A22A 3ITCA 2IQDA 3RLUA 4W8BA 2JKEA 3DFNA 3PP7A 3M6YA 4RW5A 3S9YA 5A6KA 2C16A 1AL7A 2X8RA 4PMZA 2WJFA 3MZ2A 1V93A 5JBFA 3NSNA 4CCDA 3IIXA 3I7SA 4C1KA 1LCOA 3OLDA 2YCIX 1AL8A 3EB3A 4FA3A 4C1NA 2C1GA 2VWSA 3B8WA 5I3DA 1EBGA 2Z1VA 4AC1X 1KV5A 3M47A 5T91A 4UTUA 4NRRA 4A8IA 4NI3A 1WZAA 4Z2IA 3BW3A 2FHBA 3GVWA 4XB3A 1E6SM 5I3KA 4Z2JA 3TX9A 4K38A 1EKOA 3L23A 4GXWA 1NVMA 2PSNA 4HNNA 5K7JA 3PF3A 4RE2A 4IT1A 1PKMA 4HSHA 1E15A 4JIHA 1YX1A 2YXGA 4Q7BA 3H53A 4EOUA 1R7OA 4HD5A 1XSJA 3UJRA 3GHTA 5CC7A 1H09A 4KRZA 3GVRA 2E0PA 3ZVIA 3CNYA 2CXEA 2VFFA 2VD8A 2RH9A 3TQVA 1KBKA 1L2UA 3PZTA 4H9YA 4TX6A 2B7PA 2NQ5A 4TTGA 2QKFA 1EC9A 2OYMA 4FZIA 1V6XA 2FJKA 3KRBA 1TFVA 4NI8A 3C6CA 1TUXA 1WPCA 2G37A 5FJUA 2E28A 3MJMA 4UMBA 5FF7A 3EA3A 2ZUMA 4PZVA 2I1OA 1GWJA 1UWQA 2DJXA 4PCPA 1BHGA 3V5OA 3BTNA 4HZ7A 1NFPA 1FWIC 1KLZA 1GOWA 4AW7A 3NTYA 2ALDA 2VEFA 6A3HA 3L65A 4HHMA 2P50A 1XIGA 4IMEA 4HP5A 4FSAA 2NT0A 4M51A 4QR6A 4HOXA 4ALDA 3ECQA 2PDNA 3MP5A 5IHRA 1EEXA 5AHIA 2J9XA 1SSGA 3V0TA 3HJEA 4PRTA 7REQA 3HGOA 1JUEA 3W01A 2Y8VA 4UZUA 1ZCCA 2HEJA 4QAWA 4IF2A 3W7PA 4AZIA 1BGAA 1LL4A 3IAQA 3VZXA 1LDCA 1JPMA 4AD2A 3WLTA 4Q8QA 4OUEA 4RLIA 3NQFA 5HUOA 4UFMA 3DYOA 3CUJA 4PBFA 3TK7A 1MDRA 3FX4A 2GSEA 3VM5A 4JIEA 2XIOA 1ZL1A 2WCSA 4GPNA 4B5UA 2PDPA 4K68A 1REQA 3M0XA 3FYOA 2X16A 5JU6A 2DZTA 2P76A 3QF0A 3BLDA 3FIGA 1PB0A 4AZCA 4AZ7A 3L5MA 1CGTA 2Z26A 1BF2A 2H3DA 4BI7A 3FS2A 1YDYA 4HZ6A 2PDFA 3L4XA 1W9BM 1OY0A 1M7OA 1B3WA 3VOGA 4MFEA 4ZQRA 4KIRA 4H41A 1XKYA 4B91A 3ZOAA 3NQ8A 4WOQA 3VGFA 4MB1A 2OU4A 3ZJ7A 2ZE3A 3JR2A 1M65A 1HJSA 3SUWA 4CQ8A 1ONRA 2CXGA 3S5YA 2F2KA 4L4MA 3ITYA 2DSZA 1EP3A 4CU7A 2J62A 3EDKA 3MA8A 1F9CA 2PRMA 5CPSA 3WF1A 4B2DD 1DIOA 1PAMA 1QMLA 2IKIA 5LGZA 4U4MA 4JTFA 5JUVA 4DXKA 4RZ6A 1O95A 4CNOA 5DY2A 4M8UA 1XLHA 1GW1A 3WLRA 3BC9A 2VFDA 3OBAA 4Z1YA 4DVOA 5LNSA 3T4WA 3GXTA 1T8QA 2CZ5A 3QH2A 4HA3A 1EBHA 4DO4A 5FKYA 1CNVA 4MB4A 4F8XA 3CYJA 1JPKA 3AHVA 4B9ZA 3GR7A 1DWIM 1X1ZA 3SEPA 5AKQA 1RLDA 4UUIA 2YCLA 3ICJA 6ENLA 3P67A 1MRQA 4JBRA 4LUTA 3BOFA 3QKEA 3M6DA 3ARSA 4XO6A 5HNUA 1EZ2A 1S1PA 1YEYA 2OZTA 4X0NA 4UNIA 3CL7A 2V5CA 5RUBA 4MGGA 3W6LA 3SCWA 2KZHA 4D6DA 1R2RA 2YFOA 4TX8A 3ZO9A 3V5FA 5D2YA 4R53A 4BQ3A 5CPLA 1GHRA 1R46A 2WC4A 1HIZA 4KEUA 1QPRA 2TMDA 3GNNA 5HWJA 2Z1XA 3EWDA 3HG5A 1EJRC 1ADOA 3H8AA 4AVOA 3SN1A 1PX4A 2F38A 1JCXA 4MWAB 3NSMA 4FXFA 1S5MA 3O2LA 3MP4A 2J78A 1UASA 4X2PA 2Y8UA 3SY5A 2ZFAA 5I03A 2PDIA 4O15A 1WKEA 3M1ZA 3AYRA 5H1WA 3BDKA 1MVYA 3W24A 1AK5A 3P82A 3A4AA 1V3JA 3I65A 3DKLA 3MKCA 4YU1A 4AU0A 5C8BB 2C13A 5FF2A 3VTRA 3B0XA 1SVDA 1XL9A 4C6JA 3EPNA 3WK0A 5FF3A 5C0QA 3Q94A 1HT6A 3VGDA 4UTMA 1R9ZA 4IPLA 4DUXA 3TONA 2ACRA 3ELFA 3KTSA 3A5FA 3W7HA 1WDRA 1RV8A 1CLXA 2YA0A 3FYPA 4FR1A 4PCSA 4YMZA 3HU7A 4DRSA 4L7ZA 2D0HA 3F5LA 3U6WA 1MFVA 4MNLA 4PB4A 3KOFA 1TTPA 1BYBA 2GLKA 1E1FA 4XAGA 4Y9PA 1KWGA 1VLWA 4JHOA 4Y2WA 1FCBA 2P0OA 3QV9A 3SDOA 4KQNA 1JDDA 4C6QA 3T8QA 1XUZA 4LAMA 3CZGA 1H63A 4A3UA 1L6GA 4B3ZA 1ESWA 4UR7A 1W8GA 4QEEA 1ZHAA 1JYNA 1RXOB 1TWSA 1JZ7A