1GWJA

Morphinone reductase
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
374
structure length
374
Chain Sequence
TSFSNPGLFTPLQLGSLSLPNRVIMAPLTRSRTPDSVPGRLQQIYYGQRASAGLIISEATNISPTARGYVYTPGIWTDAQEAGWKGVVEAVHAKGGRIALQLWHVGRVSHELVQPDGQQPVAPSALKAEGAECFVEFEDGTAGLHPTSTPRALETDGIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPLEVVDAVAEVFGPERVGIRLTPFLELFGLTDDEPEAMAFYLAGELDRRGLAYLHFNEPDWIGGDITYPEGFREQMRQRFKGGLIYCGNYDAGRAQARLDDNTADAVAFGRPFIANPDLPERFRLGAALNEPDPSTFYGGAEVGYTDYPFLDNGHDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacterial Morphinone Reductase and Properties of the C191A Mutant Enzyme.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords MORPHINONE REDUCTASE
total genus 132
structure length 374
sequence length 374
ec nomenclature
pdb deposition date 2002-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gwjA00
3T55A 2BWGA 4WZHA 1PL9A 3IV3A 1UJPA 1K3UA 4L4MA 5D30A 1IXNA 1KV8A 2QKFA 2G97A 1JCXA 3SGZA 2YZRA 2V2HA 1PV8A 4XUGA 4PL2A 2J6XA 3HJZA 4JR5A 1XXXA 4MJZA 4XQ6A 1QO5A 2ZRUA 4JS3A 3SECA 2YXGA 5DY2A 3FEMA 2C14A 3FLUA 3B06A 4X9SA 4O1AA 4FF7A 1ICSA 3HG4A 2A1YA 4RV8A 3WJWA 3C8FA 2ZZ3A 4NQ1A 3S5NA 3EWYA 4MYXA 1T99A 2A4AA 3C0JA 1TV7A 3LHVA 3NM1A 4N4QA 1K7FA 4M6PA 5TIMA 4E2BA 4NX0A 1KW1A 3LX9A 2X16A 2E6YA 3MYOA 3NPVA 4LVBA 2RDWA 1YDNA 1Q3NA 1O94A 3G22A 4R7JA 4K37A 3GDMA 5FF0A 1H62A 2QUUA 3P67A 2EGZA 3AJXA 3W2JA 1F73A 5LNSA 3S1WA 3EWUA 3NQCA 2XN1A 5BOOA 3I7RA 1A5AA 3M9YA 3QEZA 2Q8LA 3CTLA 4NZFA 1O5KA 4JTSA 3HB9A 1XM3A 1TPEA 1OX4B 2JK2A 3CEPA 1L2UA 2J27A 2NUYA 2QCNA 4MKNA 5BRBA 2H6RA 3QYQA 3NQDA 1WYIA 4MLJA 1RQEA 2DZSA 1VHCA 3BG9A 4FNTA 5CPMA 4YMZA 4AAJA 1R2TA 1HL2A 5CPOA 2P1FA 1A5CA 3N9SA 3GZ3A 3R13A 3W1AA 4FIQA 1WOBA 2QDGA 2ZZ4A 3W2MA 3FYOA 2B4GA 3UWQA 1K8XA 3UWZA 1YTDA 3CB8A 4JYEA 4EIVA 3FKRA 3STCA 4C1KA 1RV8A 4S2CA 1P0KA 5G2HA 3W22A 2Y85A 2J88A 2ZA1A 4PTNA 1AW2A 3LCLA 2ZZ2A 3STEA 4AWUA 1FCBA 3QPYA 1KTBA 3QF0A 4BI7A 4BF9A 1D3GA 1SO3A 2DZPA 1OFQA 3W86A 3ZR4A 4EVZA 3L9CA 3QSTA 4O13A 1NF0A 3W7EA 4DBEA 1EWEA 2E5DA 3IGXA 2BZNA 2QCDB 1I45A 2QAFA 5AOUA 2WO5A 1WAUA 3W7IA 1EUAA 1QO2A 2V2DA 1FWNA 1WQ5A 3SSJA 3NQAA 3STGA 3N3MA 3LLDA 1DKWA 3B8DA 2QJHA 5CZJA 1QR7A 3ABQA 4WY0B 3GB6A 3TNOA 1H7NA 1GVFA 2ISVA 4Q32A 1E51A 3GKAA 2V5BA 1D3HA 4GUJA 3P5YA 4RR4A 4DQWA 3L68A 1Q6OA 1M5WA 1QPQA 1I2RA 1W3TA 5L6UA 3NO5A 1VR6A 5D09A 4BK9A 2BXVA 4LVGA 1IXOA 1KFKA 3MP3A 2Y7FA 4AVFA 5BW6A 3L65A 4IX0A 2JBMA 1ZNNA 2I14A 5K9DA 1RQHA 2QEZA 2FQIA 3GAKA 3IIXA 2NX3A 1H7RA 5L9FA 4O19A 5KMYA 3C2RA 3BVJA 5U7SA 4WOZA 1LP6A 2E6DA 3G1SA 4HIBA 3DHFA 4O50A 4I9AA 4LC8A 3A5FA 1TRDA 1TCDA 4Y6GA 3W7KA 4CQAA 3MYPA 3GKFA 2EKCA 4M7TA 2C6QA 1KFCA 4OT7A 2YW3A 2DU2A 4UFIA 2ZZ1A 3H55A 5AN7A 3B4UA 3W1NA 1JVNA 2FTPA 3HF3A 4UNLA 1L6WA 1TTIA 4DELA 3P7YA 1VHNA 5BMWA 4ICNA 4UCGA 2XFWA 1K7EA 4O15A 2AGKA 4XBSA 4OV9A 1XBXA 1R47A 1V5XA 3ATZA 3HO8A 3SI9A 1OX6A 3EXTA 3S5OA 4UTMA 4X3ZA 3LCWA 2A0NA 3TFXA 3QW4B 5K9CA 2O7SA 2NWRA 4DEFA 2ZFAA 3INPA 3QMRA 4Q33A 1VYRA 1ICPA 4OGZA 1FCUA 2QUVA 3B03A 4HNTA 2H3DA 2VC6A 3MI2A 4KWWA 3EKLA 3MWAA 3G0UA 1GTEA 4PH6A 3QC3A 1TQXA 2Q3OA 2OX1A 3W7GA 3D0CA 3G1FA 5DXYA 5IBXC 1JCYA 4O4WA 2ZRVA 2P10A 2WOQA 3UPBA 3NQMA 5BMXA 3TV8A 1G67A 1LLWA 1L6YA 3A5VA 4UTWA 3MUXA 4Y9AA 2CU0A 1LBMA 3GDLA 3WK3A 1ZCOA 2OCZA 1B9BA 3TKFA 1HFBA 1C29A 3ZFHA 1EP3A 2F84A 3W7JA 2FFCA 5LZLA 2NWSA 3HPXA 3MHFA 2GVLA 3LHWA 1H5YA 4W9TA 4JX5A 1ADOA 3FA5A 3HGOA 4TU1A 4LU0A 1U83A 5K3VA 4JGDA 5EYWA 3QMTA 1QPOA 2VELA 1VYPX 3W70A 3SY5A 5DBUA 1GOXA 4DPQA 2H90A 1FDYA 4RXFA 4X2RA 4WOQA 3VKJA 5LNWA 5HJLA 2ZBTA 1JCLA 1VLWA 3W76A 4O4VA 2QCGA 3NL5A 2A5HA 2DZUA 2GQ9A 3DXIA 2TSYA 3HG5A 3O8AA 3P8JA 5G2IA 4N6EA 1TPDA 3MO7A 1GVQA 2FPVA 2QCMA 4LRTA 3DI1A 3EWBX 4K38A 4UTTA 3CIWA 2QCHA 3QRHA 1W5PA 1TB3A 4IMEA 4UTTC 5DY3A 1XKYA 4K36A 4ZMGA 3W1LA 3TC6A 2W79A 4Q4KA 1G7VA 2Z0IA 1FBAA 1P5BA 3KXQA 5HQEA 4RLIA 1JR1A 3S1VA 2C3ZA 3C2OA 4XZ9A 4QAIA 1EB3A 1TPB1 1SQ7A 3W87A 4AMAA 5CSRA 1MEHA 3EWWA 3ABSA 2PE4A 3LM7A 3G1VA 3M6YA 1KFJA 3CC1A 4KWVA 2HS6A 5D32A 5FEZA 1TV5A 4A2SA 3S9YA 4JXCA 2NUWA 4FNQA 3TW7A 1KM4A 1W31A 3QW3A 4QITA 4MZYA 3W7PA 1G7UA 4M19A 4TX9A 4LRSA 1EEPA 4LVFA 3JR2A 3T44A 2WPBA 3C6CA 2UV8G 4NT0A 4MOZA 4OU1A 3S1UA 1SSGA 4AHPA 4LWWA 3F03K 2QJGA 2C16A 2VKZG 1ZJIA 4XKYB 3KVKA 2QCDA 2RKXA 1TJRA 2V2CA 1HO4A 2Y88A 5I3FA 2WNZA 3THQA 3LCHA 3G3MA 2I1OA 3TUUA 1H1YA 1GVSA 3Q37A 1SUXA 4E2DA 1PCWA 1OX5A 3MI6A 2ATMA 3EX2A 1MO0A 3HPZA 3KRZA 3M5YA 1F6KA 3NGJA 1LOQA 1F7BA 4JN6A 3HMJG 2Y70A 1OF8A 1FQ0A 3O16A 1OF6A 3PR2A 5AHLA 1QCWA 3S6DA 1LRTA 1H7XA 1ZAIA 3M7WA 5I3GA 3W72A 4ORMA 2PRMA 5IM51 4HN4A 6TIMA 5C54A 4JYDA 5KITA 2PCQA 2VEKA 1I2PA 1KBIA 3KVLA 1HUVA 1R30A 1FDJA 1RPXA 3R5EA 4QISA 1KBJA 2E68A 2NXIA 3LBMA 1Q6RA 4BI6A 2A7PA 3THAA 3QPZA 4NU7A 3NQ7A 3IGUA 5HNRA 4QSHA 1DL3A 3LV5A 5K7JA 5EA9A 5A8GA 5LSMA 2JKAA 4AF0A 3W7QA 4KFOA 5K4ZA 1OABA 5G1YA 2A7NA 1JUEA 1XBZA 3RLUA 3LV6A 3DH7A 5F1UA 5F4XA 5DXXA 1JCNA 1GG0A 5DLCA 5F4WA 3IIZA 3VFLA 4FNRA 4K6AA 4UFLA 2VOMA 4O28A 3FIGA 4IX2A 1ZAJA 1QWGA 1XI3A 3I65A 4CNNA 2Z2UA 4LW7A 2HSAA 2CLEA 3UY8A 2FPYA 1QAPA 2FB3A 3HG3A 5G4EA 2LLEA 4CLMA 4OWGA 1F5ZA 2AAMA 3TAKA 3BG5A 4ADUA 2VEPA 4AF0B 3A21A 4WJEA 1H51A 3W7HA 1HG3A 3GDTA 4GUHA 1JCJA 5J5DA 5I3JA 1TTQA 4OQVA 1UUMA 2DORA 1T0OA 1OX4A 1NSJA 4MY1A 3NQ8A 3UWWA 2GVGA 3AO0A 1K03A 3NA8A 2PRHA 1H7OA 2OT1A 3ATYA 1I4NA 2A21A 3QZEA 1H7PA 4RZ5A 3C2EA 4UNKA 2B7QA 2GVJA 2HTMA 1VYSX 1H63A 1GVRA 3IRDA 5LNUA 2GOUA 4S2BA 4DF2A 3PBVA 2CLIA 3LRLA 2C13A 4EWND 5AHIA 1NFBA 4U4MA 2FDSA 4ONVA 3LLFA 2C19A 3R8RA 4LS1A 1W54A 1S5VA 4EF9A 2GPTA 5DCEA 1VCFA 3TDFA 1DV7A 1YADA 4N6FA 1W8SA 1M7PA 1VC4A 2R94A 4IMCA 1XFBA 3I68A 4O8RA 4O54A 4MFDA 1BKSA 3NZ1A 4WQ6A 4OV4A 4LUJA 2P0OA 1I2NA 1YDVA 3P62A 3W74A 5AYYA 5AC6A 4H4IA 4Z1AA 3MP4A 4ZQMA 1DOSA 1OVDA 5TQLA 3KVJA 3I7SA 3TR2A 3WFAA 2GQ8A 2WNNA 3EX3A 3PF3A 4JTGA 1TMHA 2E6AA 4UC5A 4LV4A 1YDOA 3KFTA 3WJXA 5CPNA 2NV2A 4NNAA 3LCIA 4IQLA 1F2JA 5K2ZA 5FEXA 1DQXA 4HPJA 1XUUA 3NPUA 3EX4A 3MW7A 4HHPA 4K8EA 2TPSA 4ZQNA 5AC7A 1VS1A 4LTSA 1ZAHA 5KZEA 1VQTA 4TMCA 3RF9A 4JTUA 2CZEA 1H7WA 3UWVA 3NPWA 1ZENA 3DKJA 3GR8A 3NR0A 4R53A 3F1QA 1LOSA 2VFIA 4O17A 5LKYA 2QDHA 2YCEA 2JKEA 4X22A 4UTKA 2IQTA 2WSQA 1LTDA 1P0NA 4LOCA 3TU9A 3UD6A 1LRQA 4N9DA 3LRMA 3H53A 3C3NA 1A5SA 3UXAA 2G96A 3W6YA 3GNNA 3CWOX 4NVTA 4AXKA 3SGUA 5HULA 2ABAA 1QPRA 1JRBA 4J9JA 1KFEA 4HNVA 2BLEA 3BARA 1AL8A 2J9XA 5DN1A 5G1TA 2VEIA 2Z1BA 3CPRA 3N73A 1ZHAA 2ZTKA 5HR7A 4IPIA 4K7YA 3LCGA 3TSBA 3A23A 4YCOA 3USBA 3NVTA 3TW6A 4S1FA 4NJHA 5J5RA 1J2WA 3DFSA 1G4EA 4FX6M 2R91A 4O12A 3TCEA 4ZQPA 2X1TA 2YW4A 3MJYA 1S5WA 3Q58A 5AB3A 2CLKA 4N9CA 4HNNA 5GVJA 1PS9A 1A5BA 2FJKA 4XTDA 4QQ3A 1QOQA 3RU6A 5K4XA 4DO5A 8TIMA 1EPXA 3BK0A 1W5MA 3CU2A 4NNCA 3DKLA 3ZS4A 5F2MA 1DORA 3G1XA 1YTKA 4PODA 4BR1A 1Z48A 3C4UA 3NQ2A 3UWUA 3O1NA 5D03A 4WXZA 5HR6A 2NUXA 3QFEA 4O0ZA 1MXSA 1O60A 2WSYA 3DBPA 4UFMA 4P61A 1ONRA 2A6LA 1A50A 1WX0A 3QQ0A 3EWZA 2VFEA 5CSSA 5CZSA 2ZYFA 3BGJA 3DI0A 4HPXA 3LI0A 3CQ0A 3HQ1A 3N19B 2V0TA 2ZRXA 4NXSA 1EWDA 5LGXA 4GBUA 2Y63A 5G4WA 2V5LA 3C61A 1K7XA 2AQWA 4PA8A 1KTNA 3MMTA 3LERA 4DBDA 3MP5A 3W1RA 3DU0A 4HKPA 2QCCA 2ZA3A 1X1ZA 1SSDA 3JRKA 5HWNA 5FF4A 3G24A 5F2IA 2NXHA 3S1XA 1EA0A 3TFCA 5DELA 3NPXA 1LOLA 2F7FA 3S8HA 2B7NA 2ISWA 4Y96A 3S42A 1O95A 1PCKA 4O1BA 1RVGA 5CZTA 5FESA 1GVOA 4R34A 4HSNA 6ALDA 3YPIA 3F4NA 3BLEA 1J5TA 4JIQA 1N55A 3C56A 5F2LA 2WQPA 4O10A 1THFD 1FWTA 4OBTA 3OG3A 3L5AA 2QR6A 2YFOA 5D02A 4LS2A 2DZXA 4JX4A 1ZALA 4WXYA 3W3OA 3W1PA 3P8IA 4XTIA 3P81A 4FNUA 1P4CA 2X30A 3BPWA 1B57A 1FY6A 3HG2A 4ZL1A 2X1UA 4LV9A 1JJKA 2GJNA 3O05A 1UASA 3GYEA 3TSDA 4NX5A 1VGAA 3HPSA 3DAQA 3FKKA 3GAYA 5KZDA 5FF7A 4DO4A 2A85A 1GEQA 5AYZA 5C2XA 3NQGA 5K9XA 1TPFA 4FIRA 3PVFA 1I2OA 4BI5A 3UPWA 2V81A 2FPTA 2ATSA 3TJXA 4A22A 5I3IA 3W1MA 1PHWA 4FX7A 2HMCA 3OVRA 4AHOA 3W7NA 4O0KA 2Q3RA 1YPFA 1KV5A 3RFAA 1B4EA 5E93A 3PUDA 3S5YA 1LBLA 1G4TA 2ALDA 1XBYA 3KRUA 3TXVA 4OHQA 3LHUA 3FOKA 5G2WA 3R2GA 1OYBA 5FEWA 1SO6A 1ME7A 3ZWTA 4JY8A 4YLWA 2E6FA 3PULA 3HGRA 2VFFA 2B0MA 2J24A 1FWRA 4I7UA 1LDCA 3W07A 3W23A 5T26A 1JQVA 3T78A 3SFKA 2XN0A 3GDKA 1N8FA 1B3OA 2H8ZA 2Y61A 3UXDA 4BFAA 1Z41A 1FX6A 3N2MA 3LCFA 3OIXA 5U4NA 5HWJA 4Z1BA 3NNTA 4RK8A 4FXSA 1IGSA 3EWXA 1JUKA 1QNVA 4RZ6A 1OK6A 2H3BA 2TRSA 3L5MA 1S5TA 2ZDRA 4FO4A 3N9RA 4ZQOA 3LXCA 2YSWA 1TPH1 5C5YA 2CLHA 3IVTA 1EP2A 1U5JA 3FS2A 3W2UA 1CX9A 1I2QA 3HOJA 4FXRA 4POCA 3UNDA 1YLVA 1QDSA 1FWWA 1MEWA 1TO3A 1DHPA 1KM3A 1NVMA 1NF7A 2DJXA 2WJZA 4E38A 3U8GA 1W5QA 3BW2A 3KOFA 5HUPA 4YWIA 3PWAA 1GJPA 3SZ8A 3N34A 4UMAA 3CM4A 1JRCA 3TA6A 4OE7A 1AG1O 4A29A 1SR9A 2Y7DA 1PVNA 1FCVA 1EP1A 3GVGA 1FWSA 5FF3A 1SPQA 1ZY9A 5D2WA 3NQFA 3TE9A 2C15A 1WA3A 3LI1A 2A6NA 2BTMA 4IMGA 3ELFA 1M7OA 1K8YA 3U2OA 4O53A 2NLIA 4PCFA 4UXDA 2V30A 1VLIA 3VE9A 4CNOA 1OJXA 3PB0A 3W7OA 2CZ5A 3B0VC 3VNDA 3M0ZA 4JTJA 4HNUA 3W84A 1RZMA 3UQNA 3I6RA 2Y7GA 1LCOA 3SW6A 1X1OA 2ABBA 3I7QA 3VCRA 1VZWA 2W6RA 4P2VA 1AW1A 4K8HA 2WSRA 1I8JA 2OMAA 4MZ8A 1SFLA 1G4SA 3L0KA 4UTLA 3UY7A 1HTIA 1F76A 1Z44A 1PIIA 3SIZA 4LT9A 3CWNA 1A53A 3M5VA 4LNYA 4ZVJA 2EPHA 1DBTA 4KKXA 2PC4A 1UCWA 2QCEA 3PY2A 5EKYA 3S5ZA 1TPUA 1XDMA 2J9ZA 3B05A 3IIPA 5D38A 4UR8A 2NX9A 3LTYA 4CCDA 3CHVA 5EL1A 2ZZ6A 3G1AA 4M6QA 4RX0A 4E0CA 1R2SA 4AWSA 1YTEA 4O16A 3HGJA 3TQKA 3ZWSA 3TXZA 1OFPA 1SO5A 3L5LA 2ZCGA 3NOEA 2E5CA 3O6DA 5IBXA 1PE1A 3LB0A 1QOPA 4MFEA 4DF0A 4LY8A 2OT0A 4PFMA 4JDBA 2FLIA 3TC7A 1SW3A 3A22A 4K7VA 2CW6A 5SWUA 1DQWA 3FFSA 4UTWC 4WD0A 3E12A 3WJZA 3W88A 3TH6A 4XBKA 3M47A 2PRLA 1TYGA 4NJGA 1CW2A 4RXGA 1W3NA 4JICA 4O18A 2O7QA 1UB3A 4RJEA 5F2GA 1CI1A 4FNSA 3W7RA 1AMKA 1TRIA 2Z6JA 1C8VA 1KLYA 1H61A 4FHAA 4NXKA 1QPNA 4MZ1A 5C55A 1VPXA 3GXTA 4LC6A 3KHJA 3G1YA 1SW0A 2HS8A 4TO8A 3HGSA 1RR2A 4XKYA 2ZRZA 4ZZ9A 1TV8A 4I7WA 3W7LA 3GDRA 4CCEA 4QIUA 1TPC1 2VENA 5DCBA 5H91A 5TBOA 1AL7A 4MY9A 1KM2A 3W2KA 1O4UA 3DFQA 3P80A 3LOTA 3QH2A 2X2GA 5I3HA 1KM0A 3TQ0A 1PHQA 2DZTA 1OHLA 2VXNA 4R33A 3G3DA 5AFDA 5DBTA 1SFJA 1B4KA 3IGSA 4IJBA 5CPLA 4M7SA 5LNRA 2YPIA 4MYAA 2E09A 3RLVA 3ABOA 1YYAA 2FB2A 4GE8A 2Y7EA 2CLFA 3F4WA 3C52A 3EEGA 1SW7A 4GUIA 3EXSA 3Q94A 4ZQCA 1WV2A 3P61A 3WK2A 1ML1A 3QMSA 1H1ZA 2R14A 5EBUA 4I7VA 2ZQ0A 1TIMA 4MVAA 4ADTA 5AYXA 3G8RA 2CZDA 5HWMA 4NNBA 1VH7A 2NV1A 3UYCA 1X6UA 4JTEA 2JKPA 3B04A 3TMQA 3OA3A 1K02A 1NEYA 3B0PA 1EIXA 1TJPA 5BNKA 1GTHA 1XL9A 3W73A 2BX7A 2EHHA 1XC4A 3IVSA 2B7OA 4PEKA 3WK1A 1XBVA 2DP3A 4IUOA 1X7FA 3PB2A 1ZFJA 5CKSA 1T8XA 2VFHA 2E1DA 4JTFA 5D2TA 2ZZ5A 3P74A 1W0MA 3BW3A 3L66A 4O1CA 3W85A 2ZTJA 3EXRA 4O52A 4JTIA 1SU5A 1W37A 1FUYA 3G1DA 4K39A 3QSRA 3DFOA 4PC8A 3P82A 1H60A 2ISSA 3PM6A 2I9EA 4DPPA 3BW4A 2VFGA 3DFNA 2Z6IA 3BGGA 3FJ6A 3O6YX 1ALDA 4MLRA 4QNEA 5KINA 4JDYA 1F6PA 1ME8A 3NG3A 1TSIA 1DVJA 4MY8A 3QJAA 4XWUA 1J4EA 1P1XA 4Z1CA 4N9BA 3C2VA 1LORA 3MI3A 4JTHA 4UFKA 3VI2A 1D9EA 1OK4A 3M1ZA 3T4CA 1S3HA 3PSVA 3TQVA 2TYSA 3C2FA 5HMSA 1Y0EA 4M5PA 5KTLA 4O57A 1GYLA 1VRDA 3GXNA 3RMJA 3TK7A 4O1DA 2NX1A 2OJPA 4WY0A 2NZLA 5G5IA 2VFDA 1LLZA 2RHGA 2R8WA 3VE7A 1SZEA 1OYAA 2ZZ7A 2RDTA 3LTPA 1YXYA 4Y90A 3PBUA 4TIMA 3LXBA 2XN2A 2ZRYA 4WY0F 3O15A 4UTUA 3MBDA 3U6WA 3NL6A 3NEVA 3NYZA 1F05A 2CFFA 1SZNA 5A5WA 4GRSA 3SJ3A 4FNPA 3W7DA 3R89A 4YXGA 3WJYA 4IXXA 1OFBA 4KFNA 7TIMA 1SZGA 1BTMA 2CZFA 3DHDA 1G6CA 1RQBA 3LTSA 1FCQA 3GR7A 4NJJA 3V1PA 3A9IA 1WBHA 1JCMP 3W75A 5ABTA 1AW5A 3NM3A 5LHFA 1SO4A 3UZ5A 3OVQA 1LBFA 4O14A 2G95A 5D33A 2YR1A 4ORIA 4MUZA 4JY9A 3GK0A 2A2IA 2YDAA 4IMDA 4NZJA 3STFA 3OVPA 4RCXA 4NUWA 1TTJA 5AHNA 4M6VA 4UTHA 1XUZA 3FYPA 3DGRA 3M43A 4UMCA 1GT8A 1IXQA 3CIXA 1OFAA 3BO9A 4GXMA 5C6MA 3G0XA 4JYFA 4AH7A 1Q45A 3WK0A 3O06A 1O5XA 4GFSA 3ANYA 3PG8A 4AHQA 4N02A 3KVMA 2ZA2A 1GPWA 4DF1A 4FEZA 4RKAA 4CQ8A 3SR7A 1V7YA 4UFJA 1W5OA 2QF7A 3BLFA 3NXFA 3TIMA 5D05A 1LM1A 3T40A 3W1QA 1KFLA 2V9DA 1WBJA 2V8ZA 2C18A 4QM1A 1OFOA 4IMFA 3NQ6A 1IXPA 5CZ0A 3LCXA 3A24A 3KX6A 1NAL1 5KSWA 3DFPA 1TPWA 5E0KA 4GC4A 4NJKA 2QJIA 2JGQA 1KFBA 4HSOA 3MBFA 4FB7A 4D2JA 1VCVA 3OHIA 4YL2A 2GQAA 3L21A 1WXJA 4IPJA 3NL2A 1W5NA 2FIQA 5EPDA 4KFPA 4GUGA 3L2IA 5FI8A 3E02A 2W0UA 4UR7A 2YYTA 3EX6A 4LVDA 4EF8A 1JQXA 1AK5A 2DZVA 3BV4A 4WUIA 3Q2DA 3LHTA 4AWTA 4C1LA 3QM3A 3W7CA 1ME9A 4JIPA 3RNDA 2QCLA 3P5ZA 4AB4A 3M41A 2CWNA 1JUBA 2X1RA 5AHEA 4A3UA 3PUEA 1K8ZA 4H6KA 3WJSA 2JGYA 3IIVA 1ICQA 2GJLA 1YXCA 3GLCA 3E49A 3W2NA 5KZMA 2G5WA 1KTCA 1QMLA 1TTPA 4MIMA 3W9ZA 5I3KA 2GUUA 2C0AA 4FX8A 4IWWA 1BWKA 5H2ZA 5MHBA 4LS0A 4DO6A 2H8XA 1LZOA 1Z42A 4JEQA 2Q8ZA 1TQJA 4IXHA 1L6SA 4UUIA 1WOAA 3DZ1A 1HO1A 2VEMA 1G4PA 1N7KA 2QAPA 3S0CA 1TPVA 3JS3A 4JX6A 5CG7A 3CT7A 4MPQA 1RD5A 2KZHA 3TROA 1EUNA 3BLIA 3N14A 3B0UX 1WDWA 1W1ZA 1BEUA 3W1TA 2J9YA 4DXVA 3K30A 4CQ9A 2QCFA 4TMBA 3LGEA 4JTTA 1KM1A 1T96A 1IIGA 1MEIA 3PS7A 4GNJA 4HT3A 3V75A 3NL3A 2QUTA 3PG9A 3UZJA 4JNMA 3T7VA 4BWLA 5LNVA 5LGZA 2Y89A 5FEPA 5LHEA 3IIOA 3IEBA 3PSWA 4UTIA 2YGYA 1GWJA 2YFNA 4MJMA 4TR9A 4AEOA 2WKJA 3DFTA 1IF2A 5HUOA 4RZ4A 3R12A 1W3IA 4JTLA 2E77A 2EAWA 2Y6ZA 4BWLC 1F74A 1XDLA 5D2VA 2DZWA 1GG1A 1YXDA 3G8EA 4N4PA 3GNDA 1OFEA 3L0GA 2CLMA 4G1KA 1R2RA 5D2YA 5AC8A 3NAVA 3E0IA 3LBCA 2NXGA 2V82A 4U28A 2C1HA 4CNPA 3NZRA 3PUOA 5D37A 5D2XA 4Z08A 4LVAA 5D04C 3G18A 2CLLA 2D73A 3M44A 2YX0A 4CCCA 1OG0A 2RDUA 3NDOA 4IOTA 3E9AA 5DCDA 1QFEA 3UWYA 1KM5A 3DENA 2E5BA 4Z0JA 3EX1A 3RK8A 1G69A 3M5XA 4PL1A 3N2XA 3CEUA 3MHUA 4UFHA 1OFRA 3TX9A 5EMUA 1X8FA 3BG3A 1C9DA 1GYNA 4UTJA 4H3DA 4NJIA 3NQEA 3LHZA 1FXQA 3CLMA 4N9EA 2WV8A 3P60A 2X1SA 3PC0A 3FJLA 4O11A 3KRSA 3PBWA 4LUIA 3G1HA 1EX5A 3TAOA 3TMLA 4B5NA 1IIHA 3GXPA 2BSLA 4Y8FA 4A21A 4Z0SA 1XCFA 3H54A 2DJLA 3EKZA 3W83A 1VJIA 3LHYA 4IGHA 1BWLA 4UMBA 1LROA 4EOUA 1OYCA 4GUFA 4QNWA 2B7PA 1YPIA 1LYXA 1GZGA 1FXPA 4UIOA 3TJLA 3M5ZA 2A7RA 5EY5A 4ZQRA 1TREA 3LXAA 1GQNA 1MSSA 2CLOA 4GJ1A 3L0NA 4A2RA 1Q6QA 3LDVA 3HIJA 2TMDA 1OFDA 3GIYA 3O07A 3GX9A 5E1QA 3L67A 1MZHA 1R46A 5CGQA 1Q6LA 5AHMA 5AHFA 2OZ0A 3KAOA 4WX2A 5F4SA 3W7MA 3P84A 2EF9A 3W1XA 1VCGA 2PURA 3TSMA 3E96A 4ML9A 4JTKA 2RFGA 3W71A 1UUOA 4L4LA 3PAJA 5FF2A 3NQVA 3O63A 3ABRA 1KM6A 3PBYA 1DJQA 4QJ1A 3G0SA 3W2LA 1FDZA 3OEXA 4JD4A 1SZFA 1M6JA 3MHGA 1KLZA 3W1UA 2ZRWA 3EB2A 3IVUA 4ALDA 1DJNA 1W56A 2RH9A 4YCPA 4N2YA 1L9WA 2Y62A 5HINA 5F1VA 1KA9F 1JULA 2YYUA 4ADSA 3QQ1A 1H50A 4GWEA 3HBLA 2WNQA 4Z1DA 3OBKA 3O6CA 3M16A 1UBSA 1LRNA 3LRKA
chains in the Genus database with same CATH superfamily
3GHTA 4P8VA 1A0EA 4I9TA 2VC5A 1UJPA 4QS6A 5D30A 2QKFA 2G97A 1GCYA 1JCXA 3SGZA 2V2HA 3UW6A 2Z29A 4HK7A 4PL2A 1LT8A 3QGAC 1XXXA 4MJZA 4XQ6A 4JS3A 2PTWA 3SECA 4E6MA 4P7LA 1LUCA 2Y5EA 4O1AA 1J0ZA 3T07A 4FA3A 1XG4A 3HG4A 3C8FA 2ZZ3A 2BOGX 2PSNA 3DCPA 3EWYA 2XVNA 3LHVA 3A47A 1KW1A 1KCKA 3LX9A 4LVBA 3VIHA 1Q3NA 1KCLA 2OEJA 2X42A 5BZAA 3CUIA 4K37A 2WVVA 4PUKA 3NFUA 2QUUA 2ISFA 1JZ6A 5IXEA 2DSZA 3VABA 4D8AA 3O9NA 3ARRA 2PDHA 2HJPA 3S1WA 2J7DA 3EWUA 2EJAA 2XSBA 2FHCA 4NZFA 4TVCA 5EB8A 4H6EA 4DY1A 1TPEA 1OX4B 4Q3MA 4PMQA 1BWVA 1L2UA 2H6RA 3CUHA 4ZSUA 4XX6A 3H24A 3PJXA 4MLJA 1RQEA 5FJIA 2DZSA 2WJEA 1VHCA 3AQUA 3BG9A 2J7HA 4YMZA 3OLDA 1UR8A 3GZAA 5GJMA 3KTXA 4CD8A 3SCUA 4FIQA 4YYCA 3W28A 1WOBA 4IIDA 4OTKA 2VGGA 3EB4A 1K8XA 3SN4A 2CESA 4EIVA 3IJ7A 5JMUA 4KCUA 3CL6A 3ZLGA 4GYJA 4C1NB 3QV6A 2ZA1A 1AW2A 1UBPC 2J8FA 3LEPA 3BAXA 2ZZ2A 3STEA 3NSNA 3MUY1 2X7VA 4EVZA 3LENA 1NF0A 3R25A 4DBEA 2XPKA 4HA1A 4Q8MA 7REQA 3GFZA 1KXVA 4NAFB 2V2DA 3VGBA 1YE4A 2GVEA 3STGA 2D22A 4TXEA 1VFSA 2OXNA 2GYIA 1I1XA 4WY0B 1H7NA 2ISVA 1BRLB 1FFQA 2V5BA 3ITGA 3L68A 1Q6OA 1I2RA 2WJFA 1W3TA 1E3XA 2OGYA 4FS9A 1IXOA 3U5UA 1KFKA 2PDFA 5H8PA 1ITCA 5BW6A 1O1HA 2JBMA 1ZNNA 1XRVA 4F8XA 5K9DA 1XYCA 4DWSD 2FQIA 1P6CA 3GAKA 4UCFA 3IIXA 1RSCA 4GQ0A 3MTWA 1UMYA 5KMYA 1XIHA 5U7SA 2OOGA 1LP6A 4RDYA 2GJXA 3ZJ6A 4XIMA 1TRDA 3W7KA 4C7GA 3GQYA 4CQAA 1XIDA 4M7TA 2C6QA 4OT7A 5AN7A 3VTRA 4KMQA 4QJ3B 3WH8A 3RAOA 1JVNA 2FTPA 5IFTA 4WJXA 3TZFA 1SZRA 1O5QA 4HCLA 3P7YA 2XIMA 4ICNA 4UCGA 2XFWA 3UVAA 2BXYA 1K7EA 2AGKA 4PB3A 2TODA 4R3UA 4J35A 4Q7NA 1OX6A 3EXTA 3S5OA 3UJFA 2OKTA 4X3ZA 8RUCA 3ZZ1A 4M81A 3LBOA 1OGSA 3UGRA 4H9VA 4RDVA 3QV9A 3ERPA 1E9YB 4DXXA 2NV9A 3CK5A 3IRSA 4P7NA 4HNTA 4CQDA 4C6FA 1GTEA 1W8GA 3FDKA 3TLQA 2WHKA 3B8TA 3P93A 3HZ3A 1W9VA 5DXYA 5IBXC 2JEPA 2QUNA 4O4WA 4H7VA 1YRRA 2YCLB 3NQMA 2PB1A 3TV8A 1B31A 1LLWA 2QUMA 2Q6ZA 4JHMA 1C93A 1JGIA 1ZCOA 5HOSA 2VCCA 1JZ8A 1UMLA 1JYXA 1BF2A 1KRBC 3T9PA 2R82A 1XYLA 2FFCA 5HPOA 5LZLA 3HPXA 4FXFA 3MHFA 1CGXA 1UOZA 4W9TA 1ONXA 2CXGA 3GSMA 1U83A 4JGDA 3B9AA 1R9YA 4ZXOA 2PDMA 2RGLA 3QMTA 5DT5A 1Q7ZA 4RPQA 1DXFA 4TV6A 1IEXA 4PMXA 1IQ8A 1UR9A 4DPQA 1MW2A 4X2RA 3DHUA 1VAHA 5LNWA 1GW9A 4HNOA 1JFHA 4R7OA 4O4VA 1C9WA 2DZUA 4Y2WA 3DXIA 2INFA 3HG5A 4CN1A 5I07A 3HA1A 3MO7A 3KBNA 2CBJA 3EWBX 1PX3A 2QCHA 3K1DA 3W0KA 4E8GA 4UTTC 1QNPA 1X6NA 1JD7A 4ZMGA 3WQGA 5CLWA 1MQRA 1XIIA 3KXQA 1T40A 3MSDA 4RLIA 1JR1A 2C3ZA 1ZTVA 1SQ7A 3STPA 3W87A 2G4FA 4NAEA 5I24A 2G3MA 3SRFA 3ABSA 4KWVA 3CC1A 3HM7A 2FTWA 1M7XA 1TV5A 3BAKA 1VBRA 2UZ9A 1ZJAA 3MJMA 2R1PA 1IEVA 4B4HA 3QW3A 4QITA 1VFUA 4MZYA 4BQ3A 1R8LA 3OLEA 3ZJ7A 2C0HA 4QCEA 1JNEA 5DFAA 2WPBA 3CH9A 4MOZA 4XZMX 1QI0A 4ASTA 2HPIA 4AHPA 4LWWA 5EBAA 4MADA 2VKZG 1CT5A 1DJIA 3NIYA 4XKYB 4J27A 1EJVC 1HO4A 3QOMA 3B3DA 3LCHA 2VP8A 5ECVA 4R9OA 1UR0A 3MA8A 3HPZA 4EWJA 3NGJA 3CHEA 1F7BA 3HMJG 1OF8A 1FQ0A 3O16A 1TA3B 4DJEA 4H9YA 1H7XA 1ZAIA 2I56A 3M7WA 2HPMA 2VM8A 3GDBA 2DQXA 1DIDA 1UIPA 4HN4A 1ZJBA 3PWGA 6TIMA 4DM2A 4E8CA 3KDOA 4CU8A 9XIAA 2VEKA 3DN5A 4Q8UA 3M0KA 1FDJA 3CAKA 1XLMA 2WQDA 2E68A 2WMKA 1ZBCA 1Q6RA 4MNJA 3THAA 4NU7A 3NQ7A 5EA9A 3LA4A 2JKAA 5XIMA 3GFYA 3IUIA 4KFOA 3U5YA 1S3TC 5DXXA 1DYSA 1JCNA 4CGTA 1UWUA 5F4WA 2OYMA 3VIOA 3VCCA 4UFLA 1E4NA 2VOMA 5CBIA 1QWGA 4MDOA 2ZWYA 4ZE4A 2HSAA 3RYSA 1V0KA 2FZ9A 2FB3A 3HG3A 3B9NA 4AY7A 2D3LA 2ZX6A 1YNPA 1F5ZA 2AAMA 2OQHA 1MYRA 3TAKA 2PFHA 2WW5A 4ADUA 1BRLA 3W7HA 1UA3A 1HL8A 1HGYA 2VX6A 2OQYA 1UUMA 1OX4A 3AZSA 3VVGA 3FDGA 3UWWA 1K03A 3NA8A 3N25A 2OT1A 3ATYA 2BNJA 2A21A 3QZEA 3EMCA 4UNKA 2B7QA 1SFSA 2IPWA 2GOUA 4FR6A 4S2BA 4C6CA 4DF2A 3FX4A 1PZ0A 2GJXB 3LRLA 2PCEA 1QW8A 1NFBA 1PB0A 1Q63A 4U4MA 1TJ1A 1SR0A 4XV0A 2PDCA 2D2JA 2GPTA 3BJTA 5DCEA 1GEHA 1YADA 1GNXA 3G6MA 2REQB 1HX0A 1ECEA 4O8RA 4O54A 5CH9A 1B1YA 1BKSA 1NFPA 1IYXA 3W74A 3S3GA 3MP4A 2PZNA 3A4AA 3KVJA 4Y9MA 3TR2A 4A3RA 1K70A 3EX3A 2VEGA 3WQDA 1VBGA 1PYMA 3T2OA 2YKKA 4NNAA 2ACRA 1F2JA 5K2ZA 2G3JA 3GE7A 4TTGA 4K8EA 3MKVA 4REQA 2TPSA 4F9JA 1GHSA 2HBXA 5BXRA 2INZA 4LTSA 3QFWA 1PBGA 3S9IA 4GIEA 1CNVA 3UWVA 1UROA 3OZYA 4C6OA 3CZEA 3F1QA 2VFIA 1R9ZA 4I5RA 3S2NA 5JBDA 1V0MA 1I0DA 4HHHA 1C7SA 4LOCA 3ABZA 1EBGA 3NWRA 1DEDA 2EEXA 3BLLA 4URIA 1VJSA 2G96A 3GNNA 3TYEA 3H70A 4NVTA 4AWEA 2ZKMX 3WCZA 2ABAA 3WQ8A 3AU6A 3NZGA 2QS8A 4HNVA 2Y8KA 1K9TA 3KHDA 3AMLA 1AD1A 4LAMA 4RNHA 5HR7A 1REQB 3LCGA 4W8BA 2PA6A 5LXEA 5FOOA 3MCMA 1Z7AA 4YCOA 3HTWA 4S1FA 4S3GA 4NJHA 3C86A 5A6LA 4EXBA 2F8QA 2WMJA 1DIKA 5J5RA 4I6VA 1J2WA 1XF0A 4ZOCA 4FX6M 1KRMA 1ESWA 2WC3A 2PGWA 2AQOA 1S5WA 4ATDA 2E67A 2ZWZA 2CERA 4L6DA 1FKXA 3F2CA 1FHLA 3OW1A 4WSHA 5C7VA 4X9YA 3CNYA 3G1XA 5LXXA 2PAJA 4MTVA 3GFXA 3C4UA 4NZ3A 3UWUA 1EF3A 2ZUVA 5GJPA 3SFWA 4LF1A 3DYMA 2Y8VA 4UFMA 1HKKA 4MNLA 1ONRA 3N6JA 1NWUA 2NLYA 5FSDC 1PIGA 3WLNA 3DI0A 3U7BA 3N19B 1UYQA 3RX3A 4QJ5B 3N2OA 3OQEA 3WUFA 5G4WA 3I6EA 4L6OA 4CD5A 1K7XA 2DH3A 3LERA 3MP5A 3DU0A 4HKPA 2QCCA 1TJ0A 4YVXA 4UZSA 3SCRA 3G24A 3B8VA 2NXHA 2DZBA 2NT1A 3H4WA 3UU0A 1I9CB 4DO7A 1XIFA 1H49A 3MDUA 2ZXBA 5A3HA 1RVGA 4INFA 2I7GA 3KBSA 4AIUA 2HV5A 4C60A 3ID7A 4ZO6A 4CNSA 1VBUA 2E25A 5AECA 3C56A 5CC3A 1M1BA 1BAGA 1OC7A 4ENLA 3L5AA 2WHLA 3KE0A 2J6VA 1XSIA 3VNYA 2HXTA 1A5LC 1ZALA 5I6SA 2FHFA 3DFYA 4Z42C 4G6CA 3ZR6A 1JZ7A 3BPWA 1FY6A 1B57A 4XO7A 3HG2A 4RW3A 2X1UA 3U2EA 4QHRA 1CLVA 3HPSA 1Y5VA 3TTEA 1V6UA 3GYCA 1EH9A 5FF7A 4DO4A 2A85A 4J1OA 2XWEA 3NQGA 5K9XA 1TPFA 2AAAA 1PKLA 1HVQA 2ATSA 5I3IA 3W1MA 1PHWA 4ZXLA 4O0KA 4MB3A 1YPFA 2DFAA 2QIWA 7ENLA 4U10A 3MKCA 4X2PA 3GXFA 1H09A 5CEWA 5HQLA 4EXQA 2ALDA 4H83A 2V5JA 2VJXA 1KBBA 3FAWA 3ZWTA 3TYUA 5A6SA 4YLWA 2E6FA 3PULA 4XZWA 1FWRA 2GSEA 4RL3A 1JQVA 3S4TA 3VMPA 3T78A 3IUDA 1W1YA 1B3OA 2ZUNA 3UXDA 1FX6A 3IAQA 4Z1BA 3NNTA 4MWAC 1QNVA 1OK6A 2H3BA 4GC3A 1S5TA 4ZQOA 2YSWA 1TPH1 5C5YA 1EP2A 2B31A 3FS2A 3W2UA 1CX9A 5AYIA 3UERA 1GGOA 1QDSA 1FWWA 1JZ2A 3RO8A 2V3GA 1D7KA 3GS6A 2BFGA 3CYVA 3N1AA 1YE6A 4F9DA 1E9LA 4QFUA 4OE7A 1AG1O 3NZPA 1SR9A 3AIVA 1PVNA 4AYGA 4WDTA 1O6IA 1ZY9A 1AD4A 3K4DA 3TE9A 1BLIA 1WA3A 1XIBA 2P0IA 4AD3A 1M7OA 8XIMA 1QHOA 3I3EA 3NYDA 3WLPA 1ADSA 4I3GA 2EG8A 4PCFA 1VLIA 1XSKA 2QHAA 5JUVA 3SCWA 4AVOA 3B0VC 2XIIA 3PPGA 3WNMA 4HNUA 4X0VA 1J11A 2VURA 8CGTA 1LCOA 3SW6A 2Z2AA 3ARVA 2W6RA 3WMCA 4PSPA 1MQQA 4L56A 3UXIA 4GQBA 4C6PA 2CHRA 2OMAA 2PP3A 3OBEA 4NZCA 3L0KA 2YCKX 1WPCA 1Z44A 4NG3A 2ZC8A 4LT9A 4LCSA 1A53A 4LNYA 2EPHA 4KKXA 1UCWA 3OGVA 1XDMA 2GQ3A 1WKYA 4H04A 1W3KA 1MVYA 1KXHA 4IF2A 1F3WA 5EL1A 2ZZ6A 4GYPC 5E0CA 5DX7A 2BS9A 4MWAD 4O16A 2OZTA 4LAZA 1DWIM 3AWNA 3ZWSA 3RRXA 2VR4A 4HB7A 1NH6A 1XC6A 3BH4A 1PE1A 3CGTA 3O2LA 4LY8A 1V6XA 2OT0A 4QEEA 4JN7A 1D3CA 1F4HA 3LPGA 2QNEA 4Z2KA 1DQWA 1XV8A 2NT0A 1P1MA 3AZRA 2WXDM 4I90A 3TH6A 3VINA 2VOTA 4H8NA 4XBKA 2D20A 2PRLA 1TYGA 3E2RA 4NJGA 3VKDA 2OWXA 4JICA 4O18A 4A3QA 1CI1A 1UWSA 3SB0A 2Z6JA 2J7EA 2GZXA 3FHAA 1POKA 1BSLA 4H2HA 4FHAA 5M3WA 2W3ZA 1QPNA 3GXTA 3G1YA 2HS8A 4TO8A 5A6MA 5H6HA 1KGUA 4LF2A 2PMQA 4MB4A 3WF3A 2PBOA 1Q6FA 1I1WA 4DLFA 3OA5A 4V33A 3VGHA 4I7WA 1TPC1 1J6PA 5DANA 1AL7A 1GVYA 5CXPA 3P80A 2X2GA 2OEKA 1PHQA 2DZTA 3WBYA 1SFJA 3IGSA 5HJXA 3APGA 3RLGA 5LNRA 2UY5A 3TEVA 3CV1A 4BKNA 2KAUC 3RLVA 4IFOA 5GNZA 2FB2A 2Y7EA 1B2YA 3F4WA 1AJ2A 2CLPA 1SW7A 1OM0A 2V69A 1WV2A 5HXMA 3WBEA 5EBUA 1BYDA 3KLKA 4MVAA 1J0KA 4WEVX 2CZDA 4FLOA 1IZJA 1X6UA 2OO0A 3B0PA 2VO5A 1TJPA 3MO4A 2HZGA 3URQA 1XL9A 3H2EA 2EHHA 1RK6A 2G3NA 4GXWA 4J4KA 2BHZA 3FA4A 2Q71A 1QNOA 4HMCA 3WDRA 1T8XA 1QVBA 1G94A 4F4RA 1XYZA 1JPIA 3K1GA 4G7EA 1W37A 3W38A 3CYJA 1W9PA 1QATA 3DFOA 3HURA 4BEQA 4J5NA 1WO2A 1E43A 1Q85A 2VFGA 4UNIA 2INEA 4DNMA 3FJ6A 3SJNA 4AIOA 9CGTA 4MLRA 2ZOXA 3QJAA 4AZ7A 2PLKA 4ACZB 1LORA 4JTHA 1D9EA 3MZNA 4AEFA 2PODA 1GKRA 1U22A 2IQDA 4M5PA 2QJJA 1GYLA 2PTZA 2J7GA 1FP9A 4EPKA 2PWDA 1KRCC 1W1VA 4M1BA 1GW1A 3T42A 4WY0A 2VFDA 2RHGA 4G1NA 3VNLA 1SFTA 2RDTA 3GTXA 5IHSA 1E1CA 3EDFA 3LXBA 2XN2A 3DFHA 3UG4A 3O15A 4UTUA 5JQ9A 1F3XA 4GX8A 3U6WA 3NL6A 4ZO9A 3GG1A 3OOQA 4Q4MA 4YVPA 1F05A 1K9FA 3WLKX 1IZCA 2XINA 3C0LA 3V5OA 4YXGA 3KOXA 1J0IA 1J79A 4KFNA 7TIMA 5HDRA 4DZAA 1RQBA 3LTSA 3A9IA 4QJ4B 1WBHA 3QV8A 3W75A 2JALA 3E38A 1AW5A 3KLLA 3OODA 1TG7A 3HQPA 2YR1A 4ORIA 2OLHA 3CQKA 1A0DA 2O9OA 1BHGA 4UTHA 4LJ3A 4U5IA 3DGRA 3M43A 4P5UA 2VRJA 4BQ5A 3VGFA 1OFAA 2RUSA 5JH2A 4GXMA 2HBVA 3WD3A 4JYFA 2NSXA 1YBQB 2DIJA 4ZOAA 1O5XA 4Q8OA 3AWOA 4AD4A 3ANYA 4IICA 4AHQA 4TX6A 1PUDA 3FGCA 3FVMA 4AC1X 4QE1A 3NVDA 6A3HA 2ZUTA 2FKPA 4UFJA 3SQMA 2DW6A 1XPYA 5ECUA 1FKWA 4ES4A 3W53A 1DE6A 4ERAA 2V8ZA 1E1FA 4GVHA 4HYVA 1JF5A 1OFOA 2ZXDA 5CZ0A 1JDDA 1EGMA 3A24A 3KX6A 3AFBA 3GC4A 5KSWA 3WD4A 2QJIA 3BV7A 4PSRA 1KFBA 4HSOA 3MBFA 4AZ5A 2GQAA 3VIPA 1UC5A 1KBKA 4GUGA 4H9MA 4LVDA 4YIWA 2DVTA 3WDHA 2AQVA 3Q2DA 4HTYA 4C1LA 3W7CA 3LSCA 1X7IA 1Z3NA 2QCLA 4B5SA 4DI8A 2PDYA 5B7YA 1XRTA 4H6KA 2F6UA 1EC8A 4BQ2A 4DAFA 1QI5A 3WJSA 2JGYA 3IIVA 1YXCA 4HPNA 1UD4A 3HPFA 3P0XA 1KTCA 3CZLA 5AYBA 2VHLA 4FX8A 5H2ZA 2V3DA 2H8XA 3W00A 3TN4A 1TQJA 4YHGA 4HA3A 1WOAA 5LIYX 1FWJC 3DZ1A 1HO1A 1NTHA 1W1PA 5D4YA 2GUBA 2QAPA 4EAMA 2R1NA 3JS3A 2YXXA 1OB0A 2J13A 4CVUA 3VNKA 1J6OA 3B0UX 4FAMA 1BEUA 3W1TA 4DXVA 4PZVA 6CGTA 3A4JA 2FVKA 4QDPA 1UZHA 3CZKA 3PPHA 1M53A 1W9XA 3L4XA 1KM1A 4EX4A 2W27A 4QDMA 3N2BA 3NL3A 1ISVA 1MMFA 1V4YA 4LUTB 5FSEC 4B5WA 5IRPA 3UZJA 1S5NA 3T7VA 2DDXA 2XVLA 3HJEA 2O9TA 3V1HA 1XGDA 1JEZA 4CD7A 3DFTA 2RJGA 1HZYA 1IF2A 5HUOA 3WY1A 1MUWA 1F74A 1TFVA 1YXDA 2BVTA 1JL8A 3L0GA 4ZCWA 1XLGA 3LBCA 2PLMA 3GH4A 4U28A 4CNPA 1DJGA 4YTQA 3NZRA 1FFRA 5D04C 2CLLA 4QLJA 4CCCA 5JIPA 1QFEA 4Y9PA 3NOYA 3GU1A 1KM5A 3NURA 1EX1A 2DEPA 3HV9A 3SCSA 1A3WA 2BODX 3AHVA 1N8WA 2AL1A 3BG3A 1C9DA 4G7EB 4MM1A 3LHZA 4BY3A 1FXQA 3OU8A 3ZVHB 5KETA 4NKCA 3AS1A 3PBWA 3IAPA 3OGRA 1EX5A 3TMLA 4R85A 4B5NA 4A21A 4F0HA 2DJLA 2PD9A 3CPGA 1ODUA 3W83A 3EA2A 1IHIA 4QDWA 4XAGA 2ZX7A 1RCOB 4MF4A 3WQ6A 1LYXA 1DJZA 1TA3A 1GQNA 5I2UA 3L0NA 1NIUA 1Q6QA 1OD8A 3GIYA 5E0FA 1R46A 2WBGA 3SAZA 5AHFA 3W6LA 5ABHA 1DIEA 3GVRA 3W7MA 4IGMA 3E96A 4JTKA 4CQBA 2YA1A 5DMNA 5M2FX 3GBDA 4RNJA 1KM6A 3OEXA 4Z2IA 2GFTA 6REQA 4IMAA 4N7QA 1UC4A 3K8MA 3GNXA 4YCPA 4N2YA 1EEXA 3PZ9A 3H8AA 2O56A 4WGHA 4LB4A 1JULA 1U33A 1YX1A 2GVYA 4GWEA 1WXZA 5HMEA 4Z1DA 4H6RA 3O6CA 3M16A 3O0KA 1Q66A 4H01A 3PJWA 2WZMA 1UBSA 1LRNA 3SGGA 3GC2A 3UFYA 2VZTA 4KQNA 2HK1A 3WQWA 1UPMB 4O1FA 4GO9A 2BASA 1PV8A 2PGFA 2WZEA 4LPCA 4AXNA 2J6XA 3HJZA 3SCNA 2ACUA 4GFIA 5DY2A 3FEMA 4X9SA 4Z17A 1EQCA 4FF7A 3WNOA 1FH7A 3M7SA 3FXYA 2VC7A 4RV8A 3WJWA 4NQ1A 4F2UA 3C0JA 1K7FA 3BLOA 5TIMA 3ZLHA 4TVDA 1RA5A 1YDNA 1ZZMA 5C9UA 4XVEA 3AJXA 4Q6XA 4LB3A 1WKDA 3W2JA 1ZJHA 4E2VA 3ZVIA 2ZDSA 3I7RA 3QEZA 1Y5WA 3CTLA 5IFPA 3M0JA 4RW5A 2XZ9A 3CEPA 4MSSA 2J27A 1RBAA 3QYQA 3NQDA 3QR1A 1EDTA 4ATWA 1MZRA 4FNTA 3LNPA 1BYCA 4HJWA 1XH2A 4AAJA 2P1FA 1A5CA 2XUCA 1GZ1A 4NRSA 3PZNA 1EIBA 2CKSA 3W1AA 1UWTA 3OYXA 3UP8A 1TZZA 3VD7A 2ADAA 2QDGA 2B4GA 3FHQA 4DBSA 1YTDA 3CB8A 3FKRA 2ZC1A 1TVNA 5CC6A 1LWIA 2HXUA 2PDXA 4Q8QA 5C8BB 5I5RA 1P0KA 3W22A 2HNHA 1P43A 3GTNA 4IP4A 2VNCA 1IEIA 1KTBA 1E71M 3QF0A 3IK2A 4BF9A 1D3GA 4W84A 5I7GA 3W86A 4O13A 1CGTA 3PZUA 2QCDB 1I45A 3CHDA 5AC5A 2V67A 6REQB 2WO5A 4NILA 4YPJA 1J93A 5EFDA 4NI3A 4AD5A 3BWWA 4DX3A 4K2SA 1X6LA 3N3MA 2PTYA 2QJHA 2PDLA 3AI0A 4ILSA 4DI9A 1E56A 3RO6A 2DUXA 5D9PA 1CLKA 2F61A 4GYFA 3NO5A 1VR6A 4BK9A 4LVGA 4JKLA 3VPLA 3MP3A 3L65A 1VP5A 4GK8A 3AROA 1FWBC 3BE7A 3BZGA 3DESA 1H7RA 3CWHA 3WLJA 3C2RA 4Y9OA 3BVJA 3IV8A 1V3LA 1WZKA 4NYUA 1GUVA 3U4AA 3G1SA 3RITA 3BLPX 3TWAA 4LC8A 3BURA 1TCDA 4HYWA 3MSGA 1WZLA 3AICA 3EOSA 2CETA 1KFCA 3HN3A 2IKIA 3KWXA 4IIEA 1SYTA 4C6BA 3CUXA 4S3EA 4OV9A 1V5XA 3SI9A 5I77A 1PKMA 1E6ZA 3TFXA 3AHXA 2Q8XA 2PWVA 2BHUA 4ACYA 1C8XA 1MI3A 1PO9A 4L6HA 2ZFAA 3INPA 1ONWA 2W66A 1UD5A 1VYRA 2QUVA 3BL3A 3B03A 4RE3A 2H3DA 1ZRQA 3KS5A 4KWWA 5C2GA 1E15A 4AFYA 1J18A 4PH6A 1F8IA 4JFVA 3BXWA 2Q3OA 2HDJA 1DTNA 1J2BA 1GJUA 2O4QA 3K4AA 2PWHA 2J8GA 4AQLA 2P10A 1PWMA 3Q67A 2G3IA 4H00A 5FAGA 1DWHM 4PUWA 3GNRA 4Z1YA 4PMNA 4L9YA 3BDKA 2J74A 3ZFHA 3SURA 3UYIA 3Q45A 3GD6A 2WWDA 2WC4A 3CPUA 3SEPA 4PCSA 4HA4A 1W3HA 3PZIA 4C91A 4JX5A 5FJOA 1ADOA 1NDZA 3S2LA 2VR2A 3SCOA 2ZADA 3SRHA 2XGZA 4R5EA 4C5YA 3LMZA 3FN9A 4K1GA 3SY5A 1GOXA 3M0VA 2H90A 2GDQA 1YW1A 3QN3A 2DSUA 3PHAA 2FMOA 4PCTA 2V6AA 4PB4A 3AHZA 1S39A 1NP0A 3QLLA 3NL5A 1EZ2A 2TSYA 2UY4A 3P8JA 5G2IA 3W01A 1U1JA 3CS2A 1ODZA 4N6EA 2QCMA 3VGEA 1RAKA 3DI1A 4LRTA 4AZHA 4UTTA 2QDEA 4UR9A 3QRHA 3BSGA 1W5PA 3VKBA 1Z32X 5DY3A 4B4FA 1XKYA 3W1LA 4B3KA 4Q4KA 3WDJA 1RY0A 2A3CA 1EZWA 5A6TC 1ZS2A 5HQEA 3T0TA 1R3QA 2JQXA 4TOQA 1PZ2A 5CSRA 3FJNA 1BKHA 5BROA 1KFWA 5D32A 2BV9A 5RUBA 1TWDA 1DWGM 4XZHA 3RR1A 2NUWA 4F2TA 1KM4A 3MWCA 1W31A 3REQA 1AQMA 1BVWA 2HVMA 2J47A 3UNTA 2PPGA 4LRSA 1EEPA 2YCJA 4G5DA 3T44A 1JG9A 2UV8G 1LQ2A 3S6TA 4D6IA 4S3DA 4G9PA 1MXDA 1SSGA 1EYEA 1VFTA 1W2PA 2W61A 4QE5A 3T0DA 2C16A 4GD0A 3BICA 1V08A 2QJNA 1SGJA 2GDUA 2ZE0A 3EWDA 4DXKA 1S2VA 5I3FA 3THQA 1GVSA 5AZ1A 1UIOA 4JIIX 4E2DA 1PCWA 1A3XA 2ATMA 3EX2A 4KT2A 3KRZA 3W6MA 4G8TA 2VX4A 3VGDA 3M5YA 2GUYA 4M3PA 1LOQA 2Y70A 3AHYA 3VOFA 1QCWA 1LRTA 4MHBA 4UOZA 4S38A 5CJMA 4B3LA 2HK0A 2PRMA 5IM51 1OEPA 1XGZA 3M4HA 3MCNA 3W4RA 5C54A 3PZMA 5KITA 3WKZA 2BGNE 3VOHA 3KVLA 4HOWA 2ZXQA 1M68A 2NXIA 3G1RA 4ECLA 4IZGA 4IIFA 8XIAA 1QT1A 2HVOA 4IIGA 2ZX9A 1RCQA 5K7JA 4QR6A 5A8GA 5LSMA 1KR1A 3HMCA 1VFHA 3W7QA 4AF0A 2Y1HA 3H4XA 3VYLA 2A7NA 3GU9A 4LEQA 5F1UA 1GG0A 5DLCA 1IEWA 1BF6A 3IIZA 4FNRA 3ARWA 3IACA 4O28A 3W37A 1ZAJA 1XI3A 1ENUA 4CNNA 4ZFCA 1YIXA 4LW7A 2SFPA 2J25A 3FGCB 3NJ3A 1KKRA 1TX0A 4B9YA 3I10A 2ZUSA 4OWGA 1UWAA 2ZICA 4Q8VA 2ASHA 3L12A 5CZKA 2VEPA 3WQEA 4WJEA 2Z4GA 4X61A 2QF8A 1VD6A 5J5DA 4GH3A 5I3JA 3BLKA 4HOXA 1T0OA 3VZYA 2WVTA 2E8ZA 3UETA 3LPFA 2PRHA 3H26A 2WHMA 1H41A 1Q6GA 2J78A 3C2EA 3LUTA 2HTMA 3IRDA 1H63A 1GVRA 5LNUA 2Z1SA 3GUWA 5ABFB 5CBJA 2O55A 5AVHA 3F4VA 3BAYA 2C19A 3QKZA 3R8RA 4LAKA 2PD5A 4HTBA 3MVTA 1VCFA 3D6NA 1W8SA 1M7PA 1AMYA 4IMCA 4R27A 3I68A 4DZ5A 4IG2B 4MFDA 1NM9A 1VPQA 4Q6JA 3GU2A 3L4UA 4UQDA 4LUJA 3P62A 3AOFA 1YDVA 4Q4QA 4ATLA 1XIGA 4HOZA 3GIPA 1JZ5A 3BQ6A 3I7SA 3WFAA 3BTNA 2GQ8A 4JTGA 1TMHA 1YDOA 2BGQA 3WJXA 4DUOA 2WM1A 3PZOA 2NV2A 2QGHA 4NP7A 4H7ZA 1XIEA 1PXGA 1FHVA 1XUUA 3NPUA 3EX4A 5REQA 4HHPA 2AGTA 1R3RA 2QPXA 5KZEA 1VQTA 1WAWA 2YXOA 3RF9A 4AD0A 1ELSA 2CZEA 3NPWA 2DY3A 3BJSA 1ZENA 1UD8A 3DKJA 3NR0A 4UOJA 1TKKA 1IT7A 2QDHA 3QPEA 4X22A 4UTKA 2IQTA 2FH8A 1KBLA 1P0NA 5EMKA 1HJXA 4N9DA 2YLAA 3LRMA 4JNYA 3NCOA 3ALFA 5LIKX 4XZNX 3UXAA 1YHTA 3RN6A 5BXTA 4TVUA 5DEZA 1J8VA 4W88A 5HULA 4CU6A 3D5HA 4UOQA 1QPRA 4ZR8A 1JRBA 2CC0A 3TOYA 3K13A 1KFEA 1NU5A 3BARA 1AL8A 4OVXA 2YBVA 1B3XA 1DJXA 3B9DA 4PRRA 2CYGA 2XIJA 2POTA 3EGJA 4K7YA 3TN6A 1J12A 2JIEA 4GGHA 3IJLA 3BCJA 2Y5SA 2G8ZA 2YBTA 3GY1A 4HNNA 3UCDA 2FVLA 3KCOA 2FJKA 2WBKA 4QQ3A 4DO5A 3BK0A 2C71A 3KTCA 6ENLA 4F0LA 2VRKA 4GYPA 1RK5A 4IQEA 3TCSA 4V2XA 3P6LA 2DGAA 3MUZ1 1IV8A 2NUXA 3QFEA 1WNOA 1KB3A 4AY1A 3PWIA 1JYVA 2A6LA 3EOLA 4RE2A 1WX0A 3QQ0A 5CSSA 4LANA 2E9BA 2Z1KA 4HPXA 3SN0A 2ZRXA 1M65A 2CBIA 1EWDA 4JCLA 1CXFA 5LGXA 2Y63A 1B90A 3HV8A 2O92A 2Z27A 2X0YA 3LN3A 4PA8A 2AQWA 5E9AA 3T2PA 4KCTA 3VIMA 1SSDA 3ENLA 3DYOA 3MS8A 4MKSA 3TTSA 3S1XA 4QE4A 3MKKA 2RGMA 5E9XA 3NPXA 2F7FA 3S8HA 1R86A 4MB1A 1A47A 4DN1A 3PPFA 4Y96A 2VGBA 4AZGA 2WLZA 1O95A 1PCKA 4O1BA 1UKTA 4GIYA 4EK7A 5FESA 1GVOA 2X09A 1L8PA 3YPIA 2YA2A 3BLEA 1J9YA 2PTXA 1CCWB 4YTRA 2WQPA 1THFD 1FWTA 2HE8A 4YU1A 5D02A 5HANA 4JX4A 4WXYA 1XLJA 4EXAA 2CCRA 3S9ZA 3P81A 3T8LA 2V38A 1P4CA 4K1WA 1GJWA 1JJKA 2GJNA 3O05A 1UASA 3GYEA 4XKMA 1ISYA 3FKKA 3VZXA 2WB5A 5KZDA 1PPIA 4KIRA 1UKOA 4PCNA 1CXHA 3PVFA 1O66A 3N4EA 1KXTA 1DQUA 2NQLA 3TJXA 4A22A 4FX7A 1JXKA 4XB3A 3DX5A 2BHYA 4L61A 4C1NA 3N6HA 4A4AA 3PUDA 2BP1A 3VM7A 1WUFA 1UOKA 4BHYA 4WDUA 3PTDA 1W6TA 4OHQA 3R2GA 1HP5A 5FEWA 3GIQA 4HZ6A 1Y5XA 4ZO8A 2B0MA 3W07A 1W1B1 4ZB5A 5T26A 3W26A 4X60A 3M0MA 3RCYA 1DXIA 3VILA 3QYSA 5FJTA 4BFAA 3L4TA 3AS0A 1UP0A 3WD2A 1F61A 1L8NA 2VX5A 5IHRA 5HWJA 3RJYA 4RK8A 1J5SA 1V93A 1VIWA 2CPUA 4RZ6A 5LA2A 3TYDA 3WMLA 5HQMA 3N9RA 4NYYA 3T0BA 1U5JA 1BTCA 3K8KA 3UNDA 1KM3A 1POJA 4YTUA 1J01A 1XH1A 4E38A 1W5QA 3BW2A 2G50A 2VZOA 2WHJA 3PWAA 4YWIA 2XFRA 1OIFA 3CM4A 1DXEA 4XZIA 1TV3A 4PBFA 4W5UA 4Q8NA 5FF3A 1SPQA 4H8UA 2A6NA 4IMGA 3ELFA 1BGGA 1V02A 2QMJA 1XCXA 1K8YA 1F8MA 1Q7MA 4GVIA 3SRKA 5FL1A 3BGAA 4X63A 3QC0A 1X1NA 3VE9A 3H7RA 4B5TA 1K6AA 3PB0A 3W7OA 2CZ5A 1Q2SA 3VNDA 4JTJA 1GORA 5LIWX 3W84A 1RZMA 3IJ8A 3IJ9A 3EB3A 4GX9A 2Y7GA 4UB9A 2GL5A 3VCRA 1U30A 1AW1A 2C8NA 2DW7A 4KEZA 3WSUA 3RX4A 3N12A 3MCOA 1RJPA 1AQFA 4L1WA 4R88A 1P48A 1SFLA 3QY6A 7A3HA 4UTLA 3UY7A 1H5VA 3MANA 1R0MA 1UH2A 3GVQA 3CWNA 4ZVJA 2PC4A 2QCEA 2XJ7A 3S5ZA 1TPUA 1QNSA 4XAPA 4W4QA 5I00A 1H3GA 1JFXA 2NX9A 4N42A 3ZIZA 3KOZA 2EJ1A 1WDSA 3EDKA 2FJUB 3H6OA 2JIWA 3O3RA 4DVOA 1UZ4A 2YCLA 1D8CA 1R2SA 3M0LA 4YTTA 3QR0A 1SJCA 3EMQA 1OFPA 4QX4A 3TXZA 2XFFA 1XLIA 3UJRA 1R3YA 4LY4A 1K6WA 5FJJA 4US5D 4PCPA 3FW6A 4DF0A 1V3HA 3OQ8A 3K46A 5TAOA 4JDBA 1U1HA 3W24A 3TC7A 3A22A 3TA9A 4K7VA 4J7RA 1AQ0A 1XYMA 5SWUA 2ZUMA 4WD0A 3ARYA 5G4HC 3OHMB 3ZXWA 3SIMA 1Z6KA 3M47A 3ITCA 1J0JA 4WK9A 2P88A 4LSBA 4GZEA 3WN6A 2FHBA 3OBAA 4RXGA 4F0KA 1UB3A 2DSKA 5F2GA 4U2YA 4D8LA 2PWGA 5FJRA 1MW0A 1QJWA 4IL0A 3CL8A 4RV3A 3EWCA 1SW0A 4C6KA 2QULA 4XKYA 4EE9A 5ABGA 2JF7A 1WDDA 4ZO7A 5E70A 3W7LA 3GDRA 4QIUA 4E4FA 1KR0A 3THUA 5H91A 1O4UA 2IQ0A 3ZMRA 3TQ0A 1OHLA 3AYRA 3G3DA 5AFDA 4LYKA 5JBEA 2NQJA 1JAKA 5CPLA 3CQJA 3GO2A 1M41A 4GE8A 3MVIA 5TNVA 4GUIA 3EEGA 3WK2A 4ZQCA 2G0WA 3DG6A 3QMSA 2XG9A 3GW0A 2R14A 2QV4A 2ZQ0A 3E0WA 4ADTA 2JFEX 4HK6A 3TJ4A 4GG9A 1DJWA 1PX8A 4JTEA 3WLSA 3OA3A 4GKTA 2AL2A 1EIXA 2Z1XA 4W87A 5J8LA 1B3WA 4D6GA 3R1ZA 2BX7A 1QHZA 1XC4A 3IVSA 3UCCA 2B7OA 3MMDA 4WLCA 5EGRA 4RPPA 3WQCA 4JTFA 3AMKA 2ZZ5A 1W0MA 3W85A 3EXRA 1ZLPA 3LQGA 3ONCA 3TC3A 3BSMA 3ARZA 1FUYA 2DQWA 1ZGDA 3GG8A 2ISSA 3PM6A 4C6DA 2I9EA 1LUCB 1E5NA 4M0XA 3BW4A 3WYZA 3URAA 3O6YX 2QZRA 2CZVA 1DVJA 1TMQA 4MY8A 3B9EA 4P8XA 3TTQA 1J4EA 1P1XA 4LGXA 4S3BA 1Z89A 4UFKA 4AZIA 4GOAA 1BXNA 2VWTA 2YCIX 3PSVA 3R0UA 1UR2A 5HMSA 1BPLB 3QKEA 4BQ4A 1FWCC 2D1ZA 1VRDA 5A6AA 4Q7BA 3I4EA 3RPDA 2MUCA 4HZMA 3ZQ9A 4LBUA 3TK7A 2NX1A 1SJBA 5G5IA 3EMZA 1LLZA 3VE7A 2FYMA 4LBRA 1RBOB 4Y90A 2HROA 4JAWA 4TIMA 3EA3A 1OZQA 3CBWA 4L64A 3NEVA 3NYZA 4J40A 4JL2A 1SZNA 4CN6A 4GRSA 4FNPA 3R89A 1E0TA 3GXIA 4GJIA 1CZ1A 1SZGA 4CCZA 2BBFA 4GPNA 3LGDA 1EJSC 5ABTA 2PP1A 4KS0A 5CC5A 3OVQA 1HW6A 1LBFA 3UJSA 3L4WA 4MUZA 2A2IA 2YDAA 3JVAA 4IMDA 1CTNA 4JFUA 2H9AB 5BWAA 3T0CA 4NUWA 3S1GA 7PTDA 1GT8A 1SJAA 2HQAA 3U48A 1NFGA 3UVIA 5CJ5A 4MWAB 1GOKA 4DBWA 1Q45A 3WK0A 4FLSA 3HFTA 4GI6A 3N11A 1BYAA 3PG8A 3WDQA 1WCGA 1OCQA 3ANVA 2ZA2A 2PF0A 4FEZA 4RKAA 4XBJA 1ZBWA 4CUCA 4CQ8A 3PAOA 3PZGA 4GY1A 4QEHA 4OOUA 4DJDA 1W5OA 2QF7A 2XVKA 3QGVA 1HNYA 3KZSA 1PJ9A 2WC7A 3TIMA 1UUQA 5D05A 3T40A 1HJWA 7TAAA 2ACQA 3KUMA 3EKGA 4JKKA 2Y4SA 3CIVA 4QM1A 4DHGA 3VIFA 4Q7IA 4IMFA 3AIUA 3GTIA 1IXPA 3OIHA 2E9LA 4E3VA 4NJKA 4QG8A 4IPPA 3THCA 1JDAA 4TUFA 4AIEA 4FB7A 4D2JA 3WELA 2VZVA 2XH0A 4IPJA 2X1IA 4PMVA 1LJYA 5EPDA 4KFPA 4DJFC 3L2IA 4OIFA 4UR7A 4NI8A 1N2VA 2BY3A 4EF8A 3CB3A 1NARA 2DZVA 4GY0A 4NAEB 4AWTA 3LHTA 5HATA 4ZOBA 1FH9A 1ME9A 4CNTA 4AB4A 1C3FA 1NOUA 3WNNA 1X39A 4A3UA 1C90A 1W9UA 4KIEA 3TQPA 1ICQA 2EPMX 1NDWA 3AXHA 2DSWA 4IUGA 3IJIA 3SSZA 4Q8WA 3VNIA 4UZUA 1R6WA 4LS0A 3QV7A 1LZOA 4MUPA 4KEMA 2IXVA 2Q8ZA 1XJBA 6PTDA 4B91A 4HGXA 2PU0A 1OIMA 5A6BA 1UQYA 4HCHA 3WL1A 1E70M 5FAJA 1OG6A 5CG7A 4MPQA 2KZHA 1NWTA 3ITVA 2Z26A 3NO3A 1W1ZA 2J9YA 2QCFA 1EO7A 4TMBA 3UG5A 4WHBA 3AZTA 1VFFA 4IGSA 3WD0A 4L65A 5AKQA 5LHEA 3GNPA 1T7LA 1FWHC 3E0FA 4TR9A 4BZYA 2WKJA 2F6KA 5EMYA 2PDQA 1Z9AA 3N3TA 3ZR5A 3DC8A 2VWSA 1LG2A 5HMDA 4P8UA 3A3WA 1WE5A 3GVWA 4N4PA 3GNDA 3I3BA 4G1KA 4HNCA 1GKPA 4D1IA 5D2YA 5B7ZA 1MFVA 1BGAA 3E0IA 2NXGA 4WF7A 3H22A 3PUOA 3BOXA 5D37A 1R3SA 4US5A 3C0SA 4Z08A 4LVAA 5REQB 3NZQA 1FHDA 2RDUA 4UBPC 3CLWA 3UWYA 2D2OA 4F79A 1OINA 3M07A 4P7QA 2E5BA 5EMLA 3RK8A 3F7JA 1G69A 4PL1A 1HKWA 3CEUA 4UFHA 3N2XA 4GYKA 2AKZA 2DIEA 5EMUA 2XZ7A 1X8FA 1MNSA 1DE5A 1GYNA 4FMVA 2IPGA 2WSPA 3NQEA 2X7WA 4N9EA 2X2YA 3R79A 2Z1WA 4LCRA 5CJNA 1E55A 4JHOA 5D9MA 4FXJA 3TAOA 1IIHA 4WKAA 4IP5A 3FNDA 4AVNA 3AIQA 3EKZA 1AJZA 1VJIA 4F48A 4FF5A 3JU2A 4D6EA 1V3JA 1WDPA 1BWLA 4UMBA 2PP0A 1OYCA 1M7JA 4QNWA 2B7PA 3TJLA 3KM8A 1F3TA 1GOMA 2MANA 2YB4A 5AY7A 2XIOA 3U57A 2P3ZA 2CLOA 4U3AA 4MB5A 2OR2A 4E4UA 5GNXA 4A2RA 4EANA 3LDVA 3M0IA 2TMDA 1OFDA 3O07A 3GX9A 1MZHA 1Q6LA 3QZ6A 2ZIDA 2QVNA 4PTDA 3WZ0E 3M64A 2OSWA 3AIBA 4IIHA 3P84A 2ZX8A 1XICA 2WMHA 2RFGA 3W71A 3XIMA 5FF2A 3NQVA 2O4MA 1JDFA 1DJQA 2PDWA 3W2LA 3N2CA 4A8IA 4DM1A 4JD4A 3RM8A 3W1UA 3DC0A 1X96A 1JPKA 1US3A 2RH9A 2X41A 1EOMA 3GTFA 4C5ZA 3SUSA 5M03A 3WH7A 3WX7A 1L9WA 2Y62A 4IISA 4LUTA 3KCJA 5F1VA 1DTUA 4ADSA 3UT0A 2E4TA 3WUGA 1H50A 3OBKA 3FXGA 1VEMA 3LRKA 1RH9A 3POHA 5FJPA 4WZHA 1JCTA 1PL9A 3B8SA 2BVYA 4L4MA 1IXNA 4KWSA 4J3VA 2W62A 4EACA 5LIUX 3VOCA 4JR5A 3VUPA 1QO5A 1Q8JA 2YXGA 2PUZA 3FLUA 2FGLA 1QK0A 3WDIA 1RUSA 1E9IA 2A1YA 4W89A 3WLRA 4P7OA 4W8LA 4MYXA 4M56A 1V7AA 4NAFA 3NM1A 1RD6A 3PUGA 3ZT5A 5A8PA 4IQDA 4MKVA 3NPVA 1W1A1 2RDWA 3SCPA 2YL9A 4QSFA 3OGSA 5MKGA 3NSMA 3G22A 4R7JA 1PZ3A 3GDMA 1H62A 4R7WA 4Z2JA 3T2QA 3P67A 2C7FA 1OGGA 4J2MA 1V79A 1F73A 1M03A 1PEZA 5LNSA 1XLHA 1U2YA 2FFIA 3MUAA 2Q8LA 1UH4A 1O5KA 4JTSA 3HB9A 5BU6A 4FP1A 2JK2A 2NUYA 2QCNA 3B8IA 3WLQA 1PKNA 1A5KC 4Q8PA 1YEYA 1WYIA 2X8RA 3R8HA 1DP0A 3R7MA 1Y65A 1R2TA 1HL2A 5CPOA 3N9SA 2C1GA 4H8VA 3EZ4A 2J75A 3VX0A 2X05A 3H2NA 4MNKA 3MU7A 3PBMA 3W2MA 3FYOA 3K2GA 5DMLA 3UWQA 4LBSA 3EA1A 5CSYA 4JCMA 5A1AA 3GHUA 4S2CA 1A4MA 2CEQA 2J88A 3F2BA 1TR1A 1MW1A 1NELA 1ZB5A 3E6EA 3RCMA 2QIIA 3NGFA 4AWUA 4BI7A 1UH3A 1OFQA 3L9CA 1H1NA 2NQ5A 3W7EA 2E5DA 3IGXA 1LL4A 3NEHA 3AUOA 2OWCA 1WAUA 4KGLA 4JFWA 4PMUA 1QO2A 3ONBA 2POZA 2Y5JA 1FWNA 2IS7A 4B92A 3FK4A 3LLDA 1DKWA 3B8DA 5CZJA 1B3VA 3ABQA 3RLHA 2YB1A 3GB6A 4QXIA 1GVFA 4Q32A 4KRTA 1QI3A 3GBEA 1E51A 3GKAA 1CXIA 2FZDA 3P5YA 4RR4A 2Y8UA 3USZA 4IH3A 1JYNA 1XYAA 1EJ7L 3P0WA 1A5UA 1XG3A 5L6UA 5EFFA 2BXVA 4CN4A 4AVFA 3FYYA 1ZBKA 2I14A 1RQHA 1W1IE 2BY1A 2QEZA 4V1YA 2PDKA 2NX3A 1BXCA 5L9FA 1LLOA 2XIBA 4FK9A 1TWIA 4WOZA 2FZBA 3RG6A 2OSYA 4HIBA 1S2AA 3A5FA 4Y6GA 3IK4A 1FA2A 2X0SA 2EKCA 3F5JA 1DJYA 2YW3A 2DU2A 2ZZ1A 3H55A 3NQBA 3HF3A 1L6WA 4GI4A 1JXJA 4GA8A 3FCPA 1VHNA 3CV7A 1MWOA 4XD6A 3QHNA 7ODCA 4O15A 4OFCA 1XKJA 4CNUA 1XBXA 4M24A 3ATZA 2OODA 3HO8A 1F6YA 3UBPC 2A0NA 3BOFA 1RXOB 3QW4B 4KGJA 5K9CA 1EHNA 1XWYA 5E5CA 1E4IA 2J4GA 4IHCA 3EDDA 4OJYA 1TX2A 4D6JA 4DEFA 3HQOA 4RE0A 4HU3A 4OGZA 1FCUA 4OBSA 4ZE5A 1KWGA 2W91A 3G0UA 3WLIA 1EL3A 2JEQA 5HNTA 7CGTA 1TVPA 2OX1A 3W7GA 3D0CA 3G1FA 1E0WA 3MB9A 2ZRVA 2WOQA 3AMDA 2D2GA 5BMXA 1C92A 2WLYA 1G67A 5AVNA 4D6HA 1L6YA 2PWUA 3V5FA 3A5VA 3MUXA 4Y9AA 2CXEA 2VDIA 4F0RA 1XD1A 2OCZA 1B9BA 3TKFA 3P3BA 1C29A 1EP3A 1UWQA 4RNIA 4DIAA 3VOJA 2YLLA 2GVLA 3LHWA 3LM3A 4TU1A 3OZMA 5K3VA 3K4WA 4HA0A 6XIAA 1QPKA 4V27A 1QPOA 2VELA 1XINA 3WF0A 2PC8A 1XSJA 5DBUA 4NASA 3HPAA 1FDYA 1RBLA 4JQ2A 3VKJA 5HJLA 2ZBTA 4YVVA 1D8WA 3WMBA 3B8UA 3CXOA 3W76A 3K5XA 3MY9A 3T8QA 3U7VA 2QCGA 2A5HA 3AJ7A 4M8UA 5GQBA 5FL0A 4C6EA 3O8AA 1EGVA 1TPDA 4ROQA 1E5JA 4K38A 2QPSA 4XIAA 1CBGA 1FWIC 4IMEA 3LSBA 5JH1A 3I4KA 1M01A 1UD3A 2W79A 4OUEA 3QY7A 2Z0IA 1FBAA 1P5BA 2ACSA 5TD4A 4QQUA 4G2DA 1O5RA 3S1VA 3C2OA 4XZ9A 5M5DA 4QAIA 5A2BA 1TPB1 3ZT6A 4OKDA 3UZXA 3WNLA 2DV0A 3B9OA 1MEHA 3CHFA 2PE4A 3LM7A 3M0XA 3M6YA 3KBMA 1FHUA 1BQCA 2ICSA 4A2SA 3LZ5A 3S9YA 4JXCA 1GYMA 3TW7A 1HKIA 2J7BA 2AOSA 4R9XA 3W7PA 1G7UA 1KCZA 4TX9A 3OZOA 4LVFA 3JR2A 1A5NC 3VIIA 4LUSA 3EOOA 4S3AA 3SY1A 4KEUA 4NT0A 2IUZA 4OU1A 1Z69A 3WLMA 1E0VA 1ZJIA 4L5ZA 4C6IA 3RUBL 2V5CA 4HVXA 3KVKA 2QCDA 2D0GA 2RKXA 8A3HA 2V2CA 5H1WA 3TZNA 1F9CA 2J79A 4H7CA 2ODOA 3A3HA 1H11A 3TUUA 3L4YA 4QAWA 1SUXA 3UJEA 1DWJM 1OX5A 3MI6A 1MO0A 2R1MA 4GISA 2IKHA 3VKCA 5AHLA 1DJHA 3ARQA 3S6DA 1ISZA 1Y7VA 4NY2A 3ZOAA 1U5HA 5I3GA 1EJTC 3W72A 3RILA 4ORMA 4FI4A 1X38A 1B3YA 4YTSA 1J10A 2EPNA 4JYDA 1JDCA 5FD0A 1I2PA 2OWWA 1RPXA 1UZ1A 1I75A 1CIUA 1SMDA 3R5EA 5G1MA 4QISA 1KBJA 3VMNA 1PYFA 4QCFA 2PDBA 4BI6A 2A7PA 3IPWA 2V63A 5HNRA 1DL3A 2BDQA 4K8GA 5H8MA 5K4ZA 5G1YA 1XBZA 2R1KA 3PTKA 3WLTA 3ARUA 3DYPA 2R9RA 2TAAA 3H2AA 4K6AA 5C70A 5BXSA 3FIGA 1JIBA 1VENA 2BOEX 4HMNA 5GNYA 3WDPP 2UBPC 2CLEA 2FPYA 3V7PA 3A9BA 1E73M 4IGNA 3UZWA 1JDEA 4ZB0A 3COTA 3MV11 3BAWA 4KETA 2BOFX 3BG5A 4NHVA 4AF0B 1H51A 1EDGA 3GDTA 4H19A 4GUHA 1JCJA 4C7DA 1TTQA 2E1WA 2PTDA 2IPJA 4OQVA 3H21A 3XISA 1M9HA 3NQ8A 3AO0A 4D9PA 4FOKA 1H7OA 3RPTA 4D72A 4RZ5A 2GVJA 1XGEA 1EHAA 2I5GA 3VFCA 2A3HA 3WQFA 3PBVA 3VM5A 2CLIA 1BG4A 4EWND 5AHIA 2Y0FA 4W7UA 3GH7A 2FDSA 3LLFA 1IT0A 1E6XM 4E8DA 1S5VA 2BXZA 4PMZA 3E74A 3OO2A 1E4MM 2R94A 5I02A 1OGBA 1XFBA 4DJED 1E4LA 3E0LA 4JIRA 5DQPA 3LY0A 1YMYA 6TAAA 3FEQA 5DT7A 4OV4A 4DJFA 2P0OA 1I2NA 3CZGA 5AC6A 5DRCA 4ROPA 1DOSA 4L1GA 4AX6A 1OVDA 4FALA 3ARPA 2WNNA 2ZXAA 3KP0A 2E6AA 2WYSA 4UC5A 4LV4A 2DT2A 1EC9A 1KQZA 4GBDA 3BMWA 3KFTA 3SO7A 1T41A 2WCGA 3WH9A 1RLCL 4JEJA 3LPOA 1E6RA 3LCIA 2WK2A 5FEXA 4C6JA 4XD4A 5KZ6A 4F66A 4RE4A 1AA1B 3OP2A 4LH8A 1QASA 3UXKA 3P14A 3MUCA 5AC7A 1VS1A 3CT2A 4TMCA 4JTUA 1A3HA 2FTYA 1XQLA 3GR8A 4R53A 1R7AA 5LKYA 1NY1A 3U0HA 5EU9A 3ALGA 2JKEA 1F4AA 2OOFA 2WSQA 1LTDA 3V0UA 5A8MA 3E5BA 2QW5A 2CIPA 2P50A 2XSAA 1JPMA 3H53A 3WIJA 2VDGA 4AXKA 2BY2A 2ZUWA 2B81A 2O9PA 5CGTA 2BLEA 5DN1A 5I79A 4ACZA 3ZSSA 1TV4A 2ZTKA 4IPIA 1XYFA 4D8ZA 3AIRA 3NVTA 3TW6A 2ANUA 2ONEA 4WJ8A 5HNNA 1TR9A 2HWGA 3DFSA 4DYJA 3F5KA 2GOKA 2R91A 4O12A 4ZQPA 2X1TA 2YW4A 3DGBA 4D6DA 5AB3A 1P7TA 2CLKA 1EXBA 5GVJA 1PS9A 4XTDA 2NVDA 4NL1A 3RU6A 4WIWA 4PUDA 9XIMA 3TYAA 1OBAA 1EPXA 4QROA 1W5MA 2OG9A 4JBRA 3CU2A 4NNCA 3GG7A 2I5QA 1YBQA 3BOLA 2I17A 1WUEA 1DORA 2ALRA 1YTKA 4PODA 4BR1A 1Z48A 3NQ2A 3GUGA 4WXZA 5HR6A 5FJUA 2WSYA 1CWYA 4P61A 1OQFA 3N15A 3PZVA 4NZ4A 1Y8BA 3EWZA 2FVMA 5CZSA 4M29A 4D6FA 2HVNA 2ZYFA 3BGJA 3LI0A 3CQ0A 3HQ1A 1UD6A 4AU0A 1IWPA 1XCWA 5C0QA 4GBUA 4WRHA 2V5LA 4IP7A 5PTDA 3ZJ8A 3C61A 3VZZA 1KTNA 3CASA 3MMTA 4DBDA 1W3LA 3E3HA 3RHGA 2ZA3A 1H4PA 3JRKA 3CUFA 5FF4A 5F2IA 4GO8A 5DELA 3M0YA 4QBXA 3VU2A 1AH0A 4WKFA 2XM2A 2ISWA 4V1XA 2QV5A 2XH4A 3S42A 3MMUA 4GIAA 4AG0A 4R34A 1ITUA 6ALDA 1XR2A 4HU0A 1J5TA 3J7HA 5F2LA 4KH2A 4OBTA 3OG3A 4L4PA 4LS2A 2DZXA 2R6OA 1ZP3A 3BCDA 4XTIA 1MFUA 5D9NA 3VKAA 1WDQA 2X30A 4RUBA 1IR1A 4ZL1A 5CAHA 4LV9A 2VD9A 2VD8A 3TSDA 4NX5A 1VGAA 2CHNA 3SCVA 2Z7KA 4BCEA 3DAQA 1K4HA 3ZYZA 1E40A 5C71A 5BRQA 1UWRA 3GVVA 3TLLA 3ITTA 4ICCX 5BOFA 2V81A 2VQUA 2REQA 1NDVA 1XISA 1X97A 3OVRA 4GACA 1EOKA 2FGBA 1C8YA 1KV5A 3RFAA 5CLTA 1T6MA 3CUGA 1AH3A 1G4TA 4GI8A 2XVPA 2OKOA 5G2WA 1SO6A 1ME7A 2GSHA 2OSXA 4FR1A 3GRIA 4DUXA