2Z2UA

Crystal structure of archaeal tyw1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
279
Chain Sequence
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNSQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0026 protein MJ0257
publication title Crystal Structure of the Radical SAM Enzyme Catalyzing Tricyclic Modified Base Formation in tRNA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 103
structure length 279
sequence length 311
ec nomenclature ec 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).
pdb deposition date 2007-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF08608 Wyosine_form Wyosine base formation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z2uA00
4BI5A 2YZRA 4TR9A 4ADSA 1AMKA 4YL2A 1Q6OA 4ML9A 3UWUA 4O57A 5DY3A 1JJKA 1MO0A 3O6DA 2ZZ5A 4YCOA 5LNWA 5D2XA 5HWJA 3W7RA 5LSMA 3BVJA 1LDCA 3P84A 4FNPA 1VC4A 1T99A 3ZR4A 1SFLA 2NX9A 2OT0A 3SI9A 4MZ8A 5A8GA 4WY0B 2V81A 4FXRA 4XUGA 5FESA 3UY7A 1SUXA 4LVGA 3STGA 5CPMA 3G1XA 1KM4A 4FNUA 4QSHA 3W1QA 1JCNA 2YYTA 5LNVA 1QPOA 1IIHA 5K4XA 1X7FA 5D30A 3NQDA 3LCIA 1VGAA 3M47A 4O19A 4LC6A 4WJEA 3TV8A 3GIYA 3WJZA 1TJPA 1PIIA 1HG3A 1CW2A 2WNNA 2EPHA 4FNQA 3STCA 1H63A 4O53A 3W7HA 3M0ZA 3DFSA 3CIWA 3O06A 3RF9A 2FTPA 2NX3A 3CWOX 2X1RA 5E1QA 3OEXA 1P4CA 4O17A 3C2VA 1VQTA 1OHLA 3OHIA 3ZWTA 1H1YA 3U6WA 1XFBA 5A5WA 3W7EA 5G1YA 1OYBA 1SO4A 3EWZA 4HNTA 3Q2DA 4JDBA 5AFDA 1J4EA 2VEKA 5LNUA 3KVLA 3W2MA 3W86A 3WK3A 2WNQA 1H62A 3QH2A 2ZZ7A 1FWNA 2E6YA 1ICSA 5K7JA 4Z08A 3RFAA 3NXFA 3IVSA 3NL6A 5IBXC 3CB8A 4QM1A 3YPIA 5FF0A 2V82A 4ZQOA 5KITA 4UFKA 1OFAA 4P2VA 2QCDB 1V5XA 5AHFA 1LOLA 3G3DA 4N6FA 4LS2A 4JYFA 3KVKA 1VPXA 1LZOA 1I45A 3PVFA 2TYSA 5AYZA 4NZJA 3G1VA 1QO5A 2QCEA 3QFEA 2ZA2A 1TO3A 3C3NA 5LGZA 4O52A 3A22A 1W3IA 4QJ1A 1XUZA 1S5TA 1Q6RA 4POCA 2FPVA 2VFFA 5CPLA 5CSSA 2QKFA 2VFGA 3L66A 4QNWA 1TTJA 4ICNA 2NWRA 2YYUA 4UTTC 1LBFA 3OIXA 4DBEA 1NSJA 3MHFA 5HR6A 3QEZA 3QQ0A 4HNVA 1QO2A 3TU9A 4WOZA 2GUUA 3F4WA 1TTPA 2J27A 1W8SA 2ZRWA 5C54A 3NQ8A 3W1UA 1ZHAA 3CLMA 4OBTA 1W3NA 1QWGA 3NDOA 5F1VA 3TXZA 3MHUA 4UFIA 5D2WA 1MXSA 1DORA 1QOPA 2XN1A 3LRKA 3S42A 4IX0A 3KFTA 3CC1A 4M7SA 3OA3A 5KTLA 1OX4B 4WOQA 3W1RA 2DORA 1K8XA 3LXBA 5DY2A 4JYDA 4AHPA 1UUMA 2LLEA 3QRHA 5EL1A 2RKXA 1OYCA 3OVPA 4DPPA 1RQBA 4FXSA 1OK4A 1PCKA 3GKFA 3P7YA 4ZMGA 1YTDA 2YDAA 2NUWA 3LRLA 1VYRA 1K8YA 1XDLA 4WXZA 3ABSA 3TMLA 3W07A 3TDFA 1F05A 3LGEA 3M43A 1H7OA 3M5ZA 5D38A 4FNRA 3MI6A 1LBMA 4O16A 3LB0A 5ABTA 3PG8A 2O7QA 2GVJA 5IBXA 3H55A 3KRUA 4ZQRA 4JTIA 5K3VA 4UNKA 2P1FA 1CI1A 5T26A 1JULA 5D37A 4RXFA 1O4UA 4P61A 4AWUA 4ZQMA 2NV1A 3FYPA 2VC6A 4LRTA 5HUOA 2CZ5A 4LV4A 3UWVA 1A53A 1TRIA 2QAPA 3W7NA 3BO9A 3G0XA 2ATMA 1BTMA 3LCHA 1NF7A 3T55A 4XBSA 2A21A 4XWUA 4UTTA 3F1QA 4ZQPA 1FDJA 3LI1A 4O28A 4I9AA 1JCLA 1TRDA 4XTIA 5E0KA 3TJXA 4U28A 2CZDA 1U83A 2E5DA 2RH9A 2FDSA 3C56A 1B4EA 2A6NA 1I2PA 3GDLA 3DFPA 2GPTA 5DCBA 1HL2A 3GDKA 5DXYA 3MWAA 3L5AA 3WJWA 3LTPA 3FJ6A 4IMEA 5G5IA 3M7WA 2D73A 3CWNA 4UIOA 4HPXA 2Z0IA 7TIMA 4GJ1A 4LW7A 4ZZ9A 3W23A 1ME9A 4K39A 4KFNA 2KZHA 3HMJG 2CLLA 5FEWA 3ZFHA 1R46A 2PRHA 3R12A 1W37A 1RQHA 3LCWA 2RDWA 3G22A 4TMBA 1FCUA 5FEZA 3UNDA 1G6CA 2YFOA 2Q8LA 1G4TA 4L4LA 1SO6A 3DH7A 5KINA 1IIGA 1A5AA 1MZHA 2VFHA 1P5BA 1QPNA 2HSAA 1DOSA 2VFDA 2YX0A 2FLIA 3TX9A 4AXKA 1OFBA 1F7BA 5LHFA 1D9EA 1WAUA 3ATYA 1EUAA 3M5XA 3TA6A 2RFGA 1N55A 2P10A 5F4SA 2ZBTA 4ZQCA 1O94A 4LS1A 1UASA 1OX6A 3I68A 5DBTA 1W5MA 2B0MA 3ABRA 2F7FA 1GVQA 3MI3A 5D2VA 2NUXA 2XFWA 1GQNA 1EP3A 2J9ZA 1ADOA 4N2YA 4RZ4A 2DZUA 5CPOA 1FBAA 3LXAA 3DFQA 2Z6IA 3W3OA 1KM3A 1D3HA 3W85A 4JD4A 4RZ5A 2WQPA 3TE9A 2HMCA 3PB0A 1YXCA 4NJHA 2QCNA 3RNDA 3IVUA 2VFIA 3SR7A 2Y63A 5J5RA 3NPUA 3BPWA 1EP2A 3N73A 4LOCA 1LORA 3S6DA 1DJNA 1Q45A 1T8XA 3LHWA 4JN6A 3TNOA 1YXDA 4NX0A 2OX1A 1RZMA 4K37A 3GX9A 4LUIA 1OFOA 3L0KA 1DHPA 2NXGA 3F4NA 3SGUA 1SPQA 4UNLA 1KV8A 1Y0EA 2J88A 4CQ9A 2ISVA 3VE9A 3G0SA 2V2CA 1RVGA 3M41A 1W1ZA 4FHAA 4K38A 2JKAA 3THAA 1C9DA 4Q32A 4D2JA 3KXQA 4MUZA 4WY0F 3NZRA 3DHDA 4Y9AA 5CZSA 4WD0A 1AW5A 2QCFA 4MIMA 4M6VA 2X30A 5K9DA 5DBUA 3HF3A 1TIMA 3MP5A 5KZDA 3ATZA 1G4PA 4BK9A 1DV7A 4N9DA 1NAL1 3O07A 2YCEA 1OYAA 2Q3RA 3IRDA 2Y61A 3MHGA 3G18A 4LVAA 4BR1A 1VCGA 1I4NA 3W70A 5DCDA 1ML1A 3G1SA 1SZGA 3DI0A 4FX8A 1DKWA 5AYYA 4MYAA 1GOXA 1MSSA 3UWWA 3LHTA 2QDHA 4TO8A 3HG5A 1OFDA 1VYSX 3NPVA 4NNCA 1TB3A 3TK7A 3C6CA 1WOAA 2CZEA 1GEQA 1QR7A 3W7CA 4O0KA 3LCGA 4UFJA 3GAYA 1F74A 3KRZA 5U4NA 3Q94A 4LV9A 4JTHA 2YPIA 3F03K 2H8XA 2R8WA 1SZNA 1YPIA 1TPWA 4Z1AA 5IM51 1W56A 3TR2A 1H7WA 4NXKA 4GWEA 4OGZA 3GYEA 1LM1A 1IXOA 1WBJA 3I65A 4LS0A 2V9DA 2QF7A 4IPIA 3AO0A 3TW7A 1UUOA 3G1HA 3OVQA 3M9YA 5HQEA 1UBSA 4RJEA 1LRNA 1E51A 3QPZA 4MY8A 1YDVA 5BNKA 3IGXA 2CLIA 1K02A 2VEMA 3NGJA 3W1PA 1JCXA 4MZ1A 3L2IA 5K2ZA 3IEBA 1RQEA 2DJLA 4XBKA 3Q58A 3CHVA 1VHNA 5D04C 1PS9A 2XN2A 1GVFA 1R2TA 3LLDA 4UFMA 1OX5A 4PA8A 1TV8A 1EUNA 4HSOA 1X1ZA 4WUIA 1KBJA 3NL3A 5C2XA 3LCXA 1GTHA 5HWMA 1VCFA 4DF0A 2ALDA 3RMJA 4HHPA 1LCOA 3W2JA 2E68A 2I14A 3EXSA 1LOQA 3W88A 3TAKA 4FX6M 3S8HA 2B4GA 1W0MA 3PAJA 1L6WA 3QMSA 1C29A 2FB3A 4E2DA 3W1TA 1HO4A 1TQXA 3NQVA 2BX7A 3G1FA 4A3UA 3E02A 4O50A 1EEPA 1GVRA 1VR6A 1AL7A 4CNNA 3UZ5A 3HIJA 2HTMA 3THQA 1TJRA 2Z2UA 3QM3A 2Y7GA 4RK8A 2WSRA 3W9ZA 2H6RA 5LHEA 1W54A 4CLMA 4K6AA 3S5ZA 1IF2A 1TPC1 4JTSA 1IXPA 2V30A 3TJLA 5LKYA 1HUVA 1OFEA 3H53A 3N9RA 4O4WA 3USBA 3W2LA 4ZQNA 4O1DA 2B7OA 1GZGA 1VLIA 1A5SA 1SFJA 1R2RA 3B0VC 3HG2A 2GJLA 1G7UA 4BWLA 1S5WA 2R14A 2G97A 3TAOA 1TREA 5DELA 2CLEA 3R13A 3CPRA 1M7PA 3LHUA 4AHQA 4FX7A 1XBVA 3LBMA 3R89A 4H4IA 3HGRA 4HPJA 1XM3A 3PB2A 1Z41A 3KX6A 5EYWA 5KMYA 1KV5A 2Y89A 1RPXA 1FWSA 2CLFA 1M7OA 1ZFJA 3W87A 2WSQA 3HG4A 2CFFA 3E49A 2B7QA 1JCJA 2B7PA 3GR8A 5FEPA 3LHVA 2A5HA 1H60A 1TSIA 1BWLA 5EA9A 1NFBA 4N9EA 2FFCA 2H90A 3WJSA 4BI7A 4RKAA 3W7KA 2ABAA 2W0UA 2WSYA 1H1ZA 3A21A 5C6MA 1JUKA 6TIMA 1LP6A 2QR6A 4JTUA 1FDZA 4IPJA 1C8VA 4Y6GA 1ICQA 4K7YA 4AWTA 1X6UA 3TSDA 5I3HA 1QDSA 4H6KA 2B7NA 3TCEA 1SW3A 3GXNA 4HKPA 4JDYA 5EY5A 2CLOA 3CU2A 5C5YA 3P81A 3A5VA 4TMCA 3G8EA 5F2GA 4W9TA 1KLZA 3P8IA 2ZTJA 3ABOA 4JTJA 1O60A 1I2NA 2QDGA 4X3ZA 4YXGA 2WOQA 2ZFAA 4NT0A 3KRSA 1NF0A 3NQGA 3M16A 2NUYA 1W5PA 1CX9A 1GTEA 2GVLA 3N19B 2DP3A 2A0NA 3IIZA 3T78A 1T0OA 2ZZ1A 2QUUA 3L68A 1KFBA 3P8JA 2V2HA 3UPWA 3TKFA 3UYCA 5D2YA 1H7RA 3WJXA 3LOTA 1SZEA 3EX2A 4N4QA 1H7NA 2J9XA 3DU0A 3U2OA 2Y7FA 3BG3A 2PE4A 3NEVA 2BXVA 1O5XA 4YMZA 1ZENA 2WKJA 4MZYA 4BI6A 4HNUA 4NNAA 5EBUA 4X9SA 4OWGA 3ANYA 4CNPA 4FB7A 3KOFA 1QMLA 4K7VA 3PWAA 4UUIA 2Y70A 4FIRA 2DZVA 3PSVA 5CSRA 3W1AA 3EKZA 3PS7A 6ALDA 2E6FA 3W1MA 3I6RA 4CQAA 1ZALA 2DZTA 5AC6A 1KA9F 3O05A 1O95A 1MEWA 2GOUA 5EMUA 3QMTA 3W75A 3GNDA 3CQ0A 1XI3A 1HFBA 1X8FA 4NXSA 4RCXA 1KFLA 2ZA3A 4N9BA 1KM2A 4WZHA 3ABQA 1JRCA 4AB4A 1HTIA 2ZRVA 3BW3A 3SECA 4O11A 3P5ZA 3O15A 4O18A 3C2FA 5K4ZA 1K03A 3BK0A 1B57A 4M6QA 5D05A 1DBTA 5H91A 1S5VA 1YTKA 4JX4A 1SO5A 4K8EA 1B9BA 3PBYA 5D02A 1XBXA 3P74A 2X1TA 5BMWA 3IVTA 4LTSA 1GVOA 3O1NA 3N2XA 3S5YA 3M5VA 2Y7DA 4E0CA 2J6XA 2HS8A 2YR1A 3BLFA 2DZPA 3EXRA 4XQ6A 4Z0SA 3OBKA 1AK5A 3N2MA 4MLRA 1KW1A 3NNTA 1NEYA 4DEFA 4JTGA 1EP1A 1L6SA 4O1BA 4OV9A 2EF9A 3NQAA 2QCLA 3NM1A 4LNYA 3HG3A 1W5NA 4GUIA 4IMCA 4A2RA 3Q37A 3SGZA 2Y7EA 1UJPA 1TCDA 3FFSA 1WBHA 4N6EA 3FS2A 4AF0A 2TSYA 3C0JA 3CM4A 3FEMA 3BGGA 4KFPA 4UTWC 2C1HA 3NA8A 2W6RA 2CW6A 2BSLA 2E5BA 3QW4B 3QW3A 3CEUA 3LXCA 3MO7A 2VKZG 4FEZA 1JCYA 3A9IA 3PBUA 5SWUA 4NZFA 3W7LA 2YSWA 3NM3A 4UFHA 3DENA 1WYIA 3EEGA 3TW6A 2ZTKA 1DQWA 2G96A 3BLEA 4NNBA 4R53A 1FXQA 1L9WA 3B0PA 3GDMA 3S5NA 1QPRA 3UZJA 2C13A 2FPTA 2GQ8A 4PC8A 2NWSA 4IMDA 1K7FA 3W1NA 1W5OA 3GAKA 4PEKA 1SQ7A 3O6YX 3S1WA 4Y90A 1TV5A 3O63A 4RX0A 3PBWA 4PFMA 3W22A 4HN4A 4OV4A 1AL8A 3L5MA 4O1AA 2WV8A 1OG0A 3B05A 3LM7A 3SY5A 1I2RA 1KM5A 3U8GA 3O8AA 1XBZA 2A7PA 2C3ZA 2J24A 4X22A 2GVGA 2W79A 3NQ2A 4Y8FA 4LT9A 2ZYFA 5TQLA 3NL2A 4NJKA 3B4UA 1WOBA 2Q3OA 1KTBA 2WNZA 3W2UA 2QCMA 4CCEA 2Y88A 1TYGA 3TMQA 3NPWA 8TIMA 4C1LA 3LV6A 3W7OA 1EX5A 2C6QA 3W7JA 3CT7A 2ZRYA 3EWWA 1F73A 1FCVA 3E96A 3JRKA 4GUFA 2FJKA 3PC0A 3NPXA 3MP4A 3WK0A 1SSDA 2Y6ZA 3C2OA 4U4MA 4XKYA 1P0NA 3G3MA 1DVJA 4NJIA 2XN0A 2ZZ6A 4GUHA 3B03A 3NQ7A 3W7PA 2QUTA 1XUUA 1KBIA 4N02A 2CZFA 1K3UA 4O1CA 2HS6A 4JY9A 3PULA 3M44A 3GK0A 3W1XA 2NXHA 2NZLA 2NX1A 5I3GA 1FWTA 1XKYA 3PUDA 4OHQA 3DXIA 4ORMA 5FF3A 1OF6A 4UTWA 3MJYA 3GDRA 1OFRA 3DAQA 2R94A 2ZQ0A 1TTQA 3BG5A 5I3FA 3P67A 5BRBA 2FB2A 2NV2A 5G4EA 3UD6A 1OFPA 1YPFA 3P60A 1B3OA 3LV5A 3G1DA 4N4PA 3SIZA 5F2IA 4MJZA 3NQCA 3BW2A 1G4SA 3NQFA 1PCWA 4IGHA 4A21A 4O4VA 1ME7A 2EKCA 4MY9A 1FUYA 1SO3A 4TU1A 4ZVJA 2DZWA 1GWJA 1TPB1 2G95A 4AWSA 1LRTA 1PL9A 4PL1A 5HUPA 5AYXA 1EWDA 4UMCA 2PRLA 2C0AA 2C19A 4UTKA 1PHQA 1T96A 5AHEA 1EWEA 4ORIA 1QNVA 2OZ0A 3MP3A 3LERA 3HGJA 1WXJA 1OFQA 1ME8A 3TFXA 2JBMA 3MYPA 2QUVA 4EOUA 2E1DA 1SSGA 3EX1A 1H51A 2H8ZA 4BWLC 3DBPA 1VJIA 1QFEA 3IV3A 3R5EA 5L6UA 5HR7A 3G0UA 1U5JA 1W5QA 3VCRA 3LDVA 3QPYA 4O15A 4DO6A 3W76A 3FKKA 3QSRA 3EWBX 1RV8A 5G4WA 5KZEA 5LNSA 2VFEA 5BMXA 3MBFA 5DXXA 2OT1A 3TQVA 4ALDA 2G5WA 1JUBA 1YDNA 2JKPA 1SZFA 1TQJA 2A7RA 3KAOA 1RR2A 1ALDA 3P80A 3FOKA 3PY2A 1NVMA 3GZ3A 3EKLA 3W71A 3UWQA 3G8RA 5AHIA 3LRMA 5HMSA 5U7SA 1QCWA 1YTEA 3LTYA 2Y62A 3KVMA 4CNOA 1KFKA 5DN1A 3KVJA 3L5LA 2ZRZA 4A22A 3N3MA 5E93A 4DXVA 3C4UA 1Q6QA 4O0ZA 4UR8A 1I2QA 3TC7A 2AAMA 3GR7A 1F76A 1IXQA 1HO1A 3SW6A 3STEA 3E0IA 4S2CA 5G2IA 1VCVA 4JIQA 1VZWA 4JICA 3M6YA 1GJPA 2PCQA 1GG1A 5J5DA 3NG3A 2WPBA 4Z1CA 4JY8A 4KWWA 2FPYA 4H3DA 1KM0A 2A4AA 4UCGA 2E6DA 3QZEA 5K9CA 4EVZA 3QSTA 2AQWA 3HO8A 1EPXA 2GQ9A 5CZ0A 4LWWA 2ZDRA 3GXTA 1VHCA 1YDOA 5AC8A 3LX9A 1JQXA 3EWXA 1H61A 5FF4A 2JK2A 2A7NA 2H3DA 3TUUA 3ELFA 3VI2A 2A85A 1LRQA 3P5YA 1RD5A 3TSBA 3WJYA 3EX3A 4WY0A 3NQMA 2VELA 3ZS4A 4EF8A 1EA0A 4MVAA 2IQTA 5AC7A 1ONRA 4MFDA 1GG0A 3S9YA 4IMGA 4TX9A 1DQXA 2C16A 1S3HA 5I3KA 5DLCA 4UTHA 3STFA 2DU2A 1SW0A 1D3GA 3TC6A 1FWWA 4IMFA 4FNSA 4DF1A 2X2GA 1KM1A 1TPUA 3LTSA 1VRDA 1SW7A 3EWUA 2Q8ZA 1F5ZA 1JCMP 3T7VA 1H7PA 1ZAJA 2CU0A 4FF7A 3TQ0A 3SFKA 1SU5A 3WK1A 4A2SA 1P0KA 4M5PA 5D2TA 5EKYA 2TRSA 1G69A 3DFNA 1LYXA 1W31A 4Q33A 3IGSA 4JTLA 5F4WA 2O7SA 2FIQA 4HT3A 2J9YA 1G67A 5AHLA 4RR4A 4NVTA 3HGSA 2C15A 5F4XA 3EWYA 2DZSA 3T44A 4UR7A 2E77A 1FCQA 3VKJA 1OVDA 3H54A 3NL5A 2QCDA 3A23A 3LCLA 3UXAA 5L9FA 1LLZA 3A5FA 2E6AA 2V8ZA 3HB9A 3IIXA 3E12A 3W6YA 4JYEA 1YXYA 4IXXA 4Q4KA 3TXVA 4ADTA 4FIQA 2YFNA 3S1VA 4AAJA 3QYQA 3QJAA 1A50A 1TPDA 1KTNA 1A5BA 3VFLA 2QJIA 3W83A 3BLIA 3TIMA 1FQ0A 2ZZ4A 3T4CA 4WQ6A 4ZL1A 3GB6A 1TPEA 3C2EA 4PCFA 1K8ZA 4NU7A 4WX2A 3UXDA 4BF9A 1MEHA 4WXYA 2YXGA 2JGYA 4HNNA 4DQWA 2C18A 5F2LA 1ZNNA 3IIPA 3UQNA 4J9JA 4QIUA 2VXNA 1TPH1 1K7XA 1Z44A 3NZ1A 1Z48A 4I7WA 2ZRXA 3EXTA 1TPVA 4LY8A 3UY8A 3LI0A 4X2RA 2GQAA 1Z42A 3QQ1A 1J2WA 4IWWA 1JVNA 2ABBA 3GDTA 3TFCA 3LHYA 3W7GA 4FO4A 4O13A 3S1XA 4R33A 3DFOA 3QMRA 5FI8A 3PM6A 2TPSA 4YLWA 3QF0A 4JNMA 4OT7A 3IIOA 2YW3A 1IGSA 2CLMA 4KFOA 4RV8A 1OX4A 3JS3A 3PF3A 4JTKA 3C52A 5F1UA 1UCWA 3E9AA 3HPZA 2EHHA 1ZAHA 1VYPX 4UTUA 1FDYA 3NYZA 2BZNA 1N7KA 2JGQA 3UWYA 3B04A 5CZTA 3W2NA 3DKJA 1WQ5A 2VENA 5AHNA 2YGYA 3BW4A 4AMAA 1IXNA 2PC4A 3M1ZA 2BWGA 2X16A 2RDUA 1UB3A 4PL2A 3L21A 4QISA 5EPDA 4NQ1A 2QJHA 3BV4A 4Z1DA 4JTEA 4BFAA 1TV7A 3NAVA 4O12A 3B8DA 3HPSA 1Q3NA 5GVJA 4QAIA 3W7IA 1N8FA 4DO5A 5CG7A 2QJGA 3N14A 3W74A 4LRSA 2CWNA 4K36A 2RDTA 1KFCA 4OQVA 5CZJA 3SSJA 2JKEA 3LHZA 1I2OA 4XZ9A 4Z1BA 3FKRA 2WO5A 1EIXA 3BGJA 2WJZA 1OJXA 3DHFA 3TQKA 3W73A 5LZLA 3PUEA 2Z6JA 1FCBA 1R30A 3NQEA 5I3JA 3W7DA 4DF2A 4GXMA 4EWND 3OVRA 1YLVA 1XCFA 3WK2A 2QCHA 2R91A 4Y96A 5I3IA 4GE8A 3S0CA 1DL3A 2ZCGA 1FWRA 4LVBA 3MUXA 1XXXA 3DGRA 3I7SA 3GVGA 4MYXA 2YW4A 3GKAA 4NJGA 1G7VA 1KFEA 4CCDA 1TPFA 2E09A 1XL9A 5FF7A 4JEQA 3RK8A 3K30A 4JS3A 1XBYA 4MOZA 2H3BA 3V1PA 3ZWSA 1GT8A 1JUEA 3IIVA 3PSWA 4Z0JA 5D32A 1KM6A 3FA5A 2UV8G 1M6JA 2PRMA 5HJLA 4MFEA 4JR5A 4LUJA 3V75A 4PODA 1H5YA 3GXPA 3QC3A 1O5KA 4JX6A 3L9CA 1LBLA 1R47A 4AF0B 1AW2A 4KKXA 2X1SA 4UXDA 3EB2A 5F2MA 1F6PA 4KWVA 3LLFA 1EB3A 4MKNA 3AJXA 5G2HA 1WA3A 4I7VA 3P82A 2QAFA 3C8FA 1GYLA 2NLIA 3M5YA 4MY1A 4PTNA 4OE7A 5CGQA 1J5TA 3DI1A 3MI2A 4UTMA 3O6CA 3A24A 3S1UA 3HBLA 3R8RA 4IXHA 1FX6A 2F84A 1JRBA 4IOTA 4JXCA 4UTJA 3MBDA 2OMAA 4LVDA 5AHMA 4NX5A 5D33A 4DPQA 4GC4A 2VEPA 3I7RA 4LVFA 3LCFA 4CQ8A 1DJQA 4L4MA 4JIPA 4OU1A 3UWZA 2ZZ2A 3G24A 4HIBA 1ZCOA 1XC4A 4O54A 2QCCA 1JR1A 1PE1A 4RLIA 3RLUA 1XDMA 1ZJIA 1KLYA 2DJXA 1GPWA 1MEIA 3WFAA 1AG1O 5K9XA 3CIXA 5TBOA 4A29A 4HSNA 4GFSA 4GBUA 3RLVA 3UPBA 3HGOA 5CKSA 1LTDA 4O10A 3MMTA 4JTFA 1G4EA 3RU6A 3C2RA 3MYOA 1AW1A 2QCGA 3L0GA 4XKYB 1P1XA 1THFD 3NVTA 5G2WA 4R7JA 3LBCA 4NJJA 3L0NA 1I8JA 4QITA 1M5WA 1OF8A 2VOMA 4XTDA 2ZRUA 2VEIA 3KHJA 3SJ3A 1FXPA 3NR0A 3GLCA 4DBDA 2ISSA 3CTLA 1LROA 4RXGA 2P0OA 1OK6A 1PV8A 3R2GA 1H50A 4E38A 4O14A 4YWIA 2V5LA 4QNEA 3W72A 3PR2A 1SR9A 4GUGA 2BLEA 1ZAIA 4IX2A 2EAWA 5C55A 4N9CA 4PH6A 4MJMA 1YYAA 5H2ZA 3PUOA 2Y85A 3HPXA 5HNRA 4TIMA 2CLKA 4YCPA 1LLWA 5AOUA 1TTIA 3TROA 1JQVA 4CCCA 1YADA 3L65A 5FF2A 4O8RA 3MW7A 4EIVA 1A5CA 1VS1A 1PVNA 3D0CA 3NOEA 4DO4A 3L67A 4I7UA 4UTIA 5BW6A 4RZ6A 1ICPA 2NXIA 3P62A 3INPA 3W7MA 4K8HA 3FYOA 4GNJA 4LU0A 4MLJA 3EX6A 3DFTA 1GYNA 4C1KA 5HINA 3EX4A 3W1LA 4AEOA 2I1OA 2RHGA 2A6LA 3DKLA 4EF9A 4UFLA 3BARA 5HWNA 4ADUA 5D09A 3S5OA 3NO5A 1ZY9A 3GNNA 3O16A 4S2BA 4UTLA 4IUOA 1QAPA 2TMDA 3T40A 5LGXA 1KFJA 3TH6A 2X1UA 5AB3A 2OJPA 1BEUA 4AH7A 4GUJA 2A2IA 4GRSA 3PBVA 3FIGA 4JTTA 5AN7A 3VNDA 2V2DA 4ONVA 2E5CA 2Z1BA 4AVFA 4AHOA 5G1TA 5D03A 3I7QA 3IGUA 2BTMA 1WDWA 2ATSA 2DZXA 4JX5A 1OABA 1FY6A 1QOQA 5BOOA 5KZMA 3NQ6A 4M7TA 4M6PA 2AGKA 1PHWA 3C61A 1Q6LA 1V7YA 2EGZA 2ZZ3A 3JR2A 3CEPA 3HOJA 1R2SA 1QPQA 4QQ3A 3B0UX 2ISWA 4M19A 1K7EA 1H7XA 1L2UA 4IJBA 5TIMA 3SZ8A 4IQLA 4B5NA 3HJZA 4UMBA 3W84A 4MPQA 3G1AA 2CLHA 1F6KA 5KSWA 4G1KA 3B06A 2OCZA 4R34A 1F2JA 3N34A 1LOSA 5LNRA 3FLUA 1TMHA 3G1YA 5MHBA 1VH7A 1B4KA 4UMAA 3VE7A 1L6YA 1X1OA 2I9EA 3FJLA 1KTCA 2FQIA 3N9SA 1WX0A 5FEXA 4S1FA 4JGDA 2PURA 3HQ1A 2ZA1A 3OG3A 3TSMA 1BWKA 2GJNA 5CPNA 4E2BA 3W2KA 3BG9A 4LC8A 4NUWA 2V0TA 5DCEA 3DZ1A 1GVSA 1BKSA 2QEZA 5HULA 4DELA 2V5BA 2A1YA 3PG9A 1VLWA 3W7QA 2C14A 4FNTA 3P61A 1W3TA 1WV2A 4UC5A
chains in the Genus database with same CATH superfamily
2EO7A 4UB9A 2YZRA 1GUVA 4R88A 1Q6OA 4YL2A 1AD1A 4DUXA 3UWUA 3NURA 3O6DA 2ZZ5A 4YCOA 5REQA 2WW5A 5LSMA 2NV9A 1LDCA 3P84A 4FNPA 3CHCA 3ZR4A 6CGTA 3B8VA 5A8GA 5EMYA 4XUGA 3URBA 3KL3A 4EWJA 3UY7A 3WMLA 4LVGA 3GUGA 5CPMA 1CT5A 1FP8A 1QPOA 1X7FA 3LCIA 1M65A 4KERA 3VINA 3GIYA 1PIIA 1CW2A 4YWSA 2WNNA 4DJFA 5JH1A 5I0DA 2X8RA 4FNQA 2WVVB 1W2VA 1A5UA 3O06A 3KWXA 3ARPA 1AD4A 4KRZA 2X1RA 3CUZA 1GJWA 5HXMA 6PTDA 3EOOA 3O0FA 5HDRA 3G77A 4XSMA 2WNWA 1WDRA 3TN5A 2CHOA 1TX0A 3W7EA 2ACRA 2OR2A 2ZICA 3M46A 3HFTA 4AZHA 1ISZA 2PLKA 5I78A 2ISFA 3KVLA 3BANA 2R1MA 3W86A 1NWSA 2WNQA 3MUY1 3KE0A 3H26A 1Z69A 3PTMA 5I6SA 3NL6A 3GRIA 1V3IA 1P6BA 1W1YA 4P2VA 1V5XA 3PZTA 3G3DA 4EPEC 4U10A 4WGHA 4JYFA 1LZOA 5T9CE 3G1VA 2PZNA 2ZA2A 2I17A 4O52A 1JZ8A 2PZ0A 1IT0A 1S5TA 3B40A 3STPA 3GU2A 2Y24A 4FPSA 2OLAA 4W87A 3WQVA 1KXTA 4ICNA 2NWRA 2VRQA 2INEA 1LBFA 2EPMX 3MQTA 3LEPA 2VRJA 5M17A 4A05A 2J7CA 2FZNA 3MHFA 3WQ4A 2YBTA 3DG7A 4AYGA 3IUHA 3RCYA 3M0KA 1W8SA 5A8PA 3W1UA 1F3WA 3CLMA 4L6DA 4OBTA 4XZIA 4H9YA 2R1PA 3BJFA 4IMAA 2VL4A 3MVTA 4WEVX 3E0LA 3NDOA 1ODZA 2WZHA 1QT1A 3ES8A 2ZVIA 5F1VA 3CB3A 3MHUA 1IZCA 3LRKA 1L8NA 1QOPA 3I4EA 3R11A 3MS8A 3VUSA 1J0YA 3OA3A 1JFXA 1AUSL 3U2ZA 1DYSA 1PUDA 4JYDA 4YPJA 1R3YA 3TNBA 3CPUA 2HEJA 3OVPA 4DPPA 1KQYA 1SJAA 3LRLA 1VYRA 1XDLA 3SY8A 1KBBA 3CZJA 3I6TA 3TMLA 3W07A 3ARYA 1DPMA 1H7OA 3M5ZA 4FNRA 1UR3M 4O16A 3LB0A 3PG8A 1L6GA 1HN1A 5I7GA 3KTXA 3RX2A 3HQPA 3TOPA 2XSAA 3W24A 1LWHA 4UNKA 1UJQA 1FWGC 4HHMA 4RXFA 4AWUA 3K13A 4R9XA 2CBJA 1Y5XA 4PBGA 3QTGA 4Q8WA 4LV4A 4JZ5A 1TRIA 4FLOA 3CJPA 4H41A 4DX3A 5FIPA 2WKLA 1J79A 4OZOA 2CWXA 4DBWA 3N1AA 1FWDC 2INZA 4GG9A 3EOUA 3PJXA 3LCHA 1B2YA 1NF7A 3T55A 1C92A 3KS5A 3VDBA 2A21A 4XWUA 2C7FA 1FDJA 2OXNA 2XU2A 4O28A 4ZO9A 3QKZA 4DJED 1FH9A 1TRDA 1ZQ5A 4XTIA 2E8ZA 3KUMA 1R0MA 2CZDA 1W1PA 2A6NA 4P7RA 1I2PA 1Q85A 3DFPA 3WBXA 2GPTA 4QJ5B 1PZ1A 2BY2A 3OLGA 3MV11 4L56A 3MWAA 3L5AA 1CGUA 3LTPA 4PMZA 2J79A 3M7WA 2X09A 3DEQA 2Z0IA 2UY3A 4FALA 2VNCA 4ZZ9A 5LIUX 3VCCA 3ZT5A 3TJ4A 2CLLA 3BE7A 3LCWA 1OGSA 4AC7C 1FCUA 3UNDA 3RLGA 4EPBC 2Q8LA 2VVNA 1FHVA 2OYLA 1DWHM 3KLKA 3KW3A 1MZHA 3IRSA 1S2CA 5LIXX 3CUHA 2HSAA 2XFYA 4AXKA 3UU0A 4ZGYA 1OWQA 1EUAA 4HD5A 4S3CA 1KD0A 2P10A 2BVTA 2PWUA 5F4SA 3ZJ8A 2YL8A 2ZUVA 4KCWA 4LS1A 1OX6A 5DT5A 2X0YA 3CASA 3RILA 3MCOA 3MI3A 2NUXA 3FGCA 2XFWA 4S3FA 3KM8A 1KBLA 4N2YA 4W89A 3B8SA 1UWIA 2Z6IA 3W3OA 1V93A 2FDMA 1Q6DA 1UH4A 2OWWA 4RZ5A 2CKRA 2WQPA 1R3RA 2O9TA 2VD8A 1YXCA 2QCNA 1JZ6A 1E4MM 1JNEA 3NPUA 2CESA 3EKGA 4PSPA 1E4LA 3V7PA 2WXDM 3S6DA 2GYIA 1V3MA 1YXDA 1KGUA 1RZMA 2Y4SA 3ZIZA 4P8UA 4S3AA 1J0JA 3GX9A 4I5RA 1OFOA 5C7VA 3F4NA 1SPQA 5CAKA 4AZGA 5IDIA 1EOKA 1QW7A 3RU8X 2ISVA 3VE9A 4QJ4B 1O68A 2YKKA 3MTWA 5M3WA 1C9DA 4UQBA 4PMUA 2V38A 3GXFA 1XSIA 1OB0A 4S3JA 4WY0F 1B9ZA 2DEPA 4GGHA 4QCFA 1UR4A 2ZE3A 4UR9A 1W3JA 2PDKA 1G4PA 2P50A 4MB4A 3VGFA 3EYPA 3S2JA 5BXSA 2V3EA 5MKGA 1I4NA 5CZKA 5DCDA 2RAGA 3G1SA 1SGJA 1SZGA 4XZNX 3LHTA 2QDHA 4TO8A 3WLQA 2ZKMX 3HG5A 4LPCA 5BRPA 1NOWA 3SRHA 1GOMA 4H6QA 1WOAA 4H9ZA 4JNZA 2VD9A 3KRZA 4K68A 3ITCA 3E2VA 3Q94A 3TYAA 4UTFA 3F03K 4LY4A 3OQEA 1TPWA 5XIAA 1W56A 3GVQA 4GWEA 3AIQA 1T7LA 4PMNA 1TWZA 1WBJA 4Q4RA 4LS0A 3ANVA 3ITYA 5AC5A 5KEZA 4U2ZA 3N18A 1PWMA 2VO5A 1QU4A 4DJFC 1R3TA 3J7HA 1K9EA 3NGJA 1JCXA 3L2IA 2ZX7A 1NDWA 2WHKA 2DJLA 3CHVA 1VHNA 5HA7A 4MAZA 1GVFA 1R2TA 1PYMA 1TV8A 4H6EA 1J96A 2FHBA 4WUIA 5C2XA 1GTHA 4F79A 1V6VA 3E0WA 2E9BA 4DF0A 3G6LA 4RL3A 3FSUA 4NZ4A 1G9HA 3L4UA 1TWSA 1JIBA 2UWFA 3FSTA 5I5RA 3W2JA 3TAKA 4FX6M 5AZ0A 2IS7A 3QMSA 6XIMA 1XISA 2FB3A 3A64A 3NQVA 2BG5A 4URIA 3OGRA 3AXKA 1BF2A 3THQA 2AOSA 2ZUNA 1MXDA 1BQCA 2DUAA 2WSRA 1B3WA 2NQZA 2YBVA 3WF3A 4K6AA 3S5ZA 1IF2A 2WHLA 5LKYA 1OFEA 3H53A 1YE6A 1EQCA 3USBA 3W2LA 2B7OA 1X39A 1VLIA 3T42A 2ZADA 1S38A 1TA3B 3BC9A 4GVIA 1NOUA 2VR2A 3CYVA 3P93A 3UF9A 1S5WA 5I00A 5DX7A 3VOCA 4HCLA 1WZMA 1M7PA 3E2QA 3LBMA 4CGTA 3PTKA 3BCDA 3HJEA 4ZTXA 4Q8MA 3BAYA 2PDCA 3UR7A 3KX6A 3S9IA 1RPXA 5ABEA 2A3HA 5AECA 4GGBA 2VX7A 1FWSA 1QXLA 1M7OA 2VX4A 4JKLA 2CFFA 4NF7A 2B7PA 3GR8A 4MADA 3FHQA 3R0KA 1TSIA 4N9EA 2H90A 3WJSA 4CVWA 3W7KA 3SCRA 1EPVA 3IPWA 1FH7A 3THUA 4MNKA 1FKWA 4IJCA 1JUKA 2O9PA 1ICQA 1DQUA 3AYRA 3CT2A 3BMXA 3GW3A 3B9EA 3N3TA 3SB0A 1H11A 2Z4GA 2BVDA 1DJIA 1X38A 4XB3A 2B7NA 1JXKA 5T91A 3TCEA 4HKPA 2VGFA 3KL5A 3P81A 3SUSA 3ES7A 5LIYX 3A5VA 4GFIA 4PMOA 1KCZA 3ABOA 3NVDA 1I2NA 2QDGA 2J7GA 3WKZA 2D3LA 4DWSA 2ZX9A 2VUNA 3M16A 2NUYA 2GVLA 2DP3A 2A0NA 4RE0A 4ZR8A 3UA4A 1T0OA 3LPFA 3L12A 2V2HA 3UPWA 3UYCA 1R86A 1TZZA 5D2YA 1H7RA 4E8CA 3N11A 2AAAA 5D4YA 2F6KA 3DU0A 1BHGA 2Z24A 2Y7FA 4MB1A 1KRAC 4PMQA 3CPGA 2BXVA 1IEQA 1UG6A 3VKBA 4BI6A 3ISIX 4B5SA 5EBUA 4X9SA 4OWGA 4P5UA 1QW9A 3MJMA 3FVMA 3KOFA 3A4WA 3B0YA 2DZVA 2OKTA 4WHBA 4EXQA 5CSRA 1RBLA 2NSOA 6ALDA 5JBEA 4D8LA 2WVTA 1LQAA 5AC6A 5XINA 2QMJA 3O05A 1O95A 1WDQA 5EMUA 3E5PA 1XI3A 1X8FA 4N9BA 2XJ7A 1WXZA 1UIOA 4WZHA 2ZRVA 4UOJA 2WHMA 1HZYA 3WZ0E 3RRXA 2EBNA 1N82A 4MNJA 3WNNA 4ZOEA 2DPEA 4JTQA 1YTKA 4JX4A 2C91A 3N2BA 2YCLA 3PBYA 3PHAA 3ID7A 2X1TA 3L4WA 4LUSA 4HA0A 3SURA 4LAUA 2DVTA 2W66A 4D1JA 4AZBA 3N2XA 4PCSA 2BHZA 2J8FA 3M5VA 1A5LC 2HS8A 4B2DD 2DZPA 3EXRA 4XQ6A 4OKDA 4Z0SA 1XIJA 1BTCA 4Y2WA 3OBKA 5EMKA 1EFZA 3N2MA 4JTGA 1L6SA 1H0IA 1AH0A 4HZ8A 4L4OA 3NQAA 4LNYA 1AH3A 5BXPA 3HG3A 4RE4A 4GUIA 2ADAA 3KWSA 3E5BA 3ARSA 1UJPA 3FFSA 1WBHA 2ZE0A 1PDYA 3FS2A 2TSYA 2V5DA 4UTWC 3BOXA 3KEHA 4IGNA 2NQ9A 3VGHA 2WKGA 5GJPA 3C2YA 3KDOA 3QW4B 4JTDA 3CEUA 4FEZA 1Q66A 4XAGA 3DENA 1WYIA 3KOXA 3TW6A 4LBUA 4F0SA 1DQWA 3OO2A 2DT2A 3L2MA 3B0PA 3MKKA 1PX4A 3CV6A 2GQ8A 3BWWA 3W1NA 1DE5A 7REQB 2DQWA 3U57A 3Q45A 3AYVA 4HN4A 1AL8A 2VGIA 3EOLA 3LM7A 3U8GA 1E73M 3O8AA 1HGYA 1XBZA 2C3ZA 1J11A 2J24A 3TTOA 1UOKA 5I03A 3NQ2A 3R7MA 4ZENA 4C1NA 4CD6A 1A3HA 2ZYFA 3T0AA 3NL2A 2VX5A 2YXXA 1DJHA 1FH8A 3DECA 1EF3A 1OCQA 3TMQA 3KBWA 4C1LA 4R85A 1EX5A 2EEXA 1IWAA 4MNMA 2ZRYA 3EWWA 3SCVA 1JYVA 2REQA 4GUFA 3MP4A 3CMJA 2J62A 1SSDA 3C2OA 4W8LA 1DVJA 1U1UA 4NJIA 5T9BG 2DVXA 2ZUWA 4U3CA 4FSAA 5E0FA 3WQ8A 3W7PA 2QUTA 3U2CA 3E2RA 5HMEA 2HDJA 3V5CA 4GH1A 4JY9A 1JZ2A 3M44A 4U3AA 3W1XA 2NX1A 4I3GA 1SM9A 1I9CB 1REQB 3PUDA 3DXIA 5FF3A 3MJYA 3PZNA 3SEPA 3BZJA 1AH4A 1J0ZA 4YYFA 2ZQ0A 2GJRA 3P67A 2FB2A 2NV2A 3CUIA 1OFPA 4AUBA 4HTBA 3G1DA 2WCSA 4IJRA 5M03A 3SIZA 1X7IA 4MJZA 4KH2A 1PXGA 1G4SA 1PCWA 4A21A 4MY9A 2FZMA 2XWEA 3NZPA 4TU1A 4IFRA 3WNLA 4Q4PA 1LRTA 1UZHA 1PL9A 2VEFA 4Z2HA 3WLJA 1EWDA 4UMCA 3EDKA 4C7FA 1GEHA 4ATLA 2C0AA 5I02A 2PDYA 2C19A 2OZ3A 4NAEB 1PHQA 5AHEA 1BYAA 3TLQA 1E72M 3R25A 3ZVIA 1E4IA 4ROPA 3MYPA 4EOUA 4AW7A 2E1DA 4UZUA 3Q65A 4H8VA 3QTPA 3LN3A 1VFSA 1VJIA 4MWAB 3HURA 3IV3A 4CU8A 5HR7A 3G0UA 1U5JA 1WKYA 3VCRA 3KBNA 4ZODA 5LXEA 3QPYA 4O15A 4DO6A 4DWDA 2OGJA 1GKPA 3ZZ1A 2Z00A 1RV8A 4NHVA 1UMYA 5C70A 4YYCA 3WNOA 2VFEA 1NFGA 2HVMA 5I3DA 1EL3A 4HU8A 1SZFA 2A7RA 3ZR5A 1RR2A 3FOKA 3GZ3A 3W71A 2IXVA 2FJUB 2VX6A 2VGGA 3LRMA 5HMSA 2P88A 4YVVA 1YTEA 2Y5EA 3NYDA 5A6TC 4CNOA 3U9IA 2IKHA 1XLEA 1HL8A 3KVJA 3VVGA 3E74A 2ZRZA 3M64A 1FWFC 2OTDA 2PP0A 4QDWA 3F2DA 1KO0A 2HBXA 4PTMA 4LF1A 2UY2A 1FHDA 1GJPA 2E0PA 2D1ZA 4KRTA 3UZZA 3CXOA 4S38A 1WUEA 4H83A 2IW0A 3A4AA 1KM0A 5M1TA 2E6DA 4EVZA 2PU1A 4LWWA 3GXTA 1VFMA 3LX9A 2PTXA 3U3HA 1OIMA 1DWJM 1GJUA 3LQGA 2JK2A 1IE7C 2H3DA 3TUUA 3VI2A 2A85A 1LRQA 3P5YA 4X9YA 2OEMA 3A4JA 2Y5SA 3WJYA 5B7ZA 3EX3A 2UY4A 1ZL1A 2FGBA 3NQMA 4EF8A 5CC3A 3VDHA 4I5XA 1A5NC 3S9YA 2EPOA 2V69A 4LBRA 1DQXA 1BG4A 1IWBA 4FLRA 1IQ8A 2VEGA 5DLCA 1R7OA 5HNTA 4R9OA 3TWBA 2DU2A 1SW0A 3TC6A 4IMFA 3UWEA 4KWOA 1VIWA 2X2YA 1TPUA 3LTSA 2G3JA 2XZ9A 1H5VA 1JCMP 5FJPA 3VNKA 3T7VA 5CJMA 3K1DA 1ZAJA 4FF7A 3SFKA 4LUTA 3WK1A 1HKKA 1P0KA 1W1TA 4X60A 1W91A 2TRSA 2J77A 4KQNA 1S2TA 4JTLA 1BSLA 4XZBA 2RGLA 3C0LA 4C6LA 1E9IA 3QN3A 3GZAA 5F4XA 2E1WA 2DZSA 1BQGA 1V0LA 4AIBA 4L80A 2E77A 1CXEA 2BHUA 3R58A 2QCDA 1EO5A 4A8RA 3W6YA 4JYEA 4IXXA 4HGXA 3SQSA 2XH0A 4FIQA 4Q8TA 3S1VA 2F8QA 4C6CA 1MQPA 1LQ2A 2V3DA 1V6XA 4ERIA 2QJIA 3LPPA 5FD0A 3BLIA 5M2FX 4R5EA 1CXKA 1XYFA 4U31A 2F9RA 3T4CA 1TPEA 4RDVA 4H2CA 1TIWA 4KESA 1K6AA 3AIWA 4DQWA 1EA9C 5F2LA 3UQNA 2R24A 1GW9A 3LYEA 4XIAA 1Z48A 2ZRXA 4RZBA 4LY8A 3C5QA 2I56A 4X2RA 4H9VA 3QQ1A 1OC7A 3W7GA 4FO4A 4O13A 4YLWA 3QF0A 4JNMA 2YW3A 1IGSA 2OLHA 3PF3A 2YJQA 5F1UA 4LAMA 3HPZA 3U4AA 2EHHA 2BZNA 4E3VA 1ZU8A 1JZ5A 1OGGA 3GFXA 1YKWA 4Q8UA 2HXUA 1SMDA 1IXNA 2X16A 2RDUA 1Q65A 1WNOA 2IPWA 1RP8A 1UB3A 1RUSA 4QISA 3WIJA 4NQ1A 2QJHA 3DG6A 3BV4A 3M07A 5DQPA 1KWGA 1A0DA 1MQRA 4Z1DA 2WK2A 4BFAA 1CCWB 4O12A 3HPSA 4IICA 1UWTA 4H8NA 1HKVA 1S46A 3USZA 1W32A 4AYSA 3LMZA 1UKPA 4WDTA 4LRSA 1XS2A 1FVPA 2I9UA 5CZJA 2JKEA 3QY7A 4LANA 2BY3A 5CG0A 2OOGA 4Z1BA 1Q7QA 1F07A 3BGJA 3TQKA 1PJ9A 5LZLA 2VYOA 3PUEA 3SJNA 3R10A 1R30A 4NRSA 5I3JA 5CCZA 1WDSA 4DF2A 1QK2A 4GXMA 1DE6A 3OVRA 2QCHA 2VT0A 3TJIA 5I3IA 3I3DA 2ZCGA 3I7SA 2YW4A 3GKAA 4NJGA 1G7VA 1S1PA 1TPFA 2E09A 5FF7A 4MTVA 3RK8A 4JS3A 1EJWC 4QLKA 3V1PA 1JUEA 4Z0JA 5FL0A 5D32A 1KM6A 3FA5A 3GVRA 2XIMA 4PN2A 1SFTA 4QLJA 3GXPA 2QQ6A 1O5KA 4I6KA 3RUBL 1AW2A 4KKXA 2X1SA 3EB2A 1F6PA 1HT6A 4NAFB 4P7NA 1WA3A 1EBHA 4PUEA 1A3WA 2QAFA 3TN3A 3B8IA 5CGQA 1J5TA 3WNPA 1D3CA 2VMFA 4UTMA 3A24A 2HK0A 2W9MA 1JPIA 1FX6A 3UZXA 4IOTA 1RJRA 2PP1A 5BXRA 4EXBA 2ASHA 1V6WA 2A3BA 3KCOA 4IH3A 4DPQA 1BYDA 2VEPA 4LVFA 3UG5A 3G24A 4L9YA 1KRCC 4L1XA 4R3UA 1XC4A 4DYEA 1E15A 1JFHA 1GQLA 1JR1A 3ZJ7A 2QGYA 4ZEPA 1PE1A 1ITQA 1NY1A 4F2TA 2D0HA 5FJUA 3PZGA 1XDMA 1ZJIA 1KLYA 1ZRQA 1GPWA 2DJXA 5A2BA 1AG1O 1KRBC 3QV7A 4HK7A 2DFAA 3WY1A 2D3NA 1GPFA 1R3VA 1AZ2A 2WMKA 1LTDA 3T1GA 4GKLA 7ENLA 2Z26A 4CN4A 3V0UA 3VAVA 4S3KA 1AW1A 5JBDA 3SO7A 1VEOA 5G2WA 1HF6A 3LBCA 1Q6GA 4UQEA 4QITA 4B16A 2XSBA 3NR0A 4DBDA 1JYWA 2DW7A 4E38A 1H50A 3AS3A 4YWIA 2V5LA 4QNEA 3ZVHB 3W72A 1SR9A 1B30A 1RCOB 2QV4A 4JEJA 3VIPA 4FOJA 1UW9A 3PUOA 1X6NA 5HNRA 4YCPA 1TTIA 1NARA 3VMPA 1XYZA 3A3WA 2X05A 1YADA 5BOFA 1B3XA 1UPMB 2EQDA 2VJXA 4DO4A 3L67A 1BF6A 4LYQA 4UTIA 1U1JA 4N7QA 4RW3A 1MRAA 4AEFA 2YLLA 4RZ6A 6REQB 2IQDA 4B9ZA 3P62A 4MLJA 1WE5A 3HMCA 2W4XA 5HINA 2GLKA 3W1LA 3NCOA 1CENA 3B8UA 4FP1A 2A6LA 5CLWA 3LGDA 2PWHA 2I5IA 2HZGA 4CQBA 1FWJC 3T81A 3NO5A 1ZY9A 3GNNA 3KLLA 3O16A 4HJWA 4S2BA 3T0CA 1PWLA 3T40A 1KFJA 3TTYA 5AB3A 3ITXA 1BEUA 4AH7A 2GVEA 4O1FA 5A6KA 3PBVA 3ABXA 3RYSA 1ECEA 2V2DA 2E5CA 4ES4A 5EMLA 4J40A 1BVNP 1EBGA 1MRQA 1WDWA 1NP2A 1OABA 1QOQA 3EDDA 3K46A 4E2OA 3DG3A 3KOYA 3NQ6A 4M7TA 2AGKA 2UY5A 5FL1A 2PDHA 1Q6LA 4IGSA 3O9NA 3KCJA 1TJ2A 3MY9A 1YRRA 2ISWA 1K7EA 4ACZA 4MPQA 1E6XM 2CLHA 2PGEA 3EWDA 3B06A 4R34A 1CEOA 2P3ZA 5CGMA 2DSWA 1ODUA 5LNRA 1TMHA 4TX8A 1GVIA 4B92A 4B3KA 3VKKA 3WLOA 3VNMA 3ZR6A 1X1OA 2I9EA 3VMNA 2XVLA 3IARA 1WX0A 5FEXA 4MDPA 3M0JA 2PURA 3DC0A 4J3ZA 3TSMA 3SRKA 3W2KA 3BG9A 4NUWA 5DCEA 1GVSA 1BKSA 1HJWA 5HULA 3TEVA 2DH3A 4HCHA 3RMEA 3PG9A 3VOGA 1VLWA 3ZT6A 4JOMA 2C14A 4FNTA 1XWYA 2XGZA 3GSMA 3KZPA 3P61A 1WV2A 4BI5A 1AMKA 4ML9A 2BDQA 1F61A 4AZ6A 1VRXA 4AVOA 1KNWA 3SN4A 1JJKA 3DHUA 4IG2A 3PPCA 1WKEA 1VC4A 1T99A 2J13A 3QGKC 1UD8A 1SFLA 4FXJA 3VOHA 2OT0A 4P7LA 5FESA 1SUXA 2W5FA 1WKDA 3STGA 1KM4A 4H19A 2AL2A 3TONA 1JCNA 2YYTA 5LNVA 1G0CA 1IIHA 1RALA 5K4XA 4XAPA 1JYXA 3M47A 3R8HA 4D6FA 2WC3A 4LF2A 4LC6A 4WKHA 3TV8A 3S3GA 3WJZA 3OLIA 1Q8JA 4LEFA 4AX7A 1C7TA 2OU4A 3RF9A 4C6BA 5E1QA 3OEXA 1YDYA 4O17A 3OHIA 4MJ2A 2D22A 4L61A 3CQHA 1V51A 3AROA 5JBFA 2DVUA 3SCOA 1IEVA 3BH4A 2XH4A 3VIMA 4J3VA 1VFUA 3SDOA 1J4EA 5LNUA 3VD4A 1RLCL 2OZTA 3W2MA 3WK3A 1H62A 3WUFA 2ZZ7A 1ICSA 2PS2A 5K7JA 2OG9A 3VX1A 3NXFA 3IVSA 4QM1A 1A80A 5FF0A 2V82A 1E1CB 3ARUA 1B1YA 3GTIA 2RJHA 2IXUA 2WC4A 1NWUA 1LOLA 1JYNA 3COTA 3DDMA 3NXLA 1W9VA 1YQ2A 3H8AA 1ONWA 5DMNA 3CUJA 5AYZA 1PB0A 2QCEA 3C3NA 4J2MA 4X63A 3A22A 2G50A 1WPCA 4POCA 2FPVA 1BAGA 1L8PA 3GO2A 1MFVA 2VFFA 3WFLA 2WM1A 5CSSA 4DAIA 2QKFA 2VFGA 3KBVA 3CGTA 4DUWA 4UTTC 4ZE5A 2Y2WA 3OIXA 3JZEA 3MU7A 2PPGA 5GNZA 2NVAA 2O9RA 4KEUA 4HPGA 1NSJA 1FWCC 2VCBA 5E0CA 3RHGA 1HVQA 3NSXA 1QO2A 3WD1A 3TU9A 3CO8A 2GUUA 3FEQA 1TTPA 2J27A 2ZUMA 2ZRWA 5C54A 3MKVA 5E6ZA 8RUCA 4X61A 1DJZA 1QWGA 2X40A 3CTTA 5CLTA 3TXZA 3AXHA 5D2WA 2XN1A 3QYSA 3KFTA 4PTXA 4PYSA 1M41A 4GIEA 5KTLA 3GU9A 2VGBA 2DORA 5DY2A 2YB4A 2E7FA 1HJQA 3BSGA 4IHCA 1OYCA 1RBOB 1RQBA 1KGXA 4FXSA 1OK4A 2JIWA 3P7YA 4ZMGA 1VJSA 2YDAA 4Y9OA 3ERPA 1UC4A 4WXZA 3URAA 1BKHA 5D38A 3MI6A 3M0VA 1KWKA 1B3ZA 1HVXA 5ABTA 4QROA 4F0KA 1P7TA 3KP1A 5IBXA 2CXGA 2FKPA 4JTIA 1Z7AA 1UD2A 5DMLA 4XO6A 1UC5A 1PO9A 3N2CA 2P1FA 4KT2A 1CI1A 3FYPA 2VC6A 4LRTA 2CZ5A 3NDZA 2SFPA 1D7KA 4F2BA 3BO9A 1XPGA 4W88A 3LPGA 3AIRA 1C3FA 1LWIA 3GVVA 1BTMA 5F7UA 1XCWA 4CN6A 3F5KA 2Q8XA 3W01A 1FWIC 4WCJA 3OIHA 3W27A 1E6RA 3OVGA 3FHAA 3SADA 1PX3A 2RH9A 2J7DA 4JTRA 3L4VA 4AU0A 1BRLA 2I5QA 1K77A 3NIYA 1J93A 4Q22A 3UESA 1HL2A 4X0VA 3GDKA 2DIKA 3PPGA 4FLSA 4IMEA 7TIMA 4GJ1A 4LW7A 4IT1A 1GYMA 3HMJG 3XIMA 1RP9A 5FEWA 3R12A 1GOKA 4TMBA 4W86A 5FEZA 1G6CA 1U5HA 2YFOA 3I3BA 1J5SA 3ALFA 3M6DA 3P0WA 3NTYA 4L9XA 2HE5A 4EACA 4A3YA 3HZ3A 4XAFA 3WF2A 1DOSA 2VFDA 2YX0A 2FLIA 5LHFA 1D9EA 3ATYA 3TA6A 1QATA 3G6MA 3W0KA 3I68A 1W5MA 3FK4A 3N4EA 1GQNA 1P0EA 3T0DA 3FDGA 2QVHA 3EZ4A 4NY2A 1BXNA 2DZUA 5CPOA 3Q4DA 1TVLA 3CH9A 1D3HA 3IAQA 3W85A 4AY1A 2QVNA 1XLKA 4EK7A 3PB0A 4P7OA 3RNDA 1MUCA 1UR9A 3N73A 3URNA 2W62A 3IUIA 4RV3A 3RPTA 3VD7A 1CGVA 4NX0A 1EJSC 1DHPA 2ZC1A 2GJXA 4Y8EA 1X1NA 5CQ1A 1KV8A 2J88A 1P0DA 4L64A 4K38A 4FHAA 3THAA 1XRSA 1OCNA 1DWAM 2XIIA 1WDDA 2J47A 3DHDA 4Y9AA 2IKGA 2QCFA 1J2BA 2WYSA 2X30A 3UYIA 3WQGA 3ZOAA 5K9DA 5DBUA 3HF3A 4BS0A 3UA3A 1UKQA 5D8WA 3SUUA 4BK9A 2VRKA 1EJVC 4R7OA 1RSCA 1EIBA 3CUFA 1OYAA 2Q3RA 2VM8A 2Y61A 1QNPA 3NO3A 2F38A 3W70A 3V0TA 1ML1A 3OYXA 5AYYA 3UWWA 3AXXA 2J7EA 1YX1A 4H1ZA 4U5KA 2OO6A 2PODA 3APGA 1GEQA 1QR7A 4H2HA 5LA0A 4UFJA 1AQHA 5I07A 3A6OA 2ZXDA 2X0SA 3FDKA 3BZGA 1YPIA 1H0GA 5IM51 3TR2A 3WLLA 1H7WA 4NXKA 1CXFA 2XYLA 2EG6A 3GYEA 1LM1A 4WDXA 2BXZA 2V9DA 2GUYA 3EPNA 3TW7A 1CPUA 4KMQA 2QJNA 4GBDA 2BY1A 3G1HA 3EB4A 4RPQA 4I9JA 1OC6A 3QPZA 4MY8A 3ORWA 4TUFA 1YDVA 1VBGA 3W25A 3S5SA 1K02A 2VEMA 4AY8A 2VR4A 3IEBA 4MMWA 1Y65A 4CUCA 1RQEA 1EH9A 3H23A 3WH6A 1IEWA 5D04C 1PS9A 4ZE4A 2XN2A 3LLDA 4LNCA 4UFMA 2ON3A 1A4MA 3QHNA 4ZXOA 1KBJA 3NL3A 5ENLA 3SCSA 3TA9A 3OZPA 3LCXA 1W1B1 4QBXA 1VCFA 4HMEA 2DUXA 3RMJA 4HHPA 2WCAA 1GVYA 3GHSA 3EXSA 4GCAA 1LOQA 3GTXA 3W88A 3PAJA 4JIIX 5G1MA 3WUEA 4D9PA 4QG9A 4E2DA 3CL8A 4PB5A 3VX0A 3W1TA 1TQXA 4DXXA 3G1FA 4A3UA 4O50A 1GVRA 1VR6A 4LFYA 3EAUA 2ZIDA 1RAKA 2HTMA 2AMXA 3GVWA 1A5OC 2DIJA 1TJRA 4RK8A 2CHNA 1YMYA 4JKKA 4F3HA 1PTGA 1SMAA 1IXPA 3LQLA 3TJLA 3N9RA 4O1DA 1WZLA 2POZA 1A5SA 1SFJA 3V3WA 3M4HA 3HG2A 2BOFX 1G7UA 4Y9PA 3UBPC 4FAMA 4K8GA 1TREA 5REQB 3R13A 5FJTA 3BAIA 2WLZA 3LHUA 4AHQA 2PD9A 5E09A 1XBVA 4H4IA 4HPJA 3PB2A 5LXXA 5EYWA 3T08A 4DWSD 2ONEA 3EBVA 3SCQA 3MCNA 3IS4A 2CLFA 3TR9A 4C91A 3AHZA 2RJGA 1D8CA 3E49A 3FAXA 3LUTA 2A5HA 2J25A 1BWLA 5EA9A 3KHDA 1XCXA 1A0EA 1YNQA 2PWDA 4BI7A 1LL7A 1ZLPA 1US3A 4JTCA 3A21A 3CH0A 1LP6A 4TVDA 4IPJA 4Y6GA 3WD2A 4Z17A 4Y9NA 4K7YA 4AWTA 1AVAA 3FJ4A 4GO9A 2HNEA 3KZSA 5EY5A 3GM8A 4GI4A 4DRSA 4HSHA 3THCA 2ZUSA 3KOZA 3GC5A 2A3EA 4ERGA 3SQMA 3WH9A 1O60A 3RPDA 1B0IA 3ITTA 4YXGA 2WJEA 2WOQA 4NT0A 1RD6A 2PDPA 3RDKA 5BZAA 3LNMA 1W5PA 4PTDA 4DYKA 3CUXA 1PEZA 1TR1A 1S1RA 3P8JA 3K1GA 2BVYA 3SN1A 3W6MA 3WJXA 1SZEA 3EX2A 4I90A 1HNYA 3GD6A 2J9XA 4F40A 1CDGA 3BG3A 4GOAA 4YMZA 1HKIA 4JTAA 4MZYA 3H22A 4F66A 3GYCA 1EDQA 4OBSA 4DZAA 2Y0FA 3ANYA 6TAAA 2YB1A 1S2UA 3ARZA 4LB3A 2OLSA 4CNUA 5EBAA 2VQTA 3MMWA 4X0NA 1BYBA 3PSVA 1XSKA 2WMJA 1GQJA 3W1AA 1EQPA 3PS7A 2E3ZA 2XFRA 3W1MA 4W7UA 1QHZA 4HZMA 1C9WA 1I0DA 3QMTA 2Z25A 4E6MA 4NXSA 1HX0A 2Q6ZA 1KFLA 4PMYA 4RNFA 1KM2A 1HTIA 3GNOA 4HMCA 1U22A 4F8XA 1QK0A 3ABZA 4YVPA 3GFZA 3OZOA 4O18A 1K03A 5A2AA 3BK0A 1B57A 1Q7MA 3ARTA 4M6QA 1F4HA 5H91A 2PAJA 2BY0A 4DUVA 3IK4A 5AKQA 4KIEA 3OQ8A 4AZCA 3NOYA 3CK5A 5BMWA 2CXEA 3IVTA 1TV2A 1C8YA 1R5YA 2D23A 1AODA 2Z1XA 4LTSA 4DBUA 4ATWA 2QUNA 2Y7DA 3GE7A 4MAVA 1VEMA 1SJCA 1XJBA 2J74A 4GYPA 2D69A 3NSMA 1AK5A 4E3TA 1NEYA 4HA4A 1EP1A 4Q7IA 2VTFA 4HN8A 3NFUA 2EF9A 3GWQA 3AMGA 2PU0A 3WL0A 1JGMA 1TCMA 1VBRA 1W5NA 4BHYA 3D47A 3Q37A 1AQMA 2ZDSA 3SGZA 1RA0A 3I3EA 4KFPA 2FMOA 2RDXA 2C1IA 2WPGA 4NRRA 5C8BB 2E5BA 2VKZG 1NDZA 3MO7A 3PBUA 5AYBA 4NZFA 4KGLA 2YSWA 3M7SA 5J8LA 2QDDA 3JW7A 1XYAA 1L9WA 4UWMA 2P3EA 3UZJA 2FPTA 3GFYA 3K4AA 1K7FA 1W5OA 4PEKA 4F9DA 3H21A 1F9CA 1TV5A 3O63A 4PMDA 4RX0A 2CBUA 3W22A 4OV4A 4H8HA 4O1AA 3L5MA 1R9YA 1OG0A 4L7ZA 1Q2RA 1TZ9A 3IJLA 3VA8A 2W79A 1H41A 4S3DA 1GCYA 4QP0A 2EPKX 3RJYA 1WO2A 5TQLA 2Z28A 3B4UA 4C6NA 3B9OA 2QCMA 4K3ZA 3ITGA 4UQDA 3FGCB 4HB7A 1R6WA 8TIMA 4NI8A 2O56A 3GH5A 1FCVA 4FF5A 4M24A 2Y6ZA 2J7HA 4U4MA 4XKYA 3QLLA 1HKJA 5E9XA 1GZJA 3PUGA 4GUHA 5TNVA 4MHBA 2VUYA 2FH6A 3NQ7A 4HHHA 1HP5A 1XUUA 1Y8BA 3WEZA 3EMZA 3GK0A 1CXIA 5I3GA 1PTAA 3DHPA 1AJ0A 4ORMA 3AHXA 3H4GA 1OF6A 4NP7A 3R43A 2FYMA 3DAQA 2R94A 5C9UA 5I3FA 3BG5A 3TVAA 3GNPA 2VHLA 5G4EA 4C90A 3P60A 1B3OA 3LV5A 4N4PA 3QR0A 1UOZA 2IMRA 2XHYA 1Y5VA 2YL6A 4BQ4A 3ZM8A 1TMQA 3BW2A 4IPPA 4PUDA 4IGHA 3VIJA 3EOSA 4O4VA 1ME7A 3CV2A 2DZWA 1TPB1 4AWSA 4C6EA 1PKLA 1XGDA 4GIAA 4DNMA 3WNMA 5ABFA 3DCPA 1XKJA 4B90A 5BWFA 1W9XA 5MKGB 2Z29A 1EWEA 4GYJA 3UJFA 3MP3A 3LERA 4RNIA 4IQDA 1WXJA 4LCSA 1OFQA 1Z3NA 2QUVA 2Y8VA 3BLOA 1FWAC 5EU9A 3M0HA 4GZ7A 1H51A 2H8ZA 3H2EA 3DBPA 1IT7A 3UVIA 1IR1A 4UOQA 3C0SA 4AG0A 4WKFA 3VKAA 1EHAA 3FKKA 3AUOA 1CWYA 3ZLHA 9XIAA 5KZEA 1XR2A 5LNSA 2XIJA 1OT1A 5IOBA 3ECQA 2HPMA 4CEXC 2OT1A 2G5WA 1JUBA 2DZAA 1TQJA 2AL1A 4AX6A 3RX3A 4B4HA 2DSZA 1ALDA 3P80A 2GJPA 1NVMA 1TMLA 3PAOA 3ZQ9A 4BQ5A 3WQOA 2PBOA 3B4YA 1KFKA 2KAUC 4GJIA 2G41A 3PBMA 3AXMA 4PZVA 2VC5A 1JDAA 1BG9A 1XRTA 4HNOA 4D6CA 3SW6A 3STEA 3E0IA 1VCVA 4JIQA 1TE1A 3M6YA 2PCQA 3LM3A 3AHVA 3LA4A 2FZDA 5J5DA 2C1GA 2WPBA 1R7AA 2DZBA 2AGTA 5CJNA 4XD6A 3B8WA 1S5MA 2FPYA 4L1WA 4UCGA 2G3IA 4ZXLA 4M1RA 5E6YA 4DUOA 5K9CA 3QSTA 4A8LA 1EPXA 2BS9A 5CZ0A 1KR1A 4YTTA 1T41A 1EDGA 3RM8A 3EA3A 3GTFA 4IPNB 1VHCA 1YDOA 3EWXA 4NZ5A 2HCVA 3C3UA 1H61A 2G3NA 5FF4A 1NDYA 2E67A 3ELFA 1Q8AA 3URQA 2BOEX 1QVBA 4CD5A 4QHRA 4WY0A 1EO7A 1VBJA 3QZAA 1IEXA 5BXTA 1EA0A 4MVAA 4OVXA 4IMGA 3UW6A 2C16A 2PSNA 5I3KA 3WD0A 2WM0A 3SY1A 3QR1A 3L7RA 1WP6A 1FWWA 3TTSA 1RHCA 2I5GA 4HU0A 1HJXA 1ZP3A 4C6PA 1VRDA 1SW7A 3T2PA 1YNYA 5CXPA 2X42A 1H7PA 2CU0A 1EF2A 1ZUAX 4LXFA 1V03A 2VCAA 4WVXA 4A2SA 1XH0A 1CTNA 4US5A 4CQDA 1LYXA 1XPYA 1UQZA 3DESA 3IGSA 1ECQA 3AIVA 4DM1A 5F4WA 2O7SA 2FIQA 2XH2A 4YTSA 2WQDA 5AHLA 2NVCA 4KEVA 4OTKA 4Q3MA 2C15A 4A4AA 4GCXA 1R3QA 1F4AA 1DWFM 2YA2A 1FCQA 2PP3A 4BF7A 1TWIA 3A23A 3TN6A 3UXAA 3H2MA 3A5FA 4JIEA 1BXBA 4ICCX 3E12A 2Z1KA 3CHDA 1J9YA 3S47A 5E9AA 3QJAA 1TPDA 4DWSB 1UYQA 4GYPC 1I1XA 2E9LA 1EX1A 4ZSTA 1FQ0A 4CD4A 4ZL1A 4MWAE 2Z1WA 4QG6A 1BVWA 1LWJA 5HPOA 4NU7A 2YDSA 2JGYA 4HNNA 1E1FA 1S2WA 3MVIA 3IIPA 4QIUA 2VXNA 4HMNA 3VUPA 3PFRA 2PA6A 5EGRA 3E38A 3UZYA 4I7WA 1H4PA 2VDIA 2PFHA 2GL5A 4J3SA 3CAKA 1J2WA 2ABBA 7XIMA 1ITXA 3LHYA 3N13A 3BV7A 1JAKA 5FI8A 2TPSA 3DYMA 3IIOA 1RLDA 4AVNA 1OX4A 1TJ1A 2XINA 1UCWA 1VYPX 3PK7A 4NIRA 1FDYA 1X97A 3BICA 3B04A 5CZTA 1FWBC 1WQ5A 1V79A 4IGMA 5AHNA 2YGYA 3BW4A 1UKOA 3AWOA 4GVFA 3WMSA 4W93A 3TZNA 4ZB5A 4I8DA 1XH2A 1TV7A 3BLKA 2WVSA 4D71A 1NTHA 3NZQA 2QLYA 5GVJA 4QAIA 1ZCCA 3W74A 1XP3A 1BVZA 2CLPA 2CWNA 4K36A 1KFCA 4OQVA 3HV9A 4PTWA 2OSXA 5CC5A 3WCZA 3EWCA 2YCLB 4XZ9A 1GQIA 1XLMA 2W63A 2DT3A 3FKRA 2DUZA 4LUSB 1EIXA 1OJXA 3DHFA 1R87A 2Z6JA 3SN0A 3LS9A 4EWND 3PZQA 1O1HA 3SCUA 4I9MA 4AD2A 2WZEA 1VJZA 4Y96A 1YBQA 4V27A 2EG7A 4GE8A 1GOWA 4LVBA 1XXXA 4HNCA 4L6HA 1KFEA 3F7JA 5DANA 4CCDA 2WHJA 3LZ3A 3OW1A 4M0XA 2VDGA 1BPLB 3K30A 4MOZA 1OT2A 3CO4A 3WF1A 3IIVA 2UV8G 2OB3A 1M6JA 4MFEA 4LUJA 3GG8A 4PODA 1E71M 3QC3A 4JX6A 5TF0A 1LBLA 4UXDA 4QXIA 4KWVA 1UPPA 4GZJA 2ZX5A 1BYCA 3P82A 1E9ZB 1XD1A 1GYLA 2ZC8A 2NLIA 3MI2A 5IDZA 3O6CA 5FSEC 2WBKA 1YW1A 3HBLA 4IXHA 3VNYA 3CHFA 1XFCA 2R1NA 4FZIA 2OMAA 2TAAA 3SUWA 1BSIA 3CZ8A 4E8GA 1E9LA 2PDLA 1B54A 4J7RA 4M8UA 1TV4A 1DJQA 4JIPA 4OU1A 3UWZA 2ZZ2A 4KIRA 1QJWA 5A94A 2A3LA 1OQFA 2GFTA 3IJ8A 1G94A 1AMYA 4C1NB 3RLUA 4B91A 1AQ0A 1MEIA 3WFAA 4DHGA 3VABA 4XVEA 4HSNA 4GFSA 3UPBA 4C7GA 1XG4A 5I2UA 3HGOA 3WL1A 3A47A 3MMTA 3SSZA 1EGZA 1A47A 3AMKA 2REQB 3W28A 2QCGA 4H01A 1JNDA 4Z1YA 1SJDA 3NVTA 1THFD 4F2UA 4R7JA 3BSMA 5AY7A 4J35A 4DY1A 1I8JA 1M5WA 1OF8A 2VOMA 4I5UA 4UQAA 2VEIA 1V3JA 4INFA 3K5XA 3MMUA 2ISSA 4JAWA 3CTLA 3VGBA 2HBVA 2P0OA 1OK6A 2XSXA 3NO1A 3R2GA 1HL9A 4MF4A 3W37A 1TVNA 4H7ZA 1UR2A 4RDZA 4GUGA 3EDJA 3VD3A 1ZAIA 2EAWA 1JDEA 2YCKX 4MJMA 5H2ZA 1A3XA 1XLDA 2IUZA 4TIMA 3E2SA 1LF1A 1LLWA 4AFYA 2HK1A 3AYTA 2W61A 2WMIA 4HK5A 3UEQA 5LA2A 4CCCA 3MW7A 5HMDA 2PGWA 4EIVA 3REQA 1PVNA 3D0CA 2O4QA 3NOEA 3VK5A 2QPUA 5BW6A 4DM2A 2HVOA 3INPA 3W7MA 3R8GA 4LU0A 4W8AA 1GYNA 2OQHA 4HMDA 3EX4A 3CMGA 4AEOA 1UMLA 3BARA 5D09A 1UWRA 1LT7A 1EGVA 4UTLA 3VC5A 5LGXA 3TH6A 3CIVA 4Q8PA 3CZLA 1T40A 3OZMA 2OSWA 3AOFA 2Z1BA 3SIMA 2NT1A 2BP1A 4AVFA 1PSCA 3N6HA 4J5NA 1YE4A 3VM5A 5D03A 2OYKA 3I7QA 3IGUA 2BTMA 3F5LA 3AI0A 1O12A 5KZMA 1XLAA 3ZSTA 2B31A 1PHWA 2WWCA 2PDNA 3MSGA 4AC1X 4PMXA 1E4NA 1V7YA 4DZHA 1QI4A 3B9AA 3IV8A 3SGGA 2EGZA 3OA5A 3ZSSA 3CEPA 1QPQA 2WSPA 3U7VA 1XV8A 1L2UA 4OUEA 3MSRA 5TIMA 3HJZA 1TX2A 1XICA 4AIUA 2JF7A 2VVSA 2OCZA 4TXEA 3NQBA 2L5HA 3N34A 3WQ5A 1LOSA 5CAHA 3FLUA 3RG6A 4PEEA 5MHBA 3LZ5A 1L6YA 4AZIA 3FJLA 7PTDA 3N9SA 3FCPA 4X2PA 4DJDD 4PRTA 3NUKA 3N6QA 2FHCA 2ZA1A 3N2TA 4E2BA 3HFYA 2Z2AA 4DELA 4GZIA 4AZ7A 5HAOA 3NGFA 2GWGA 3PNZA 4UC5A 4GI6A 4ADSA 1XLHA 4JFVA 4F9JA 1FP9A 4MSSA 1AA1B 4LGXA 1W9DM 5DY3A 2O9OA 1MO0A 4HCDA 3WENA 5D2XA 3W7RA 1VFLA 3BVJA 3WQWA 4IIHA 4KRUA 3RAOA 5AC4A 2R1LA 4GC3A 1VFOA 3HU7A 4YTRA 2NX9A 4MZ8A 3UR5A 4FXRA 1EGMA 4Q8OA 4LALA 3G1XA 4QSHA 3DOPA 3W1QA 4LEQA 4LYRA 5D30A 1ISXA 2O4MA 2IQ0A 1XLIA 3ZO9A 3QOKA 3STCA 1H63A 1Z8AA 3OTRA 1JPDX 3M0ZA 3CIWA 2NX3A 3CWOX 4PGLA 4LUTB 4NZ3A 1QI0A 1WZKA 1V6UA 3WQFA 1BGAA 1VQTA 1OHLA 3ZWTA 1H1YA 3U6WA 1XFBA 3EDEA 1VIZA 2Z1VA 1KBKA 1OC5A 5G1YA 1OYBA 1SO4A 3EWZA 8A3HA 4JDBA 2VEKA 4J3TA 4UQ9A 2E6YA 1N8IA 3YPIA 2OEJA 4ZQOA 5KITA 3POHA 4RPPA 3K8KA 2FMNA 2JFEX 3VXGA 2QCDB 3VD9A 1QBBA 4N6FA 3W6LA 4H9UA 3IACA 1JDFA 1I45A 3PVFA 1M03A 2TYSA 4NZJA 1TO3A 5LGZA 1MMFA 1W3IA 4QJ1A 4TTGA 1XUZA 1Q6RA 3I10A 4NZ1A 3ARXA 4M3PA 3L66A 4QNWA 1TTJA 7TAAA 1ZSXA 1PPIA 5BYWA 1K4GA 4XBJA 3GDBA 1BLIA 4DBEA 3P6LA 4JFTA 4L9ZA 1NWRA 1Z6KA 1Z89A 3D3AA 4YVXA 5HR6A 1IEIA 1CNVA 4QE5A 3T6CA 3WD3A 3QQ0A 4HNVA 1XGEA 4WOZA 1DTNA 2P8CA 2WB5A 1ZHAA 1IZJA 1E6QM 5IRPA 2HROA 4UFIA 1DORA 3S42A 4AD5A 5C9ZA 3CC1A 2ANUA 3CL6A 4O1EA 1EKOA 3W1RA 1K8XA 3E0FA 4GH3A 4GQBA 2LLEA 4WR3A 2VZSA 4HYVA 3W00A 1Y5WA 3QRHA 5CPSA 3QV8A 5EL1A 2RKXA 2H9AA 1RPKA 3DIPA 1SFSA 1PCKA 3GKFA 4U33A 3N04A 5GNXA 5JIWA 1YTDA 4E4PA 3WEMA 1K8YA 2YA0A 3ABSA 5JU6A 3TDFA 1F05A 3M43A 4LAZA 3VZYA 2ZOXA 1J12A 1E5JA 2GGHA 1FWHC 2Q02A 2DT0A 1OZMA 3KRUA 3O2LA 1AZ1A 3A13A 4H9MA 3GC4A 5GPRA 4EAYA 4ZQMA 2NV1A 3DFYA 5HUOA 4XVDA 2QDEA 1OCBA 1O7AA 1A53A 3FXGA 3ZLFA 2QAPA 3W7NA 3QFWA 1J10A 2PC8A 4E2VA 2ATMA 5A8QA 3UCDA 3PZUA 1ZBKA 5PTDA 3H6OA 5FJRA 4XBSA 4ZQPA 4QDPA 3A4XA 4HP5A 3LI1A 4BQ3A 4I9AA 1JCLA 3OU8A 3TJXA 3TP4A 4HHLA 1U83A 1C7SA 3PANA 1B4EA 3RM9A 1T5AA 3GDLA 5DCBA 5ABGA 1IZKA 2HWGA 5DXYA 4AXNA 2HE8A 1OCJA 2A79A 1DTUA 1GHSA 3WJWA 3FJ6A 5G5IA 4UIOA 3MB9A 1TE6A 4A35A 1NIUA 2P8BA 2NQJA 1ME9A 4K39A 2Q01A 1MVYA 3ZFHA 1R46A 1W37A 1RQHA 2G3MA 1V3KA 3G22A 3GIPA 4L4LA 5BRQA 1R9XA 3AU6A 2GVYA 3DH7A 3LNPA 1A5AA 1CECA 2GQ3A 2AQVA 2D2HA 4PUUA 5E5CA 2VFHA 1QPNA 4WDUA 4QCEA 2PDXA 3KBMA 1IV8A 4GKTA 1WAUA 1N55A 4ZQCA 1O94A 5DBTA 4G56A 3ABRA 3ARQA 5D2VA 4H6RA 1OEPA 1EP3A 1ZJAA 3F2CA 3BAKA 3LXAA 2PWVA 3V35A 3VIOA 4FI4A 1J0HA 1KM3A 4D8AA 1XIMA 4XG1A 3TE9A 2PB1A 2HMCA 4ZOAA 3L4XA 4NJHA 4EE9A 2VFIA 2CBVA 3UJ2A 3QV6A 5FKYA 5J5RA 2BV9A 3BPWA 1YIXA 1GZ1A 1F6YA 3HA1A 1HKWA 1Q45A 4JN6A 1JGIA 5A1AA 2OX1A 3DBNA 4K37A 3EMQA 2WBGA 3QC0A 2V5JA 2NXGA 1KXHA 4UNLA 1Y0EA 4CQ9A 1D8WA 3G0SA 2V2CA 2DSKA 3M41A 1RJQA 2JKAA 3BXWA 2NT0A 2NVDA 4WJ8A 3LGGA 4Q32A 2Z7GA 4D2JA 3KXQA 4G7FA 4MUZA 3NZRA 1AW5A 4GYFA 3R0UA 4M6VA 4HU4A 4XD3A 2CHRA 3MP5A 3TWAA 3ATZA 1DP0A 3XISA 4Z2IA 1UA7A 1I1WA 1NAL1 3E1F1 1JDDA 3IRDA 4LUYA 3MHGA 1VCGA 3Q67A 4GQQA 4FX8A 4IZGA 1DKWA 4H9TA 5DFAA 3D6NA 1OFDA 1VYSX 1TB3A 4FK9A 4MB3A 4F4RA 2CIPA 3V5FA 2XGBA 1W9PA 4WIWA 2BGQA 4JTHA 2YPIA 3S2LA 2V5CA 2QS8A 3VM7A 4GNVA 1V0MA 4J3WA 1NWTA 4A8IA 4EPKA 2PF8A 2VOTA 1QWKA 3I65A 2QYGA 4IPIA 1NELA 3AO0A 1A4LA 2EG8A 3OVQA 3DX5A 4ERAA 5HQEA 2WANA 2QIIA 3IWPA 1LRNA 2XM1A 1PZ3A 3BQ6A 2JF6A 3SFWA 5BNKA 2OYMA 4A6GA 3W1PA 2YXOA 3DUGA 3M0MA 5K2ZA 2XG9A 4A3RA 1F3TA 1KCKA 4DAFA 1E56A 4XBKA 4KS0A 5CEWA 3TW9A 1OX5A 1EUNA 5EFFA 4ACZB 1VD6A 5HWMA 1RK5A 1L0PA 2ALDA 4W7WA 4IP7A 1G01A 1LCOA 2E68A 5AYIA 3W53A 2B4GA 1W0MA 3RCNA 4NASA 1L6WA 2XVPA 1C29A 4ILSA 1HO4A 2QF8A 1V0NA 2BX7A 1ZTVA 3E02A 4J3XA 1EEPA 1A5KC 4K1WA 4CNNA 3HIJA 2Z2UA 3QM3A 1O66A 4MB5A 3PTQA 2Y7GA 4DWSC 1MNSA 1W54A 1TPC1 5A6BA 2V30A 1HUVA 3VILA 4LAOA 3EDFA 1LUCA 1XX1A 4S23A 3B0VC 3CAWA 2GJLA 3AWNA 2R14A 4G7EA 1U33A 5DELA 2CLEA 4IG2B 1XC6A 3CPRA 2EJ1A 4IM4A 3V1HA 1ITCA 2JIEA 4FX7A 4BY3A 3TYBA 2WMGA 3RM4A 2BBFA 4LX4A 3PWGA 4GJJA 3BCFA 2Y89A 4HVXA 2J8GA 3ME3A 3IANA 3TCSA 5GJNA 2AL2B 1P6CA 1M9HA 3OLEA 1ZFJA 3W87A 2WSQA 4J4KA 2B7QA 5FEPA 2FHFA 3C0QA 3AYSA 2Y8UA 1UP3A 1NFBA 4DN1A 2V6AA 4YTQA 2ABAA 2WSYA 4M80A 4O8AA 4B3LA 4W5ZA 1C8VA 1ITUA 4DZIA 3K8MA 3AMLA 1UWQA 4LAKA 4F0MA 3WX7A 1XIIA 4ROQA 2PCEA 1QDSA 3WBEA 4H6KA 3P2VA 3CLWA 1DXFA 2CLOA 3PZ9A 2J66A 2ODOA 5C5YA 3ARRA 3DERA 4CNTA 5AVNA 4QE1A 2VWSA 2ZTJA 4JTJA 4QJ3B 1E55A 2ZFAA 1UHVA 4AD4A 1J18A 1MDLA 1CX9A 1GTEA 3N19B 2IKIA 1V6TA 2ACSA 2F6XA 3MKCA 2QJMA 2QUUA 1KFBA 3TKFA 3GW0A 3CQKA 3CV1A 1VPYA 3WD4A 4Z42C 4CNSA 3LOTA 1CBGA 4M51A 1M7JA 4N4QA 1ZB5A 2MANA 1NFPA 3WELA 1ZENA 3B3DA 2P5NA 2R9RA 4Q8VA 2WKJA 3UGRA 4HNUA 1QI2A 2HRWA 3FJNA 1W1IE 2JEPA 4CNPA 4EP8C 1PKNA 4FB7A 5EMJA 1QMLA 1CGXA 4K7VA 2JQXA 3PWAA 4UUIA 2Y70A 4FIRA 4WJXA 3WDHA 3H70A 1K70A 3VNIA 3EKZA 3WF4A 2OVLA 3QXBA 3VIGA 5HPCA 2PDFA 1ZALA 3ICJA 2DZTA 4IIFA 1K4HA 1KA9F 3MSYA 1HQTA 2DSVA 4GXPA 3CQ0A 3LSBA 5A2CA 1HFBA 4RCXA 1OM0A 3A12A 2ZA3A 3MPGA 1JRCA 3OZYA 1VEPA 4AISA 2FVMA 2DIEA 1PZ2A 3SECA 3WMCA 1TR9A 3P5ZA 3O15A 1IT8A 1NU5A 3RRAA 5D05A 1DBTA 1JD9A 2CITA 1CIUA 3GUWA 3VKDA 1SO5A 4U2YA 1P7TB 5D02A 2DW6A 1VPQA 3D5HA 2QUMA 4YJ5A 1K6WA 2Y1HA 3RIKA 5ECVA 2QPXA 3GG1A 3CZEA 3UXIA 1Q6CA 3S5YA 3TYDA 2EPNA 3BLFA 4PCPA 4EXAA 4RW5A 3OBAA 5HNNA 1I60A 3BGAA 4MLRA 1KW1A 3NJ3A 3NNTA 3TYEA 4O1BA 1G1YA 4OV9A 2Y8KA 3V36A 1ZGDA 3WLHA 3L2LA 4IMCA 1UH2A 4A2RA 3UG3A 1K9DA 2Y7EA 4GVHA 1TCDA 4N6EA 3VCNA 4AF0A 3W29A 3C0JA 1BRLB 3BGGA 3BMWA 3NA8A 1IHIA 2CW6A 4BEQA