2Z2UA

Crystal structure of archaeal tyw1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
279
Chain Sequence
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNSQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Radical SAM Enzyme Catalyzing Tricyclic Modified Base Formation in tRNA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords UPF0026 protein MJ0257
total genus 103
structure length 279
sequence length 311
ec nomenclature ec 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).
pdb deposition date 2007-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF08608 Wyosine_form Wyosine base formation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z2uA00
3QJAA 1T8XA 1GWJA 1SO3A 4ZQMA 4DPPA 1Q6RA 2E6YA 3EX2A 1WQ5A 2W6RA 3QSRA 1K8XA 2FTPA 1TPH1 4JTFA 3C61A 2ZA3A 4LVBA 5D32A 4JTSA 1KM6A 1SO4A 2NUYA 4UIOA 4LRTA 3WK0A 1IGSA 1G6CA 3JRKA 3PR2A 4WY0A 5H91A 1F76A 1XUZA 3NQ2A 2YYUA 1GTEA 3DGRA 1L6SA 1FXQA 3G3DA 5C54A 5DELA 2FPYA 1TV5A 3DZ1A 1DJNA 3L9CA 4WX2A 1OF6A 3TQVA 1TPUA 2V2HA 3N9RA 3ANYA 4ZVJA 2YW4A 3G1FA 1GOXA 1X7FA 3M0ZA 4JTHA 4ORMA 1VRDA 1FDYA 4MYAA 5U7SA 1XC4A 5HUPA 3RF9A 1H5YA 2C3ZA 3SGUA 3P5YA 4ADTA 3NOEA 3R89A 3FA5A 5MHBA 3STGA 3P8JA 1A5SA 3UXDA 2J24A 3M41A 2VEMA 8TIMA 3P5ZA 4OWGA 1JCYA 1PHQA 1DQWA 2FDSA 3W7MA 1HFBA 1ZFJA 4JN6A 1TPVA 5CPMA 3H54A 3HGOA 1G4PA 1JUBA 1VGAA 1G4TA 4Y96A 3G3MA 1TJRA 1LM1A 1HO4A 2V30A 4WUIA 4K7YA 1JQXA 4UC5A 2ABAA 2A1YA 3BLFA 1I45A 2QJIA 2QDHA 1KM1A 3B04A 5DCBA 3CWOX 4RCXA 2BLEA 3FFSA 4YCPA 5D02A 3TMQA 5BRBA 1H7XA 5AC7A 1C29A 4DO5A 2ATMA 3YPIA 3BO9A 2WOQA 3DAQA 3W3OA 3NQ6A 3LOTA 1AG1O 1JCXA 3S1XA 4LTSA 4GNJA 2C13A 2ZZ7A 2CWNA 3LCWA 2ZTJA 3EWZA 4LV9A 2CFFA 5E1QA 3DI1A 2ZA1A 3LV5A 5EYWA 3N19B 2O7QA 2QCDB 3PUOA 4JIQA 4DQWA 3KOFA 3IIZA 3CT7A 2A85A 1A50A 2CU0A 3ABRA 4GUGA 4C1LA 1OG0A 3GDTA 2V2DA 1I2QA 3E49A 1OYCA 3B03A 4FNSA 4O11A 1T99A 3SGZA 2VFIA 3DFOA 3W1TA 5L9FA 3O15A 4TO8A 1G4SA 4DBEA 2WSRA 1ME7A 4GUJA 4WXYA 3CM4A 3MJYA 3WJXA 2P10A 4Y90A 1GZGA 3IVSA 2CLEA 3IIOA 3RMJA 2OZ0A 4NNAA 1W3IA 2C1HA 2J88A 1GVSA 1GYNA 1Q3NA 1EPXA 3Q94A 1OX4B 4PC8A 1DKWA 1KLYA 3QMSA 2A5HA 4YCOA 2VEPA 3LCXA 1SU5A 3UPBA 3DFSA 3V75A 3O6CA 5TBOA 1W5QA 3IIXA 2A21A 5CGQA 3TUUA 1W37A 1AL8A 4O4VA 4ORIA 5CPNA 1CI1A 1A5AA 4YMZA 1XCFA 5AHLA 4AH7A 5I3FA 2DORA 3A24A 4O1AA 4JTGA 2Z2UA 3TKFA 3TQ0A 3VE9A 1I2RA 1YDOA 3A9IA 3NQ7A 5DBTA 3HGRA 4WY0B 3QMTA 1DJQA 3TA6A 3W7GA 3WJWA 4RR4A 3QFEA 1KM2A 4UTKA 2BX7A 1UB3A 4GBUA 3TC7A 4LOCA 3NPUA 4EVZA 1NFBA 5EA9A 3P74A 1H7NA 3B06A 2QCGA 1H1ZA 4S2BA 1EUAA 5HJLA 3IGXA 4IMGA 2NXHA 3HF3A 3NPVA 1OHLA 4YWIA 2Y70A 3BW4A 3FIGA 3A22A 1A5CA 5AHEA 1QAPA 3KHJA 4IWWA 2GJNA 4FEZA 2Y61A 4QJ1A 1YDVA 2W0UA 3E96A 3I6RA 3PS7A 3HG4A 2YPIA 3W7PA 1SFLA 3ZS4A 6ALDA 1YPIA 4XWUA 1GEQA 4PL2A 5CPLA 3JR2A 2ZBTA 2ZZ6A 3DFPA 5C55A 1TQJA 3FYPA 3U6WA 2QCCA 3CEUA 4JY8A 4LC8A 2G96A 1O5XA 1WA3A 2R8WA 5HULA 2QUTA 3SW6A 2TMDA 1DQXA 1QO5A 1VQTA 1EB3A 2WNQA 3W2LA 4QQ3A 1D9EA 3LCFA 5G5IA 4CNPA 3S0CA 3OHIA 4IXHA 4QNWA 1OJXA 3LV6A 1ONRA 2VEIA 3ZFHA 1JCMP 2ZRUA 3W1LA 5LHEA 2QCFA 4LC6A 4EOUA 4UTUA 4IJBA 1M7PA 2ZZ5A 3M9YA 5KSWA 3NNTA 1TIMA 3C0JA 3LDVA 1LRTA 1R2SA 2ZYFA 2Q8ZA 2JBMA 5EMUA 4BWLC 2ZDRA 1VR6A 4IOTA 3IV3A 4CCDA 4MZ8A 3P80A 1W56A 3GYEA 4QM1A 4CNNA 2F7FA 4UMAA 1QPRA 1B4KA 1KFCA 2VFGA 3FLUA 3LHZA 3MP3A 2DP3A 5HMSA 2GOUA 3TU9A 2QDGA 2WSYA 3L0GA 3C2OA 3R5EA 3W7NA 2QAFA 4O18A 1MO0A 1VYRA 1XUUA 3EEGA 4O53A 1EEPA 4O54A 3W1MA 1SQ7A 2CLLA 3AO0A 3GDMA 3T55A 3P62A 3HJZA 3PSWA 1E51A 1KTNA 2DZPA 2ZRWA 4CQ8A 3OIXA 4ZQOA 3W2KA 4FO4A 3P81A 3DBPA 4A22A 1FWWA 3U2OA 2AQWA 3HPXA 1ICPA 1RPXA 2X1TA 1B57A 2A2IA 1YXYA 1GVOA 1EUNA 3QF0A 2P1FA 4XTDA 2QR6A 4KFNA 1TRDA 3RU6A 1EWDA 2IQTA 1GG0A 3G8RA 3NL6A 3BPWA 1SR9A 3EX4A 4PH6A 1ZAIA 3TROA 2Y88A 4HN4A 4MJMA 4ZQPA 1YXDA 5DY2A 3JS3A 4OT7A 5EPDA 2QUVA 3CIXA 3NM3A 1XDMA 1B9BA 4O16A 3S5NA 2YSWA 3HGSA 1K8YA 3PBWA 4RKAA 5LSMA 3M43A 3O16A 2ZZ4A 3BW3A 4PCFA 1G69A 1MXSA 1KM3A 3QW3A 5D03A 2Y7EA 1OX5A 3M7WA 4FIRA 3W74A 2D73A 4BI6A 3BG5A 3GK0A 3C2RA 1TPEA 4HT3A 3H53A 1UUOA 4J9JA 1WAUA 1JCJA 4NZJA 4BF9A 5T26A 3GX9A 2NV1A 5HNRA 3M5ZA 3QSTA 5G1YA 1U5JA 4MYXA 5K7JA 1ICSA 3GVGA 1ZCOA 2RDTA 2VFHA 4H6KA 2YCEA 3DHFA 1WBHA 1LTDA 1Y0EA 3PG8A 3VCRA 1OFEA 1HG3A 1VJIA 1EIXA 2Z1BA 6TIMA 1RD5A 3THQA 1AL7A 2Z6JA 1W5OA 3O6DA 3L2IA 3NZ1A 1GJPA 1SZGA 1AK5A 2GUUA 1QPNA 4DELA 4MUZA 3G1HA 4X9SA 1J4EA 5E93A 3TE9A 1AW2A 1XBZA 1JR1A 3UQNA 5EY5A 5FF3A 2OT0A 4UTIA 3WK1A 5FESA 4CCEA 4QITA 3BGJA 2EGZA 1F7BA 2NV2A 3BK0A 1C8VA 3M16A 3KVJA 4OGZA 4UXDA 4XBSA 2X2GA 4DPQA 3P84A 1I2NA 4WQ6A 4UR7A 3OEXA 5CZJA 2Q8LA 4LS1A 4NJKA 2J6XA 4LV4A 4M6VA 5DLCA 2X30A 3B0PA 4JD4A 1OYAA 1H51A 1SUXA 3EKZA 3GDKA 2J9ZA 2YW3A 4JR5A 2BWGA 3TK7A 3OA3A 3RNDA 3THAA 5C6MA 3A23A 2ISSA 4MZYA 4JYDA 1YYAA 4KKXA 4DO4A 3W7LA 4IPIA 5F4XA 4EIVA 3M44A 3EB2A 2Z6IA 5LNWA 5HR7A 3Q58A 4W9TA 2YFOA 2WKJA 4N9BA 1TCDA 2ZCGA 3OVQA 1NF0A 2JKAA 4UTHA 3LXBA 3M6YA 2YZRA 4L4MA 2BZNA 2E77A 3HOJA 1AW1A 3DH7A 3TH6A 3HMJG 3GKAA 3LHVA 4JXCA 4R7JA 2QCDA 4M6PA 4DF0A 3TAOA 2X1UA 4FNPA 5LNVA 1S5TA 1UCWA 3NZRA 3LGEA 3PVFA 5DXXA 5LGZA 4M19A 3AJXA 1ALDA 3CB8A 4XKYB 3GR8A 4EF9A 1UBSA 3LRMA 2V82A 2TSYA 4GUFA 4NVTA 2A6NA 1VLWA 1XBVA 4DF1A 3H55A 1H63A 3LBMA 2Y89A 3T40A 4B5NA 1OFPA 1SZEA 3W1UA 1R47A 3C8FA 3NL2A 5G2HA 1L6YA 2FPTA 1EWEA 3HPZA 2B7QA 1WXJA 3DENA 4O17A 1FCVA 4FX6M 2TYSA 4JS3A 3LB0A 1CW2A 1XDLA 4HNTA 3G1AA 1VHCA 2VFDA 5CZSA 5D38A 3PWAA 3FKKA 3KVKA 4XBKA 4K39A 5D2XA 3UZ5A 1XI3A 4K36A 4JICA 1NVMA 3UZJA 4FXSA 3S42A 3NXFA 3PUDA 5KZEA 1K7EA 2E09A 3QPZA 2R14A 1JCNA 3MP5A 5TQLA 1ZALA 3RK8A 5FF2A 4O12A 1W54A 3DI0A 4NJJA 1VYSX 1Z48A 4GWEA 4I9AA 2ISWA 1GVRA 3SIZA 1X1OA 4Z1AA 4AWSA 3NQEA 3L5AA 4UNLA 1BKSA 5DCDA 3IIPA 3CQ0A 1SZFA 1MEWA 1R46A 1PHWA 5G2IA 1OX4A 4AF0A 3P67A 4GXMA 4Z1BA 2NX3A 3EWWA 3EXSA 4UFJA 5BOOA 1ADOA 5CZTA 4X22A 4R34A 4JTEA 5AYYA 3VI2A 4U28A 2Z0IA 3KRSA 3L0NA 2Y6ZA 3NGJA 1KBIA 3TSBA 4UMCA 1W0MA 1GTHA 1BEUA 4A2RA 3TR2A 1WDWA 1KM5A 3KX6A 2PRLA 1ZY9A 4N6FA 4ADUA 3CLMA 3UXAA 1OVDA 4UR8A 1IIGA 4S2CA 3W2NA 3FS2A 1FUYA 1X1ZA 3VNDA 1H7RA 1YTDA 1LDCA 3F1QA 4RV8A 3FEMA 4N9CA 3W85A 4E0CA 1OFAA 1KA9F 4FF7A 3O6YX 2P0OA 2E5CA 5J5DA 3GNDA 1G7UA 3C3NA 1GT8A 1BTMA 5AN7A 2BXVA 3KVLA 1VCFA 3W7KA 1SW3A 5I3HA 1ZAJA 2TPSA 4JNMA 4DXVA 3USBA 1LROA 2AGKA 3FYOA 4CCCA 4S1FA 3RLVA 2FB2A 2GVLA 4GFSA 3TX9A 3S5OA 4LVAA 3DKLA 3DXIA 2OX1A 4UFKA 4N02A 5D33A 3UYCA 4AXKA 2CLIA 2E68A 1X6UA 1GG1A 4YL2A 4IMEA 5LHFA 3GXNA 3TSMA 3NQMA 1K7XA 1QMLA 1DL3A 3W2MA 3W6YA 1QWGA 3LM7A 1KBJA 4I7VA 1NSJA 3SR7A 4D2JA 3LCLA 4O4WA 3GAKA 3I7RA 1FWRA 3UY8A 3O07A 1Q45A 4AWTA 2VENA 3W1QA 1D3HA 3SI9A 3TXVA 3NEVA 1RR2A 1RV8A 4JTUA 4O57A 2ZQ0A 1C9DA 5F1VA 1VS1A 4IPJA 2YX0A 3LXCA 1F2JA 3EX1A 4XUGA 4WXZA 1GPWA 4K38A 1MZHA 3UNDA 3EXRA 1A5BA 2H6RA 1QDSA 3WK3A 1IXOA 4BI5A 1F05A 2DZTA 3W70A 4LUJA 4Z0SA 4DO6A 2QF7A 1EA0A 4FNQA 3NQ8A 5DY3A 5K4XA 3G0SA 3W83A 1KV5A 4K8HA 4HPXA 1VC4A 3E02A 3EWBX 1L6WA 5F2IA 1NAL1 3UWYA 3W7CA 3T4CA 3S8HA 1W5PA 1DV7A 5HWJA 4QAIA 1Q6QA 4RX0A 5AOUA 4TMCA 2VKZG 5AHIA 4Z0JA 3NQVA 1JUKA 3OVPA 4X2RA 1S5WA 1H62A 2ZRXA 2PC4A 4NJGA 4IUOA 3R12A 3N2XA 3W2JA 1AW5A 5C5YA 3QYQA 2ABBA 3OVRA 2RDUA 4BI7A 1R2TA 1VZWA 1GVFA 1MSSA 3MHFA 2NWRA 3OBKA 2B7NA 4POCA 4DEFA 1V5XA 1I8JA 5D2VA 3IVTA 4ZQNA 4AHOA 3EX3A 1T0OA 2DZWA 5L6UA 4PEKA 4Z1CA 2KZHA 1J5TA 1P0KA 3S9YA 4MY8A 1LZOA 2YXGA 2HSAA 4K7VA 3PG9A 4H4IA 3GNNA 3L66A 3IIVA 4UUIA 2WO5A 3I68A 1FCUA 3W1NA 2C19A 5LNSA 3I7SA 1CX9A 2XN1A 3G24A 3NQDA 4E2DA 1H7OA 1LORA 2E5BA 2GVGA 2CZFA 1TPB1 3W75A 1GQNA 2WPBA 4TU1A 5H2ZA 3HG2A 3M5XA 1PE1A 4N2YA 5AC6A 5KZMA 3NL5A 4AVFA 4O0KA 3LHYA 1VHNA 3NA8A 4UFMA 3TC6A 2EKCA 3MYPA 5AYXA 1N8FA 2VELA 3SSJA 4IX0A 5A5WA 3R8RA 1YXCA 3QRHA 3W87A 3N9SA 3KRZA 3W7JA 2J9YA 2ZZ1A 4R33A 3BG3A 4AEOA 2GVJA 1M6JA 5LNRA 1QR7A 4IMDA 5AHFA 3MHUA 3FJLA 4O1CA 5CPOA 1FCBA 3TDFA 4A29A 3QH2A 3KAOA 3GAYA 1Z42A 5BNKA 5D2YA 2ISVA 2VFFA 2Y7GA 4MY9A 4MOZA 4NX5A 4K6AA 2JGQA 1YPFA 3INPA 3EWXA 1W1ZA 3M5YA 2ZTKA 3SY5A 1LOQA 3B4UA 1TMHA 4HSOA 3DFQA 1VCGA 1KLZA 1FY6A 1UASA 1HL2A 3S1WA 1O94A 1LRNA 1K02A 1ZENA 4ZQCA 1YLVA 4HNVA 4JX6A 3L5LA 4MLRA 1ZHAA 1ML1A 5FF4A 1T96A 1GVQA 2F84A 3STEA 5BW6A 3DKJA 1PIIA 3W7DA 1ICQA 5F4WA 4RJEA 1H61A 2EF9A 5DBUA 1QPQA 2QCHA 3VFLA 1M5WA 4LS2A 1O4UA 5HQEA 1FWTA 3C52A 2BTMA 3NL3A 4UTMA 4M7TA 4K37A 3HO8A 2DZVA 1VYPX 1KFJA 2C16A 4LRSA 4HSNA 4N4QA 3G1YA 4RLIA 4CNOA 3EKLA 5F2LA 1JQVA 4UTTC 4MJZA 3MP4A 1Q6OA 5FEXA 3GDRA 1VCVA 3LCGA 2NZLA 3OG3A 4LU0A 4PA8A 2GQAA 1KW1A 5G2WA 5AC8A 4HHPA 2WSQA 3L65A 1FWNA 3MO7A 1M7OA 3WJZA 2Y7FA 3C2FA 3TAKA 3QC3A 4OE7A 1KV8A 4KFPA 1DORA 1N55A 1QCWA 2H8XA 3W22A 4FX7A 3W9ZA 3L0KA 2A0NA 1FQ0A 4RZ4A 2EAWA 4AMAA 1VPXA 3QW4B 2V2CA 2YGYA 3GB6A 4OV9A 3MYOA 4CQAA 3NVTA 4CLMA 4HIBA 2HTMA 3C56A 1FWSA 1OFBA 1XXXA 3LBCA 1PVNA 1LLZA 4Q32A 4R53A 2NLIA 1OFQA 3L21A 4LUIA 4JX4A 3TJXA 5F4SA 2NUWA 4A3UA 2HS6A 1B4EA 4O14A 5C2XA 1OFOA 2JKPA 3HB9A 4NNBA 2PE4A 3HG3A 3STCA 4RZ5A 3V1PA 1RQHA 1W8SA 1F74A 1DBTA 3KFTA 4E38A 4FB7A 4X3ZA 4NJHA 1G4EA 4I7UA 5K2ZA 1MEHA 4H3DA 3CU2A 3CWNA 4U4MA 3TV8A 2ALDA 3NM1A 4JTLA 4HPJA 1BWLA 1SW7A 3L67A 4LW7A 2W79A 4HNNA 4IGHA 2NX9A 2CLFA 2PRMA 4WOZA 4NX0A 5HUOA 3GXPA 4JEQA 2ZRYA 3DFTA 5CG7A 2FLIA 2B4GA 3BARA 4GC4A 2E5DA 2G97A 1TV8A 3A5FA 4QIUA 3M1ZA 4NT0A 5I3KA 1PV8A 2RFGA 2WV8A 4ONVA 2VXNA 4FNUA 5K9XA 1FCQA 2CLOA 2X16A 3TCEA 3W7QA 1S5VA 2XN0A 4LNYA 4OU1A 5LNUA 2A6LA 3LHUA 3NQAA 4M6QA 3O8AA 3D0CA 1OK6A 2A7NA 4WD0A 2X1RA 3N73A 1SSDA 3LTYA 5K4ZA 3G1DA 4NU7A 3T44A 4JTJA 3VKJA 1LBFA 1H7WA 4JIPA 4MY1A 3PBUA 3W7RA 5FEZA 2BSLA 3G1VA 3NR0A 2C6QA 2YYTA 4NXKA 4GE8A 4Y6GA 1IF2A 1ME8A 4Z08A 4GUIA 1JULA 3BG9A 4NUWA 1EX5A 3W84A 4O8RA 4O1DA 3W07A 3S5YA 3G1SA 4MKNA 5HINA 1HO1A 3VE7A 1KM4A 4XTIA 1N7KA 5CSSA 4BWLA 1O95A 4GRSA 2CZ5A 3O1NA 3O06A 4O15A 1XBYA 3GXTA 5FEPA 1LBMA 3TW6A 4ZMGA 3E0IA 2UV8G 1WV2A 4O52A 1LBLA 3C6CA 3TFXA 4YLWA 4UTTA 5BMWA 2O7SA 2WNZA 3LCIA 3PB0A 5G1TA 1LRQA 2OJPA 3TJLA 4O28A 4O0ZA 3W7OA 2VFEA 2FQIA 3N3MA 3N34A 4IMCA 1K8ZA 4JTTA 1YTEA 4LY8A 4O19A 5AB3A 3A21A 2QCMA 3G18A 3PC0A 4UFIA 2A4AA 2DJLA 1W3TA 3GKFA 1EP2A 3MW7A 4OBTA 3LERA 3PY2A 3ZWTA 1F6KA 3UY7A 3QM3A 2CLKA 1XBXA 3MBFA 2QAPA 3ABQA 4JDBA 4A21A 2PRHA 2B0MA 4Y8FA 5LGXA 3P61A 2VOMA 5D2WA 3LHTA 1L2UA 2A7PA 3IEBA 3LI0A 5FF0A 3HIJA 4QSHA 4MZ1A 1OFRA 3P8IA 3QMRA 5BMXA 1Z44A 1L9WA 3FKRA 2Y7DA 4PTNA 5GVJA 5DXYA 1FDZA 4LT9A 5DCEA 1QNVA 5K3VA 4ZQRA 3CTLA 3KVMA 4AHQA 2JGYA 1IIHA 3GDLA 3W7IA 1F6PA 1ZAHA 2H90A 3DFNA 3STFA 4UTWC 3I65A 1G7VA 4C1KA 3R13A 3ABOA 4WZHA 3EX6A 5KTLA 2RDWA 1JRBA 2GJLA 1W3NA 1TREA 2OMAA 3Q2DA 3NO5A 3LCHA 4DF2A 3BLIA 3CHVA 2H3BA 3SZ8A 4P61A 2C0AA 4LVGA 2DJXA 4JTKA 4JYFA 4JY9A 1TTPA 5D09A 3ABSA 4ALDA 2ATSA 3PSVA 4XQ6A 5IM51 3TW7A 2V0TA 2A7RA 2GQ8A 2FJKA 3NPWA 3WK2A 4N6EA 4UTWA 3W7EA 1KFBA 4TX9A 1IXQA 3WJSA 5AYZA 1S3HA 5A8GA 4O10A 2JK2A 3PULA 3NQFA 2YDAA 3E9AA 1KFLA 3F03K 4TMBA 1TPC1 4N9DA 1SSGA 2CZDA 1G67A 1TYGA 2QCEA 3CC1A 2CLHA 3LLDA 3UWZA 2OT1A 1OABA 1PCWA 3BLEA 4RXFA 3W1RA 2AAMA 1TTQA 2E6FA 4PODA 1JUEA 1OX6A 1LCOA 3CIWA 1R2RA 3IVUA 2E6DA 1TRIA 2Y85A 5AHNA 5CKSA 1K3UA 1H50A 4M7SA 3GLCA 4JDYA 3W23A 1TTJA 4FIQA 3S5ZA 3I7QA 1OK4A 1K03A 4AAJA 4AB4A 1K7FA 2FB3A 1VLIA 3T7VA 3TIMA 5IBXC 5F2GA 5TIMA 3F4NA 4YXGA 1WBJA 3TNOA 5ABTA 3N14A 1P0NA 4OQVA 2GQ9A 1P1XA 2XFWA 1F73A 1SZNA 5EKYA 3W2UA 1PCKA 5D05A 2ZRZA 4XKYA 1V7YA 1KFKA 3W1AA 4JX5A 4AF0B 3LTPA 3MWAA 3L68A 1FX6A 3FJ6A 4PFMA 1YTKA 1JVNA 3BVJA 5AHMA 3NAVA 3SECA 4OV4A 1P5BA 3ATZA 1DOSA 2ZFAA 2V8ZA 3G0XA 3MMTA 3L5MA 3PAJA 1XL9A 2DU2A 2VEKA 1RZMA 3B05A 2CZEA 3WJYA 1NEYA 2C14A 3MI2A 2FPVA 3PM6A 3RLUA 3HG5A 3QZEA 4UFHA 1O5KA 1SO5A 2H3DA 4LWWA 2EHHA 2QKFA 2QJGA 3W88A 2J9XA 4MFEA 4NXSA 1FDJA 1NF7A 1BWKA 3BGGA 3O63A 1JCLA 1D3GA 5SWUA 1PS9A 5LZLA 4XZ9A 1H60A 4ICNA 3LXAA 1ME9A 1EP3A 5FF7A 1R30A 5HWMA 1I4NA 4O1BA 5HWNA 2V5LA 1YADA 2QEZA 1F5ZA 2E1DA 1TSIA 5D2TA 3IRDA 2QUUA 3G0UA 1AMKA 4IQLA 4MIMA 4G1KA 2Y62A 1H7PA 3DHDA 5DN1A 2FFCA 2NXGA 4ADSA 1TB3A 2E6AA 2JKEA 5FI8A 3Q37A 3DU0A 3CEPA 3B0UX 1IXNA 5I3GA 3LLFA 1Q6LA 1HTIA 5I3JA 5E0KA 1A53A 3NYZA 2QCLA 2B7OA 4BFAA 3O05A 3TMLA 5IBXA 3E12A 3S6DA 3TFCA 3MHGA 2ZA2A 3GZ3A 2OCZA 1W5NA 1OYBA 4ZL1A 1TJPA 4JTIA 1QOPA 4IXXA 5J5RA 3KRUA 1IXPA 2ZRVA 1RQEA 1TO3A 1TPWA 2FIQA 3W76A 5F2MA 3W1XA 1B3OA 3GIYA 3CPRA 3P60A 3MI3A 4OHQA 4L4LA 4Y9AA 4NJIA 2R94A 3P7YA 3BV4A 3NQGA 2V81A 1XFBA 3MBDA 1OF8A 4JYEA 2DZXA 1WYIA 3TXZA 1DHPA 3A5VA 1ZJIA 1O60A 1LLWA 4E2BA 2PURA 1LOLA 2J27A 4DBDA 3MI6A 1VH7A 3R2GA 2YR1A 3EWUA 4GJ1A 3BW2A 3W1PA 3LI1A 4PL1A 3WFAA 1TPFA 2Q3OA 2LLEA 3F4WA 1PL9A 5G4WA 1HUVA 2B7PA 3G8EA 3M5VA 4MLJA 1UUMA 4TIMA 3MUXA 5KMYA 1QFEA 5AFDA 2G5WA 4BK9A 1KM0A 3P82A 4UCGA 4HKPA 3W72A 3QPYA 1TV7A 4P2VA 4MVAA 1X8FA 1RVGA 4FX8A 2X1SA 4ML9A 1LOSA 2R91A 1P4CA 4Q33A 5CZ0A 2I14A 3N2MA 3W86A 3C2VA 1TQXA 4RZ6A 4WOQA 1W5MA 3UWVA 4KWVA 4EF8A 2CW6A 1FBAA 4MPQA 3T78A 2NUXA 3EWYA 2EPHA 3NPXA 3S1UA 4AWUA 3C2EA 4Q4KA 4A2SA 2RHGA 1ZNNA 5LKYA 1MEIA 3KXQA 3UWQA 1U83A 3G1XA 3B0VC 2C18A 1SW0A 1WX0A 3UPWA 4LVDA 1DVJA 5KITA 1QOQA 2NXIA 3NDOA 3K30A 1EP1A 2QJHA 3TQKA 2DZUA 1LP6A 3LX9A 1I2PA 5U4NA 4HNUA 3UWWA 2TRSA 4MFDA 4QNEA 2ZZ2A 1THFD 3SFKA 2VC6A 3ATYA 2HMCA 2ZZ3A 2QCNA 5KINA 2YFNA 4CQ9A 3HGJA 2DZSA 4NNCA 2WNNA 2V5BA 3M47A 1JJKA 4UTLA 1WOBA 2CLMA 4N9EA 5EBUA 2WJZA 3NG3A 4WJEA 2NX1A 4FXRA 4QISA 3ZR4A 3HBLA 1LYXA 4NQ1A 1QPOA 4WY0F 1SFJA 1TTIA 4I7WA 1I2OA 3W71A 4NZFA 1XKYA 1UJPA 2RH9A 3TSDA 5D30A 4IX2A 4AHPA 1H1YA 3PBVA 4UNKA 1Z41A 5EL1A 1W31A 2HS8A 5D37A 1J2WA 7TIMA 4O13A 3G22A 2XN2A 3UD6A 4UMBA 3HPSA 3LRLA 3NQCA 4KFOA 3HQ1A 4UFLA 4FNRA 1QO2A 3ZWSA 1YDNA 2GPTA 4EWND 2G95A 3PUEA 2Y63A 1KFEA 5D04C 3B8DA 3RFAA 2C15A 3LTSA 4LVFA 3UWUA 5F1UA 4ZZ9A 3IGUA 3S1VA 2RKXA 4GUHA 5I3IA 5K9CA 4UTJA 4JGDA 2PCQA 1KTBA 3GR7A 5HR6A 2I1OA 3LRKA 4FNTA 1JRCA 3PF3A 4M5PA 5KZDA 3PBYA 3QQ1A 3EXTA 2I9EA 3W7HA 3ELFA 4FHAA 4KWWA 1FXPA 4O50A 3PB2A 4K8EA 1RQBA 2V9DA 1OFDA 4LS0A 1SO6A 3IGSA 4BR1A 4TR9A 3QEZA 4IMFA 3FOKA 3C4UA 4RXGA 5G4EA 4Z1DA 3LHWA 2Q3RA 3SJ3A 3U8GA 4N4PA 1TPDA 2WQPA 1GYLA 5FEWA 3W73A 1KTCA 2NWSA 1SPQA 1WOAA 5K9DA 3QQ0A 4RK8A 5CSRA 2H8ZA 1XM3A
chains in the Genus database with same CATH superfamily
3QJAA 1GWJA 3EA2A 3BURA 2E6YA 3S2NA 4MAVA 4DVOA 4HA3A 2CITA 3C61A 5HA7A 3SGGA 1E0XA 1V3HA 5FSEC 3S83A 1AQ0A 1KM6A 2J77A 4LRTA 1QU4A 4H19A 2VTFA 2P8BA 1Q6GA 1F76A 4C6EA 1TMLA 4AISA 3U2EA 1IEIA 1GTEA 1E9LA 2FHCA 3G3DA 3M0KA 5DELA 3WEZA 1UD3A 3VTRA 2QS8A 1GQJA 3LK6A 1E3XA 3VD4A 4GYFA 1E0VA 4U2YA 2YW4A 1M3UA 4AU0A 1ISWA 3O0FA 3QKEA 3PJXA 1W1A1 4LBSA 3WLNA 2C3ZA 5MHBA 1PO9A 4OWGA 5H8MA 5F7UA 1GVEA 4JN6A 1TPVA 2WNWA 1FWGC 2D2OA 3HGOA 1G4PA 1VGAA 1G4TA 2WAGA 4E2VA 4Y96A 3W24A 1TJRA 2DGAA 2G3IA 1SGJA 4I3GA 1RUSA 5CBJA 1TJ1A 2BHYA 4UC5A 2QJIA 2IS7A 1KR1A 5DCBA 5I77A 1FOBA 4J4KA 4TUFA 3UFYA 2J4GA 5D02A 3TMQA 1B54A 3AALA 4XZLX 3T6CA 1C29A 2ATMA 3DAQA 2Z28A 3W3OA 3LOTA 3S2LA 2YLAA 3G6LA 2CFFA 1JI2A 3AYVA 5E1QA 5IRPA 2E9BA 1RPKA 4DQWA 2EPLX 1DJGA 5AKQA 1C8QA 1DYSA 4H7CA 1NP0A 2CU0A 2NT1A 3W53A 1GQIA 1HX0A 1P6BA 4KRUA 2G4JA 4TO8A 3CUXA 1ME7A 1WP6A 4GUJA 4WXYA 3MJYA 3OQ8A 1C92A 3IVSA 2CLEA 3RMJA 4NNAA 2VCCA 1GYNA 1Q3NA 1ZP4A 1OX4B 4MWAA 4PC8A 2RGLA 1US2A 1KCLA 3PAOA 1NM9A 4MG4A 1XIEA 2BMBA 3O6CA 3RPMA 1W5QA 3HJEA 5A6LA 1W37A 5CPNA 2BB0A 4M3PA 5AHLA 3TQPA 1DWAM 2VMFA 3FHQA 3A9IA 1XR2A 3NQ7A 5DBTA 3QMTA 4QJ3B 1DJQA 1KM2A 2BX7A 1K77A 4LOCA 3NPUA 3M4HA 3VIGA 4A6GA 3BXWA 3IGXA 3HF3A 3NPVA 4DHGA 3MSGA 2Y70A 3F7JA 3ZO9A 4Q8MA 1QAPA 1VBHA 4ERIA 3IK4A 4GVFA 1TWWA 2IPWA 3VIOA 4O1EA 4QG9A 3E96A 2OZ3A 2DVTA 3HG4A 2XZ7A 4QP0A 1EGMA 1YPIA 1UWSA 3FGCA 3LA4A 4X0NA 4BEQA 4DXXA 3KBNA 1YW1A 3W38A 4FK9A 2QCCA 4LC8A 2BOEX 2G96A 2R8WA 2OZTA 1Z6KA 1QO5A 4QQ3A 2OFJA 4ATDA 1V0LA 2ZVIA 4CNPA 3S0CA 4QNWA 1JZ3A 3FXYA 3W1LA 2IPJA 3RCMA 5LHEA 3EOOA 3ITLA 2QCFA 3Q4DA 4UTUA 3TNBA 1GKPA 2QVHA 3TJIA 3LDVA 1KFWA 1R2SA 1XIDA 2JBMA 3F2BA 4JN8A 3UVIA 4BWLC 4PB5A 2ZDRA 1VR6A 1M7JA 4YS1A 1F4HA 3GYEA 4QM1A 1K4GA 4CNNA 3LENA 3DECA 4GIAA 4P8UA 4UQ9A 4PUNA 1KFCA 2VFGA 2FGZA 2PDBA 3XIMA 5HMSA 4FF5A 2F61A 3BLKA 2OG9A 2WSYA 1X39A 4ROQA 3CB3A 4R9XA 1XKJA 4C6DA 1MO0A 3EEGA 1A3HA 4JQ2A 1SQ7A 3KZPA 3AO0A 3T55A 3SQLA 2NQ9A 3PSWA 1R7OA 2DZPA 1KTNA 2ZRWA 3E38A 1IEQA 2PDCA 3F5KA 2OVLA 2CYGA 1FWWA 2VGIA 4S39A 2A2IA 1YXYA 1LL4A 1EUNA 2QR6A 4KFNA 4DBUA 5M03A 1TA3A 2NQ5A 1XSKA 2IQTA 1GG0A 5HPOA 3NEHA 3TTSA 2XISA 3TROA 2Y88A 5DT5A 1WB0A 2D0GA 1W2VA 3R0DA 4MJMA 1YXDA 1O6IA 4JHOA 4H41A 2OO6A 1XDMA 1B9BA 4O16A 4RKAA 2VQUA 4KF1A 3VCCA 3BW3A 4PCFA 1G69A 5CXPA 3QW3A 5D03A 4J3WA 1WE5A 4I9JA 4GMEA 1JZ7A 4BI6A 3BG5A 3WD2A 4MWAE 3H2NA 3WMCA 3PZ9A 5HNRA 3M5ZA 1MMFA 1J12A 3QYSA 4MYXA 2PTXA 3BQ6A 1B0IA 5A6AA 2YCEA 3NDZA 4WIWA 3BCDA 1ITQA 1SM9A 1WZAA 3AS1A 6TIMA 4LAMA 3THQA 3GRIA 1JIBA 2Z6JA 4PCNA 5CC3A 1AK5A 4MUZA 4X9SA 3GNOA 5E93A 3TE9A 1UC5A 4EE9A 3BGJA 4OGZA 4YVPA 3SO7A 1Q5MA 3PNZA 4UXDA 4CKQA 2EJAA 4GBDA 3RGTA 3SQSA 4S3DA 3VD3A 1ZJBA 4H9VA 2A3BA 2Q8LA 1NJJA 4IJRA 2J6XA 2V3DA 1QBBA 1HZYA 5GQBA 4TTGA 1JD9A 2AL2A 4M6VA 1GUVA 4B9YA 4GIEA 3TN4A 4KT2A 4TV5A 1OYAA 4PUWA 1H51A 3EKZA 4OOUA 1QHOA 2D0HA 4JKMA 2CBUA 2WYSA 1XYZA 2YW3A 1OINA 4URIA 1T41A 3QHMA 1BXCA 2WVVB 2ZX8A 4NZ1A 3RNDA 1C8YA 3OW1A 4HZ8A 4XVDA 3A23A 2ISSA 2XVPA 4LF1A 3W7LA 4IPIA 3NZQA 1EQPA 1UZHA 3KCOA 3U0HA 4IIEA 5LNWA 1EQCA 5HR7A 1PWLA 3OVGA 2YA0A 2VGBA 3RX2A 1MW2A 5BU9A 1HGYA 1PBGA 2P50A 3B8UA 1E1CB 2E8YA 3TVAA 3TZNA 2FZBA 1Q6DA 4L6DA 1Y7VA 1RSCA 5I3DA 3KW3A 4S3BA 2QCDA 3W02A 4YWSA 3AXIA 1BGGA 1RD6A 3VNZA 1NOFA 4IF2A 2WC3A 4KEUA 1IGWA 1ALDA 3N18A 1UROA 2YBTA 5H8UA 2Z24A 1UJQA 4EF9A 4GUFA 4NVTA 2A6NA 3AXHA 3WLPA 5IDZA 4DAFA 2FZDA 2CIPA 4B5NA 3W1UA 5HANA 3MUY1 1R47A 3C8FA 1P7TA 3W00A 2PWDA 2YLLA 4O17A 1UKPA 4QGCA 3WELA 2ZC1A 2PU1A 3CO8A 3QFWA 1ZL1A 3C86A 1UPMB 3L2MA 4U5KA 1UP3A 3FEQA 4MUPA 3OYXA 1XYBA 2KX9A 3CH9A 3OZPA 1XPYA 4W5ZA 1H0IA 1QBAA 3WMLA 1F4AA 3LMYA 3ERPA 2OOFA 4O12A 1W54A 4NJJA 3BAKA 1IR2A 1VYSX 3QOMA 1GVRA 2QPSA 1K9TA 3PFRA 1E6SM 3H70A 2BFGA 4GD0A 3IIPA 2GGJA 4MDOA 3SUUA 4DJED 4K2SA 1PHWA 1BVZA 5G2IA 4DUXA 3SUVA 1Q4WA 3DOPA 2D20A 4NHVA 4JTEA 3VINA 2Z0IA 4D6GA 4QG6A 1P6CA 4DWDA 4DI8A 1LUCB 1BEUA 1QJWA 2CNCA 3BSHA 3CPGA 3CIVA 1V6UA 1MQPA 2WB5A 1R3SA 1W1IE 4UR8A 1IIGA 1TWSA 1H7RA 3JZEA 4GYPA 4E0CA 1OFAA 1KA9F 1PZ1A 4GCAA 2E5CA 1M68A 5J5DA 2YBVA 3XINA 1JXKA 1BTMA 4D6HA 3BMVA 3VVGA 2HE5A 2PUZA 2W66A 1ZBKA 3KVLA 1S1RA 1OC5A 2OLSA 1ECEA 1ZAJA 2FDMA 4JNMA 3VMNA 3MVTA 2QJJA 4CCCA 4S1FA 3RLVA 1V51A 3IS4A 1ZB5A 5TNVA 3S5OA 2CESA 3ZT6A 5B7YA 2V5DA 3DKLA 2OX1A 2QGYA 1XC6A 5E0CA 3R25A 1Y5VA 3GU2A 4M0XA 2VM8A 3MA8A 4YL2A 3GXNA 4RPPA 4HU4A 5HJXA 1QWGA 2ZUUA 4LUTB 3LCLA 3MSYA 4JAWA 3UY8A 1Q45A 3QTGA 4DJDD 1PYFA 1AFSA 2VENA 4HPHA 3W1QA 3SI9A 3TXVA 1RR2A 3ITXA 3MJMA 3AUOA 1G94A 3WD4A 4W85A 5CPSA 2EG6A 4K38A 2DY3A 3EXRA 4GGHA 2H6RA 3JU2A 4MHBA 4C6NA 4BI5A 4YVVA 4QQUA 1DJIA 3V5CA 3WL0A 4B5VA 1BQCA 2QJNA 1MW3A 5K4XA 2BGSA 6ENLA 1KV5A 1WPCA 4MWAC 2PGRA 2F6UA 4N0RA 5F2IA 4CQDA 7ODCA 3PK7A 3VU2A 1KNWA 2PWVA 4BA0A 4QAIA 4QX4A 4CN1A 2DIKA 4Z0JA 4PRRA 3NQVA 4TOQA 3OVPA 5AYBA 2ZRXA 2PDXA 1HN1A 1RCQA 3R12A 3MTWA 3DCPA 4FSAA 5C5YA 4EKJA 3QYQA 3F2CA 1E0UA 2RDUA 1R2TA 2WMKA 3K4WA 3EPMA 3AIWA 1JPHA 4DEFA 2ACUA 3K5XA 3T9PA 5L6UA 1XLCA 4LALA 2KZHA 2NVCA 3ZXWA 2BNJA 4ZA0A 3LPFA 3RG6A 5FIPA 2DUAA 1PPIA 2WO5A 1EFZA 1H4PA 2XN1A 3W01A 4YYCA 1H7OA 1ADDA 1BYDA 1JYVA 2GVGA 1M9HA 3OLDA 4J1OA 3B8VA 3CT2A 5H2ZA 1KQYA 3ZR5A 3HG2A 3R94A 1PE1A 5D4YA 4NRRA 1Q13A 3WLQA 3NL5A 4AVFA 3CGTA 3NA8A 1J10A 2PODA 2EKCA 2VI0A 3U4AA 1H41A 1N8FA 2XIIA 4IX0A 5A5WA 1YXCA 3QRHA 1REQA 1YQ2A 2XVGA 1GW1A 3IJQA 3W7JA 2GVJA 1WNOA 3SB0A 5M1TA 3KTXA 2WBKA 2QULA 4IQJA 3FJLA 2ZX6A 1PTAA 3A3HA 1R3TA 3UCDA 2X1IA 1Z42A 1WKDA 5I5RA 2Y7GA 3AHXA 2JGQA 1YPFA 5AC4A 1HQTA 1LOQA 3B4UA 1V4YA 3W37A 1GJWA 3SN4A 1SMDA 1JF6A 2E67A 5I06A 4C6LA 3LD5A 5AYIA 2D3LA 4YHGA 4W8BA 3L5LA 3CH0A 1T96A 2PGWA 4Q4SA 4YIWA 1E5JA 1Q6FA 3M0IA 3W7DA 3WH7A 2QCHA 4LS2A 1WZMA 1O4UA 4EWJA 1FWTA 3MB9A 9XIAA 3T8QA 4M7TA 3ARWA 4AD0A 4DWSA 5BZAA 1VYPX 1KFJA 1UR2A 1AH0A 4HSNA 3LUTA 5F2LA 2HK0A 1N82A 4QAWA 1S2TA 2J7BA 5C9WA 3GDRA 1VCVA 3OG3A 4LU0A 4ILSA 1OY0A 1MQQA 3OIHA 3RAOA 3C2FA 1UR0A 1F61A 4J27A 1MW0A 3QC3A 1KV8A 3VNJA 3WLLA 3WKZA 3EDJA 2OZ8A 1QCWA 2H8XA 3L0KA 2A0NA 4AMAA 3QW4B 1JDAA 5CZKA 1K9EA 4CLMA 3C56A 1FWSA 2DH3A 1E9ZB 1PJ9A 4G2DA 4R53A 3ALFA 1WXZA 5DANA 4LUIA 1JZ6A 5F4SA 3K8MA 4I5UA 1UBPC 2NUWA 2HS6A 1XINA 2OGJA 1OFOA 2JKPA 1EO5A 4RZ5A 3RCNA 4R27A 1EF2A 2PBOA 1VFHA 2YIHA 1I9CB 4PCSA 2GYIA 3FK4A 1KRBC 1G4EA 4I7UA 4DB7A 1P1MA 3CU2A 4CN4A 4U4MA 5C7VA 1K70A 3OYZA 4S3KA 2ALDA 3NM1A 3P14A 3H22A 4HPJA 1SW7A 3L67A 4LW7A 1JF5A 4TX6A 5T9BG 1I75A 3A4XA 2AAAA 5HUOA 4JEQA 2ZRYA 1HKIA 2FLIA 3ONCA 4F8XA 2E5DA 4D8LA 1TV8A 3KE0A 2QF8A 1PTDA 3A5FA 4Y9PA 4NT0A 4X60A 4ONVA 2VXNA 2PD9A 2XTKA 5K9XA 1KKOA 4KWOA 1PSCA 2BHZA 4LNYA 5A94A 3CQJA 3IPWA 1RLCL 1XV8A 3NQAA 4LAOA 3O8AA 1W9XA 3D0CA 1OK6A 3QPEA 5DMLA 3LTYA 1CGYA 3T44A 4JTJA 1E56A 4JL2A 1V3KA 3B9EA 4QXIA 3WDIA 1ZBWA 5FEZA 3SRKA 1K1DA 4NXKA 4GE8A 3FHAA 4DI9A 4LAKA 3KOYA 1QASA 4YU1A 3VNMA 2PWFA 3UZZA 2CZ5A 2X41A 3NURA 4Q6XA 4DM2A 5FEPA 4PRWA 3E0IA 2F8QA 3RM4A 3B9DA 1YIXA 3UJSA 1TR1A 1YNQA 4UTTA 2O7SA 3LCIA 2V63A 2XFRA 5I0DA 1POKA 4LANA 3W7OA 3BMXA 2OODA 1J0JA 1T8QA 2Z29A 1WO2A 2R1NA 1YTEA 4O19A 4FAMA 3A21A 4IPNB 4WCJA 3GM8A 2GGGA 4LPCA 4UOZA 3SBFA 2A4AA 2D2HA 1A0EA 3VUSA 3GKFA 5BXPA 3SY1A 3H7UA 4W4QA 3TJ4A 2CLKA 2PDWA 1F6YA 3GXMA 2GQ3A 2PRHA 5LGXA 4PBGA 3QGKC 3IEBA 4FMVA 5T91A 2PZNA 3QMRA 5BMXA 1V93A 1Z44A 1L9WA 3FKRA 2Y7DA 4PTNA 3PWGA 1P6WA 3I6EA 1HIZA 5K3VA 3R43A 2EEXA 2DZBA 4EANA 3CTLA 1UOZA 4HTBA 1P48A 2JGYA 3EOSA 4JIRA 3STFA 5E5CA 4UTWC 1DJWA 3BSMA 1JRBA 1JDEA 1TVPA 4AZ6A 1W3NA 2D0FA 2J8TA 3LN3A 4DF2A 2YDSA 5C9UA 4NYYA 4YTQA 4JTKA 5D09A 5GNXA 4ALDA 2ATSA 3SSZA 3PSVA 4XQ6A 3KLLA 5IM51 4F0LA 3ENLA 3VD9A 3WQ4A 5CLTA 1QUMA 1Y5XA 2WCSA 1XG3A 2VJXA 4O10A 4UQDA 1KBBA 3LS9A 3WBWA 2YDAA 4IPLA 3E9AA 1UKOA 4KGJA 4I90A 4TMBA 4IP5A 4WLCA 4F66A 1G67A 3S47A 2V6AA 4BY3A 3BLEA 1GPFA 2DQXA 1IWBA 1KGXA 1TTQA 4PODA 1PX3A 1TX0A 1TRIA 4AD2A 5CKSA 2PTWA 1EJWC 3OJGA 3GLCA 1EO7A 1R7AA 3W23A 4FIQA 1DPMA 4A8RA 1OK4A 2CHOA 1FWCC 3TN5A 3WLTA 2O92A 1LQ2A 3NZPA 4HPGA 1QNOA 1WBJA 3TNOA 3N14A 3BICA 4NL1A 3BE7A 1NOWA 3B0YA 3W2UA 4XKYA 1XLHA 1WDQA 1R3YA 3L68A 1FX6A 3ARQA 3LY0A 4P7RA 3KCJA 4PFMA 3BVJA 1GKQA 3WQCA 4OUEA 3B0XA 2X8RA 3SECA 3DESA 4OV4A 3ATZA 3AWOA 5TF0A 3L5MA 1HL9A 4OFCA 2VEKA 3PWIA 1JPDX 1DWHM 4H9XA 4XZWA 3QXBA 3RLUA 3PM6A 2NSXA 2X7VA 1O5KA 2H3DA 4LJ3A 3L4TA 3POHA 1Q63A 3HQPA 2WVSA 2QV5A 2VR5A 1ISYA 1KXTA 2FHFA 3BAXA 1BWKA 4IHCA 3KBSA 5FAJA 1JCLA 2ZXBA 3LXAA 2J7CA 3CZGA 1EP3A 3TYZA 2VX5A 3IJIA 1OB0A 2V5LA 2PBGA 1F5ZA 3EB3A 1ISVA 3LGGA 3TTYA 5D2TA 3G0UA 1AODA 1H7PA 5DN1A 5JH2A 2NXGA 3BMWA 4ADSA 5LYRA 1TB3A 1HVQA 3CEPA 4AIEA 3KS5A 3KBJA 3UZWA 3QY7A 3ARSA 3NYZA 2B7OA 2E9MA 4HNOA 3TFCA 2ZA2A 4KWUA 4J3VA 1OYBA 1GVYA 1TJPA 4W8AA 1QOPA 4S23A 2G50A 7XIMA 1R6WA 3KRUA 2FHBA 1IEVA 2FIQA 4J3SA 1GQKA 3L7RA 3W1XA 3MWCA 3GIYA 1N8IA 3WFZA 3GTHA 3P60A 1UC4A 4Y9AA 4NJIA 3IRSA 3PTQA 4Q4MA 1B31A 4L6OA 1XD0A 5FSDC 3N29A 1OF8A 1UA7A 2DZXA 4DNMA 4ZB2A 4EXAA 3R7MA 1O60A 2PURA 4DBDA 2J27A 1ECQA 2PI6A 3R2GA 2YR1A 3EWUA 4BQ4A 3W1PA 2RJGA 1FWHC 4NF7A 5CEWA 2XM2A 1PL9A 4WSJA 1HUVA 2CHRA 3G8EA 1Q65A 1HXJA 2C8NA 2G5WA 4HKPA 4HB7A 3W72A 4A8LA 2QNEA 4P2VA 4GYPC 4MVAA 1RVGA 1IHIA 1L0PA 1M41A 2PLJA 2ZX5A 1WKYA 4HBKA 2R91A 1HNYA 3SY8A 5LIWX 1CLXA 4TV6A 3W86A 4G7EA 2VC9A 3CWHA 2CW6A 1FBAA 4PB4A 3VGFA 4HCDA 4CU6A 1RBAA 8XIMA 3NIYA 3UT0A 4WKHA 1ZNNA 4WJ8A 4HTYA 1MEIA 1X96A 3IWPA 5MF5A 3G1XA 3UPWA 4LVDA 3H8AA 1DHKA 1EP1A 3CMGA 4OUIA 1LP6A 3LX9A 3CUZA 4HGXA 1THFD 2Z27A 1F3XA 2VC6A 4B5XA 1MNZA 2HMCA 2ZZ3A 1XLLA 4OECA 2JF7A 4V27A 2BASA 3UR5A 3HGJA 4AZ7A 4EACA 4LY4A 4U3AA 3RM8A 2VX7A 2J74A 4UQCA 4DJDA 2C7FA 2NX1A 4HMDA 3ZR4A 1LYXA 2Y8VA 2EBNA 3PZMA 3GC4A 4FS9A 2RH9A 1UR9A 5HQLA 4AHPA 4UNKA 2ADAA 5D9PA 1W31A 1B3WA 3P6LA 1UA3A 1YBQA 4I5RA 3P2VA 4JKKA 1Q2SA 3HPSA 1ZS2A 4UFLA 5T9CE 5HPCA 2GPTA 4LNCA 4EWND 3K4AA 4NP7A 2POZA 1I0DA 4AX7A 2XYLA 2Y63A 1R3RA 5E6ZA 1KFEA 1EYWA 4US6A 2NQZA 3B8DA 4GI9A 1NOUA 5F1UA 4ZZ9A 2RKXA 2O4MA 4IIBA 1IZCA 1NDYA 2I5QA 4GUHA 2DT2A 4LF2A 3MS8A 2OELA 1KTBA 3NYDA 3T0BA 3PF3A 5KZDA 1XIIA 3PBYA 4FHAA 4Z2KA 3DYPA 1FXPA 4HHHA 3IARA 3PB2A 4NAEB 4KCUA 2WPGA 3M0LA 5H8PA 1OFDA 1MXGA 4QE5A 2Z1XA 4BR1A 3QQWA 3H7VA 2OXNA 2ZE3A 2BVTA 3FOKA 5JBEA 4RXGA 4Z1DA 3LHWA 3TN3A 2WQPA 3W73A 1WOAA 5K9DA 3AMKA 3GTIA 3VDHA 5CSRA 4PBFA 4BQ3A 1SJCA 1T8XA 2QT3A 4DPPA 4A3QA 3KOWA 2VURA 1Q6RA 1WQ5A 4J2MA 3QSRA 4RPQA 2V68A 1E4MM 2WQDA 2ZA3A 1J0ZA 4AZCA 2HPMA 4NKCA 4D9PA 1IEWA 1E72M 5A6MA 4OOZA 1XYCA 1IGSA 1UW9A 5H6HA 3N12A 3PJUA 2HVMA 1J01A 5H91A 2DIEA 2J47A 3C8NA 4AEEA 1RA0A 2Y8KA 3DGRA 3N13A 3TYEA 1XYLA 2ZUTA 4PFHA 5HDRA 1WKEA 1FXQA 1DJZA 3LQLA 4IT1A 1E6XM 3L9CA 1OF6A 4NG3A 5I78A 5JIWA 2V2HA 4ZVJA 3G1FA 4LAUA 1X7FA 2GJXB 3M0ZA 2PLKA 4J40A 4ORMA 1FDYA 4MYAA 4ICCX 3PPHA 2CXEA 2OR2A 1VAHA 4IISA 3OB8A 2FGBA 2RJHA 3NOEA 3AU6A 3STGA 3P8JA 2J24A 2VEMA 8TIMA 1JAEA 3VGEA 2WSPA 4RE2A 1KO0A 1PHQA 1DQWA 3GIPA 2PWEA 2QUMA 1D7FA 3W7MA 2PS2A 5CPMA 4B5UA 4IICA 1JUBA 3QOKA 9CGTA 1TZ7A 3G3MA 3TYCA 1LM1A 1HO4A 4KH2A 4WUIA 4K7YA 3OO2A 1OD0A 2VR4A 4XZHA 5A95A 1GHRA 2ABAA 2A1YA 3AHVA 2QDHA 3B04A 1XFCA 2D1ZA 1E6ZA 3FFSA 1POJA 4LXFA 1CXHA 4LCSA 3CV2A 2HE8A 5BRBA 3GZAA 5AC7A 3SAZA 1PTGA 3I6TA 3BO9A 2WOQA 4Q4OA 2WJEA 3S1XA 4DUOA 4LTSA 1F3TA 5IXEA 4JEJA 5I6SA 1Q4NX 1IWPA 1BSLA 4LYQA 1SFTA 4G1NA 2CCRA 5EYWA 2QCDB 4JIQA 3MU7A 3IIZA 2ZIDA 3ABRA 2PC8A 2PFHA 1JZ5A 2WMGA 1OYCA 2VWTA 3A4AA 3SGZA 3DFOA 1HJQA 3CM4A 1S5MA 3WJXA 5CAKA 2P10A 4LBUA 1GZGA 4PMUA 2E25A 3OGVA 2C1HA 1C8XA 4CNUA 1FKWA 1GVSA 2OEKA 4XAZA 2A5HA 4YCOA 4DRSA 3DFSA 3WQGA 1UD6A 2I7GA 4C6CA 3L4ZA 1EC9A 1HJWA 3TUUA 4O4VA 4ORIA 1VFMA 1A5AA 3HURA 4EPKA 1XCFA 4XAGA 3ITYA 3A24A 2YL9A 4JTGA 2Z2UA 4XZMX 3TKFA 3TQ0A 2A3CA 2XH2A 3HGRA 4PUJA 4WY0B 4HYVA 3W7GA 2YL5A 3QFEA 4UTKA 4QFUA 3NDYA 1UB3A 4GBUA 1EBHA 3TC7A 4EVZA 4L9XA 3EPOA 4C1NA 5DF0A 2QCGA 5HJLA 4FXFA 4A3RA 1K6AA 2ZUMA 4US5A 4B5TA 2P0IA 3A22A 4QEEA 1KBLA 5AHEA 3KHJA 4FEZA 3PJWA 1Z69A 4HOXA 1VFUA 4D6FA 6XIMA 1VBJA 3I6RA 2X0YA 4MADA 3W7PA 4D72A 5EGRA 4K8GA 3AICA 1R0MA 2W3ZA 4WGXA 2ZBTA 2Z7GA 3OG2A 1U1UA 3GHTA 2AGTA 1P43A 1FWFC 3OODA 4M1RA 4H04A 4GY1A 1WA3A 5HULA 1QWKA 4IL0A 4GQGA 1YEYA 3SW6A 2TMDA 1DQXA 2FZ9A 3W2LA 4GI8A 5M3WA 1X8CA 3LCFA 2X09A 2XG9A 4NZ3A 3ZFHA 1RALA 7A3HA 1XPGA 3TLQA 4H83A 1XLAA 3M9YA 1UWAA 3QGAC 4PYSA 3PPFA 3GC2A 2Q8ZA 3EDDA 1CYGA 3CNYA 1NWTA 3P80A 1W56A 4KRTA 4UMAA 4AVOA 5GNZA 2FZNA 4FR6A 3FLUA 3TZFA 3M64A 3CTTA 3UETA 5B7ZA 2GOUA 3TU9A 2HVOA 4C60A 1BXBA 3R5EA 3NSMA 2WHKA 4KW2A 3K13A 4W84A 3PTDA 1QNPA 3P62A 3WUEA 2RGMA 3OIXA 4ZQOA 3W2KA 1PKMA 1W91A 4H6EA 3P81A 3DBPA 2DVUA 4D8AA 1XCWA 3WH5A 3QF0A 4XTDA 2CERA 2FVLA 1ENUA 1EWDA 1G9HA 3G8RA 1W9BM 1SR9A 2FH8A 3VKBA 5IDIA 4PH6A 1VB9A 2V5JA 4OT7A 3W6MA 5EPDA 1OCJA 3S5NA 1A80A 3PBWA 1PAMA 1TG7A 1KM3A 3WN6A 1S2AA 2A3EA 2WKGA 2PDYA 2Y7EA 1OX5A 3M7WA 2P88A 2VR2A 3W74A 2D73A 4Q3MA 1XYFA 1ZSXA 3GK0A 4HT3A 1UUOA 4QJ5B 1EGZA 3AOFA 1WAUA 4HOZA 3HM7A 2P53A 5H1WA 2NV1A 3QSTA 5G1YA 2HISA 4BQ5A 3GVGA 1ZCOA 2RDTA 1TIWA 2PA6A 2HXUA 2ESCA 3W28A 1LTDA 4HMNA 1Y0EA 2Z26A 4HK7A 2QV4A 4XAFA 3CHFA 3U5UA 1CXEA 2Z1BA 1RD5A 1W5OA 3L2IA 4IGNA 2XGIA 4TQTA 4I8YA 1R3WA 3WF2A 2HNHA 5HMEA 2YKKA 1TVLA 3AROA 3WG6A 2J75A 5FF3A 2OT0A 2E28A 3II1A 4CCEA 4QITA 2EGZA 3BK0A 2Y0FA 4F0MA 3V0UA 3UXKA 3H2OA 3GY1A 4F9JA 3P84A 4P7NA 5CZJA 2VDIA 4LS1A 4LV4A 3VNLA 3R10A 1ISZA 4J3TA 2E0PA 2ANUA 4EPEC 4CVUA 1E1FA 3Q65A 4AZGA 4WSHA 2WM1A 4WVXA 2XUCA 1HKVA 4UB9A 1AH4A 3BZJA 3V3WA 5HQMA 4CD7A 3P0WA 3S46A 5C6MA 5IHRA 4PTDA 4KKXA 1EPVA 4XO7A 1DTNA 2PDIA 3M44A 3ICJA 1CXFA 2CEQA 1VBRA 5EFDA 1QI0A 3Q58A 4W9TA 5EMJA 3G2GA 1KCZA 4N9BA 3OVQA 1NF0A 4MGGA 4NAFA 3V35A 3LNMA 4HHLA 1E4LA 2A3LA 3TH6A 7REQA 3HMJG 2W62A 4R7JA 4C6QA 1GHSA 2Z2AA 1A0DA 4HQVA 4DF0A 2NT0A 3TAOA 1JXJA 1ZCCA 4B5WA 2X1UA 3AS3A 1UCWA 3NZRA 5D8ZA 3LGEA 4ERGA 3UW6A 3U5YA 3WLKX 1PX4A 1ZJAA 4Z17A 2HCVA 3LRMA 1RJQA 4NSBA 3QVQA 1XBVA 4QROA 1XIHA 3LBMA 1OFPA 2FVMA 3NL2A 4GQQA 5G2HA 2FPTA 4QEHA 3HPZA 5DMYA 2DT1A 1YE6A 3A9BA 2CKRA 1OIMA 2TYSA 2YCJA 3LB0A 4PMXA 3R8HA 3HZ3A 3T0DA 1VHCA 4LB3A 3ARRA 2HQAA 2H9AB 3WLRA 2OSYA 3E0VA 3FKKA 4XBKA 2VL4A 2CC0A 4C1NB 2VZOA 4K36A 1L6GA 2WVVA 2WJFA 4JICA 3FA4A 4U2ZA 4FLRA 4GOAA 4QLJA 5JH1A 5KZEA 1K7EA 3ITCA 1JCNA 4RDVA 3OLEA 4OBSA 1SMAA 3K2GA 3UR8A 4I9AA 2ISWA 4Z1AA 5I02A 1KRAC 4XD4A 4C6IA 3NQEA 1F9CA 3L5AA 4UNLA 4GNVA 2AQVA 1BKSA 1R46A 4D71A 4Y9NA 4QE4A 1E4NA 4AF0A 3WD0A 4Z1BA 3IUIA 3EXSA 3OU8A 2BBFA 4UFJA 5EFFA 6REQB 1ADOA 1DWGM 1J0IA 4X22A 4PCPA 5AYYA 3BZGA 3VOFA 1HT6A 3L0NA 5E0FA 3NGJA 1KBIA 4UMCA 3XISA 4E4PA 2YL8A 3BJFA 5DO8A 3A13A 4PCTA 4A2RA 3TR2A 2ZXQA 4NILA 3WDJA 1RJRA 2CETA 3UXAA 3R8GA 5BOEA 4DWSB 4J3UA 1X1ZA 5FOOA 3FAWA 1YTDA 3NXLA 2R1PA 4FF7A 2EPKX 4AQLA 4DWSD 4ROPA 2PGEA 3MSDA 1G7UA 3C3NA 2AMXA 4EPBC 3SIMA 2AQOA 2FZ8A 4IG2B 2F2HA 3AIUA 2INEA 4Z2HA 1XRSA 3H4XA 4C7DA 3BLDA 1GVIA 4CD4A 3ES8A 3OGSA 1RBOB 2GVLA 4GFSA 1BWVA 4IFKB 3ABZA 1DXEA 4LVAA 4QDWA 4GX9A 1PIFA 3OZMA 3UYCA 4AXKA 2CLIA 2E68A 3BAYA 1X6UA 2GDVA 1GG1A 4IMEA 2ISFA 3VK5A 4ECLA 1S2CA 1KBJA 3WENA 3W81A 5REQA 2PMQA 4JQ4A 3L4UA 1PKLA 1D3HA 4FOJA 3BV7A 2XWEA 3NEVA 3ID7A 4JTUA 4PMVA 2QIIA 1CNVA 1VP5A 1B5TA 1C9DA 1JZ8A 1VS1A 1TX2A 2YX0A 3FXGA 5HMDA 4WDXA 3EX1A 3FYYA 4XD6A 2YA1A 2QGHA 1QDSA 3LQGA 2WMIA 3WK3A 3SRDA 2BODX 3N25A 1AQFA 4HU3A 4LUJA 4Z0SA 4DO6A 3M0JA 1M01A 2OEJA 2WBGA 3RCYA 2AL2B 4JQAA 2Q09A 2WW5A 4PTWA 3AZSA 3S5SA 3B8WA 3T4CA 5HWJA 1DV7A 2XSXA 1E6NA 2XM1A 2R1MA 4RX0A 5AOUA 3EB4A 3ME3A 4MKSA 1CLKA 1JUKA 1B3ZA 4X2RA 1S5WA 3S4TA 4B2DD 6A3HA 4NJGA 3WLHA 4B91A 2DZAA 4ZCWA 3VIPA 3T81A 2CBIA 3SN0A 1J5SA 3OVRA 2XIOA 4MKVA 2VUYA 4Q7IA 1GVFA 5DRIA 1QK0A 3TTQA 1V5XA 4UOQA 1CEOA 4LUSA 3OQEA 1B1YA 2UBPC 4XD5A 3GU1A 5AC5A 4PEKA 1JYWA 3S9YA 2YXGA 3VD7A 4H4IA 3FJNA 3L66A 3L2LA 3I68A 1BYBA 4JFVA 1UUQA 3MKCA 1B3XA 2C19A 4H8VA 5BOFA 4IIDA 4DM1A 3OTRA 4E2DA 4W8LA 1S1PA 4ML4A 2ZXAA 2QVNA 2R1KA 1TPB1 1GQNA 4TU1A 1NFGA 4N2YA 5AC6A 5KZMA 2J8GA 1UH3A 1E40A 4UFMA 3UXLA 4JPGA 1XICA 3MYPA 5AYXA 1KWGA 2VELA 4H8NA 3N9SA 3MKKA 3KRZA 2J9YA 4R33A 3F4VA 3UF9A 3ZLGA 1QR7A 5AHFA 4GISA 1A5KC 5CPOA 3TDFA 1ZP3A 4A29A 2PWUA 1E6RA 1ZUAX 1U2YA 4MY9A 1E5NA 1F07A 4L9ZA 3H2FA 1FKXA 3INPA 3EWXA 3TCSA 2I5IA 1TMHA 1FH9A 1C7TA 1PIGA 2BY3A 3N6QA 1KLZA 1FY6A 1UASA 3S1WA 1O94A 4TTUA 1YLVA 4P7OA 2TAAA 4XZNX 1WDDA 1GVQA 5LA0A 3MQTA 1A5OC 4M81A 1EA9C 1PIIA 4PN2A 1ICQA 4KS0A 1H61A 2ALRA 2EF9A 1QPQA 5HQEA 4Q8PA 2VQTA 3ARVA 4XAYA 1J18A 1PKYA 4C5YA 4K37A 2PTYA 4LRSA 3W29A 3WLJA 1AD1A 2PP1A 2REQB 4MJZA 4H7VA 5BCAA 1QNSA 1V79A 4UQEA 2Z4GA 3CK5A 3UGVA 2WSQA 3AU2A 4HCLA 3DN5A 1Z3NA 1M7OA 3TAKA 2F2KA 1DORA 2OYMA 1N55A 1BVWA 3PNUA 1D8WA 4FX7A 3W9ZA 5D9OA 2EAWA 3GNXA 1VPXA 3S6TA 2V2CA 1FH8A 5KEZA 1GOWA 5CC7A 2NVAA 4OV9A 1M04A 3NFUA 2YXOA 1QPKA 3NVTA 2HTMA 2VCAA 3NUKA 3U2ZA 3WD1A 1XXXA 1PVNA 4Q32A 2GGHA 2CPUA 5E70A 4JX4A 3TJXA 3AC0A 2O9RA 3IK2A 2QLYA 3FDKA 5E9AA 2CWXA 1P7TB 1RQHA 1F74A 2VC5A 4A05A 3KFTA 2FFIA 2ZUWA 1WDRA 3F4CA 3VDGA 4H3DA 3V5FA 3PFMA 2J8FA 3PTKA 4G9PA 3M07A 3R11A 1S3TC 4R9OA 2OPJA 4RW3A 4WOZA 3B8IA 1WZKA 4QDMA 2FTWA 5CGTA 3H7RA 4KERA 3GXPA 1UKQA 4A3YA 3NSXA 3TYUA 3BARA 4GC4A 2G97A 1NIUA 4QIUA 1NQ6A 3ARXA 3WO8A 1QT1A 2CXGA 1UZDA 5FD0A 1BGAA 2RFGA 2WV8A 3K1DA 4FNUA 2CLOA 3TCEA 2X16A 3W7QA 4OU1A 3REQB 2GWGA 1A49A 2B81A 2A7NA 2X1RA 2V5KA 3LPGA 4ZB0A 5K4ZA 4BJHA 4NU7A 4GNKB 1EC8A 3VKJA 3FVMA 3B9OA 2FYMA 2YDQA 4Y8EA 3N6HA 3W7RA 4V15A 3NR0A 3AMGA 4CEUC 4K1GA 2YYTA 4Y6GA 4LYPA 4GUIA 1JULA 1ZRQA 2YDRA 1XIBA 4NUWA 4US5D 1C93A 1W9DM 3BOXA 3CV6A 3PZOA 3W84A 4O8RA 4A8NA 3FGCB 4W93A 4O1DA 2YCKX 3W07A 4GK8A 3B9NA 1HO1A 3VXGA 1HF6A 1KM4A 3F4DA 1XGZA 4GQ0A 3SCTA 4U10A 1BVNP 4UOJA 3GXTA 3TW6A 4ZMGA 4EAYA 5A8PA 3WZ0E 4O52A 5CBIA 3C6CA 3TFXA 2R82A 3VKDA 3PB0A 3F5JA 1U30A 2WSKA 5A8QA 4GIRA 3CAVA 2VUNA 3FJ4A 4O28A 4O0ZA 4ZEPA 2FQIA 1DQUA 3N3MA 3N34A 2JEPA 4IGSA 4LY8A 4GI4A 2QCMA 2L5HA 3VIKA 2XIQA 4DN1A 2WC4A 1AJZA 3GVRA 3THUA 4GO9A 2FMOA 4UWMA 1XIGA 1XQLA 1G1YA 3RUBL 1EP2A 3MW7A 4OBTA 5T8GA 3LERA 3PY2A 1F6KA 4G8TA 3URAA 1XBXA 3ZJ7A 3MBFA 2OSXA 2WZHA 4KCTA 3HFTA 2B0MA 3P61A 3LHTA 3LI0A 3HIJA 3T2QA 3UP8A 4D1JA 3GSMA 4MZ1A 5MKGB 1D7KA 4H00A 2BVYA 5GVJA 3WH8A 4LT9A 1EC7A 1AQMA 5GJPA 4IGMA 3MZNA 4AHQA 5HNUA 4PUDA 1S5NA 3DFNA 3I65A 3PZVA 4C1KA 3R13A 3AS2A 3ABOA 1K9FA 3ARYA 5KTLA 3EX6A 1DE5A 4PMNA 1EDQA 1UYQA 3GXFA 3WNNA 2OMAA 3Q2DA 3LCHA 1VIZA 2H3BA 3R6IA 4LVGA 4JY9A 1TTPA 1EDGA 3ABSA 3OA5A 4M80A 4OVXA 4ZO9A 2DQWA 2A7RA 3OLGA 4UTWA 3W7EA 1KFBA 4AIOA 4AYGA 1S3HA 2XIBA 2JF6A 3GNRA 1XGDA 3CJPA 3NQFA 2VCBA 2QPUA 3SCQA 3I10A 3CV1A 1HP4A 1SR0A 3WLIA 1T6MA 3PJTA 4XO6A 3VDBA 2CLHA 3LLDA 4KEVA 3UWZA 2PAJA 3E0LA 3H6OA 2E6FA 1CLVA 4R85A 4EAMA 1OX6A 3DBNA 3IVUA 4CEXC 4ZO7A 1A5MC 4INFA 4F2BA 3MCNA 3OP2A 2G37A 4M7SA 3QV8A 4Q8OA 3I7QA 1H09A 4MNMA 4AB4A 3QR3A 1VLIA 3T7VA 5MKGA 1UZ1A 4YTTA 3RLHA 4LEFA 2XFFA 4GY7A 3H2CA 1P0NA 4OQVA 5AZ1A 3FCPA 2XWDA 1RHCA 1PKNA 1F73A 8A3HA 5D05A 4FZIA 1GOOA 1KFKA 4JX5A 1TFVA 1ITUA 3B9AA 5AHMA 3DG7A 3STPA 3J7HA 2Y5SA 3NAVA 3P93A 3WNKA 2WKLA 3GTXA 1V8EA 1DOSA 1DJYA 1JPIA 3IGHX 3G0XA 2EQDA 3EDKA 1XLGA 3MMTA 4JIEA 3GC5A 2XDFA 2CZEA 4YYFA 5C9XA 5DFAA 2FPVA 2QMKA 3QZEA 4Q4RA 4LWWA 4D6JA 2EHHA 2POTA 3KDNA 2QKFA 3WD3A 2J9XA 4MFEA 4NXSA 2ZWYA 3BAWA 3CQHA 1NF7A 3NQBA 1W6TA 3BGGA 4ZTXA 3OZOA 5SWUA 5AECA 1PS9A 5I79A 4XZ9A 1H60A 1ME9A 1QVBA 3E2RA 3G6MA 2R6OA 5HWMA 1YADA 1HKKA 4GZ7A 4ZXLA 4KBXA 4IQLA 2PDHA 4G1KA 4JFTA 3E1F1 1J0KA 3KLKA 4DJEC 2E6AA 3N4AA 2VD8A 3B0UX 1IXNA 1XS2A 1W17A 3CZJA 2QYGA 2PWHA 3GD6A 2D22A 5E0KA 4XISA 1S46A 3TYBA 2G4FA 3TMLA 3E12A 1W9VA 3KEHA 1W5NA 4F79A 3EMZA 4ZL1A 4JTIA 4GYJA 3ZLHA 1B30A 3U7BA 1TO3A 2ACQA 5F2MA 1B3OA 2WVTA 1KQZA 5E09A 4OHQA 1H49A 2UY3A 1Q6EA 3BV4A 3H2AA 3HN3A 2YCLA 4JTAA 2DUZA 4S3JA 1NH6A 4YVXA 4JYEA 3KBWA 2QPXA 1WYIA 3ZYZA 3A5VA 2XFYA 1LLWA 1LOLA 3UJ2A 3EEZA 4GJ1A 3VKAA 2G3FA 3BW2A 1EZWA 6XIAA 4GIYA 2DEPA 3WFAA 2LLEA 3F4WA 1YX1A 5G4WA 2B7PA 4V1YA 4MLJA 1W3KA 2C91A 3TTEA 3RR4A 5GJNA 3U2CA 2A3AA 3RRAA 4OJYA 4LUSB 4FLOA 1HL8A 2DSWA 3QPYA 4Z2GA 4ZFMA 4OZOA 5DT7A 2XJ7A 4FX8A 2X1SA 4X9YA 2Q8XA 4Q33A 4RNHA 1TELA 3N2MA 2AMGA 3C2VA 2E1WA 3T78A 2NUXA 4WR3A 3IJDA 1J2BA 3O6AA 1ITCA 3S1UA 3SURA 4Q4KA 4A2SA 3GBDA 2RHGA 4PUKA 5LKYA 1A0CA 3KXQA 3WQ8A 1UR3M 3BANA 3SUWA 4Y2WA 1WX0A 4DUWA 1QOQA 2NXIA 3K30A 4R7WA 2QJHA 1VFSA 4HNUA 1C9WA 2GOKA 4AIBA 1UQZA 3ATYA 4RE4A 3ZQ9A 1ZZMA 4H9YA 5A6BA 2QCNA 4IM4A 1AD4A 3E2VA 3SDOA 5A3HA 4R3UA 2WNNA 3IACA 1JJKA 1QNRA 4UTLA 4QJ4B 2J62A 3NG3A 3UCQA 3B4YA 4WJEA 4FXRA 4NZ5A 3QR1A 3NOYA 1PX8A 4NQ1A 4Q8TA 1YHTA 2PDFA 4I7WA 4LB4A 3C0SA 1I2OA 3RPDA 4NZFA 3LPOA 1XKYA 4HA1A 4UR9A 4HA4A 1E9IA 5I2UA 3PBVA 1Z41A 5EL1A 4ZOCA 4P8XA 3CYJA 1J2WA 4ZE5A 7TIMA 4O13A 1TE1A 3NSNA 4UMBA 3VABA 3LRLA 1LQ0A 4FNRA 1CGVA 1YDNA 4MWAD 3VOHA 2G95A 2PF0A 1MFVA 1EJTC 3N2OA 4REQB 3SRFA 3RX4A 1WXYA 3DHPA 2V3GA 4U5IA 2INFA 2C15A 3RFAA 3LTSA 4LVFA 3UWUA 4GZEA 3IGUA 3RX3A 1EXPA 4GFIA 5C0QA 5I3IA 4ATWA 3UG8A 1UR8A 4UTJA 1EL3A 4GQRA 1JRCA 2SFPA 4BQ2A 4W7VA 2FZMA 4PMJA 3ELFA 1CZ1A 9RUBA 2OYKA 1RQBA 1DEDA 3LM3A 5A69A 5A8NA 1SO6A 1J11A 1CB2A 3WF3A 2O55A 4TR9A 4IMFA 2OSWA 1FH7A 1TPDA 3SADA 5FEWA 1KTCA 3BJTA 2NWSA 1SPQA 3QQ0A 2H8ZA 2WANA 4RZBA 3THDA 2IKHA 5E6YA 3BCFA 3AI0A 1OGSA 2F38A 1OGBA 1YNPA 2W6RA 3MKVA 2VEFA 4V1XA 1R85A 4B3ZA 5A6KA 2JQXA 4JTSA 3R58A 1SO4A 3WK0A 3EMCA 3JRKA 2V5CA 4CU7A 2C79A 3ORWA 1XUZA 3KOZA 3NQ2A 3QV6A 1L6SA 5CGMA 2E8ZA 4FLSA 1KRCC 1TV5A 4NRSA 1MQRA 1DJNA 4ICMA 4WX2A 4I9MA 3TQVA 3N9RA 1KWKA 2DFAA 4WGHA 2WVUA 5U7SA 5HUPA 4PMQA 3APTA 2VC7A 3P5YA 4ADTA 2C0HA 3T1GA 3R89A 3CUFA 3UXDA 1M7XA 2HROA 4GKLA 4AD4A 1JCYA 1Z7AA 2WK2A 3RXZA 4F9DA 2ICSA 3RR1A 3FY1A 3QV9A 3WNPA 4AW7A 3BSGA 3EDFA 3BJSA 4AD1A 3GH4A 2E9LA 2I5GA 2D69A 1Y8BA 4DUVA 3PP7A 2GFTA 1KM1A 3CWOX 4RCXA 2BLEA 2PGFA 4YCPA 1I1WA 4M8UA 1KD0A 3T0CA 1H7XA 3TOPA 3DUGA 5CPQA 4DO5A 3YPIA 3NQ6A 1Z9AA 1RCXB 4IL2A 4GNJA 2C13A 4XSMA 1PZ0A 5CBBA 4S3AA 1U22A 4L5ZA 2WMFA 3F5LA 5D8WA 2ZTJA 3EWZA 4LV9A 3DI1A 3KBVA 3CT7A 1A50A 4GUGA 3WCZA 1TJ2A 1CGWA 4C1LA 1OG0A 1I2QA 5C8BB 2ACSA 4F0KA 5CH9A 1XH0A 3W1TA 5L9FA 3O15A 1G4SA 1XCXA 2WSRA 4PEEA 4DBEA 3UPMA 3GXDA 5EB8A 2J7FA 3BWWA 2YL6A 5DRCA 3UR7A 3IIOA 1W3IA 4RDYA 3DIPA 1BF6A 1EPXA 3Q94A 5AZ0A 3QMSA 1D8CA 3MVIA 2VEPA 3ISIX 1SU5A 3UPBA 1JCTA 2BV9A 2XVLA 1UOKA 1AL8A 3GFYA 1CI1A 4AH7A 1UWIA 4J2PA 2VRJA 1KGUA 1WUEA 3AYRA 3VE9A 1I2RA 1MW1A 4QDPA 3ITGA 2OQYA 3I3BA 2R9RA 3GDBA 3TA6A 4Y9MA 2PDJA 4HMCA 4RR4A 3QGVA 1A3WA 1ONWA 3UG3A 4Q6JA 3TWBA 1EDTA 3VC6A 1NFBA 5EA9A 2PDLA 4MNKA 3P74A 1EKOA 1H7NA 3D46A 1H1ZA 4S2BA 1EUAA 3ZSTA 1JNEA 4ACZB 5I00A 1OHLA 1V6YA 3M0HA 3N1AA 4YWIA 3BW4A 2VOTA 1A5CA 2FH6A 1EJRC 2Z1SA 4IWWA 2GJNA 4QJ1A 1YDVA 3PS7A 5HAOA 3ZS4A 4XWUA 1GEQA 1JZ4A 3VKKA 3JR2A 2W67A 4Q7BA 2ZZ6A 3DFPA 5M17A 2VO5A 3WEMA 1TQJA 4LGXA 3U6WA 4JY8A 3CEUA 1U5VA 1O5XA 2QUTA 4KQNA 3S2JA 2WNQA 1D9EA 3RLGA 5G4HC 3MUAA 1MDRA 1J79A 5G5IA 3OHIA 4IXHA 1ONRA 2E3ZA 5BU6A 1GW9A 3ES7A 3VIFA 2ZRUA 2Y4SA 1RY0A 2GWNA 1OSEA 1VBUA 5KSWA 4KESA 2RDXA 2VDGA 3NNTA 4JQ3A 1TIMA 3C0JA 1LRTA 3N3TA 5ENLA 3B8SA 3IV3A 4PMRA 4MZ8A 4CCDA 2PDUA 1JD7A 3O0KA 2IXUA 3OZYA 1B4KA 3MP3A 4EX4A 2F6KA 2QDGA 3L0GA 1XGEA 3C2OA 3BLPX 3WSUA 3CQIA 1XUUA 4O53A 1EEPA 4O54A 3W1MA 2CLLA 4C65A 1LWIA 2ODOA 1E51A 5EMYA 4CQ8A 2Z1WA 1I0BA 3SCSA 3VZZA 4CUCA 1XYMA 2XH7A 4FO4A 3UESA 1KXVA 4A22A 5CJNA 4DYEA 2AQWA 1IZJA 1RPXA 2X1TA 3ONBA 1LL6A 3MDUA 3SM0A 1LF1A 1V77A 3WLOA 3RU6A 1XH2A 3EPNA 2MNRA 2J79A 3BPWA 1NP2A 2ZWZA 4F3HA 4IP4A 3UJFA 3CL7A 1GOIA 4X63A 2ZE0A 4ZQPA 5DY2A 3JS3A 4UQAA 3VC5A 4U31A 2QUVA 3CIXA 3IAPA 1QI5A 2YSWA 4IP7A 2UWFA 2ZZ4A 3VA8A 1MXSA 2ASHA 3THCA 2GJRA 4FIRA 2GGEA 4P5UA 1EJSC 1OC7A 1XH1A 4CD5A 4J9JA 3SCVA 2XPKA 1JCJA 4NZJA 4BHYA 3M0YA 3VILA 4KEZA 1ICSA 3LSBA 3R4IA 1A5LC 1YDYA 1WBHA 3PG8A 3GVQA 1VJIA 1HG3A 1EIXA 1ZPTA 4RDZA 1KBKA 1AL7A 3O6DA 3S2CA 1X7IA 3NZ1A 1SZGA 1IEXA 2E7FA 2ZXDA 3M0VA 5C2CA 2GUUA 1QPNA 2XVKA 1GOMA 1AW2A 1H2JA 3KL0A 4PSRA 5EY5A 3EBVA 3IUHA 4UTIA 3CAKA 3WK1A 5FESA 1F7BA 2NV2A 4CD8A 1C8VA 1XSIA 1TV2A 3TW9A 3GNPA 2VVNA 2WXDM 4DPQA 3GW3A 2GSEA 3CAQA 1I2NA 3VZXA 4UR7A 4NJKA 2CZVA 4RV3A 4Z2IA 2HXTA 4IQEA 5DMMA 2PLCA 1FVPA 2CBVA 3B0PA 3C2YA 1OQFA 1LQAA 2VYOA 5C9ZA 1KCKA 3GQYA 4JR5A 2OU4A 1MXDA 4MB4A 3TK7A 3FV9A 3OA3A 3THAA 5KZ6A 8CGTA 1D2KA 1LG2A 2TODA 4MZYA 3R1ZA 4DO4A 1W2PA 1EJXC 3H4GA 4H8UA 5F4XA 4EIVA 4D1IA 4XZIA 1V3JA 2Z6IA 3FDGA 3CHCA 4PMZA 2OKOA 1ZBVA 2YFOA 2WKJA 2EJ1A 1NDVA 4ZTYA 4IFRA 3IJLA 2JKAA 2BXZA 2BZNA 4L4MA 3B97A 4G6CA 3DH7A 1B90A 3GKAA 3LHVA 1E73M 4L1XA 2I57A 3MY9A 3NTYA 4M6PA 3SJNA 4Q8QA 5XIMA 1GZJA 1VRXA 1LT8A 3QN3A 3UWEA 4FNPA 3C0LA 2O9PA 3LSCA 2PDQA 4LCRA 2BOGX 2A3HA 5DXXA 5LGZA 3GO2A 2WHJA 3PZIA 2IKGA 3UZYA 3CB8A 4XKYB 4DX3A 2PLMA 3GR8A 1UBSA 2PF8A 2V82A 2TSYA 2P76A 1IYXA 3WMBA 1VJSA 2JIEA 2XH4A 5ABHA 3FVDA 5M5DA 3PZTA 2J6VA 2B7QA 3ZZ1A 1WXJA 2JEQA 3DENA 1RCOB 1FCVA 4FX6M 1XDLA 1DXFA 3G1AA 1KKRA 2VFDA 5D38A 1H0GA 5JXQA 4G7EB 4D6DA 5XINA 1X6NA 3PWAA 1M65A 2XGBA 2X05A 4FLQA 3KVKA 3UZ5A 1FWIC 4ZR8A 4GJJA 1VPYA 3UZJA 4FXSA 3PUDA 2E09A 1RAKA 5TQLA 1L6FA 4LEQA 4IPPA 1SJAA 3BCJA 1ZALA 5FF2A 5HNTA 3DI0A 4NY2A 3FA3A 1Z48A 4GA8A 5JIPA 3SIZA 1X1OA 4S3EA 5HATA 4AWSA 4OTKA 2CKSA 4RW5A 2AKMA 4TX8A 5DCDA 4H1ZA 4NAFB 1F3WA 3RRXA 4DXKA 4MTVA 2FTYA 3ZT5A 4AZ5A 1UWRA 1XQKA 4GHRA 1OX4A 3P67A 4GXMA 2NX3A 1SVDA 3EA3A 5BOOA 3URQA 1P0BA 4R34A 3CHDA 3VI2A 4J35A 2D2JA 3VAVA 1JG9A 4U28A 2Y6ZA 2GDQA 1GTHA 3VNYA 2OQLA 5DX7A 4YTRA 3LZ3A 4F48A 1ZY9A 4GX8A 4N6FA 2F9RA 3FS2A 5CJMA 4UTFA 4RV8A 3W85A 2P0OA 4HZ7A 3OGRA 4ACYA 4XG1A 4DZIA 3GNDA 1W1TA 1YPXA 3UJRA 1AZ2A 2XHYA 5AN7A 4KCWA 3WBEA 2BXVA 4DZHA 6PTDA 1WDPA 4AG0A 1H11A 4BF5A 4N7QA 4H8HA 1BG4A 2J7DA 1OZQA 4KRZA 1CDGA 4DXVA 3USBA 1LROA 2AGKA 3FYOA 3WYZA 4HYRA 2FB2A 4U3CA 1AUSL 3TX9A 3KUMA 1SZRA 5BWAA 1CXKA 4UBPC 4MWAB 3DXIA 3EAUA 1VFFA 3AIBA 1JDFA 3VDCA 3WDPP 3AIRA 1N2VA 3V16A 2V69A 5LHFA 3GR4A 2PEVA 4FR1A 1K7XA 1QMLA 3W2MA 3DC8A 1JI1A 3LM7A 2W4XA 4I7VA 1NSJA 2VZUA 3L4VA 1XLFA 1E71M 3GAKA 1QHZA 1W1B1 4AWTA 2VEGA 1RV8A 3LG3A 2ZQ0A 4IPJA 5CC6A 1EYEA 1F2JA 1HJUA 2BGQA 1DWJM 1RY8A 1GPWA 4IMAA 1MZHA 3UNDA 4UNIA 1A5BA 4JNYA 4TVCA 3TOYA 1U5HA 1F05A 3W70A 2DUXA 1EA0A 4FNQA 3NQ8A 1T5AA 5DY3A 3IANA 3GIQA 3L23A 5FJOA 3UERA 4HPXA 3DX5A 3EWBX 1K9DA 4G7FA 1HJXA 3W0KA 3VMOA 3VOCA 3S8HA 4ENLA 1PZ2A 2QZRA 3T05A 4AY7A 1YBQB 1UG6A 2D3NA 4KWSA 4L4OA 2OWCA 1H62A 4IUOA 4QLLA 3WQWA 1CECA 3W2JA 3V7PA 5A2CA 4LX4A 1AW5A 2XINA 2ZUSA 2ABBA 3WH6A 1XP3A 1G5AA 4BI7A 1REQB 3NO1A 1MSSA 3MHFA 2NWRA 4DJFD 3H2MA 2IKJA 2V3FA 5D2VA 1I8JA 5REQB 2C1IA 3IVTA 4ZQNA 1VD6A 4AHOA 3EX3A 2DZWA 4DAIA 4FOKA 4PTVA 1OWQA 4X61A 4MY8A 1LZOA 2HSAA 2VGGA 3PG9A 3UU0A 3GNNA 3T2O