The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
103
|
sequence length |
311
|
structure length |
279
|
Chain Sequence |
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNSQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Radical SAM Enzyme Catalyzing Tricyclic Modified Base Formation in tRNA
pubmed doi rcsb |
molecule tags |
Metal binding protein
|
source organism |
Methanocaldococcus jannaschii
|
molecule keywords |
UPF0026 protein MJ0257
|
total genus |
103
|
structure length |
279
|
sequence length |
311
|
ec nomenclature |
ec
4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent). |
pdb deposition date | 2007-05-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04055 | Radical_SAM | Radical SAM superfamily |
A | PF08608 | Wyosine_form | Wyosine base formation |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |