2Z2UA

Crystal structure of archaeal tyw1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
279
Chain Sequence
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNSQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords UPF0026 protein MJ0257
publication title Crystal Structure of the Radical SAM Enzyme Catalyzing Tricyclic Modified Base Formation in tRNA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 103
structure length 279
sequence length 311
ec nomenclature ec 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).
pdb deposition date 2007-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF08608 Wyosine_form Wyosine base formation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z2uA00
3C52A 4ZQMA 2TYSA 4YXGA 3O6YX 3I7RA 2VOMA 3MP4A 3PSVA 4DBEA 4DF1A 3G0UA 3PR2A 1O5XA 2CLKA 3N19B 1O5KA 1TO3A 1ZAIA 2QDHA 2WSYA 3WJXA 1SR9A 3PB0A 1UASA 3OVQA 1NVMA 2WSRA 3DBPA 3HOJA 1SW0A 1IF2A 4NQ1A 3UXAA 1JCNA 5FF0A 3NQDA 4DF0A 4IMEA 3LERA 3L5MA 4RR4A 4N9EA 2Z1BA 4AWTA 1EUAA 3OHIA 3LCXA 2YPIA 4MKNA 1AG1O 2X2GA 3LHUA 5E1QA 3W6YA 3VE7A 2X1TA 3U2OA 2Y7GA 1KV5A 3BG9A 4JR5A 4MJMA 4YMZA 3TQKA 3IV3A 3TXVA 3P8JA 4OBTA 3QRHA 3UY7A 1MEWA 3TE9A 2DZSA 3FEMA 5HINA 3V75A 3CC1A 2R8WA 3WK1A 1C8VA 1OFAA 4NNBA 4JD4A 3KFTA 5A5WA 3TSBA 1MEIA 3KAOA 4MFEA 2VEKA 3IRDA 5D2WA 4IXHA 2GQ8A 4JTSA 3O06A 5K9DA 4ZQRA 5C5YA 1SO3A 4O0ZA 1Z44A 2ZRZA 4UR7A 1DKWA 2AGKA 1G4SA 3TW6A 5ABTA 4N2YA 2E09A 2YYUA 3M7WA 2J9XA 5FESA 2H3DA 1KFLA 5D38A 1SFJA 1UB3A 3I65A 1F2JA 1MXSA 4UFJA 3H54A 4EF9A 1L2UA 5G2IA 2HSAA 1OFPA 3ABRA 4CCCA 3M5ZA 3BLEA 3QM3A 3LOTA 3W1UA 4N9DA 2Q8ZA 4O50A 4PODA 2JKPA 3TCEA 2CLMA 1G7VA 2ATMA 1ZCOA 3G18A 5J5RA 5CPMA 2W6RA 2ZZ2A 1OHLA 3F03K 2FQIA 4O10A 4WD0A 3CB8A 3A5FA 3S5ZA 2GPTA 5G1YA 1TJPA 1KFKA 3W1RA 5HWJA 3G3MA 3USBA 1S3HA 1XUZA 1QPQA 3NQCA 1W5QA 3EX3A 4LVAA 2F7FA 3S1VA 1K7XA 3BW2A 3PBWA 4JTKA 3C6CA 4Q33A 3E49A 4L4LA 1H5YA 3OIXA 3W73A 5LZLA 3GIYA 5EY5A 3KVLA 1HTIA 3EKZA 4JTIA 1JQXA 1VR6A 2ZQ0A 1J2WA 2I1OA 3HG5A 1QO2A 2EGZA 2VFFA 4NU7A 4AWSA 4PCFA 2C1HA 3G1YA 7TIMA 3SECA 2YR1A 4IPIA 2RFGA 4GUJA 5FF3A 1AW1A 4M7SA 2PRMA 1OG0A 3FA5A 3EXRA 4H3DA 1OFOA 2V5LA 2I9EA 3QW4B 1TPFA 1VPXA 3N3MA 3QPYA 4A3UA 3LXAA 1JR1A 2Q8LA 4JDYA 3P84A 4ORMA 5K4ZA 1BKSA 3T7VA 3VNDA 4UMCA 1EUNA 3HPZA 5I3GA 5DCEA 3F4WA 5HR7A 3GNDA 1RVGA 3BW4A 1W3NA 2GOUA 5DN1A 3LDVA 1TPB1 1XBZA 4ADUA 3LI0A 4OWGA 3TV8A 1OX6A 1P5BA 4MJZA 4O1CA 3LHZA 3W2KA 3WJYA 2NXGA 4O18A 4IMFA 1XUUA 4NX0A 1DJNA 1GYLA 2V2DA 3VE9A 2FPYA 3MJYA 1JCJA 3M5YA 2ALDA 3N14A 5I3FA 3G8RA 3WJWA 4YCPA 3QQ0A 3P5YA 1VRDA 1H7NA 4QSHA 1S5WA 2ZZ1A 1DV7A 1EP2A 3N2XA 5C2XA 1OYBA 4N6FA 4HNVA 4UFLA 1LRQA 3G8EA 1V5XA 1A5CA 3LCFA 3TR2A 3AO0A 2NUWA 2YXGA 3Q94A 1QOQA 4AAJA 3SZ8A 1FCVA 1M5WA 2QEZA 3W7EA 4ICNA 2QCFA 2QR6A 5AHLA 4ADSA 3W7KA 4WX2A 3UWQA 4AHOA 2C16A 4RK8A 4MPQA 1KA9F 3NQ7A 2A21A 2FDSA 2TSYA 4ZQNA 4HSOA 2OZ0A 4KWVA 3W70A 5A8GA 4EOUA 3DFNA 4HNTA 1VYRA 1SO6A 2J9YA 2A0NA 3UWZA 5AC7A 2E6AA 1BWKA 3WK3A 1U83A 4WOZA 1O60A 4EIVA 5G4WA 2VFGA 4A29A 5G1TA 2Y70A 1KFCA 1ML1A 3UY8A 4CQ9A 1VH7A 3R12A 3V1PA 5U7SA 4Q32A 2XN2A 1Q6OA 3GDRA 4P2VA 2QAFA 2FIQA 4UMBA 3W1MA 3PG9A 3F1QA 4JTLA 2DZVA 1O95A 2RDUA 2B7NA 4X3ZA 4UFKA 1RQBA 4OT7A 2DZWA 1OF8A 1YLVA 2QUUA 3IGXA 3KOFA 5HULA 5HQEA 4QITA 1LOLA 4W9TA 3EWYA 5G4EA 1GVQA 4DPQA 1UCWA 4O14A 1SZGA 4UTTA 2VEPA 2DORA 3W75A 4N4QA 2BZNA 3I6RA 3ZS4A 3W7DA 2XN0A 2H3BA 5KZEA 1LTDA 3TQVA 3KXQA 3B06A 4PL1A 4LT9A 4LY8A 1JULA 1EIXA 2Z0IA 3STFA 4N4PA 3TKFA 3UZ5A 1I2QA 4NJGA 3W23A 1HFBA 1EPXA 1DBTA 2E6YA 3GVGA 4UTUA 1Q6QA 5D37A 2QCEA 4TO8A 4YCOA 4JICA 1LRNA 2QAPA 1ADOA 2CLFA 3HB9A 3L67A 2O7SA 1TREA 1N8FA 3QMTA 4X2RA 3NPWA 4WQ6A 4LUJA 3EX2A 1QWGA 3N9SA 3NA8A 2C13A 3L2IA 3S8HA 3L0GA 3W7RA 3PUDA 1UUOA 1SW7A 3EX1A 2YW3A 1L9WA 1ONRA 3W85A 4LC6A 3QEZA 4H6KA 3NQGA 4M5PA 3DFOA 5AN7A 3BK0A 1JUBA 3CWOX 3UYCA 5J5DA 3VFLA 1W56A 3PBYA 1QPOA 1VS1A 3W7PA 4WY0B 1I45A 1TSIA 1TTJA 4FNPA 4JTGA 4LU0A 2LLEA 4DO5A 1Y0EA 4O17A 4O54A 3R2GA 4LNYA 4AEOA 1X7FA 3N73A 2A4AA 2NWSA 5D30A 1K7FA 1QPRA 2QUTA 5D32A 1XI3A 1SZFA 1LBLA 3TA6A 3OEXA 1WOBA 1C9DA 4UMAA 3W1QA 2GVGA 2CLOA 3L65A 4O16A 5U4NA 3UQNA 3O05A 4HPXA 4LV9A 3IVTA 4MIMA 3NM3A 5AHIA 3W3OA 4X9SA 4JDBA 1WV2A 2PRHA 3CT7A 2D73A 3IIOA 1G7UA 3NVTA 5FEPA 5BMWA 1W8SA 4UTKA 3UWUA 3WJSA 1FWNA 3RF9A 1QNVA 5AC6A 1U5JA 3SR7A 3A21A 1ZHAA 2YFOA 4UNKA 3O6CA 5CZJA 3GXNA 4JTJA 3W7CA 4DO6A 1DJQA 3P61A 2BLEA 4UNLA 3HIJA 1TPUA 3BO9A 2X1SA 1Q3NA 3KVMA 3TK7A 2WOQA 3ELFA 4AVFA 2ZBTA 4M6PA 5E93A 1JRBA 3O1NA 4GC4A 3L21A 5DXXA 2YYTA 4O4VA 1KM1A 3HG2A 1TV5A 1RQHA 1T96A 3ATZA 2FB3A 2DJXA 4KFNA 5LNUA 1GG1A 4O57A 5MHBA 2H8ZA 3DFTA 2ZTJA 3G1HA 1HO4A 2RHGA 4C1LA 4LC8A 3OVRA 2J9ZA 3G1XA 4XKYB 3TSDA 4MY1A 4OGZA 3FOKA 1W5PA 2FPVA 5CPLA 3LCHA 1KM3A 3NQFA 4MY8A 1D3HA 1HG3A 2AQWA 1DOSA 1IIGA 1PCKA 1EWEA 3M0ZA 5FEZA 4FEZA 5LGXA 1YPFA 4LVFA 1X8FA 3LX9A 1VQTA 2RKXA 3W7MA 5CZ0A 4JY9A 3HBLA 2Q3RA 4ZQOA 1YTKA 3MP5A 3Q37A 3DFPA 3T44A 2X16A 1YADA 4GJ1A 4O28A 1OFEA 3MYPA 3HGSA 4RX0A 3CM4A 4RXFA 1KTNA 3CIXA 3PUEA 1OK6A 3HJZA 5D09A 2P0OA 3DAQA 4NX5A 3SGZA 4BR1A 3LCGA 1YXDA 5DLCA 4M6QA 3GR8A 2ZRXA 4RZ6A 3W1AA 5IBXC 2EAWA 1KM6A 5AYYA 4DBDA 1G6CA 1XL9A 1PS9A 3EEGA 4NNCA 4JYDA 1GOXA 4NZJA 3M16A 3ATYA 4JX6A 3N34A 4O15A 1LZOA 4JIQA 4UXDA 1FCQA 4JY8A 4O0KA 3BGGA 4JYEA 3HGJA 5IBXA 3L9CA 2ZZ5A 5KZMA 2E5CA 3JR2A 2V82A 3A9IA 4WY0A 3S5YA 1BWLA 4TMCA 2E1DA 2Y85A 3M5VA 2QF7A 1SUXA 3U6WA 4UTHA 3I68A 1LOQA 3GLCA 2CLIA 3QSTA 4WZHA 3DHFA 2QJHA 1TPH1 4EWND 4UTMA 3EWWA 1R2SA 1Z48A 2YX0A 2QCGA 1ICPA 3NL2A 1FDZA 1ME9A 4IX0A 4TR9A 5LHEA 4R34A 2NUXA 2UV8G 3HMJG 2B4GA 1A53A 3T55A 1K3UA 1SPQA 2GJNA 1OYCA 3W1LA 3CWNA 3NOEA 1GJPA 1K8XA 4HN4A 3MHUA 3A5VA 2EHHA 5G2WA 1HL2A 1O4UA 3B04A 3S1UA 1FX6A 2YGYA 5BW6A 3QF0A 1TQJA 1F7BA 4MZ8A 3WK0A 5FF2A 1AMKA 4FHAA 3D0CA 1TJRA 3W87A 2QCCA 1TPDA 4O13A 1PL9A 3P7YA 2VC6A 1KFJA 1XM3A 2JBMA 5AHMA 1QOPA 3C2EA 3PVFA 2E5BA 2CLLA 2WJZA 4LWWA 2ZA2A 5D03A 1H63A 1SO5A 4K8EA 4WJEA 1ZNNA 3L0NA 4O12A 1GVOA 4CNNA 1H7WA 1XBYA 3CLMA 4MYAA 4OE7A 2Y63A 1DQWA 3FLUA 1RZMA 2V30A 3LHWA 3G1FA 3O16A 1KTBA 3MUXA 3S42A 4HKPA 3GAKA 3W76A 3OVPA 4KFOA 2Z6JA 1AW2A 3B0PA 2BTMA 4XKYA 2B7QA 1IXNA 4L4MA 1ZAHA 3KX6A 1NF0A 1T0OA 1UJPA 3KHJA 4JTHA 2VENA 4J9JA 3IGUA 2HMCA 4O11A 1M7PA 5HR6A 6ALDA 5EPDA 3LRKA 4R53A 4LW7A 1AW5A 4NZFA 3HPSA 3LLDA 2BX7A 4PFMA 3STEA 3ABOA 2DZUA 1NF7A 3B03A 3UWYA 3OG3A 3CQ0A 3SI9A 2RDWA 3GAYA 1K03A 3LCWA 1AL8A 3A23A 2GQAA 1EA0A 1A5AA 1H7PA 4O1AA 5KZDA 3LB0A 3OBKA 3P81A 1L6WA 4LVBA 4TX9A 4LS2A 5T26A 1NAL1 2BSLA 4K38A 1MEHA 1GEQA 1L6SA 3EWBX 4RZ5A 1GZGA 3NQ2A 4O52A 4O53A 3W1PA 1WOAA 2G5WA 1FWWA 3DXIA 5HJLA 5F4WA 5F2MA 5GVJA 3P74A 2CU0A 1R30A 1OJXA 2W79A 3QQ1A 1R2RA 4K39A 4QISA 3WK2A 4MZ1A 2J24A 2QCLA 2NX9A 5E0KA 5CZSA 3O07A 1XXXA 3G1VA 1DVJA 1OFDA 1KFEA 3IVSA 2VFHA 4FO4A 4RKAA 4P61A 2Y89A 3GXPA 4DXVA 1FXPA 2A85A 2I14A 2YCEA 3MO7A 3W22A 2EF9A 5AYZA 4PL2A 4K37A 3K30A 3W1TA 4Y6GA 5KINA 1DL3A 2QJGA 4LUIA 3S1WA 4IMDA 2J6XA 1EX5A 3LI1A 1FBAA 5LNRA 1P0NA 3DGRA 4XZ9A 2G96A 4AB4A 3EX6A 3IGSA 1H60A 4XTIA 4FXSA 1CW2A 2B7OA 1OX5A 1KV8A 1JCMP 4PH6A 4UFIA 1HUVA 4OV9A 1SZNA 2ZFAA 3B05A 3C2OA 3C3NA 1H1ZA 3NR0A 1ALDA 3AJXA 1EEPA 3W7NA 5AC8A 2YFNA 3W7QA 1YYAA 2A7RA 4O1BA 1RD5A 1RQEA 2C14A 4KFPA 3VCRA 4C1KA 4UTLA 3YPIA 1PV8A 1KLZA 3RU6A 1FUYA 1H51A 2V2CA 2FJKA 3HO8A 1YXCA 4LS0A 4JTFA 5HWMA 1B57A 3G1AA 2TRSA 5G5IA 3C0JA 4O19A 1KLYA 3TUUA 3EWZA 3THAA 2NXIA 1M7OA 4Z0SA 3M1ZA 5AOUA 1WBJA 3KRSA 2DP3A 3SFKA 4LV4A 3UZJA 5BOOA 4AF0B 3LHTA 3BG3A 3ABSA 1W1ZA 4I7UA 1EWDA 1TRDA 2NXHA 5I3HA 2OCZA 2ZA3A 4NT0A 4OV4A 1WYIA 2ZRUA 1QPNA 3T40A 4Y8FA 1L6YA 3MP3A 1XFBA 3NL6A 3NZRA 3NPUA 2F84A 3M41A 4XQ6A 1FDJA 1VC4A 3PAJA 4ONVA 1AL7A 3GX9A 3CPRA 2ABAA 3IEBA 4CQAA 4CCEA 3QYQA 3DENA 3BLFA 3PBUA 1XDMA 1FCUA 1A50A 3STCA 4Z0JA 1VLWA 1JVNA 3WJZA 3C8FA 3W2JA 1LM1A 4K7YA 4BK9A 2QDGA 1QR7A 1BTMA 5H2ZA 3GDLA 2NLIA 1MZHA 2X30A 3P82A 1XBXA 1VGAA 4DEFA 1LORA 3E0IA 1NSJA 1DHPA 3EX4A 1XDLA 1GYNA 2KZHA 2JKEA 3NGJA 1ZFJA 4MLRA 1M6JA 4ZMGA 4AXKA 5D2XA 3A22A 4JN6A 4U28A 4HPJA 2HTMA 4CNOA 1X6UA 3PS7A 3S9YA 5BRBA 3W9ZA 1A5SA 3QSRA 1X1OA 1GVSA 4GXMA 2PC4A 1QCWA 4GRSA 3ABQA 3NO5A 2NZLA 3MYOA 3MWAA 4YWIA 3NQAA 1DQXA 3N9RA 4O1DA 2EKCA 3DZ1A 4ZZ9A 3FS2A 3FKKA 5K9CA 4QAIA 2WNNA 4KWWA 5CPNA 1VCGA 3MI6A 4Y9AA 2JGYA 5EMUA 3CEPA 3M9YA 1JQVA 3W7LA 1PCWA 2OT0A 4R7JA 4PTNA 4UTWC 1CI1A 3FJ6A 4GFSA 1QO5A 3L66A 4NXSA 4BWLC 1SSDA 3T4CA 4FIQA 3W7JA 2ISSA 2WQPA 2ZDRA 5DXYA 4UC5A 2YW4A 3W2MA 4E38A 5KMYA 4JIPA 3M47A 3EWUA 1I8JA 3Q2DA 2RH9A 2YZRA 2VXNA 4UIOA 2B0MA 4ALDA 2JK2A 3G1SA 5CG7A 1B4EA 5I3JA 1FY6A 1VHNA 1G4TA 2ZTKA 1TRIA 3HG4A 3EB2A 2G97A 1EP3A 2VEIA 1G69A 2Y7EA 1EB3A 4D2JA 1C29A 3PM6A 2R14A 3ZFHA 2QCHA 1W5OA 3W1NA 4WXYA 1F5ZA 3GKAA 3U8GA 2GVLA 4GUFA 1H61A 4Y90A 4TIMA 5HUPA 4A2SA 2A1YA 2A6LA 1FDYA 5DCDA 2P1FA 3IIXA 3W86A 4ADTA 4Z1AA 1XC4A 1Q45A 3S0CA 1Z42A 1SQ7A 5I3IA 5LNWA 4XBSA 1KM4A 3W7HA 3TFCA 2WPBA 3TJXA 5CGQA 2TPSA 4X22A 1QAPA 3R13A 1W0MA 2AAMA 1N7KA 3TNOA 3MHFA 2GQ9A 3C2VA 5F2GA 4HNNA 4RJEA 4M7TA 1KM2A 3TFXA 3E96A 4AF0A 1J4EA 1JJKA 3SJ3A 4DO4A 4BI5A 1AK5A 4WUIA 3DU0A 1GVRA 2C6QA 4RV8A 3IVUA 1I2OA 4B5NA 4M19A 1OFBA 4K36A 1S5TA 3P67A 3LBMA 1LOSA 4FNRA 1IIHA 5D33A 4JX4A 2FLIA 2XFWA 2WNZA 1I4NA 1G4PA 3NDOA 4HT3A 1LLWA 3BARA 2ZZ3A 2Y7FA 3UXDA 2Z6IA 2Y6ZA 3C56A 1B9BA 2ZYFA 3BGJA 3LTYA 4ORIA 1ZALA 4QQ3A 4NNAA 5HUOA 3P60A 3PC0A 3EWXA 3HQ1A 5L6UA 3DFSA 2CZ5A 4PEKA 2FFCA 3TH6A 1QMLA 2A7NA 4G1KA 3LTPA 3L0KA 1KFBA 3BLIA 2QCDB 3GKFA 1OF6A 3EKLA 3PB2A 4ZL1A 3DHDA 5EL1A 2X1RA 3P5ZA 2CWNA 5KITA 1XKYA 2ATSA 4U4MA 3TU9A 3ANYA 1PE1A 2CLEA 3W7IA 2WO5A 3S5OA 4IMGA 3NXFA 4FX7A 2A2IA 5K3VA 3GNNA 3STGA 3HGRA 3G22A 4RLIA 4XWUA 1O94A 1P4CA 1W3IA 2BXVA 1FQ0A 3TSMA 4JEQA 5AHNA 5K4XA 5C54A 1XBVA 3PG8A 2OMAA 2XN1A 5DBUA 1W3TA 4LRTA 3G0SA 2V9DA 3SW6A 4S2CA 1VZWA 5EA9A 3FIGA 3PWAA 3SY5A 3PF3A 2ZRYA 3C2FA 2H8XA 3JS3A 5I3KA 2DZXA 5F1UA 3O15A 4WOQA 4A2RA 1SFLA 1VHCA 5EYWA 2V5BA 4IWWA 3RLUA 3G1DA 3FYOA 4UTJA 3LCLA 2WNQA 1G67A 1WDWA 1H7RA 3O8AA 2NV1A 3S1XA 4A21A 5C6MA 4XBKA 2PCQA 2QJIA 1LROA 1GTEA 1TPVA 4Q4KA 5D2VA 4E2DA 3L5AA 3NM1A 4XUGA 4YLWA 1W37A 5TQLA 4MLJA 3BPWA 3L5LA 5HNRA 2JKAA 3LBCA 5FF7A 4K8HA 2V81A 1TIMA 3LGEA 2RDTA 3UWWA 2Z2UA 3TC7A 3TROA 4NJJA 4IGHA 2CLHA 3MW7A 3HGOA 3UNDA 1WXJA 2ZZ6A 1ZY9A 2WSQA 5CKSA 3EXSA 1H1YA 4FNQA 2BWGA 4OHQA 2ZA1A 2GUUA 3W2UA 4FXRA 3LXCA 1TTIA 4Z1CA 4QNWA 4O8RA 3NL3A 3M43A 4S2BA 1JUKA 1TTQA 2FPTA 1GTHA 3QMSA 2Y88A 4IJBA 2A6NA 4TMBA 4UUIA 4FX6M 2NUYA 4DQWA 4H4IA 3LLFA 1NFBA 2ZZ4A 1B3OA 3SSJA 2ISWA 5K2ZA 3UPWA 2ZRWA 4LS1A 1JCYA 3CU2A 1YDVA 4K6AA 3VKJA 3QFEA 3QPZA 3MBFA 5D05A 1VCVA 3FFSA 1S5VA 3LV6A 4MYXA 1FWTA 1GPWA 3CTLA 5KSWA 1P0KA 1TPEA 3DFQA 3KVJA 4LRSA 2HS6A 4LTSA 1ICSA 3IIZA 5F2LA 1LCOA 3THQA 3LHVA 2V2HA 1EP1A 1I2RA 5CSRA 5CZTA 5LNSA 1OFRA 1VYSX 2CZDA 3TC6A 4NJHA 2ZCGA 2PURA 4IOTA 2QCDA 3LRLA 4NVTA 3DKLA 2WV8A 1GQNA 4UFMA 1KBJA 3WFAA 2J88A 4GUIA 2Q3OA 1ME8A 2QCNA 2WKJA 3NL5A 1KW1A 3LM7A 4LVDA 1GT8A 3HPXA 2GJLA 2O7QA 1E51A 4FF7A 2VFIA 1I2PA 3NQ6A 4IXXA 3N2MA 1NEYA 2JGQA 3B4UA 1H50A 2CW6A 2CZFA 5FI8A 4E0CA 3TMLA 5LHFA 3RMJA 8TIMA 4NXKA 1KM5A 5EKYA 1UBSA 5F2IA 4K7VA 2B7PA 2DJLA 1UUMA 3IIPA 4FNTA 3TAKA 1VCFA 4GUGA 4IMCA 2CZEA 3ZWSA 3CEUA 1LBMA 3Q58A 1W5MA 3P8IA 5D2YA 4YL2A 3NYZA 4BI6A 4XTDA 5DY2A 5K9XA 1OFQA 5D02A 2C19A 3JRKA 4TU1A 3W2NA 4N6EA 1ZAJA 3R8RA 5LSMA 4FB7A 1R46A 2C18A 2YSWA 1WX0A 2VEMA 1HO1A 2Y62A 5C55A 3PBVA 3W74A 2FB2A 1IGSA 4GBUA 5L9FA 4RCXA 4N02A 5CSSA 3I7SA 3QMRA 3QZEA 2E6DA 2VELA 4DF2A 1YDOA 4IX2A 1XCFA 1YPIA 1W31A 4AHQA 2W0UA 3C61A 4GNJA 3TW7A 1W54A 2C0AA 3C2RA 3SIZA 5LGZA 1X1ZA 2R94A 1FWRA 4ZQPA 3W07A 3NQVA 1JRCA 4AWUA 1T8XA 4CNPA 4HHPA 5G2HA 4S1FA 3E02A 3RK8A 5TIMA 4AHPA 3HG3A 4CQ8A 5D04C 4JTEA 3GR7A 3B8DA 1PIIA 4A22A 4QM1A 3RFAA 3LV5A 3TQ0A 1V7YA 1ICQA 3NPXA 1K8YA 3PSWA 3R89A 4Y96A 3MHGA 1SU5A 1JCLA 2QUVA 1KBIA 4R33A 3GZ3A 1F6PA 4HNUA 5IM51 1OK4A 1GG0A 4HIBA 3P80A 4M6VA 4MZYA 5TBOA 2PE4A 3M5XA 4PC8A 1YDNA 4QIUA 1Q6LA 3DKJA 1PHQA 5HWNA 1FWSA 1SO4A 4E2BA 4UTTC 1BEUA 3FYPA 3KVKA 3TDFA 1D3GA 3CHVA 1GWJA 4AH7A 2CFFA 3GDMA 3W7OA 1VJIA 4N9BA 3E12A 1QDSA 3H53A 3QC3A 3NZ1A 1LBFA 3W72A 3BG5A 4FNUA 3BW3A 1MSSA 1OX4B 3DI1A 3NEVA 3GK0A 3MBDA 2J27A 4LOCA 3BV4A 2X1UA 4JTTA 1VYPX 2E5DA 2VKZG 5AHEA 4IQLA 3RLVA 3LCIA 4RZ4A 1I2NA 4CLMA 5BNKA 3LRMA 3G24A 2P10A 5F4SA 4ZVJA 1H7OA 4IUOA 1Q6RA 3T78A 4IPJA 2A7PA 2R91A 1F05A 5K7JA 2E77A 4OU1A 4N9CA 4FNSA 1TPWA 3W88A 5LNVA 4FIRA 4I9AA 5D2TA 1N55A 1F6KA 3BVJA 4NJKA 3GDTA 4BF9A 1ZENA 3NG3A 1WBHA 1IXOA 3MI3A 4JGDA 3OA3A 1OYAA 3PULA 1W5NA 4GUHA 3M44A 3PUOA 4WY0F 3MMTA 1CX9A 1TB3A 4EF8A 3VI2A 2QCMA 3QH2A 3NAVA 3NPVA 1F74A 4PA8A 4Z1DA 1PHWA 5CPOA 3TAOA 3W71A 6TIMA 2HS8A 3QJAA 2DZPA 4I7WA 1J5TA 1TQXA 1TV8A 3UWVA 3INPA 1ME7A 1A5BA 1T99A 4DELA 2Y61A 1P1XA 1TYGA 3O6DA 4MUZA 3IIVA 2FTPA 1KTCA 5AHFA 4LVGA 3R5EA 4UTWA 4NJIA 1K8ZA 3W83A 1WA3A 3FJLA 5DY3A 1LP6A 2H6RA 4UCGA 1MO0A 2GVJA 1TPC1 3NNTA 3MI2A 3B0VC 3W2LA 4BWLA 2C3ZA 2G95A 1K02A 2NWRA 3TJLA 2V0TA 1YTDA 4JX5A 1FXQA 4ZQCA 3S5NA 1R47A 4MOZA 4HSNA 5KTLA 1F76A 3GYEA 2NX1A 3LTSA 4POCA 4QNEA 3TXZA 3EXTA 3W84A 1FCBA 5LKYA 5EBUA 5FEWA 3G0XA 4UTIA 1H7XA 1JUEA 4BFAA 5AFDA 3W7GA 1TTPA 4ML9A 1SZEA 1VLIA 1R2TA 2ZRVA 4JTUA 4OQVA 5SWUA 5HMSA 4EVZA 3QW3A 1G4EA 1ZJIA 3UPBA 5DCBA 3B0UX 4GWEA 3C4UA 3G3DA 1KM0A 5FEXA 3GXTA 4CCDA 4Z1BA 1QFEA 4JS3A 3NQEA 2VFEA 3PY2A 3H55A 4Z08A 3ZR4A 4I7VA 3KRUA 4GE8A 3LHYA 2TMDA 3I7QA 2OX1A 1OABA 5BMXA 3SGUA 3W1XA 4QJ1A 5H91A 2NX3A 2V8ZA 3CIWA 2EPHA 3TX9A 4NUWA 3NQMA 3RNDA 3LXBA 1IXPA 1TCDA 3F4NA 3FKRA 1YXYA 2ZZ7A 2A5HA 2NV2A 4DPPA 1THFD 5AB3A 1SSGA 1LYXA 1LRTA 4FX8A 3TMQA 1IXQA 5DBTA 1OX4A 1JCXA 3DI0A 2PRLA 1LDCA 1OVDA 4JXCA 4UR8A 3GDKA 1TMHA 5FF4A 5DELA 1WQ5A 3A24A 1GVFA 1PVNA 1B4KA 4RXGA 2IQTA 5AYXA 1SW3A 1K7EA 4O4WA 4BI7A 1YTEA 3ZWTA 4AMAA 1LLZA 2OJPA 3UD6A 3KRZA 1RV8A 1RPXA 4MY9A 3O63A 4WXZA 1DORA 4JYFA 3NQ8A 2VFDA 1TV7A 2E6FA 2DZTA 2YDAA 3P62A 2OT1A 1WAUA 4JNMA 1F73A 2QKFA 4UFHA 3GB6A 2E68A 2Y7DA 1RR2A 1Z41A 2H90A 3TIMA 2C15A 2DU2A 1H62A 3S6DA 3E9AA 3L68A 1D9EA 5F1VA 2ABBA 3DH7A 5F4XA 3M6YA 4MFDA 4MVAA 2ISVA 4KKXA 3HF3A
chains in the Genus database with same CATH superfamily
3C52A 4HBKA 1EDGA 2AMXA 2OVLA 3I7RA 1XIEA 3WNMA 5C70A 3T6CA 1GJUA 2WSYA 3PB0A 2VUNA 1B1YA 1UASA 1N82A 2J8GA 5GQBA 4P7RA 1SW0A 4Y9NA 3UXAA 1E5JA 1I0BA 3NQDA 1F9CA 3AYRA 3LERA 4S3JA 2VP8A 3H7VA 3ZR6A 3OHIA 3EOUA 2YPIA 4D1JA 3W6YA 5J04A 4BZYA 3L4WA 3EPNA 4O0QA 5DMLA 4FF5A 3GVWA 2CERA 2FFIA 3IV3A 2FDMA 3P8JA 3RO8A 3WD1A 3VIKA 1OZMA 1OC5A 3WK1A 3DX5A 4JOMA 1XLDA 1KGXA 3TSBA 3CL8A 4H7VA 5D2WA 3GNOA 8XIAA 1XCWA 4ZQRA 1Z44A 3E0VA 5CJMA 2AGKA 4C6EA 3E2VA 4PUWA 3KCOA 3AYVA 1VFMA 2BOGX 2YYUA 3HQNA 1DEDA 1UB3A 2AKMA 2YL8A 3RMEA 4E5TA 3ALFA 4UFJA 3BAKA 3PZTA 1US2A 4MWAC 2HSAA 5REQA 3M5ZA 3QM3A 2VZVA 4N9DA 3M0KA 5RUBA 2JKPA 2CLMA 5CPTA 2ATMA 3PWIA 4F9DA 3M07A 3G18A 1KBLA 4TQTA 1T6MA 2PWUA 5I6SA 2ZZ2A 2Q6ZA 1WZMA 1EYWA 1US0A 2XPKA 1OHLA 5A8PA 3F03K 2HRWA 4MWAA 4DUWA 4H00A 5B7YA 3NJ3A 5DMMA 4A3HA 3S5ZA 2GPTA 1VFHA 1KFKA 2XH7A 5HWJA 1OINA 2PDNA 3G3MA 4KPLA 1XUZA 2CCRA 1QPQA 3KE0A 1K7XA 4L9XA 3KEHA 5FACA 3BW2A 1UPMB 1H5YA 3W73A 4F0MA 4R88A 5LZLA 3KVLA 1HTIA 4JTIA 2GDQA 2ZQ0A 1IQ8A 2DVTA 1WAWA 4HMNA 3WH5A 4NU7A 4QGCA 2DT0A 1TX0A 3WLTA 5E70A 3KBWA 3B0YA 3MVIA 4NG3A 3QV9A 4L6DA 4DN1A 1GGOA 5CAKA 2PRMA 1XH2A 4MKSA 3EXRA 3QW4B 3AALA 2BS9A 4ZE5A 1VPXA 3SQSA 2D2OA 3CJPA 3QPYA 1PX3A 5K4ZA 1BKSA 1J9YA 1V6UA 3W53A 4UMCA 1EUNA 3REQB 5DCEA 4R5EA 1JAEA 3BW4A 1XIIA 1IEVA 1CWYA 2EEXA 5BXTA 3BQ6A 4ADUA 3LI0A 1P0EA 3SCRA 1L8PA 4O1CA 2F6KA 3WJYA 4IMFA 4Q4QA 3VNMA 2QPUA 1G9HA 3M0MA 1QHOA 3SEPA 1UD8A 3QHOA 4WJ8A 4YIWA 2ALDA 2ZVRA 2V3GA 1DTUA 1OSEA 3P5YA 4NAEA 1H7NA 4QSHA 1AH0A 4HPHA 1VENA 1CPUA 1KQYA 3SN0A 3N2XA 1DHKA 3VIMA 2RAGA 2NUWA 1I0DA 2OQLA 4J3TA 1QOQA 3SZ8A 1FCVA 3QOKA 2QCFA 1UZDA 1HQTA 3EZ4A 3D47A 4ADSA 4PUMA 4QP0A 1J12A 2C16A 2Y5EA 3NQ7A 3P14A 4S39A 3H2CA 4ZQNA 4HSOA 2OZ0A 1ISYA 3O6AA 4HNTA 1SO6A 2J9YA 3UWZA 5AC7A 2NQJA 3WLJA 2OQHA 4ECLA 2VT0A 3PUGA 4FI4A 3WLPA 3TYCA 4RE3A 3AQUA 4IIHA 1ML1A 1R3QA 4CQ9A 1MNZA 2PSNA 4Y9MA 1VH7A 4Q32A 2AL1A 2FVLA 3RU8X 1Q4NX 1SJDA 4JTLA 4H8UA 1UKTA 1RQBA 5HPOA 2DZWA 4YTTA 1YLVA 3CAQA 5HQEA 4QITA 1EJRC 1LOLA 1AVAA 4W9TA 1EOKA 4IQJA 3UF9A 1UCWA 3M0LA 4O14A 3W75A 4GYKA 3ITVA 2VD8A 1QJWA 4HHLA 4ERAA 4E8GA 3PHAA 1UWUA 4PL1A 4S3BA 4LY8A 4YN5A 4N4PA 1EPXA 1DBTA 2OO0A 2Z2AA 1L6FA 2GJPA 1LRNA 1B0IA 2A3EA 4GQBA 1PDYA 3WBAA 4GHRA 4ICCX 3L67A 1TREA 1N8FA 4X2RA 4QBXA 4WQ6A 5B7ZA 3CXOA 4LUJA 1XYLA 3U2ZA 2WHLA 4LYQA 3PUDA 3EA1A 4ZXOA 3LGGA 2OKTA 4QR6A 3P6LA 1UR2A 2YW3A 1ONRA 3ITYA 4UQEA 3RUBL 1FVPA 4LC6A 3REQA 5ECUA 2GL5A 4M5PA 3DCPA 5AN7A 1JUBA 3RR4A 3CWOX 3NZGA 3UYCA 4M1BA 5J5DA 1W56A 4D6HA 1WUEA 4Q7BA 4FNPA 3C0LA 3RPDA 5DQPA 5LA0A 3R2GA 1A0DA 4AEOA 1X7FA 4DNHA 1VJSA 2WC7A 3IJQA 1BLIA 1VD6A 4LAOA 4IT1A 1EJWC 3VIHA 1XIBA 1SZFA 3TA6A 3OEXA 1C9DA 4UMAA 3FA3A 2GVGA 2DIEA 2CLOA 3BOLA 4CQDA 6XIMA 4EXAA 4O16A 3UQNA 2PWDA 1T5AA 1E15A 3SQMA 4HPXA 4LV9A 4D8ZA 4IHCA 1PIGA 3W3OA 1OC6A 4Q8TA 1HIZA 4PZVA 4BQ3A 4C6IA 1G7UA 3RILA 1BVZA 3UWUA 4PCSA 1QNVA 1O7AA 3W01A 3SR7A 2YXXA 3A21A 2DQXA 2CKRA 2YFOA 3RYSA 3GXIA 3FYYA 5CAHA 4ZE4A 2V3EA 2WSPA 1W2VA 3HIJA 4EWJA 1AH3A 4IP4A 4EKJA 2Z2BA 1Q3NA 5TNVA 2WOQA 4ZSTA 5E93A 2QVHA 2VCAA 1HGWA 3HG2A 3ITXA 2FB3A 4D6IA 4W88A 1XYAA 1FWAC 4QX4A 5MHBA 2H8ZA 5LA2A 2GUBA 5C2GA 2ZTJA 2RHGA 5HMDA 1OY0A 3F5JA 5A8MA 2Z25A 4MY1A 3FN9A 3SSZA 3CZ8A 4WDTA 4YWSA 1VBHA 3QTGA 5A1AA 2HXTA 1D3HA 3A12A 1LQAA 3AS1A 5TAOA 1VBUA 3M6DA 2BY3A 1M7XA 1XLIA 1EWEA 4FEZA 5LGXA 4LVFA 3LX9A 1IHIA 3GTXA 1J18A 3USZA 4JY9A 1YQ2A 1POJA 3EDEA 1BF2A 3ARXA 1YTKA 4JQ4A 1E43A 3W0KA 3THCA 3AUJA 3DFPA 2X16A 2NVDA 1VAHA 3RR1A 3V5FA 2IKJA 3E3HA 4GJ1A 1XG4A 3FJNA 3KP0A 4RXFA 3CIXA 2G3FA 3PUEA 2P0OA 4TOQA 4KCTA 3URBA 3AWNA 4WGXA 1AZ1A 3ZT7A 2XM2A 3IK2A 2ZRXA 1E9LA 1UIPA 2EG8A 1V77A 5IBXC 3NTYA 4NF7A 3II1A 3MC5A 3EEGA 4NZJA 4ASTA 2PBOA 1W1PA 4MPKA 3N34A 3WQOA 2J75A 3CPUA 3CHFA 2BG5A 4PRTA 3H2AA 5IBXA 3JR2A 1DPMA 4J1OA 4MJ4A 1FWHC 2HBVA 4U5IA 1CGYA 1ISVA 4GA8A 1H0IA 1BXNA 3CZJA 1ITQA 3L4VA 4UTHA 3M4HA 4WZHA 5IDZA 2QJHA 1TPH1 1XLGA 3EWWA 1V6WA 3LK6A 2HK0A 1ME9A 3NL2A 4IX0A 1XLFA 2NUXA 1ZQ5A 3TR9A 2F9RA 3ZLFA 4AYSA 3T55A 5JH2A 5BU9A 1SPQA 3VNIA 3QR1A 3O3RA 3W1LA 3CWNA 2PUZA 3NOEA 3R25A 4GBDA 1K8XA 2CYGA 4HD5A 3A5VA 2EHHA 3W02A 1X7IA 4M81A 3T07A 2PTDA 5BW6A 1FX6A 5FJJA 1H41A 2CXEA 2IQDA 3Q4DA 4NY2A 1J01A 3LYEA 3WK0A 1K9EA 3RCMA 1CB2A 4FLQA 5M17A 4R85A 1TJRA 4WDXA 2PDPA 2F38A 3LEPA 3M0IA 1XWYA 1VEMA 2DZAA 2E5BA 3LPPA 3MWCA 1FH9A 1H63A 1SO5A 2BP1A 5FOOA 1ZNNA 4IL2A 1J0ZA 4ZSUA 2NQZA 2IPJA 4WEVX 3A4XA 4DB7A 1XBYA 3E1F1 1VBJA 4MYAA 1Z6KA 1FWIC 1TMLA 1UC5A 3GG0A 3S42A 2CBIA 4A8RA 5PTDA 2Z6JA 2PDKA 3N1AA 5A95A 3A4JA 5FL0A 4OECA 4XD6A 2W91A 4GYJA 2GDVA 3IWPA 2IMRA 1KRMA 4LSBA 1UJPA 2DUXA 1UH4A 1K8CA 4S3EA 5HR6A 4JFVA 1MFUA 2FTYA 1AW5A 4H1ZA 4PMNA 3AUOA 2BDQA 3HU7A 4JHMA 3CK5A 1GQKA 1DP0A 4OUIA 3EAUA 3B03A 3KP1A 4HZMA 1XRSA 1EHNA 1E4NA 2PZNA 2RDWA 4YVPA 1K03A 3EA2A 3LCWA 1AL8A 3A23A 4Z1YA 1E6XM 3RX4A 3PZ9A 4O1AA 1RY0A 2WQDA 3EOOA 2GJXB 1OZQA 1HW6A 4PTVA 4LVBA 2E3ZA 4YS1A 3RM8A 3U5YA 3TQPA 2POZA 5LIWX 1BWVA 2BSLA 4W84A 1L6SA 1E70M 1V3HA 5ABHA 3G6LA 1QNSA 1C91A 1JDFA 1FWWA 3DXIA 5F4WA 4LJ3A 3ZLGA 5CC6A 1X97A 1QI4A 2QJJA 1WB0A 1VPQA 1R2RA 2DT2A 4N0RA 2QCLA 4GJJA 5HNTA 1NWTA 1HKMA 3EPOA 3G5EA 1DVJA 4HA0A 1UKOA 3IVSA 4HNCA 3LSBA 1S2CA 4P61A 2Y89A 3B8WA 3K46A 4CU8A 3VK5A 4HK5A 3BCDA 3N4FA 2E4TA 1QHZA 1R87A 1MFVA 2GVEA 5AYZA 4K37A 4LX4A 4Y6GA 2ASHA 2ZUNA 1XV8A 4LUIA 3VIJA 1FBAA 1KQZA 3UXIA 1P0NA 3DGRA 2G96A 4Z2GA 2GGGA 3IGSA 2I16A 1CW2A 4CCZA 1OX5A 1KV8A 3PPCA 4DY1A 3QV6A 4GABA 5HOSA 3JW7A 3SY8A 1BGGA 4UTLA 3CV2A 5CXPA 4QG8A 3ITLA 3U3HA 1BRLB 4PMXA 3B8IA 2YL9A 4AVOA 1IT7A 3N12A 4JTFA 2G3NA 4QE1A 3WDRA 4O19A 4MNKA 3ICJA 4S3GA 5BOFA 1XLLA 1UH3A 3WEMA 1WBJA 2DP3A 4LV4A 3ABZA 4BEUA 4KMQA 3LHTA 3BG3A 3CGTA 3ABSA 4YTSA 1CEOA 2OCZA 4XO6A 1WYIA 2ZRUA 2RGLA 1QPNA 2F6UA 3OLGA 4JCLA 4C6BA 1F3TA 3T40A 2X7WA 4US5D 1RBLA 2IPWA 3OG2A 4A8NA 3M41A 1V93A 2YB4A 4F0KA 1GOMA 1PKLA 1XGEA 2ABAA 3RO6A 1LQ0A 1A50A 3NZPA 3Q67A 1VLWA 3WJZA 2PWFA 3C8FA 2XISA 2QDGA 2FKPA 1BTMA 4HA1A 3TTYA 4KEUA 1Y8BA 4DEFA 5AC4A 3LPGA 1LORA 4HU4A 5I07A 1DHPA 2GJXA 4GZ7A 4DLFA 1GYNA 2I5QA 3GFZA 2VWTA 4MLRA 3AOFA 1M6JA 4AXKA 4AEFA 5D2XA 3DG6A 4HPJA 3UPMA 3T0BA 4DJDA 3S9YA 5BRBA 1GVSA 2QT3A 3GUWA 2NZLA 3GVVA 3NQAA 4HSHA 3N9RA 2PDUA 3W24A 2VR5A 3PTDA 3FKKA 4XB3A 4KWWA 1VCGA 4J3ZA 3RJYA 5D8ZA 3CEPA 1PCWA 4UTWC 1CI1A 1AZ2A 4C5YA 3CBWA 3OBEA 4FIQA 1K9DA 1TJ1A 3AXKA 3M47A 3EWUA 3Q2DA 1DWAM 3WX7A 4FLOA 2B0MA 3G1SA 3PZQA 5E9AA 3URAA 2WHMA 4JTQA 3HG4A 3EB2A 1FWGC 2PI6A 4RL3A 3W29A 2Y7EA 3N2OA 3PM6A 3E5PA 1F5ZA 3GKAA 2VMFA 1V0KA 2ZUVA 3TVAA 4TIMA 5HUPA 2NT0A 2AGTA 4LUTB 4DBWA 4KW2A 1QASA 2VDIA 1Z42A 1WKEA 2ZC1A 2WMFA 2W92A 1W1B1 5CGQA 4MJ2A 3VINA 1EH9A 1GW1A 2GQ9A 3H2MA 5F2GA 1XIHA 4U10A 4M7TA 5D9OA 2CIPA 3E96A 1JJKA 4W89A 4Q7IA 3WNLA 2F6XA 1M3UA 1GVRA 2C6QA 3EDKA 1I2OA 3UP8A 1DIEA 4M19A 4MSSA 1S5TA 3NIYA 2P8BA 3BAWA 1K9FA 1LL6A 3LBMA 3P67A 1HX0A 4ZOCA 3A4AA 5D33A 1C7TA 2PA6A 1O68A 3NDOA 2ZZ3A 1MRQA 1TVNA 2Y7FA 3ZSSA 2Z6IA 1TWSA 2ZYFA 1MNSA 1ZALA 3SUVA 3HQ1A 4CU6A 2FFCA 1KFBA 3BLIA 2XJ7A 3EKLA 4ZL1A 3C3UA 1SVDA 4PB5A 4AY8A 1V3KA 4S38A 2ON3A 3D3AA 3GU1A 4LB3A 2ATSA 2WK2A 4U4MA 2C71A 3W38A 3MKVA 3S5OA 3QFWA 1WXYA 2NSXA 1H49A 2A2IA 3PZUA 2QQ6A 2WVSA 2PP3A 4DUOA 1Q7ZA 1TR9A 3UNTA 3L4XA 4NL1A 1YHTA 1TVPA 4GVHA 3PG8A 2XN1A 5I78A 3L2MA 1FTXA 4DJFA 5BXRA 3G0SA 2V9DA 3SW6A 1I60A 4L1XA 1VZWA 3NSMA 3MUY1 4ZTYA 2Y5SA 3PF3A 4JAWA 1WO2A 5I3KA 1CECA 2DZXA 1TJ2A 3O15A 4HA3A 4A2RA 4HB7A 5CLWA 1DE6A 4FXFA 3BL3A 1EEXA 1VHCA 4GNVA 1R0MA 1RY8A 1PKMA 1W9BM 1H7RA 2HVOA 2NV1A 2QJIA 1GTEA 2JALA 2IKHA 4PUNA 1W1TA 4RUBA 4YLWA 5TQLA 2HVMA 4O8AA 3DG7A 2JKAA 4K8HA 2D3NA 4FMVA 1S2WA 2YCIX 3LGEA 2RDTA 3UW6A 2Z2UA 4IJRA 4BQ5A 4LUTA 4C6KA 3TC7A 1MXGA 2XIOA 3T2QA 4DI8A 1RP8A 4B5TA 2AMGA 4KWSA 3BSHA 3I4KA 4HK6A 3UNDA 2CBUA 3VKDA 5IFTA 1WXJA 2J62A 2WSQA 3UXLA 1V08A 3OYXA 4FNQA 1F07A 4V15A 3SCVA 3LXCA 3R8HA 4AZBA 1EPVA 2VJXA 4KRUA 4Z1CA 3M43A 1TTQA 2FPTA 3VOIA 1GTHA 2Y88A 4W85A 3F4VA 4BY3A 1X96A 2PDQA 2A6NA 2NUYA 2VX4A 2J7GA 1QHPA 3BLDA 4FOUA 1M65A 1XRTA 1B31A 5K2ZA 1UWAA 3UPWA 3CUIA 2ZRWA 1YDVA 1CBGA 4K6AA 3VKJA 3QFEA 3FV9A 2XH2A 3MBFA 1X6LA 4GY7A 1VEOA 1MZRA 1JF6A 1XIDA 5ABGA 1YW1A 4KT2A 4LAMA 3VMPA 3TTQA 1SJBA 3TC6A 3RXZA 2ZCGA 1EJXC 3LLXA 2AQVA 4NVTA 4KIRA 3WFAA 6XIAA 2WKJA 5JVLA 1UP2A 3LM7A 1LL7A 3P0WA 4WVXA 1GT8A 3HPXA 2GJLA 2O7QA 5AVNA 4C6OA 4YHEA 1E51A 2JQXA 2ZIDA 3WF1A 3UFYA 3N2MA 1NEYA 3B4UA 3GTHA 5FI8A 1QUMA 3PFRA 3RMJA 2BB0A 5EFFA 5EKYA 1UBSA 5F2IA 2E40A 2B7PA 4K7VA 1UUMA 4X0NA 2EPMX 1A4LA 3AAMA 1S2UA 2CZEA 1LBMA 2PAJA 2SFPA 4B9YA 3Q58A 1QVBA 1W5MA 4CN4A 1UQZA 4IIDA 5K9XA 1OFQA 1UMYA 1LQ2A 1QK0A 5ABFB 4U2ZA 4A4AA 1XIJA 1ZAJA 3R8RA 3ONBA 4FB7A 2Z27A 4XAYA 2YSWA 1VKFA 1EDTA 1A5OC 5BROA 2VEMA 3W74A 4DXXA 1B54A 2E6DA 3GZAA 1XLJA 3OIHA 4K2SA 4DF2A 1XCFA 4CVWA 4RW3A 4Z2LA 4PRWA 5CGTA 2C0AA 1FWRA 2CKSA 2BY2A 1KGUA 2WZHA 4ZQPA 4AWUA 1T8XA 4CD4A 3GG8A 3PAOA 5TIMA 3RK8A 3HG3A 4YYCA 4H8VA 4XZBA 4JTEA 1EGMA 3B8DA 4A22A 3CASA 3TQ0A 3D46A 1ICQA 3NPXA 1KCLA 1K8YA 1ISZA 3PSWA 4Y96A 3GC4A 7PTDA 1J2BA 1HVXA 3I3BA 4R33A 1F6PA 4HNUA 1R7OA 4ZO8A 2XTKA 3IARA 3KDOA 4KGLA 3BMXA 3VMNA 2ZXQA 3PPGA 3FYPA 4XISA 5I5RA 3TDFA 3QLLA 4CEXC 3W7OA 1VJIA 5HJXA 3H53A 3QC3A 3ZR5A 1LBFA 3W72A 1CGUA 4HTYA 3BG5A 3BW3A 2OZ3A 2CZVA 3NEVA 2VYOA 4FLRA 1UH2A 3HFYA 2P8CA 2J27A 3BV4A 2HDJA 2E5DA 2VKZG 5AHEA 1H1NA 3MS8A 4IQLA 2JIWA 4D6FA 4KWOA 2D2GA 4B4FA 2JIEA 4A05A 3LRMA 3VZYA 3R79A 2P10A 2DDXA 1H7OA 2VQUA 2B81A 1Q6RA 5BXSA 1MMFA 4S3AA 8CGTA 2R91A 2GFTA 2E77A 3BXWA 4N9CA 4FNSA 1EZ2A 3PJXA 5LNVA 3UG3A 4URIA 1VFUA 3U4FA 4E6MA 1ZENA 3NG3A 3QGAC 1IXOA 3OA3A 3Q45A 1W5NA 5HATA 4GUHA 3M44A 3OVGA 1IZCA 4PMVA 3OLIA 3BMWA 3IJIA 3VI2A 1XIGA 3QH2A 1FWBC 1TX2A 2OWXA 4L80A 3QR3A 4B91A 3W71A 5IXEA 3QHMA 4J40A 1RK5A 2HBXA 4I7WA 1TV8A 4DWSD 3AS0A 4XZMX 1YIXA 1A5BA 3PJUA 4L1GA 1TYGA 4GC3A 4CGTA 4MUZA 2Z26A 1J10A 4HU0A 5C9XA 1KTCA 5ABFA 3HPFA 1S3TC 1K8ZA 5JIPA 1YNPA 3RAOA 2NWRA 3LA4A 2V0TA 1ONWA 5G1MA 4ZQCA 1UR0A 1J5SA 1HJQA 3U7BA 1US3A 2ZUWA 3T05A 3MSGA 4GI6A 3WQGA 4ZFCA 4DWDA 1X38A 4DJEA 1KR0A 4H6QA 3BAXA 2OU4A 5AFDA 4GKLA 3E2RA 1TTPA 4ML9A 2ZRVA 5HMSA 4EVZA 3QW3A 1G4EA 3LMZA 7A3HA 3AMGA 5DCBA 2OEMA 3THDA 3C4UA 4G9PA 1KM0A 1E1FA 3GXTA 4Z1BA 1KD0A 1OD0A 4HP5A 3T09A 4B5UA 4I7VA 4XZHA 5BRPA 4GVFA 1OABA 5BMXA 4Q8OA 5KZ6A 4PTMA 4Y8EA 3GG7A 2EPHA 4AW7A 2O9TA 1ITXA 3LXBA 4DPPA 2CETA 1Z89A 2QGHA 3URNA 1LRTA 1E6NA 3TMQA 1IXQA 3NGFA 2VD9A 3WLNA 3GXFA 4G56A 5GJPA 4FS9A 4UR8A 3F2CA 1D7FA 1ZLPA 5FF4A 2OO6A 3UT0A 3GR4A 4RE0A 1PVNA 1B4KA 2IQTA 1SW3A 4BI7A 1CLXA 4W93A 2OJPA 1TELA 4ZOBA 1O5RA 3KRZA 2J7HA 9XIMA 1DORA 3NQ8A 4B16A 1ZUAX 3AHXA 2OYKA 1F73A 3NZQA 2Y7DA 1TKKA 4JEJA 1M04A 3TIMA 2C15A 1BD0A 1H62A 3S6DA 3E9AA 2J74A 2ABBA 1PYMA 3M6YA 2XYLA 4MFDA 4W4QA 1DIDA 1XLBA 2TYSA 3GHSA 5E09A 2ZUMA 2VOMA 4DBEA 3P93A 4PUUA 4DF1A 3WDHA 3G0UA 4NRRA 2CLKA 2F2HA 3CZKA 3PTMA 4K1WA 4GYPC 4F3HA 3AI0A 1NVMA 2WSRA 3GSMA 3BAIA 3FEQA 4MKVA 4DO7A 2BASA 4PMJA 2FJUB 4NQ1A 4PB4A 2NQ5A 5LIUX 2INFA 4IMEA 3L5MA 4RR4A 1D8CA 4FOKA 4N9EA 1TV2A 4BJHA 3AIEA 1H4PA 1KC7A 1AG1O 2WJDA 2XDFA 4GYPA 2O4QA 5DF0A 5HAOA 3V7PA 3DUGA 3QY6A 1EHAA 1KV5A 3BG9A 4JR5A 4MJMA 4YMZA 2PWHA 2GWNA 3BUVA 2GGHA 3QRHA 3V75A 2DZSA 3FEMA 5HINA 1E6SM 4JN7A 3CC1A 4MGGA 3F7JA 3KFTA 3HZ3A 4GISA 3ZXWA 2ZC8A 4MFEA 3VXGA 3IRDA 1AQHA 4LUSB 2PTYA 5K9DA 1MUWA 4O0ZA 2O9RA 2F2KA 1DKWA 1CXIA 4X9YA 2A3CA 1OCBA 2E09A 5FESA 2J9XA 2EXOA 2QW5A 2WWCA 4S3FA 5D38A 1SFJA 4QQUA 4RV3A 1F2JA 3AZRA 4ZXLA 1J11A 1L2UA 5G2IA 1EC7A 1E3ZA 5EMYA 3LOTA 4PODA 3B40A 1G7VA 5M2FX 3T4WA 5IOBA 5CPMA 4H9UA 1SFTA 3WD2A 2X41A 4U5KA 5CJNA 1JF5A 4WD0A 1J0JA 3A5FA 4IUGA 1TJPA 2HPIA 1O1HA 3USBA 5I0DA 3H23A 1JL8A 4ICMA 2CBJA 1GKRA 3TYAA 4ATDA 3OIXA 3GIYA 4L61A 1XH1A 1Z3NA 2YDSA 3EKZA 1HZYA 1OIFA 1JQXA 1S2VA 3GS6A 5JBDA 1P6BA 1QO2A 2EGZA 2OXNA 4DZAA 1XYMA 3BZGA 4MNLA 4H2CA 5JH1A 2C1HA 2YR1A 4Z2HA 2RFGA 5FF3A 3WQVA 1M03A 4M51A 5E0FA 1EJ7L 4PR4A 3NVDA 1XRFA 2F61A 1KWKA 1JR1A 2Q8LA 4JDYA 3P84A 2X8RA 4YPJA 3CYVA 4L64A 3VNDA 1JZ7A 1RXOB 3RLGA 3TYDA 1XQKA 3HPZA 2P3EA 3F4WA 3GNDA 3E74A 5DN1A 2J8FA 3LDVA 2ZX7A 3WF0A 1XBZA 3B8VA 4OWGA 1OX6A 3M0JA 3ZJ8A 5C8BB 3SJNA 3ARQA 3QZ6A 3WSUA 2PPGA 3CO8A 3L7RA 2V2DA 3VE9A 3SDOA 2O9OA 3M5YA 3N14A 4ZCWA 1YDYA 2ISDA 1JG9A 2JEPA 1EIBA 2I7GA 3H4GA 1VRDA 2BGNE 1POKA 5A6TC 3WDQA 5C2XA 3CUZA 4UFLA 1LRQA 3MKKA 4W7UA 1UP0A 3TR2A 1M5WA 3DECA 1JZ8A 2QEZA 4MHBA 3W7EA 3KBVA 4ICNA 3K8LA 2FH6A 3LMYA 1E6QM 5M03A 3W7KA 1NDZA 2PDMA 3NURA 4WX2A 4W7VA 4AHOA 1T8QA 4H6EA 2OSXA 2A21A 4C6MA 2FDSA 1KCKA 2CLPA 1Q6CA 4LUSA 2A0NA 2E6AA 3L4YA 2QMKA 4WOZA 2XM1A 4EPEC 3SRHA 4EIVA 5G4WA 2VFGA 4F4RA 2QPXA 4H41A 2Y70A 1KFCA 1UWIA 1CB7B 3MO4A 4GIYA 4ILSA 3UY8A 2XN2A 4K1GA 3W1MA 1JAKA 4UMBA 3PG9A 5H6HA 2DZVA 1BAGA 1O95A 4X3ZA 3WQPA 1NDWA 4OT7A 4MM1A 3IGXA 5HULA 2BY1A 2XVGA 1XYZA 5G4EA 2AAAA 3J7HA 2O0TA 2V5JA 4UTTA 1ESWA 4N4QA 3SCQA 1NIUA 3I6RA 2VTFA 5JUVA 1BFNA 1W1VA 1MI3A 3TQVA 5FAJA 4LT9A 3DN5A 1JULA 1EIXA 3STFA 3TKFA 4NJGA 2CHOA 3KBSA 3MZNA 1PB0A 3GVGA 3AC0A 2L5HA 5D37A 4GY0A 4TO8A 2GVYA 3SB0A 1ADOA 4NZ1A 3VZZA 3V3WA 2GJRA 1EZWA 3BOFA 2W61A 3HB9A 4XAFA 4I5XA 4QCFA 1ZTVA 1GQLA 3HJEA 5CH9A 1Z8AA 3N9SA 3L2IA 2Q09A 3L0GA 3FSTA 2QF8A 4IISA 2WJEA 4I8DA 1L9WA 1B90A 2E9MA 3CUGA 3A3WA 3K13A 1AD4A 3QEZA 1KRCC 1TIWA 2GUYA 3LGDA 1DJWA 3PNZA 1XQLA 3W7PA 1I6NA 1OADA 1TTJA 1AJZA 3UESA 4O54A 4LNYA 3VX1A 1CNVA 4IG2B 2PF8A 1K7FA 4J7RA 5D32A 5BU6A 1WOBA 1JGIA 4AIOA 3BMVA 4GGBA 3H22A 5EMMA 3IVTA 3NM3A 1VB9A 4X9SA 3AS3A 1WV2A 2ZUSA 4HYRA 4GVGA 2PRHA 3CT7A 3IIOA 1LT7A 3NVTA 1W8SA 4M80A 1HGYA 1JD7A 1FP8A 1OBAA 1U5JA 2WHKA 3UVAA 2WBGA 4JTJA 3W7CA 3AMKA 1DJQA 2BLEA 4UNLA 4H9ZA 1TPUA 2WXDM 3BO9A 3KVMA 1ISXA 4M6PA 3O1NA 4GC4A 3L21A 2YYTA 2VZTA 5A2AA 3WLKX 1KM1A 1RQHA 1T96A 3ATZA 3L4UA 2PP1A 1YMYA 4O57A 3XINA 2Z4GA 4YU1A 3DFTA 4F0RA 1HO4A 1OD8A 4MDOA 4PCPA 1PTAA 2J9ZA 3TSDA 2VRKA 2FVKA 2W63A 3FOKA 4EPBC 1W5PA 3QXBA 5CPLA 3WZ0E 1DOSA 1EL3A 1IIGA 4MMWA 3OQ8A 4LCRA 1L6GA 7REQB 2RKXA 2J8TA 3KTSA 3GW0A 4B3KA 3T44A 4UQCA 1CGWA 2RJHA 1KTNA 4YJ5A 4JIRA 5D09A 3W37A 1C3FA 4NX5A 3SGZA 2HVNA 5HBFA 1BGAA 1GOKA 2WANA 4IP5A 4KEVA 1F8IA 1V6VA 3KW3A 3MSYA 2EAWA 1G6CA 4DZHA 4NNCA 1GOXA 3WQ4A 3M16A 2R1PA 4HMDA 4XK2A 4AISA 3AMCA 3VOFA 4O15A 4I9JA 1CDGA 3ARYA 2I5GA 1UUQA 5I23A 1FCQA 3BGGA 4PYSA 2E5CA 2PLMA 2V82A 3R0UA 4TMCA 1I1WA 1OT2A 1E9IA 5CSYA 2FH8A 1XIMA 1UD6A 4IG2A 2EG7A 3I68A 1LOQA 3BSGA 2CLIA 4EWND 1R2SA 1V3JA 4NHVA 3IUHA 2BMBA 2E9LA 3VKKA 3TYEA 1GOWA 3HMJG 1LUCB 2E25A 1OYCA 3R10A 1E0WA 1I1XA 3SCNA 4HN4A 3MHUA 1MQRA 5G2WA 4ZENA 1UG6A 3UJSA 2YGYA 3N25A 3CV7A 3QF0A 1TQJA 1QU4A 1SM9A 2WKLA 1VRXA 4MZ8A 3QY8A 1W9XA 5FF2A 3CTTA 3T0TA 3W87A 4HYWA 1TPDA 4O13A 3P7YA 1RHCA 1R6WA 3EOSA 2P76A 3F4DA 2F8QA 1KFJA 5AHMA 2BVWA 1QOPA 3PZMA 2CLLA 3VOGA 2HISA 2Y2WA 1ZSXA 4DYJA 4H7CA 3BAJA 2IKIA 1H7WA 2E28A 5FAGA 2Y63A 4KIEA 3LHWA 3N4EA 1KTBA 3IK4A 1W3LA 3GAKA 3TN4A 1GQIA 3OVPA 4UZUA 1WZAA 1AW2A 2OWCA 3B0PA 2BTMA 2B7QA 4PMYA 3KX6A 1UD5A 2GGIA 5D8WA 4D6GA 1T0OA 1UR8A 4JTHA 1RJQA 3C8NA 2W4XA 3AXXA 3F5LA 1K70A 6ALDA 3LRKA 4DBSA 4R53A 3UJRA 4WKFA 3AIUA 2BVTA 1ZBKA 3HPSA 4NZFA 3T08A 2R1NA 7REQA 3IS4A 3CZLA 3TP4A 3B8SA 3PZNA 2PTWA 3ABOA 4H8NA 1B3YA 1NF7A 3UWYA 3GIPA 3SI9A 3GAYA 4A8IA 1FP9A 3CMJA 1EA0A 4A6GA 5A3HA 1OCQA 1GVEA 1V02A 5EBAA 3LB0A 4QFUA 2ZE0A 4KEZA 3SADA 1S46A 5T91A 5FJPA 1UA7A 2J7BA 4K38A 1QXLA 4RZ5A 2ZDSA 1GZGA 3NQ2A 1OCNA 4O53A 2W27A 3S1GA 4Q8PA 1FA2A 5HJLA 2IQ0A 5GVJA 1ODUA 4N7QA 3S4TA 2WSKA 1J0IA 3G1RA 3PZVA 3QQ1A 4K39A 4QISA 3WK2A 4E3VA 4MZ1A 4IJCA 2J24A 1SZRA 1ONEA 1BTCA 1ZU8A 2NX9A 3O07A 1R3SA 2FHCA 4HHHA 2QV5A 4DXKA 1V3LA 3APYA 3DYPA 4L7ZA 3RIKA 4IZGA 2VVNA 2GZXA 1RCXB 4LALA 3O9NA 3K4AA 2QUNA 2EF9A 1QI5A 3W1TA 2YL5A 1MW2A 3DC8A 4XAPA 3S1WA 1OCJA 1LUCA 1C90A 3OODA 4XZ9A 1GVYA 2PTXA 2VCCA 4TX8A 3EX6A 4GCXA 1H60A 2R1KA 3IGHX 4FXSA 2B7OA 1M01A 1JCMP 2QVNA 4KBXA 4OV9A 2ZFAA 3C3NA 1EEPA 5AC8A 2YFNA 4HCLA 1XS2A 2WHJA 4B9ZA 4O1BA 2C14A 2YOCA 3OQEA 2C1GA 3CV6A 3RU6A 1FUYA 3SUUA 3MCOA 1YXCA 5HWMA 1B57A 2I17A 3K1DA 2TRSA 3BH4A 3CQKA 5G5IA 3TUUA 3EWZA 1JDCA 4MB3A 1M7OA 1KCXA 4Z0SA 2VDGA 1QNQA 1LT8A 4KEMA 1EXPA 1ECEA 4I7UA 2UY4A 3WD3A 3Q65A 1I9CB 5I3HA 2ZA3A 4NILA 4J35A 3U2CA 3AU6A 3BJFA 4UOJA 4F66A 3CQJA 2QJMA 3L23A 1J0KA 3LENA 3MP3A 1XFBA 1O1ZA 2F84A 3GU9A 3VFCA 1FDJA 4GK8A 1ZB5A 1TWDA 4EAYA 4ONVA 1AQFA 2D69A 3IEBA 3DENA 3BLFA 3PBUA 1FCUA 1KBBA 5JU6A 4Z0JA 3PPFA 3KOXA 1LM1A 4HZ7A 1QR7A 4N42A 2PWEA 3B3DA 3GDLA 2NLIA 1RPKA 3GXMA 1MZHA 4PBFA 3GIQA 1XBXA 4DYKA 3E0IA 2PMQA 3EX4A 3WMSA 1XDLA 2KZHA 3PBGA 4X2PA 1GVIA 3VZXA 4ZMGA 2AOSA 3G77A 2HTMA 3UEQA 4X61A 2YJQA 1BSLA 3T0CA 3AIRA 3UZYA 1NJJA 1R3TA 4DI9A 3QSRA 4GXMA 2PC4A 3MWAA 1DQXA 3GNRA 4I5UA 5D4YA 3QVQA 2EKCA 3DZ1A 3FS2A 4E4UA 5K9CA 2OQYA 4QAIA 1ONXA 4Y9AA 3W7LA 2PD5A 2P0IA 4R7JA 3N9KA 2ZUTA 4PSRA 4GKTA 1GUVA 1YNQA 3L66A 1ELSA 3M0HA 4NXSA 1SSDA 3T4CA 2XG9A 2ZX5A 2E0PA 2YW4A 1UA3A 1DTNA 3RLHA 3IJ6A 1IZJA 2YZRA 4B5XA 2VXNA 3QHNA 4ALDA 2JK2A 4PBGA 1FY6A 1MQPA 4GPNA 5TD4A 1XGZA 2DT3A 3BWWA 1C9WA 4W5UA 4F48A 1EP3A 3UR5A 1CENA 1G69A 4B2DA 2R14A 2ODOA 1BHGA 3W1NA 2GVLA 4A2SA 2G3JA 4L5ZA 1QI2A 5CCZA 1F4AA 2P1FA 4ATWA 1AMYA 3S0CA 4GVIA 4XBSA 3W25A 3DOPA 2TPSA 1WE5A 3L2LA 3R1ZA 1I75A 4ZOEA 1UMLA 3MHFA 1EC8A 5AY7A 3BE7A 4HNNA 4P7OA 2VDHA 1PX8A 1XYFA 1J4EA 4KS0A 3AZSA 3SJ3A 1EO5A 4PMOA 4RV8A 1M1BA 3IVUA 1LWJA 2PLCA 4CQBA 3WN6A 1CXHA 1AUSL 4HCDA 3GO2A 2FLIA 3F5KA 1XKJA 3UCDA 1HJUA 3GRIA 3QV7A 1DJHA 3RGTA 3C56A 3TYZA 4ORIA 1C7SA 4DYEA 4QQ3A 4I9TA 2ESCA 4NNAA 5HUOA 4AIEA 4M6UA 4LUYA 3DFSA 4CD7A 1WZKA 1ZPTA 4LAKA 4PEKA 1HJWA 3LTPA 3L0KA 1XG3A 3A47A 4D9PA 2PDCA 1U5HA 4C7FA 1SJAA 3SCOA 3R7MA 4IICA 1T41A 1IT0A 3MDUA 4QJ3B 1XKYA 1LG1A 4AC7C 1Q2RA 3ANYA 1PE1A 5CPSA 2CLEA 5IDIA 3W7IA 1Z7AA 5K3VA 3STGA 1ITUA 3G22A 3GQYA 5DRIA 4XWUA 1W3IA 2BXVA 2HJPA 3WFLA 5K4XA 3S2CA 1TE6A 4ZA0A 1WDRA 4HU3A 5DBUA 1K4HA 1W3TA 4QE5A 4XIAA 1UC4A 4IGNA 4S2CA 3LN3A 2EO7A 5EA9A 1DJYA 4LCQA 3W26A 1QK2A 3AZTA 2OEJA 3LG3A 2Z7GA 1SFLA 1AJ0A 3K8MA 2OPJA 4NAEB 3G1DA 1TVLA 3FYOA 3LCLA 1NQ6A 3DYMA 4XBKA 4E3TA 1TPVA 5D2VA 1RBAA 4E2DA 3L5AA 3T8LA 3NM1A 3V4BA 4XUGA 4J27A 3WUFA 3VA8A 1XLHA 4LNCA 3LBCA 5FF7A 3VDBA 1ADSA 1E1EA 1U1JA 2X42A 3OOQA 1JI1A 4AZHA 5EMKA 2VOTA 5GNYA 1VEPA 3JVAA 4G2DA 2CLHA 1AQ0A 1ZY9A 5CKSA 4ZTXA 1KKOA 4F2TA 4HK7A 4B15A 4HVXA 2DEPA 4S2BA 1SMDA 3L4TA 2DW6A 1B30A 4BA0A 3F4CA 3NXLA 4UUIA 4TV5A 4XZIA 3WNPA 3LNPA 2HE5A 3WQEA 3C0SA 1U22A 3SSJA 2V3DA 4LS1A 4CD5A 1PAMA 1BF6A 2J25A 3I6TA 3QPZA 5I00A 3H12A 1VCVA 2O9PA 2VX6A 4LRSA 2DH3A 3PZGA 1UZ1A 3TLLA 4EPKA 5F2LA 1B3ZA 5FJRA 4NASA 1PKYA 2AKZA 2QIWA 3MMDA 1RLCL 1PEZA 1EP1A 1OFRA 2D2HA 4HMCA 2YA2A 3LRLA 3DKLA 4UFMA 2J88A 2Q3OA 1Q6GA 3NL5A 3W00A 1OM0A 1XICA 3FDGA 3GC5A 3FCPA 4QE4A 2JGQA 3EKGA 1UOZA 3U48A 1IR2A 3LD5A 2CW6A 2CZFA 4M24A 5LHFA 1WKYA 3WO8A 1KM5A 4YYFA 4UQBA 3CB3A 4Q8WA 4GUGA 3CEUA 4R9XA 3P8IA 3ZLHA 4YL2A 1EYEA 5DY2A 3I4EA 2C19A 2XFYA 4W8LA 3U4AA 3WBEA 4GINA 4Y9OA 1REQB 3VKCA 2Z1XA 3FAWA 2D20A 2Y62A 2FB2A 2W62A 3QZEA 3ES7A 2E9BA 4GX9A 3VCCA 1JZ4A 2V69A 1YPIA 1W31A 4AHQA 2W0UA 3TW7A 1W54A 3C2RA 5DO8A 3PTKA 4HHPA 4CQ8A 5HDRA 2YKKA 3GR7A 3RN6A 2X0YA 4QM1A 4RNHA 1B3VA 3LV5A 3RFAA 3FDKA 3FVDA 5FKYA 1OIMA 4ENLA 4NKCA 2VO5A 4HNLA 4NZ3A 1L2QA 3GHRA 1ZP4A 3WL0A 1JCLA 1KBIA 3JZUA 3KL5A 3GZ3A 2QUMA 1OK4A 3MU7A 1GG0A 3P80A 4M6VA 4UZSA 1Q8JA 2PE4A 3ITTA 5LIXX 2GSEA 1PHQA 4MWAE 1FWSA 1SO4A 3VNJA 4E2BA 1BEUA 5LIYX 1E40A 1QI0A 1D3GA 3N13A 2CFFA 2W9MA 4N9BA 5A94A 3E12A 1QDSA 1KRBC 4CN1A 3PANA 4FNUA 3AHVA 1MSSA 2OGJA 4LY4A 3GK0A 2PLKA 4GQRA 4B5SA 5FCZA 4JTTA 3EDFA 4H8HA 2V67A 1A5MC 3NYDA 2DFAA 4G8TA 3W4RA 4NAFB 2XSXA 3VIFA 4FLSA 4KGJA 2DW7A 6TAAA 5I7GA 4IUOA 2A7PA 4K68A 3UCCA 1F05A 4OU1A 3UR2A 4JFUA 3B9NA 3W88A 4B2DD 1Y5XA 2WMKA 1V6YA 3BVJA 3NOYA 5XIAA 4BF9A 1GZ1A 3H4WA 4AUBA 1OYAA 1P1MA 2BNJA 1XSJA 3PUOA 4J4KA 1O5QA 5JXQA 3IJ7A 3IAPA 1CX9A 1Q7QA 4OOZA 4QRNA 4EF8A 2MUCA 1L8NA 1F74A 4QDPA 4PA8A 2QS8A 3SAZA 1JFXA 6TIMA 1ZGDA 2X0HA 1TQXA 5BWAA 4US5A 1EJUC 1NTHA 3DGBA 1T99A 4DELA 2Y61A 3V5OA 3M7SA 3ZIZA 3O6DA 1UJQA 1JYWA 2FTPA 1EF3A 1HJXA 1PBGA 2QNEA 3W83A 1WDDA 2H6RA 1REQA 4V33A 3PTQA 2GVJA 3MI2A 3B0VC 3W2LA 4BWLA 3AMLA 1K02A 3H7UA 1V6XA 1FOBA 1FXQA 2D22A 3VX0A 3EB3A 5KTLA 1F76A 2FYMA 3LTSA 4IF2A 1TUXA 2XGZA 4LXFA 2J78A 1TJ0A 5LKYA 2EPNA 5EBUA 5FEWA 1QOXA 2JE8A 4DUXA 1JUEA 3MKCA 3L12A 1P48A 3PZOA 3W7GA 3BURA 1R2TA 4NZCA 4OQVA 1TWZA 1ZJIA 3CT2A 8A3HA 3B0UX 3OLEA 4E8DA 1DXEA 4GI9A 3LZ5A 2HZGA 3G3DA 1A3HA 4CCDA 1UR4A 4FR6A 3GH5A 3UYIA 3H55A 1NP2A 1ZL1A 3AIWA 3F2BA 4KF1A 2TMDA 3FAXA 3OB8A 4CD8A 3CL7A 3LPFA 3I7QA 4GI8A 1XH0A 1UOKA 2O92A 2V8ZA 3CIWA 3UJ2A 3CH0A 4NUWA 3RNDA 2A3AA 2VHLA 3JZEA 2ZZ7A 2A5HA 2NV2A 1YX1A 1SSGA 3JU2A 5DBTA 3DI0A 2PRLA 4J3XA 3ES8A 3NDZA 4XKMA 4XZNX 1OVDA 4GQGA 5DRCA 4IPPA 1GW9A 3WKZA 2Z28A 2G50A 3PN8A 2V3FA 1RP9A 3A24A 3UERA 5A6BA 4NAFA 3AHYA 3TWBA 1K7EA 4F9JA 2EQDA 1YTEA 1LLZA 1Q66A 3ZSTA 1DWGM 4PMDA 1RV8A 3WUBA 3E5BA 2XIMA 4WXZA 1MUMA 1E4IA 3P62A 2OT1A 3POHA 1QNPA 2ONEA 2OLAA 3ITOA 3SY1A 2QKFA 4QROA 1WDSA 4P8VA 3CWHA 1ZBVA 3S2MA 3UR8A 3L68A 3DH7A 4WSKA 3MUCA 4V1YA 4PUJA 4AXNA 4TX6A 5CPQA 4YXGA 1PWMA 3MQTA 3MP4A 3SCTA 4E8CA 1HJSA 1RCQA 3WUGA 3PR2A 1RSCA 4QEHA 3N19B 1O5KA 2QDHA 3WJXA 1OG6A 1Q2SA 1UQYA 1SR9A 4F2BA 3OVQA 3WENA 3EWDA 3HOJA 3B9OA 4Q7NA 4CNSA 3BOXA 1FHDA 1IEXA 5FF0A 3BLPX 1CYGA 4DF0A 3ZYZA 1VBRA 1EUAA 4U33A 4ZEPA 3LCXA 4MKNA 2WCSA 1A5UA 5E1QA 3LY0A 3VDHA 4LBUA 4LBRA 2DSWA 3U7VA 3TXVA 3N17A 4OBTA 3T0DA 3TE9A 3UGVA 4FA3A 2Z7KA 3ZT5A 2HWGA 3ALGA 2R8WA 3TWAA 3IJ9A 1OFAA 2FZ8A 1D8WA 3IACA 4NP7A 5A5WA 4AU0A 1MEIA 3KAOA 1W1IE 2VEKA 4Z2JA 1EO7A 4IXHA 2GQ8A 3VC6A 4JTSA 3O06A 2UY3A 1TR1A 1SO3A 2ZRZA 3WYZA 2VZSA 5A6MA 1G4SA 4N2YA 2DSUA 3WQ6A 3M7WA 2WVTA 3OW1A 5HNNA 4JPGA 1MXSA 4HHMA 5GNXA 3MTWA 1DWIM 3CLWA 4EF9A 1JFHA 3VOCA 2ZE3A 1Q65A 3BLEA 3TTEA 2Q8ZA 1ZS2A 3VKAA 1NP0A 1J6PA 3AIQA 1N2VA 1J0HA 5J5RA 1PPIA 4PTWA 1JD9A 2Z1SA 1UD3A 4O10A 1NARA 3CB8A 3TN3A 3OGVA 3UA3A 5F7UA 1VP5A 4GIAA 5G1YA 4AD4A 3W1RA 3N29A 1K6WA 5FJIA 1NQKA 3BZJA 4LVAA 3PBWA 2QDDA 4XD3A 3C6CA 1W3KA 4LAUA 3E49A 2ACSA 3DHUA 3N3TA 5T9CE 1ZJBA 3ONCA 3GTNA 3QV8A 4FSAA 5FD0A 1J2WA 1G01A 2VFFA 4AWSA 4PCFA 3WD0A 3VUSA 1RD6A 3G1YA 7TIMA 3KHDA 4C5ZA 1SMAA 4LYPA 5C9WA 2ZVIA 4H3DA 1OFOA 2V5LA 3GFXA 1WKDA 4S3KA 4NI8A 2DT1A 2PP0A 5HK4A 1IEIA 2DV0A 3T7VA 3R11A 3DHPA 4LPCA 5I3GA 3UZWA 2JF6A 1RVGA 3NO1A 2IKGA 1TPB1 2OEKA 3S9IA 1GNXA 3TV8A 3HV8A 4MJZA 2X1IA 3LHZA 4FPSA 3W2KA 4GXWA 4IP7A 3RDKA 2NXGA 3K1GA 2XZ9A 1XUUA 3A13A 4NX0A 2FGLA 3MUZ1 2FPYA 1JCJA 4EANA 3CNYA 1BVWA 5I3FA 1XP3A 3G8RA 1W1A1 3ZJ7A 1W9DM 1S5WA 1YNYA 2ZZ1A 1DV7A 1KXVA 2PWGA 4L9YA 1SR0A 1OYBA 2HQAA 4N6FA 4HNVA 3G8EA 1A5CA 1EFZA 4FALA 2WLZA 3LCFA 1RVKA 3AO0A 1IZKA 3Q94A 4AAJA 1B3XA 2DUZA 3NO3A 4L56A 3UWQA 1KA9F 1NU5A 1PYFA 2TSYA 4KWVA 3W70A 5A8GA 4EOUA 1R9ZA 1PKNA 4EXBA 1H2JA 3NCOA 3NDYA 1Q6DA 3WK3A 3OZYA 1O60A 4A29A 5G1TA 4B3LA 1P7TB 4JKKA 2C0HA 4US6A 1UR1A 3V1PA 4UTFA 1Q6OA 4DWSB 3GDRA 4P2VA 1M53A 3CZEA 2FIQA 3T9PA 2RDUA 3WF2A 3S6TA 4DX3A 1M68A 1UYQA 1OF8A 3BANA 2QUUA 3KOFA 3OYZA 1HN1A 4DPQA 4V28A 1RJPA 4QTGA 2BZNA 3ZS4A 1S5NA 2J13A 3BLLA 5KZEA 3VDGA 1LTDA 1MW1A 1Y5VA 1W91A 1FWJC 4YHGA 2V5KA 5TF0A 4NYYA 3WEOA 2Z0IA 3MJMA 1XFCA 2V5DA 3UG5A 2E6YA 4P7QA 3FW6A 4UTUA 4F0LA 2Y4SA 1MQQA 2QCEA 4DJDC 3PFMA 2QAPA 1TWIA 4LYKA 4CNTA 4KETA 4DLMA 4HPNA 1EBGA 1S1PA 2O7SA 1RA5A 3QMTA 2A3LA 3NPWA 2DPEA 1XR2A 3EX2A 1QWGA 3NA8A 4HPGA 3W7RA 1XIFA 1BKHA 5DMYA 1G1YA 1UUOA 3EX1A 3W85A 1WDPA 1WXZA 2YZ5A 3GHTA 4B90A 3PWGA 3NQGA 3MCMA 2OFJA 3BK0A 3VFLA 3PBYA 1QPOA 3OP2A 1I45A 2XINA 1TSIA 4JTGA 4LU0A 4GZJA 4DO5A 3LNMA 3UXKA 3UG4A 3VNYA 3N73A 2PU0A 2VZOA 2A4AA 1F4HA 2NWSA 1QPRA 2FZNA 4HA4A 1XI3A 4UCFA 2D2JA 3W1QA 1E1CB 4HYVA 2Q8XA 4L4OA 5AHIA 3SFWA 5D9NA 4J2MA 2D73A 1HL9A 3HFTA 4UTKA 2DZBA 5AC6A 2R82A 1W1YA 1ZHAA 3OZMA 3C5QA 4REQB 3P61A 3DESA 4LFYA 2NQ9A 1V0NA 2PDHA 3QQWA 3GY1A 2BXYA 2XIJA 5A6BD 3TK7A 1K1DA 2FMOA 2PGWA 4AFYA 4PTXA 5DXXA 2PODA 4E4PA 4O4VA 4HN8A 2EBNA 1TV5A 1P7TA 2DJXA 3WF3A 2BVYA 1JZ6A 1UD4A 1GG1A 4X63A 2C7FA 1DIOA 4XVEA 4DWSA 3WCZA 1A4MA 2G3IA 4U3CA 4H19A 4PMZA 3GNXA 3OVRA 4XKYB 3EMZA 2FPVA 3LCHA 3NQFA 4MY8A 5DT7A 1DE5A 2AQWA 3WQWA 4G7FA 4QLKA 1JPMA 3ANUA 4S23A 2GGJA 2IUZA 1S2TA 2YBUA 3UWEA 3M0ZA 3BJSA 5CZ0A 3A6OA 3HBLA 2Q3RA 4ZQOA 4BF7A 1DJXA 1YBQB 4K3ZA 5CGMA 1YADA 4O28A 1OFEA 3HGSA 1ISWA 3CM4A 3HJZA 3DAQA 2E1WA 4BR1A 3LCGA 2W3ZA 1YXDA 3VDCA 4JQAA 2IS7A 3W1AA 5CG0A 3PBMA 4PGLA 3H70A 1KM6A 4IGSA 1CT5A 1PSCA 2OKOA 1PS9A 2NLYA 2PTZA 4FP1A 4JYDA 1XLEA 3ATYA 4UQDA 4JX6A 1BXBA 4A8LA 5AYIA 4JIQA 2YIHA 4R7OA 1GZJA 4DJFC 4TVUA 6ENLA 5KZMA 4WRHA 3GU2A 1CXLA 5C7HA 3A9IA 3S5YA 4TVDA 2E1DA 2NW0A 2QF7A 3LUTA 3U6WA 2IW0A 3QSTA 4D72A 3DHFA 4UTMA 3OU8A 1GOQA 4DM2A 2YX0A 3PK7A 2QCGA 1FDZA 4TR9A 4ZB0A 4ACZB 1XCXA 4R34A 1E1CA 2ICSA 2UV8G 4PSPA 2PDXA 1A53A 1K3UA 2AL2B 6PTDA 1GJPA 4D71A 1U5VA 3KTCA 3N6HA 1HL2A 1G5AA 3B04A 4D8LA 2QYGA 5CJ5A 4UB9A 1KGWA 3PJWA 1F7BA 5D9PA 1QBAA 4V2XA 1W3HA 4REQA 1E0UA 1AMKA 1XSKA 4FHAA 3D0CA 3HURA 3IJLA 2QCCA 4B3ZA 1VBGA 3NSNA 2PDGA 2VC6A 3DFYA 2JBMA 6CGTA 1W8GA 3WLQA 3PVFA 4PUEA 3RPTA 1IEWA 2YA1A 3WEZA 2WJZA 3COTA 2ZA2A 3ZVHA 5D03A 1TCMA 2OSYA 4WJEA 4AZ7A 4O12A 1GVOA 4KCWA 7CGTA 3WDPP 4JTAA 3TZFA 3CLMA 4OE7A 3TLQA 1DQWA 3FLUA 2V30A 2QHAA 1JZ3A 3G1FA 4C1NB 3MUXA 1MW3A 4HKPA 1XYCA 2VL4A 4AD5A 1V4YA 3W76A 4KFOA 3MMUA 3ZMRA 4XKYA 1E6RA 4IIFA 4WLCA 3M0XA 1ZAHA 5DEZA 3H6OA 1U2YA 3R94A 4J3SA 1UD2A 2VENA 3I3DA 2HMCA 1M7PA 3LQLA 2OG9A 2WB5A 4LW7A 3CV1A 1PTGA 3RPMA 1V3IA 4XO7A 1HT6A 2DZUA 3VPLA 3SO7A 3LZ3A 3OG3A 2QMJA 3CQ0A 4QJ4B 2ISFA 1YBQA 4DM1A 3O2LA 3EOLA 2G4FA 2X7VA 1ZJAA 5CC7A 5H1WA 3OBKA 3TONA 3S3GA 1L6WA 5T26A 3EWBX 4AMCA 4JL2A 1EJSC 3W1PA 1WOAA 1B2YA 3AU2A 1X6NA 2I57A 4D8AA 2Y24A 1UIOA 1ZBWA 3P74A 1R30A 3S83A 1OJXA 3O0KA 2W79A 3VGFA 4UQAA 1XSIA 1Z9AA 1UROA 5E0KA 5CZSA 2EKGA 2ZICA 1OFDA 4MNJA 2VFHA 4FO4A 2D1ZA 4RKAA 3GXPA 3TOPA 8RUCA 1PWLA 2ZX9A 2UY2A 2DIKA 4WKAA 2YCEA 2XWEA 3W22A 4AYGA 4RE4A 3KZPA 1BYCA 2XZ7A 4ACZA 1R3YA 2RDXA 4IMDA 2Z1VA 2J6XA 2YB1A 3LI1A 2AL2A 4JQ2A 3WMLA 4AB4A 2PD9A 4QLJA 4XTIA 1E56A 1GHSA 3SCPA 4C91A 4PH6A 2YLLA 4AZIA 3WQFA 3VNKA 1HUVA 4Z17A 1SZNA 3B05A 1H1ZA 3NR0A 3WD4A 3W7NA 1X39A 3OLDA 5T9BG 3W7QA 1RD5A 4KFPA 5XINA 4C1KA 3MUAA 3YPIA 1PV8A 1DJIA 2V6AA 2POTA 3T8QA 4HOXA 1H51A 2FJKA 4UBPC 3HO8A 1E72M 4HCHA 4LS0A 4IIEA 2ACRA 3WLLA 4HZ8A 3G1AA 3UCQA 3C0JA 2HEJA 2NXIA 2ZOXA 2D23A 2JEQA 1E6PA 2FGBA 3KRBA 3M1ZA 2ZWYA 3UZJA 4Y2WA 4C1NA 5BOOA 1W1ZA 3N11A 1XDJA 4XBJA 2NXHA 3PZIA 4RDZA 3K5XA 2Y0FA 1SJCA 5CEWA 4F0SA 1BXCA 3KLKA 4OV4A 3I10A 4LEFA