2Z2UA

Crystal structure of archaeal tyw1
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
279
Chain Sequence
MIPEEIYKILRKQRYQIDGHTAVKLCGWVRKKMLEDKNCYKSKFYGIETHRCIQCTPSVIWCQQNSQIKEPKWEEPEVVYEKILAMHKRIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVSNGILTDVIEKIEPTQLYISLDAYDLDSYGGKKEYWESILNTLDILKEKKRTCIRTTLIRGYNDDILKFVELYERADVHFIELKSYMDMLQHDEILKLAKMLDENSSYKLIDDSEDSRVALLQNENRKINPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0026 protein MJ0257
publication title Crystal Structure of the Radical SAM Enzyme Catalyzing Tricyclic Modified Base Formation in tRNA
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 103
structure length 279
sequence length 311
ec nomenclature ec 4.1.3.44: tRNA 4-demethylwyosine synthase (AdoMet-dependent).
pdb deposition date 2007-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF08608 Wyosine_form Wyosine base formation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z2uA00
3A5FA 2XN0A 4YWIA 1VGAA 2VFDA 3LGEA 4YLWA 1LOLA 4XKYA 4D2JA 1KTCA 3G8RA 1YTDA 3DHDA 4NJKA 1P5BA 1W5OA 1H5YA 4DELA 1TQXA 3IGXA 5F4SA 5EL1A 1PL9A 3LLDA 1K7FA 4Q33A 2ISVA 1LDCA 1DJQA 1WV2A 3STFA 2RFGA 3MP4A 3PUOA 3DFOA 3L2IA 1F05A 1DQXA 5G4EA 3UPWA 3JS3A 4MY1A 3EXTA 2HSAA 4H6KA 4JIQA 4PFMA 3GDTA 1OX4B 2F84A 5D30A 4L4MA 5G1TA 2O7QA 1ALDA 4PODA 1TPC1 1OX5A 3KFTA 1MEHA 3I68A 4OE7A 4ICNA 1XXXA 1TQJA 2VC6A 1XM3A 3P84A 1FWTA 3PBYA 3P82A 2J27A 1TTJA 2V8ZA 3NG3A 3EB2A 4L4LA 4AF0B 4NT0A 4YXGA 4BWLC 4NVTA 4UNLA 2ZRVA 3G1VA 5KZDA 3W7QA 3ABQA 1TIMA 3WJXA 4CCDA 2WO5A 1QAPA 2A7NA 3MP3A 5DCDA 3A22A 3BPWA 1GEQA 3N2MA 4ZQRA 1IXNA 2EHHA 3TDFA 5IBXC 2HMCA 4Z08A 1LOSA 1OK4A 4RKAA 3LI1A 4O54A 5D32A 5KINA 1OYCA 1ZAJA 4N6EA 5TQLA 4GC4A 2DZPA 2Y85A 3ZS4A 4R53A 1TSIA 3TAKA 1PIIA 4IGHA 4W9TA 3ANYA 2VFEA 5F1VA 4K38A 4X22A 3KVLA 3P80A 3QSTA 3NQVA 3HPXA 3QF0A 2E5DA 5F2LA 3CEUA 4N02A 1KW1A 1YPIA 1UB3A 3VNDA 1ZJIA 5CPOA 1JQXA 4JTIA 4AMAA 5FF3A 3TXVA 1TREA 2QJHA 1LROA 4IMEA 5GVJA 1SW3A 3V75A 2FJKA 2E6AA 2VXNA 3B05A 3B4UA 3W7JA 3SIZA 3M7WA 4LW7A 3LCWA 2QUUA 1TV7A 2QCHA 3C0JA 2WOQA 3LXBA 4O17A 1QO2A 1JCYA 4OQVA 3C2OA 1YXYA 4DO6A 4FXSA 3STCA 4QNWA 4HNNA 3WJYA 2EGZA 3BVJA 2WKJA 4XQ6A 2DJLA 3NQEA 1SSDA 1GPWA 1N55A 3CIWA 3M44A 3SI9A 4AWSA 1LRQA 2QCLA 1G7VA 1KFEA 5DN1A 4RR4A 4O10A 5D2WA 2OX1A 1FQ0A 3W1AA 4HN4A 1KM0A 3EXRA 1J4EA 3TC6A 1UCWA 2ZCGA 1CI1A 3PB2A 1SFLA 3LRLA 3TW7A 1IGSA 2YDAA 3YPIA 4GUHA 4X9SA 2J24A 3HG2A 1UBSA 1Z44A 1DQWA 2JKAA 2NWRA 3GAYA 2Q3RA 1KA9F 3A23A 2VKZG 3LXCA 2VENA 1XKYA 1KBIA 3O1NA 4LV4A 3KRSA 2JGQA 3KOFA 4ADUA 2DORA 4DPQA 2VFFA 5EMUA 2DP3A 4NZFA 4UTKA 4UFHA 3HG4A 1H7WA 4IPIA 2QCDA 3LXAA 1TO3A 4MYXA 5HUPA 1LLWA 3IGSA 1T8XA 3CM4A 5D38A 3UWZA 1EX5A 3W76A 3VE9A 1W56A 2RKXA 4IX0A 4LWWA 3W7LA 3HQ1A 1FDJA 1XBVA 5EPDA 1DKWA 5G4WA 2TSYA 4PL1A 3ATZA 3M0ZA 1S5VA 1KFBA 2QCCA 3WK2A 4GFSA 1ZENA 1T96A 1F5ZA 3W75A 1R47A 3W74A 4JDYA 1OFPA 1LBFA 4MZ8A 4KWVA 4NX0A 3LBCA 1P4CA 3NQ6A 4LS0A 1YLVA 4XTDA 3TH6A 4RZ6A 1F2JA 3U8GA 4WY0F 1H62A 2YR1A 3HG5A 1FWSA 3OVPA 2A5HA 5FI8A 3BW2A 2QAFA 1OK6A 2QCMA 1B3OA 4IMFA 2VEMA 1TPFA 2NWSA 3I65A 3TE9A 3GAKA 3M47A 3PC0A 4JTUA 4E38A 1GZGA 1GVSA 4UTTC 1OVDA 2BTMA 3NYZA 1A5BA 3QEZA 1CX9A 3GDRA 3F1QA 4UFIA 4RZ5A 4RCXA 1K8YA 3BG5A 3IV3A 3MHFA 3NDOA 1FXQA 2VFGA 2ZA2A 5G2HA 3LBMA 4MPQA 4UIOA 1JJKA 3DH7A 1SFJA 3CLMA 1U5JA 3M6YA 3EKLA 4O53A 5LHFA 2E77A 3OBKA 2P1FA 3UZ5A 4HNUA 2EKCA 5DXYA 3NR0A 1VRDA 4WOZA 3MHGA 1TV5A 2ZQ0A 1IXPA 3QJAA 2ALDA 1R30A 3T4CA 4A29A 2ATMA 3M43A 3L5LA 2FQIA 4UXDA 1GQNA 5DCBA 4BI5A 3O6YX 2YZRA 3TKFA 1OFEA 4ADSA 4OV4A 1DJNA 4LRTA 4O52A 2PC4A 3B04A 4JR5A 4LVAA 1I2RA 3C2FA 3N3MA 4XZ9A 4MY9A 4QJ1A 4IXHA 3V1PA 2Z2UA 3CIXA 2XFWA 3PVFA 4BK9A 4TMCA 5FEXA 4UTUA 2YGYA 1H60A 1M5WA 4AHOA 4DO5A 1FDYA 3TROA 3NGJA 4FNUA 4FIQA 5CGQA 3W23A 2QDHA 1TTIA 1VCGA 1C29A 1S5TA 1VHNA 2OZ0A 2V5BA 2J88A 5E1QA 1KTNA 4ML9A 2ISSA 3U6WA 2NZLA 3LCFA 4CCEA 4I7VA 4JTLA 1OABA 1IXQA 4K39A 4OV9A 3TW6A 3B0VC 2FTPA 1OFDA 4H3DA 4YCPA 3CC1A 1KFCA 1U83A 4WY0A 3S1XA 1LM1A 3S1WA 3OA3A 3TC7A 1G7UA 3KVMA 1JRBA 4NU7A 1EEPA 4ZQCA 4RJEA 4WD0A 2BWGA 1XI3A 1ZALA 4S2CA 3Q58A 3G3MA 6ALDA 3N34A 1P0KA 3OG3A 3D0CA 1O94A 3W2KA 2CWNA 2WNNA 1HTIA 4K6AA 5C2XA 4UFJA 4GWEA 4JEQA 2ZRUA 1XL9A 4JTHA 1LBLA 5LGZA 3DBPA 2QUVA 2IQTA 5U4NA 5I3GA 4FNSA 4IWWA 1QPOA 2RDWA 4LS1A 3EWXA 3RNDA 3N73A 2JBMA 3HOJA 4M6PA 1DHPA 4DBDA 5K2ZA 2BLEA 1YADA 4X2RA 3ATYA 3UZJA 1OYAA 4GUFA 1F7BA 3L5AA 4RV8A 2H6RA 1Z41A 4YMZA 4O4WA 3L5MA 3SFKA 5D03A 3LHTA 1KM4A 1N7KA 5CZ0A 1YPFA 5G2WA 1QNVA 4QM1A 1HO4A 4XBKA 5BMWA 4TIMA 4FNQA 1K3UA 1LBMA 5K9XA 4JYFA 3G24A 3FS2A 3BG3A 5D33A 3W7OA 2V2HA 3LDVA 5FEWA 1SZNA 2FLIA 4UMCA 3PBUA 3TQKA 1ZCOA 2Z6IA 2EPHA 1Q6LA 3G3DA 1DVJA 3HG3A 3NPXA 4AWUA 3DFPA 3G1SA 3N14A 3GKAA 1DORA 4UTJA 2RDUA 4HT3A 4N4PA 3W2LA 3HGSA 3MBDA 3NZRA 4TX9A 4JX5A 4UMBA 2D73A 3L0NA 5DXXA 5HQEA 3W1TA 1ME7A 1KFJA 1JCLA 3PULA 5FF0A 5FF2A 3W73A 3W1UA 3NQMA 5D2YA 2W6RA 1M6JA 3DFTA 1E51A 2NV1A 3DHFA 3LRMA 3QSRA 4N2YA 1S3HA 5K4ZA 5K7JA 3LI0A 1OHLA 4R33A 4LRSA 3G22A 2V5LA 4ZQMA 1VR6A 3BGGA 1TJRA 5AYXA 3IIXA 1QOPA 4IX2A 2QCNA 1JCJA 4A3UA 3C61A 1ZHAA 4O11A 3C2VA 1VH7A 3CPRA 2B7NA 4UNKA 1GG1A 3FOKA 5HJLA 3O06A 4O1AA 1YXDA 3M5VA 4UUIA 1ME9A 4E2DA 1X1OA 4GE8A 4HPJA 3KRZA 1PHQA 4E0CA 4LC6A 3GR8A 2ZZ4A 3NVTA 4IMGA 1KFKA 4O12A 4FX7A 2FPYA 3GYEA 1FX6A 3IEBA 3NQ8A 4N9EA 4ZQPA 1XDMA 3ABRA 3MI2A 2C1HA 3NPWA 3GZ3A 4GUJA 4JX6A 4WOQA 1SZFA 3S42A 2Y61A 5AC7A 1W5QA 4JTJA 2KZHA 3QC3A 4FNPA 4ALDA 3BW4A 3B0PA 1SO5A 2LLEA 2GVGA 3LCLA 1YTEA 4PL2A 1TPVA 3B03A 1DL3A 5D04C 1MO0A 4P2VA 1G6CA 4CQ9A 3W85A 3DU0A 2GQ8A 3GK0A 4XUGA 4Z0SA 3DGRA 1AL7A 3FFSA 2OJPA 2QKFA 3AO0A 1FCBA 1ICSA 1FWWA 3HPSA 3H53A 3MWAA 3KX6A 2CZ5A 1I8JA 1ZFJA 4DF2A 3M1ZA 5IM51 4QNEA 5EYWA 3UWYA 1SQ7A 4O8RA 3QMRA 3HMJG 1EIXA 4QAIA 1JCXA 3CT7A 1WX0A 4U28A 2VFIA 1P1XA 2JKEA 1MXSA 4Y90A 1O5KA 2FB2A 4Y6GA 2CW6A 1RV8A 3TCEA 1WBJA 2FFCA 3PG8A 3TK7A 2NLIA 2E1DA 1OX4A 1EA0A 1SZEA 4EWND 3JRKA 3EXSA 4GJ1A 4R7JA 3W7IA 1WYIA 1KV8A 5LNSA 2CLIA 1OFBA 4K7YA 4K8EA 4QSHA 3Q94A 1S5WA 2V0TA 3N2XA 3TXZA 3NZ1A 3C8FA 4AF0A 1DBTA 5D09A 1OJXA 2WSYA 3A9IA 1JVNA 3TFCA 3IRDA 5AYYA 2V2CA 1KM5A 3S8HA 3LB0A 2DZWA 2YFOA 3IIOA 1SW7A 4BWLA 1H50A 4C1LA 1H7OA 3KHJA 2H90A 1VCVA 5H91A 4ZQOA 4A2RA 5EKYA 5I3JA 2RDTA 1FUYA 5AHFA 4PCFA 3DFNA 3MP5A 1R2SA 3C56A 1YYAA 2ZA1A 3UWQA 1VHCA 1XFBA 3LCXA 1OYBA 3W07A 2QEZA 1BWKA 4DXVA 3STGA 5AC6A 4G1KA 1GT8A 1W0MA 2I14A 4LVFA 3VE7A 3I7RA 1GVQA 4DF0A 3SW6A 1YTKA 4FNRA 2GUUA 2EF9A 5AB3A 2A7PA 3NL5A 2CLEA 3M5ZA 3DI0A 1AMKA 3E02A 3GXTA 3LCHA 1XUUA 3CWOX 4AHQA 4MJZA 5CZSA 4RXGA 3UY7A 1DV7A 3R13A 2NV2A 4FEZA 4UTWA 1SR9A 3M5XA 3P74A 2VFHA 5CG7A 4RZ4A 1I4NA 3EWBX 4YL2A 3I7SA 3DZ1A 4OU1A 3RLVA 2YFNA 2TYSA 3H54A 3S5OA 3OHIA 1O5XA 3LV6A 1G4EA 4O1CA 1JQVA 1WA3A 1ME8A 3L0KA 3QM3A 1Q3NA 1K7XA 3TSBA 3SY5A 3DKLA 3LX9A 3WK3A 4JY9A 3EWYA 4Z1BA 1ZAHA 4O28A 3IIPA 4Q32A 4A2SA 2PRHA 3W1RA 4Z1AA 1UUOA 4JYDA 4MUZA 2BSLA 3KXQA 4M7SA 1MZHA 2RH9A 1L6YA 4O18A 1JULA 3S5ZA 3LHVA 2Y70A 3TA6A 5I3IA 3EX3A 1TTQA 5HR6A 3UQNA 2CLOA 1L6WA 4N4QA 3L67A 1GOXA 3FIGA 4O15A 4PTNA 5FF7A 3NL2A 1TB3A 3EWWA 3CU2A 2J6XA 1A5SA 4DF1A 1F6PA 2C0AA 1W5NA 3CQ0A 3NQDA 5HWNA 1QMLA 4P61A 3P8JA 2Y7FA 4JD4A 1SPQA 3NM3A 5DY2A 5KSWA 3M41A 1TV8A 2B0MA 1NF0A 5HINA 4BR1A 1AL8A 1SO6A 3L68A 2QCDB 3HGJA 2GOUA 4ADTA 2A2IA 1WOAA 2Y63A 3GDLA 5LHEA 2E6FA 4AH7A 4QISA 1H7RA 3FYPA 3SGUA 5AHNA 2HTMA 5F4XA 3P81A 5AOUA 2PE4A 2QR6A 4JTFA 1PHWA 1GJPA 2R14A 5K9CA 3S0CA 3W88A 4GBUA 3ZWSA 3O63A 1JUBA 2BX7A 1HUVA 5CZJA 2TPSA 2X30A 2GQAA 1LRNA 3WJZA 1RD5A 1RR2A 3HB9A 1NAL1 2C6QA 2QUTA 4FIRA 4O4VA 2CZFA 4UR8A 3P67A 3PY2A 5CSRA 3P8IA 4UFLA 2X2GA 4ORMA 3BK0A 1A5CA 3UWVA 1OG0A 2B7QA 3PUEA 1TPDA 2ZA3A 3NQCA 1B57A 2ZZ7A 3QQ0A 1YXCA 4EOUA 3EEGA 1YDNA 2R91A 5G1YA 3GXPA 1WXJA 4MLRA 1H61A 5J5DA 3STEA 1O95A 4PC8A 1AW5A 3HPZA 4WJEA 4O50A 1QFEA 5F2GA 3IIVA 1TPEA 2E09A 1SO4A 4UFKA 3BLFA 1WOBA 2C15A 1SO3A 4UTMA 1KM2A 5SWUA 2E68A 2NX3A 2ZYFA 4WXYA 5C6MA 1F74A 1VZWA 5K3VA 3JR2A 3B06A 1PVNA 4BFAA 5AHIA 2Q3OA 4S2BA 5D02A 4JGDA 3QRHA 4MY8A 3W7KA 3O07A 5DCEA 2YXGA 4MYAA 5CKSA 3MYPA 1CW2A 4M19A 4JTGA 3NO5A 1D3GA 2Z6JA 3C2EA 2Y6ZA 3BV4A 4O13A 1NFBA 4PH6A 3UYCA 2P0OA 3NPVA 1QPRA 3EX4A 4NZJA 2FB3A 3W71A 3QW3A 2Y7EA 1G4SA 3K30A 4XTIA 3MYOA 1F73A 1ZNNA 5HWMA 4IPJA 3QPZA 3W7PA 4TO8A 4JNMA 4M7TA 4Z1CA 2EAWA 5CPLA 1W31A 1JR1A 3BO9A 2QJGA 3UWUA 2YW4A 2ZZ6A 4NNAA 5AHMA 1KM3A 3W2NA 3W1MA 1OFOA 1Y0EA 2C3ZA 4GRSA 2DJXA 3KAOA 2GVJA 3SGZA 4GUGA 3Q37A 3F4WA 5HNRA 1O60A 1A5AA 2CLMA 2Z0IA 3BLEA 3NQ2A 3HGRA 4N9DA 1Q45A 3WJSA 3G18A 3QMSA 2C18A 2DU2A 3A24A 1H63A 1AW1A 1RPXA 1IXOA 1VYPX 4GXMA 4CQ8A 3LHUA 1VLWA 2H8ZA 1KV5A 8TIMA 4HIBA 4HHPA 3W70A 4NNBA 3RMJA 2V81A 4DO4A 1JUKA 1GG0A 2I9EA 4R34A 4WQ6A 5BRBA 4OBTA 3TQ0A 3LTSA 4LC8A 4Y8FA 3R89A 3W1QA 3CHVA 5CZTA 2C13A 1I45A 3LCGA 2VOMA 3B8DA 3TMLA 2NX1A 3TAOA 2CLFA 4QQ3A 2Y7GA 5A8GA 1A53A 3PWAA 1LORA 3EX1A 4HSNA 3W7HA 1M7PA 1ADOA 2I1OA 4CNPA 2DZSA 2H8XA 5AN7A 3IGUA 5BNKA 1K8ZA 1G4TA 1TPB1 3QW4B 4RXFA 1GVOA 4LNYA 2CU0A 3PBWA 5C55A 1X1ZA 2UV8G 3T40A 4E2BA 4JXCA 2Y89A 1K03A 5KZMA 3QZEA 2ZZ3A 4HKPA 3O15A 4AB4A 1C8VA 3HBLA 4ORIA 2J9YA 1OFQA 5TBOA 5EBUA 3MO7A 2R8WA 2ZRZA 3NQAA 4LV9A 5KTLA 3CTLA 4K37A 1C9DA 2ZRWA 3W83A 4AHPA 1VC4A 3GR7A 1EPXA 3MUXA 1RQHA 4UTIA 3GIYA 3GXNA 3LLFA 2Y62A 4PEKA 4S1FA 4POCA 4NUWA 1F6KA 1GVRA 4I9AA 1BWLA 4NJJA 1TYGA 1L9WA 3QH2A 3HIJA 3Q2DA 4LTSA 2E5CA 4FF7A 1I2QA 1W3TA 2X1UA 3SSJA 1PV8A 3FLUA 4CNNA 1LTDA 1J5TA 3GDMA 5ABTA 2ZRXA 1FWRA 1OFAA 2V82A 3U2OA 1IF2A 1FCVA 3UNDA 2W0UA 3G0UA 4TMBA 1HG3A 3RF9A 2YX0A 3DXIA 4NJHA 2VEKA 1UASA 3C4UA 3NOEA 4LOCA 1HL2A 4UFMA 2V2DA 1H1YA 3W2UA 3O05A 3B0UX 1QDSA 4EF9A 3UD6A 3C2RA 3W87A 1QO5A 2DZUA 2YYTA 5AC8A 4UTHA 1V5XA 1AK5A 2OMAA 3UXAA 3W3OA 3N19B 2B7OA 3LCIA 2YSWA 1MEIA 1KFLA 4NX5A 2YW3A 3L66A 5D2VA 3F4NA 2NUXA 3N9RA 3NL6A 1KLZA 2YYUA 3W2MA 5DELA 1N8FA 5LGXA 3W1PA 1FWNA 3P7YA 1H7PA 4AAJA 1H7XA 3FKRA 3BG9A 4LVBA 1J2WA 3O8AA 1WAUA 3F03K 4LS2A 2CZDA 4NNCA 5U7SA 3PSVA 4FNTA 2GJLA 2F7FA 2VEPA 1ML1A 1X8FA 4XKYB 5D37A 1W54A 1W3NA 1TPUA 1PCWA 2ATSA 2DZXA 1GVFA 3DFSA 3EX6A 3G1AA 5CPMA 3W7CA 1KBJA 2CLHA 3LV5A 3W7EA 3TJLA 1TPWA 1W3IA 3QQ1A 1B9BA 1R2RA 4JN6A 1QWGA 5AHLA 2ABBA 2J9XA 3EWZA 3AJXA 1X6UA 3ABOA 3OEXA 3T44A 1Z42A 3S5NA 4ZZ9A 3GDKA 5D05A 3O6DA 1RZMA 5CPNA 2W79A 4JTSA 1W8SA 3QPYA 1XDLA 2QAPA 1ZAIA 5D2TA 2ZBTA 1JCNA 2ZRYA 4JY8A 5C5YA 4QIUA 1I2OA 2XN1A 3PM6A 1WQ5A 4AWTA 1PE1A 3H55A 4LVDA 1EB3A 2HS8A 2ZZ5A 2J9ZA 1D9EA 1VYRA 3ZR4A 1TRIA 1AW2A 5DY3A 3S1UA 3LERA 4GNJA 3FYOA 4OHQA 1SUXA 2ZZ1A 2E6YA 2FPVA 1WBHA 3I6RA 2E5BA 4X3ZA 3GNDA 1LOQA 2FPTA 4UR7A 1EP3A 1NF7A 5DBUA 4O19A 5AFDA 5IBXA 3W7NA 2H3DA 1LCOA 1LYXA 4B5NA 4FX8A 5E0KA 4JIPA 4K8HA 2V30A 3TJXA 3W7DA 2NX9A 3DKJA 2DZTA 3R8RA 3DFQA 3WJWA 4EVZA 5FESA 1LLZA 2Y7DA 7TIMA 1OF6A 3MMTA 3GVGA 4BI7A 3MHUA 1K02A 1GTEA 3A5VA 4O57A 3OVRA 1NSJA 3GLCA 5C54A 3WK1A 4DBEA 3W1LA 3NA8A 2ZZ2A 3L21A 3G1FA 3W86A 3NQ7A 3FJLA 4MIMA 1R46A 3T55A 4O1BA 1EUNA 1MSSA 2GQ9A 1VCFA 2QF7A 3O6CA 4UTLA 3LOTA 4O0ZA 5G5IA 1VS1A 3SZ8A 4DPPA 3G1DA 1FBAA 4UTWC 3HJZA 3OVQA 3DI1A 2JKPA 3RU6A 4AXKA 4IJBA 3TV8A 2AQWA 3I7QA 2VELA 2JGYA 1OF8A 3MBFA 4JDBA 2PURA 3M5YA 1XC4A 4OT7A 3EKZA 5BW6A 3UXDA 2WQPA 1EP1A 4IMCA 5G2IA 3S9YA 2WV8A 1KLYA 2XN2A 1A50A 1FY6A 3MW7A 3T78A 2Z1BA 3INPA 3PS7A 1XBXA 1B4KA 3EWUA 3LHZA 1IIHA 2WNZA 3CEPA 3C6CA 3W84A 4AEOA 3PBVA 5LNUA 1K7EA 1NVMA 3UY8A 4QITA 5HUOA 4BF9A 5H2ZA 3TUUA 1SZGA 3TSDA 2CLKA 3NNTA 1RQEA 4WX2A 4LUJA 4DQWA 4C1KA 4Z1DA 1G69A 1JCMP 5FEZA 4XWUA 3W22A 3W9ZA 2A85A 5F1UA 2V9DA 3NXFA 1EUAA 3LM7A 1XUZA 4MOZA 2NUWA 2H3BA 3KVJA 5LZLA 3W2JA 1VPXA 2A21A 2PRLA 3UPBA 3SR7A 3WK0A 3M9YA 4KKXA 4HSOA 1H7NA 5BMXA 2NXHA 3P5ZA 1RVGA 1BEUA 4DEFA 4JTTA 1UJPA 1H51A 1ONRA 4NXSA 1K8XA 1QOQA 4CCCA 4WZHA 2QCFA 4M6QA 4NJGA 2TRSA 3E12A 1Z48A 3NQGA 4RLIA 4MKNA 1XBYA 4IXXA 4TR9A 2BZNA 3KRUA 3G1HA 3VKJA 3NL3A 3FA5A 4MJMA 3SECA 1T0OA 4JICA 2QCEA 2CZEA 2BXVA 1FDZA 4IOTA 4CQAA 1TJPA 4UCGA 4WUIA 4PA8A 4WXZA 3A21A 4H4IA 3FEMA 4A21A 3KVKA 5LNRA 3TMQA 1H1ZA 3TQVA 3THQA 1TMHA 4MFDA 1OX6A 4MFEA 4UTTA 3LHYA 1R2TA 1GYLA 1HO1A 3IIZA 5F2MA 3W7GA 5I3HA 4HPXA 1L2UA 1G67A 1TRDA 5EA9A 2A7RA 4Z0JA 3G1YA 2OCZA 1BKSA 1FXPA 5HULA 2ISWA 4YCOA 1GTHA 3BW3A 2GJNA 1L6SA 4FX6M 3VCRA 1Q6RA 1GWJA 2WJZA 4CNOA 2A6NA 3LTPA 2X1RA 5LKYA 1FCQA 1W1ZA 3PSWA 3GB6A 1TPH1 2C16A 3ZFHA 4Y9AA 2Q8ZA 2AGKA 3WFAA 3L9CA 3PB0A 3NAVA 1EP2A 3N9SA 3W72A 3FKKA 2OT1A 1LZOA 2A1YA 2OT0A 3W6YA 3QYQA 6TIMA 1VLIA 3CB8A 2TMDA 3ABSA 2E6DA 4ZQNA 1I2NA 2G97A 4AVFA 4J9JA 4LT9A 5FF4A 5I3FA 1XBZA 2GPTA 4KFPA 5CSSA 3HGOA 1XCFA 1EWDA 2G5WA 1ZY9A 4LUIA 4JTKA 3PUDA 3S6DA 1Q6QA 5K9DA 3DENA 3MJYA 1VQTA 4JTEA 3ELFA 3RK8A 3THAA 5A5WA 3HF3A 4OGZA 4NJIA 2Q8LA 3SJ3A 5BOOA 3QFEA 2HS6A 3MI6A 2YCEA 5E93A 3E49A 5TIMA 1JRCA 2X16A 1GYNA 2ZTKA 1VJIA 4O1DA 2Y88A 4FO4A 2NXIA 4OWGA 1ICPA 4FXRA 4LY8A 4RK8A 1W5PA 1WDWA 1EWEA 3DAQA 4CLMA 1D3HA 4JX4A 3G0SA 2ABAA 3OIXA 3LTYA 3W1XA 4TU1A 4JS3A 5LNWA 2FIQA 2DZVA 2QCGA 1HFBA 3W7MA 2WPBA 4WY0B 1M7OA 2ZFAA 3E0IA 1YDOA 3TNOA 3TR2A 1KM1A 3G1XA 1P0NA 4ZL1A 5KITA 1F76A 5K4XA 5I3KA 1V7YA 4XBSA 4EF8A 5HMSA 4EIVA 3GX9A 4RX0A 2WNQA 2P10A 1SSGA 2A0NA 2GVLA 3HO8A 3G8EA 4O16A 5T26A 4IMDA 4ZVJA 2B7PA 2B4GA 3IVUA 4KWWA 1I2PA 1O4UA 4O14A 4KFOA 3M16A 3T7VA 2PCQA 1OFRA 3RLUA 1G4PA 1IIGA 1THFD 3PAJA 4MVAA 5HR7A 1AG1O 4KFNA 5DBTA 2NXGA 4N6FA 5HWJA 3NEVA 3W7RA 1SW0A 3S1VA 2PRMA 2QJIA 1T99A 1W5MA 3L65A 4U4MA 4UMAA 2NUYA 4I7WA 3BLIA 4LVGA 1MEWA 1QCWA 2RHGA 3IVTA 1RQBA 5LSMA 1KM6A 3TFXA 1KTBA 3R5EA 3R2GA 3ZWTA 1LP6A 3C52A 4LU0A 4O0KA 3TIMA 2O7SA 4IUOA 2CFFA 3TX9A 1TCDA 3PG9A 4FHAA 5EY5A 3MI3A 4N9CA 1PS9A 1UUMA 1X7FA 3S5YA 4MZ1A 3P60A 3BGJA 3R12A 4GUIA 2X1SA 2ZDRA 2C14A 3NM1A 4FB7A 3W1NA 5KMYA 2VEIA 3QMTA 1LRTA 3BARA 1Q6OA 4M6VA 2WSQA 4M5PA 3VI2A 3LHWA 4A22A 3NQFA 3PF3A 5KZEA 2AAMA 5FEPA 2YPIA 4I7UA 1VYSX 3USBA 2FDSA 3TU9A 4HNVA 4HNTA 1QPQA 1B4EA 1PCKA 3EX2A 2R94A 3LRKA 3VFLA 5J5RA 4ONVA 3TSMA 3RFAA 5DLCA 2QDGA 1FCUA 2C19A 2G95A 3FJ6A 1QPNA 4K7VA 5LNVA 4ZMGA 4IQLA 4MLJA 3NPUA 1QR7A 1ICQA 2CLLA 2WSRA 3CWNA 3E9AA 1YDVA 2JK2A 5AYZA 5MHBA 1DOSA 4JYEA 5AHEA 1TTPA 4N9BA 3L0GA 3UWWA 3IVSA 2X1TA 4BI6A 5L9FA 4Y96A 3G0XA 4NXKA 1W37A 2G96A 5F4WA 3PR2A 4UC5A 5D2XA 4K36A 2A6LA 3C3NA 5L6UA 2A4AA 1JUEA 1BTMA 2ZTJA 3P62A 4NQ1A 4Q4KA 1SU5A 1NEYA 3GNNA 4MZYA 5F2IA 3O16A 3P61A 3GKFA 3P5YA 3E96A
chains in the Genus database with same CATH superfamily
2VC5A 5XIMA 1V6UA 4RZBA 1V08A 2JIWA 3LGEA 4EE9A 2REQB 2A3HA 3G8RA 3MZNA 1H0IA 5F4SA 2ZDSA 5IRPA 3MMWA 3IJ8A 1K7FA 3IAQA 4H00A 1CGTA 1WV2A 3STFA 5HNUA 2CXGA 2WC7A 3M07A 2YKKA 2H9AB 3UPWA 3N25A 4ZOEA 3V16A 4A3QA 4P7QA 2XVLA 3FK4A 3NO3A 2AAAA 1R9YA 3GDTA 1OX4B 1DWAM 2XGBA 3UJFA 2OEJA 4PODA 1TPC1 5A2BA 1GJUA 1MEHA 3E3HA 2VO5A 2Z26A 1WZKA 2VC6A 3V0TA 1TTJA 4LUYA 3W01A 4HD5A 3EMZA 1B1YA 4UNLA 2ZRVA 4HU8A 3BWWA 2PB1A 1PTDA 1VENA 3W7QA 4CCDA 4NYYA 1QAPA 2OSYA 3N2MA 3UR7A 1A47A 2EHHA 1OK4A 2PDLA 1KBBA 3VCCA 3WNNA 1TVNA 1Q65A 4CCZA 4N6EA 3ZS4A 1TSIA 3TAKA 4RNJA 2IW0A 3P80A 4NY2A 4A8RA 3AIEA 2YL6A 1GKRA 3VGHA 3V35A 3L4YA 1WKDA 1FHDA 3W7JA 4AFYA 1X1NA 2IMRA 1XRVA 3GHUA 1J0HA 4QG9A 3WF0A 4O17A 4GCAA 2OYLA 4EPBC 4FXSA 5EFFA 2VTFA 4QNWA 4DJFC 5C9XA 4GGBA 2RAGA 4INFA 4IFKB 4HNNA 3VNZA 2ZWYA 3ONBA 2WKJA 4XQ6A 4C6QA 2J8FA 3CIWA 3SI9A 3M44A 3KBWA 3UZXA 4PYSA 4E4UA 2B31A 3TZFA 1KFEA 3SM0A 1ZJAA 1U5HA 4FSAA 3W1AA 2VEFA 1RJRA 1KM0A 3EXRA 4GQQA 1RA5A 4IT1A 3TJ4A 5ECVA 1V6WA 1V03A 1E0VA 1UKOA 2PDMA 3PB2A 3QR1A 5A6AA 1E6RA 4D8ZA 1TJ0A 1Z44A 4REQA 1DQWA 2D23A 3G1RA 3I4EA 3I3EA 3CB3A 2PDPA 3UZZA 2JGQA 4ADUA 5EMUA 1DTNA 2DP3A 1B54A 1JPIA 2QVNA 1E4NA 1KFWA 3FSTA 3SUSA 2ON3A 2QCDA 4D6EA 4JNZA 3GTNA 4LAKA 3CM4A 4HK7A 4B2DA 1ONWA 3PPHA 4GVGA 3RAOA 5JH1A 3VE9A 1IWPA 3W7LA 4CVUA 1FDJA 4ZXOA 1CYGA 5T9CE 2VX4A 3U48A 5G4WA 3ATZA 3M0ZA 3OPSA 3SUUA 2IPJA 4H8HA 1S5VA 2BGSA 2BVYA 2UY3A 4JHMA 4GFSA 4DNHA 4GYKA 1R47A 3W74A 4JDYA 1LBFA 2WZTA 4NX0A 1ZP3A 2G3MA 3LBCA 3TR9A 4FAMA 1E6SM 4L9XA 2POTA 4P5UA 1YLVA 4X0VA 3NDYA 1PXGA 4RZ6A 1XH0A 5FI8A 4C6JA 3OHMB 2QCMA 2VDGA 1B3OA 1UIOA 4J4KA 5A6JA 1EOMA 2F9RA 3TE9A 3VX0A 1CXEA 3PC0A 4JTUA 1OVDA 5HJXA 5BWFA 2HRWA 1MNZA 1W9VA 1E1CA 1B2YA 4RCXA 1FXQA 4JAWA 3TLLA 2VFGA 3CH9A 1NJJA 5G2HA 1DWFM 4NZ3A 1U5JA 3M6YA 1FH8A 1DWIM 2XJ7A 1R0MA 1FWGC 2EKCA 3NR0A 4L56A 2X09A 3UBPC 1TV5A 1XRFA 3AHXA 3AWOA 2DUAA 1QWKA 1IXPA 3ECQA 3NXLA 4CNUA 2XIBA 8XIMA 2WVUA 3M43A 2VJXA 3L5LA 2PDJA 4C6KA 3P6LA 3O6YX 1PEZA 1DJNA 1F4AA 3AMLA 2PC4A 3OOQA 2WMGA 3LG3A 3GIPA 4XZ9A 6REQA 4MY9A 1ZBCA 1W9DM 4KPLA 1UD2A 2Z1XA 3JVAA 3PVFA 4BK9A 9XIMA 2GK1A 4HCLA 3QOMA 1FDYA 4FNUA 3FGCA 2OZTA 1EGZA 2CEQA 1TWDA 2OZ0A 3BQ5A 3EGJA 2OZ8A 4MNLA 2J88A 1RPKA 2WMHA 5LXEA 1KTNA 4ZFCA 2D0FA 2CKRA 4CCEA 4HVXA 3TW6A 4K39A 1VEOA 4XAPA 2I57A 1OFDA 4H3DA 1RHCA 1D8CA 3CC1A 2WW5A 4WDTA 1YBQA 3ZLGA 4LB4A 4EAMA 3S1WA 3OA3A 1L6GA 1EEPA 4ZQCA 1P0KA 3KS5A 1LL4A 3D0CA 3W2KA 4NAFA 2XIMA 1OCQA 1Z6KA 2CWNA 1L0PA 5C2XA 4UFJA 3BSGA 1UR1A 1KR1A 3WNMA 3EZ4A 2EG6A 4AZHA 2W27A 1DIOA 2DH3A 1B30A 4XVEA 1QPOA 1FWJC 1HNYA 2OB3A 4GK8A 1SJDA 3RNDA 1A5MC 3PZGA 4M6PA 1RUSA 1HGWA 2BLEA 4IQDA 3VA8A 4XZIA 4D6CA 4GUFA 4Q4QA 3WQWA 3WFZA 5HNTA 4ZB2A 1N7KA 2WC4A 3WQ8A 1J9YA 5CZ0A 3C2YA 5GNYA 2E8YA 4CN6A 1LBMA 3PAOA 5K9XA 1PYMA 3GUGA 3MJMA 1CXFA 1JL8A 3W7OA 2Z00A 3AZSA 2PI6A 3TQKA 4Q4RA 1EHAA 3IUIA 3BAIA 1X97A 3G3DA 4N4PA 4M81A 3TP4A 1V4YA 3N9KA 4IQJA 1AVAA 2O9TA 1D7FA 5HQEA 4GNKB 1KFJA 1JCLA 1ODUA 5DX7A 5D2YA 3DFTA 2NV9A 2FGLA 3OU8A 5FA5A 2O92A 5IFTA 5K4ZA 4ZQMA 1F07A 5CBIA 2UBPC 3TA9A 2DFAA 5A6SA 5DF0A 1PKNA 1HKIA 3VC5A 1T7LA 1JAKA 1JCJA 4Q8UA 4MGGA 4A3UA 1J0ZA 1XISA 2W5FA 4O11A 1FWCC 4UNKA 1VH7A 2WANA 3CPRA 5LIUX 5HJLA 3O06A 1R9ZA 1YXDA 4ATLA 3L4WA 4HPJA 3KRZA 4QTGA 1OIFA 2CWXA 1GVEA 1IV8A 4UQDA 1S2CA 2YCIX 3NQ8A 4N9EA 3CUJA 1XDMA 2C1HA 2OLAA 4GUJA 4LPCA 3S42A 1W5QA 1WZMA 5CBJA 4BJHA 1XQLA 2HXTA 4ALDA 1H4PA 5EMYA 2BB0A 3WL1A 4DUOA 1EJ7L 6TAAA 2XIIA 1M1BA 4PL2A 1PB0A 3B03A 5D04C 1F8IA 2DV0A 2GQ8A 3GK0A 4L1GA 1XIEA 2V5CA 3QKZA 3FFSA 3UJSA 4MNMA 3K1GA 1TX0A 1I8JA 2WJDA 1W1A1 4ZA0A 2PGEA 4QNEA 5EYWA 1R3TA 4O8RA 4TVUA 4AISA 1PX8A 4Z17A 3UR8A 3QHOA 3F4DA 3H24A 4H41A 3C86A 4RDYA 2KAUC 2FFCA 1EA0A 1RY8A 4EWND 2I5QA 4RW3A 1UWRA 4K8EA 4B4HA 4C6LA 1JI2A 1KXHA 3N2XA 4ML4A 1L8NA 1K9TA 3C8FA 4LBSA 4AF0A 1DBTA 5D09A 3A9IA 2BOGX 1JVNA 3NDZA 5AYYA 1KM5A 3EPNA 2UY4A 1XD0A 2YFOA 1SW7A 4QS5A 1UH3A 1H50A 2J62A 4C1LA 3OGVA 2H90A 2VWSA 1VCVA 5H91A 5I3JA 1BRLA 4YVVA 4GPNA 3DFNA 2FH8A 3C56A 1YYAA 5IHSA 1XFBA 1GOWA 1OYBA 3W6MA 3R79A 2WHLA 3W81A 1W3LA 1UWAA 3LSCA 3P0XA 5JIPA 1W0MA 2I14A 2TODA 2PMQA 3SEPA 3HQNA 1KQYA 2GUUA 2Q71A 1M53A 4GH1A 3NL5A 4GVIA 1AMKA 3DI0A 3GXTA 4IIFA 5CZSA 1VPQA 1DV7A 2NV2A 3MDWA 2PDYA 4DN1A 3OQ8A 1EBGA 2VFHA 3H70A 4RZ4A 3WD0A 1NWTA 3UVAA 4LYPA 2YLLA 1PKLA 4FLRA 3IJQA 1NTHA 3R1ZA 5AC5A 2XGZA 3S5OA 1GOIA 3O7UA 3QM3A 4AYGA 1Q3NA 3ZSTA 1J6OA 2VZSA 3DKLA 3GG7A 3SY1A 5ENLA 4M1BA 3E5PA 3EWYA 3G5EA 3IIPA 3W1RA 3SCUA 3CJPA 3P93A 3KXQA 4M7SA 2XVKA 4O18A 2X0YA 3S5ZA 3TA6A 3EX3A 4PSRA 4D72A 3T09A 2A3EA 4CU6A 3I6EA 3A47A 1XPGA 5FF7A 1J0KA 2J6XA 1A5SA 4PMNA 1NM9A 4QHRA 1FA2A 5ABFA 5J8LA 4RL3A 4YJ5A 1ODZA 5HWNA 1CCWB 1LWHA 3WLQA 1SPQA 2XHYA 3DIPA 1C8QA 4I8DA 1DJHA 5KEZA 4RDWA 1EJSC 1AL8A 2VD9A 3L68A 2GOUA 2PP3A 2HE8A 4ADTA 1WOAA 1VJZA 2Y63A 1DE5A 5LHEA 2E6FA 4A3HA 1AODA 1EGMA 4QISA 3CV7A 1W3HA 3BMWA 1XYCA 4UQAA 4C7GA 3TYBA 1FP9A 3ARRA 3WEZA 1NP0A 2ESCA 3T0DA 4YTUA 2ZC8A 4L7ZA 4C5ZA 3PZ9A 5FAGA 1ADDA 1V79A 1W91A 4GBUA 3ZWSA 2IPFA 1D3CA 3BOFA 4DNMA 5A8PA 2QUTA 3PP7A 2CZFA 2F6XA 4HMCA 3WMCA 3RCNA 2NSOA 2OU4A 4ORMA 4PEEA 4P8UA 1OG0A 4Q6JA 5GJPA 3AZRA 5LA2A 3CHCA 4H7ZA 1H09A 3REQB 4EOUA 1W9UA 2WB5A 3GXPA 4MB1A 4HCHA 1M03A 2JQXA 1H61A 4E8CA 3CAWA 4B3LA 3GVRA 4MWAD 1BF2A 1V7AA 4MAZA 3PZTA 1TA3A 1Y5XA 1QFEA 4FZIA 4UFKA 3GZAA 3B3DA 4AD2A 4UTMA 3NIYA 1A0CA 2D22A 5SWUA 2NX3A 2XTKA 4LAUA 4Z2JA 3IRSA 2IS7A 4J1OA 3SCTA 4H9YA 1POKA 4M1RA 3DFHA 1QI0A 1PVNA 2PDKA 4PRWA 5AHIA 4JGDA 2VYOA 2BV9A 5DCEA 1H3GA 2WMKA 2YOCA 5CLWA 4Z42C 4CU8A 1LL6A 1EQCA 3W02A 3NO5A 3CQHA 4O13A 1NFBA 2FZNA 3UYCA 2P0OA 3NPVA 4DXKA 3W28A 2ZUWA 3U7BA 3GNPA 3QW3A 3QPZA 4TO8A 4ZE4A 1E4LA 5CJNA 2R6OA 3AMCA 4GYPA 3BO9A 1W9XA 4B9ZA 4OFCA 5JUVA 4NKCA 2WYSA 4AMCA 4X63A 3QTGA 2DJXA 3GG8A 4PTMA 3KAOA 4JFSA 3Q37A 2CLMA 1VEMA 3Q45A 2JALA 1UMLA 3DBNA 3HGRA 3U2ZA 1G5AA 3WJSA 1UPPA 3ZJKA 3GHSA 2DU2A 2V3GA 1H63A 5BZAA 1AW1A 1QASA 1IXOA 1VYPX 3KBSA 4GXMA 2J66A 1IEIA 3NTYA 4CQ8A 3MSGA 5CC3A 3N2CA 1ESWA 3WDQA 4HIBA 3UEQA 2QQ6A 2Z25A 3RMJA 4EX4A 1BXCA 5BRBA 4OBTA 5JBDA 3LTSA 4Y8FA 1KXQA 3QR3A 5CZTA 2NX1A 4M80A 2CLFA 1XLDA 5A8GA 3WDRA 1QATA 3PWAA 3CGTA 4S3DA 3W7HA 1M7PA 1FFQA 3E2RA 2I1OA 3QW4B 4QQUA 4L9ZA 1X1ZA 3T40A 1TFVA 2DH2A 4JXCA 2QV5A 4AZCB 2ZZ3A 2Z1WA 1C8VA 1MUCA 4ORIA 4C5YA 3H2AA 1BSIA 4LV9A 3VDAA 4K37A 1C9DA 5GJNA 1TWSA 1VC4A 1RQHA 2CBJA 1J96A 3KRBA 1QBAA 3GXNA 3VOCA 4DUWA 1KRBC 4GIEA 3VUSA 2VRKA 3AXIA 5C9UA 2BNJA 2IKIA 1GVRA 4J3XA 2JF7A 3AUJA 1QUMA 4DYJA 1TYGA 3MANA 3TJIA 2FKPA 3P3BA 1I2QA 1W3TA 4GNVA 1IEXA 2X1UA 3H22A 2WNWA 1ZPTA 1IQ8A 4EPEC 3CUFA 1IF2A 1GYMA 4F8XA 1EF3A 4GQGA 1U1JA 2YX0A 3DXIA 4QP0A 1NWSA 2WVSA 4Z2KA 2ZWZA 4XSLA 1SVDA 4EF9A 4TTGA 1MQRA 2Y8UA 3SCPA 5AC8A 3UXAA 1A4LA 3N19B 1HL8A 1NARA 4KRZA 4NX5A 1QOXA 2YW3A 3L66A 4BQ2A 1ZUAX 4FXJA 4YYFA 3NSXA 4M6UA 3NL6A 1GHRA 1QVBA 2FZMA 4GIRA 3JW7A 1TELA 3BG9A 4LVBA 3UT0A 3AXXA 4GKLA 1WAUA 4PTWA 3F03K 4X2PA 3VNJA 3L7RA 2PDFA 4D9PA 2J7EA 1ML1A 3W38A 1W54A 5H8PA 3RMEA 5KZ6A 3DFSA 3WY1A 2BGQA 3T1GA 3WX7A 3V3WA 3PTMA 2OLSA 1FWEC 3EWZA 3AJXA 1E6QM 3ABOA 4QLKA 4US5D 4ZZ9A 3AMKA 3EB4A 1Z89A 1ZP4A 1RD6A 2QDDA 6CGTA 1EDTA 3VMOA 3DHUA 3EYPA 2QAPA 3FA3A 4XZHA 1W9BM 1JCNA 4JY8A 1YE6A 5IDIA 3UA3A 3KBMA 3DYMA 4QIUA 3SFWA 1R8LA 4JQ2A 1EB3A 1VYRA 1LWIA 1PZ3A 2PDWA 3UG4A 3SGGA 3G6MA 4B5WA 4OHQA 1UA3A 3H4GA 3E2QA 2FPVA 1XX1A 4X3ZA 2QGHA 4UR7A 1EP3A 3COTA 2QDEA 1LCOA 3S2MA 5E0KA 1H2JA 1W1B1 2NX9A 4IHCA 3CMJA 4WRHA 3LLXA 3DFQA 4EVZA 5FESA 3IK4A 3MMTA 3GVGA 2E9LA 3MA8A 3MHUA 3A4XA 3A5VA 4IG2A 3WDPP 4GX9A 4G5DA 5C54A 4DBEA 1NWRA 1I0BA 3L21A 1XDJA 3I10A 3MSRA 5C7VA 3BSHA 3SQMA 3O6CA 3ES8A 4O0ZA 1M68A 1GQLA 2IQ0A 5AYBA 2HPIA 4DPPA 2PWHA 3OVQA 1SMAA 3CQKA 2ISDA 4FF5A 1E0UA 4WKAA 1C8XA 2VELA 4JDBA 4WJXA 2PURA 3M5YA 4MNJA 1NDWA 1RSCA 3EKZA 3BOXA 4PTXA 2WQPA 3LM3A 5G2IA 4EXAA 3V36A 3PJTA 3RGTA 3VIGA 3HJEA 1NH6A 3RCMA 2GUBA 3GNXA 9RUBA 4JEJA 4PRRA 1ITCA 2J13A 2Z1BA 3PFRA 1B4KA 3EWUA 1JG9A 1L2QA 3HPFA 3PBVA 1CXKA 2PWFA 4IMAA 4GC3A 4ZODA 2ALRA 1RQEA 3B8WA 4REQB 3MWCA 4DQWA 4DYEA 1JCMP 3VILA 5F1UA 4B92A 2V9DA 4MOZA 2CLPA 4ZSUA 3GQYA 4KCUA 2A21A 4G6CA 4FOUA 1V0NA 1E4MM 3KBJA 3CMGA 1KKOA 1RVGA 4C90A 2GJPA 4JTTA 4LUSB 4ASTA 1Q5MA 1UJPA 4S3BA 2FVKA 2G0WA 1K8XA 1QOQA 3F4VA 4WZHA 4M6QA 4XD6A 2INFA 1Z48A 1XBYA 2FZDA 3ARTA 1ISWA 3OZOA 4ZENA 4S3KA 3FA5A 3BAWA 2HBXA 4JICA 8XIAA 1FDZA 4CD5A 4H4IA 2X05A 3KVKA 1WNOA 5LNRA 3TMQA 1H1ZA 3QV8A 3THQA 4MDOA 3CHDA 1CLVA 4NZ1A 5I3HA 4HPXA 4M0XA 4H8NA 5HULA 4YCOA 4ZSTA 4DB7A 3GUWA 1L6SA 1E1CB 3ZQ9A 3LTPA 3GXDA 1VFMA 4R88A 5E09A 3K13A 1FCQA 1W1ZA 2C16A 4QE1A 2YA0A 3EBVA 3E0LA 2QV4A 4XSMA 3L9CA 3N6QA 5JBEA 5EB8A 1EP2A 4H9VA 3T0CA 3PTKA 4C6DA 4G1NA 3A64A 2A1YA 4QE5A 1UD4A 2OT0A 2R9RA 2WC3A 3QYQA 1TX2A 4IUGA 4ZQNA 2WCSA 5MKGA 3E74A 4J9JA 5FF4A 5I3FA 1XBZA 2GPTA 1XCFA 1EWDA 2VX7A 2V5DA 3PUDA 1QNSA 3H26A 6REQB 1I9CB 4JTEA 3ELFA 1S2WA 2WM0A 5A5WA 5BOOA 1A5UA 3QFEA 2GK1B 2X16A 3FGCB 4O1DA 3WNOA 3T8LA 1OQFA 3PZQA 2PA6A 3OZMA 4U10A 3DAQA 4CLMA 1D3HA 2DSVA 2VP8A 5AKQA 3W1XA 3F7JA 2FIQA 3LNPA 1HFBA 1QNQA 2DQXA 2Y5SA 4F2UA 1YBQB 2ZFAA 3B9DA 3E0IA 1YDOA 1OC6A 3TNOA 2EG8A 4WKHA 2WCGA 3G1XA 2FZ8A 2VWTA 2CPUA 4NAFB 4MB4A 1F76A 5K4XA 3MKCA 4XBSA 5HMSA 2VNCA 3GX9A 2FHCA 3VNIA 2P10A 1SSGA 2A0NA 3VOIA 2BY0A 4IMDA 4ZVJA 2BVDA 5HQMA 4O14A 3NO1A 4PUUA 5FJUA 1Q8JA 3RLUA 1G4PA 3NWRA 1XIMA 4EAYA 1M7XA 2BG5A 2BY2A 3RYSA 4WR3A 2PRMA 1T99A 4GQ0A 2VGBA 4LVGA 4CGTA 3DG6A 2RHGA 3FHAA 2F61A 1XHGA 4PMZA 4K68A 3C52A 5CQ1A 2TAAA 4GXWA 2ACUA 1SFSA 4N9CA 1Z7AA 3WF4A 1UUMA 3S5YA 3B4YA 4GOAA 3BGJA 3R0KA 2O9OA 1ZGDA 4QGCA 3APGA 2YDQA 2F2HA 3KBVA 3ID7A 1XCWA 3AHVA 3H2CA 4YHGA 3M0XA 2VUNA 4A22A 3PF3A 3QV9A 3USBA 6ENLA 3FDGA 4HNTA 4S38A 2PCEA 1KRMA 3EX2A 2R94A 2Y5JA 4EANA 4KCVA 5CEWA 2VDHA 2C19A 2G95A 4GI6A 5LNVA 4ZMGA 5H6HA 4IQLA 1ICQA 1TWZA 4NZ5A 2CLLA 3TTOA 4C7DA 2PC8A 3ARPA 4X61A 2WSRA 3CWHA 4GVFA 2Z7GA 2FHBA 1DOSA 1G0CA 3UPMA 3EWCA 3GVVA 4N9BA 1CB7B 1Q13A 3WZ0E 3M64A 3G0XA 5BU9A 3WQEA 5BXPA 4UC5A 4AX7A 5D2XA 5L6UA 2BODX 1WKFA 2ZIDA 4Q4KA 4MZYA 2QNEA 5F2IA 1DEDA 1EO7A 3GKFA 3P5YA 4IIHA 3T6CA 4MWAA 1CB2A 3A5FA 2RGMA 4MKSA 1VGAA 4OVXA 3TVAA 3NYDA 4NASA 2XH0A 3M0IA 3DHDA 4NJKA 1XLEA 2P88A 2Q02A 1AH4A 4DELA 3U9IA 1PL9A 4RUBA 2E67A 4MDPA 5FOOA 4Q33A 3BL3A 3TN6A 5H8UA 1K77A 2D2HA 2CBUA 3MP4A 2YCJA 4PCNA 5JIWA 3S1GA 1F05A 2QLYA 1XSIA 5G4EA 5LYRA 4XZWA 2G41A 1FP8A 3VOHA 4Q3MA 4JIQA 2DT3A 3MUIA 4PFMA 4JQ3A 1K9EA 5D30A 3LQGA 3KFTA 3MPGA 4UR9A 3W6LA 4OE7A 2NLYA 2GGHA 1TQJA 2VCCA 4ZOBA 3P82A 2J27A 2OYKA 3NG3A 3VPLA 1QBBA 4L4LA 4AF0B 3MUZ1 4YXGA 1IYXA 4OTKA 4WKFA 1G94A 3K5XA 3ABQA 5A6KA 3R25A 1S39A 4PFHA 2BBFA 5DCDA 2C1IA 1GEQA 3BPWA 4PBFA 1CXHA 2D0HA 1BRLB 2YLAA 2HK1A 3TDFA 5IBXC 3ARWA 3U5UA 1E6NA 4GC4A 2DZPA 4R53A 4IGHA 3ALFA 1BG4A 3ANYA 4K38A 1HKWA 4H7CA 4AIEA 1AQ0A 4Z1YA 1Q2SA 2XFFA 3HPXA 5F2LA 4QG6A 1KW1A 5CPOA 1JQXA 3DC0A 4C6FA 5FF3A 1HZYA 4ES4A 4JKKA 1ITXA 1EXBA 2YA1A 4LQ1A 3ENLA 1YNPA 3B05A 3B4UA 3H8AA 3M7WA 3MO4A 3OZPA 2QCHA 3C0JA 1R86A 4AD3A 4F3HA 3NZGA 1QO2A 2NQHA 4EXQA 2Z1SA 3OGSA 4DO6A 1IZKA 1XKJA 3STCA 2QZRA 2GZXA 3F5LA 4UOQA 2EGZA 4DWSC 3AUOA 3BVJA 3BURA 1PAMA 3N1AA 1HQTA 1JZ4A 1SSDA 1GPWA 1N55A 2XM2A 4DWSB 1LRQA 1F61A 1G7VA 5DN1A 4RR4A 1PDYA 4S23A 5D2WA 3OVGA 2OX1A 1FQ0A 5BYWA 4HN4A 4MG4A 3TC6A 1SFLA 2WAGA 4AD0A 4X9SA 4LUTA 4DJEA 2J24A 2HVNA 1RJQA 2BHZA 2WMIA 4OIFA 4NRSA 3GAYA 5A2AA 2VKZG 5I5RA 3LXCA 2VENA 1E9IA 1KBIA 4LV4A 1O12A 4AZBA 4DPQA 2VFFA 1GQJA 2X7WA 2CNCA 4UTKA 2HXUA 3HG4A 4GBDA 5ABFB 3LPFA 3LXAA 1NQ6A 1TR1A 1TO3A 4L64A 1UQYA 3P0WA 2INZA 3KW3A 3W27A 1EX5A 5GPRA 4WLCA 1W56A 4LWWA 3WLIA 1XBVA 3BOLA 2GDUA 4S3CA 4PL1A 4E2OA 4H04A 1W1YA 1A5NC 3CL7A 1T96A 4V1XA 3H2NA 1ZSXA 3QGVA 4F48A 2XDFA 4MF4A 3VUPA 5E6ZA 3OGRA 4LS0A 1WKYA 2FZ9A 2V3EA 4Y7EA 2XGIA 3T8QA 1F2JA 2YR1A 3HG5A 2PBOA 2A5HA 3BW2A 3VD3A 1FWIC 4IMFA 3TTSA 1BVZA 1VRXA 3HQPA 3OBEA 5BU6A 3M47A 1TJ1A 4PBEA 1XYAA 4UTTC 1GVSA 2WWCA 1A5BA 3VNYA 1RXOB 3MHFA 4QCFA 1IEVA 3AXHA 4O53A 5AVHA 5LHFA 2E77A 1TG7A 1E9YB 2P1FA 1RAKA 4H8UA 2X1IA 4PCPA 4RNIA 2ALDA 4U5KA 1K6AA 3UXKA 1TA3B 1R30A 5EMKA 4KF1A 4XZMX 3CUXA 2YZRA 3TKFA 1OFEA 2VZOA 2VVNA 4LRTA 4O52A 2V3FA 3GHRA 2VRJA 4QJ1A 2HDJA 3QBUA 3V1PA 1QI5A 5I6SA 1J0YA 2XFWA 3ES7A 1FFRA 4AHOA 1BGAA 4MSSA 4FIQA 2P5NA 3KM8A 2ICSA 3IARA 2J74A 3W4RA 4EPKA 4DM2A 5GNZA 3GC2A 4JIIX 2ISSA 3U6WA 3H4WA 2NZLA 3FAXA 3VOJA 4H19A 4I7VA 3ABXA 5IHRA 4W84A 3B0VC 3N29A 3CL6A 1KFCA 2YL8A 5FJJA 4GYPC 3V5OA 4NU7A 3R0UA 4RJEA 4WD0A 1QNOA 4WDWA 3F5JA 6ALDA 2D2JA 2X0HA 4IP7A 4AU0A 1KC7A 3CO4A 3EEZA 4K6AA 1DJWA 3Q67A 3WNPA 2EPLX 1GGOA 2VVSA 1XL9A 3DBPA 1F3EA 2QUVA 1V02A 4EACA 2IQTA 5I24A 4A8NA 4FNSA 2RDWA 2JBMA 3HOJA 1DHPA 5K2ZA 3KCOA 3ATYA 3UZJA 1OYAA 2E40A 3S5SA 2CZVA 1V6YA 3L5MA 1KM4A 1UP2A 5FJIA 1JDFA 1YPFA 1QNVA 5I77A 4QM1A 1VIWA 4XBKA 4DJFD 1LJYA 4Q4MA 1XIJA 3BMXA 4JYFA 3POHA 1JF6A 4MKVA 4LCRA 3GW3A 3LDVA 2FLIA 4UMCA 2E9MA 3RO6A 1UD5A 4JHZA 3FV9A 3NPXA 2RDUA 4HT3A 3W2LA 3HGSA 4YNGA 3KS6A 1JGMA 3ARVA 3L0NA 4N7QA 2F6KA 4HHLA 4Q7BA 3W1TA 2YCLA 3BDKA 1JGIA 1P6CA 5FF2A 3WQ6A 2GFTA 3W1UA 1Q7MA 4DX3A 3NQMA 1HL9A 3OP2A 1E51A 2XUCA 2OGJA 3QSRA 1S3HA 1OHLA 4R33A 3G22A 2V5LA 1VR6A 4K1GA 1TJRA 5AYXA 3SO7A 1WDRA 1XG3A 4IX2A 2EPOA 2DSZA 4MJ2A 3EOUA 2VR4A 2B7NA 1GG1A 3ITCA 4U2YA 1RBAA 3M5VA 4UUIA 2FJUB 4GE8A 1PHQA 1DWGM 2ZZ4A 3CBWA 3GR8A 3NVTA 4IMGA 5FACA 1KFKA 3V5FA 4O12A 1P1MA 4FX7A 2FPYA 3BMVA 1FX6A 1LWJA 1TWWA 1JAEA 1BSLA 3MI2A 3ARXA 3NPWA 3GZ3A 2Y61A 2KZHA 1J6PA 4FNPA 4J3SA 4YTTA 1NFGA 4F4RA 3MV01 4U2ZA 1SO5A 1K4GA 2GVGA 3LCLA 1PDZA 3QLDA 4JIRA 4L4PA 4GY1A 4A3RA 5ABGA 1DL3A 1HN1A 4P2VA 4EK7A 1Y5WA 4HTYA 4UWMA 4XUGA 5CCZA 4XK2A 1AL7A 2QKFA 1UWQA 4J3ZA 5DRCA 4B5TA 1FH9A 5DRIA 2YB4A 4H6EA 3NGFA 3H53A 5C9WA 1E3XA 3KX6A 3VGEA 1J5SA 2DZBA 5IM51 4AZ7A 1SQ7A 3QMRA 4J40A 2FMNA 2FGZA 4QAWA 4QAIA 1WX0A 4C6MA 3RLHA 2QUNA 4AG0A 2JKEA 1MXSA 4F66A 1NDZA 4FP1A 1RV8A 3TCEA 1EDQA 2E1DA 4LJ3A 3VD9A 3WLKX 1CGXA 2CCRA 3VMPA 4K7YA 2ISFA 2FHFA 3TXZA 3ZOAA 3NZ1A 1CECA 4PMXA 5D9PA 3FDKA 1RBLA 2F38A 1OJXA 2WSYA 4ATWA 4CD7A 1AD1A 1XYBA 4IJRA 5JQ9A 1XQKA 4BWLA 1IZJA 3LZ5A 2F8QA 1I1XA 3UJRA 4D6FA 4A2RA 2Y1HA 1MDLA 4I3GA 4E4PA 3CMFA 5A95A 3UERA 2QEZA 3STGA 3AISA 3QPEA 3BANA 4S3FA 4U3CA 4BQ4A 4D1JA 3VE7A 4PMDA 3I7RA 1SM9A 1GVQA 2AL2A 3PTQA 1NIUA 4DF0A 3SW6A 4M8UA 1W6TA 1VBHA 1YTKA 5M5DA 1GPFA 2A7PA 4IG2B 3KTSA 3M5ZA 2V63A 1T6MA 3LCHA 5M2FX 3HV9A 3WN6A 4MJZA 4Q22A 3UY7A 3R13A 3RPMA 3P74A 3WQCA 5DT7A 5CG7A 2PLKA 1I4NA 3K8MA 2J25A 3MUAA 1BYAA 3RLVA 5FKYA 3B9OA 3USZA 1XLBA 2WM1A 2PDQA 4AZ6A 3A4JA 4GY7A 3OHIA 3LV6A 1G4EA 4C6IA 1JQVA 2VQUA 3A9BA 1WA3A 1ME8A 1PWLA 1Q8AA 1IT8A 3SY5A 3SCOA 2NT1A 1DJIA 1LG2A 2CESA 1F3WA 4A2SA 1UUOA 4MUZA 3N2OA 1IT7A 1NY1A 4TVCA 1MZHA 1M65A 1ADSA 1JULA 3LHVA 4FR6A 2VI0A 1A0EA 1L6WA 2WVTA 1GOXA 4PTNA 1JPKA 5A8OA 3VK5A 2Y24A 4DF1A 1F6PA 4JPGA 2PLCA 1K9DA 4TUFA 1OZQA 4A05A 1MW3A 5D9MA 4JD4A 3ITGA 3M41A 3FYYA 1L6FA 2GWGA 1J11A 4GXPA 2B0MA 1NF0A 2QF8A 1V3HA 3S9IA 3IS4A 3GH5A 1S38A 1R7OA 5M3WA 2OR2A 3B8IA 1H7RA 3SGUA 5AHNA 2HTMA 4HNLA 5HMEA 1MW2A 5AOUA 3UJ2A 2QR6A 2PDIA 4JTFA 1PHWA 4HYRA 1R3QA 4PMRA 3U4FA 1D2KA 1K1DA 5K9CA 1GONA 1HJUA 3W88A 5REQA 1EQPA 3V5CA 2OELA 1WB0A 3V4BA 1HUVA 5CZJA 1PZ1A 2X30A 2XZ9A 2ODOA 1RR2A 1MXGA 4FIRA 4O4VA 5G1MA 3P8IA 1UKPA 3LGGA 2X2GA 2IKHA 3CS2A 2Z1VA 1A5CA 3UWVA 1K9FA 1TPDA 4XZLX 3NQCA 3E1F1 4LX4A 2CXEA 3EOLA 2XWEA 1TVLA 1XG4A 3TC3A 3QHNA 4HQVA 4G2DA 3W00A 1PWMA 3ARYA 3E2VA 3VIOA 1MFUA 3TYDA 1P0DA 5J5DA 5A6TC 4PC8A 3GM8A 1AW5A 2FFIA 3MC5A 5HPCA 1XLIA 1XLKA 1CXIA 4D6HA 4O50A 1Q6FA 2PFHA 1SO4A 4P7LA 4GFIA 3CXOA 1EPVA 1WOBA 4PCTA 2VHLA 3EDDA 3T2PA 5BOFA 2C15A 1SO3A 3WF3A 1KM2A 5C6MA 3WL0A 3II1A 4P8VA 2XFYA 3JR2A 5MKGB 3B06A 3M0MA 4KEUA 3W7KA 3FXGA 1F3TA 4Q8OA 1XFCA 4UCFA 2XYLA 3MYPA 4GIYA 2O4QA 4N0RA 3C2EA 2WWDA 1B31A 4XTIA 3QFWA 4B3KA 1E9ZB 3C8NA 2YBVA 4DAFA 2GDQA 4V1YA 4XISA 3W7PA 4D8LA 4JNMA 4L61A 3T81A 5CPLA 3CHEA 1W31A 3WH5A 1JR1A 4KT2A 4RE4A 4PB5A 1KGXA 3AALA 1KM3A 3W2NA 4XUYA 3W1MA 1DIEA 3CL8A 5D9OA 2GVJA 2O9RA 3SGZA 5TD4A 1SJAA 1WPCA 1O60A 1A5AA 4XZBA 2DPEA 2I5IA 3BLEA 1XJBA 4LYKA 4CNTA 1ELSA 4JQ1A 3B8SA 1W2PA 1SGJA 1PKMA 3A24A 1MQPA 1V3IA 2VMFA 1K6WA 1OD8A 2VOTA 3SSZA 1E73M 4UB9A 3LHUA 1VLWA 2H8ZA 1KV5A 2VURA 2HROA 4KWSA 4NNBA 4AW7A 1JUKA 4DZIA 2I9EA 4LC8A 3ZT7A 3W1QA 3CHVA 3K8LA 4TXEA 3T08A 2C13A 3LCGA 4PMJA 1H1NA 2OQYA 4OECA 4Q4PA 4QQ3A 3EX1A 1UD3A 1GK8A 4C7FA 4CNPA 5AN7A 3IGUA 4MB5A 1TPB1 1OGBA 1B9ZA 2PU0A 3T05A 1KNWA 5DQPA 4E2BA 4JFTA 2Y89A 3LS9A 4DBUA 1LT7A 3O15A 2I16A 3B0XA 5AECA 2YDRA 2J9YA 5CPTA 3WBYA 1Y65A 5KTLA 1VIZA 3CTLA 3GBDA 5EMLA 3W83A 3MT1A 4AHPA 3GR7A 5RUBA 3RX2A 3MUXA 4HB7A 3KZSA 3KL5A 3LLFA 4HGXA 2Y62A 2D24A 4PEKA 4AIUA 2BY1A 4S1FA 1ZBWA 4POCA 1AQFA 3MKKA 1F6KA 5CZKA 4KCTA 1S2TA 2J4GA 1LQ0A 4NJJA 3ZR5A 1L9WA 4WJ8A 1ZJHA 3Q2DA 4LTSA 4DWDA 1TIWA 4FF7A 3SSJA 1EJVC 1PV8A 4CNNA 4UZUA 1X39A 1UC5A 2OFJA 3GHTA 5ABTA 1FWRA 3N04A 2ONEA 3PHAA 3ITVA 4L9YA 3UNDA 2W0UA 2EQDA 1W8GA 3PN8A 3HA1A 1FRBA 3NOEA 1YX1A 3MVTA 3B0UX 3HZ3A 4KIRA 3C2RA 2YYTA 2DZUA 5EGRA 1UKTA 1UROA 3W3OA 4WDXA 2D0GA 3ORWA 3LCIA 1T8QA 1US0A 2YYUA 3W2MA 5DELA 3W1PA 1H7PA 4GI4A 3ZR6A 1H7XA 1Q4NX 3FKRA 3U5YA 3ANVA 3WLRA 4RNFA 1E0WA 5CC7A 2CZDA 3QVQA 4AVNA 3UA4A 2INEA 3KWSA 3T0AA 3PBGA 2Y8VA 3WIJA 2E28A 3OTRA 4P7NA 2ATSA 2DZXA 1B90A 5CPMA 1O5QA 1JPHA 4IPLA 1TPWA 3GVQA 1BLIA 1W3IA 1F4HA 1B9BA 3AMGA 1QWGA 3HFTA 2ABBA 1V0MA 2J9XA 5AHLA 5A6BD 3KE0A 4L1WA 1X6UA 1C9WA 2XSAA 4I5RA 4EPDC 1E1EA 1YQ2A 5D05A 1E40A 6XIAA 2J7FA 3CUZA 1RZMA 2W79A 4MM1A 1W8SA 2YZ5A 3QPYA 2J79A 1XDLA 3VZXA 2DIEA 5BRQA 1R3WA 3DG3A 3PM6A 1WQ5A 3H55A 3SRHA 2ZZ5A 5FIPA 5C0QA 4ZR8A 3T9PA 3ZZ1A 1R85A 1SUXA 1WBHA 1MI3A 2ZADA 3WLTA 1DQUA 5DBUA 3C0SA 3RM9A 3W7NA 2H3DA 5CC6A 1LYXA 4GZIA 4S3JA 2MUCA 4JIPA 2DZTA 3WJWA 2Y7DA 1OF6A 4BI7A 2PDNA 1VJSA 1K02A 2WBKA 5T91A 2XISA 3QGAC 3LYEA 1A3HA 3NA8A 1MWOA 3G1FA 1DXIA 2CBVA 2IXVA 3FJLA 3NQ7A 1HKJA 3CUHA 5I03A 1N2VA 3TYZA 1GKQA 3S2CA 2J8TA 4UTLA 3AHTA 3DCPA 3LK6A 4IFKA 1E71M 3LU2A 4J5NA 4X9YA 3SZ8A 4AIBA 5TF0A 4UTWC 3DI1A 2E3ZA 1A0DA 3RU6A 4W7WA 1AJ2A 1CIUA 1C93A 4AXKA 4IJBA 2AQWA 1UH2A 2JGYA 3GU2A 2ZUTA 1XC4A 1EYEA 1KLYA 4OUIA 1IWBA 4W85A 4JL1A 3U3HA 3MW7A 3T78A 1GEHA 3GFZA 1KXTA 3WQGA 2Z2BA 4G7EA 4YPJA 3CEPA 4DJEC 3UCDA 1RBOB 2PTXA 4AEOA 4O8AA 2VD8A 1P7TA 1F3XA 2IKJA 5T8GA 5H2ZA 3TUUA 3TSDA 2ZUUA 3NNTA 4WX2A 2WMIB 1UOZA 3GYCA 4LUJA 2R1KA 1UPMB 1MW1A 1BF6A 4QXIA 3IJLA 1EUAA 4ROQA 1XUZA 3KOWA 1MXDA 3KVJA 5LZLA 1WDDA 3VD7A 1XLLA 3O3RA 3LD5A 3A3WA 3Q65A 2W66A 1JXJA 4XAZA 1Y5VA 3UPBA 3SR7A 2NW0A 3M9YA 2JEPA 3E0VA 5E0CA 4IP4A 4BQ3A 1BEUA 1XIDA 3E0WA 1M3UA 3WQ4A 1EJTC 5C71A 2VCBA 3CHFA 3ICJA 2BZNA 3G1HA 3VKJA 4G56A 3SCQA 4FLOA 1T0OA 4MJ4A 1TZ9A 3RIKA 4W87A 4YYCA 4IOTA 3UZWA 3MMDA 4QSFA 3LMZA 3WSUA 4DZHA 1EOKA 1R38A 3PZOA 1TMHA 4MFDA 4B9YA 2ASHA 3IIZA 1GYLA 1HO1A 3W7GA 1G67A 5EA9A 5HATA 1BKSA 3Q4DA 3CYVA 2ISWA 2J7BA 3GWQA 2GJNA 3NURA 3VNLA 5E0FA 2W62A 2CITA 3VCRA 4CNOA 3UU0A 4HP5A 2A6NA 4QDWA 2PLMA 4Y9AA 4ZE5A 2Q8ZA 3WH9A 3UCCA 5HAOA 1LZOA 1UR4A 3PPGA 1VLIA 2TMDA 3ABSA 1I2NA 2P0IA 2G97A 5HMDA 4KFPA 3GTIA 4QBXA 1B0IA 1NOFA 1OCBA 4LUIA 2WMJA 4JTKA 2VC7A 3S6DA 1Q6QA 3RK8A 3THAA 3LPGA 1RK6A 2ZXQA 3HF3A 1H11A 4NJIA 4Z2IA 3MI6A 2YCEA 5E93A 1TZZA 2R82A 3E49A 3F2DA 5TIMA 1GYNA 4BF5A 5LA1A 2XVGA 2Y88A 3QZAA 1Q85A 3H2MA 4FO4A 2C71A 3SBFA 2E1WA 4OWGA 1BTCA 1W5PA 3CV2A 4HNCA 4E3TA 4JL2A 3EA1A 4DI8A 2Q8XA 3BLKA 3THUA 4M51A 4HMEA 2QCGA 4HA0A 1M7OA 5MF5A 1IR2A 3FAWA 3ZVIA 2DY3A 4ZOAA 1KM1A 1NOUA 4MPKA 5XIAA 2GLKA 3AQUA 4CN4A 2CBIA 1X96A 1IE7C 4OZOA 3VZYA 5I3KA 1V7YA 4EF8A 3LGDA 4YVPA 4W88A 3RU8X 3HO8A 1Q6DA 1VF8A 1KQZA 1N82A 1K4HA 1O4UA 2QYGA 5I02A 3V0SA 2EO7A 3M16A 3WKZA 4DAIA 2PCQA 1UWSA 3T07A 3C5QA 4NHVA 5A8MA 3EPMA 3PAJA 1AG1O 5DBTA 2NXGA 5HWJA 1PTAA 3W7RA 3VIMA 1SW0A 4E2VA 4U4MA 2NUYA 4I7WA 1O66A 3BLIA 3BCFA 3RRXA 3AIUA 2D3LA 4OBRA 1RQBA 4HPHA 3LY0A 2OGYA 1KM6A 3SDOA 3TFXA 1I1WA 1KTBA 3ZWTA 1LP6A 1X98A 1AUSL 3TIMA 2FH6A 3AXMA 3RRAA 1F6YA 4W8AA 1TCDA 1NWUA 3AZTA 3MI3A 1NP2A 3BAKA 1EJXC 1X7FA 2DVUA 2W92A 2ZDRA 3KLLA 2YCLB 1HJQA 3WDHA 3W1NA 3GC4A 4O1EA 2VEIA 4ZO9A 1LRTA 3BLDA 4M5PA 4R9OA 3NQFA 1QK0A 5KZEA 4KETA 2AAMA 4MMWA 4K8GA 3IUDA 1VYSX 3WDJA 3GBEA 3TU9A 1ZBKA 3AU6A 1Z8AA 1XYLA 3LRKA 4B2DD 1JI1A 3WELA 4A8IA 3HQOA 1FCUA 4Q8QA 1XIIA 1R9XA 3HURA 2NQJA 2EEXA 4MLJA 4LFYA 4PRTA 2W61A 4LCSA 7ODCA 1KR0A 4TX6A 3ZYZA 2G3IA 3SN1A 3E9AA 4HTBA 3QQWA 5AYZA 5MHBA 1MZRA 3FVDA 2WZIA 2X1TA 4Y96A 3CV1A 3TOYA 2IXUA 3L4VA 3PR2A 3S6OA 1XLFA 3N2BA 2A6LA 2BASA 4K36A 4V15A 1ZLPA 1JUEA 2A4AA 5LIXX 3SCSA 3R8HA 3P62A 1SU5A 1NEYA 4JNYA 4Q4SA 4RPQA 3GNNA 3QZ6A 2ACRA 3P61A 3IPWA 1UR0A 2IQDA 4HZ7A 3TYAA 1XLGA 5C2GA 2VEGA 1RH9A 3W29A 4YWIA 4U31A 4YLWA 1LOLA 4D2JA 1KTCA 2QMKA 1YTDA 4GO8A 1FWAC 1P5BA 4FOKA 4UQBA 1XWYA 3RHGA 1W5OA 1H5YA 1TVPA 3DDMA 3VKCA 1CTNA 3IGXA 5FJTA 5DANA 3LLDA 2WSKA 3UJEA 4ZEPA 2ISVA 2RFGA 3PUOA 3MY9A 1E70M 3L2IA 1DQXA 1DJGA 4CD6A 3JS3A 3BJTA 3OLIA 1LUCA 4MY1A 4ILSA 2HSAA 2VZUA 4GO9A 4MNKA 5F7UA 2F84A 1W1PA 3K2GA 4J35A 1DIDA 2HPMA 4Z2LA 1CBGA 2O7QA 1ALDA 3FY1A 1G01A 1UP3A 3I68A 1VFSA 4ICNA 1XXXA 1XM3A 3OB8A 4XVDA 5LIKX 3WYZA 2V8ZA 3CPGA 1G9HA 4BWLC 1FVPA 4XO7A 4NVTA 3G1VA 5KZDA 1F8MA 4QDMA 1TIMA 3W25A 3VIIA 3A22A 3LSBA 2DDXA 4ZQRA 5C70A 2J75A 3C3UA 2HMCA 3VIFA 3VNMA 3W53A 3T42A 3A3HA 4O54A 3EOSA 5KINA 1OYCA 4CEXC 2WKLA 4LH8A 3KLKA 2IPGA 4W9TA 4TOQA 3RXZA 5FL1A 1MNSA 5F1VA 3KVLA 2QMJA 4MUPA 3QF0A 2E5DA 3E38A 2AL2B 3V7PA 3ISIX 1UB3A 2J6VA 5ABHA 4URIA 4A8LA 3WMBA 1CDGA 4IMEA 4ZO6A 2R24A 5GVJA 1SW3A 2GUYA 2E6AA 1IWAA 1EHNA 3SIZA 1C7SA 1TV7A 3L2MA 4HA1A 2XM1A 1JCYA 5DMLA 3SQSA 2EKGA 3GFYA 5AZ1A 2JE8A 3ZLFA 3BJSA 2CIPA 4GABA 1EIBA 2VGFA 2PTWA 2KX9A 4FOJA 2GJXA 2A3AA 2QCLA 5JBFA 3GO2A 4MB3A 5JMUA 4O10A 1V3MA 4B4FA 5DMMA 3GH7A 4LAOA 3ZIZA 3DERA 4HU3A 5B7YA 1YIXA 1U1UA 2YDAA 3TW7A 3YPIA 1GVIA 4GUHA 3GG1A 4R5EA 2J78A 2PPGA 3HG2A 3LMYA 1UBSA 5XINA 1GVYA 3KCLA 2JKAA 2NWRA 2Q3RA 1KA9F 1SJBA 2VUYA 2D2GA 1XKYA 4S3GA 4LXFA 3AIRA 3KOFA 2DORA 1DP0A 1RCXB 3EMCA 4UFHA 1BKHA 1V6VA 3HM7A 2I7GA 3T2OA 1H7WA 4IPIA 1HKMA 4JIEA 1KB3A 3ABZA 4MYXA 3S2LA 1LLWA 4F0RA 2VX5A 3H2OA 1T8XA 2Z28A 1EZ2A 2PGFA 5AC4A 4N42A 5EPDA 2OWCA 5H8MA 1UBPC 2J47A 3F5KA 3PNUA 2QCCA 3ALGA 2V3DA 3W24A 2DGAA 4KWVA 2O0TA 2XVNA 1ZS2A 5CC5A 3NQ6A 3BE7A 5BXSA 2QPXA 4HZMA 1FHLA 4XTDA 3TH6A 4F0LA 4WY0F 5REQB 1H62A 1FWSA 3OVPA 3QTPA 1DXEA 4BY3A 1JPMA 3VKDA 2VEMA 1TPFA 4DXXA 2WKGA 4AZ5A 3BXWA 4ZXLA 3NYZA 3QEZA 5I06A 5FL0A 4JTCA 1XF0A 3KOXA 1R6WA 4UFIA 4O0QA 1OM0A 4RZ5A 3WQOA 3IV3A 5IOBA 3PWIA 3U0HA 3T0BA 2GGJA 3TN5A 2ZA2A 3LBMA 1XD1A 3FCPA 4UIOA 2D20A 1KXVA 3ME3A 2OOGA 3EKLA 1JDDA 3OBKA 3UZ5A 5A6BA 3MHGA 3VGFA 3ZJ8A 4JFWA 4PMOA 2PD9A 3T4CA 4A29A 2ATMA 1E3ZA 2Z2AA 5FJPA 3FHQA 4ACYA 3GXMA 4UXDA 1GQNA 4BI5A 1ISXA 1YE4A 4B90A 4P8XA 4D8AA 7REQA 3DYOA 3UGVA 3PZVA 4JR5A 4LVAA 1I2RA 1PSCA 3N3MA 4FR1A 2GJRA 5FD0A 4ENLA 2OSXA 4QE4A 5LA0A 1O7AA 3CIXA 4C1NB 3AU2A 4UTUA 1M5WA 2JFEX 3W23A 3IACA 1TTIA 1VCGA 1LQAA 1VHNA 4DZ5A 1NOWA 4J3VA 5E1QA 2C91A 3JZUA 2GL5A 4ML9A 2J7HA 3LCFA 3TTYA 5HANA 1IXQA 4GA8A 1UWTA 3AYSA 3LN3A 3S1XA 1U83A 1LM1A 3DC8A 1BAGA 4C6NA 1UZ4A 4S2CA 1QI4A 1JCTA 3Q58A 3G3MA 3OG3A 3ITYA 3MV11 4ATDA 1J8VA 4KCWA 2ZUSA 4GWEA 4JEQA 2ZRUA 4JTHA 1LBLA 5LGZA 3D6NA 2W3ZA 2XH2A 5I3GA 3WMLA 4IWWA 3H4XA 4LS1A 2E25A 3H12A 3BAXA 1Z69A 2XSXA 4GI8A 4DBDA 1LQ2A 3AOFA 3ITLA 4M56A 1BVWA 3KHDA 3DECA 4PCSA 4RV8A 4YMZA 1Z41A 2CC0A 4O4WA 1G1YA 2QS8A 5D03A 5ECUA 3VOGA 2RUSA 5E70A 1ZZMA 1TMQA 3E0FA 5BMWA 2PODA 4FNQA 1K3UA 2VDIA 1EX1A 4DWSD 3G24A 5LXXA 2ZUVA 3FS2A 3BG3A 5D33A 1YMYA 5FEWA 1DJZA 1ISYA 2Z6IA 1WKEA 2CHNA 1P43A 1Q6LA 5I3DA 1DVJA 4AWUA 4F2TA 3N14A 4W7VA 3W0KA 4RE3A 3PZUA 5I07A 3NZRA 1AA1B 1W3JA 3LBOA 4JX5A 4UMBA 2D73A 5DXXA 4NZ4A 2HISA 2Q01A 1XCXA 3W73A 1XLJA 2HVOA 2W6RA 1SJCA 2NV1A 3DHFA 2PF0A 3LRMA 2VM8A 3RJYA 2OO6A 3DEQA 3SAZA 3SRDA 2J77A 5K7JA 4LRSA 1H0GA 1QOPA 2QCNA 3WCZA 5I00A 3C61A 1JIBA 4QJ4B 1BXBA 3PTDA 2BHUA 3FOKA 1JDAA 1UHVA 4O1AA 4WSJA 3VGGA 2XH4A 2DSKA 1X1OA 3RR1A 4GVHA 4EXBA 4YS1A 4LC6A 4E0CA 2A3LA 2QPSA 3DG7A 4XAFA 4IF2A 4YTSA 3GYEA 4B15A 4YTRA 3CZJA 3WO8A 1EL3A 2P50A 3WEMA 4ZQPA 3JU2A 3ABRA 5DT5A 4WOQA 1SZFA 3BZGA 8RUCA 3MCMA 3DN5A 1IEQA 1HW6A 3B0PA 1BYDA 1UKQA 1HIZA 1R3YA 3GDBA 3NJ3A 1UWUA 1YTEA 3RX4A 1PTGA 1TPVA 3F2BA 2E4TA 3VDHA 4CQ9A 1A49A 3W85A 4QR6A 3DGRA 1W1TA 4QDPA 2OJPA 1OC7A 1J18A 4KWUA 3AO0A 4GYJA 1FCBA 1ICSA 1FWWA 3HPSA 3MWAA 5I09A 1ZFJA 2PDHA 5B7ZA 1AZ1A 2Z4GA 3UWYA 4GCXA 4JFUA 1VD6A 2CERA 1EIXA 1JCXA 2ZXAA 3S47A 4IFOA 1J01A 2AQOA 1P1XA 1O5KA 3MVIA 2WHMA 2HQAA 1WBJA 3PG8A 2YXOA 3TK7A 2V67A 1SZEA 1BQGA 1YDYA 3JRKA 3EXSA 4GJ1A 4HK5A 4R7JA 2OG9A 1WYIA 1KV8A 5LNSA 2CLIA 1OFBA 3BCJA 4QSHA 3Q94A 3WQVA 1EGVA 4PZVA 2AL1A 2P53A 4G7FA 1GCYA 4AXNA 3B9NA 5I78A 4E6MA 4XIMA 3TFCA 3IRDA 3RJXA 2V2CA 3OG2A 3LB0A 2DZWA 2HEJA 4UZSA 4DBWA 1RJPA 4QX4A 5HNNA 2GQ3A 1EYWA 1H7OA 1K8CA 2E7FA 4ZQOA 2RDTA 1FUYA 1YW1A 4PCFA 4GYFA 1R2SA 1KRCC 3UWQA 1VHCA 4I9TA 3L4ZA 3W07A 1BWKA 1JFXA 3DHPA 4DXVA 1B3WA 1CLKA 3VOFA 5AC6A 5JVLA 2ANUA 2DEPA 2VX6A 5AVNA 2FMOA 4LVFA 2X42A 4Q8VA 2OWWA 1TR9A 3VIKA 1P0EA 1CNVA 1GOKA 4FNRA 1E5NA 1YHTA 4GJIA 2EF9A 3KZPA 4J3UA 4W5UA 1XP3A 3E02A 3CWOX 2OVLA 2WK2A 3R4IA 3LA4A 4M82A 1SR9A 4AY8A 3M5XA 4Q4OA 3WLNA 3URAA 2PDUA 3EWBX 3I7SA 3M0LA 4J27A 4OU1A 4H8VA 2YFNA 1MFVA 1Z32X 3E2SA 3WUBA 2TYSA 4JBRA 5EMJA 3RILA 4O1CA 3F4CA 3L0KA 1P0BA 4QJ5B 5GNXA 3LX9A 3WK3A 3HFYA 5CLTA 1ZAHA 3AS3A 4Q32A 4Z1AA 1PZ2A 4HA4A 1XLCA 3AAMA 3SB0A 2RH9A 4DUVA 4QEHA 2Y70A 5HR6A 4G7EB 3EA2A 4N4QA 4PMUA 3MSYA 1P7TB 3NL2A 1TB3A 2GOKA 3CU2A 3PFMA 4IPPA 3W37A 4LBUA 4GZ7A 3I4KA 3VKBA 1W5NA 3K4AA 4FK9A 3CZKA 1QMLA 4XAGA 3P8JA 2PSNA 5DY2A 5KSWA 4LGXA 2AKZA 5CH9A 4LUSA 1QNPA 2IUZA 5CJ5A 5HINA 1EO5A 4BR1A 1SO6A 3OJGA 2QCDB 3HGJA 3PUGA 5EFDA 1GW9A 3K4WA 3BH4A 3FYPA 1KWKA 2VT0A 3P81A 3GH4A 2PE4A 4FPSA 4LCQA 2V69A 1R3RA 2ACSA 3OA5A 2DUXA 1GJPA 2RJGA 2R14A 5E9AA 3HMCA 3APYA 1JZ7A 4HPGA 7PTDA 3AWNA 4AWEA 3O63A 4GQRA 3OLEA 1TUXA 1WZLA 2BX7A 3UF9A 2EPKX 2VCAA 4H6RA 4A35A 4B5VA 4ECLA 1RK5A 5D8ZA 1RD5A 4DZAA 3ZT6A 4IIGA 1OC5A 3HB9A 2C6QA 4LANA 4JZ5A 4ZTXA 3BK0A 4XZNX 2B7QA 3PUEA 4H83A 3ARQA 1YRRA 3PPCA 1B57A 2ZZ7A 3QQ0A 1YXCA 2YJQA 5A1AA 3EEGA 3IGHX 1YDNA 5ABEA 2WCAA 2CHOA 1OG6A 5G1YA 1X6NA 1WXJA 4MLRA 3LEPA 4WEVX 4I8YA 2FTWA 3IIVA 1TPEA 1BWVA 3ZVHA 3BLFA 3AIWA 3EB3A 2HNEA 3OBAA 2E68A 4KW2A 4B91A 4OUEA 3BGAA 3TYUA 2PDXA 2ZYFA 4WXYA 2I9UA 3DYPA 3FVMA 1F74A 3ZJ7A 1WUEA 4JCLA 5D02A 4UQEA 3GC5A 3RN6A 5JU6A 1VEPA 3PNZA 5C7HA 2WZEA 2YXGA 4MYAA 1MVYA 1GQIA 4JTGA 1D3GA 4TVDA 2Y6ZA