4JTDA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
b'LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
total genus 121
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtdA00
1XJBA 1IEIA 3S3GA 4GACA 2C91A 1ZGDA 1Z89A 2BGQA 4R9OA 4PRRA 4WDUA 4XZMX 4JTQA 4EXAA 1LWIA 2IQ0A 2FVLA 1S1RA 3BV7A 4FZIA 4XO6A 4XO7A 1ADSA 2VDGA 2R24A 5DANA 3WBWA 3D3FA 1X97A 1ZUAX 3WG6A 2INEA 3RX4A 3QKZA 3O0KA 3R58A 3UGRA 4DBSA 3ERPA 4NKCA 3R7MA 3LBOA 3UYIA 2IS7A 2PDYA 4YU1A 4ICCX 2ACUA 2HDJA 3RX2A 4GA8A 4MHBA 4XAPA 3WBYA 4IJCA 4XVDA 2PDPA 2IPGA 2BP1A 3LZ5A 2PDUA 4PMJA 3V0TA 4IJRA 5M2FX 2P5NA 2CLPA 4GQ0A 4RPQA 2IPJA 4DBWA 1QWKA 3EB3A 4DZ5A 3Q65A 2PEVA 4H7CA 1X98A 1GVEA 2PDIA 2NVDA 1FRBA 1YNQA 1XF0A 4XZNX 3CV7A 1US0A 3DOPA 4QXIA 3U2CA 1OG6A 3LN3A 1QRQA 3COTA 2HE8A 2PF8A 4PUUA 4JQ2A 1HQTA 3R8HA 2PDLA 1AH4A 4LAUA 2HVNA 3UZWA 1MZRA 2PDGA 1RALA 2R9RA 5HNUA 4JIHA 2PDJA 5AZ0A 4LB3A 1X96A 1S1PA 4JTCA 1RY8A 1AH0A 3GHSA 2PDCA 4ASTA 5AZ1A 2DUZA 3V36A 5LIWX 3EB4A 2J8TA 5HNTA 4WDXA 3MB9A 3CAQA 1ZQ5A 1RY0A 2IKJA 3M64A 2IPWA 3O3RA 3H7RA 3V35A 2I17A 4YVVA 1S2CA 4YVPA 4L1WA 3LNMA 3C3UA 1R38A 1VBJA 4QBXA 2FZBA 3EAUA 3G1RA 2PFHA 2PDWA 3R6IA 4G5DA 4LBRA 1PYFA 2PD5A 2PDFA 4WGHA 4JIRA 1AFSA 4GQGA 1PWLA 3KRBA 3H7UA 4QX4A 2PDBA 4WRHA 5LIKX 2F38A 2IKHA 1Q13A 1Q5MA 3N6QA 1LQAA 4JTRA 1MRQA 1M9HA 4QR6A 1HW6A 5KETA 1Z8AA 2I16A 4WDWA 2PDQA 3UFYA 4PUWA 1EXBA 2NVCA 3UZZA 5LIYX 3R94A 2WZMA 3VXGA 1EKOA 4L1XA 4XZIA 1PZ0A 1T41A 3T42A 2ALRA 5C7HA 3WCZA 4WEVX 2AGTA 4JQ4A 4ZFCA 5LIXX 1JEZA 3UZYA 2IKIA 2ISFA 4FALA 2FGBA 4OTKA 2QXWA 2FZDA 3GHUA 1K8CA 3LQLA 2FZ8A 1IHIA 2HV5A 1PWMA 3LEPA 2ACRA 2IKGA 2HE5A 4JTDA 4XK2A 3WBXA 2HVOA 1AZ2A 1ZSXA 4JTAA 3CAVA 3BURA 2PDXA 4DBUA 3Q67A 3GHTA 1T40A 3R8GA 2INZA 3N2TA 4F40A 3V0SA 1AH3A 3LZ3A 4LB4A 3CV6A 2PDNA 5JH2A 5JH1A 3MC5A 4JQ1A 1Z9AA 1XGDA 2WZTA 4GCAA 3NTYA 2IQDA 1YE6A 3F7JA 3ONCA 4FAMA 1S2AA 4YS1A 4Q3MA 2HEJA 3LD5A 4YVXA 4PR4A 3BUVA 3H4GA 1J96A 3GUGA 5HA7A 3RX3A 1PZ1A 4XVEA 4I5XA 4JIIX 3UG8A 1UR3M 3P2VA 1C9WA 3R43A 2PDMA 4IGSA 4FA3A 3LENA 2BGSA 1YNPA 2A79A 1A80A 3DN5A 3G5EA 3ONBA 3FJNA 1MI3A 4LBSA 1AZ1A 4H8NA 3CMFA 2PDHA 1Z3NA 3UP8A 2PD9A 2ACQA 4WDTA 3LUTA 1SM9A 4AUBA 3UZXA 1EL3A 1YE4A 4PRTA 3M0IA 2DV0A 4HMNA 5LIUX 4GIEA 4LAZA 2FZ9A 3CASA 4JQ3A 3GHRA 2F2KA 3B3DA 2PDKA 1EF3A 3LQGA 4GABA 3FX4A 3UWEA 1VP5A 4Q7BA 3BCJA 4HBKA 2DUXA 4EXBA 4JQAA 2IPFA 2ACSA 4XZHA 3V0UA 3M4HA 4XZLX 2PZNA
chains in the Genus database with same CATH superfamily
2OOGA 3I7SA 4AWTA 4E8DA 4IL0A 1O5XA 3W7RA 4A2SA 5LSMA 3L0KA 1K9FA 4JTIA 2ZQ0A 1G0CA 3O6DA 2JK2A 4MFEA 1LBLA 1TZ7A 1QNQA 4AD2A 1OVDA 2E9LA 1TV8A 3L7RA 3W00A 2ZA1A 3MQTA 5D8WA 3GR7A 4DELA 3IJQA 3ARVA 1ONXA 4K38A 4KIRA 1EPVA 3EWWA 3CL6A 4PUDA 1J2WA 3RX4A 4S2CA 4K1WA 4QNWA 3O0KA 2YYTA 3IIVA 1LOQA 3LBCA 4GKTA 3ITVA 4X2PA 3VDBA 1MFVA 2VC7A 1KTBA 3QZ6A 1MQRA 4A22A 4C6MA 4LYQA 2HDJA 4FIRA 1WDSA 2BY2A 3RX2A 1DPMA 3WBYA 5TBOA 2GL5A 5XIAA 1KFWA 3M0XA 2FTYA 3ZWSA 3V0TA 3LU2A 4HYVA 4IG2B 1LUCA 2J7CA 1NEYA 3QW4B 3L4TA 1KXHA 2VR2A 4DBWA 3ZOAA 3M07A 1KKRA 4DZ5A 5AECA 5FL1A 2QYGA 4JTUA 2G3NA 4RNIA 3UG3A 4H7CA 2YBVA 4U5IA 2O7SA 1XCWA 4S39A 3UJ2A 4CNUA 5G4EA 1SU5A 1F4HA 3WDRA 5CG0A 1UA3A 4GX8A 3DFTA 3DEQA 2HPIA 4JOMA 1GTHA 1VEOA 4Y2WA 1D9EA 3KCOA 4JQ2A 1E15A 4NJHA 4XAYA 4XISA 2ZVRA 4NXSA 3SN0A 2A3BA 5KZEA 4F0RA 4UMBA 4DWSA 1G69A 1RCQA 2Q6ZA 4FNSA 1WV2A 1F3EA 5BYWA 4CEUC 4UTJA 2XFRA 4D6DA 1MQPA 4KMQA 3W87A 2FHFA 4JIHA 3A3XA 2OWCA 1UB3A 3SJ3A 4OIFA 1EJRC 4C6EA 5B7YA 5IFTA 5AZ0A 4QSFA 4JTCA 4UUIA 4UB9A 3ZMRA 4XD4A 3PTDA 4NHVA 1NTHA 2V5DA 5LIWX 4GCXA 3EB4A 1VEPA 3E12A 3E74A 3T78A 1NQKA 5D4YA 1IR2A 3MUCA 4IGMA 1EF2A 3I7QA 3H26A 1M1BA 4MJMA 1V6VA 2VNCA 3DYOA 5KSWA 5HWNA 3MDWA 2TPSA 4H7VA 3WNLA 3RRAA 2WV8A 4QJ4B 1T7LA 2VYOA 1EA0A 3AAMA 3A9IA 4PCNA 2GK1B 4G5DA 4TX8A 3O6YX 4GZJA 6TAAA 4K39A 2QF7A 1CX9A 2EF9A 4GH3A 4ENLA 1V02A 4YPJA 1H1YA 1AD4A 1AL8A 2PDBA 1OCNA 1E43A 1Y65A 1B54A 4LX4A 2F38A 5AYBA 2J78A 4KRZA 4ZOAA 4LYRA 4GJ1A 2CCRA 1TJPA 3HOJA 2EHHA 4B3ZA 2YCLA 1S2WA 1DQXA 4QR6A 3VGDA 1FHDA 1GHRA 1KBLA 5GNXA 2BASA 2REQA 3CO4A 1ZTVA 1UR2A 2QV5A 4GYJA 1HJVA 1SJDA 4ZSUA 4NNBA 5A6MA 3OVPA 1HT6A 2A3AA 3KFTA 3W6LA 2CXEA 4V2XA 5MKGA 2WNNA 4PTDA 3HB9A 3PZNA 2CKRA 3WK0A 1TZ9A 2CERA 4L4MA 4Z1AA 2V6AA 1JZ4A 4TTUA 4EVZA 2J77A 1CGXA 1R3WA 3CQJA 2BVTA 3S2LA 2ZRVA 3LPOA 2XH4A 5E6YA 1SUXA 2ZX5A 4RW5A 5AYXA 2YCJA 4RCXA 4A35A 3WH5A 1LBMA 5C55A 4PTNA 4GKLA 4HPJA 2OSYA 3F1QA 3FJLA 1XLAA 4A8LA 1R46A 2FZ8A 2ISSA 4L65A 1IEWA 1LM1A 1UASA 4JN8A 3W1XA 4ZZ9A 2QCGA 1VRXA 5K7JA 4Z2LA 3WBXA 2BLEA 3U0HA 1S39A 4US5A 4BQ2A 4A8NA 2E09A 2IXUA 3ES8A 5AHLA 2WHKA 1TKKA 4V27A 2X41A 3EWYA 3CZKA 3AJ7A 1H2JA 4S3KA 5BXTA 1CEOA 2WJFA 2RJGA 3PFMA 2V82A 2D73A 4JQ1A 2BNJA 4GZEA 5GJPA 4PYSA 5A8PA 1WA3A 2ASHA 3QW3A 1RBOB 4GXPA 3UZ5A 1S2AA 2E3ZA 1EGMA 3CH0A 2I57A 1M6JA 1BEUA 1XG4A 5HWMA 3QYQA 2G3JA 1PS9A 3VOGA 2GQ9A 4CNPA 4GRSA 1TQXA 4LALA 4IXHA 2XIJA 3SN4A 1ODUA 3VZXA 1HVQA 2O9TA 3ENLA 4A6GA 1EC8A 5ABEA 4DN1A 3W6MA 3GLCA 5DRIA 3HMCA 3ZWTA 1C9WA 3R43A 1NFBA 1C90A 1V79A 3H2OA 5A6TC 3WJXA 2RKXA 2CPUA 1IXOA 1O5QA 2QUTA 4N9DA 3IS4A 4C6DA 1E6QM 3WN6A 1YX1A 4P2VA 1QO2A 3EB2A 3KDOA 3LBMA 5EBAA 1W5QA 4DO4A 4EPEC 3SCPA 3KWSA 2DGAA 2E1WA 4PBFA 4NI3A 4JAWA 3NPVA 4G9PA 2R6OA 4FB7A 1V77A 3FEMA 3DKLA 4KBXA 3OZPA 4M1BA 1U33A 4MPQA 2YB1A 5BMWA 1A50A 2OO0A 3OZMA 3W7LA 3QHMA 4XAGA 1R2RA 1CECA 1G4SA 4XTDA 4IIHA 3V0UA 1HGWA 1K4HA 4GIRA 4N4PA 4RDYA 3K8MA 4FF7A 1OGSA 3P60A 4ZO6A 3NQ2A 4B92A 4O28A 4CD5A 3GFXA 5AVNA 4J28A 2DJLA 4PRRA 4WDUA 2Y88A 1Y0EA 4KWVA 1EEPA 4E6MA 4LW7A 4XO7A 3LI1A 1SO6A 3G6MA 2D23A 4Q8TA 2X42A 4W89A 3BAJA 4H9TA 4IMEA 3XIMA 4GY7A 5AY7A 2XTKA 4YTTA 5DCBA 1JAKA 1BTCA 3UGRA 5G4HC 3FJ4A 2V5LA 1GVFA 5AHEA 3NL5A 1UIOA 2CLIA 3UPMA 3GNNA 4IZGA 2Y6ZA 4PUNA 1L6WA 3UJRA 2PPGA 2VCBA 2WXDM 3TSBA 1IIHA 4JFWA 1VYSX 5G2HA 3CHFA 4MWAC 4YMZA 4B5VA 3F5KA 5A6AA 3GDTA 1ITXA 4DJDD 3ZVHA 1UWSA 4QDMA 2JGQA 1NDZA 4H3DA 3JVAA 5BROA 3A4WA 2VOMA 1SYTA 4JX4A 2A4AA 3RM4A 2WLYA 3FK4A 1JUKA 3QC3A 4XZNX 2OR2A 4RZ5A 4KCWA 3EOSA 2R82A 1LL7A 4NU7A 1GOMA 1YTEA 1TYGA 2HE8A 3NDZA 3FSTA 4LJ3A 5E0FA 1WDPA 4BWLA 3KOXA 3WLTA 3QPYA 4QNEA 1XDJA 3UXLA 3G0SA 1EX1A 2NX1A 2VFHA 4XAFA 3CZGA 2GVGA 3ANVA 1KWGA 3LM7A 2F84A 2VFFA 3MY9A 4DF0A 1UBPC 4E2VA 1MW1A 5E70A 5JIWA 4JYFA 3VC6A 3WF4A 5M03A 8CGTA 3RIKA 5FD0A 3JZUA 3MB9A 2Z27A 2DZAA 5EA9A 2VKZG 1CLKA 3IPWA 4PMDA 2XVGA 3LCGA 4O17A 3AI0A 2A6NA 4BF7A 3DX5A 4R5EA 1QXLA 4JR5A 2HROA 2CHNA 1UOZA 4MAVA 1SW0A 1CGVA 1XCFA 5HANA 1YXCA 1TE1A 3HPSA 2OSWA 1GJUA 4XZ9A 1H61A 4IMDA 4GHRA 4DJFD 5KMYA 2AAAA 3JUGA 4ROQA 2VZVA 4D2JA 4O8RA 1R8LA 1K70A 2Y8UA 1E9ZB 4GX9A 1WAWA 3IUDA 3LPPA 5LIKX 5C6MA 1TZZA 2J9ZA 1S5MA 4JTRA 3AXHA 4GUFA 2FB2A 1RPXA 2BOGX 1WQ5A 4BY3A 3VGBA 1EHAA 2Y7DA 3H2FA 1W5NA 1E0TA 1I6NA 3SR7A 2QMKA 2PWDA 4CQBA 4AVOA 3C56A 2X30A 5CZKA 5F2MA 1ISZA 3W1NA 2PP0A 4XZIA 5DBTA 1XPYA 4IFKA 4FR6A 4HK7A 5FEWA 2DDXA 4V1XA 5CXPA 2BBFA 4DUVA 3HGJA 3VM5A 1U1UA 1GOIA 1XLKA 1V0KA 1NVMA 1O6IA 1REQB 4MGGA 3GXDA 3PZUA 4H9UA 4H9MA 3PPHA 4K37A 3GK0A 3VIFA 3LQLA 1A0DA 4FEZA 2WC7A 5LNUA 1X7FA 1RBAA 1ONEA 1RR2A 4ADSA 4AY7A 2IKGA 2NLYA 2NWSA 2OT0A 1ZSXA 3QLLA 1MXDA 3N2MA 4CU8A 2UY2A 4IIFA 4HK5A 3L2LA 4LV4A 3H2CA 2P53A 2BS9A 2AKZA 4A3QA 1AH3A 3SUTA 2PDNA 3GFZA 3PPFA 4IQDA 1YBQA 4LVFA 3KP1A 4IICA 2QEZA 3A6OA 2VZSA 1XGZA 3VD5A 3RAOA 2WVSA 3MW7A 4NQ1A 4DF2A 1CENA 4AIUA 1WOAA 3VX1A 1XIEA 1BKSA 4B5UA 1GVQA 4TVUA 5A8MA 3STFA 3LHUA 4IG2A 4LTSA 4ORMA 4J3ZA 4AZGA 4U31A 3GAKA 5HA7A 2HSAA 4CQDA 1TWSA 3MI2A 2Y62A 4B5TA 2DSWA 3BMVA 1WO2A 3AHVA 3TYCA 4L1GA 1AW2A 2EPHA 2GGGA 4CCDA 4BS0A 2OFJA 4I5UA 1UC4A 3E02A 4W7VA 3FEQA 3II1A 4J9JA 4LBSA 4Z2KA 3BK0A 4I5RA 2ABAA 3BSMA 4TOQA 1FQ0A 1IE7C 3POHA 4TVDA 3K13A 1E1CB 3VMOA 1GZJA 1ZBCA 1GKQA 1O1ZA 4XKYA 1SR0A 1MUMA 3M0HA 4AG0A 1YE4A 4LOCA 1TIWA 1XRVA 5HJYA 1P7TB 4Z1DA 2X7WA 2QJNA 2X16A 1E6XM 3LM3A 3IANA 4WJ8A 1U5JA 1PXGA 1OX4B 2Y7EA 1DJWA 1M41A 3KX6A 4S3EA 4DY1A 2E6FA 3N4FA 4JTTA 4MNJA 2AL1A 2NUXA 4QIUA 3N73A 1ZBKA 4Q7BA 3TQPA 1PL9A 5A95A 3NDOA 3KOFA 1E9LA 4UTFA 4CQAA 1XYMA 3FYOA 1LL6A 3TCEA 3ABXA 1XJBA 3G77A 3TXVA 5T8GA 8A3HA 1G4PA 3VI2A 1Q45A 5I3IA 4JICA 1UKSA 2GSJA 4LUSB 2CXGA 3W1QA 3CQ0A 5HINA 4X0VA 3M9YA 4U4MA 4UZSA 4DNMA 2WBKA 4MKVA 4H9YA 5CPOA 2GK1A 2HPMA 3M44A 1MSSA 3K4DA 1XH1A 1FOBA 4PB5A 3LCWA 1WB0A 3BQ5A 4N6FA 5F7UA 4F4RA 1RQEA 3QJAA 1C9DA 5EMYA 1KLYA 3LCXA 4YHGA 2INEA 1GJWA 3QKZA 4MY8A 2J4GA 3IUHA 4EKJA 4QEEA 1D8WA 3T2PA 2J13A 4E8CA 1TPEA 3UGVA 3SQMA 3AWNA 4GGHA 1HTIA 2O0TA 4JEJA 1OINA 1QNPA 4KETA 4ES4A 4XAPA 1LROA 2IPGA 1DIOA 4KH2A 2PTYA 2CZVA 1SW7A 1OYAA 4PUKA 4JL2A 3SB0A 4P7RA 1VS1A 3TNOA 3NPUA 1Z7AA 4IJRA 1V02E 2P5NA 1ME8A 3KAOA 2NLIA 4M24A 1HUVA 5HMFA 1TTPA 2DQXA 1BGGA 3WD3A 3BCDA 3MUXA 4MB1A 5EPDA 1EP2A 3LPGA 5DMLA 2WOQA 3N04A 3H55A 4D1JA 2XN1A 3OYXA 4GUHA 3ALGA 1YNQA 1W1B1 1QU4A 3FIGA 2BVWA 4AZ6A 3NQBA 4QDWA 2HNEA 3REQB 2X0HA 5IBXA 4F0MA 4Y96A 3DDMA 1HQTA 3S47A 2GSHA 4DM1A 4PN2A 4PB4A 4Q7NA 3RUBL 2VEMA 2BDQA 3PBUA 1AJ0A 1CLVA 1NM9A 2C1IA 2QULA 1XIGA 3ARZA 1XYCA 3MZ2A 3PJXA 1RCOB 4H4IA 3NWRA 3T9PA 5HR7A 4YYCA 5D8ZA 3P0WA 4ZTXA 4WSKA 2GVJA 2YA1A 1LRTA 5CGQA 1UD2A 4DUOA 2FFIA 1V6WA 1IT7A 3MKKA 5B80A 2C0HA 4L7ZA 2IKJA 3VMNA 4AEFA 3F4VA 3GVRA 1G1YA 2I17A 2QCEA 3CHVA 3FVMA 4UFKA 4DWSD 2ZOXA 1S2CA 4GIYA 2FDSA 1Q6LA 1WUFA 1E51A 4B90A 2HMCA 1XICA 4F66A 3VD9A 4BF5A 3EAUA 5IRPA 5FEZA 1KV8A 5E9XA 3S42A 3AS0A 4DJEA 4JIRA 3HGSA 2ZUVA 1DWJM 3N2OA 1F9CA 2E68A 3ANUA 5I06A 1W1VA 4UTUA 3VIIA 2A3EA 4FP1A 3BLPX 4BHYA 3TWBA 6CGTA 1OF8A 3T44A 4B15A 1E56A 4M8UA 1A5KC 4GVFA 5A6LA 3AWOA 3KEHA 4IWWA 3QMRA 2FPVA 2H3BA 3PC0A 1HKJA 5A6JA 5CPSA 3LERA 4A29A 2PTZA 4MNLA 2ZE0A 3EDFA 3L4UA 1MUCA 2VT0A 4U3CA 1EQPA 1HJXA 2J8FA 3LV6A 4CUCA 4M29A 1VZWA 1XH2A 3GYCA 3P14A 5I09A 3OZOA 3EWBX 2B4GA 4A05A 5EMLA 4U2YA 4JTKA 1NP2A 4E5TA 3TW9A 4OVXA 1IWAA 4WLCA 1XHGA 3TWAA 3VIPA 2FGBA 1NWTA 5CSYA 1FWSA 2E8ZA 5I7GA 4GJJA 4PUEA 3PZMA 3FFSA 2P1FA 3HPZA 5D9NA 5K9CA 3SW6A 1K8CA 3QBUA 3E3HA 5I78A 3LB0A 3DFNA 4NSBA 3A23A 2ACRA 3ARXA 4JTDA 3I3EA 1UR0A 4AVNA 2J88A 1XLFA 4C5ZA 5AHIA 4DBUA 1QVBA 1T40A 4CNSA 2INZA 3ITYA 5BCAA 3N2TA 4CCZA 2GWGA 5FIPA 4XX6A 3NQGA 4LGXA 5IHSA 3SIZA 3L5LA 2WVTA 1I45A 3SUWA 3TYZA 3DFQA 1J4EA 2XVPA 2WKLA 4GVGA 3SCSA 1GK8A 3R25A 4Q4MA 3MSRA 3W22A 4B4FA 3O63A 4UFIA 2NQHA 3TAKA 2RGMA 3WDQA 3DIPA 2C18A 3W7OA 4YXGA 1KC7A 3QGAC 1I2OA 3RX3A 1S46A 1ESWA 2BX7A 3EOOA 4BEQA 5LYRA 1Z42A 4O1CA 1GW9A 5TNVA 3MMDA 3LENA 4AD1A 5AVHA 4KIEA 4ZB0A 2A79A 4R33A 3G1SA 2VMFA 5EMKA 3SCOA 1HIZA 5DMNA 4MZYA 2X09A 4FF5A 5REQB 2VTFA 3ZT7A 4B5XA 2DZSA 1VIWA 5H1WA 4XZBA 1NDVA 1BYCA 5CC5A 2BY3A 2QJIA 3TQKA 1JXJA 1JYWA 4XAZA 3ZO9A 1A4MA 1N8WA 3GXMA 2EKGA 4EANA 3HQOA 3CASA 1C29A 1XWYA 4WQ6A 1O7AA 3MKCA 2CLKA 2WM0A 1ELSA 5I6SA 4PCFA 2AMGA 3P5YA 4O4WA 1HKMA 3LV5A 4LXFA 3EGJA 2CLMA 3R4IA 5ECUA 3PZ9A 4L80A 3RITA 1SW3A 4JHZA 5FOOA 1SR9A 4HU0A 3ZR4A 1LJYA 2BVDA 1HJWA 4Z2JA 2BXYA 3H6OA 1RXOB 3W82A 5PTDA 4QTGA 4Q8QA 1J0HA 3C2OA 1FY6A 1S1RA 5AYIA 4IF2A 1W1TA 2WMKA 2ZXDA 3PUEA 1QI2A 3OTRA 4RV3A 2Z1BA 1Z69A 1B3XA 1D7KA 3PY2A 3SSJA 5AHMA 2VELA 3HFTA 3EDEA 1B4EA 1XLLA 2QZRA 3R7MA 2PWFA 4JZ5A 2IS7A 3OLGA 5LHFA 2PDYA 4DO6A 1I4NA 2OXNA 1JCMP 1SJBA 1I2RA 5KZMA 3W26A 3N4EA 4O52A 2VFDA 3BJSA 3C61A 1H09A 3W7CA 1H7OA 1JI1A 4CD6A 1SZFA 3WDIA 1F05A 2QJMA 4W9TA 2BP1A 3L23A 4G7EB 3E0IA 4IMCA 5I77A 2CITA 3SGGA 2Z28A 3TR2A 4DZHA 1XG3A 4DWDA 2RGLA 3VFLA 4HHLA 3EPMA 1ITCA 1JPHA 1JDDA 5I3HA 4AY1A 4HZ7A 3GTFA 5LA1A 1REQA 4UQDA 1EZWA 4KWWA 2OB3A 3SRDA 4Y9AA 2WYSA 3W74A 1OG0A 1TA3B 1VIZA 4PRWA 1G67A 1NU5A 1FCVA 1C8XA 2PU1A 3LGEA 4JFVA 2GQ8A 2DH3A 1FVPA 1I2PA 2OKTA 4O10A 2ALDA 2D24A 1F6KA 3NQ6A 3SRFA 2V0TA 2SFPA 7REQB 3LI0A 4PMYA 3UCQA 3ICJA 2GJXA 3VE7A 1NWUA 3WNPA 1ZBWA 4EF8A 1AH0A 4AISA 5C8BB 4PMQA 2C13A 2D2JA 3M5XA 3SDOA 3GR4A 4NYYA 1I0DA 1R3QA 3EWDA 2PI6A 3SZ8A 3EWZA 5H8MA 3GM8A 4CNNA 3SRHA 3TQVA 1FH8A 2WSKA 2ISWA 2YKKA 1DWIM 3AYVA 4N9CA 2BHUA 4PTXA 3HO8A 5FF7A 4F2UA 3W23A 2ZZ2A 3L65A 4NRSA 2P8BA 1CCWB 3G1VA 5I79A 3TW7A 4OECA 3U2OA 2QAPA 4XSMA 5AHNA 1AFSA 3GXIA 1VD6A 2C71A 2E8YA 2Y0FA 5CSSA 3RJYA 4ZXOA 5ABTA 4QX4A 4W88A 2D20A 3AALA 3N11A 1FWWA 5C2XA 3CZ8A 3WH9A 2G3MA 1OGBA 1XYLA 3TFXA 1IGSA 3HJZA 4TV5A 2J7FA 3S5ZA 1HW6A 3I4EA 2OKOA 1E1CA 3VIHA 1V6XA 5E6ZA 1EXBA 4NT0A 1XLJA 4O1DA 4HSHA 3LS9A 4YYFA 1P7TA 3GXNA 3MO4A 1PTAA 3TQ0A 5EMMA 3BG3A 4RK8A 3F4NA 4AMCA 2XVKA 4G1NA 1B3YA 3AXXA 1XLDA 2NZLA 3M0ZA 3WCZA 3SCQA 1YADA 2QIWA 4WKHA 1XX1A 2Z1SA 1H0GA 4MKSA 2ISFA 4Z42C 5FJJA 4E2OA 3TYAA 2YCKX 3SBFA 1E5JA 1QTWA 3CLMA 2NSOA 4N42A 4ZOBA 1L6GA 1ODZA 4I7VA 4LUSA 4IGNA 3UWUA 3FW6A 3TK7A 4ALDA 3KL3A 5FESA 4MIMA 1CXIA 1QOQA 4UTTA 3VKBA 2GOUA 4QQ3A 1R86A 2W67A 4LAKA 3OBKA 1DJGA 4KPLA 4GO9A 3W71A 5EKYA 1UH2A 5A69A 4Q4OA 2WMJA 4GZIA 3IVTA 1TE6A 4O1AA 2ADAA 3F4DA 2ZTKA 3D47A 3C0JA 3EDJA 4ZQCA 3ONCA 5C71A 3WLSA 3GZ3A 4YS1A 3BSHA 4JN6A 1IXNA 2H8ZA 2ZXAA 1Y7VA 2POZA 4H00A 2J7DA 3QSRA 1DJIA 1FXQA 4MJ4A 4AH7A 3T81A 1P0EA 2V38A 3HPFA 5H91A 3A22A 3TDFA 3GNPA 3IVSA 1CYGA 1Q6GA 5F1VA 4YHEA 1QUMA 3M0LA 1UKQA 3KDNA 5I07A 4FNPA 3MWAA 3OW1A 4XBJA 3INPA 4I5XA 1H7PA 4JIIX 1WDWA 3L2MA 4IGSA 3OQEA 1Q66A 4O15A 3NVTA 3H8AA 2QPSA 3VE9A 3H23A 5CPQA 5D9MA 4LH8A 4ATDA 4DRSA 1XISA 3REQA 3VZYA 1SGJA 3MBFA 1RVKA 2DJXA 3I65A 4UNKA 2FZNA 3IJIA 1AJ2A 2ZBTA 1NWRA 2CETA 3WF1A 3HN3A 1VFTA 1J01A 1LLOA 1R6WA 1P0BA 2Q02A 3RYSA 1Q7QA 1OJXA 5HATA 2AAMA 2DSKA 2V3DA 3EEZA 1GCYA 1JZ3A 5CJMA 5FJPA 1EYWA 1NIUA 2Y5SA 2ZWZA 4D71A 2G96A 2PDKA 3BLKA 2VCCA 1RP9A 2VGIA 3E49A 2JF6A 5J8LA 4POCA 1VP5A 4JTLA 1H51A 1KFKA 4JQAA 3TC6A 3EX3A 1OYCA 2EAWA 3MI3A 1SZRA 3RR1A 4JIQA 3THDA 3HURA 2XN0A 1RA5A 4HZ6A 3CLWA 2QDEA 2C91A 1Z89A 4ZEPA 2WM1A 3W72A 4YTRA 5MF5A 1VEMA 3N4AA 2ZUTA 3VD7A 3DFHA 1XFBA 4R9OA 2B7NA 2CZ5A 1C7SA 5LA2A 1XBZA 4FZIA 3GY1A 3RO6A 3HG4A 3BARA 2JKAA 3JZEA 2XINA 2ZZ1A 4P7OA 3H2EA 1WKDA 5A2CA 2B0MA 3Q94A 5A5WA 3N29A 4U5KA 5D38A 3C6CA 4Q4KA 4F0KA 4NKCA 4JKLA 3GAYA 3WX7A 3WEMA 2E0PA 4KCUA 1JZ2A 4ICCX 1NFGA 1W3HA 3W53A 2YBTA 1EIXA 4RPPA 4JFSA 4KQNA 5M1TA 2QDHA 1OFRA 2CZDA 2C6QA 2JKPA 3WLOA 2X2YA 1PV8A 4K6AA 2NQ9A 3WLLA 2X7VA 1NDYA 1NF7A 3W38A 3K2GA 1OIMA 4S3GA 3AMLA 1NP0A 3DI1A 2VUNA 2XGIA 3UVIA 4H6QA 4MAZA 4I6KA 2PODA 3GUWA 1IEQA 1U30A 1W3JA 1A3HA 4HA4A 9RUBA 1POKA 4NJIA 3F4CA 3NQ7A 2BMBA 3M6DA 2JALA 4H9XA 5C2CA 4TO8A 3PZTA 1CXEA 5GQBA 1KGWA 2R9RA 2W62A 1ME9A 2YW4A 1KRAC 5BRBA 2JIEA 3FKRA 3RILA 3R79A 1TPFA 2QCNA 2PRMA 4MZ1A 2GSEA 4BA0A 3BVJA 4MKNA 2YDQA 4O12A 4GWEA 3U5YA 3G0XA 1P4CA 4AYGA 4E0CA 3RO8A 4GBDA 1ZQ5A 3GFYA 4FI4A 1RY0A 3N17A 1XW8A 4UIOA 3H7RA 1V3MA 2V81A 1W5OA 4M0XA 3HF3A 4YVPA 5A8QA 4HA3A 1CTNA 3QOMA 1XLHA 1H1NA 3TKFA 1H1ZA 1VFHA 2WSPA 1R30A 1JCTA 1PAMA 4GQQA 3VTRA 2PDWA 3W6YA 1E55A 3O05A 1R87A 3T09A 3IV3A 3K46A 1RK5A 5I3FA 3H7UA 1CBGA 3KRZA 3NZPA 3GW3A 3PVFA 3IVUA 3ABQA 2GQAA 1X7IA 1WXJA 5FJTA 1MRQA 4LRTA 1J18A 1M9HA 2NX9A 4ZQNA 4BQ3A 3W27A 5D09A 3QKEA 1TPUA 5REQA 1PKMA 1AQFA 3BDKA 1ADDA 3WDJA 3UZZA 1QASA 4FNQA 5CBBA 3L5AA 4DJED 3BLIA 4GFIA 4CNTA 3EOUA 1XL9A 1DJQA 2J62A 3GKAA 2NSXA 2QQ6A 5LXEA 3N18A 3PNUA 5LIXX 4UOQA 1NELA 4YIWA 1PZ2A 4OKDA 3HG2A 1AK5A 1I9CB 1TVLA 4FALA 3KTXA 3TYEA 3GHUA 3AYRA 4AVFA 4UNIA 4HHPA 3URBA 1IWPA 3U3HA 4WKAA 4MNMA 4JEQA 1TPWA 4HPHA 2XVNA 5CC7A 3GDRA 4ROPA 1I60A 4GUJA 1PSCA 4XBKA 1YDYA 3A4XA 3DAQA 1V7AA 3W7EA 1P1XA 1XBYA 3CYJA 2XGZA 1OFEA 3EKLA 2WCAA 2EG8A 1OM0A 4X9SA 5FAJA 1JZ5A 2YXOA 3KLLA 1G9HA 3A3HA 3A47A 3LTSA 4S3CA 1M01A 5FSEC 2FIQA 1ONRA 4GCAA 5CH9A 5A3HA 2FLIA 5C70A 3IUIA 3UR8A 4ICMA 1NOWA 3CUFA 2OU4A 3L4WA 2C15A 2EPOA 2Z1XA 4WXZA 4Q3MA 4AZIA 2JEPA 3ZYZA 5J5RA 4E3TA 3MKVA 4G7EA 4A21A 1W32A 2VZUA 2FMOA 3HFYA 4Z2HA 2NQZA 4K8HA 3GH7A 4MVAA 3SY1A 3PS7A 1UIPA 3GXPA 2J75A 3ATYA 4J1OA 2PRHA 1A80A 5IXEA 4HNOA 3USBA 2D0HA 2HRWA 3WLKX 3DI0A 3PG8A 3NQDA 1HO1A 3BV4A 3W85A 1XYAA 3W81A 2F61A 1XRTA 4FXSA 1XR2A 1OZMA 3AIWA 3P81A 4CEXC 4MZ8A 1DE5A 3IGHX 3TVAA 4H8UA 4G2DA 4G1KA 4JQ3A 1XH0A 3CIWA 4RE4A 4JGDA 3UEQA 3WF0A 3V5CA 2XGBA 2PGRA 2V2HA 1JF6A 4HJWA 4MYXA 1DHKA 3S83A 3C0QA 3ARRA 4GNKB 4UXDA 1EYEA 1Q4WA 4UCGA 2WZEA 3BW4A 1FP9A 5AHFA 1HGYA 4S3FA 3W7QA 3KVLA 4S38A 1EUNA 2VXNA 2ZXBA 1GTEA 1O66A 1MZHA 5FCZA 3MV11 3LLXA 2P76A 2BGQA 3SCNA 3OG3A 3W88A 4WX2A 3QZAA 4K68A 4IQLA 3TTQA 1DIEA 1BG4A 2TSYA 4F3HA 3P6LA 4Q8PA 1EC7A 4ZCWA 4N9EA 1UROA 2V3EA 2O9RA 3ABSA 5FI8A 4TMCA 2RFGA 2NT0A 4S3JA 3T6CA 4JTFA 2ZZ3A 4YU1A 5A2BA 2DZVA 5E93A 3LTPA 1XIJA 1J0JA 1VHCA 4MHBA 4XVDA 1H5VA 2RDTA 2OEJA 3GTHA 2ZRZA 3QYSA 4D8ZA 3GIQA 1RA0A 3U4FA 4XZWA 4Z1YA 1B30A 1OBAA 3OIXA 2XG9A 4GY0A 2WPGA 3W0KA 4JDBA 4ADTA 2TYSA 1V08A 1C8YA 3AMKA 3NZQA 2PEVA 1XC4A 4HA0A 3B9AA 4E8GA 3WF2A 1LYXA 2JBMA 1C7TA 1GHSA 3MJYA 5EFDA 2VZOA 3DOPA 1DJXA 4FX7A 3FLUA 4WSHA 3S9YA 3BOXA 4QS5A 2FTWA 2XVLA 1HXJA 2W92A 1CXHA 3MBDA 2DSUA 2VC6A 1O95A 5HNRA 2A5HA 4O1EA 1Y5XA 2QUVA 1UJPA 3TN5A 3KTCA 3CL7A 3WBEA 5BWAA 2F6UA 1VBGA 3ZZ1A 3MYOA 4RKAA 1X96A 1QW8A 1CT5A 1H4PA 3I6RA 5K9DA 3DUGA 1GONA 4REQB 4WGXA 1PKLA 4PCTA 3PAJA 1KWKA 2YXXA 3DHUA 4Z08A 4H6RA 2DSZA 1GORA 1Q63A 2XDFA 1VPXA 3G1RA 1JZ8A 1E0XA 4LVDA 3M41A 3R12A 1E6NA 1YRRA 4LBRA 1FFRA 4DXVA 3AUOA 4NZCA 4X60A 1FFQA 3W29A 3CZLA 1EIBA 4DLMA 3N3MA 4ZO9A 1GYLA 1K9EA 4NILA 1T5AA 3AS1A 4QS6A 2DORA 1X1NA 4GOAA 4QG9A 1RAKA 2JE8A 1KBIA 2GUYA 1JNDA 1TWDA 1JD7A 1GOOA 4P61A 1VCVA 4LFYA 4A2RA 3T8LA 1H3GA 2A21A 4YNGA 5BXRA 3WD0A 3WMLA 1LOSA 4QG8A 5AN7A 1OHLA 2C19A 5DX7A 5BXSA 2P3EA 3T1GA 1VR6A 1KGXA 2HK0A 1JEZA 2DVUA 3D46A 4WZHA 4R34A 1W31A 1AJZA 3IJLA 4JDYA 3BSGA 3QQ1A 2J74A 3CAKA 3ABOA 3GU2A 4KRUA 3UQNA 1RBLA 1UW9A 4J27A 4H04A 1NWSA 2E5DA 1W54A 2E6YA 4CGTA 1Y5VA 3RPMA 3BURA 4LU0A 1E6PA 1EX5A 4ZQRA 3MHFA 4V33A 2NQJA 3UVAA 1JYVA 3ITLA 4F40A 1F2JA 4DI8A 4RNHA 1FWBC 1PE1A 1VFMA 5JH1A 2PCEA 3S1WA 2FYMA 3P82A 2IQDA 3BCFA 1FH9A 4AQLA 1JUEA 4GIAA 1AD1A 3NUKA 3WQCA 4HU8A 1GJPA 5FKYA 4GNVA 3WLQA 1EFZA 2HISA 1K7XA 3AZRA 3B0VC 2OZ3A 1UQYA 2P50A 1IT0A 4FLQA 1FWAC 4C6BA 1PX4A 2VR5A 1ZU8A 4R53A 3I7RA 5M3WA 1CI1A 4ADUA 2JGYA 4ZE4A 4C7DA 2YX0A 1UD3A 5GJMA 3OLDA 2PDMA 4HN8A 1CB2A 3OVRA 3CHDA 3FJNA 2E7FA 1CXKA 4RDZA 1XRSA 1CGUA 2PD9A 1DWGM 3VCNA 4UTIA 2ZADA 3CH9A 1NARA 1VJZA 3C5QA 2VM8A 4WVXA 5HULA 4ZE5A 4LCQA 3BE7A 4C90A 5AC6A 1YYAA 1O1HA 2Y85A 3BLDA 3Q45A 1UH4A 2E40A 2PTDA 1JVNA 1KTCA 1XBVA 1LRNA 1NJJA 4UMCA 3PP7A 3BCJA 1V3HA 5A6KA 1ZCCA 3GYEA 5EGRA 2RH9A 4XZHA 4IHCA 2OYMA 5HXMA 2XZ7A 3EXSA 2GGHA 3SURA 2NVAA 1A49A 1H49A 4GZ7A 4S23A 1TPH1 5EYWA 5HJLA 4XZMX 1UKOA 4JTQA 1LWIA 4C6PA 1OFQA 2R24A 4JIPA 4GNJA 2PB1A 4LVAA 1RHCA 1TQJA 2DIJA 3IWPA 4FOUA 3WY1A 2QJJA 2BTMA 3W7HA 3WLPA 1ICSA 4DBSA 2G3IA 1T8XA 1UWUA 5BMXA 3UYIA 1J0YA 1XUUA 3W1TA 3HTWA 3W2KA 1K3UA 5H2ZA 1VKFA 3KXQA 1UP0A 1V3IA 3HGOA 2Q3OA 2ZZ5A 3JS3A 2G37A 1FHLA 3WNNA 2ZA2A 1M3UA 2NV1A 3BLOA 3JU2A 4M6VA 3HZ3A 3TU9A 4UR9A 4C1LA 1KLZA 3FXYA 3DU0A 1E73M 2QCDB 3CC1A 3TLLA 4RPQA 1QWKA 1WZLA 3AROA 4HD5A 4ZB2A 1OEPA 1XPGA 3D0CA 1GOKA 2DEPA 2VEGA 4WCJA 1FRBA 2H90A 1JFXA 3L0NA 3M0YA 2CBIA 3EXRA 4K36A 1EWEA 1QRQA 2Z6JA 3M46A 4B5SA 2DZWA 4IFRA 2VWTA 3MO7A 4JCLA 5IDZA 3NQAA 2G4JA 5HQLA 5HR6A 4CD7A 1F7BA 2HVNA 1U22A 2PDGA 1LL4A 5CBJA 1XLCA 2V5JA 4LY4A 3WD4A 4HZMA 4CCCA 5FF4A 4C91A 4ZGYA 2XJ7A 3FNDA 3NSXA 4AZCB 4Z2GA 2G3FA 1BYDA 1UWIA 3N2XA 2Z29A 4KERA 5F2IA 3HJEA 1E4MM 4LB3A 2AL2A 2YBUA 3O7UA 4AXNA 3VIJA 3BQ6A 4DWSC 3V36A 1D3HA 2C0AA 3POCA 6ENLA 5G5IA 2V2DA 3O3RA 1F4AA 1K77A 1Q6CA 4QQUA 4Z1BA 1GWJA 3B4UA 2CFFA 1W5PA 3N9RA 2CBJA 1WNOA 3WO8A 1TJRA 2DSVA 3MMWA 3APYA 3NFUA 1J8VA 5A8OA 5CEWA 3GO2A 2I9EA 2ZVIA 3CUZA 3LHVA 3NO3A 2X0YA 1H41A 4AHQA 2EPKX 4HJFA 4WGHA 5CQ1A 4QCFA 1Y5WA 3SRKA 3S1XA 2YGYA 5HUOA 2G4FA 2WVVB 1JGIA 4GVHA 3IK2A 3GXTA 1EZ2A 3KVKA 3GG1A 4R85A 1Q5MA 3WH7A 1FXPA 1F8IA 1LQAA 5C2GA 3NL3A 1G94A 1QT1A 1QI5A 2GPTA 1QW7A 3BPWA 4LS0A 4H1ZA 3KZSA 3TTYA 1D7FA 5FJUA 2NXHA 4PB3A 4IIDA 1GG0A 3CAWA 4HCDA 1VF8A 1BVZA 3LHYA 4ZO8A 3A13A 1CWYA 4HVXA 4PMXA 1DTUA 4JL1A 5I2UA 3T42A 2WSYA 4MLJA 4H8HA 1L8PA 3KL5A 3SI9A 1PCKA 5SWUA 4RZ6A 2LLEA 4DX3A 1KBKA 3NQEA 4RZBA 4PFMA 3SQSA 4UTWA 2OZ8A 3AQUA 4S2BA 2Z26A 3NZ1A 1SO3A 4O11A 2D1ZA 1W9DM 3KVMA 4YLWA 1RLCL 1V03A 5G1YA 3TLQA 3SY5A 1UUQA 3TA9A 1R2SA 3NL2A 5BNKA 1U5VA 2NWRA 3UPWA 1AVAA 1Q7MA 1PPIA 3AYTA 5F4XA 2WMIB 1EQCA 2VX5A 1OCBA 3MUIA 5ABHA 4QRNA 3RCMA 5F4SA 3R8GA 1JYNA 1CW2A 2PWEA 3LZ3A 2V8ZA 3EPNA 3PB2A 4R27A 2DZTA 4PMNA 2EPMX 3RFAA 4PMRA 1WZAA 4D6IA 1JDCA 2V67A 5C9UA 3WJZA 1PHQA 3LA4A 3RU6A 4AHPA 1UR4A 1OFAA 5C9ZA 3IACA 2EBNA 4D9PA 1IWBA 3LD5A 3BG5A 3EDDA 1TV3A 5KINA 4G8TA 4M51A 1V7YA 3BUVA 3FGCB 4A3UA 2YIHA 4S3DA 3LCLA 4P7NA 3ZQ9A 2ZA3A 3LRLA 3STPA 4EF9A 1LWJA 5HQEA 3CMJA 2XU2A 4DEFA 5F4WA 3GVQA 3SO7A 1VFOA 2BODX 4WKFA 3BGAA 2FJKA 4HCLA 4WY0F 3GDMA 1KV5A 2VVSA 2Q8LA 3WJYA 1QBBA 4Z2IA 2YL9A 1YNPA 5C9RA 1LORA 1TELA 1VFFA 1VQTA 3CU2A 3G5EA 4BFAA 4M7TA 3O0FA 1BVWA 4MG4A 4PUMA 3CEUA 1MDLA 2HK1A 4U33A 2VC9A 1ECEA 1Z3NA 3W7PA 3NNTA 3KWXA 3UBPC 3UZXA 1BF2A 3LGDA 7ENLA 4YTUA 2DV0A 3N9SA 4PE8A 3NOYA 4LSBA 3T0TA 2J8GA 2ONEA 1BQCA 2FZ9A 3CWHA 3G1HA 4AU0A 1O68A 3H70A 2WJEA 3TJXA 3PBGA 3T8QA 3UXAA 3QTGA 3W28A 2OMAA 4KS0A 1VBRA 1ZJHA 3M5ZA 1BWKA 3WUEA 1B5TA 4F9JA 3K1DA 4FK9A 4REQA 5CSUA 3P84A 2PZNA 3BL3A 3R8RA 1OFBA 1GVSA 4WD0A 1ZL1A 3NIYA 2R14A 2VP8A 4DZIA 1XYBA 1PIGA 3MP3A 4UBPC 3B0XA 4IX2A 1UYQA 3Q2DA 4O18A 4UFMA 1UD6A 1LP6A 4ML9A 2Q09A 3NGFA 4EXAA 1ECQA 1CDGA 4TXEA 3N19B 1MNZA 4GXWA 5I3KA 2H8XA 5AC4A 2VDGA 5FL0A 5DANA 1DQWA 3LLDA 4ATLA 4LAMA 5GVJA 4DPQA 1E4IA 5DMMA 2HTMA 2JF7A 2CLLA 4QGCA 1ADOA 1ISVA 3F2BA 4ACZA 4ERGA 1KRMA 2Y5JA 4PODA 3NYZA 4YWIA 3GXFA 4GA8A 4X2RA 1KD0A 5FAGA 4O4VA 1T96A 1U2YA 3VINA 4AW7A 3OA3A 1P43A 4JN7A 3NM3A 1Q7ZA 2Y63A 3LZ5A 4RXFA 1P6WA 3AIQA 2PA6A 3HPAA 3PZOA 3W1LA 1DWFM 3W73A 3G0UA 4P8UA 3PJTA 1B90A 1W56A 3W75A 2E67A 3MZNA 1PX3A 2AKMA 1CB7B 1EA9C 1K6AA 2E6DA 2F6KA 2VR4A 3I6TA 3CV7A 1ISWA 3MTWA 1WX0A 4UFLA 1X6LA 3COTA 1JCLA 4CCEA 4W5ZA 4DYEA 4S1FA 4LC8A 2EEXA 4HNVA 4GVIA 1BQGA 2QNEA 4HTBA 1KM2A 2XH2A 2ZRUA 3OBEA 4Q33A 2J6VA 1Z44A 1BPLB 2W66A 1JCJA 3H53A 3ZT6A 3NA8A 3EMZA 2ZYFA 4ZENA 4MY1A 3ZSTA 2HBXA 1UUOA 3JR2A 3PG9A 3UESA 3N2CA 4BWLC 2FH6A 1KFCA 2C1HA 3PN8A 2YSWA 3S9IA 3RXZA 4HA1A 2DU2A 2Y24A 1TRIA 1KCKA 4WR3A 3MA8A 1AW1A 5ENLA 1AQ0A 4NX0A 5JBFA 3M0VA 3URNA 1K8YA 4YN5A 2ZICA 3C3UA 1DIKA 2E9MA 3VUSA 5JBEA 3AMDA 3TAOA 3AXMA 5DY2A 4GI4A 2O4MA 2YL8A 4F0SA 4B4HA 3UWQA 3QRHA 4QP0A 4GMEA 1E0WA 1EJUC 1XDLA 2ATMA 4H01A 3N6QA 1H63A 3KOZA 2ZIDA 4C65A 2B7QA 2GYIA 3C2FA 3E2VA 2Z24A 3S5NA 1A53A 5HK4A 4ZO7A 1FWHC 3E2SA 1XIDA 3OZYA 2DZPA 1Z48A 3R94A 1GKPA 2HVMA 3TW6A 2FGLA 4NJGA 3L2IA 2RDXA 1T41A 4NZFA 3PUOA 1GQJA 2HJPA 3W7DA 1ZAJA 3RN6A 4M6UA 3UR7A 2J79A 5H8PA 3RDKA 4EPKA 3M47A 3ZXWA 3UJSA 1OIFA 5ABFB 3HQPA 4J40A 1LZOA 3KRSA 2W0UA 2IKIA 3HV9A 1EDTA 1DXIA 4KKXA 3GNOA 2BG5A 3IIZA 1F3WA 2WCSA 4ZQOA 2D2HA 4MB4A 3PSWA 1TV2A 4HSOA 3I4KA 3V16A 2Z1VA 3H2NA 2FQIA 1W9VA 4QAIA 3TCSA 1SMDA 4NXKA 1FWIC 4JTAA 4YJ5A 4B5NA 2V5KA 4ZVJA 3S1UA 1ZLPA 4DHGA 5AC7A 4A3YA 3ZFHA 3VD4A 3V1HA 5JH2A 1DWHM 4CU7A 1V3JA 1WXZA 4DZAA 3FYPA 4C5YA 3QHNA 1YE6A 1US3A 4BCEA 4Y8EA 2FHCA 4NZ1A 3RLUA 3I10A 3KBVA 1A5LC 3SFWA 4H2CA 4U3AA 5EY5A 1DJYA 5CAHA 5I00A 1J0KA 4IX0A 1V6YA 1QNOA 3GG7A 1B57A 4IIBA 1NFPA 5M5DA 2OQLA 3EZ4A 3LY0A 3CV2A 3FA4A 1WDQA 2QCDA 5I23A 5LNSA 1ZCOA 4CD8A 3W7NA 3GDBA 1UMYA 3P2VA 3WMBA 1V3KA 4CLMA 5A6BA 1A4LA 3KE0A 3GDKA 5D2XA 4L6OA 2B81A 1GVRA 5GPRA 1Q6OA 4JKKA 3L66A 4FOKA 4FOJA 1DKWA 4PUJA 1FDYA 9XIAA 1YEYA 1SM9A 4KWSA 2PWUA 1CXLA 1GQKA 3TC7A 1V51A 2WMFA 3GRIA 1G6CA 2O56A 2GJLA 3M7SA 3DH7A 3NZRA 1B0IA 4AZCA 3KBNA 3W2UA 4Q4QA 4E3VA 3PANA 3EA2A 3UF9A 3SADA 3NCOA 3B0PA 3TN4A 5CPTA 3OHMB 1X39A 4TR9A 1V3LA 3L21A 2F2KA 1ZBVA 3B3DA 4BI7A 1EJSC 1TX0A 1QHOA 4DWSB 2WHMA 1X38A 3GVWA 4RDVA 4UQBA 5H8UA 1W8GA 4RL3A 2R8WA 1FUYA 1UJQA 2JKEA 3QH2A 3HV8A 5LNVA 4IMFA 2ZZ6A 3PAOA 2CLEA 4QITA 3PB0A 3E2RA 3BV7A 4I9AA 3P8JA 2VQUA 3DENA 3WDHA 5FA5A 2WVVA 3RRXA 2I1OA 3E0WA 3O16A 1KRBC 2BZNA 3L67A 4HP5A 3P3BA 5DELA 3CEPA 3B8VA 3TP4A 1ZP4A 5K3VA 3GD6A 1RUSA 3EEGA 3ABRA 3OG2A 4XV0A 1YKWA 3Q37A 4L4PA 4DAIA 3CT7A 3KCLA 3V7PA 3PUGA 5DQPA 4BEUA 3B8TA 3DESA 1JDFA 2R1NA 4IJCA 2WO5A 4QE5A 3ITCA 2BFGA 1FWFC 4QROA 2AQVA 4G6CA 2CBVA 1A5BA 2YCLB 1Y8BA 4KCVA 1WYIA 4HHMA 1G4TA 2VQTA 4UMAA 2WPBA 2XWDA 1P48A 5DMYA 1D3GA 4P8WA 4DYJA 3DFPA 1UD4A 1QO5A 1R3SA 2P10A 3B0YA 1V6UA 3ZR6A 4AIBA 3QQWA 1OC7A 3DGBA 1BKHA 1DOSA 3L4VA 4GI8A 3ISIX 3KHJA 4ZR8A 2QV4A 1FTXA 3BANA 1N7KA 2R1PA 1VBHA 2VURA 3VX0A 1UZ4A 1TWIA 1D8CA 2WNQA 3APTA 5IBXC 4AIEA 1KXVA 1KM5A 2ZZ7A 4Y90A 1XKYA 2YLAA 2HBVA 4IMGA 5E0CA 4JHOA 4AD4A 1EXPA 3W01A 2F2HA 2ABBA 1M04A 3PBMA 1L2UA 4NL1A 5I02A 1HJQA 7PTDA 1WKEA 4ZOEA 5E09A 4EOUA 4C60A 4P8XA 4IFOA 3GZAA 3S5SA 1PEZA 3EYPA 3E2QA 4FX8A 4CNOA 1RP8A 1QNSA 2DW6A 1OWQA 2V69A 3PFRA 1JD9A 2DQWA 2QAFA 1VBJA 4NG3A 4DJDA 3UR2A 3GIPA 4GQBA 4RJEA 1AMYA 3K4WA 3K5XA 3S1VA 4W85A 1UHVA 3MU7A 4MSSA 7A3HA 1JPDX 4EAYA 1Q6EA 4HT3A 2Y2WA 3W1MA 1F6PA 4I90A 4S3AA 4K8GA 2Z2BA 3QM3A 4R7JA 2VJXA 2RDUA 4W87A 3AUJA 1HP5A 2QCHA 3MVTA 2EPLX 5HQMA 3SQLA 3T4CA 4WJXA 2YJQA 3I3DA 1JCYA 1K4GA 2ZUUA 1XLMA 4C6KA 4UQ9A 3CPRA 3PM6A 5IFPA 1N8IA 4DJEC 4ONVA 3W1PA 2PDQA 3M5YA 1OY0A 3AIBA 4PUWA 5E1QA 4AIOA 1M7PA 4RX0A 2FVMA 3LMZA 3EX4A 2I5GA 3QR1A 2HS8A 3ATZA 3T0AA 1JL8A 4IH3A 2Z1WA 3TJ4A 2PLKA 1AUSL 4Q6JA 4EACA 1UKTA 3UCCA 1C8VA 2X1IA 3HBLA 4C6JA 5D30A 4HN4A 3WH6A 1EB3A 4GYPA 3VNJA 3KTSA 1B9BA 4KT2A 1O5KA 2UBPC 4J4KA 3M1ZA 2ZRXA 1THFD 4QFUA 2HV5A 1YHTA 2GJRA 1SZGA 5HMEA 3LEPA 4DJFA 1BSIA 1IYXA 1R3VA 1UWTA 1XIIA 1TPB1 2DVTA 1GOWA 1KNWA 1TCDA 5DEZA 1YPXA 1YW1A 3I68A 5CLWA 4MUZA 2NT1A 3QMSA 2A7NA 4JBRA 2QMJA 4DNHA 3CV6A 1IF2A 3R5EA 5L6UA 3UG4A 2DT2A 3U5UA 4GBUA 1WZMA 2BVYA 5DLCA 3V4BA 3WMCA 4Q8MA 2OGYA 3KBSA 3PPCA 3IJDA 1GNXA 1VCFA 3W2JA 2FTPA 2EGZA 3TXZA 4DM2A 3NO5A 4NZ4A 1WZKA 2PU0A 3TFCA 1MUWA 1A0EA 3RMEA 1IXQA 1Q2SA 3ITTA 4HQVA 3B06A 5CZTA 2OELA 1GGOA 5CAKA 5T9BG 3VC5A 5J04A 2WQPA 1G5AA 1S5VA 4JPGA 4DBDA 1SZNA 3WQVA 1KGUA 3WYZA 3IJ8A 1UR3M 2E4TA 4XUGA 3TUUA 3CIVA 3WENA 1SFSA 3DZ1A 2D69A 2PS2A 2E25A 3FOKA 1XM3A 3GB6A 1RV8A 3VCCA 2X05A 1OFOA 5BXPA 1E70M 3U7BA 2OPJA 1EBGA 1BSLA 3EWXA 4F79A 3UWVA 1QOPA 1MEHA 3NURA 4JNZA 2Y7GA 5JMUA 2PLCA 1IZKA 1KQYA 4R7OA 1JG9A 1DEDA 2DP3A 1KCXA 2E28A 2PE4A 4H6EA 4C7FA 1QWGA 2NW0A 2D22A 3R11A 2PGWA 1FCQA 2A1YA 3RCYA 3CWOX 1QI3A 3QSTA 3B0UX 4DLFA 2OVLA 4HBKA 3OLIA 2OLSA 2GJPA 2ACSA 5CZJA 4AC7C 4KESA 4LAOA 1HZYA 4DYKA 2WVUA 1YNYA 3LCFA 3QV8A 1K7FA 2G8ZA 4YCOA 2PMQA 1RJPA 3S9ZA 4WHBA 1AW5A 3U9IA 4D6GA 1LLWA 4PMVA 3WELA 1B1YA 4IL2A 2HXTA 3ANYA 2VO5A 3KCJA 4XO6A 1HKVA 2VL4A 1CPUA 3WBAA 3UY7A 4IQEA 1VLWA 2IMRA 3VGGA 5TQLA 4M81A 2Z7GA 2GJNA 1XINA 3UJFA 1KKOA 5HDRA 4MF4A 3VNZA 5AOUA 4NVTA 2WKJA 1UWAA 3B4YA 4MYAA 3RF9A 1NAL1 4ZQPA 3T08A 2ZE3A 2OOFA 3S2CA 3NO1A 4A3RA 2ZCGA 4R3UA 1JFHA 3V3WA 2FJUB 1TVNA 3SUSA 4YTSA 2ISVA 1KM0A 3PWIA 4J3XA 1QJWA 2V3GA 1ZJIA 3ZS4A 1ICQA 4LEFA 1XS2A 3CUIA 3FV9A 3W7GA 4C6LA 3FVDA 3S2MA 3CJPA 4L5ZA 5ABFA 4F8XA 1FWNA 4IPLA 1B3ZA 4QG6A 1MXGA 4XKMA 1JCNA 1MO0A 1YXYA 4GK8A 1SVDA 4RW3A 2QF8A 3QTPA 1E4NA 3P67A 1RVGA 4D1IA 4L9ZA 3K8LA 1E9IA 1K7EA 1XQLA 4V28A 1KM6A 3LN3A 4MTVA 5DF0A 3GC4A 3QFEA 3ITGA 3MMUA 1R0MA 3H2AA 3IIOA 4KEZA 4NJKA 1JULA 2YYUA 1NQ6A 1CZ1A 3E5BA 1H50A 1XIFA 1UZ1A 2OJPA 3WQ6A 3QGVA 1W3NA 4KGJA 3LDVA 4AZ7A 1V5XA 1I1WA 2J8TA 3A24A 4ZXLA 1HKIA 3KS5A 1L8NA 3UU0A 3V35A 4TQTA 3VPLA 3QPEA 2Z2AA 5IM51 4Q32A 3LNMA 1H60A 3GW0A 3YPIA 2FZBA 1DL3A 2ZDRA 3BZGA 1E6SM 1YBQB 1OD8A 3WLMA 2X40A 3BH4A 1JPIA 2W91A 3BJFA 5AFDA 2XH7A 5XIMA 4US5D 3EOLA 2QGYA 4OE7A 1TPC1 2ZFAA 3OHIA 3VA8A 5HMSA 1GPFA 4N4QA 1A0CA 2PBOA 2WK2A 2WNWA 4MWAB 1XI3A 3WD1A 3UFYA 3S4TA 2I7GA 4N6EA 1R7OA 5LIYX 3K30A 3NR0A 1MYRA 3BICA 2VD8A 2OWXA 3IARA 1G7UA 4AWEA 3LHTA 1NY1A 1EKOA 3W3OA 5BZAA 2UY5A 3N2BA 4XD5A 2ALRA 4JX5A 5FJIA 4CN4A 4LPCA 4WXYA 1XYFA 1MDRA 4E4PA 1XLBA 4IP5A 5A1AA 3UZJA 3G1AA 1J5TA 5MHBA 1FCBA 1ISXA 1QR7A 3VMPA 4XKYB 4W93A 3NYDA 2QXWA 3K4AA 3NSMA 1G01A 4XD6A 3CYVA 1P0DA 4EP8C 4JIEA 4JY9A 5JXQA 3IIPA 6TIMA 1FWGC 3L5MA 4H9VA 2ANUA 1WP6A 3K1GA 2J7GA 4NAEB 1MWOA 1SZEA 1UD5A 3AFBA 2HVOA 1AZ2A 4MDOA 4B16A 2OG9A 1KRCC 3LGGA 5I0DA 2YL5A 5CC6A 7ODCA 3Q67A 3RM8A 4AB4A 3GNDA 1XLIA 2YW3A 1EGZA 3WQGA 3VDGA 2ZRWA 3XISA 4Q8OA 3V0SA 1K8ZA 1XSJA 4PSRA 1DP0A 4IGHA 2RHGA 3EMCA 3MC5A 1UD8A 1Z9AA 1BVNP 1QPRA 4PTWA 4UTTC 1PIFA 4JKMA 1W3TA 1XLEA 2HQAA 4HNLA 5AB3A 1LG1A 3A4AA 3T07A 1J0IA 1VPQA 1LDCA 2A3HA 2O55A 3W84A 2HS6A 1DHPA 4RE0A 1EWDA 4Y7EA 3DKJA 3IJ7A 4LY8A 6ALDA 1TO3A 1U5HA 3QV6A 1JQVA 4YVXA 1K1DA 6XIMA 2J25A 2BHZA 3IGXA 2WSQA 3UXIA 2B7OA 1X1ZA 2DIEA 1PO9A 4CN1A 4IQJA 3DECA 1H7XA 8XIAA 1UKPA 3C8FA 4XG1A 4FSAA 2F8QA 2ZX6A 3CZEA 4MM1A 1KM3A 2A7PA 4RDWA 2BGSA 3RK8A 3H4XA 2DT0A 3DN5A 2UWFA 1B3WA 4HMEA 2Y8VA 3CMFA 3F4WA 2WB5A 3G1YA 3TA6A 3AJXA 2ACQA 3WQ8A 4AZBA 1EP1A 3LUTA 1A5SA 1R2TA 4AUBA 1KM1A 4FIQA 1BFNA 3GNRA 2Z25A 1BWLA 2PC4A 4HNCA 3CXOA 3VYLA 2I5QA 4ZOCA 4IM4A 3AMGA 3GU9A 2EJ1A 5LIUX 4GIEA 1V8EA 2PWHA 5I5RA 3GHRA 4C6IA 2VZTA 4Y9MA 4ICNA 1BG9A 2UY4A 1EF3A 1GVOA 2BXVA 2CHOA 5A6BD 1LQ0A 1GQIA 4Q6XA 3OOQA 1YPFA 4XIMA 2DUXA 3T2QA 2V2CA 1A5CA 4HOXA 3IGUA 1QFEA 2RJHA 1F74A 3S3GA 5G2IA 1XYZA 4C1KA 4PCSA 4UOZA 3LCIA 4XD3A 3W7IA 5TIMA 8RUCA 3G18A 3HA1A 1XC6A 5CJ5A 3MHUA 3APGA 3GH5A 1S5NA 4U28A 2J24A 2CESA 5HBFA 1KBJA 3UPBA 4V1YA 1TTQA 1M53A 2WHLA 2J9YA 1J11A 3D3FA 1N82A 4U10A 3W7KA 4X3ZA 1EJ7L 3VIMA 1ZAHA 1OQFA 3B40A 1XFCA 4FLSA 4HCHA 3ERPA 3DFOA 2GGIA 1EO5A 2Y1HA 3QY8A 1Z32X 2W63A 1UA7A 4GI9A 1H62A 5A8GA 1Q6RA 3BGGA 1P0NA 2XIBA 4C6NA 1BTMA 3B03A 2G41A 3VOCA 2NUYA 4QJ3B 2AGKA 2XUCA 3T40A 2PDUA 4PMJA 2GUBA 2Y8KA 2X0SA 1MXSA 4GQ0A 1JYXA 1SO5A 4OBSA 4IPJA 4UR7A 2F6XA 2O7QA 2YA2A 1X6UA 2CWXA 1FBAA 1GUVA 1KM4A 1WCGA 3AHYA 5EBUA 2NVDA 1YTDA 2FHBA 2OEMA 1QPQA 4US6A 1OX4A 1JI2A 4B91A 5K2ZA 3CB8A 1TSIA 4CN6A 1TTJA 2PF8A 2QCCA 2ZRYA 3CTTA 3O06A 3IV8A 1VB9A 2ZUMA 5CLTA 3CMGA 3NZGA 1VJIA 3EPOA 2DIKA 3CQHA 5ECVA 1MZRA 3EA1A 3OA5A 2WQDA 4NASA 4L61A 3IAQA 3UJEA 1MEIA 3UD6A 4FNRA 4OOZA 2YL6A 4LBUA 3F2CA 1S1PA 1QPOA 3QV7A 3GNXA 2Q3RA 3DFYA 3TX9A 2G5WA 3P80A 5CKSA 2PZ0A 3VKCA 1KW1A 1DV7A 1XUZA 3C0SA 3FA3A 2VGGA 2Z2UA 1H11A 5IHRA 2IPWA 3BG9A 3O2LA 2J7HA 2GVYA 4DIAA 2WANA 4PMUA 4Q4SA 3ZJ8A 4Z17A 1V4YA 5D37A 5I3JA 5H6HA 4QBXA 3CZJA 1W3LA 2V9DA 1EDQA 4Y9NA 4MOZA 3R6IA 3PTQA 4F0LA 1SJAA 1OZQA 1FX6A 3HM7A 3GIYA 1GQNA 4GQGA 3KRBA 1FHVA 1PTGA 3UY8A 5T26A 1I2QA 1TR9A 2ON3A 2I5IA 3W7JA 4NJJA 1TWZA 2VUYA 3QEZA 4JNMA 3WZ0E 4LS1A 3FY1A 2CZFA 1US2A 3BMWA 4BF9A 4PFHA 2CHRA 2ZDSA 3AIVA 3U2ZA 4I7UA 5BOOA 3T7VA 1I0BA 1ZP3A 4URIA 2YDSA 1QDSA 3G2GA 3MCNA 5K4XA 3VOIA 2FPYA 4OZOA 1MEWA 3VVGA 3W9ZA 3VUPA 3WQ5A 3STGA 4WEVX 3TOPA 3MJMA 2GOKA 2OCZA 3C2YA 3MT1A 4AC1X 4HNUA 1HL8A 3C2EA 1W9BM 1A5MC 3A5FA 2O4QA 3VCRA 1LG2A 4PZVA 3N34A 2PWGA 3V75A 3XINA 2FZDA 3G1XA 4J5NA 2PWVA 1TCMA 4ERAA 2X1RA 2YXGA 3W24A 4NZ5A 3VKDA 3F03K 1U1HA 2PP3A 2BWGA 3V5FA 1KO0A 3VNLA 1XIBA 5KTLA 3M0MA 1TPVA 2PBGA 1XRFA 3H12A 4J35A 1DQUA 2NXGA 3I3BA 4G7FA 4CQCA 1SPQA 2A0NA 1FWTA 3OJGA 1TWWA 4DUXA 1A5AA 2YDRA 2UY3A 2QDGA 3F5LA 3N13A 1O4UA 4WJEA 5CCZA 3S46A 4X22A 3SIMA 3DBPA 2GVLA 3IJ9A 4C6QA 1JRCA 3WEOA 2EG6A 5TD4A 1OYBA 1Q6FA 4QCEA 4TV6A 3CNYA 3O6AA 3A21A 4A8RA 1DIDA 2QPXA 4DF1A 4L56A 3IRDA 1HKWA 1I2NA 2J47A 2OQYA 3SUUA 1PKYA 4GQRA 4EPBC 1AQHA 1W6TA 4PR4A 4ACYA 2YZRA 4PEEA 4BKNA 1SMAA 2PF0A 3H7VA 4LWWA 2V3FA 3NVDA 3QY6A 4B9ZA 2J9XA 1QPNA 3ELFA 4FPSA 1UZDA 1KTNA 4OT7A 2Z0IA 4M7SA 4QJ1A 3WNMA 1JZ7A 2JQXA 4IUOA 3GTXA 1BF6A 2GQ3A 2WBGA 2ODOA 1IT8A 4AF0B 4EPDC 3VIGA 3QF0A 1N55A 4B2DA 1TV4A 2YR1A 1MMFA 2YDAA 3WFLA 3LPFA 1ZS2A 3URQA 1R5YA 4H8NA 5FSDC 2PDHA 2ZX7A 2CU0A 3DYMA 1WDRA 1M7JA 3UNTA 2P0OA 4KF1A 3NJ3A 1FP8A 3GDLA 4LF2A 1VFUA 1ICPA 1W9PA 1FHUA 3N3TA 4FX6M 1R9YA 1IQ8A 3BTNA 2TRSA 4PMOA 3R89A 1IEVA 3PWGA 5BOEA 4ZQMA 4NUWA 1NF0A 3RMJA 2OODA 2YFNA 4JFTA 3U4AA 1YDOA 4O14A 4AYSA 1SSGA 1IZJA 4XZLX 3N25A 4FNTA 1MVYA 3N1AA 4GY1A 1L6FA 1X6NA 1HP4A 2HXUA 2BOEX 2YPIA 3ZVIA 1ZGDA 2GJXB 3WMSA 1WXYA 1TREA 3H21A 3EX1A 4Z0JA 4ZBCA 1SFJA 5CJNA 3WFAA 4E4FA 4BZYA 3G8RA 5CPMA 5AC5A 1UPPA 3SGUA 1O94A 1EUAA 2OLAA 1TUFA 2BHYA 1J93A 5BU6A 3KOWA 1UP2A 3V1PA 3R58A 3AXIA 3RNDA 4TU1A 3SECA 4PH6A 3BOFA 4IIEA 5CGMA 4MWAA 3P61A 2QHAA 3FAXA 4ATWA 3DG3A 5LHEA 2CZEA 4JTHA 3DG6A 1JUBA 1W5MA 3ITOA 3F5JA 1GOQA 1JGMA 3D3AA 1S3HA 2D0GA 3B9NA 2UV8G 4HPNA 1C93A 3OGRA 2PURA 3GTIA 1BXBA 2CLPA 3RPTA 3LX9A 2IPJA 4RLIA 4HYRA 3NEVA 1OK6A 1VLIA 1GQLA 4HPGA 1X98A 1KFLA 1O60A 3H54A 1VAHA 5TF0A 4XUYA 1F73A 2D3LA 4UFJA 3OO2A 2Y5EA 2XSBA 9XIMA 4PUUA 1XKJA 3PBWA 3GS6A 1M03A 4Y6GA 2VVNA 5DY3A 3UXKA 1A47A 3R8HA 4NAEA 1WBJA 2X8RA 2EKCA 5LNWA 4QISA 4WSJA 1HVXA 3S2NA 1JNEA 2GWNA 2DH2A 4IP7A 3NPXA 3S2JA 2DZXA 1T99A 5LKYA 3NXFA 3TEVA 1RJQA 3TMLA 1LQ2A 3AZSA 4Y8FA 3SSZA 3L4ZA 5EU9A 5DBUA 3GHSA 3VGEA 2PDCA 4C6FA 2DUZA 2H6RA 4M56A 1AL7A 2DZUA 3TN6A 4LCSA 3MV01 1JAEA 2OQHA 4EAMA 2EPNA 1TMQA 2ISDA 1EH9A 1QI4A 2AQOA 1LCOA 1ZALA 3M0KA 4JYEA 2O92A 1RQHA 3PBVA 1QAPA 3ARWA 3JRKA 3SJNA 3ALFA 2BOFX 4W8LA 3M5VA 2I9UA 1PHWA 3WF3A 3CIXA 2PAJA 3MSDA 3VNKA 1PYFA 3QQ0A 2PD5A 3LMYA 1FCUA 3RU8X 4RE2A 3L4XA 4EIVA 3LOTA 3OVQA 4UWMA 5D2YA 1LT8A 1FH7A 4LS2A 2KZHA 3SCVA 1Q13A 4F2BA 4KFOA 5D05A 3RLGA 1LTDA 2OZTA 2VGFA 2GLKA 2J6XA 4NZ3A 3FDGA 1SQ7A 1MW0A 2I16A 1HO4A 4H9ZA 2C14A 1H0IA 5CPNA 3CUJA 4AY8A 2ZXQA 3VXGA 4P7LA 3QFWA 1WOBA 2OX1A 3BXWA 1TA3A 4AX6A 4XBSA 1HN1A 1P6CA 3W02A 3CUHA 3AICA 1HKKA 1W2VA 1YQ2A 3T0BA 4LUIA 2AGTA 3BAWA 4Q22A 3HMJG 5D03A 3TROA 3BO9A 5HMDA 2QCMA 3UZYA 2GVEA 3LCHA 1L0PA 2W27A 2PCQA 1UG6A 7REQA 4LRSA 3VNMA 3AS2A 5CSRA 1GOXA 2Z7KA 1QHZA 4LVGA 2W4XA 1EOKA 4BR1A 3GKFA 4JY8A 2Q71A 5HPCA 2HE5A 1EC9A 2VX6A 4B5WA 2AQWA 3VKKA 3QXBA 3AIUA 1XSKA 3THUA 3GHTA 2X2GA 1QW9A 4JX6A 2L5HA 2BSLA 1VFSA 3IAPA 2B31A 4M6QA 5JBDA 3KRUA 4XB3A 1ALDA 1UMLA 1B3VA 3H22A 1E0UA 1EJTC 3VIKA 4H19A 4FS9A 3RPDA 3PZGA 3KBMA 4HYWA 3O15A 4B3KA 3GTNA 4BK9A 4HNTA 7TAAA 5CBIA 5D02A 1NOFA 1UPMB 2QVNA 2VFIA 4M19A 1TV5A 3N14A 5DT5A 1PYMA 4AMAA 1S5TA 1TJ2A 1SFTA 3SCTA 3MI6A 1VC4A 2FMNA 1JJKA 4JTGA 1CIUA 1Q8JA 2CBUA 1R9XA 5FF3A 3N12A 5G4WA 1V93A 3VO0A 1ZZMA 3OLEA 4GH1A 3ONBA 1ENUA 2G0WA 4CVUA 5M17A 2G95A 1MI3A 1DXEA 1A5UA 1KR1A 1BWVA 4D72A 4WF7A 2D2OA 2KAUC 2PLJA 6XIAA 1J12A 5KEZA 4FR1A 2GUUA 2QJHA 3W76A 2PP1A 3ZJ6A 1ZHAA 2YZ5A 4Q4RA 4PRTA 1R3TA 3B8SA 1TVPA 3WL0A 4X63A 3MUY1 2XWEA 1DORA 5T9CE 3AC0A 3WQDA 2CLOA 1ZRQA 3GX9A 3CTLA 2E77A 3OGSA 4NX5A 1OT2A 3RR4A 1WAUA 3TZNA 4NI8A 4O0KA 1ISYA 1PIIA 5HWJA 3TR9A 3CK5A 1VYPX 1N2VA 3NXLA 1IIGA 4K7YA 3FX4A 2I14A 2INFA 3G24A 1E40A 2A2IA 1KFEA 4IPIA 5XINA 3S5YA 4YL2A 1IEIA 4UTLA 1PB0A 3KL0A 5K9XA 5AKQA 3TJLA 4IPNB 4LUJA 2MUCA 2RAGA 2TAAA 3TYBA 2WWDA 4JD4A 4LC6A 1E3XA 4AXKA 1VCGA 4LNCA 5BW6A 1QHPA 2FVLA 5DRCA 6PTDA 1GPWA 3WUBA 2Y61A 1OB0A 3STEA 3WBWA 1S2UA 1M5WA 3KZPA 2XHYA 1VHNA 2VEFA 3WH8A 3WQWA 1JCXA 5FACA 5FJOA 3BMXA 3TOYA 3OGVA 2OTDA 1HJUA 3H4WA 1C3FA 1R9ZA 3AO0A 2IW0A 1E71M 1KFBA 2J27A 4YTQA 3E0VA 1H5YA 1KXTA 3H2MA 3OODA 4IXXA 2NX3A 4QLLA 1OADA 3QGKC 3LYEA 4K8EA 3BC9A 1GZ1A 5JQ9A 1DBTA 2DPEA 3O8AA 3G3MA 1DVJA 3S6DA 4J3WA 5DT7A 2Q8ZA 2HCVA 1W91A 2W9MA 4P8VA 1QOXA 4YCPA 4H6KA 4LUTB 5BU9A 2XIIA 3B8IA 4NF7A 2IUZA 2O9OA 2XM2A 2MANA 3CV1A 4J2PA 3PSVA 2ZTJA 2Y7FA 4TIMA 1S3TC 4KFPA 3T05A 4WIWA 1QPKA 2PSNA 1K02A 4QXIA 3U2CA 4GC3A 1UQZA 1WKFA 3BWWA 3M7WA 3NEHA 1E4LA 3KBJA 1E6RA 1V0MA 1AH4A 3M0JA 2ZUNA 1RJRA 2QUUA 4FMVA 1MFUA 1DYSA 4W5UA 2WMHA 3RG6A 4IOTA 3DC8A 1RD5A 1PTDA 1BAGA 3BLFA 4LT9A 2PDJA 2PGEA 3SCWA 3V18A 3W1AA 1Z6KA 1RY8A 1KFJA 2XPKA 4ASTA 5AZ1A 4O8AA 3Q4DA 3W1UA 4HSNA 1O5RA 1CGWA 1NSJA 3CAQA 4MLRA 2ZUSA 1W0MA 2NV2A 1QK0A 3M64A 3WQEA 4GYKA 1MW2A 3UA4A 4R88A 1YXDA 2A85A 2PUZA 4YVVA 2QKFA 4OQVA 2OT1A 6REQB 2ZC8A 1HJSA 5KZ6A 1W1PA 4W8BA 3S6TA 4GI6A 2A6LA 4OUEA 2XISA 2XM1A 1IEXA 4CKQA 4KEMA 3UG5A 3HIJA 1OT1A 3ARTA 2A3CA 1PVNA 3VZZA 1BRLB 4Q4PA 4AF0A 2DUAA 2YB4A 4ZTYA 4MJ2A 4C6CA 2BGNE 4QM1A 1FWCC 1XV8A 4O57A 4J3UA 3WK2A 1E0VA 4JFUA 3TE9A 1CGTA 2XYLA 3WNKA 2D3NA 4R9XA 2QT3A 5BWFA 1Z8AA 1LOLA 1PCWA 4XTIA 5KITA 2V63A 2VCAA 3VM7A 1YMYA 3MVIA 2OO6A 4MB3A 3TC3A 4Y9OA 3QPZA 1PZ3A 2CKSA 2X1UA 3KVJA 5JU6A 4OWGA 3EWUA 4MPKA 3K8KA 1LT7A 4W8AA 2GDUA 1XGEA 4OGZA 2W5FA 3B8UA 4AZHA 4GG9A 5CPLA 3AMCA 4AD5A 2V68A 1J6PA 2TODA 4RV8A 3LLFA 4L6HA 2Y70A 2XSAA 3WQ4A 4OOUA 4Q7IA 2DFAA 3QV9A 1ZFJA 1MRAA 3WK1A 4DB7A 4PL1A 4M3PA 2C7FA 4GYFA 4QHRA 5HAOA 1RK6A 1X8CA 3NGJA 3B8WA 3EOEA 4XK2A 4UCFA 4HB7A 4IMAA 4I9TA 2Z00A 4UTWC 4ORIA 2W61A 1P1MA 5EFFA 3R0KA 3ZSSA 3U2EA 1W17A 3SUVA 3R13A 3NQ8A 2NV9A 1UZHA 2VD9A 4I8YA 4I9JA 1QMLA 5I3GA 1ITQA 1QATA 3ME3A 4NP7A 3WLJA 1YLVA 2WZHA 3NTYA 4AD3A 3TYDA 4FAMA 3IK4A 1FWDC 2JEQA 1ZNNA 5F1UA 5C9XA 2QPUA 3G6LA 3VOJA 4E2BA 2Z4GA 3BLEA 1GG1A 5ABGA 3TMQA 1K9DA 3PTKA 2ZX9A 4GGBA 4X0NA 3H4GA 4UC5A 1TV7A 3GR8A 2WLZA 3PNZA 2ATSA 1ML1A 1TIMA 2EJAA 4HOWA 5D32A 4Q8UA 2XIQA 4FA3A 1GKRA 2R1LA 3DHFA 1LLZA 2IQTA 4OBTA 1GW1A 4ZB5A 1OK4A 4MWAE 4HHHA 3UYCA 2EXOA 6A3HA 2YA0A 4KFNA 2JIWA 1B2YA 1J0ZA 1ZPTA 1JF5A 5CG7A 1U1JA 3GU1A 1JPKA 1G4EA 3QN3A 2VRJA 2AMXA 2VX7A 1QBAA 4GE8A 1MW3A 4HIBA 4HK6A 1GT8A 5A6SA 5CGTA 1XQKA 2CLFA 4XQ6A 1JDAA 3W4RA 1QNVA 2J7EA 3PZIA 4NNCA 5EMUA 1EHNA 4HMNA 3C3NA 1PJ9A 4LVBA 5A8NA 2VEIA 4LAZA 3TN3A 1JR1A 3TONA 1DXFA 1XLGA 1J6OA 4J3SA 4QLJA 3P93A 3UT0A 1LBFA 1XDMA 3GG8A 2ESCA 4H7ZA 4HOZA 4LV9A 4B2DD 3P62A 3P7YA 3W7MA 4X9YA 4UZUA 3MP5A 4O16A 4GC4A 4DO7A 1EJVC 3WL1A 3OP2A 4UOJA 4MJZA 5CZ0A 3M4HA 1IZCA 3FS2A 4KWUA 4W84A 4GLEA 4J3TA 1TJ0A 4L9YA 5G1MA 1FWJC 1WDDA 2A7RA 4PTVA 4K1GA 1HG3A 3CS2A 2ZKMX 3ECQA 4K7VA 5I3DA 4CQ8A 5D2WA 4O0ZA 3TSDA 2VEKA 1B31A 1ONWA 3A3WA 3WSUA 3ZIZA 3NL6A 3LG3A 3ARQA 3P0XA 4D6CA 3MMTA 3WQPA 2EO7A 4NZJA 4ZMGA 2WHJA 3B04A 3VGFA 2HWGA 3M43A 1OGGA 1S2VA 3LBOA 2V5BA 4JTEA 1WE5A 4WY0B 4L4OA 3T0CA 1YDVA 3VABA 1E9YB 2YLLA 1TJ1A 3CWNA 3IIXA 2VI0A 1E1EA 2D0FA 4UTHA 4HKPA 4G56A 1HFBA 4L64A 3BJTA 5D9OA 3A9BA 1VFLA 4R7WA 1B4KA 5M2FX 1KR0A 3WQOA 2AOSA 1X8FA 3J7HA 3LSBA 4CQ9A 3EB3A 3WKZA 1LF1A 4W4QA 3S5OA 1OC5A 1HL2A 3SEPA 3OEXA 1K03A 4EWJA 5K4ZA 1GVEA 2OGJA 3PHAA 1DJNA 4C1NB 4MWAD 1DE6A 2ZUWA 1XF0A 4W7WA 4Z1CA 3CPUA 1VRDA 1OCJA 2Q01A 1F5ZA 2MNRA 4RUBA 5GNZA 3SFKA 2EQDA 3QY7A 3ORWA 3G1FA 3LHZA 3AZTA 4H8VA 3P74A 4ZFMA 2PDLA 5T91A 3UZWA 9CGTA 5JUVA 2PTWA 1V0NA 3E1F1 3DGRA 5HNUA 2V30A 2WC4A 4PMZA 3W2LA 4HMDA 2POTA 3ITXA 3R1ZA 4DXXA 3KBWA 3WD2A 3DERA 4BI6A 2YCEA 3OQ8A 5I24A 5B7ZA 5HNTA 3IGSA 1BXNA 1XXXA 4WDXA 3S6OA 4DPPA 4QE1A 3SCUA 4L4LA 3CQIA 3RGTA 3ZT5A 2PGFA 3LXCA 3FXGA 2WWCA 4QJ5B 3OU8A 1O12A 2W3ZA 1EP3A 1IV8A 2DT3A 3E0FA 4LUYA 1IGWA 2NXIA 1UC5A 1XIHA 2FDMA 3HQ1A 3VNYA 2GGEA 4BI5A 3DHDA 1DTNA 2WJZA 3UWWA 4E2DA 1L6YA 4WUIA 3KS6A 1PWLA 4GO8A 3OBAA 7TIMA 5U4NA 1KCZA 3KUMA 1FKWA 3NAVA 3C52A 2IKHA 4HPXA 1POJA 4Q8VA 4HU3A 4TX9A 3BOLA 1GYMA 3MS8A 3PWAA 2QS8A 3CHCA 2C8NA 1EOMA 3VU2A 3B05A 4AX7A 1E6ZA 1I8JA 4WDWA 3WNOA 4Y9PA 1SO4A 3QVQA 3E5PA 2HNHA 3FHQA 3THAA 3W70A 2H9AB 3M6YA 5C7HA 4LYPA 2B7PA 5TAOA 4JXCA 4AEEA 1W3IA 3G3DA 3F2DA 4D6JA 5HNNA 1KCLA 1FDZA 2WAGA 5HUPA 1YIXA 4NAFB 4FXFA 3WUGA 2XIOA 3EX2A 3O1NA 4RNJA 5C9WA 3BGJA 3WUFA 1GVIA 3NOEA 2WZIA 4A8IA 1IHIA 1JQXA 2VGBA 3LTYA 1J9YA 3VOHA 1PWMA 3GE7A 5DXYA 3MPGA 4KEVA 2FPTA 1ITUA 4FLOA 4UQAA 3DXIA 4GPNA 4UTMA 3W83A 4CVWA 2PDXA 3O07A 1XSIA 4YWSA 3VILA 3QHOA 5J5DA 1RSCA 3CM4A 1XD0A 4I6VA 3TZFA 1QK2A 3IEBA 3FSUA 2Z1KA 3PBYA 4EK7A 2OX4A 3QR3A 2VDHA 3UXDA 3EMQA 3FDKA 3TNBA 3WEZA 5LZLA 1PUDA 3DCPA 3F7JA 1KA9F 3CUXA 3DYPA 1JRBA 2DT1A 1BYAA 4LEQA 3W07A 2QLYA 4HU4A 1DJHA 3I6EA 5HPOA 1VH7A 3V5OA 4OV9A 4K2SA 1W37A 4RZ4A 4UFHA 2FVKA 5C7VA 3THQA 3RHGA 4D8LA 2VOTA 2DVXA 2QUMA 2OZ0A 4LUTA 3PULA 1RLDA 3TIMA 2PLMA 3LHWA 3ARSA 4XVEA 1WPCA 4PCPA 3U48A 5CC3A 1HX0A 1Q4NX 4GISA 1C8QA 1QI0A 3BW3A 3KLKA 4N0RA 3GWQA 2WMGA 3UW6A 3HGRA 3EDKA 4QDPA 3VIOA 3URAA 3ZLGA 3D5HA 2ZZ4A 3MYPA 3VDCA 3PPGA 4GD0A 3UR5A 1E5NA 3NQCA 1W1IE 1DJZA 5G2WA 3UP8A 1G7VA 4H41A 2V5CA 2FZMA 1ZB5A 3TSMA 1XIMA 5E9AA 5D2VA 4LNYA 3T2OA 3M0IA 5F2GA 1OFPA 3GBDA 4L9XA 4PBEA 1QNRA 3C86A 4INFA 5F2LA 3KOYA 5U7SA 4N7QA 1MNSA 4O19A 4WOZA 4AWSA 3FHAA 4LYKA 4PTMA 1UUMA 2Q8XA 4M5PA 1GEHA 4LCRA 5LXXA 3UNDA 1TG7A 4GACA 3UERA 4EXQA 6REQA 1T8QA 1AA1B 4E38A 3L4YA 4A3HA 2E6AA 2AL2B 4KWOA 1KQZA 1PBGA 4IUGA 2NQLA 3AIEA 3NPWA 3CUGA 2IQ0A 4FO4A 4HTYA 2QUNA 4J2MA 2CYGA 4JCMA 3GVVA 3PZVA 1ADSA 1FKXA 1BRLA 2VHLA 4DBEA 1GVYA 4ECLA