4JTDA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Voltage-gated potassium channel subunit beta-2
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 121
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtdA00
1Z9AA 1PWMA 3GHSA 3LNMA 4YVXA 5JH2A 4H8NA 1XF0A 4JQAA 3BCJA 5C7HA 2QXWA 3F7JA 1XGDA 4OTKA 4PR4A 3CMFA 1AFSA 1AH4A 4HBKA 4DBWA 5KETA 3N6QA 1YE4A 3GHTA 2ACUA 1RY0A 1HW6A 2BGQA 3MC5A 4LBRA 3LUTA 4LAUA 1M9HA 3M64A 3D3FA 3WG6A 3DOPA 2INZA 3CASA 4FAMA 4PUWA 4XO6A 2PDWA 4QXIA 3FX4A 4XO7A 1US0A 3UFYA 2HVOA 3CV7A 2DUZA 1GVEA 2HE8A 4JIHA 2IKIA 2F38A 1Q5MA 4ICCX 2HE5A 5LIWX 1JEZA 1T41A 4JQ4A 1Q13A 3UGRA 1ZSXA 2PDLA 1R38A 2ALRA 3RX3A 2IKGA 2IPWA 1ZGDA 3V0TA 3CAQA 4FALA 1Z3NA 3EAUA 1ZUAX 3BURA 2HV5A 1LWIA 4JIIX 2PEVA 1FRBA 2FZBA 2PDXA 4F40A 3LZ3A 2J8TA 4PUUA 2PDBA 3R8GA 2HDJA 2PDJA 3RX4A 5AZ1A 1YNPA 3COTA 3H7RA 3R8HA 1EXBA 1Z8AA 2ISFA 3BUVA 4HMNA 2HEJA 4PRTA 1A80A 3R43A 2CLPA 1RY8A 1S1PA 2PD5A 4LBSA 4DBSA 4FZIA 4XVDA 2PDFA 4ASTA 1PYFA 1T40A 4DZ5A 1MZRA 4EXAA 1PZ0A 2PDMA 2WZMA 2PF8A 1EKOA 1SM9A 4WDWA 3VXGA 4L1WA 1J96A 3ONCA 4RPQA 1MRQA 2FGBA 3M0IA 2ACQA 2DUXA 4Q7BA 3V36A 3RX2A 1ADSA 3WCZA 3LZ5A 2VDGA 3G5EA 3O0KA 3BV7A 3UZZA 1XJBA 3LN3A 4JQ2A 4GQGA 3GUGA 4XK2A 1IHIA 3T42A 3NTYA 4PMJA 2NVDA 4WDXA 1Z89A 1VBJA 1MI3A 2ACSA 4JTCA 2I16A 4H7CA 5LIUX 4GQ0A 1S2AA 2R9RA 1QWKA 4GIEA 3V35A 3R6IA 3CV6A 1YE6A 4QX4A 4G5DA 1EF3A 1S1RA 4IJRA 1UR3M 4EXBA 3H4GA 4XVEA 5JH1A 4XZIA 2PDPA 5HA7A 1X98A 2R24A 3LQLA 4JTRA 2F2KA 1K8CA 3ERPA 2BGSA 2IQ0A 3Q65A 3DN5A 3P2VA 3ONBA 4AUBA 2I17A 5HNTA 3UZWA 2IQDA 1QRQA 2A79A 4Q3MA 3UP8A 5AZ0A 4XZMX 2IPGA 3QKZA 4WDTA 3GHRA 4GABA 1PWLA 1AZ2A 5LIKX 2IS7A 3V0UA 2PDCA 4YU1A 1C9WA 1ZQ5A 5HNUA 1HQTA 3EB4A 2IKHA 2ACRA 2P5NA 4XZNX 2PDGA 2PDKA 3KRBA 4YVPA 4PRRA 3MB9A 3R94A 2PDQA 3U2CA 1AH0A 4IGSA 4WRHA 4I5XA 2PDUA 4WGHA 1X97A 4QR6A 1AZ1A 4JQ3A 4WDUA 3B3DA 2AGTA 1LQAA 4LB4A 3N2TA 1X96A 4IJCA 2HVNA 3Q67A 1AH3A 3UWEA 1EL3A 1S2CA 2INEA 3LBOA 5DANA 3V0SA 4GACA 3CAVA 4LB3A 2PDNA 3WBXA 2FZ8A 5LIYX 2PZNA 5LIXX 1PZ1A 4NKCA 3UZXA 2NVCA 4JTQA 2PDYA 3UYIA 4XZHA 3LD5A 2WZTA 4JQ1A 4LAZA 3R7MA 4GA8A 4WEVX 3S3GA 4MHBA 1IEIA 1VP5A 3G1RA 2FZ9A 4JIRA 3O3RA 4XZLX 2C91A 3R58A 2DV0A 2PFHA 2IPFA 5M2FX 3C3UA 2IPJA 2PD9A 2IKJA 2PDIA 4GCAA 4ZFCA 1OG6A 3H7UA 3LEPA 3WBYA 1RALA 4XAPA 3LENA 3WBWA 1YNQA 3EB3A 3UG8A 4FA3A 2PDHA 3FJNA 4YVVA 4YS1A 3M4HA 3LQGA 4QBXA 2FVLA 2FZDA 3UZYA 3GHUA 4R9OA 4JTAA 2BP1A 4L1XA 4DBUA 4JTDA
chains in the Genus database with same CATH superfamily
4NXKA 3PZIA 1F3XA 5JH2A 2GWGA 1V93A 3XISA 2W67A 3CM4A 3U48A 1RLDA 2R1MA 4Y9PA 2HPIA 2WHJA 1I75A 5IDIA 1SR9A 3C0LA 2ZX8A 4Z1CA 3KTSA 3MYPA 4C6CA 3E0VA 4HBKA 2XTKA 1MNZA 1NDVA 4QLJA 4DPPA 4DO5A 1DWHM 3IIVA 2JGQA 3QY6A 5AYXA 5E1QA 1JZ6A 4LCRA 5BOOA 4QDWA 4XO7A 3RCNA 5J8LA 1XCXA 4WKAA 1QNVA 4W7UA 4MGGA 4UR9A 2EKCA 5D9NA 1Q5MA 3M46A 1JJKA 4H83A 1T41A 3IS4A 1BTCA 3SRDA 4RCXA 4LV9A 1BRLB 1RQEA 4CCCA 4WHBA 3O16A 3EDEA 1CGVA 2TPSA 5FF2A 3TOYA 4HU0A 3DFPA 3SECA 4HNTA 4NZCA 2J62A 4AVNA 3MTWA 3VYLA 2VT0A 2A7RA 4F40A 1NU5A 4RE0A 2EQDA 3VIGA 2Y6ZA 4HMDA 2BBFA 4Q6JA 2ZUNA 3VUSA 3U57A 3SY1A 3MDUA 1HL2A 1CW2A 2YCIX 3CU2A 3IGSA 5AKQA 1JPIA 1G69A 3G1VA 3N25A 4TV5A 4FX7A 4OUIA 3Q37A 4AG0A 1UKQA 1ZAHA 3VNYA 1J4EA 3CZEA 5CSUA 2PDFA 4W7WA 3PHAA 2PMQA 2YZRA 2DZAA 3JZEA 1QMLA 4U5IA 3OB8A 4NAEB 5G1YA 3WF3A 2GVEA 1YHTA 4YL2A 1B3OA 5CLTA 2G0WA 4ZTYA 3GXFA 1B54A 4B5WA 1Q7ZA 4O11A 1V3JA 2V6AA 3GNPA 3MWCA 3E9AA 4L1WA 5HMDA 1GKRA 4AXKA 3F2DA 2WSPA 3AJXA 1E71M 1XPGA 4WVXA 3WH8A 4OBSA 5EPDA 1E0WA 3QH2A 1KM0A 4UOZA 4MUPA 3G22A 3KRSA 1LRTA 3VMOA 1YKWA 2P53A 4NJIA 5HULA 1RVKA 3OG2A 1TE6A 4XD4A 3TQKA 4OBTA 2VX5A 1IHIA 1R2RA 4NJHA 2GFTA 2QJHA 1U33A 2WNQA 4AIBA 1JG9A 5J5RA 4JBRA 3NQ2A 5DMLA 5FAJA 3DFTA 4O10A 5D02A 2D73A 2QCLA 4GFIA 1LT8A 1SFLA 3QZ6A 1KCXA 2Q8LA 3ID7A 2V2CA 1S2AA 4JNYA 3M43A 1NDZA 3G1SA 1KCZA 2GUUA 3WD0A 3BLOA 4C6QA 3QGVA 4HPXA 1EFZA 4IL2A 1DIEA 4GNVA 5FF7A 3HPZA 4MNMA 2BOGX 4ZQNA 2YOCA 1NDYA 4PSPA 3ABRA 1X98A 3ORWA 4PUMA 3W24A 3T05A 4GXMA 2GJXA 2A6NA 2IQ0A 4TVDA 4IMFA 1TZ9A 2FHBA 3WQCA 4NNBA 3KL0A 3FEMA 2J7GA 1WUFA 3KHJA 4CN6A 4D1JA 3KS5A 3N2CA 1UROA 2V5BA 2Q8ZA 1X38A 1ESWA 4YLWA 3BW2A 1LLWA 3GW3A 4XD3A 2G41A 3QW3A 2NUXA 1F76A 1J2WA 3QRHA 1UC5A 1TJ2A 5K9DA 2PP0A 1BKHA 3A3WA 2IKHA 3QW4B 2MANA 1F2JA 3KUMA 3AUOA 2VI0A 2WSYA 3MVIA 3BLKA 3NPUA 2QVHA 4ZA0A 2GGHA 4IUGA 2HWGA 1P0KA 5EA9A 2QUTA 3VA8A 2AOSA 2VVNA 2O9OA 2VGIA 3OYXA 2WO5A 2NLYA 4FS9A 1R47A 3DZ1A 4BFAA 2RJHA 1BYDA 2PLKA 1U5JA 3BMWA 5JBEA 2ZADA 4JY8A 1L8PA 4J4KA 1YPFA 2IXUA 1FWHC 4XKMA 3SCUA 3GAYA 1W3HA 3AXHA 1XBXA 3CHFA 3K46A 1LROA 4RW5A 2OQLA 1ZL1A 2VX7A 1OX6A 2QPSA 4Q32A 2Z0IA 3BWWA 3R7MA 6TIMA 1KW1A 2VL4A 3DFHA 2DW6A 3CZ8A 2FZ9A 1JF6A 4IT1A 2GOKA 3LPFA 3OZPA 1K6WA 3HPAA 2PU0A 4CUCA 1K7XA 4PTVA 4DJFC 1N82A 2PWUA 2QNEA 2VDHA 2IKJA 3PC0A 5DO8A 2Z7KA 2RUSA 2Y89A 1VYSX 3TN3A 5I07A 1FY6A 3B8DA 2NX3A 5EMLA 2BNJA 3ZQ9A 4RR4A 3RMEA 4ZL1A 1CENA 4ATDA 1UR2A 3H23A 4FPSA 3AIQA 3SRKA 2GK1B 4TX9A 2AQVA 1F6PA 3BE7A 3FVDA 2RDWA 1W1B1 2PP3A 1TG7A 4H8VA 3LYEA 2PZ0A 3B9NA 3K2GA 1E5NA 3PTMA 4IHCA 1PJ9A 2VZSA 3RUBL 4JQAA 3BCJA 1C93A 1BLIA 1OC7A 1VYPX 1KBKA 3NQ7A 1SYTA 2ASHA 2V3EA 4K6AA 4DUOA 2FZNA 1XIIA 2WSQA 3ENLA 2CITA 3REQB 4S39A 4QNEA 2H3BA 3BGGA 3TNOA 2FMNA 3LRLA 3SCOA 3KLKA 3SN0A 4M7TA 4DJED 2W5FA 4QQ3A 3GU1A 1OK6A 3LHZA 4Q7IA 3M64A 2OKOA 3D3FA 3WG6A 1KBLA 4PCSA 3WQWA 2W27A 3I4EA 2ZCGA 2BVDA 3NA8A 2Y8UA 3P14A 5LXXA 4KCVA 1GVEA 4QDMA 4I5RA 5DCBA 2O55A 3LLDA 1QOQA 2Y63A 4QROA 2WMFA 1G1YA 4MOZA 2ZA2A 3VGBA 4LF1A 2Q3OA 5IM51 3IPWA 3TDFA 1SR0A 4MFDA 3AFBA 2HV5A 4Z2GA 2XIIA 3PSWA 1OHLA 1EIBA 2XINA 1PEZA 1UWRA 4TMBA 3AMLA 3RK8A 1TR1A 4WCJA 2X09A 2D2JA 1TPC1 3ES7A 4EF8A 3W7GA 2O92A 1ONXA 5AZ1A 2E9LA 3N14A 3ITOA 1QW8A 1M6JA 4RKAA 3L2IA 4ROPA 1S5TA 3MMUA 1EOKA 3EWWA 1HP5A 3CV1A 3CH9A 3CWHA 4B5TA 4DBSA 3MY9A 2J9XA 2PPGA 4BI5A 5E09A 1JFHA 3TLQA 3UNTA 2HJPA 4H6EA 3WF4A 4PCTA 2QIWA 3BQ6A 3NQDA 4HA1A 3TU9A 3GKAA 3KVMA 4M0XA 2G3NA 4Z1YA 4QS5A 1J8VA 1ISVA 4TXEA 2NQJA 5I3HA 1Z69A 4QGCA 2Z6JA 2FGBA 3TX9A 3N17A 3HQNA 2JBMA 2Z4GA 3FHQA 3W1AA 1NF0A 3C6CA 3TP4A 3B9EA 4XAGA 3EWCA 1B3YA 2BVYA 3V3WA 1W9PA 3UZZA 1CGWA 3AROA 3ARVA 4J2MA 3LCXA 5EBUA 2BY1A 4HQVA 1DL3A 1OY0A 2DORA 4JTEA 1YBQB 1POJA 4LT9A 3IIPA 4PB5A 5A95A 4ADUA 2YA0A 2YYTA 3W73A 3THQA 3G0SA 1A4LA 1J0KA 4DI9A 3N2OA 4O8AA 3BG3A 3LHYA 2F7FA 4AWSA 3C8FA 5T8GA 4ORMA 1MRAA 4LWWA 5FF0A 4DM2A 3CT7A 4AZ6A 5FKYA 3GDRA 1M5WA 1NFBA 2CLIA 1PCWA 1UZDA 4JEQA 3DC0A 2VCAA 1ITXA 4CD6A 2Z1XA 2PGWA 1Y7VA 4NJJA 1SW0A 4JX5A 3KS6A 1P48A 1ZTVA 4TU1A 3S2NA 1J6OA 2XVNA 3CPGA 1OVDA 3K8MA 4Q8MA 1EBHA 3AISA 4J7RA 5DCDA 5FAGA 1WX0A 3ERPA 3UJSA 3DN5A 1AK5A 2P3EA 2HXUA 1KXHA 5KMYA 4HMEA 4GJ1A 4LAKA 1OFPA 3UP8A 2V2HA 3LCWA 2ZZ2A 1UP3A 2YL9A 3W23A 4L4OA 2CIPA 3ZT6A 1RLCL 4H6RA 3M0MA 1REQB 3GIQA 2XFRA 1WKEA 5T91A 1CECA 1DIDA 4JTIA 5GJNA 4JTFA 2GQ9A 3MO7A 1O5RA 3QQ0A 3VIPA 5EFDA 1MMFA 3USZA 4GC4A 2NWSA 1LUCB 4FHAA 4K37A 1M7XA 4KWOA 3GDMA 4WQ6A 3U0HA 1UW9A 3SUUA 2P5NA 1NVMA 4RDVA 3LXBA 5H6HA 1CGXA 1BWLA 1OB0A 4WGHA 1TA3B 4UZSA 1K7EA 2PWEA 1QNSA 1MWOA 4YHEA 3GQYA 3T55A 2WKGA 4C65A 1WCGA 2B31A 4WKFA 2NVAA 2HS6A 1K7FA 3RHGA 3UWEA 5A8GA 3CPUA 4K1WA 1SJDA 3HFTA 2YZ5A 4W84A 1AJZA 1KCKA 1OFQA 1P0EA 2Z7GA 4GACA 4WGXA 2PDNA 3UGVA 1QI5A 3A23A 3BTNA 1SU5A 1TVLA 2NXGA 1VBUA 1FP9A 3S1VA 4M24A 4I6KA 4KQNA 4MNLA 4IIDA 1J5TA 4QNWA 1RK6A 3PVFA 1EC9A 2VWTA 3UF9A 1F61A 4IUOA 1XV8A 4LYQA 3M07A 3UYIA 5A6JA 2XISA 1EGVA 1YRRA 4Q8VA 5G5IA 1M41A 4DPQA 4IFRA 2JF6A 1T0OA 5CBJA 2CBVA 3L4UA 4KCWA 3TC3A 3WQDA 3NQBA 2ISVA 4L5ZA 1FWRA 3MUY1 3G1YA 4E0CA 2BV9A 3RCMA 3TN4A 4H8HA 1TPDA 3HM7A 3P80A 3NURA 5D33A 3HTWA 2OT0A 4NY2A 3AWNA 1QXLA 4TTGA 1EPVA 2CWNA 3GBEA 5PTDA 3M0KA 3LENA 4F0LA 3I68A 7REQB 5BU6A 3GO2A 3VFLA 4JYDA 2QPUA 4JEJA 3LQGA 3WBEA 4D6JA 5KTLA 5IOBA 2R94A 1O6IA 3K13A 3AMGA 4AHQA 1KFJA 5E0KA 4GC3A 3PWGA 2RKXA 3HG3A 1GOMA 3W3OA 1N7KA 1EJVC 5IBXC 3FAWA 2TAAA 1O94A 1VBHA 3GKFA 3LNMA 4DY1A 1E6XM 1V3MA 1TWWA 1OYAA 1WDDA 3E0WA 1GCYA 3IGXA 3UCCA 1QK2A 4GY1A 2NW0A 3W7RA 3RAOA 4A22A 3SQMA 1B30A 2O9RA 5D4YA 3VUPA 3PJUA 3U8GA 1FCVA 3BJSA 1YTKA 4DJEC 4LEFA 2FZMA 1Q6RA 4CEXC 2ONEA 3OZMA 4GX9A 1A4MA 4GG9A 4LW7A 1QNQA 2DZSA 3LUTA 3DFSA 1V6TA 3TA6A 4UOJA 5AN7A 2QGYA 3ANYA 1QHPA 5DMYA 2A7PA 3LMYA 3BLEA 2HRWA 1U22A 5K7JA 2Z00A 4XZWA 3OU8A 1QBAA 1JZ5A 3AZRA 2BOFX 2QMJA 5GJPA 4JQ4A 1K1DA 3RU8X 3TIMA 1XH2A 4QISA 3RLUA 1VIZA 1RSCA 2CLHA 1A5BA 2IPWA 4TOQA 5XINA 1V4YA 1KLYA 5HK4A 3OODA 3P5YA 1HKKA 4JYFA 1WZLA 2PEVA 3A3HA 1E3XA 3E74A 5CSRA 3EX4A 3DX5A 3LM7A 3O06A 2PDBA 1HJWA 5HWMA 3LU2A 1MDLA 1NTHA 3RX4A 4D71A 3HGJA 2RGMA 5U7SA 2NXIA 4L4MA 1FWBC 2QYGA 4IQJA 3O07A 2W66A 4HCLA 1KFBA 3ITGA 3R4IA 1MEIA 1QVBA 3I3EA 1AQHA 1IWBA 2VDIA 3GDLA 3ZO9A 3C4UA 1HGWA 1P43A 1TJ1A 1SFJA 4TR9A 4UCFA 1RAKA 3S8HA 1Y65A 4FP1A 5M5DA 3E0LA 1E4MM 3SGGA 2V3DA 1L6SA 1BSLA 2JALA 1QBBA 3EGJA 1YPIA 1SW7A 1K8YA 1P5BA 4U3AA 2QDHA 4O52A 3U9IA 3NQ8A 3EOLA 3C2VA 2GJNA 1MRQA 4F0HA 1HUVA 5F4XA 2NSOA 1EF2A 1OIMA 2GQAA 3UWQA 1TTJA 1BWVA 1YQ2A 3TYAA 3LZ5A 1H49A 1DP0A 1XSKA 4ZO7A 2JFEX 2ZA1A 3R89A 4K68A 4WKHA 3WLKX 3DC8A 4Q22A 5CPOA 5JU6A 3N9SA 2A1YA 2ZX7A 1FHLA 3BVJA 4Q8TA 3PZTA 3IARA 3ZSTA 3FA4A 5CQ1A 5JIWA 2VNCA 4O53A 1UG6A 1GW9A 4HOWA 4F2BA 1WB0A 4WJ8A 1EJXC 4RUBA 1DWJM 4IMGA 1V6XA 3WIJA 1S46A 1H7PA 1OC5A 3OO2A 3CTLA 2R91A 1ME7A 4KPLA 3WMBA 3EMZA 3KWXA 1VBGA 3G6LA 2YFOA 3BW3A 1R7AA 3GE7A 1D3GA 1GJPA 4XVEA 4XB3A 5EY5A 1NH6A 5JH1A 2CLEA 2ZTJA 5K9CA 3JW7A 1OFDA 2F2KA 1K8CA 4RE4A 4CNUA 3TMQA 1A0DA 4AUBA 1HKIA 2XM1A 5SWUA 1EHAA 1W3NA 1HF6A 3UJ2A 1DJZA 2A79A 2JK2A 3VKDA 1S3HA 2VVSA 3W81A 5HINA 4XZMX 2Z1WA 4M8UA 4WDTA 1C29A 1P6CA 1RR2A 3I7SA 3FK4A 3QJAA 3P62A 1AZ2A 1FWWA 3LY0A 5CPMA 4YU1A 5HR6A 3CL7A 1ZQ5A 5BRQA 3N04A 1TPUA 4GNJA 4O28A 3R10A 3DHUA 1AJ2A 2UBPC 5LNRA 1OFOA 4BS0A 4IIHA 1TWZA 2ZUWA 4IGSA 3U2CA 1SZGA 4AXNA 1O7AA 3GNNA 3QR0A 3WH5A 3RMJA 4OIFA 4QR6A 1AZ1A 2C19A 4PMYA 5HPOA 3VIIA 1GQIA 4DNHA 2AGTA 3TW7A 3BAKA 1UP2A 5FJJA 2BVWA 7ODCA 3O63A 4YXGA 2OLHA 3ABOA 5LNUA 2VOMA 4MWAB 1XIEA 2W63A 3MHGA 3KBWA 4H9ZA 3GLCA 4GQBA 1K9TA 2QKFA 3SCTA 2CYGA 5E93A 5A6LA 3NXLA 4LCQA 5BRBA 1DJWA 3N6JA 1GOKA 1TJRA 3M41A 3TW9A 5LIYX 3E38A 2WWCA 3FJ6A 3LXAA 3O8AA 3WY1A 5GJMA 5JIPA 2WLYA 3TQ0A 4DRSA 2GL5A 2PGEA 1YMYA 1KXQA 3AC0A 3FFSA 4MJ2A 4WLCA 1LBLA 4HNVA 1D2KA 3KL5A 2VEKA 4GZIA 4AYGA 1WA3A 3OA3A 3W2JA 2V3GA 1OCJA 1EUAA 1Q6DA 4K7YA 4LAMA 4N6EA 3WF0A 4PCFA 3R58A 3AIEA 3PZGA 1H1NA 1ZRQA 1T8XA 4OFCA 4FNSA 2H8XA 4UC5A 5A2BA 2WWDA 5LNSA 4YPJA 2INFA 4I7WA 1RALA 4KEVA 1HG3A 1BEUA 3GXDA 4ZO6A 3C5QA 4QITA 1TTIA 3G3DA 3UR5A 2OZ3A 4EAMA 1ZLPA 3L12A 1FCBA 1PZ2A 4H9UA 3D46A 2H9AB 1QCWA 2QDDA 1PDYA 1RCQA 2BG5A 2BP1A 5HOSA 3HG5A 1LORA 4LYPA 4AD1A 3OVPA 4GYPC 1Z9AA 1V0LA 4IP7A 4J3TA 2OU4A 1K03A 2E0PA 5CPQA 1M7PA 5KZEA 1US3A 4M81A 1R5YA 4Y7EA 3GG8A 3T08A 3WUGA 4G1NA 2QQ6A 4HNLA 4FX8A 1ZBKA 1LP6A 1V6VA 2DQWA 3N6QA 1O1HA 1MXDA 4Z0SA 2W62A 1I60A 3AHVA 4CCDA 1PO9A 1HW6A 4U2YA 5CEWA 4LBRA 5I24A 3EX3A 5AB3A 4AZCA 3HQPA 1EIXA 4QIUA 4IQEA 3WNMA 1US0A 3UFYA 3NJ3A 2AQWA 1CCWB 1SO6A 1UYQA 1BRLA 3A13A 3MKKA 1PV8A 4GYPA 3JR2A 1X39A 2Z1VA 2Y7EA 2FTPA 4DAIA 4ICCX 2VC5A 4QS6A 1QPKA 4ACYA 1LF1A 2PDLA 1ZBWA 1KFLA 1E40A 1XCFA 3V0TA 3EA2A 2P0OA 1NWSA 3FYYA 3S83A 3BURA 4M80A 3VIMA 1A5KC 1LWIA 1BVZA 1AD4A 2PDXA 2J78A 2Z24A 2QCEA 4IF2A 1MUCA 1HJVA 3KOYA 4XIAA 1Y0EA 1K8XA 3GFXA 3MV11 1DE6A 4MZ8A 2OT1A 3A47A 2G96A 3H7RA 4S3KA 1UWAA 3BMXA 1XLIA 3ZJKA 3OW1A 1R9XA 4DEFA 4QJ3B 1O1ZA 1RY8A 1SVDA 3S5YA 3I3DA 4LBSA 4JICA 1K77A 4LS1A 3TH6A 2XZ9A 3VE9A 2QW5A 3F4DA 4X2RA 1U2YA 4EPKA 1THFD 1OGSA 4NYYA 1OM0A 1QI0A 4NF7A 3WLNA 3BC9A 2XWEA 3W7KA 2PF8A 4HN4A 3NYZA 2NT0A 1K70A 2G3JA 1J96A 3TYBA 3T0AA 3P74A 4XV0A 4IFKB 3VE7A 3KBVA 3GXMA 4J40A 2Z25A 3PZUA 1XGEA 2VFGA 2Y8VA 2GVJA 1R9ZA 4JDYA 1L8NA 2ZC1A 3N9RA 1HJSA 4KWUA 2ALDA 3KM8A 1HJQA 3R0UA 2VWSA 3PPHA 4XAZA 4AEOA 5H8UA 1EWDA 1GT8A 4UOQA 4POCA 4BHYA 1IEXA 3PZOA 3DU0A 3MHUA 1VBJA 1RJPA 3MU7A 1GKQA 4A3RA 1DYSA 3NZQA 3UPMA 4B5UA 1WNOA 1FXQA 3WYZA 5C2CA 3CV6A 1I45A 5T9BG 3VKJA 2E5CA 2BY0A 3CUIA 4EAYA 2WMIB 3S0CA 2GJLA 4F8XA 1BGAA 2BX7A 1TQXA 1CXKA 4AISA 4GZJA 1A5CA 4HIBA 3IIOA 2Q02A 4JKLA 1S5VA 3ITCA 2PDPA 3WJZA 1QNRA 4CQBA 3NSMA 2VEFA 2BGNE 3LTPA 3TZFA 3LQLA 4A3UA 4I90A 3CMGA 2F6UA 4ZQPA 1EA9C 3P2VA 4Z2KA 1MQPA 4OOUA 4U5KA 3WH7A 5HMFA 3SFWA 4Q3MA 3NEVA 3SUSA 3IJ7A 3GFYA 4M6QA 4HYVA 1HX0A 5D03A 4H6QA 4MADA 3GHRA 4ZOAA 3W7EA 3DUGA 4KIRA 5LIKX 3DHPA 5DFAA 4MLJA 3BZGA 5AHMA 2H90A 3I4KA 1E5JA 1BYBA 4W86A 2ACRA 2XN1A 3DEQA 1DJIA 1L2UA 1QO5A 2WPGA 5DXXA 1KBBA 4ZMGA 4GISA 3NZRA 1DJQA 3TTOA 2RH9A 3M7WA 1HVQA 2ZDSA 2Y88A 3GR7A 1VEPA 3GH7A 4ICNA 3KOFA 3MYOA 2ZUTA 3CO4A 3LCLA 5D05A 3SM0A 4LUIA 3ECQA 4UQEA 5RUBA 4PL2A 2W6RA 3W1UA 2E7FA 4D1IA 1W3JA 3PTDA 1E9ZB 1KM3A 3ARWA 3HQ1A 4DLFA 4D2JA 3UEQA 3EA1A 3PBYA 4ERIA 1WV2A 2V9DA 1EP1A 5C0QA 1HN1A 1FDYA 1Q4WA 1N55A 5EMJA 3GXIA 1FVPA 3AMKA 5CAKA 3HPXA 4JTQA 4H41A 1D7FA 4XZHA 4JQ1A 4LAZA 5CJMA 4C6PA 4AVFA 1IEIA 1E0XA 1BVWA 3SEPA 1B90A 5I02A 2BDQA 4ZE5A 1K3UA 4UMBA 3UNDA 3SCPA 4RW3A 4PMUA 3UJRA 3AHTA 3B40A 4KS0A 3C8NA 2GK1A 3ABZA 4AYSA 4FLSA 1HTIA 2YW4A 4XAPA 4R88A 4AD4A 2PGRA 4ZOEA 4KT2A 2ZYFA 4QQUA 3FKRA 1PCKA 2GGEA 1M01A 3UG4A 3M4HA 1NOUA 3P7YA 5H8MA 4QBXA 4Y9NA 4U3CA 3WMSA 3WF2A 3AQUA 3VGFA 4N4PA 2OSXA 1MFVA 1NEYA 1VFOA 3NPVA 1MFUA 2Y8KA 1BG9A 4DBUA 5G2WA 1OGBA 3GDBA 3G77A 9XIMA 2XUCA 4WK9A 3REQA 3TAKA 4BF5A 3UQNA 4D6DA 4HN8A 4J27A 4E2VA 3INPA 1OADA 1KRAC 2AKZA 5A5WA 4DBEA 5I3IA 3M6DA 3B9OA 4EWND 1XBZA 1JZ8A 5HAOA 2X1IA 3DOPA 2F61A 2G95A 1FOBA 4UTMA 5BU9A 4BJHA 2C71A 3M16A 3MI2A 5HPCA 5JXQA 2HVOA 3DHFA 2EPLX 5D04C 4W7VA 2J47A 1JEZA 4XBSA 3VIHA 4Q8UA 2J66A 4LFYA 4MM1A 4P7NA 2FIQA 1JIBA 1XIGA 5D8ZA 3RO8A 3NDZA 1XC6A 3W00A 1A5UA 4X22A 5CC7A 3WLIA 1XWYA 1XISA 4B3LA 3DKLA 3WLTA 3TK7A 1GQJA 2QMKA 5CC5A 1JNEA 3LK6A 4NI8A 1S2TA 3O15A 4YHGA 2DIJA 1TWIA 4UTJA 5DBUA 1XDJA 3GAKA 1H7OA 2QCCA 1YNPA 3DFOA 2FJUB 3FDKA 5BRPA 1IZJA 3ISIX 4XUYA 2PWDA 2Y7FA 2GJXB 3PG8A 3LHUA 4TX6A 3B8UA 5BXRA 4OBRA 1LJYA 4W5ZA 4XAYA 1EC7A 4C5ZA 1GHRA 4ICMA 1TPH1 3U2EA 3PBMA 5CGTA 3CC1A 3MKCA 1L6FA 1Q45A 3DKJA 5A1AA 4LS0A 5D9MA 4EX4A 3S1UA 1OF8A 4U31A 4DYEA 3MANA 2ZUSA 1ISXA 1W1YA 4TVUA 2DH2A 1LBFA 3F2CA 1M65A 3WO8A 4CD8A 1UKSA 2I57A 1E1CA 2YXXA 3M47A 3L0NA 4WSKA 2E5DA 4GVGA 4UFIA 3ZIZA 4E2BA 2O0TA 4PMOA 3OLGA 3BSHA 3AIBA 4KGJA 4S3CA 3T42A 8A3HA 3LLFA 3ZXWA 3MBDA 1G0CA 1LZOA 1DWFM 3L2MA 1TCDA 5CG0A 1J6PA 4JTCA 2D1ZA 5CC6A 3E02A 3WLHA 1GVQA 3ZVHB 1VB9A 2YGYA 3EOSA 2TODA 2FDSA 2PTDA 3L5AA 1KFEA 3GXNA 4W5UA 2FH8A 4QG8A 2X8RA 3GH5A 4MNKA 1QI3A 3OBKA 4AC7C 4RK8A 3TSBA 3QV9A 3AIRA 3I6EA 3VU2A 1EJSC 4UR7A 4XZIA 3ZR6A 5GNXA 1EEXA 4MVAA 4R7OA 1DJGA 1TYGA 3GDTA 1REQA 5F1UA 1QRQA 4MWAD 1TCMA 2BVTA 2HS8A 4BCEA 1T8QA 4FB7A 3EDDA 1L0PA 3AS3A 3VIKA 4IOTA 4AD2A 3MJYA 3RITA 4GYKA 4C91A 3OBAA 3GB6A 1A5AA 5AC5A 2GWNA 4NIRA 3MPGA 1LUCA 4N9BA 4Y9AA 4W9TA 1JRCA 3P0XA 1ZP4A 4XZ9A 3STCA 2BFGA 4V15A 2EEXA 3HJEA 1NWRA 2ZQ0A 4KRTA 1PSCA 4NZ5A 4GGHA 5I06A 2HROA 4OV4A 1CX9A 4Z17A 4ERGA 3A4XA 4O1BA 3GNOA 3NXFA 3T8QA 4FNRA 1GQNA 1PX4A 2XIMA 4BQ5A 1IR1A 1XS2A 4K38A 4RDWA 3DYMA 2DFAA 3W29A 4GFSA 1XH1A 1WKYA 4WY0A 3JUGA 3Q67A 1AH3A 4W8LA 1IR2A 5F7UA 7TAAA 1FKWA 3BG5A 3VGDA 4NRRA 3B4YA 4LJ3A 2O56A 2VR5A 2NQZA 1RP8A 3FN9A 1XG4A 3TWAA 1GQLA 4DWSA 3SGUA 4NAFB 2F6XA 1B9BA 3H4WA 1XBYA 2CZEA 2OR2A 3AXMA 3ALGA 3RRAA 2PTZA 5JVLA 2HQAA 3LD5A 1RCOB 3S3GA 1A53A 3RCYA 4CQ8A 4JKMA 3L4WA 3S42A 3EXRA 4XZLX 1DJXA 1UR1A 1AQMA 1AL8A 1BF6A 3N4FA 4JDBA 2NXHA 1EX1A 1V7YA 4IISA 1QUMA 4H2CA 1WKDA 3H7UA 4UIOA 4HSNA 4EPEC 4FF5A 2IW0A 1UPPA 3CS2A 4JS3A 3T4CA 1Q7QA 3V18A 5A8MA 1A3HA 4K3ZA 1EHNA 2PDHA 1WDWA 3AHZA 3EXTA 3WN6A 1MZHA 5FSEC 2DVXA 1UKTA 1RVGA 4OGZA 1YW1A 1EP3A 4Y9OA 5ECUA 3BV4A 4X3ZA 3RR1A 2BY3A 1PWMA 3GHSA 4XQ6A 4QLKA 1DOSA 1P7TB 1FCUA 3E0IA 3PZQA 3HB9A 1CIUA 4C90A 1Z44A 1UR8A 2YXOA 1XIMA 4X61A 2VCBA 3SY8A 3PF3A 1UMLA 3ZR4A 2QGHA 3GHTA 4F0RA 5E9XA 4PBGA 3I7QA 2VC7A 4AX7A 1UQYA 2DZWA 1JZ3A 1EJ7L 1VPQA 4K1GA 4NYUA 2WHMA 2GSEA 2D20A 1P1MA 4Q8WA 3NQAA 5KINA 1A5OC 2HE8A 3BO9A 4GK8A 4S3JA 3IK4A 1KA9F 1W0MA 3IIZA 3IV8A 3H53A 3MP4A 2CETA 4JIEA 3GUWA 2FTYA 2UY4A 1JI1A 5LA0A 4LTSA 3L4ZA 5FF4A 1DWAM 1D8CA 2QV4A 5DMMA 4IJBA 3ARRA 4FOKA 1OWQA 2V0TA 3VKCA 5EBAA 4HD5A 1FHUA 1S5NA 2EAWA 5EGRA 4MB5A 2YX0A 3W7LA 3PWAA 1IF2A 1KTCA 2J8TA 3UG3A 3W1PA 3T6CA 1EJUC 1A0CA 1KR0A 3URAA 3S2JA 3K4DA 5C54A 4FXJA 2YA1A 1W8GA 4PA8A 4R7WA 4XBJA 4HNOA 3H26A 2Y62A 4DB7A 1R2TA 1Z8AA 2ZZ5A 4PCNA 2MNRA 1Q6CA 3R43A 1XLMA 1PKMA 2TRSA 3SBFA 2EPMX 4J5NA 2J7BA 1CYGA 2ZDRA 1BKSA 3A64A 4IH3A 1B9ZA 1ZJBA 2XIBA 1E1FA 2VOTA 5TNVA 3QLDA 2OMAA 1F4HA 2WZMA 2DJLA 1J0IA 2E68A 1OZMA 1GHSA 4OE7A 4HZ6A 2TYSA 2VM8A 3GXPA 1EA0A 3FEQA 4I3GA 5MHBA 2V5DA 3KBMA 1NELA 4K8EA 3BGAA 1DQXA 5D2VA 4FNPA 5A6BD 1PVNA 3CUXA 1R2SA 2JE8A 4JY9A 2DJXA 3E6EA 4NZ3A 3URQA 2DT0A 3ZFHA 3KAOA 3QGKC 3D0CA 4M29A 3ZSSA 3UJFA 2XN0A 3B0UX 2B7QA 5AHEA 2X41A 3T44A 4CN1A 1JDFA 2KX9A 4KWVA 4J3WA 3AMCA 4DF1A 2CXEA 3VVGA 2OZ8A 3WQFA 4WDXA 4QM1A 4CKQA 1S2UA 2B7OA 4KESA 4ML9A 2J4GA 4GQ0A 1JCTA 2Z2UA 1KM5A 4J3ZA 5G1MA 1JPKA 2YFNA 1YE6A 3W9ZA 3G1HA 1C7TA 3TQVA 4QEHA 3IJLA 4RNJA 1AQ0A 2CEQA 4N02A 1Q6FA 3VNJA 1NP2A 1XFBA 2YCKX 3KDOA 2RJGA 4P2VA 1F3TA 2J7HA 3RN6A 1U83A 1UD8A 2R24A 4G56A 3T40A 4ES4A 4H6KA 1AMYA 1NWTA 4FO4A 5FACA 1DORA 2IQDA 4MWAC 1W8SA 2FTWA 4UMCA 4HGXA 1S38A 3EDJA 2DZTA 2YL6A 4FLQA 4UTLA 3NGFA 1XW8A 3NQEA 3QKZA 1AODA 1E72M 3ZLGA 1FHVA 4GABA 2E4TA 1JL8A 1F3WA 2HZGA 4JPGA 2DQXA 5LA2A 3ITYA 3C61A 1G7UA 2A0NA 4IIGA 5FOOA 1PTAA 3AU6A 3IVSA 4ADSA 3H55A 4J3SA 3W88A 1XI3A 2E9BA 3TA9A 4M6UA 2WVTA 4PRRA 1ONRA 4RL3A 2QEZA 1ZPTA 3KCOA 1JD9A 1BQCA 2EHHA 4GVFA 2HCVA 3C86A 4UFLA 4DO4A 1W5NA 3FVMA 3V7PA 1QFEA 1JUEA 1LQAA 3W7HA 4ECLA 1GUVA 4UQBA 4MWAA 1XLKA 1GG0A 3LCHA 3GC2A 3WJSA 2EG6A 4DQWA 4N2YA 1BD0A 3CL8A 3UWVA 2C0HA 3CUHA 4FXRA 1O95A 4UFKA 3EPOA 3G2GA 4PYSA 3SRHA 1TMQA 3OG3A 3WLPA 3M9YA 3NL5A 4X0NA 4CU8A 2W91A 4P8XA 1Q65A 3GK0A 1VJSA 5CPTA 1PZ1A 3WD2A 1J11A 1BPLB 4ZB0A 4PMZA 4GA8A 4PUDA 4ENLA 1T99A 1AJ0A 1VRDA 3HZ3A 1J12A 2JKPA 3QPZA 4B91A 4M7SA 1RD5A 3LTSA 3JU2A 2C18A 1E15A 4MKVA 2PDIA 2JEPA 3NSXA 5I3GA 3CHDA 3MBFA 1H62A 3PP7A 4QCEA 4UNLA 1DTNA 3M0HA 1UBPC 3WH9A 3L4YA 2DSKA 3BMVA 3BANA 3CV2A 1JNDA 4FA3A 2RFGA 2C14A 2REQA 4F0KA 4UQ9A 1XLCA 1RBLA 9XIAA 1W9VA 1EZWA 3DFNA 4ZQMA 3I6RA 3UZYA 3UZ5A 3WF1A 1J18A 1DTUA 4WSHA 3CHVA 2ISDA 4J3XA 2DIKA 2X1SA 4YJ5A 3F2BA 1UJPA 4HA4A 4YWSA 1RA5A 3E12A 3WFLA 4ZXLA 1CEOA 2VUNA 3P8JA 4H8NA 4Z42C 3FJLA 4IFOA 2V3FA 4Y8EA 1GVFA 3THCA 3BOXA 1E9LA 3H2CA 1IEWA 4OTKA 4C6KA 5I3FA 3N6HA 3GU2A 4CU7A 3NM1A 2QJGA 4UR8A 5BZAA 3XIMA 3VIFA 3H21A 4K8HA 1O68A 1TELA 3KFTA 4CD5A 4LAUA 3N15A 3CASA 1B3XA 3H70A 6REQB 2ZRVA 4UTHA 3PANA 3U7BA 1EPXA 3VZZA 4IM4A 2CERA 3CWNA 4ZO8A 2D3LA 4Z2JA 3L2LA 4M1RA 3UXLA 1ODUA 1KLZA 1Q6EA 1E6NA 4H3DA 4XX6A 4X63A 5MF5A 1LOSA 3W84A 3V5FA 5LKYA 2ZICA 3NOEA 3L0KA 1C92A 1IZCA 2G37A 1EJRC 2PODA 3H24A 3QBUA 4Q4MA 5C6MA 2D24A 4C6BA 1VQTA 4TVCA 2CXGA 4DXXA 3BLDA 3VZXA 1TVNA 3M7SA 5CKSA 1W5QA 4XUGA 3G1FA 4US6A 4K39A 1E6QM 3BICA 4DJDD 4L80A 3W2LA 1V6WA 4I9JA 1ZJHA 3GH4A 3CBWA 4WX2A 1V03A 3HV8A 4DAFA 4O4WA 2HPMA 5LZLA 5F2LA 2XIOA 3CT2A 2WZEA 2WHKA 4Q4QA 1QOXA 1KTBA 2KAUC 4CNOA 1PYFA 2NZLA 3H7VA 1B1YA 1SGJA 3S1GA 4O14A 3L7RA 3MI3A 1UD3A 4QJ5B 1E73M 2V63A 4IFKA 2ZWZA 2RGLA 4RLIA 3VXGA 4LNYA 2ZKMX 2PTWA 4XG1A 3M0IA 3W7IA 2WJDA 5HXMA 1UBSA 1JRBA 4RPPA 2E77A 3MW7A 1P4CA 2J7EA 4QDPA 3WDRA 3AXIA 3WFZA 1GPWA 4ONVA 5A8QA 2I9EA 4H4IA 3L4XA 1UD4A 3F4NA 3VOJA 5K2ZA 2WBKA 2V82A 3VX1A 3VGEA 1A5LC 3N2XA 3EWDA 2OG9A 4XK2A 4A29A 2FLIA 2V69A 3NQGA 3B0XA 3GTXA 5IFTA 2E9MA 1IXOA 2O4QA 3P67A 4H7CA 3HA1A 3TJXA 1N8IA 3ITTA 4BZYA 3G18A 2VX4A 5A8PA 3S4TA 5LA1A 2KZHA 3PZVA 3OGVA 2QUUA 1TB3A 1FCQA 5DT7A 5LYRA 1HXJA 5GQBA 1H4PA 3M0JA 3KBNA 2TSYA 4NZFA 5A6BA 4HSOA 1ZCCA 3ZLHA 5BXSA 1UR3M 1EP2A 3WK0A 1I1WA 3O05A 3G1AA 1BWKA 1KFWA 2EBNA 3LV6A 3WLMA 1Q8AA 4PBEA 1JR1A 4BWLA 1UJQA 3DYOA 1P0DA 4AY7A 4FR6A 3R11A 3QV8A 3SGZA 3TTEA 1DWIM 1W9UA 3W1MA 4MG4A 1KWKA 5KZDA 5TIMA 5A6AA 4PN2A 2IS7A 1C9WA 5C55A 4TQTA 3MT1A 4NQ1A 1LL7A 1FUYA 1MVYA 1E55A 2Y24A 3VOIA 3K1DA 4GIRA 4IWWA 5HJLA 3CQJA 1B3VA 3GD6A 3MUZ1 3B0YA 4G7EB 2VZOA 2A7NA 3U4AA 1U30A 1AG1O 2HTMA 3L65A 2P1FA 1XLDA 3L21A 4ZTXA 1TJPA 2XWDA 3MI6A 1E43A 1XLHA 4JD4A 2YCLB 3WD4A 3SI9A 4L65A 3QSRA 1CB7B 4O1DA 3GIPA 1QPNA 3UR8A 2YKKA 3M5YA 1Q7MA 3NPXA 1TUFA 3THAA 3OJGA 5CZJA 7CGTA 2QCDA 5HNNA 1ME9A 4C6NA 2TMDA 3FSTA 1GKPA 1OEPA 3QMTA 2ZE0A 1IE7C 2G4JA 2WC3A 3VDGA 2PRMA 3PBWA 4GQQA 3PBGA 1O4UA 4IPNB 4AZCB 2WSKA 4PBFA 3NIYA 5DF0A 4L1GA 3LCFA 4L4LA 3KE0A 3G8EA 3CTTA 4ZO9A 2PDYA 1V3HA 3C0SA 4Q4KA 4F9DA 1EUNA 5FJOA 1KM1A 2GLKA 2QDEA 2FPTA 4UTIA 3CQHA 4I9TA 1EGZA 2Y1HA 3CAKA 1KQYA 1XQKA 1TTQA 3FYOA 4LRTA 2X7VA 5DCEA 4CCEA 4JHZA 3H6OA 2W61A 2V5CA 4YTRA 3N18A 2WZHA 2D0FA 3WBYA 3WMLA 3GBDA 1FWGC 5D9PA 3AO0A 4NZJA 3N12A 4S3AA 4AZ5A 2NV1A 1W5MA 3DGRA 1H7XA 4GBDA 2GDUA 3MWAA 1NF7A 1QI4A 4N9DA 1KV5A 2CZFA 1HKJA 2YW3A 4LVDA 3GHUA 3ARTA 2J8FA 4R9OA 1UD5A 3QPYA 4FF7A 2YYUA 3W53A 2QF8A 3TXVA 3S5NA 4B90A 5AHIA 4HHLA 3T2OA 1R6WA 3G1DA 3UBPC 3SJ3A 2BHUA 2NQ9A 4OKDA 3LGEA 3W87A 2WVSA 4LYKA 3HIJA 4AY1A 3OP2A 1MW3A 4HPGA 9RUBA 3CMFA 1XSJA 4PZVA 4WOQA 3VNMA 5KETA 5BWFA 1U5VA 2VFEA 1OG0A 1V6YA 3U4FA 4RDZA 4WY0F 3MC5A 3TFXA 4G7FA 1DWGM 4S3DA 3LTYA 2GQ8A 2OFJA 2ZA3A 2XIQA 3W2UA 2DZXA 2FGZA 4GYFA 5DELA 5BOEA 7XIMA 3VABA 4IIEA 5D2XA 2OLAA 1W2VA 1XUZA 4GUHA 4WXYA 3MJMA 1PX3A 1MEHA 1UWQA 2J6XA 3H2NA 2QLYA 2VTFA 1S2VA 2FFIA 3ITVA 2NV2A 1KC7A 1I8JA 2WMJA 3FCPA 5T26A 4MZ1A 3DI1A 3LM3A 3NZPA 2SFPA 4UFHA 4EKJA 4UQAA 2B81A 1KCLA 1UR9A 2ATMA 1FWNA 3U7VA 2E09A 3B9AA 3MSRA 2A3LA 3MSYA 1KGWA 4Q8PA 1MUWA 3M5VA 2XH7A 3H2MA 3ARSA 1O12A 2E1DA 1HKVA 1IGWA 2Y2WA 3URNA 4DJDC 4C60A 4QJ4B 1Y5WA 2WVVB 3LI0A 4IMCA 5A2AA 3HGOA 3KOZA 5A8NA 4PRTA 3MKVA 1NFPA 2BZNA 4M5PA 2V38A 3NYDA 2JKAA 2WPBA 3R12A 1EO7A 2ZTKA 4LQ1A 4U4MA 4FXSA 5CJNA 3VX0A 1UR0A 1UOZA 3UD6A 4Z2LA 4A8IA 3TFCA 2NLIA 3W7QA 3KW3A 2WW5A 3LPOA 1JYNA 1SM9A 1E4NA 1WXZA 2XFFA 1LG2A 3OEXA 5C9UA 1JYVA 1VCGA 2ISWA 4FR1A 4JTJA 3N4AA 4IQLA 3HV9A 3N13A 2OQYA 2E3ZA 4PUKA 1CNVA 1GYLA 4DJDA 1W5OA 2PTYA 4IPLA 4CCZA 1XLBA 2OB3A 3THDA 4JFTA 2QULA 2O9TA 3OYZA 2X0YA 4F0MA 3WQ5A 2VQTA 3J7HA 4O19A 1PX8A 1QJWA 4MF4A 3OHMB 3LN3A 4ZXOA 3U3HA 1IGSA 3TKFA 3WELA 4A8LA 1F05A 1TV3A 1NQKA 1EC8A 1LLZA 1WXJA 1BF2A 4QAWA 3HN3A 3ZVHA 4HHPA 4JOMA 3VGGA 3GFZA 4B5VA 1MI3A 4YTTA 3M0LA 3HOJA 2OZTA 2Z1BA 3MUAA 4E2DA 1JPHA 3NCOA 5IFPA 4DZIA 5HATA 2WANA 2OYMA 1OBAA 4MTVA 2FFCA 4PH6A 4NZ4A 5XIAA 2XH0A 4IJRA 1XRSA 1UZHA 5DX7A 1NJJA 2FVKA 3KEHA 4URIA 3DBNA 3LERA 3MHFA 4R85A 3R25A 4GVIA 4MY1A 4QLLA 1VHCA 4OECA 2QJNA 1T5AA 4LH8A 4E3TA 3FV9A 2E25A 4H9XA 5HA7A 3V16A 4KWSA 5TQLA 3RLVA 4PC8A 1MNSA 5JUVA 2BXZA 1BTMA 4UFJA 1QU4A 1AA1B 3UZWA 3KX6A 1BYCA 3I65A 2NT1A 4D6IA 5AZ0A 3TC7A 4F0SA 1ZBVA 1SZFA 1DXIA 2FJKA 4PB3A 3STEA 4O8RA 2OYLA 1EX5A 2XU2A 4AD3A 2OO0A 4MWAE 1PWLA 4ZCWA 5BROA 3SO7A 2J7FA 2IUZA 3C2RA 3QM3A 2V8ZA 3EEZA 3WQEA 4W89A 3MCOA 2XPKA 2DIEA 4MDOA 2WOQA 1TWDA 3A3XA 8TIMA 4WRHA 4AMCA 4F48A 3BL3A 2FVMA 3QN3A 1GONA 3NAVA 4AWUA 1TPWA 4AZHA 3OVRA 4PMQA 3L4VA 3B3DA 1AD1A 3O2LA 2ZRYA 3I3BA 3WDPP 2WAGA 2OEKA 1X96A 3LPGA 3NZ1A 3ATYA 1G4EA 4MYXA 2AAMA 3QMRA 2INEA 4L6DA 4NAFA 4MNJA 5DN1A 3WEMA 2XFWA 4HNCA 3QFWA 5F4WA 3GWQA 4P8WA 1A0EA 1XRVA 2PZNA 1MW2A 1SJBA 1IT7A 3KL3A 2XG9A 5JBDA 3MMWA 4NKCA 2HBXA 2HVMA 1DVJA 5DEZA 1UA7A 1X8FA 2E67A 1O5QA 4TUFA 2PF0A 4C6EA 4JTLA 1PE1A 3STGA 4FX6M 2PFHA 1H61A 3PZNA 3TR2A 4QCFA 3VCRA 4BR1A 4G1KA 5K4ZA 3NVDA 1R3TA 3GSMA 4XISA 2I9UA 1OX5A 5E0FA 4HZ8A 1PL9A 1QNPA 4J35A 2J7CA 4INFA 2CBIA 2W9MA 1JCJA 2YA2A 2RHGA 5FEWA 2BY2A 4GRSA 3KRZA 4QSFA 4YVVA 2DSZA 2I5GA 4KCUA 4Q8NA 3GVQA 1LWHA 2WNNA 3WD3A 3FS2A 3NM3A 2VUYA 5KEZA 1P7TA 1WYIA 3BK0A 3H22A 3RJXA 1MO0A 3QXBA 4LVFA 1E3ZA 1JPDX 1XF0A 4GD0A 3VNZA 1FX6A 4WOZA 5C7HA 3W25A 5EKYA 3A6OA 4HU3A 2JIWA 3ZVIA 4LANA 2G97A 4REQA 4HNUA 1J01A 4G2DA 3VD3A 3PPFA 5CPLA 2DDXA 3BOFA 4NSBA 5ENLA 2JF7A 1TV5A 1J2BA 3NNTA 1SFSA 1VRXA 1E1CB 2PDWA 1OD0A 3A24A 3QKEA 3SAZA 4BQ2A 1L9WA 4KBXA 1FXPA 4NG3A 2CC0A 1XYLA 3WEOA 1NIUA 2EGZA 2YDRA 1E9YB 1XM3A 4YYCA 3CJPA 1SSDA 4L9ZA 1R3YA 2CZ5A 2FPYA 1I0BA 3UESA 2GDQA 3O0FA 1ZSXA 4AD5A 3RX3A 1ICSA 1PXGA 1EGMA 4R53A 5ABGA 3CAQA 4R7JA 5C70A 4P8VA 4EXQA 3EAUA 3WLOA 3L9CA 4HYWA 1HT6A 2OEMA 2VELA 1FRBA 3KZPA 2DZVA 5E70A 4UTTA 2WKLA 3WDQA 2BODX 3CIWA 1CPUA 2BHYA 1GPFA 4L56A 2G3FA 3DFQA 1HJUA 1N2VA 3VM5A 4ZOBA 3NQCA 1JDAA 3GRIA 1EXBA 3UY7A 3AXXA 3NDOA 1TV2A 3A9BA 3LHVA 3M6YA 4UTFA 3DG6A 1DKWA 2RDUA 3ABXA 3R8RA 3E5PA 1H3GA 4L7ZA 3LCGA 5I23A 3WNOA 3RM8A 3OLEA 4DXKA 1VF8A 4CVWA 2A5HA 4J28A 4XKYB 2D3NA 3MP5A 4YIWA 3H2AA 1EKOA 4IX2A 4JX4A 4D6CA 1FWEC 2ZXDA 3H8AA 3K8KA 3T0BA 3E2QA 3TNBA 1EDTA 3PPGA 2ZX5A 3DIPA 4Q7BA 1YLVA 2GJPA 1ENUA 2BMBA 1F8IA 3QOKA 3RM4A 3IJQA 4AWTA 3EOOA 5FJRA 4MMWA 4N4QA 2PB1A 4EP8C 3P84A 2GVLA 4NVTA 1GGOA 3GNRA 3SUVA 4JQ2A 1G9HA 3S6OA 4O1CA 3CPRA 1SUXA 4GGBA 1WAUA 3CZJA 1ODZA 4Q4OA 1SZNA 1PUDA 4IXXA 1TIMA 1SO4A 3HG4A 5ABFA 4JYEA 4WY0B 2RAGA 3R0KA 3F1QA 1JAKA 1AQFA 4DF2A 2PLJA 1XCWA 2XH2A 3STFA 2O9PA 3DECA 3IUIA 3R6IA 2A4AA 3HG2A 2XJ7A 2F2HA 1KD0A 2HISA 4CQCA 4UTUA 4DWSB 3VI2A 1QPRA 3VILA 4XWUA 3W7DA 3LA4A 1QHZA 1EDQA 4D9PA 1GWJA 3E1F1 3HO8A 1H5YA 1KR1A 4X2PA 2I5QA 2ADAA 4O0KA 1PHQA 3Q65A 1SZEA 5F1VA 1PIGA 3CH0A 3O6AA 2C13A 5LGZA 3C2EA 3IK2A 5REQA 1K9FA 2UWFA 4MSSA 3PN8A 3T07A 3V5CA 5HMEA 2WCAA 4YTSA 1PB0A 1CXHA 1SMDA 5LNVA 1AVAA 3PJWA 4PMDA 1YDVA 3ZJ6A 4A35A 1E6ZA 1Q66A 3IJIA 4RJEA 1ICQA 3CAWA 4C6OA 3DENA 4ZFMA 4Z0JA 2XSXA 2IQTA 5FJIA 1XLFA 2QZRA 4OZOA 2WMHA 3WJXA 3SCNA 2PGFA 4A05A 2VC6A 2PDGA 2CKSA 2PDQA 3R13A 3F4CA 3A21A 4I5XA 1W6TA 3HF3A 1A3WA 1GVYA 4ZB5A 1POKA 1JQVA 3APYA 5TD4A 1OC6A 2D23A 4V1XA 4RNHA 2V5LA 1R3WA 1Q6QA 4GH3A 2VZUA 4AH7A 3PNUA 2A6LA 2HVNA 1GVSA 2QS8A 4MKSA 3W27A 1UKOA 4LVBA 3ITLA 1XYAA 5E5CA 1QAPA 4R5EA 3SY5A 1YADA 1FH7A 4UXDA 1GOQA 1Z48A 3TSDA 4HOXA 5BYWA 2VMFA 4B15A 4G6CA 1EXPA 4DYJA 3MUXA 4BF9A 3M5XA 5LIXX 1VLWA 5C7VA 1U1UA 4DLMA 3IJ6A 1OCQA 2X30A 5HNRA 4JNZA 4UCGA 1H1YA 3QHOA 4IXHA 4MHBA 1VP5A 2ODOA 3OBEA 3KP1A 4A3HA 1VKFA 1FWDC 4EANA 4C6MA 3QSTA 2ZUVA 1D8WA 3QTGA 2CHNA 4DO6A 1K9DA 3ANUA 4GCAA 4PMRA 2QIIA 1JCMP 3SRFA 1CT5A 3OVQA 3GM8A 1UUMA 1H5VA 1LLOA 3WK2A 1O60A 1I2RA 3HMJG 4GCXA 4GUIA 4AC1X 1PS9A 2V68A 4AU0A 3GW0A 3VTRA 1ITUA 1EH9A 3OPSA 4MJZA 4GQRA 3TYCA 4I9AA 3FIGA 2OPJA 2DZUA 2WQPA 1XC4A 4MPQA 3MUCA 4B9ZA 2VFFA 4GY7A 3FYPA 1YDNA 2WKJA 3ARPA 4JTDA 2CBUA 3VDAA 2XVKA 2AMGA 1H1ZA 1JZ2A 5BOFA 3DG3A 1I2PA 1BVNP 1XHGA 4AIEA 3VO0A 5HWNA 2ZVIA 4IZGA 1ZALA 4NJGA 1B4EA 4DBWA 3C0QA 4KFNA 6REQA 2BGQA 3RG6A 3IACA 2WV8A 1KV8A 3N9KA 3AWOA 4FAMA 3H4XA 1X8CA 1CXLA 4JKKA 2Q8XA 1ECEA 3TTYA 1X6UA 1TX2A 3II1A 4JTHA 1ISZA 1KM6A 1E0TA 2YB4A 3QPEA 4GE8A 4MIMA 8CGTA 2HE5A 3OZOA 3MDWA 1B0IA 4O50A 1HJXA 1A5MC 1UC4A 5CCZA 2NWRA 4IPPA 5LHFA 1GW1A 1XYMA 2YBVA 3YPIA 5TF0A 1V5XA 3TE9A 4JFUA 3OGSA 4FALA 1H7RA 3NR0A 4BQ4A 4MB1A 1W31A 1GNXA 4MY9A 3QHNA 3BLFA 4O1EA 4E6MA 4JL1A 4B92A 4P7QA 1OFBA 4LNCA 4DJFD 1DHKA 3U2OA 3FA3A 3JVAA 3PFMA 1BAGA 5I03A 3NQMA 3AYRA 4E8DA 2OODA 4HMCA 2A3AA 1UB3A 1V02E 4EVZA 4RV8A 1XICA 3ABQA 1NP0A 1XIFA 3B8WA 1A47A 2XIJA 3LHTA 2PSNA 3EA3A 3PULA 1UWSA 2ABBA 2PI6A 4FZIA 1H11A 2DSUA 1VFMA 1UUQA 3W85A 4K8GA 3RFAA 1JDEA 2GSHA 2FMOA 3OQEA 3TWBA 1B31A 2HK0A 2RDXA 1F5ZA 4PODA 1LCOA 4HKPA 4PL1A 1PKNA 3LGDA 4UTWC 3H2OA 4TMCA 1EOMA 6CGTA 3NWRA 4JIPA 1OF6A 3WDIA 1Z41A 1VAHA 3BAXA 3W37A 1TX0A 3SQLA 4PFMA 1VYRA 4C6JA 1ADOA 3CUFA 4AHOA 1CZ1A 4BI6A 1IXQA 1OCBA 1V3LA 2DP3A 3HPFA 4NNAA 1F6KA 4C6DA 3IJ8A 3KLLA 2OX4A 4F79A 3UW6A 3VDBA 1WDPA 4CEUC 2PA6A 4UWMA 2A3HA 5TBOA 4LCSA 2XDFA 2ZIDA 2BTMA 2AL2A 3BXWA 4MKNA 1LOQA 1FWSA 1OJXA 4GY0A 3UWUA 1OYBA 3U5UA 5CAHA 4PFHA 4UQCA 1VD6A 2EKGA 3OHIA 4UTWA 1QOPA 2UY2A 5JBFA 1Z89A 5E9AA 4ZGYA 4H7VA 2QF7A 5DQPA 4BF7A 1W1TA 4JFWA 1ML1A 1YYAA 1DIKA 3M0XA 1UPMB 1R0MA 3WNPA 4QX4A 1R8LA 1S1RA 7ENLA 3OIXA 3DXIA 3UR2A 3APGA 4UFMA 1Y8BA 1U5HA 5K9XA 5MKGB 2MUCA 3WK1A 3GX9A 3AS1A 3IANA 4GZEA 4KFPA 4UB9A 1L6WA 3S5ZA 3K5XA 4FIRA 1FWTA 1NFGA 3KTCA 1TPB1 4F66A 2C1HA 1PTDA 5FL1A 4V28A 4Z1BA 3G0UA 1CLVA 3EDFA 3VINA 2I17A 4A2SA 5HNTA 3W1XA 1Q2RA 4XSMA 3TLLA 1FTXA 2D2GA 5A94A 3W7JA 4XTIA 1C8XA 3LNPA 3VNKA 4B16A 1PZ3A 1H41A 3P81A 1W1PA 4V33A 4L9XA 3WLJA 5EL1A 2G3IA 1LBMA 4HPJA 2REQB 5FD0A 1I2NA 4W85A 5G1TA 4G7EA 2R8WA 3IJDA 3VMPA 4JTKA 1OCNA 3PSVA 5FJTA 5FSDC 3SB0A 4A2RA 1SQ7A 4KW2A 4YVPA 1GORA 2Z27A 1AH0A 3MS8A 1IIHA 3W7CA 1CXEA 2YCLA 3G24A 5FCZA 1QK0A 1O5KA 3RDKA 1W3TA 2VENA 3TV8A 2OX1A 2QCNA 4O16A 1PKLA 2V67A 3NQVA 4HP5A 5AHFA 4QP0A 4V2XA 5E6ZA 2GDVA 1WZAA 2NSXA 5EB8A 3VOHA 1VIWA 4HHMA 2Q71A 3DDMA 4FMVA 3QY7A 1CI1A 5G4HC 5KZ6A 1A5SA 4GXWA 3WBXA 3L5MA 3GR8A 4IPIA 5I00A 1IWAA 2BASA 2IMRA 3EPMA 3KTXA 4P7RA 4N9EA 1GTHA 1XP3A 4HJFA 2QUVA 3UERA 4IMDA 4BEUA 4CD4A 1B2YA 3VCCA 2WZTA 4LBUA 3QZAA 3U5YA 1CWYA 3URBA 1TFVA 3A12A 1RV8A 1IWPA 3CL6A 1S3TC 3WH6A 4B5NA 1JF5A 1E1EA 3SADA 4A21A 4GUFA 4JIRA 2J74A 3ZMRA 3LLXA 3V75A 4K7VA 1US2A 4M3PA 3FKKA 1ME8A 1WBJA 4PTWA 3UZJA 2I1OA 2ZXBA 5U4NA 1NOFA 1R7OA 4DZAA 2Z2BA 3QYSA 3WLSA 1KGUA 2BHZA 3CWOX 3OVGA 3WQVA 4S23A 1GK8A 3PJTA 2PWVA 3CK5A 2EXOA 3GNXA 1CB2A 1SZRA 3WBWA 3WQOA 1E70M 3UG8A 3W72A 2Z2AA 3CMJA 4M1BA 1IXNA 3FJNA 1EB3A 5F4SA 5AY7A 1J0JA 4MAVA 1JZ4A 1XLGA 3NL3A 3CB3A 1R85A 4JTAA 4G8TA 5C9XA 4QRNA 1YTEA 3SIZA 4FOJA 4QE1A 1PDZA 1UD2A 1UQZA 1UZ4A 4ZVJA 1LYXA 1Z6KA 3WLLA 2VRQA 2YDQA 2G5WA 2XHYA 2YIHA 3RF9A 3BJFA 3AHXA 1TTPA 3IWPA 4PR4A 3N3TA 1FWFC 2ACUA 1KRCC 3WUEA 5F2MA 2DT3A 1QASA 3UA3A 3RNDA 3EWUA 3ZJ8A 1HGYA 1E6SM 4UMAA 1KBIA 5DY2A 4YCOA 5A2CA 1J0ZA 3F03K 3FX4A 1P6WA 1NQ6A 1M53A 2ZBTA 5DBTA 2Q01A 1GVOA 2IKIA 6ENLA 2F38A 3LPPA 1XINA 4V27A 2V30A 5KITA 2GGGA 4O15A 2YB1A 5HJYA 4CLMA 3VKAA 1HO4A 1EWEA 4PUEA 1XQLA 2WCSA 3TC6A 3GY1A 5FL0A 1BQGA 4QE4A 1MSSA 5DRIA 4GO8A 2H8ZA 2XZ7A 2WVVA 1KXVA 3IJ9A 3NFUA 2CNCA 2QCFA 3JS3A 3UXDA 1YDOA 2ON3A 2PDJA 1V8EA 3DG7A 3L4TA 4LVAA 1VH7A 1JXKA 4GNKB 4WZHA 4A3QA 1Y5XA 3BUVA 3T09A 1C8VA 4C1NB 4C6IA 1S1PA 2PD5A 3S6DA 2EJAA 3CLWA 4QG9A 4QAIA 3F5KA 4KGLA 4E5TA 3Q45A 3UPBA 4GLEA 1W17A 3APTA 4M51A 3G6MA 2VEIA 1ALDA 3S9ZA 4OT7A 3QVQA 5HQMA 4ZB2A 4O0QA 3VDCA 2V81A 4O13A 4MZYA 4S38A 4WDWA 3H12A 4DJFA 1DV7A 4CQ9A 4PSRA 4ATLA 2X2GA 1KKOA 1VHNA 4ZEPA 1V3IA 5H2ZA 1G94A 1KB3A 4DWSD 1XH0A 2WJFA 1R3RA 2X1TA 4XAFA 2ZZ6A 1GZ1A 3NQFA 4EIVA 3WK3A 1CTNA 1HKWA 5EMMA 2VKZG 2W0UA 1MQQA 1QTWA 5I3KA 5BMXA 1OZQA 3TYEA 1TE1A 4GQGA 1TV7A 5AOUA 2ZZ4A 1VENA 2B0MA 1J0HA 5C2GA 2CW6A 3EMCA 1JYWA 2ZRXA 2D0GA 2VEGA 2I56A 4OU1A 1W37A 3OLDA 1V3KA 5TAOA 5K3VA 3GDKA 5AYZA 3C3NA 3HURA 3ZOAA 4WD0A 1V0NA 2CLMA 2POZA 2QCDB 4XBKA 3CQIA 1FKXA 3V35A 1LL4A 1JDCA 3E2RA 2CU0A 2OCZA 1VJZA 3RO6A 4MPKA 1LRNA 1RJRA 3ZZ1A 2FGLA 4GIAA 1DIOA 4LVGA 4FI4A 4ZSUA 1Q6GA 4IP5A 1YXDA 3C2YA 5AYIA 1AMKA 2XVPA 3O6YX 1FFRA 3TTSA 4IP4A 1EJWC 3ONBA 2YBUA 3B04A 1YTDA 1UOKA 2X2YA 3EKLA 4NJKA 3S9YA 4C6LA 3ARQA 4HHHA 4O1FA 3FW6A 3IV3A 1F7BA 3BSMA 1VCFA 3UT0A 3USBA 1J93A 1S5WA 3HJZA 1R3SA 2F9RA 3WBAA 4GKTA 4MDPA 4ATWA 2HNEA 3W26A 1H60A 4GI9A 1HQTA 5D37A 4F2TA 2PDKA 1KQZA 5D38A 3UXAA 2YR1A 5EMYA 4IG2B 1XLJA 4JIQA 2PRLA 1XSIA 3JRKA 2XSBA 3TJ4A 4D6GA 4IQDA 4AZBA 2FPVA 2W79A 4WDUA 5I7GA 3TCEA 4MB3A 3MV01 4LB4A 6TAAA 5DXYA 4YCPA 4A4AA 1DJHA 4HA0A 4AEEA 3K4AA 2J9ZA 2OKTA 1RBAA 3PAJA 3KOXA 4AIOA 2VCCA 4Q8QA 1M03A 3ZM8A 3TYDA 3P93A 2R1PA 1C3FA 1O66A 3T2PA 3XINA 3RPDA 2ZRWA 2FZ8A 4JAWA 5A6KA 2J75A 5BXPA 4JTUA 5FJUA 3NL2A 1JCYA 4XTDA 4E8CA 5CXPA 3PK7A 3Q94A 5ABHA 1ZHAA 2YJQA 3HMCA 3FXYA 3ZT5A 1E9IA 2UV8G 3PM6A 2E6AA 1UH3A 1X7FA 4O18A 5DY3A 4P7LA 2V5JA 4X0VA 1TZ7A 2C91A 1X6LA 4QEEA 5BW6A 1XXXA 3R5EA 4FNQA 1GVIA 4HB7A 2XFYA 3ABSA 1UP0A 2EPNA 2EPOA 3DESA 1QR7A 3L66A 3SIMA 4N7QA 5DT5A 3GVRA 1JD7A 5AC4A 4LC6A 1E0UA 3TJIA 1LQ0A 1XDMA 4N6FA 2AMXA 2NV9A 1YNQA 3EB3A 1ICPA 3LMZA 1VJIA 4HA3A 4PMNA 3RGTA 4RZ5A 5HR7A 2OQHA 1VPYA 4Q4RA 3ZYZA 3AJ7A 2UZ9A 1PYMA 4L1XA 3FGCB 1I1XA 1K4GA 4L6OA 1D7KA 1M68A 2EG7A 3TVAA 3WDHA 4AZIA 4LRSA 3HFYA 3DERA 4O17A 4NL1A 3QHMA 4M19A 2X0HA 3F7JA 1UR4A 3ALFA 1E6RA 1OX4A 1BXBA 5CZKA 5D9OA 1AH4A 2FHCA 3R0DA 2WNZA 3AMDA 2FYMA 4JFVA 4K36A 4WXZA 1J9YA 1M9HA 1SSGA 2P8CA 2INZA 2VD8A 4LAOA 4G9PA 4US5D 2VEMA 2DU2A 2VYOA 4JIHA 3CGTA 1CBGA 3WQGA 3ZLFA 3KCJA 3VC5A 4RZ6A 3LGGA 2GJRA 1FDZA 1BG4A 1LRQA 4IGHA 2IKGA 1WKFA 1JVNA 4JTTA 1ZGDA 3CIXA 8RUCA 1J79A 4BK9A 5HJXA 2C8NA 2R1NA 1FWCC 3D47A 4LS2A 3WQPA 3OOQA 2Z28A 3WD1A 2HXTA 4TIMA 4RX0A 2DSVA 3NSNA 2VX6A 3S5SA 3HBLA 3TW6A 2BXVA 3COTA 1QDSA 1OINA 1S5MA 1W1A1 3HU7A 3DFYA 4IIFA 2PWHA 4FOUA 5LNWA 3A4JA 4HMNA 4OQVA 3B03A 2AQOA 3GTFA 5A6MA 2CLLA 2ICSA 3W6YA 1P0BA 4XKYA 3W2MA 3S46A 3W7MA 4GPNA 4LYRA 4EXAA 1P6BA 2WB5A 3ZJ7A 3GU9A 3EWYA 3TUUA 3WJWA 5I78A 3BQ5A 3SN4A 2PDMA 1KBJA 3F5LA 1ITQA 2PP1A 4CQDA 4EACA 7PTDA 1F07A 1GQKA 3KVLA 3U6WA 1EBGA 1LQ2A 4HK5A 1EZ2A 4DWSC 1RXOB 4O57A 1RK5A 2CZVA 2ACQA 3OIHA 2DUXA 2Y85A 4H9TA 4B5SA 4H19A 4WUIA 5EFFA 4C7GA 2DUAA 3NEHA 1QO2A 1GYMA 3BV7A 1A3XA 4N42A 4UNIA 1QPQA 2FHFA 4PTNA 4Y90A 4KEMA 1U1JA 1U1HA 2J25A 4GWEA 3NTYA 3NQ6A 1ADDA 5IBXA 4ILSA 4E4PA 3VOCA 1WZKA 2ACSA 3BLIA 8XIMA 1JCLA 3PNZA 4GIEA 3GXTA 2ZX9A 5AECA 3VZYA 2GGJA 4DUXA 1GEHA 4PGLA 4DJEA 2GYIA 2EJ1A 4S3EA 4B3ZA 3B9DA 4WJEA 3ZWTA 4JHOA 4KERA 4LUTB 3UU0A 1XFCA 5E6YA 1ITCA 4LF2A 3W83A 4DHGA 1C9DA 3G1XA 4IMEA 1UMYA 3CIVA 3F4WA 4JTRA 4LOCA 2NX1A 2BGSA 4Z2HA 2ZX6A 1C8YA 2WYSA 3N19B 1CGUA 3C2OA 1RQBA 4IL0A 3RLGA 5AHNA 5C9WA 1V0MA 1SO3A 1KNWA 3W6MA 3W22A 1MXSA 4PUJA 1DHPA 4QSHA 4RNFA 5HBFA 3OZYA 5ECVA 2DZBA 3R79A 1C7SA 2X05A 4J2PA 1KRBC 4RXFA 2OO6A 3V0UA 5D09A 3WQ8A 3OTRA 4DYKA 3L23A 3N34A 3EB4A 3D6NA 4AFYA 4KWWA 1LOLA 1D9EA 3SSJA 3KRBA 1TPVA 3R94A 3T4WA 2WK2A 3D3AA 2E6DA 2VGFA 3ITXA 2PDUA 4IGNA 1AUSL 2YL8A 4HSHA 1F4AA 5I09A 3GVVA 4IICA 1G01A 1NDWA 1DJNA 3QYQA 2A3EA 3UPWA 3CHCA 3B0VC 5IRPA 2XVLA 3B8VA 3BCDA 2PBGA 2J9YA 1WOBA 4UBPC 1EL3A 2BSLA 4HU8A 3PBUA 2ZZ3A 3A4WA 1NM9A 4REQB 3QC3A 3LCIA 4V1YA 5FEZA 3BARA 2OEJA 3B4UA 4LB3A 1FQ0A 5FEPA 2CESA 3BCFA 2ZXQA 4S3FA 4B4HA 2O7QA 5G4WA 4PEKA 1B57A 1IIGA 3RYSA 3VPLA 4W87A 5ABEA 2EO7A 5FF3A 3AS2A 3QOMA 1YNYA 5C5YA 1YXCA 4HK6A 3GVWA 2DV0A 2VP8A 4GH1A 4NXSA 4GJIA 3SCRA 4KIEA 1TR9A 4E38A 4E4UA 1VFSA 3U2ZA 1KXTA 3CYJA 5CSSA 1FP8A 1QI2A 3T0CA 4IIBA 1I2OA 5CH9A 3WNNA 3AICA 1W1ZA 5CGMA 3VM7A 4LU0A 3UYCA 3KXQA 2OZ0A 4YS1A 4K2SA 4TTUA 2B7PA 1S2WA 2FZDA 3THUA 1E56A 4TO8A 2G4FA 4D8AA 3B05A 2E8ZA 2QCGA 1ISYA 1NWUA 2QUMA 3I7RA 4AF0B 1QATA 3TQPA 3WUBA 1EQPA 1SJCA 2YBTA 4LY4A 2OYKA 1Z32X 3CQKA 2G8ZA 1XYFA 4I5UA 3EWBX 2F6KA 4C1KA 2X0SA 3GR4A 1OFEA 4ZSTA 4ERAA 4W4QA 3AYSA 5CZSA 1V6UA 1MEWA 1EYWA 1AFSA 3NG3A 1YIXA 3W38A 3DH7A 2GPTA 4I7UA 4JCLA 3PAOA 2E8YA 4R3UA 3MSDA 3DCPA 5B80A 4D6EA 1CGTA 6ALDA 4CNTA 4PUWA 3CYVA 2OVLA 2X16A 1PAMA 4ORIA 4QXIA 4BI7A 3TTQA 3VGHA 1KM2A 4RXGA 8XIAA 1FH8A 1VFHA 4DWDA 5C9ZA 3M1ZA 2Q09A 2BB0A 3RJYA 2LLEA 1UIOA 4C7FA 1OT2A 1XL9A 1GOOA 2DPEA 4ADTA 4A3YA 1SFTA 4CQAA 1HZYA 4XSLA 4JNMA 5ABFB 4DUWA 2PWFA 3GZ3A 1ZUAX 3MP3A 4ZQOA 1BHGA 1DEDA 3WZ0E 4YWIA 2D22A 5C8BB 4I8YA 3WEZA 2VGGA 4PULA 1WO2A 4I6VA 4Q4PA 3LDVA 5T9CE 2PC8A 2OWWA 1F3EA 1F73A 3PBVA 4US5A 5LSMA 4M6VA 4HYRA 3R8HA 1BSIA 2GUYA 1CXIA 1RCXB 3E3HA 5AYBA 2R1KA 1KRMA 3RM9A 3SSZA 1E4LA 4O4VA 4ZQCA 1AW1A 4OVXA 4OOZA 4ACZA 2OWXA 3P6LA 4PMVA 1RQHA 2VFHA 2VJXA 4ASTA 4AY8A 4ZR8A 3ARXA 4U2ZA 2Z6IA 5REQB 4U10A 4NI3A 4LGXA 1TV4A 3O9NA 3S2CA 3AIVA 3EX1A 4AD0A 4FNUA 4FLRA 1HKMA 2J27A 3PS7A 2OGJA 4DBDA 3HGRA 3PFRA 1VGAA 4UUIA 1EDGA 1EO5A 4NHVA 4JTSA 3WKZA 2DW7A 3BPWA 4W88A 2FB2A 3AIWA 3V36A 4I9MA 3WCZA 3T0TA 3BOLA 2VDGA 2R82A 1ISWA 1ZENA 5B7YA 3ARUA 3SCSA 4PMXA 4TV6A 1I0DA 2AAAA 4YTUA 3IRDA 3FHAA 2GZXA 4KEZA 3TXZA 1F74A 2WM0A 5CSYA 2QJJA 1XYZA 3EWZA 2YCEA 3RPMA 3BW4A 3LI1A 4DVOA 4GUGA 5C9RA 4N9CA 3EOUA 4EPBC 1E6PA 9CGTA 2ZFAA 5LIUX 3KWSA 4LY8A 3RXZA 2PE4A 3CNYA 1QWKA 4HNNA 1KWGA 1Q3NA 1GYNA 1ZBCA 5MKGA 4S3BA 2QR6A 2ESCA 2XGZA 4EXBA 4Q7NA 3FY1A 6XIAA 1ZFJA 7TIMA 1WP6A 5LXEA 4MAZA 1W9XA 4ZBCA 5I3JA 4RE3A 4PB4A 4E3VA 1GEQA 1T6MA 3W7OA 4UQDA 4C7DA 1LL6A 1TSIA 4H01A 1CLKA 2GOUA 4H04A 1VPXA 4NAEA 1M3UA 3DGBA 3ANVA 5D30A 5LGXA 4E8GA 4YYFA 2D0HA 3O1NA 2Y7DA 2JIEA 3EWXA 1G4TA 5CPSA 1D3CA 4O54A 1KGXA 4I8DA 1F9CA 3TROA 4GIYA 1YX1A 1TV8A 1MDRA 2I5IA 5L9FA 1F8MA 2PDCA 2Y5JA 4FNTA 5KSWA 1FBAA 3CEUA 1D3HA 5AHLA 4GI8A 3EOEA 4HTBA 2WMKA 5ABTA 2YDSA 1RZMA 2CKRA 5HQEA 4JN6A 3W2NA 1X1ZA 4D8ZA 2VD9A 3BAYA 3P0WA 2DVTA 4XZNX 1W3KA 2PCEA 3S5OA 1Z7AA 1ECQA 1XIDA 4D8LA 4CNPA 5IDZA 2CLOA 4B3KA 5I6SA 1JZ7A 5AC8A 3QC0A 3AHYA 1WOAA 3PPCA 5HUOA 1M7JA 2UY5A 4BQ3A 1Q4NX 2E28A 1YPXA 4PTXA 4A6GA 1PBGA 4HCDA 4DM1A 5EMUA 1B3ZA 5DLCA 1KKRA 2IXVA 1KM4A 2CWXA 3PY2A 4L64A 1ONEA 3CAVA 4Z08A 4JN8A 2PCQA 5FI8A 4YTQA 3T81A 2O7SA 3UXIA 4X60A 3ES8A 1JULA 2C79A 4RE2A 4MUZA 1G5AA 1OYCA 2VC9A 3GC4A 3UZXA 4RZ4A 5D2TA 1YXYA 3B8TA 4GXPA 3PG9A 2WCGA 1W91A 3GYEA 3A5VA 4WEVX 2WZIA 3G1RA 3F4VA 4L61A 2VEPA 3SURA 4ALDA 3PUGA 2ZZ7A 2IPFA 1ZAJA 1A49A 1YDYA 3AYTA 3M5ZA 4DF0A 2HK1A 1BFNA 1IT8A 5M2FX 3UG5A 3VIOA 3RILA 1KO0A 2IPJA 4MYAA 4EPDC 1C8QA 1F6YA 1GJUA 3R2GA 3POCA 1AW5A 4GZ7A 4U33A 3AXKA 4H00A 1GZJA 2D2HA 4LUSB 2GVGA 1WDRA 2C7FA 3PJXA 5LHEA 4Y6GA 1OD8A 2Y70A 2X42A 1H51A 3VNLA 3ZS4A 1M04A 3RR4A 2E40A 2QDGA 2ANUA 4FEZA 2VZTA 3K1GA 1ELSA 2YL5A 2QVNA 1XGZA 3LHWA 3CZLA 2Z1SA 1G4SA 4YVXA 3CHEA 3JZUA 3OQ8A 1LTDA 5M3WA 1XIHA 4XD5A 2Y4SA 1YEYA 2YPIA 2XGIA 1FFQA 3HQOA 3WQ4A 1DXFA 1B4KA 1ZZMA 3GG7A 4B2DD 2E6FA 5I77A 1IEQA 4EWJA 3Q4DA 1CXFA 4BEQA 5CZ0A 3CQ0A 4GKLA 1SO5A 1XUUA 2NUWA 5B7ZA 5AVHA 4GO9A 3CV7A 2DUZA 3W76A 4CD7A 3K8LA 3PUEA 1ZB5A 4X9YA 2PC4A 2WNWA 2Q6ZA 4BWLC 3FA5A 4O12A 1RHCA 1Q13A 2AL2B 1W2PA 3UGRA 5BXTA 4M56A 1R38A 1H7NA 2ALRA 3W1LA 2PWGA 2C3ZA 3PZ9A 5FEXA 5D2WA 3SJNA 2EPKX 1UUOA 4DNMA 3T0DA 2Y61A 1XD0A 2FKPA 2XYLA 4BY3A 3NZGA 4Y96A 4R27A 4QFUA 3WNLA 4MB4A 2NQHA 3M0ZA 3TOPA 5CBBA 3UA4A 4CU6A 4NT0A 4LX4A 2DT1A 4DELA 4C1NA 1VFFA 3SR7A 4DXVA 2XM2A 3IUDA 3OGRA 1XIBA 1DQUA 1IV8A 3W75A 3LB0A 1ZCOA 1QPOA 1Q6LA 3BZJA 3NUKA 3VFCA 3RLHA 3SZ8A 3EKZA 1PIFA 3LX9A 2A3BA 1AW2A 1VS1A 3S2MA 1J10A 1SW3A 1L6YA 3PUOA 1V77A 5A69A 2QT3A 1OK4A 1K6AA 3MMDA 3FSUA 2VXNA 4DZ5A 3H2FA 4NX0A 4J3VA 3TAOA 1QNOA 1MZRA 3EXSA 3MQTA 3CZKA 1VEMA 2RDTA 1TREA 1LDCA 1R9YA 5HMSA 1XDLA 3W86A 2E5BA 1WUEA 4GX8A 3ONCA 3H54A 4RPQA 2CFFA 3A4AA 4NILA 1UA3A 1SPQA 1Q85A 2DH3A 3S47A 1N8WA 5CZTA 3UWZA 1I9CB 2R14A 3MCNA 2VR2A 3QR3A 2VGBA 3QR1A 3N29A 1TUXA 3IRSA 1FWAC 4GI6A 1XIJA 2PUZA 1XJBA 2VRJA 4L4PA 3AUJA 2XN2A 3TCSA 2J7DA 3GUGA 4AAJA 4F3HA 3TYZA 2OLSA 3VOGA 3DYPA 3POHA 4KMQA 2ABAA 1KFCA 1PTGA 1C91A 3MUIA 3VKKA 3TONA 4EF9A 4PRWA 3WENA 1JGMA 2HSAA 3W28A 3M0YA 1QT1A 3GTHA 1DPMA 2VHLA 3IAQA 1XG3A 3EBVA 2ZE3A 3LSCA 1HNYA 4G5DA 2DY3A 1OFAA 1HIZA 1WDQA 1W5PA 4U28A 2XH4A 2A2IA 3SCVA 1ZJAA 3H4GA 4R9XA 3TSMA 2QAPA 2WM1A 3EDKA 4C5YA 3P60A 3UWYA 1N8FA 3W6LA 3I6TA 5G4EA 3MVTA 3PWIA 2Y0FA 2X1UA 1M7OA 4L9YA 3OLIA 3FNDA 2NUYA 3SW6A 3B0PA 1NARA 4PUNA 4Z1DA 2BXYA 3SUWA 3P3BA 5IHRA 2G50A 3ARZA 6A3HA 1J0YA 3WL1A 5IXEA 3GIYA 4ZOCA 3TN6A 4DUVA 4P7OA 3C52A 2AKMA 2H3DA 3ZWSA 5JQ9A 2J79A 3ME3A 2BOEX 3W01A 4RZBA 4IG2A 3P61A 4AVOA 4XIMA 1H7WA 4AZ7A 2YSWA 4NNCA 1OQFA 4DN1A 2GUBA 2B7NA 2DVUA 3LRMA 2Z1KA 1YBQA 2EF9A 5HANA 4JQ3A 1EJTC 2C0AA 4WR3A 2OJPA 3P8IA 5H8PA 4KETA 4IJCA 4AX6A 3O7UA 4KH2A 2DGAA 5D32A 4LSBA 3STPA 3W1NA 2ZRUA 3MZ2A 1TIWA 3V0SA 4LV4A 5BMWA 2OSYA 4CNSA 2ZC8A 1UZ1A 5FJPA 1WE5A 1W1VA 3LRKA 1TRDA 1TRIA 3G0XA 2H6RA 3V5OA 5K4XA 2FDMA 3DHDA 1FH9A 3N73A 4GVHA 3B8IA 4H2HA 3NO5A 3SDOA 1QWGA 5EMKA 1GOWA 5G2HA 3L67A 1H50A 1WZMA 1V7AA 1H09A 1P1XA 3O3RA 2YDAA 1UASA 5I79A 3D5HA 2X1RA 3KOWA 1TWSA 3TMLA 4DX3A 2JGYA 4X9SA 4Z1AA 3VAVA 3S9IA 5AC6A 3MA8A 2OELA 2O4MA 1H2JA 3LEPA 1OABA 1H63A 1V08A 4P8UA 5FIPA 3BG9A 1PHWA 3VD5A 5HDRA 4EOUA 2W4XA 3FGCA 4CVUA 3PZMA 3WUFA 3K30A 3AI0A 4XD6A 2HNHA 2ZXAA 1TKKA 2VFIA 3NVTA 3IAPA 3W82A 4WSJA 3WNKA 3QZEA 1TA3A 2EG8A 3M44A 4LUYA 4NRSA 3TJLA 1WDSA 4LEQA 3CXOA 1V02A 1OT1A 1CGYA 3UXKA 3KHDA 2QXWA 3ICJA 4FLOA 1XGDA 4QTGA 1LG1A 2WJZA 2NX9A 2ZWYA 1YE4A 1XLAA 1RPXA 3CLMA 4YMZA 2ZRZA 1BGGA 1JAEA 1MUMA 3SFKA 2WSRA 4R34A 2C15A 5AVNA 1T7LA 1R3QA 4GI4A 1BYAA 1AL7A 1J5SA 4S2BA 4J9JA 4BKNA 1VC4A 4HVXA 3ZT7A 6PTDA 5G2IA 1ZP3A 2WMGA 5LIWX 2PRHA 1RD6A 3W2KA