4JTDA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 121
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtdA00
4IGSA 2WZMA 4EXBA 1ZSXA 1EF3A 5AZ0A 1PYFA 3G1RA 1R38A 3LEPA 3UZZA 2DUXA 1EXBA 2HEJA 4PMJA 4XZNX 3WCZA 4XO7A 3N6QA 3DN5A 4DZ5A 4H8NA 4PRTA 3M4HA 2BGSA 3GHTA 2ACUA 3Q65A 4G5DA 4H7CA 5LIYX 1T41A 4RPQA 2ISFA 3GHSA 1MRQA 4ZFCA 4L1XA 3KRBA 5LIKX 1FRBA 4FALA 4JQ3A 4LAZA 3H7UA 3UWEA 3LUTA 2IKIA 3NTYA 3V0UA 1J96A 1EL3A 4WRHA 2A79A 2PDHA 1Z8AA 4EXAA 4DBSA 4XZMX 3H7RA 1PZ0A 5HNUA 3FX4A 2WZTA 4XVDA 5KETA 5HA7A 2HE8A 1S2AA 1AZ2A 4PRRA 3UZYA 2IS7A 3UG8A 1UR3M 4LBRA 1ZUAX 3MC5A 4JQAA 1GVEA 4WDXA 3WBYA 1PWMA 2HDJA 2PDXA 1QRQA 4XZIA 2IKJA 4GCAA 2PDWA 2PDBA 1X96A 4QR6A 2INEA 2PF8A 1ZGDA 4WDUA 1VBJA 3V0TA 3R6IA 3UGRA 3B3DA 4XK2A 1AH4A 2PDPA 1PZ1A 2PDMA 4WDTA 3EB3A 2PDKA 4FA3A 1S1RA 3D3FA 4MHBA 3ONCA 3ERPA 4JIHA 3RX2A 1MI3A 1IHIA 3CAVA 3BUVA 2IKHA 4PUUA 3UZWA 4JTCA 3M0IA 2DV0A 4LB4A 2PDUA 4YS1A 3COTA 3CAQA 4IJCA 2J8TA 4DBUA 1XJBA 4WDWA 3V36A 3UP8A 4OTKA 5DANA 2IQDA 3LD5A 1HQTA 4JQ4A 3CASA 2FVLA 1RALA 1AH0A 1SM9A 4JIIX 3F7JA 2PDGA 1Z89A 4GIEA 5HNTA 2CLPA 3LBOA 3UFYA 4YVXA 1Q5MA 4YVPA 3BV7A 2HE5A 1LQAA 5JH1A 2FZ8A 4GABA 3LQGA 2R24A 4WGHA 2PDCA 4DBWA 4PUWA 2I16A 3V35A 4JTAA 3MB9A 2ACSA 1YE4A 1RY0A 4QXIA 2PDIA 2ACQA 1S1PA 5LIXX 2PDJA 4XZHA 5LIWX 3WG6A 1X98A 2AGTA 3Q67A 5AZ1A 4GA8A 5LIUX 4ASTA 2NVDA 4LAUA 2IQ0A 4JTRA 2NVCA 5M2FX 3CMFA 1YNPA 2PDYA 2FZDA 4JTQA 2I17A 1XF0A 3DOPA 1HW6A 3R8HA 4HBKA 4PR4A 2PD5A 4JQ1A 3O3RA 1Z3NA 1AZ1A 3V0SA 1C9WA 2PFHA 1YE6A 1A80A 3QKZA 3UYIA 1XGDA 3GHUA 3LQLA 4XZLX 1EKOA 2IPJA 2INZA 2IPGA 4YVVA 3U2CA 3GUGA 3UZXA 3FJNA 1PWLA 2PEVA 3ONBA 1AFSA 2BP1A 3O0KA 2FZ9A 2VDGA 2PDFA 4XAPA 4AUBA 1US0A 1JEZA 4LB3A 1OG6A 4HMNA 3EAUA 4JTDA 4YU1A 3CV7A 3CV6A 2BGQA 2PDQA 1MZRA 4R9OA 1Z9AA 2P5NA 1T40A 4I5XA 3RX3A 3LNMA 5JH2A 3GHRA 4QBXA 1ADSA 2F2KA 4LBSA 2HVNA 3M64A 3LZ5A 2QXWA 2IPFA 3R8GA 4QX4A 1VP5A 3VXGA 3R7MA 2HVOA 4FAMA 2FZBA 3G5EA 4XVEA 4IJRA 3N2TA 4L1WA 3T42A 1QWKA 1M9HA 5C7HA 3LENA 1YNQA 4XO6A 4WEVX 4Q3MA 1K8CA 3WBWA 2HV5A 3R94A 2PZNA 4GQGA 1S2CA 3H4GA 1AH3A 2PDNA 3BURA 2R9RA 3BCJA 3EB4A 1ZQ5A 4ICCX 4JQ2A 1LWIA 2IPWA 2ALRA 3LZ3A 2FGBA 3C3UA 4GQ0A 3P2VA 4Q7BA 3R43A 3R58A 1X97A 2PD9A 3LN3A 4GACA 1RY8A 4NKCA 1Q13A 3S3GA 2DUZA 4FZIA 2IKGA 2F38A 4JIRA 2ACRA 1IEIA 3WBXA 3RX4A 4F40A 2C91A 2PDLA
chains in the Genus database with same CATH superfamily
1P7TA 3MMTA 3I7RA 1VPQA 4RV3A 3N9RA 4AQLA 1E4NA 3N4FA 1E70M 1XLDA 5AYXA 1K9EA 3LEPA 1UQYA 1W9BM 1XLKA 2HEJA 4S2BA 3DXIA 3HQOA 4ACYA 1S3TC 4AZ6A 5XIAA 3ITGA 3V1PA 3QV6A 2VZUA 4I7UA 4PMRA 3ZSSA 4GK8A 2D24A 2WKLA 4CGTA 2REQA 4H7CA 4LU0A 4QS6A 2CBVA 1VEMA 3BSGA 4GBUA 3UR2A 1MRQA 2I7GA 3EWXA 4KBXA 4HA1A 5LZLA 3M0LA 5LIKX 2Q6ZA 3KTSA 2GJXB 3I6TA 4BF9A 4ML9A 4X60A 3K13A 3MCNA 3WLTA 3V3WA 3KCOA 1HUVA 5SWUA 3QV8A 3RO8A 3MI3A 4GUGA 4MJMA 3W27A 2NXHA 3C0QA 2RKXA 4TV5A 4MG4A 4LYPA 2CLMA 5XIMA 1XGZA 4WZHA 7CGTA 1VR6A 1EB3A 3VOGA 1LG2A 3M44A 1KCKA 2XYLA 4HU8A 3USZA 4YHEA 2O9TA 2QUNA 1AZ2A 1TPUA 3CU2A 1NDVA 2ZUUA 4CD8A 1CGYA 3WK3A 3BAWA 1VFOA 3HQ1A 2R94A 4EPEC 4JQAA 2ZRZA 4BEUA 4PCTA 5HAOA 3JU2A 2WCSA 4O0QA 4W88A 3M46A 2QEZA 1HKVA 8RUCA 2IMRA 4CN1A 4PUJA 4Z17A 3B04A 1UKPA 4MWAD 3SBFA 3L0NA 3IVSA 1F05A 3G1AA 3AYRA 3LCIA 1QI4A 1ZAHA 4QAIA 1ADDA 3MZNA 3L2LA 3BUVA 2YCEA 2ZUWA 5A8QA 4AY8A 2QNEA 1WZMA 2OYMA 2VOMA 1K1DA 5FEXA 4E38A 2YR1A 4EF9A 2X2YA 2G4FA 3GDRA 4IX0A 3K5XA 2ZC1A 2OGYA 4JTLA 4WDWA 3WUFA 4GVHA 4DF2A 1VGAA 3L0GA 3A12A 1TJ2A 3W29A 1V03A 3S5ZA 3TK7A 1VFSA 1XISA 1SU5A 1S5WA 7ENLA 3HTWA 3LSBA 3BG3A 2F84A 1MUMA 5C6MA 1YPFA 4AXKA 1EEPA 1GQNA 4YVPA 3VZXA 3E0VA 2FZ8A 2VEKA 1F9CA 4O15A 1PTGA 2PDCA 3P5YA 4JTSA 1K6AA 1GOMA 3EZ4A 3TC3A 1LLZA 2FPTA 1K9DA 2ACSA 4KWVA 4B4HA 3UWVA 1B5TA 3TH6A 4ACZB 1IXPA 4U31A 3W74A 3UCDA 3PJWA 3Q67A 1GJPA 3XISA 2PODA 4IUOA 3LCWA 4GYJA 2A3LA 3EKZA 4JTRA 1Y5VA 4MVAA 3VILA 1MEHA 1OFPA 2J7EA 2C3ZA 1C8QA 4JTTA 2CHNA 3RMJA 3SRHA 4JFVA 2VT0A 1NF0A 2VEGA 1XKYA 1P6CA 2CETA 3L5AA 1JYVA 1RP8A 4XD3A 4YN5A 2XIOA 2DZTA 4MOZA 4TVCA 5CPQA 1HP4A 3QH2A 1U33A 4W85A 1DVJA 2OU4A 5REQA 2VD9A 1QK0A 1FH8A 1WDRA 1KRCC 1PDZA 2YDRA 2C14A 3NDYA 3BLEA 4LXFA 1EX5A 3ONBA 4PFMA 1TRDA 2BP1A 4I5UA 1P1MA 4X2PA 1UP0A 4JEJA 1FWRA 2C6QA 3ATYA 3UXLA 2CBUA 1XYFA 2DZBA 3FHQA 4XQ6A 2ANUA 3MMUA 1SR0A 1RQHA 3BVJA 1QU4A 1JAKA 1UUOA 2RGMA 3K1GA 1Y5XA 4PODA 4CNPA 4YU1A 1A0EA 2XDFA 3PNUA 4F48A 1R7OA 1VENA 3EKLA 1OINA 1ZZMA 4HNOA 1Z9AA 3ZQ9A 4LAMA 3PC0A 5BXPA 4JKKA 4LBSA 3W2LA 3AHXA 3NZGA 2J7CA 2E9MA 4R88A 3WQWA 3N2OA 4AYGA 3SCWA 1R2SA 4PMXA 3O05A 3GNXA 4Q8UA 3VXGA 3R7MA 4AC1X 4TX8A 3HGOA 1UOKA 3HB9A 1F8MA 4IMDA 4XAFA 4C1LA 3TONA 1MO0A 1ZP4A 3ZWSA 4CQDA 2VZOA 1SZNA 3LENA 2PWDA 3W3OA 4XO6A 2J66A 4KCTA 4QJ1A 2JBMA 3TCEA 4IGNA 4OECA 4C6LA 3WLNA 1FP8A 3UA4A 5AHEA 3T0CA 4B5VA 4IXXA 3GO2A 1K8XA 5CPSA 5ABHA 3M5VA 1B3WA 4MB4A 1E9IA 4M6UA 3GU9A 4LNCA 2FTPA 1D8WA 1GJUA 1EQCA 3RIKA 2EPMX 3GR7A 4YYFA 3I3EA 4PCPA 3OA5A 2YIHA 3NVDA 4O28A 4GUJA 2Z28A 5E5CA 1XIIA 1A49A 1B9BA 2PPGA 5CG0A 3IIPA 2OTDA 1RY8A 4BF7A 1W0MA 4D6HA 5DCBA 1GUVA 1JDDA 4ZFMA 4JFTA 1EH9A 3LXBA 1DKWA 1ZCOA 1Y65A 2W62A 2EJ1A 3TN6A 2WJFA 2ATSA 2HVMA 1DIKA 2DJLA 1VFMA 1LRTA 3AZSA 3MQTA 5E0CA 3U7VA 5HJXA 1KR0A 4W8BA 3LK6A 3R79A 1X6UA 3ENLA 5J04A 2D22A 4J3UA 2VEPA 1DTNA 1KLYA 1OD8A 1XLAA 5JIWA 4K8EA 2E09A 1Q45A 5ECUA 3QTPA 4HZMA 1JYNA 4DWDA 1GWJA 4C5ZA 3LCHA 2VCBA 4TMCA 1I9CB 1UZ1A 1EXBA 2QJGA 4TX9A 4B2DA 1W1TA 3B4YA 4FOUA 1IQ8A 3MZ2A 4O1FA 3VO0A 4PRTA 4FR1A 2I57A 4HCDA 2QF8A 3V4BA 1QWGA 3TJXA 4E2VA 4ZEPA 5I24A 4UNLA 1T41A 2ISSA 1FKWA 1DOSA 4YWIA 2OWWA 3FGCA 3IAQA 4OOUA 2OX4A 5C55A 2C8NA 1JAEA 3G1XA 3P5ZA 4TUFA 4ADSA 2OYLA 2V63A 3GVGA 5HNUA 3OB8A 4Z2IA 5CCZA 4QGCA 4NU7A 1WXJA 4MIMA 2WHKA 1QI5A 3IVTA 4KEZA 3W70A 4H4IA 3C8FA 1NU5A 2Z6IA 1ZALA 4S39A 5A3HA 2GVLA 3L21A 4GIRA 1SSDA 4QNEA 1ONXA 1WDWA 3NEVA 2QCHA 1QFEA 2DW7A 2E7FA 2GDQA 3PY2A 5F7UA 2PDXA 4IIHA 5CSYA 1JGMA 1IZCA 3TSBA 1WDQA 1GQKA 3PZMA 3V0TA 2CZFA 3R6IA 2ZOXA 3W76A 1QPKA 4WXZA 2I9UA 5K9DA 3GG0A 1VJZA 3QR3A 2C18A 2VZSA 1KNWA 4UTWA 4MHBA 1FBAA 3S5YA 3ONCA 3ERPA 3B40A 4Z42C 4J4KA 2WC4A 2W79A 4M1RA 1HFBA 4YPJA 2F2HA 1DWIM 1LT8A 4IZGA 5TD4A 1RCQA 4LBUA 1GOQA 4RX0A 3GTHA 3USBA 1FWSA 1YTDA 2YBUA 1PV8A 1KXTA 1WZLA 3CHFA 5ABFB 3PN8A 4MWAC 5E0FA 3ZLHA 3BW4A 2NSOA 4TTGA 1KBIA 3MPGA 1UD3A 2HMCA 4AHPA 1ISXA 5BWFA 4IIEA 1OBAA 4WJXA 4AIUA 3KCJA 1XCXA 4JIIX 5I2UA 5LNUA 3ARQA 1NH6A 3SY5A 3WLOA 3URBA 3W22A 3N15A 1JF6A 1HN1A 3FV9A 3N6JA 1WQ5A 3EMZA 3TC6A 3F2BA 3IARA 2IXVA 1X7FA 4BHYA 1QHOA 2V3GA 4PUNA 1J0ZA 4GLEA 4W7UA 1JR1A 3GWQA 3NWRA 4B5NA 3THQA 5HJYA 3VGBA 3W73A 4H6RA 2DU2A 3EWUA 1F3TA 3RGTA 2DY3A 4LCQA 3C2EA 1KBKA 5LIXX 1YDVA 4RLIA 2GSEA 3H2CA 1GW1A 1JZ2A 3TCSA 1E5NA 9XIMA 3H70A 5I79A 2AGTA 4L4PA 4KCWA 5AZ1A 2ABBA 2CYGA 4MDOA 3W7DA 3RR1A 3B9EA 1K77A 1K4GA 5LIUX 1R8LA 1E4IA 4I9JA 3P60A 2Y2WA 2IQ0A 4E5TA 1TV5A 2QIWA 1T8XA 5ECVA 5CSRA 1YNPA 1Z32X 3SGUA 3I68A 1MDLA 3O06A 1E0UA 5M1TA 1XF0A 4WF7A 1HW6A 5IFTA 2BSLA 1SR9A 3HU7A 3A5VA 3QBUA 4PR4A 3T40A 2Z26A 4GH3A 3S0CA 4MY1A 2VGGA 3O8AA 3V16A 3WEMA 1AZ1A 3EKGA 1R86A 3A21A 3IJDA 3M0ZA 2WYSA 1G5AA 4P2VA 3NVTA 1QDSA 2JEPA 4YVVA 2F61A 1DJGA 1E6ZA 3LPOA 1FHDA 1IT0A 1P48A 4GPNA 4DM1A 1XDLA 2D20A 4LUYA 1XUZA 2YZ5A 3BMWA 4LCRA 1Q85A 2PU1A 1KTBA 2FYMA 3EMCA 1A5LC 3KL5A 1EWDA 1BGAA 1EGVA 4IUGA 1QT1A 3BLIA 3A9IA 4EK7A 4HN4A 1JPHA 2EXOA 2BNJA 1SZEA 3FKRA 4J2MA 4JPGA 5JMUA 4R27A 4GO8A 3CL8A 3L65A 1H1YA 4JYEA 4C6KA 3OW1A 3KCLA 1EJ7L 3CLMA 2FZBA 4XVEA 3ZS4A 1F07A 2X7WA 3TP4A 2PWVA 1IEXA 1QWKA 4Q8PA 1M9HA 2WSPA 1PKYA 5M03A 4D6FA 3HM7A 2XH4A 4NILA 3ANVA 7A3HA 3ORWA 1J5TA 1GVQA 3PJUA 4REQA 2Q3RA 1X38A 3C3NA 1HL2A 3ZT5A 5CAKA 1RV8A 3BWWA 5I02A 4FLSA 4W8LA 2V2DA 3T81A 1GG0A 4JXCA 3AROA 1ME9A 3AJXA 1RQEA 5E70A 3QHMA 1LDCA 1W8SA 1SJAA 3VNKA 3ZJ6A 2OCZA 4O4WA 4F0HA 1B3OA 3WY1A 3CB8A 3N2XA 1P7TB 4UTTA 4ZB5A 3SCSA 3DFSA 3DFPA 3W7LA 3LGDA 2F9RA 1YADA 4UBPC 1HVQA 4JIRA 2GJLA 2DSVA 1XRFA 2XJ7A 3TYBA 3UESA 3ZR5A 4CQAA 3WBXA 1TPWA 4ZXOA 3AHZA 4RKAA 2PCEA 5E9AA 4NSBA 1AQHA 3AAMA 2PDLA 2ISVA 3NEHA 4P8UA 2R1LA 3QGAC 1EJTC 2PBOA 1ZSXA 2VWTA 3JZUA 2AAMA 1F6PA 2YCJA 3N9KA 3B8IA 1KA9F 3DHFA 3L23A 3B4UA 1JGIA 3F2DA 1OVDA 4PMUA 2GGHA 5CLWA 1S39A 2PI6A 5FEWA 2X0YA 4JFSA 3N14A 2X7VA 3W83A 2PUZA 1D3CA 1DORA 1CPUA 3AMKA 4N2YA 1R3WA 2VR2A 3DKJA 2DSZA 1C7TA 3H54A 4H41A 4EVZA 3N19B 4DJFA 1N55A 2OSXA 4AISA 3E0WA 2H9AA 2I5IA 1JXKA 4TVDA 5HATA 5E6ZA 3E2QA 3QHNA 3CEUA 3CO4A 1QO2A 4EXAA 3GAYA 3H7VA 4RE2A 4PEEA 3W7MA 4HPJA 1XCWA 1YKWA 3LLDA 3THAA 4O1EA 3TMLA 4N4QA 3KOZA 3EDFA 1JDCA 1CGXA 3EA1A 1R3QA 3BGJA 3DCPA 3MSRA 3LRMA 4JTHA 1UR3M 2BHZA 1OY0A 1WP6A 1B1YA 3WF0A 4UZUA 3RJYA 1RCXB 1X7IA 2ZRYA 3GM8A 1VBJA 2FHCA 4FS9A 1SYTA 3UD6A 3VMNA 3RHGA 4XK2A 1CB2A 4WDTA 1H0IA 1W32A 1VBGA 1IEVA 2HRWA 3W07A 4Y8FA 1VFHA 1KQZA 3LNPA 3ABZA 1W1ZA 5DRIA 5A6SA 3CIWA 3SQSA 4YL2A 2D0HA 1TVPA 3SO7A 4O12A 3PG8A 3HURA 1IT7A 1E15A 3WNLA 1B0IA 3LM3A 4RNIA 1SUXA 2BVYA 4J9JA 4GFSA 1XJBA 3EXSA 1GG1A 4IGMA 3AIWA 1V3KA 5FCZA 2E6AA 1B9ZA 3Q4DA 5DRCA 3E0FA 2Q8ZA 3WKZA 3RCNA 4B3LA 3W1UA 1IEWA 4J3SA 1H41A 1V0NA 2Z1VA 1A5AA 3LCXA 4AG0A 3CUJA 4NG3A 2EAWA 2HXUA 1W3KA 2C79A 4C7FA 2HE5A 1K7EA 2VX6A 4QDMA 1FWHC 1RUSA 3NPXA 1XYLA 1FWNA 3VCCA 1E55A 3NG3A 4GJJA 1B3XA 4PSPA 4Q8OA 1RK6A 3HPZA 4IQLA 2ACQA 3CJPA 3M9YA 1HTIA 5D9MA 1WAWA 4PZVA 2PP3A 3BE7A 1NOWA 3U2OA 3TTOA 1NWRA 4QG8A 2GDVA 1T96A 5MKGA 4JDBA 3WO8A 1UYQA 3IANA 3BZJA 1VYSX 2YYTA 2DSKA 1KBBA 5ABFA 2B31A 1I6NA 2EEXA 4Z0SA 3M7WA 4J1OA 2I5QA 5C7VA 1FWCC 1UIOA 3MW7A 3GIQA 3NO1A 1K7XA 5AHFA 1L2QA 4ZB0A 2EPKX 4LVAA 3N17A 3IIOA 4S3JA 2I5GA 1UBPC 4OWGA 2XIBA 2O7SA 2P1FA 4W93A 1TJ1A 5I6SA 3TYAA 1FWGC 4ZL1A 3QOMA 1V8EA 4H9MA 4MDPA 4AC7C 9XIAA 4X9SA 1V3HA 1TX0A 2CBIA 4PBGA 3GVQA 4KT2A 2A3CA 2OZ3A 3AOFA 2TRSA 3ZR4A 1UOZA 2OB3A 3IWPA 2XFFA 2A4AA 3GDMA 1L6GA 1ZBWA 1M7XA 2VC6A 4S3CA 2O9PA 3LXAA 3W6MA 4O0ZA 5CSSA 4ZOBA 3WLSA 4R9OA 1U30A 3P61A 1T40A 3OJGA 4BF5A 4DZHA 1UROA 3UWZA 1AMKA 2VUYA 3CZKA 4UCFA 3POCA 3KBWA 1TWDA 4JYFA 1A5OC 1OFEA 3LRKA 4N7QA 4JX5A 3V75A 5G4WA 1WKFA 3CEPA 1A0CA 1E72M 2ABAA 4LUSA 2GVEA 4R7OA 3GG7A 2POTA 2BFGA 1W2PA 2OO6A 5CAHA 1C9DA 5C7HA 3GH4A 4HJWA 4KEUA 4CEXC 3OG3A 1CXEA 4L4LA 5AHIA 3WK1A 5HR7A 1R5YA 3OIHA 2XWEA 4MJZA 4M1BA 1E6PA 3OIXA 3OVPA 4IJBA 4E8DA 1MSSA 1PAMA 5FF0A 2BVWA 4FX6M 3UXDA 2RFGA 4WXYA 3A6OA 3BURA 1XS2A 1E3XA 4WJEA 4P7NA 3GR4A 1SZGA 1Q7ZA 1VYPX 3GC5A 4OIFA 4U3CA 1UWAA 1MW1A 3N3TA 3ZJ8A 5EMMA 3L4WA 3WMLA 1Y7VA 2ODOA 4BJHA 3CUGA 3W6LA 1TIWA 4D9PA 5CZJA 4QLKA 4UUIA 1D3HA 1JDFA 4U10A 1LOQA 3K4DA 3PTMA 5I09A 3IGUA 1RPXA 4Y9AA 4O1DA 4D1JA 5JXQA 4W86A 4K39A 5D33A 1CTNA 1UPMB 4E4FA 2VJXA 1JCYA 3VFLA 2Z24A 5CZTA 1SQ7A 1OFOA 4XAGA 1NWTA 2NQHA 4JNYA 3R25A 1LTDA 3AMCA 4C7DA 5KITA 4U33A 4F0MA 4NRSA 5EMKA 2B7NA 3GXFA 1KFKA 3GIPA 4XO7A 5LNSA 4O17A 4DZ5A 3O1NA 2YW4A 2J7HA 4C1KA 5AHNA 1F4AA 2UWFA 1F8IA 5HWNA 3HMCA 4QCEA 3O6AA 4QRNA 2AMGA 1XH1A 2NX9A 1DXIA 5AB3A 3GW0A 3OG2A 3W7JA 3GX9A 5HDRA 2WNWA 3W0KA 3EXRA 1L0PA 3ABSA 4WRHA 3W9ZA 1GK8A 1J8VA 1KKOA 2QHAA 2V3FA 3WQ8A 3LBCA 3RM4A 4E8CA 2XG9A 3NPWA 4NNBA 3GG8A 1EYWA 4UQBA 1HXJA 4XVDA 3WDHA 4JZ5A 3I6EA 3H26A 1ISYA 1L8NA 1X1ZA 2G95A 1CLVA 3SCTA 2C13A 3U0HA 2J78A 2X41A 2Y61A 3S2LA 4N4PA 2WWCA 2DEPA 2UY2A 3IJQA 3NGFA 5I06A 4P61A 4ZVJA 2CLFA 2Q09A 3U48A 1I8JA 2A21A 4PTVA 1XLFA 4GCAA 1UMYA 2PDWA 1YPIA 2GGEA 3AI0A 1ZGDA 3LB0A 2J13A 2V5CA 4XX6A 2OQYA 1ZJBA 5HXMA 4YTUA 3TLLA 1LL7A 3NJ3A 3MHUA 1VQTA 5K4ZA 1JRBA 4QG6A 3SW6A 5D09A 4QEEA 4IMEA 4GGHA 3CAVA 3CTLA 2C0AA 1F6KA 3B03A 3KBNA 5A6BA 5TAOA 4NZJA 4UIOA 1RA0A 1OEPA 4UFJA 3G1HA 3DESA 3WF1A 3GSMA 3W2KA 3WDJA 3WJSA 2V2CA 3VIFA 4LGXA 4WJ8A 3LD5A 3S6OA 1NTHA 2OKTA 2BOFX 4K68A 1FWIC 3CASA 1OCJA 4Z2LA 1A3HA 3B8VA 2PLKA 4XKMA 2WVSA 2BS9A 3M0XA 2GOUA 5C9XA 3BL3A 1DPMA 5REQB 1W8GA 3T09A 2ZA3A 2RDXA 1JUEA 1VBRA 5A6LA 2W91A 3O07A 4PUWA 3PZ9A 4B5WA 4JTAA 4M56A 2WQDA 2VDIA 3O9NA 4O57A 5HQLA 2CWXA 5KSWA 4LEFA 1GNXA 3UVIA 2YA2A 4GBDA 1Y8BA 1H60A 4GE8A 1VKFA 4L1GA 3R0UA 2JKEA 2PSNA 2RAGA 4G8TA 3AU6A 5H6HA 4GFIA 4ASTA 3S9YA 2OPJA 5CPOA 3QMTA 4PCNA 1SPQA 4XD4A 3NFUA 4DIAA 1GVRA 2YL9A 1GOXA 4A3UA 1YDYA 1KTCA 4F79A 4JTQA 2FFIA 4MNJA 4WVXA 3VIMA 3GR8A 4D6EA 3JVAA 1PJ9A 2NX3A 2O92A 4D6CA 2PA6A 4JQ1A 1OC5A 4RNFA 4BZYA 1TWWA 5K4XA 3M16A 3TA9A 4YIWA 1C8YA 1CXLA 4Q4SA 2VXNA 3H6OA 4AEOA 1MNZA 2J4GA 4TX6A 4AZBA 1KFBA 2PEVA 5B7YA 2Y8UA 3NR0A 2PS2A 1ZB5A 1UASA 2VDGA 3PTQA 2GDUA 3B0UX 4HOZA 3WF4A 1I60A 3CHEA 4C6PA 5LYRA 3VGFA 2JF7A 5GNXA 5TBOA 4BKNA 4NZCA 2DZWA 2VKZG 3UWYA 4BS0A 3C0JA 2P5NA 5HMDA 2GVJA 2GJNA 1ME8A 3BSMA 4RK8A 4ENLA 1ZY9A 4Q8NA 3HFYA 3MS8A 1PBGA 3UETA 5DF0A 1PIIA 3CUXA 3KBMA 1LG1A 3KFTA 4H19A 2VVSA 3PTKA 1N2VA 3E2VA 3ZT7A 4IJRA 4L1WA 1UW9A 2UY4A 3GDBA 3M6YA 3SN4A 3IJ6A 4QP0A 1ITUA 2FQIA 4QE4A 3QR1A 1UR2A 1QCWA 4I8YA 5EKYA 4MY9A 3W23A 1XL9A 1XI3A 3APYA 4UFLA 1KO0A 4GI4A 4UZSA 4AD4A 2EKGA 5KEZA 1G7UA 1Q8AA 3MO7A 3V5CA 3CT7A 1BRLA 4PCSA 1HJQA 2L5HA 1TO3A 1XD1A 3WQ6A 3VTRA 1TB3A 1XR2A 4CNSA 3T4WA 2DT1A 3BCJA 3OVQA 1W6TA 4D6DA 4F4RA 4ZQPA 3EPNA 3G18A 4AIOA 3IGXA 5D4YA 3F4CA 3REQB 4Q7BA 1E9YB 4PUEA 1OZMA 5D30A 5FEPA 5HK4A 2VURA 2FZMA 3N4AA 4J5NA 1OX5A 2XSBA 4MB3A 3WK2A 2ZVIA 2IKGA 3CPRA 4WCJA 2YX0A 3NQ7A 3NQMA 2PWEA 3DDMA 4Z2KA 1XIFA 2QIIA 1I4NA 4IGSA 1K9FA 3VAVA 4GI9A 4YTSA 2PTWA 3FY1A 4LOCA 4S23A 4V33A 4DLMA 3IK2A 3KDOA 4IP4A 2WC3A 3VE7A 4CU8A 4B5XA 1MQRA 3T8QA 1U1UA 4DWSA 3WCZA 2J47A 4W87A 3L0KA 4GXPA 2WPGA 4YCPA 3BGGA 1K7FA 3OQEA 3OBAA 1OC7A 5I78A 4QLJA 3M4HA 1GPWA 1B30A 1EO7A 1MFVA 1ZU8A 4B90A 5BU6A 2VELA 4CLMA 1BXNA 3CO8A 4NIRA 2X0SA 1U83A 2OEMA 2C71A 4JY8A 3PULA 1EL3A 3SCNA 4DBEA 2CLOA 1UPPA 1Q3NA 2YL5A 5F1VA 3H7RA 2LLEA 3FX4A 3B8SA 2WZTA 3SCUA 1TVNA 2OKOA 2ON3A 2HE8A 2WZIA 1XQLA 3BLLA 4LAOA 1XICA 1BSLA 3W81A 1RH9A 3W1LA 1V7AA 4Y6GA 1ZP3A 1F73A 1XSIA 2QUMA 5BRPA 3N6HA 3AHYA 4X22A 4C6QA 1Q2SA 4YTRA 3BJSA 1PWMA 4C6BA 2V69A 2DZSA 4GD0A 2X0HA 5DMNA 2O4MA 1QHZA 4QR6A 3F4VA 2XIIA 5C5YA 3XIMA 4WDUA 1GZ1A 1EIXA 4DXKA 7REQB 3LYEA 3NL6A 1FDYA 2Z1BA 3G8EA 3ITTA 3CWOX 1R3VA 3EB3A 4FA3A 1S1RA 1DYSA 3RCYA 2OT1A 2QCCA 1NM9A 1FHLA 5A5WA 1FUYA 2ZX8A 2C1HA 1M7OA 2DZAA 2QUTA 3E2RA 4LPCA 3LA4A 3GNDA 4AEFA 1SJDA 3TQ0A 2Z1WA 1EJRC 4NT0A 4ZXLA 2CLHA 3G24A 4W84A 5EBUA 1F3EA 3E02A 5DEZA 1KV8A 4P8WA 3A4AA 1AQMA 1NWUA 1HQTA 5PTDA 3F7JA 4ROPA 4Q4PA 3UWUA 3LOTA 4DB7A 3KAOA 4IT1A 5HNTA 3GH7A 4S3GA 2BMBA 1CENA 2GWGA 3KBSA 3M43A 2JGQA 4K36A 4QQ3A 5M3WA 1E6RA 3QY8A 3E5BA 4PMYA 1EQPA 1FWFC 3GFZA 4OT7A 3GUWA 3TFCA 2JGYA 1R3TA 2VZVA 3OGSA 4Z1YA 1R47A 1S1PA 2R8WA 2ZXDA 1LBLA 1M5WA 1YHTA 1EPXA 1X98A 4BQ3A 4IGHA 1HJXA 4GZIA 2FVMA 4B9YA 4QLLA 3EYPA 1XIDA 3MKKA 3QGVA 2V0TA 3G0SA 2ZZ2A 1K4HA 1E9LA 3KTXA 4UFMA 2PDYA 3N04A 3WD1A 2QQ6A 4RE3A 5HQEA 3BAKA 3BCDA 4BWLA 4GUFA 1KFEA 2OMAA 1RBAA 1KCLA 3WF3A 4O10A 4D8LA 4RE4A 5FD0A 5DCEA 4MWAE 3L66A 1W3HA 2GPTA 3QV9A 4CQBA 2WVVA 3GDKA 1R3YA 1VLIA 2J88A 1V79A 5EMYA 5H8MA 2PWHA 4MAZA 4BQ4A 1DWFM 3RXZA 5FA5A 3R13A 2WHLA 4W7VA 5FJIA 3DI1A 3ABRA 3SM0A 1E6SM 4LS0A 3QQWA 4AD2A 2ZADA 2WBKA 1W3TA 3QMRA 5F2GA 3L68A 4Z1CA 1EXPA 3G1DA 1UKOA 2BBFA 2DP3A 3FA4A 2FJKA 4H9XA 3MV11 3BCFA 1GGOA 2Y6ZA 4FMVA 3DC8A 6ENLA 2WLYA 2DIKA 3E38A 4GISA 1XX1A 4IPPA 4HNUA 2DVTA 2BHUA 1TJRA 2E8YA 5E93A 4KW2A 3HPSA 4F9DA 3PJXA 4KCVA 1Z42A 4E2BA 3FDKA 2IPFA 3CBWA 2OZ0A 4RNJA 5LXXA 1NFBA 3H2AA 1W9VA 3PBWA 3ICJA 4I9TA 4BK9A 4DWSD 3WJZA 3ZVIA 1O1ZA 4EACA 1CGWA 3UEQA 1DJIA 1UKSA 4PTWA 3EDDA 6CGTA 3VD7A 2Y63A 4K7VA 3HN3A 4DAFA 4O53A 2QUVA 4QROA 1EUAA 1KM5A 3P62A 3FAXA 4LVFA 1AK5A 1LYXA 4F0KA 4H8VA 2QDDA 3QFEA 4GJIA 3TXZA 3E2SA 3W2UA 1P43A 2AQWA 2OO0A 7XIMA 2J7DA 3LGEA 3PZVA 2QF7A 1VFUA 2IPWA 3WQ5A 3HG2A 4UTLA 3SY1A 1W9UA 3C3UA 1KW1A 1GQJA 4RW3A 1ICSA 3CQ0A 2G3MA 1TX2A 4WSJA 4IHCA 5EY5A 3A64A 4B5SA 2J9ZA 3AS3A 1OFBA 3IVUA 4M7SA 1AW1A 2W6RA 1JPDX 2GSHA 3S2NA 4XIMA 1QI3A 1HO4A 2Z2UA 5I00A 1IEIA 3RX4A 2ZBTA 2F7FA 1W5OA 3CUHA 4DNMA 3LTSA 2G3JA 5A2AA 1PIFA 5LA0A 4MZ1A 2NWRA 3BW2A 2HK1A 1PYFA 1WYIA 1NELA 3KRZA 1NQKA 1UWTA 3Q94A 3E49A 1FH9A 3RF9A 1Q7QA 4PULA 1SW3A 4MUPA 2OT0A 4LUTB 4IOTA 4G5DA 4U3AA 4C6OA 4BCEA 3GHSA 4GYFA 5LA2A 3KVJA 2Y8KA 1B31A 1KM3A 2ZX5A 3AS1A 3E6EA 2C1IA 1KWGA 4ILSA 1XLHA 4XWUA 3MUZ1 3AQUA 4GIAA 4X0NA 3ZVHA 1QOQA 3M0KA 1KM0A 4IG2B 4CD5A 3AHVA 1XP3A 2VHLA 2VEMA 3EX2A 4FXJA 3BMXA 3EMQA 2FLIA 2YCLB 5KETA 3E74A 2ESCA 3VDBA 2W63A 1S2TA 3PZOA 3TC7A 3W85A 3C86A 3UZYA 3EA3A 3W1QA 4P8VA 3OA3A 4PMQA 1VEOA 1W9PA 3H8AA 3GD6A 5AN7A 3S1XA 1PE1A 3RM9A 2CFFA 4OZOA 3VZYA 2YZRA 1DE6A 4RJEA 4OKDA 4MLRA 4XZIA 3L7RA 4G2DA 1KFCA 1WE5A 4W7WA 4LANA 1P4CA 2YKKA 3H2OA 7TAAA 4MB1A 4MKSA 2P0OA 3CGTA 3UWQA 3UW6A 3A24A 5AHLA 5G4EA 1N8WA 5A1AA 3IIZA 4RZ5A 3VDCA 2YDAA 5GJMA 2OZTA 3CHCA 2Q71A 1BKHA 3GXNA 4DYEA 3FSTA 1TUXA 2DV0A 4LB4A 3WLQA 4JTUA 4KIRA 4M80A 2W61A 1KM2A 4DHGA 1DIEA 4US5A 3P14A 1RD6A 4ZR8A 2FGLA 4EAMA 1ZPTA 1TPDA 2X16A 3NNTA 3EOOA 3KL0A 3K2GA 3CT2A 3WF2A 1V3MA 2G3NA 3WQOA 1V6TA 1YBQB 3NQAA 3TQPA 4I8DA 3UQNA 3N2MA 2X09A 4TQTA 4C60A 3M0JA 4HB7A 1EHAA 3CPGA 1LQAA 1TV7A 3DBNA 4WGHA 4K3ZA 1IGWA 3NA8A 3WENA 4IG2A 2GLKA 1A5BA 1L6FA 1MXDA 1NDZA 3NSNA 2BWGA 1RY0A 4ERGA 4L56A 1JDAA 3QZAA 5BCAA 4QS5A 1RQBA 4J35A 4GQQA 3F5LA 4E0CA 1KTNA 2FVKA 4GA8A 4GO9A 3IUIA 4KRZA 1JCMP 1OK6A 3LLXA 1FOBA 2O7QA 1W31A 5AHMA 3VM7A 3R1ZA 5BRBA 5FI8A 4GMEA 5CC7A 1EA0A 4DEFA 3SECA 3GIYA 1BEUA 1RSCA 1RPKA 3SSJA 2VVNA 4H83A 4TV6A 4WK9A 2A0NA 5CG7A 2ASHA 3W72A 5D32A 2J27A 3BG5A 1YNYA 1JZ7A 3ARTA 4PEKA 1V6WA 1OFQA 3UPWA 4Q4MA 4ZSUA 4ES4A 3QF0A 4QSHA 3DZ1A 2W66A 1BYDA 3MVTA 2VDHA 1VRXA 3O0KA 5JVLA 4R33A 3V18A 3ZJ7A 2D3LA 3AS0A 2ALDA 2TSYA 1X6LA 3EAUA 3CTTA 3JRKA 7ODCA 4GVIA 3OOQA 1HKJA 3PZGA 1IGSA 3AXXA 6XIAA 4CQ9A 3PFRA 4H6QA 1ONEA 3KRUA 2PE4A 2YDQA 1QNPA 1G4EA 1H09A 4Z1AA 3GXPA 4JBRA 4QX4A 1EEXA 3HO8A 2OQHA 4Y8EA 1NFPA 1TCMA 1E1FA 4GH1A 2HVOA 4UR8A 4FAMA 2ADAA 4Q4QA 1NIUA 4Q32A 3BLOA 3ALFA 2XM2A 3RPDA 3BQ6A 4PB4A 3NQFA 1LROA 3ARVA 5FF3A 3MT1A 2AKMA 5HNNA 2AL2B 4RNHA 5FL0A 1S2VA 3FA3A 1U22A 3DYMA 3MKVA 4NJGA 1RBOB 1T6MA 5CGQA 3VINA 4UC5A 3OVGA 3R12A 1A4MA 4AW7A 1GQIA 1OF6A 3BOLA 3M6DA 4KQNA 4AFYA 3TYEA 3FOKA 1W3LA 2PDNA 1R9XA 3RPMA 3BOFA 2XISA 4N9BA 4RCXA 4WOQA 3GRIA 4J3XA 3BZGA 1LQ2A 3WLHA 4AD1A 2J75A 5G2WA 2VX7A 1TZ7A 1BWKA 3CV1A 4L6DA 5H91A 4F2UA 4FZIA 1H5YA 1N8IA 3NO3A 3L9CA 5A94A 4JCMA 3WH8A 3WDRA 1TV2A 2HS6A 2V5DA 1GW9A 4DJDC 3TTYA 3KM8A 3TAOA 2B7OA 3LU2A 4R7JA 1W1A1 3WNNA 1VAHA 1OCBA 1UWQA 4GUHA 3DFNA 4J28A 4LVBA 3BAJA 4MUZA 4UTHA 2Q01A 2VRKA 5EGRA 2Y7FA 1LORA 4H8NA 2BHYA 1J2WA 1OX6A 3T4CA 3EA2A 5D2WA 1D3GA 3TROA 4H01A 1I2OA 1R85A 4MJ2A 4ZB2A 4URIA 1EA9C 3UZ5A 2ISFA 2DH3A 2NVAA 4MYXA 4LVGA 3N29A 3BLKA 3IUHA 4ZO7A 1C7SA 3D6NA 3GK0A 4HVXA 1ELSA 1KD0A 1W1VA 3VIHA 5E6YA 5D04C 4GI6A 1VS1A 4DBSA 1F3WA 4K8HA 1IXNA 5AC5A 1QVBA 2IUZA 2WHJA 1EJVC 1PDYA 2OELA 4DZIA 3WH6A 5G5IA 1P0NA 1FHUA 2XZ9A 4DAIA 3L4YA 3HV9A 2GVYA 2WNNA 1QR7A 3NQGA 3FS2A 1P5BA 2Y85A 3G3MA 1ZUAX 2UY3A 1FXQA 1FCBA 2BG5A 4G6CA 3WNKA 3R0DA 4TU1A 3P84A 4OQVA 4HU4A 3MO4A 2DQWA 2YB4A 1QRQA 3W7IA 6XIMA 1UR9A 1DL3A 2ZUTA 3VKAA 1B57A 4UWMA 3OGVA 3AMGA 2DT0A 4UFKA 3AJ7A 4CUCA 3GKFA 1XFCA 2GSJA 5LA1A 4GJ1A 3W7QA 4L64A 3LGGA 4JIHA 3M5ZA 2YB1A 3MCMA 4C7GA 1B3YA 2JQXA 1MI3A 3UF9A 3DFOA 3APTA 1J18A 4AVOA 1O5KA 2PTZA 2VL4A 3RCMA 4GYPA 1V3LA 1IR2A 2WO5A 1BLIA 3RLVA 4ZODA 5EMJA 5CBIA 4QDWA 1Q7MA 3I4KA 5FJRA 4AWTA 3CAQA 3PBGA 1Q6CA 1MFUA 2OOFA 3L5LA 1E6QM 2ZWZA 4UOZA 1I45A 3VFCA 3FYOA 3I4EA 5D9NA 5B7ZA 1IZJA 2PDGA 1VYRA 3VDGA 5K2ZA 4HOXA 1LRQA 3SIMA 3SGZA 1VH7A 1MEIA 3TN4A 3UFYA 1I0BA 1OFRA 4IL2A 4YVXA 2V9DA 3V1HA 3MANA 4W89A 1F76A 4GABA 1CECA 2W27A 3GXDA 4KCUA 3FNDA 3W7NA 1FKXA 5HANA 3TWBA 5CPNA 1A3WA 3U5UA 1LBFA 1YIXA 2ZUMA 5A6JA 1G9HA 4BQ5A 4DI8A 1GORA 4GKLA 4GINA 2VFDA 1UH4A 2REQB 3CNYA 1TJPA 3GZAA 4PL2A 4KESA 3SIZA 4IF2A 4Z0JA 3OLGA 2B81A 4BEQA 3TE9A 2QCFA 2WVUA 3U4FA 1BQGA 1Q6LA 3PG9A 2VEFA 1OGSA 4KGJA 2BVDA 2PGRA 1TREA 3O3RA 1WZAA 1H7XA 1Z3NA 5AVNA 3VNMA 2UY5A 1HJUA 1W3IA 2Q8LA 3CK5A 1ISWA 1TKKA 3LTPA 4GNVA 5DBUA 4IP5A 4MADA 4ECLA 3DFYA 5AYBA 3RN6A 1IYXA 3S47A 2DFAA 4QHRA 3STFA 1VZWA 1PWLA 1UIPA 4NJJA 2Q02A 1XINA 4LUTA 3R11A 4GG9A 1AQ0A 5EMLA 1OX4A 4HMNA 4NNAA 1VJSA 4KF1A 4KWWA 3SCRA 3W82A 3T9PA 5IRPA 1EJXC 4FSAA 1BGGA 1V6XA 1AJZA 1M04A 3C56A 3P74A 1F4HA 4IIFA 4ZQOA 3K8KA 4UB9A 1XLMA 3VIOA 4XSLA 3VNDA 4A3RA 5JH2A 3L4UA 4QBXA 4IQDA 3D3AA 3M47A 2RHGA 3U9IA 4L80A 2PP0A 1PXGA 1VRDA 1H7WA 1BVWA 2WW5A 4IX2A 1SMAA 1AL7A 3WUGA 1KV5A 1R0MA 2OXNA 1A5MC 2WSRA 1KXQA 3GXMA 3G3DA 3GBEA 1HL9A 3OHMB 2DSWA 1K6WA 3TW6A 2HV5A 3PZNA 2PAJA 2YA1A 4YHGA 2OJPA 1JULA 2CHRA 3WQCA 1KGXA 2ZTKA 1EPVA 2VOTA 1QPRA 2D2OA 3A3WA 2BY0A 2NQLA 2QGYA 5D02A 3I6RA 2WMGA 2DZXA 3GG1A 3LHTA 1LT7A 4MKNA 4ICCX 5G1YA 1WUEA 3DERA 2VCCA 3THCA 3W7GA 2QPSA 2O4QA 2CEQA 2GQAA 1WXYA 5C70A 2OLSA 4M8UA 1JL8A 2CHOA 3W28A 3LXCA 3TUUA 4RUBA 1X97A 3NM1A 3IK4A 3LN3A 3RU8X 2ZX6A 1EOKA 1SW0A 3ZSTA 5A2BA 1EZ2A 4XBKA 3N12A 4AWUA 4ICNA 2NQZA 3CB3A 4R3UA 3PZUA 3K4WA 1V3IA 3RDKA 2B7QA 4R9XA 4Z2JA 3NQDA 4JAWA 1J9YA 5FF4A 4K2SA 3HGSA 4EOUA 2XFYA 3N2BA 2CERA 4EXQA 1Z48A 3DEQA 4EXBA 2A7RA 1K02A 3QC3A 1E0XA 2P50A 3C8NA 2QCLA 4AIBA 3QSTA 5F4XA 1N82A 3MP5A 2X42A 2D2JA 1AJ2A 1J93A 1TV3A 3FHAA 2H9AB 2GK1A 3H2FA 4QJ3B 3E0IA 4RXGA 2ZQ0A 4H9YA 1EGMA 4LVDA 5GQBA 4IH3A 4PMDA 2VFGA 2BGSA 2YLAA 1BQCA 2EG8A 5FJUA 2ACUA 2OEKA 3GBDA 2C7FA 5FSDC 4H2CA 1GHSA 4QEHA 4RPQA 5EPDA 3U2EA 4B3ZA 4FNTA 4L1XA 4KKXA 3RRXA 4G1KA 5CPMA 4LAZA 3KLLA 3CUFA 3SN0A 1FH7A 1U5VA 3A4XA 3TNBA 1TE6A 4GWEA 3UWWA 1POKA 3CMGA 4BWLC 2JE8A 5HA7A 2D3NA 4HYRA 3AWNA 3GAKA 3URNA 2O56A 3WFAA 3KE0A 3L4VA 1WDDA 1CB7B 4PTXA 2FB2A 1SFTA 4XZWA 4HSNA 2PRMA 3WZ0E 1Q6GA 1OCNA 3HIJA 1UR4A 1GVEA 4RDYA 4ZQMA 2G3IA 5H2ZA 5FF2A 4OBSA 5J8LA 1W1PA 2ZA1A 2PDBA 1X96A 2INEA 1IXQA 3QEZA 4ZENA 2H8XA 1HX0A 3E1F1 4S3KA 1IE7C 2GOKA 1ZAIA 4DLFA 4KH2A 3PSVA 4N9CA 1XC4A 2JKPA 3QM3A 4AB4A 1E9ZB 3AXIA 3CPUA 4ATLA 3PWGA 2TMDA 2Y8VA 4TVUA 1XYZA 1X39A 4ZZ9A 2XSAA 3NM3A 4GZJA 2QVHA 2V6AA 2ZIDA 4V27A 1MUWA 3BICA 2A6NA 2WB5A 3MU7A 2NWSA 1ISVA 3RLHA 1JZ8A 2BODX 4C6DA 4JTCA 3ZWTA 4PBEA 1AG1O 4R34A 3B0YA 1D9EA 4YS1A 3R10A 1MXGA 4M7TA 2PC4A 4YMZA 1TTJA 4LCSA 2INFA 2V68A 3WUEA 1GKQA 1XHGA 5AFDA 1OWQA 1J79A 4MJ4A 5A8OA 4M0XA 2X1RA 2DVUA 4Y9MA 1AH0A 3H22A 1R46A 3LTYA 3DHUA 2XIQA 2D0GA 3HOJA 3NQBA 4S3EA 4NAEA 2MANA 3ARYA 4QIUA 1Z89A 3E3HA 1EP3A 4AAJA 1XYAA 5A6AA 2Y7DA 3L4TA 1W9XA 3G0UA 4U5IA 3WQPA 2EPNA 2ZZ5A 5BOOA 3SI9A 2E5DA 5A8NA 3VOHA 2DGAA 1UKQA 2CITA 3QRHA 3QV7A 2G41A 2A6LA 3RAOA 3WQGA 1E0TA 3DU0A 5LIWX 5I3DA 3WG6A 3VUPA 3AXHA 3S2JA 4ZOEA 1QW9A 1QNOA 1QPQA 4NL1A 4I9AA 1TPEA 4C6JA 2PB1A 3D47A 4NZ5A 2NVDA 3GXIA 2CLKA 4UTUA 1F61A 1X8CA 2JK2A 3WSUA 3WD2A 3VD5A 3LX9A 2I17A 5AC7A 3KUMA 3GU2A 1SFLA 1WDPA 1O12A 1YQ2A 4QE5A 2ZZ3A 3OYZA 3SCPA 2EJAA 1O66A 4FLOA 3F1QA 3B06A 3NSXA 3UG5A 2PFHA 4DUOA 3KRSA 4NAEB 3UYIA 4O50A 2CC0A 2ZRWA 2VQUA 5L6UA 4ZTYA 3CZJA 1KM6A 2HWGA 4H7VA 1KRAC 1VIZA 2AQVA 1IWPA 2ZICA 5B80A 4FI4A 1LUCA 4K1GA 3V5FA 2XN0A 4DO5A 3S1VA 4TTUA 1RZMA 4OV4A 3WK0A 5DCDA 1NAL1 2ZWYA 3BW3A 4A8RA 4JHOA 4UR9A 1CLXA 4LB3A 5D05A 5HBFA 2FKPA 2C16A 4JTDA 3BPWA 2D2HA 3MJYA 2G37A 2V3DA 3AIQA 3GTXA 3NIYA 3QPEA 4LUJA 3ZIZA 5C9RA 1HF6A 4NP7A 4CD7A 1SFSA 3CC1A 4Y7EA 4DJDD 1F5ZA 5IFPA 1GEQA 1A4LA 4O8AA 4B9ZA 3GB6A 3TR2A 1QASA 1JQVA 3SY8A 4FXFA 3UR7A 2OEJA 1YW1A 4JX6A 3SUSA 5HMSA 4HNVA 4Q8VA 3N2TA 1CDGA 1VCFA 4HGXA 3P67A 2QCMA 3EX6A 1XFBA 3MBDA 1PEZA 3EXTA 1FY6A 3PK7A 2D23A 2A3HA 5J5DA 1EYEA 1CX9A 4V1YA 3EX3A 1UD2A 4M51A 1WBHA 4KWSA 1VBUA 3L2IA 1JCXA 4DRSA 2PLMA 3F5KA 4QISA 5DFAA 3DFQA 1RCOB 3HV8A 3INPA 1OB0A 4HPXA 2GJRA 2GJXA 3FYYA 4NJIA 2Z2AA 3DH7A 1X1NA 5JBEA 1W17A 3N3MA 4LV9A 5EU9A 3PF3A 5BOFA 5M17A 2PRHA 2Z27A 2CKSA 5A6KA 1XKJA 2GK1B 1SGJA 2CWNA 5E09A 4D1IA 1E0VA 2E9BA 1BPLB 2BXYA 5M5DA 2V30A 3YPIA 5A69A 2H90A 2VO5A 4OJYA 4LUIA 2PMQA 4E4UA 3W24A 1RJRA 2C91A 2Z0IA 4L6OA 2BB0A 3NAVA 3G2GA 3PHAA 1ONWA 3ZR6A 3H24A 4XD5A 3UPBA 4OUIA 1QK2A 3C2FA 5F1UA 5AC6A 5AZ0A 3UCQA 3M0HA 3STGA 2QJIA 3P0XA 2ZXAA 4ERIA 7PTDA 3B97A 4H8UA 1RHCA 3S6DA 4UR7A 2P0IA 3HPFA 1XG4A 1WAUA 3LI0A 8A3HA 4AX6A 4CNTA 3KVMA 2Y88A 3LG3A 1JD7A 1ZENA 3P3BA 1G94A 1XSKA 3TOYA 3Q65A 5CH9A 4CCEA 4PA8A 4F0SA 4UTWC 4G7EA 3WJXA 1OCQA 3PS7A 2AKZA 3W1XA 2PGWA 2A1YA 3QW4B 4C6NA 4HHMA 3N25A 4S1FA 4XZBA 4QFUA 3VPLA 2ONEA 2A79A 3P0WA 3SRDA 2OWXA 1PS9A 3MYOA 3MUY1 2O9RA 1KCZA 3EWCA 3C2YA 3UNTA 2WVVB 4HHPA 5IBXC 3G6LA 4NUWA 4PRWA 4LYQA 1T7LA 4LBRA 1PZ2A 5KZDA 4OBTA 2VGIA 2EGZA 2JIEA 3P8JA 5D9OA 5FF7A 4M29A 2PBGA 4KGLA 4IISA 1JCNA 2NV9A 3SGGA 2HNEA 3NQCA 3WDIA 2XINA 3NGJA 1O68A 2J8FA 3KOWA 3VMOA 1ODUA 1EX1A 4ZCWA 2PDPA 5BNKA 1PZ1A 2PDMA 3O6YX 5JUVA 1ZJHA 3CZGA 4XTIA 5A8MA 4MZYA 4PCFA 3CUZA 1TPB1 4HK5A 1A50A 3PPHA 1TTPA 3SJ3A 4F9JA 1YX1A 5JIPA 4KWOA 3EPMA 3H23A 4MNKA 4K7YA 1RJPA 4UQCA 5TQLA 3SFKA 4AY7A 2ZZ1A 5T91A 2J79A 3COTA 3EDKA 5DT7A 2J8TA 2WMKA 4M3PA 2O0TA 5CJNA 4FR6A 5D2VA 3GC2A 3TZFA 5CJMA 5C54A 1DHKA 1M01A 1XLIA 4Q8QA 5T9BG 3U8GA 1NSJA 3SUWA 5HUOA 5BZAA 4YTTA 3A3HA 3FDGA 1JVNA 3I10A 1Q5MA 1PL9A 4O1CA 2QV4A 3C2RA 4EWND 2A5HA 4IFOA 2PF0A 3VX0A 2WSQA 1QHPA 3GU1A 2C0HA 3EBVA 1UP2A 1JJKA 3EX1A 1YE4A 3URQA 4DJEC 2XPKA 1G0CA 1DEDA 3UG3A 3MV01 3BANA 4XZHA 4HNTA 1S2WA 4R85A 3UU0A 2NLIA 3ME3A 3VKCA 4AZ7A 1QBAA 1WOAA 2VQTA 2VX4A 2NX1A 2NVCA 2QAPA 1QTWA 5G4HC 5FL1A 4XSMA 2GUUA 1VFTA 4A4AA 4ORIA 4B15A 1XYCA 4NAFB 4NI8A 3E0LA 4M24A 2ISWA 2CW6A 4HU3A 4Q22A 3RFAA 5HULA 1JDEA 4DO4A 4XBSA 4DWSB 3AFBA 4G1NA 1O7AA 1O5XA 1KR1A 4LAKA 4E2OA 4GQBA 2NT1A 2PWGA 4N02A 4HKPA 4ZA0A 3VC5A 1SO6A 1YLVA 1J2BA 1FP9A 1QMLA 3UZXA 2FTYA 1YRRA 1MW2A 2YFNA 3KS5A 3I65A 3DG7A 1OF8A 2VNCA 1ITQA 6TAAA 4L65A 5HWMA 3RILA 5DXYA 1RVGA 5GNZA 2FH8A 4OVXA 1W3NA 1GONA 2EG7A 5KZ6A 3QY7A 1T0OA 3TOPA 1XD0A 3ARPA 4YWSA 4DPPA 1JEZA 1KLZA 1R30A 3N11A 1OSEA 5A6MA 5CXPA 1ENUA 4ACZA 3CQHA 3W38A 1SVDA 1GJWA 5GVJA 3FJ6A 3VUSA 5IOBA 2WJEA 1C8XA 3KHDA 3AALA 4UTKA 2PDQA 1L8PA 1DIOA 4K1WA 2PWFA 2D69A 1IT8A 3UBPC 2IQTA 4DBDA 1REQB 3LNMA 5CBJA 3WQDA 2CU0A 2F2KA 2R91A 3NQ8A 3M64A 3OO2A 1B2YA 2NXIA 2UV8G 2QXWA 1DTUA 2W92A 1SZFA 5D9PA 3AZRA 4QTGA 1Z69A 1GHRA 4JFUA 3WD3A 1YDOA 4O8RA 1JXJA 2HTMA 3W2MA 3KHJA 1HKWA 4XAZA 1EGZA 1UCWA 4UTIA 4Q3MA 1V5XA 1FWBC 1K8CA 3HF3A 3BDKA 3IRDA 3AU2A 3KX6A 4V15A 1AMYA 1UD4A 1M53A 3T6CA 5J5RA 4RDWA 1OYBA 1ZNNA 4J2PA 3W7HA 4GQGA 5GJNA 4B2DD 1XLCA 4PC8A 3BLPX 1TPVA 1ZQ5A 3CL7A 3STPA 1G4PA 1QNQA 1R87A 1J6PA 1UD5A 4HT3A 2QUUA 4UNIA 3PUDA 4NRRA 1Q6EA 2CPUA 4IIGA 4ADTA 1U1JA 2ATMA 5CSUA 3CUIA 3RM8A 1P0BA 3VGGA 3VC6A 2A85A 2V38A 1KB3A 2EHHA 4JD4A 5LGXA 4H6EA 1GOKA 1Q13A 3CZ8A 2F38A 1UWRA 4HTBA 3UZJA 2RJGA 1W5NA 5DELA 4H9UA 3CLWA 3UGVA 2CIPA 2WZMA 1AJ0A 1TV4A 1HJSA 1XG3A 2J77A 1UC5A 3G8RA 4HHHA 1Q8JA 1XDMA 3T0AA 5TF0A 5HQMA 4MPQA 3NQEA 4M81A 3GNOA 1FFQA 1H5VA 3N6QA 3SURA 1QW8A 1J6OA 2WK2A 4ADUA 1L6SA 3QYQA 3DFHA 1IV8A 5JQ9A 3ZLFA 1CXFA 4L9ZA 3ARUA 5I0DA 4KEMA 5F4WA 6PTDA 1C93A 4NVTA 3W02A 4Q7IA 1NOUA 3NSMA 1EUNA 3LUTA 2R1MA 2ZZ7A 3NTYA 5DY3A 2J7FA 2XH0A 3PTDA 1UR0A 3Q45A 3BO9A 4GC3A 5L9FA 5FOOA 4XZMX 3VKKA 1PZ0A 4AF0A 4S2CA 2G96A 3ABQA 4DJDA 3EOSA 1DJWA 5JU6A 1FCUA 1OFAA 1HIZA 4WUIA 3S83A 3UG8A 4J3VA 1YMYA 3FSUA 4LF1A 3EDJA 2XWDA 2YBTA 4AX7A 4WDXA 4QJ4B 3B0VC 1ADOA 5MKGB 5LGZA 2WCAA 4IPJA 3S6TA 2JIWA 1WDSA 1R9ZA 1V3JA 3BXWA 2BDQA 3G22A 1HVXA 5ABTA 1RBLA 5LSMA 1MYRA 2VEIA 2YSWA 1DV7A 3QKEA 4AZHA 1JG9A 2Q8XA 3ECQA 4L6HA 1Q63A 4EP8C 2VP8A 4H9ZA 3O0FA 2DPEA 4AVFA 4HCHA 4F0LA 4P7RA 4UOQA 3VDHA 4D8AA 1V08A 4HHLA 1TE1A 1XBYA 4W4QA 3WDQA 3ALGA 4PUUA 2NXGA 1A0DA 1GOWA 5IDIA 5A8GA 8TIMA 3SUUA 3M0IA 1BYBA 3C5QA 2OQLA 2EBNA 3CL6A 2DIEA 3UG4A 3NZ1A 4PUDA 4LS1A 4DI9A 4MNLA 3RITA 1PTAA 4PB3A 3TTSA 1UUQA 2C1GA 1D2KA 1RAKA 2E77A 1H63A 5K9XA 2AL1A 2RDWA 1PX3A 1NDYA 2NQ5A 1M65A 2JEQA 1US3A 5F2MA 1PCWA 5DXXA 5LNVA 3A47A 1LBMA 4JGDA 5LKYA 2CLIA 1LWHA 2E6YA 4NZ4A 4DO6A 4GIEA 4ZE4A 4FLQA 3KL3A 2WMJA 3GC4A 3ISIX 1LOLA 1VHCA 1EJSC 2OLAA 4XKYB 2GGGA 1A5KC 2FPYA 2ISDA 2I9EA 4JN8A 2VCAA 3WD4A 3VA8A 3AS2A 3GDTA 1OX4B 1DJXA 1W37A 2DIJA 1J10A 2PDJA 5I07A 3N4EA 4NI3A 2FGZA 4AWSA 4DF0A 1I1XA 3IJ9A 1UBSA 2WHMA 1R7AA 4DPQA 1EJWC 4Y9OA 1CGVA 1XIBA 2FB3A 4KRTA 5EBAA 1CXKA 4D6GA 1Z41A 2QJJA 3VD4A 5CC3A 3KDNA 4JEQA 3HQNA 2PCQA 3QMSA 4UTJA 4W8AA 1TR9A 3WFZA 2X8RA 4MMWA 4KFPA 1E1EA 4PBFA 3VOIA 1BHGA 2IPJA 5C8BB 2Y5JA 4KERA 3FCPA 3FJ4A 4H7ZA 3D0CA 5D2XA 4MTVA 4EPDC 3T07A 1W1YA 2Y0FA 4O1BA 4J3ZA 1BYCA 4FB7A 1QW7A 1GOIA 4U2ZA 4PFHA 1DJZA 1J0HA 2A2IA 3MSGA 2YLLA 2ZZ4A 2TAAA 3TXVA 5GPRA 2A3EA 1US0A 3TYDA 3ITLA 2V2HA 1TZZA 3IJIA 1M6JA 4O1AA 2FMNA 3KXQA 2RGLA 2QULA 3ARSA 5E1QA 2XVPA 1J0IA 1TVLA 2OG9A 1JZ6A 4V1XA 4IMGA 1Q2RA 2VRQA 4HA4A 3PWAA 3QPYA 4QJ5B 3EOUA 2ZC8A 3DECA 1UA3A 4UTTC 5I3KA 2WVTA 1A3XA 3M41A 3R89A 4AHOA 1YEYA 2PP1A 4IIDA 1SSGA 1VP5A 1I2NA 3W1TA 4Y96A 4PE8A 1TV8A 5FAGA 2Z1XA 4HN8A 1XBZA 3LCLA 3O7UA 1FA2A 1TYGA 3PJTA 3R5EA 1MZHA 1WKYA 2WNQA 4ZGYA 5CGTA 5XINA 3UCCA 4XG1A 4HOWA 4US6A 4HIBA 1N8FA 3C2OA 3IUDA 3R94A 5I23A 1RK5A 1RD5A 3MUXA 3F4NA 4EF8A 1DXEA 3DHDA 3PB2A 4XISA 5DN1A 5H1WA 4GKTA 3ARZA 3UY8A 4WY0F 3W26A 3WNOA 4CD4A 4IMFA 4LFYA 5EMUA 3TAKA 1FDJA 4ALDA 4DXXA 4DM2A 4M19A 3S9ZA 4JQ2A 4QG9A 2J74A 2ALRA 3DIPA 1XLBA 1V6UA 3BK0A 3E9AA 1O60A 3MI2A 1P1XA 4HK7A 1G4TA 1WKEA 3UJSA 2W9MA 4GQ0A 3R43A 2DJXA 5LHFA 2RJHA 4GOAA 4KS0A 3GFXA 1EZWA 3EOEA 4GZEA 1I2PA 4UOJA 5AVHA 2D2GA 4HZ8A 1TELA 4WD0A 2NZLA 1XCFA 1WA3A 3FLUA 4X61A 4INFA 3VOJA 2VGBA 1DBTA 2QPUA 1ITXA 3SCQA 1GTEA 2FMOA 1NDWA 2XGZA 4M5PA 1NVMA 4HTYA 1N7KA 3FA5A 5I5RA 3IGHX 3WLJA 2A7PA 4Q8TA 1TIMA 4Q4RA 1XIHA 3PBMA 3QY6A 1R38A 4F8XA 1XRVA 2E9LA 1FQ0A 1FWTA 2PLCA 5DMLA 3AC0A 4UQEA 1EO5A 3VKBA 2XFWA 3Q37A 3M5XA 3O15A 1DJQA 4O14A 3TV8A 2QCDB 2WMHA 1XRSA 4DO7A 3WNMA 1R9YA 4Z08A 2Z25A 2DZUA 3VD3A 3K4AA 4H9TA 4JQ3A 4KPLA 1E0WA 3UWEA 4I3GA 3HJEA 2VFHA 1DWJM 3OEXA 1VHNA 2I1OA 5ABGA 4NZ3A 4E3TA 1EJUC 1YXYA 3T1GA 1WUFA 4GYPC 3A5FA 4IIBA 4ZQCA 3I7SA 1OJXA 1XM3A 5BW6A 3VNLA 1TZ9A 1F6YA 1TPFA 1J0JA 2PGEA 4JICA 2CZVA 4DUXA 1FFRA 3EX4A 1XW8A 3WMBA 3WMCA 4IQEA 4WQ6A 2VR4A 3G1VA 1KWKA 3U5YA 4FXSA 1ECEA 5C2CA 1XDJA 3NL5A 2QMJA 5A6BD 4B3KA 3T44A 1NY1A 4QE1A 3VVGA 5C71A 5DQPA 5IM51 3VE9A 4LY8A 3QC0A 1ZJIA 3D3FA 3W1RA 4BI5A 1VC4A 2XVKA 4CCCA 5K9CA 1H2JA 3THDA 4D6IA 2E28A 4EIVA 3QTGA 3I7QA 1OYCA 1GKPA 1UD6A 1QO5A 4MLJA 2QCNA 2YJQA 3ZMRA 2G4JA 4CCDA 3OHIA 4Q4OA 1JPIA 3T55A 1BD0A 2EO7A 4YJ5A 1H4PA 3W7CA 2OSWA 2WSKA 1PZ3A 1XC6A 4JY9A 4EAYA 2Z6JA 1QNRA 2WQPA 4FK9A 3HGJA 5E9XA 1PIGA 4TMBA 3UXKA 2AQOA 1L2UA 2DORA 3W86A 1HT6A 3BV7A 2BY3A 2YW3A 4PH6A 1BSIA 3PPCA 4A29A 2WANA 3LQGA 2J6XA 1H3GA 5DO8A 5HNRA 3MB9A 1BRLB 4PN2A 2PDIA 3KZSA 2YL8A 2HBVA 2NUWA 4O0KA 2HPMA 1K8YA 3WQEA 2VYOA 4XIAA 2G5WA 2XGBA 3B9DA 4G56A 1JCJA 3PFMA 4TOQA 1NP0A 1EP2A 3PM6A 4Q6XA 5I3HA 1IF2A 4QSFA 4Q7NA 4JNMA 4BQ2A 2VWSA 1ZBKA 4L4MA 1LLWA 3CMFA 3WUBA 4YYCA 2FZDA 4AZGA 3JS3A 3DAQA 2VC5A 1JYWA 1U5JA 4YNGA 3NURA 1O4UA 3DG6A 4WIWA 4ZBCA 1LP6A 1JNDA 1EC9A 1UWIA 3HPXA 1S5NA 3W37A 3R4IA 3TJLA 3NQVA 2Q3OA 1C9WA 4OFCA 4KWUA 4F0RA 3BSHA 3OU8A 2WM0A 1DP0A 3CH9A 1H11A 2IPGA 6REQB 4LYRA 3NZPA 4E6MA 3UJRA 3R8RA 2J8GA 1FHVA 1C29A 4MF4A 1MDRA 4H8HA 5G2HA 5MHBA 3VX1A 4KMQA 4A8IA 4XTDA 2QJHA 1KBLA 2GVGA 1MW0A 3TA6A 3TQVA 3VMPA 1PB0A 5FJPA 1QI0A 1WCGA 3VNJA 5D03A 3H2MA 3SCVA 3CV7A 4UQ9A 1BYAA 3HG5A 1JD9A 1EC8A 2Y89A 4AWEA 4AF0B 4ATDA 2XH7A 2KZHA 4EANA 3GHRA 3EWYA 5ABEA 1VIWA 1J0YA 2NUYA 3LHZA 4GZ7A 3LPPA 2B0MA 2R6OA 3E5PA 3WDPP 2ZX9A 2QW5A 1J4EA 3R8GA 4IPNB 3W01A 1QI2A 3O63A 4K6AA 4PMNA 4G7EB 1K9TA 2CZDA 3SUVA 4ZO9A 3G1SA 3QFWA 1A53A 1XH2A 4AHQA 5EB8A 3VIPA 4JTGA 3IIXA 1HGYA 5AYZA 4J7RA 2J6VA 4FIRA 3HG3A 3PPFA 3K1DA 1BG4A 2OSYA 5KMYA 3TYZA 4W9TA 3HA1A 1SZRA 4UTMA 1AODA 4NF7A 4AU0A 3GZ3A 1IWBA 5BU9A 3EWBX 1VEPA 5CQ1A 1NOFA 4W5UA 2F6UA 2D1ZA 2YDSA 2XTKA 2VZTA 1LM1A 1G67A 3OTRA 4GQRA 2VR5A 3GH5A 3ZJKA 4LSBA 1E43A 2QYGA 1TSIA 5T8GA 3SN1A 2FGBA 4PL1A 3B8DA 1TPC1 3ZFHA 4MKVA 1X8FA 4Q33A 1W1IE 3S1WA 1C92A 1IIHA 1TWIA 1ZJAA 3TLQA 4Z2GA 4H3DA 5EYWA 3KP0A 2BY1A 3L2MA 4D6JA 2HROA 3T8LA 5BXTA 1QOPA 2O55A 3AICA 1D7KA 1AUSL 1UKTA 1Q6FA 1K8ZA 2OYKA 4ATWA 3BLDA 2NQ9A 1KM4A 4RE0A 4N0RA 4R7WA 1R2RA 5C9WA 3LMYA 2GQ9A 2W67A 2ZDRA 4NJKA 1W5PA 1ZCCA 4ZOCA 1CXHA 4UMAA 3IAPA 1OGGA 3IJ7A 1Z44A 3ZLGA 1CBGA 6ALDA 2G8ZA 2VRJA 2VM8A 3G1RA 4LF2A 3W7PA 2DUXA 1P0DA 3DGRA 1J12A 2PC8A 2FDMA 1WB0A 1E73M 1RR2A 4UCGA 3TKFA 3N13A 4MWAB 1L6WA 1ZAJA 4JHMA 2QV5A 2Y5SA 1UHVA 3BJFA 1TWZA 3MUAA 1XXXA 3KRBA 3Q58A 3STEA 3VKJA 1JCLA 3W53A 2HISA 4NX5A 2Y7GA 1A5CA 2BTMA 3V0UA 5T9CE 1H7PA 4C91A 2WKGA 4PTNA 1SO5A 2ZZ6A 4JIEA 3QGKC 3TVAA 1ITCA 4EE9A 4DY1A 2QPXA 3T78A 4ZOAA 3BG9A 2Z1KA 4PRRA 4GX9A 4K38A 4EKJA 2VFFA 1JZ4A 2CBJA 5BXRA 3P8IA 4GYKA 4ZMGA 1ZRQA 3EPOA 3NZRA 3WBYA 3MDWA 1RP9A 3LY0A 3NYZA 2QVNA 3PBVA 2J9YA 4FHAA 3V5OA 3IIVA 3EWWA 2OGJA 2YCLA 2FH6A 4JKLA 2GUYA 3CXOA 3T2PA 6TIMA 2P3ZA 4FPSA 2DSUA 4PB5A 3G0XA 1W3JA 3WD0A 5CPLA 3SJNA 5AYYA 4NYUA 1NP2A 2HS8A 1XPYA 4B4FA 1V51A 5CKSA 1H62A 4X9YA 3QXBA 2XUCA 1GYMA 2WNZA 2XN2A 4LY4A 4WGXA 4I5RA 3B8UA 4ML4A 4KRUA 4EPKA 3OPSA 3ID7A 4NAFA 2I14A 1B90A 2F8QA 4QQUA 4DBUA 3ZO9A 1UZHA 2Z4GA 4J3WA 4NYYA 4PTDA 3V36A 1KKRA 4C5YA 5DANA 1DWHM 3O2LA 1WXZA 3FN9A 1B4EA 2WZHA 3L12A 1G01A 4IFRA 1RJQA 1BFNA 4I6KA 1SJBA 2FHBA 4Z1DA 1ZTVA 3MP4A 3VU2A 2B7PA 1TUFA 1FDZA 2JALA 3IPWA 4L61A 2VD8A 1G7VA 3N73A 5IHRA 1R2TA 2VFEA 3A22A 2DT2A 1ZL1A 1NJJA 4DBWA 3V35A 2BX7A 3LDVA 2Z2BA 3REQA 4FIQA 3GW3A 4QDPA 1ZBCA 4DJEA 1JI2A 2BLEA 4WKFA 4V2XA 3GDLA 3NPVA 1JPMA 2QCDA 3ES7A 3DC0A 5DX7A 1GVOA 4ZO6A 2D73A 2YOCA 5HMEA 4HJFA 4NQ1A 4HSOA 3M07A 3SRKA 4L9XA 3W7OA 3IEBA 5DMYA 1M03A 9RUBA 3DOPA 2QCGA 3KW3A 3R8HA 1S5TA 5BMWA 4FF5A 4ERAA 2E1WA 1BXBA 2ZVRA 2PLJA 3W7RA 2PD5A 1F7BA 3H2NA 1AD1A 2DUAA 1MW3A 3G6MA 1A80A 3QW3A 2WPBA 3T0BA 2WXDM 2ZTJA 1XGDA 9CGTA 2WJDA 1QUMA 3WJYA 2E0PA 3MHFA 3W2JA 1BF6A 2R14A 2INZA 3HPAA 3M7SA 1XQKA 3EWZA 4IPLA 1UZ4A 2GYIA 1GVFA 1WBJA 4OOZA 3A23A 4HNLA 3VABA 3PUOA 1FX6A 2BGNE 2POZA 3CWNA 3DENA 3II1A 3U6WA 4DQWA 5I03A 4WY0B 5C2GA 4YXGA 3ZM8A 2FZ9A 5T26A 1KFLA 1XLEA 1B54A 2PDFA 4XAPA 4X2RA 3JUGA 2ZRXA 3M0VA 1KXHA 1JZ5A 4J3TA 3SADA 4AMAA 1GQLA 1RXOB 3VD9A 1I2RA 3W25A 4HPHA 5H8PA 3DKLA 5HUPA 3OLDA 4DXVA 4LJ3A 5BRQA 3KWSA 5D2YA 3U7BA 3NCOA 2BASA 4UQDA 3RX3A 4P5UA 3AZTA 1HKKA 3RR4A 3B8TA 2FJUB 1E6XM 2ZUVA 3S5OA 4X0VA 1DHPA 4F3HA 3KBVA 3U2ZA 5LNWA 3ZYZA 2QR6A 5CC6A 3WLRA 1UD8A 1AA1B 2WAGA 2FHFA 3AUJA 1Q6QA 3G5EA 4U2YA 5DY2A 4A8LA 2CZ5A 3T42A 3FW6A 3BAYA 1T8QA 3SR7A 1ZS2A 2VFIA 2CESA 3AIBA 1OIFA 4N6FA 3OODA 5FJOA 3T2OA 3HBLA 2XVLA 1GVYA 3N18A 1GOOA 3UNDA 5EFDA 3JW7A 1FTXA 3PUGA 1YYAA 4O16A 3UVAA 4MZ8A 4G9PA 4HU0A 4A35A 3QOKA 2PZ0A 3H4GA 1OT1A 3F2CA 1PX8A 3NQ2A 1TR1A 2R9RA 3WJWA 3AXMA 3DUGA 5AC8A 2QDGA 3VYLA 1U2YA 3AHTA 1J01A 1OYAA 3LZ3A 3O16A 1GTHA 3TR9A 1BKSA 3R0KA 1B3ZA 2QT3A 3LRLA 1LL6A 2NT0A 1H7NA 4WR3A 3R58A 2W3ZA 4GACA 1XBVA 3CHVA 5E0KA 1ME7A 3S3GA 2YPIA 1UR1A 1XV8A 3IS4A 2E5BA 1PKLA 5G1MA 1K70A 3MWCA 1E51A 4IM4A 1E40A 4LH8A 4M6VA 5FACA 1VJIA 4XB3A 3GTNA 4KIEA 3J7HA 1NARA 1UUMA 2P53A 3EEZA 4HZ6A 3SQMA 4A2RA 2AL2A 3R2GA 4CVWA 5CGMA 3WLMA 5H8UA 4FNRA 2ZUNA 4TO8A 4C1NB 2Y5EA 1Z7AA 2W4XA 2E67A 4GI8A 3TN5A 4M6PA 2HBXA 2ZYFA 3H4XA 4CVUA 3L5MA 5IXEA 1E71M 1XUUA 2E5CA 3FK4A 3KLKA 3A13A 3TIMA 5F2LA 5LIYX 3GQYA 4MB5A 3CS2A 3TZNA 3H4WA 4OV9A 1G4SA 1SMDA 4N9DA 3UT0A 3HFTA 2YXOA 3IRSA 3H7UA 4C6CA 2IKIA 1C90A 2OR2A 3ANYA 1HKIA 4AD0A 2X1SA 3F5JA 1TPH1 3G77A 1A47A 4LV4A 3MDUA 4NXSA 5BROA 3LM7A 3WLKX 1GZGA 3SB0A 3EDEA 4CKQA 4D72A 1GYNA 1M1BA 5LNRA 3B9OA 4GRSA 1NWSA 1B4KA 2X1IA 1GVSA 2CLLA 2GL5A 4EPBC 3H12A 3BMVA 4LQ1A 3E96A 1JCTA 2ZFAA 2HQAA 1OFDA 1IEQA 3CM4A 2V8ZA 4LUSB 4NZFA 3CHDA 2BZNA 2JFEX 3MCOA 1UH2A 4YLWA 5HPOA 3FVMA 3FEMA 4B16A 4RXFA 3W6YA 1UR8A 3TDFA 3BH4A 2FZNA 3UGRA 3B3DA 4N9EA 5BMXA 4DJFC 2OOGA 1MQPA 5DT5A 3RLGA 1C3FA 1Q6DA 4IMAA 4I9MA 3B05A 3CZEA 5KINA 1JRCA 4H2HA 2E40A 3AIVA 4N42A 4GXMA 1G1YA 3F03K 5AY7A 1O6IA 2QKFA 1C8VA 4CQ8A 4AH7A 3UA3A 4AZ5A 3T7VA 1UB3A 3JR2A 4XUGA 4A21A 1O1HA 3QQ0A 3LLFA 3HMJG 3BGAA 3SFWA 3KOYA 1UJQA 4OBRA 1WZKA 4JS3A 3H21A 1H7RA 2XGIA 1IXOA 4IWWA 1FCQA 1W91A 3NXFA 4FP1A 1QNVA 2FVLA 1FXPA 1JFHA 2J7GA 3TW9A 3ZT6A 4H6KA 3UR5A 1W5MA 1CIUA 3FKKA 2W5FA 2WZEA 4Y9NA 1VF8A 3DI0A 2MNRA 3LBOA 3MY9A 3DX5A 3VGEA 1FWJC 1T99A 3OZMA 5FIPA 4J27A 3PZTA 4LALA 2R1KA 2RDTA 3QSRA 3A4WA 4WOZA 1MQQA 4JNZA 2QJMA 1YXDA 5C9UA 1UWSA 1SJCA 3DHPA 2QJNA 5TNVA 1BVZA 4I6VA 4P8XA 4HK6A 4FOKA 1A5UA 3CQKA 4U5KA 3NDZA 1X1OA 3MMDA 1XH0A 2OZ8A 3C0SA 1PSCA 3BARA 1H51A 2YXXA 4LAUA 1POJA 4A3YA 4LX4A 3WBAA 4IP7A 3QZ6A 3PR2A 5GNYA 1Y0EA 1YPXA 4QNWA 3P82A 5F4SA 3U57A 3PANA 1FCVA 4FLRA 4LT9A 4HBKA 5HR6A 3MMWA 3T2QA 3VNIA 4Y90A 1YE6A 2VMFA 4BA0A 3LHVA 1I2QA 4HQVA 3RJXA 3GHUA 5F2IA 3S8HA 2GUBA 2J7BA 4GGBA 4HNCA 1AL8A 4Z2HA 1SW7A 2HNHA 1H61A 3AIUA 1FWAC 4FX7A 3ITYA 4CN4A 3W7KA 3ZOAA 1LJYA 4RR4A 3RO6A 1W56A 4AUBA 3PVFA 4GX8A 1OG6A 3WH9A 2NQJA 2WSYA 4B5TA 2P3EA 3OGRA 1XBXA 2BGQA 1MZRA 4MSSA 2XH2A 1QPNA 1DE5A 2ZRUA 3JZEA 1UA7A 4E4PA 1JIBA 1MMFA 3AYTA 3AISA 3SEPA 5FSEC 3SDOA 3OLEA 2E6FA 4MY8A 5AECA 5I3IA 2DZVA 1CZ1A 3G1FA 1LCOA 3CQIA 4BI7A 2RH9A 1DJNA 3AUOA 2XFRA 2QZRA 3EOLA 5A95A 5C9ZA 1EBHA 3RLUA 4Q8MA 1TQJA 2EG6A 1CXIA 4C90A 3W1AA 1UJPA 4ZSTA 3UPMA 3QPZA 1XLJA 4E3VA 3GKAA 4C1NA 1EWEA 1CEOA 3OQ8A 5BXSA 3W1MA 1IZKA 3SCOA 2IW0A 2X1UA 2QGHA 2PU0A 1AH3A 1F74A 4XAYA 2F6KA 2XU2A 3ARXA 3GYEA 5EL1A 3SZ8A 1V0MA 4P7OA 2RUSA 1LWIA 1ONRA 2EF9A 1TA3A 3VK5A 1NF7A 4HNNA 3FEQA 2ZUSA 4AMCA 1BWLA 5IHSA 3OZPA 3WELA 1DIDA 8XIMA 3WMSA 4NKCA 3W88A 3M0YA 3RG6A 3N9SA 4GUIA 1JI1A 1XWYA 3KVLA 1H49A 4PTMA 1ZFJA 4MYAA 1XPGA 5I3FA 3VGDA 1CGUA 1OC6A 4E8GA 4FX8A 3W84A 3LHWA 3MSYA 4F40A 2X30A 5HINA 2YCIX 3VKDA 4WSKA 3MUIA 4OU1A 2VENA 3TSDA 3CAKA 2WKJA 1H1ZA 3FYPA 4JIPA 3IJ8A 5CZ0A 3UYCA 3VOFA 3OP2A 1MRAA 2C19A 2BOEX 1SFJA 3GFYA 3TNOA 2PTDA 3IACA 3NUKA 3TEVA 1Q65A 5DLCA 3W75A 3LV5A 2E3ZA 3P6LA 2G97A 3CH0A 1H0GA 4S3BA 3TFXA 3W1NA 4XV0A 4ZFCA 1KGWA 4A22A 1CNVA 3HJZA 1P0EA 3VCNA 1FRBA 2DZPA 3WLPA 3KWXA 1JUBA 4HYWA 3TQKA 3MHGA 5D8ZA 1DXFA 3F4WA 2YYUA 3OVRA 3S1GA 2BV9A 4HP5A 2PRLA 3VNYA 4MAVA 1EDTA 3NDOA 1EC7A 2VC7A 1EF2A 4CCZA 2D0FA 3B9AA 4IXHA 4JN7A 3TU9A 3GE7A 3LHYA 2IS7A 1TMQA 3NYDA 3GVVA 1DQUA 1KBJA 2KAUC 1KC7A 2A3BA 3FGCB 1ZBVA 5TIMA 3OLIA 1LQ0A 1VPYA 4LTSA 1UH3A 1V0LA 1M7JA 4D8ZA 2PTYA 3IV3A 1H50A 3K8LA 4GC4A 5AC4A 1XLGA 3S5NA 4K8GA 2PF8A 2P10A 2R82A 4OHQA 4LW7A 1Q6OA 4RL3A 3L4ZA 2GWNA 4C6MA 3W87A 4XBJA 3W2NA 3NPUA 2PDKA 1T5AA 2HPIA 1NEYA 3LV6A 4F66A 1VCGA 4AXNA 4A8NA 3FFSA 1IHIA 2IKHA 4H00A 3DGBA 1OD0A 4V28A 4DN1A 3SAZA 3UZWA 3B0PA 1BTMA 4R5EA 1TA3B 3KVKA 4NNCA 1OABA 4DF1A 4MNMA 4HD5A 2A7NA 1CYGA 2P8BA 2HK0A 1MVYA 2V5JA 3QN3A 4DVOA 5AOUA 2ZE3A 4CNUA 4OTKA 2XVNA 5KZMA 3H55A 3PP7A 3TYCA 1I1WA 2OODA 3ES8A 4J40A 1SM9A 1V6YA 1WPCA 2QCEA 1WO2A 1S5MA 3UXAA 3NL3A 1VCVA 1D7FA 5G1TA 3ZZ1A 5CEWA 1K3UA 2XIJA 5JH1A 3S1UA 5DMMA 2NUXA 4GCXA 1TCDA 4MPKA 2I16A 3GVRA 1PPIA 2DVXA 2E25A 1TG7A 2R1PA 3OBKA 4QXIA 4YTQA 1ECQA 1YBQA 3LPGA 2Y4SA 4AD5A 1OT2A 3CWHA 2OX1A 4E2DA 4DZAA 4JOMA 4PMZA 4C6EA 1G6CA 2Y7EA 4CD6A 4BY3A 6A3HA 5M2FX 1EBGA 1O95A 4ONVA 3N34A 2Z1SA 3B0XA 3C6CA 4DWSC 4IQJA 2Z29A 1MXSA 3D46A 1YXCA 3CV2A 4GNKB 3C4UA 1E4LA 3TW7A 4WKAA 4CEUC 5BOEA 3S2CA 3PBYA 3V0SA 3GNPA 2H3DA 1WKDA 3LI1A 4S3AA 5KZEA 4ICMA 4A3QA 3LQLA 1S46A 4XZLX 4A3HA 1R6WA 1EKOA 1UC4A 1E1CB 2YBVA 4S38A 4JTJA 3IV8A 2YL6A 3U2CA 3APGA 4D71A 3WIJA 1WX0A 4REQB 2B4GA 3WL0A 4DJFD 1I0DA 1V0KA 1FWWA 5CPTA 2FTWA 4LNYA 1UWUA 1XIMA 3UERA 3LSCA 1J11A 2FPVA 3QVQA 4IMCA 4B5UA 1E3ZA 3OZOA 1PHWA 3S2MA 5MF5A 2Y24A 2O9OA 3CV6A 4Q4KA 1V7YA 4RPPA 4CQCA 3BJTA 4MGGA 3PB0A 3ITXA 1GKRA 4IFKA 2ZXBA 4H04A 4CU7A 1CCWB 4PUMA 5DBTA 1J0KA 2HVNA 1NFGA 4Y2WA 5ENLA 4EX4A 3W4RA 1HP5A 3RMEA 5CC5A 3VM5A 4MFEA 3NQ6A 5FJJA 1EP1A 3B8WA 3HG4A 4U4MA 4ZO8A 1U1HA 4IPIA 1ZLPA 4JTKA 2WWDA 1BXCA 2ZRVA 2EPLX 1D8CA 1ESWA 2ZXQA 3VIIA 3P81A 2A3AA 4O19A 4GHRA 1PKMA 4JIQA 4UXDA 2W0UA 2PURA 3DG3A 3ZVHB 1TQXA 1M3UA 4O54A 3NL2A 1PTDA 2QDHA 3WQFA 1KFJA 1Q6RA 1EOMA 1HL8A 1V93A 1EHNA 3H2EA 3LS9A 4HPGA 4CU6A 2WMFA 3P93A 4K37A 4JHZA 2VC9A 3MA8A 3I3BA 1L6YA 3C52A 1IIGA 3WBEA 4JDYA 1L9WA 1JPKA 2ICSA 1LUCB 2FDSA 3MUCA 3CYVA 1XYMA 2FFCA 4AZIA 1EDQA 3AWOA 2ACRA 2V5BA 3MSDA 4L5ZA 1DQXA 4DNHA 3VOCA 2C15A 2XM1A 2P88A 3TJ4A 3U3HA