4JTDA

Crystal structure of kv1.2-2.1 paddle chimera channel in complex with lys27met mutant of charybdotoxin
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
326
Chain Sequence
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein/toxin
molecule keywords Voltage-gated potassium channel subunit beta-2
total genus 121
structure length 326
sequence length 326
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4jtdA00
3CV6A 4G5DA 3T42A 1YNQA 2PEVA 1XF0A 2A79A 2ACUA 1Z89A 4WEVX 2DUZA 4LBSA 4FAMA 1VBJA 3RX4A 4ICCX 3N2TA 2ISFA 3LZ3A 1XGDA 3H7RA 3UZYA 3U2CA 3ONCA 4WGHA 2I16A 4XZLX 3NTYA 5KETA 3RX3A 5AZ0A 4XO6A 2PDKA 1US0A 3C3UA 5LIYX 3BV7A 4JQ1A 3M4HA 4JTRA 3F7JA 4R9OA 4JQ3A 2NVCA 3WBXA 3N6QA 4WDTA 2PDGA 4QR6A 4GCAA 2PDHA 3UWEA 4F40A 2CLPA 4GQGA 1YE6A 3VXGA 2ACRA 2PDFA 3V0UA 3BCJA 4XVDA 1T41A 1IHIA 1XJBA 5LIWX 4PUWA 5C7HA 3R6IA 1X96A 2BGSA 4QX4A 3DN5A 2PDWA 3WBYA 2PDLA 5LIXX 4JQ4A 3LQLA 2PDBA 4RPQA 2FZDA 4XK2A 1RY0A 1AH0A 4XZHA 2IPJA 4PR4A 4DBWA 2WZMA 3R58A 4LBRA 4GABA 3GHSA 3QKZA 4GIEA 2PDYA 2AGTA 1ZGDA 4PRRA 4FZIA 2HV5A 5JH2A 1M9HA 3O3RA 3COTA 1HW6A 4JQAA 3V0TA 3V35A 4JTDA 4XVEA 4YS1A 4JTCA 1EF3A 3M0IA 2IS7A 4XAPA 1Q13A 3EAUA 1PWLA 5AZ1A 3M64A 2HEJA 3CMFA 4JIRA 1R38A 2F38A 3DOPA 1MZRA 1S2AA 1RY8A 1SM9A 3LQGA 2P5NA 1A80A 2PDXA 3G5EA 3B3DA 3G1RA 5HNTA 4JTAA 4MHBA 2IPFA 1AZ2A 1PZ1A 1YNPA 2IKHA 3RX2A 3P2VA 2FZBA 3LUTA 4LB4A 4WRHA 3UYIA 1Q5MA 4I5XA 1Z9AA 4JTQA 2PZNA 3UFYA 1IEIA 1EL3A 4Q7BA 3GHRA 4AUBA 3KRBA 2R24A 1MI3A 3LEPA 5LIUX 4NKCA 3O0KA 2INZA 1ZQ5A 3WCZA 4YU1A 4DBUA 2ACQA 2PDMA 3BURA 3LNMA 4H8NA 1ADSA 4XZIA 3H4GA 3H7UA 5M2FX 3UZXA 2HVNA 1RALA 4EXBA 4GQ0A 4YVVA 2PDJA 2PD9A 2J8TA 2HVOA 2QXWA 5DANA 4L1WA 4L1XA 3GHTA 2IKGA 1PYFA 1GVEA 3R7MA 3Q67A 2PDQA 3Q65A 1AH3A 2HE8A 2WZTA 3WBWA 5LIKX 3FJNA 2DV0A 3UZWA 1ZSXA 4LAUA 2C91A 1AFSA 1FRBA 4OTKA 1C9WA 3LBOA 4YVXA 4PMJA 1YE4A 2VDGA 1UR3M 1ZUAX 4HMNA 4QXIA 3EB4A 4XZNX 4GA8A 2IPWA 3EB3A 3UZZA 1PZ0A 1T40A 2F2KA 3FX4A 2PF8A 5HA7A 3V0SA 1EXBA 3LN3A 2PFHA 4QBXA 3GHUA 1LWIA 1S1RA 3ERPA 2DUXA 5JH1A 3GUGA 1QRQA 2PDPA 2PDCA 3D3FA 2FGBA 2HE5A 3BUVA 3S3GA 4GACA 3ONBA 4EXAA 1PWMA 4ZFCA 2FZ9A 4JIHA 2PDUA 1OG6A 3CASA 2PD5A 4PUUA 4LAZA 1MRQA 4H7CA 4DZ5A 4XO7A 3LD5A 4JIIX 2NVDA 4PRTA 2ACSA 4IJCA 2PDNA 2PDIA 3LZ5A 4DBSA 1LQAA 1S2CA 2BGQA 3R43A 2IPGA 3R8HA 4FALA 2ALRA 1EKOA 3V36A 2I17A 1AH4A 1K8CA 4FA3A 1J96A 3UGRA 4WDWA 3CV7A 2R9RA 2IQDA 4HBKA 2BP1A 1AZ1A 4JQ2A 3CAQA 4IGSA 3CAVA 3R8GA 4ASTA 1X98A 1Z3NA 3R94A 5HNUA 3UP8A 3LENA 3MC5A 4WDXA 2FVLA 1S1PA 2IKIA 4IJRA 1QWKA 2INEA 2IKJA 3UG8A 1VP5A 2IQ0A 2FZ8A 2HDJA 3WG6A 4LB3A 4WDUA 4YVPA 4Q3MA 4XZMX 1HQTA 1JEZA 3MB9A 1Z8AA 1X97A
chains in the Genus database with same CATH superfamily
4RV3A 1I9CB 4HGXA 4G5DA 1YNQA 4BQ4A 4RZ4A 2B7PA 2WMGA 3AXKA 3CTLA 4DJEC 1WP6A 3OJGA 1V4YA 5CXPA 3L66A 1ONXA 1YDVA 1IIHA 1V93A 3T81A 1FY6A 2J79A 4DPPA 3Q37A 3EX2A 2DZSA 3PUDA 3TNBA 4RR4A 2G4JA 2IQTA 4AEEA 5JIPA 3A9IA 3NQAA 4C6DA 4LRSA 2F84A 3CQJA 2Y63A 3RPMA 2Q09A 3BGAA 3F7JA 1L0PA 1TPVA 2WJZA 3QMTA 1XPYA 1FBAA 1RA5A 3T44A 2G3MA 3RRAA 2WMJA 4M19A 1PUDA 1GCYA 2YIHA 3A4XA 3BSGA 4UFHA 4LYPA 1X6UA 4LC8A 5LGZA 4AMCA 3TCEA 2IXUA 3LXAA 5A6JA 3W02A 2OT0A 3STFA 2FFIA 4D9PA 4AC1X 3RLHA 1GEQA 4AZBA 4TV5A 4R53A 4LS1A 4LAMA 4AX6A 1XXXA 3TYAA 3EDJA 4W7UA 4IIHA 1H49A 1EWDA 1M41A 1W5PA 1V77A 1NJJA 1O4UA 3G0SA 2ZC1A 4X63A 5D9MA 4NUWA 2R8WA 3WO8A 1SJBA 5LSMA 4D71A 2Z4GA 3O3RA 1S3HA 1HW6A 4J2MA 3KZPA 4BCEA 4AHQA 3V0TA 2RH9A 3S1UA 2Z29A 4R88A 2JQXA 4W7VA 1GKRA 2GVYA 4M56A 1BVZA 4OIFA 1MQRA 3PNUA 3MZ2A 4IPJA 2G3JA 1JPMA 2YCEA 4C60A 3IJIA 5M17A 1VFOA 2DVXA 3LCXA 1AMYA 3PNZA 1IXQA 2G37A 1AW2A 3HOJA 3OIHA 3T8LA 3WSUA 3DHDA 4HTBA 1UQYA 3LQGA 3ICJA 3LV6A 2QMKA 1Q6EA 4HNLA 4IISA 5E6ZA 3T07A 2JKEA 1EEXA 1TVPA 3W88A 2IKHA 1XIEA 2FGZA 4UTHA 1ME8A 3WFAA 3VE7A 4LU0A 3PZ9A 3TC6A 2A7NA 4KKXA 5D02A 2NZLA 2NX1A 4KIEA 4MFDA 4OBRA 1XCXA 1IZCA 1PXGA 5FEXA 1YADA 2YLLA 2R82A 4U33A 4ZTYA 1SR0A 3QSRA 3VIIA 4LW7A 4JDBA 1S3TC 1VIZA 1XR2A 2VDIA 8TIMA 2PRMA 3QPYA 2OT1A 4JTTA 3GXIA 3TJLA 4AX7A 4NNAA 3H4GA 3ZXWA 4U2ZA 2BVTA 5KITA 5IHSA 1VFFA 5FF2A 4FNQA 3RPTA 4EXBA 3DBPA 3GDKA 1R6WA 3CZGA 5T91A 3WLIA 3RILA 5DANA 2X0YA 3DC0A 3LV5A 3CB3A 5FF7A 3GDMA 2OXNA 3L2LA 1TIWA 3GO2A 1OABA 4DYJA 1Q6DA 3KFTA 2YDAA 3PR2A 5D30A 3E2SA 5FF3A 3M0KA 4US5A 5A6TC 1ZB5A 3NVTA 4GYJA 1P6CA 2V0TA 2WZTA 2YLAA 3E96A 3HPFA 4E8CA 1RK6A 3IRDA 1HKJA 4XWUA 3MU7A 5BXRA 4PMJA 5G4HC 4PGLA 3SUWA 3E6EA 1XL9A 2WHJA 3C2FA 4HMNA 3BLKA 3MMDA 1UR2A 1A5UA 2XTKA 1QOXA 2DSKA 3NURA 1TPWA 2Q6ZA 4MZYA 2Q8LA 3V0SA 3SURA 2A1YA 2E40A 3WNLA 1VFUA 4U4MA 1UWTA 4KGLA 1I2QA 4PN2A 2WSYA 5EYWA 3IUDA 3PZQA 4GO8A 1BWVA 4IIFA 3LA4A 2ZWYA 3ECQA 3PN8A 3CIVA 4YWSA 1POKA 3ABOA 3EOLA 2GGHA 5I23A 4QEEA 5BRBA 4L9ZA 4ZR8A 5CGTA 3G1VA 1XW8A 3F4CA 1GQKA 4BJHA 1WBJA 1TVLA 1KV8A 3R12A 1P0DA 4PMRA 3GR8A 2XH4A 4WZHA 1LRTA 3SFKA 2VEGA 4UXDA 2ACSA 4AW7A 3RFAA 2DH2A 5A3HA 2E4TA 2VZUA 1IYXA 2D2GA 1F9CA 3GNNA 3R8HA 2XPKA 2ALRA 4LQ1A 3OVQA 3HO8A 4NJIA 3W6MA 3Q4DA 3FYOA 4PTWA 4JCMA 1GG0A 1W3TA 2YCJA 4D6GA 3KOXA 2WC4A 5LA2A 1KFKA 3VGBA 3P61A 2QHAA 3NSXA 3ARUA 4LY4A 1QPQA 1C3FA 1VLWA 2C0AA 4W84A 5I09A 4ZSUA 3H22A 3IVUA 2RKXA 3QTPA 3NQ6A 1B3ZA 3CUFA 4WVXA 3P67A 5I02A 3WJYA 2CWNA 5JVLA 3V18A 2IKJA 1VBRA 2YFOA 5EFFA 3VCNA 3NDOA 2YCIX 3VC5A 3VILA 2J62A 3O07A 4ZZ9A 1YXYA 1DWHM 1XS2A 3WLPA 2ANUA 2V69A 5AOUA 2GDVA 1Z8AA 2X09A 1M53A 4IH3A 3W1RA 5A2CA 5T26A 3CK5A 1CWYA 4IMGA 2DUAA 4AD2A 4HPNA 4K7YA 4MSSA 5IRPA 1J2BA 1UD6A 4NF7A 2C18A 4O8AA 1XIFA 3GAYA 3BAIA 3P81A 1HJWA 4C6LA 2V5JA 3N29A 3TSBA 1XGDA 1TUXA 5DLCA 1Q65A 5CSRA 4MKNA 1CXKA 2R1PA 5FKYA 4IMEA 2BSLA 3OIXA 3WFZA 2ZX6A 3B05A 1EJXC 3BV7A 2NX3A 3QY6A 4A3QA 1VFLA 4GXMA 3O15A 1OX4B 4WK9A 3N9RA 1R0MA 5LYRA 3QLLA 1P1XA 4UTTC 2D1ZA 3H54A 3UCCA 5MKGB 2VVSA 4HPXA 3UZJA 4A4AA 4O4VA 1VFTA 3QQ0A 2PF0A 4NX5A 2Y2WA 3IS4A 1CI1A 1XIJA 3PBUA 1TWDA 1W3JA 3GFZA 4PUWA 3SW6A 5E6YA 3QFWA 4Q6JA 3WBYA 5HJLA 1Q7MA 4R5EA 4BEQA 3GTIA 1FWSA 1WDDA 2F6UA 1V03A 4AIBA 2W92A 4RDZA 3HGJA 5F4WA 3GHSA 1FWIC 3NQ2A 5C9UA 4O50A 4L9YA 3ALGA 1EFZA 5AECA 3MI2A 1B4EA 3UPMA 3GUWA 5GJNA 3WQCA 5AC6A 3SCVA 5JXQA 1NU5A 1H0IA 4FX6M 5JU6A 1I2PA 3NQ8A 1EZWA 1F7BA 8A3HA 1PX3A 4TTGA 3U9IA 4B92A 3N17A 4JTCA 1JDAA 1V3IA 2E09A 3M0IA 1OK6A 1QU4A 3KHDA 1LG1A 1QNOA 5B7YA 1MRAA 4HSHA 2HVMA 2DVTA 2FKPA 1EPXA 2YL9A 2X1SA 1MSSA 1PIGA 1KKRA 4QDWA 3VDHA 3C4UA 3DOPA 1PJ9A 4Q4MA 1DQWA 3OZYA 4KCTA 3C2VA 3W6LA 3MHGA 1D8WA 4CU6A 2QF8A 3AZSA 4PMDA 1WXYA 3UESA 2DEPA 4JZ5A 1JUEA 4S3AA 4WKHA 4KH2A 4F3HA 1OF8A 3MKCA 1AVAA 3VINA 4X9YA 5JUVA 1QNRA 4QLJA 4HYRA 2ISVA 3GFXA 2ZZ3A 5HK4A 1NF7A 1BWLA 3KBMA 4ORIA 3KRBA 3OZOA 3TN6A 3ANUA 3T0CA 1LP6A 2VMFA 4G8TA 4JN8A 5E9XA 3SIZA 2OG9A 4MUZA 2D3LA 3WQ6A 2I57A 5FF0A 3CUIA 1LYXA 2BMBA 2V8ZA 3BVJA 3AXMA 4BF7A 3WD1A 4AZGA 2EPNA 1LQ2A 2HVNA 2E5DA 1U5JA 4AWEA 3PHAA 4CNSA 2HS6A 3UWWA 1TQXA 1PIFA 4JKMA 5I5RA 1OCBA 2XIQA 1NWRA 3UQNA 1L8NA 3GNRA 1J12A 1LORA 4QE1A 1H1NA 3F4DA 4W8LA 2ADAA 1GVEA 3C61A 1TREA 1JZ4A 2E9MA 2BODX 1UP0A 3MPGA 4DBEA 2XN1A 2Z7GA 1DE5A 3FJNA 3VIGA 3P5ZA 1VFMA 5ECVA 4NU7A 3FJ4A 4M0XA 5XIAA 1W31A 3OB8A 2J74A 5MKGA 5KZMA 4RJEA 1I45A 2YZ5A 1KWGA 1UA3A 3EB3A 2XVLA 4M80A 4WY0F 4V1XA 1CLXA 2ISDA 3GSMA 2YB4A 1GOOA 3MO4A 3WNKA 3D3FA 3W27A 2FGBA 1V02E 2WVVB 3R0UA 4O57A 4QEHA 4UNKA 4HZMA 1L6SA 3C2RA 5LNUA 5I3FA 1R3YA 4Q4PA 5I00A 3O2LA 2WVSA 5C2XA 2CHNA 1R9YA 4N2YA 1OIFA 4ZFCA 2QPSA 4JAWA 3SCTA 3GE7A 2W62A 4AD5A 2PA6A 3BJTA 4DZ5A 3MUZ1 2VR4A 3SRFA 3ARSA 2NVDA 1X1OA 4LV9A 2YDQA 5DFAA 2VURA 1TRIA 3DU0A 2A6LA 3W3OA 4ZVJA 4GUIA 3WLRA 4C5ZA 3PG9A 3IK4A 3UG3A 2G8ZA 2VEFA 4AD0A 2IPGA 4FALA 5ABHA 4ROQA 1AW1A 1RCQA 4QCEA 4HNOA 3OVPA 1PPIA 3WQGA 2G0WA 3XINA 2E25A 3U4FA 2GOKA 4XQ6A 3T0BA 3QPZA 4KFNA 1SZRA 3BMWA 7REQA 3R2GA 1X98A 3M0MA 2J25A 3FIGA 2ZRYA 4JYDA 4W93A 1RH9A 5FEZA 3LHWA 4PTXA 3LENA 1BTMA 3EX1A 3OZMA 3TFXA 2RDTA 3STCA 1OM0A 4JTIA 2A6NA 1YX1A 4IJRA 4OGZA 4J28A 3R13A 3WG6A 1NWSA 3VGEA 2NQJA 1X38A 3NDYA 4MDOA 3UERA 2ZOXA 4L1GA 1HQTA 4YCOA 4MB5A 2OLSA 1POJA 4J3VA 1D7FA 1HG3A 5JBDA 3N2BA 3NQDA 4PMNA 1BXBA 1RHCA 4JNZA 1WDPA 4L4MA 1W2PA 2CHRA 2WYSA 2O9PA 4NZ5A 4TUFA 4CCZA 2PWUA 5CZKA 3A6OA 4WGHA 4FF7A 1YQ2A 1WE5A 3HQNA 4XG1A 5AZ0A 3AZTA 4UTFA 4WKAA 3WUBA 1HGYA 5A1AA 3WF3A 3EZ4A 1LUCA 4ZOEA 1IZKA 1EDQA 4PMXA 3QEZA 1BF2A 3NVDA 4IQJA 2VX7A 4AXKA 4J3XA 1PKNA 3WBXA 3G0UA 1QW7A 3M0XA 3ENLA 5CBJA 3N6QA 3PZMA 3LMYA 3UR2A 3FK4A 4RXGA 3UWEA 3QR0A 3OA5A 4LAOA 1N8IA 2FHCA 3GVGA 1ODUA 3K1GA 4LFYA 2D73A 3W2JA 4JTUA 4GX9A 3LI0A 1GW1A 2FJUB 1TJ0A 1CGUA 2PDLA 3DIPA 5G1MA 3WJXA 3L5LA 4FX7A 2NQLA 4NZ1A 2G97A 5C2CA 4UMBA 1GPFA 1JCTA 5L9FA 5HMEA 1UOKA 2FQIA 2IXVA 3ES7A 1DE6A 4PB4A 1T8QA 3UPWA 4HKPA 2YJQA 3TE9A 1E3XA 3TAKA 3W1UA 1Y5WA 2D2HA 3L65A 1FP9A 1DP0A 4PCFA 1I2NA 4RE4A 5EA9A 4PCPA 4KWSA 1P6BA 5CEWA 1M1BA 2QCMA 4C1KA 1PIIA 3QSTA 4AB4A 1JNEA 2REQA 2IS7A 5CC7A 2DT0A 1A4MA 4DX3A 4S3FA 2CZFA 1H51A 1B0IA 3M64A 4BZYA 3CLWA 4FLSA 1ZS2A 1KKOA 2PLMA 2PE4A 8CGTA 5BWFA 3W87A 2BBFA 2HBVA 3ZWTA 2DW7A 1XFBA 2F7FA 3ITOA 3HG2A 2VL4A 2QCLA 1IEVA 1J0HA 2NWRA 2V68A 2WJDA 1DJNA 3E49A 3H4WA 1HVQA 3RUBL 3S1XA 1AQFA 3HG5A 4Q8MA 3QV7A 1PYMA 3PUEA 2FZMA 3LSCA 3EDFA 1RAKA 4EVZA 2QDEA 2XVPA 2PZNA 4LUSB 2H3BA 1MMFA 1Y8BA 1S5MA 2ZE3A 4NZFA 1AQHA 1RPKA 1TUFA 2J7DA 1F76A 1DXFA 2PC8A 4E2BA 1PKYA 1RVGA 1ZTVA 1ISYA 3ME3A 3N6HA 1DWIM 1B5TA 5AHMA 4JX4A 3FYPA 1WZMA 3DCPA 4MF4A 4LYRA 3LBCA 4FXSA 4PFHA 3F2CA 2V3EA 5I3HA 4ZEPA 3PFRA 4IWWA 3GDRA 2FH8A 1HP4A 1SO3A 1ALDA 2A7PA 3LHTA 2D24A 2J8TA 5KSWA 5CZSA 2AMXA 5DN1A 2WZHA 3DFTA 2YPIA 2UWFA 5HUOA 4O28A 2QGYA 4FS9A 3NGFA 2FYMA 1VPXA 5LIKX 5LHFA 2XWEA 4H9UA 3S5NA 3RITA 2G5WA 7TAAA 1BVNP 3VCCA 2B31A 3VMPA 3AXHA 3GLCA 3E38A 1YE4A 3QR3A 4IPIA 4EF8A 3LLXA 1ZUAX 2OU4A 1PS9A 4KWWA 1Y5XA 4LVDA 3RCMA 1JPDX 4HZ8A 4ERAA 5HA7A 3VVGA 3LN3A 3S9ZA 4BS0A 1TO3A 3PWIA 2CBJA 3AISA 2DUXA 3JS3A 2GGJA 2VZVA 2VHLA 2W0UA 3KDOA 3UA3A 4C6OA 5DCEA 1NFPA 1ELSA 3MJYA 4IG2A 3NEHA 4GQRA 4XKYB 1YXDA 4GD0A 4YHGA 1PWMA 2O4QA 3GY1A 4RDYA 1JUBA 3NOYA 1DOSA 1K3UA 4K2SA 2QVNA 2HTMA 4L61A 3IJDA 4CUCA 3WK3A 4AVOA 1JAEA 5AHNA 3Q45A 5TIMA 3WH9A 3NPXA 4DJDC 1E6NA 2YCKX 4Q4OA 2C19A 4NRSA 4PUNA 5CPSA 3THQA 2I17A 3W7OA 3VOIA 3RMEA 3STEA 1FKXA 4AH7A 4WDWA 2GWNA 4I9JA 5FA5A 2R9RA 1Z42A 1T6MA 4PUMA 2DIEA 4D6CA 3UP8A 4LEFA 3NAVA 1ZAHA 4RNFA 1E1EA 1RQBA 5KZ6A 1C8YA 4UIOA 3QV8A 1IXNA 1W5MA 3SGGA 2ZKMX 3W2UA 2E28A 3UY7A 2D20A 4U2YA 3UVIA 1TPEA 3T7VA 1VHNA 5M3WA 5E9AA 4JNYA 1I75A 3MP4A 1ZJBA 2D0GA 4AZ7A 5A94A 1GVRA 5CJNA 3GH4A 1FCBA 4ZO8A 3M46A 4XB3A 1I8JA 3SDOA 3TOPA 3VZZA 2ZXDA 5AKQA 3UWYA 3EDEA 5C5YA 1GWJA 2EGZA 5A6LA 3V5CA 4LJ3A 2EQDA 5F4XA 3P6LA 3ZLGA 5CLTA 5EFDA 3PJUA 2C15A 2VCCA 1K1DA 3LGGA 5CH9A 3ZT5A 4IICA 4E4UA 4ATDA 3EPMA 1LL7A 4AD4A 2GL5A 1FXPA 3C2EA 5A8PA 3NG3A 1MDLA 4CKQA 3PG8A 4K1WA 1J0IA 4P61A 4QITA 3MP5A 4PCNA 3WJWA 2Z0IA 3LY0A 3OGRA 3UJFA 3UJ2A 4OFCA 1L6FA 3RJXA 4AY8A 1KXTA 3RRXA 1B57A 1MEIA 3G2GA 1KRCC 2Y8UA 2VUYA 5K4ZA 2XJ7A 1R2RA 4QFUA 3DZ1A 3RCYA 1H7NA 4WR3A 4HJFA 3AIRA 4S3EA 3GG8A 1AG1O 1VC4A 3HV8A 3V0UA 2V5BA 1QI2A 5C55A 3ABRA 5DT7A 1R7AA 3MUAA 2VC9A 5C7HA 3T6CA 4DRSA 2PDWA 4H8UA 3VIFA 1MVYA 1DJQA 3SUSA 1E0WA 4KCWA 2OWCA 1FWGC 3SRHA 4K7VA 4PZVA 2WVVA 1WYIA 4URIA 1XRTA 3TTEA 1K6AA 3ITTA 4ALDA 4OECA 3GU2A 3H55A 4LBRA 1IGSA 2X2YA 2W4XA 1DXEA 4OT7A 1J18A 4R7WA 4FXJA 1DPMA 4LS0A 5T9CE 1TPFA 1XBVA 2RDXA 3COTA 2CBVA 1LTDA 1V5XA 3W26A 1HKKA 2Z28A 3CH0A 4LUTB 4GJIA 3N4FA 4RZ6A 3UJSA 3UNDA 1O7AA 2OO6A 1KV5A 1K9TA 1O5RA 3WD4A 1SU5A 4CD8A 3ARQA 3NZ1A 1F4HA 1BQCA 1C91A 4H19A 3GTNA 1QHOA 5KZEA 3AIEA 1BPLB 1XISA 2MANA 1NDZA 1R5YA 3AMDA 1PCKA 1ITUA 4E8DA 1XCWA 5H8UA 3APTA 3B8SA 4GINA 3TQKA 3A12A 4H00A 1Z32X 1J93A 2R94A 1KR1A 3FA3A 3ZMRA 4DAFA 4J3ZA 3WL1A 4HU3A 1UBSA 1UASA 1XIIA 1Q45A 4L4LA 4FOKA 2EF9A 3VAVA 2UY5A 1UR1A 2FPYA 3EOUA 3PWGA 3MI6A 1HGWA 4CN6A 4JNMA 1SW0A 3MVTA 2Z6JA 4NZ3A 2Y85A 1L6YA 3WDPP 4DO4A 2CKSA 5A6BD 2WWDA 4P8UA 3W1AA 4G9PA 2INZA 4A22A 1UOZA 2DQWA 2WNQA 2C1HA 3SJ3A 1XRSA 4QNWA 2VR2A 2HNHA 3DC8A 3NO5A 1H1YA 2QUUA 1FP8A 2F6XA 3V5OA 2ZZ7A 3GG0A 3PZUA 1YLVA 3TOYA 3WQWA 3NQGA 1XDMA 3CXOA 1B3OA 5CJ5A 2GDUA 3ATZA 2OODA 2XGIA 2QCHA 3LCHA 4HCDA 3TEVA 3P7YA 4G7EB 3BXWA 4CNOA 3HMCA 4MLJA 2G50A 5M1TA 1Q3NA 2ON3A 4UOJA 2DGAA 1JULA 3MBFA 1NQKA 3E5BA 3NL3A 1G4SA 3SCSA 2FVMA 3WBWA 2OZTA 3FNDA 3L5MA 3TC7A 3B03A 4IGHA 2Z1SA 4GI9A 3AI0A 3S2NA 2PCQA 5DQPA 3GXDA 3BW3A 3L4ZA 4GVGA 3M0LA 1MYRA 4ILSA 1US2A 1IEXA 3EWWA 3UZZA 3UYCA 5F2MA 4IP5A 1T40A 3E2VA 1GG1A 1XRVA 3PB2A 2ZX9A 3BGJA 4AXNA 3DUGA 1XBYA 2Z26A 4QP0A 2GQ9A 3RG6A 5DMNA 1RBLA 3SIMA 2VFFA 4P7RA 2CWXA 3KXQA 2YKKA 3F5KA 1P1MA 2JEQA 1KLZA 3PTKA 1P0NA 1VZWA 1XFCA 1ITCA 3OBKA 2PWDA 4DI8A 5AHFA 4H6QA 3DECA 3UGVA 2GWGA 3CHEA 5RUBA 1EGVA 2W27A 2Q8ZA 1Q4WA 3NQEA 3P0XA 1B3WA 4XZWA 4CNUA 2GQAA 3AXIA 1KLYA 3CPGA 1PTDA 3VX1A 4K38A 5LNSA 3BOFA 1YXCA 4Q4QA 2VVNA 3DEQA 3O6CA 4CU7A 2VWTA 1ZBKA 1O5KA 1HIZA 1K8CA 4MKSA 1WUFA 2WBGA 2YBVA 4M6QA 1GKPA 1TA3A 3T0AA 1OFBA 1E3ZA 2WLZA 2BP1A 1W9DM 4HYWA 5XINA 2WNNA 1OX5A 3ZO9A 3QR1A 5KZDA 1QO5A 1WBHA 1YDNA 1UKPA 4S38A 3NIYA 1GT8A 1A4LA 3A3XA 1FWWA 1OGGA 6TIMA 1PBGA 3BLFA 1YDYA 1ZP3A 4HOXA 3WENA 3W25A 1M68A 3AMGA 1EO7A 5HR6A 3TYUA 2OYKA 3GZAA 2YDRA 1LUCB 1ZLPA 4IPLA 2YYUA 2VQUA 4YIWA 2Y5JA 3S5OA 3SCNA 1SZEA 4MM1A 1A3XA 3LPOA 1KM6A 1AD4A 3NXFA 3IJLA 1TFVA 1XF0A 2VC7A 1ITXA 3WF4A 4PFMA 1LF1A 1XGEA 2VENA 1UKQA 4R27A 1WKFA 1QCWA 1UR8A 2X1RA 3NZRA 4XUGA 4YHEA 1WO2A 1OT1A 4ICCX 2AQVA 3E2QA 4J7RA 4YTRA 3LS9A 3RHGA 4MB1A 5EU9A 4Q8OA 2GGEA 3URQA 4RDWA 3A21A 1UD2A 2TPSA 2I16A 4LUYA 1E6SM 4UB9A 1E5JA 1L6GA 4D6FA 4DZHA 1E43A 4KEVA 3VKCA 3RO8A 2VDHA 5EMJA 1RBAA 3L5AA 4LX4A 1EBHA 3N19B 2O9RA 3TC3A 2A3HA 4TXEA 4GNVA 4AIOA 4B4FA 4MJMA 1EXPA 5FIPA 1WA3A 3WQOA 5EGRA 4LXFA 2V63A 3W70A 1TMQA 4WSKA 4AYGA 5A6KA 3THDA 3VOHA 4HNTA 3VXGA 1SZFA 3MCMA 2XH2A 4BQ3A 4XBKA 1PTAA 4GNJA 1XJBA 4WOZA 3L67A 1W32A 2FMOA 3R6IA 4P2VA 3GNDA 3PZGA 2E1DA 1QK2A 2FHBA 3KWSA 3QOMA 4JD4A 1VF8A 2C8NA 5LIXX 3OU8A 3WH8A 2TAAA 3D0CA 4RE2A 1IGWA 2V82A 1XCFA 4HQVA 4DBWA 1X7IA 2XISA 1G4TA 1T0OA 1GJPA 4WKFA 3L7RA 4D2JA 3K1DA 1JUKA 2ESCA 1KD0A 4FZIA 1EF2A 2VGIA 4QG8A 2PAJA 4FNSA 3GU9A 3HB9A 3NCOA 5BMWA 3D47A 4JTDA 3GXNA 4LUIA 1GOKA 1H7RA 2VX4A 5CSSA 3PZVA 1UIPA 1Q6QA 1OFDA 4JTJA 5I78A 2WMKA 3QMRA 3QC3A 2ZUUA 2VO5A 2GFTA 4WLCA 2BGNE 1V02A 5SWUA 1E6RA 2OX4A 3I6EA 4GX8A 1FKWA 5AZ1A 2PU1A 2VOTA 3MWAA 5K3VA 2QPUA 1SFLA 2F2HA 2GVEA 2GSHA 3POCA 4GC3A 6REQB 2EG7A 3R79A 1PDYA 2C16A 3WLLA 2FTWA 3NM1A 3HQOA 2EG8A 2P3EA 4HPJA 3M6YA 3LMZA 1XV8A 4GH3A 3L68A 3VGHA 4JTAA 3KWXA 4TQTA 4PYSA 4NHVA 1PZ1A 2OR2A 1TPUA 1H0GA 2XIJA 3P2VA 3FSTA 3T2QA 1FHUA 2B7NA 3QTGA 4W5ZA 5AC8A 1RJQA 1OFOA 1QI0A 4NI3A 2D0HA 5DY2A 4JR5A 4GBUA 4JTQA 1EHAA 4LY8A 4LRTA 4B5UA 3O6YX 4HA4A 1JF5A 3W75A 2A3AA 1HNYA 5LIUX 5BRPA 3FY1A 4ZQMA 4R7OA 1JPIA 1BEUA 2WC7A 1PHWA 1WKEA 3AMLA 3VNZA 2Y4SA 4BI5A 1FVPA 1N2VA 2TRSA 5C8BB 4FXFA 3A4AA 1K9FA 4IPPA 4ZQCA 5ECUA 4B5TA 2WJEA 2OPJA 2XIIA 9XIMA 3A5FA 4I7VA 4RL3A 1AQMA 1CXLA 5F2GA 1UKOA 3TA6A 3W86A 1V08A 5IBXC 3KRUA 2CZDA 4GQ0A 1VYRA 5F1UA 3VM5A 1OYBA 3B0UX 4YVVA 3B4YA 1OWQA 4Y9PA 2PD9A 1ZP4A 2QCEA 3VFLA 1TCMA 2PP3A 1E6ZA 1V0LA 1FHVA 2IKGA 3CC1A 4HHPA 1UWRA 1PYFA 1F05A 4S3CA 3VOCA 3W83A 3R7MA 3Q67A 2ONEA 5IXEA 1AH3A 2VR5A 2VKZG 5TF0A 3DFPA 5AC7A 2X42A 1RK5A 2GDQA 1B3XA 2QS8A 5U4NA 2I5QA 1XYLA 4HSOA 3F4NA 4W85A 1K6WA 1EDTA 5EBAA 1ISZA 3ANVA 5E70A 2DSVA 1JRBA 3TV8A 5BXSA 4M6VA 3UVAA 3SY8A 1XG4A 3AFBA 4I5UA 2ZXBA 2PF8A 1SPQA 3QH2A 3T2PA 1BVWA 2QPXA 1ECEA 2Z27A 3OQ8A 3GHUA 3PC0A 1J8VA 1A5NC 3A4WA 1Y65A 5CC3A 4XKMA 2J24A 3GUGA 2WHMA 3ZLFA 2PZ0A 3R89A 3MSDA 1A5MC 5H2ZA 1GYNA 1KBBA 1XH2A 1XH0A 1XYCA 1SJDA 2NUXA 4A3RA 3SUUA 2Q01A 4YMZA 2VEKA 3IIOA 3FHQA 5DBUA 4EACA 1CXIA 5D03A 2I9UA 1NP0A 3P5YA 3VK5A 4IXHA 2ZRZA 1H7OA 3W7IA 1Q63A 4RK8A 4OJYA 1AJZA 3WFLA 3IIZA 3BZJA 3K13A 4L4OA 1S5NA 4JY8A 4C7DA 4DZIA 3KRZA 3W85A 3R43A 4IGNA 1LBFA 4NILA 4I90A 4RE0A 2BLEA 1EP2A 4GUJA 3QFEA 4Y9OA 5F2IA 4E4FA 3VKKA 1WV2A 4DO5A 5CLWA 2DZAA 2FZNA 1JD7A 2ZXAA 1WZKA 1CEOA 4O8RA 4UOZA 2YFNA 3SADA 3QW3A 1P4CA 2ZRVA 3G22A 4ZO7A 4ORMA 2CCRA 2P50A 3VD9A 4TX8A 3CMJA 1TE6A 2ZWZA 4Q8VA 2XINA 4DXXA 1EP3A 2Z1WA 2ZUNA 3AMKA 2Z6IA 4IQLA 1XG3A 1BGAA 4N6FA 1I1XA 3W7PA 1G7UA 3AWOA 2B81A 4GI6A 1WCGA 4LB3A 2QDDA 2D69A 4WJXA 4G6CA 3GB6A 3P74A 4AWTA 1W5OA 1GVQA 1GORA 4NI8A 5A8OA 4B3LA 1O5XA 4ZOCA 3DG3A 4DYEA 1KM2A 1WXJA 3JZUA 3AYRA 4JCLA 3I3BA 2ZICA 3FAWA 3LM3A 3KBJA 2RHGA 3MANA 4DWSD 3M16A 1Q6LA 3R1ZA 4Z2IA 3TUUA 1OC5A 4LCQA 3GU1A 3L4YA 4R9XA 4BWLA 5K9CA 3KLKA 3M41A 1TR9A 4LALA 4W5UA 3W38A 1XLEA 4LBUA 2Y88A 1QASA 4HMCA 5D9NA 1RV8A 3ID7A 2OQLA 2QW5A 3CIWA 3CHCA 1IR1A 4H83A 4CD7A 1EB3A 3FGCA 3EOOA 3GC2A 3N73A 2O0TA 3PM6A 1NVMA 2E3ZA 3WH6A 2PI6A 4H7ZA 3P8IA 2ZX7A 3S46A 2ZTJA 4HA0A 4C1LA 2OQYA 3BAYA 3EPOA 2XIOA 2ZDRA 3U4AA 4WOQA 3HM7A 1M01A 4TOQA 2BVYA 2FMNA 1FWDC 4CQBA 3AALA 2VEMA 3DBNA 1Z7AA 1YTKA 2Z25A 1C90A 3IJQA 2HPIA 4LGXA 2A3BA 3SO7A 1XM3A 4OBSA 3S1WA 4IG2B 2YZRA 1E40A 1BGGA 4DEFA 2PDYA 4GFIA 2PGFA 4KEZA 2OB3A 3RK8A 4MWAA 7ENLA 1G1YA 3LHVA 3I7QA 2KAUC 4B5NA 3BAJA 2VGFA 3VNDA 4Y96A 4A21A 3O16A 1UB3A 1OK4A 2PBOA 3OW1A 3L4UA 3MV11 1XLJA 4AISA 3CUHA 4N9EA 3SCOA 2CETA 4HU4A 1HJQA 3W7EA 2PGWA 4HIBA 3V5FA 1LBLA 4XAPA 3PJWA 1S2UA 5HATA 5CG0A 2CBIA 2NXHA 3N2MA 4IFKB 4UZUA 2J7CA 4OQVA 3WLKX 1LWJA 1SZNA 3CIXA 4K8EA 4NZJA 1U2YA 2QAPA 4O10A 1E1CA 1XLKA 4OVXA 3BLOA 5BW6A 2VTFA 1TPH1 3CHFA 2O9TA 4H3DA 3WUEA 2VM8A 2PGEA 4M7SA 3TA9A 3OYZA 4GMEA 5HBFA 1D2KA 2AMGA 3OOQA 4A3UA 3OEXA 3U7BA 1E55A 1FHLA 1CGYA 3T0DA 3LBMA 1TV8A 4KGJA 3L4TA 2HJPA 1U5HA 3LCFA 2XFRA 2QJHA 4KRUA 4JHZA 1ZQ5A 3EXSA 2VCAA 3MUY1 1U1JA 2RGLA 1CBGA 3BMVA 2V3FA 3MO7A 3IVTA 1PE1A 3ZLHA 3R0DA 1UUOA 4GVIA 3W1XA 1V7YA 1GQJA 4J2PA 4YLWA 5CC6A 3F1QA 4FI4A 2X41A 5I79A 1A50A 3GNPA 3A3WA 1HJSA 5A8QA 2Y8KA 1XIHA 3LDVA 1EJSC 1XLBA 2DZWA 3PSVA 1UQZA 4UCFA 4EWJA 3ZFHA 4GIYA 1U22A 2HBXA 4UOQA 5HAOA 3W1PA 3NNTA 1VCFA 4W8AA 4UR8A 3KOYA 3PUGA 1YKWA 5D33A 2DZPA 3T55A 3G1HA 2NV1A 4LAUA 4HPHA 3EEZA 1WNOA 2G3FA 4HNUA 1AFSA 3BLEA 1V6XA 3UD6A 3RM9A 4UFMA 4UTUA 2ZRXA 2I5IA 3MV01 1BTCA 4EPKA 5C70A 3C2OA 4O52A 1JZ3A 1GTHA 4JTGA 2QCNA 2OO0A 2E8YA 3FXYA 4F2TA 4IIDA 1MNSA 2F2KA 5HWNA 2A4AA 3CWOX 5EY5A 2CBUA 1WZAA 1FH7A 1KFLA 4G7EA 1IQ8A 1TV7A 4NIRA 3O63A 1DJGA 3UBPC 2E67A 4FR1A 1R2TA 4Z2LA 2J13A 1UG6A 1U30A 3FLUA 1G4EA 1TE1A 2H3DA 4XD5A 1SR9A 4H7CA 2Z2UA 2WMIA 1DHKA 2A2IA 2V3GA 1FWFC 1VBHA 3VU2A 3PBWA 2Y7GA 4JKKA 4S1FA 2JE8A 4MUPA 1TSIA 2QYGA 3N18A 3PPCA 2Q8XA 1VPQA 4HNVA 4ERGA 4U10A 2VNCA 1OHLA 1D9EA 1E4LA 1ZZMA 4FK9A 1ZFJA 4BEUA 3WQEA 3KUMA 4AQLA 2PLKA 2W79A 1JGMA 1TWSA 2IQDA 1EOKA 1DL3A 3MA8A 2ALDA 3RU8X 5AYYA 3L12A 3B9NA 4GRSA 2QVHA 4NQ1A 2D0FA 2QJMA 5K2ZA 4IMDA 4F0MA 3GD6A 1UR9A 2Y24A 2QT3A 4DXKA 1CGTA 2CZEA 1T7LA 4B5VA 3E5PA 3N4EA 1TV5A 1A49A 3B40A 3A23A 1CENA 4DAIA 4DB7A 1V79A 1RQEA 3RGTA 4ES4A 1PHQA 5EL1A 1JZ7A 1DYSA 3A3HA 4E0CA 3CV6A 3BZGA 4B3ZA 2Y5EA 2W91A 4HYVA 4RLIA 1JZ6A 3W84A 4M6UA 1DJXA 1Z89A 8XIAA 4LBSA 5C9ZA 4FAMA 3LHUA 3W1MA 2VZSA 4UQCA 5JBEA 4K68A 1YPIA 4CN4A 1D3GA 2WSQA 4S2BA 3VCRA 4POCA 4I9AA 2YSWA 1V3LA 3E12A 3SI9A 4PUDA 1SJAA 3U2CA 1G6CA 4MTVA 3VKDA 2OZ3A 3ANYA 5D04C 4F2UA 2OSXA 4F66A 4XO6A 2PDKA 1W1YA 2EXOA 4LVGA 5CPOA 3B8TA 1WXZA 2BOGX 2QJIA 4JQ1A 5IM51 2PLCA 3AU6A 4JN7A 2XM2A 2NV9A 1YPXA 4O1CA 4JBRA 4C6EA 4FIQA 2WJFA 2POTA 3KBSA 5J5RA 3E1F1 3GIPA 1YEYA 1QI5A 4O16A 1LL4A 3U8GA 3K4AA 2W61A 3WN6A 5I77A 3BCJA 3MMUA 3UWZA 4MY1A 3IUIA 7XIMA 4OBTA 4QJ4B 1OFRA 3MI3A 2OWXA 3UNTA 4H4IA 1X96A 1E1CB 1XDLA 1X6NA 3DN5A 3MUIA 4OUIA 2YA2A 5IDIA 4GWEA 5I0DA 2H6RA 1S5TA 1ZJIA 1M6JA 1GUVA 1QMLA 1BYAA 1K9EA 2IPJA 3NQBA 2CERA 4YYCA 2VX5A 2J6VA 3KAOA 4ZQNA 3CJPA 1EJUC 4NVTA 1XINA 2OYLA 1IE7C 1VB9A 2VD9A 2R1MA 1HF6A 2ZVIA 1OT2A 3MMWA 3UCDA 2GUYA 1CIUA 1Z44A 1IEQA 4FR6A 4ZODA 5D9PA 3QF0A 4R7JA 2REQB 3HQ1A 4DLFA 1NWTA 1EA0A 3EGJA 3GR7A 2GK1A 1NY1A 3CT7A 3FEMA 3GR4A 1L2QA 1NFBA 2Y7FA 3BLDA 2OOGA 1PWLA 4O54A 1J6PA 3FA4A 3PANA 1MW1A 4BWLC 4EOUA 1P0KA 4PCTA 3I6RA 1XICA 3VM7A 1JZ8A 5TBOA 3C0JA 1KXHA 1R87A 3N3MA 3EB2A 1CDGA 4AG0A 2A3CA 1KR0A 3O7UA 1KTCA 1Q5MA 1CXFA 1WAUA 1QOPA 2YOCA 1NOUA 3P0WA 4Y8EA 4XTDA 3LTSA 3OA3A 1PKMA 1OC7A 4MY8A 1ITQA 6TAAA 3FCPA 4JDYA 4BKNA 3CUGA 2F8QA 4XISA 2PDMA 3ZZ1A 4E8GA 2E6DA 2V5KA 4GVFA 1WKDA 4PL1A 3DI1A 3UG4A 4DZAA 3EWZA 1R8LA 4HCLA 2HS8A 2WM0A 3MUCA 4H6RA 4ECLA 2QJJA 3QYQA 1VEOA 2OFJA 1GOIA 2G3NA 1KFWA 2B0MA 3OLEA 4CEUC 5D32A 5HR7A 1OJXA 3CWNA 1EP1A 2YXXA 3WK0A 4K1GA 1GONA 1LOLA 4X22A 3QHOA 3U0HA 3BOXA 5KMYA 4UCGA 1VPYA 4LF1A 1IXPA 4NAEA 1UR4A 3IK2A 4C6NA 2I5GA 3VIOA 4NJJA 2TMDA 3S2LA 4MB4A 1H50A 2V5LA 3MHUA 1TTQA 4XZBA 1DJWA 4DNHA 3GC5A 4P7NA 4GY7A 5FL0A 3WKZA 4UFJA 2Y8VA 1XSKA 1W0MA 3SQLA 3V1HA 1MW0A 1E9IA 4XBSA 2NLIA 2YCLA 4HK5A 3VNKA 1QPNA 1H60A 3LOTA 5HOSA 1QATA 1KWKA 1A5OC 5G2HA 1ME7A 5BXPA 2AQOA 5F2LA 3DFNA 4DUOA 2DZXA 5K9XA 3EWXA 4PC8A 2DQXA 3LPGA 4GKLA 4Q8QA 1KFBA 1GHSA 2H9AB 3DKJA 3KZSA 1XYMA 1RZMA 3BUVA 1MUWA 3BV4A 1YRRA 1H7XA 3FAXA 2AAAA 3HPSA 1W1A1 4EXAA 4DJEA 3N11A 1JZ2A 6ALDA 2D2JA 3N15A 1GEHA 4HNCA 4PBEA 1BKSA 4XO7A 3UY8A 5ENLA 3LD5A 2JK2A 4Q4KA 3A22A 4N4PA 4OE7A 4PRTA 3F03K 2IMRA 1TJ1A 3AS1A 3OQEA 3J7HA 3F5LA 4NYUA 1FHDA 4RX0A 4W88A 4FLOA 1RP9A 2BGQA 4M29A 1JR1A 1Z48A 1EHNA 3L2IA 4J27A 2Z1XA 1UC4A 2Z2AA 4E3VA 1F6KA 2XIBA 5DX7A 3N14A 1X7FA 1AZ1A 4JQ2A 2Y1HA 5A8GA 1JI2A 4GH1A 4MADA 4OWGA 1KGWA 1KM3A 1H7PA 1A5KC 4XV0A 4ZBCA 1Y0EA 2WB5A 2X1UA 1QAPA 3G3DA 4UMCA 1VAHA 1S1PA 5DMLA 1FQ0A 3AROA 3S6OA 4DUXA 1AW5A 2MNRA 4IMFA 3AICA 3G1DA 2HXTA 4YVPA 2R6OA 3EA3A 4Q3MA 3W24A 4Y9NA 1VD6A 3GFYA 3RXZA 3KOZA 3KTXA 3B0VC 5CBIA 1OG0A 4Y6GA 5CAHA 3T42A 3QV6A 5JBFA 1U33A 4F0RA 1BSLA 3SB0A 3K8MA 3CB8A 3G77A 1BXCA 4TV6A 2CLFA 3PZIA 3N9SA 3CZEA 3VNMA 1HKIA 2E6YA 1TPC1 3ARTA 1PEZA 4MWAE 3QQWA 4UTKA 2XFYA 2NT1A 1QNQA 1GJUA 1UJQA 4S3JA 3B8WA 1FWHC 4XZLX 1IT7A 4BR1A 1UD4A 3HU7A 1TX0A 1C7TA 3P62A 1YPFA 4QSHA 3REQB 3UF9A 3UR5A 1TZ9A 4PMYA 1V3MA 3SQMA 4I6KA 5CG7A 3G24A 3EX4A 4M82A 2RJHA 2PP0A 3AIVA 3TFCA 1WDWA 3TIMA 4QG9A 3CL6A 1OF6A 1PTGA 1H41A 3TLQA 3M9YA 4CN1A 2PWHA 1DIDA 2PDHA 4QG6A 3SSJA 3KCOA 5CPLA 2QEZA 3VNYA 3G1FA 3R5EA 1G4PA 1VIWA 1HXJA 2E5CA 2ATSA 4C7FA 2VYOA 1W9XA 1QNPA 2BGSA 3BL3A 4PMQA 4UTLA 3ORWA 2WAGA 7REQB 2VFHA 3VA8A 1AODA 3U5UA 1EIXA 3SCUA 1F6PA 3TWAA 3GTXA 3WF1A 2XH0A 4ZQOA 1IEWA 2IUZA 3BE7A 2WZMA 4Q7NA 2FB3A 2BY3A 2YW4A 1O66A 3GVWA 4J3WA 4GZ7A 2PUZA 4GUHA 4GIEA 3ZOAA 3EMCA 3APGA 5JH2A 3G6LA 1G9HA 4GKTA 1BFNA 4B5SA 3W81A 1E6PA 2BHUA 4LYKA 5EMUA 1KBIA 1K8ZA 1ZHAA 2ZCGA 1MNZA 1OVDA 3LX9A 3G18A 4K6AA 1BWKA 3DFHA 4QS6A 3U2OA 3B9EA 2QF7A 3BOLA 2AL2A 3DDMA 1H2JA 4UR7A 3ZR5A 4REQA 4IM4A 1C8VA 4QCFA 2QLYA 4ZQPA 3GXPA 1PDZA 1PKLA 3G1YA 1ZAIA 1M7XA 4Y90A 4GIAA 2F38A 5FF4A 2V5CA 4UTJA 4US6A 2E9BA 1SW7A 3W37A 2J7GA 1AZ2A 1KQZA 6CGTA 4IIBA 4UTMA 2BZNA 5BRQA 3GBDA 3LUTA 1XIDA 4NSBA 3SN1A 1AJ2A 4D6DA 4W4QA 3PBGA 1JIBA 5FJUA 4ZE4A 4FSAA 1K8XA 3DG7A 3S5ZA 2FDMA 2JGYA 3OVRA 5AYIA 4DJED 1G69A 3ARRA 2P10A 2ACQA 4RNJA 1RXOB 4O1AA 4GYFA 2CNCA 3WDIA 3WIJA 1KC7A 3QC0A 2VFEA 1QHPA 3S1VA 4FF5A 2BTMA 2WKGA 2ZDSA 4AEOA 1XLAA 3HA1A 2FHFA 1VLIA 3GXFA 1NOFA 1FWJC 3OYXA 2HXUA 4QRNA 1DORA 3IV8A 4X0NA 2ATMA 2VD8A 3A5VA 1J6OA 4XD3A 4O0QA 4JOMA 2PBGA 1A3WA 1LWHA 1JYXA 4N6EA 2CESA 3GXMA 1CW2A 4N42A 1M03A 1JJKA 5K9DA 1VRXA 3P84A 2XFWA 5AHLA 1MEHA 2JFEX 1Z69A 4GGHA 1VJZA 1F6YA 1VCGA 3PP7A 4JTHA 3WDJA 5HQEA 2XFFA 4ZO9A 1N55A 4GA8A 5JQ9A 1FCVA 4GHRA 1E4IA 3FX4A 1W3KA 4F2BA 5B80A 1SFJA 2VEPA 4EK7A 1XQLA 1EEPA 4MFEA 3MSYA 4AIEA 5HMFA 2HK0A 2FTYA 1W9VA 2KZHA 4XZ9A 3SM0A 4O0ZA 2PDPA 5CZTA 2XIMA 2PRHA 2WMIB 1AL8A 4OOZA 3QOKA 4DQWA 2WOQA 4HZ6A 4JICA 3PF3A 4JFVA 1FOBA 3FKRA 4KWUA 3FKKA 4CCDA 5EPDA 2Q71A 3TP4A 3AUOA 1UCWA 4AZCB 3KL0A 3CU2A 3QZEA 2YW3A 1TV4A 1ZPTA 2GJNA 2V81A 4M3PA 5LXEA 1V3JA 3VYLA 2WXDM 4LSBA 3WQDA 2Y5SA 2ZZ6A 1VQTA 4H6EA 1W8GA 3MP3A 4F0SA 5F4SA 3UGRA 4F4RA 1WOAA 4EF9A 1DKWA 2QQ6A 4EPEC 3EKZA 3PJXA 1KRBC 2EEXA 3B0PA 4GC4A 3HURA 2D23A 3R94A 3VI2A 2WC3A 2OTDA 1GQNA 4W87A 1P43A 2J7HA 1V6YA 3L4XA 5CZ0A 4CLMA 4ZA0A 2VRQA 5I3JA 1E73M 1LRNA 3EOEA 2JGQA 4KMQA 3SBFA 1BLIA 1VP5A 5HULA 5LNWA 1RR2A 3VNLA 1TMHA 4BA0A 1F73A 2RUSA 4XZMX 4KEMA 2QNEA 1R3SA 3W7LA 4K3ZA 1QR7A 4N4QA 1S46A 2QDHA 2I56A 1KXVA 3AO0A 2XN0A 1EQPA 1IWAA 1GOWA 1QW8A 4TTUA 3UR7A 4EAYA 5DCBA 4X60A 1N8FA 2Z00A 4LC6A 1EGMA 3KCJA 2GVLA 1CYGA 4CNPA 4GIRA 4QM1A 3ONCA 4K36A 4N9DA 5AHEA 3UU0A 3CHDA 5A8MA 4Z2KA 1G01A 3S5YA 3ATYA 3B9DA 4IL2A 4NXSA 4NNCA 1K8YA 2BNJA 3O8AA 4F0LA 1WX0A 4IT1A 2A7RA 3M4HA 3GDTA 4AF0A 4QLLA 1UYQA 2X16A 4C6BA 3CWHA 3ITLA 3RU6A 1SMDA 5GNXA 3IGHX 3G8RA 4YN5A 1X6LA 1Q6OA 4X9SA 2DZTA 3TR9A 4TVDA 4DHGA 5CPTA 5C2GA 3CBWA 2EAWA 3IRSA 4YTTA 2ACRA 2J9YA 3WH5A 1YTEA 2ABBA 2QJGA 3SR7A 2OGJA 3HQPA 5LHEA 1YIXA 1QI4A 1G7VA 5I7GA 3NQVA 3B8DA 1L6WA 3NXLA 2FGLA 4NAEB 1R46A 2XSXA 2WSKA 4LUJA 5AN7A 3WF2A 5IFTA 3BO9A 3B8IA 3I4KA 1P7TB 2VFDA 1MWOA 4GABA 3ARXA 1VKFA 4ACYA 3SQSA 4PRRA 2FDSA 2HV5A 3T09A 5K4XA 2VGGA 4NY2A 3L2MA 4D72A 4JHOA 2TSYA 5E0CA 3V35A 3M7WA 5HMSA 1SJCA 3BWWA 4QQ3A 4YS1A 3S83A 4LH8A 1YBQA 3PWAA 1TV3A 1JCXA 1PO9A 4ML4A 4AAJA 4KFOA 3RLGA 1GYLA 2XU2A 2YB1A 2NQZA 1QDSA 3UEQA 2HISA 3KVJA 5AC4A 3G0XA 1UWQA 2OSWA 1R85A 5CKSA 4V33A 3FVDA 5DCDA 1E6XM 3Q94A 4R3UA 1VFSA 1XGZA 2QAFA 1OCJA 1O1HA 1MZRA 3M5XA 2GOUA 2PDXA 1TTJA 4GLEA 4YTQA 3TK7A 3KM8A 2DIKA 5HNTA 3MCNA 1TJPA 1EJWC 5DEZA 2HSAA 1AD1A 3S6DA 4KRZA 2E77A 3VUSA 1OSEA 2BY0A 1R3WA 1V0NA 4IX0A 2P3ZA 1X39A 5G2IA 3C0SA 3CZJA 2E1WA 2RDUA 1PAMA 4NT0A 2GLKA 3QMSA 4YNGA 5D2TA 4L6DA 1BYDA 1FFQA 4DBUA 5IOBA 3W1LA 1TPDA 2F61A 2X0HA 3N3TA 4QLKA 1H11A 3BGGA 3K4DA 3PUOA 3FFSA 1XIBA 3TAOA 2CIPA 1RALA 3TYZA 3TZFA 1XKYA 1EJVC 4WIWA 3OO2A 4CCCA 1B30A 3MBDA 2KX9A 4K8GA 4MKVA 2NXGA 3SJNA 1UUQA 3AHTA 1Q2RA 4FNRA 3MHFA 1W3NA 4K37A 4Z0SA 2J8FA 3CEPA 4IL0A 1RCXB 1K7XA 1KCLA 4E4PA 4Y9MA 3W28A 3R25A 3M47A 1Z41A 1ONRA 1UZ1A 2ICSA 3ARYA 5D37A 2FH6A 4DBDA 3TKFA 1O95A 4KEUA 4OU1A 4I7UA 1CB7B 1XSIA 4QNEA 3PPGA 1BF6A 3GYCA 8RUCA 3LBOA 3CUZA 4TO8A 1C93A 2VDGA 4I6VA 4JTEA 2HZGA 2EPHA 1WZLA 2IPWA 2A85A 4HU8A 2H9AA 2WO5A 2INFA 4HA1A 3LSBA 3H26A 4EXQA 2ZA1A 1G5AA 3ERPA 4DXVA 1B90A 3FDKA 2NUYA 3CUJA 4HMEA 4I8DA 1QRQA 2VEIA 4GO9A 2HE5A 3SY5A 5HINA 3O9NA 5I07A 4LYQA 4MB3A 3CZLA 3P8JA 4H7VA 3WNMA 3ABXA 3WEMA 1UR0A 2ZVRA 2ZQ0A 4GXWA 4H6KA 2PTYA 1OG6A 3E2RA 1D7KA 3U2ZA 4PUUA 4LAZA 4WJ8A 4EKJA 5M03A 3TYEA 1ZALA 3L0GA 1ICQA 2VT0A 3WNNA 5LA1A 3TYDA 4PL2A 3W71A 3H21A 3GVRA 1E0UA 5DXXA 3BK0A 3LCGA 2Z2BA 3KW3A 4Z2GA 4MMWA 4UFIA 4FA3A 2WWCA 1UD5A 3LNPA 3LHZA 1XC6A 1Q6GA 3WLTA 1KCKA 3GBEA 4H8VA 1OCQA 4OV4A 5I3DA 1JCYA 4M8UA 3VMNA 1UZHA 3TWBA 4S23A 3MUXA 3S42A 1GVIA 4O1BA 3AHYA 5K7JA 1M7OA 3FGCB 3Q2DA 1IF2A 3D6NA 4C5YA 1K03A 4L80A 4PMUA 4HOZA 3UG8A 4JTKA 3S9IA 2HDJA 4IF2A 1XBZA 2I9EA 3KVLA 1XC4A 4C91A 1XI3A 4GUGA 1N8WA 1FWEC 3M5ZA 3W1TA 1JDCA 5FJPA 4Q33A 1BYCA 1CTNA 1X97A 4DNMA 1I1WA 2G4FA 3LYEA 3B8UA 4DF2A 2A79A 2WMHA 2QCCA 3KP1A 2G95A 1EWEA 3BICA 2XVKA 1EPVA 5ABEA 4RZBA 1Q6RA 1UC5A 1UKTA 1E0XA 1J0KA 3ZSTA 3THCA 3VDAA 2OMAA 3MS8A 4JN6A 5JMUA 4WF7A 1XQKA 1A5CA 4CVWA 1SW3A 2WQPA 3AYSA 3KHJA 3WBEA 1H3GA 1M7PA 1EQCA 2ABAA 3C3UA 4TU1A 1X8FA 4CGTA 1HKWA 3KS5A 3KX6A 4NX0A 4EWND 2CLMA 4LWWA 4ENLA 4PBFA 1RJPA 5LKYA 3RCNA 3AS0A 3PJTA 1XYFA 3ARVA 5CCZA 3DENA 4FIRA 2ZUWA 5FESA 2PDFA 1FCQA 4IFKA 3AAMA 1FDYA 9RUBA 3QYSA 1JDEA 3GRIA 5CPQA 3SECA 3U57A 1XD0A 2YR1A 3GG7A 3WX7A 1KRMA 1RY0A 1QK0A 2WHLA 3USZA 2YL6A 3GS6A 1CX9A 4KCUA 1XH1A 4M81A 1KBLA 4R33A 1BKHA 2QCGA 4JL1A 5M5DA 2UY3A 4DWSC 1M9HA 4GPNA 1GVOA 3U2EA 4JQAA 3NQCA 4D6JA 1S2VA 3CT2A 5TNVA 2QKFA 4FLRA 4WX2A 3WD3A 2W5FA 5G4EA 4X0VA 3GW0A 1TB3A 1YTDA 2JF7A 5GPRA 2VI0A 2B4GA 4PTMA 3T4WA 4H2HA 1E71M 3UCQA 2HEJA 3N2OA 2O55A 1QPRA 3B3DA 4O17A 4C6PA 1EC9A 4TMBA 2PMQA 4AZ6A 1PL9A 2OKOA 2ZZ2A 3VX0A 2DZVA 3HPZA 2DP3A 2FZBA 1RPXA 2FJKA 4I3GA 1A5AA 1YBQB 3PFMA 3WNOA 3W74A 1EL3A 3GXTA 3ZVIA 4AUBA 3VD5A 4BQ5A 3MVIA 4MPQA 4DWDA 2UBPC 3T08A 4C7GA 3TLLA 3I7SA 1B3YA 1FH9A 2QV4A 1EYEA 1JNDA 1JVNA 1ICSA 1YNYA 1KBKA 3N13A 2CFFA 2W66A 2C6QA 4DLMA 3MKKA 4HVXA 3WLHA 3LU2A 1DTUA 4H8NA 3H7UA 5M2FX 4C6JA 3RDKA 4UC5A 3T8QA 4X2RA 2ZADA 3AS3A 4AZHA 3E0FA 3KS6A 3M5YA 4JFUA 3N6JA 2Z1KA 4IFOA 1XUUA 2PDJA 2QXWA 6A3HA 4IP4A 4QE5A 1H61A 3II1A 4DWSB 2QDGA 1K02A 3GHTA 3TYBA 3GX9A 4H9VA 1EBGA 4JEQA 2IW0A 1DIEA 4LV4A 3O6AA 3WJSA 1VHCA 3W7KA 4HMDA 4A8IA 1B54A 2E8ZA 3WLNA 1UZDA 3WF0A 2XDFA 4MYXA 3UZWA 3CNYA 4Y9AA 1ZSXA 4GI4A 4AEFA 2GJRA 3KOFA 1OADA 3NQMA 5FJRA 4MYAA 2J8GA 4REQB 1I4NA 5CPNA 4KIRA 3GVVA 1UR3M 3PSWA 4JXCA 3UR8A 4G7FA 3H2MA 3OTRA 2YCLB 2UY4A 3BLLA 6REQA 1EC7A 1VYSX 1LG2A 2PFHA 4E2DA 3PBVA 2UZ9A 1OINA 3DFOA 2QIIA 4ACZA 2NSOA 3BJSA 4RCXA 4ML9A 1F3WA 4R34A 1H4PA 1ZY9A 4O12A 3HGSA 1KCXA 5GJPA 1J79A 3F4WA 5BWAA 3S3GA 5EB8A 3BARA 3GC4A 3EA2A 1J11A 3BG3A 2X1IA 2WNZA 3NM3A 4UNLA 4AMAA 1T8XA 2BB0A 3VE9A 1KO0A 1FWAC 4JYEA 4IJCA 1I2OA 3VGDA 3C56A 3BDKA 3E0IA 4KETA 3ZR4A 5BU6A 3ZJ6A 3ZT6A 4G56A 1KFEA 3PTMA 3SUTA 3SCPA 1HN1A 4BF5A 5BXTA 4NG3A 4I9TA 2DPEA 2AOSA 1EJTC 1SO5A 4YPJA 4HBKA 3OLGA 3WMCA 1P5BA 1TZZA 1TTPA 4LNYA 2DJLA 1ODZA 1I0BA 3NPVA 4Q4RA 2V2DA 3W4RA 3OHMB 2O9OA 1OFEA 1NEYA 2BX7A 4ZFMA 2J47A 6XIMA 1QWKA 4Q8WA 5ABGA 1TG7A 4AZCA 4MVAA 5XIMA 3BPWA 2MUCA 4MNLA 1LM1A 4HOWA 1JFHA 3B06A 3AXXA 1JZ5A 4FB7A 4O53A 1UMLA 1PSCA 5FJIA 4ERIA 5J8LA 3ARZA 1O6IA 4F9JA 4B5XA 1HL9A 4BHYA 2XSAA 4MWAD 4GZJA 3QHNA 1IT8A 3W23A 3N2TA 5JIWA 2YXGA 4V15A 3MCOA 3VDBA 4HT3A 1UZ4A 4TX6A 5E5CA 1S5VA 1J5SA 3NTYA 5IFPA 5FOOA 2Q3RA 4P8VA 2ASHA 1TMLA 4MGGA 4ZMGA 4E5TA 4GNKB 5FSEC 1Q7QA 4CQDA 3GTHA 4A05A 1TELA 2PTZA 3P3BA 3E0LA 2RGMA 3RJYA 3ITGA 1QT1A 3S1GA 4Q4SA 4AWSA 4NJGA 4OV9A 3NPWA 1KA9F 2NVCA 5H1WA 4L5ZA 4A8NA 4E2OA 4GXPA 5A69A 4XBJA 3M0HA 3FW6A 2HCVA 4LVFA 4HP5A 4GQGA 1YE6A 1UW9A 4RNHA 2GUBA 3PZOA 3BH4A 1T41A 2RFGA 2QZRA 1WQ5A 1DTNA 2X8RA 3KEHA 3LI1A 2D22A 3QBUA 2P0OA 3H2FA 1P6WA 4UWMA 3T1GA 3URAA 1LRQA 3OBEA 4RW5A 1SQ7A 5D2XA 3OGSA 3THUA 5LNRA 5HNRA 3LQLA 2PDBA 4O11A 3NQFA 4M6PA 1DV7A 1AH0A 3HG4A 4CQ9A 4B90A 1Q8JA 2R91A 4PBGA 4MNKA 1E0VA 1V6TA 1WDSA 5A5WA 2I1OA 2A3EA 1M3UA 3H2OA 3QKZA 4ZXOA 2AGTA 3TZNA 3VD3A 2CW6A 2FB2A 1JCMP 1XLCA 3M0VA 3ARPA 1R86A 4XVEA 4LVBA 3TMQA 4QS5A 2GJLA 3OP2A 1XLIA 4DJDA 3TJXA 2YBTA 1EF3A 2WVUA 3TMLA 1LLOA 3SZ8A 2VRKA 1GHRA 4ICMA 4A3HA 1NDYA 3NR0A 3ZM8A 3WK2A 3CTTA 1C8XA 4L6OA 1GZ1A 2GJXA 1R47A 5FL1A 3FA5A 3AJXA 1WOBA 1XRFA 5E93A 3W7MA 3PZTA 3BW2A 3K30A 1W9PA 5CGQA 2NXIA 3IGXA 2FIQA 4J3TA 4KPLA 2OLAA 1KGUA 3PK7A 3MMTA 1U1HA 4ZSTA 4HA3A 4KT2A 2O4MA 3WD2A 3W2NA 1HP5A 2RAGA 4ZL1A 1A0EA 3P82A 4L6HA 5AHIA 3N12A 1IEIA 3GVQA 3C8FA 3UFYA 5FCZA 3VC6A 1WPCA 1MQQA 2PSNA 2ZUTA 1EOMA 1JYVA 4B2DD 4JFTA 3W2MA 1NDVA 4KW2A 4JIEA 3WCZA 1NF0A 1NP2A 2ZFAA 5G1TA 4DJFA 3CQHA 1ADSA 4XZIA 4QSFA 2OEKA 4DPQA 3AHVA 3WDRA 3TTOA 4MJZA 3WL0A 1F2JA 4MLRA 3UJEA 2FPTA 1E1FA 1LDCA 3N4AA 3WUFA 4Y2WA 4UFLA 2WZIA 1OYCA 3LXBA 3M44A 3PTQA 3C0QA 4GCXA 2E9LA 4L1XA 4K8HA 3DX5A 4C6KA 1TQJA 2J9ZA 1YHTA 1H5VA 3PS7A 1FDZA 4TMCA 5H8MA 4UR9A 2CPUA 3STGA 1W1ZA 1EUNA 3GH5A 1JFXA 2C91A 4DO7A 2WMFA 4V2XA 5AVHA 3S5SA 4YVXA 3UETA 5BU9A 4W86A 3EB4A 3OG2A 3W7NA 2C1GA 2ZC8A 4XZNX 4R85A 5AYXA 2NUWA 2WW5A 1CPUA 3KL3A 4RXFA 1OQFA 1EXBA 3ALFA 3TJ4A 3UXLA 4LUTA 5DY3A 4ZB5A 3T78A 4BY3A 4GYKA 1P7TA 3RO6A 1W5NA 5IDZA 2V30A 4QJ3B 1TWIA 2PDCA 1DHPA 1OX6A 1PZ3A 2CLIA 3KRSA 2QUMA 1Y5VA 4U3AA 2VGBA 3K8KA 1R7OA 4M51A 1NWUA 2PTDA 4PTNA 1BG9A 2VOMA 4PE8A 3S47A 1KM1A 2VJXA 1MO0A 4MWAB 4O4WA 3EPNA 1OY0A 3NEVA 3O1NA 3DYOA 3NZPA 4JIHA 1PVNA 4B91A 2PD5A 2DIJA 3AS2A 4S3DA 3XISA 3O0FA 2PWEA 3TSDA 2NQ5A 5DRCA 4J3SA 3WELA 5CJMA 3ZS4A 1RLDA 4O14A 1AA1B 1OGSA 5A8NA 3CV2A 3C0LA 2UY2A 1GKQA 5HQLA 2Q3OA 4KRTA 1GGOA 3V36A 3WD0A 4DVOA 3H23A 1KQYA 2WNWA 5E0FA 1W1IE 2GGGA 1F8IA 2FVKA 4BK9A 3CV7A 4EPDC 3DHUA 1XBXA 2J88A 3HMJG 3D5HA 4JX6A 2DORA 1MXGA 1TWWA 3E3HA 3N2XA 5FEWA 1I2RA 3SEPA 3C86A 4ASTA 4YTUA 1IIGA 2NQ9A 5EBUA 3KVMA 2XGBA 1DJHA 4LT9A 3ZJKA 3MC5A 1YYAA 5AVNA 3H2AA 4BFAA 1C7SA 4DM2A 4HHLA 4S39A 3UWQA 3LGEA 1A5SA 2YA0A 2W67A 4XSMA 4DF0A 1V51A 3EWDA 2IKIA 4GFSA 3H7VA 4MIMA 4WGXA 4A8RA 1VGAA 5DMMA 3AHZA 5CZJA 3FSUA 1JCJA 1VH7A 2P1FA 1H7WA 2OZ8A 4JTSA 2FLIA 2WPBA 3W7RA 2YX0A 4D6EA 2PEVA 5C9XA 1LL6A 1FDJA 4JY9A 3ARWA 2EJ1A 3OODA 2WZEA 2XZ9A 1CXHA 2HQAA 1R3TA 4EP8C 4ZENA 3W53A 3IJ9A 3QN3A 2ZUSA 1E4MM 2ISFA 3OGVA 1XYZA 1VR6A 2BXZA 3U7VA 4KBXA 3GAKA 4H9MA 3RMJA 1ISVA 3VO0A 2E0PA 4CVUA 1ISWA 4PMOA 2J66A 3BCFA 4FOJA 5FEPA 1QTWA 4PB3A 3G6MA 1OB0A 2RDWA 5HWJA 3AYVA 3I3DA 1V0KA 2WKLA 3GYEA 3PY2A 4AY7A 1TJ2A 1JDDA 3MDUA 4AC7C 1TJRA 1TPB1 3PVFA 4Z0JA 4D8ZA 4DYKA 3MSGA 3EWYA 4NZCA 3RLUA 3EKLA 3DFQA 4IP7A 2JEPA 1TWZA 4WDTA 2PDGA 2OWWA 4QR6A 3BSHA 3VD7A 5HPOA 2ZA2A 4WSJA 1W37A 1KFJA 3V4BA 4DM1A 2R1NA 5TAOA 4MJ2A 3KCLA 2QCDB 4A2RA 1K4HA 5C9RA 2J77A 2EPOA 4H2CA 3JVAA 3CYJA 1OX4A 3EMQA 3PULA 2NT0A 1C29A 3QRHA 3VZYA 2FTPA 4PR4A 2GYIA 3E0VA 4AZ5A 1FTXA 4EANA 2CZ5A 5C71A 5I03A 5CSUA 2W9MA 2DU2A 3VOJA 2P76A 1BD0A 3P93A 3CHVA 3H2NA 3LTYA 3W7GA 3WYZA 1E15A 3EBVA 6PTDA 1H09A 1FXQA 1W9UA 2W3ZA 1MW3A 4PEKA 4U3CA 1DBTA 2XHYA 1ZENA 5HUPA 2HWGA 3MYPA 4MAVA 1OBAA 5ABFB 3GWQA 1S2AA 3G1SA 5A95A 1FWNA 1V6VA 4CQAA 3TU9A 4DF1A 4KCVA 3INPA 2IPFA 1JYWA 1NSJA 3E0WA 3RX2A 3SSZA 4DY1A 3AUJA 4WRHA 3UYIA 4DIAA 5AY7A 3P80A 2Y6ZA 2P88A 1Z9AA 4QROA 1J5TA 1W2VA 4Q7BA 4BI6A 1LQ0A 3K4WA 5AYZA 5C0QA 7ODCA 3Q58A 1XLHA 4HHHA 3GKAA 3LEPA 3NA8A 1V0MA 1ZBWA 2DW6A 4HHMA 4Q8TA 4PA8A 1O12A 4Z1YA 4KESA 5BOEA 2GVGA 2GPTA 1U83A 1ZBVA 2PPGA 3L9CA 1BYBA 1XLDA 3H2CA 1JD9A 3YPIA 1RSCA 3EKGA 1JDFA 4Q8PA 2HNEA 3QW4B 5G5IA 1ECQA 2DVUA 3UXKA 1UWUA 1LJYA 1A53A 3GIYA 3TTYA 3BLIA 5LXXA 2JIWA 1QPKA 4GJ1A 4IUOA 1Q66A 4UQDA 3URNA 1F3XA 2BHZA 3QQ1A 2CLHA 4ADTA 4PTVA 5BNKA 2ZX5A 2PP1A 1MUMA 1W56A 2VUNA 4IOTA 4LCRA 3RF9A 3TW7A 1UWSA 1HT6A 1ZL1A 2OOFA 1W91A 2ZRUA 2C79A 4GQQA 2P0IA 4RDVA 3Q65A 4ATLA 2D2OA 4QIUA 1V8EA 2PU0A 1RVKA 1W3HA 3QGVA 4O1EA 3VUPA 1IWPA 4I5RA 1GVSA 4IFRA 1JPHA 1RD6A 5FD0A 1PX8A 1DQUA 1SZGA 2GJPA 3NOEA 3ELFA 3ABQA 4Z42C 3CMGA 4EE9A 4QXIA 1QW9A 3CO8A 1V3HA 5BCAA 1PZ2A 3LPFA 4HPGA 3IAQA 4O18A 4RPPA 2ZRWA 3HJEA 4AVNA 1S1RA 3SCQA 1F07A 4MY9A 3WMLA 3ITXA 1CZ1A 3WK1A 5GJMA 3WQVA 3M43A 1XYBA 1M5WA 3DERA 1MFUA 1K7FA 1P0BA 1W3IA 3ONBA 2CZVA 3WMSA 2X1TA 3WQPA 3CASA 3S6TA 4OOUA 4PCSA 1UH4A 1GZGA 1TKKA 2PWFA 4ZCWA 4FNTA 3HG3A 1W9BM 1JQVA 1ZJHA 2BOEX 5I6SA 3GZ3A 2PDNA 4GI8A 3LZ5A 4WY0A 8XIMA 1N82A 4P7QA 4XAZA 1S39A 4L9XA 4GGBA 4J9JA 3QJAA 1ZU8A 3ZYZA 4C90A 2BHYA 1T96A 2VQTA 3O06A 4XAGA 4B5WA 4NJHA 5I2UA 3W1NA 1E9LA 5GQBA 1TX2A 1NAL1 4H9YA 2XVGA 5D8ZA 1XWYA 2Y0FA 4RNIA 3CPUA 3ITCA 3RPDA 4KWOA 4D1JA 3VFCA 3DHFA 3PPHA 5GNZA 2JBMA 1EO5A 1E70M 4PMZA 1J4EA 4ICNA 2P53A 3AJ7A 3CUXA 3MDWA 4KWVA 3USBA 3CQIA 3W22A 3UXIA 4L4PA 3S2JA 4NNBA 3B0YA 3H12A 2FZ8A 4PODA 1QO2A 2EPMX 3VKBA 4BF9A 2CXGA 2TYSA 4KFPA 4WDUA 2G41A 5IBXA 4PUJA 4C6CA 2WLYA 1X1ZA 1BRLB 3FN9A 4RZ5A 4UBPC 1Y7VA 2XSBA 2DFAA 5GNYA 2J9XA 3UJRA 3C6CA 3MW7A 1H62A 2DT3A 2YL8A 4GVHA 2Z24A 4GBDA 2FPVA 3JZEA 4DUVA 1R3VA 1MFVA 2R1KA 2P8CA 4IQEA 4LCSA 3MQTA 1P48A 5MHBA 1M65A 1B4KA 4XAFA 2WCGA 1W17A 4PRWA 4EIVA 3LB0A 2JKPA 2PWGA 5E1QA 1DIKA 1B9ZA 1RA0A 1KRAC 3R4IA 4IIEA 1B31A 4JIPA 3CQKA 3S0CA 2OX1A 3OLIA 4R9OA 3DG6A 2GUUA 1XSJA 1E72M 1JI1A 4JQ3A 3BAXA 2F6KA 1MXSA 2GGIA 3HGOA 1CECA 2OCZA 5A6AA 2NX9A 4ZTXA 3FJLA 5G2WA 4U5KA 1S5WA 4A35A 5LIWX 3SGUA 2PRLA 4NASA 4XIMA 4RV8A 1PV8A 3FV9A 1X8CA 4FO4A 4L64A 2PGRA 4QX4A 2ZIDA 3B9AA 3I3EA 1BXNA 1TYGA 3B0XA 4B2DA 3KBWA 3NGJA 4FPSA 2WHKA 1V3KA 4RPQA 2PCEA 4V28A 1K4GA 2ZZ4A 3OZPA 4YL2A 2DY3A 4HCHA 3MJMA 1JF6A 1K9DA 3S9YA 3BAKA 5KINA 2WQDA 3LG3A 3WLSA 3W07A 5REQA 3EDKA 2DSWA 1KTBA 4GOAA 1KXQA 3IUHA 3BQ6A 4FP1A 4Y8FA 3URBA 4ATWA 3CL8A 4W89A 3WY1A 3EXRA 1UIOA 1W8SA 3WJZA 3AIQA 4NRRA 5AFDA 2OKTA 4AFYA 3ZT7A 1HL2A 4J3UA 4GE8A 4Z1AA 3NWRA 3K46A 1UBPC 2GZXA 2DSZA 3W00A 1VCVA 5FACA 1L9WA 4ACZB 3UXDA 3CMFA 2Z1VA 3W2LA 2AGKA 1CT5A 4C65A 3W7QA 3N25A 1LLZA 1SM9A 1AK5A 2P5NA 4O15A 3G5EA 2OEMA 4F48A 3AU2A 3WH7A 2Y89A 5J04A 3JW7A 3CEUA 4CD5A 5D9OA 2QGHA 3I65A 2JKAA 2BXYA 1YNPA 2C0HA 1QXLA 4GY0A 5ABTA 7PTDA 2X0SA 2OQHA 1ME9A 1AUSL 2EBNA 2YA1A 4QE4A 3UPBA 3F2DA 1YMYA 1HJUA 2DT2A 1MZHA 3S8HA 4JL2A 4UMAA 2DT1A 4NZ4A 3D46A 5A6MA 4NKCA 3DYPA 5I3IA 4IGMA 1WAWA 2BG5A 3JU2A 3LHYA 4HNNA 3SY1A 2H8XA 3UZ5A 4H9TA 1JQXA 4UQ9A 3RM4A 4N0RA 5A6SA 1ML1A 4WSHA 3TDFA 5FJOA 3NYZA 3DGRA 4IUGA 3AMCA 4XIAA 1SGJA 1ISXA 4YCPA 5TQLA 1L8PA 1TIMA 5D2VA 3FEQA 3STPA 3PBMA 6ENLA 4ZQRA 4B3KA 3WQ5A 4H9ZA 2J7BA 3UG5A 4P7OA 1JPKA 1XPGA 4JX5A 4LANA 5HWMA 3VKAA 3HZ3A 3JUGA 1UROA 2PDQA 3QKEA 2O56A 2XM1A 3CH9A 1DWAM 6XIAA 3BC9A 4O0KA 3ZSSA 1VENA 1JL8A 1KB3A 4OTKA 2Y70A 3APYA 3NZQA 1W1TA 4GYPA 3NQ7A 5BROA 1OEPA 1DEDA 2VX6A 3BAWA 4IMAA 1PCWA 2ZZ5A 1ZNNA 2J7EA 5EMKA 3AOFA 3FJ6A 2G3IA 3PAOA 5T8GA 3A13A 1J0YA 1HKMA 1LOQA 1E4NA 4CQ8A 1TV2A 4UTWA 3GNOA 1DVJA 1DJZA 4AHPA 5HXMA 3QPEA 2ZZ1A 2NW0A 4HK6A 3AC0A 2C13A 3PZNA 1QOQA 5DRIA 1TCDA 3VIPA 3ZVHA 4LNCA 2ZE0A 3M1ZA 1VYPX 3TVAA 3H2EA 4IX2A 2QV5A 3EX6A 4LVAA 4PULA 1ZRQA 4HD5A 4XSLA 3W7JA 1R9XA 3IACA 7CGTA 4DJFD 1PB0A 4Y7EA 1EIBA 2EPLX 2ODOA 5DO8A 2BY2A 2JALA 1ZAJA 3HF3A 3DFYA 1NOWA 4E2VA 1HX0A 4AY1A 4I8YA 2VFIA 4GUFA 4DBSA 2DZUA 1S2CA 2VZTA 4JGDA 3GDBA 3E74A 4FMVA 4HB7A 4LUSA 1AH4A 3DXIA 5H8PA 3DESA 1HTIA 3LCIA 2BV9A 1ZCCA 2DJXA 4K39A 5EMMA 4KERA 1XDJA 3VGFA 1DJIA 1GQIA 1XIMA 3TROA 3ZQ9A 2XG9A 3TW9A 1Z3NA 1EX1A 4UTTA 3MKVA 1C9DA 1B9BA 3M07A 1R3QA 2PLJA 1KFCA 4DJFC 1CNVA 5F7UA 4MJ4A 4FXRA 3R8RA 3EDDA 2OZ0A 2VP8A 3XIMA 3VMOA 1R9ZA 5D2YA 3HPAA 1VFHA 3S2CA 1Z6KA 1D3CA 1UA7A 3TYCA 3ABZA 3NSMA 1I60A 2EHHA 4O13A 3P60A 2IQ0A 2QCFA 1VJIA 3C8NA 4ZO6A 1SMAA 3C52A 5ABFA 3DHPA 3M0ZA 4KF1A 3ZWSA 1TZ7A 5AC5A 3TTSA 4GJJA 3REQA 3L23A 4S3KA 4MNJA 4IMCA 3W2KA 4E6MA 1HJVA 2VZOA 4UUIA 2DUZA 3POHA 3WLOA 1VS1A 1OFPA 1O60A 5D4YA 3CGTA 2YDSA 3KBVA 3W0KA 1HO1A 3WLMA 3ZJ7A 1W1VA 2X2GA 1LROA 1FWTA 3ZR6A 3UZYA 1OIMA 2NVAA 5FJTA 4C6FA 4B9ZA 4UZSA 4Z1DA 3BSMA 4A6GA 1FUYA 3M6DA 3WMBA 5LIYX 2ZXQA 2ZUMA 3U48A 3OBAA 4F79A 2V67A 3CAKA 4WXZA 3IPWA 3W9ZA 5DELA 2Y62A 1KGXA 4RUBA 3W7HA 2QULA 3V16A 3SUVA 1BG4A 4CNTA 1KCZA 2V6AA 5U7SA 4Z2JA 3JRKA 1G94A 2Z1BA 3BMXA 4F0KA 1LZOA 2DSUA 3W01A 3NYDA 1W3LA 7TIMA 1UHVA 4E3TA 4WY0B 2VRJA 3DFSA 3WDHA 4YWIA 4UTIA 4CQCA 1OGBA 2BOFX 4XVDA 3W6YA 1VBGA 3IIPA 3T4CA 2VELA 1J0JA 1LT8A 1FA2A 3DH7A 3L0KA 3KBNA 3M0YA 1SSGA 2E6FA 3PB0A 5EKYA 3ITVA 4CD4A 5B7ZA 7A3HA 1TA3B 3T40A 1Q8AA 2XVNA 3PBYA 5BOFA 1EA9C 3BTNA 2E7FA 3BCDA 3BJFA 5E09A 5HPCA 5DT5A 4V1YA 3RYSA 4DO6A 2O92A 4LTSA 1ZBCA 2QJNA 1BHGA 3QHMA 2CC0A 4E38A 1XD1A 1YDOA 4F8XA 4HU0A 1JCLA 3SRDA 1FWBC 3N34A 1UD3A 4UQAA 3SGZA 1E9ZB 4FHAA 1UD8A 4QAIA 4QDPA 1IXOA 2AKMA 4QAWA 1Q13A 2VFGA 5I06A 2CLKA 2OGYA 1F3TA 5FI8A 1I6NA 3A24A 3TXZA 1SO6A 3VNJA 4J4KA 3HN3A 1ICPA 3TCSA 1RY8A 4PB5A 3VIKA 2ZUVA 1H5YA 1L2UA 5G1YA 4EAMA 3I7RA 1IT0A 1GOQA 3G1RA 1EDGA 3HPXA 3TONA 1RD5A 2E6AA 2EG6A 3EA1A 3IJ8A 1S38A 5HNNA 4FOUA 4MNMA 4P7LA 2BXVA 4RE3A 4X3ZA 5D38A 1SUXA 1F5ZA 2JIEA 1ENUA 5EMYA 4FLQA 1TRDA 1IZJA 3FXGA 1DWFM 1BAGA 1D3HA 4JTFA 5D05A 3IGUA 2EKGA 4Z17A 1DIOA 1RCOB 2BWGA 4Q8UA 3TQVA 4JEJA 3LGDA 2Y7DA 4UQEA 5CQ1A 2QR6A 2BDQA 4D6IA 1IV8A 3U5YA 1GVFA 2POZA 4C1NB 1SFTA 2BFGA 5L6UA 2C7FA 1B3VA 1UH2A 3D3AA 1QBAA 1MXDA 1AMKA 1QNVA 2BS9A 1GOXA 3VZXA 3KL5A 1ZCOA 2WKJA 2BVWA 1CGXA 3AZRA 3S2MA 5I24A 1IR2A 4H8HA 4HTYA 1S2WA 2DV0A 1HJXA 5MF5A 1OCNA 4LAKA 1I0DA 2WCAA 1XLGA 3TXVA 1C9WA 1FFRA 2WCSA 3GW3A 4S3BA 1KM0A 5LA0A 3B9OA 2P8BA 2AKZA 4P8WA 4X2PA 4RW3A 4N7QA 2FFCA 1REQA 3QVQA 1W54A 1UWAA 1OD0A 1A3HA 3IV3A 4KQNA 1RUSA 4OZOA 1MDRA 3AYTA 3MWCA 1XUZA 1FX6A 4TX9A 3LRLA 4INFA 1M04A 3FVMA 1W6TA 3CZKA 4JPGA 5AYBA 5I3GA 4PSPA 4NJKA 4H9XA 4XTIA 1OFAA 1U5VA 4GACA 2UV8G 3KTCA 4GZEA 4XX6A 4WHBA 5H6HA 5HQMA 4TVCA 1RQHA 3VIMA 4MPKA 4M5PA 1JRCA 2HPMA 2Z7KA 3OPSA 4FX8A 3KVKA 2V5DA 4BI7A 4JIIX 3PTDA 1ADDA 3WQFA 4U5IA 2PDIA 4MAZA 1LQAA 1RP8A 3VKJA 3GK0A 4IHCA 3BQ5A 2R14A 1XYAA 3IJ7A 1GYMA 4JYFA 4TIMA 3NSNA 3QXBA 2CHOA 2GSJA 3C2YA 1E9YB 2VCBA 1J96A 1M7JA 1QHZA 4JTLA 3DI0A 3CAQA 5EMLA 4FEZA 3R8GA 3LTPA 2VWSA 4YTSA 4M7TA 4HJWA 3CZ8A 4A8LA 5HJXA 3ES8A 4MZ8A 1A47A 3WBAA 4ZB0A 4LOCA 1U1UA 1TTIA 3TN5A 1H1ZA 3TH6A 3PPFA 3NJ3A 3WEOA 3NO1A 1KNWA 3LRMA 1MQPA 3M0JA 5REQB 3IIVA 3UA4A 4ADSA 3SCRA 1NELA 4WUIA 4NXKA 2F9RA 3SRKA 2HMCA 3HV9A 3NZGA 4DELA 5T9BG 4QDMA 3HFYA 3TR2A 1OZMA 1QWGA 2BY1A 1CLVA 3MT1A 5D2WA 2X7VA 2ACUA 4ZGYA 4WEVX 4LEQA 4N9BA 4MG4A 4AVFA 4QJ1A 1QPOA 1KM5A 1XHGA 3NFUA 2PB1A 5E0KA 3RAOA 3LZ3A 3FYYA 1GJWA 3H7RA 4WQ6A 3WZ0E 2G96A 3R0KA 3GTFA