3HV8A

Crystal structure of fimx eal domain from pseudomonas aeruginosa bound to c-di-gmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
242
Chain Sequence
GDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Protein FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 80
structure length 242
sequence length 247
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3hv8A00
3TLQA 3PFMA 4Y9OA 4RNIA 3PJXA 5MKGA 4FOKA 4AFYA 4HJFA 4Y8EA 3HV9A 4LJ3A 4AG0A 3PJTA 4J40A 4LYKA 3GFXA 3KZPA 3PJUA 4Y9NA 4HU3A 3U2EA 4Y9MA 2R6OA 2BASA 4RNHA 4Y9PA 2W27A 4FOUA 3PJWA 5MKGB 3HV8A 3SY8A 4Q6JA 3GG0A 5M1TA 4ES4A 4KIEA 4RNFA 4HU4A 3N3TA 4F48A 3GG1A 3S83A 5MF5A 3GFZA 3GFYA 4RNJA 4FOJA 4F3HA
chains in the Genus database with same CATH superfamily
3ONCA 1W1B1 3JW7A 5TF0A 2XHYA 3KLLA 3B9NA 3VIJA 5AYIA 4DNMA 1KD0A 2G3MA 9XIAA 3N19B 3SADA 2E8ZA 3OBEA 1V02E 1JRBA 1UKQA 1XLAA 4XBSA 5HUPA 4XAZA 4AIOA 3TLLA 4LQ1A 1QATA 3F5JA 2GFTA 3BG3A 3QMSA 1J0HA 3CL6A 1NDWA 1VFFA 3OA5A 3VYLA 2DVXA 3NR0A 2X7WA 3REQA 1TMQA 4UFMA 5G1TA 4H3DA 3FKRA 3UT0A 1TPEA 2CLFA 4BI6A 4GFSA 3LXBA 3QR0A 3UA4A 1W2PA 4UTKA 2FMOA 4FPSA 4IFRA 3FHQA 2X40A 1GJWA 3K1GA 5BMWA 3GQYA 2VZVA 2X05A 3B8SA 3R8HA 3WBYA 1R9YA 4GYJA 4FOUA 4ACYA 1VB9A 4XAGA 4HOXA 1ITUA 2PP0A 4XQ6A 1KM6A 2WQPA 3S2NA 4P5UA 4PODA 2X1TA 3AAMA 2F38A 3MSYA 3NQDA 1TV3A 3MYPA 3KCJA 4MJ2A 1KV8A 2JKAA 3AIWA 3GKAA 4E4FA 4G7FA 5AHMA 4V2XA 2WAGA 4O8RA 4XZWA 4EP8C 1JAKA 4JHMA 1SFLA 2V5CA 3WUGA 3SECA 5G2HA 4LV4A 1SGJA 1C7SA 3UYCA 2P76A 3CZGA 2PP1A 1CXFA 3I3BA 1QNRA 3QN3A 3MSRA 2ACUA 1JYNA 2FZ9A 4AD3A 2PDLA 2C6QA 4US5D 3W1RA 4XAFA 1EWEA 4EXBA 3MB9A 2EJ1A 3NEVA 4PCSA 4AD1A 1CT5A 4CCZA 2CWNA 4BEUA 3CZEA 1I2QA 1DJGA 1HGWA 1IT0A 1BG9A 4C6MA 2VCBA 1GTEA 2YDAA 1OABA 2BZNA 3C3UA 3NQBA 3CB3A 4G7EA 1LRQA 1CPUA 4XVDA 1H5YA 3LGEA 4LW7A 2C71A 3WK3A 3AJXA 2A7RA 4S23A 1NFPA 4JFSA 3GH5A 1GQLA 5DELA 1GKRA 3KP0A 1VPXA 4UTMA 1F05A 3UG5A 4EF9A 4GVHA 4J3VA 4B5VA 1GK8A 1EJVC 1V3IA 2HSAA 3MUZ1 1KBJA 3TU9A 2QV5A 3VGDA 3S0CA 2G4JA 1LT8A 1S2WA 3C6CA 4PBGA 3RLHA 4YVPA 2H9AB 1J5SA 1VIZA 2BY3A 4DO5A 2Z1SA 4BI7A 4IPLA 3NL6A 5DY2A 1B3XA 4CCEA 1W9PA 3N11A 2YA2A 4NJJA 4U33A 4QCEA 4KF1A 5HR7A 1V3MA 2F61A 3W53A 4IGHA 3QM3A 3O8AA 5EY5A 4KFOA 1GUVA 1BHGA 1V0KA 1YTKA 1CXLA 4O18A 2FJUB 1W1YA 4ASTA 5L6UA 2E09A 1DTUA 2PSNA 1H51A 1R3SA 4Q8VA 3TEVA 1W5MA 3FYPA 3F4WA 1RBLA 4EOUA 3FCPA 3M0MA 4ROPA 1V6TA 3TROA 4BY3A 3DFHA 2QULA 1H4PA 4DXKA 1UP2A 4MKNA 3TH6A 4WQ6A 3PJWA 1RH9A 1IT8A 4B2DD 3PZNA 5LNUA 2E40A 2WJDA 4XZBA 1J12A 1YBQB 3FKKA 5BOFA 4FR1A 2X2GA 4UZSA 2IKGA 1P0KA 4PCFA 4CN4A 3FYOA 1X7IA 3TN6A 4MLRA 1ENUA 1S3TC 1GNXA 3WF2A 2Z25A 3L0KA 1M5WA 1YPFA 3MHFA 5C9ZA 3S3GA 3QSTA 4QJ1A 4RV3A 4N6EA 2XIIA 2DT1A 3PVFA 3CQKA 1GVSA 4XG1A 1JIBA 1BXCA 1K3UA 4XAYA 4W7VA 4R7OA 1S5VA 1RV8A 4MNLA 3N9SA 4UTWA 2GVJA 4RKAA 3CH9A 1OFOA 4CVWA 5T26A 3QV8A 3C3NA 4DAIA 2PGWA 1CWYA 1X1ZA 5FF2A 5LHEA 4CKQA 4NAFA 1K70A 4DJFC 4DYJA 5TQLA 1R9ZA 3G8EA 1Q6EA 3W1AA 3CLMA 3BMWA 5EU9A 3LUTA 1T99A 3ENLA 3L4TA 3P14A 1L0PA 2A3CA 3TR2A 5FJJA 1KXHA 1SO3A 5CC6A 3FY1A 3SEPA 3UXLA 5GQBA 1EJTC 5BXRA 4ZQNA 3I68A 2HTMA 2GYIA 3JUGA 3R8GA 4AU0A 4ZODA 4DBDA 1MXGA 1U5HA 2WNQA 3SCVA 3LK6A 4GO8A 1KCXA 3HG4A 1XKYA 2F8QA 5A6BA 1AD4A 2Y1HA 1K9FA 2VGBA 3VOJA 3TOYA 5BWFA 3KHDA 4FLQA 2HDJA 1SFSA 1B57A 4Q3MA 4Q8PA 3V16A 5HK4A 5IM51 3HBLA 5FJRA 2CWXA 2YZRA 3W7CA 1ZAJA 2H6RA 1HTIA 1KW1A 5LIYX 3B9AA 1XH0A 4Q6JA 1IEIA 2CLMA 3AHYA 4R9OA 1UWRA 4AC7C 1ZLPA 1KRMA 4JIQA 4WRHA 3AIVA 5FEWA 3ZT5A 4AMCA 2Y24A 4FZIA 2WMIB 1GQKA 4CNNA 1PZ2A 1SMAA 3W88A 1VJIA 1I0DA 4LBSA 3R2GA 5J8LA 3W75A 1G4PA 4FALA 1U30A 1DJWA 1PPIA 5BWAA 3WF1A 1JRCA 8RUCA 3D47A 3WL1A 3V0UA 3EA1A 2XSBA 3NQGA 3NYZA 4FF7A 1YTEA 4DO6A 1LQ0A 3L4ZA 3QY6A 3J7HA 4RUBA 3GTXA 2E9MA 1OFDA 3ATYA 3SSZA 1E1EA 2DZWA 1SSGA 1GHSA 1VBGA 1JQVA 3U5UA 1K9TA 3KBMA 4PMRA 1WOBA 3AIRA 3SCPA 3NO1A 1Q4WA 5JQ9A 3MCOA 1AH4A 3R12A 1J96A 2Z26A 3WEOA 1P0DA 2YFNA 3ZIZA 5E93A 4P8WA 1YNQA 2OLAA 4FX8A 3SQMA 3ZVHA 3O63A 3UG8A 3WD4A 4Q8UA 3PZMA 1NQKA 2WSQA 2WJZA 2OTDA 2WBGA 3I7SA 2EKGA 4JN6A 3URAA 3E6EA 5I07A 1LF1A 4WXZA 2QAFA 2DZBA 5FEXA 1LORA 2ESCA 1XCWA 3VOGA 1EEXA 3WJSA 1VFSA 2JBMA 4R33A 3W83A 4NX5A 1QWGA 1RHCA 4GLEA 1CXIA 3S2CA 1TZ9A 1UD5A 4PCNA 1UB3A 1EBGA 4J1OA 1RJQA 4UXDA 2GJLA 2YYUA 5LIXX 2P5NA 5CPMA 4MTVA 3W7IA 1NAL1 4QDPA 2WJEA 1C9WA 3GNRA 1A53A 2GGJA 3NQ2A 3PK7A 2PDUA 1VHNA 2OFJA 1NQ6A 1HKWA 1KFKA 4GZIA 2A2IA 3UZXA 4NZ5A 1QCWA 1YMYA 4ZSTA 2UZ9A 3AQUA 4JQ3A 4YPJA 3C2FA 4H9UA 1RZMA 3NGJA 2OGYA 3FN9A 1E0WA 3CO8A 1XH1A 3ARXA 4D1JA 1ODUA 5E0FA 2Q8XA 3FYYA 4UNKA 1V6XA 4LAUA 1W5QA 3SIMA 3WMSA 2Z1VA 1TV5A 2ADAA 3MP5A 2C14A 4HU4A 4HB7A 1UH3A 3TNBA 4TV5A 1XSJA 2O4QA 1WCGA 4M3PA 4L6OA 1V7AA 4Q22A 3OQEA 3CV6A 5AYZA 1KM0A 1QW7A 3GDLA 4HTBA 1XBYA 2W0UA 4WGHA 3VDGA 4LC8A 1UASA 4Z2KA 2IW0A 3JR2A 3BUVA 1T5AA 1GKPA 2J75A 4OBRA 1XISA 2FVLA 5EPDA 4MY1A 3TA9A 4XZ9A 1IXPA 4KWSA 4ZTYA 2F6UA 4IGSA 4W7WA 1RAKA 1R3QA 1XLHA 3CAKA 5J5DA 3W7OA 1Y5WA 4NZJA 1S2CA 2X1SA 2YDSA 5HINA 7TIMA 4ZQMA 3TN3A 1ME8A 1GVOA 3O6CA 3H7UA 3PZ9A 2YZ5A 3QYQA 4WF7A 1XBXA 1OIMA 2EG8A 4JYFA 3SQSA 8XIMA 3D3FA 1ME9A 1K8XA 1DQUA 1AMKA 3MUAA 3P5YA 4FXFA 1GOWA 2OSYA 4IWWA 1QPKA 2QCGA 1IXQA 4O57A 3M4HA 5D8WA 2PF8A 5CKSA 2YBVA 1KRAC 3MSGA 4XB3A 3IV8A 4FX6M 4PL2A 3WFZA 2XPKA 3NA8A 2D1ZA 1F7BA 2QCFA 2DZTA 3CEUA 4WHBA 1EFZA 1Q63A 1MFVA 1Z89A 4FR6A 4JTRA 2J7BA 1MW3A 2PWEA 3E2RA 3CHFA 4GPNA 1EXPA 1PWMA 3CHDA 3P6LA 3E1F1 4GABA 3NZGA 2Q01A 4Z1AA 3WJXA 3KL3A 1W17A 4WOZA 1EJWC 4IX0A 5EA9A 3HOJA 3PFMA 4H8NA 4XO7A 3PJXA 3RRAA 3RO8A 2PCEA 3ZM8A 1SSDA 1V0LA 5FJPA 1VBUA 3RLGA 2XVNA 3BARA 5MKGB 3HV8A 1ZBKA 4BF9A 3MMDA 1OX4A 1GVQA 2DT3A 3WLIA 3EA3A 3ID7A 1XCFA 2E7FA 3GZAA 3EWYA 2J62A 4J3UA 2ZADA 5FF4A 1L8NA 3N2XA 2VWSA 4Y2WA 1UA3A 3W1NA 2V38A 4RX0A 2ZE0A 4V15A 3L12A 2PAJA 3AUJA 5DF0A 1KTBA 6TAAA 2FH8A 2ISFA 3GFZA 4GNJA 2XZ9A 1VFOA 4PSRA 3FDKA 2V30A 4TU1A 4LF2A 3LENA 2NQHA 3RRXA 2CLIA 3N2TA 2P88A 3UGRA 1W5OA 4MDPA 4JAWA 2ZRZA 2P3ZA 1FCUA 4AXKA 4J3ZA 2ZXDA 3UJFA 2ZRWA 1TPH1 4WUIA 1K6AA 1UA7A 4ZVJA 4Z1DA 2OQLA 4A3HA 4JCLA 4GRSA 4NNAA 3WG6A 2C1GA 1F3TA 1M3UA 1RD6A 4FMVA 2Z1WA 1MZRA 3BC9A 4HZ6A 5CZSA 4FS9A 4C6PA 4Y90A 4Y9OA 3UCDA 1B3WA 1GPFA 3T0TA 5IFTA 1C29A 3G1DA 3B4UA 3CIVA 1ML1A 5CG0A 1M7XA 4UQCA 2XVGA 5C54A 1S5TA 2V63A 4I9TA 1G5AA 1BVZA 4O10A 3VOFA 2I17A 1TRDA 1E6PA 4AISA 1TWWA 4GI4A 4ATLA 3VUSA 1AK5A 2ZX5A 5AY7A 2NW0A 2OG9A 3WLLA 5CSYA 3F2BA 3PNZA 3G3DA 1XBVA 3LMZA 3P80A 1C8XA 4BFAA 1W8GA 3A5VA 1KM2A 1EJUC 5C7VA 2QS8A 2Y62A 3KVKA 5DBUA 3ZLGA 1F3EA 4LX4A 4PB3A 3ZVIA 4I7UA 3E5BA 2DIKA 4GMEA 1ICSA 4B5TA 4UBPC 2GVYA 1EKOA 4AD5A 1PX3A 4C60A 3H70A 1OCNA 2GUBA 3S1WA 3WF4A 1BVWA 1FWEC 2J7HA 5HWJA 4B5NA 5DMNA 4DJEA 1AQHA 4OHQA 4PTMA 3Q37A 1S3HA 2HVNA 5GNYA 1KO0A 2VDHA 1UD8A 5D2TA 2VC9A 3LYEA 4ZQOA 3I3DA 2DT0A 2CXGA 1DYSA 4IL2A 1RVKA 4RNIA 1ZTVA 3DOPA 3VNMA 2VC5A 3GHRA 1DTNA 2ZICA 4LT9A 2Y6ZA 3CV7A 1ZBCA 2WPGA 1DIOA 2Y85A 3FV9A 3IJ7A 1TMLA 4NJIA 1XIHA 3TLQA 2OLSA 1GG1A 2OB3A 4W5UA 3EX6A 2XH7A 4DJEC 3PUDA 1XR2A 4GXMA 4UQEA 5FJUA 1BYAA 5IBXA 4TUFA 1WKYA 1JJKA 3W87A 1LG2A 2G3FA 3O6DA 3THDA 1ECEA 4N7QA 4QLKA 2FMNA 2WHKA 1ZJBA 3VDCA 1GVYA 3K1DA 1G1YA 2HMCA 1PEZA 1JI2A 4H8HA 4Z2LA 3T2QA 1QPOA 2I1OA 3CB8A 3JZUA 1T0OA 1MI3A 1WDSA 3GYCA 4EPDC 4JR5A 4DQWA 2EPHA 1J6OA 3GKFA 2PWGA 3SI9A 3EWDA 3BCDA 1XYZA 5JBDA 4QSHA 5I02A 1RA0A 1B9ZA 2XFYA 2OEJA 4LBRA 2YL9A 2YBTA 1MXSA 2XFWA 3UY7A 1IYXA 3EYPA 4PTWA 3LG3A 3NXLA 4UMCA 4YIWA 3RLUA 3PS7A 4AIBA 4QISA 1UKTA 1NWRA 3WDQA 5AECA 3T0AA 2PDGA 5FJIA 1JZ8A 1L9WA 2GQ3A 4N2YA 3WQFA 3WCZA 2C3ZA 4Z17A 2ISSA 3T8QA 5H8UA 1H61A 4LAZA 3TVAA 2ZZ2A 2XGZA 1V0MA 1JEZA 1TUFA 1F61A 4LANA 5KZMA 3FFSA 3AXKA 4PUEA 3OPSA 4M8UA 1BGGA 1W1TA 2OO6A 4B15A 1F9CA 3W7MA 4U3CA 4ZSUA 1QK0A 3VD4A 2XM2A 1E0TA 4WD0A 4BEQA 3KCLA 4ZB0A 3W3OA 2FFIA 4RCXA 2CBIA 2ZZ3A 2ZXAA 3K2GA 2FVMA 1G9HA 2GPTA 3ES7A 4EK7A 2HVOA 1RR2A 1POKA 3THCA 2ZA2A 1JAEA 4W85A 2Y8KA 3GDMA 1YYAA 3L7RA 1I2PA 4GIAA 5CJMA 2QAPA 1H1NA 2WLYA 1OWQA 1KBKA 4JBRA 5D2WA 4I9AA 1KTNA 4K7YA 4BWLA 4RDWA 4D2JA 4M19A 2ACQA 2YXOA 1M03A 4GCXA 1D9EA 1H49A 1F6YA 1RPKA 1TVLA 3LHWA 2V9DA 4ORMA 3RX2A 2FGZA 2CXEA 3GFXA 3AMLA 4NI8A 3S2LA 3KS5A 1UKSA 1RJRA 4Z42C 2DZUA 1D7KA 4PCPA 3NM3A 3EOSA 4GQQA 3SZ8A 3DECA 1AW2A 1ZALA 1QBBA 1VFLA 2Y8UA 4GZJA 3A5FA 1IGWA 2BMBA 2NT1A 2PGRA 1M1BA 3U3HA 1GOKA 4RZ4A 2CESA 3STFA 3YPIA 2R24A 1EWDA 2IXVA 1KC7A 1SZGA 4AF0A 1H7NA 5C5YA 1R2RA 2NSXA 4P2VA 1VBHA 4N42A 2FJKA 3EBVA 3IGXA 3VXGA 3CEPA 5I77A 2XWEA 4REQA 1A5LC 1ZRQA 1TTQA 4NIRA 3UR8A 3WD1A 3FOKA 2W79A 2VX4A 2WPBA 3USBA 1W6TA 3N9KA 1JCLA 5D9NA 4PRRA 4OECA 1X6NA 1WDQA 2XIJA 5CPSA 2PDJA 1Q45A 4H9TA 3P67A 1OGBA 5ABHA 5H8MA 4DBWA 1DIKA 4YYFA 3LGDA 3Q58A 4INFA 3TFCA 3G1RA 3U0HA 3HJZA 3R94A 1ZPTA 1ONXA 2VFIA 3W6MA 3QZ6A 5D37A 4Z2GA 2DPEA 3LCLA 1V79A 2WBKA 3TA6A 3VE7A 1GQNA 2CZFA 2D69A 4U2YA 3ABSA 1BYBA 5BCAA 3BJFA 4GYKA 5EMJA 4DUOA 5B7YA 2BTMA 1JPDX 3MS8A 4JL2A 4JYEA 5CBBA 2FTWA 3P62A 3R13A 1U83A 2NQLA 1CCWB 1W9UA 4CD5A 1RCQA 4JTKA 1F4AA 4NVTA 1KCLA 1TJ1A 1DKWA 3V5CA 3KOYA 4IPIA 2YLLA 3TQPA 1OFEA 2WZEA 2CZDA 4J4KA 5BYWA 1GG0A 2PRHA 4UUIA 4NRSA 1NTHA 1OX6A 3MJMA 4GX8A 1XCXA 1ZL1A 4R34A 4ZO8A 1PX8A 3P0XA 4LCRA 1I1WA 3FXYA 1Q6QA 1PV8A 3BE7A 1UKPA 2VOTA 4PMZA 1HJXA 2W63A 1OYBA 4IF2A 2WNWA 1V4YA 3LMYA 3AU6A 2XIQA 3R0UA 1YTDA 2OPJA 3V3WA 3LRMA 1DVJA 4JX6A 1XWYA 1R7OA 2HBVA 3LM3A 2EJAA 4M6UA 4HNVA 1XH2A 3EDEA 1JR1A 2ZZ4A 1F8MA 3BAWA 2WQDA 3THQA 2UY5A 3GH7A 4MUPA 1DV7A 1OGGA 2O9TA 3M0XA 3KCOA 5FJTA 1DHKA 3VIPA 1S5WA 4QQ3A 5CZKA 2NQZA 2D2GA 4B4FA 1R8LA 1EZ2A 2E25A 1VPQA 3T7VA 1OT1A 4IMGA 3CZKA 4UTTA 1Z41A 4FIRA 3L4UA 2FPYA 3ITGA 3KLKA 1DBTA 2VRQA 5CPQA 1W5NA 4ZQRA 1IF2A 1JF5A 3BK0A 4AUBA 4KWWA 1S1RA 1XRVA 3G0UA 4Z08A 4M1RA 1L6SA 4RW5A 5TBOA 3NO3A 2ZUWA 1KQZA 3O1NA 2QNEA 4WDXA 4CQ8A 3TP4A 4UOZA 3LLDA 1NWSA 4WDTA 1BQGA 1R3RA 4U5IA 1MQRA 5CPLA 3Q4DA 3ICJA 4J3XA 3RN6A 1EO5A 1H09A 3PUGA 1TYGA 5AHFA 1QVBA 3ALGA 3AYVA 3U7BA 2X16A 3GYEA 1TV4A 2A4AA 2GZXA 4TX6A 4MPQA 3PTKA 5IHSA 1VS1A 5LIKX 4NZCA 5CC7A 2R1KA 1L2UA 2QPXA 4MB4A 1BD0A 3IUDA 1LOLA 4HVXA 5JU6A 1UD2A 4PUUA 4GVIA 1RLCL 3TIMA 2H3DA 2Z4GA 3EXSA 1LWIA 3VIHA 3NGFA 4H4IA 2X7VA 1GVEA 4MMWA 1SW7A 2CU0A 3WH7A 1PIFA 1ZP4A 2PDYA 4FP1A 1O68A 4DWSC 4W88A 2QW5A 3IK4A 1RA5A 3UCQA 4OJYA 5AC5A 2ALDA 1KFWA 3A22A 1GPWA 3MO7A 3L4YA 1J9YA 1JCMP 1OFPA 2ZRXA 3WH5A 3WDRA 3PG9A 4YXGA 4TO8A 9CGTA 4DJFD 1CW2A 3EKLA 3TX9A 1UR1A 4QDMA 1O66A 1T41A 3M1ZA 4O28A 3M0LA 1X6UA 3PTQA 1E9YB 5J5RA 3V1HA 4LUJA 3A3WA 4PB4A 4PTNA 3WUFA 2BDQA 3LTYA 4O50A 2QUVA 4OKDA 3VGGA 1W3HA 1A0DA 2B7OA 5A6MA 1RPXA 2CERA 4H04A 2OKOA 1WUFA 3CYVA 3GTNA 1EYWA 3N29A 1CX9A 3H6OA 4NYYA 3SGUA 3CIWA 1Z3NA 5FEPA 4K8GA 4HPGA 3H2OA 2PE4A 1O60A 3B06A 1EQCA 1OZQA 3M0ZA 1OFBA 1ONRA 2GWGA 5HANA 4S39A 2Z29A 3M41A 3DCPA 4H01A 4UNIA 5CAHA 2CLOA 4HBKA 3VNYA 2VWTA 3D5HA 4NX0A 2CHOA 4UTJA 1A3WA 1R9XA 2WSPA 2Z2BA 3QH2A 4GK8A 3TCEA 5A6BD 4ZFCA 5LNWA 3H2EA 2X41A 1E55A 2C16A 4OVXA 3SRKA 5I23A 9RUBA 4L4OA 3UY8A 2V8ZA 1KBBA 3KE0A 1N8WA 3N3TA 4A29A 1CB7B 3L2MA 4C90A 4JTGA 3PANA 3LD5A 2EHHA 3HG5A 1IHIA 4HQVA 3KBVA 5A6KA 3S1UA 1EA9C 1H7XA 3LBCA 4WDWA 3QPZA 1TJ0A 1P6WA 3DG7A 4IP4A 4B91A 2CBVA 3O07A 5D4YA 2VQUA 2XFFA 1CGYA 1JYVA 2PC4A 1LDCA 2FZBA 3UF9A 2P50A 5C70A 1T6MA 2POZA 3GNXA 3GVWA 3PBWA 1E3XA 2V2HA 4ZQCA 3N2CA 4HYVA 1FWGC 3W2NA 3RCMA 2VJXA 2OKTA 1JDFA 2X8RA 4I5UA 4O52A 2C15A 4F3HA 1MFUA 3GSMA 2VUYA 1E6NA 2W67A 1ECQA 2CHNA 3JRKA 2ZDRA 1MQPA 1H1ZA 1Q6FA 3BOXA 4A4AA 1OADA 4YWSA 1FDJA 5BXPA 3SFWA 5T8GA 4GH3A 4G6CA 4MZYA 2A5HA 3LBOA 2P1FA 4KWVA 4YU1A 4J35A 5LNSA 2BSLA 4BQ4A 5K4XA 5DT5A 1QOQA 3AHXA 5FESA 2YA1A 5LYRA 3W7RA 3N1AA 2P3EA 1J4EA 1E40A 4NAEA 3MW7A 1VGAA 3MZNA 4KRZA 1TTIA 3N6QA 3VIOA 1WXZA 4H8UA 1P6CA 4IXXA 2UV8G 3STGA 1V6UA 3QLLA 4MHBA 1HKMA 3FLUA 2NVAA 2WMGA 3UYIA 2OR2A 4PSPA 1G7UA 3V1PA 4JQ2A 1UYQA 1QXLA 2PFHA 3HQ1A 3VABA 1JCYA 3EWZA 3C2RA 2Y0FA 1XLGA 3SN4A 3HQOA 4YMZA 4GXPA 3NJ3A 2F2KA 2VDIA 4IJBA 4DWSB 1W3LA 4OUIA 3GAYA 5A69A 4G9PA 5KZ6A 3QSRA 4ERAA 3MI2A 4DX3A 1AA1B 4L4MA 3BXWA 3RJXA 3MDWA 3W2KA 1EHNA 3POHA 2OWWA 4AIUA 4QGCA 3VOHA 3TCSA 2JEPA 4Z2IA 4LCQA 1VLIA 1KGXA 2YL5A 3BZJA 2QCCA 4W7UA 3JU2A 4HOZA 1R7AA 3UJSA 2GSHA 2P0OA 1QNQA 3FA5A 3PZVA 4NG3A 3MCMA 2J8GA 1WBJA 4HK6A 4D6IA 1SYTA 1Y65A 3WLPA 1EUNA 3P82A 3STCA 1G6CA 4Q7NA 4EWJA 5F2MA 4X2PA 1B3ZA 1Q2RA 3BMVA 3W7EA 3MP4A 3GB6A 1VRDA 1XLMA 3T55A 2OMAA 4IIBA 1DWFM 3KEHA 3VIKA 3LEPA 1QI3A 2P10A 2RDXA 2CYGA 3GG0A 1NH6A 3USZA 4MY8A 3GXDA 3PAJA 1F8IA 4PEEA 3NO5A 3IVTA 5BXSA 4AFYA 3A9IA 4QXIA 3CUZA 3W73A 2Y63A 3AI0A 4AHPA 3VIGA 2YYTA 4GISA 1RQBA 1S5MA 4UFLA 5EMYA 1U1UA 1JVNA 4IG2A 3EXTA 3WQ5A 3F2DA 1HKIA 2E9LA 4NXSA 5JMUA 3WH6A 4F0HA 4C6KA 3P81A 4HNUA 3PB2A 1XP3A 2PDNA 2DQWA 1R3TA 2R1PA 7REQB 3MBDA 2ZZ7A 4V33A 3KW3A 1KFJA 4LU0A 1XL9A 1FX6A 1EGMA 2PWDA 4ERIA 2QPUA 1K7XA 5I3FA 3O9NA 1AMYA 1UZDA 3B9DA 2PODA 5EGRA 6ALDA 4Q8MA 5HNNA 1VFMA 2FQIA 7PTDA 1H62A 7A3HA 3IK2A 3RO6A 2OOGA 1JZ4A 2HV5A 2FHBA 4ZO9A 1NARA 3KOWA 2D2OA 2OVLA 3UJEA 4X9YA 4JYDA 1Q7QA 3VD7A 4JD4A 1P48A 1A4LA 2OEKA 3ZJ6A 1EF3A 3QXBA 4DNHA 3GX9A 2DY3A 3LXAA 2AAAA 3KOFA 2BOFX 4YN5A 3VFCA 1PCWA 1I60A 2V82A 4O1EA 1JUKA 2TPSA 2ZZ5A 4IIGA 3LPFA 3QV6A 4IOTA 4IMEA 3VILA 1D3HA 3TJ4A 4QNWA 3P7YA 1XLBA 3GG7A 3SCTA 1LRTA 2ZXBA 4H19A 1GT8A 4U28A 1E9IA 4X9SA 5FKYA 4KFPA 3W9ZA 4FNTA 3LSCA 3VZZA 2DSUA 3FJNA 4A3QA 5JH2A 4JHOA 2QKFA 3S47A 4JEQA 4UR7A 1FQ0A 3VNLA 2Z2UA 1NY1A 3K4WA 5G1MA 3IUIA 3KTCA 3OJGA 1V6YA 1VFTA 1UC5A 5EMKA 2EPKX 1KA9F 3GDTA 4H7ZA 1XYFA 5A6SA 1XRFA 3G2GA 3VCNA 3GO2A 4Y9NA 4D8LA 4CN6A 2WVVA 2G0WA 3H22A 3UWZA 4TOQA 3THAA 3SY1A 1W9BM 1X6LA 2PDQA 3UD6A 4MKVA 2CHRA 3NQ8A 4GQ0A 4DJDC 3AUOA 3H7VA 4NASA 2BHYA 4TXEA 4Y8EA 1QUMA 1REQB 3B0YA 3TAKA 4JIHA 1E4MM 4S1FA 2A6LA 1P1XA 3GU1A 2PDIA 3EMQA 3TXZA 1ODZA 2RH9A 2YL6A 3QPYA 1EBHA 4JKMA 1WX0A 4BK9A 1UR4A 4OU1A 4UZUA 4EACA 4G1NA 6REQA 3QLDA 4F0RA 1WZKA 1NEYA 1W31A 3BLDA 1B31A 3F1QA 3N12A 3EKGA 2DZXA 1XLEA 3P61A 1AQMA 1UUMA 3SURA 5CJ5A 5AB3A 5ABFB 4CCCA 4ACZB 4IICA 1H0IA 3K46A 1FH9A 3V5FA 2GSEA 1EUAA 3NFUA 3GC5A 1A5NC 3MHUA 4L1WA 1N8IA 5KITA 5HMFA 2YBUA 1ZZMA 3G5EA 4MADA 1QI0A 4Z2JA 5HNUA 4GNKB 3BLFA 4UCGA 1DPMA 3EWXA 3G77A 2VZTA 4F4RA 4RNHA 4CQDA 4HHMA 3ZR6A 1GQJA 3LZ3A 4MAZA 1UOKA 4JTQA 4EAYA 1EDQA 5K9CA 4H2CA 1W0MA 3GS6A 3PBVA 3LQLA 4AX7A 3EOEA 2J7DA 2ZX7A 3GAKA 3ZJ7A 2XDFA 4H1ZA 4AZ5A 2J74A 2GSJA 4IMCA 4Q6XA 4PUMA 4FLRA 2DSWA 3IIPA 1SZEA 4MY9A 4C1KA 3KL0A 4DHGA 2GGEA 1AQ0A 1AZ2A 4XUGA 3SN0A 2JF7A 3NURA 1OM0A 3WBEA 1JCTA 1ZGDA 3QOKA 1XKJA 4LVBA 5HDRA 3ANUA 2VGFA 5A2BA 2A85A 5KZEA 2HK1A 3ARTA 5DT7A 1C92A 2J25A 3GD6A 1N82A 2V68A 4DJED 1R85A 4YCPA 1HL2A 3C2YA 2RDTA 1O1ZA 3S2MA 3T0BA 4FEZA 5HOSA 3TKFA 3C8NA 4J2MA 1FWTA 1K8CA 1EJ7L 4JQ1A 4CGTA 4C6BA 1VYPX 3AIUA 5CCZA 3R43A 3RAOA 2ZIDA 3M16A 5FEZA 4A8NA 4A21A 3W0KA 4L6DA 1P0NA 1Z69A 4BF7A 3CNYA 4A05A 4BI5A 1TQJA 2YCEA 4JX5A 1DJQA 5FACA 3CS2A 4RPPA 2VMFA 2P53A 3AICA 4AZCB 3BW4A 3UCCA 2PLKA 4YYCA 1G94A 4OGZA 1DWAM 1MDLA 4UFKA 2VEIA 4R53A 1TSIA 3GDBA 3RDKA 4B90A 4NXKA 5CPNA 4GQRA 1Q6OA 5AC7A 1TWSA 1W56A 1XG3A 1FH8A 2IKIA 3QHOA 4ZZ9A 3GVRA 4HNOA 3AS1A 3NZQA 1Q8JA 2XYLA 3DFQA 1KFBA 2PC8A 2WMHA 1QNPA 1MNZA 4Y6GA 2PDBA 3VDHA 2DUZA 3DUGA 3EMZA 2EKCA 2WOQA 3WX7A 1XLIA 2VR2A 4HU8A 3N34A 1B54A 5AYYA 1SUXA 1ADDA 2QZRA 3W1QA 5CH9A 1A47A 1V3LA 2G97A 2OJPA 1KXTA 2HK0A 1KR0A 1ZS2A 2QJNA 4ERGA 5FCZA 2Q8LA 4GWEA 1BFNA 4R85A 4WX2A 3P8IA 2PRMA 4LUTB 1GORA 3KAOA 1R2TA 4AEFA 5EBUA 2J77A 4ADTA 2W4XA 3FGCB 3SCQA 2EPLX 4HHLA 3ZSSA 4I6VA 1XIMA 1H3GA 3OYXA 3L5AA 3D6NA 1EPVA 4J7RA 1O5XA 4LBUA 2ZA3A 4TVCA 3VMNA 5F4WA 3S5YA 3IIVA 1JG9A 4NZ4A 1AJZA 2Z6JA 3O15A 2EPNA 3A21A 1SM9A 2ODOA 3KRBA 4QDWA 5KEZA 3UVIA 3PSWA 1UR3M 1ZAIA 5F2IA 3A6OA 1HNYA 3MTWA 4IISA 5CSSA 4XSLA 4GIYA 4K7VA 4FOKA 4P8XA 3LHVA 1FWNA 3FEQA 4J5NA 4DXXA 3QHNA 5D2YA 3IJQA 1L6GA 4X63A 3IARA 5XIAA 3ZLHA 2FGBA 1TELA 4LY4A 4Q4MA 1XPGA 4H9MA 2EG7A 3MUXA 2VO5A 3HPSA 2BY2A 2DIJA 4O11A 3NQMA 2A3BA 1TV7A 1BGAA 3MUIA 1FWWA 4WY0B 5D04C 3BL3A 2WO5A 4P7QA 1FHUA 3KUMA 3E0IA 2R94A 3N15A 3AYTA 2OX4A 3AU2A 5FSDC 1CGXA 4Q8WA 1XHGA 1XLDA 3WQDA 4ZENA 3W7JA 2PU1A 4O1AA 1K4HA 1XX1A 1A5CA 2OYMA 1C3FA 4I90A 1P0BA 1TMHA 1YE4A 3M7WA 4IXHA 1HJWA 2OT1A 3VC5A 2JKEA 4B5SA 2GK1B 1XXXA 3UZWA 3CBWA 4DWDA 1XFCA 1FCQA 5CZTA 2E0PA 2YCKX 3SCOA 1R2SA 2V6AA 3H2CA 4CU7A 4Y9PA 3CM4A 3STPA 5K7JA 1BKHA 5CAKA 4MWAC 1GHRA 1VZWA 1W37A 2EBNA 2ZUUA 3BTNA 3M5YA 1TPC1 3IJ9A 1F07A 4DXVA 3ARQA 4S3GA 5HMDA 4O1BA 1RLDA 1E3ZA 4QNEA 2Z0IA 4EKJA 1TE6A 2A3LA 5BNKA 3RF9A 1Q6DA 2Y4SA 1FCVA 5AYXA 2XU2A 3OEXA 4IJRA 1E72M 1UP0A 1W3TA 4ZOBA 4K39A 3KXQA 3UPMA 3VVGA 1U1HA 3ANVA 3R0KA 4I8YA 1XD1A 4C5YA 3TTYA 1XINA 1YIXA 2WMKA 3EOOA 4K37A 3UESA 3BG9A 3CZJA 1M7PA 3GFYA 2DZPA 1DJXA 1R5YA 2FB2A 2YOCA 1ZBWA 1FOBA 1LUCA 1XLCA 3PJTA 4XVEA 3H4GA 3CPUA 3B8VA 3LNMA 3FSTA 4XV0A 1XD0A 1R3VA 3CAVA 1F5ZA 5TAOA 1W1ZA 3WEMA 2C0AA 4H9ZA 3L2LA 2CLEA 1PKNA 4DZ5A 3LHTA 1NOFA 1KFCA 2WSKA 3HPXA 2I5GA 1L6YA 3G1XA 1QASA 2PURA 3G0SA 4GCAA 4O13A 2VZUA 2G96A 1N8FA 4HMCA 1E70M 3TTEA 4NZ1A 2WKJA 4HTYA 3UXKA 3OZMA 5I24A 2YSWA 3WDPP 3K30A 3WQWA 1WDPA 2QCDB 1GVRA 5CXPA 2Q3RA 4UTFA 4RLIA 2VOMA 4CD6A 3BGGA 3GG8A 3QW3A 2Z6IA 1TZZA 4GE8A 2BNJA 4FNQA 4D6GA 1VF8A 2HE5A 1U2YA 2D20A 3VZXA 1TG7A 3C86A 1B3VA 4FSAA 4IMAA 4FNUA 2CFFA 5IOBA 4GOAA 4PN2A 3OU8A 3Q67A 2QIIA 4Y8FA 2J6VA 4LJ3A 2VX6A 2CKSA 4U10A 1WZLA 3SJNA 3MO4A 1CIUA 4BQ5A 3B04A 3OOQA 3NZ1A 1E4NA 2RKXA 2NXGA 2HEJA 2PLJA 4MPKA 3H2MA 3IUHA 4IFKB 3SCRA 3NVDA 3NSMA 1E9ZB 4M7TA 4M5PA 4XBJA 4DN1A 3SUTA 3CZLA 1P1MA 2OWCA 1A5AA 5CJNA 3SBFA 1XF0A 3I65A 2QDGA 4U2ZA 1XJBA 4IPNB 3BQ5A 4KRUA 1PZ0A 3TYAA 5D9MA 2XN0A 5T9CE 2IKHA 5SWUA 3AMCA 5DCBA 4YTSA 1JD9A 3FVMA 2OZ8A 3DHFA 2P8CA 4DWSD 1E71M 1E1CB 1Q6CA 1S38A 5XINA 3TTSA 4JTFA 1EZWA 1TX0A 3PSVA 2DIEA 2A7PA 2DZSA 2BLEA 2GJXB 2OQYA 7ENLA 2CLHA 1UD6A 3TZFA 1WP6A 3F4CA 1V3HA 2WHJA 2J13A 3H7RA 4ZO6A 5A95A 3EWBX 1HG3A 1RP9A 1XUZA 2NVDA 3W72A 3WQVA 2BY0A 1ZSXA 2ONEA 4O14A 5HJXA 8XIAA 1I1XA 2WK2A 5REQA 4W5ZA 4KETA 2VHLA 3UP8A 3MMTA 1BKSA 3T05A 2Q71A 5B7ZA 3LHYA 1BF2A 2GOUA 2VELA 4HJFA 3OIXA 4K6AA 3CTLA 1EJXC 2IS7A 3GXNA 1GJPA 1FWDC 2PS2A 3W74A 4GBUA 3TYBA 4MWAB 1ALDA 1SZNA 4YCOA 4RDZA 1XGZA 2YW3A 5C9RA 4M0XA 2G95A 4O8AA 4GC4A 2QCHA 3M47A 3XINA 2PDCA 3AHZA 1SO4A 2XN2A 5CSUA 2DDXA 3OZPA 4PTDA 1A5OC 4ZE4A 2JGYA 1NIUA 4KPLA 2C1HA 3HG3A 3QHMA 3ABQA 3SGZA 1KM5A 4NHVA 3E2QA 3TQ0A 4GJ1A 4DM2A 5J04A 3QTPA 2W92A 1LM1A 2AMGA 2GJPA 3MWAA 4A22A 2XH4A 1A3HA 1Q7MA 2OYLA 3UWYA 3GU9A 2XJ7A 3W2MA 4B9YA 4OTKA 3UU0A 1D8CA 4LS1A 3W82A 2HPIA 2WVSA 2E1DA 5CPOA 4FA3A 2IMRA 3QMTA 1UHVA 2PEVA 3CTTA 3BW2A 3W07A 4Z1YA 3A64A 3AYRA 2WYSA 4GINA 1CGTA 4OIFA 4GKTA 3QQWA 4KWOA 4KERA 1IT7A 3NQCA 4NRRA 3AALA 3T2OA 1EOKA 1ISYA 4GA8A 1TV8A 4LUSA 5HQLA 1A3XA 2WWCA 2VI0A 1JULA 4EVZA 4S2BA 4C7DA 1J0ZA 2REQB 4ZCWA 3W01A 4BF5A 4NNBA 3T4WA 3BJSA 2WZHA 2INZA 2PGEA 2PBOA 3EX1A 2DQXA 4LVDA 3K8KA 4US5A 3SRHA 4RW3A 3KS6A 4PTXA 3PHAA 1HF6A 3KL5A 4UB9A 3NM1A 4IP5A 1BTCA 1V02A 2DH3A 5C0QA 4MYAA 1F6PA 5E9XA 4Z1CA 3ABZA 1UH2A 3APGA 4H9VA 3GBDA 3UZ5A 4P8UA 2VFFA 4LRSA 4BQ2A 1OVDA 1JDAA 4Q32A 3T1GA 2FTPA 2AL2A 3G6MA 3LI0A 3PNUA 3DI1A 1DXEA 1TB3A 4ENLA 2QUMA 1UWAA 4U3AA 3A13A 2NQ9A 3SDOA 2FHCA 4R9XA 2DZAA 5D30A 2AKMA 4DBSA 2DZVA 2X30A 5EB8A 1YHTA 1V5XA 2QCMA 4A8LA 2BXVA 1EF2A 4Q8OA 3WQCA 2P8BA 1XQLA 4EPKA 3S6DA 2J27A 2EG6A 3GXPA 7XIMA 4YS1A 2Q8ZA 4PMVA 1IIGA 1HN1A 4P7RA 5KMYA 2CZ5A 3C2OA 4U5KA 1H7OA 3G1VA 2IQDA 5U7SA 2SFPA 3VNJA 1BSLA 1JPIA 4X2RA 1OHLA 1H1YA 4HIBA 3BWWA 4C6QA 1EYEA 2DJXA 2YKKA 4JFTA 1N2VA 4CUCA 5JH1A 1I2NA 2NQ5A 2NUWA 4F40A 1PXGA 3OG3A 5FF3A 2WCSA 1XICA 1LWHA 3FJ4A 3MA8A 3BMXA 5LNRA 4ZGYA 1EO7A 1PHQA 1SW3A 1M53A 1VEPA 4M56A 1WDDA 4PMUA 2BVWA 5FIPA 3FX4A 4B2DA 4NUWA 5CC5A 1OFQA 4K2SA 4H6QA 4ATDA 1K8ZA 3I6RA 3PN8A 1D3CA 3RM4A 3SFKA 1EP1A 1ITXA 4J28A 3WLQA 1B30A 1J6PA 1ZY9A 3D0CA 4BS0A 4AY1A 1K77A 2V67A 1U22A 2E5DA 4XTIA 4WKHA 3KZSA 1X96A 1TR1A 3CV1A 3TFXA 3GR7A 1JFXA 1JZ3A 4C1NB 5EMMA 1H7PA 1M7OA 3GXFA 2NVCA 3Q45A 2WMJA 3ARVA 4KCVA 3CPRA 1W91A 3M9YA 1NWUA 5ENLA 1P5BA 4FO4A 3BDKA 3ITOA 3GNNA 5LSMA 3GZ3A 3O0KA 2V81A 4XO6A 1QPQA 1H50A 1FHVA 4HYRA 1SFTA 4XD5A 3G6LA 2QXWA 1V0NA 2YL8A 3DAQA 1WKDA 1TCDA 5BRPA 5C71A 4MFDA 2PUZA 4QAWA 2PF0A 2OELA 3WFLA 3MKVA 5FI8A 3PBYA 3N3MA 1UH4A 4IFOA 1PIGA 3ARRA 3GRIA 1TJ2A 5A1AA 2C1IA 1HUVA 2PRLA 1HGYA 3HQNA 2YJQA 1V03A 4MJMA 4D1IA 2VYOA 2C7FA 1W9VA 2XUCA 5FL1A 3GVQA 1NSJA 2OU4A 1OX5A 1JI1A 3WELA 3C0QA 4FHAA 4C6LA 4KWUA 3FNDA 6CGTA 3NL5A 1DL3A 3EWCA 3RGTA 4NJKA 1C91A 3EX2A 4XKYA 2ISDA 1Q6GA 5EYWA 4BR1A 4WCJA 3BV4A 4N4PA 1FFQA 4PC8A 2QJMA 3M0IA 4YVXA 2W6RA 2ZQ0A 4JCMA 4YTUA 4JY9A 2HCVA 3LBMA 2VR4A 1TA3B 1DE5A 4DI8A 2Z27A 2XIBA 4AY8A 3F7JA 3TW6A 1W9XA 4KH2A 1J2BA 2VVSA 3UXIA 3W7DA 4GUIA 4JKKA 3P93A 1RQEA 4NZFA 3H2NA 1XM3A 3CQIA 4DJDD 3IJIA 1P7TB 3S4TA 4WZHA 2GDVA 1LG1A 4LTSA 3W1XA 1R6WA 2W62A 3MMWA 3PPCA 2HXUA 2RGMA 4NJHA 4UTWC 3S9IA 2QGYA 1BRLA 1JZ7A 2XINA 3EDJA 3V35A 4CNPA 5EL1A 3LZ5A 5HQMA 3IGHX 4I7WA 4HMDA 2X1RA 3XIMA 3URNA 1CGVA 3O7UA 1XDMA 2D3LA 2J9XA 1HO4A 5DN1A 3PC0A 3W76A 3BLLA 5K4ZA 1LOQA 3AXIA 3REQB 4JX4A 5F2GA 5A8NA 3AXMA 4LVFA 4O54A 3W1PA 4C6EA 1XIJA 3RJYA 1PYFA 3QYSA 1XSIA 2PTDA 6XIAA 4A2SA 2Z1KA 1HP4A 2XM1A 3E49A 3RU8X 3I7QA 2VL4A 2X1IA 3WDJA 4LNCA 1PJ9A 3D46A 1H11A 4OV9A 3MDUA 3G24A 3G3MA 3F4DA 3HIJA 2E8YA 1IEQA 2OSWA 4WLCA 5F4SA 1EH9A 2QT3A 2R1LA 2I5QA 1GYLA 3H21A 1HT6A 2FDSA 3M6DA 3NPXA 3WUBA 1GOOA 3V5OA 4UQ9A 2JIEA 5JXQA 4MJ4A 4LCSA 3F5KA 3URBA 2Y5EA 4Q8QA 1B2YA 3ORWA 4L4PA 4WJ8A 3NCOA 1DIEA 5M17A 4CD8A 4CQAA 3VKCA 3CHEA 3UVAA 5GJPA 4B3ZA 4CCDA 4ZA0A 3B8DA 4O15A 3UG4A 3LOTA 3OVRA 3NOEA 2CCRA 2DJLA 4CU8A 3W6YA 3TW9A 2QUUA 4US6A 2J78A 3B8WA 1XYLA 2EEXA 1OK6A 1W9DM 3AWNA 5HQEA 2D0GA 1TIWA 1RJPA 3DFPA 3PZIA 1BWVA 3BANA 3V7PA 2RJHA 4FIQA 1ONWA 4EE9A 2ZRUA 1EQPA 1GOMA 4AMAA 5DQPA 1WO2A 1Q7ZA 3NDYA 4Z0SA 1JFHA 4G7EB 1LP6A 2OX1A 3HGSA 1SZFA 1K9EA 4AH7A 1JQXA 3RM8A 2I14A 2QMJA 4L1GA 1SJDA 3DFSA 3RU6A 1N7KA 4O12A 1X8CA 4XUYA 1SVDA 2ZCGA 1VH7A 3PJUA 3B8TA 4UCFA 1DWJM 2PD9A 2D73A 2WNZA 1POJA 4PH6A 4E8CA 4FLOA 1NF7A 4HZ8A 3RCNA 5FJOA 4KEUA 4WIWA 3SY5A 3A4WA 2WMFA 1S2TA 3KRUA 4BJHA 3ZMRA 3URQA 4P7NA 1Z32X 1ZU8A 5H8PA 2BFGA 1OD8A 3QKZA 3WQEA 2R1MA 3RX3A 2KX9A 4M81A 3ITCA 1ZCCA 1G4SA 3VKJA 2QV4A 3ZJKA 1DXFA 5CQ1A 1UG6A 4L9XA 5HXMA 5LA2A 1UBPC 3KVJA 3DFNA 2PWHA 3U4AA 1ZNNA 3PPHA 3L68A 2I9EA 4OZOA 3LN3A 3BURA 1ZFJA 1WXYA 3DI0A 3M5XA 1JPMA 1JZ2A 4N6FA 3AWOA 1F73A 4LVGA 4K1WA 3OLIA 3NOYA 4AC1X 1WAWA 5L9FA 3MWCA 4WSHA 3LGGA 1RD5A 5JUVA 3SUVA 3M07A 3MKCA 1WKFA 4LPCA 2XH0A 4AHQA 2F6XA 1QRQA 2Z24A 2BHUA 1EJSC 4I5RA 5AYBA 2E68A 2RJGA 1NFBA 3BG5A 2BGSA 4TX9A 2PTYA 3NDOA 1A0CA 5A8PA 1EL3A 3OA3A 1D7FA 2DFAA 1A5UA 1S46A 1S1PA 3ABXA 4DUXA 1XYCA 5LXEA 3WK0A 3GWQA 4QEHA 4DLMA 4JTLA 2WB5A 4B9ZA 1KCZA 4B3LA 2KZHA 4I3GA 4LB3A 4ZTXA 4NAFB 4C1LA 1VYRA 4FXJA 4LB4A 4XD4A 4MWAE 4GFIA 3DX5A 2OZTA 2E5CA 5EKYA 5JBEA 1THFD 1XLKA 3GG1A 3T40A 3TMLA 2PA6A 1YXDA 3DIPA 3GK0A 4OE7A 4RK8A 1GCYA 5HR6A 1EC8A 3MVTA 1M01A 4HCHA 3EPNA 3LHZA 1VCVA 1TVPA 5F1UA 1QOXA 4O0KA 1I8JA 3NWRA 3UPWA 2J9ZA 1LJYA 3AMKA 5AVHA 4JTIA 4U4MA 3BICA 1KRCC 2E6YA 2V3FA 1HP5A 1U5VA 3HGOA 1KV5A 3TSMA 3E5PA 4GQBA 5CGMA 2Y5JA 2NT0A 4RXFA 2Z1BA 3I4EA 1E56A 3R10A 1B9BA 1C9DA 3RXZA 2E9BA 4B92A 1R3WA 2Y89A 1LT7A 4KEVA 3AFBA 2PDHA 3WNMA 3QQ1A 4C7GA 3IANA 3UW6A 3B8IA 1VFUA 3NQ7A 2ZYFA 1S2AA 2YB4A 2HQAA 1IWBA 3DFTA 4WXYA 2UY4A 2DUXA 3GTHA 4AWSA 3U4FA 2O55A 3NSNA 4KEMA 3KVLA 2W9MA 3M43A 2HNHA 2PDWA 4WR3A 1SW0A 4CN1A 1Y0EA 3OHIA 1QT1A 4TIMA 3AIEA 3W1MA 3M0VA 4NYUA 4MWAD 2C18A 1GVIA 2NWRA 2VFDA 3KWXA 1Q2SA 3N13A 2WZIA 4MSSA 3PR2A 2GOKA 2DVTA 3C52A 1JDCA 4W86A 1OSEA 4YL2A 2O9OA 3CYJA 1RCXB 3UQNA 1TX2A 3THUA 3W22A 4QHRA 1BWKA 3EEGA 3LPGA 1MDRA 3DBNA 4YNGA 1YADA 5CG7A 1XFBA 4K36A 4HMEA 1NP0A 3WDHA 3C8FA 3GTIA 3GY1A 2X0SA 3PZTA 4NL1A 3T9PA 5DRCA 2CLLA 1CDGA 3WSUA 3ZVHB 3ELFA 5GNXA 3SIZA 4Q4OA 4E5TA 1X1OA 4IX2A 3CWHA 1OIFA 2VURA 4JXCA 4QX4A 5D38A 1MEHA 2GVEA 2WM1A 2QR6A 1OC6A 1ICPA 4MF4A 1BLIA 3EWWA 1RBAA 3IAQA 2ZRYA 2ZVRA 3B03A 3GNDA 3KDNA 2XVLA 1KXQA 5GJMA 1LOSA 4QSFA 5DFAA 3S5SA 4X0VA 1WOAA 2GGIA 3T4CA 2F6KA 1H7WA 3ERPA 2VQTA 3M5VA 1AUSL 4NILA 2CNCA 3T6CA 4F0MA 4J9JA 4P8VA 2EAWA 2AGKA 3N2BA 2RDUA 4D72A 3MP3A 1DJZA 4ML9A 3OZYA 4I6KA 3AJ7A 4UFHA 4CQBA 3L4XA 4QROA 5CGTA 3C56A 2ZC8A 3CH0A 1RBOB 5G4EA 3BO9A 2BS9A 1PDZA 5IDIA 4C65A 2VFEA 3VGFA 4QEEA 2IXUA 3W27A 1PCKA 3W6LA 1T8QA 1PZ3A 3IGSA 3TR9A 3HFTA 1G4TA 4H8VA 2ACSA 1EEPA 8TIMA 2V2DA 3ZS4A 1W3KA 3M0KA 2CIPA 3M5ZA 4AD0A 1W32A 2D2JA 5I00A 3LY0A 1CLXA 1XBZA 2ZFAA 4DY1A 3QGAC 3TZNA 1SU5A 3W1TA 2H8XA 4FI4A 3EAUA 3UGVA 3N9RA 3U2OA 3TOPA 2R1NA 1CLKA 4GI8A 5AHEA 4GD0A 1VYSX 4J27A 2J9YA 1XDJA 4I8DA 1Q66A 1I75A 3WDIA 3S1XA 1NDZA 1FXPA 4AWEA 3E0VA 2HROA 4JOMA 3OHMB 1W8SA 3TYDA 4C6IA 2E1WA 3L23A 1RXOB 1QNVA 4UR8A 1QI2A 1UIOA 4F48A 3VMPA 3V18A 2H9AA 3MSDA 3W38A 1BPLB 3VOIA 3DXIA 1RP8A 3HA1A 2QF7A 3IGUA 2UY2A 5KINA 2PI6A 3RNDA 2YCJA 3OTRA 4HA0A 4S2CA 2TMDA 4A8RA 4HA3A 1QAPA 1BEUA 3LLFA 4GYPA 2I9UA 5A6JA 5AOUA 4EIVA 3GC2A 1EPXA 1SMDA 2CBJA 5IBXC 1SQ7A 3CXOA 4WDUA 4KKXA 2H8ZA 3IIZA 4O17A 4EPEC 3SCUA 2BVTA 4JHZA 2Y88A 3M7SA 3ITXA 3OQ8A 1WZAA 4HT3A 4JNYA 4IUOA 4ZXLA 4O53A 2FZMA 3QZAA 1YBQA 2INFA 1LZOA 1V3KA 4AIEA 1NFGA 1Q6RA 3BSHA 4GGBA 3BAIA 2PCQA 3IACA 5CBIA 1PO9A 4MAVA 2VGIA 4ADSA 4DO4A 1AODA 2FKPA 1RCOB 4UNLA 3K4DA 2WLZA 2QF8A 3LRLA 4KESA 1OY0A 2E28A 1H5VA 6A3HA 4OT7A 1FWFC 3WLNA 4EF8A 3BAYA 1OX4B 3V0SA 4DM1A 4NU7A 3MUY1 4JTDA 3CO4A 1BWLA 2WJFA 1GZGA 1E5NA 4JIEA 1QU4A 5AKQA 2H90A 3ONBA 4PMYA 3VGEA 3OLGA 3BH4A 5DXXA 1EIXA 3N4FA 3QY8A 4S3CA 3BOLA 3ITTA 3GVGA 1M6JA 4KGLA 2C8NA 3PULA 4PA8A 1UR2A 2A7NA 1JPKA 1QI4A 1WYIA 1KLYA 1KTCA 2HRWA 3WY1A 1DP0A 2YFOA 4RNJA 2FFCA 2BOEX 4GNVA 3RHGA 1J79A 3ISIX 4QBXA 3A47A 3FK4A 1LBLA 5CC3A 1C8QA 3S9YA 1TPUA 1QHPA 3A3HA 3VUPA 1PTAA 5A2AA 1US0A 3LCXA 1OG6A 3TW7A 4EWND 2XZ7A 2HS8A 2DW7A 1Q8AA 2NUYA 3R8RA 3C4UA 2QYGA 4H7CA 1GW9A 1TFVA 1FBAA 1G0CA 5LGXA 1V08A 2ZKMX 1UOZA 4IJCA 2GL5A 5BZAA 4KIRA 2GUYA 4F2UA 3TC6A 4QM1A 2PU0A 2HXTA 3S42A 5A8MA 4ZL1A 1EDGA 3DG6A 1FWAC 3E2SA 3EDKA 4IQLA 5A3HA 1QJWA 5E5CA 4ZMGA 1VBJA 1VC4A 2ATSA 4F66A 3CWOX 4BWLC 3P5ZA 5EFDA 4E8DA 4LVAA 3OZOA 4RR4A 2NV1A 3DGBA 3CUGA 2DW6A 1DEDA 1O5QA 3COTA 5BU6A 2WMIA 3LI1A 1PWLA 3VC6A 1PBGA 3CASA 4K1GA 2IUZA 1GZ1A 2VGGA 4PUNA 1F4HA 2J8FA 1SR9A 5HULA 2H3BA 4DUWA 3T0CA 3EPMA 3WQ4A 3NXFA 4XD3A 3GIQA 1W54A 1QFEA 3KOZA 1ISXA 3S2JA 1GZJA 4LRTA 3SCNA 3VNKA 4LV9A 5D32A 1XG4A 3PZOA 5DRIA 4IIEA 3G1YA 3WK1A 3QRHA 3UNTA 1FWRA 4OOUA 2FZNA 4W4QA 4F8XA 4R27A 3T8LA 2J7EA 3U8GA 2YCLB 4HCDA 3LPPA 2DSVA 4CNUA 4UC5A 3RPDA 4AAJA 4ICMA 1G7VA 1EC9A 4FXRA 1BYCA 3GIPA 3WLTA 1EP3A 1OD0A 1Q4NX 2ZZ6A 1QO5A 1O4UA 3WKZA 1CNVA 3CUIA 5M1TA 1B90A 2E4TA 3TYCA 3QZEA 2WKGA 1KM3A 5E9AA 5BRBA 3EGJA 4ZFMA 1RY8A 3B05A 3AHTA 3DH7A 3I10A 3W37A 2YPIA 3EB4A 2RHGA 3UZZA 2ZDSA 3BSMA 1K4GA 3IJLA 1LTDA 3WNLA 1KXVA 2J7CA 4GUFA 4XZIA 4UIOA 2BV9A 3S9ZA 1VHCA 2XTKA 3VKKA 4EX4A 2PTZA 4IGMA 4R88A 4UOQA 2NXHA 2X1UA 3NUKA 1AQFA 3WD0A 3LV6A 3QQ0A 3CK5A 1ME7A 2GVLA 4RE3A 2VM8A 3T09A 1DJHA 3TONA 3ARYA 2XVPA 3W7HA 3NZRA 4AZ7A 3K8LA 2DH2A 2BOGX 4IIFA 4FAMA 5DXYA 4HSNA 1KM4A 2MUCA 3N6JA 4Q8TA 2J7FA 1VIWA 1AZ1A 4RXGA 4NNCA 3UJRA 3WYZA 2HWGA 5FSEC 3PUOA 2XIOA 3DC0A 1LYXA 4DBEA 4WSJA 4QIUA 3W24A 4KCWA 5I79A 1KFEA 1CB2A 3E0FA 1K9DA 2WW5A 3CJPA 4LALA 1MUCA 1LROA 1SZRA 2WKLA 2BGNE 1XRSA 2DSKA 3ZT7A 3CIXA 2ZUVA 5I3IA 2GLKA 1FKXA 4DJFA 1MUWA 4QP0A 2OOFA 1G67A 3OW1A 3W7LA 3UBPC 3N17A 4AEEA 1WBHA 8CGTA 2R8WA 4LOCA 2ZX9A 2FZ8A 1NDVA 3B3DA 1V77A 3CUJA 1ADSA 3FXGA 2GGGA 1NJJA 4AZ6A 4M1BA 5IDZA 4GQGA 3LXCA 3WJZA 3VMOA 3QBUA 5TD4A 1MXDA 4M80A 3G0XA 4XZLX 4O16A 2I5IA 4PGLA 2NLYA 4B5WA 1ZJIA 4QCFA 3QGVA 1QTWA 3TYUA 3CL8A 3CMFA 4KS0A 4UTTC 3M46A 1G01A 1E51A 3GW0A 3L9CA 4JZ5A 2QPSA 4TQTA 4HN8A 1W3IA 2DV0A 2QMKA 4JTCA 1GJUA 4HGXA 2Z28A 2D0HA 2XGBA 1QPNA 3ZR4A 1Z6KA 1BG4A 4O1DA 4PUJA 2QVHA 3PZGA 4H2HA 1J2WA 2GUUA 3LU2A 1OT2A 3L65A 4LNYA 4W87A 4H41A 1FHLA 4ILSA 1RK5A 1TPWA 3MT1A 2JE8A 3H4WA 1NELA 2PDXA 1FY6A 3RX4A 1IGSA 4QITA 5ABEA 2WSYA 2IKJA 2RFGA 4NY2A 3EDFA 4HA1A 4PZVA 1JZ6A 1QI5A 1QK2A 2NQJA 2QJJA 1MWOA 4AG0A 1HFBA 2FH6A 3PBGA 5F2LA 2G3JA 3MVIA 4Q7IA 5CBJA 4LYRA 1ZJHA 3DHDA 1HKKA 4I7VA 3EDDA 1FCBA 1TPVA 4LYPA 1YXYA 5HMEA 2Q3OA 3HQPA 4HD5A 1NDYA 3PB0A 3KP1A 3E0LA 3NZPA 2VDGA 5MKGA 4JICA 4RL3A 4JEJA 3SB0A 4TMBA 1UP3A 1SFJA 4CEUC 4DI9A 1VENA 3PWAA 4MM1A 4MJZA 2XIMA 3AMDA 3ARSA 5D2XA 1ISWA 3BOFA 1OFRA 1CENA 1VKFA 3APTA 2QDHA 4CQ9A 5I03A 4AF0B 2E6AA 3OGSA 1GOIA 1GEQA 4A35A 1OFAA 1BYDA 4REQB 3BLIA 4IT1A 2ZUMA 3W02A 2AQOA 3TTQA 3WMBA 1FDYA 4F2TA 3VNIA 3VZYA 2KAUC 3KM8A 4F0SA 1B0IA 3BGJA 4OV4A 3LX9A 2BP1A 3BAXA 2BVYA 5C2GA 4FX7A 2VD9A 4N9BA 3AS2A 2G41A 4TX8A 3MUCA 7CGTA 2V5LA 4RPQA 1IR2A 4NP7A 3ZLFA 1B5TA 2GJNA 4DPPA 4GZ7A 3CGTA 1Q6LA 3LCIA 3QPEA 5H1WA 3OLEA 3WN6A 3VCRA 3VKAA 1EA0A 2E6FA 3UPBA 1V51A 1N55A 3QVQA 1ISZA 3FEMA 3G1AA 1J0YA 1W1VA 5D2VA 3GDKA 5HNTA 1ELSA 4B5UA 1OC5A 4KMQA 4AVOA 1KM1A 1HJSA 2ICSA 1UZ1A 1LL7A 5BROA 3AS0A 3DG3A 3LTPA 5K3VA 3HTWA 1RQHA 2VC7A 2R91A 3LCFA 3NSXA 2PP3A 3SW6A 2OLHA 2XSAA 1GVFA 3H55A 1XLFA 2WZTA 4WSKA 1R86A 2P0IA 1V7YA 5DY3A 4H00A 5AZ0A 3EB2A 4RDYA 5AHIA 5E6YA 3IJ6A 3F2CA 1J8VA 1FWIC 4YWIA 4LSBA 2CKRA 5LGZA 2EXOA 2CZEA 3GXIA 3HZ3A 4Q4SA 3LB0A 4YHGA 5BW6A 1YW1A 2PLMA 4OOZA 4D6FA 5DCDA 3O06A 3TYEA 4IIHA 5G1YA 4G2DA 4M82A 4E8GA 2QJIA 4R7WA 2PDMA 3VPLA 3UR2A 2YDRA 4J3WA 4BZYA 4DBUA 5JIWA 4D6HA 2FLIA 1DE6A 4PMJA 1MW1A 1SJAA 1QNOA 4D6DA 2OSXA 3Q2DA 5I09A 4MB1A 2HS6A 3TYZA 4Q7BA 3V4BA 3FHAA 4N9DA 2PMQA 2YW4A 3AS3A 1E6SM 3NL2A 1KBIA 4OBSA 3CZ8A 3M64A 1JXJA 4GO9A 3KWSA 3SRFA 2V69A 5AHNA 2L5HA 2IPGA 1R30A 2NX3A 2V3GA 2OQHA 2G8ZA 4Z1BA 2NSOA 1M41A 3WLRA 3O2LA 4XZMX 4WEVX 1FWJC 4F79A 4PMDA 4TMCA 3DEQA 4H9XA 2TAAA 4HK5A 5LA0A 2D2HA 6ENLA 3R7MA 4ZB2A 3OO2A 1FWSA 1TE1A 3RMJA 3N25A 1UPPA 4LY8A 4C6JA 3T78A 4JFWA 1BXBA 1QPRA 3AISA 3FJ6A 5KETA 2A0NA 4D6CA 2W27A 4DYEA 3ECQA 2NUXA 4JTEA 4L80A 2B7PA 3ZWSA 3IJ8A 4AW7A 3N2OA 4PB5A 1ZQ5A 1TJRA 3P84A 3TQVA 4JN7A 3GUGA 3A9BA 2BBFA 4CD4A 3WNNA 1IZJA 2ZUNA 3L0NA 4OWGA 1PB0A 3VINA 3ABRA 2JIWA 2V5KA 3S1GA 1I45A 2D23A 1E15A 3ARWA 5ABTA 5FF0A 4HZ7A 3DYPA 1PTDA 1MZHA 2J7GA 4MOZA 5CLTA 2ZX6A 1YPXA 3WENA 3NPUA 3OP2A 4QE4A 3V0TA 3VIFA 1CBGA 2G5WA 4WY0F 3ZQ9A 2VRKA 4AEOA 1Q13A 1U1JA 1WUEA 2GVGA 2CEQA 3QKEA 2NX1A 4HHPA 1W1IE 4C91A 3R4IA 2CITA 4AWUA 3P8JA 3VKDA 4FXSA 4TTUA 1EXBA 1WAUA 2C0HA 5A94A 3M6YA 4Y7EA 4L9YA 3DERA 5I3KA 3M44A 2ATMA 1H7RA 1WV2A 3BLPX 5I6SA 1TPDA 3JS3A 1QW8A 1GONA 2AKZA 3W84A 1W1A1 5H91A 5E09A 4NI3A 3TK7A 1Q65A 1PS9A 1W1PA 2GQ9A 3CUHA 1VBRA 4XD6A 4HP5A 1FUYA 4L4LA 1E4LA 5HWNA 4C6OA 5DX7A 4J2PA 3G8RA 2HZGA 5D9PA 1E1FA 1FWHC 4C6CA 1QMLA 3LCGA 2ZC1A 2EO7A 3BZGA 1J0JA 4ICCX 2B4GA 3CLWA 1DJYA 1EX1A 2R6OA 1YXCA 1UWQA 5D03A 1TUXA 1F6KA 4GZEA 1TTJA 2V5JA 3KBWA 3W85A 1CI1A 5HJLA 5A6AA 1BVNP 5DO8A 1HJQA 2B31A 4W93A 3T0DA 3FA4A 4LYKA 1KWGA 5BU9A 1UMYA 3HGJA 3U48A 4HKPA 4NSBA 2ISWA 3TC3A 1FTXA 4IGNA 3VO0A 1UMLA 1Y8BA 4LEFA 1V3JA 2D22A 1B3OA 2VTFA 2OEMA 2WZMA 1KGWA 4S3KA 2VFHA 5G2WA 2VR5A 3W2UA 4I9MA 4AYSA 2O9PA 1E6ZA 1A5MC 3AMGA 4BQ3A 3POCA 2EPMX 1PYMA 1U5JA 1ZCOA 3IIXA 5AVNA 4XIAA 3H26A 4CNTA 7ODCA 1FXQA 4JN8A 4HNLA 4C5ZA 4A2RA 4N4QA 3CU2A 4ROQA 4UQAA 5I3HA 3QV9A 1TRIA 2NX9A 2DP3A 3TWAA 3LCHA 2VZOA 3NPVA 5M03A 4K3ZA 3R11A 4UR9A 2QJHA 1O7AA 2OT0A 2YR1A 3O6YX 3WMCA 4IQDA 4S3JA 4ECLA 1ESWA 1UWTA 3L2IA 1WPCA 4W8BA 4CU6A 1LBMA 1NOWA 1KBLA 4JQ4A 4HSHA 4L65A 5KTLA 3MCNA 3UEQA 1KNWA 3UETA 4ZBCA 5MF5A 2WV8A 4HK7A 4LAKA 2Z7GA 1MMFA 2YGYA 1UCWA 4NKCA 5M5DA 2YCLA 3HN3A 2B0MA 3DN5A 4JFVA 3W71A 3I4KA 2I57A 3MV01 1TQXA 5XIMA 2FGLA 2ASHA 1YX1A 3A4JA 1EDTA 4QJ3B 3NQ6A 2INEA 4GJJA 4NAEB 3BLKA 3W1LA 1T96A 1M9HA 1YNYA 3IJDA 3NQVA 3B0UX 3CT7A 1HXJA 1J10A 1F2JA 4QQUA 3BJTA 3PZQA 2ZXQA 4DLFA 4JGDA 4AY7A 3QV7A 3B0VC 1MEWA 4LUYA 1OEPA 1UWSA 1IXNA 2PWUA 4PMQA 3QFEA 1PE1A 3WUEA 4HHHA 5MHBA 3UXAA 1B4KA 5M2FX 3AYSA 1PIIA 3W7PA 4EAMA 2RAGA 3MMUA 4RZ5A 2ZBTA 4CLMA 4GY7A 2OYKA 1W3JA 2TODA 4DUVA 2ZWYA 5LHFA 3W1UA 1MRAA 3TDFA 1IZKA 3C61A 3H53A 1GQIA 3CPGA 4GYFA 2BVDA 3AC0A 2AGTA 4I9JA 3E12A 4ES4A 4L6HA 4HOWA 4DO7A 2FTYA 2VEGA 1DQXA 3AXHA 1UQZA 3KBSA 1DXIA 2PZNA 4DIAA 4PTVA 1OCJA 1YLVA 3CQHA 2PBGA 5A2CA 1H60A 2EGZA 5G5IA 2O7QA 1O5RA 3OLDA 2OWXA 1XSKA 1OCQA 5C6MA 2VEPA 2W61A 3E38A 4LXFA 2E3ZA 1P0EA 4AZBA 3C2VA 3PAOA 2FVKA 2Y5SA 3NDZA 4WJEA 2O56A 4F2BA 3FVDA 4ZOCA 3ES8A 1WXJA 3ZT6A 5D05A 3SRDA 2PWVA 5E0KA 2VX7A 3WZ0E 4F9JA 1HL9A 1HW6A 1GEHA 5HUOA 3NG3A 4KBXA 2WWDA 3LM7A 3EWUA 4IG2B 4HSOA 1MUMA 3BSGA 3DYMA 3N18A 4S3AA 3T81A 3FSUA 2JK2A 3FW6A 4CQCA 1EOMA 4YTRA 2G50A 2Z1XA 1VCGA 3TC7A 2BXZA 3H24A 1YEYA 2WHLA 1CZ1A 2NLIA 2W91A 4A3RA 4LAOA 1A49A 1XYBA 4K8EA 3DBPA 4YTQA 2VXNA 3SCWA 1Y5VA 1XIFA 1R46A 1C8YA 1A4MA 1OK4A 1ONEA 3GBEA 5I3GA 3UG3A 1NF0A 3HF3A 4AZGA 3N2MA 1ZENA 5H2ZA 1PAMA 5I06A 4IMDA 4Q4PA 4DVOA 1F3WA 1F74A 3IAPA 2VEMA 2BXYA 3CMGA 2YXGA 4NJGA 1MW2A 3BLEA 1L8PA 4GY0A 4JIIX 4E38A 3SUWA 4DEFA 3EA2A 4KW2A 3WD2A 2NXIA 2EF9A 3GVVA 3RPMA 4K8HA 1MQQA 5HWMA 3U6WA 4UWMA 3RIKA 1IIHA 4U31A 5CGQA 3KBNA 1ICQA 2VVNA 4TVUA 3ZOAA 3LDVA 3F5LA 4QFUA 4C6NA 1LWJA 4RE0A 3L21A 1E73M 4E4PA 3INPA 1O6IA 2D0FA 1LL4A 4YVVA 4PBFA 1TWIA 3VNDA 3ZJ8A 3ZYZA 4YHEA 1FH7A 1Z8AA 3O6AA 1AJ0A 2DU2A 3VIIA 3MHGA 3M0HA 4MDOA 1ZBVA 3OG2A 2PB1A 5A6TC 4D9PA 3W7QA 1HJVA 2R82A 1EC7A 5I7GA 5RUBA 3B4YA 3G18A 3PBMA 3S83A 4QG6A 2O0TA 2Y7GA 2WVVB 3KDOA 1AFSA 1VD6A 3E74A 5LXXA 4O0QA 5C55A 3CAQA 3H8AA 2Z2AA 2O92A 2W66A 4GACA 3UR5A 5LZLA 1MYRA 2OCZA 3LA4A 1IZCA 2WC4A 4ALDA 4MNMA 3PG8A 3U2CA 2DORA 4QG9A 5I3JA 3C5QA 1NVMA 5AC8A 2FZDA 1O5KA 3TSDA 2PTWA 5IHRA 3KHJA 2IQ0A 2GDQA 4HA4A 2O9RA 4AX6A 1QW9A 1EGVA 1X97A 2I56A 3OIHA 4X3ZA 4IQEA 4AB4A 1EJRC 2A21A 4V1YA 6REQB 1EIBA 4UQDA 2VX5A 1UD3A 1T8XA 2YCIX 5C9UA 1ZHAA 5K2ZA 3UR7A 2B81A 3OGVA 3FAXA 1S5NA 4TV6A 6TIMA 4MUZA 4ADUA 1QHZA 3TJXA 3PZUA 3GNOA 2ACRA 3WLJA 3LQGA 3AOFA 3SJ3A 1E4IA 1JCXA 2WANA 1EB3A 1UWIA 2TYSA 2AOSA 4FF5A 4TVDA 2CETA 3WJYA 3ANYA 4NZ3A 5HAOA 3DYOA 3EZ4A 4EXAA 3Q65A 1XYAA 4IMFA 1LLOA 3SUUA 3HG2A 4PUKA 1UPMB 4QJ5B 2DGAA 3UWUA 3KTSA 2VEFA 2JQXA 2C19A 1J11A 3DZ1A 1VR6A 3NQEA 1XC4A 4X0NA 3MPGA 5CZ0A 1R47A 3PPGA 5M3WA 3BW3A 2J47A 2BB0A 3D3AA 3PM6A 3OVGA 4OQVA 3AIQA 3L4VA 2QUTA 1GYNA 1J0IA 3TMQA 1CGWA 1FHDA 2R14A 3EX4A 3VA8A 4WGXA 2X42A 2ZZ1A 2OODA 3HGRA 5C9WA 5A8QA 2ANUA 4JDBA 4RZBA 2Y61A 5EFFA 2WC7A 4O0ZA 3LSBA 4HPNA 3P3BA 2JGQA 3EPOA 4CD7A 3WBXA 3C0JA 2POTA 2TSYA 4MNJA 2ON3A 3DKJA 2OXNA 3AHVA 4LS2A 4FNPA 4UTUA 3CL7A 3WLKX 3TUUA 4HNNA 3WNKA 1BTMA 2QJGA 2VRJA 5G4HC 2CPUA 2DSZA 3WLSA 5HMSA 5FAJA 1X98A 3GLCA 1SR0A 3I3EA 1AL7A 4M51A 3I6TA 2IPJA 3FS2A 4FB7A 4MB3A 1YRRA 4J3SA 4DWSA 3VD9A 1GOQA 4HCLA 2QIWA 3KRZA 1FWCC 4CEXC 1AG1O 4KRTA 4F0KA 3PUEA 3KVMA 2A79A 1ZJAA 2XH2A 3W29A 4KQNA 1WE5A 3N04A 3N14A 1UR0A 8A3HA 3GDRA 1DQWA 5LA1A 1IV8A 4MYXA 3KOXA 1K7FA 2ABAA 5DLCA 2QQ6A 3MKKA 3RR1A 4YLWA 4ZO7A 2E77A 2WNNA 4FOJA 1P4CA 3VD5A 4DPQA 3H23A 4CNOA 2Q09A 3BQ6A 1SPQA 1I2OA 5C8BB 2FPTA 4RZ6A 3SR7A 2W5FA 1CXHA 1UBSA 4S38A 4Y9MA 5GNZA 3TV8A 3JVAA 3VM7A 1XIBA 2Q6ZA 3HPZA 2VC6A 4QLLA 4P61A 3RG6A 5ABGA 5DBTA 1AL8A 1UD4A 6PTDA 1ISVA 4JTJA 1A50A 3W2JA 3MU7A 3TN4A 1KKOA 4WKAA 3QC3A 2NWSA 3B9EA 4N0RA 2PGFA 3IEBA 2Y7EA 7REQA 1NU5A 3A12A 3F4VA 1V6VA 3DC8A 4XSMA 3N4AA 2J8TA 1K7EA 1PVNA 2OZ0A 3NQAA 3QR3A 3PF3A 3MANA 1UJPA 2XN1A 5B80A 4DZAA 1Y5XA 2BODX 4HPXA 2XISA 3CAWA 4B3KA 1O1HA 2G37A 3RM9A 5ECVA 1BXNA 3DFOA 3W70A 1OG0A 1SJCA 3PFRA 1DHPA 1IE7C 4HPJA 3GH4A 2ZVIA 1VCFA 4UTHA 4P7LA 1JD7A 1KQYA 4GHRA 1XLJA 4IPPA 3UZJA 1AVAA 2ZUSA 3HFYA 3FJLA 3S5ZA 4NF7A 3E02A 1W5PA 3QFWA 4IP7A 1PKMA 3UWWA 3L4WA 3UWVA 1HKJA 2ZA1A 4X22A 3XISA 3WH9A 4KEZA 5HJYA 5D8ZA 3ARUA 2GQ8A 3OBKA 2ZTJA 2YA0A 3W23A 4PBEA 1ZP3A 4GUHA 1YDYA 3K5XA 4N02A 4DAFA 1YE6A 3DDMA 4G5DA 3W86A 1E43A 4UTLA 3GHUA 1JXKA 1XIGA 1OJXA 3MQTA 3WO8A 3A4AA 5FA5A 4R5EA 4E3VA 3DESA 3TJLA 4PL1A 1ITCA 1FP8A 3WQGA 5C2XA 1DWGM 4WJXA 3S1VA 1EP2A 5T91A 1KR1A 1OF8A 4GH1A 1GOXA 4LH8A 1R38A 1J18A 2QDEA 3VD3A 2HNEA 4MZ8A 1OZMA 1BQCA 1REQA 3ITVA 4EANA 4H6KA 3QTGA 1L6WA 1P6BA 4ATWA 5AC4A 3RUBL 3WQPA 1VP5A 2E67A 5BXTA 4IQJA 1CEOA 4LWWA 1QO2A 3IIOA 2F9RA 4GC3A 1E0UA 4L64A 4DF0A 2ZX8A 2IPWA 3CC1A 1XGEA 2X2YA 5LIUX 2O7SA 2ZWZA 4ZB5A 1VRXA 2A3EA 2PTXA 3QEZA 1FWBC 2BY1A 3VE9A 4IL0A 3MZ2A 4X60A 2NV2A 2AL1A 1XW8A 4GY1A 3GXMA 4YJ5A 3R89A 3SUSA 5ABFA 3CHCA 1DIDA 4ACZA 5K9DA 3G1SA 1LUCB 3HMJG 3ZWTA 3PTMA 3M0YA 1JNDA 1WZMA 1OB0A 2RGLA 5HPOA 4URIA 4PEKA 1FP9A 1I6NA 1I4NA 1LRNA 4L56A 2HJPA 3ZSTA 1IWAA 4F9DA 4ML4A 2V3DA 1XDLA 3EB3A 5C9XA 1OYAA 4CNSA 3PTDA 2DT2A 5DMLA 3W4RA 4ONVA 5LNVA 5A6LA 1DJIA 3EEZA 3WBAA 3CT2A 3BPWA 4L61A 4W9TA 4D6JA 5AZ1A 1PHWA 3LERA 4QJ4B 4AXNA 4O1CA 6XIMA 4AQLA 4QE1A 4W8LA 2BWGA 4G1KA 4XTDA 5DMYA 5JBFA 3C2EA 1PTGA 4Q33A 3QW4B 3G22A 4GI6A 4LAMA 1CYGA 1EHAA 4DF1A 3CUXA 3GU2A 1J01A 4E0CA 3VDBA 2YXXA 4DELA 4IUGA 2G4FA 2OZ3A 4HNTA 1US2A 3LHUA 1XYMA 4XAPA 3SM0A 2BG5A 1LL6A 4JIRA 3EX3A 2QLYA 3NVTA 3GE7A 3H54A 3I7RA 1JDEA 3APYA 3UNDA 2PWFA 3H2AA 4AZHA 1GWJA 3LTSA 2WM0A 1OCBA 3OYZA 3R58A 4IHCA 4DZHA 3NTYA 2JKPA 1DJNA 1D2KA 3TN5A 2ALRA 2YIHA 3HJEA 3BAJA 1O95A 3AROA 4PRTA 1WNOA 1S39A 1RK6A 1GKQA 2XG9A 1J5TA 5HA7A 3JZEA 4HZMA 5AC6A 1X38A 3R0DA 1K6WA 1VJSA 2IPFA 2QHAA 3WQ8A 2VCAA 3UERA 4ZR8A 4AZCA 2PPGA 3GTFA 3B9OA 4K68A 5C2CA 4XK2A 2VT0A 3T2PA 2WVUA 4GUGA 1YPIA 4H9YA 2G3NA 5CPTA 2J88A 4GI9A 1TKKA 3U9IA 2PZ0A 1Z42A 1FKWA 3P74A 1E9LA 2CZVA 3ME3A 3IRDA 1UZHA 1EGZA 3GR4A 1U33A 3GHSA 4XZHA 3WBWA 1H41A 3QGKC 3WLOA 4J40A 1I2RA 3VGHA 4Q4QA 1OGSA 1ITQA 4E6MA 4MKSA 3HO8A 3GHTA 4K38A 2PLCA 4M29A 3TNOA 1JNEA 2UWFA 1V6WA 2XFRA 3TE9A 3U57A 3RILA 1SO5A 5REQB 4JIPA 5BRQA 3O0FA 4UFJA 3L67A 1SO6A 5JVLA 4JTHA 5HBFA 3SO7A 2BX7A 3R6IA 3G1FA 4GXWA 4C6FA 2RDWA 3LRKA 4GX9A 2NV9A 3CV2A 4LUTA 3MBFA 4QRNA 5I0DA 1F76A 3QJAA 1WDWA 3LPOA 1AD1A 3LCWA 2J24A 1OQFA 1CXKA 4DJDA 3GUWA 3STEA 1LLWA 1X1NA 3WK2A 2X09A 4MZ1A 3NYDA 3MY9A 4MGGA 3LV5A 3FAWA 3GNPA 1HKVA 3K8MA 4IIDA 1RVGA 1US3A 3FGCA 1W3NA 3BV7A 3II1A 2CC0A 5F1VA 4XISA 1S2VA 1IEXA 1XLLA 3UFYA 3NAVA 5HPCA 1GTHA 2CW6A 3A3XA 5H6HA 4QLJA 1JCJA 1JGIA 3NQFA 3SGGA 3W2LA 1XUUA 2JFEX 1C8VA 1OC7A 1TTPA 1WQ5A 3EKZA 3L66A 1IWPA 3G1HA 3RK8A 3KTXA 4PFMA 2J4GA 4GIRA 1X8FA 5TNVA 4KCTA 4D6EA 4W8AA 3RLVA 1QBAA 4B16A 5KSWA 1E6QM 1PUDA 2JEQA 1L6FA 4JDYA 5I2UA 3ABOA 1Q85A 4O1FA 3SSJA 2RUSA 7TAAA 1MVYA 2QCEA 3HM7A 3W7GA 3ARPA 3UWEA 5C7HA 4FK9A 1CLVA 4Y96A 4MLJA 1TPB1 1HZYA 3ITYA 1A5KC 2XWDA 1X39A 2V5BA 3IVUA 5A8GA 3H4XA 1FA2A 1UQYA 3HURA 4HU0A 5DCEA 4WY0A 5I78A 4IZGA 3B0XA 1CGUA 1WA3A 4F0LA 1AW5A 3QR1A 1RUSA 1NOUA 4LUSB 2X0HA 4ZEPA 2GWNA 4ZE5A 1D8WA 3HU7A 4JY8A 1KRBC 1ZAHA 2VCCA 3MV11 3O3RA 1YDOA 3CQJA 5E6ZA 1OF6A 4M6QA 1QDSA 4L9ZA 2XSXA 2QVNA 1G69A 3AO0A 3P2VA 1Y7VA 2TRSA 3B40A 4JTUA 4AYGA 3VOCA 1LQ2A 3VCCA 5IRPA 2GK1A 3S5OA 4HPHA 3GW3A 2AQWA 2DVUA 3VFLA 1YDNA 1UROA 2VFGA 4HYWA 1K1DA 3FIGA 1DWHM 3U2ZA 1UUQA 4UOJA 1XIIA 2Y8VA 3SY8A 1XV8A 1XIDA 2A6NA 1OYCA 3ITLA 3FA3A 3E2VA 1QR7A 2J79A 1MW0A 2V3EA 3E9AA 5EMLA 4PCTA 5BOOA 1UWUA 4UMAA 1E5JA 3OGRA 5IXEA 4J3TA 4V28A 3T44A 2AL2B 1C7TA 2I16A 4BHYA 3WFAA 1VEOA 4LF1A 2OO0A 5K9XA 4A3YA 3TWBA 4L5ZA 4ORIA 4JTTA 3SAZA 1JYWA 1AJ2A 3RCYA 3IPWA 3AIBA 4LGXA 1T40A 1TWDA 5JIPA 3U2EA 1XI3A 1ZB5A 3EXRA 1TJPA 4PR4A 4M24A 2V5DA 3KBJA 2MNRA 1LQAA 1PX4A 3IRSA 4OFCA 1X7FA 4G8TA 3VTRA 3VAVA 3S8HA 5U4NA 5CZJA 2CLPA 1TCMA 4N9EA 4C7FA 3R1ZA 4E2BA 1VAHA 1OINA 1PSCA 3QF0A 4YTTA 3RFAA 4E2VA 5G2IA 3ALFA 4ZOAA 4AVFA 1GW1A 4H7VA 4A8IA 4RNFA 4AD2A 1FRBA 1YDVA 3IVSA 1BF6A 3QMRA 4AVNA 5G4WA 3T42A 1VLWA 3ZO9A 1XIEA 4I5XA 1PZ1A 4HU3A 5DEZA 4UTIA 3GM8A 4D8ZA 5D02A 1DOSA 2I7GA 4OBTA 1J93A 1TR9A 4MIMA 5GVJA 4EXQA 1UIPA 3M0JA 1YQ2A 1RSCA 5DMMA 1ADOA 3HPFA 3P60A 1R87A 3PPFA 1HVXA 4LEQA 3DHPA 3GXTA 2QCDA 2BASA 1HO1A 1UR9A 3IV3A 3QC0A 3WD3A 4GBDA 4WVXA 3HPAA 2V0TA 3DU0A 4IH3A 3RR4A 2MANA 1UW9A 3U5YA 5TIMA 2O4MA 1KB3A 4UFIA 3VDAA 5CEWA 2FDMA 1W2VA 4S3DA 3VU2A 4H6RA 4Q8NA 1K03A 3TSBA 3R79A 4P7OA 1A5BA 2AAMA 3ZFHA 4B4HA 1C93A 4L7ZA 1B3YA 4S3BA 3WF0A 1JUBA 1YKWA 4GJIA 1TWZA 4RE2A 1PL9A 4LC6A 2HE8A 1UC4A 3O05A 1Q3NA 3UJ2A 3PBUA 3EMCA 1KCKA 5IFPA 5CLWA 4JFUA 3WQ6A 2GDUA 4IFKA 3KRSA 2BGQA 4NT0A 2W3ZA 2PD5A 4S3FA 4W89A 2C13A 5FL0A 3AZSA 4GG9A 4PRWA 3PWIA 4DYKA 1KWKA 2QCNA 4IPJA 1M68A 3PWGA 3VKBA 1Q5MA 3B97A 3BCFA 4XZNX 2EQDA 1UZ4A 3GC4A 3Q94A 4E2DA 4A6GA 4DRSA 3HV9A 3H12A 2F2HA 4S3EA 1GGOA 1LLZA 1E1CA 4PUWA 5DANA 3N73A 4E4UA 4O4WA 4XIMA 5EMUA 4E2OA 2AQVA 3WLMA 5E70A 2F84A 4ZOEA 3S6OA 4MB5A 3VI2A 2A3AA 3WIJA 4UMBA 3RMEA 3GR8A <