3HV8A

Crystal structure of fimx eal domain from pseudomonas aeruginosa bound to c-di-gmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
242
Chain Sequence
b'GDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 80
structure length 242
sequence length 247
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3hv8A00
4Y9PA 4RNJA 4AFYA 4F48A 3GG0A 4HU4A 4HJFA 3N3TA 3PJTA 4FOKA 4F3HA 5MKGB 4KIEA 4RNFA 4AG0A 3TLQA 3GG1A 3PJWA 3PJUA 2BASA 4Y9OA 4FOJA 2W27A 4RNIA 2R6OA 3U2EA 3GFXA 5M1TA 4HU3A 4RNHA 4FOUA 4ES4A 3GFYA 3KZPA 4J40A 5MF5A 3HV9A 4Y9MA 3S83A 3HV8A 4Q6JA 3GFZA 4Y8EA 4LYKA 4Y9NA 3SY8A 5MKGA 3PJXA 3PFMA 4LJ3A
chains in the Genus database with same CATH superfamily
1Z6KA 4Q4PA 3V7PA 3M43A 1I2NA 3GNPA 1RQBA 4QLKA 4MWAA 4DN1A 4IFRA 1BTMA 5BYWA 1EJRC 3V0UA 3TP4A 2INFA 2XZ7A 1PVNA 2OODA 2REQB 1SUXA 1V6XA 3NO1A 1W9VA 3CWNA 4ICCX 2Z27A 4Q7BA 5LIWX 3MCOA 3VOGA 3C2VA 2WNZA 1HVQA 3K8MA 1UKTA 2Y2WA 4M19A 3VD7A 4UR9A 1JZ2A 3U2EA 1H49A 4HCLA 4F0LA 3ZLFA 3IUHA 2PDKA 3H21A 4YTUA 3WF1A 3CTTA 2YFNA 1C3FA 1N8FA 2Y8UA 3GR8A 4M6QA 3NO5A 1WX0A 2DZTA 4KFPA 3P3BA 4V15A 4UTTC 3P74A 1QVBA 2VCBA 5GJMA 3ES7A 6TIMA 2PE4A 3HMCA 1GVQA 1P43A 1TTJA 5JH1A 5XIAA 1X1ZA 1F8IA 4OFCA 4GXWA 5C5YA 4PUEA 5BOOA 3S6TA 4HGXA 3WLQA 1XRSA 3ZSSA 2J47A 4ZQPA 4DJFC 3E5PA 3L12A 3ECQA 3BJSA 3K4WA 3T55A 4EXAA 3SUSA 1XD1A 3R58A 3CQJA 3AUOA 2NXHA 1PCKA 1W2VA 1R9ZA 1GHRA 3G24A 2WSKA 3BAJA 4RDYA 4DZ5A 2PMQA 3G1DA 3GTIA 3A47A 4O11A 2NSXA 3XINA 2QYGA 2QGYA 1YNPA 3RM8A 3K2GA 3TE9A 1FWAC 2FIQA 1D2KA 1K9TA 4DPQA 2ALRA 2J9XA 2BXVA 3C2RA 2Z00A 4CNSA 1QOQA 3M64A 1DQUA 2FJUB 3W00A 4JQAA 4AEFA 4GXPA 4N7QA 3OGRA 1V6WA 4F0SA 5D8WA 2GVEA 1TUFA 4LY4A 1I1XA 3L4UA 3I6EA 4FS9A 3I3EA 1KD0A 3EZ4A 4KWWA 3W02A 1EIXA 4N4QA 3TKFA 2ZUNA 1AH0A 2ESCA 4O4WA 3EB3A 1EYEA 4D71A 1DJZA 4TMBA 2OELA 1YYAA 2E09A 3HJEA 2JKAA 4CNTA 4L9XA 3TN6A 1JD9A 4Q4OA 4LAZA 3G1HA 2BSLA 3WD1A 3NUKA 1F76A 1YDVA 3GDKA 1FRBA 4DEFA 2RJGA 3N14A 1X98A 3VIIA 4PCFA 2FJKA 4U31A 5CH9A 1QOPA 4PBEA 1L2QA 3MMTA 5FJUA 4LUTA 2Z7KA 4HU8A 2OO6A 2DPEA 4L7ZA 2NQ9A 3FOKA 4LYPA 2YL9A 4XSLA 5AYXA 5M03A 5D2TA 1YNQA 4BQ3A 4UQAA 3SCWA 4Z2KA 1V0KA 1W9XA 3SJNA 2Y24A 3AZTA 3O7UA 2VC7A 1XX1A 1SW0A 4FAMA 1SJCA 3M0IA 1Q66A 4B16A 1QAPA 2QCLA 3AMDA 4G7FA 2R14A 1DE6A 3WJYA 1GQIA 4QQUA 4PL2A 4NT0A 4MIMA 3NDYA 1TV2A 1K9EA 4UQ9A 3L0GA 4GK8A 2NLYA 2X0HA 1ME7A 2X41A 2BHYA 4Q4RA 2Q3OA 3EA1A 3OLIA 4UFLA 2I9UA 3DH7A 2DSVA 2EQDA 2YDQA 1WDDA 1OFRA 2HTMA 3KBWA 1XD0A 3E49A 4IGMA 2YZ5A 4C1NB 2PUZA 3BGAA 1PB0A 1KRCC 1GKQA 4HKPA 1G67A 2PDPA 2G3IA 2FVMA 3WK3A 4D1JA 5AC4A 1E6NA 5EMUA 4GYPC 4IXXA 4QR6A 3G1YA 1JVNA 2QJMA 3H22A 1OYAA 3UESA 1EIBA 4US5A 1XIHA 1A47A 3ITCA 1ODUA 4DHGA 4GUGA 2OEJA 1I2QA 2ABBA 5HANA 4N6EA 4KEUA 1OC7A 3WNOA 1XH2A 3JW7A 3CIWA 2WLYA 3KWSA 4GYJA 2VT0A 4HNOA 1UD3A 2PZ0A 4XZNX 3HF3A 1DIOA 1L6SA 3VINA 2FB2A 2AMXA 4ZFMA 2A6NA 4D9PA 5AZ1A 4HNVA 3KBNA 3GH7A 3GO2A 4Y96A 4JDBA 3CWHA 1A5AA 1NU5A 2XFRA 1U5HA 3RFAA 2ZXDA 1OM0A 2ZKMX 2VQTA 4DUVA 3BCFA 1IZJA 4U3CA 2E8YA 2G96A 3FEMA 3TQPA 3W0KA 2G95A 3LLFA 2X05A 4LUSA 4CVWA 1RJPA 3LCGA 4Q33A 2VUYA 1YADA 4QX4A 1S1PA 3UZXA 2WPBA 1A5SA 3F2BA 1NSJA 3NJ3A 4LNYA 1EJWC 5FJPA 2QAFA 2XGBA 4WHBA 3LM7A 2VOMA 1XRTA 3LGEA 4O0KA 3BLDA 5FJJA 1RY0A 3A9IA 3S46A 5I0DA 1AL7A 5G4HC 4FX8A 3R7MA 3URQA 1MI3A 3W9ZA 4TIMA 5GJNA 3SY5A 4IQDA 1R85A 4Z2IA 1H1YA 2XFWA 3GXNA 3FJ4A 4LU0A 1EEPA 2J27A 3KRSA 4CCCA 1C90A 2YA0A 3PANA 1GJWA 3WDJA 3WD2A 4MLJA 5CPOA 2BG5A 2ZVRA 4HOZA 1OD0A 5GNZA 4AD3A 1WOAA 1XP3A 4PSRA 3S4TA 2POZA 3EPNA 2DW6A 4F9JA 2ZX6A 5JBDA 5KTLA 3KE0A 2ZTKA 3AHZA 3FYYA 3POHA 4U2YA 4X0NA 3T05A 3STPA 1SJAA 3REQA 2DVUA 1MUWA 3IIVA 4JTUA 2BBFA 4GNKB 4LCRA 1HO4A 2EHHA 1IXNA 3VYLA 4V28A 3SRHA 3AI0A 3VGFA 3E38A 3JZUA 1XQLA 2YJQA 4LSBA 3LSCA 4PMDA 1UWIA 1W3LA 3DFQA 3B05A 3KCJA 4LB4A 4HYRA 4QSFA 3UWVA 1YDOA 1F2JA 1T7LA 4DY1A 5CAKA 4XK2A 1OX6A 4AF0B 2PGRA 3BOLA 3WG6A 3LNMA 1RHCA 2HNEA 1CXLA 3PG8A 1AFSA 2HRWA 1YXYA 3VE7A 1EHAA 1NWTA 1H1ZA 3VOIA 1O60A 3OO2A 1ZTVA 4CNOA 4ERGA 1CIUA 5G4EA 1W3IA 3BWWA 3H53A 4QSHA 1QRQA 4LF1A 4GLEA 1E1CA 1QT1A 4L9YA 1QU4A 1H62A 2NXGA 3N4AA 1EB3A 4E8GA 4YYFA 1RCOB 4J35A 4BCEA 2ZA2A 4FNRA 4WJ8A 3NQFA 5CJ5A 1UIPA 4REQA 3UY7A 3RG6A 5F2GA 3VZZA 3AXXA 4P8WA 1OF8A 4AZBA 4MB5A 1T6MA 4OHQA 3IJ7A 4JTCA 3CK5A 4GI6A 4WZHA 3WCZA 2FVKA 3AIEA 5I24A 2FQIA 1ZCCA 1MQQA 4ZB2A 4XZMX 4YTQA 5EBUA 1A5MC 2WCSA 2B81A 4RK8A 1XRFA 3LCFA 2R82A 3NM3A 3W4RA 1U5VA 4AZ5A 5ABEA 4JN7A 3APTA 5REQA 1AL8A 1RBAA 3HGSA 5KETA 1ADDA 3RN6A 1XYCA 1E15A 1JCXA 3DG6A 4MUPA 3HGRA 2YB1A 2ISWA 1F8MA 2W61A 4LUTB 4UTIA 1EGMA 1KQZA 4PBFA 3SI9A 3LXCA 3SB0A 4IJCA 4J3TA 5I6SA 1HL9A 1Z32X 4IFKA 3ZMRA 2PDIA 5LZLA 2DSKA 2EF9A 3N29A 3AIBA 4W7WA 4A8LA 2GUBA 4ENLA 4RXGA 1B31A 2X16A 3B8TA 3S47A 3BL3A 3M0JA 4NYUA 2WYSA 1RK6A 3U2OA 2YXXA 4IFOA 3RAOA 3CYVA 2XH0A 4IPNB 4RNHA 1WZAA 3FLUA 4E38A 4WRHA 1E1EA 1PKLA 2QCEA 3GTXA 3FKKA 1J01A 2YR1A 4EWJA 4I5XA 3H7VA 4D8LA 2YA1A 1TUXA 4QS6A 4F8XA 2HS6A 3C2OA 1PKYA 3NO3A 3KCLA 3TR9A 3FVMA 3T4WA 2YB4A 5C9RA 3ATZA 2PTWA 3VZYA 1K8XA 2E28A 5DXXA 2PSNA 2FTYA 4HB7A 2W63A 1QHOA 1UCWA 2E68A 5HNNA 1HXJA 2X42A 3QHOA 4OBRA 4BQ4A 4C6NA 1GQKA 2EJAA 1XYMA 3WYZA 1XG4A 2ZA1A 4AQLA 3VKBA 3VIJA 4WR3A 2OWXA 1OX5A 3MI2A 2Z4GA 2Y70A 2DH3A 1J9YA 2B7NA 3M44A 3NL2A 3NSXA 1IT8A 1MRQA 5HR7A 3DECA 1HF6A 4O1FA 1UASA 1KGXA 3OEXA 4EPDC 4LS1A 3T09A 1TQXA 1MYRA 4K36A 3W7NA 4A3RA 4GC3A 5HQMA 2E6DA 4OUEA 3TW7A 4XAZA 2YCEA 2Y5SA 3GDBA 3SAZA 3RXZA 4K6AA 2AKZA 4GACA 3TN4A 1OZQA 1FX6A 2UZ9A 1M7XA 3W6LA 5K3VA 4GWEA 4QIUA 3LD5A 2O7SA 4MPQA 1DWFM 4S3EA 1D3GA 4E2VA 4GE8A 4QJ1A 2ZXQA 2XVGA 4QCEA 3RITA 5M2FX 2C7FA 4L56A 1CWYA 3BJFA 3MPGA 4A8IA 2WMFA 1DEDA 4ZO8A 2RGMA 1UD4A 1BHGA 4FF7A 2PTDA 2PURA 3EMZA 4LH8A 2HE5A 2JALA 1F73A 4J5NA 4AWUA 1ZGDA 4HD5A 5LYRA 5M1TA 3IJIA 2ZRZA 4GFSA 7REQB 3GVVA 5JVLA 3JR2A 4PCPA 3NQ8A 1EQCA 3MHFA 3MUIA 3UXDA 2KAUC 4BQ5A 1BVWA 4B92A 1UUQA 3AJXA 2FPYA 4DUWA 1I0DA 3FX4A 5LIKX 1VC4A 4EK7A 3GDLA 1O5QA 3R2GA 4W5ZA 4MWAE 3NQCA 3T08A 4S2CA 4V2XA 4YJ5A 4MHBA 1ZCOA 4HJFA 4GI4A 2ZE3A 3ITTA 1POKA 2PB1A 3IRDA 2POTA 4B4HA 3AFBA 4PMOA 3GKAA 4MG4A 3NQBA 1UWTA 4ZR8A 1LLOA 2EG6A 1EDGA 3OJGA 4A4AA 1GK8A 1BYDA 3CIXA 3HPSA 1KM3A 1Q4NX 4B5NA 4GO9A 1VFHA 3TU9A 3WLPA 4O57A 2PGEA 4YTSA 1KWKA 4RPPA 2FPTA 1QXLA 4J2MA 4PUWA 1NWRA 3GS6A 3CHFA 3SECA 4DYJA 2DSWA 2GJRA 5DF0A 4WDTA 1XYAA 3CMJA 1R6WA 3HPFA 2JIWA 1LUCA 4QAWA 1F5ZA 1KV8A 4A21A 4QP0A 4XIMA 5CSSA 4Q8NA 2PDQA 1OZMA 1I2PA 3TW6A 1V79A 2WHJA 4GIAA 3W7PA 2BXZA 1GHSA 1SFSA 3I7RA 1E0TA 3TVAA 3PNZA 3UR2A 1W1IE 4ZGYA 1ODZA 4Q4KA 3CZKA 3VDAA 5BU9A 4F2TA 1MQRA 4K8EA 5FSEC 3VIPA 5CEWA 3EDKA 4NJGA 4W9TA 2GK1B 4H19A 3NZPA 2JK2A 3QY6A 4UFJA 3C8NA 4JTEA 1XIBA 4C6FA 3W26A 4DAIA 3LN3A 1BWKA 3THQA 4HU3A 4MAVA 4AVFA 1G7VA 3EOEA 3ZJ7A 1MEHA 1MNSA 4UTWC 2FFCA 5DMMA 7PTDA 3MMUA 1G9HA 3A12A 2YLAA 3WEMA 1FWCC 5DBTA 3URAA 1R9XA 3UT0A 2Z29A 2QAPA 1GOXA 5CC7A 2Q8XA 4YU1A 4ZXOA 4DIAA 1H7NA 1RPXA 3GG8A 1VBRA 3WQEA 3TNOA 1A50A 4MJ4A 1FWDC 1EQPA 3C0LA 1M7PA 3C0JA 3UJFA 4PZVA 6REQA 2EPNA 2WXDM 2XN2A 3KTCA 3QSRA 2C1GA 3F1QA 2O4QA 3HO8A 1NELA 3N25A 2GQ8A 2GUYA 3QGAC 4HSOA 1JFXA 3RRXA 5HQLA 5BXTA 4DWSC 1W1VA 1AG1O 4DO7A 5ABFB 2AQOA 2NWRA 3PSVA 1ITCA 2Z1BA 1W8SA 3THUA 4M56A 2UY3A 3AMCA 3ES8A 2WWCA 4NNBA 2OZ0A 1HKMA 2JBMA 1XSKA 4ML9A 3CEPA 2WOQA 3B8IA 1QMLA 1LOLA 1N2VA 3STCA 4XD3A 4I9MA 1BWVA 3AU2A 2O7QA 4HBKA 4OKDA 1FWNA 3S9IA 3T8LA 2QF7A 1RCQA 2WVSA 3BQ5A 4Q6XA 3CZLA 1LQ0A 3VGGA 4L5ZA 1BVNP 1TZ9A 4OWGA 4H01A 1XKYA 2E9LA 1S2UA 4O1BA 5H8MA 5HMDA 3CH9A 3DFNA 4BKNA 4FNUA 4F9DA 4Q8WA 2VEGA 4WGXA 1E73M 4OJYA 1FWIC 2TRSA 3WLSA 4IX0A 1LT7A 2BY2A 3GU1A 1OFOA 5AKQA 3LZ3A 3OB8A 1QUMA 4UR8A 4ZE4A 1Q4WA 3SZ8A 1E5JA 3C3NA 4QRNA 4EIVA 1TR9A 4O0ZA 4IIBA 4UTJA 4HPXA 4U2ZA 4AD2A 1XXXA 2OJPA 1CB2A 3KHJA 5CPTA 3W72A 1M7JA 3R8GA 1AJ0A 2WC7A 3UWZA 4EPKA 1OWQA 1S46A 4X61A 1S3HA 3EA2A 4S3GA 1N55A 1S2TA 2Z24A 5EBAA 1AH3A 1ICPA 4XV0A 2RH9A 1JQVA 5GNXA 1VFMA 5BCAA 3QW4B 4DX3A 2CHOA 4H8VA 3CQKA 3MC5A 2G4FA 4LANA 5D02A 1W1A1 2PLMA 4CQ9A 1M03A 1PTDA 2ACSA 3GRIA 4DWSB 1V3IA 1O5KA 3AIUA 3VKCA 3NQ6A 4EX4A 3UWQA 1WAUA 2GDQA 3RLVA 4AIUA 3QMTA 4O19A 3QH2A 2Q09A 3LBMA 5HULA 1YPFA 4DVOA 1LWIA 1SFLA 2ALDA 3WQOA 3N13A 3JZEA 5AHNA 1NDZA 3PAJA 3BO9A 1Z9AA 3KFTA 2ZRVA 3H2OA 2E40A 2BGQA 5AVHA 4RNFA 1ZALA 4NAFB 5E0CA 3ZT5A 3UR5A 3SN0A 4DJEA 2R1PA 4XKYB 3GTFA 2AAMA 3W82A 1JPHA 1YMYA 2ZA3A 4RE3A 1OFAA 2YCKX 3G1FA 5K7JA 3WQVA 1WE5A 3LXBA 5TNVA 1U1HA 1PPIA 3N11A 4XZHA 1ICSA 2XPKA 5A6TC 3ITGA 4RZ5A 2C0AA 2NVCA 5HNTA 4XUYA 1E72M 1J5TA 1YBQA 3CL6A 2PI6A 3AIWA 3OODA 4DJDD 3AYRA 1UWSA 3U8GA 1H63A 4XBKA 4ORIA 3UVAA 2ACQA 1HX0A 4FA3A 3B97A 3KOXA 1DP0A 2X1TA 3WQ6A 4MMWA 3CM4A 2DZBA 4MGGA 3P5YA 4BF9A 5GJPA 4X2PA 1N7KA 3CQIA 5LA0A 3GSMA 3HM7A 1IWAA 2F6XA 3C61A 2P50A 3ONCA 3QVQA 2VXNA 2GQ3A 2ABAA 4QNWA 3CZJA 1J5SA 3FSUA 4HN4A 2Y5JA 3AHVA 5IOBA 2DP3A 5CC3A 3R4IA 1DJWA 1US3A 3PZ9A 4KBXA 3PBGA 1FWBC 2O56A 4K8GA 1Y5WA 4C1KA 4EF8A 5CGTA 3W70A 3S2JA 1SFTA 1JZ4A 5CPNA 3WQFA 1SU5A 5C71A 2MNRA 3AMLA 1VIWA 3CYJA 3KM8A 3R0DA 1W1PA 2C14A 2DJLA 4IIGA 3GXTA 3WEOA 4KWUA 1V3HA 2QEZA 5ABGA 1V5XA 5A69A 3A21A 1MZRA 4FLQA 3MQTA 1AMYA 4GUFA 2UBPC 2V3EA 1VENA 4ACYA 2PDJA 1E6RA 3CU2A 3OLGA 3M1ZA 4IQEA 4EKJA 4C6BA 4O54A 4AZHA 1XWYA 2PCEA 5TQLA 4HJWA 4AUBA 1GVFA 4DO6A 3H24A 3EAUA 4DZIA 5FJRA 4U33A 1GJPA 3UWWA 3VMOA 2FPVA 3T42A 3ALFA 5I09A 4PGLA 4ZVJA 2D22A 4MJ2A 4JFSA 2XYLA 5IBXA 1O4UA 3L4TA 4HVXA 1CEOA 5FEZA 5FAGA 3IJ8A 2Z1WA 4B5WA 3G3DA 3XISA 2ZOXA 2BZNA 3WQPA 1HN1A 3W27A 2BDQA 2XSBA 4ZODA 2EPLX 2GUUA 3LYEA 1A5UA 3SCTA 4WF7A 1TE6A 3PJTA 5HWMA 4JFVA 3W6MA 2VVNA 2VWTA 5DLCA 1UPPA 2A3AA 1J96A 3NZGA 1ZSXA 3KCOA 1F3TA 1UP2A 2A6LA 2G5WA 1HQTA 4D6CA 1SFJA 1MWOA 3ITOA 3TC6A 1MW2A 1ISZA 1GEHA 3NEVA 1A4LA 4GZ7A 4NQ1A 3RGTA 8XIMA 2XVNA 3TNBA 4GVFA 3ARYA 3ICJA 3SUVA 3LENA 3OG2A 2W27A 5M3WA 4MZYA 4M7TA 4KKXA 1YHTA 1BF2A 1PIIA 1I8JA 4ZBCA 1CGYA 3TA6A 5BRBA 4JQ3A 1GONA 4FXSA 1E9ZB 3BJTA 3TLLA 2PP0A 2XFFA 1FCBA 1XLBA 2BWGA 1VPYA 1ZU8A 1OK4A 1V6UA 4ADSA 5K9XA 3W25A 1YRRA 4N0RA 4UXDA 3B8VA 1M6JA 2HDJA 1GVOA 5LHFA 4Q8OA 2J88A 4RV3A 3U3HA 3MS8A 4OVXA 2BP1A 2EKCA 1CW2A 2X7WA 1HKJA 3CXOA 3I6RA 4WIWA 5A8QA 3KZSA 2WWDA 2A7PA 2CXGA 4EANA 1VRXA 5C6MA 1JCNA 3KVMA 3PZGA 4ILSA 3SGZA 4A8NA 4UTKA 2X0SA 4S38A 4LV4A 3DUGA 4RR4A 3VKDA 4M51A 2GVYA 3CV7A 5AC8A 4UTMA 1RV8A 4PR4A 1KM1A 1QI5A 3AAMA 3T0DA 4E2BA 1QI2A 3EYPA 2Y5EA 1AD4A 1XG3A 4TVDA 4LUJA 2Z26A 1CZ1A 4AHQA 4LBRA 4E0CA 2A1YA 2DSZA 3A64A 3NA8A 2YCJA 1DHPA 5FL1A 4PCTA 3AO0A 4GIYA 4ZQOA 5FEXA 4C5YA 1UZ4A 1FWFC 1XCFA 3MT1A 4MZ8A 1KC7A 2GJXB 4W84A 4LWWA 1XLFA 4NUWA 3THCA 4LOCA 3FXGA 4QE1A 1ONRA 3S5NA 1I4NA 1FXQA 2A85A 2QCCA 2NVDA 3PTMA 1YLVA 2RUSA 1J11A 4Y8FA 4IGHA 3S5ZA 3WZ0E 2V68A 4AU0A 1JRBA 4NI3A 1TPH1 1PV8A 4XIAA 1NDVA 4XZLX 4AD1A 2NV2A 4HSNA 1TREA 5FKYA 3W75A 3RU6A 3DXIA 2IXVA 4AY1A 3HMJG 5AC6A 1UMYA 2EJ1A 3V3WA 4BWLC 1OG6A 2HS8A 1R3SA 3WK2A 1HVXA 5F4SA 2JE8A 3CUZA 1UR8A 3MUCA 1B5TA 1EC9A 1HJVA 4KEMA 3H2AA 4R7OA 3NQMA 2V69A 4UFIA 1HZYA 2PF8A 1CTNA 4F0RA 3ZS4A 1WXYA 2Y6ZA 1R7AA 4IH3A 3R10A 4DWDA 3MUY1 3WJZA 3O6YX 2XH7A 3IV3A 4FK9A 2I5QA 2F7FA 5CJNA 5EMKA 2CITA 1ZUAX 3IVUA 4W4QA 4XVDA 5DCEA 1ZRQA 3GX9A 1QPNA 5A3HA 4FXJA 1XS2A 3IJDA 3PZTA 3DCPA 2CBIA 5BNKA 4O13A 4P7OA 1RVKA 3NVTA 1GYNA 2GJNA 1G4EA 4MNMA 4XUGA 1JR1A 2PDUA 5HAOA 3R43A 2DGAA 3PHAA 2O9TA 5EFFA 1GW9A 2DFAA 3EMQA 4IX2A 2NQZA 3TWAA 1EX1A 2ZUWA 2J8TA 4C6KA 2DZWA 3B8DA 3JS3A 2XH4A 3S2CA 1FQ0A 5RUBA 5DANA 3LCLA 1B4KA 1R2SA 7A3HA 3EKGA 3UY8A 3VABA 4D6IA 3ZVHA 3N2BA 1K9DA 2OQYA 4JAWA 2PP3A 4R3UA 1W6TA 4HA4A 4GO8A 4QXIA 3GC2A 3VIMA 1LRQA 3AC0A 5BWFA 4YS1A 6XIAA 3V35A 1WKFA 4H8NA 4QGCA 4FO4A 2GOUA 4NSBA 3WSUA 2H90A 4DJDA 3BZJA 3ZT6A 1BLIA 1AH4A 3WUBA 4JKMA 1JJKA 2OXNA 3IGXA 4YTTA 3LLXA 4S3DA 3SM0A 3W29A 2ZXBA 3S2LA 1EWEA 3FHQA 4NG3A 5FEPA 3C2EA 1DXFA 1MRAA 1W1YA 3FNDA 4LCSA 4MY9A 4IP4A 1EX5A 2X1RA 4UNIA 1OVDA 1J0IA 3EEGA 1SO3A 4JTKA 2NUXA 3DEQA 3GXPA 4W89A 3M46A 4CVUA 1JUBA 1AQFA 2XIOA 1PWMA 2YIHA 3SSJA 1LL4A 3SRFA 2ZYFA 3LGDA 3WQ8A 4XVEA 3EX6A 4R9XA 1F6KA 2BY3A 2V5BA 4NYYA 3CIVA 2W9MA 1VBJA 4J3VA 2WMIA 3N3MA 1NTHA 2VZSA 3L4YA 5EMLA 4UNLA 3EWDA 2HROA 2PDHA 4KW2A 3W2MA 3NPXA 2HWGA 1AMKA 3MP3A 4ZQRA 3WIJA 1B3OA 2Z25A 1CGVA 1DXEA 1OYBA 4G2DA 1IE7C 3N2MA 1XUUA 5D9MA 3QGKC 1J0JA 1K4HA 4LB3A 3AUJA 4OQVA 1XYBA 3P62A 1X1NA 2XIJA 4LAUA 1OY0A 5FAJA 3QJAA 5JBEA 1E9LA 1OGGA 1Q6OA 1L6WA 4O0QA 1ZS2A 1WDRA 4MDOA 3QEZA 3KRBA 3U7VA 5E0KA 4LBUA 4AIBA 5LGXA 1FWJC 1LF1A 1FWEC 3OIHA 1C7SA 1FWTA 4LT9A 4FNQA 3VM5A 3F5LA 2Q01A 1AQ0A 3LHTA 4D6EA 4GABA 3H70A 5FD0A 4FMVA 4YXGA 1R3QA 3NZ1A 4JIQA 1TTIA 3W2LA 4AC7C 1FHUA 4YCOA 4LYQA 1AW2A 1Z8AA 1FKXA 2PD5A 4GC4A 2AGTA 3GHRA 2ASHA 5I23A 4XZWA 2L5HA 2DZPA 4LEQA 3G5EA 3BXWA 4IIDA 1GVSA 4C7DA 3BLLA 4IHCA 1W5OA 4HCHA 4RXFA 1UUOA 3C3UA 1B3ZA 1QPKA 5E70A 2ACRA 3WLIA 3GXIA 3GW3A 3N2CA 5CBIA 2PLJA 2R24A 4PUUA 4W8AA 3QV7A 5CZSA 1RQHA 4B2DD 1IV8A 4XO7A 3N1AA 4KWSA 4ERIA 1SW3A 4K3ZA 3G6LA 4M6UA 1FY6A 3QZEA 1UBPC 3DAQA 2PZNA 2R1MA 3QPZA 4TMCA 1WDWA 4I8YA 1UWRA 4H9YA 3M5XA 1NM9A 3CBWA 1E6SM 4A05A 1QJWA 2Y4SA 5HK4A 3NXFA 5CG7A 1PSCA 1EA9C 4BA0A 4YVXA 1EP1A 2OO0A 4LV9A 3PTKA 4KCVA 1D7KA 3EBVA 5BZAA 4WY0B 1IR1A 2DZVA 3WH9A 3TLQA 3UVIA 5BOEA 3TJLA 3AMGA 1OADA 1VFTA 4M3PA 3BOFA 4AIEA 4UOQA 4AD0A 4YVPA 4AAJA 4ATDA 4WDUA 4JX6A 4NI8A 4Q8TA 4BR1A 5A8OA 2CLMA 2CHNA 1P0BA 3L0NA 2VC9A 4B5SA 5G1MA 3ELFA 2ZDSA 4BF7A 4GKTA 3NQDA 2V2HA 3ZJ8A 2XUCA 2Q8LA 3STGA 4GZIA 2FGBA 5IFPA 3VOCA 4AXNA 5ABTA 4RX0A 1X7IA 4GY0A 4JL1A 3BGGA 3TTQA 1VR6A 1CXHA 4LY8A 1U2YA 1FP9A 3NOYA 5DQPA 2ZZ4A 5DX7A 1JGIA 5DY3A 3WFZA 4RV8A 4HNLA 3ZYZA 2A5HA 5FESA 4O18A 4ZOBA 4HA0A 4PTMA 4LUIA 2PF0A 3AIRA 2RKXA 2FGZA 1UQYA 1F07A 1TRDA 3T2PA 2CIPA 4HA3A 1GZJA 3EB2A 2FHCA 3P8IA 1QOXA 1TPC1 1PX8A 1KB3A 4BQ2A 2X1UA 3QZ6A 1NF0A 1JNEA 2BMBA 4X9YA 6A3HA 3P8JA 4RDZA 3UXKA 4FEZA 2IS7A 1TTPA 2VFFA 5JH2A 2FHFA 4TTUA 2MUCA 1CB7B 3HG2A 3C4UA 1WB0A 1M68A 3UG8A 1R9YA 1OCNA 3ONBA 2CNCA 1EJTC 2D0FA 4F3HA 4HMEA 4Y90A 4LAKA 3MVIA 4L9ZA 4YVVA 1WP6A 3ZFHA 1V4YA 4FOJA 3ZOAA 3R89A 3LI1A 4IPJA 2NVAA 3VK5A 4PE8A 1WZMA 3H7UA 1D8CA 4FSAA 2VHLA 4XSMA 3VD5A 2ZDRA 2J6VA 2DUZA 3POCA 3NPVA 5D38A 3GG0A 2V82A 3DKLA 3TMLA 3BAKA 1A49A 5DCDA 4ZOAA 3GIPA 7ENLA 3KHDA 2NUWA 3QKEA 3GNDA 4FHAA 2DVXA 3T07A 5FF3A 5HJYA 2OX4A 1GGOA 2FVLA 4S3CA 1GPFA 2W3ZA 2ZUUA 4TO8A 2G0WA 4JHOA 2W67A 4GNVA 1JI2A 2Z6IA 3P60A 2BVTA 4FLSA 3J7HA 3LHZA 1K8ZA 4D6HA 3U5UA 3OIXA 2F2HA 2FZMA 1MW1A 1JCJA 3W7CA 4XKMA 2QPSA 2TMDA 2WMHA 4CU7A 1KXVA 4UCGA 4E4PA 5A6MA 2PTXA 3TN5A 4P7QA 2A21A 1KM4A 3CO8A 1WKDA 1D9EA 3RYSA 1P7TB 3HPXA 2GPTA 5LGZA 3UJRA 2ZWZA 1E4MM 1UG6A 1UKSA 3GC4A 1R86A 3QV8A 4DJFD 2WJDA 1CPUA 4H9TA 1WXJA 3VFLA 1P0EA 4A3HA 4TVUA 5C55A 1DWAM 4LFYA 1E56A 3NWRA 1IR2A 3OTRA 1C8XA 2J6XA 1P0KA 4HK7A 4RW3A 1I75A 4E2OA 2DORA 1XKJA 2H3BA 4PH6A 1KBLA 1GJUA 2IPGA 3PBWA 4GUJA 4EAYA 1UR3M 1TVPA 8A3HA 3NSNA 4EPBC 1KM5A 1XIJA 3AJ7A 2ATMA 3ZWTA 4Z17A 3C52A 3ARQA 1UR9A 4DELA 3FA4A 4I90A 5L6UA 3VOFA 3VKAA 4LJ3A 3ZLGA 1TPUA 4ZEPA 2E25A 4C6DA 3LCHA 2OTDA 3W01A 1DJHA 3RMEA 1GCYA 4NJHA 2JF6A 3ZXWA 3G77A 1OABA 3NOEA 4MLRA 4ZFCA 5AC7A 4K2SA 3EDFA 3L2LA 4IJRA 3LHVA 4GQRA 2ZRWA 3E2VA 1OCJA 4PUJA 1EXBA 5AY7A 3AWOA 2P5NA 1K3UA 1I9CB 2F61A 3EKLA 4TX6A 1Q6QA 3R1ZA 3L5LA 3UG5A 4UTFA 2OWCA 5FJIA 2CXEA 3FYOA 2WCGA 4HMDA 3IK4A 1TWIA 5TF0A 2P8BA 3II1A 1G4TA 3E3HA 1HFBA 1GQLA 2BODX 3VNJA 1E6XM 3O9NA 4LCQA 3E6EA 1PHWA 4PTXA 3LY0A 4TX9A 5EGRA 5LNSA 3IANA 4AWEA 3KRZA 5B7ZA 2BS9A 5MKGA 2YDAA 1DTUA 3H7RA 2NZLA 3F4WA 1SZEA 3HQ1A 1WOBA 3DC8A 3UD6A 1JRCA 5K2ZA 1UKOA 3CT2A 3F7JA 1OEPA 3R94A 1JIBA 3PK7A 4LEFA 2W79A 2PD9A 4YPJA 4AWSA 2RDUA 2XGIA 5DT5A 4NU7A 3W7DA 1HL8A 3EX1A 1Z44A 1E70M 1TV8A 3B9EA 3KDOA 4FIQA 3EX3A 1MDLA 3NL6A 4AX6A 4GJ1A 1K7XA 2QDEA 1TJ2A 2QJIA 1V08A 4J27A 4XAYA 1GVYA 2QIWA 1QBBA 5I3IA 2PCQA 1H7PA 4TR9A 5A8NA 4LVFA 3CJPA 1QATA 4HYWA 1ITXA 3AHTA 3EOOA 4GMEA 1PZ0A 4OTKA 2V8ZA 3UZ5A 1ELSA 2GVLA 3ARSA 3AIVA 4IUOA 3ZJ6A 4W8LA 1GOIA 5I02A 3R8HA 4B2DA 2PDNA 3S1UA 4ORMA 3MANA 3AMKA 4WX2A 3W7JA 5AYIA 1DJXA 4GZEA 2R8WA 1UH3A 3F4DA 5CPQA 3A4XA 1LRTA 4DZAA 1SW7A 4XISA 2W6RA 3AS0A 4KGLA 3PS7A 1CXEA 2PDGA 2Y62A 3KOWA 1W17A 3DIPA 3WDIA 3RF9A 4HZ6A 1ZJAA 3DESA 4PMNA 1EJSC 1LCOA 2WQPA 3D0CA 4JCMA 4P61A 1JFHA 2DH2A 2ICSA 4G9PA 4CD8A 4PCSA 2VEIA 4O8AA 4BEQA 3G22A 5I00A 2WSPA 2HNHA 3B0UX 4GJJA 4K38A 4AWTA 1OC6A 3HG4A 3PNUA 2Y1HA 4O10A 3LPPA 4JIHA 4JTDA 3CO4A 2WCAA 2VI0A 4NHVA 2REQA 3W1AA 1LP6A 2D0HA 1QDSA 2EKGA 3RPDA 5AECA 3RR4A 4J28A 5JMUA 1WZLA 1XUZA 3UEQA 4W87A 5FI8A 1CXKA 2VL4A 3M0XA 4J3WA 1LBLA 3UCDA 2A0NA 3KWXA 4AZCB 3HFTA 1D3HA 1ME8A 3E2RA 3CT7A 5CAHA 5C8BB 1PZ1A 2OVLA 3YPIA 1F3XA 4TQTA 4N9EA 4C60A 4LRTA 4O52A 3V1PA 1TV3A 1VCFA 3W7HA 3W7LA 1GPWA 1H0IA 4UTLA 5HMFA 1OFQA 3NSMA 3A23A 1RSCA 3WQCA 2J62A 4MY8A 1GWJA 3OA5A 1PKMA 4AD5A 1XV8A 4UUIA 4EWND 1MSSA 2PDLA 3UWUA 2QCHA 3VMPA 4QS5A 1XLAA 3VGDA 3GDTA 1O66A 2HMCA 5D05A 2BGNE 2FMOA 4C6JA 3SW6A 3GH5A 4IISA 4QE4A 4F4RA 4WXYA 2EPHA 1MDRA 3SN4A 5DXYA 5LIYX 3NGFA 1JQXA 2A7RA 5TD4A 3GG7A 2QDGA 3ANVA 5IHSA 4JQ1A 3LRKA 1TELA 1CX9A 3VX0A 3G8RA 3MWAA 1XFCA 3QN3A 1WNOA 2PDXA 3UPWA 1E6ZA 3S0CA 1VBHA 3CQHA 3ABZA 3AHYA 4JTJA 1GORA 3LOTA 3I68A 5BROA 1GTEA 1F3EA 3GUGA 2WQDA 4AZ6A 4AIOA 1GYMA 4KH2A 1KR0A 3B8WA 1L0PA 4S3JA 2QULA 4PL1A 1ISXA 1V7AA 4CD5A 2VZTA 1EC7A 4LTSA 1W9BM 2HVOA 1YTDA 3FW6A 1S1RA 4XB3A 2OYLA 5D30A 5J5DA 3M5ZA 4PBGA 5BRPA 4HU4A 1W31A 3M5YA 5FA5A 1A5OC 2Z1VA 1XLCA 3TSBA 1LWHA 2Q6ZA 3VO0A 4H9UA 2Z1XA 1RH9A 2CWXA 3VC6A 3WMCA 1FFRA 3ARPA 3D3FA 3RX2A 4H6QA 1F6PA 3KOYA 4H7VA 4ZO9A 4BF5A 3DI0A 4YN5A 5A95A 1C7TA 1M7OA 3L5MA 3QV6A 2E1WA 3BK0A 5CSYA 2VZUA 4UTTA 5FF0A 1XIDA 1EH9A 3BSGA 2VP8A 1HJWA 5AYYA 2ZVIA 4MPKA 1KCXA 5A6SA 3B8UA 1J2BA 3GFZA 1HIZA 2FTWA 3P61A 4IMCA 1V02A 4H8UA 1GVRA 3LMYA 5H8PA 1KBJA 1KBIA 4DJFA 4L6HA 1IXOA 3P6LA 3PJUA 4AZ7A 1WUFA 3WLHA 3BCJA 3B8SA 1HKKA 2OEMA 4LF2A 3H2EA 3FJLA 3P93A 3W76A 4DBUA 4E8CA 2CYGA 3G0UA 5I3DA 1DJGA 3WF2A 3MMWA 3CV1A 3VZXA 1P0NA 4G6CA 3OBAA 3FV9A 4DI9A 1H09A 4XD6A 3V36A 1FWRA 2E6FA 1FUYA 5EPDA 3WLLA 1A5NC 3DI1A 1DE5A 4DF2A 5G4WA 3EWXA 2WMGA 2YDSA 1HGWA 2GWNA 1Q7ZA 4IL0A 5EA9A 3AS3A 3MKCA 4YCPA 1BRLB 1PTGA 4CNUA 2O9OA 1PIFA 4C1NA 1MFVA 3WH6A 1OBAA 4PTWA 3NPWA 7TAAA 3GXMA 3TX9A 3WLOA 4KESA 2IQ0A 3N17A 4Q8VA 2OU4A 2AOSA 4AMCA 3QW3A 3PVFA 3UW6A 4DLMA 4G7EA 3WD0A 1JEZA 1KA9F 3ZIZA 4H2CA 3TYUA 3M0MA 1LRNA 3DZ1A 1GZGA 1RD6A 4JHZA 2B31A 1EUAA 4MY1A 1TYGA 2VFGA 3DHDA 4K68A 2BFGA 1G4SA 1BXNA 1DWGM 2QJNA 4ZTYA 1Z89A 4LVGA 1EGVA 4N9CA 3AOFA 4HOWA 3PM6A 3BPWA 4AG0A 1FH8A 1VEOA 2XSAA 2E5BA 2Q71A 3AXHA 2P0OA 3GDRA 2WZEA 5K4ZA 5TIMA 2A79A 4D72A 3IAPA 3KTXA 3N2TA 1TZZA 2D2OA 3O6AA 4QG8A 3CV6A 2XINA 1XF0A 3PUEA 3C0QA 3HJZA 2QR6A 4JEJA 2ZZ6A 1M04A 4K1GA 3Q94A 2V30A 1LQAA 4GQQA 3BLIA 4Y9AA 3HURA 4XTIA 2Z7GA 3MHUA 3S1VA 3D5HA 3W7EA 4NKCA 1H11A 1H1NA 3UJ2A 1VFUA 3GM8A 3QR0A 1F9CA 4HSHA 1MMFA 3N3TA 2KX9A 1L8PA 5F4WA 4GCAA 2OG9A 4TX8A 4ICMA 3WQGA 4IG2B 5LIUX 1HW6A 2TODA 2Z2BA 3BW2A 5C2CA 2QCGA 1QW9A 1Q3NA 4DF1A 3VX1A 1R46A 1XFBA 3BW3A 1OK6A 1NH6A 2NQHA 2YBVA 6ENLA 4UFMA 4AYGA 2AAAA 1V51A 2V9DA 3DFSA 1WPCA 4BI6A 4B5TA 5F1VA 4YHGA 2WJZA 1XH0A 5FF4A 3MDUA 1EC8A 4J3SA 2VFHA 1UWAA 1ZZMA 3EKZA 1FTXA 2CW6A 3CLWA 3INPA 1KRBC 4PB3A 4DO4A 4GYPA 4B3ZA 1VLIA 4FF5A 1XQKA 2X2GA 1W3KA 3GTHA 3UCQA 4H9MA 3CB8A 1B57A 3U57A 1J6PA 2QV4A 1HT6A 1ML1A 1PYMA 3W2KA 2DVTA 4GY7A 2C79A 1GTHA 3SSZA 3WH7A 3N34A 4AF0A 1TMHA 3O07A 3F2DA 2HISA 1FHDA 4XWUA 5FEWA 1NVMA 3C86A 2FGLA 5I03A 4QG9A 1UJPA 4UOZA 4N42A 1U30A 2X7VA 3Q4DA 2OOFA 1JAEA 2VCAA 2QPUA 2C6QA 4S3KA 2FMNA 6ALDA 5DBUA 2DDXA 2ZFAA 3RR1A 3NPUA 1EL3A 3T0AA 2ZXAA 3OG3A 1A3WA 4TU1A 3LUTA 3AICA 3FGCB 3PZUA 3S1XA 1WKEA 1SPQA 1PIGA 1WA3A 2LLEA 5MHBA 3MV01 4O50A 3TOYA 5DN1A 1U22A 1K6AA 4HHHA 4O12A 4GX8A 4R85A 1ZBVA 3WNPA 4MSSA 2VDGA 5T91A 2CZDA 4AEOA 4PCNA 4IQLA 4IPPA 4J3UA 2J7FA 4M0XA 3GBEA 3WQ4A 2OX1A 4QBXA 3S1WA 1KFLA 4P7RA 4MB4A 1ITQA 2DUAA 2G3MA 2Z28A 3IJQA 1NEYA 1EZ2A 4YMZA 1QNSA 3G18A 4EVZA 1E4LA 3WL0A 2PFHA 5JIWA 2VR2A 4OV4A 3N2OA 4PULA 1FKWA 2CBVA 3BLKA 3WDHA 1CGXA 2EXOA 4DAFA 3WBYA 5D9PA 3S83A 1ADSA 1DIDA 4F48A 1EFZA 2BLEA 1RK5A 1NWUA 2XH2A 1CYGA 3TAOA 2ZZ5A 4GKLA 4ADUA 3M7WA 1OJXA 3LCXA 3N9KA 1ADOA 1BEUA 2DY3A 5CZTA 3IPWA 3O1NA 2X8RA 4L6OA 1IWBA 4NRRA 4O1CA 5I3GA 4WEVX 1UPMB 2WVVB 3KBSA 1OCQA 3KEHA 4MM1A 5GNYA 3GNOA 1GYLA 1EJXC 4U10A 3CMFA 2JGYA 2PBOA 2VX6A 4G1KA 1XLDA 5AYZA 4GI9A 4EP8C 4B5VA 1Q85A 4KRZA 4LC8A 1XPYA 2F84A 4RNJA 3DC0A 4D6DA 2BHUA 4P2VA 1GG0A 3IEBA 2R6OA 4IMAA 3COTA 1YE4A 3S3GA 3WMBA 4M80A 2V5JA 3IS4A 4HPJA 1E3XA 2YOCA 3SUTA 2B7QA 1OF6A 1RD5A 3VNYA 3GXDA 4DWSD 4Q7NA 4G7EB 4Z0SA 1K6WA 1AW5A 3T44A 3PJWA 1RXOB 3A22A 4FI4A 4JIRA 2ZUTA 4NJJA 1Z42A 1UP3A 3O06A 2OLAA 1GKPA 1XGDA 2WZHA 3TDFA 2BHZA 4CQDA 5GQBA 1B9ZA 1SJDA 4LS2A 2I1OA 3BDKA 3IIXA 3SCVA 4UFKA 1R3RA 2ZRUA 1W3HA 1VYRA 1S3TC 4TV5A 3HOJA 1T40A 4GYFA 2XIMA 4F0MA 3B4UA 1CLVA 4GNJA 5EYWA 2BY1A 3SCUA 1FCQA 3CNYA 1BAGA 4GQBA 4UZSA 3BAWA 4F40A 4LVAA 4A3QA 2PAJA 2CLLA 3CC1A 2OZ8A 1EF3A 5T9BG 4ZTXA 2VEPA 1DKWA 2EPOA 4A6GA 1J0YA 1VFLA 3QQ0A 4QLLA 2QPXA 2D23A 3MJMA 1G5AA 1FOBA 3O8AA 2E77A 3QXBA 3ABOA 4XZ9A 2CLEA 2W92A 3ENLA 3QFEA 5I07A 1XI3A 1IZKA 2GDUA 1CGWA 3DGBA 4NNAA 5G5IA 2XN1A 1V3JA 3CL8A 1OFPA 5MF5A 1MXDA 1E1FA 1GVIA 3DG7A 2TYSA 5K9CA 3TONA 4XZBA 2QVHA 3UPMA 3BLFA 1DV7A 3B40A 3LHUA 1P6BA 7REQA 2P0IA 3U4FA 1A4MA 3VE9A 1KGWA 3W24A 2FZ8A 1RP9A 1V77A 2J8FA 2Y8KA 3KLLA 3T0BA 3QY7A 3EX4A 4GHRA 1W1TA 3W07A 3K30A 1OC5A 2R1KA 1S5TA 4PSPA 4C6OA 2J7CA 3LM3A 3ABSA 2QUMA 1WV2A 3TK7A 3B0YA 1YDYA 1LM1A 5I3JA 2I57A 3CS2A 4JCLA 1UYQA 1S38A 1L8NA 5JQ9A 2OGJA 2IPJA 1P1MA 4RE0A 5I3HA 1IXPA 4RLIA 1IEQA 2E4TA 5CG0A 2XHYA 1JI1A 4Y2WA 2XGZA 3TROA 1JZ8A 2CPUA 3AQUA 2HQAA 1KW1A 2ZUMA 1N8IA 2A3BA 2HK0A 1E55A 1Z7AA 2I9EA 3BV4A 1XLJA 4GCXA 2VZVA 4JN6A 1TJ0A 2FZBA 1HTIA 1LYXA 1S2CA 2G37A 4O53A 4ZE5A 1V0MA 3UWYA 3TTSA 3T7VA 1UQZA 1JF5A 2J7EA 3V5CA 4LALA 3GNNA 4KWVA 2DW7A 2WHKA 3MUZ1 4KWOA 1TWSA 2DIEA 4ZO7A 4HZ8A 3SCOA 4NL1A 1LL6A 4M81A 2W66A 3NL3A 3ARZA 4WSHA 2BNJA 2RDTA 2ZUVA 3QPEA 4RE4A 3WJXA 1VIZA 1X38A 4G56A 1SO6A 1JYXA 3FK4A 1KCLA 3PWAA 2X1IA 3HPZA 4WVXA 4IIHA 3BTNA 2WPGA 3W81A 1UA7A 2XTKA 2XVPA 5DMLA 3T0CA 3WFAA 4C6QA 2CEQA 2V5DA 1XM3A 4NXSA 3THAA 4NJKA 2XM2A 4NZCA 2VELA 3BSMA 4UQEA 3W2JA 3EOLA 4GG9A 4DUOA 4Z2LA 2X09A 1OFBA 2GK1A 1VFFA 1TPDA 4ES4A 3VGHA 4NJIA 2G41A 3LB0A 1J10A 1JUKA 5E93A 2RJHA 1E6QM 1A5BA 3PSWA 2FHBA 1KFKA 1R8LA 1H50A 5GPRA 4P7LA 4B91A 4JIPA 1R0MA 4D2JA 1NOFA 2P3EA 3GWQA 3CUHA 2PS2A 1EP3A 4ZA0A 1QNOA 3RO6A 3RHGA 2C3ZA 1GG1A 4M29A 3Q65A 4I3GA 4KEZA 1CBGA 1FP8A 3BUVA 5LNRA 1TA3B 1LQ2A 4PMVA 1Q8JA 4Q7IA 2QJJA 4PMYA 1X8CA 3ABXA 2DEPA 5C54A 4N9DA 2WVTA 1EJVC 3SUUA 4US6A 1JNDA 2FB3A 4JY8A 4RW5A 2DT2A 1ZP4A 4WOQA 2FTPA 1XIMA 2X1SA 2DT1A 2DT3A 4J2PA 1JDAA 1BXCA 2I17A 1OIMA 1ZY9A 3BOXA 1R3YA 3ATYA 1M41A 4WLCA 3MW7A 1QK0A 1UR0A 3DFPA 1T41A 5FOOA 3LS9A 4Q8PA 1HJSA 4Q3MA 5BOFA 3S2MA 4KRUA 2WV8A 4KERA 5ABFA 1VQTA 1XW8A 2FFIA 3B0PA 4IMGA 2YL5A 1H60A 5FACA 4AB4A 2IUZA 1KRAC 2WZIA 2DIKA 1KTCA 1H5VA 2GGEA 1AD1A 5ECVA 5HMEA 3EPMA 5G2HA 2D2HA 4GX9A 4L4MA 1KFCA 3O16A 3I10A 1YIXA 1POJA 3BG3A 1X6NA 4DZHA 1ONXA 3UR7A 4M82A 4D6FA 4LAOA 3D46A 3N15A 3HQOA 5E9XA 3PFMA 9XIAA 3HIJA 2I16A 3QKZA 4AVOA 3L2IA 3L5AA 4UNKA 3A24A 1RBLA 3RLGA 4DM2A 2ZC1A 4J7RA 4HP5A 2VDHA 3ARWA 3LCWA 3WUEA 3IIOA 2WANA 4WDXA 1EO5A 1W5MA 4RDWA 4C65A 1XSIA 3W38A 4Q6JA 3M6DA 4PUNA 3K4AA 4DJED 1TPVA 4CU8A 4UTWA 1B90A 1BYCA 3N6QA 2V6AA 1KO0A 1O12A 1HKWA 3WNLA 5JU6A 1J93A 1ME9A 4Q4QA 1O5XA 4OBSA 3SDOA 3MVTA 1B3WA 4H7CA 2INZA 2C18A 4P8VA 8RUCA 4DO5A 1Q2SA 3EOSA 2PDFA 3WNNA 1E0WA 3NTYA 4HMCA 4MB3A 5HQEA 1DTNA 3VPLA 3M0KA 3RPMA 1ZJHA 2OPJA 1NAL1 2WJFA 2WC4A 1AZ2A 5AFDA 3P5ZA 4MB1A 1KCZA 5BRQA 3IV8A 2TSYA 3S42A 3EXRA 5CSUA 1TRIA 3MO4A 3S9YA 1VYSX 2YXOA 1E0UA 4X0VA 1MNZA 4DYKA 4J1OA 3G1AA 4DWSA 1EYWA 1VHCA 4GINA 2ZBTA 1OCBA 1RA0A 4H04A 2F8QA 2XU2A 2VD9A 1MFUA 4BY3A 2I5GA 1C9DA 4BS0A 1EP2A 1W9UA 3T4CA 5LSMA 1UOZA 1KQYA 4UCFA 1GOQA 2AL2B 3NFUA 4FNTA 2OT1A 2G3FA 2VJXA 1ZAJA 4TXEA 3BSHA 4L80A 4A22A 3PZNA 3GBDA 1JDDA 4NZ5A 3MYOA 3HV9A 1L6GA 4JDYA 3ZR5A 1IGSA 3FIGA 4NAFA 4JIIX 4WJXA 1GQJA 3B06A 4XKYA 4QJ4B 2E8ZA 4QJ5B 4H7ZA 4PB5A 1RP8A 1XSJA 3ITLA 1Q6GA 3VIOA 4A29A 3ZWSA 4ZB0A 5C70A 1A5KC 1KLZA 4ZXLA 2VX5A 4BI5A 1PKNA 2Q02A 3MZ2A 3NURA 3CMGA 4NX5A 3O3RA 3T2QA 2ZZ3A 1IIGA 5A2BA 3RUBL 3TJIA 3E0IA 4IGSA 1DORA 3TSMA 4OIFA 1A5CA 3E5BA 3W84A 2WO5A 3N2XA 5KZEA 1HL2A 1SO4A 4QE5A 3GU9A 1HP4A 3UXIA 1A0CA 4IXHA 1UIOA 3BW4A 1AUSL 1ISVA 2J66A 3OP2A 2J7HA 4Q22A 3KBVA 1SR0A 3W85A 5JBFA 2OZTA 2V3GA 3N12A 1QI3A 1NDWA 1ZAHA 2F2KA 1V6TA 3WMLA 1D3CA 1EOMA 3TW9A 2NLIA 3N73A 1EXPA 2BOGX 2D0GA 3MO7A 3STFA 4QAIA 2VGIA 3HFYA 5CZ0A 2WHMA 3QOKA 1BSIA 3MB9A 1W56A 4IUGA 1K77A 5A8MA 3M7SA 3F2CA 1XH1A 1QW7A 4NNCA 3FSTA 4B9YA 4PUMA 3QBUA 4KGJA 1UP0A 2R1NA 1NDYA 3W6YA 3VU2A 4MUZA 4IOTA 2F38A 2P10A 4UR7A 4D8AA 4MF4A 2WVUA 5HR6A 1E9IA 1UOKA 1ZLPA 4AMAA 2IMRA 1HP5A 3WDRA 3HQNA 3L0KA 1K8YA 5BMWA 3URNA 4E6MA 1TQJA 2JEPA 4RPQA 1E9YB 3MKKA 2WC3A 3A5VA 3PY2A 4N9BA 1UA3A 2PGFA 1MO0A 1F3WA 3KOFA 1XICA 5A5WA 4YTRA 2A3EA 5HA7A 1ZJIA 3LBCA 3N6HA 1PZ3A 4P7NA 4HPGA 1S2WA 1J0HA 5J8LA 4LRSA 2CZVA 5C9WA 5T9CE 2H6RA 4UQBA 2VDIA 1EBGA 3CUGA 3WLMA 1M65A 4WDWA 4IJBA 3ANYA 3G8EA 8XIAA 1SMDA 3WK0A 4OU1A 1W3TA 3ORWA 3W7RA 3U5YA 3SQSA 1ZNNA 3PWGA 2VOTA 2VURA 1EJ7L 4GXMA 3RIKA 1KM2A 2NV9A 3RCYA 4J3XA 3IVTA 5XINA 5KSWA 4W88A 2XIIA 5ECUA 3OQEA 1KFBA 3HGOA 2EPMX 2OOGA 5FJTA 3NQVA 4GVHA 3PPCA 4F0HA 1C92A 2VKZG 3EWWA 2D1ZA 2HE8A 2YA2A 4MFEA 5LKYA 1TWDA 1VEMA 2Y7EA 1V03A 3RLHA 4B4FA 2PDMA 1ONWA 4V33A 4DUXA 1REQA 1S5WA 2W91A 3BMXA 3R8RA 1GNXA 7TIMA 4CN1A 4OOZA 4B15A 3SADA 3B3DA 4NP7A 3U9IA 3TYAA 3KXQA 5AC5A 1PHQA 1W37A 3VDGA 1V0NA 2EEXA 2FZNA 3HBLA 4FNPA 5GVJA 5C2XA 1A3XA 5DY2A 1IIHA 4L6DA 3VC5A 3QLLA 4IT1A 3R11A 3NG3A 3TXZA 2JQXA 3SJ3A 1R87A 1SMAA 5AYBA 3NAVA 4ADTA 1K03A 1Y7VA 1G4PA 5CPLA 3M07A 4A2RA 5HJXA 2J25A 4QNEA 3MWCA 2JKPA 1T96A 2B7PA 4B3KA 2FZ9A 1FWGC 1GKRA 3R12A 2GVGA 3TSDA 1AA1B 2J7BA 7XIMA 3LTPA 3QQWA 3OPSA 1PUDA 4ZOEA 3A6OA 3LNPA 3HA1A 2PDWA 3UNTA 1HO1A 2BVYA 2JF7A 4R27A 4I7VA 3EWBX 3MMDA 3CUFA 3BG9A 4HPHA 4HNNA 3CQ0A 1OG0A 3GZAA 2JGQA 4M8UA 4OE7A 3UQNA 6TAAA 4FR6A 2WZMA 1Z48A 1XYLA 4CN6A 4A35A 4LUYA 3B9AA 5HMSA 2OQLA 3G0XA 4Z08A 3CPGA 4X22A 5I7GA 1NFBA 3CL7A 2PU1A 3ANUA 3S1GA 3Q58A 4R33A 2CZFA 5CKSA 5DRCA 5CPMA 3WELA 2QUVA 5D03A 1OINA 3QMRA 2GJXA 3NQEA 5CBJA 3F4VA 1XLKA 1IXQA 2X2YA 1JZ5A 3FY1A 2VX7A 3BANA 1DBTA 1DYSA 2OB3A 4AFYA 2I14A 3W7OA 5ABHA 1UZDA 1LROA 4R53A 4WSKA 1UD5A 1P6CA 1V3KA 2QIIA 3IK2A 4E4FA 5D2YA 2W62A 5ENLA 4ACZB 2VO5A 2OQHA 2J7GA 2DJXA 1TPB1 2D2JA 2FH8A 3OU8A 5F1UA 3VNIA 2O55A 1E4NA 2CZ5A 2EG7A 3SIMA 1MW0A 1PS9A 2ZTJA 5CBBA 2OKOA 4JEQA 3FS2A 3B9NA 1BF6A 3TZNA 1UR1A 1GW1A 1OX4B 1XR2A 2V81A 3CEUA 1FDYA 4UZUA 1Q2RA 2VC6A 3DN5A 4CQ8A 4BK9A 4HK5A 4C6CA 2PDCA 5I78A 5DEZA 3VNLA 3RX4A 4RCXA 3T40A 2FZDA 4NILA 3G3MA 3KBJA 1T0OA 1AQMA 4ATWA 5EU9A 3NYZA 1R5YA 5HUOA 2DZSA 5M5DA 1UR2A 2OFJA 4C7FA 3QC3A 3GK0A 2C8NA 2VR4A 3OYZA 2FH6A 1H3GA 3QZAA 4EXQA 1K70A 1AJ2A 4ZQCA 4DBSA 1XLGA 1ICQA 2J24A 3APYA 1DQWA 2EO7A 2C1HA 4MNLA 3W7GA 1KFEA 3MCNA 2R91A 2C1IA 3LLDA 3RJYA 1KXHA 4R9OA 3TN3A 1WBJA 1L2UA 1XIIA 1M01A 2QMJA 4ERAA 4YYCA 2GGHA 4X9SA 2Y89A 3WBWA 3DFYA 2Z2UA 4FX7A 3HQPA 1FH7A 3VNKA 5T8GA 3MSYA 3IIZA 1HGYA 1IQ8A 2BXYA 1GQNA 3CLMA 1GT8A 5D2WA 1DWHM 2ZX9A 4O14A 1MEIA 4H9XA 1DJIA 3PN8A 4H2HA 1CECA 2Z6JA 4NF7A 4YHEA 2CLKA 4MYAA 1F74A 3OW1A 3P82A 3IARA 4MJMA 4TOQA 1ISYA 3M0ZA 3KBMA 1JYWA 1K7FA 3LERA 3PR2A 3TXVA 4QDMA 3FN9A 1QW8A 4LC6A 4AD4A 4JTGA 3BLPX 4ZENA 3EWUA 3QTGA 3M0YA 2HSAA 4W93A 3IAQA 1JDFA 2V2DA 4MWAC 3V75A 1RLCL 1FH9A 2E5DA 3W1UA 1W8GA 1L9WA 3R0KA 3GIQA 4KEVA 1J18A 4JTIA 5E6YA 1BG9A 1S2AA 1YQ2A 5TAOA 9RUBA 2RAGA 4JTTA 2E3ZA 5J04A 3WBAA 4BWLA 3OQ8A 4C6IA 2DZAA 4H9ZA 4LQ1A 1W54A 1Z3NA 4H4IA 3CGTA 1KKOA 1LBFA 4I5RA 4S1FA 1EEXA 1XINA 2DZUA 3N4FA 3LXAA 1UD8A 3LQGA 3FA5A 1DVJA 4QLJA 3WY1A 1Q6FA 3OYXA 3DYMA 1DIEA 1FWSA 1VYPX 4Z0JA 2VC5A 2G3JA 3GYCA 2HZGA 4EE9A 4S3AA 2PC8A 3FEQA 4GGBA 2ZZ2A 2J77A 4Y8EA 4ASTA 4NZFA 1BKHA 1P1XA 2C0HA 3HG5A 4HA1A 4U5KA 3SQMA 3G1VA 2J79A 1XBYA 3N04A 1TJ1A 1JCLA 1REQB 1TVLA 4H83A 3QYQA 2Z1KA 2UY5A 3MU7A 5U4NA 5CJMA 1GOMA 1SO5A 2EPKX 1XLMA 2JEQA 4AW7A 4H9VA 1TV5A 4WKHA 3PTDA 3GU2A 2C13A 1KFJA 5AHLA 3TWBA 3EXSA 4EAMA 1UC5A 3MUAA 1W3NA 1PO9A 1MZHA 2QUTA 1ECQA 4PRTA 3W87A 4I9JA 4IMEA 4Q4SA 3IRSA 5CLWA 1EKOA 1NY1A 4Z2GA 4JNZA 2H9AB 1BQGA 3MBFA 4JTRA 4MWAB 2UWFA 3UZWA 4FXFA 3SCNA 2XISA 1W2PA 5CSRA 4XX6A 2E5CA 1ECEA 4N6FA 3F4NA 3WDPP 3VNMA 4GUIA 2PDBA 5HWNA 1C8QA 3W28A 1W3JA 3LRMA 1XPGA 2D20A 2NUYA 4B5UA 5HNUA 1HJQA 3EA3A 5G1TA 3W86A 3I3BA 3WD3A 4WUIA 1J8VA 4U28A 5EMJA 3UA4A 3FDGA 3P80A 1KV5A 2E0PA 1FHLA 4Z1YA 3EWZA 4J4KA 3DFHA 3VMNA 3EGJA 4QDWA 3K4DA 4GVIA 4MDPA 1B2YA 4EF9A 5AB3A 3W7KA 4ZB5A 3PZQA 4AY7A 3TYEA 1TKKA 4WKFA 5E5CA 2BOFX 1K4GA 3VNZA 2I7GA 3P0XA 4DBWA 1G0CA 1AK5A 1XC4A 2FLIA 2IKGA 1IZCA 2ODOA 1QI0A 3VCNA 1O68A 2HPIA 5C9XA 4FPSA 2V0TA 4BFAA 4EXBA 2H3DA 2VRQA 2IPFA 3DFOA 1QNQA 4HNTA 1QK2A 3R79A 3WUGA 4DBDA 3AYTA 3PZIA 4OECA 3C2YA 2AQWA 2PTZA 4WY0A 5A2CA 1NQ6A 1NFPA 4NZ3A 4FB7A 1Y5VA 1OFEA 3RCMA 4CQAA 2G8ZA 1EZWA 4ML4A 3O0KA 4OOUA 3LI0A 1XDJA 1CXFA 3GVGA 4DLFA 2BOEX 1S5NA 1TB3A 3GE7A 4Y9NA 1OD8A 3LHWA 3HTWA 1DWJM 5EL1A 2GL5A 4XAFA 1KBKA 4KRTA 2BTMA 1EO7A 1UBSA 4GVGA 3LEPA 4A3YA 1YPXA 1VP5A 4Q8QA 1QFEA 9CGTA 3M16A 1B30A 5A6AA 3LG3A 3QM3A 5LXEA 1PWLA 1B4EA 3TTYA 3TC7A 1WZKA 4JZ5A 1UZ1A 4HTYA 5DMNA 4Y7EA 4BI7A 1JPMA 1PBGA 2IKIA 1PX3A 1VPXA 4IP5A 3UP8A 3CB3A 3DFTA 2D3LA 4YIWA 4R7WA 5J5RA 4JS3A 1CNVA 3IUDA 4LVDA 7ODCA 2OT0A 1XLIA 5AHMA 1SYTA 4PC8A 3NL5A 3S6OA 2CZEA 5T26A 5I2UA 3VDCA 4MKVA 1DXIA 1UB3A 4L1WA 3IGHX 4GQGA 4JYFA 3RPTA 4NZ4A 3B9OA 1AZ1A 2GQ9A 4DNMA 1PJ9A 1XYFA 4S2BA 2AKMA 1GZ1A 1Q6RA 2ANUA 2ZADA 3EPOA 1JL8A 1RR2A 3A13A 3DERA 3GR4A 1VAHA 5A6BD 1W32A 2OZ3A 2VWSA 1UW9A 1BPLB 3THDA 1JGMA 4E4UA 3MI6A 1NWSA 1QTWA 4LAMA 4ONVA 3BAXA 2G50A 3O63A 4U3AA 2GOKA 1QR7A 1RJRA 3U7BA 3C56A 1X1OA 3L67A 3LGGA 3QPYA 6CGTA 2D69A 2O92A 1PXGA 4PODA 3TCSA 1JZ7A 3I4EA 2J7DA 2AL1A 1ZENA 1M3UA 1TCDA 3ZSTA 1BTCA 3LRLA 3S8HA 3USBA 3H2FA 1I1WA 2WZTA 4UFHA 4PEKA 3TYCA 2F6UA 3OOQA 3QF0A 1S5MA 1G6CA 3MJYA 4CD4A 3D3AA 2GZXA 4L65A 3FVDA 2HPMA 2YZRA 4B90A 4CU6A 2HVNA 5FF2A 2D24A 3U0HA 1TJPA 4GA8A 3SY8A 3UGRA 3FDKA 3OLEA 1TWWA 1NQKA 4A8RA 4IIFA 2YKKA 3ALGA 4M7SA 1JZ3A 3K1GA 1KTNA 3TCEA 1P7TA 1H7OA 4GBUA 2X40A 3H8AA 1JZ6A 3HGJA 3GVQA 3MYPA 1EGZA 4D6GA 5CZJA 4NZJA 3QQ1A 1K1DA 2VNCA 3UJSA 3MBDA 3U2CA 2AQVA 2C71A 2HCVA 1N8WA 4CGTA 3NNTA 2QCDA 1E43A 2PLKA 4W7VA 3L66A 3W2UA 3M0HA 4MKNA 2B4GA 2VENA 2FDSA 1BYAA 2CBUA 2Y7GA 4LUSB 5BMXA 2GGIA 3DOPA 3OA3A 1U1UA 5D32A 3CZEA 1EOKA 3KVJA 3SRDA 3TYDA 3UG3A 4C6MA 4Z1BA 3WUFA 3ZR4A 4KCWA 1E0XA 2VD8A 1BWLA 3WNMA 3URBA 5H8UA 4NX0A 3WQ5A 1FWHC 2VFIA 3E74A 3B03A 1ALDA 4HN8A 4MYXA 1H51A 1WDQA 4JFUA 4PMXA 2WMJA 4HK6A 1PAMA 3PF3A 3C5QA 3GVWA 1XGEA 1VEPA 5FF7A 3S6DA 3WJSA 1UKQA 3MZNA 3SO7A 2O0TA 3VNDA 1TPWA 4L4PA 2V67A 3PZMA 1FWWA 2XDFA 2CLPA 1JCMP 3VI2A 3WLTA 1BQCA 3K5XA 1E5NA 5I79A 3ME3A 2V5KA 3T9PA 3PBMA 4JTHA 5CQ1A 3REQB 5AHIA 4WSJA 1VJZA 1XCXA 2QMKA 3ZT7A 3U6WA 4DI8A 4IZGA 1X97A 4HOXA 3CAWA 2PTYA 2EG8A 4KFNA 4W5UA 1F7BA 3HB9A 1ZBKA 4W7UA 1GOOA 5HXMA 5EB8A 2Y8VA 4E3TA 1XHGA 1RQEA 2CBJA 3VM7A 1X8FA 3WN6A 4AVNA 4AC1X 4N2YA 3A4AA 4JIEA 1VJIA 3SGGA 1QI4A 1VCVA 4RZ4A 3TUUA 3SCRA 4PFHA 2V63A 4NXKA 5KZ6A 4R88A 4GISA 3I7QA 4AEEA 3D47A 4XAGA 1TG7A 2BVDA 1E1CB 2NSOA 1G1YA 5I3FA 3MCMA 3ERPA 3TYZA 3BICA 2DUXA 2WNNA 4AYSA 3WF4A 1I6NA 3CAQA 4REQB 1QPRA 3LTSA 3H4XA 4Y6GA 4EPEC 1V7YA 3T8QA 2ZC8A 3DHUA 1E40A 2E6AA 4LBSA 3NQ7A 3W37A 3C0SA 4FOKA 5HINA 3P84A 4HZ7A 3EWCA 2WLZA 3C2FA 1YW1A 4YL2A 5I5RA 1TMLA 1GUVA 1WXZA 4CEUC 4CN4A 1DHKA 1KM0A 1OIFA 1KR1A 4FIRA 5D04C 3BG5A 1LJYA 1LOQA 3QOMA 4Q8UA 2QF8A 4PTDA 2BV9A 1IGWA 1QO2A 2YX0A 4JN8A 5REQB 4KCTA 3ITVA 4GPNA 4ZMGA 4P8XA 2PBGA 2VFEA 3DHPA 4HHMA 3JRKA 3VFCA 1ZFJA 3GNRA 1LBMA 3BLEA 4UQCA 4PEEA 1LOSA 1Q8AA 2Y85A 1AVAA 2Z2AA 3VOHA 3CPUA 5HBFA 4N02A 4O17A 3T2OA 2CLOA 3DENA 4AH7A 4IFKB 3WBXA 3NDZA 4CKQA 3FYPA 3PB2A 1KWGA 2IKJA 2ZE0A 2VEFA 4H00A 4QG6A 4AHPA 1HNYA 4KS0A 5A8GA 1B0IA 3ITYA 4O28A 3L68A 3VIGA 1M5WA 5G1YA 3H6OA 1Y65A 1SZRA 2VRJA 2WBGA 2B7OA 1VH7A 4AZCA 1SQ7A 2H8XA 4KMQA 3TIMA 4U4MA 5L9FA 2VGGA 1XDLA 3L4ZA 1WDPA 3KVKA 5BXRA 1BGGA 1SSDA 3KS6A 3L2MA 4PN2A 4XD4A 1DL3A 1KXQA 5EMMA 5H1WA 3SCQA 2YW3A 1Q7QA 1JPDX 1VD6A 1JD7A 4AZIA 1O7AA 1XYZA 4G8TA 4S3FA 3E0LA 2CC0A 2PU0A 5LNVA 4I7WA 3LTYA 3OHMB 5EFDA 3GW0A 1U5JA 3W53A 1UD6A 4B3LA 4HHLA 4NVTA 4GH1A 2CFFA 1T99A 3UA3A 2PLCA 1O1ZA 1V6YA 2HBXA 2PRHA 1E6PA 5CCZA 3WO8A 4W8BA 3M41A 2XJ7A 3S9ZA 3ZJKA 4D1IA 3SEPA 2QXWA 4PRRA 4WOZA 1R7OA 2WB5A 4WJEA 3BMWA 5A6BA 5M17A 3ID7A 2PGWA 2QZRA 5BW6A 1CT5A 1F4HA 1VGAA 1RJQA 1KCKA 4WK9A 1IWPA 4BHYA 4GZJA 3GH4A 4KF1A 4X60A 4J9JA 2QCDB 2XIBA 4GJIA 4IP7A 1F61A 3P67A 2NQ5A 3ZM8A 2W5FA 2ZZ7A 1LG1A 3XIMA 5D33A 4FR1A 4M1RA 2XM1A 3R0UA 3I7SA 1Y5XA 3FKRA 4POCA 4ZO6A 3E12A 2I56A 4C6EA 2VTFA 2Q8ZA 5C9ZA 3U48A 1JDEA 3GLCA 1LTDA 1PDYA 2ZIDA 3FJ6A 3WF0A 1BKSA 4I9AA 1ESWA 4I5UA 3LV6A 3V0SA 3GYEA 1UHVA 3KP0A 5IXEA 4ZZ9A 4H3DA 4WQ6A 1UKPA 4G1NA 4F79A 4INFA 1S39A 2DIJA 4K7YA 3USZA 1IEIA 1QPOA 1GOWA 4HT3A 4Z1CA 2WW5A 4DBEA 1DWIM 4DXKA 2CESA 4GQ0A 1T8XA 5G2IA 2ISDA 1M9HA 5IDZA 1H5YA 2ZQ0A 1W0MA 2P53A 1HJXA 2DSUA 5A1AA 3LU2A 4YNGA 3IVSA 4H1ZA 4QM1A 3SRKA 1A53A 1UD2A 4ZCWA 4MNKA 3H54A 3KX6A 2E9MA 2AMGA 1L6FA 4K7VA 3F03K 5F2LA 3HN3A 5LNUA 5H2ZA 3E2QA 2WKGA 3PPFA 2ADAA 3CHVA 3ARRA 2JFEX 4B9ZA 1W1B1 3QFWA 4M24A 3FJNA 3IJ9A 3VIFA 1XRVA 4NASA 2HJPA 4PMJA 3OVRA 2PDYA 4JX5A 3PFRA 2DV0A 3L23A 1BRLA 3WH8A 2FYMA 3LZ5A 1DIKA 3B04A 4O15A 4XQ6A 2P3ZA 2BY0A 2V5LA 1R30A 3PPGA 5AN7A 1LUCB 3PBVA 3DDMA 2D3NA 4CCEA 3V16A 1CCWB 2TPSA 3GZ3A 4K1WA 3OBKA 3W1MA 1TV7A 2R94A 3BZGA 5C2GA 1VZWA 2OSWA 5C7VA 4MKSA 4S3BA 1JCYA 4D6JA 4HPNA 3KL5A 1D8WA 4PYSA 1X7FA 3TQVA 2G3NA 2KZHA 5B7YA 3O15A 3A4JA 1FDZA 1Z69A 3BLOA 3E1F1 5K4XA 4CQBA 1K02A 1EUNA 1U1JA 2E7FA 1YTKA 3P2VA 4IM4A 3RO8A 2BX7A 3VD9A 1BVZA 4Z2JA 3NM1A 2IPWA 3KTSA 1B3XA 3IGSA 2PPGA 3S5SA 2JIEA 1QASA 4D8ZA 1XLLA 4GD0A 2NQLA 1MXGA 1XL9A 3H2MA 4MADA 2WKLA 1CDGA 2A2IA 3RK8A 3F4CA 3T6CA 3CZGA 4DXXA 1UH4A 3M5VA 3NEHA 1E0VA 3ARVA 1ZPTA 5IRPA 4IG2A 2X0YA 2WSQA 2PWEA 2E67A 2GSHA 3AXMA 1UWUA 5DO8A 1MUMA 2NWSA 1FA2A 4JY9A 3PAOA 4UC5A 2O9PA 6REQB 2A3HA 2J4GA 3O6DA 4QDPA 2I5IA 1CLKA 5AOUA 1IT7A 1TPFA 1MXSA 1UH2A 3MDWA 8TIMA 2PC4A 3PTQA 4AHOA 3FAXA 4L4OA 5E0FA 3MY9A 5H91A 4XTDA 1D7FA 1RA5A 1Q6LA 3KL0A 2ZUSA 4NY2A 3M47A 3PWIA 3TQKA 4C1LA 3NDOA 4UOJA 2QCFA 2OMAA 3R5EA 4DYEA 3DX5A 3WH5A 4ATLA 4Q8MA 3BQ6A 3G1SA 1A5LC 3VXGA 2UY4A 1GOKA 4DJEC 1XIGA 4C6LA 1OB0A 4CD7A 5BWAA 3SR7A 2PODA 1J79A 3APGA 4HZMA 3TEVA 3GY1A 3NXLA 2Q3RA 2QCMA 3W22A 3I65A 3LDVA 4GIEA 2QJHA 4TVCA 2ISFA 3BARA 4QISA 1I60A 7CGTA 3ZZ1A 1EBHA 1QHZA 2VEKA 4Z1AA 3L4XA 4C7GA 1T5AA 1XBXA 1VCGA 5CLTA 3A3XA 3FGCA 3RNDA 3SGUA 2J8GA 1VBUA 1LLWA 4ZSTA 3V5FA 4DRSA 2V3FA 3KW3A 2VUNA 4IL2A 1JAKA 3VCRA 1BFNA 3SIZA 4LVBA 3ABRA 2NX9A 4O8RA 3AXIA 2PWGA 3N4EA 1J4EA 3KLKA 2XVLA 4J40A 3UETA 1B54A 2A3CA 2EAWA 4LYKA 3O05A 3BC9A 2P88A 1H7XA 3DKJA 3EOUA 3OVGA 3H55A 4ROPA 3KAOA 3Q2DA 3LPGA 1DJNA 3TZFA 3OLDA 4IF2A 3RRAA 2AGKA 3UR8A 3TFXA 2CLIA 4M6PA 3A3WA 3D6NA 1JXJA 3W1NA 4GFIA 1J0KA 5KMYA 3I6TA 1FXPA 3CUXA 5C9UA 4JTSA 1QWKA 3IIPA 3VGEA 1VRDA 3NYDA 1C93A 4XBJA 1Q45A 1Z41A 5LA1A 2OLHA 2QCNA 3WX7A 5CC5A 3L65A 3WLKX 3ZR6A 2YXGA 1O1HA 3UZZA 3WLJA 3OVQA 2Y88A 4L4LA 1EPVA 3WJWA 1NF7A 2QV5A 1TX2A 3WF3A 1E71M 3E0FA 4JNMA 4IWWA 4L1XA 3BGJA 4EOUA 3WNKA 1CXIA 2WSYA 2C91A 5F7UA 2EGZA 1MW3A 2QDDA 2WVVA 3Q67A 4Q32A 4HQVA 1A0DA 1IEWA 2YW4A 4LW7A 4C6PA 5K9DA 4RUBA 1FBAA 3UPBA 1P48A 1VKFA 4P5UA 5D09A 2QUUA 3GC5A 1YXDA 1XCWA 1VF8A 4QHRA 5IBXC 1YBQB 4M1BA 1O95A 8CGTA 1OHLA 1W1ZA 4CD6A 1YNYA 4WY0F 5HOSA 3R25A 5IM51 3CHEA 1US0A 5CC6A 3QV9A 1U33A 3SCSA 4AXKA 1LL7A 2PWFA 1KXTA 3O0FA 4FLRA 2YPIA 3A4WA 2PWUA 1THFD 3H2CA 3VGBA 4JKKA 3AU6A 5HNRA 4WGHA 4OZOA 2DQXA 1DQXA 1LG2A 3W7QA 5DMYA 2YL6A 2WHLA 5D9NA 3WD4A 4QROA 4YWSA 3RM9A 1TO3A 5KITA 3BV7A 4QFUA 5HPOA 2V38A 2E9BA 3PBYA 1K7EA 1XIEA 2ZCGA 9XIMA 3SQLA 4CNPA 2IKHA 3BAYA 4W85A 5FCZA 3UFYA 4ICNA 5BXPA 2BGSA 3QHMA 1M1BA 4PRWA 4TV6A 1W9DM 1J6OA 3AZSA 2PRMA 3UXLA 5PTDA 1PE1A 2WAGA 3ARTA 3GHTA 4XAPA 4A3UA 3CHCA 4OV9A 4AY8A 4Y9OA 1PZ2A 4O1AA 1J2WA 2YLLA 2CKSA 3KRUA 2R1LA 4I8DA 3NQGA 2WMKA 3B9DA 2QT3A 3FAWA 4LX4A 3W1PA 1T8QA 3PPHA 3RMJA 1YDNA 1EA0A 2WM1A 2GJLA 1GVEA 4S39A 3BCDA 4M6VA 4XBSA 4GYKA 2NX3A 5D2XA 4E2DA 2J9ZA 4XZIA 3L7RA 3PZVA 3GIYA 4GRSA 4Z2HA 3V4BA 1TPEA 2HXUA 2PP1A 2QLYA 3Q37A 4ZQNA 1OT1A 3MSGA 1VB9A 2J74A 1F4AA 1K9FA 1Q65A 3RDKA 1B3YA 3SCPA 3CPRA 2INEA 3UZJA 1HKVA 1SVDA 3V18A 3RX3A 3C6CA 1HUVA 3LCIA 1UMLA 2A4AA 1OT2A 1TMQA 5A6KA 2OLSA 4IICA 1YX1A 2YCIX 3GTNA 4PUKA 2ZRYA 2YYTA 3MSDA 3H12A 2Z1SA 2RGLA 4K39A 3WLRA 3LMZA 3NCOA 4FZIA 2CKRA 4OT7A 1AQHA 4JD4A 1KBBA 1WUEA 3W1QA 4PFMA 2E1DA 3L4VA 2ONEA 4RNIA 4BEUA 2Z0IA 1ZP3A 3U2ZA 2OKTA 4DF0A 5I77A 2EBNA 3UYCA 1FCVA 2ZWYA 3JU2A 2J13A 5SWUA 4F0KA 4QEEA 2PWVA 3EXTA 5FIPA 2BASA 3W23A 1ZBCA 1EF2A 2ZRXA 4MVAA 5HWJA 2IXUA 4R7JA 1TWZA 2VGBA 1SZGA 4OUIA 4H41A 5DCBA 3QYSA 4Y9MA 4JFWA 3L9CA 5EMYA 5U7SA 4O1DA 2Y61A 3NQ2A 4QCFA 3HU7A 5E9AA 1TSIA 1KKRA 3ABQA 1Y0EA 1C8YA 2W0UA 1XC6A 1LLZA 3CAKA 1RVGA 3VOJA 4OGZA 3GXFA 4NAEA 1A80A 2W4XA 4FX6M 2ZX7A 3RILA 5G2WA 2HVMA 1RAKA 3OZOA 4GY1A 4UTHA 3KVLA 1C91A 4MAZA 1O5RA 3GNXA 3BH4A 1ZL1A 5A8PA 1MQPA 2TAAA 1EDQA 1R47A 3PULA 3W74A 4BJHA 1OGSA 4K37A 1WAWA 2YFOA 4CCZA 4MJZA 1L6YA 1CENA 1X6LA 4CQCA 4FXRA 1EJUC 2NW0A 4L61A 3LA4A 1XGZA 2E6YA 4KFOA 3S2NA 5KZMA 2Y63A 3PZOA 4LXFA 5D9OA 4FNSA 3OBEA 1BGAA 4JXCA 1NARA 4JX4A 3EDDA 3TJ4A 3BE7A 2VVSA 3G2GA 4URIA 3RJXA 4JBRA 1Q6CA 2CWNA 2XWEA 5DELA 3V0TA 2GYIA 1WKYA 2ACUA 3AISA 3G1XA 1YEYA 3TFCA 4HNCA 1XLEA 2VZOA 3PP7A 1TA3A 2XG9A 4X2RA 3AALA 1PEZA 3OZMA 3UXAA 2PWDA 1R3WA 3HV8A 3CUIA 1P0DA 4JGDA 1OYCA 1S2VA 4JOMA 5F4XA 2YCLA 4HCDA 4F2UA 2VGFA 3N19B 4KIEA 2Y7DA 5LA2A 2C16A 1G01A 1Q63A 4HYVA 4YWIA 2IQTA 2PWHA 4JTLA 4I9TA 3LV5A 3PUOA 5IFTA 1V3LA 3T0TA 5EY5A 3TR2A 3V1HA 3KDNA 3MI3A 4DJDC 1XLHA 1ENUA 1H7WA 1P5BA 4UWMA 4H6EA 1H4PA 4H6RA 3EEZA 3SFKA 3RLUA 1TFVA 1HJUA 3DYOA 3W7MA 2J78A 3E9AA 3W1LA 2V2CA 5C0QA 2OYKA 1TE1A 3WMSA 4PMZA 3QRHA 1DOSA 2XN0A 3CUJA 3LBOA 4UMCA 3W1RA 4KCUA 3WQWA 4HMNA 3AS1A 3M4HA 5LIXX 2ZICA 4LNCA 3AYSA 4JQ2A 5CPSA 4IIEA 5BXSA 3CHDA 4IPIA 2NXIA 3OHIA 3QHNA 3WLNA 3LHYA 5I3KA 2VQUA 2HV5A 3K8LA 3BVJA 1JYVA 1ONEA 1WBHA 4L1GA 2VRKA 1V3MA 1RPKA 3AS2A 3TMQA 3WDQA 3RU8X 3E02A 4I7UA 4LGXA 4DPPA 1S5VA 3AXKA 1RLDA 3L4WA 4UQDA 3VTRA 3S5YA 4ZL1A 1YTEA 3M6YA 1W5QA 3GKFA 5KZDA 2QKFA 3H26A 1TVNA 1VFSA 1VFOA 2YBUA 1CLXA 3VIKA 3W7IA 2WBKA 2CCRA 4TTGA 5HJLA 5A94A 1O6IA 1JPIA 2CHRA 2ISSA 3E0VA 4CNNA 4LPCA 1EHNA 1P6WA 3G6MA 3GAKA 3W73A 1YKWA 2YBTA 4JHMA 2UY2A 3F5KA 2PRLA 3VDHA 1C29A 3OGSA 1SJBA 2QQ6A 2WNQA 1UROA 5TBOA 1UC4A 3M0LA 3ZVHB 2B0MA 3KZPA 2QDHA 1MEWA 4UMBA 4HIBA 4HNUA 4CCDA 5E09A 1H0GA 2VCCA 4Q4MA 3UCCA 5FL0A 3EB4A 2ZZ1A 1DJQA 2XWDA 1RBOB 1PL9A 1LT8A 1B9BA 3UGVA 4ECLA 2QHAA 3LK6A 1V93A 5CGQA 1TTQA 1US2A 1XJBA 4DXVA 1SGJA 3U4AA 5BU6A 1AW1A 1RY8A 1B3VA 3NQAA 1NP2A 3SURA 3EDEA 1FHVA 4GUHA 1VS1A 5A6JA 4O1EA 1H41A 2HXTA 4PB4A 5A2AA 2G4JA 5AHFA 1UUMA 2AL2A 5FJOA 5DT7A 3DBPA 1TX0A 1RZMA 4ALDA 3CAVA 3TTEA 1G94A 3EDJA 1V8EA 4MTVA 1UJQA 3UJEA 2GQAA 5AHEA 3ARUA 3TV8A 1YXCA 3I4KA 2WMIB 4FLOA 4QTGA 1QNVA 4S23A 2RDXA 4FP1A 2NQJA 4V1XA 2R9RA 3T78A 2ISVA 2XSXA 4FALA 2G97A 4UB9A 1IT0A 4X3ZA 3UNDA 2A3LA 4LYRA 2NV1A 4JL2A 4QJ3B 2YDRA 5D8ZA 2VR5A 4I6KA 4UIOA 4IPLA 1BSLA 3MP5A 4HU0A 1AODA 1I2OA 1XDMA 1SSGA 3GAYA 3QR3A 3GG1A 1MUCA 2GJPA 4JPGA 4MZ1A 1MVYA 3P81A 4ZSUA 2WM0A 3A9BA 4MNJA 1JULA 1V0LA 4NAEB 1H7RA 1LZOA 1UR4A 2F6KA 2CU0A 3CASA 3MSRA 3TAKA 5JUVA 3WFLA 3K46A 3B4YA 4MOZA 3O6CA 1G7UA 1N82A 3ZVIA 3WEZA 3TTOA 5AZ0A 2GSJA 1V6VA 3ARXA 4MFDA 1F6YA 4KT2A 4GI8A 2MANA 3H4GA 4Y9PA 4WKAA 5KINA 3ZLHA 3B0XA 3FFSA 4CLMA 1HG3A 1VHNA 4UMAA 3N6JA 4JYDA 3PUGA 1K8CA 1OGBA 2ATSA 1PCWA 2QUNA 2VFDA 2WNWA 2P1FA 3E0WA 3RM4A 5F2IA 3VKJA 1C8VA 3CV2A 3LX9A 1ZAIA 4QQ3A 3T1GA 5I06A 4NZ1A 4W86A 2V3DA 1PDZA 2CERA 1PYFA 2QJGA 5B80A 3IUIA 4IGNA 2OEKA 3GUWA 3T81A 3V5OA 4CEXC 1VLWA 3Q45A 2OYMA 3PJXA 3G0SA 5LXXA 2VMFA 1OSEA 1B1YA 1I45A 5CZKA 1WQ5A 4PUDA 1EWDA 4V1YA 1I2RA 2YCLB 3EX2A 1UWQA 3JUGA 3QGVA 1C9WA 1Q5MA 3H23A 1X96A 3VA8A 4XG1A 1X39A 2P8CA 3L21A 4YLWA 3TOPA 1X6UA 4TUFA