3HV8A

Crystal structure of fimx eal domain from pseudomonas aeruginosa bound to c-di-gmp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
247
structure length
242
Chain Sequence
GDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords Protein FimX
total genus 80
structure length 242
sequence length 247
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3hv8A00
2R6OA 3GFZA 3GG1A 3PFMA 4FOUA 4F48A 3U2EA 4RNFA 4AFYA 3GFXA 4Y9MA 5MKGA 5M1TA 3PJTA 4HJFA 4Y9NA 2W27A 4AG0A 4ES4A 3PJWA 3HV9A 4LYKA 3N3TA 3KZPA 4RNHA 4RNIA 5MF5A 4HU4A 4Y9PA 4Y8EA 4J40A 3HV8A 4Q6JA 4Y9OA 3S83A 3GFYA 4RNJA 4F3HA 3TLQA 3SY8A 4FOJA 2BASA 3PJXA 4FOKA 3GG0A 4KIEA 3PJUA 4LJ3A 5MKGB 4HU3A
chains in the Genus database with same CATH superfamily
4G1NA 4G56A 1XSJA 3BCFA 3G3MA 2ATMA 1QDSA 1FXPA 5AYBA 3S1XA 3LLXA 3VIGA 4IPLA 4MKSA 4DBSA 1XYZA 2ZRXA 1JG9A 1SMDA 4CGTA 1E4MM 3Q45A 1O12A 1IT0A 2J78A 3LG3A 2OYKA 1R87A 1EPXA 3NQCA 1T40A 2QIWA 3S1WA 2Z1XA 1XRVA 3RO6A 1XIHA 3UZJA 1TO3A 4LV4A 4DZ5A 3EKLA 1QNRA 1REQA 3V1HA 1XS2A 4MF4A 4BJHA 2DJLA 3VE7A 3A5VA 4HMCA 1H61A 4J3WA 3S9IA 4Q6XA 1J6PA 1ENUA 3QRHA 4WKFA 4TVCA 1ZAIA 3CL8A 5G1MA 1LWJA 3T08A 1P0NA 3I6RA 1XLAA 4F0HA 5G1TA 3WF1A 4FAMA 4ZFCA 3QN3A 4KESA 3MWAA 5HAOA 2HSAA 1M3UA 1UH2A 1XISA 2VUYA 3RLUA 3CHEA 3FX4A 2XG9A 1ALDA 3CZGA 1UQZA 2AL2A 2C18A 1H0GA 2DH2A 1R3YA 4H9UA 4HGXA 4JYDA 3T9PA 1ME7A 2HNEA 3NZGA 4Z2KA 3HA1A 4BS0A 3B8VA 3W37A 2E5CA 2YL8A 1XLLA 2XSBA 4MADA 1BTMA 2WZEA 3CO8A 1EC9A 3NQBA 4ERGA 4GJ1A 1CTNA 3K8MA 3WNPA 1JD7A 3HG2A 1JCLA 1YNYA 3FVDA 2OMAA 1JYWA 3AXMA 4F0KA 1KNWA 4JHOA 1VFSA 2F6XA 5T8GA 1GYNA 5A2BA 1PX8A 4RE2A 4OZOA 3S1VA 3N18A 1K03A 3JR2A 1E6SM 1U83A 5KZMA 1EJXC 1UZHA 5J5RA 2CZVA 2EQDA 4DWSA 3W6MA 1TPUA 4QE1A 2PWHA 3KL0A 3EDJA 3THDA 1RA0A 3L4WA 5FL0A 3MHFA 4O12A 4IL2A 4A35A 1LLWA 1TWZA 2QMJA 4KRUA 1LZOA 2OX1A 3U6WA 5AYZA 4IJCA 1RPXA 3TR9A 2PWUA 3CC1A 1SO6A 2ZA2A 1OF6A 2QDDA 4E4FA 5EMUA 4EP8C 1OZQA 5H1WA 3OVQA 1ZLPA 1HJVA 3Q2DA 1GVEA 1PKMA 3B0XA 2VGIA 4X22A 3ZQ9A 1P1XA 2O4MA 1XCWA 3OLEA 3PAJA 2WV8A 4JTHA 4YWIA 2G3NA 2PWGA 1T96A 1OFRA 3U7BA 1IXOA 1H7WA 3W1MA 2H3DA 1EOMA 4NXSA 3P80A 3QF0A 4DRSA 4E0CA 4DLMA 3BANA 3SN4A 1W1TA 4UTHA 1TE1A 4ADUA 4E2OA 2V5LA 5F7UA 3DFHA 1XIBA 3EXRA 4Q8TA 5DMMA 4LVFA 3OTRA 2YA2A 3WQCA 1ZJBA 3PTQA 4ZCWA 5FEXA 3S2MA 1SM9A 1G67A 4GZEA 1QNSA 5FOOA 3WELA 2UY3A 2FPYA 1QOXA 3BTNA 4WKHA 1YPIA 2A6NA 3SCVA 2BOFX 1EGZA 3BGAA 2AGTA 2ONEA 1Q6QA 1JZ5A 3CBWA 3PUDA 3WD2A 1AH0A 1ME9A 4HB7A 4D6CA 2A3LA 4IP5A 3LUTA 3NL3A 1RP8A 2OGYA 4H6EA 4JS3A 1RY8A 3V0SA 3FA3A 4Q8UA 4IP7A 1B4KA 1XSKA 1Q8JA 1IIHA 4AISA 3K46A 4WY0F 4UCFA 1TELA 4YTSA 1MQQA 1DYSA 3GH5A 1TPH1 3DYOA 1X96A 3SGUA 3WQ4A 3QZ6A 1J5TA 1H62A 4PL2A 1EC7A 3DUGA 4LCQA 1A5BA 4MAVA 3BG5A 2VC7A 1TV7A 4HU0A 2VR4A 4YTRA 3GXNA 1NIUA 2VURA 3CZLA 3EMQA 3BW4A 3P84A 3PWGA 1TPB1 3MYPA 4Y6GA 4AF0A 4C6FA 1AMKA 1UWSA 3GTHA 2OPJA 3PPFA 4LAKA 1XINA 4BY3A 1RVGA 4V15A 1C92A 1QPQA 1BGGA 1E3ZA 4KWOA 2QDGA 3WD1A 1XW8A 1A5UA 3A3HA 4UTFA 2WO5A 1JEZA 2R91A 3L2LA 2WM1A 5I03A 4R7JA 4IJRA 4DX3A 4F0SA 3FGCA 1M65A 4M1BA 4E2BA 1UA3A 2QCLA 4B16A 2PODA 3DU0A 2ZKMX 3OLGA 4JN8A 3KCLA 4C6MA 2V82A 3PS7A 3PZMA 1UWIA 4BWLC 4UIOA 3TAKA 3QQ1A 4O18A 1TV2A 1H51A 4UQ9A 1FDYA 1OM0A 4S3EA 5CPLA 3WZ0E 4QCEA 3NDYA 3O6AA 5C7HA 5C2CA 1Q6FA 3RRAA 5LHFA 4D6IA 3NJ3A 4U2YA 3BLOA 4GPNA 5FF7A 3SCQA 3RPMA 2X30A 1GOWA 1U5VA 1U1HA 1FHVA 4MB1A 3MTWA 2YCLA 1ESWA 3W27A 5I06A 1OQFA 2WPGA 1S2CA 4UNLA 2Z7KA 1KLYA 1Q2SA 4QEHA 2YCEA 3LCFA 4EK7A 3MKCA 3U3HA 2Y6ZA 3ABOA 4EE9A 4AVNA 4Q32A 3M0JA 4HJFA 4TTGA 4DAFA 3GTIA 3VKBA 4MMWA 3PJWA 4YJ5A 4HMEA 3L66A 2CERA 3TN3A 3VOGA 3G24A 4DWSB 5HMEA 1EWEA 1TQXA 1UBSA 3EDKA 1TCDA 5K9CA 4B3ZA 1W9PA 4PEKA 4OECA 3LQLA 3VOFA 3KAOA 3MSYA 1XF0A 4MJMA 2OEKA 2QV5A 4RDVA 1SFSA 3NO3A 3UFYA 3AZSA 4GVHA 3BJSA 4S3KA 1UBPC 4WX2A 1UMLA 3GXDA 2B7NA 3TW6A 2H90A 4A29A 4DNMA 3F5JA 2ZQ0A 4ZEPA 5A6LA 4DUOA 2P8BA 5AKQA 4RW5A 3AMLA 1MUWA 1TUFA 2F61A 4RV3A 4PH6A 2VTFA 3A3XA 3VM5A 1R7AA 1YHTA 2XH0A 4DY1A 5H8PA 3WLHA 1WDDA 4AYSA 1IR2A 4HNLA 4AX7A 4WY0A 2E6DA 2PAJA 3ZLGA 3R0DA 3LLDA 1R0MA 4NZCA 2XM1A 2WJZA 1RK5A 3EDDA 1FWDC 3KBJA 1AA1B 1MZRA 3RLVA 4Z1YA 2VR5A 4GD0A 1I2OA 4YN5A 1UASA 1X6UA 4I6KA 3WLRA 3UVIA 4F40A 1J5SA 4ZFMA 4LEQA 2PTZA 4D6DA 3WJZA 3REQA 3TNOA 3W7JA 3M4HA 1HF6A 4J40A 4EOUA 1FKXA 3V75A 4EVZA 4LALA 1SVDA 4IT1A 1MSSA 4M1RA 1PKNA 1T41A 4P7LA 3CWOX 4O4VA 3FY1A 1N8IA 4TO8A 4XZIA 4AZIA 1RA5A 3PNZA 3AS2A 2G37A 3A4WA 3V5CA 2OEMA 1XYBA 4F9JA 1TTQA 3IANA 3W73A 3BMWA 2KZHA 4LBSA 4GWEA 1UQYA 4QNEA 3TYEA 3KWXA 2WCSA 2HS8A 2FVMA 3U2OA 3TP4A 2FHCA 1B57A 2WC4A 3GH4A 1GW1A 3A21A 1SJAA 2ZA1A 3G1DA 4GLEA 2YL5A 1UR1A 3TSBA 1PYFA 3GXIA 3USZA 1H7PA 4XZLX 3W6YA 1QPNA 2FZ8A 2J62A 2WC7A 4W8AA 2WBKA 2OFJA 3WQFA 3HQPA 2FVLA 2NVCA 1KXHA 4Y8EA 1E56A 1XC6A 2G96A 3AISA 4E38A 5FAJA 2R1LA 4NX5A 2Q3OA 4RDYA 3FGCB 4XZ9A 1JPIA 1A3WA 4B2DA 2HV5A 1U2YA 3ARXA 5J04A 4QFUA 2Q6ZA 3ALGA 4MWAB 2DY3A 3M5ZA 1V0NA 4JGDA 1BTCA 1EKOA 1VKFA 4AZCB 1E9YB 4DF0A 3UG8A 3NPVA 2BS9A 4UMCA 1BKHA 3W7CA 2OZ3A 1FH8A 3OODA 4E2DA 2XIMA 4JQ3A 4QS5A 1CB7B 1JL8A 1S3TC 3W7IA 4YWSA 3KOXA 1BYDA 3GC2A 2OO0A 1F8MA 2HZGA 3F7JA 2X16A 1Q4NX 5C8BB 3NIYA 4B4HA 2AMXA 4K1WA 2V3GA 3AJ7A 1LOQA 1GYLA 3MCNA 2EJAA 4R3UA 3O1NA 1VJZA 4KFOA 1CGXA 3UZXA 6TAAA 2CWNA 2ZX8A 4K68A 1IIGA 3OLIA 4JXCA 4PA8A 3KRZA 3W25A 3ZWSA 1ZPTA 1HIZA 3UXLA 5I3FA 1W6TA 4MWAE 1AMYA 1IZJA 3TW9A 7TIMA 3CAWA 4O4WA 2QGHA 3PF3A 4KW2A 1PAMA 3B8DA 2X8RA 2AKMA 1O4UA 3L5LA 3LM7A 5F1VA 1UMYA 3KXQA 2HVNA 1ZAJA 4IMDA 4A05A 4AF0B 2VEPA 4EX4A 2D3LA 4ZOAA 2P88A 4UFIA 3AUJA 3WLQA 1AFSA 3ABZA 4Z1DA 2X09A 4PB3A 4Y9PA 2EPLX 2WPBA 4LBUA 1JZ2A 1TJ2A 3MZNA 5KTLA 1VZWA 4QTGA 3BE7A 1XLFA 3FA5A 2BZNA 1OX4A 4YS1A 1SFJA 2R9RA 5BRQA 2EJ1A 5CPOA 1MVYA 3UJRA 2XH4A 2CCRA 4PCFA 4M6QA 1I8JA 4RZ6A 3U2CA 2I1OA 2PDMA 4XUYA 2PLKA 4JCMA 4V33A 4F2UA 2X40A 3HFYA 2HE5A 4KCWA 3CQKA 3MI3A 4UNIA 2JKPA 4HOXA 1C93A 3GAYA 5C6MA 1PO9A 1EGMA 3B8SA 1P1MA 1XL9A 5HANA 2PP0A 1KQZA 1QCWA 4FPSA 4PR4A 2E4TA 3R2GA 4K7VA 2IKIA 5EB8A 3VNDA 3P5YA 1P0KA 4HTBA 1DJNA 1V3KA 2A3AA 4TXEA 2ISSA 1ZL1A 1QTWA 3IV8A 3QV7A 3ANVA 2AGKA 4HBKA 2RJHA 1XICA 1XUZA 2DUZA 1VH7A 3GG8A 2I16A 2V5KA 1WOAA 5LSMA 4PRRA 4G1KA 4H7ZA 2BX7A 1U1JA 3E2RA 2WLZA 1S5TA 3SO7A 3UGVA 3HN3A 3QMRA 4J2PA 2ZVRA 5D4YA 1XYCA 4MB4A 5FJUA 4IG2A 3ZJ8A 4AU0A 4Z2GA 1EC8A 1ZBCA 3DOPA 4MJ4A 4MWAD 4JY8A 5BRBA 4B5TA 4KT2A 1KTNA 2GGEA 1Z69A 1HJQA 3DECA 4IM4A 4JNYA 3GFXA 4BQ2A 3SUTA 3TYAA 3CAQA 4M24A 1F6KA 3EXSA 4W85A 2VELA 4C91A 3DFYA 4EPEC 2VCBA 1F3EA 1BG4A 8TIMA 1RJQA 4ORIA 4PMQA 1TYGA 4CD5A 1KQYA 1ODZA 3O6DA 3PTDA 3UQNA 5F2MA 3W2KA 4D6JA 4FSAA 1S2VA 1B3YA 3M7WA 1XC4A 3P8JA 3UETA 4AZBA 1CIUA 4PUEA 4PC8A 2QDHA 3OZOA 5ECUA 1V6YA 2OWCA 1F4AA 2V2DA 2WWDA 3Q94A 3UNTA 6ALDA 4NG3A 2A3CA 1E6QM 1LT8A 1XIIA 2ZXBA 3NVTA 3TU9A 2D24A 1OC5A 2FHBA 2ZE3A 2XVLA 2GDUA 3H12A 3VDBA 4JFSA 3IWPA 4TIMA 4M0XA 5D37A 3EB2A 4BR1A 2DSZA 3ITYA 4DO7A 1M9HA 5LKYA 1BWVA 1XCFA 3ITOA 3B03A 3T2OA 3HQ1A 4U3CA 5BWAA 2GJLA 4TTUA 1PIIA 3M6YA 4AHOA 1OD0A 3DG3A 4YMZA 4S38A 1MDLA 1TKKA 5CXPA 1KV5A 4DJEC 2PRMA 3GQYA 4DJEA 4BF5A 3SFKA 5JBFA 1MXGA 3AS0A 1QBBA 2WQDA 1VFHA 1OX4B 2CZDA 5FF4A 2ZYFA 3JZUA 2EF9A 3QQWA 3QGAC 4X2PA 3TDFA 2I17A 3KHJA 5DMLA 5RUBA 1QR7A 3MO7A 3SIZA 4RUBA 1YYAA 1R3RA 1W9UA 1UW9A 1P0EA 1Q7QA 3G6MA 3T0DA 4ERIA 1FDJA 1NVMA 4W7VA 2QUUA 4Q4PA 4DBDA 3GB6A 1F74A 5A8GA 2EPMX 4AD4A 2BXYA 5AYYA 1Q45A 5I3JA 1JFHA 1KTBA 2AQVA 2PDBA 1C8QA 2GGGA 3UR7A 2IPFA 3PC0A 2Y88A 3RPDA 3KUMA 1UOKA 4YYCA 3G0SA 4BI7A 2RH9A 1MO0A 4N0RA 3VD3A 3E1F1 2R1MA 2IXUA 3TYCA 1CXLA 1QJWA 4EWJA 1E6PA 1GT8A 1XH2A 2B0MA 1BF6A 1BVZA 5HQEA 4TMBA 2W5FA 1YBQB 4GI8A 3VGHA 2F7FA 4EF8A 2RAGA 2VEIA 5DXXA 1UWQA 3V5OA 3IJQA 2Y5EA 1RXOB 4H2HA 2CXEA 3UWZA 1ZJAA 1Y5WA 2OO6A 3M0HA 1Y65A 4FR1A 2DT1A 3WJYA 3VCCA 5CSUA 2PS2A 2E9MA 2ESCA 4H9YA 2WVVB 3S9YA 1PKYA 3LHYA 1A5MC 4PTXA 5IM51 1XG3A 2HK0A 1XRTA 1MW0A 5CKSA 1QUMA 1JCNA 4JD4A 4HPGA 5I07A 6ENLA 1ITUA 1LCOA 5BYWA 3NWRA 2C1GA 3AXHA 3SN0A 2CFFA 2OKTA 8XIAA 1PL9A 3H26A 1FWHC 1LL4A 2DZTA 5CJ5A 1TV5A 4ZSTA 1BYBA 3QJAA 4HCDA 4KH2A 3NSXA 3U9IA 2F38A 3PULA 2GGHA 3PVFA 4UTTA 2HXUA 5AN7A 1QW8A 4DWSD 2PLJA 2Y7GA 3B8WA 4JL1A 1VBJA 4ZENA 3T0AA 4YLWA 4Q8NA 3WLSA 1EDQA 4UFMA 4AD2A 3WD0A 4EPBC 1KGUA 4GXWA 1K3UA 4GQGA 2QCDB 3UERA 2YXGA 3AALA 3WUFA 2DZUA 4L5ZA 4UQDA 3K8LA 2UY2A 2X0SA 3KRBA 2BXZA 3GR8A 1EUNA 3VI2A 1DTNA 5C0QA 4NVTA 3NQFA 3W23A 4FIRA 1TWIA 4D6HA 2E40A 5DO8A 3PFRA 1WUFA 1PS9A 3LTSA 4IMGA 1EFZA 1S46A 2VXNA 4XIAA 3DFQA 4B92A 1W3NA 1U1UA 4ACZB 3HJZA 4GKLA 3TX9A 1UJQA 2DPEA 5ABFA 2MUCA 5CZTA 3CUXA 5G4EA 4S3FA 1PIGA 1XJBA 2GZXA 4XZWA 4J3XA 1TREA 1J0KA 4GUHA 4W8BA 2WZIA 1TPEA 2HXTA 3N11A 3GM8A 4B9YA 3PZGA 3NOEA 4ZODA 3NDZA 2HCVA 4IIHA 3POHA 2OVLA 3MWCA 3QHOA 4F48A 2Z28A 2VKZG 2W0UA 4JQ4A 1Y7VA 5A69A 4GCAA 1LLOA 3VPLA 3URBA 1X97A 1NDZA 2CZ5A 5I24A 2IKHA 4GY7A 4ZMGA 5JMUA 2ZA3A 4JDBA 1TUXA 4IIBA 1LOSA 2R14A 2GDVA 4U5IA 3JU2A 2Z7GA 3OGSA 4FLRA 2O7SA 1JZ8A 3CU2A 2R94A 1HGYA 3VZZA 2V6AA 3OBAA 4HT3A 4CUCA 5EMYA 2JFEX 3UWWA 7REQB 2H9AA 1ZBKA 1LBMA 1XD1A 1ZCOA 3H2CA 1FVPA 3K30A 1Q6CA 4WR3A 1J0YA 3TAOA 4F0LA 2OCZA 2ZRZA 3RMEA 3LHZA 8RUCA 4DM1A 2VD9A 1SW3A 3PJUA 2PDNA 5B7ZA 5D9OA 2OJPA 1DORA 1IEWA 4NU7A 2A7NA 4IF2A 2PZNA 3WK0A 3G6LA 3LYEA 5DBUA 1EQCA 1A3XA 2QCFA 3E0IA 1QHPA 1YEYA 4PULA 3RCYA 1QWKA 4W88A 2X42A 1FWFC 3TXVA 1XGDA 4D2JA 4Q8MA 3IK2A 4AD3A 2HVMA 2YSWA 1MYRA 5CC7A 1H5YA 2PGEA 2WMIA 3NQAA 3WJSA 4OV4A 2OOGA 3WF4A 1XLGA 4X61A 3MUXA 2VGFA 3N3TA 2MANA 4YNGA 4ZQPA 1NP2A 1R6WA 2PP1A 4Q3MA 3QKZA 5C5YA 4WKAA 3HGSA 1GPFA 4QSHA 3LQGA 4CLMA 4JFVA 3LTPA 3B9NA 4IH3A 1EF2A 3VNZA 1JCMP 2EPHA 7ENLA 2PGWA 5D05A 2HROA 1TR1A 1CGYA 1GVRA 1P6BA 4M7TA 4JHZA 4L9YA 1B3VA 3EWZA 1JGMA 3K1DA 5A8PA 3IUDA 3THQA 4UR8A 1O6IA 1W3IA 3SY1A 2O0TA 3OQEA 4EKJA 1YDOA 1NEYA 4HVXA 3SB0A 4KEUA 1AJ0A 6CGTA 1EJRC 2QT3A 1YXCA 5AVHA 4HN4A 1OC7A 2IQ0A 3L0KA 3ZSTA 1R2TA 1VS1A 3EXTA 3P62A 4LX4A 3VO0A 4MSSA 4Q8OA 3W76A 2F8QA 3OA3A 3VDGA 3U2ZA 4KRZA 3KBNA 4QE5A 4V28A 1I2PA 3XIMA 5E5CA 1CT5A 3BGGA 1QI3A 4JTDA 1SQ7A 2ZE0A 3I6EA 3RU6A 1XPYA 1UR0A 2NZLA 2VMFA 4IMEA 3UWUA 4DXVA 2FB2A 3NM1A 3WFZA 3K2GA 4F66A 4Y9AA 2DSVA 4IFOA 2CC0A 1IGWA 2X7VA 5HJLA 3CMFA 2X1IA 4B5SA 1TVNA 4NAFA 3VOHA 1VYSX 5C2GA 2IXVA 4HU3A 4XTIA 2OX4A 1DBTA 2BHZA 1V4YA 3WUEA 3ZIZA 1CXHA 4TX9A 4QLJA 4QSFA 1Z8AA 4JTFA 4OU1A 5HULA 4J7RA 3GUWA 4H04A 4UCGA 2HVOA 1TG7A 3KL3A 3TTYA 4XAFA 5HINA 3CWHA 3FCPA 4JPGA 1LRQA 2J6XA 3QH2A 3IVUA 1AD1A 4BK9A 1HW6A 1SFTA 2EKGA 7PTDA 3WN6A 1P43A 3GKAA 4B9ZA 2REQB 2P1FA 3JZEA 2WHLA 2Y8KA 3L23A 3L4UA 1ZQ5A 1JD9A 1XD0A 3L2MA 4JKKA 4IZGA 3GZ3A 1OIMA 3AWOA 2FFCA 2I5IA 3H2AA 4UTWA 2DUXA 5HQMA 2QUMA 3QW3A 4C6LA 4OBRA 3TYZA 3NXFA 4DAIA 1XBXA 3MDWA 1NFGA 7REQA 3QSRA 4WDUA 1KCKA 3MS8A 2GFTA 2XH2A 4YVVA 3W2NA 5E0KA 1E73M 2E28A 1B30A 4PTWA 4AXNA 4FF5A 1HG3A 4FO4A 5ABTA 1XBZA 2GUBA 3VNYA 2ZVIA 4GABA 1E4IA 3EEZA 2CLEA 2BHUA 3UXIA 1OJXA 4XX6A 3QPYA 4LRTA 4HCHA 5K4ZA 1YNQA 1FCVA 2PI6A 3AIWA 5C70A 4AUBA 5DBTA 1QO5A 2J8GA 3RHGA 3BAXA 2RGLA 1OZMA 2ADAA 3BV7A 1QI5A 3D47A 3IAQA 4GI6A 2Z25A 3FYYA 5A8OA 3AXKA 2PTXA 4G5DA 3B3DA 4CCDA 2FDMA 1GTHA 3WDPP 5AZ1A 3MB9A 1ZY9A 3B9EA 1DIEA 1B2YA 3T8QA 5KZ6A 4QGCA 3DEQA 3WLNA 3W7HA 2R1NA 5LA0A 1IQ8A 1ISVA 1R47A 3N4FA 3DFTA 2B7QA 2IKJA 3OO2A 1WQ5A 3O7UA 3W1LA 5LZLA 1VPQA 5ECVA 4PUNA 3M0KA 1JPHA 2D1ZA 2NSXA 2EXOA 1UH3A 4O1EA 3W7GA 1D3HA 1DL3A 4JKLA 4NI3A 1DJHA 5KETA 3VGBA 4YTQA 1C8YA 3M7SA 3ZWTA 1TPFA 4AZCA 3W02A 1XUUA 3TQVA 5D09A 1X1NA 1DWFM 4FNUA 3F4CA 4CKQA 1LDCA 1BVWA 3KTXA 3VIOA 2XIJA 2B7PA 1PZ1A 3MKKA 2BMBA 3NEVA 1SSGA 2G4FA 2Y70A 3DH7A 1VR6A 3WNNA 3VNMA 1PDYA 3LK6A 2PDLA 2A3EA 5JH1A 1ADSA 1AD4A 1NSJA 3QOMA 3FIGA 1ISXA 2WOQA 4XUGA 4AWSA 4C6DA 3IUHA 2E67A 3HU7A 2G5WA 5EY5A 1FXQA 1JFXA 3P81A 4FALA 1Z6KA 3FJ4A 1ITXA 1I0DA 3R8RA 3BLDA 4HU4A 3IJDA 3GVGA 3LCLA 5CG0A 1A4MA 3I7RA 2ZTJA 3G1XA 1UD6A 3AU6A 3BWWA 4L7ZA 1KA9F 1JNDA 5HOSA 2FVKA 1TSIA 3CB3A 1E0UA 1XIDA 3E5BA 1EXPA 5FEPA 3UF9A 1DV7A 1J0IA 2ZDSA 3RR1A 1RZMA 4RE4A 4WUIA 3N34A 5CZ0A 4K1GA 4DWDA 1SW0A 3TQPA 1WOBA 1JCJA 5M3WA 3C8NA 3G3DA 2VENA 4DUWA 5I3DA 3NPUA 4KCVA 2OZ0A 5EGRA 1F5ZA 3OYXA 3E02A 4C6KA 4OOZA 1C29A 2XIBA 3IARA 5J5DA 4IWWA 1VJIA 4GHRA 2WK2A 3W29A 3QOKA 3WLMA 1A49A 5K7JA 3T40A 3CNYA 2ZX9A 1GQNA 3I65A 6PTDA 1G4PA 1EJVC 4OQVA 1THFD 4GZ7A 2YLAA 3MHUA 3GWQA 3L4YA 2OELA 2GUUA 4N42A 3KCJA 3LV5A 5CCZA 3DCPA 4NI8A 1Z48A 4ZE5A 4FNSA 3ABSA 4N4QA 1IXNA 4XKMA 3VNJA 4MLRA 3UA4A 2JF6A 1Q7MA 3NSNA 1CI1A 1J6OA 1PCKA 3EOSA 2AL2B 2XIOA 4NSBA 4MGGA 4U31A 1REQB 2A5HA 4H7VA 4UWMA 2R8WA 1TJPA 4F0MA 4TOQA 3MBFA 4GYPA 1W9BM 3UGRA 2WNQA 4OVXA 4PUDA 2JGYA 4PCTA 2V5DA 4AVOA 1DKWA 1VLIA 5LA2A 1QI0A 2YDAA 2Z24A 3D5HA 4QDMA 3ECQA 3GNRA 2BBFA 3EA3A 2NVAA 3ICJA 4LF2A 5G1YA 1B1YA 1GKQA 4M6VA 3BOXA 4BWLA 4XSMA 1RQBA 2IKGA 4A2RA 4HNNA 1I4NA 2V63A 1XLKA 4RXGA 1WAUA 3WLTA 1QO2A 4LUYA 3RX2A 2QLYA 1UA7A 4TX8A 2DVTA 3UWEA 3ITXA 4LSBA 4NQ1A 2QJGA 3CASA 3EOEA 1S2AA 4RXFA 4KCUA 1XFCA 3G8RA 4QG8A 2JIWA 3SI9A 3TJIA 3FOKA 3F2CA 2XVGA 4AW7A 1GPWA 3ATZA 3NPWA 3THCA 2F2HA 2J6VA 4HYRA 1LUCB 5K9DA 3WQWA 2CW6A 1I75A 3WIJA 1SJCA 3V0TA 1YADA 1OBAA 3KZPA 2CEQA 3VINA 3T78A 3TC3A 1FFRA 2ZC1A 4FXSA 4Q33A 4NXKA 3GO2A 3IVTA 2P10A 5DANA 3MBDA 1V3IA 1PTDA 3ZR5A 3QQ0A 2Z1WA 4UC5A 1MUCA 3LPPA 1E51A 2YFNA 5DF0A 3UR8A 3KWSA 3IJLA 4CNUA 4KIRA 4DF1A 2ZDRA 5EU9A 4ATDA 1WAWA 1LBFA 1EO7A 3IAPA 4G7EB 3DXIA 4XBSA 2HK1A 3WQGA 3L4VA 4FOUA 3TN4A 2Q8XA 4MZ8A 5AHMA 4WQ6A 3SRFA 4N02A 4DNHA 3T0TA 4WOQA 3VIPA 3VGGA 5T9BG 3AIQA 1JDAA 2BY0A 5EL1A 4AD1A 1AQHA 2EPOA 4GY0A 5H8UA 5IBXC 2XINA 3WO8A 2FPTA 1TTPA 3I3EA 1PWLA 5M17A 3HPSA 3QYQA 3V7PA 1KTCA 3QW4B 3SSZA 1RV8A 1WDPA 5KINA 3A9IA 4KCTA 5PTDA 4H3DA 3VZXA 3IS4A 1SPQA 3BMXA 1ZALA 1PUDA 1BXNA 1FCUA 1F2JA 2O9PA 1UUMA 1SU5A 4UTWC 3ZO9A 1KM6A 3OZMA 5DRIA 4AH7A 4I9TA 4NKCA 4KEMA 1JZ7A 1QVBA 4N4PA 4F0RA 3TVAA 1V0LA 3PB2A 4IGMA 4L4MA 2RDUA 1H7NA 4XD3A 3VX1A 1AW5A 3NL5A 5LNSA 2ZX7A 3HPXA 1A0CA 4I3GA 4X9SA 1WV2A 2ZZ5A 2J88A 1LM1A 5G4WA 1NOWA 4WSHA 4AX6A 3AI0A 5BRPA 4JTJA 1XPGA 4BFAA 2QCNA 3E2QA 1ZJIA 4O19A 2H6RA 1F61A 1PX4A 4W87A 2D0HA 4BQ5A 4HYVA 2RGMA 2PDKA 2OOFA 3QC0A 3USBA 4FLOA 4DYJA 3ONCA 1DWGM 4CD6A 4HMDA 4BI6A 1PZ3A 1Q6GA 2VX4A 1R8LA 4A3UA 2GL5A 3PZUA 2QR6A 4K2SA 4JTCA 2J9ZA 4V1XA 1MEWA 4JICA 3VNIA 1IF2A 1UWTA 2YL6A 2HWGA 1KM4A 1W0MA 3CTLA 1AL7A 1ZGDA 3LCWA 3G5EA 3TC6A 4JTQA 1RUSA 4IIFA 3RITA 3LERA 2NQLA 5F4SA 3MJYA 4H8HA 3CT7A 1B0IA 1EDTA 3LRKA 4AFYA 3AS3A 4GVGA 4NJGA 4LVBA 4JHMA 3ANYA 3AMGA 4WIWA 2XWEA 1DWHM 1FWJC 2W9MA 3E96A 1R2SA 4QX4A 5AHIA 2DSUA 2ACUA 2CLKA 4Z1CA 3MZ2A 5IHSA 5JH2A 5HWJA 4HNTA 3P82A 2ASHA 4Q4OA 3T09A 1YTEA 1UWUA 3F03K 3PZQA 2GSJA 3NSMA 1UWRA 4XKYA 5TNVA 4HZMA 5AECA 1H63A 4GQRA 3RCMA 5G4HC 3KS6A 2V67A 1UD2A 1D8CA 1A5OC 1SJBA 1Z7AA 4BF9A 4P8XA 1W9XA 2UWFA 5K9XA 1RCXB 1XCXA 4UOQA 1W1IE 2Z4GA 1SW7A 4NJKA 3ITCA 1W56A 2ALRA 2WSKA 2WHJA 1PWMA 1H0IA 4A3RA 1U5JA 2GVLA 4N6EA 4KWVA 3OGVA 1GOOA 4R7WA 2P50A 3AHTA 4WHBA 3CV2A 1S5WA 4LY8A 3VIHA 5FJPA 3AIEA 2GWNA 3UY7A 3EPNA 1TMLA 3EZ4A 3LX9A 4JTUA 1UJPA 3GUGA 1PKLA 1R30A 2Y7FA 1H7OA 3PR2A 3ARUA 1NQ6A 1T8QA 4I9AA 1W3LA 2WVSA 1EGVA 4AMAA 5K3VA 2YBVA 3I4KA 4KFNA 4X9YA 3MI2A 4PN2A 3W2UA 4GNVA 3QY7A 3B4UA 4LT9A 2EBNA 3GC5A 2GWGA 3WLJA 4UNKA 3VFCA 3FVMA 4JIEA 2YA1A 1R7OA 3GC4A 4L9XA 3TZFA 3S6DA 4QRNA 3PZNA 1E1EA 4ZQOA 3SECA 5FF0A 3WF0A 4H9ZA 3M0VA 2XFWA 2F6UA 3VMPA 2IQTA 3SR7A 3QR1A 3E0FA 3TWBA 4Z08A 2PRHA 4CD7A 4LC8A 1OYCA 3ARYA 3BVJA 1KRMA 3BLFA 1QMLA 4Y90A 4ZO7A 1NTHA 4CQAA 3VUPA 3BSMA 3TYBA 3QM3A 1DVJA 1GGOA 1LLZA 4H01A 2CLIA 1C9WA 2GJXB 3S83A 1JXJA 1YPXA 1POKA 1LQ2A 4GYPC 3OGRA 1FWRA 4O1BA 4E2VA 2V8ZA 1UG6A 5TIMA 2POTA 3VE9A 1ZS2A 2G3IA 1TE6A 4ZR8A 1UP3A 2PD5A 1GVQA 1CXEA 1L6YA 3B05A 3MSGA 2V0TA 3HJEA 1BG9A 2PU1A 5FJJA 1X7FA 1CXIA 1F6YA 1IE7C 3NO1A 1T5AA 3TWAA 3G0XA 2YW3A 3KVMA 6XIMA 4DJFD 4WJ8A 1W1VA 4DZAA 3LTYA 1IWPA 4HK6A 2WQPA 3TMQA 1TMQA 1ML1A 3IUIA 2J27A 1BAGA 3TQKA 3SN1A 1UKTA 2VVSA 1YPFA 1WDQA 1BFNA 1NWSA 3UWVA 1TX0A 1ITQA 1A3HA 2E0PA 3P93A 1UH4A 3FJNA 3U5YA 4ZO6A 4BEQA 1ONEA 3A5FA 3KTSA 1WKYA 1FWCC 5L9FA 1WXZA 1B54A 3D3FA 2OXNA 3W7RA 2Y1HA 1NH6A 2GPTA 1HL9A 1R3WA 5C9WA 1EJSC 3IV3A 3GS6A 2B4GA 1DIDA 3THAA 3U4FA 3JS3A 3UJ2A 4QLKA 4HNUA 4MLJA 4LY4A 1Q3NA 4MWAA 3OG2A 4MWAC 5HMDA 5ABFB 3H21A 1VCGA 4E4UA 3UZZA 4QQUA 2XH7A 3KOYA 2V3FA 3GG0A 5HATA 2NV9A 3UA3A 4JIRA 1JI1A 4XBKA 2FMNA 3VIIA 2WLYA 4ILSA 3ME3A 2O55A 5CGTA 1LOLA 2NX3A 3LNMA 3K8KA 3RAOA 2QF7A 1H3GA 3SW6A 1JCYA 1X8FA 3C56A 2OLSA 1XGZA 3TROA 4DPQA 1XYAA 3E0LA 3MUCA 4L56A 4JQAA 4ZQNA 2D3NA 3G1AA 4D9PA 4DZIA 3HGOA 1U30A 1W17A 3AJXA 4GK8A 4TR9A 4E4PA 1J0ZA 1I45A 4J2MA 1Q6OA 4YXGA 4JN6A 2WNWA 1YTDA 4IUGA 4YYFA 5I3IA 4YHEA 3WCZA 1TR9A 5A6AA 5D2VA 4AG0A 1L8NA 5D04C 3DKLA 1EEPA 4H1ZA 2J79A 2Y24A 2ZZ4A 4Q7NA 1KCLA 3W7OA 4C5ZA 1WXYA 3UG3A 1PDZA 3WUBA 5HA7A 1HX0A 3MV01 1JULA 1D9EA 1EL3A 4JTEA 1UWAA 3OIXA 1BF2A 2PBOA 1BQGA 4IGNA 2WVTA 4ZVJA 1W3KA 2JF7A 1R3VA 5MHBA 2OWXA 1OFEA 2W27A 3BCJA 3N3MA 4FX6M 4I7UA 3ABXA 5KZDA 3UG4A 2VCCA 4AAJA 1NARA 3KW3A 4J3VA 2B81A 2UY4A 1O1ZA 1H7XA 5A1AA 3DG6A 2DU2A 3ANUA 3U5UA 4IP4A 4O14A 1US2A 3GVVA 2JBMA 4O16A 1GVOA 2B7OA 1EO5A 3IEBA 4QG6A 1XLJA 2CWXA 3TUUA 5F2IA 4KPLA 1J12A 1EHNA 3SY8A 2OR2A 3U48A 5DEZA 4DUXA 3QHMA 1CGWA 2NWRA 4H8NA 1MRQA 3OJGA 4LUSA 4PMNA 2Y63A 3IIOA 1Z89A 4XBJA 4RX0A 4GG9A 2ZXAA 2DZVA 2YCLB 4XISA 5FKYA 4WRHA 1UCWA 5GNXA 2VR2A 4J9JA 3NUKA 2QPXA 1KBJA 4CVUA 3E9AA 3GBEA 3M5VA 3KZSA 4N9DA 4WY0B 3A23A 1NAL1 4GINA 4CN1A 1K8XA 1EIXA 2DW6A 4O28A 3RUBL 1RCQA 1B90A 4DXKA 5A94A 1EX1A 3M0YA 3BARA 3P0XA 3QMSA 1OCJA 1B5TA 1HNYA 4CCCA 1FHDA 1KKRA 5B80A 1KB3A 3O07A 3STCA 3W83A 1K6WA 1V77A 1HL2A 4HNOA 4RDZA 3U4AA 3CPUA 3NVDA 4GC4A 4W7WA 5BU9A 3MUAA 4FA3A 2O9OA 3FDKA 3L4TA 4LXFA 3WQEA 4XB3A 4Y96A 4DYEA 2GVJA 2Z27A 3C0LA 2DIKA 5I6SA 3EOOA 3BC9A 4GX8A 2G97A 1QW9A 1EP1A 4WSKA 3UZ5A 1V5XA 2YIHA 1V8EA 5SWUA 4GIRA 4KWUA 4MYAA 5DELA 3N14A 3W2LA 2PUZA 2POZA 3QZAA 2TYSA 4D72A 1NM9A 1WA3A 4LUTA 4Q4RA 3AIUA 2OWWA 3RRXA 1RLDA 2ACRA 5ABHA 4JX6A 3SUVA 4V1YA 3VKJA 4RNIA 1DE5A 5JUVA 1KV8A 3WF3A 3UXKA 5HK4A 1OGSA 4JDYA 4NILA 3BUVA 3S4TA 1E72M 3UW6A 1M5WA 2VRQA 3IGSA 4OWGA 2YXXA 3WDJA 3TFXA 2PDPA 3LBCA 2H9AB 3URQA 1IEIA 3N2OA 4F4RA 3W1AA 3G1FA 5BMXA 1E4LA 1Q65A 2EG8A 3NA8A 4P7QA 1XLBA 1KCXA 1XP3A 1PPIA 3VXGA 2ZZ1A 2YLLA 1C90A 2FTWA 4UOZA 2ACQA 1A47A 2J47A 1T99A 2HPIA 2NQ5A 1FWNA 3AMCA 3P14A 5EBAA 7A3HA 3R89A 2ZRVA 4MIMA 2J25A 2RUSA 3CTTA 2E3ZA 3AIBA 2VT0A 1GOIA 4JIIX 1SR0A 3GVRA 5I02A 1VCVA 1JF5A 2W63A 3R43A 4QE4A 3GTFA 5DQPA 2OSXA 3MU7A 4UMAA 3GHUA 1S38A 4EF9A 4N9EA 3NCOA 2WC3A 4FI4A 1AH4A 2R1KA 2KX9A 4IPPA 4PTDA 3H7UA 4GUGA 1JAKA 2AMGA 2J7BA 3YPIA 4E5TA 1FQ0A 3A64A 3FEMA 2VFEA 2VQTA 1Y5VA 2OG9A 3OZPA 2H3BA 2YBUA 2HDJA 1XKYA 3HG4A 2VVNA 3W1UA 2YX0A 3N6JA 1K7EA 4P7RA 1XLHA 4DBEA 2VJXA 4AMCA 1E15A 2X41A 2ZBTA 3LGDA 3ZJ7A 4C6IA 4IPNB 4AD5A 1SR9A 4PCNA 4XVEA 2Q8LA 4Z0SA 2X0HA 3MCMA 1MNZA 1A50A 5HXMA 5IDZA 1KM0A 4S39A 3CLMA 2V3EA 4H8VA 3PBWA 1FH9A 4GNJA 1W3JA 2CZFA 1K6AA 4JFWA 3CL7A 2DSWA 1DQWA 5FL1A 3TSDA 3JRKA 1XSIA 2J8TA 3Q65A 3RLGA 3CGTA 2ZADA 2DW7A 2IMRA 2XJ7A 3UZYA 4IL0A 4XVDA 5DMNA 1DP0A 3AROA 3VGDA 3WH5A 1RBOB 4O10A 3VCNA 2QGYA 1BEUA 3HF3A 5A95A 1TJRA 1LTDA 2FFIA 1V02A 2Y7EA 3AAMA 5BOEA 2A7RA 5KITA 3MP3A 4NUWA 2Z00A 5CLWA 3EOUA 1UZ4A 3V16A 5C9RA 2IQDA 3UEQA 4IPIA 1DJQA 2G4JA 3VILA 1YKWA 2QUVA 5EMMA 4A8IA 4N2YA 1AJZA 2WMFA 2WVUA 4V27A 1KKOA 3VNKA 3BJTA 1T6MA 5CC6A 1OFDA 4R88A 4BQ3A 3PJXA 4GH1A 3AOFA 4MKVA 3VYLA 1P0DA 1GOXA 1MQPA 3GD6A 1LBLA 3EA1A 3POCA 1GCYA 3CMGA 4JNMA 1EJ7L 4XSLA 4Q4QA 5HUOA 5D38A 1HXJA 1TWDA 1VJSA 1TMHA 4PFMA 1PJ9A 1P7TB 2PDHA 1BSLA 3IK4A 5I5RA 3GNDA 3W7LA 2CBVA 4LC6A 1XIFA 4JIQA 5DMYA 4S3AA 4IQDA 3H23A 2Y8UA 2D69A 2PWFA 4S3CA 3OHMB 2XSAA 3NXLA 1C7SA 1FKWA 2E77A 3S8HA 4M6PA 2WSRA 2VRKA 3LCXA 2C1IA 3VD5A 4OOUA 2V5BA 2QHAA 3L0NA 2Y7DA 1Y8BA 4C1KA 4FP1A 5CJNA 4PBGA 3VKCA 1E6RA 1GORA 1U33A 2XFFA 1WX0A 1LWIA 2ZX5A 1S39A 1JCXA 3BG3A 4C7GA 1BRLB 4GIEA 1WYIA 2VGGA 3NZ1A 4G7FA 4I5UA 4Q8QA 1I60A 3A47A 3F1QA 5XIMA 3GHSA 3IACA 3LU2A 3W7EA 1QI4A 4MJZA 1JDCA 3H70A 3VZYA 3OZYA 2HE8A 2FZMA 1H4PA 5H2ZA 3S0CA 1ONWA 4JTKA 3W72A 3W1QA 5LNUA 3B97A 1GTEA 1ZBWA 3E3HA 4ASTA 3WNOA 2ZWZA 1PTGA 4BQ4A 1A0EA 1U5HA 1Q6EA 5H8MA 4ROQA 3GSMA 5LA1A 3W07A 3GDLA 2TPSA 5F1UA 5GJMA 1X38A 3LMZA 2BVWA 3P0WA 1WKFA 1JYXA 2WAGA 3WLIA 2OTDA 3MI6A 3LEPA 3NQMA 3VGEA 3ZT5A 1VBHA 4AHQA 3M0LA 5EFFA 4GYJA 2BB0A 2G41A 5D9PA 1Z42A 3OQ8A 4R7OA 1ZFJA 2BY3A 3ZLHA 3LPFA 1DJXA 1QHOA 1PIFA 5C9ZA 3SIMA 4WEVX 2OGJA 1E0TA 4YCPA 5I0DA 2QEZA 1GJWA 2O7QA 1FHUA 3M5XA 4UQAA 1Q8AA 4M6UA 4NAEB 4P7OA 1PX3A 1W91A 1AZ1A 2PDCA 2QCMA 3R0KA 2E5BA 4G2DA 2BY2A 2JIEA 3UXDA 2D23A 3MUZ1 4CNOA 2YKKA 3C2YA 1Q4WA 5GPRA 3N9KA 1HO1A 2A3BA 4JBRA 1O68A 3O3RA 3MHGA 2GUYA 5I3KA 2Y61A 2W67A 4FNRA 5CPTA 1TPC1 3QLLA 1H49A 2JEPA 4QJ4B 3PPCA 1JUKA 4DQWA 2Z0IA 3WMSA 2BHYA 1UUQA 1UR8A 1EA0A 2J9XA 3LHWA 5G2WA 1H11A 2ABBA 2JK2A 1OFBA 1V6WA 1IXQA 3KE0A 2QCEA 4KETA 3W38A 2XVNA 2DP3A 3DGRA 4WGXA 3EWBX 2OLAA 1OCQA 1XM3A 4O0ZA 3VIMA 3WBAA 2LLEA 4DJED 3PTMA 3FSUA 2FGZA 4A4AA 1O5QA 1BWKA 2OZTA 4QR6A 3S1UA 3HBLA 3G1HA 2C16A 3P67A 5BXTA 3KRUA 1W1PA 4IG2B 4UFKA 4C7FA 1VFOA 3SJNA 2VQUA 3AMDA 4LUSB 2EKCA 4IJBA 4UTKA 2H8XA 3W87A 3WNMA 4ICNA 1AZ2A 1KGXA 2PD9A 3NO5A 5M5DA 1AH3A 2VRJA 2G8ZA 4Z2HA 1OY0A 2CZEA 3C6CA 4HA3A 5HMFA 3LHUA 3MKVA 4KFPA 5C9XA 4UFJA 4CQCA 1K7FA 1BVNP 4IISA 1POJA 3ITVA 1Q5MA 3E12A 3MVTA 3WBYA 1HZYA 3EX3A 3K4AA 3SCRA 1HVQA 2CYGA 1J0JA 4Z0JA 4B91A 3H2NA 4IIEA 4H00A 2X2GA 1GQLA 2BTMA 1PTAA 5CPMA 1HO4A 4GUIA 2PGFA 4C6QA 2IW0A 4C5YA 1KFKA 1H2JA 1RVKA 3T7VA 2PWEA 5BCAA 2O56A 3QPEA 3ITGA 1G5AA 1YE4A 1F05A 4UZUA 1Q6RA 1V03A 2VFIA 3TTEA 3L4XA 3R8HA 2PDWA 1W3TA 3I68A 2Y0FA 3ARVA 5A6BD 4WZHA 1H1ZA 3V0UA 1CX9A 1DJYA 2D22A 4M81A 2JEQA 1XYFA 2YPIA 4HZ6A 4XIMA 1GHSA 3RN6A 3S2JA 4L6HA 2VOMA 4EXQA 4HPHA 5LIKX 2OB3A 1F9CA 1IT7A 1XH1A 2PC4A 4LAMA 4GI9A 4LW7A 2QYGA 1RQHA 3STFA 3LNPA 1V6TA 4CU8A 1P48A 5DT7A 2DT0A 4P2VA 4CNTA 1EA9C 4DJDD 3NGJA 4CN6A 1WBHA 1G7UA 1UD3A 3CWNA 1W3HA 1V08A 2QJNA 3M41A 4HZ7A 4A8NA 4NYUA 1LRNA 4EXBA 3OVGA 1TIMA 4B5WA 3LCGA 3GYCA 1XIMA 4W84A 3WEOA 2EO7A 1Y0EA 4LRSA 3IGXA 2UBPC 1JF6A 4RW3A 1ECQA 4WLCA 1UPMB 1EJUC 3QSTA 3R13A 3EPOA 1EX5A 1QK0A 3AYRA 3B0VC 2G3FA 4HNVA 4L6OA 1X39A 1A5LC 3LGEA 3MA8A 1QFEA 1R9ZA 3G0UA 3FHAA 3RYSA 3NQDA 1E6NA 2Z26A 3C8FA 4TU1A 4C6EA 1A0DA 1EBHA 4JTAA 3UPBA 3GXPA 4UB9A 2HTMA 2D0GA 3CV6A 2WB5A 3KBWA 4HA0A 2OSWA 2JE8A 3ZVHA 4B3LA 3QY6A 1VIWA 3B9DA 3FFSA 1G6CA 5GJNA 5CEWA 4GUJA 1OX6A 2Y62A 3H4XA 4UUIA 3B9OA 1S2TA 1R3SA 5JIWA 5JBEA 3GHRA 3WLPA 4GGHA 3UCQA 1WDWA 2PDJA 1TPVA 2W62A 2YCIX 3SRKA 4OFCA 2FTPA 4LV9A 2YR1A 1G01A 1X8CA 5FEZA 4PMVA 6A3HA 3B8UA 2RFGA 2WXDM 1UIOA 3QFEA 3W22A 5CPQA 3A4JA 1VF8A 2C91A 3AC0A 3HPFA 4DF2A 4Q6JA 2XGZA 2VDGA 2Y2WA 1A4LA 1J96A 4MY1A 4K3ZA 4PSRA 4M19A 3H4WA 3I7SA 5DXYA 2DUAA 3QR0A 3ITTA 3AYTA 1YQ2A 4AEEA 4L1XA 1XBVA 4J1OA 3FV9A 3W2JA 5G5IA 3O2LA 2Z1VA 4BCEA 1F07A 1RSCA 2BVTA 4LF1A 4NZ3A 4Z2JA 4AY1A 3AXXA 3PZVA 1E0VA 3B4YA 1UHVA 4JYFA 1M01A 3CQHA 4I5RA 1X7IA 1S5VA 3KFTA 2XVPA 1HTIA 1DJIA 4D6FA 4G8TA 1Q66A 4UTIA 1FA2A 3D6NA 1JYVA 1J01A 2OQYA 1UKOA 4G6CA 1JUEA 2DJXA 1BD0A 5U4NA 1F4HA 3UJFA 4A3HA 1C8VA 2A6LA 5C2XA 3BLLA 4EAMA 1ZAHA 4XAZA 4YVPA 3SRDA 2YB4A 5I00A 4O1AA 2NUYA 4AWUA 2DIJA 3CHCA 5HMSA 3FW6A 2JKAA 2Y8VA 4KWWA 3FA4A 4AIUA 1HVXA 3MT1A 5IBXA 3PWIA 1OADA 4QAWA 2NT1A 4GRSA 4RV8A 5LNVA 3WQPA 3GXMA 4G7EA 2DH3A 5D2YA 4PUUA 4AZ6A 2A1YA 1K02A 1X6LA 1EHAA 4IQLA 3ZVIA 3R0UA 2CLOA 3ARZA 3VIFA 3WK3A 1F3TA 1H1YA 1W8GA 3HMCA 4O57A 3L2IA 1V6UA 2Q3RA 3SCUA 1C3FA 1ZHAA 4LBRA 4JIHA 4LPCA 3KOZA 4I7VA 4LTSA 1NWTA 4A22A 3LPOA 4ML9A 3WL0A 4ZL1A 1IV8A 1R3TA 3SGZA 1OIFA 1UIPA 1CXKA 1M41A 2NVDA 3P60A 4MHBA 2CIPA 1J79A 2GQ8A 1KXQA 2Q8ZA 3GY1A 4IFRA 1G69A 1W5NA 3OB8A 2E6AA 3AWNA 3FXGA 1RHCA 2VEGA 3L4ZA 4GMEA 3SURA 1V02E 4ZQRA 1EJTC 3VDCA 3FXYA 2VL4A 5FI8A 1F76A 1ISZA 2FQIA 3WY1A 2ICSA 2C13A 4JTTA 3IIZA 4RCXA 1TWSA 4C1LA 3OIHA 1XG4A 3TTQA 2FHFA 1M68A 3F2BA 2GSHA 1L6SA 2DVXA 3MUIA 3W74A 3WK2A 2E8ZA 1VBUA 1JUBA 4C6BA 3NGFA 1UC4A 4AWEA 4Y9NA 1MMFA 4ZXOA 1L2QA 4S1FA 2E6FA 2QS8A 5TF0A 3HOJA 2XN2A 3UCCA 3EWYA 4QJ5B 3HV8A 1OC6A 5E0FA 3DG7A 2FDSA 3CHFA 3O06A 2RJGA 3AYSA 4MOZA 1KR0A 2W6RA 4PTMA 1KFEA 4Z2IA 2J77A 1WP6A 2VUNA 2QPUA 3JW7A 4LH8A 3KP1A 3N2TA 4H9TA 1TQJA 3H55A 4OJYA 4Y8FA 1EP2A 4MPQA 3PTKA 1FY6A 3QV9A 3MC5A 1XQKA 4IXXA 3N2MA 1K4HA 3RILA 4FS9A 2XSXA 4AY8A 3R11A 4R9OA 1UR4A 3S2NA 1M04A 3DGBA 5AOUA 2V5CA 4X3ZA 1RH9A 1B3ZA 3L21A 4MNLA 3CAKA 4ZB5A 1HKMA 3TC7A 1CNVA 4MZYA 2QJJA 3E0VA 4LCSA 4NNAA 1O7AA 3W3OA 3GBDA 4IGHA 2YGYA 1TB3A 3T8LA 1WZLA 4NF7A 3S1GA 2ZOXA 1LWHA 1EQPA 5D32A 4I9JA 4XTDA 4JL2A 1MQRA 1M03A 2ALDA 1CECA 1H7RA 2ZIDA 3KBVA 4J35A 4DYKA 1KXVA 4ORMA 2OQHA 3TN6A 3HB9A 2XN1A 1QBAA 3HMJG 4C1NA 2W3ZA 3VMOA 3Q58A 3MY9A 1AQ0A 1R46A 4Q4KA 2J13A 5FSEC 3P8IA 1E5JA 4MB3A 1GEQA 4IIGA 1OK6A 2ZWYA 3DC8A 1S1PA 3DBPA 2WMJA 2WANA 4YHGA 2YCKX 5A6SA 3KVJA 3CXOA 4CQ8A 1US3A 3H2EA 1EZ2A 2OU4A 4UR7A 1YIXA 4ZSUA 3TK7A 4EANA 4QDPA 4QM1A 2RKXA 3BOLA 4WXZA 1SFLA 4W86A 4DN1A 1UR2A 1BRLA 1G4SA 2FZBA 3CH9A 4WCJA 4NJHA 3AUOA 4F9DA 4NRRA 2PCEA 3FK4A 1VYRA 2DT3A 4UZSA 2GVEA 4NIRA 4AIEA 2J7DA 4IOTA 3VOIA 4FX7A 4XV0A 3RFAA 3MO4A 4KEVA 4D1JA 4REQB 4GX9A 3VNLA 2QVHA 4DJFC 1EUAA 3H2OA 1R38A 1Z44A 3T0CA 1WB0A 3QFWA 4OE7A 3GXTA 1RY0A 3AMKA 3CZJA 4IX0A 5HWMA 4H2CA 2E09A 3WLKX 5AFDA 2WHMA 2CNCA 2I7GA 4O8RA 2GQAA 2VFFA 3G8EA 1PB0A 3TZNA 1DQUA 1PBGA 1MFVA 3H54A 4S3GA 5I78A 3PBUA 3UWYA 1BYCA 4O17A 4CU7A 3M44A 2WJDA 1ODUA 4FOKA 4A8RA 1LL7A 4B5UA 4CQ9A 2YDSA 4P8UA 2PF0A 3I7QA 1GWJA 3M0MA 4OHQA 1VQTA 1OX5A 3V3WA 1KCZA 2XGBA 5REQA 3LRMA 2KAUC 4IMFA 1OEPA 1SGJA 4QEEA 2BWGA 3APTA 3LBMA 2FJUB 2I5QA 1G1YA 1HT6A 3LLFA 4LYQA 4AVFA 3NQ2A 5AHFA 1QASA 2PU0A 3KP0A 5E0CA 1KBBA 5A2CA 5CPSA 3SAZA 1ONRA 3Q4DA 1XXXA 4GQBA 1BPLB 2V5JA 4PGLA 4U2ZA 3CIWA 2XUCA 4RNFA 3H2MA 3GNPA 1DHPA 2J7HA 2VZSA 1NP0A 4M56A 2CETA 3RU8X 5HNTA 1V3MA 1YXYA 2QPSA 4PBFA 3NQVA 2WYSA 4P5UA 3LCIA 3AHXA 2UZ9A 4PE8A 3CL6A 4ML4A 3QXBA 4GJJA 5DT5A 1PHQA 1G0CA 1TPDA 3KEHA 5D2WA 4C6CA 3TJLA 3LXBA 4OKDA 1MZHA 1P7TA 1W37A 2SFPA 1V0MA 3UD6A 4I8YA 2W61A 3WQDA 2PPGA 4Y9OA 2VEMA 3BK0A 5K4XA 3KL5A 2D0FA 5CLTA 2V2CA 3EX2A 3MCOA 3NL2A 1R9XA 3PNUA 4O53A 3WMLA 4FX8A 3CK5A 4D6EA 3BMVA 3VA8A 1O5RA 4QXIA 3KBMA 3APYA 5AC7A 2GQ9A 3TLLA 3W26A 1OGBA 1WUEA 3LPGA 4FOJA 4GZJA 4RK8A 2QAFA 2BVYA 3AQUA 1LQ0A 3WH6A 5I79A 1GHRA 5LYRA 3S6TA 3LDVA 1WBJA 1ONXA 1E70M 4K36A 1VBGA 4HIBA 2XFRA 1CCWB 1A5SA 5HNRA 3R25A 2E9BA 4GIAA 3TEVA 2UV8G 3STGA 1J11A 1VEPA 2BASA 2E1DA 1A5KC 1PV8A 1MRAA 4ZTYA 3ZFHA 3JUGA 3R94A 4GACA 3TR2A 1TV4A 5D02A 2AQWA 3BLPX 1E6ZA 4XQ6A 2D2HA 3SM0A 3GR4A 2V3DA 1GOKA 3TQ0A 2I57A 4O54A 2INZA 3LBOA 3W81A 1XDJA 4S3DA 1NQKA 3W71A 2G50A 2C79A 1UZ1A 1DXEA 4L6DA 5G2IA 5BW6A 2E8YA 3BV4A 2V9DA 2Q09A 3S47A 4GIYA 5CSRA 2DQWA 3DIPA 3N29A 3PANA 1YXDA 4C6PA 3DYPA 2GOKA 3SUUA 4QQ3A 1XRFA 3S5ZA 4AZHA 5IOBA 2BXVA 2F9RA 5EA9A 4JFUA 5FCZA 3S9ZA 3RMJA 3CZEA 5H6HA 3MDUA 4PRWA 5E70A 4L1GA 2W66A 2PA6A 4MFEA 2NX1A 4XZBA 3DHUA 1JZ3A 2NQJA 4PL1A 3OEXA 4HSOA 2Y85A 4YU1A 2Z6IA 4Z1BA 2QW5A 1NWRA 3Q37A 3PBVA 3EWWA 3A13A 1W1ZA 3BLEA 4Q22A 4FXFA 1ISYA 3ZYZA 2VFDA 1ZP3A 4JX5A 1FFQA 4L80A 4XD6A 3FYOA 3STPA 4HKPA 4QS6A 5GVJA 3H8AA 4R5EA 3OA5A 1DIOA 4FXRA 5HR7A 1GJUA 3KVKA 3GAKA 1XIGA 3PSVA 1LROA 2TRSA 4O0QA 1ZRQA 8CGTA 3EDFA 1Q2RA 3IIPA 5HPOA 2EGZA 1ICPA 3NTYA 3PY2A 1JZ6A 3N4EA 2DZPA 3CUGA 3J7HA 5DN1A 2PTWA 3R6IA 1W54A 1NELA 1VIZA 3N2BA 4D6GA 2J66A 3CYJA 4K39A 1OFQA 4MY9A 1SYTA 2GGIA 1R9YA 2XU2A 5BMWA 4UXDA 1IGSA 3EOLA 4K8EA 1B4EA 3G1YA 4ZO9A 5HWNA 4RL3A 1NOUA 4NJIA 5CBJA 1X6NA 2VC6A 3CQIA 1GKPA 3OPSA 2HEJA 3H7RA 3WD4A 4FNPA 4RJEA 1FWEC 3M46A 1VYPX 4AIBA 1XRSA 4MKNA 1Q6LA 2YDRA 3NL6A 2XHYA 5M1TA 2GK1B 5AYXA 4UR9A 2NUWA 2P3ZA 4GFIA 3NFUA 1D7FA 2PE4A 1VFTA 1KFWA 3GNNA 1LT7A 5A2AA 3PBGA 4LU0A 1O95A 2Z2BA 3DI0A 2WJFA 3QV8A 4US5D 3ARSA 2Z2UA 3GTXA 1RD5A 3EYPA 3P7YA 2J4GA 2VDIA 2L5HA 4HN8A 3WJXA 4GVIA 5XIAA 3CM4A 2HPMA 5CC3A 1K9DA 2PCQA 1WZMA 1XWYA 5TBOA 5AC6A 3ABRA 3L0GA 4J5NA 1IR1A 3FKRA 1J2BA 4GFSA 3RM8A 3WDIA 3W0KA 2Z6JA 2ZZ6A 2XZ7A 4O0KA 4ZA0A 3WK1A 1YLVA 1MW2A 1JAEA 1TV8A 5IXEA 1A53A 1TWWA 2VEFA 3L68A 3WDHA 3HPAA 4FLQA 4DLFA 4PMYA 3VX0A 3TV8A 5TD4A 1KRAC 2FYMA 5DY2A 3EX4A 2O92A 5D8WA 1IEQA 3OG3A 3PK7A 1XKJA 4K7YA 4KMQA 2FIQA 4PUWA 5E9AA 4DXXA 2HBVA 2OT1A 2ZZ7A 3ZXWA 2OYLA 4UTMA 2REQA 2QIIA 1ELSA 1UZDA 3PSWA 1ME8A 2C19A 4OUEA 2XGIA 1RCOB 4TV6A 2INFA 3CHDA 1OFAA 4KWSA 2QV4A 1RP9A 5TAOA 1CDGA 2GJRA 3GU2A 5A8NA 4FEZA 4QNWA 1JRCA 4J28A 4J3ZA 2DFAA 1B9BA 3KM8A 1QHZA 1VGAA 1C8XA 2IPGA 2PDQA 4MY8A 1I0BA 3ISIX 2J24A 1KM3A 3C3NA 3CUJA 2D2OA 2E6YA 2CBUA 1C9DA 3CO4A 1E40A 1QK2A 1I2NA 3BSGA 4HPNA 1MW3A 2ZCGA 5FF3A 3E2VA 1QNVA 2H8ZA 3RGTA 4CEXC 3B9AA 2ACSA 4Q4MA 5LIXX 3WMCA 3UYIA 3L5AA 3WMBA 1GVYA 1XHGA 2EEXA 2VP8A 4R85A 2PF8A 3B0PA 1QW7A 3O16A 4PSPA 4B90A 1PXGA 4XD5A 3P5ZA 3WDQA 3DZ1A 5BU6A 3TTSA 1OYAA 3RJXA 3N73A 3LZ3A 4B5XA 2NXHA 4RNHA 2AKZA 4UTJA 3RPTA 1E6XM 4PZVA 8XIMA 4H41A 3EA2A 4S2CA 3M0XA 1K9TA 3UT0A 1GQKA 1OB0A 1JCTA 1EH9A 5J8LA 1JQVA 3QR3A 2J9YA 4TMCA 4PUJA 3H22A 1L9WA 3ZR4A 4RZ5A 3O15A 3GIPA 4FMVA 3W75A 3T55A 2P3EA 3PZOA 3W1XA 4MAZA 4UQBA 3QPZA 3OOQA 3MP4A 2OZ8A 3MMUA 3HG3A 1J4EA 1VENA 2A2IA 1B9ZA 4RE0A 3RJYA 1RR2A 1R5YA 3F5KA 3R8GA 3SQLA 2RDXA 3N9SA 4HMNA 3T2QA 2VHLA 1X1OA 5G2HA 2D20A 3HM7A 2E1WA 2ON3A 3EX1A 4K37A 2NLIA 3ARQA 5EMLA 4DIAA 3BAJA 3KOWA 2VOTA 3M07A 2Y89A 1NDYA 3O9NA 3N04A 1NJJA 2DZBA 2YBTA 5FJTA 1HJWA 1LP6A 4YTTA 3COTA 3L65A 3ARPA 5LXXA 5BROA 1TZ9A 1I1WA 3NAVA 4P8VA 5H91A 3WEMA 3NZQA 1W9DM 2PTYA 4BHYA 4AB4A 2PTDA 4HPJA 2CHOA 1LG1A 3IJIA 4L4PA 1ZJHA 3CQ0A 2F6KA 4FF7A 4S23A 1DOSA 1PZ0A 2G3JA 1W1YA 4LNYA 3R4IA 2BOEX 1R86A 3BAIA 2PMQA 3C4UA 4XZNX 1MWOA 4L64A 3H24A 6REQB 1F8IA 3FJ6A 2A79A 3B06A 3PP7A 4AEOA 5FJIA 3SCSA 1TZZA 3GRIA 4GA8A 3SEPA 4IPJA 3VIJA 3T6CA 2QJIA 2NXIA 2YA0A 1XV8A 3S5OA 6TIMA 4LOCA 2TSYA 1ZP4A 2ZUTA 1E1CA 2VX5A 1DWIM 5FA5A 4JEQA 3GVWA 2HS6A 1HUVA 4MPKA 4INFA 1H60A 3GVQA 3TYUA 1D7KA 5HBFA 3WLOA 2VZTA 3WJWA 4HD5A 3TN5A 4AIOA 4H6KA 2FZDA 2R24A 4JY9A 5DY3A 2A85A 3W53A 3ENLA 1V51A 3MW7A 5CGMA 4QROA 3H6OA 3C0QA 1LQAA 1ZTVA 4LAUA 1OGGA 3FLUA 3PZIA 4IX2A 5KEZA 1WZAA 3KX6A 4JTGA 2VNCA 5F4XA 3V36A 3PG9A 3AYVA 2JQXA 4NZJA 2ZXDA 5K2ZA 2P8CA 2VWSA 1YNPA 1QPOA 4QDWA 1Z32X 3CAVA 1O60A 3BG9A 4FXJA 1WPCA 2J7EA 3TOPA 1N55A 2BLEA 3QBUA 5ABGA 4MZ1A 3LOTA 2OSYA 2CPUA 1FWAC 3MV11 3AS1A 3PUGA 2MNRA 1FX6A 3I10A 1UP0A 5HJXA 1Q7ZA 3DFNA 2ZX6A 4B15A 3O6YX 4ZBCA 4CVWA 7ODCA 1HJXA 3DFOA 4M8UA 1ISWA 4RZBA 3CB8A 4RPPA 1OSEA 4X0VA 1ADOA 4ZQCA 3TONA 3T42A 2CLFA 3E38A 1SUXA 2X0YA 2WSYA 3VOJA 1HJUA 3CV1A 4MDOA 3GLCA 2P0IA 1JDEA 2PGRA 1TPWA 4CD8A 5M03A 1ZBVA 1DJGA 3CZ8A 2Q02A 4BEUA 1XQLA 3Q67A 1BYAA 4HYWA 2W92A 3H53A 3QKEA 1KRCC 3VD4A 1AW2A 3SCTA 4GQ0A 4IMCA 4D1IA 3KBSA 3MVIA 1TV3A 2WMIB 4E8CA 4AZGA 2XZ9A 4X2RA 4A21A 4AC1X 3C2OA 1MEHA 4E6MA 2WW5A 1CGUA 1F3XA 1CENA 3UJSA 1QAPA 3KS5A 3QMTA 3G1RA 1W32A 1XGEA 3DC0A 4ERAA 3E5PA 1KFBA 5CBIA 4LVDA 5D30A 1W2PA 1MXSA 5FD0A 2QJMA 1DHKA 1VB9A 3P61A 1JPDX 1RLCL 1WO2A 4MYXA 4TV5A 4LWWA 4NZ1A 3UXAA 3N17A 5A6BA 2V2HA 3ELFA 2P53A 3OVRA 3AZTA 3UZWA 4GUFA 1TX2A 1VD6A 1UKPA 2XVKA 4EPDC 3LN3A 4TVUA 1G4TA 4F3HA 1WXJA 1FWWA 1M7JA 1AJ2A 4EIVA 3K4WA 2V30A 2WCAA 5MKGA 4QCFA 2DGAA 4NNBA 4UQEA 4J4KA 4I8DA 4DHGA 5EYWA 9CGTA 3W28A 2WZTA 4OTKA 2YZ5A 3ZR6A 5JVLA 4QJ3B 9RUBA 1XLIA 1D3GA 1OFOA 5AC5A 4IXHA 2XDFA 4ZO8A 3VTRA 2PDIA 1P5BA 2R82A 2ZZ3A 3UPWA 3E0WA 3O0FA 3IRDA 1XLDA 4XKYB 2QCHA 4XD4A 1O5XA 2AAMA 1MXDA 5CC5A 2QQ6A 4RNJA 2FH6A 3PBYA 3UBPC 3AIRA 3T1GA 2WKLA 3M64A 4ACYA 2DZWA 1KBLA 2ATSA 2BP1A 2RDTA 3HV9A 4DJDC 4LYRA 4W7UA 2EG7A 3IJ7A 1VHCA 1OG0A 4X0NA 4ZB0A 4F79A 3QV6A 3KRSA 2FPVA 3S5NA 2QNEA 1DJZA 2O9RA 2OKOA 2VGBA 4R33A 3U57A 1GNXA 3EEGA 2WCGA 1W8SA 3TA6A 1QPKA 3P74A 4EPKA 1KO0A 4LANA 1V7YA 5D03A 2I9UA 1GZGA 3AZRA 4H6RA 5DCDA 3ZLFA 4JN7A 3NQGA 3EMCA 1V79A 4QJ1A 4GOAA 4HP5A 3DBNA 1J9YA 2VWTA 4HSNA 4C6NA 1AUSL 3ZS4A 5CZKA 1UUOA 1R85A 1MI3A 2E9LA 1EP3A 4PMUA 3I6TA 2X1SA 3BDKA 4FK9A 3NR0A 2G3MA 1RK6A 2F84A 1S3HA 4O1FA 1EYWA 5CBBA 1DEDA 1FWGC 3C2FA 3QHNA 5KZEA 1TTIA 4IQJA 3RM4A 1YDNA 3S46A 2A4AA 1L6WA 4BKNA 3EWCA 3ES7A 2NXGA 4HSHA 3OBKA 3TTOA 1EIBA 3KDOA 1AODA 1HKKA 4MTVA 1QNOA 1VFFA 2PC8A 4NZ5A 4S2BA 4MNMA 3GR7A 3CHVA 5T26A 4HA4A 3VAVA 2INEA 5BXSA 1K8YA 4AWTA 3R1ZA 1T0OA 2PURA 1K77A 4L65A 1CLVA 3S3GA 2X1RA 2YCJA 4BI5A 4W5UA 1OHLA 3T0BA 5MF5A 3PWAA 1JDDA 4OBSA 4ENLA 3TCSA 1AW1A 3ERPA 3NZRA 3A3WA 3GK0A 3BXWA 3WH8A 3T2PA 1GOQA 2YJQA 3LHTA 2P0OA 1BWLA 3MPGA 2J75A 1QPRA 3QGVA 3W7QA 4LYKA 4PFHA 1BSIA 3VMNA 4XAYA 4JOMA 5FACA 2WJEA 3GDMA 4YPJA 3ARRA 3LCHA 4OIFA 1NWUA 4PB5A 3CLWA 3DN5A 3BW2A 3UU0A 3EPMA 1EOKA 3GHTA 1UR9A 4DBWA 3LV6A 3ZVHB 2VDHA 3QEZA 4PODA 4U5KA 2OODA 3K13A 5E93A 2VZUA 4O1CA 3NPXA 4E8GA 4KEZA 5GNZA 3MMTA 1WCGA 3EMZA 3FAWA 1Q85A 1G4EA 4DO5A 4NZ4A 4N6FA 4Q7IA 5IHRA 4GVFA 5LGXA 2V68A 2FZ9A 5JU6A 3QC3A 1J8VA 2QAPA 1KBIA 1GW9A 5FSDC 3E74A 4G9PA 1E9IA 4PCSA 4NP7A 3LXCA 3VD9A 3ZT6A 1ZUAX 3VD7A 3KLLA 1SZGA 1PE1A 3ID7A 1KFJA 1RD6A 2WNNA 3R58A 3NEHA 5LIUX 3MSRA 1E71M 3ORWA 1XIJA 3CEUA 4REQA 3UVAA 1J10A 4DZHA 3PM6A 3CYVA 3QLDA 3EWUA 5FF2A 4X63A 3A24A 2NUXA 1PCWA 1KLZA 5CZJA 4LAOA 4DEFA 4UTUA 4GNKB 5A8MA 2OT0A 3EKGA 4W5ZA 1D3CA 1S2WA 1XDLA 1YDVA 2V81A 3GIYA 1W5MA 1TRIA 3VC6A 3P3BA 5A6MA 4LUTB 1XBYA 3PJTA 5EMJA 4ZXLA 3WYZA 1WKEA 3M0IA 4Q8VA 5A6KA 2JALA 3WEZA 1P6CA 3VM7A 3ONBA 5E09A 4R34A 4RLIA 3AHZA 3CT2A 1RBAA 1G94A 3SBFA 3EWDA 4WK9A 4AQLA 2CESA 5D33A 3UP8A 4CNSA 4M82A 4GBDA 3BJFA 3HGJA 1P6WA 2WKGA 1GUVA 4H9MA 2C8NA 1DXIA 3FS2A 4I7WA 5AVNA 4OV9A 4AHPA 3AO0A 1EWDA 4M80A 5C55A 1PHWA 1DTUA 3SUWA 5JQ9A 2WSQA 4EWND 1E43A 5EPDA 3C2VA 5AYIA 6XIAA 2CHNA 1GG0A 2WMGA 3DHFA 2J7CA 1WKDA 2ZRWA 4QLLA 5A3HA 1EDGA 4IHCA 3UCDA 4D71A 1FTXA 1PZ2A 3E2SA 1IYXA 4D8LA 3I4EA 4QP0A 3NQ7A 3TJ4A 4Z2LA 4B2DD 5CGQA 2CXGA 4IICA 5HPCA 3ZJKA 2PDFA 4RZ4A 4XO6A 4ATWA 1P0BA 3B0YA 1PYMA 1UR3M 5CJMA 3A6OA 4CD4A 3WH9A 4PRTA 3FEQA 5A5WA 3T05A 3VABA 3WNLA 2IPJA 4JX4A 1IXPA 4AEFA 2PDYA 5FESA 3W88A 2CU0A 3M16A 3NNTA 3DX5A 4L61A 1IWBA 4E8DA 1L2UA 2VFHA 2JGQA 3O63A 3NQ8A 4PEEA 4KGLA 4PBEA 3KOFA 2W4XA 5FJRA 4A3QA 2XFYA 5D2XA 1H5VA 1CGTA 3W7MA 3L12A 2PRLA 4ES4A 1JQXA 3CUZA 4J27A 2CBIA 1EB3A 3NOYA 2FTYA 4QIUA 3VGFA 4I90A 5CH9A 2XIIA 1Z9AA 3V5FA 1NDVA 1TJ0A 5AHLA 3GH7A 4KQNA 1QWGA 2QKFA 2V69A 3N12A 1UD4A 1KM1A 4JEJA 3QGKC 4JAWA 4ZQMA 1GVSA 3F4NA 2IPWA 2Y5JA 4GI4A 5BXRA 1EYEA 2VD8A 1O5KA 1JZ4A 3W1NA 2CLMA 4NJJA 2VX7A 3HIJA 5A6JA 4DO6A 3ABQA 4O50A 4HOZA 1FCQA 4W9TA 3U0HA 3FSTA 3VDHA 3WKZA 4U4MA 4B4FA 1NFPA 3OBEA 3GTNA 2ZTKA 1MFUA 2BDQA 1GKRA 5GNYA 3THUA 3GYEA 4MJ2A 1QI2A 2XPKA 1L0PA 3PBMA 3TKFA 4C1NB 1VC4A 2BGSA 5EFDA 4I6VA 1ZENA 2NQ9A 4W8LA 3WBEA 1B3WA 3ZM8A 2WBGA 1P4CA 4PUMA 1D2KA 4JKMA 5L6UA 4UMBA 1Q63A 1XLEA 2Y4SA 5BOOA 1TA3A 3N13A 4GKTA 4CNPA 4V2XA 2OEJA 3W6LA 2C14A 4H83A 4PMXA 4KS0A 4M29A 3F4VA 3RO8A 1F6PA 2GJNA 1AQFA 3DHDA 1W2VA 1HGWA 5LXEA 3RLHA 4DJFA 4FLSA 3UR2A 1AG1O 5C54A 4B5NA 4DO4A 1GK8A 2I5GA 2D2GA 4XAGA 4DWSC 2IUZA 1CXFA 2ISFA 4HJWA 4ECLA 2WKJA 1BKSA 1YDYA 2Q01A 1HN1A 1WDSA 3GE7A 1XLCA 3INPA 4W93A 3UNDA 4OGZA 3WFAA 1NY1A 3CIVA 4WD0A 4N9CA 1K8CA 1ZZMA 2X7WA 2D2JA 1LUCA 3F2DA 3ZOAA 1GZ1A 3II1A 3WSUA 2I14A 3WQ5A 3TLQA 1EJWC 1V3LA 4U33A 1LG2A 3BQ5A 3R7MA 3PZTA 1KRBC 3WF2A 3O0KA 5EKYA 5F2LA 1Y5XA 4K38A 1N8WA 1ZSXA 5GJPA 2C6QA 1K8ZA 2Z1KA 4JTLA 7CGTA 2NV1A 3IPWA 1I1XA 2BSLA 4Y7EA 3MQTA 1GOMA 3NQ6A 1I2QA 2B31A 3HURA 3W7PA 3VDAA 1H41A 4U3AA 1XIEA 2WZHA 3VU2A 3W86A 2AOSA 4P8WA 1A80A 1FWSA 2YB1A 3L9CA 4WVXA 4I9MA 4O15A 4HK5A 1TRDA 2C71A 3ARTA 1UD8A 3P6LA 4L4LA 2VEKA 5B7YA 3DHPA 1N7KA 1HJSA 3NQEA 4NNCA 4MUPA 2QMKA 3WDRA 4RDWA 1KBKA 3UPMA 1XH0A 4PMDA 3H4GA 5BNKA 4HCLA 2ISVA 3VC5A 3WBWA 1OFPA 2XWDA 3GFYA 4GCXA 5C7VA 3OLDA 3PPGA 4QBXA 1NF7A 4U10A 4AYGA 3GG1A 3A9BA 1VAHA 3URNA 4M3PA 2ZUVA 4O8AA 3RM9A 3BH4A 1V7AA 5D8ZA 4A3YA 3W7KA 1RPKA 3DENA 4JQ2A 1WDRA 4WDXA 1IWAA 2A7PA 1SZEA 1QU4A 4KF1A 3G18A 4CCZA 4MG4A 3WG6A 2HNHA 2VZVA 1GJPA 1UB3A 1ZNNA 3W1TA 1S1RA 2CLHA 1UYQA 4F2TA 5CPNA 2DZAA 3RX3A 5FIPA 4H8UA 5C71A 3B8IA 3N2XA 2ZC8A 4P7NA 4DI9A 4LEFA 4CQBA 1I2RA 1HFBA 4QG9A 1DIKA 1LRTA 1OVDA 5FJOA 5I09A 2C7FA 4HOWA 1OABA 3M43A 4NT0A 3E49A 3PPHA 4NAEA 5BOFA 5DRCA 3EX6A 3D3AA 4O1DA 4ZZ9A 2NQZA 1NOFA 4C6OA 1EEXA 2VO5A 1E1FA 3W24A 4S3BA 1KFCA 4AZ7A 1Z3NA 2XN0A 1KXTA 3ITLA 3CEPA 2HJPA 1JIBA 2BOGX 2WSPA 1CBGA 1XLMA 1ICSA 3CIXA 4H6QA 3WBXA 3GG7A 5DX7A 1IT8A 3FKKA 3GX9A 1IEXA 1HKIA 2HRWA 4NY2A 1QOPA 4O52A 3HPZA 3WQ6A 1UPPA 2PSNA 3FYPA 3GW3A 1TVPA 3NZPA 4HHHA 4K8GA 3RG6A 5C9UA 2D73A 2W79A 1L8PA 3EAUA 3S5SA 2PB1A 4LYPA 3W01A 4Q4SA 4MM1A 4LVGA 1VP5A 3XISA 4PYSA 3C86A 4NAFB 1MEIA 4N9BA 2NQHA 1OYBA 1I6NA 5AC8A 1E55A 2Y5SA 2X1TA 1HP5A 1FUYA 3A4XA 4WJEA 2WVVA 3SCPA 3HG5A 3FJLA 4XZMX 3N6QA 4CEUC 5CSYA 1KM5A 5IDIA 2EHHA 4IMAA 4NZFA 1BQCA 1H09A 2GQ3A 2ZRYA 5AZ0A 4I5XA 1EXBA 2TODA 3OYZA 4PMZA 2C0HA 3TOYA 4LUJA 4A8LA 1FWTA 2A0NA 1G7VA 1NF0A 2QULA 4WJXA 4C6JA 4NX0A 3MMWA 4XG1A 3N4AA 2PZ0A 1EF3A 5HUPA 5HJYA 3SY5A 2Z1SA 3CPGA 1US0A 3C2RA 1GQJA 1SZFA 1DQXA 3LMYA 3ES8A 1CLXA 1GQIA 2PWDA 5T9CE 1X98A 2BGQA 3RNDA 2WMHA 1ECEA 1ADDA 2YXOA 3SRHA 1KC7A 1BLIA 1M53A 4FB7A 3N6HA 3HO8A 3AHYA 3UWQA 4KIEA 2I9EA 3V18A 3BPWA 4GO9A 3W1RA 2OLHA 1ZU8A 5D2TA 3VIKA 2WMKA 7TAAA 1FWIC 4H4IA 5DFAA 3UJEA 2QZRA 1KM2A 1E0XA 1IEVA 2GOUA 4HA1A 5TQLA 2AAAA 4JFTA 3H7VA 1SO5A 3XINA 4NRSA 3T81A 3DERA 3E6EA 2G95A 2VM8A 4B3KA 2FGLA 2QJHA 4L4OA 1VFUA 4LB4A 2PWVA 3T4WA 2NX9A 4ZOCA 4GC3A 3GXFA 5CZSA 1NU5A 3M1ZA 3TE9A 4F8XA 3AU2A 1IHIA 4HZ8A 4ACZA 1GEHA 1FOBA 4U28A 3LENA 1W9VA 4ICCX 3GNOA 1CPUA 3PN8A 2GLKA 4EACA 3OU8A 2E7FA 4IQEA 4NYYA 2FLIA 5AHNA 1H50A 5AHEA 1DPMA 4CQDA 4TVDA 1VPYA 3MP5A 3FAXA 1K9FA 4JTRA 3WNKA 1OINA 4TUFA 4JQ1A 3W2MA 2BGNE 4B5VA 4EXAA 5LGZA 1WNOA 4ZOEA 1F7BA 5IFPA 3BAYA 2JKEA 1GYMA 3KDNA 1WE5A 2E68A 2NSOA 4AZ5A 3FDGA 4C60A 1UP2A 1W5QA 2VC5A 1W1A1 3TJXA 1R3QA 8A3HA 3HFTA 5CQ1A 3N19B 3GIQA 2BVDA 2GYIA 1QATA 1N2VA 3U7VA 4AXKA 5HDRA 3BQ6A 2CKSA 1CB2A 3QY8A 4J3UA 1JDFA 2R1PA 1V3HA 3PZ9A 3C0JA 2DV0A 5KSWA 4KKXA 3FNDA 1KR1A 3GDKA 2XISA 5I7GA 1OCBA 2IS7A 4URIA 3LA4A 2XIQA 1VLWA 3LSBA 1A5AA 2WNZA 3LI1A 3KCOA 4DELA 1RQEA 2ZUUA 4HNCA 2YDQA 1DWJM 2ZXQA 2FMOA 3TYDA 1W5OA 3TXZA 3W4RA 5A8QA 1W5PA 4MNJA 2ZUNA 3HTWA 2GVGA 3TW7A 1IZKA 3A4AA 4GYFA 3SSJA 1XR2A 3V35A 1MDRA 3OW1A 1L6GA 4H19A 1OWQA 3C5QA 2J74A 2E25A 3W00A 2X2YA 1VRDA 4FHAA 3L7RA 2RDWA 5DCEA 3SADA 3LSCA 2TMDA 3ZJ6A 3FN9A 3VKAA 2C3ZA 5I3GA 1YTKA 3S5YA 1ICQA 3SJ3A 3S2LA 4M51A 5ABEA 4CN4A 1WZKA 4Q8WA 1FH7A 1V6XA 2BV9A 1E0WA 3MUY1 1LL6A 1FCBA 1B3OA 1RALA 2DORA 4KBXA 4S3JA 2FKPA 3R5EA 3ZT7A 3DYMA 3C61A 2VX6A 4WSJA 4HTYA 2W91A 2EAWA 3TA9A 1VRXA 1AL8A 2BODX 2QDEA 4BA0A 3KVLA 3N1AA 4IIDA 1UOZA 1YBQA 1K7XA 2P76A 3EGJA 1VHNA 1J2WA 1H1NA 4LCRA 4D8AA 2C1HA 2G0WA 3BAKA 3WFLA 1SJDA 4KERA 1CZ1A 4Z1AA 1PVNA 4GISA 2AL1A 3QTGA 3V1PA 3M47A 1RBLA 4FZIA 1SSDA 3V4BA 3URAA 4LQ1A 3WD3A 4UTLA 1YW1A 3IJ9A 4POCA 1E1CB 4PUKA 4TX6A 1JGIA 4PTVA 3W1PA 1MW1A 4D8ZA 3W82A 4Z42C 1UKSA 1OF8A 2ANUA 2X05A 2Z2AA 5D9NA 5E6YA 3WX7A 4ZOBA 3RIKA 1TJ1A 2J8FA 2YL9A 1JXKA 3MANA 2YYTA 1AVAA 3W7DA 4RR4A 4JYEA 1T7LA 5I2UA 4IGSA 4MDPA 3BSHA 4GQQA 1JVNA 2DVUA 2C0AA 3BLIA 1JR1A 3GZAA 4IFKA 4A2SA 2OQLA 2NV2A 4O11A 3U8GA 4HPXA 2EPKX 1ZB5A 1F73A 2CLLA 4WDWA 1KFLA 1BGAA 4ZE4A 4WF7A 4MUZA 4WOZA 1SZNA 5JXQA 3LM3A 3AIVA 1CLKA 5I23A 3AXIA 4WDTA 3LD5A 1YX1A 4GJIA 3HZ3A 2FGBA 4RKAA 3A12A 3UG5A 4QHRA 3B04A 2DQXA 1OCNA 1JRBA 3JVAA 1E9ZB 3B0UX 2VCAA 4L9ZA 5CAKA 2HISA 1FBAA 3TMLA 3LHVA 1MNSA 2YYUA 2PLMA 2QCDA 3T07A 3BAWA 3TH6A 1O1HA 5JIPA 2X1UA 1S5MA 1BHGA 3SDOA 4DB7A 2VC9A 4GBUA 1V6VA 3RCNA 4WXYA 3DESA 3FHQA 3MSDA 5U7SA 2FH8A 1CWYA 4HU8A 3GKFA 4L1WA 1LF1A 1J18A 9XIMA 3GDBA 3TSMA 2R6OA 1IZCA 4F2BA 1JYNA 5HQLA 3ZSSA 1Q13A 2FZNA 4EAYA 3BCDA 3CQJA 5HNUA 4N7QA 2QVNA 2GSEA 1NDWA 4PTNA 2NLYA 3UY8A 4LUIA 1ZCCA 4PB4A 4JTSA 3M9YA 1MUMA 2WWCA 3PAOA 1KW1A 2F2KA 1YRRA 1EZWA 2BFGA 4HHPA 3W9ZA 2GGJA 3OHIA 5F2GA 4CNNA 5CG7A 1K9EA 1L6FA 4YIWA 2DZSA 4HK7A 1OD8A 4ZTXA 2WM0A 1HKVA 3RXZA 4ADSA 1VEOA 3F5LA 4CCEA 3D0CA 3EWXA 1T8XA 1TTJA 3AICA 3M6DA 3BLKA 4LGXA 3O6CA 3TIMA 3R12A 1BXBA 4R53A 1XI3A 1S2UA 3ATYA 2PEVA 4LAZA 4ADTA 1M1BA 2ABAA 4GE8A 4GXPA 3GDTA 3H2FA 4UFHA 1PSCA 4JNZA 2DEPA 1E4NA 4LJ3A 1LJYA 3IGUA 3BOFA 4H9VA 4C7DA 3GDRA 4W89A 3W84A 1FP8A 2ISDA 3LI0A 4JTIA 5T91A 1SO3A 3RF9A 3MJMA 1UC5A 1V3JA 4LFYA 4GH3A 7XIMA 3PFMA 1PEZA 1JNEA 3APGA 1K4GA 1W31A 1S5NA 2A3HA 3S6OA 3CUIA 4LS1A 4RPQA 2O9TA 3BO9A 1FDZA 2ZRUA