3V35A

Aldose reductase complexed with a nitro compound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v35A00
4XZHA 5LIKX 3R58A 2PD9A 4L1WA 4LB4A 1AZ1A 4JIRA 3LD5A 1M9HA 1EKOA 3H4GA 3GUGA 3R94A 2R9RA 3R43A 1XF0A 3UFYA 2IKHA 1MZRA 3UZWA 1OG6A 1IEIA 2PF8A 3BURA 4Q3MA 4FALA 2P5NA 1XJBA 5AZ1A 3FJNA 1AFSA 4JQ3A 4L1XA 4DZ5A 5LIUX 1X96A 1LWIA 1ADSA 4JQ4A 1X98A 1EF3A 1AZ2A 1RY8A 4EXAA 1YE4A 2HE5A 3R6IA 4GQ0A 2I17A 4QBXA 2IPJA 2ACSA 2PDGA 4LBRA 4AUBA 1EL3A 4WRHA 5C7HA 2IPWA 1JEZA 3R7MA 3UWEA 1Z89A 4H7CA 2WZTA 4YVVA 2PDQA 4PUUA 4I5XA 1A80A 3H7UA 4Q7BA 1C9WA 2PDPA 4JTRA 4F40A 2HVOA 5DANA 1ZQ5A 3S3GA 1S1PA 3UP8A 3O3RA 4MHBA 5HA7A 3RX4A 2VDGA 4GIEA 1XGDA 2I16A 3O0KA 3EAUA 4NKCA 2PEVA 3G5EA 2FZBA 2IKJA 3DOPA 3LZ5A 3CV7A 2PDLA 2IS7A 1HW6A 3BV7A 3ONCA 4ZFCA 2PD5A 2HDJA 2IPFA 4QR6A 2BGQA 2C91A 4LAZA 2NVDA 3ONBA 3Q67A 4H8NA 1S1RA 3LQGA 3RX3A 4ASTA 3UZXA 1LQAA 3EB3A 2HE8A 2INEA 3M0IA 5M2FX 3F7JA 4JIHA 1PZ0A 4YS1A 5KETA 2BP1A 5JH2A 3R8HA 3C3UA 3CMFA 3LUTA 1MI3A 4JTDA 4FA3A 2PDYA 1VBJA 2WZMA 3LQLA 3MC5A 4JIIX 4PRRA 4ICCX 2ALRA 3NTYA 2FGBA 3N2TA 3GHRA 3UGRA 3EB4A 4WDTA 1PZ1A 4QX4A 4XK2A 5LIXX 4GA8A 3BUVA 4LBSA 3V0SA 2A79A 4XZLX 3LZ3A 3V0TA 4DBUA 1YNQA 1AH4A 3VXGA 4IGSA 1R38A 3LN3A 3B3DA 2FZ9A 1PYFA 3UZZA 4RPQA 2NVCA 3R8GA 2HEJA 4XO6A 4PRTA 2PDKA 4PR4A 5HNUA 1AH0A 3WBYA 1J96A 1ZSXA 1YNPA 2DUXA 4XVEA 1GVEA 3GHTA 1X97A 3T42A 1PWMA 3BCJA 3V36A 4GACA 1QWKA 2ACUA 3N6QA 3V35A 3V0UA 2PDMA 1ZGDA 1PWLA 1QRQA 1T40A 1RALA 1S2CA 3D3FA 3GHUA 2CLPA 4YVXA 1S2AA 2F38A 4FZIA 1Z3NA 3P2VA 5HNTA 4WDWA 2HVNA 3LBOA 4HMNA 3DN5A 4OTKA 3M4HA 2FVLA 1FRBA 4G5DA 3WCZA 1SM9A 4XAPA 4JQ2A 4PUWA 4GCAA 5AZ0A 3M64A 1T41A 4JTQA 3CASA 5LIWX 2F2KA 4IJCA 1K8CA 3CAQA 4JTAA 1UR3M 4EXBA 3U2CA 3FX4A 1YE6A 2PDCA 2PDIA 3H7RA 4IJRA 2IPGA 4WGHA 4HBKA 1HQTA 2INZA 3G1RA 1ZUAX 3UZYA 1MRQA 2HV5A 4XZIA 2DUZA 1Z9AA 4QXIA 5JH1A 4GQGA 2IQDA 2FZDA 2DV0A 4R9OA 4XZMX 4XVDA 2QXWA 3QKZA 3LENA 2ACQA 2PDXA 2PFHA 4LAUA 3UYIA 1VP5A 2PDJA 5LIYX 1Q13A 2ACRA 2IKIA 4YU1A 4WEVX 4JTCA 1RY0A 4XZNX 2IQ0A 4XO7A 1EXBA 2PDUA 4DBSA 2PDBA 1AH3A 1US0A 2PZNA 4LB3A 4FAMA 4YVPA 2PDWA 2IKGA 3KRBA 2J8TA 2AGTA 2ISFA 2R24A 4JQ1A 1Q5MA 3Q65A 3LNMA 3COTA 2BGSA 3UG8A 2PDHA 4DBWA 4JQAA 2PDNA 3GHSA 3RX2A 4WDXA 4PMJA 3WBWA 2FZ8A 3ERPA 3WG6A 3LEPA 3WBXA 2PDFA 1Z8AA 3CV6A 4WDUA 3MB9A 1IHIA 3CAVA 4GABA
chains in the Genus database with same CATH superfamily
2VEIA 1A0CA 1F76A 4MKSA 3PJTA 3PTKA 4CNNA 4L1WA 4WLCA 3C56A 2WMFA 2GJXB 1EH9A 2VNCA 2VT0A 3N18A 4WY0B 3B97A 3P74A 3GUGA 3T1GA 3P82A 3SQLA 1KW1A 3EBVA 3ZMRA 3E0VA 1RSCA 4MNLA 3CS2A 1QBBA 2GGHA 1GVRA 4ZO7A 4Z2IA 4WJEA 2GYIA 3K2GA 4MPQA 5K7JA 4JYEA 3P84A 2V5BA 1XV8A 1JQVA 1GOMA 2D0GA 4JTSA 3CZJA 2QCFA 1BVWA 4AW7A 2QJNA 3WJWA 2X2YA 5FF3A 3PFRA 1VBHA 3VGFA 1GVSA 1V6TA 3BW2A 4U10A 4AD3A 4AHOA 1BXNA 3DYOA 1RY8A 8TIMA 3G8RA 3BAYA 1SJAA 4P8UA 4QRNA 1K8YA 3ARZA 3PHAA 4L6DA 5FEPA 4LBRA 4FOJA 1XD0A 4WHBA 4EPEC 3APTA 3PWGA 4Y8FA 5H8MA 2I1OA 1ISXA 4IPPA 4I5XA 4Q4KA 3DGRA 3WUGA 2P10A 2PDPA 2WNZA 2YA1A 3GVWA 1OYAA 2X1SA 3WLJA 1JFHA 4GJ1A 2Z26A 5BWFA 1I2RA 1XXXA 4IH3A 2W6RA 4GIEA 1XGDA 5BYWA 1LP6A 2XFWA 3OGRA 3W6YA 1B5TA 2EPOA 2Q3OA 3AFBA 3G5EA 2RGLA 1TMHA 1ENUA 3LCXA 4M8UA 4Q8MA 5I03A 4BHYA 4O53A 3DYMA 2JIEA 3KWXA 1E73M 4X61A 3FYYA 4L7ZA 4DXXA 3RF9A 3KX6A 3MUCA 2UY2A 1XISA 2QUVA 4IWWA 3ME3A 1TE1A 3DBPA 5D9OA 1QOPA 1DWIM 3B8DA 1E0XA 2OX4A 1DWFM 1V3KA 3G3MA 4H6EA 1LUCB 2VFHA 4HU0A 3SCVA 4HNTA 2OZ8A 1BYAA 4H9VA 1GOQA 3EB3A 4JIHA 4FX7A 1UWSA 1R9ZA 2EHHA 2WQPA 4RW5A 5A2AA 2Z1XA 1OK4A 2PP0A 3MC5A 4I9TA 2A3CA 3GH7A 3HN3A 3TQPA 2V0TA 3P14A 4BKNA 3AMCA 5LGZA 1OFQA 1SJCA 3GHRA 2FTWA 2Y5SA 1K3UA 3SUSA 2V3FA 4O52A 4S3CA 4DYJA 3IV8A 3LRMA 1CEOA 1JPHA 1TVNA 4MZ8A 4B3ZA 4M3PA 2PUZA 3VKDA 3AIQA 3UXIA 2E1DA 1PV8A 3BQ6A 5LNSA 4L80A 3AICA 5AY7A 5ABTA 2QULA 4CD5A 1UD5A 1VIWA 1GVIA 1JDDA 4GGHA 3W1AA 3AZSA 3VOIA 1UYQA 1RJRA 1HKMA 3WNMA 3GKAA 1VYSX 2PP3A 2W4XA 2JGYA 5HNUA 2JKPA 2R1KA 2CU0A 1TV4A 1RJQA 1A5CA 1VAHA 1NOWA 2P1FA 5JXQA 2ZUUA 2F2HA 2VFGA 5G2IA 4WY0A 2CNCA 3JRKA 1RQHA 1J0JA 1BQCA 1IXNA 4H9UA 3V0UA 2NW0A 3N2XA 4BI7A 5EL1A 2ZWZA 3FKRA 5CSRA 4P8VA 3FA5A 1QRQA 2QDGA 3PTQA 4QM1A 1L9WA 4XD6A 2XIQA 5E9XA 1NM9A 1A5MC 4LFYA 2GUYA 4RV8A 4REQB 2F9RA 4XAGA 1VCVA 3FJ4A 2YXOA 3VUSA 2RDTA 3V16A 3S46A 2NX3A 3BLLA 4ROPA 4GI8A 2CLFA 2WC7A 3LBOA 3VDGA 3E0LA 4JTTA 3KAOA 3PZTA 3NQGA 3THUA 1XLIA 1ZRQA 3SJ3A 4HKPA 4GO9A 1TV2A 3HGSA 4Q7NA 1XIGA 2YBVA 3CWHA 4GCAA 3EWZA 3CT7A 4AZHA 3NDZA 2FGZA 5BMXA 7PTDA 3N73A 3U2CA 4FNPA 1ECEA 3VGHA 3BLOA 1WOAA 1HQTA 3IPWA 3L5MA 2ATSA 1OX4B 2WB5A 4DF1A 2WHJA 3A6OA 2NUWA 4QLJA 2OFJA 4OBTA 1FX6A 1U5JA 4IG2A 5I79A 4LUSA 2VDIA 3VZYA 3QW3A 3G18A 3NJ3A 1HJQA 1E55A 3OP2A 3A47A 4GLEA 1NOFA 1RUSA 3DFSA 3FA3A 2OCZA 2I57A 4JZ5A 3NAVA 1LCOA 2C8NA 1UZDA 2NQZA 4XO7A 2YBTA 2VC6A 5FL1A 3QF0A 3VFLA 1WZKA 4NRRA 3HPXA 2AKMA 3W85A 3SEPA 5E0FA 4J3WA 1MDLA 2R24A 4M82A 4JCLA 2FJKA 3UPMA 2OX1A 2PDHA 2CLOA 3F5LA 1P7TA 2GGGA 1MW3A 3RX2A 4CNSA 3QY8A 5FL0A 1F73A 3RLUA 1XIHA 3B0YA 1CGWA 1RLCL 1WCGA 5MF5A 3U5UA 4GY7A 4EWND 1G4EA 1K9TA 4XBSA 3HFYA 1CW2A 1AG1O 3ZS4A 4E8DA 1HFBA 1EP2A 1E3XA 2YJQA 1E4NA 1IE7C 3ES8A 1R3TA 5C2GA 4DJDD 4LB4A 2ONEA 3O0FA 4IQLA 3LD5A 3QGKC 2J8FA 3H4GA 4D6GA 2BB0A 3F2CA 4Z17A 3VD4A 2CFFA 2OT1A 1ISZA 1V3IA 2VX5A 1JI1A 1PAMA 3CLMA 1FDJA 1VFHA 1W54A 1Q6FA 2OXNA 3T78A 4LAKA 1I2OA 3A5FA 1PCKA 1M04A 4IFKB 4O0KA 3WEZA 5AVHA 3LV5A 3GTXA 3UFYA 2IKHA 5G1MA 2NV1A 2GGIA 5C2CA 1I4NA 9CGTA 4HNOA 3I68A 2F6XA 1EWDA 1UKQA 2OSWA 4YPJA 1F4HA 3ITGA 4H6RA 3SB0A 1X96A 4KRZA 3WDQA 3DI1A 2Y70A 3VYLA 2I7GA 1ZP3A 3O06A 5EKYA 1RQBA 2ZUMA 5T91A 5BZAA 2WNNA 1V51A 4UQEA 1OD0A 3WQ6A 4W8AA 3M0KA 3BZJA 2WKGA 1CYGA 4WRHA 3MCNA 2EJ1A 2EKCA 2EO7A 6A3HA 3IGHX 3LNPA 4M0XA 1XLBA 3AYVA 4ZL1A 3L5AA 1HN1A 1C93A 3LU2A 4UMCA 1KBBA 4G2DA 1HJUA 4UWMA 5DMLA 3ID7A 5H8UA 2ZYFA 5BCAA 1LWJA 1P43A 3VCNA 3DESA 3CQHA 2OG9A 2C16A 3P0WA 4UFLA 1T96A 1QFEA 3W7KA 5G4HC 3UWYA 1VJSA 4BWLA 1EBHA 4DPQA 2IXVA 2VUNA 3HBLA 1BRLB 1TMQA 1WAUA 4HT3A 3EKGA 4NILA 1XLHA 5E5CA 4B4HA 1S39A 2IPFA 1QK2A 4MG4A 2BGNE 3BV4A 2FDSA 1UG6A 2VUYA 3E74A 1KC7A 1A4LA 1A5UA 2OMAA 2QJGA 2NX1A 4OBSA 2DT2A 4LS1A 4ZBCA 3D3AA 3IACA 4FF5A 3BOLA 3INPA 1V0NA 3IJDA 3LHVA 1CLKA 3UR8A 5G1TA 4A2RA 1V6WA 2BZNA 4FNUA 1SVDA 2FFCA 1R2SA 3R11A 3GAKA 3EWBX 4EP8C 1P7TB 5HANA 1XIFA 3KDNA 1UW9A 1XLDA 3G8EA 4ORMA 1KO0A 5D4YA 3W1LA 2X0YA 1O1HA 1EX5A 3B9DA 3B4UA 1IZJA 3MMWA 5DCDA 2Y5EA 2XHYA 3B3DA 3DFOA 3FYOA 4U3AA 3WENA 4RZ4A 4QITA 2CPUA 2ZADA 5GNYA 3MUAA 4UFIA 1I9CB 3WLTA 2XUCA 1ZY9A 3OPSA 1T8QA 4JEQA 2QIIA 3GXNA 3IIVA 3EYPA 4XUGA 2UY4A 2EPLX 1W3KA 3SY1A 4OE7A 1U22A 4XVEA 5ABGA 3TH6A 1X97A 1DTNA 1H7XA 6REQB 4HPNA 4L1GA 2XZ7A 3TQVA 3NQBA 4W7VA 3H2FA 3NDOA 1B3YA 1GTHA 3QR1A 4JTJA 2E09A 3LPPA 4AD2A 3AXMA 4YTQA 1RALA 3KL3A 4Z08A 3PPGA 1EEXA 1L8PA 3WJSA 2ODOA 2X16A 3T0AA 4B90A 4J2MA 2HWGA 3A12A 1S2AA 1H7RA 4E2DA 1R85A 4WSKA 1ZJAA 1GPFA 1AQHA 1XIJA 1WBHA 1TZ9A 2QKFA 1RCXB 1SZRA 1DHKA 3FJ6A 1IGWA 2QDDA 2O9OA 2O4QA 3P80A 1WP6A 1WKFA 2X1IA 4ZB2A 1IWPA 1Z42A 3PZNA 3ISIX 2OWWA 3PB2A 4CU8A 4JQ2A 3I4KA 4O1BA 3AI0A 5AZ0A 3THAA 1EJWC 1B4EA 2X42A 4B15A 1XW8A 1GW1A 2WW5A 1GOXA 4E3TA 3AU6A 2ZICA 5FF4A 4IMDA 4O4VA 4QQUA 1KM4A 1XYBA 1PKMA 2HS6A 2INZA 1W3HA 4JNZA 4ATLA 5C9ZA 1TB3A 2DT3A 3QN3A 1B3WA 2HV5A 2FVKA 2Z1VA 2CWXA 4C6EA 3SGGA 1KB3A 1UASA 1W3LA 1ICQA 4NJGA 4QDPA 4D6FA 1A5AA 5DRCA 1UKTA 1KM1A 2A5HA 3CAKA 3FHAA 1VP5A 1YYAA 3GC4A 3H2EA 3VOGA 1RY0A 3POHA 1OADA 1JD7A 5E09A 2EQDA 1GZ1A 5DCBA 3FNDA 1QNQA 2VD9A 1P48A 3SCOA 3B8SA 2RFGA 2IXUA 5BMWA 2WVTA 3U57A 4IIEA 3FVMA 3LMYA 2XFRA 4R88A 1KLYA 3WLKX 3TLLA 2E6FA 4F0MA 1S5MA 2D3LA 3U2EA 3RILA 3L4ZA 1EO5A 1EOMA 3K8LA 1T0OA 1I60A 3VD9A 3WD0A 5CLTA 3CHCA 2FB3A 4A3YA 1DKWA 4CD6A 3N2CA 4JS3A 3UYCA 3EZ4A 3CUJA 1UD3A 1FCVA 3LGGA 2PRHA 2WLYA 4WDUA 4RR4A 2ZUWA 3CAVA 2ZZ1A 4Q6XA 3S5SA 9RUBA 2PD9A 3MANA 2NV9A 4MKVA 1XYCA 3BVJA 5FOOA 3O8AA 4LAOA 2ZQ0A 4YWIA 3K8MA 4BJHA 4KPLA 1D9EA 1K9DA 1G7UA 3BCDA 3GNDA 1XLMA 3KXQA 1WUFA 3BURA 1JPDX 4CCDA 1KCXA 3G0SA 1KLZA 1UUOA 2XFYA 1VB9A 3M07A 3DBNA 1OABA 2OEKA 4K68A 5A95A 3DKJA 4LVAA 5CCZA 3WEOA 2KZHA 3QOMA 4AD1A 1PSCA 1UMYA 4JNYA 4GYFA 2XTKA 4ML4A 4CD7A 1OB0A 3S47A 1ZNNA 4Q8QA 1W5PA 5DXXA 3ABRA 4TMBA 1Q8AA 1YE4A 1X7FA 3AXKA 3A23A 1V79A 3QY6A 1Q6DA 1NFPA 1JPKA 4CQ9A 3ELFA 3T6CA 1LT7A 3GG1A 3VABA 3G1AA 3A4XA 1RP8A 2D22A 4BF7A 1A80A 4GNVA 3VVGA 8XIAA 5BRQA 4D8ZA 3DFYA 4DWSC 2BXZA 2NUYA 3EGJA 4JOMA 4H7VA 2E3ZA 1QPNA 4R5EA 3UF9A 1DORA 1FWHC 2C18A 1XG3A 5AHLA 4PTXA 1EZWA 3NVDA 2NZLA 1G9HA 3ZJ7A 1KXVA 4I9AA 4RE3A 4OU1A 3FN9A 3W24A 1F9CA 1KV8A 3M41A 3WEMA 2PDLA 1UWTA 1T8XA 3B8IA 3MHUA 3OG3A 3PWIA 4IMAA 2H6RA 3SY5A 3NQAA 3SY8A 3CZLA 2WZHA 5GVJA 1W1B1 4DZIA 1OFPA 4DNHA 3B9AA 3ITXA 1KRCC 3VDHA 3OVGA 1LBMA 3L5LA 2CLKA 2E5DA 1O95A 4DN1A 3VNKA 4Z1DA 4AXKA 1IEWA 3W70A 1CTNA 3TROA 3T2OA 1QR7A 3H2AA 1Q6RA 5FF2A 4HTBA 3ZSSA 1GGOA 3L9CA 3BMWA 1GQNA 3C3UA 1MI3A 5CC3A 2Y7EA 4XSMA 2YCKX 5E9AA 4W88A 1OC6A 2VVNA 4FSAA 5D8ZA 2F6KA 2DGAA 2X41A 3HQPA 2VKZG 2ANUA 4ZO9A 3UG4A 3LZ3A 4J7RA 3ARVA 2ZZ6A 2XSAA 1L6YA 3DX5A 3LN3A 3KS5A 2Z29A 2BNJA 3BAKA 4GUIA 4Q8UA 2QIWA 3KP1A 1CGXA 2Q3RA 3M0ZA 3UJSA 4QHRA 4HU8A 2J25A 3PM6A 4TTGA 4B5UA 1I2NA 3RG6A 3WDHA 4XO6A 5LSMA 1TUFA 5HMDA 3Q94A 4NJKA 3WLOA 1BVZA 1YNPA 3FHQA 3TMQA 2BY3A 4MFEA 3NDYA 7XIMA 4PRWA 2VC9A 2J4GA 4L6HA 4C6FA 3MZNA 2XH0A 2QLYA 3AJ7A 3CQ0A 2ZX8A 2X05A 3L7RA 3LLDA 2ZA1A 2WCAA 3ABSA 4AIBA 2I9UA 2Z7GA 3F5KA 4Y9PA 1BEUA 1QOQA 5U7SA 1XDMA 4KCUA 4URIA 4JIEA 1S2CA 1H63A 4HCDA 4PTWA 4DWDA 4IIGA 2XSXA 4TUFA 1H62A 3VFCA 5HMFA 2RDWA 1FXQA 1S5VA 4LQ1A 1DYSA 1AJ0A 4UFHA 2ZX6A 5D32A 4U5IA 2CXGA 5FI8A 5HPCA 1QXLA 2V63A 3OIXA 1FTXA 1NSJA 4FS9A 2LLEA 4N42A 1SW7A 1P6CA 4RNJA 1JAKA 3IIPA 4UQDA 3TJIA 1YX1A 3MO4A 4W5UA 1EYWA 1S2TA 2VGIA 1MXSA 1FFRA 1RQEA 1XRTA 5LIWX 1JF6A 4OHQA 2D69A 3T0TA 3B40A 1CCWB 4JHOA 4ZOEA 2O7SA 3R79A 1E9LA 4C1LA 4DUXA 1P6BA 4JX4A 2VI0A 4F0HA 3W84A 2PTYA 1J10A 4WUIA 1A5SA 4HCHA 2DUZA 1O5RA 3OTRA 1MEWA 5DQPA 4ATWA 3REQB 4A3UA 3TC6A 3UESA 3BQ5A 3STFA 2VURA 4JFVA 4UTIA 4ES4A 2QR6A 3ANVA 3PK7A 4L9XA 3KDOA 2PI6A 3QFEA 2V3DA 3IGSA 5LIYX 3KRUA 5FJPA 3RO6A 4WEVX 3VIKA 4D8LA 5CPLA 3QQWA 4B2DD 4GBDA 3K5XA 3D46A 5HAOA 3I6EA 2ZRXA 3DC0A 4LH8A 5A69A 4HJFA 3L4WA 4LB3A 5H2ZA 1ME8A 3R4IA 2J75A 1CX9A 2GJRA 3PNUA 1V3HA 2I14A 2IKGA 3UWZA 1EDQA 1KD0A 3RPMA 2OELA 5TNVA 1OFEA 3GKFA 3O9NA 5DT7A 1BSIA 3L0KA 3CUXA 1UUMA 3UG8A 3M5VA 4MLJA 1KR0A 1VCGA 1DXFA 1QATA 3OIHA 4FP1A 5TF0A 4PFHA 3W6MA 2PC4A 4S3DA 4Z2GA 5IBXC 3ZLFA 3LTSA 3IJLA 4K7VA 3NXFA 3CGTA 1VFTA 3UBPC 1UWRA 3N19B 5I0DA 3UJRA 1IHIA 7ODCA 4C1NB 2R1PA 4J28A 2OT0A 3BDKA 4J3VA 4AMCA 3UPWA 4JTLA 1XIDA 1D7FA 1TFVA 4IXHA 4XWUA 4GI9A 1TWWA 3T9PA 3HG4A 2PTWA 5EB8A 4YHGA 4CUCA 1HP5A 2VQUA 1JRCA 1AD4A 3V5FA 1HXJA 1LL6A 1A4MA 1D3CA 3W22A 2WQDA 1KXHA 1FWWA 4AVOA 4C91A 2IMRA 1W3TA 2HBVA 2GQAA 1LWIA 4ZCWA 1D2KA 4B2DA 2VDHA 2AGKA 1ONEA 2RDUA 5FKYA 1EJ7L 4EXAA 4NAEB 3MZ2A 2WMIA 3ES7A 2V3GA 4YHEA 2PDGA 3TJXA 4MMWA 4I6VA 1ONXA 3GNXA 1ONWA 1Q63A 1TPFA 3QMSA 4OWGA 7ENLA 3ANYA 4S3AA 4RDZA 3W7EA 4PFMA 2W92A 3CV2A 1TRIA 3CWOX 3W1XA 3C2EA 1AL8A 1OK6A 2J6XA 4LALA 2C3ZA 3TYAA 1VS1A 3VKKA 3DUGA 4GXPA 3W00A 3W86A 5I78A 2D24A 4HVXA 2XWDA 3GH4A 3ZIZA 1LM1A 4INFA 1B9ZA 1R3WA 2QPXA 3NSMA 1OINA 3WQOA 1VIZA 2X7WA 4UOJA 3N9RA 2DSWA 1R47A 3UWUA 2PEVA 3MKKA 2Y88A 4PUJA 1QNOA 1KTCA 5J8LA 2ZUSA 1C3FA 2GFTA 2ZDRA 4FX6M 2E67A 2QPSA 3SADA 1TWZA 4UCFA 1C90A 1BGAA 2V81A 3GAYA 3IUIA 2DQWA 3E2QA 4UXDA 3LYEA 4P5UA 4D6IA 2QPUA 4GZ7A 5D37A 1YW1A 4BF5A 2WCSA 4JFTA 2GGJA 3GDTA 3GVQA 3WBEA 2GVJA 1GK8A 1ZFJA 2VEFA 4J1OA 1MUMA 1S1RA 1JPIA 1NWSA 4O1CA 1Q6QA 1BG4A 3TYUA 1E9ZB 5FJUA 5E1QA 1B31A 2Q8ZA 6REQA 1NFBA 1F8IA 3DHPA 1W31A 1BTMA 3BSHA 1HKIA 3H2NA 1O5KA 4JIIX 3K4AA 1HKJA 3QSTA 5IBXA 3RRAA 3LHZA 3GXFA 1U1JA 3XIMA 4FXFA 4JFUA 3SECA 4UTMA 1DJYA 4DUVA 4F0RA 2O9RA 2ZZ4A 3O63A 1XYLA 4NZFA 1M3UA 3FSUA 1BHGA 4G1KA 4NG3A 3TXZA 1H09A 3FY1A 4KESA 1HL2A 3IARA 4A6GA 3VO0A 2Z1SA 2X09A 4NZ5A 4LVBA 1RD5A 4WK9A 4H4IA 1PYFA 3BG3A 3OZMA 2EPMX 4RPQA 3TW6A 3UJEA 2NVCA 4D1IA 3R8GA 3UU0A 4W87A 2G4JA 4ZXOA 4B9ZA 3QMRA 4KRUA 1H5VA 4GXMA 5CSSA 1GHRA 3WBYA 2QJJA 4IUOA 1EIXA 3H12A 3GTIA 2R6OA 3VAVA 3HQ1A 3R13A 4BQ2A 1QAPA 2WHMA 3HMJG 3VNYA 3LY0A 5LHFA 4Q4RA 1CZ1A 4P7OA 1W9DM 1NDZA 4B5WA 4LNCA 2JKAA 4GYPA 3VNDA 3WMBA 1VQTA 4Q33A 5IXEA 3ZQ9A 1A5LC 4N02A 3GY1A 3KHJA 4ZXLA 3GC5A 2E25A 2WPBA 3RR1A 4HA0A 4PB5A 3SJNA 3DFNA 4G9PA 3DYPA 1KGUA 4UFJA 3AWOA 3F03K 4BA0A 3KFTA 3KEHA 3LCWA 4DRSA 3AUJA 3B0UX 4Y6GA 3DN5A 3SAZA 2YZRA 5BOEA 4MJ4A 4J3ZA 4HOXA 4N9CA 3DFQA 4G8TA 5C70A 3GTHA 1DVJA 4IPNB 1JCMP 5MKGA 1XDLA 1XLKA 1E0WA 1PJ9A 1A47A 4JTQA 4PUDA 3XISA 2QCLA 2F7FA 4OT7A 1A49A 3VGGA 2VEMA 3QOKA 1GKRA 3A4AA 3IS4A 3TN5A 4J3TA 1RXOB 2OGYA 4RW3A 1YEYA 4HA3A 4NAEA 3H7RA 2WMIB 1AJZA 2WMKA 3CZEA 3W6LA 4HBKA 5CPQA 4RKAA 3WIJA 1JUKA 4R34A 1XSJA 3R0UA 6ALDA 4HD5A 4W9TA 2DVUA 1JGMA 2TPSA 3UA3A 4DELA 3CHEA 1OYCA 1LL4A 3P8JA 3V1HA 4QSHA 3H22A 1JXKA 2PFHA 4O28A 1BWLA 1QO2A 2MNRA 3KS6A 3STEA 4P2VA 2RGMA 3BWWA 4WJ8A 2F84A 4LCQA 1DIKA 3K4DA 4OOZA 1K7EA 3HGJA 3RIKA 1XRFA 3ZJ6A 1UIOA 5H1WA 4GJJA 4WZHA 2PDWA 1W9UA 2J8TA 1UMLA 3BJTA 4MY8A 3M6YA 4AD4A 4O19A 2UWFA 1Q66A 4DBWA 1PIGA 3QBUA 3UZJA 4UOZA 1V08A 1I0DA 3L2IA 1YTKA 3IV3A 4WR3A 2VJXA 3QPZA 4M7TA 3FEQA 5EFFA 1UWUA 3JU2A 2OKOA 4YTRA 4K1GA 3ZJ8A 4GIRA 4UTJA 3HJZA 4GY1A 4M80A 1UP3A 3MB9A 5A94A 1FP9A 5DMMA 2YR1A 3OHMB 5LKYA 4IP4A 3TSDA 1TIMA 1XRSA 2WJEA 3M47A 2C0HA 4DJEC 4FNRA 1TSIA 3GNNA 2ISWA 2ISDA 4FHAA 4H01A 1JZ3A 2FHBA 4C6CA 4WCJA 1DPMA 3VIIA 1MZRA 2WM0A 1UH2A 8A3HA 4CCZA 2CZ5A 1JZ2A 2C13A 3LI0A 1H1NA 4L5ZA 3WQDA 3HFTA 1OC7A 1Q85A 1TTIA 1UR9A 2ZRUA 1X98A 1HL8A 4P8XA 1UJQA 3KVLA 1V3MA 1V4YA 3WQPA 1ISYA 2J7HA 4H1ZA 1QW9A 5F4XA 3R6IA 3ZLHA 1W1ZA 3CZKA 4LC8A 3HF3A 4L61A 4GQRA 2O0TA 4ADSA 4NT0A 4MY9A 2PDQA 2OZTA 1JULA 4JNMA 4S3GA 2PURA 4GH1A 2PLCA 1BKHA 4C7DA 3HQNA 5D8WA 3V18A 2PTZA 1CXKA 1TPVA 3KOYA 1G67A 3M46A 2CLEA 3NVTA 1ZCCA 2VRJA 1J12A 5EBAA 3LHUA 4XTDA 3QZ6A 3L4XA 3EPNA 4JXCA 3ZLGA 4DJFC 1G4TA 3TN4A 4WX2A 1SO4A 1JCNA 5CZJA 4J40A 3S5OA 2ZXAA 4IIFA 3WK2A 3HA1A 4PC8A 3OW1A 3N9KA 2WYSA 2PGFA 1JZ8A 1O5QA 2C15A 3H2CA 1Y7VA 4DQWA 3BV7A 4B5NA 4ZQPA 1JCXA 2VR2A 1W5MA 1HL9A 1ONRA 1REQA 1ZHAA 4S3KA 2IW0A 2RH9A 3UG3A 4UCGA 4AIEA 4JN6A 4WKFA 4OIFA 5HMEA 1MFUA 4MFDA 3EMQA 2P0IA 2W91A 1QPKA 3QLLA 1IV8A 2HE8A 1MWOA 4MWAA 4TOQA 4O18A 4H04A 2WZMA 1AJ2A 3WN6A 2ALRA 3PS7A 1PEZA 2ZTJA 3TVAA 4Y9MA 3UQNA 4LPCA 1JDFA 3MY9A 2G4FA 3OYXA 5LIXX 4DVOA 3AS1A 4JIPA 5KZDA 2V82A 3EPOA 3RM8A 4FR1A 2Q6ZA 3MHFA 1S2WA 4UQ9A 1KXQA 1ZCOA 3RM4A 4IFOA 3C0QA 3LI1A 4P7LA 1ITCA 1GWJA 3GG7A 3FA4A 3KE0A 2DT1A 1OCBA 4AD5A 3PBUA 5CZ0A 1OZMA 3AHXA 4Z2JA 3W82A 5E6ZA 4KWWA 4M29A 1AW5A 2P50A 1JD9A 1O5XA 4HYRA 3MO7A 2Y7DA 2E6YA 1DOSA 1J0HA 2ACUA 1T7LA 4AU0A 5SWUA 4U31A 1OIFA 2OO0A 1GOOA 3N6HA 2OZ0A 1F3WA 2VP8A 2GSJA 5D2VA 2G37A 4MAZA 3MBFA 3CEUA 2FTYA 1X1NA 3W76A 4E4UA 4BQ3A 4FLOA 2GZXA 3NEHA 3ARTA 4HJWA 3VTRA 3FKKA 1GEHA 4FZIA 3WELA 2VL4A 5K9CA 1VPYA 3LBMA 3JS3A 1EHAA 5CG7A 4JFWA 2Y4SA 5IRPA 3PUEA 5DY2A 4CKQA 1ESWA 3VNMA 4UBPC 2GUUA 3BW4A 3U6WA 3TN6A 4AEEA 1SR9A 3PZGA 3IUDA 4ZEPA 3CB3A 1DIEA 4KGLA 1JDCA 3ZO9A 2NXGA 5HWJA 1UQYA 4S1FA 3W2UA 5DRIA 1K8CA 4DM1A 1AL7A 3LERA 5CC6A 2CBJA 4CLMA 3LTYA 2R1MA 4AZGA 3BXWA 1XKYA 3G6LA 4GRSA 3UY8A 4RV3A 4LS2A 1DEDA 3RMJA 3TWBA 3C52A 5CAHA 4PH6A 3G1RA 1OFAA 1RPXA 5KITA 2ZRWA 1N8FA 1SFTA 3UR2A 4AF0B 3WF2A 3H6OA 2YBUA 3TAOA 2ZWYA 1I8JA 1J6OA 1KM6A 4O14A 5FESA 1V6VA 2P76A 1J6PA 2BXYA 3ANUA 4LAUA 2OEMA 5F2GA 1DWAM 4B9YA 4QJ1A 3PBVA 2BHYA 3RFAA 4NQ1A 3N14A 4S3EA 3LMZA 1AH3A 3KCJA 3KTSA 4D1JA 3AZRA 4EVZA 2PSNA 3WLSA 1Q5MA 3Q65A 4EF8A 4LF1A 1MW2A 3ARRA 3CH0A 1Q6LA 3W0KA 3S5NA 2P3ZA 3UZ5A 1H61A 1K03A 3S2JA 1HO4A 2C19A 2INFA 3H8AA 4D6HA 1NWUA 3WBWA 4H41A 4HN8A 4LC6A 2VYOA 1SO6A 5ABEA 1H7WA 1JL8A 1Z7AA 3OGVA 1UD6A 4DXKA 5I3JA 2PDFA 3I7RA 1OY0A 4N0RA 3NO3A 3W9ZA 3CQKA 4K6AA 3TW9A 4QCEA 5C8BB 3SIZA 1ICPA 2PF0A 4MTVA 3W28A 4LSBA 5LIKX 1W1YA 3NZRA 2NT1A 3WMCA 4RNFA 5JU6A 2VHLA 5ENLA 3VIGA 1AZ1A 1POKA 3SQSA 2W27A 3ARWA 1HJXA 2AOSA 1JI2A 2FIQA 1B3VA 3WH5A 3M0HA 1CB2A 2C1HA 5TAOA 5LNWA 3H2MA 4YYFA 3CUGA 2Z24A 4AG0A 1KXTA 2WJZA 5HK4A 2QUUA 3B8TA 5D2TA 3TW7A 3IK4A 4Q22A 4WSHA 4FALA 3HG2A 1UD2A 4JTGA 5LYRA 1VFFA 4KKXA 2AKZA 3BMVA 5ABFB 1E71M 1C7TA 4BK9A 4M51A 4XV0A 4F66A 1C8QA 2DDXA 3IAQA 5ABHA 3DAQA 5GNZA 3B8VA 4JX6A 4UIOA 2XVNA 2DPEA 4D6DA 2WSKA 1RHCA 5IHRA 4KETA 2IPJA 4QEHA 2ABBA 5C9WA 2QCDA 3K13A 3HB9A 3WUEA 3O16A 4DM2A 2RHGA 2Z00A 4D8AA 4PEKA 4YVVA 5AYXA 3WH6A 4LUYA 1LDCA 5EBUA 1EA0A 1E1FA 3LCHA 2E8ZA 2GVEA 4O1EA 1KM2A 4H83A 1H60A 1YDYA 1KFBA 2HPIA 3PTDA 4XX6A 1E40A 1XQKA 2J27A 3G1XA 4GQBA 5HA7A 5DBUA 3OA3A 1JCJA 4AC7C 1NEYA 4EXQA 2Y0FA 4J4KA 2XYLA 3DCPA 4W5ZA 3VMNA 4GYJA 4AD0A 1TV3A 3H24A 4R27A 5FA5A 1MUCA 4YTTA 1R3SA 3M9YA 1DQXA 5DMYA 5A8PA 1IF2A 3AIWA 1PE1A 1QI4A 5A6KA 2NSXA 1LG2A 3NQVA 1YIXA 1UPPA 3KOFA 3NNTA 3NFUA 2EPHA 2Y2WA 4LAZA 1FH8A 3HGRA 3Q67A 5F4SA 3IAPA 4MADA 6PTDA 1DBTA 1FA2A 1UC4A 1W6TA 3M0IA 1CECA 5TIMA 1ZU8A 4LRSA 4TMCA 3TIMA 1AW1A 1QDSA 3TZNA 4IXXA 1IQ8A 3MBDA 3USZA 4LGXA 3NO1A 1J0IA 4KH2A 7TIMA 2NSOA 3SUVA 3VE9A 3NTYA 3T81A 4WDTA 1PZ1A 4V28A 3C5QA 4F0LA 3W1RA 4WJXA 2GJXA 2A79A 3PZOA 1KBIA 4QIUA 5CQ1A 1EPXA 1KBKA 1E6SM 2YFOA 5CZSA 2QJMA 1I2QA 5F2MA 1O7AA 4HA1A 1TPC1 4TV5A 3EKLA 3WQCA 2QCHA 3IK2A 1F3TA 3G22A 4K8EA 4UNKA 4UTKA 1F6KA 2DIEA 3OG2A 1N55A 3QGAC 2CITA 3BJFA 2W63A 4I3GA 3BL3A 3AMDA 6XIAA 1DTUA 1C8VA 4Z0JA 1QI3A 2BOEX 1J8VA 1SFLA 3ARUA 2PODA 3S1XA 3WNNA 2DJXA 3G3DA 3GO2A 5IDZA 1Q65A 4WD0A 3N6QA 3N12A 2WM1A 5A8NA 2XWEA 2E77A 3KBSA 4AZIA 1EA9C 1SW3A 1TR1A 2WZIA 3QFWA 3CYJA 5XINA 2V67A 3TXVA 4E6MA 2E5CA 3LG3A 3HQOA 1TX0A 1NTHA 1D7KA 2WZEA 1Q6OA 4TO8A 4OUEA 2VCCA 3LK6A 4KRTA 2WBKA 5JMUA 1B4KA 1V7AA 3NGFA 1OX5A 2OQHA 1GW9A 1FWTA 3B0VC 1J2WA 1M41A 3CPRA 3ARQA 3EA3A 4GI4A 2GOUA 3MMUA 4QAIA 5DN1A 5BXTA 6ENLA 2PWFA 1W56A 2ISVA 1IIGA 1LLWA 3EX3A 3WCZA 4CQCA 4JYDA 2VGFA 4M6PA 2F2KA 1B3XA 1Q6CA 4GVGA 3T09A 5CSUA 4CD8A 4QP0A 3CZ8A 9XIMA 4DWSA 6TAAA 4O57A 4YNGA 1YNYA 3GDBA 3E12A 4WKHA 3FK4A 4NZ4A 4CNOA 3DIPA 1P1XA 4DAFA 4GQQA 4PSRA 4H9ZA 3NSNA 2OYMA 3PANA 1UKPA 4GQGA 3O05A 3GYCA 3TTYA 1ZBCA 1WQ5A 4IFRA 5HOSA 3EXSA 4UTTC 1JCLA 1W3NA 4DZHA 2W5FA 3KVKA 1KKRA 4RXGA 4I5UA 2PDJA 1DV7A 1Q13A 3KOZA 3R0KA 1Q45A 5BXSA 4W86A 3PUDA 1JFXA 2YGYA 4MF4A 3MI3A 4D6EA 4HIBA 2NX9A 3WK1A 3NR0A 2ATMA 4FAMA 1DWHM 4GUGA 1LROA 1RLDA 4LV4A 2ISFA 5BOOA 2PWHA 4UZUA 2ZOXA 3ZR4A 2HXTA 3A3WA 3GFYA 3QTPA 2QEZA 2YA2A 2GDQA 3MTWA 3SBFA 1KNWA 1GKQA 2V3EA 3N4FA 3SQMA 6XIMA 2FZ8A 4B92A 3ERPA 4Z2LA 2NWSA 4TX6A 3OVRA 3QV6A 1JUEA 3B03A 1KA9F 5JBFA 3MDWA 1LZOA 3E02A 3L4YA 2G5WA 2DZVA 3PZIA 4PMYA 5CBIA 3WNLA 1VHNA 3ZR6A 4XSLA 4GCXA 1DJZA 1DJNA 3VU2A 1EC8A 2VWSA 1M9HA 3SN1A 4S39A 3NURA 1DHPA 3CUFA 3OBKA 1V93A 3WQ5A 3T08A 2X0SA 1NQKA 1VBGA 3CO8A 3AYRA 2CYGA 4DLMA 4NVTA 1BAGA 4Z2KA 4Q3MA 4LOCA 4DIAA 2NVAA 5LGXA 4S3BA 3VUPA 2PP1A 1JIBA 1ALDA 1HIZA 3I3BA 4GUHA 5HR7A 1VYRA 1M65A 4BQ4A 3AO0A 3L4VA 4LEFA 1EF3A 1KFWA 2ICSA 1AZ2A 4EAYA 4CN1A 6CGTA 2JF6A 1EFZA 5CPOA 1OWQA 3NPWA 4ZODA 1ISVA 3HV8A 1OYBA 3KLLA 3MJMA 3OVPA 5K4XA 4NZ1A 3UETA 1V3JA 2BSLA 3EEGA 2YDAA 4PUUA 2DVTA 2P8CA 1UWAA 3A64A 3ZZ1A 5XIAA 4Q7BA 3PSWA 3SSZA 4MJ2A 1B3OA 1ZB5A 3J7HA 4QJ3B 3DFTA 3GFXA 4IMEA 4JL1A 4L4PA 3HU7A 4JKKA 4U3CA 2I5GA 4UMBA 4ALDA 2NQLA 4Q7IA 2I16A 4XD4A 5A6AA 1WDWA 5MHBA 3RJXA 3S1WA 4WQ6A 2E9LA 2YKKA 4EWJA 1XYZA 4LVFA 3PPFA 3LZ5A 3H23A 3WQGA 2A21A 3GDMA 2G95A 3W2JA 4ECLA 1DQWA 3H7VA 1RBLA 4ZMGA 5AVNA 3TNBA 3WD2A 1EDGA 2PGEA 2PD5A 1UHVA 1BGGA 5LZLA 3W87A 1PPIA 4ZQRA 1BG9A 3E0IA 3QKEA 2C91A 1WPCA 4NX5A 2QGYA 4UOQA 3AOFA 2X40A 1KR1A 3C8FA 3SRDA 1M6JA 4GFIA 1UR1A 3LPFA 2YCLB 5CSYA 3KBVA 4B16A 1IT7A 2PDYA 2DQXA 3VIOA 6TIMA 1WXZA 3S4TA 4HQVA 1A0EA 3U0HA 4PRRA 4AY7A 4PTMA 5D2XA 5TQLA 1MQPA 3QR0A 2HXUA 2WKLA 3EB4A 1L2UA 1TV5A 1TG7A 3F1QA 3CU2A 4GA8A 3VCCA 3NZ1A 3EDFA 1ZJIA 4LBSA 5JIPA 4DI8A 3QHOA 1NH6A 1CLVA 4W7WA 3AIUA 5CPNA 4GE8A 4WVXA 1QHPA 2YDRA 2D2HA 1JRBA 4C6BA 3AIBA 4A4AA 3G1FA 2GDVA 3GM8A 3TQKA 1BXBA 3FIGA 4DY1A 2OYLA 5I7GA 3E5BA 4BQ5A 2BLEA 3TTEA 1A53A 1AH0A 3F4CA 3PG9A 4GVFA 4Q8PA 1ZTVA 1EX1A 2OYKA 4EAMA 5AB3A 4MWAE 1FWIC 3TDFA 5FJIA 3UEQA 3BCJA 4XUYA 4MGGA 1NELA 3GTFA 3S9IA 4A8IA 2WVVB 2XN0A 1ZGDA 4PEEA 4MNMA 4DF0A 4FLSA 2Y63A 3QW4B 1MW0A 1L0PA 4QE4A 1LLOA 3C2VA 3GU9A 2Y8KA 1POJA 3UXAA 1Q7QA 3NL3A 2XH4A 5D33A 2F38A 1ECQA 4K36A 2Z6IA 4A8NA 4XB3A 4AZ6A 1R2TA 5CJMA 3N13A 4M6VA 3B04A 3G1HA 3JVAA 3PBGA 1A5BA 4WDWA 1L2QA 2H3BA 1UH4A 1FDZA 2GSEA 4R7JA 2WAGA 2WV8A 4ILSA 4KEMA 2GPTA 4MB4A 3MYPA 5TBOA 1KFJA 1PO9A 4ERIA 4IL2A 1J5TA 3W7MA 2ZTKA 1EUNA 1IT0A 4KERA 3HM7A 5IOBA 4IQEA 4H8VA 1WZAA 3MQTA 1OT2A 1C8XA 1EF2A 2PGRA 3QXBA 1JCYA 3VDCA 4P7NA 4CGTA 2G8ZA 2P53A 1K77A 5KMYA 3NQEA 4RLIA 4E0CA 4FB7A 4N6EA 1MYRA 1YQ2A 3H26A 3QQ0A 4BF9A 4QE1A 2E68A 5AHFA 5C5YA 5JH1A 1PX8A 4ZSUA 3WDIA 5FIPA 1R46A 3HZ3A 5CAKA 4R9OA 3W7NA 4KFNA 4E4FA 1F3EA 3KZPA 2XZ9A 3TTOA 5BU9A 5AHMA 3C4UA 1W3JA 2D2GA 4UTWC 4TVCA 3UYIA 4YWSA 3C0SA 2ZDSA 2HNEA 4XZNX 4AY8A 1ISWA 1B2YA 1E1CB 1EJSC 1I1WA 4IM4A 1NP0A 2HBXA 3STGA 2J9XA 3ABOA 3CPGA 1OIMA 2WLZA 4M81A 4ZOBA 2TMDA 4XZWA 3U48A 5KZ6A 2YB4A 1EZ2A 4R33A 1NIUA 2PLJA 4BZYA 1K4HA 2O92A 3WD3A 2D23A 1K70A 3MUY1 4ZVJA 1NVMA 2OLHA 3LHWA 2PLKA 1LQ0A 3CHDA 1JJKA 3M5XA 3BARA 4I8YA 3AYSA 1ODUA 3GG0A 3RO8A 3USBA 3WD1A 1I75A 3EA1A 1E0TA 3ECQA 4QLLA 2ASHA 1IZCA 3PR2A 2QHAA 3CHFA 3SN4A 3WBXA 2HS8A 4NYYA 3HGOA 1W0MA 2XVGA 2Y62A 4FX8A 4XZHA 2FJUB 1VHCA 2ZUTA 3GDLA 2I56A 1MSSA 2J66A 3G2GA 1R9XA 1PDYA 3AYTA 3GVRA 4Q4QA 1M7PA 5AKQA 3B05A 1HKWA 3BLFA 4PL2A 1BF2A 5T26A 2P5NA 2BASA 1XHGA 4S38A 5G4WA 1LUCA 2PGWA 1AFSA 1KRBC 1ZBWA 2B7NA 2XIOA 2OVLA 2WVVA 5FCZA 3PBYA 3B4YA 3SCTA 2XJ7A 1CLXA 2JALA 5DFAA 3G77A 1UROA 3NUKA 4EACA 2C0AA 3ZWTA 3TEVA 3EDKA 1UP0A 1W9XA 3UJ2A 4ACYA 3O15A 1P6WA 4GQ0A 3N29A 5LXXA 4Q32A 1FXPA 1MEHA 3I6TA 4KWUA 1Y8BA 4LRTA 3U8GA 1EDTA 2G0WA 3VZZA 2ZUNA 1Z6KA 3P61A 5AC5A 3TNOA 3H7UA 2EKGA 1XFCA 3VDBA 5AYBA 1N7KA 3IJ8A 3RNDA 1JYWA 3N34A 3CPUA 2ZRYA 1KBLA 1OT1A 1VF8A 3S3GA 3W2LA 3BLPX 2CLLA 4S2CA 1H49A 4MHBA 1Q8JA 1C92A 2ADAA 3MYOA 1VFOA 2GQ8A 3BANA 4LV9A 1FHDA 1DIOA 3CM4A 4KBXA 1SUXA 4GZIA 4KWOA 5JUVA 4PMVA 3KLKA 2PE4A 2GK1A 2XU2A 3GIPA 4QISA 1K7FA 1A5NC 3WX7A 3YPIA 1UA3A 3UXDA 3TUUA 3LPOA 3AJXA 1OG0A 5FEZA 3GE7A 1GYMA 1EIBA 3M43A 3DC8A 4DJED 2O9PA 3VIJA 3DHDA 3BSMA 5K9XA 5FJOA 5A6LA 5AN7A 1OX6A 1DL3A 1BWKA 2QT3A 1A50A 2AMGA 2ZXDA 5A2CA 2OTDA 3LQGA 3RX3A 1JYNA 4N7QA 4QROA 2P88A 5A6BD 1VYPX 4KQNA 1X38A 5KETA 2BP1A 1XWYA 3E96A 3UNTA 5JH2A 5FAGA 1OF8A 3WZ0E 5DMNA 1GZJA 2V8ZA 3C61A 5I24A 4JICA 3K30A 2Z4GA 4RL3A 1QNPA 3LXCA 3BG9A 2B0MA 3W1QA 1GVYA 3W75A 1PZ2A 3SDOA 1YHTA 4F48A 2EF9A 1ZALA 2YL9A 3R8RA 1AQ0A 4JPGA 4CU6A 1TTJA 2VXNA 5A6MA 2J7EA 3CT2A 2V5CA 5DO8A 1FKXA 3OZOA 3E49A 4MY1A 3ZOAA 4AZCA 2PC8A 1LOSA 2FZ9A 3WQEA 2DZSA 4L6OA 3A5VA 2CIPA 4UR7A 5A8GA 1CBGA 5C7VA 2PDKA 3WO8A 3I7SA 3WNOA 4ZQNA 3FV9A 1L8NA 4CNTA 3MPGA 3BE7A 1QI0A 3GXDA 3OVQA 3R0DA 1E5JA 4ATDA 4KT2A 4CD4A 1V03A 5FF7A 4AFYA 3P67A 3ZVHA 2OO6A 3WQWA 3DHFA 1NOUA 2I5IA 4MWAC 4PYSA 5BU6A 4HNNA 2CESA 3N4EA 5I3DA 3QYQA 3GX9A 5AC8A 1WXJA 2P0OA 2DT0A 4ZA0A 3N04A 3I65A 1V77A 1F74A 4V2XA 1V3LA 3SFWA 2VX6A 4Q4SA 4KEZA 5C6MA 1QHOA 1P0DA 3JUGA 3S5YA 2ZX7A 4F9DA 2B81A 1HUVA 3LRLA 1W1PA 3MS8A 5I6SA 1THFD 3EOOA 3LCFA 3W72A 3OLDA 1V7YA 7TAAA 2Y8VA 4XAPA 5FACA 3LXAA 3TMLA 2NQHA 3POCA 3KBWA 3SCUA 5M5DA 2WSPA 1VEPA 1B90A 2PBGA 3CAQA 4X3ZA 1XINA 1VRDA 1H4PA 1OGGA 3EOSA 2VQTA 1GVQA 3TSMA 3OZPA 1JGIA 1R3QA 2VTFA 1JVNA 4M7SA 2YFNA 4I7WA 5A8MA 3WH8A 2VC5A 1I2PA 1QJWA 1RD6A 1KFEA 3ZT6A 5IFPA 3SUWA 2D3NA 2DZTA 3FCPA 4CVUA 4DNMA 5F4WA 4KS0A 2IQDA 4HMDA 1QOXA 1QMLA 1EJUC 2DSZA 2PWDA 2J7CA 2PS2A 3VOFA 5T9BG 2WHLA 4OKDA 2IKIA 4LEQA 1US2A 3JR2A 3IEBA 3PZMA 3DERA 5U4NA 2WJDA 1R7OA 3THQA 4JTKA 4R9XA 2WCGA 2DU2A 4PUEA 4JTIA 3W1TA 4HSNA 2A0NA 4AEOA 2V6AA 2J7DA 3P7YA 4K37A 3C2YA 4DAIA 1IYXA 3TR2A 1XRVA 2PDNA 1WZMA 5AHNA 1V6UA 1W2VA 3WL1A 4MOZA 2NUXA 2ZC1A 3P81A 1W1A1 1KFKA 1P0NA 4UTFA 3R5EA 2BX7A 2ZVRA 3QC3A 3K1GA 4GK8A 4GHRA 5G5IA 2VEPA 2XVLA 1NDYA 3NPVA 3VE7A 4Z1AA 1OEPA 4Z1YA 4GNJA 4DBEA 1MMFA 3WDPP 4YN5A 4RPPA 4U2ZA 4MB5A 2YB1A 1OSEA 1KFLA 1XCXA 1EQPA 2D0FA 3B9EA 1BRLA 1F3XA 3NQ6A 2POTA 3E0FA 2HISA 4LUTA 1Q4WA 1KCLA 2YLLA 4IMFA 1VKFA 2G3IA 5K9DA 2R9RA 1UIPA 3DENA 4JD4A 5CKSA 3MP4A 1P5BA 3V3WA 3IRSA 4ZENA 1UA7A 1BPLB 3KRSA 1E0UA 3BZGA 4JFSA 1YMYA 4L1XA 4DZ5A 5HUPA 4O1FA 4AHPA 4JN7A 1AD1A 3CUIA 2BHUA 1QNVA 1XGZA 4NUWA 1W1TA 2YW3A 2QCDB 2V5JA 5D2WA 3P62A 2G3JA 4QBXA 4OGZA 4K1WA 1P0BA 1EUAA 1EL3A 1GVFA 4GJIA 1CPUA 5CPMA 5EY5A 1AK5A 3NL6A 4HK6A 3CWNA 3PPHA 2DIJA 3M0LA 1H51A 3HPZA 4OZOA 3B8WA 1RBOB 4FLRA 2CKRA 2YCLA 2YPIA 4X2RA 2FHFA 4FI4A 2GQ3A 3D5HA 4O1AA 2W3ZA 4GG9A 3UP8A 4QAWA 3O3RA 3HO8A 3LCIA 3UGVA 1PYMA 2XSBA 4Z2HA 1HF6A 1AMYA 3HPAA 3OU8A 5LHEA 4C6KA 2B31A 3BG5A 1R0MA 2WO5A 1J79A 3MMDA 2Z2AA 1RR2A 3LDVA 3UJFA 2JEPA 3WQ4A 3WK3A 1J5SA 4D71A 3UG5A 4AWEA 4LXFA 3FGCA 3EWUA 3PWAA 3IGXA 1E0VA 1ZLPA 1LRNA 5A5WA 2ZA3A 3GD6A 2HDJA 4CQAA 4XAYA 1M53A 4X9YA 2FH8A 5BRBA 5GJMA 1RH9A 3DXIA 4H8NA 2GWNA 3VNZA 4DEFA 1UJPA 1B30A 1TPDA 5C9RA 3S6OA 3RM9A 4PULA 4JTDA 1TJRA 2E8YA 3G0UA 2ZE3A 1OFOA 2OOGA 1T5AA 2YDQA 3VD7A 1X8FA 4CNUA 1CNVA 2Y89A 3S8HA 3BUVA 3TYBA 3GG8A 2JK2A 4LUJA 4Y90A 3QHMA 4EPDC 1P0EA 1ML1A 3VKJA 3VXGA 1QPRA 3MV01 5J04A 1FH9A 5L6UA 2X2GA 3Q58A 4HZ6A 1B0IA 1FOBA 1S5NA 1GNXA 2OWCA 4DZAA 4UC5A 4TVUA 1DE5A 4AVFA 1BXCA 2D2JA 4AX7A 3CV1A 4FR6A 1K9EA 3GRIA 1BYCA 3B9NA 2J88A 4Q4OA 3CTTA 3MI6A 4J3UA 1GVEA 4WGXA 1EGVA 1K8XA 3STPA 1RVGA 4IIBA 4NRSA 2BOFX 1WO2A 3V35A 4IZGA 3AXHA 3CH9A 2PDMA 3H2OA 5REQB 5HBFA 3WL0A 1BF6A 4Y2WA 1G1YA 3PSVA 1REQB 1TIWA 3RR4A 3WF1A 2PWEA 2DH2A 3FOKA 4F0SA 3SUTA 2VFDA 3GXMA 1QNSA 5CC5A 1WYIA 3CL6A 1PB0A 1Z3NA 1JQXA 4DJDA 1XL9A 4S3FA 4CU7A 5DCEA 1KQYA 1W5OA 3EWWA 2A3LA 2VGBA 3N25A 1E1CA 1V02A 4NASA 1XQLA 1P1MA 2VOMA 4MAVA 1BTCA 1SM9A 2OKTA 1UWQA 2AMXA 2ZRVA 3BMXA 4R7WA 1TREA 3G1SA 1F05A 4DWSB 3T0BA 4DJEA 3IANA 2D0HA 1PUDA 3LGEA 3EX1A 2MANA 2Y61A 4REQA 4GXWA 3O6DA 3PZUA 3E2SA 3KZSA 4BR1A 3EWXA 2Y7GA 3IJQA 7REQB 1EP3A 4I7UA 2QCCA 3OOQA 3LRKA 3AMLA 1LBLA 3AIEA 4D6JA 4PMOA 2J7FA 2Q01A 4S3JA 3TKFA 5I00A 1SSGA 4HSOA 1YRRA 3MKVA 4P8WA 3FXGA 1KM0A 3U2ZA 4DO5A 5IHSA 1EO7A 3ZSTA 1SJBA 5I77A 3SUUA 3PPCA 4NXKA 5K3VA 2XM2A 1VPXA 5T9CE 3WMLA 4K7YA 3FW6A 3L2MA 4RCXA 2JKEA 1US0A 2PZNA 4AWTA 3RHGA 3UCDA 3MUZ1 4WXZA 2WOQA 1GTEA 3EDJA 3V75A 3AHYA 4LTSA 2X1TA 2AL2A 1G4SA 4GIAA 2BGSA 4RDYA 1WDPA 3PULA 3P8IA 1YXCA 3BLEA 3KUMA 2FPYA 1TR9A 1MNSA 4GZEA 1OFBA 3AMGA 1DIDA 2J79A 2QYGA 1KGXA 4TVDA 2C14A 1FP8A 3P5YA 1RAKA 1FY6A 1J11A 2TAAA 3WLNA 2OU4A 3RK8A 4C6QA 4GBUA 4O50A 5CJ5A 3OA5A 5IM51 4GABA 1FDYA 1NWTA 2NQ9A 1CXIA 4PA8A 3MKCA 3I6RA 1H5YA 4M56A 4W89A 3U7VA 4JY8A 2O56A 4M1BA 3TK7A 4UFKA 4MZ1A 4MJMA 1JDEA 1XF0A 2FPVA 2BVYA 2YXXA 4AX6A 3A22A 3M0XA 4HP5A 4QG9A 1YXYA 4FXJA 4Q8TA 1Q2SA 4AF0A 2WWDA 1XJBA 4MYAA 5FSDC 1DJWA 4GVIA 5HQEA 1M68A 1B3ZA 1EJTC 4BI5A 4GUFA 4LW7A 4QDWA 4DJDC 2GK1B 3VCRA 3FAWA 4RDWA 1E70M 2BHZA 8XIMA 1RBAA 4A3RA 4QDMA 4JY9A 5LXEA 3MVIA 3FLUA 1LOLA 4HMEA 1W9BM 4HHHA 2PA6A 1CI1A 1S2UA 2P3EA 2CZEA 3TR9A 4JYFA 3AS2A 3T44A 4N4QA 1EC7A 2WZTA 3WY1A 4B5VA 1GJWA 4NZJA 2D2OA 3GK0A 1VGAA 1FWJC 3N3MA 3ITVA 4H9TA 1TJ1A 2PCEA 2HROA 3EPMA 1DJXA 2DZBA 3AROA 3XINA 3DECA 4AZBA 1WKYA 1X6LA 3AWNA 1FHLA 3W2KA 3C2RA 3GU2A 3BAXA 1AQFA 1BD0A 1YPIA 3WNKA 1PL9A 1YDOA 1G5AA 3QY7A 3TWAA 3VIPA 1MW1A 4W7UA 1GT8A 1JCTA 4RUBA 5BRPA 2O7QA 4LNYA 3EDDA 2CETA 4DYKA 1J0ZA 5GPRA 3EWDA 4J35A 4ZFCA 1W32A 3CIVA 4ONVA 5EYWA 4I8DA 5CC7A 2TODA 3T0DA 3A3XA 4LYPA 3R25A 5JBEA 1ME7A 1E1EA 3BGGA 4ASTA 3NIYA 3QRHA 3QTGA 1R3YA 5FF0A 3CMJA 2DZWA 3HOJA 1EOKA 3LM3A 4HOZA 4CCCA 1TE6A 4R3UA 1PCWA 2UY3A 1AW2A 4B5XA 3EOEA 5DEZA 1QASA 4BY3A 2FGBA 3N2TA 3W38A 3OBAA 4B5TA 1E6ZA 2QDEA 4KWVA 4OV4A 1SU5A 1HP4A 5EPDA 1E3ZA 3RCMA 3PP7A 1HKVA 2IUZA 5IFTA 3RLGA 2Z25A 1QHZA 1TPEA 1KQZA 4MKNA 1NJJA 4V15A 2DH3A 4GC3A 4F0KA 2CBUA 1I45A 2QGHA 4MVAA 1SJDA 3OYZA 1XYAA 3IWPA 4Q4PA 5EGRA 4A3HA 4C6NA 1V5XA 2YIHA 1IEVA 4LWWA 2OWXA 4JGDA 3U4AA 1YPXA 2BY1A 2VD8A 5I06A 1J96A 3ITYA 2Q02A 2XN1A 2ZVIA 1TJ0A 2PU1A 5DLCA 2ZBTA 2CW6A 3VMOA 2BBFA 4US5A 4CCEA 4N9DA 2GVLA 1KWGA 1TPWA 2Z0IA 3R10A 4IGMA 1XPGA 3KWSA 4PMZA 3OB8A 4HMCA 1M1BA 2XGZA 1RA5A 4PMXA 3QPEA 2OB3A 1TPUA 3M16A 1WKEA 4ROQA 4ACZA 8RUCA 1QT1A 4A3QA 2CLPA 5E6YA 2EG7A 1WZLA 4UQCA 4C6OA 3W83A 3P6LA 4Y9OA 5HNTA 4XIAA 3DFPA 3EX2A 1HX0A 3WFLA 2AAMA 1LT8A 4GVHA 2WXDM 5DF0A 3O2LA 3GS6A 1W1IE 4OTKA 4H7ZA 2F6UA 4DJFD 1GYLA 3L65A 3AS0A 4Q8WA 3PUGA 2YA0A 2YX0A 3MI2A 1XLLA 4QSFA 4Q4MA 4I5RA 3EWYA 2VFEA 2G96A 4TV6A 2EBNA 4EXBA 3FX4A 1NY1A 3M44A 5HWNA 3VDAA 3CL8A 1TX2A 1R2RA 5A8QA 3U4FA 4DJFA 3C0JA 3BC9A 3AU2A 3AHZA 1L6WA 4H2CA 2DV0A 3NQ8A 4HK5A 1CDGA 3PVFA 2QXWA 3LENA 4HHPA 3W1MA 2ACQA 1EWEA 1IIHA 1Q7ZA 2HRWA 3TOPA 2MUCA 2FPTA 4ORIA 4GX8A 2O9TA 3C3NA 2Y7FA 3MMTA 2XVPA 3C2FA 3MV11 3PAJA 4PUNA 4UUIA 1EXBA 1HZYA 3DU0A 1C29A 1UCWA 4GGBA 2HK1A 3THCA 4PCTA 3LPGA 3FDGA 4ICMA 2AGTA 4U5KA 3S83A 1Y5WA 1ITQA 3COTA 1VZWA 1G94A 4DO7A 1U5VA 4NJHA 1CXLA 3D0CA 1PTDA 3HJEA 3C0LA 1KRMA 1UR2A 4ZQCA 5DT5A 2ZC8A 4NNAA 5E0CA 3M5ZA 4XKYB 2GSHA 1GOWA 1MEIA 4OBRA 1H41A 4AAJA 1XIBA 2E9MA 4AISA 2QCMA 1TWSA 3GUWA 2CKSA 4NY2A 3LTPA 1TMLA 5H6HA 2A3EA 1UUQA 3GYEA 4H2HA 5HPOA 2BODX 2GQ9A 3N15A 3R58A 1TYGA 4PUKA 2TRSA 1LBFA 3BOXA 3JZUA 2OLSA 5HATA 4JIRA 2HTMA 3AXIA 1RK5A 4IQJA 5D38A 4ZQOA 2ZX5A 1Q7MA 3PB0A 4Z0SA 5G1YA 5I5RA 4EK7A 4CNPA 3OBEA 1LJYA 5H8PA 4V1YA 2WSRA 4HN4A 4O13A 2PB1A 5I09A 4V27A 2HNHA 4IG2B 2SFPA 2L5HA 5LIUX 4DWSD 4AIUA 4CEUC 2FGLA 3KP0A 2PTDA 1QI5A 4E4PA 3DEQA 2C1GA 5GQBA 3G0XA 3VOHA 1IT8A 4C6MA 2WWCA 1XSKA 3BK0A 3VILA 3B0XA 2WNWA 3S2CA 4GPNA 2DSUA 2DZAA 4F4RA 4G7FA 3GW3A 1JZ7A 3L12A 3FYPA 4JR5A 1JNDA 1RVKA 2XN2A 4FNTA 2H9AA 1LWHA 1PHQA 2FQIA 3FDKA 3GC2A 1XM3A 4F40A 4HZMA 4HGXA 4XTIA 3W1PA 2NV2A 4E38A 5RUBA 3URAA 1JYVA 4C7FA 1LLZA 2YXGA 4NIRA 1J9YA 1JF5A 1BFNA 1EPVA 4J2PA 1I0BA 4JIQA 2XDFA 4UMAA 5A2BA 1MZHA 3WLPA 4PMQA 3QC0A 3TYEA 3KW3A 3NG3A 5F7UA 3IJ9A 4W93A 3DOPA 4TTUA 1CT5A 3CV7A 4HNCA 3O6CA 4K3ZA 2AQOA 4O15A 2IS7A 3MW7A 4IJBA 4O54A 1QPOA 1RV8A 2Z6JA 2CWNA 1FWDC 1U83A 4IFKA 2BFGA 1VENA 3S9ZA 2E0PA 8CGTA 3PF3A 3GTNA 4HPJA 1K9FA 1FCQA 4H8UA 3M0MA 4PUMA 5B7YA 4EPKA 4JKMA 2VRKA 3UZXA 4ZE5A 3B06A 2BVWA 1R9YA 2WJFA 3S2NA 3AXXA 4JTHA 2CHOA 4B5SA 1LQAA 2GDUA 4UTWA 1SMAA 3F7JA 3GSMA 3URQA 2E40A 1R5YA 1D8CA 3LUTA 4K2SA 2EPKX 3HPFA 5LA1A 1K6WA 2PWUA 5AYYA 2YL8A 1CGYA 2YW4A 4L9ZA 3VZXA 5CJNA 5F2IA 3WKZA 3O6YX 3C86A 3O07A 1IXPA 4OV9A 1UZHA 3M7WA 1J4EA 3V0SA 2UV8G 2NXIA 3ZR5A 1AQMA 3WLQA 4XKYA 3MP3A 3HMCA 3ZXWA 2AAAA 1ZBVA 3UVIA 3IIXA 2HCVA 1PXGA 4NJIA 4PBFA 4EOUA 4FPSA 3W23A 1A3WA 3H70A 3UXKA 3CXOA 2QUTA 5D9PA 1S3HA 2A7NA 3M0VA 3VNLA 4QE5A 1J0KA 1Z32X 4QEEA 2GLKA 5D2YA 1VH7A 3RYSA 4EF9A 3OGSA 1TA3A 1G4PA 1XBXA 5E70A 4BCEA 3GU1A 4LU0A 1SW0A 4HA4A 1QWKA 3TC3A 1PIFA 2YCJA 4FIQA 2E5BA 1NARA 3PC0A 4GKLA 4OFCA 3SM0A 4F2TA 2PMQA 4H3DA 3QGVA 3P3BA 1H2JA 5AYZA 1W8GA 2QVNA 4ZOCA 5DBTA 2CZVA 3KM8A 2WPGA 3W73A 3BLDA 3GHUA 1OQFA 1CIUA 2FMNA 1D3GA 3WQVA 3GNPA 1XUUA 4PMNA 1ZS2A 1E43A 3P2VA 3G6MA 3LBCA 1E4IA 3T2PA 4IISA 3BOFA 1G01A 1H7PA 3MHGA 4L56A 2XGBA 3NQCA 3WD4A 3REQA 1IZKA 3R2GA 1TKKA 3DG7A 4GFSA 4HK7A 4AWSA 4JN8A 4NNCA 1NAL1 2ZXBA 1UR0A 3VNIA 2EJAA 5LNVA 2XG9A 3CIXA 4O1DA 4S23A 2H9AB 3TZFA 3AHVA 4PBEA 3GDKA 1MUWA 4IP7A 3QR3A 5A8OA 1UR3M 7A3HA 2QNEA 5D03A 3W7GA 1ZZMA 3ZT5A 5FD0A 2OR2A 4BFAA 3OEXA 3CQJA 3TCEA 3EEZA 4X60A 1WUEA 3EX6A 3PN8A 4NU7A 4AVNA 4C6LA 5CG0A 4XZMX 3QKZA 2HMCA 3WLHA 5HNRA 3L2LA 1XLAA 5HULA 2R91A 2FHCA 4TQTA 5ECUA 4AB4A 4JTCA 2J6VA 1CGUA 4JAWA 5EU9A 3TLQA 2I9EA 5D09A 3TCSA 4MB1A 4LY4A 4C1NA 4A05A 4LF2A 1UKSA 4WOZA 3VI2A 2JEQA 2VEGA 1R86A 3DH7A 2NXHA 3QV9A 3S42A 1CXEA 4TXEA 3OODA 1ZJHA 2OLAA 1FWRA 3TJLA 3ITCA 4XD5A 4YL2A 3W7IA 1GVOA 4RZ5A 2GJPA 3WG6A 2REQA 3N4AA 3BW3A 3L4TA 3VNJA 3UY7A 3ITOA 1G7VA 4UNLA 3LM7A 4JHMA 3TX9A 4YMZA 3KVJA 4DF2A 5CGMA 2BS9A 2D73A 1DP0A 2A6LA 5XIMA 2R14A 4I90A 2FZMA 3PAOA 2CZFA 4ZTXA 4BI6A 1QVBA 2DY3A 2V5DA 3THDA 1S5WA 1DJIA 1FVPA 3VC5A 1U33A 4C7GA 1F6PA 2QW5A 2W66A 5CPTA 1B9BA 1R6WA 2YCEA 4QNEA 2ZZ3A 4MDOA 4NAFB 2A7RA 3SSJA 5J5RA 1F07A 3NQDA 2VENA 4MM1A 5CBBA 5D9NA 2VR4A 1R30A 2ZE0A 2FTPA 1KFCA 1VFLA 1NF7A 4M5PA 4JQ3A 4MPKA 3H21A 1JDAA 2Z7KA 2RJGA 4NSBA 3S2MA 2VELA 3WLRA 1G6CA 2A7PA 3VD3A 1UBSA 1UR4A 4M6QA 3MUIA 4IL0A 3RU6A 1M7JA 3E5PA 1HJWA 1ZBKA 1KV5A 1WV2A 1XPYA 3C8NA 2VR5A 1EGMA 1FWAC 4PMUA 3TTSA 3SW6A 1Y5XA 3IUHA 4C5ZA 2NWRA 3N17A 3NCOA 2ZIDA 3GXTA 3FEMA 3VOJA 3MSRA 3VD5A 4AUBA 1IGSA 4J27A 1V6XA 4KFPA 1QK0A 2IPWA 4C6DA 4C65A 1JEZA 3CL7A 5A6SA 1BQGA 1K4GA 3H53A 4GH3A 4UQAA 4B4FA 1XCFA 1XIEA 4RJEA 3RGTA 2ZA2A 1VJZA 2CXEA 3KOXA 1S1PA 3W7DA 3W88A 3WK0A 4A2SA 3T2QA 4GOAA 4PMDA 2YCIX 1PX3A 3T07A 4H6KA 1GHSA 2Q71A 1UZ1A 1XLJA 4YTSA 2KAUC 5GJNA 4NKCA 1QWGA 3OLIA 1PDZA 4J3XA 5CGTA 1Y5VA 2ZZ5A 3NYZA 1Z69A 1EJVC 1K6AA 4GWEA 4JDBA 1C91A 3IRDA 1ZJBA 3IIOA 1QI2A 3QV8A 1HW6A 3WSUA 3R1ZA 4PCSA 3WLMA 2BXVA 1KBJA 2ISSA 2A1YA 1GG1A 5AFDA 1AODA 2EG6A 4O11A 3H54A 1XS2A 3ITTA 4OVXA 1TJPA 3HIJA 3PZQA 1GG0A 3ABQA 2PRLA 3NPXA 3QJAA 5D9MA 2GGEA 3NGJA 2BDQA 4BEUA 4YYCA 1Q6GA 3S6DA 5M2FX 3GQYA 4OOUA 3SFKA 4FEZA 3RPTA 3LQLA 5JIWA 1YDNA 3QQ1A 4L4OA 4MB3A 5L9FA 4RX0A 4WIWA 2HK0A 1K7XA 4E3VA 3EMZA 3SGUA 3W27A 5I02A 1S3TC 3EB2A 1PHWA 1UC5A 4KWSA 3NZGA 2REQB 5C54A 3URBA 3P0XA 4NF7A 1E51A 1O4UA 3UZZA 1EJRC 3CQIA 3B8UA 1LL7A 5JBDA 1T6MA 3SCWA 3UVAA 1QTWA 5EMJA 3AUOA 3EA2A 4O8AA 1OCJA 5CXPA 3OJGA 1QBAA 3GVVA 4C6PA 3V7PA 4L65A 1XIMA 3BO9A 2FLIA 1ITUA 3T42A 1PWMA 5HQMA 3LS9A 1QW8A 3V1PA 4H6QA 4GACA 3V36A 1VD6A 4CN4A 1TTQA 4Z1BA 3W7LA 2DZUA 3W71A 3F4NA 1LYXA 2QMKA 4YXGA 5KINA 1DQUA 4WOQA 2R1LA 4LYRA 2VVSA 3W2NA 2NLIA 2C79A 1DWGM 1OD8A 3CC1A 4PB3A 4CQ8A 1QCWA 1BYBA 3KHDA 3P60A 1NP2A 4MNJA 2OZ3A 1EQCA 3ATZA 1GQKA 4N6FA 3NWRA 4TX9A 1MVYA 1FWEC 1WOBA 3SGZA 4WKAA 4Y9AA 1E9IA 2AL1A 4HNVA 1XC4A 1SZGA 3T40A 4Q8OA 2B7PA 2OSYA 1W17A 4QNWA 1FRBA 4G5DA 3VX1A 4PUWA 4GKTA 5KZMA 3VM7A 3QPYA 2CLHA 3PUOA 1VFUA 2VC7A 4FK9A 2BY0A 2R82A 4PTNA 2J24A 3AALA 2Y85A 4W8LA 1YE6A 1IEXA 4Q6JA 2YOCA 3ALFA 3S1UA 3PZVA 1ZUAX 4L4LA 4N9EA 2ABAA 4XZBA 3UZYA 1Q2RA 1K02A 3GB6A 4QXIA 1NDWA 4E5TA 3BICA 2BV9A 3O7UA 1ODZA 4KIEA 1XX1A 2P8BA 5CPSA 4JEJA 2VFIA 2Q09A 1MO0A 3SCSA 4FLQA 2F61A 1Y0EA 2XIMA 3NQ7A 4DO4A 4RK8A 2IQ0A 4O12A 1O1ZA 2RJHA 1W3IA 1VC4A 1B57A 3CMGA 5I07A 5LNUA 4M19A 4MSSA 1IEQA 4D72A 3MUXA 4F2UA 1SGJA 4NHVA 3GBDA 5JVLA 1M01A 2BY2A 3P5ZA 1GEQA 3TYDA 3U3HA 4HOWA 4WDXA 4RNHA 3F2BA 3UCQA 4FNSA 4PGLA 2UY5A 3LEPA 3H4XA 5HXMA 3VGDA 4JL2A 1A5OC 2J77A 4IPJA 2PCQA 3E2VA 3G24A 3GIQA 1W8SA 2XH2A 3QM3A 3CV6A 4IQDA 1FWBC 2QDHA 4H00A 2GVGA 4E2OA 5A6TC 4C6JA 2W79A 1H7OA 1LQ2A 4MZYA 3A3HA 1F61A 2DEPA 3Q2DA 1U1HA 2A6NA 4KIRA 4DBDA 1UP2A 3TE9A 5I2UA 3R94A 4GYPC 3A4JA 3TP4A 1KTNA 1U1UA 3WH7A 2WC3A 4IGNA 1V02E 5BNKA 3TU9A 3UZWA 2QF7A 4M1RA 2B4GA 4NNBA 5HUOA 4O17A 5AZ1A 3TFCA 3PZ9A 3T4WA 2VZUA 4NP7A 3D6NA 3S1VA 3VX0A 3M0JA 3CUZA 3GR8A 4ZOAA 4E2VA 2DFAA 2CHNA 2FFIA 3PG8A 3WQFA 2I17A 1SZFA 1OFDA 2QJIA 4DB7A 1JZ5A 4LVGA 3WQ8A 3WBAA 5C7HA 1X1OA 1XDJA 3UWEA 3CHVA 3R7MA 1HG3A 2DP3A 1FHVA 4XAZA 2QCNA 3WNPA 4QS6A 2WK2A 2WSYA 3W2MA 1OJXA 4YTUA 2R94A 1WXYA 5A6JA 1A3XA 4ADTA 2XVKA 5E0KA 4QG8A 1XYFA 2YLAA 2BVTA 3L0NA 4MJZA 4O0QA 4CEXC 1H0IA 3VKBA 2V30A 1UOKA 1HVXA 1CGVA 4ZQMA 5KTLA 2FDMA 3EXRA 2PU0A 3RAOA 3RU8X 5M3WA 4IHCA 2E6AA 4LYKA 4GUJA 1E6QM 3UD6A 3WUBA 3GFZA 3OQEA 4IMCA 4DLFA 3W81A 2WVUA 4HHMA 4X63A 3VMPA 5AC6A 2DJLA 2CHRA 1BLIA 4GNKB 3W7HA 4EX4A 3SRFA 4QR6A 1CXHA 1A0DA 1U5HA 5FEXA 2BGQA 4ZO6A 3E2RA 5H91A 4PZVA 1XH1A 3S6TA 3WF3A 3IIZA 4U2YA 3CK5A 3Q37A 2JGQA 4KF1A 3W26A 2YL5A 3IVUA 1YDVA 2BMBA 3EXTA 3QMTA 4UZSA 2H3DA 3TQ0A 3BLIA 3B0PA 1ITXA 4YS1A 1DXIA 2QAFA 4CVWA 4HNUA 4XISA 1XLFA 3N11A 1DJHA 2XIJA 4YCPA 5G2WA 4DPPA 4IX2A 2AQVA 3K46A 4GO8A 3UGRA 3ZT7A 3NPUA 4IIHA 3S5ZA 3EOLA 2NLYA 3BTNA 5D04C 4HNLA 1XBYA 2Z1WA 3UPBA 4JTEA 4EANA 1TVLA 3V0TA 2ZCGA 4RDVA 2QUMA 4BWLC 1AH4A 1M7XA 1XR2A 2PLMA 1TPH1 3W3OA 4Q8NA 5LA2A 1KCKA 1I6NA 3HPSA 4G1NA 4PRTA 4UTTA 5EMKA 4PR4A 2OSXA 3ITLA 1TQXA 4YCOA 3C6CA 4ZGYA 3GNOA 4UTHA 3W74A 3FGCB 2VEKA 3LSCA 1Q4NX 2XPKA 1H0GA 1JR1A 2CBIA 1PKLA 3ABXA 4Z42C 3CIWA 1ZAIA 2CZDA 1R3VA 3D3FA 5FJJA 5I23A 3EMCA 1I1XA 4V33A 3IJIA 1G0CA 3HG3A 2F8QA 2OJPA 4RZ6A 4LJ3A 4DX3A 1UOZA 4ICNA 1IXQA 4G56A 1UD4A 2OOFA 1F8MA 4JTFA 5D30A 1E6RA 1TZ7A 3U2OA 4KCTA 4F3HA 3V4BA 1EBGA 3M4HA 1X6UA 3FS2A 2E6DA 4H8HA 3O6AA 2DORA 3MT1A 2Z2UA 3LSBA 5K4ZA 5LNRA 3LXBA 3SI9A 3M64A 4NYUA 3CASA 1GJUA 2DW6A 1XFBA 3GR4A 3K4WA 2J78A 1W1VA 1E9YB 2J7BA 1EXPA 3VIFA 3HV9A 5M03A 1WKDA 2OPJA 4WGHA 3RMEA 4I7VA 3IJ7A 2X8RA 4P7QA 1YKWA 3W25A 1KWKA 4Z1CA 1KKOA 1TRDA 3KTCA 1FQ0A 3QEZA 3BGJA 3BH4A 3MCMA 3BPWA 2FZDA 5A3HA 3KBNA 4QG6A 1X8CA 2PDXA 4WSJA 3PJWA 3WMSA 2HZGA 5AYIA 2WNQA 4AHQA 3LOTA 4Y7EA 2OEJA 4PCFA 1F2JA 3WFAA 5ECVA 3D47A 1W37A 3T8LA 1W5NA 1WDSA 4DBSA 3CNYA 3QSRA 4YVPA 1AUSL 4LUIA 3A9IA 4AYSA 4XKMA 4JQ1A 4KCWA 3UWQA 5CGQA 1IXOA 3AS3A 3LNMA 2WMGA 1SYTA 3SCNA 1TV7A 4KCVA 2VZSA 1RZMA 2J47A 1VBRA 3H55A 3GHSA 1A5KC 1GZGA 3BAJA 3LCGA 3VGBA 1S46A 4M6UA 4IF2A 3GR7A 1OM0A 4PTVA 3SZ8A 3F4DA 2QJHA 3EKZA 3ZVIA 4S2BA 3L66A 3KOWA 5I3GA 1FH7A 2EG8A 2YSWA 3GWQA 4RZBA 4F9JA 2D1ZA 1KTBA 4EPBC 1WAWA 4QLKA 1FWCC 5DELA 3ZJKA 2DUAA 4L64A 5I3IA 1EKOA 3GDRA 3FJLA 1E6NA 2H8ZA 4XAFA 2DZXA 3A24A 1OC5A 4CN6A 3R43A 4BS0A 3RJYA 4A8LA 4AC1X 4XBJA 1M5WA 4PE8A 3T55A 2Z28A 3W1UA 2DVXA 1IR1A 4D2JA 1GQJA 3T7VA 1PBGA 3A4WA 2IQTA 3LV6A 3RPDA 4GC4A 4FXRA 4JQ4A 1LOQA 1RP9A 4I9MA 4W84A 3WF0A 3W4RA 4POCA 1NU5A 4XIMA 5I3KA 1JYXA 5HNNA 4L4MA 4UR8A 4H9MA 3LLFA 4W85A 4GIYA 1Z89A 4YIWA 1ZAHA 2E28A 4PN2A 1H7NA 3GXPA 1C9WA 4W8BA 2HVOA 3AQUA 4RE2A 1C8YA 1ZQ5A 1YLVA 3VIHA 2YYUA 2C6QA 1W91A 4K39A 1M7OA 4E2BA 1DJGA 3FFSA 2QVHA 3MJYA 1DWJM 2XIIA 3O0KA 2HJPA 3EAUA 4HYWA 3L67A 4GI6A 1SZNA 3LHYA 4ERAA 3W7OA 1NFGA 5CH9A 2FZBA 1GORA 1E56A 2OODA 2H90A 4IICA 5I3HA 4F79A 3AMKA 2J62A 2J9YA 4A22A 2GWGA 1QW7A 1GKPA 3TSBA 4L9YA 3ONCA 5CLWA 4UTUA 2CLIA 1CWYA 1JZ6A 2J13A 2ALDA 1XUZA 4AEFA 1D8WA 2Y5JA 2BWGA 3W01A 3GNRA 3CBWA 2H8XA 3N2BA 2WHKA 1WBJA 3QLDA 4DI9A 3TN3A 4QGCA 5C2XA 1GUVA 3ARSA 4WXYA 1RK6A 3SCRA 2VCAA 3I3DA 1YTEA 3URNA 1VCFA 2NQJA 2X1UA 4AXNA 2INEA 1GQIA 2PPGA 1OCNA 4HHLA 1EJXC 1O6IA 1R3RA 1K8ZA 5C0QA 4R53A 4EKJA 4FA3A 3CZGA 3LGDA 4Y9NA 4LANA 1UPMB 3PBMA 3N3TA 4PCNA 1JG9A 4ICCX 5HDRA 3RCNA 2J9ZA 3F2DA 3UWWA 5TD4A 5HQLA 2FH6A 2BTMA 4XK2A 4LUTB 3VOCA 3FSTA 2YZ5A 3MSYA 3VGEA 1Z48A 2Y6ZA 1FUYA 1V0KA 5CZKA 2YL6A 5C71A 3SR7A 1HGWA 4IGSA 2QZRA 5CEWA 4O8RA 3RN6A 1UB3A 2OQYA 4C6IA 5GNXA 3DG6A 1US3A 3JZEA 2XISA 1R87A 1WA3A 4ZR8A 3QYSA 1TVPA 2W9MA 5EMYA 1O60A 2QQ6A 3KBJA 2DUXA 1GOKA 1OCQA 1WDQA 3WH9A 1XC6A 3GHTA 1BWVA 3LB0A 3RLHA 3EDEA 1GOIA 1KCZA 2HPMA 1LTDA 1VR6A 2V38A 4ZB0A 4MLRA 2D20A 1DE6A 4ML9A 1FWFC 1HTIA 1XBVA 3E1F1 3Q45A 2AQWA 4WF7A 2WVSA 1YTDA 3EOUA 3TYZA 4RE0A 2QAPA 2HQAA 1HO1A 1HKKA 1F6YA 2Y8UA 2XIBA 3JW7A 4MWAB 4O4WA 2HVNA 4PB4A 5GJPA 5AC4A 2EEXA 3NL5A 1XCWA 3NXLA 1TCMA 1TO3A 1VPQA 3TJ4A 5EA9A 4QQ3A 1FWNA 1EEPA 1QO5A 2QF8A 4JBRA 3A9BA 3M0YA 3WDRA 4JTAA 1WE5A 1FBAA 4PODA 4KMQA 1EGZA 1LRTA 3ARYA 5LA0A 4PL1A 1RCQA 3PY2A 3DGBA 2XINA 3V5CA 4O16A 3Q4DA 1UR8A 1TWDA 2ZRZA 1L6GA 1E6XM 2PBOA 2I5QA 1C7SA 2XGIA 3L21A 5M1TA 2EAWA 4WY0F 4LYQA 5CZTA 4LX4A 4LS0A 4GX9A 1OX4A 5E93A 3U9IA 4DHGA 2PRMA 1MXDA 3MCOA 4GZJA 5HJXA 1V0MA 2VFFA 4TR9A 2WSQA 5C9XA 4LUSB 1UH3A 2W61A 4YU1A 2GUBA 3AAMA 4B91A 4HZ8A 2VCBA 1S5TA 1QPQA 1LG1A 4HPGA 1YBQA 4PTDA 1JZ4A 2WANA 3QHNA 2PDUA 3N1AA 2O55A 1UZ4A 3WJXA 1TPB1 2R1NA 1XGEA 3KRBA 2BOGX 2PZ0A 2CLMA 3ARXA 3E9AA 3DG3A 2HSAA 4G6CA 4JQAA 1AMKA 2V2HA 3AZTA 4I9JA 3SO7A 2JF7A 4R85A 4X2PA 1E6PA 1FKWA 1IWAA 1OGSA 3UXLA 3TONA 4Q8VA 1XSIA 1C9DA 3SN0A 3SCQA 1VJIA 3BGAA 3GLCA 3TYCA 3S0CA 4CQBA 5REQA 5BW6A 4AMAA 3NM1A 3GZAA 2A85A 3T4CA 1NF0A 4HU4A 4D6CA 3CJPA 4V1XA 3B9OA 1XI3A 4NAFA 5KZEA 4X0VA 3R89A 1FWSA 4QJ5B 4AY1A 1OG6A 3NYDA 4AZ5A 1HJSA 1YPFA 3MDUA 3W7RA 4XZ9A 3MU7A 3DKLA 1XH0A 1YADA 4AZ7A 3G1VA 1NQ6A 1MFVA 3OZYA 1VFMA 2Q8LA 4E8GA 3WYZA 3SURA 3ABZA 2GOKA