3V35A

Aldose reductase complexed with a nitro compound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v35A00
5C7HA 1PYFA 5AZ0A 1C9WA 3H7RA 5LIKX 4H7CA 2BP1A 4GACA 3ONCA 3LQLA 1T40A 4EXAA 2F38A 3CAVA 3LD5A 1R38A 1QRQA 4IGSA 4JTQA 3S3GA 4OTKA 2WZTA 3U2CA 5JH1A 1MZRA 4XO7A 3RX3A 2FVLA 4JIHA 1AZ2A 3KRBA 4WDWA 2DUXA 2INEA 1K8CA 4YU1A 2DUZA 2BGQA 4GCAA 3LN3A 2ACQA 3R8HA 3O0KA 1A80A 1QWKA 3GHUA 5AZ1A 2PZNA 3UZWA 3M4HA 2ACSA 3Q65A 4HBKA 1HQTA 4WGHA 3UG8A 4PR4A 2A79A 2PDHA 2HVOA 4ASTA 2HE8A 2QXWA 5HNUA 4DBWA 4JQ2A 2HEJA 2NVDA 2J8TA 4LBSA 3T42A 1ADSA 4RPQA 4JTRA 4FAMA 3LZ3A 1XGDA 1YNPA 1Z3NA 3GHRA 2ACUA 3COTA 5M2FX 2IKHA 3R94A 4Q7BA 4YVVA 1YE6A 4L1WA 3EB4A 2INZA 3LBOA 4XVDA 4PUWA 3WCZA 4QX4A 2PDUA 1LWIA 3UP8A 3LZ5A 1FRBA 3CMFA 1S1PA 4GABA 2PDKA 5HA7A 3ERPA 4WEVX 1ZUAX 2IQDA 1XJBA 4F40A 1J96A 3GUGA 4JTCA 4QR6A 1YE4A 4ICCX 2ALRA 2IPFA 3BURA 1X96A 4XK2A 3M64A 4YVXA 1XF0A 2PDWA 3CV7A 3CV6A 2WZMA 4WDUA 4XZHA 3UGRA 3UZXA 2PDIA 4ZFCA 3QKZA 4L1XA 4FALA 4LBRA 2VDGA 3BV7A 3WBYA 3ONBA 2FZ8A 2BGSA 5HNTA 3LNMA 5LIWX 2PDCA 2IQ0A 4WRHA 3G1RA 3N6QA 1PWLA 1YNQA 3C3UA 3UZZA 1ZGDA 4PMJA 2PF8A 4IJRA 1VP5A 5KETA 3RX2A 1SM9A 3V35A 4H8NA 3MC5A 3GHTA 3MB9A 4JQAA 5LIUX 3BCJA 4LB4A 2FGBA 1PWMA 4JTDA 1AH4A 1PZ1A 5LIYX 2ACRA 1X98A 1X97A 3V0UA 4AUBA 5JH2A 1US0A 1IHIA 2FZ9A 4GA8A 4WDXA 2NVCA 2FZBA 2AGTA 4R9OA 2IPGA 4IJCA 2R24A 2I17A 2HVNA 2PDYA 3V36A 2PDBA 1JEZA 4Q3MA 2IKIA 3DN5A 1M9HA 4QBXA 2PDXA 3M0IA 1EKOA 3V0SA 2ISFA 1EL3A 2PD5A 1EXBA 4QXIA 1S2CA 1ZQ5A 3H7UA 4GIEA 2FZDA 3R8GA 3CAQA 3V0TA 2PD9A 4GQ0A 4XZNX 3UYIA 3R58A 1Z8AA 3RX4A 3G5EA 4XO6A 2IS7A 3B3DA 4I5XA 4JTAA 4FZIA 1MI3A 2I16A 3WBXA 4WDTA 3Q67A 1EF3A 3O3RA 1UR3M 4XZLX 1Q5MA 1RY8A 2PDQA 3UWEA 3H4GA 2PFHA 4PRTA 3EAUA 4LB3A 1AZ1A 2R9RA 1MRQA 1Q13A 2F2KA 3R43A 3VXGA 2PDLA 4PRRA 3GHSA 4YS1A 3LUTA 4EXBA 3EB3A 4G5DA 4NKCA 3NTYA 1S2AA 1IEIA 1Z9AA 2P5NA 1T41A 4FA3A 4YVPA 3WG6A 4JQ4A 4GQGA 4DBUA 4XAPA 4JQ1A 2IKJA 3F7JA 1PZ0A 1LQAA 3FJNA 3P2VA 1S1RA 1VBJA 2PDMA 2IKGA 2DV0A 3R6IA 3R7MA 4HMNA 4LAZA 1Z89A 4JIRA 2PDJA 4MHBA 4DZ5A 5LIXX 2HV5A 4XZIA 2PDPA 3LQGA 3UZYA 2HE5A 4DBSA 4LAUA 3DOPA 1AH0A 3UFYA 1RY0A 2PDGA 3N2TA 4PUUA 3FX4A 2HDJA 3D3FA 3LEPA 4JQ3A 1GVEA 1OG6A 2IPJA 1ZSXA 1HW6A 2PEVA 2CLPA 3WBWA 1RALA 4XVEA 2PDFA 2C91A 4JIIX 3CASA 2PDNA 1AH3A 3LENA 1AFSA 4XZMX 5DANA 3BUVA 2IPWA
chains in the Genus database with same CATH superfamily
5BWAA 1IZCA 4HNVA 2GGEA 1C9WA 4EIVA 2G4FA 1A4LA 2O56A 1B0IA 1XG3A 3ZVIA 4H7CA 3VFLA 1PXGA 4UMAA 1GQKA 4MIMA 1EH9A 1Q65A 3S9ZA 1GW1A 1QOPA 1KFEA 1BQGA 2GGHA 1UROA 3N29A 5JIWA 5M17A 3DUGA 1GQLA 2HS8A 2GVYA 2E77A 3LTPA 1J2WA 4XSLA 1HFBA 3AIWA 4OQVA 3IK2A 1XLBA 3TYDA 4Q8UA 2FVLA 2OSYA 3KRZA 1GQNA 3NGFA 2CBVA 3IJDA 2XIJA 2YFOA 4L6HA 3KDNA 1MW1A 4MY9A 4Y9NA 1ZAHA 1EZ2A 4LAOA 3PR2A 1WXJA 2Q8ZA 5FJIA 3KW3A 2QIWA 1P7TB 2XZ9A 3S1GA 5ABTA 1EDGA 1IGSA 2WNZA 2YDAA 3JS3A 3EA3A 5FF0A 1Z41A 3HM7A 4GD0A 2X8RA 3BV4A 4MGGA 1V0NA 3S1WA 4D71A 4ES4A 2EAWA 3SM0A 5ABEA 3OGSA 4UTTA 2C7FA 3WFZA 1RQHA 5LZLA 2HVOA 4ALDA 4H19A 4JQ2A 3IGHX 4E5TA 2VDHA 1RQEA 2BOGX 1V6TA 5EA9A 4FXFA 1BVWA 4N42A 3AMLA 1ZBCA 2QIIA 2PWEA 1GKRA 1EQPA 4FAMA 1SQ7A 5IRPA 4LVGA 1F2JA 1Z3NA 4J4KA 3JZEA 3HQPA 4AZCB 1ZU8A 3R94A 1V08A 3QH2A 1YMYA 1XYZA 2YR1A 4HGXA 3TQPA 2QCDA 5IXEA 3LBOA 4XVDA 1QNPA 3AHVA 3N9KA 4H83A 2BHYA 3T05A 3U2ZA 1EGVA 2RDXA 4XD6A 1YBQA 4JHOA 4IMGA 4UXDA 3CMFA 2WW5A 9RUBA 3D46A 3G24A 3HFTA 3CUZA 3PNUA 4RZ4A 7CGTA 3UR8A 1JAKA 3PANA 1QOQA 1XJBA 4F40A 3U3HA 2DVXA 4EE9A 3NQ2A 2RGLA 3OLEA 3TYUA 1KQYA 1G69A 3UWUA 4U5IA 1TR1A 5AVHA 4NY2A 4GWEA 3OZMA 4AD5A 4WY0A 4JOMA 3W1MA 3HFYA 3LHUA 1EB3A 2OYKA 3WNLA 2VM8A 4W93A 4IMDA 3BOFA 1GVOA 4NX0A 3OJGA 3VMPA 2XIOA 2BHUA 1R85A 1WAUA 1REQA 4UBPC 3ES8A 3QTGA 3ONBA 3S1UA 4O0QA 5DQPA 1PX8A 1JYWA 4Z2KA 2NXGA 5LHFA 1UC4A 2Z00A 3FYPA 2CZ5A 4BI5A 4D9PA 3AJ7A 2QCHA 1YDOA 5E09A 1PIGA 1MMFA 2W61A 4WF7A 4ERIA 4C1KA 1RUSA 1TVPA 4AXKA 3FN9A 3A4WA 3KOWA 4FX8A 2GWNA 4K3ZA 4NU7A 1UKQA 1XHGA 2ZICA 4EF8A 4NZFA 4RW3A 4JTSA 4J28A 3SUUA 1RLDA 4JTJA 2FDMA 2J47A 4EX4A 2V5BA 1CGYA 1JNEA 1X6UA 3NVTA 1SW3A 4IJCA 1W8GA 3B06A 3U6WA 1E0WA 1JCLA 1H11A 2VC9A 1EKOA 2C14A 2OQYA 4D1JA 1XH1A 1TPUA 5FKYA 3AISA 2XDFA 4N0RA 4TU1A 5AHIA 1Q45A 1RBAA 4LF1A 1V5XA 3LM3A 4JICA 3UWQA 4J3SA 2OQLA 2DY3A 5HPCA 3E12A 4GISA 3IANA 4LCRA 1EC7A 3OVGA 1DJYA 2UY4A 3EXRA 4PMVA 4XO6A 2I56A 3GTIA 4KERA 3W2NA 3H22A 1HNYA 4QRNA 1RHCA 1ZPTA 4B5NA 1VGAA 4U3AA 1R2SA 1QU4A 2E0PA 5FOOA 2YB1A 3RM9A 4DZIA 5AHLA 2QUVA 1WZKA 5JMUA 3AMKA 4LAMA 4KWUA 1UUMA 4B5UA 1CXEA 1WP6A 3EA1A 1EPXA 2Z26A 2R9RA 2YBVA 4GY1A 2NQHA 3EX2A 2ZZ5A 4FK9A 5CZJA 3OO2A 4FOUA 4AHPA 1SO6A 1W9UA 3OZPA 1UBPC 3R10A 5FJJA 2W27A 2Z25A 3M5XA 3W73A 1FWFC 4O50A 2WCAA 2W62A 3IJLA 3F7JA 1EYEA 2NQLA 1EJ7L 1VBJA 2GUBA 1TVLA 2DV0A 3LSBA 3WEOA 4Z1DA 1E15A 1T7LA 1WPCA 3TUUA 4UUIA 4HQVA 3WO8A 2HV5A 2H90A 4GHRA 3L2LA 1S5TA 3O6YX 3GVRA 3UFYA 4ZB0A 1WUEA 1X39A 4PMQA 3WF1A 3WQPA 1KRBC 4YLWA 1KCXA 3PB0A 1XUZA 3EMQA 4S23A 5HK4A 4IJBA 3WF4A 3R2GA 5REQB 4JIIX 4UTUA 3GC2A 5AYIA 3MP5A 5I3DA 3NL6A 3BAKA 5BXRA 2V2HA 3SSJA 5CG0A 1KB3A 3P5ZA 1KR1A 1GOQA 2QULA 1PKYA 1BYAA 3WF0A 4KW2A 2JIEA 3ARWA 3CHCA 3PZ9A 1XH0A 4GVIA 3ABRA 4O1BA 3KTSA 4MNKA 4TR9A 1FWIC 4KCVA 4ZZ9A 4GYPC 1U30A 4Y9MA 1YPXA 5CGMA 2OGJA 2HCVA 4FLOA 2E6DA 3L0GA 4WDWA 1I1XA 1L8NA 4D1IA 4AYSA 3MS8A 3HGSA 3WNOA 1RJPA 3EKLA 1Z48A 3R8HA 2VD9A 3BGJA 4O57A 3PN8A 1DQWA 2KX9A 1JDDA 4RZ5A 3W7HA 3TWAA 2Y1HA 4W87A 1NVMA 4PA8A 2QMKA 3NQCA 4BJHA 3BG5A 2ZCGA 3TYCA 2GK1A 5FCZA 1XIHA 3VC6A 3RR4A 3KBMA 3DENA 2XH2A 4DBWA 4DI8A 2ANUA 3TFXA 3RRAA 1Z7AA 2QJIA 2J8TA 1KM3A 1JF5A 3UXKA 3ITOA 3K8LA 4C6BA 5AHFA 3K4WA 3O8AA 2ZZ1A 4H6KA 3OG2A 4N9BA 3DG6A 3IJ8A 1B90A 4LRTA 3G77A 2AQWA 5FEXA 4FEZA 4Y8FA 4Q7BA 1WO2A 1U22A 2V3DA 4LUTA 2GVEA 4W85A 3NPVA 1R2TA 1V3KA 3DC0A 3GNRA 3RRXA 3B0YA 4Y8EA 1G5AA 1SFSA 2ZA3A 3WSUA 1EGZA 4GY0A 4TV6A 2ZC8A 1UOKA 3VYLA 3UP8A 2E3ZA 4GQQA 4DJDD 2PP3A 2WZEA 3KL3A 1CB2A 1V6XA 3LYEA 3MYPA 2QUMA 1WZAA 2J78A 1NWRA 2CKSA 3BTNA 2NQZA 1NF7A 3AWOA 3ABSA 2YXOA 3KVKA 3UG5A 4QR6A 2INFA 1EQCA 3M44A 1NEYA 2ZZ3A 4HOZA 5MKGB 4XK2A 5TD4A 2W6RA 2R6OA 5HWNA 3L7RA 4W8AA 5CGQA 3CV7A 2F6XA 3OTRA 5I3IA 2BVDA 4J3VA 3TVAA 1H7OA 3K5XA 4DF1A 5LXXA 2H8XA 3VDGA 1E3ZA 3VOIA 3WBYA 5EMJA 2DW7A 3B4UA 1XBVA 4POCA 2BASA 1HJXA 3OA3A 1EBHA 3LHZA 4DVOA 3BLPX 3G1RA 1XLAA 3MO7A 3N6QA 5FF3A 1IGWA 2Y85A 1W17A 3RDKA 4MAVA 1IEVA 2OVLA 1G7UA 2ZDRA 4K7VA 1E6NA 3N1AA 5KETA 1YQ2A 4IFKA 1H1NA 1E0TA 4DX3A 1W3HA 4JQAA 1XUUA 1UH3A 1SFJA 1S2TA 3B9DA 4JYFA 4F4RA 2FGBA 1PWMA 1DHKA 3QW3A 4Q8PA 2CPUA 3GBEA 3MMDA 3MUY1 1LZOA 3W7IA 3WJZA 3OVQA 5CPNA 3CB8A 4GUJA 1EOMA 4JZ5A 4M51A 3H2EA 1PKNA 4IMFA 4WJXA 2QJNA 2I17A 2PWFA 5CPTA 1TUXA 3FSUA 2ZZ7A 4IPNB 2P50A 4D6IA 3POCA 3H2OA 3TX9A 4Y6GA 3POHA 1F61A 4FNTA 1EXBA 2WQDA 4GOAA 2B81A 2KZHA 3ISIX 3P5YA 2V30A 2A4AA 3SO7A 1MXSA 1EF2A 4N4QA 1BTCA 2WKGA 4KFNA 1DJXA 4PTMA 1NJJA 4GXMA 1OGBA 3SGUA 2ZWZA 3RHGA 4OGZA 1OYBA 3T0DA 3B0UX 2X09A 2BWGA 3H2NA 4ML9A 1RVGA 1DE6A 4HSOA 4O11A 1WX0A 2X1IA 2W63A 4INFA 3PBYA 3LCIA 4I5RA 3CZKA 1ITQA 3N3TA 3A47A 3E2VA 1VJZA 4DWSD 4TIMA 4D6EA 1QWGA 1QI4A 4H2CA 4GGHA 3N14A 1MXDA 4A35A 2WLZA 4OV9A 2WOQA 3S5YA 2EPHA 3SSZA 3ATZA 3LCWA 5AYBA 1XBYA 3JR2A 3H53A 2B7PA 3NSMA 1TWWA 3STGA 2Q09A 6REQB 4UB9A 1V51A 4CD6A 4ZO6A 1DIDA 3TQ0A 2IKGA 1QW9A 4WLCA 1EBGA 1UMYA 2QDEA 2RHGA 3BLEA 3N25A 1MW3A 1K9TA 3MKCA 2PDJA 1PYMA 2DSKA 3UXDA 3S46A 5LIXX 2YZRA 3F4NA 3O07A 3VIJA 3P61A 3TN5A 3UJSA 1AQMA 3L2MA 4ATWA 1SFTA 4WY0F 1FH8A 2PDGA 3N2TA 1TX0A 2ZZ6A 5GJNA 1ISVA 3WZ0E 2A5HA 3URQA 4JKKA 2CHNA 3IGXA 3IVTA 4M0XA 3W1PA 5AC7A 3UWZA 4IMCA 2WVTA 1D3CA 3CL6A 2HMCA 2QQ6A 4K8EA 1DWJM 3SCWA 3M0MA 2G4JA 1PX3A 3WEMA 4HNUA 4FOJA 2HQAA 3NR0A 1TX2A 1TV7A 4MJMA 2OODA 1FXQA 4FIQA 4GMEA 3F03K 1ZBVA 1OCQA 1P1MA 1YXCA 3WJXA 2YFNA 3ITYA 4E4UA 4KWVA 1DWFM 4RX0A 4GACA 3HG3A 2UV8G 1Q2RA 1MNSA 2WK2A 4IQJA 3EDDA 3ITCA 4NSBA 3TXZA 4MB3A 3QR3A 1C8XA 1VS1A 3GFZA 3PUEA 4IGSA 5CCZA 1I8JA 4JTLA 1S5MA 4JL1A 4CU7A 1MZHA 4HK7A 4NAFB 1Y0EA 4XTDA 3DECA 1C8YA 4GC4A 4V1YA 1OADA 2QR6A 1KD0A 1GEHA 3R89A 3WBEA 3LN3A 2B7NA 3ID7A 1YKWA 3ZM8A 3ABXA 3A5FA 2ZWYA 3NQVA 4B2DD 1WZMA 2CW6A 3BO9A 4EAMA 3DKJA 4J27A 2OZTA 2OO6A 1IZKA 2GL5A 1WDQA 5HDRA 4WGHA 1VEPA 3QC3A 3I7RA 1AODA 3VIHA 3HZ3A 3PZUA 2QXWA 1DEDA 1NFPA 2I14A 4ORIA 4XD3A 3WF3A 1G9HA 1K7FA 2IQTA 2WKJA 1ADSA 1F3XA 3AZTA 3BSHA 2WMFA 3CWOX 1R3WA 2XN0A 4HPGA 3ARPA 4US5D 1YNPA 3Q4DA 1E1CB 2WB5A 3K8KA 4KBXA 3VKJA 5M2FX 1TG7A 3SW6A 2QJJA 3GTFA 3TTQA 3MJYA 4NZCA 5EFDA 3WY1A 3W2JA 4GX8A 3CPGA 3VGBA 4UC5A 3NZQA 3EBVA 4AWUA 1OGSA 3K1DA 4MWAB 1FRBA 3UY7A 1ZJAA 4RPPA 2VFDA 4TX9A 4GLEA 3CGTA 4Z08A 3SCRA 2DDXA 4AZGA 2A7PA 1TB3A 3ARYA 4AAJA 1OFBA 3PP7A 2D0FA 3FS2A 5DN1A 2NV9A 1NY1A 2GQ3A 3T0CA 2QCGA 1VF8A 1GOXA 3VNLA 1E55A 3V16A 4U4MA 1X96A 3VKDA 2G95A 1UR2A 4HD5A 3EWWA 2VZUA 1J5SA 2XG9A 3VNJA 2D20A 4JNMA 4I7WA 3PWIA 1W32A 3UZXA 1GHRA 2QGYA 4NAEB 2ZRWA 2Y2WA 1W0MA 4K38A 2PWUA 5BCAA 3LCLA 3APGA 3BV7A 1KBJA 2Z6JA 3T9PA 4CCDA 2BOFX 3CQHA 5A1AA 3E9AA 3GVQA 3MZ2A 4DF2A 1SGJA 1XPYA 2RUSA 4M5PA 3HTWA 3LXCA 3QLLA 5LNUA 4AG0A 1CEOA 5FJTA 4CNOA 4YMZA 5E93A 2J9YA 2PF8A 4JGDA 4FF5A 1QCWA 3CV1A 3NDYA 3P8JA 2WNWA 1BKSA 4LQ1A 1UZDA 1I2OA 3QMSA 2PA6A 3MP4A 1AH4A 1K6AA 1TQJA 4HZ6A 1UASA 4LFYA 4RDVA 1FHDA 2RDTA 1HJSA 1XIGA 2WHJA 1BFNA 3KBSA 4HSNA 2WQPA 2ZUMA 4WXYA 4KESA 4ZB2A 4PTWA 1HJQA 1JRCA 1V3IA 3GG8A 5DT7A 1XBXA 3SFWA 4DNHA 2BODX 5JBFA 4L65A 2XH0A 3EWBX 4B5TA 2CLHA 2ZA2A 4CU8A 1HIZA 1HXJA 4N6FA 3UPWA 4XAYA 3QFEA 2R1PA 4X0NA 2OLSA 1Q2SA 2FZDA 1ZJIA 1W5MA 1RK6A 5D2XA 3R58A 3SCTA 1M1BA 4R7JA 1TPH1 5HMFA 3QV7A 3M0LA 4O4WA 2ZXBA 2GWGA 3PG8A 1RPKA 3VDBA 4LCSA 1P0KA 1FDYA 1K7EA 2WAGA 5K9CA 1GYLA 3OBAA 4AMAA 4AH7A 3UR7A 4MY1A 3DFYA 5HR7A 4FO4A 5MF5A 4IP5A 1SMAA 3B40A 4QE5A 3F5JA 3LK6A 1R46A 3HOJA 3MKKA 4IGHA 3BW3A 2HZGA 3M0JA 5ABHA 4D8LA 2X1RA 2HBXA 2AL1A 4QNEA 1LLOA 4C60A 4FXRA 4G5DA 4NKCA 1ISXA 3SCQA 4IZGA 3NXFA 4FXSA 1MEIA 1HVXA 4GQGA 4H00A 1VFTA 5CBJA 2V5JA 1KM2A 4GX9A 1MQRA 3WD3A 2B7QA 4QE1A 3W75A 4B92A 5DELA 3R6IA 1ALDA 1UR1A 3W74A 4ZEPA 1ADOA 4LU0A 4R9XA 2C13A 4Q7NA 1DPMA 4C6QA 2F61A 1HT6A 2C16A 3C52A 4DB7A 1AUSL 1ZCCA 1U1UA 2E67A 3KCLA 3KM8A 3DOPA 1J2BA 2PF0A 4KWOA 4WVXA 3N4EA 3SQSA 4M6VA 3QYSA 1ZP4A 2PWHA 1GVEA 3H6OA 3VIPA 1B31A 4UNKA 1FA2A 2Y63A 3O6DA 4FS9A 2EXOA 5DLCA 3STEA 1VD6A 1Q6QA 3MA8A 3R4IA 3CASA 2Y4SA 1DORA 3DCPA 1WKEA 2IPWA 3P74A 1X1ZA 2OEJA 4XKMA 2X0YA 3A3XA 4JTKA 4XISA 1V3MA 5IHRA 1SZNA 5TNVA 1W9BM 1EC9A 1XSIA 3PM6A 1JI2A 1OX4B 2X42A 4MKSA 4RJEA 5D4YA 3F2CA 4PTNA 1CGVA 2WCSA 4GZIA 3GD6A 2F6UA 3W07A 5HR6A 3VDCA 1ECQA 3NZRA 1EA0A 3BOXA 1IEWA 3AIEA 3TZNA 1UP0A 1LROA 5DRCA 5FF2A 3EEGA 1WKYA 5SWUA 1KTCA 3SRDA 1R3YA 2YBTA 2PUZA 3W4RA 3RX3A 5AC6A 4DO4A 4LY8A 4NJJA 2V69A 1TZZA 3DI0A 5TAOA 3UJRA 3IRDA 3W1LA 3PB2A 2YJQA 1DJWA 3EPOA 3S5NA 3OPSA 2P3ZA 3I6RA 2ACQA 3PF3A 2VX4A 9XIAA 1UPMB 2CU0A 3GAKA 3SCNA 1BGAA 3OB8A 1OY0A 1Q4WA 1AK5A 3ITXA 5HWMA 2FQIA 1A3HA 1XP3A 1OQFA 1KXQA 1OINA 1CGTA 4G7EB 1IWPA 1CLXA 2FH6A 3WUFA 1K77A 3CAKA 2ZVIA 4UTIA 4HOXA 4J3WA 2HEJA 1G4TA 4PRWA 4QP0A 3PZVA 4DY1A 3E02A 5A6SA 4Q8WA 5CZSA 5B80A 4Q4SA 3UVAA 1SW0A 3STFA 3S6OA 3WKZA 1S3HA 2ZADA 3B9AA 3BGAA 1J6OA 4A3RA 5H1WA 3W23A 2BY3A 3LXAA 2R1NA 3VX0A 1W8SA 5G2HA 1IR1A 2OO0A 1P7TA 2ZRZA 3IEBA 3E3HA 1JCXA 5CJ5A 2NXHA 3QMRA 1PTGA 5C9WA 2ZQ0A 4LWWA 3OBKA 4KKXA 3BOLA 5BMWA 1PCWA 2B4GA 1QI3A 4HYRA 2J74A 3CZEA 4EKJA 1DHPA 5HNRA 1IR2A 3T4WA 2PTDA 4ICCX 4PFMA 4AF0A 4D8ZA 1RA0A 4FP1A 1QO2A 3L67A 5FESA 4ZGYA 3P8IA 3VIOA 4IIGA 1SSDA 4ERGA 2XWDA 4K2SA 2PDIA 1BEUA 3DHUA 3W7KA 4LUSB 2VENA 4OBTA 4LPCA 1FBAA 1KCKA 1A0CA 3PAOA 4GKTA 4JIQA 1GJPA 1TTQA 1KV8A 4CNSA 3PZGA 2ALDA 3CEUA 3Q58A 5K3VA 3AICA 4GIAA 2A6NA 4BCEA 1ZGDA 3SUVA 2C1IA 3CPUA 2I5GA 2PODA 4HPXA 4JTEA 3KOFA 3RX2A 1NQ6A 2V8ZA 4H8NA 2VOMA 3OZOA 1VHNA 2Z1KA 4JEQA 3ABZA 1VFLA 3WNPA 1ZBWA 4B3ZA 3TCSA 4HPJA 5G2WA 3HPXA 1ZB5A 1FWRA 1A53A 1PE1A 5HNNA 2HNHA 3TJXA 5JH2A 2O55A 2V67A 3Q37A 2FJKA 4GUGA 1T8QA 1CWYA 1HKMA 3E49A 3PZQA 1RSCA 2ZTJA 5E0KA 4O12A 4FB7A 4WHBA 3VNIA 1UD4A 4Q3MA 2R82A 2EG7A 1AL8A 3T55A 3GYEA 4QTGA 3N73A 4IFOA 1MFVA 2WWDA 4ZXOA 3UETA 1J79A 4Q8NA 3VD3A 1ZQ5A 3ARQA 3FCPA 2QGHA 1TPDA 3ENLA 3Q2DA 4ZQMA 4DXXA 1EX5A 1V77A 3T7VA 4IL2A 1FHUA 1TJRA 3G1SA 1Z8AA 2E6YA 1GYMA 4QSHA 1XINA 1CTNA 1J0JA 4HMEA 2WCGA 3BL3A 1QFEA 3M0XA 4ROPA 3KVJA 2V3GA 1CXHA 1PKLA 8CGTA 1YNYA 3OODA 1S3TC 1K8XA 5EFFA 3SJ3A 2O0TA 4ZBCA 1XFBA 4XBSA 2OB3A 5I23A 2PC8A 1E6RA 3WLSA 2YA1A 4NJHA 1H1YA 3R13A 3CJPA 1G1YA 4LC8A 3UR5A 5A6MA 5CC5A 3CEPA 5D2YA 5I7GA 4E2BA 3DFSA 2PDLA 2B7OA 1T6MA 4CNPA 2XSBA 4J35A 4AY1A 1M7XA 3AMCA 4H9VA 1A5OC 3ARUA 5LSMA 1CDGA 4UQ9A 3W01A 3L12A 2P1FA 1LQAA 3MV01 1VPYA 2QJMA 4F48A 1EJWC 3VIMA 1YPFA 2FMNA 4CNUA 2Z2BA 4LAZA 1SMDA 4O1FA 2AQVA 1MW2A 3PUGA 3FA4A 3C2FA 4XZIA 5D37A 1W1TA 1TPFA 4H3DA 3EX4A 3UNTA 3PAJA 2YYUA 1RY0A 1SJBA 4EOUA 1L8PA 2VL4A 3S83A 3GUWA 1YADA 1AJ2A 1IXOA 3C8NA 4ILSA 1XRSA 2A3HA 1LL4A 4JQ3A 1OG6A 1HW6A 1F3TA 2Z27A 4BQ5A 3WBWA 1XDMA 1VBGA 2VJXA 1D9EA 4O28A 3AU2A 5J04A 4DI9A 4AC1X 4GVFA 4CN6A 1XLFA 4LUJA 4B9ZA 3GH5A 4Q32A 5FSEC 5HMDA 2VI0A 3B0VC 2OSXA 5DANA 5JIPA 1SZFA 1VBUA 5DMYA 2WJDA 1ONRA 5DBTA 4D2JA 2FTPA 3N34A 1VAHA 3TYAA 4CQCA 5U4NA 3EPNA 3LLXA 3UXAA 2JBMA 3W53A 3FNDA 3LI1A 1ZRQA 4YNGA 9XIMA 2CBUA 1JXKA 4Y2WA 3WLQA 1FCVA 1UJQA 2CBIA 2F38A 3CAVA 2OZ8A 4KETA 1V03A 4JTQA 3L9CA 3RCNA 2FHBA 1Z42A 4EWJA 4AIEA 3P81A 1W37A 3ZSTA 3MUIA 4OVXA 3NPXA 2ICSA 1FCBA 3KP0A 4DUVA 5HUOA 1OG0A 2XFFA 1B3WA 2VRKA 1A5KC 4MYXA 2QPUA 1J12A 2YX0A 5REQA 1TPWA 1N82A 3P84A 4JXCA 4XIMA 1WOBA 4F2UA 4JDYA 3KS6A 1ZALA 4U33A 2C6QA 5HBFA 4DJEA 3DU0A 3XINA 2G37A 3BG9A 3IVUA 3SUWA 1AL7A 1I2PA 2NVDA 3CO8A 4YTSA 1VQTA 2Z1XA 4Z1CA 3LXBA 2GJLA 4JTRA 1EJVC 3MANA 4UFJA 1CLKA 4K1WA 4AZHA 5CSRA 4IQEA 4PUNA 3V7PA 2D0HA 3WH8A 2PS2A 2ZUVA 3OIXA 4JX4A 3GK0A 1VBHA 4MM1A 3W1NA 1YXYA 4UCFA 4BZYA 1XCFA 2CYGA 1G6CA 1V3JA 1ME7A 3QPYA 4GXWA 3QV8A 3THCA 4BF7A 4LAKA 4ZOCA 1Q4NX 5CAKA 5H8MA 1I60A 4PBFA 3HPZA 3VNMA 2POZA 2V6AA 5A94A 4X2RA 1K9EA 3RIKA 2DW6A 4RZ6A 3C2VA 1JZ3A 3GDLA 4HCHA 3MP3A 3W29A 2OLAA 2GJRA 5BWFA 4O15A 3GUGA 2QUNA 2CLOA 3HGOA 4UQAA 4GNKB 3DIPA 1AQFA 3NZPA 3U9IA 2VFFA 1JZ7A 3SQMA 4X9YA 2OJPA 4PSRA 5GJPA 1KRCC 2WZMA 3QPEA 5CZKA 1SU5A 4R53A 4GUIA 4PN2A 1H0GA 4FALA 3QKEA 5A6JA 2G3MA 3FIGA 5A5WA 1RCXB 2ZIDA 3W37A 3CUHA 4X9SA 3A9IA 3O9NA 3KCJA 1EHNA 2H6RA 2PDCA 3V5CA 3M0HA 2OPJA 2VCBA 4WRHA 1XKJA 1JPHA 2J7FA 3VX1A 2O9TA 4L6OA 2ZVRA 1L0PA 3QOMA 1KO0A 4LVDA 4BKNA 4GYJA 1G4PA 4TMBA 2J7DA 4LB4A 2UBPC 2Q3RA 4J3UA 4NZ4A 2GLKA 1GJUA 3E0FA 3W71A 5D9PA 3WDRA 3MMUA 1UBSA 4KCUA 5H6HA 1XLMA 1IYXA 3TQVA 1X97A 2J27A 2WLYA 3GG0A 3QY7A 5MKGA 3MCOA 2PGWA 2WVVB 5HAOA 3UGVA 1U33A 4L9XA 3LY0A 3TTYA 5LGXA 3CIWA 3CZLA 1LF1A 1W5PA 2E28A 2PDBA 1JEZA 3K30A 4PMNA 3DN5A 2ZRUA 5C9UA 2DT1A 3L4XA 3MWCA 2ATMA 4ADUA 3ZZ1A 4TVCA 2Z0IA 2QUTA 2NQJA 1XC4A 3QQ0A 1DXEA 4ZENA 2IXUA 4I8DA 3RM8A 4Q4QA 3L4WA 4IWWA 3VILA 1FFRA 1VYPX 3FKKA 3G6LA 2H9AA 4EP8C 4NI3A 4JY9A 4YJ5A 5HXMA 4IIBA 1W54A 2YA2A 4HNOA 4O52A 3Q67A 1C91A 1EF3A 2PTYA 3NG3A 1GORA 1TWZA 1TREA 4GIRA 4AZ5A 2I7GA 1RP9A 2R1LA 4C7GA 2QJHA 5LA2A 4PRTA 3EAUA 4QE4A 1KBBA 1XLLA 3L0KA 3LCHA 3ZR6A 4BS0A 1MRQA 3AAMA 2WSQA 3LHVA 5RUBA 3PPCA 4S3FA 3R43A 4CQ8A 2DUAA 5CPMA 3C2OA 3N04A 2JF6A 3ZJ6A 3QM3A 2VEFA 1QMLA 1T41A 4NI8A 4HHHA 1B1YA 2IKJA 4IQLA 5M5DA 3P2VA 4Y90A 4HA4A 3TLQA 2HISA 2VZSA 3G3DA 2OXNA 4DHGA 3F4DA 4MHBA 4DZ5A 3B8SA 4A3HA 3BLFA 4CD4A 4PCNA 4ONVA 1OHLA 4ZOBA 4ZQRA 2RJGA 3UVIA 1DOSA 4N02A 5AKQA 3M0ZA 3AROA 3B03A 1I4NA 4WZHA 4AX6A 3PTKA 4AEOA 3GFXA 1D8WA 3KL0A 5C8BB 2PURA 5D2WA 1K8YA 1FVPA 1O6IA 1WDRA 1X7IA 3C56A 3MI2A 5LNWA 1TTIA 3NO5A 2VX6A 1AW2A 3AFBA 2O4MA 4GYFA 5HOSA 4EVZA 4L4PA 2PE4A 1HL2A 5D32A 4ACZB 4K1GA 1AH3A 5A95A 5JU6A 2EPKX 3B05A 3NOYA 4QQ3A 2J25A 3JVAA 5D30A 4F2BA 2VR2A 1E0UA 2OKOA 4L56A 4QLJA 4ICMA 1UA7A 3ONCA 3LQLA 3WUGA 2QCEA 2HROA 4EXAA 3G1VA 4O18A 3W7OA 3HV9A 6PTDA 2A2IA 2E5CA 5EMKA 1GOWA 2PRMA 5JH1A 1W9DM 2P0IA 3CZJA 2ZX5A 4AX7A 1PDYA 4P8VA 4Q4RA 3VGDA 1IF2A 3NFUA 2DUXA 3RU8X 3GW0A 1XCXA 3T2OA 5A8NA 4JNYA 2ESCA 2D2GA 3N2XA 4AZBA 4NXKA 3TW6A 1H62A 1TSIA 2BBFA 4O17A 5FAJA 4IG2A 4WUIA 3GXFA 4JTUA 3TAKA 4HBKA 1ONXA 1DXIA 3GDTA 4ZO8A 5E1QA 1Q6DA 4S2CA 2HE8A 2A1YA 3MZNA 4KCTA 2UY2A 4DWSB 3VU2A 3SIZA 2FIQA 4DRSA 4QITA 3N2OA 3VCCA 3U0HA 5C2GA 2F8QA 1XGDA 3BAYA 4M1RA 3QQWA 3GHRA 1BRLB 1K9FA 5PTDA 7ENLA 1JPKA 1FWWA 1W1B1 4NZ1A 4QJ3B 4YVVA 5D38A 4GG9A 4L4OA 3TA9A 3AXHA 5EMUA 4S38A 1R3RA 3MSDA 4ORMA 3W82A 1RJRA 3C0LA 2WNNA 5LNSA 2CFFA 2HNEA 3SJNA 1QR7A 1FXPA 3TROA 3C0SA 5BYWA 3WLTA 1SJCA 3IIVA 2AAMA 3W6MA 5TIMA 2CZVA 1FUYA 1R9XA 1QPOA 1D8CA 1PSCA 3DKLA 4MY8A 3CQIA 4H8VA 2D23A 4WGXA 1ZBKA 4Z1YA 3CIVA 1F3EA 5G1YA 2YL9A 4LGXA 1YDYA 2ALRA 1KQZA 2WMIB 3WJYA 5D09A 3IUDA 3AUOA 3W28A 3NQ8A 1BF6A 2ZRYA 3PBWA 3VIKA 5BRBA 3TTOA 3RO8A 4DM2A 1K70A 3UF9A 4C1NA 3VA8A 2X1TA 1RVKA 4Q4MA 5HJYA 2VDGA 4XUGA 3GFYA 1TA3A 4R3UA 3U7BA 3BGGA 1SR0A 3TMQA 3GNDA 5ENLA 1V8EA 3H2AA 1U1JA 3WQCA 2ZE3A 1A0EA 2DP3A 2VTFA 4H9MA 1X8CA 2PP0A 3SY5A 5I3FA 3WIJA 3V5OA 4AEEA 4LS1A 1F4HA 1XYCA 1EDTA 2FKPA 3W1RA 3GRIA 3C6CA 2PP1A 1VKFA 3I10A 3W7GA 3I68A 4HNNA 4MDOA 3I3EA 1YTDA 3NPWA 4AD4A 1VJSA 3SR7A 1EOKA 5DY3A 2QZRA 1C3FA 3DESA 4F0KA 3UWVA 2G97A 5LIYX 3PZOA 2OX1A 3TR9A 3O7UA 5A8QA 4XQ6A 4ADSA 3CC1A 1FH7A 4U2YA 4M7SA 5I3GA 4BK9A 2RFGA 4CD8A 3QF0A 2AMGA 4IIHA 3O05A 4E3TA 3SUTA 1J6PA 2QCCA 5C2CA 4DYKA 3WK2A 2HXTA 5C71A 4H9YA 2DFAA 6XIAA 5G1MA 3K13A 1PL9A 2VR5A 1TR9A 4P7NA 2EPLX 4S3KA 1MNZA 5L9FA 1NSJA 3N4AA 4DLMA 2E4TA 1O5QA 2XIBA 3ZQ9A 3BPWA 4GI8A 4MUPA 3W1UA 1VCVA 1W1IE 2PI6A 1O5RA 1XD0A 3PZIA 2EF9A 3NQBA 2DU2A 1T8XA 3GH4A 3NQ7A 4Z1AA 2PU1A 3PBMA 1DJIA 3F2DA 1WA3A 4E4FA 4H8HA 3K8MA 1TTJA 4EPDC 1OD0A 3GU9A 4ZSTA 1X6NA 3HF3A 3W87A 5E0FA 3HV8A 4GJIA 5CSYA 5G5IA 1UR4A 5I78A 3WFLA 3MW7A 4V33A 4YIWA 3REQB 4UTKA 3S6TA 4DBUA 2DZAA 1DP0A 2Y88A 2HXUA 4JQ1A 3W72A 4C6EA 5DT5A 3FJNA 3QV9A 1GOMA 2NX9A 2WZIA 3D5HA 3R7MA 1B9ZA 1VFSA 2TSYA 4AHOA 2WC3A 3QMTA 2PDPA 2F2HA 3L4TA 5EMYA 4EWND 3S8HA 4LAUA 3B0XA 1C90A 1NFBA 4PUUA 4IQDA 4CGTA 4QCEA 3VCRA 2A7NA 3EWXA 3BMXA 4NF7A 3QRHA 5KINA 3W7PA 1VBRA 4ZL1A 2XJ7A 2GQ8A 3L21A 2YDQA 3HJZA 3BMWA 3SGZA 2AGKA 4IGNA 3VFCA 3C2RA 2G41A 3FAXA 3JU2A 3GNNA 2WYSA 4GKLA 1JGIA 1W3IA 5EKYA 3O16A 1W3JA 4LUYA 2OG9A 3LNPA 2E7FA 5H8PA 5FI8A 3E96A 3Q94A 1H09A 5C7HA 1XRVA 3N2CA 3GAYA 4H6RA 4L64A 2CZFA 1MEWA 2GUUA 4RNIA 2J7CA 2FGLA 2VQUA 1ECEA 1LP6A 4UTWA 1OJXA 2CXEA 1LG2A 3WH6A 3SY1A 1M04A 2CLKA 1KGUA 4JBRA 5HMEA 3EWCA 3NPUA 1T40A 5DFAA 1H61A 1BSLA 4XG1A 5CKSA 3IVSA 4RXGA 2WM0A 2SFPA 3LA4A 3S3GA 1B2YA 3GE7A 1C93A 4ZMGA 4Y9OA 2G3IA 3ITVA 1AZ2A 4FI4A 1TV2A 2OR2A 2C19A 3KOXA 5FJRA 2DUZA 3F4CA 3KVMA 4NNCA 4P61A 4HZ8A 4M56A 1M7OA 4ZQPA 4B5VA 3B8IA 3BJTA 2C0HA 3GHUA 1GTHA 2PZ0A 4LT9A 1ICPA 1P6WA 3A4XA 1R3QA 3IIXA 3R79A 1TKKA 3Q65A 1W56A 1GVFA 4YN5A 4BWLC 1A5UA 1CT5A 3ZS4A 5D04C 1SSGA 4W9TA 4JN8A 4XZ9A 3NOEA 4F0MA 4G8TA 1IEQA 1KM4A 2Y7EA 4L1GA 1Q7MA 3HG5A 5J5RA 5E0CA 3VDHA 1H7WA 4AWTA 1DE5A 1UR0A 2I5IA 4S3CA 2FTYA 2QMJA 2XGBA 4ZA0A 4Q8TA 3GXNA 3JZUA 4L1WA 1TUFA 2D2HA 5CLWA 1R0MA 4XIAA 4D6CA 2E6FA 3CT2A 2ZDSA 3FV9A 1FWAC 1LWIA 1LG1A 1DWAM 2Z6IA 1V79A 3C86A 1FWCC 4REQA 2DH3A 4LH8A 3HPAA 3U5YA 1NOWA 2BHZA 3RILA 2B31A 3S5ZA 1D3GA 3CS2A 3S2MA 4GXPA 1Q6GA 1WXZA 2VXNA 2WHLA 4MMWA 4Z1BA 3L68A 3WLPA 3W7DA 3UWWA 5AYZA 1EGMA 3T0AA 1CYGA 4QAWA 1RLCL 4I6VA 4A8IA 4JEJA 1TV8A 4DO6A 1V0LA 2VRJA 3DH7A 2YXGA 4CN1A 5FF4A 1HL8A 1JXJA 2ISSA 3CUJA 4XZHA 2QCDB 3P93A 3D3AA 4S3JA 2VEKA 1BVNP 4L7ZA 3G22A 1L9WA 3TW9A 1FHVA 2IUZA 1QNQA 1TJ2A 5AYYA 4L4LA 1YBQB 3TIMA 4FLQA 2J7GA 3LNMA 2A21A 2YL8A 4DELA 4MKNA 3C4UA 1E9YB 3QPZA 1TPC1 4UTFA 1NIUA 3R1ZA 2R91A 2XVKA 1F07A 1F9CA 1D2KA 3N17A 1DIKA 1LL7A 4M81A 3O6AA 3BXWA 3UXIA 2QDHA 1HGYA 2BMBA 1C9DA 4AU0A 1BD0A 4DUWA 2QDDA 4AD1A 1JUEA 3NSXA 2HPMA 4C6KA 4WY0B 2RJHA 4HCLA 3CZGA 4PUMA 1LYXA 2HSAA 2DH2A 4G1NA 4HU0A 1VR6A 1REQB 1R86A 5AHNA 3VZZA 2ZRXA 3FFSA 5T91A 2MUCA 2ADAA 2QHAA 2NSOA 3EMCA 3I3DA 3W6YA 3LCFA 1LOLA 1ITCA 1Q6CA 4MNLA 4E2DA 2W4XA 4O54A 4GVGA 4NJKA 3W7NA 1XQKA 1KM5A 4MFEA 4XAFA 1QAPA 1UW9A 3F2BA 3B9NA 1D7KA 3FAWA 4WK9A 5FIPA 3W76A 1FTXA 3RPDA 3BICA 3BLOA 1BVZA 3IGUA 3LOTA 3LMZA 2GFTA 3AYVA 1QUMA 2EPOA 2FDSA 1DWHM 3LBMA 3MI6A 5I06A 3P14A 5LA1A 1W3LA 2OLHA 1CCWB 4NHVA 1CGWA 1IEXA 2J7HA 1R9ZA 2HBVA 4J1OA 4BWLA 3BAWA 4DBEA 3NQGA 2QUUA 1XRTA 2W91A 4MJ4A 5HUPA 3RUBL 1ODUA 3W7MA 4H9ZA 1PEZA 3N6JA 2PDQA 3AWNA 4XWUA 3WH5A 5TF0A 3IIOA 3Q45A 5I77A 2PFHA 1OYAA 4LS2A 1KCLA 3VOJA 1LUCA 2XFRA 4OT7A 3WELA 3USBA 3IUHA 3YPIA 1XYAA 2DQXA 4WSJA 3W85A 4I90A 5CGTA 1I2NA 4K39A 5HQLA 3ARZA 4WOQA 3MYOA 3FA3A 1KFCA 2VO5A 3WQ6A 2VRQA 3GTHA 1XIBA 5AC8A 2QF8A 4HA0A 3H7VA 3G8EA 3W2MA 3MUAA 4H9UA 1EO5A 1SFLA 5B7YA 4M80A 5EPDA 3P6LA 1X1NA 3M9YA 4F0LA 4KRTA 3TAOA 1J0HA 4DJED 1M6JA 1FKXA 1HG3A 1KXVA 3CHDA 2QVHA 5DMMA 1B3XA 4KWSA 1BXNA 3A24A 1BTMA 3GO2A 3L4VA 4L61A 5BMXA 5XIAA 2VZVA 2CLPA 4QEEA 3TC7A 1OK4A 3OHIA 1PZ2A 2W67A 4CEXC 4M1BA 5HWJA 4K7YA 3AXXA 2ISDA 2FB3A 1DVJA 3NGJA 5DMNA 1US3A 3WQOA 4EPBC 1V6VA 1VHCA 3OLGA 4DWDA 5BOEA 1M68A 3NVDA 3WQDA 2FPTA 3CO4A 5K4ZA 3NJ3A 4WR3A 2TYSA 3KRSA 3PPGA 5BXPA 3S9YA 4A05A 1XYLA 3GTXA 2BP1A 3BLDA 1NWUA 1GNXA 4CQAA 2W3ZA 3FDKA 3M0KA 4G2DA 1V6YA 4GO8A 3U4AA 3LM7A 1KW1A 3IK4A 1QRQA 1OC6A 2Z2UA 4UOJA 1KFKA 2VEGA 4E0CA 4WKFA 1KTBA 3VKAA 3EPMA 3LGGA 3E5PA 1XYBA 2XVNA 4NT0A 1L6WA 1VIWA 4DUXA 1XC6A 3UERA 2QT3A 4MPKA 1IT8A 1AW5A 4OOUA 1LT7A 1VPQA 3DYPA 4NZ5A 3IUIA 2GQAA 2GDQA 1JNDA 3M46A 4E3VA 5KSWA 3KOYA 3ITLA 1EIBA 2DIEA 2YDRA 1UKSA 1OC5A 3QGVA 2NLYA 2J88A 5AZ1A 3SCPA 4HN8A 2XH4A 4CD5A 3STPA 3TN4A 4PR4A 1JYXA 2AKMA 4RXFA 4ASTA 4RKAA 4U31A 1X6LA 1HVQA 2P8BA 4M6UA 2FGZA 1I2QA 4NP7A 5D2VA 2NUYA 1E51A 1DJGA 4GNJA 3GDRA 1KRAC 4PODA 4ZO9A 1NDWA 3T42A 3AO0A 3NQ6A 3AIRA 3H26A 3JUGA 2V5LA 3V75A 2AOSA 3RJXA 1QPRA 5DX7A 1EEPA 2DT0A 2ACUA 3COTA 3WLLA 1GZJA 1JQXA 4ACYA 4V2XA 2A3EA 3GIPA 4I9TA 4FNSA 4NNAA 5FL0A 3U57A 3NDZA 1VFUA 2VWSA 4MF4A 3PTMA 4LYRA 3IGSA 3W7RA 3B8TA 3BAXA 1I75A 3CUGA 4MADA 4PSPA 4HIBA 4IMAA 1Q63A 2GK1B 4EPKA 4GNVA 3DERA 1PJ9A 4Z2LA 5CPOA 2VELA 1YIXA 1OF8A 3KL5A 3RU6A 1RK5A 3HJEA 2CLMA 1N2VA 1MYRA 1XLHA 3VI2A 4KIRA 4IH3A 5DCDA 3PHAA 2QF7A 5JUVA 4E2VA 1Y5VA 5E70A 1TE6A 1PDZA 1WCGA 1V3HA 4YWIA 3ZT5A 1H5VA 1EUAA 4IOTA 3BQ6A 2YCLA 2FFCA 4PTVA 3GKFA 2CIPA 2XVPA 4TQTA 4UIOA 4YVXA 1MWOA 1KNWA 1ZS2A 4LUTB 4B3KA 1H63A 4Z0JA 4PMRA 2GJPA 3T81A 2BOEX 3CYVA 2RKXA 4MZ8A 3AI0A 2V3FA 2OWXA 3J7HA 1E72M 3WNKA 1R30A 3B0PA 1RCQA 2AL2A 1MVYA 1ZHAA 2PTZA 4QDWA 4AVNA 2R1MA 3C3UA 1W3KA 2HPIA 4JS3A 4PMJA 5GJMA 4GO9A 3HA1A 3KE0A 1ZCOA 1UKTA 1ML1A 3AHZA 3IJ7A 2V5DA 2UWFA 2A85A 2VD8A 3MUZ1 4BF9A 3QBUA 1UCWA 3BLLA 3NYDA 1OCJA 1E6XM 3HN3A 1X98A 3RCMA 1BF2A 2EEXA 3ALFA 6A3HA 2PMQA 3WMLA 2DZSA 2EO7A 2POTA 4O0KA 3PTQA 2NVAA 2NVCA 2FZBA 3CWNA 1NF0A 4GZ7A 2FJUB 3PSVA 4AZIA 5A8GA 4DAFA 3KX6A 3WQ4A 2VC5A 3NURA 2Z2AA 1XV8A 3EX6A 1R5YA 4QG8A 3UWYA 3H21A 2Q02A 2V81A 4IFKB 3RR1A 4KPLA 4U10A 2J75A 3GXPA 4GIEA 3O63A 1KA9F 3CAQA 3FVDA 2QJGA 2DORA 2PD9A 3QZ6A 3SURA 3T44A 3RX4A 2GSEA 4F2TA 3UCQA 5BOFA 3W81A 3WLRA 3GQYA 1CBGA 2UY5A 3NQDA 2GOKA 4CD7A 1QBAA 5A8OA 4Q6JA 1YTEA 3UT0A 3I6EA 3EWYA 4JFSA 3TSMA 1W5OA 1B3ZA 1F7BA 4F9JA 4PUKA 3QR1A 4C65A 1LORA 3H4GA 2D3LA 1TV3A 1TIWA 3T4CA 4IF2A 4DQWA 3CHEA 1PO9A 2E5DA 3HB9A 2NWSA 3VXGA 3MWAA 4J2MA 1ZENA 1A50A 3A13A 3NTYA 2ZTKA 1W5NA 5D8ZA 1IEIA 1EJSC 1TV4A 2DJLA 2HWGA 4MSSA 3GIYA 2OOGA 3LRMA 1J0IA 1ISYA 1BYCA 3WNMA 1IV8A 3OIHA 3W7CA 5A6KA 1Z6KA 5TQLA 4B3LA 1W91A 6ALDA 4LVBA 5T8GA 1AH0A 7ODCA 3W83A 3WLIA 1KFBA 1EWEA 5KZDA 3CNYA 2Z1VA 3D3FA 3LEPA 3EMZA 3FLUA 5IM51 3ZJKA 1JF6A 2PEVA 4GVHA 1HO4A 1UD8A 3VGFA 3K46A 3L65A 3PVFA 1GWJA 4FNRA 5ABGA 2DPEA 3LERA 1DTUA 4MPQA 2JK2A 7TAAA 2EPNA 4JTGA 3U2OA 1JULA 4LNYA 3LS9A 1KGWA 1X8FA 4HZMA 1ZNNA 2TODA 3RK8A 4O1CA 3TKFA 3ABQA 4Q22A 4QM1A 2DZXA 4S3GA 1EPVA 3U4FA 3H4WA 1F8IA 4X2PA 2QAPA 4Y9AA 4PULA 4A2SA 4I8YA 1QPQA 4NJIA 4A6GA 5I6SA 4Z2HA 1SO3A 1LRQA 4S3DA 3LRKA 1CW2A 5BXTA 4UR8A 1UIPA 1S38A 3UY8A 3TZFA 3SRHA 2DSWA 4KT2A 4IUGA 5D9NA 4D6JA 5D9MA 2AKZA 4UQEA 1E71M 1A80A 4XKYB 4ACZA 4MNJA 4Y9PA 4DIAA 3G1HA 1WE5A 5XIMA 3KXQA 2Y6ZA 3I4KA 3HBLA 1H1ZA 1Z32X 1MEHA 2YBUA 5C9ZA 3U2EA 4K8HA 4ZE4A 3HQNA 4HU4A 1A5LC 3F1QA 2FLIA 4NG3A 1Y8BA 1JZ4A 2D3NA 3TSDA 4FNQA 4EK7A 4D6GA 2F9RA 4DYJA 2XZ7A 5E9AA 1TO3A 2W5FA 4R5EA 2D2JA 1GG0A 3V1HA 1XCWA 3WQFA 4J3XA 1OBAA 2ZOXA 2PTWA 3VINA 2ISWA 1XW8A 4GFSA 1W2PA 1EJRC 3VVGA 2IKHA 2WPBA 3TDFA 2D69A 1TZ9A 4UMCA 3R8RA 3NQEA 1HJUA 3EB4A 3GKAA 2XVLA 5E9XA 2DZPA 1NTHA 4PUWA 1UKOA 1M3UA 5I79A 4D6HA 3EDJA 1EA9C 4HJWA 4KWWA 1J0ZA 1ICQA 4K8GA 2VYOA 3RYSA 4TMCA 1OYCA 4ADTA 4BHYA 1JPMA 4JTIA 2I57A 5CQ1A 4LW7A 5HMSA 3USZA 4AQLA 1FCQA 1FH9A 1ME9A 3TTEA 4Z2GA 4AIOA 3G3MA 3MSYA 1GCYA 4GH3A 2D73A 5D02A 4W5ZA 3GX9A 3MMTA 3QGKC 3M07A 2I9EA 4DO5A 3NM3A 4B5SA 4R27A 1J10A 1DL3A 1O5XA 4JR5A 3PZMA 1JG9A 3UGRA 2Y5SA 2Q8LA 1GYNA 2P8CA 1T99A 4N9DA 2FFIA 4DBDA 1FOBA 3VZXA 1BRLA 5K4XA 4DJFC 1UWQA 1JUBA 2CZEA 1WBJA 3IPWA 1ISWA 1W31A 2FZ8A 3I4EA 3IACA 2QS8A 4A8NA 4XBKA 8A3HA 1UR9A 3HMJG 4MVAA 2BFGA 3CLWA 1A5MC 4YYFA 2JALA 3GG7A 1XIDA 1UR8A 3BQ5A 4FXJA 4GZJA 1YXDA 3RMJA 2OYLA 2YB4A 5T9BG 1RBOB 2I5QA 3KWXA 1P0BA 2EG8A 5AC4A 3MY9A 1Q6LA 3G8RA 1UG6A 4KH2A 4IJRA 3M6DA 3TE9A 4AMCA 2CBJA 2OOFA 3A4AA 4EANA 3V35A 2Z24A 3NAVA 3PC0A 1OB0A 3DYOA 3GC5A 1KGXA 5DEZA 1BYDA 3H4XA 1N8WA 5BU9A 3F5KA 1X38A 3E0IA 4W7VA 3FHQA 2VGBA 4B15A 1L2UA 4N9EA 1P0EA 3OZYA 4Z42C 3PZNA 2Y89A 3VNDA 2O9RA 4TX8A 3MU7A 3LLFA 5F1VA 3E74A 1XIIA 1KLZA 2KAUC 2XIIA 3H55A 3V0SA 3TU9A 3ARTA 1S2CA 1VEMA 1E3XA 3URNA 4NVTA 1CENA 3AS0A 3E2RA 2GGIA 3B8WA 3V1PA 2OYMA 1H7NA 4XZNX 1DJZA 3CHFA 4QEHA 4ZR8A 5A69A 1SZGA 1L6YA 3V5FA 4GE8A 2WMKA 1JCYA 2IS7A 4JCLA 3DG3A 4FZIA 4GUFA 1U5JA 1UUOA 1Q3NA 3WD4A 2WM1A 5BXSA 3OG3A 1TCMA 3VKBA 4Y96A 1TV5A 1NOUA 1FWHC 2Y5JA 4IPIA 1RY8A 4X3ZA 3EWUA 3UWEA 1WB0A 3TOPA 1AQ0A 5KZMA 3VM5A 3DI1A 1E9ZB 2WWCA 4QJ4B 1OSEA 1WDDA 3AIUA 1M7JA 2NX3A 3U5UA 1O68A 4V1XA 3UW6A 3LTSA 3FEMA 1EJTC 4P2VA 3GHSA 2TMDA 3LUTA 4YXGA 4EXBA 3ZYZA 1Z9AA 2P5NA 1NP2A 2DZUA 4YVPA 1MUMA 1EP3A 3UCCA 3NQMA 5ECVA 3LDVA 1JVNA 2OCZA 1E9LA 2DT3A 2PGRA 2JF7A 4JCMA 3AIVA 1E5JA 2HS6A 4UFLA 3BH4A 4PC8A 3A5VA 1UWRA 3H2CA 1BQCA 3MHFA 1FY6A 1OWQA 2B0MA 3B9OA 3UU0A 2WKLA 3GM8A 3CLMA 2HK0A 4WSHA 2GJXA 4HU8A 3K4AA 3SFKA 2PTXA 3KAOA 3CU2A 4PBGA 1F74A 3VNYA 4P8XA 3N6HA 3GBDA 1AMKA 3QY8A 2PLKA 1P4CA 1GG1A 1GK8A 1O4UA 1QHZA 4DJFA 1XLDA 1RALA 2ZUSA 3D47A 3EDFA 4RLIA 3NQFA 1UZHA 5CJMA 1K4GA 4AZ6A 4F66A 4PUEA 2EJAA 3UA3A 3IWPA 1T0OA 1YDVA 4MLRA 5I02A 1VFMA 5GNXA 4ZTXA 2Y61A 2X7WA 5DBUA 4QS5A 3S47A 8XIAA 1RD5A 3DX5A 3G0UA 3PK7A 5IDIA 3REQA 3MKVA 3GB6A 1JQVA 3EXTA 1HKJA 4C5YA 3AHXA 1C92A 3FKRA 4W88A 5LKYA 2OX4A 1SJAA 4DEFA 2OT0A 1BAGA 4O0ZA 4DO7A 4IFRA 4JFVA 1VB9A 3UEQA 4QQUA 4LCQA 3LHTA 1GVYA 2FPYA 4QG6A 1F3WA 1KC7A 1XLCA 1GQIA 4JIHA 4U28A 2GZXA 4NIRA 4ZFMA 4E8DA 3APTA 3RAOA 1H2JA 3SCOA 4JX5A 3LV5A 1TYGA 4GCAA 4X60A 2VP8A 3O15A 2W0UA 3O0KA 3URBA 4XZBA 3E1F1 3T6CA 5A6AA 2G3FA 4JFTA 4AXNA 1PTAA 1QVBA 4PCPA 4O1EA 1E73M 1K4HA 4W89A 2E9MA 2VX7A 4MTVA 2PWGA 1EP1A 2VKZG 4YYCA 1J4EA 1W1VA 3EOEA 4IIEA 1YX1A 2BZNA 5D03A 2XINA 4PMZA 3ZFHA 2OKTA 3PUOA 3GNPA 6XIMA 3WD1A 2PBGA 4LBSA 3M5ZA 4N9CA 4WIWA 3W02A 3WMSA 3UESA 3TONA 3GDMA 3UCDA 3T78A 3W27A 1OT1A 2Y7GA 2WVUA 5HQEA 3VC5A 1Q6FA 4WJ8A 3QLDA 2G8ZA 1W1ZA 3L0NA 1GPFA 1G4EA 2ABAA 3WJSA 1GOIA 3OOQA 1S2UA 1EYWA 4GCXA 4HKPA 3W84A 2ZA1A 3VDAA 4EACA 3HU7A 4UR9A 4UZSA 1WV2A 2R94A 3KZPA 1F5ZA 3LZ5A 4HNCA 3P67A 1J5TA 1Z69A 1GTEA 4LV4A 4IX2A 3M7WA 4G9PA 3U48A 1JD7A 1PKMA 4TVDA 2PDKA 5CG7A 1LTDA 3HURA 1B3YA 1J96A 1GKQA 1H7PA 3FHAA 3KP1A 4O53A 1YE4A 1MFUA 3LBCA 4JL2A 2IPFA 4DPQA 5HPOA 3BCFA 1ADDA 1TFVA 2OFJA 2XH7A 4ZB5A 1XF0A 4PCTA 2FZNA 3P3BA 3BE7A 4O14A 2E8ZA 2RAGA 3TMLA 2O9PA 2PDWA 1U2YA 5GNZA 4CQBA 1YYAA 3I3BA 3UJFA 4GY7A 1SZEA 2YIHA 3TSBA 1HJVA 4N7QA 1VPXA 1XG4A 3WQ8A 2CLEA 1VCGA 5LIWX 2W9MA 1GONA 3F4WA 3EWZA 3QFWA 4WQ6A 3EYPA 2WJZA 3OLIA 4UTMA 4WX2A 4E4PA 5IBXC 2V5KA 1RD6A 4G7FA 2GJNA 1OFPA 4AF0B 4ATLA 4BI7A 3KHJA 1F6YA 3P80A 5A2BA 1HKKA 2VGGA 3MC5A 3MB9A 4HB7A 3AQUA 1S2VA 2EG6A 3A12A 3LPFA 1Y5WA 2VFEA 4HMDA 3N15A 3PNZA 1F6KA 3E0VA 3QQ1A 2XPKA 2V3EA 1XR2A 3RG6A 3CWHA 4Q4PA 8RUCA 1HTIA 4X61A 1A49A 4R9OA 1JDEA 4OOZA 4LY4A 2WHMA 2J79A 2PAJA 3QC0A 1UIOA 2YGYA 2PDYA 4AD2A 4GJ1A 5FACA 1N7KA 4GINA 1CGXA 2P0OA 2ZUNA 1DKWA 1OZQA 2C71A 1XWYA 5L6UA 2IMRA 3P62A 3DFTA 4RCXA 2J7BA 1WDWA 4DNMA 4CKQA 4JFWA 1ZJHA 4LOCA 3T2QA 2Q71A 4GQ0A 4HT3A 3NYZA 1W9VA 2J62A 2XIQA 4R33A 2PLJA 2VEPA 1RQBA 3EKGA 1UMLA 1H41A 3QHMA 1OFEA 5KMYA 2NXIA 3H12A 2FHCA 1DWIM 4C6DA 3KVLA 2AMXA 3OHMB 2E9BA 3FJLA 1CNVA 3G6MA 4AVFA 4JTHA 1JCTA 1I45A 4HK5A 1GZGA 1AD4A 1HJWA 4W8BA 2DT2A 4DUOA 4LB3A 4PMXA 2BY1A 4RW5A 4GBUA 1B5TA 1ZP3A 5CBBA 4UWMA 4M82A 2NQ5A 2VX5A 3F5LA 1CB7B 1MW0A 1S2AA 5F4WA 3WENA 3WMCA 1TJPA 1AA1B 1Q66A 2FYMA 2XSXA 5CPQA 3HMCA 1E1FA 1QT1A 1QK0A 2BSLA 1CLVA 2QLYA 3AIQA 4IGMA 1G7VA 4CEUC 3BK0A 3OP2A 4HA3A 1PB0A 2YPIA 3RPTA 3DHDA 4U5KA 4FNPA 3DDMA 5CH9A 1B3OA 1QI0A 4Z2JA 4RV3A 2CC0A 2E8YA 3UZYA 1JZ5A 3MT1A 5BOOA 1TCDA 1SJDA 5DO8A 1ITXA 2V2CA 4JDBA 2BTMA 4HNLA 3SCSA 2J9ZA 3BDKA 3GDBA 5EGRA 1UQZA 1KR0A 3TXVA 5I3HA 4P8WA 3MQTA 3UYCA 1SUXA 4TTUA 1FP9A 2BB0A 1XRFA 2JFEX 2OTDA 1H7XA 3CQKA 3SCUA 4IXXA 2FPVA 4OFCA 1NARA 4JY8A 4FNUA 4KCWA 1Y5XA 2A3AA 2JKAA 4AVOA 5IBXA 1KXTA 2JKPA 2ZUTA 3S2CA 3L5AA 3E0WA 4PBEA 4FR6A 3HO8A 1PVNA 3NZGA 4O19A 4MLJA 2WC7A 2WBGA 3LHWA 4HHMA 1QPNA 3W1AA 5CLTA 3W3OA 3WQEA 5BZAA 2WZTA 1RA5A 4LALA 4P7RA 1FWEC 1JYVA 2WSKA 4JKMA 4ZE5A 3U7VA 3VD4A 4J9JA 1G94A 3R0UA 1HKWA 3TJIA 1WNOA 2CWXA 3LRLA 3QSRA 4YU1A 3M41A 3PS7A 4KRZA 4AZCA 3ZT6A 4CNNA 2CNCA 4OUEA 1I1WA 3FOKA 4HPHA 2R1KA 3PPHA 2YLAA 4IICA 4NZ3A 1WBHA 1HO1A 1EJUC 2YL5A 3WH9A 2XIMA 4ZO7A 5BRPA 5H91A 3L4UA 4Q33A 4WKHA 1JYNA 3LB0A 1TELA 3T07A 4DZAA 4OWGA 3WBAA 1OABA 2J77A 3UG8A 2NLIA 5F4SA 3HQ1A 3O1NA 4AEFA 3NA8A 3TJ4A 3B8VA 3MTWA 2OMAA 1WAWA 4U2ZA 5EMMA 1A0DA 5BROA 3ZSSA 4GK8A 4AB4A 4Q8VA 2OELA 2YZ5A 1OFRA 3I6TA 1WQ5A 2GDVA 2VOTA 3MMWA 2VC6A 3GVGA 3SB0A 3N2BA 4JAWA 2VZOA 5FJPA 3EDKA 5EB8A 3LGEA 2INZA 1BWKA 3IAQA 2EHHA 3SIMA 2QEZA 4IM4A 4ZVJA 1R8LA 1L6SA 1A5AA 2J66A 5AB3A 2PDUA 3GTNA 4CQDA 3B8UA 1XGZA 3ITTA 3WEZA 1FWDC 1E6QM 3L66A 3ALGA 4Q4KA 5C70A 1FDZA 4WEVX 3ZWSA 1XIFA 5AY7A 3QZAA 4MNMA 2ZX6A 2BY2A 1ODZA 2QCLA 3EZ4A 4DJEC 1KKRA 1PS9A 3DEQA 5G1TA 3OQEA 4IP7A 2O9OA 1F8MA 1VCFA 3V4BA 4GQBA 4B4FA 1UD3A 2WJFA 3MI3A 2BV9A 2QPXA 6CGTA 4DPPA 3G0SA 3FEQA 1QO5A 3NL3A 3CV6A 3A64A 5JQ9A 3IV8A 3C0QA 1O66A 1YRRA 3M1ZA 4PCSA 3DBNA 4LBRA 1KFLA 2XUCA 1IT7A 3WLKX 1EO7A 4IXHA 2ON3A 3HQOA 1XLKA 4GIYA 2OWCA 2X1UA 3GG1A 1V7YA 4Z0SA 4W4QA 2JKEA 3RN6A 1QNSA 3HPFA 4CVWA 1UOZA 4ROQA 3TN3A 2GYIA 2WZHA 3QTPA 3KBJA 4QJ1A 2NV2A 3DGRA 3S2NA 3ECQA 2R14A 1FWGC 5AHEA 5I24A 2PWDA 4C91A 3RMEA 4P8UA 4GZEA 1MQQA 1GVRA 3GHTA 4BR1A 2NT0A 2YOCA 4TXEA 2DSUA 2X2YA 4ZODA 3H8AA 1ONWA 4IL0A 1U5HA 2XVGA 3SN0A 3THAA 4KF1A 1NWTA 4AW7A 5K7JA 1NM9A 4LEFA 3MUCA 1BGGA 3V0UA 2XM1A 3TEVA 1US0A 2CERA 1RCOB 4A3YA 1IHIA 1EX1A 1JZ6A 2PC4A 1G67A 2AGTA 3D0CA 3TTSA 5E6ZA 3K1GA 2R24A 1GT8A 1R3VA 4YWSA 3TV8A 1UWAA 3AALA 4QHRA 1GPWA 1E4NA 4GQRA 2PRLA 5AHMA 2QCFA 1M9HA 3KUMA 3L4YA 3ZR4A 1B4KA 5DF0A 5HINA 4QXIA 3FGCB 3N2MA 1IE7C 3BLKA 4ML4A 4N6EA 3TN6A 4W7UA 4YCPA 1PZ3A 5A2AA 5KTLA 2D22A 2PLCA 3QGAC 5DY2A 3TWBA 2NUXA 2WPGA 3G1AA 3AHYA 5C5YA 2VMFA 4E8CA 5DCBA 3B3DA 1O95A 5IOBA 2H3BA 4B9YA 1MI3A 3I7SA 3DBPA 4UFMA 4PGLA 2QDGA 4WDTA 1GW9A 4LYQA 1QI5A 3O3RA 3AYTA 1UR3M 1E70M 3R0DA 2GQ9A 2CXGA 4K6AA 2CHRA 2WMGA 2W79A 5FJOA 2J8FA 4QAIA 4E2OA 1UH4A 4RDZA 4KRUA 3WYZA 1JDFA 2GOUA 4LANA 1RXOB 2DVTA 2F2KA 1OCBA 3WJWA 5G4WA 4S3AA 4P7OA 3ICJA 1MUCA 2VURA 3F4VA 4HU3A 2DZBA 1J93A 4A3QA 5HANA 2E09A 4KQNA 1E4LA 3OGRA 2H9AB 4XAPA 3WDJA 3W38A 4HA1A 3PZTA 3QV6A 2PDMA 2O7QA 4U3CA 3ITGA 2R8WA 1HX0A 4QJ5B 4OU1A 2XFYA 1Z89A 3SN1A 1EDQA 3EX3A 4J3ZA 2DZWA 3SQLA 3CL7A 1R3SA 2WVSA 3N4FA 2ATSA 3ARVA 1SW7A 4XTIA 3GVVA 3H54A 5EBUA 2VR4A 4GYPA 3IIPA 1XIEA 3N3MA 1VFOA 4BQ4A 1QASA 4QG9A 3MDUA 1KM6A 3WQGA 2PGFA 3CB3A 3VE7A 2REQB 2PCEA 3G1XA 1HUVA 3THQA 1KWGA 3OA5A 2CCRA 4RK8A 3EB2A 1FKWA 3NXLA 3CXOA 3DFHA 5C6MA 1LRNA 2G3JA 3GLCA 4PTXA 4PCFA 3QY6A 2MANA 1PYFA 2YCJA 3H7RA 2BVYA 3VE9A 5CSSA 1J0YA 4XAZA 1UD5A 4Q8QA 3AYSA 5AC5A 3FJ6A 3OVRA 3SY8A 1CXLA 2BX7A 4E38A 3M0YA 5EL1A 4DZHA 1OK6A 1TE1A 1M41A 4A8LA 3O2LA 3S4TA 2ABBA 2WSPA 2A7RA 2JQXA 4MUZA 1XLEA 4EAYA 1K9DA 3VUPA 3AMDA 1J11A 1EJXC 3ARSA 4XO7A 1JZ8A 4LRSA 2EBNA 5CBIA 1ZL1A 4IISA 4GYKA 2INEA 5I3JA 1F05A 1FHLA 3S42A 2V68A 4M7TA 1JIBA 2GVJA 4ATDA 2XU2A 2JIWA 2Q8XA 4XBJA 2TPSA 1QWKA 3GZAA 3ANYA 2ONEA 2CITA 4FHAA 5J8LA 4LYKA 5CAHA 4YTTA 4H9XA 1AVAA 3UZWA 4QCFA 5LYRA 4MKVA 5F7UA 2PDHA 1B57A 1PAMA 1CIUA 4BY3A 1TMLA 3L5LA 2VUNA 2L5HA 1AG1O 1Q85A 1TPVA 3IIZA 5JBEA 1BLIA 5G4EA 2GGGA 2WANA 1IIGA 3LZ3A 1UHVA 4PB3A 3T8QA 1XH2A 2YW3A 1DJHA 3VIIA 3H24A 3UQNA 3PJTA 1R6WA 2Y8UA 1TPB1 1VZWA 1KRMA 2NSXA 3W7LA 2E68A 1UUQA 1C7TA 2A6LA 3SZ8A 4IG2B 5I07A 5KZEA 2OZ3A 3EX1A 5CC6A 3VAVA 2CESA 3AXKA 3RNDA 2WNQA 5FSDC 3S0CA 3UA4A 5A6TC 4XKYA 5BU6A 1ISZA 5CJNA 1S1PA 5GVJA 3OQ8A 2PGEA 4GABA 5HA7A 3RGTA 3M0VA 3W1TA 1UKPA 4NYUA 1X7FA 4J40A 1EZWA 5I03A 3R25A 5CPLA 4AWSA 1K3UA 1GOKA 3JW7A 3KFTA 3UPBA 4C6NA 4C6LA 1LBLA 2OEKA 4CQ9A 2V82A 5M3WA 3WLHA 5DRIA 3EXSA 4FMVA 1W2VA 4J2PA 4TO8A 4C6OA 9CGTA 4L4MA 3BLIA 4JD4A 3S5OA 3BZGA 4I7UA 1XDJA 3LX9A 5DCEA 2LLEA 4KFOA 4NX5A 4CCCA 4GI6A 2F6KA 1FCUA 3R12A 2VGIA 1PIIA 4WXZA 5HNTA 3CM4A 3WF2A 1DIEA 3VOCA 3ZLGA 2PPGA 2V5CA 3VMNA 3W24A 3VO0A 1JI1A 1LJYA 3NL5A 2OGYA 2OWWA 1ME8A 5CXPA 3T0TA 1XKYA 3LCXA 2WSYA 1QOXA 2DEPA 3KOZA 2Z28A 4DF0A 1Q6OA 4FIRA 1O7AA 5F2LA 5LIUX 4D6DA 3O0FA 1QHOA 3GS6A 1TVNA 3HG4A 3RXZA 1Y65A 3WUEA 1PZ1A 2NWRA 3HPSA 2ACRA 1RV8A 2EJ1A 4C1NB 3G18A 3BMVA 2DZTA 1EIXA 1WZLA 3MCMA 1N8FA 2ZKMX 5EU9A 1MXGA 1TA3B 2FZ9A 4X63A 3ZOAA 4WDXA 2FMOA 4K37A 2DSZA 4V27A 1I9CB 4O1DA 4C6FA 2Z4GA 3AXMA 3CUIA 4IUOA 4S1FA 3UG4A 1ZLPA 4Q6XA 1VRXA 2FZMA 3GR8A 3N11A 4FLRA 2EKCA 4NNBA 2I1OA 2ZX9A 1NAL1 4DJFD 4MWAC 1VLWA 1GHSA 2OU4A 1M01A 1OD8A 5HJXA 4BFAA 3R8GA 1M65A 2BVWA 3UYIA 3EOUA 6REQA 4LV9A 2CEQA 4ICNA 5ABFB 2FHFA 1G4SA 5LNRA 1H51A 2Z1BA 4MFDA 1E4MM 4JTAA 1UC5A 7REQB 2VZTA 3RLUA 3W25A 4QDPA 3ZVHB 5C0QA 3GXIA 1CXFA 4PB4A 3PWAA 2YKKA 4UQDA 3WNNA 4PL2A 3T40A 1DYSA 5G4HC 4LSBA 3LGDA 3MHUA 3HGRA 3HG2A 3N9RA 3NNTA 4L80A 3ME3A 4AISA 1ZY9A 2W92A 4HPNA 1FP8A 3KDOA 4NUWA 3WX7A 3CPRA 1XD1A 4PTDA 1GJWA 1O60A 1YLVA 4FA3A 2Y8VA 1ZFJA 1PZ0A 1DV7A 5DXXA 1TQXA 1LOSA 2YXXA 5A2CA 1K1DA 3M6YA 3ZO9A 3W26A 4PE8A 3DFQA 1PTDA 2YW4A 4XUYA 4Q8OA 1XI3A 4DBSA 4I3GA 5F1UA 3VIGA 4C6MA 3A22A 1OX5A 3WD0A 4UR7A 4FLSA 1TWDA 3ANUA 4UFIA 3ZIZA 1UYQA 4NAFA 3W9ZA 4DN1A 1W1A1 3DFOA 5F2MA 3VM7A 1DJQA 1AFSA 3W0KA 1MUWA 4UTLA 4OHQA 2WBKA 4QNWA 4S2BA 3ZT7A 1LM1A 5F2GA 3GU1A 1JFXA 1J18A 3RM4A 4H8UA 2J6VA 1SZRA 4Q8MA 3S5SA 3AS3A 2VT0A 1OC7A 1V02A 4UTHA 4TX6A 2CLLA 4GPNA 4PEKA 4PL1A 3W6LA 1E4IA 5LHEA 1CZ1A 4OTKA 4MYAA 4B5WA 3U2CA 1O5KA 3PJUA 5HULA 2Z1SA 5BW6A 3VGEA 1PHWA 1VEOA 2Z7GA 4ERAA 1NP0A 3N18A 1XYFA 1G0CA 1XICA 1E1CA 3B97A 3NEVA 4N2YA 1GEQA 3OBEA 3VGGA 2V2DA 3CV2A 2QPSA 3ANVA 3WFAA 2VC7A 1LBFA 1VIZA 3BVJA 2MNRA 2PZNA 2Y62A 2VUYA 4AY7A 4MWAA 3PFMA 2PU0A 1ITUA 3GDKA 4DYEA 3BCDA 1KV5A 4UTWC 3KBVA 5HNUA 1RP8A 3GXMA 2FB2A 2XWEA 3E5BA 3BC9A 3CTLA 1XFCA 4RPQA 3TR2A 1EXPA 3BWWA 3SN4A 1UWTA 2X2GA 2ASHA 3GXTA 1B9BA 4Z2IA 3AU6A 3IJ6A 5CC3A 3NM1A 3NO1A 4C6IA 1QI2A 1DTNA 1MSSA 1XISA 2PLMA 3GNXA 2CWNA 5FF7A 5AN7A 4NAEA 1NDVA 3N12A 2V9DA 3URAA 3WCZA 4G56A 3NSNA 1JD9A 3PFRA 1ZJBA 3KHDA 1Q7QA 1ESWA 1BXCA 2ZFAA 4H6QA 4IIDA 4PFHA 1LOQA 1P43A 1MDRA 3N13A 1KM1A 1TWIA 5ECUA 3SGGA 2HRWA 1JCJA 1J8VA 4RUBA 4C6JA 4DXVA 1XQLA 1TPEA 3M47A 4BA0A 4O13A 4LXFA 1NWSA 2JGQA 3A3HA 4S3BA 5D33A 1IZJA 2Y5EA 1XLIA 4O8RA 1PIFA 3B04A 1O12A 1ZAIA 4WDUA 3EA2A 1UWUA 4L1XA 3FVMA 3THUA 3GSMA 2UY3A 4IP4A 1BYBA 2VGFA 1QDSA 2EQDA 1I0BA 4OECA 4RE3A 4OUIA 4WSKA 3KS5A 2RDWA 4W86A 4REQB 3SUSA 2VWTA 5KEZA 2GVLA 1HP5A 3EOOA 3AUJA 2IQ0A 1DXFA 4G1KA 2Z29A 3C2YA 1Y7VA 3MJMA 4L9YA 2VCAA 1AD1A 1PV8A 1PWLA 1YNQA 4IMEA 1BSIA 3LI0A 1F73A 1J01A 2AQOA 3VK5A 7A3HA 4CVUA 3H2FA 4GI9A 4N4PA 3SADA 2GGJA 2YCEA 2OSWA 4KGJA 2FH8A 2Y8KA 3VIFA 3EOSA 3GR7A 1VFFA 4B16A 1V93A 3RLHA 1DJNA 2GPTA 1B54A 4NL1A 4AUBA 3ATYA 2C0AA 4C7FA 1XDLA 4H01A 4I9JA 1JDCA 2WHKA 5C2XA 3FK4A 2DQWA 2BVTA 3BJFA 3W2LA 3M5YA 2G0WA 2X0HA 4HVXA 2QCNA 3WN6A 4RNHA 2IKIA 4LC6A 4H1ZA 3RF9A 2E5BA 3KLLA 4JYEA 2NV1A 4MB1A 1V3LA 1EL3A 2X30A 1JCMP 4XB3A 4OBSA 4AFYA 1JCNA 1C7SA 3WL0A 1OIFA 1YTKA 1E0XA 1J9YA 5GNYA 4OZOA 2C18A 1LLWA 3G5EA 4K68A 4ZSUA 3VUSA 3DAQA 1V02E 1D3HA 3TOYA 4MJZA 4I5XA 1NQKA 2Z7KA 4A4AA 3AS2A 1OFOA 1TZ7A 1QJWA 1S2WA 1M03A 2OQHA 1TJ1A 3E2QA 1MO0A 5A6BA 1S39A 3DYMA 3TC6A 3OW1A 4WOZA 1BXBA 1VYRA 3MCNA 3SBFA 1AZ1A 1JUKA 3NIYA 1Q13A 2QV5A 6TAAA 1FX6A 4FPSA 4PRRA 2QCMA 4HHLA 3UR2A 4B90A 1VLIA 5H2ZA 4MWAE 3DFPA 3WG6A 1JPDX 2GUYA 4UTJA 3DZ1A 1GVQA 1ICSA 2FTWA 4UZUA 3S6DA 1BKHA 1ZTVA 1NFGA 2XN1A 3INPA 4HMNA 3VKCA 1Q6RA 1QNOA 4PB5A 1OX6A 1VH7A 1YW1A 3LQGA 1H3GA 1OX4A 3GZ3A 3IARA 2C1GA 3MO4A 4XSMA 1LUCB 5I3KA 1BPLB 1EFZA 1V6WA 3WMBA 4W84A 1F6PA 1PBGA 2V38A 2Y24A 4E6MA 4HK6A 3ELFA 2J7EA 4LVAA 3FJ4A 3WLMA 3AZSA 4GJJA 3LSCA 1AW1A 1A4MA 2J13A 1IXQA 1UZ1A 4XVEA 2QW5A 1AJ0A 2C91A 2D0GA 2XN2A 2V0TA 3DXIA 4GFIA 3TC3A 2OT1A 4XZMX 4IIFA 4AD0A 1W3TA 5CEWA 1K6WA 1PHQA 1LL6A 2OZ0A 5AZ0A 2ZYFA 2NT1A 1K03A 4O4VA 3PUDA 1T5AA 2ZE0A 4F0SA 4F9DA 4HZ7A 4GRSA 3IV3A 1L6FA 1KLYA 4G7EA 3HGJA 5D9OA 4H6EA 3L4ZA 5I5RA 2RH9A 3TLLA 2YCKX 4LYPA 2AAAA 4GUHA 3LD5A 2VEMA 1SVDA 3PWGA 4ECLA 2C15A 4RNJA 3FXGA 4KEMA 5KITA 4L9ZA 1JJKA 1U83A 1GVSA 1FWNA 1HF6A 3WUBA 2CZDA 3KRBA 3QXBA 1C8QA 2VEIA 2C79A 3BSMA 4QFUA 2QVNA 2V63A 5EBAA 3PBVA 2J24A 2IXVA 3S2LA 1US2A 3IS4A 1L2QA 4JYDA 2ZUUA 4PUJA 3WLOA 3OLDA 3WQVA 2J8GA 3M4HA 4L5ZA 5LXEA 3CUFA 4F0RA 5AFDA 5LA0A 3UPMA 1C8VA 3O06A 2A79A 4CCEA 3BAIA 3PG9A 3SECA 3TH6A 4R88A 1JAEA 3UJEA 4LJ3A 3R5EA 2XYLA 3NO3A 4RE2A 3EGJA 3CT7A 3PJXA 4KFPA 1THFD 1SYTA 4NASA 2JEQA 4HSHA 3BAJA 1KFJA 2J9XA 2NUWA 1HN1A 1R7AA 4XZWA 2VQTA 3V3WA 3RITA 5AOUA 3TFCA 1W3NA 3K4DA 2PBOA 4A22A 4JNZA 4M3PA 4LUSA 3P0XA 2JE8A 1T96A 2ZBTA 4HOWA 3BSGA 3UZ5A 5KZ6A 1W1PA 3L23A 1QTWA 1P1XA 2PWVA 3TK7A 3DGBA 3GYCA 4JHMA 3MDWA 1P0DA 3W86A 1P6CA 3BJSA 1S46A 4OKDA 3CIXA 5AYXA 3ERPA 3C3NA 3PPFA 2J6XA 1Z44A 3ZJ7A 1UA3A 2IQDA 1N55A 4PYSA 5H8UA 4UOQA 3GVWA 4IT1A 4RV8A 1UPPA 4P7LA 1OFDA 2ZXAA 3UD6A 2P88A 3VNZA 3JRKA 2X1SA 5D2TA 4MB4A 4ZFCA 4YHGA 3KTCA 3NZ1A 1I0DA 1NH6A 5I09A 4QROA 3TW7A 3B4YA 2BGSA 3VKKA 3W7EA 4W5UA 4IHCA 1HGWA 5CSUA 7TIMA 3NUKA 3LV6A 3AXIA 3W00A 4LNCA 1LLZA 2BXYA 2VFHA 3T09A 3MV11 3VOGA 4PZVA 1E6SM 1TRDA 2RDUA 1B4EA 2YCLB 4C6CA 1RPXA 1CX9A 1CPUA 3A21A 4FOKA 3GNOA 4NYYA 3B9EA 3H70A 4JPGA 4LTSA 1RZMA 1GZ1A 1F4AA 5GPRA 4EPEC 1XIMA 2VFIA 1RBLA 5E5CA 3P0WA 2AL2B 3WK1A 1FWTA 1EHAA 3M7SA 2IPGA 2NQ9A 1AQHA 4LUIA 1TTPA 1KCZA 1FDJA 1YPIA 3V36A 4UQCA 4AC7C 3PBGA 1DWGM 3MUXA 1H0IA 4UNIA 4V28A 3M0IA 1YDNA 2A3CA 3GIQA 1F76A 2D1ZA 5FEPA 3VOFA 3APYA 5CZTA 3OYXA 1M7PA 1C29A 3H7UA 1OEPA 3SDOA 2BG5A 4XD5A 3W2KA 2XHYA 4JIEA 4WJEA 1LWHA 4RNFA 1KXHA 5D05A 4NXSA 1L6GA 2WJEA 1I6NA 4ZOAA 3WQ5A 4A21A 3T1GA 4ZQOA 1P0NA 2XGZA 4TOQA 1UD6A 2PSNA 1R9YA 4XZLX 4QSFA 2Y0FA 3EDEA 4FSAA 1H4PA 2G50A 1NDYA 1WKDA 2HK1A 4UQBA 3KRUA 4QISA 1UP3A 1RAKA 2J4GA 2WC4A 2FVKA 3N19B 4PUDA 4PMYA 3O6CA 2Q3OA 3CH9A 4PMUA 5JBDA 1QNVA 3EB3A 2A3BA 3QR0A 3XIMA 4TTGA 2O92A 1POKA 5FD0A 3FGCA 2A0NA 3U8GA 3AS1A 1TRIA 1U5VA 5J5DA 1ZAJA 3G2GA 3OU8A 4QGCA 1FWSA 4NQ1A 1A3XA 4BEUA 2YL6A 3E6EA 5JXQA 3IJIA 3ORWA 2HE5A 5AECA 1VJIA 1BHGA 4GC3A 4MJ2A 3W7JA 4IPJA 4P5UA 1W1YA 2HDJA 3A3WA 1IQ8A 3FDGA 1W9XA 1ZSXA 1J0KA 3CHVA 4YTUA 3LHYA 3GR4A 1GUVA 3TYZA 1GGOA 4LBUA 3KZSA 5EY5A 3M43A 3WDQA 3IJQA 1LRTA 4CNTA 2PDFA 1R3TA 5DMLA 2PDNA 1TJ0A 3KBNA 2X16A 3LENA 2E6AA 1CXIA 1SR9A 1GKPA 3V18A 1UJPA 3GWQA 5HJLA 4XX6A 3ARRA 4D6FA 4NJGA 1A5SA 1QPKA 5LIKX 1V0MA 1E5NA 1GVIA 4Y7EA 1NOFA 2RGMA 2VHLA 3CQJA 6ENLA 5DXYA 3AC0A 4QLLA 1XGEA 1UWIA 1ZZMA 4C5ZA 4C90A 3TYBA 2X05A 3PY2A 5A3HA 4CU6A 4WKAA 3DC8A 5E6YA 3WQWA 1RJQA 4W7WA 1QBBA 3UJ2A 3KWSA