3V35A

Aldose reductase complexed with a nitro compound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
316
structure length
316
Chain Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Partial inhibition of aldose reductase by nitazoxanide and its molecular basis.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v35A00
1LWIA 1Q5MA 3QKZA 1AZ1A 1ZGDA 2BGSA 1PZ1A 2IQDA 4WEVX 4QR6A 5C7HA 2PFHA 3FJNA 4YVVA 4PR4A 2FVLA 1VBJA 1YNPA 2INEA 4JQ3A 4PUUA 4XZNX 4Q3MA 4XVEA 3ONBA 5KETA 1PYFA 3UYIA 4FALA 2ALRA 3V36A 2IKGA 5LIWX 1S2AA 3EB3A 4GCAA 2PF8A 4LBRA 4JTCA 2IPFA 1EL3A 3EB4A 2FGBA 3V0SA 1Z3NA 2HVOA 2R9RA 4XZLX 3LNMA 2IS7A 2HE5A 2PDQA 1IEIA 2WZTA 4FZIA 1GVEA 4IJRA 3UFYA 4XK2A 1AH0A 4AUBA 4DBSA 4LB3A 2I16A 2ISFA 3UZZA 3BCJA 4JIRA 2J8TA 3BUVA 3DN5A 4R9OA 4WDXA 2NVCA 3EAUA 1AH4A 4QBXA 4YVPA 3N2TA 3LBOA 4YS1A 4JQ1A 4FAMA 2ACSA 2F2KA 4PUWA 5HNUA 1YE6A 2PDXA 2HE8A 3VXGA 4QX4A 2I17A 4XAPA 3GHTA 4H7CA 3ONCA 1S1RA 2C91A 1R38A 3NTYA 2PDUA 2VDGA 3H4GA 5HA7A 2PDWA 3R94A 2FZ8A 3RX3A 4FA3A 1HW6A 2AGTA 3UZXA 3M4HA 1X96A 4ASTA 3WBWA 3R7MA 1RY8A 1YNQA 3BURA 1RALA 4JTDA 3LZ5A 1X98A 4XVDA 4DBUA 4GIEA 3UGRA 2WZMA 2PDBA 1PZ0A 2R24A 4JIHA 1ADSA 3D3FA 2IPJA 3CASA 1ZQ5A 4PRTA 3G1RA 3F7JA 3WCZA 5JH1A 3B3DA 2F38A 3GHUA 4Q7BA 4DZ5A 3GHRA 1QRQA 3CAQA 2A79A 1MZRA 3WBXA 4XO6A 3LD5A 1EF3A 5LIXX 1YE4A 2PEVA 4JTQA 3MB9A 4JTRA 1MRQA 2PDGA 4IGSA 3LQLA 3RX4A 2ACQA 5DANA 1Z8AA 3CAVA 2PDJA 5AZ1A 4WGHA 5LIYX 3M64A 4XZHA 2IPWA 4JQAA 3G5EA 1MI3A 1SM9A 2PDNA 2PDHA 1QWKA 1PWMA 3BV7A 1Q13A 3UZYA 4OTKA 2QXWA 4MHBA 4ICCX 3V0TA 4PRRA 1K8CA 2PDFA 1XF0A 4JTAA 2HVNA 3H7RA 4GQ0A 1ZSXA 4WDUA 2CLPA 4HMNA 1XJBA 3MC5A 2DV0A 3UG8A 2PD9A 3GUGA 1AZ2A 1US0A 3LZ3A 4L1WA 2DUXA 1XGDA 3H7UA 4LAUA 4WRHA 3RX2A 4G5DA 2PDPA 4F40A 5HNTA 4WDTA 5AZ0A 3WBYA 1IHIA 4XZIA 4GACA 5LIKX 1LQAA 4LAZA 4LB4A 3C3UA 3WG6A 2BGQA 3LENA 4ZFCA 2PZNA 3T42A 3LQGA 4PMJA 2PDIA 3R58A 2PDKA 2IKJA 3ERPA 1EXBA 1Z9AA 3FX4A 4EXBA 3P2VA 2PDLA 3R6IA 3LN3A 1A80A 4EXAA 4WDWA 3N6QA 2ACRA 1HQTA 2PDMA 2NVDA 3V0UA 1ZUAX 2ACUA 3R43A 3R8GA 5JH2A 1C9WA 2INZA 2FZBA 2PD5A 3COTA 3CMFA 3U2CA 3GHSA 2IKIA 2IPGA 1UR3M 2PDCA 2IQ0A 1JEZA 1X97A 3V35A 1S1PA 1AH3A 3CV7A 4YU1A 5M2FX 4JQ2A 1S2CA 1M9HA 3UZWA 1T41A 2FZ9A 2PDYA 4HBKA 4XO7A 1VP5A 3O3RA 4DBWA 2HDJA 4YVXA 3UP8A 1RY0A 4GA8A 4IJCA 3R8HA 2P5NA 2HEJA 1J96A 4GQGA 1PWLA 2HV5A 4LBSA 1T40A 2IKHA 1EKOA 3LUTA 4JIIX 1AFSA 5LIUX 4L1XA 4XZMX 4QXIA 2DUZA 3S3GA 4GABA 4I5XA 3DOPA 3CV6A 1FRBA 2FZDA 3Q67A 3UWEA 1Z89A 4RPQA 3O0KA 3Q65A 4JQ4A 2BP1A 1OG6A 3LEPA 3M0IA 4H8NA 4NKCA 3KRBA
chains in the Genus database with same CATH superfamily
4W5ZA 5DLCA 1LWIA 3T7VA 6A3HA 4B3KA 2ISVA 2Y7GA 4R9XA 5F1VA 3PJXA 1V0KA 4GKTA 2NVAA 2RKXA 2YDRA 3ABZA 3GNNA 2WMKA 1TZZA 4PGLA 1PBGA 1Q6FA 1FDYA 1HKVA 1YNPA 4LH8A 2EPMX 1WB0A 5DEZA 2WZEA 5DELA 2ZWYA 1CCWB 5HBFA 1N7KA 1LRNA 1P0DA 2ANUA 3AJ7A 3K8KA 3QTPA 3T2PA 2Y8UA 4IF2A 3TTOA 1DTUA 2WJDA 4K3ZA 4W87A 4CCEA 1YYAA 4HU0A 3CPRA 3P84A 3V1HA 4PTVA 2X8RA 3PK7A 1A0CA 1I4NA 1IZJA 3V0SA 1Z3NA 5JU6A 1NWUA 1JL8A 1XX1A 2VOTA 1H5VA 4N6EA 3PFMA 2KAUC 1JDAA 5F4WA 1XBZA 2HRWA 2Z27A 2ZX7A 1W91A 2QV4A 3WH5A 2O9TA 1VFLA 3UFYA 1I2OA 3P80A 2GGIA 2QV5A 2H8ZA 2ISFA 2WXDM 1G4PA 4TXEA 4PSRA 2YL8A 2ONEA 3N29A 4Z1BA 3GFZA 3QRHA 2POZA 1EPXA 1O68A 3OLIA 3M0MA 1S38A 1DOSA 2CW6A 2X1SA 1GPFA 2G96A 5GNZA 3BWWA 4KBXA 3LHZA 3UWVA 1UIPA 2VRKA 1E3ZA 4ZTXA 2V2CA 3BOXA 3QW4B 2WZHA 3FJLA 2E28A 4HIBA 3EA1A 1W3JA 3W7RA 3MJYA 3WK3A 3QC0A 1BEUA 3W02A 4OV9A 2ODOA 3W7DA 2DGAA 1JZ2A 2OZ8A 3VD3A 3V3WA 3KVMA 3GR8A 1W37A 3HF3A 3V1PA 4FIQA 1QTWA 1DJIA 3STFA 1BVZA 1X98A 2WMJA 4XVDA 4DBUA 3NO1A 4CEUC 1RD6A 4HHPA 3E2QA 2WZMA 3S1UA 1PZ0A 3TYCA 2PUZA 3B04A 3B8UA 2VX4A 3CAKA 3M1ZA 3NZRA 5CZKA 1TPEA 1QHPA 1ZTVA 2YDAA 4AVFA 1JI2A 3N6JA 5JH1A 2E0PA 3B8WA 3FXGA 5A6KA 1YADA 1A3HA 4LYQA 1B54A 3GHRA 1RJQA 4IXXA 3CAQA 4A29A 5AHMA 3NA8A 4DN1A 2WPBA 2NQHA 5AECA 3EOSA 3MZNA 5FOOA 1XH2A 2DSKA 2CWXA 3CLMA 1UKTA 1UA3A 4QITA 1H0IA 3MB9A 3XIMA 4WZHA 5C2XA 1FWNA 3VFCA 4GBUA 4J3VA 2UY2A 3N2CA 1PX4A 1UR2A 3QHNA 1VFUA 2F7FA 3PTKA 2VD9A 4UTWC 1XG4A 3BK0A 4WGHA 2ZE0A 5FD0A 5EL1A 3DYPA 3WD1A 4X2PA 1P0KA 3P5ZA 5K9DA 1NOWA 3S2NA 4JS3A 3B4UA 4O13A 3GBEA 3TC3A 1R86A 2QCEA 4A22A 5ENLA 2OZ0A 4FX7A 2YX0A 1B4EA 1HJWA 2Q8XA 3G8EA 1ZBWA 5CAHA 4LS1A 2J9ZA 4NJJA 1EOKA 1QNPA 1CX9A 4XIMA 3FSUA 4IPIA 2WCAA 1KLYA 4MUZA 2TRSA 4IZGA 2QCCA 4HSOA 1CECA 1Q7MA 2J8FA 2V5DA 1NIUA 2GGHA 4EIVA 4L4MA 3TQ0A 3VE7A 3SIMA 4AYGA 4ZXLA 3CUJA 3KCJA 1CXIA 2NXGA 4RXGA 1Y5XA 1TQXA 1LQAA 1FVPA 3WEOA 1GYLA 3HM7A 4TX9A 3KRUA 3WEZA 3TN3A 4OBSA 4ILSA 3IJDA 1CB7B 1UMLA 1NWSA 4UTUA 4UFJA 2R1KA 1J11A 1H7PA 4OQVA 4RZ6A 1US2A 3FDGA 3D3AA 3VIMA 4GWEA 4LCRA 1TJ1A 1WDQA 4LU0A 4D71A 3G0SA 3MQTA 1EWDA 3RFAA 3PN8A 2W67A 1ADDA 3PC0A 3B9DA 2O9PA 2VQTA 1U1JA 3AYRA 1QAPA 4KEZA 3ID7A 1DORA 3VFLA 2ACUA 4NJKA 3GU1A 1J01A 5AVNA 2P0OA 1V3HA 1R3QA 3CMFA 3WELA 4DXVA 4BF7A 3GHSA 4ZBCA 4F0MA 3AMGA 1FHLA 4GH3A 4CD4A 3FDKA 3BG3A 2IQ0A 1W5NA 1JDCA 4Q6XA 3S5YA 2WNWA 4AZBA 1B3VA 3V35A 3CV7A 3LV6A 1AQMA 3IVSA 3N19B 4H04A 4FLQA 2BNJA 1NP0A 5EY5A 4QS5A 1CW2A 3M0HA 1M9HA 3GXFA 3T05A 2CBUA 3KVLA 4KPLA 1UOKA 4CNTA 5ABEA 1W9PA 1W9XA 1D3GA 1EZWA 5G2WA 5CC7A 2GJXB 3VILA 1OADA 4FF7A 4LCQA 1KBBA 5DMNA 2GUUA 3HGSA 3W7MA 1OBAA 2VCAA 4S23A 1O5QA 2UY3A 3DFQA 3UXAA 3CZEA 3FHQA 2CLKA 3LUTA 4JIIX 1LOLA 3HU7A 3TW6A 2YCJA 2VDIA 2CZVA 3KCLA 1ONEA 4AAJA 4S3BA 4M82A 2CYGA 5HQMA 2ICSA 3F4VA 4NSBA 4P5UA 5HJYA 2O92A 2C1GA 2SFPA 1EJUC 1AK5A 1I45A 4Y96A 5LGZA 4AD3A 5BU9A 2WNNA 3AIQA 5E6ZA 2PGWA 4R53A 1F4HA 1TVLA 1MW3A 3WQ5A 1ITQA 1EDTA 1UD4A 1AZ1A 4EWND 1H11A 3CH9A 3BTNA 5CPSA 3GNPA 4IIEA 2FLIA 2PMQA 5I3IA 3S83A 2EF9A 4ERAA 1S5NA 3W1XA 3I7SA 3S2JA 1XYMA 3WQEA 3NGJA 5TNVA 3BE7A 3UGVA 3R4IA 4GVHA 4W86A 3GVQA 3VIKA 4JTIA 2HPMA 2XVPA 3W37A 4B5XA 1DWJM 3C2VA 3CAWA 1MFUA 4E8CA 1WV2A 1I1WA 1NVMA 2Y8VA 1JDDA 1S39A 1XR2A 1VLWA 1MQRA 3ZWTA 1UROA 3MPGA 4DO7A 1W9DM 5A3HA 3SCNA 1H50A 3TTEA 5CBBA 3E9AA 5T91A 3SY1A 4RNIA 3SCOA 3TYEA 1XRSA 4HOXA 1VBUA 1X6UA 1OM0A 2QGHA 3BCJA 3ORWA 3KBMA 3DU0A 1T5AA 3DN5A 5HJXA 2TYSA 2NVCA 2QVNA 2OO0A 3CMJA 2A3AA 4CU6A 1W5MA 3V4BA 2E3ZA 1ISVA 3K4AA 1AJ0A 5FF4A 1KXQA 1VC4A 1SFJA 3KS6A 1S5TA 1ZJHA 3WJXA 5LGXA 3U3HA 2VWTA 1F6KA 4GZJA 3HURA 3PTQA 3M5XA 3N12A 4XG1A 2Z4GA 3KX6A 3FV9A 3KHDA 3LBMA 3T8QA 3VUSA 2GZXA 2C1IA 5D2VA 1UBPC 1X1ZA 5G4EA 1ME7A 1HFBA 2CITA 4AD4A 1BGGA 1CXLA 4P7LA 5BCAA 4JTDA 4PMDA 3WQOA 3WFLA 4CD5A 3S1WA 2BY0A 3VKKA 1QHOA 3KS5A 3VD9A 1E6ZA 4QQ3A 2PGRA 2QLYA 1HXJA 3FVMA 4GG9A 1S46A 4NT0A 3UNTA 3YPIA 3WF4A 3TQVA 2CLLA 1UP2A 3VVGA 2BS9A 1EF3A 5G1MA 2WKGA 3MUY1 4B5TA 3W1MA 4BKNA 1WBJA 1KTNA 3OB8A 2C14A 1RCOB 1QJWA 4LUYA 1HJUA 3T0TA 5EU9A 4B4FA 1D3HA 1IIGA 3N34A 4LNCA 5IOBA 3D47A 4DUWA 1UUQA 5AC5A 2GQ8A 1Q6CA 1NWTA 1QT1A 1RA5A 3T78A 4MZYA 4RE2A 2HROA 1QWKA 1XH0A 3AMLA 2ZUVA 3AIRA 5BW6A 4O0ZA 1R3SA 3RM4A 3N9SA 3BMVA 4PRRA 1K8CA 3GDRA 3RG6A 2YFNA 3CM4A 4KESA 4OE7A 1FWWA 5FJJA 1V6TA 3OPSA 2ZRZA 4E6MA 4Q4QA 2RDWA 4CQ8A 4WDUA 3L4XA 4JL1A 4CU8A 1LDCA 4Y2WA 3B9AA 2NV9A 1JGMA 1GW9A 4R5EA 1H60A 3JS3A 4RV3A 4WOQA 4G1NA 4GXPA 2P3EA 3WLJA 4G5DA 4TOQA 3BLPX 2D3NA 5FAJA 8TIMA 5L9FA 2R91A 2Z1VA 4WDTA 3WBYA 3LXCA 1K3UA 4LW7A 2E1WA 3MP4A 2F61A 3MHUA 4QROA 3TTYA 3MTWA 3FA4A 4DB7A 3MV11 1MUCA 3B0UX 1EC8A 2BOGX 1UD3A 1KCLA 2PZNA 2REQB 3GH7A 3QQ1A 4FXFA 1I2RA 1AVAA 2X40A 4TTGA 4H9MA 4FXSA 3QGKC 4PB3A 5A6BD 5KZMA 5FJIA 1W3NA 2F6KA 4IWWA 1EXBA 2Z26A 2NX3A 1TPC1 3N4EA 3WY1A 3ATZA 3NPWA 1A80A 3KHJA 1LT7A 3E1F1 4OOZA 4UIOA 1L8PA 3ZLHA 3VNKA 3NM1A 1X1OA 2HXTA 3GU2A 1VHCA 4LEFA 5F7UA 3WFZA 4HPJA 1LUCB 2HK1A 4NXSA 1EZ2A 2FZBA 2OQHA 3PHAA 5HMSA 3CZ8A 1REQB 4QDWA 3M5VA 4GX8A 1PHQA 1XBVA 3G1AA 1ZU8A 3W7QA 4AH7A 3R13A 2ZZ7A 4GJJA 1DQWA 4O28A 3VD7A 1T41A 4OBTA 5T9CE 3QV9A 3AHVA 3HG4A 2P8CA 1NOUA 2YKKA 5BWFA 4QQUA 2HDJA 5DY2A 1FHUA 4REQB 2HVMA 2QDHA 2ZZ3A 3WD2A 1SR9A 4QJ1A 3CGTA 1J96A 5FJOA 4KETA 1VH7A 3L23A 1KCKA 3IUHA 3NWRA 2XUCA 1IT0A 1M7OA 3K1DA 3S3GA 1ICSA 3BLOA 1VIZA 1UR4A 3W84A 1FRBA 1QI0A 1VFHA 4OIFA 3GFYA 4C7FA 1YTDA 2NLIA 2GFTA 4IFRA 1JYNA 3NQEA 4BR1A 3SRHA 4UTHA 5BRPA 1QCWA 3AMKA 5CSUA 1RJPA 3THQA 4IMFA 4XD4A 3O1NA 4ERGA 3PZGA 3SADA 3QJAA 3WQ8A 4KEMA 3P62A 1KTBA 1CXHA 1E40A 2BHZA 4K8HA 3PBGA 2IQDA 4KT2A 4WEVX 2GOUA 4WX2A 2CPUA 1R5YA 1TPB1 3GDKA 3UQNA 1CGYA 1OT2A 1P0BA 2INEA 3CWNA 3IJLA 3KE0A 5D37A 3LM7A 4AIBA 3IWPA 3CMGA 2VP8A 3TU9A 6XIAA 1JZ5A 2ALRA 3MO7A 3SRKA 4DZAA 4LTSA 4CNNA 1I60A 1JDEA 1XSKA 3H2CA 1FWHC 1WZAA 1XIIA 3REQB 2PC8A 3TYDA 3EB4A 3D5HA 1VFSA 1DWFM 1ZBVA 1VRDA 2P0IA 4R85A 4UOQA 3PZQA 3TZNA 3PZUA 2H6RA 3O6YX 4JIPA 2Q09A 4DQWA 3EDFA 5D30A 2PTZA 4WJ8A 4QP0A 4J9JA 2C7FA 3W1UA 1DVJA 1XRVA 3WLNA 1XIMA 2ZUNA 2QZRA 2YCLB 1TPDA 3BZJA 3P6LA 1W17A 4JTUA 1ZAIA 4NZ4A 4QS6A 1ISYA 5DN1A 5I23A 4MVAA 3CUFA 4X9SA 3OGRA 2HE8A 4KS0A 3HN3A 2P88A 3FEMA 4JNZA 3EWYA 3VXGA 4JX4A 2PWFA 3CIWA 3NTYA 1W3LA 4TIMA 4H9TA 4AZCB 1SW7A 3S5OA 4HU4A 3V18A 1E0WA 2PC4A 3R7MA 2EHHA 1OCNA 3V7PA 4LJ3A 2QAFA 1ODZA 2FVKA 4LAKA 3W82A 3NOYA 1UW9A 3UG5A 1BHGA 3CASA 4O1FA 1CIUA 2ZC1A 1JCTA 2VJXA 3GE7A 3KBWA 4B3ZA 1LBLA 3AQUA 4PFHA 2PTDA 3M0JA 1RVKA 2CLIA 1XP3A 1KXTA 1MZRA 4Q8WA 2H9AB 1AMKA 3B0XA 4CQBA 2NXHA 3MI2A 4FR6A 3RMEA 3QZEA 3M41A 4FNPA 3TTSA 3WQCA 3ATYA 2QJHA 4JTRA 4D6IA 2NUYA 4DUVA 5KEZA 1PYMA 2ZTJA 1LCOA 3MHFA 4MFEA 3SQLA 2BBFA 2WW5A 1PO9A 5DCEA 2QCLA 2XWEA 4QLJA 1JPIA 2PLMA 3GW0A 1V08A 3N9KA 3VDCA 4XTIA 1V77A 4PCFA 3BG9A 3E02A 3MKKA 3RF9A 4TO8A 3OODA 1TZ9A 3S6OA 3W1NA 3DG3A 1XC4A 2PB1A 2NT0A 1Q13A 1EX1A 5I79A 2W6RA 5D2WA 1E6PA 1DWHM 1GPWA 4YTTA 4XIAA 3WH8A 3LSCA 3TNOA 5EKYA 1JNDA 3EWBX 4WVXA 4A3UA 4CUCA 2Y1HA 2PGEA 1EPVA 4P2VA 4HT3A 1ZSXA 4HMNA 1IXNA 3UPWA 1UZ1A 1HZYA 2GJPA 3B8DA 2YGYA 4WR3A 4WK9A 3NOEA 3R89A 5C70A 3U4FA 5EMKA 5JUVA 4Y90A 1C3FA 4M24A 3PPFA 5FJRA 3G3MA 3LDVA 2GVLA 1G4SA 1GEHA 4W5UA 1IHIA 2TMDA 4FNQA 3AICA 3CZJA 4MUPA 4TR9A 1QOQA 3FS2A 4UTTA 3LQGA 1FKXA 4WKHA 2VX6A 2VC6A 3IANA 5HJLA 1XBXA 3R6IA 1JRCA 4MPQA 1RP8A 4MJMA 3K30A 2O9OA 4NP7A 1W5QA 4RK8A 2PURA 3W83A 4QJ4B 2V38A 2A0NA 1UZHA 3RYSA 5EMYA 1KD0A 2Q3OA 2R6OA 4O50A 2E6FA 5DRIA 2XHYA 4JOMA 1AA1B 1F3XA 1PIGA 5L6UA 2VR2A 1EC7A 2V30A 1WP6A 2QPSA 4GC4A 3O15A 2D1ZA 3L66A 4A3RA 4L4LA 4M56A 3SCUA 3B0YA 1LBFA 2X09A 2REQA 2ISDA 3QC3A 1OQFA 1H2JA 3CUXA 3GIPA 3Q58A 4YU1A 5LNRA 1M01A 2WNQA 3BLEA 5E09A 1S2CA 4MYAA 2XINA 3USZA 4FXJA 5CBIA 4CCDA 3TC7A 2WSQA 4XQ6A 4HP5A 4OECA 4OKDA 3NYZA 4AVNA 1OT1A 2UY4A 1UBSA 3I6TA 2XVKA 5BNKA 4DEFA 5CEWA 3NURA 1LUCA 1BFNA 3TQPA 3S5ZA 9CGTA 1GJPA 3B4YA 4XKYA 2OPJA 4KWVA 1G4TA 3W28A 1M5WA 1TJRA 4EXQA 4NAEB 1TRIA 1F2JA 4US5D 3FY1A 4JFTA 5FESA 4HHMA 4C6BA 1TO3A 3STCA 3MANA 4L4PA 3WDJA 1C9DA 3VNMA 1HTIA 1PCWA 1ESWA 2HMCA 4RPQA 4U33A 1ECEA 4O4WA 4DJED 2NQ5A 4PC8A 4BI6A 4P7RA 3I7QA 1E0VA 4O8AA 1TA3B 1VPXA 5D9OA 2HSAA 4EWJA 1FWJC 1ZGDA 1FXPA 4G2DA 4REQA 4E8GA 4OU1A 4QR6A 3UEQA 5H6HA 2AMXA 1EGZA 1Q4WA 3O6CA 3CYJA 1XIDA 1JAKA 7TAAA 2W62A 3GG8A 3FHAA 3PR2A 3WZ0E 2WVVB 1FH8A 3ZJ6A 3KRSA 4XVEA 4C1NA 2DSVA 2EQDA 1EQPA 5KETA 2V3GA 1RK5A 4WQ6A 5EYWA 1LL4A 4PCPA 5A6SA 3UWYA 4ZSUA 3HGOA 2VEPA 1TR9A 1G7VA 1K03A 4Q4RA 3A4JA 5HPOA 4GQBA 3S5SA 1OZMA 1HJXA 5MHBA 3SM0A 3LHVA 3T09A 4QE1A 4DYJA 4KGJA 2Z29A 3DAQA 3B8TA 3N13A 4Z2IA 3FAWA 3SUWA 3KEHA 4QSFA 3W7KA 3WLKX 4A35A 4GZEA 3A21A 4PH6A 3CQHA 5C6MA 1TPWA 3G0XA 3URBA 2VEFA 3CPUA 1MW1A 5LHFA 3VE9A 2GLKA 3FGCA 5I06A 1KM0A 3RLVA 3VC5A 2WSRA 2NLYA 3AFBA 1WAWA 3EAUA 3VMNA 4FXRA 3QMSA 2C79A 3L68A 3KTXA 2YW3A 2EJAA 1SFLA 3R25A 3B9NA 4WSHA 3P0WA 1Q66A 5TIMA 3W7PA 3REQA 3OHIA 3SJ3A 1OGBA 2Y6ZA 2J74A 4Q33A 2YOCA 2E1DA 1P6WA 3C4UA 4MAVA 4K8GA 2Z00A 3GHTA 4H7CA 3RPMA 4LVGA 4U2YA 2RGMA 2QCNA 1H1YA 3QW3A 3PUDA 3DGBA 2ADAA 3ENLA 2NQ9A 1DJNA 3SIZA 2YZ5A 2HWGA 4DI8A 1EEPA 2OWXA 2YCLA 4AZ5A 4M0XA 4V28A 2Z28A 1RVGA 1E0UA 2R24A 4L65A 4PTNA 1GOWA 4PBEA 3BOLA 3F2DA 2ISWA 1KW1A 1EYWA 3C2RA 1QNVA 4IP5A 3ANUA 3POCA 1TG7A 3KM8A 4RCXA 1PDZA 2XN0A 4W7WA 1DL3A 4ZB2A 2GL5A 1B3XA 2OSXA 1R9XA 3MT1A 3LSBA 3KLKA 1VHNA 3WNPA 1F3EA 3DC8A 2EJ1A 3VDBA 2VC5A 1H62A 4GUIA 4AWTA 4AZCA 4AIUA 1FA2A 3FEQA 4FK9A 3KOFA 3UF9A 1PEZA 3LBCA 5E93A 2YBUA 1P1MA 2WB5A 3U8GA 1G7UA 2J77A 3KOWA 1N2VA 4YTSA 3A9IA 1QPKA 3VUPA 4GK8A 2PDNA 1CYGA 2QPXA 3VNIA 2FHBA 2DT2A 4G7EB 3IJ8A 3GVVA 2UBPC 2B7NA 3UY7A 2BVTA 1BLIA 1TSIA 3FCPA 4PFMA 2FGZA 2H9AA 3A4XA 4RV8A 2VFIA 1VB9A 4ATWA 4QTGA 2XPKA 5BRQA 4GYPA 2X1TA 4B92A 4HTBA 4JTAA 3T0CA 4EP8C 3SCQA 4P8UA 1CBGA 3QZAA 4RXFA 2H8XA 3S1VA 1S3HA 3IIZA 2YLAA 1X38A 1UJPA 3UG8A 2Y5JA 1S5VA 1QK2A 1SMAA 3GUGA 4V1XA 3H26A 3SUTA 2Y24A 4ICMA 2EPLX 4AF0B 1TYGA 1I2QA 1FX6A 5C54A 1KRAC 1QASA 2CLMA 3TLQA 4O4VA 1FH9A 4GOAA 4C6FA 1Q8AA 5TAOA 1TKKA 2BLEA 1TRDA 4DWDA 2DZVA 2WHJA 3UR5A 4UNLA 5A2CA 1JUEA 1D2KA 3ZR5A 1XPGA 1F76A 1T6MA 1XYAA 5A8QA 3DFYA 2C0HA 3NQCA 1YRRA 1JF6A 5AYZA 4D1JA 3H23A 1SO4A 4EXAA 4F0SA 4DIAA 2DSUA 3CHCA 3R0UA 1QXLA 1QOXA 2I9EA 3TWBA 2ZXBA 3NYDA 1I2NA 5BXPA 1A50A 4NZ3A 4Z2HA 1E4MM 3E0FA 5HWMA 3E38A 4UQEA 1VBHA 2Y7EA 4MLJA 3R8GA 1YDVA 4UR7A 5I6SA 2BVYA 4LAMA 1VYPX 3M0LA 1M7JA 3FOKA 1HG3A 5A2BA 2YA0A 2J7GA 4IPPA 3FSTA 2CIPA 4ZA0A 2G0WA 1RK6A 3KDNA 3HV8A 4FLSA 4AWSA 4S3FA 3GVGA 4H6QA 1XLBA 1MEIA 3W85A 1C91A 3NM3A 4PMUA 2WSKA 2VEMA 1DIKA 1RR2A 3W81A 4LV9A 3VMPA 1WKYA 3QR3A 3LCWA 3MCOA 1EH9A 4GQGA 4ZO8A 3BOFA 2HNHA 1GT8A 2VVSA 1WDWA 2XG9A 2D23A 3VIIA 3H2MA 1V7AA 3HIJA 3P0XA 3HPZA 4Z08A 4RJEA 1AD1A 4I5XA 1R3YA 2CZFA 2OYKA 5HWNA 4GHRA 4PULA 3UWEA 1BXCA 1OC6A 1OG0A 1W56A 1XDJA 1Y0EA 2OFJA 1JUKA 3ARXA 1XICA 3IACA 1R9YA 2Y5SA 1BF2A 3HMCA 3VOIA 4GBDA 1UD8A 3G1DA 3TEVA 1WDDA 5B7YA 4D6EA 3OLDA 1KFJA 4RLIA 3FJNA 3MUZ1 4GIRA 2J7FA 3NQ8A 4LUSB 3ARQA 2A6LA 2E4TA 3A24A 1MUMA 2G41A 5LA2A 3L2MA 4XZNX 2J79A 1GJUA 1A5CA 1F07A 3U7VA 4O0KA 1NJJA 4M51A 4INFA 4YTUA 4ZQCA 2ZQ0A 4AHPA 2OXNA 1KRCC 2VGBA 2O9RA 4I7UA 3OW1A 1FOBA 2QQ6A 4BEQA 5HXMA 3K4WA 3V5FA 3QMRA 2R9RA 3BW2A 4UQBA 3U9IA 4UMCA 3EX6A 4XV0A 2FZMA 5MKGB 1GVEA 2ABBA 4MB4A 4XTDA 3TJ4A 1CZ1A 4AD5A 2WK2A 1EEXA 2JEPA 3UZZA 4C6DA 2WVVA 3HGJA 3BUVA 3GDBA 4GPNA 3THUA 4C1KA 1THFD 3LPGA 2XGZA 3W2KA 3LGGA 2OGYA 3WDPP 4O54A 1NU5A 2ZZ4A 2C6QA 4JX5A 2BWGA 4F0RA 3NZGA 4GMEA 2X7WA 5AHEA 3IIOA 4L6DA 2XH2A 3KLLA 1C7SA 3LCHA 3GY1A 2G8ZA 4ROQA 5BU6A 2I17A 4QDPA 3C8FA 3NIYA 1MDLA 2C13A 5FSEC 3STEA 2C0AA 5HDRA 1NQKA 4ZTYA 1KA9F 4J35A 3NPXA 4MLRA 1LROA 3VGDA 3T0AA 2ZBTA 3S8HA 5E70A 1US3A 1ZAHA 3CTLA 4PMRA 1X96A 3DHUA 2XH4A 1YDYA 3EYPA 1I8JA 3AIBA 4GUJA 2GGGA 4YMZA 3TYAA 4DWSD 4ORMA 2GDUA 4GIEA 3II1A 3EEZA 1K7XA 1E15A 3WH7A 4GY0A 3SN1A 4B9YA 1N8IA 1J0ZA 3CNYA 3HTWA 1VQTA 3WCZA 2QJJA 1RBOB 4BCEA 4M19A 3FW6A 3WLLA 4Q7BA 3C2FA 4AB4A 4Z1AA 3WFAA 3VINA 3ZT7A 2Y85A 4K2SA 1R87A 9XIMA 4MWAE 5I3JA 3WLSA 2YYTA 4JCMA 3NQDA 3AXHA 4G1KA 4HJWA 3E5BA 4OBRA 3EOOA 4ZXOA 3C2YA 3O07A 2XN1A 4Q6JA 4TMBA 3SQSA 4TVUA 4RNFA 4RX0A 1OFAA 2I5QA 2A21A 1KV5A 2WYSA 1JUBA 3PS7A 4MKSA 4RNJA 4RL3A 4C1LA 3G5EA 2DIJA 4J3WA 1V7YA 4WSJA 2YFOA 1TR1A 1W9UA 4MKVA 1EB3A 5C8BB 1PXGA 4GC3A 3S2CA 4KMQA 3H7VA 1VFFA 2PDFA 1B30A 4O12A 1P1XA 4UTJA 5I77A 4IOTA 1K6WA 4DBDA 4IQJA 1OCJA 4NAFA 4JX6A 4M6UA 1D7KA 1L9WA 1ME9A 1H0GA 1J0IA 2BHYA 4U5KA 5AYYA 4LVBA 4Q8VA 4GE8A 4EPBC 3CJPA 1GKQA 2HTMA 4FLOA 4BQ5A 3VKBA 5HQLA 3AISA 4H6KA 1K9EA 3B9OA 4O0QA 2WC3A 3EXSA 3R58A 4IX2A 1O95A 5IBXC 4XSMA 5AFDA 2JF6A 1W5OA 4O1AA 2PZ0A 2VRQA 4EANA 4J40A 4HTYA 4OVXA 3M46A 1H7WA 2V63A 2G3FA 1S5WA 5FIPA 4ZOAA 2R94A 1E1FA 4D8ZA 1R7AA 1CENA 4UC5A 4ZFMA 3SCTA 4U28A 4AF0A 2CXGA 1BQGA 2J27A 1CNVA 4F9JA 3W4RA 3FKRA 3O9NA 2CZEA 3M6YA 2JFEX 3L5AA 5M5DA 1F5ZA 3I3BA 1XIBA 3FXYA 1TB3A 4K1GA 3UR2A 1WUFA 1UWSA 1R2TA 3WF2A 1QPOA 1ZL1A 3DX5A 1OCBA 4K8EA 4CN1A 4F3HA 3WX7A 3TFXA 4N6FA 4K38A 3UZWA 2FZ9A 1XBYA 3G6LA 2XFWA 2Z25A 2GVGA 1OD0A 1J0KA 1GOIA 1WOBA 2D2JA 1UKSA 2VTFA 4HA3A 2WJZA 1Q7QA 4DJFA 1J8VA 1SSGA 1XD0A 4QDMA 3STPA 1Y7VA 1V4YA 3O2LA 2CZDA 4GQRA 1GOMA 5I5RA 1FWBC 4FNUA 1EJTC 5DX7A 2IKHA 2XIJA 1JIBA 1MXGA 2VNCA 2BMBA 1V03A 5C2GA 4GNVA 3CXOA 2GSEA 4DWSB 5LNUA 3PBVA 3TP4A 3WNLA 1VPQA 2BP1A 1JAEA 4JTLA 4N4PA 4ICNA 1TUFA 3RO8A 1LLZA 1TIMA 5A6AA 2ZRVA 3VIJA 4B5UA 1RP9A 4H2CA 5K3VA 3CC1A 4TTUA 3PUGA 3O16A 4QE5A 1GCYA 2BGSA 3CV1A 1E9ZB 2E6AA 5KZDA 3D46A 4JY9A 4FOJA 5C0QA 1J10A 3HQOA 4AIOA 3DFSA 2UWFA 1VBJA 1H7NA 3ANYA 1M1BA 3FAXA 3LHWA 7XIMA 4PEKA 1UUMA 4JQ3A 1J9YA 2GQ9A 1MUWA 2E6DA 4Q3MA 2WQDA 4GGHA 2QMKA 1FWSA 5C9XA 4FALA 5DMMA 1K70A 3DYMA 1W8GA 1U1HA 4FOUA 2X1UA 1EL3A 2G5WA 1JPDX 1MXSA 1L6YA 2VZVA 3RO6A 4B4HA 3W24A 3NG3A 2Q02A 1FWTA 3PZVA 3N11A 4ROPA 2PWVA 5D32A 5EFDA 3PWGA 4PB5A 2QJNA 1FHVA 2Y5EA 4FZIA 1MZHA 1ZBCA 1K1DA 3SSJA 3THAA 1XSJA 3NL3A 3STGA 5D4YA 1QI3A 2Y4SA 1NSJA 1KB3A 3ELFA 1PKMA 4M6PA 4IQDA 1LOQA 2GGJA 1TTPA 1WCGA 4C6JA 5CCZA 1ITUA 4DNMA 4H6RA 1JYVA 3PBUA 1W1A1 3PWAA 5A6JA 4UQDA 3GXIA 3PZNA 4IGNA 1XLIA 2GOKA 1UYQA 1JYXA 4QX4A 1DWIM 4S2CA 4ZL1A 3BLFA 3C0SA 3Q2DA 1PAMA 1TX0A 3ONCA 3S2MA 1EFZA 4W89A 4MB1A 4UOZA 1CXKA 3E5PA 5MKGA 5I3DA 4I90A 4WJEA 1HW6A 4CQDA 3DG6A 3F4WA 4EKJA 4E2DA 4CCZA 3QOKA 4BWLA 4C90A 3TSDA 5LNSA 1YNQA 5EB8A 2WM1A 1AQ0A 3M16A 3GTNA 6TAAA 4UQCA 4YYCA 1WOAA 2A7NA 2AGKA 3NO3A 5D38A 3QPEA 3LPOA 1Q45A 4R7OA 1B2YA 3QV6A 2D73A 2A3CA 1DIOA 2VEKA 3EA2A 4KWWA 5I00A 4A21A 5D33A 2F8QA 2DZXA 2FPYA 1FH7A 3DFOA 3PVFA 3UWWA 3UZ5A 2ZXQA 1G67A 3AS1A 3LD5A 4DJDA 3AYTA 3A3WA 3TE9A 3OG2A 3N2MA 4NVTA 1YDOA 3E6EA 3LG3A 2NQJA 4BF9A 4PUDA 3RR1A 3LXAA 3CUIA 1OB0A 5K9XA 3VNLA 3HQPA 1J93A 4CVUA 2XM1A 4U4MA 2WJEA 5FEPA 3DHDA 2VL4A 3WQFA 3N9RA 2WANA 3GH4A 3KRZA 4W8BA 4HJFA 2J6VA 3IV3A 1UH3A 1UD5A 3VOCA 4Y8EA 1P7TB 1MNZA 4GZ7A 4ERIA 1PWMA 3TX9A 2Z1KA 1BSIA 4POCA 2V5LA 3MUAA 1SO3A 1B90A 3GXTA 1GHSA 4HVXA 1CDGA 4ICCX 3ABXA 2GGEA 4PMZA 4F9DA 3PJUA 5J5RA 1GG1A 4WY0F 3LRKA 2HVNA 1RXOB 1FFRA 1OSEA 3NDYA 2VC7A 3C8NA 2CLOA 3VPLA 3WDQA 3S5NA 2DV0A 1G0CA 3N4AA 2PD9A 4DO5A 5DXYA 2X05A 3H7UA 3OLEA 3DG7A 3I4KA 3V5OA 3IGUA 3VO0A 2G95A 4W7VA 1WDPA 2WVSA 3VOFA 2W9MA 1GGOA 1QI5A 1MW2A 5JVLA 3NQMA 3PG8A 2MUCA 3FK4A 2UZ9A 3ARUA 3HJZA 2ASHA 1VPYA 1RSCA 2WMGA 4UMBA 2Y61A 2VFEA 1HUVA 3K8MA 4D72A 2FH6A 3P2VA 1Z41A 2R1MA 5FJPA 3QLDA 1NF0A 3LPPA 4GUGA 2Z6IA 4LYPA 2ZTKA 2I56A 3W27A 2ZUMA 2PGFA 3MW7A 1SR0A 2DVTA 4HPGA 2Y63A 2OLSA 3HV9A 3QFEA 1J79A 4MMWA 1IZCA 1RJRA 5LA0A 3S0CA 4PUNA 4GLEA 1KV8A 4WXYA 4H9YA 3OGVA 4Q8MA 3S46A 1W31A 3UG4A 3MMTA 2WZIA 3KL3A 4HA4A 1YW1A 3B0PA 3ARZA 3SO7A 4IPLA 5J8LA 3R79A 3GH5A 1ZNNA 3IUIA 1VP5A 3QFWA 1VBRA 4MDPA 1H63A 4UNKA 4IISA 4JIEA 2YXGA 3ZZ1A 3L5MA 1RY0A 3KWSA 2DDXA 3CIVA 3HB9A 4B5SA 4Q22A 4U2ZA 3EDDA 1PPIA 1JCMP 1XGZA 3E96A 3EDKA 1TIWA 2HV5A 3U4AA 1I2PA 5ABFA 1TVNA 4IL2A 1X1NA 4G8TA 5BOOA 5GNYA 1RQHA 3W07A 1GQLA 1E6SM 2C3ZA 2IW0A 4BFAA 3UA3A 1RBLA 1XS2A 3C52A 3UJRA 1XSIA 2WMFA 4PMQA 5A6TC 7REQA 3W26A 2UV8G 3EX3A 1QNSA 4NU7A 4S38A 1KR1A 2W61A 4A8LA 1TVPA 1F9CA 3DYOA 2YBTA 5DF0A 3LLFA 3NPVA 3EWZA 4V15A 4S3GA 1E1CB 3UG3A 4RUBA 2C16A 3RM8A 2A7RA 2XH0A 3NO5A 3W7CA 2W3ZA 1VJSA 4PB4A 3G18A 1Q65A 3K4DA 4PUMA 3MO4A 4QLLA 3E0LA 3I3DA 1HIZA 3L21A 1DWAM 4UR9A 3PPHA 1S2AA 2CLHA 4RZ4A 5LKYA 3K1GA 3U48A 3WJWA 3KCOA 2OT1A 1NFBA 4H9UA 3EPOA 2IS7A 2BXYA 2CEQA 1JPKA 4PEEA 4JYEA 5D8WA 1LG1A 5FKYA 3P5YA 4DBSA 3BAWA 4CVWA 1FWIC 4E8DA 1SUXA 1X6NA 4MB5A 3I4EA 2QCDB 3ARWA 3ABSA 4R34A 4WDXA 3H2FA 4XZWA 1Z7AA 2QJIA 1AH4A 3TKFA 1IXOA 1Q2RA 1JCYA 4QBXA 3QV8A 2GWGA 3T6CA 4WOZA 4L9YA 4YS1A 2WVUA 2YL5A 1YE6A 4UB9A 3G77A 1XV8A 3EPMA 5F2MA 3T81A 4Q4SA 2IXVA 1F74A 4MTVA 3T2QA 3P82A 3VD5A 3QH2A 2VWSA 1VZWA 3BLDA 1BVNP 2VR5A 1J5SA 2RDTA 4FO4A 2PDWA 1DJQA 1DTNA 2YDQA 3VCCA 3W1TA 1R6WA 4LF2A 2ESCA 3AROA 4LY8A 4OUEA 2WNZA 1RY8A 2NX9A 2JIWA 4NUWA 3GTFA 3LZ5A 5CZJA 4AFYA 3UGRA 3K5XA 1Q85A 1TWWA 2CWNA 4B2DA 1IXQA 5CPNA 4QE4A 4P7QA 1C8YA 4WCJA 2WCSA 5JMUA 1NM9A 3BSMA 3B3DA 3RM9A 1R85A 4WKAA 4EOUA 3VKCA 3OIHA 5CLWA 1QRQA 1V0NA 3ALGA 3AWNA 3RDKA 5HNNA 1A4MA 1TV7A 3VI2A 5D05A 1K9TA 4X0NA 3G1XA 1FUYA 1ZP3A 4MM1A 3GC4A 4JFWA 1TV4A 3SSZA 2BY2A 4LC6A 4ZOBA 1S2VA 2PDGA 1W3HA 2VXNA 4ADTA 2DJXA 1UR0A 3EOUA 1ECQA 1OCQA 1QI2A 5CC3A 4NQ1A 3EA3A 2VEIA 4G7FA 4QM1A 1JZ8A 3O63A 4JYFA 1WZMA 3KVKA 1AL7A 3I6RA 4BK9A 1KM3A 3PNZA 3H4WA 2GJRA 1W3KA 4RDYA 5G5IA 2XM2A 3ZJ7A 2VFFA 1XF0A 2VFGA 3HG2A 3BG5A 3M0KA 3VX1A 3MCNA 3LOTA 1F05A 3R0DA 1IR1A 3SB0A 2E68A 4FP1A 3PANA 1PVNA 1LWJA 2CFFA 4HK6A 2MANA 4C7GA 3MYPA 3ABRA 1US0A 4GO8A 5HPCA 2F6XA 2V2HA 2Z6JA 4L1WA 4E0CA 4NG3A 1RUSA 1A3WA 4KEVA 1B57A 3P93A 3UY8A 1Q4NX 3RU8X 2V5BA 1S2TA 4F79A 3W23A 3AIVA 3HBLA 5HNTA 1P7TA 1ONXA 3VIPA 3W2NA 2FFCA 1EJVC 4BY3A 4MNMA 1LG2A 1P0EA 3JUGA 4UTFA 1V3LA 1X7FA 4ZFCA 3LCGA 1AUSL 3B06A 2VRJA 3WLOA 3GD6A 4M6QA 3ERPA 5CC6A 2J7BA 1KFKA 3T4CA 2YCEA 3PZTA 4GQQA 1S3TC 3B0VC 4AZGA 1DIDA 3N6QA 5XIAA 5GQBA 3TAKA 3F03K 3M0VA 1QW9A 4O18A 1L2QA 4CU7A 1MEHA 5CSSA 1DKWA 3L5LA 1FFQA 1TPVA 1YTEA 4LALA 3DBPA 1B31A 2A2IA 2YSWA 4ACZA 3NL5A 1Q2SA 1C9WA 2PD5A 3LTSA 2QW5A 3W1LA 3UWUA 3U2CA 3AZSA 4FHAA 4DBEA 3ARRA 2IPGA 2J88A 1ZB5A 3EGJA 3HA1A 1LZOA 4NRRA 4E38A 5CG0A 4GZIA 3UPMA 3RAOA 2VC9A 4Z2JA 2WC7A 1UD2A 3WENA 1N55A 4ZE4A 4ALDA 3GRIA 3ZSTA 3LI0A 5C71A 4BI7A 2D69A 3ARSA 3WSUA 3IUDA 1EC9A 1H3GA 5A94A 2OOGA 2J78A 3IV8A 2J6XA 1DJZA 1MXDA 3MUXA 4C6CA 4D6HA 4J7RA 3GO2A 3H2AA 3M43A 3PZMA 2GSJA 1LORA 1W9VA 1G9HA 1UWQA 4AMCA 4L1XA 4I5UA 1TPFA 3MS8A 2Z1WA 4KWSA 1ISXA 1KGUA 3AZTA 4IPJA 2DFAA 3WIJA 2ZVIA 2P3ZA 2ZA3A 3JVAA 3E49A 3FKKA 5BMXA 4PTXA 1W2PA 5DQPA 2XFYA 4S1FA 4U3CA 3O0KA 1YQ2A 3W75A 1F3TA 3NZ1A 3ITOA 1GHRA 4HSHA 1X6LA 3QVQA 3USBA 2Y8KA 2HISA 1OF8A 3SGGA 2D3LA 4N9EA 2PLCA 4JEJA 4U10A 2JE8A 1GWJA 3TUUA 1VFMA 4KERA 3CEPA 1DJGA 5M17A 1WKEA 3WBEA 4HK7A 1YIXA 3ONBA 4PBGA 1PYFA 4H7VA 2QCFA 4F2UA 3FYPA 2PP1A 3FIGA 3S9IA 2PSNA 2Z7KA 2FJKA 1A49A 4MGGA 3W00A 4LBRA 5SWUA 1O5RA 2V69A 1OFOA 3Q4DA 1TJ2A 3S47A 3OTRA 3W22A 4MPKA 1IQ8A 4DELA 1TWIA 2RHGA 1UMYA 4W7UA 4Y7EA 4NJHA 5JBFA 5CXPA 3G2GA 1E1CA 1IT7A 3UESA 4AZHA 3M0XA 1ZHAA 2FJUB 2GK1A 2I1OA 1EO5A 1Z48A 1E70M 1ICQA 3BICA 3GTHA 1C93A 5FEXA 4K7VA 1G94A 2BTMA 4FSAA 2P10A 4Q4PA 3MVTA 3WNOA 1FCUA 5GVJA 3U2EA 4JHZA 3CUZA 4H41A 1V6XA 3VDHA 1RLCL 3LLDA 3ZIZA 2V3EA 1BYBA 1W1PA 3ITVA 3LBOA 3HPXA 4FAMA 4LBUA 1W9BM 1RCXB 5C7VA 1T0OA 3SUUA 1TPH1 5IXEA 1H7OA 2WV8A 5A8MA 3P8IA 2QUUA 3C6CA 1KBLA 1R9ZA 3VIOA 5ECUA 4BHYA 1S1RA 2C91A 3ZO9A 5MF5A 3B9EA 1PJ9A 2RH9A 1U5VA 4TVDA 5HMFA 3WUGA 1LQ0A 4FA3A 3GLCA 4JKLA 4QNEA 3CHVA 3UU0A 4P61A 1PZ3A 3SFWA 2QCDA 4XUGA 3MA8A 4IMDA 1XLCA 5H2ZA 2J9YA 3GC5A 3KFTA 3WLQA 2Y7DA 4EAMA 3QR1A 2B4GA 4M6VA 1W5PA 3TYUA 3C61A 2QF7A 4UXDA 3GTIA 2D0FA 1CI1A 3EOEA 2AL2A 1POJA 5XIMA 3N4FA 4Z1YA 4UCFA 1SGJA 4Z2KA 3RNDA 1O1HA 5FA5A 1YMYA 3GZAA 4YYFA 2ZUUA 1UZDA 3QY8A 5J5DA 3T44A 4NZ5A 2WHLA 3IK2A 5AYXA 1R30A 4JTQA 1YKWA 1YXDA 7ENLA 1WXYA 2OEKA 4D6JA 2AKZA 2YZRA 3VIGA 3ISIX 2IXUA 1A47A 3TH6A 2W92A 1GQJA 2ABAA 1Q6QA 2CBVA 2R1NA 1WZLA 3A12A 1IT8A 2FDSA 1VEPA 3GZ3A 1GG0A 4CEXC 3WL1A 3BV7A 3M07A 4AQLA 3SCSA 3QOMA 3UZYA 4Z1DA 2HQAA 4HHLA 1FCQA 1XIHA 2DJLA 3IRSA 3T07A 3VGGA 4NL1A 1KO0A 3SFKA 4HOWA 1SZGA 3V0TA 3BSHA 2CESA 3EPNA 1QBAA 3ITGA 4A3HA 4MYXA 4F2TA 1NOFA 3C0LA 5CZSA 2NWSA 3WBAA 4DYEA 1U5HA 2E40A 5AN7A 2D22A 3O0FA 5A8GA 1SJAA 2AL1A 5M03A 4GNKB 2XIMA 4EVZA 1MYRA 1VYSX 4R3UA 3BAYA 1EDQA 3NZQA 1YBQB 1KBJA 1TTIA 1ISWA 2PDPA 3LNPA 4F40A 3WK2A 4KQNA 1OYCA 3CUHA 4BA0A 1GW1A 3NQGA 3W7IA 5LYRA 1XLKA 1T96A 5LIKX 1E55A 2ZX6A 2X0SA 1Q63A 4HU3A 1TV5A 4UTIA 1J18A 3BAXA 3GIQA 4QAIA 4F66A 2PWDA 1UPPA 2PDIA 1ZZMA 4H8HA 3WDIA 4LS2A 2FMOA 4D2JA 3XINA 3OHMB 1DV7A 1EWEA 2OYMA 4IFKA 2EPKX 2ZRWA 2WKLA 5XINA 3T08A 3GXDA 5E9AA 4HZ8A 1HGWA 5DMYA 1XGEA 1XIFA 1IYXA 5HR6A 1GYNA 2RFGA 2OKTA 1GZGA 4W4QA 2D2GA 4BS0A 1M68A 1UB3A 4GYJA 4RW5A 1XYFA 1VEOA 3O8AA 4UCGA 2YA2A 2KX9A 3L67A 2A3EA 2OZ3A 5BXSA 3DENA 4L61A 2H3DA 1Q6DA 1B5TA 2PDCA 1JG9A 1A5UA 1P6CA 2YJQA 2JF7A 1QR7A 3MWCA 3CS2A 2JALA 1E5JA 3E12A 1UG6A 1XYZA 4LOCA 4M29A 2XYLA 2ZUTA 3TROA 3B05A 1E56A 4ATLA 2INFA 3VIFA 4J28A 4ZQNA 3W72A 1H09A 3IGHX 2ZE3A 4J3ZA 4YJ5A 4M1BA 3CK5A 3L0GA 3POHA 4DBWA 3GB6A 8CGTA 4JXCA 1E0XA 2XWDA 1GJWA 3PB2A 2ZXAA 5HNRA 4AYSA 1JZ7A 3DEQA 1TE6A 4K36A 1KFEA 5IM51 1DIEA 6ALDA 5C55A 1QNQA 2E09A 3AXIA 4AXKA 1BWVA 2DSWA 1K9FA 3MMWA 4IMGA 3ZR4A 3SQMA 4EX4A 1PSCA 4PMYA 3OO2A 1XCXA 1V3KA 2ZRUA 2HCVA 1MW0A 4NY2A 1WDRA 2GUYA 5C9WA 1OG6A 4AMAA 4S3DA 2WHMA 4NKCA 3W2LA 4DXXA 3ZR6A 1OC5A 3L12A 1PUDA 1KRBC 1O60A 3W71A 1FDZA 4A05A 1HKMA 4A6GA 1PZ1A 2R8WA 1K9DA 2OZTA 2CBJA 1CEOA 1GVFA 5C7HA 1L0PA 4MJ4A 5REQB 1G5AA 1EIXA 4NXKA 5A5WA 4LUJA 3VAVA 1DPMA 3VOHA 1XINA 1EIBA 1W54A 3OG3A 2D0HA 3BXWA 3JZUA 1XFBA 1A5MC 4PUUA 4XD5A 3DCPA 1EHNA 5DBUA 3KWXA 1EBHA 1SYTA 3GTXA 4AY7A 4K39A 3UWQA 3IS4A 3QY7A 4ES4A 3BDKA 1LLOA 4IUGA 4JN6A 3P74A 2XIBA 1PTAA 3CB3A 3AC0A 3CT2A 3E2VA 4MF4A 4JNMA 1BXBA 2IPFA 4DPPA 2AQVA 1JXJA 4ZGYA 4RDZA 1GVRA 3AOFA 1GOKA 1ICPA 3WDRA 2E5DA 3G1VA 1XW8A 3DBNA 3HOJA 2PDQA 4TMCA 4DZHA 1VF8A 2OLAA 5H8UA 2YCIX 2WZTA 3DI0A 3LU2A 3MYOA 4EPDC 1F3WA 3RGTA 4GISA 4AUBA 4U31A 1NARA 4IH3A 2AQWA 2CHRA 3IEBA 5FL0A 3NJ3A 4NJIA 4J1OA 2PODA 3ZLGA 4H8UA 1BSLA 3QSRA 3I7RA 4IT1A 1J0HA 3H54A 1VCVA 3IJ9A 3WF1A 3TQKA 3U7BA 5EBUA 1EYEA 1NAL1 3E74A 1OZQA 3CBWA 2GVJA 5CLTA 1XQKA 1DP0A 2FYMA 1Y65A 4O8RA 5U4NA 5CGQA 1R3WA 3QQWA 1E6RA 4Y6GA 2VEGA 3U2OA 5CPQA 1SVDA 4RPPA 3QQ0A 5HA7A 2BGNE 4DAFA 2XIOA 3UXDA 2ATMA 1RCQA 2VFDA 2G97A 1K7EA 4OJYA 4Q8UA 2XISA 2X0HA 4JGDA 2A4AA 3H21A 3KBJA 4MY8A 1ITCA 2CHOA 3VIHA 2F9RA 2OU4A 3MSYA 3T8LA 4HZMA 1H1ZA 3APGA 3MI6A 3MBFA 4K6AA 4MDOA 3K2GA 1Q6GA 1ZQ5A 3HPFA 5BWAA 4GVIA 2Y62A 3V75A 4AEFA 1LOSA 1Z32X 1NEYA 3TYZA 4ZQPA 1M7PA 4YWSA 2P8BA 4S2BA 5F4SA 2BDQA 5D2XA 3EX1A 5F2IA 4AXNA 4JFUA 1LF1A 3U0HA 4LF1A 4CGTA 2VELA 2P50A 2PBOA 3SUVA 4ENLA 3BPWA 5CPMA 4PE8A 1RBAA 4XKYB 1FY6A 3GNXA 1VGAA 3KZSA 1PX8A 4MY1A 3W74A 3WLPA 2J75A 4IGMA 4LPCA 1F8MA 1L2UA 1SSDA 1K77A 2VGFA 4LQ1A 3NZPA 3GC2A 5CPOA 2WCGA 1SO6A 3EWWA 2PTWA 1OF6A 4OTKA 1AG1O 2AMGA 4MHBA 3RRXA 3DFNA 4RW3A 3GNRA 1KFCA 5CSYA 3C5QA 3VABA 4MOZA 2OEJA 1NTHA 1XM3A 5CQ1A 5DBTA 2VX7A 3L4YA 2QF8A 3CH0A 5D2YA 3GR4A 3LK6A 1A5OC 5I3GA 1OWQA 4GQ0A 3C86A 3BLKA 4IL0A 4S39A 2QUNA 1XJBA 3MC5A 3P60A 1AZ2A 2YB1A 3MDWA 2DUXA 4C1NB 4WHBA 1BRLA 3MHGA 5PTDA 3K13A 1CGUA 3KAOA 4A8RA 4NYUA 3THDA 4WLCA 3AXKA 1KXVA 3UT0A 3T55A 2OOFA 3C0QA 2OGJA 2VHLA 1CT5A 3MSGA 4HGXA 1D7FA 4HCDA 4ML9A 1UASA 4XBKA 1SU5A 2PU1A 2IKJA 3BAIA 2ATSA 4OUIA 2XFRA 2I7GA 3TJXA 2DT3A 2TSYA 3W1RA 3PM6A 4B90A 1XDMA 3L2IA 2CC0A 4B16A 5K7JA 3S2LA 1NQ6A 1QU4A 3W29A 3UJ2A 3W38A 1BG9A 2V67A 4N42A 3N04A 3FGCB 1Z6KA 2DH3A 4E2BA 1YBQA 4HMEA 3TMQA 2BVDA 1Y5VA 1C92A 1V79A 3WH9A 3E2SA 2NV1A 3SUSA 2A3BA 4PMVA 5D8ZA 1I6NA 1TV2A 4MADA 4LFYA 4GJ1A 1W1VA 3ITCA 4HCLA 2E9MA 3CQ0A 1SW3A 2PBGA 4DNHA 1OGGA 1M3UA 2BOEX 4YN5A 3W88A 4H4IA 1J2BA 1A0EA 1CXEA 1WXZA 3GUWA 3KL0A 4QCFA 3N2OA 1V02E 1WZKA 1KNWA 5F1UA 1HKIA 5H1WA 3BH4A 3PUEA 1U2YA 4IJCA 2P5NA 3RIKA 4GYPC 1UKPA 3SN0A 3WLTA 1ISZA 1SJCA 4YHGA 2NSOA 1EKOA 4L56A 1EBGA 1E1EA 1K8XA 3CV6A 3PBMA 2FZDA 2BB0A 5K4ZA 4KFNA 3WEMA 4KCUA 4MWAB 5I3HA 3NEHA 1LP6A 2WQPA 4JYDA 4JQ4A 1QDSA 2PTYA 5DMLA 3IIXA 3GBDA 3H2EA 3TCEA 2YA1A 4QCEA 1XD1A 3NQ7A 4PA8A 2ZVRA 1Q5MA 5AYIA 2HBXA 3QKZA 4I3GA 2PE4A 4QNWA 3R2GA 4LXFA 2EKCA 2Y7FA 3SCRA 1LM1A 4RZBA 3WN6A 1MEWA 5HINA 5EMLA 1F8IA 3PWIA 5M3WA 1NH6A 2X7VA 4K1WA 1PS9A 2V81A 2JKAA 2OT0A 2ZWZA 1RPXA 4RE0A 1R3VA 1KFWA 1LL7A 1IR2A 1W8SA 5KZEA 3HG5A 5HQEA 2ZRYA 3M6DA 5AC8A 3M44A 2FTWA 4WY0A 4MAZA 1VCGA 3PZ9A 1JVNA 1EHAA 4KIEA 4R33A 4JPGA 1SZFA 4L80A 3U5UA 1P0NA 5BMWA 4LYKA 3LNMA 2YXOA 3DHPA 2JEQA 4C5ZA 3LHTA 3VYLA 1T8XA 1WO2A 5IDIA 4O10A 1Q8JA 5REQA 4XB3A 1EDGA 2Q01A 2PLKA 3PBYA 3VNYA 1VIWA 5G1YA 3VC6A 2CKSA 5IFPA 4MFDA 2X0YA 5J04A 4JZ5A 2G4JA 3CO4A 3W0KA 3TNBA 4YVPA 2FIQA 1UKOA 1YPFA 5DO8A 3L4WA 5HNUA 3Q45A 4NJGA 5EPDA 2QIIA 2QKFA 3CL6A 4RE3A 2ZFAA 2OLHA 2Z7GA 1LBMA 3AUOA 1W2VA 2BX7A 2NZLA 3LV5A 4LAOA 4FNTA 3RLHA 3UXKA 1XIJA 4UBPC 3TIMA 4CQ9A 2FZ8A 1W6TA 4ZVJA 5B7ZA 3MI3A 2ZXDA 2QAPA 3DUGA 4O11A 2P53A 4AX6A 3J7HA 2DZSA 1FP9A 2GWNA 1OFPA 4X0VA 2RUSA 2VUYA 3TW7A 4JY8A 3LB0A 4M7TA 4JIHA 3LMZA 4JIQA 4H9ZA 2QS8A 4X9YA 4LSBA 4WXZA 4M5PA 1VAHA 2FGLA 4DY1A 3WH6A 4IHCA 3DI1A 1K8YA 1CGWA 3H55A 3LXBA 4R7JA 4Y8FA 3GHUA 3WUEA 3W7JA 4KGLA 1DXEA 1KRMA 3G1SA 4AX7A 2PWUA 4DLFA 1VBGA 2EGZA 3P81A 3B40A 3SGUA 3EBVA 1LRTA 1WQ5A 2QGYA 1FWDC 2QJMA 1MRQA 1IEWA 2VM8A 4B15A 1QVBA 1PE1A 3UWZA 3TDFA 4HNVA 1JCJA 3WD0A 2O0TA 3D6NA 2PDJA 2QHAA 3OZYA 3DKJA 4OZOA 3VGBA 3JRKA 1YXCA 4DF1A 2WWDA 3O05A 3HGRA 4MSSA 1HX0A 1IWBA 2PS2A 1EO7A 1YNYA 3N2XA 1PZ2A 3ITYA 2VGIA 2ZZ6A 4AVOA 1Q6RA 3T4WA 2E7FA 3M5ZA 2HNEA 3MKCA 1O7AA 2C8NA 4ZENA 5D04C 2HPIA 1MRAA 1EQCA 2QULA 1GOOA 5AKQA 4ZE5A 5ABGA 4ZO6A 3HQ1A 3GAYA 2EPHA 4XD6A 3BQ6A 2QPUA 5E0CA 1BD0A 4O14A 3OA5A 3VGFA 4S3EA 4JN7A 3Q37A 2XIQA 3AWOA 2B31A 5FF0A 1SQ7A 4D6DA 1UP3A 4A3YA 7ODCA 3BJFA 3WG6A 4HPHA 4UZSA 1K4GA 3LENA 4TVCA 3PFRA 3OVPA 4I6VA 1JFXA 3TZFA 4CQAA 2PDKA 1K8ZA 3LA4A 4Q7IA 2L5HA 1Z9AA 1IV8A 2CNCA 1O4UA 2ZCGA 5EBAA 4ZQRA 2PCQA 2R82A 1HQTA 1TQJA 1FWRA 5AC4A 3ZVIA 3GDMA 5FAGA 4JTSA 4FOKA 3GVRA 4B91A 3TXZA 5RUBA 4NZFA 4AC7C 4AZIA 3GXMA 1VENA 3L7RA 1HT6A 4PL1A 2INZA 4YNGA 3WL0A 2V0TA 5LSMA 3OIXA 1UR3M 4BF5A 4DJFD 4QHRA 4NIRA 1P43A 3DHFA 3TJLA 2RJGA 3IAPA 8RUCA 2O7QA 2DQXA 4MY9A 3PF3A 4ZEPA 3TTQA 1WBHA 1GKRA 3WMCA 1TMHA 5AYBA 2ZDRA 3A3HA 3UNDA 4FS9A 1UHVA 3I10A 3R8HA 3G3DA 5BXTA 3TSMA 1IEQA 4H8VA 4DHGA 3PJWA 1V6UA 3H8AA 1B3OA 5LIUX 4OT7A 2QUTA 2IUZA 1XLGA 5A8PA 2GJNA 1Q7ZA 3LTPA 3QZ6A 2QMJA 4I5RA 4IG2A 4CN6A 3W7LA 1CTNA 1EUNA 1SPQA 3T0BA 4Z17A 4F0HA 1QK0A 2Z24A 4EAYA 1TPUA 1JR1A 5I03A 1N8FA 2X2GA 3KRBA 1WAUA 3W2MA 1AL8A 1HJQA 3SURA 3PUOA 3KOYA 3G1YA 2WLZA 3W53A 4QSHA 4XKMA 4J4KA 5E6YA 1MVYA 3BARA 2V9DA 2WOQA 3AMCA 2VVNA 5I3KA 5A6LA 5I07A 4KCTA 1WYIA 1D8CA 1YPIA 1GZ1A 1VFOA 2O55A 1UUOA 1BTCA 2E8YA 4AW7A 4DJEC 2V5JA 3M9YA 4IP4A 2EEXA 4MWAA 1GOQA 4HN4A 2BXVA 2DT1A 2PPGA 2XGBA 4NZJA 2X2YA 4WIWA 1HKWA 2A5HA 2J7CA 4F4RA 3HO8A 4QEEA 1Y5WA 4WF7A 1TWDA 4GFSA 4NAFB 2ZX8A 2CZ5A 2C15A 3W1QA 1R0MA 1J4EA 3RRAA 2A1YA 3ME3A 1KCZA 3H2NA 5DRCA 1HVQA 4N9BA 4HB7A 3AIWA 3OBAA 4XK2A 5JIPA 3PTDA 3GG0A 1M6JA 3I6EA 1XQLA 3KDOA 5EFFA 4PUEA 3CPGA 5AHFA 2OX1A 1AW1A 4H01A 4UMAA 1KKOA 1YLVA 3K46A 3RPTA 4K37A 4DZIA 1TWZA 4H19A 1EX5A 1LRQA 4AY1A 4MJZA 4DJFC 2JGQA 2NV2A 4I9TA 4PUWA 2WJFA 4JTTA 4UTKA 1ZY9A 4TX6A 2EPOA 1DJXA 3N14A 4NNCA 1TUXA 2HS8A 4HMDA 2VQUA 3L2LA 1JZ4A 4XAPA 3VMOA 3A47A 2ZKMX 4GY7A 3N17A 1GZJA 3WLIA 1UQYA 3DH7A 3AMDA 4UFMA 4CQCA 3HFTA 3UR7A 5A95A 4S3AA 1T7LA 3R10A 1TJPA 4F2BA 1CGVA 5F4XA 2AGTA 2Z1BA 3WKZA 1MQPA 2OQYA 1QMLA 3CB8A 3B8IA 3UYCA 2RDXA 4DJDD 4HA0A 5A6MA 4I7VA 1QBBA 4OFCA 1G01A 3VKJA 1YX1A 4PRTA 1LT8A 4YXGA 1WX0A 1Z44A 3INPA 3AYVA 4PCTA 1IEXA 1V3IA 3D0CA 4AISA 5HMDA 3WBXA 4UFHA 1VRXA 1FWAC 4O15A 3RXZA 3WNKA 4C5YA 4W84A 3VM5A 3R1ZA 3WLRA 3KUMA 4NF7A 3G24A 4CD7A 5LZLA 3QMTA 1CPUA 4Y9OA 4IICA 1E9LA 3KTCA 3SW6A 4XISA 2Z1XA 1GVIA 5AVHA 1Z8AA 3BAJA 1GTHA 1NFPA 3LHYA 4H00A 2UY5A 5AZ1A 1R3RA 3BAKA 3MDUA 1V0LA 3ZQ9A 1HO1A 1M53A 2ZA2A 2FHCA 3C3NA 4K7YA 5E9XA 5D9PA 4Y9NA 3DGRA 3R12A 2G37A 3NQ6A 2J25A 2JK2A 3IIVA 3TN6A 2QXWA 4YHEA 4HKPA 4GRSA 1CGTA 5CG7A 1O66A 4LVAA 4E3TA 3TMLA 1JCLA 1H7XA 2X16A 1V3JA 3NDOA 5HK4A 5U7SA 1IWPA 1KGWA 3LERA 2VFHA 3W6YA 3MMUA 4ADUA 2ZYFA 4AD2A 2OKOA 3LZ3A 4L9ZA 4AHQA 3W2UA 4E4PA 2Z2BA 3KW3A 4IUOA 5EGRA 4Q7NA 4PL2A 1QW8A 4GY1A 4Z42C 2VO5A 2QVHA 3GG1A 4JDYA 4IQEA 4GACA 1HF6A 4LAZA 2OTDA 3OU8A 3E0IA 2B81A 3P14A 4BWLC 1GK8A 3WF3A 3PG9A 4PMJA 4PTWA 1E4LA 3A6OA 4IGHA 3G8RA 3QLLA 1PKYA 1XKYA 4PUKA 3UVIA 2J4GA 5I7GA 1UWIA 1EUAA 2I57A 2OWWA 3DDMA 4DRSA 3KVJA 2GYIA 4NX0A 1UWTA 4PMOA 3KTSA 4NRSA 2ZX5A 3V0UA 3V5CA 1ZUAX 3HZ3A 4J3TA 4DJDC 2HJPA 2OELA 2VMFA 4L6OA 1WE5A 3MV01 1AJZA 3GQYA 4ORIA 2NUXA 3HQNA 1OGSA 1Q6EA 4DM1A 4W85A 3FLUA 1QPNA 2D0GA 1GVYA 1X97A 1KM5A 2PWEA 4PCSA 2PTXA 4FI4A 4D9PA 3MCMA 1KGXA 4XZ9A 3AS3A 4IPNB 4FF5A 4JQ2A 4E2VA 1OABA 4H9VA 1TTQA 5F2GA 1V6VA 3IVTA 1FCVA 4BQ4A 1XRFA 2X1IA 4IJBA 4ZZ9A 3LRMA 1HO4A 1F6PA 4PBFA 2Z2UA 3MVIA 2VYOA 4QIUA 1WPCA 2NQLA 1R8LA 3G1HA 2DUAA 2J7DA 3ZLFA 5LHEA 4LEQA 2A3HA 4HHHA 4W88A 9RUBA 3NSMA 3DOPA 3MMDA 2AOSA 2DH2A 3RU6A 4J3UA 3CO8A 2PF0A 4LUIA 4QG6A 1A4LA 1FTXA 3C2OA 2G50A 3NXFA 1D8WA 1OFBA 1DHPA 1J5TA 4ZO9A 3NXLA 3EXRA 1BYDA 1ZS2A 2FB3A 5BYWA 4NNBA 3GR7A 3QPYA 3NVDA 3XISA 2WKJA 4JHOA 5AY7A 3WQWA 2Q71A 3NQFA 4UFKA 3OQEA 3SY8A 4PR4A 3ARTA 3IIPA 3CHDA 1M04A 3WQPA 2QUMA 4QAWA 1UR1A 5C9UA 1L6SA 3GS6A 4I7WA 2W91A 3JU2A 2F6UA 3IAQA 1R46A 4RDVA 3VX0A 3VU2A 2IKGA 4J5NA 3TAOA 1UPMB 3WUFA 2V5KA 1SO5A 5KSWA 4O19A 2W66A 4JTCA 3N18A 4HNLA 2WVTA 7TIMA 3PAJA 1OD8A 4GXMA 4JTHA 1GOXA 3WQGA 2V5CA 1IEVA 4BI5A 2HVOA 2EBNA 1SZNA 4UTWA 3W2JA 4C6KA 3AS2A 2NQZA 3BMWA 2V8ZA 2Y2WA 2RJHA 2QUVA 5JXQA 3VKDA 3AU6A 5TBOA 4R7WA 1NDZA 3NVTA 1YPXA 2CHNA 4HPXA 2D2HA 2PCEA 2J7HA 1ADOA 3OJGA 2HZGA 2PP0A 1DE6A 1I0BA 4Z1CA 4JIRA 4DPQA 3VA8A 1YTKA 1ONRA 1J12A 3UXIA 4HZ6A 3PB0A 4AD1A 1JZ6A 4AU0A 1EJWC 2VZUA 4EPEC 3T40A 4US6A 3NUKA 2PI6A 1S2WA 4CCCA 1PB0A 4HYVA 1Z42A 1KFBA 2R1LA 3GVWA 3LCFA 3GWQA 2Z0IA 3NR0A 3WD3A 4OOUA 2O4QA 2PLJA 1EJRC 3VNJA 3WUBA 4QLKA 3PZIA 1GQNA 3LCIA 4B2DD 4O1BA 1OVDA 1R38A 3HFYA 4LGXA 1MNSA 3SEPA 2Y88A 2OB3A 3RX3A 1V5XA 1FCBA 3A4AA 1JDFA 1B1YA 3M4HA 1X7IA 2GJXA 3BURA 5G1TA 3GKAA 2XZ9A 3LGDA 4HYRA 1KQZA 2QNEA 5BOEA 3EWXA 3CL7A 3CT7A 5D2TA 4IMCA 2QDDA 1HKKA 1MO0A 4E3VA 4Q32A 2PAJA 3RR4A 1GTEA 3C2EA 1F73A 2W0UA 4HCHA 3GG7A 2GVYA 3G1FA 4L1GA 6TIMA 4BJHA 3ZT5A 1XLDA 4HD5A 1V8EA 4Q8PA 3TOYA 3TN5A 3W7OA 3MJMA 1JRBA 4Q8QA 4HOZA 1MDRA 1UA7A 2D2OA 4DF2A 1I75A 3I3EA 1ITXA 3MY9A 3NQBA 3L0NA 3QGAC 4HNCA 2VZOA 3BL3A 4DWSC 3PP7A 1OYAA 4IGSA 2TPSA 2VKZG 1K7FA 3APTA 3OBEA 5CZ0A 3RX4A 5ABFB 2QIWA 5DANA 4N0RA 4AWUA 1HGYA 3I65A 2DW6A 3IJQA 3QM3A 4XX6A 5LIYX 2DZPA 4XZHA 2Q3RA 1MI3A 3N15A 4HPNA 5E5CA 1EJSC 3W6LA 2DORA 4W8AA 2XFFA 7REQB 1RQBA 2E5CA 3U5YA 1IGWA 2DQWA 2XVGA 3RCMA 2XGIA 1Y8BA 3OOQA 2DIKA 1JCNA 4D8AA 4ZSTA 1XDLA 1A5NC 4GVFA 2QCHA 4GNJA 3H4XA 3W7NA 1PCKA 3SGZA 3SI9A 2PRHA 3LX9A 5HUOA 3W7HA 1XGDA 3TN4A 4JN8A 4LAUA 2EKGA 1CGXA 1OINA 3MP3A 4H9XA 3EMQA 2YB4A 4KFOA 4IIGA 2E5BA 3TW9A 4KEUA 1VR6A 5E0KA 1UWUA 2WWCA 3CHEA 2CKRA 4LB4A 3C3UA 3F5LA 1IXPA 3KZPA 3TCSA 2LLEA 6XIMA 1B3YA 1LYXA 1O6IA 1XIGA 3U6WA 4WUIA 1OFDA 4LY4A 2E9BA 1JZ3A 4JTGA 4GD0A 5FJTA 2J8GA 2XZ7A 4D6CA 5H8PA 3AIUA 1JI1A 3KL5A 1GEQA 1AMYA 1V6YA 3RJXA 3TC6A 4NX5A 1C8QA 2XSBA 5IRPA 4OHQA 1BG4A 3M0YA 3H2OA 1B9ZA 1ZPTA 3ARPA 2BY3A 1NY1A 3NCOA 4RE4A 3TWAA 2VGGA 2YIHA 3WNNA 3IGSA 1JNEA 1QPRA 2BOFX 4AG0A 2W5FA 4LC8A 4HQVA 3GIYA 1VS1A 2IKIA 2QCMA 1LLWA 3WMLA 3LGEA 2NUWA 3N3MA 4LS0A 3KOXA 2VURA 3SN4A 5HWJA 1UCWA 3A4WA 4G9PA 4GIYA 1XCWA 4GX9A 2MNRA 1AH3A 5M2FX 5FL1A 3NQVA 1R47A 4KFPA 1G4EA 3F4CA 5A8NA 3QN3A 3ZVHB 3P61A 3PPGA 2CBIA 4QEHA 1UD6A 3ABQA 3O3RA 1RV8A 3VZXA 4EPKA 3SCWA 1W32A 4Q4MA 5FF2A 1GVSA 3NSNA 3H24A 4X22A 4ZOEA 5KINA 4MB3A 3M0ZA 1DEDA 5T9BG 1FWEC 2E8ZA 1IGSA 4JKMA 4GO9A 1OC7A 4L64A 4M1RA 4F0KA 1OHLA 1AFSA 4L7ZA 3S6DA 3R5EA 4GABA 3RHGA 3OVRA 3RLGA 2PRLA 1ODUA 3U2ZA 1AODA 1SFTA 1KXHA 1OX6A 3W9ZA 3T2OA 1Z89A 3LTYA 1GUVA 1DBTA 1B0IA 1SZEA 3LEPA 1VYRA 3VM7A 2OX4A 4LVFA 5CGTA 1MQQA 1FBAA 2Y70A 1HKJA 4IFOA 1L6FA 4GUFA 2DZTA 1A53A 1XLLA 4Q8TA 2G3JA 4LWWA 3DFPA 4UOJA 4RDWA 4EACA 1UWRA 3RPDA 3EMZA 3PBWA 4HMCA 4H7ZA 7CGTA 2PFHA 2VCBA 2B7PA 5CJ5A 1A3XA 3EWCA 1QO2A 2WSPA 4MJ2A 3N2BA 3UCQA 4C7DA 1W1IE 3EXTA 4GUHA 5DCDA 3FJ6A 5ECVA 1X8FA 3TONA 1ZALA 1OFRA 2J62A 1QPQA 3EB2A 4W93A 3NSXA 4I8YA 1NWRA 3UYIA 1PTDA 2V2DA 3N1AA 3F4DA 1KTCA 1GONA 4ZR8A 4GCAA 3VNDA 2PF8A 4HA1A 2CLEA 2VR4A 1WKFA 4ZB0A 5CJMA 3W86A 3BO9A 3B97A 3ITLA 1YDNA 4TV5A 3VOGA 1QNRA 1U22A 1XH1A 4JHMA 1BQCA 1DJHA 4IJRA 3WQVA 1AH0A 1SW0A 3VZZA 4AY8A 3L4TA 3NQAA 2P1FA 2GDVA 3W25A 3WMSA 3NNTA 2TAAA 3A13A 4TV6A 4FLRA 2YCKX 3QEZA 5D02A 2OSWA 3AHZA 2IQTA 1BWKA 4JTFA 2PWGA 4UWMA 6ENLA 1VEMA 1GORA 2XVNA 2RDUA 4JICA 4GI8A 3N2TA 1DE5A 1REQA 3Q94A 1M41A 4URIA 3HPSA 3GXPA 5GPRA 4E2OA 3UBPC 4D8LA 4PTMA 1J2WA 5EMMA 1CWYA 1UC5A 2XDFA 1HJSA 3G6MA 3VD4A 4V2XA 1AD4A 5LXEA 1XC6A 1UQZA 3NPUA 3S6TA 5BOFA 3NL2A 2FPVA 1QI4A 2WAGA 2WM0A 3WJSA 4DX3A 1KQYA 4ACZB 4Y9AA 1PL9A 4O17A 1BWLA 1QFEA 4GFIA 3BW3A 3DFTA 4JFVA 1TV8A 1E4NA 7PTDA 1IF2A 4FIRA 4N4QA 1N8WA 3TXVA 1I9CB 2ZIDA 1UR8A 5AHIA 4KW2A 1M7XA 3BC9A 1KKRA 3F7JA 3F5KA 1KLZA 3GDLA 2VUNA 4LT9A 2F38A 3TSBA 3IPWA 5HULA 4DO6A 5GNXA 2X1RA 3PAOA 1RQEA 1BKSA 4CD6A 1QHZA 5IDZA 3A64A 1R2SA 3WMBA 3QY6A 4LUTB 3W7GA 2BG5A 2YYUA 3F1QA 3ZXWA 3ICJA 3HJEA 1QO5A 3QSTA 3APYA 3O6AA 2OODA 1NFGA 4BQ2A 1CLXA 4UFIA 1UC4A 4YL2A 3GX9A 3MZ2A 3VZYA 4LCSA 1DQXA 3AZRA 4JTJA 2XVLA 2C1HA 1X39A 2OSYA 2V82A 2FKPA 1V51A 3ZJ8A 1SFSA 2FTYA 3FVDA 4O52A 2PDHA 3TJIA 2E9LA 3TR2A 4P7NA 1XXXA 5CC5A 3TOPA 3H53A 3N6HA 3U57A 3CLWA 4N9CA 3ZFHA 1ZBKA 3QBUA 3IARA 1G69A 1TJ0A 3B8VA 4ACYA 1FQ0A 1PKLA 4PZVA 3BSGA 4N7QA 1JD9A 2V3DA 3O06A 1POKA 2YLLA 3RITA 4ATDA 4NNAA 3FA3A 1ZJIA 1UH2A 2VX5A 4ZCWA 3GNOA 4L5ZA 3SZ8A 3UVAA 3ZSSA 4GCXA 4LVDA 1OIFA 1OK6A 1C8VA 4GGBA 3E0VA 1PHWA 4X3ZA 5KMYA 4J2MA 2BV9A 3OGSA 2EAWA 1EF2A 1TELA 3AJXA 1GVQA 1IZKA 1H4PA 4W9TA 5TF0A 1BF6A 3CEUA 3FX4A 4O16A 5AHLA 4EXBA 1UWAA 1KC7A 2FVMA 3QV7A 4XAGA 1R2RA 4C6MA 1OX5A 2ZZ5A 2GK1B 3EMCA 5CAKA 2DU2A 1ME8A 3QF0A 3WLMA 5LNVA 4B9ZA 2FFIA 5CBJA 4A4AA 3W7EA 4IM4A 1QWGA 2BY1A 4IIDA 4C65A 2QDEA 3GAKA 2W63A 2DZBA 3P7YA 5A6BA 3S42A 1MFVA 3ABOA 1E71M 3AXXA 3M7WA 2WSYA 4MZ8A 1SMDA 1J0JA 1JEZA 3VKAA 1L8NA 5EMUA 3O7UA 3GYEA 1RD5A 4ZB5A 1RPKA 4L6HA 1W0MA 1AQFA 4ONVA 3WQ4A 2V3FA 3N3TA 5CSRA 4HBKA 2QCGA 4UR8A 3T0DA 1XFCA 5A8OA 2I9UA 1DXFA 1HVXA 3A9BA 2GVEA 3OLGA 2GUBA 4LYRA 1A0DA 4XAZA 5HMEA 4PODA 2FTPA 3BW4A 4G6CA 4XSLA 3A5VA 1E6NA 4Y9PA 2ISSA 2JBMA 5KTLA 1RH9A 2DW7A 1DYSA 3BANA 4B5WA 2DUZA 2AL2B 1HNYA 4JTKA 1UH4A 4NZCA 3CUGA 3UERA 3Q67A 3GDTA 3BGGA 1BTMA 3L9CA 2YL6A 4H6EA 1FXQA 3MSDA 1FKWA 1ZFJA 2E25A 3DESA 3M0IA 4GIAA 3ZVHA 3LCLA 3EKLA 3E3HA 4XBSA 1I0DA 4H2HA 4FNSA 2G3IA 4ML4A 4MNKA 4HN8A 3ZOAA 4X61A 4Z0JA 2B7OA 1F6YA 1A5AA 4J2PA 3TLLA 3EEGA 1OJXA 1VJIA 4TQTA 4MKNA 3UD6A 1IIHA 1LQ2A 4Y9MA 1HJVA 4XAFA 2CCRA 3GFXA 4PSPA 4DYKA 4OWGA 3DFHA 4JBRA 4XD3A 3MUIA 3ZWSA 1S5MA 5LIWX 1LTDA 3EB3A 3B03A 2G3MA 1CB2A 4K68A 2YPIA 2A3LA 1F61A 4GKLA 3O6DA 4QFUA 1SZRA 3W01A 4R88A 2WMIB 4HNTA 2BZNA 4HNUA 5K4XA 1PV8A 1CLKA 1TCMA 3LS9A 3AHTA 4NILA 1CLVA 1E72M 2IMRA 4PRWA 3QYSA 4QG8A 2J24A 3DERA 4HK5A 3TK7A 4DXKA 3IJ6A 4U5IA 2WMHA 4D6FA 4S3JA 3SRFA 2G4FA 3FYYA 2J8TA 3CHFA 3T1GA 1FHDA 3GM8A 1VFTA 1IE7C 3S4TA 4C60A 3BCDA 4PYSA 4FEZA 2FB2A 4JQ1A 4CD8A 2ACSA 5GJMA 3ES8A 2AAAA 1E51A 1KCXA 2CETA 1XUZA 2XTKA 1ALDA 1E3XA 3I68A 3A22A 3AIEA 3CWHA 1JQVA 4IFKB 1XLHA 1YHTA 1EGMA 3PJTA 1XPYA 3A23A 1ZJBA 3W3OA 3AAMA 4OV4A 1KBIA 2VDGA 3M7SA 4HYWA 1HP5A 3HMJG 4DF0A 4QJ5B 1VKFA 4ZQMA 3EX2A 4V27A 2FMNA 5HR7A 4X63A 1A5LC 5ABTA 1XISA 1AJ2A 2O7SA 3FJ4A 5AC6A 3C56A 3S9ZA 2QR6A 4A8IA 2PDBA 1V6WA 2VENA 4EF9A 5AB3A 3WQ6A 4GVGA 1J6PA 2YBVA 1RZMA 3WNMA 2VDHA 1EJ7L 2IPJA 4BEUA 1H41A 3GXNA 4GI6A 1UJQA 1DWGM 3CQKA 2I5IA 3LY0A 4HZ7A 2ZZ1A 5E1QA 1R3TA 3AHYA 4NAEA 1EP3A 5CJNA 5I09A 3SCVA 3CYVA 4XO6A 1O94A 2BFGA 2WLYA 4KCVA 5LIXX 2PEVA 3RLUA 3LM3A 5A2AA 4YWIA 4Z2LA 1K02A 1EP1A 3EKGA 4ZODA 1TA3A 1K4HA 4J3XA 1JQXA 1SJDA 1VD6A 1WA3A 5D9MA 1TE1A 1F4AA 3GU9A 3CAVA 3WO8A 1TV3A 4JD4A 8XIAA 2C18A 4QG9A 1OY0A 1QW7A 3PSVA 2CU0A 1WDSA 3LLXA 4WD0A 1SM9A 1XYBA 1NDWA 1NDYA 2A7PA 1GKPA 3EZ4A 3NFUA 2G3NA 1T99A 1N82A 3LRLA 1T8QA 3R11A 4IMAA 2WPGA 4LUTA 3H7RA 5I02A 3RN6A 2B7QA 1JULA 5EMJA 1E6QM 2CLPA 4A2RA 3H70A 4E5TA 4JFSA 3MUCA 1RLDA 2JQXA 3WLHA 3A5FA 3PTMA 2ZA1A 4L4OA 4CNOA 1KM2A 3BJTA 1IWAA 3IJ7A 4WRHA 3RX2A 2DT0A 2QYGA 2FHFA 3FA5A 3F4NA 4JR5A 3DC0A 5FJUA 1DJYA 1JGIA 4GJIA 5GJPA 3FNDA 1MWOA 4O1DA 5FEWA 4XZIA 5KITA 5AHNA 4JNYA 3ES7A 3UJFA 1TWSA 3NL6A 2BGQA 1NF7A 5C2CA 1BXNA 4TU1A 4CNSA 1E73M 2RGLA 5HATA 2DIEA 5G4HC 4Q8OA 1JXKA 3SECA 1W1YA 3F5JA 2ACRA 4Q8NA 3L65A 3WQDA 1D9EA 4HSNA 1XLFA 5HUPA 2OG9A 1PIFA 3RUBL 4W8LA 4B5NA 1O1ZA 5LXXA 3OEXA 3QYQA 4MIMA 5KZ6A 4DI9A 2I5GA 4PN2A 4Z0SA 4LV4A 4C91A 1C8XA 2Y0FA 8A3HA 4M8UA 2GQAA 3T9PA 1FWGC 5C9RA 1P6BA 4YCPA 2CXEA 1CXFA 3MU7A 2DZWA 1WNOA 1KR0A 2BASA 5G4WA 4ZOCA 3RCYA 4D1IA 4MZ1A 1XLAA 4YTQA 3BJSA 3W1AA 4PCNA 2WHKA 3GK0A 5I24A 5T26A 1QOPA 4XO7A 4MG4A 5HAOA 2BHUA 3PY2A 4YVXA 5H91A 3SCPA 4PTDA 3H22A 2OQLA 2HS6A 2X42A 3WYZA 5I0DA 4I9AA 2A6NA 4C6EA 1PWLA 5DT5A 3KBVA 1JD7A 1ENUA 4N02A 6REQB 3KP1A 4MNLA 2I14A 3RK8A 3AALA 1TZ7A 4A3QA 1C29A 1UR9A 1L6GA 1JCXA 4I8DA 1XLEA 3C0JA 2BXZA 4WGXA 3QGVA 2GSHA 1VCFA 2C71A 4CN4A 3W1PA 2VD8A 4G7EA 5CPTA 3DECA 2EXOA 3W73A 2OYLA