1B57A

Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
358
structure length
346
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEELYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Escherichia coli class II fructose-1, 6-bisphosphate aldolase in complex with phosphoglycolohydroxamate reveals details of mechanism and specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
total genus 138
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b57A00
4UTHA 4NNCA 2V2HA 1OFOA 3L0GA 1I2RA 3NQ7A 1YYAA 4I7WA 2VC6A 1GTHA 5D2XA 1T96A 3M5XA 1Q6LA 3GKFA 1M5WA 4N6FA 3DU0A 4IUOA 1KFCA 4DPQA 4N6EA 5DLCA 3MP3A 3W73A 4GUGA 1GJPA 4LWWA 1GG1A 4AWTA 4ZQRA 2XN1A 2VEKA 4UTTA 1KV5A 3I6RA 5CZJA 2FLIA 4LVDA 1FQ0A 1TQJA 2C1HA 5LZLA 3W2JA 1G6CA 1EA0A 3OHIA 8TIMA 1QPOA 4M7SA 5F4XA 4M6PA 4UTLA 2WO5A 2ZZ6A 2ZRZA 2Q3RA 2Y7FA 3W7QA 3A5FA 4FB7A 2Y70A 2NV2A 4U4MA 4WZHA 4LT9A 3S5NA 1J2WA 1JCNA 4I7UA 4O0KA 2IQTA 2ZRUA 3MW7A 3EXSA 3LTPA 1XDLA 5HUPA 3VE9A 4Y8FA 2Z6IA 4LVGA 4FX6M 5IBXC 2RFGA 1K7FA 4NX0A 4BI6A 1FCBA 3P67A 1G4TA 5HWJA 1HO4A 1CW2A 2PCQA 4RR4A 2A2IA 3KVJA 3HG2A 3LHTA 1TPEA 3R2GA 5CPOA 1MO0A 3W71A 3L0KA 2FB2A 3W7DA 5CSSA 3HGRA 1QFEA 3LHWA 1KM3A 4CCEA 3VE7A 4IMCA 1LOLA 1JRBA 2B4GA 3EX2A 2ZA1A 4R53A 4JEQA 1G7VA 2YFOA 3PS7A 1UB3A 1T99A 2QAFA 1SSDA 4ZL1A 4HNUA 2E09A 5LSMA 3KX6A 3MYPA 2CLKA 4O10A 1IXQA 1LOQA 5I3KA 4QITA 3MHFA 3BV4A 4JYDA 1O60A 3NPWA 1LOSA 2UV8G 2C16A 2JK2A 4GUIA 4N9BA 4L4LA 3HF3A 4MLRA 4FHAA 3DFNA 3G8RA 1VS1A 4N9CA 5D2TA 4RLIA 4NU7A 1OX5A 2NLIA 4MKNA 5AHLA 5FEPA 1XI3A 2ABBA 2VFIA 1ICPA 4IMGA 4LVBA 2NUYA 3S5ZA 4X2RA 3BLFA 2B7QA 5D30A 3NQ2A 5LHFA 4IX0A 1IXPA 2J27A 4EIVA 2H3DA 3OA3A 1B9BA 2EHHA 3EX1A 4K7VA 3G3MA 3UNDA 1LZOA 4OT7A 3MBFA 4MZYA 1I2QA 4AF0B 5AOUA 3ZS4A 1AW5A 1PE1A 2G5WA 3WK1A 2C6QA 3RNDA 4H6KA 2NZLA 1OFDA 4O16A 3UWUA 3M1ZA 2BX7A 3C2FA 2CLHA 2G96A 2NUWA 5A5WA 1KFEA 3KFTA 2ZDRA 1JCJA 3UWVA 2D73A 4ZQCA 1MEIA 2GUUA 1SZGA 1ZAHA 2YGYA 4O11A 5LNVA 3GDLA 4AWUA 4IPJA 4JICA 2O7SA 3GVGA 2CZ5A 4CQ9A 3E0IA 1P0NA 3N2MA 4NVTA 3FFSA 2CFFA 5K9DA 1OG0A 1TREA 3G0UA 4UFIA 5DXYA 1FXPA 2PURA 2DZUA 5DBUA 4TMBA 1KBIA 4GNJA 3SECA 3L9CA 3P8JA 1F05A 2NX3A 1TPWA 3O06A 3SGZA 2B0MA 4MIMA 1K8YA 3R13A 3GAKA 1X7FA 1EP2A 2A7RA 1H1ZA 3PG8A 1D3HA 1ONRA 4JIQA 4FNSA 1LRTA 3HPSA 3NQGA 3BGGA 3GNNA 1VC4A 1VCGA 5FF0A 1G4SA 1HUVA 3EWXA 2ZA3A 4HIBA 4FX7A 3C2RA 3PB0A 4MYAA 3FYPA 1B3OA 4E2DA 3L5MA 3GDKA 1F2JA 3MJYA 1C8VA 4N02A 1I4NA 2FPVA 3M9YA 4O1AA 3W76A 4RZ6A 3NQMA 3PC0A 3W84A 4KWWA 4UMBA 4H3DA 3LRKA 1IXNA 4TIMA 4WD0A 5DY2A 2QDHA 5TIMA 3WK2A 3W7EA 5KZEA 5L9FA 3TSBA 1O5KA 1Q6QA 3W74A 3QF0A 1EWEA 5HWMA 3T44A 4TX9A 3WFAA 1X6UA 4IXXA 2P1FA 3N9SA 4MZ1A 4NQ1A 1NSJA 5C5YA 4BWLA 3ZWTA 1DORA 1I8JA 1UUOA 3QFEA 5CPNA 3TK7A 4LU0A 4NUWA 1W3IA 4LS0A 5KZDA 3W87A 2ALDA 1FWTA 3L67A 2W79A 3LV5A 2ZRXA 3DENA 4AB4A 3S5OA 4AMAA 3SW6A 5D04C 2TRSA 4O14A 2V81A 2Y63A 1MZHA 5J5RA 4S1FA 2RHGA 1U83A 1SZEA 3OBKA 5BRBA 3M16A 2QUUA 5D33A 3PAJA 3PUOA 1GVOA 1A50A 1D9EA 3ATYA 3CT7A 1H7PA 4JGDA 5HWNA 2A6LA 3KRUA 2OZ0A 5T26A 1FCVA 3CQ0A 3W7HA 4K6AA 3ZWSA 3EWWA 5G4EA 3UD6A 3F4WA 2NXGA 1VYSX 3A24A 1TV8A 4DF0A 2RDTA 1WA3A 5DCDA 4O19A 1X1OA 2ZRYA 3TW6A 3SSJA 1VRDA 3NQ8A 4WXYA 4FNPA 3N73A 1LYXA 4DF2A 2WNQA 3O8AA 3W7PA 3N2XA 4LC6A 1Q6RA 2A6NA 4LY8A 1EUAA 2DJLA 4DO4A 1JRCA 4RX0A 1WOBA 1PVNA 1MEHA 2OCZA 3DKLA 2JBMA 1G69A 5FF2A 3MYOA 2NXIA 4NZJA 1W37A 4ADSA 3O05A 2VOMA 3E96A 3F1QA 5CPLA 5F1UA 4OWGA 3UPWA 3EKLA 4MY8A 1H60A 1QCWA 5D05A 1R2RA 3CU2A 5HQEA 3RF9A 3W2LA 5K4ZA 1W5MA 3QPZA 3FKKA 5G2IA 1SZFA 1QWGA 4FIRA 4OBTA 4AWSA 3DBPA 2ZZ4A 3Q94A 2ZTKA 4UXDA 3OG3A 1XKYA 3W1MA 4UTMA 2NWRA 5F2IA 3TMLA 1N8FA 1OFRA 3DH7A 2BXVA 1TPC1 4Z0SA 4LUIA 2VFDA 5AYZA 1FUYA 3TAKA 2F7FA 1XBVA 2OJPA 2FPTA 1W56A 1TTQA 2A21A 2W0UA 3W7MA 1A5SA 1WAUA 2BLEA 1EEPA 2WPBA 5G2WA 2X2GA 4N4PA 4PA8A 4MY1A 1K7EA 1KFLA 3EWBX 3W1UA 2Z0IA 1KA9F 1OFAA 4J9JA 4UFMA 2YCEA 2DU2A 3GYEA 3L2IA 3P60A 2YX0A 2QCHA 2ZZ1A 4LV4A 1ME9A 3LXBA 1W5NA 1W3NA 2WSRA 1SQ7A 3CLMA 3U6WA 4QSHA 4AHOA 1AMKA 5D2YA 3A21A 1SO5A 1L6YA 3W1NA 1TCDA 5H2ZA 1TMHA 3C2OA 4W9TA 4E2BA 4JTJA 2NX9A 3TFXA 2TMDA 4AH7A 1TTIA 3O1NA 3NDOA 5I3GA 3IGUA 2QJIA 2W6RA 3BO9A 4XTDA 2C14A 3IIVA 1XXXA 2C3ZA 1KLZA 1FDZA 1JUEA 3NL2A 4IMFA 3BLIA 5HR6A 1J4EA 3NGJA 2ZQ0A 1SO4A 1S5WA 1ZHAA 4EWND 3GKAA 4R34A 2V0TA 3IEBA 2BZNA 3WK0A 1VLWA 1NEYA 3N19B 3MI6A 4PC8A 2QCDB 2OMAA 2CU0A 5DCEA 4GC4A 2CLLA 1DJNA 2VEMA 3VNDA 4DBEA 3GB6A 1BWLA 2ISWA 2WNZA 3P74A 3GDRA 4K8EA 5EY5A 4BI5A 3M0ZA 1JUBA 5D2VA 3EKZA 4NXKA 1TV7A 2E6AA 4QIUA 4S2BA 4A3UA 3KXQA 1NVMA 3FJLA 1SU5A 4GWEA 2QCNA 2ZRVA 5F4WA 1YTDA 5HMSA 1Z44A 2HSAA 5I3HA 3TU9A 3MBDA 3HGJA 3B0UX 4IXHA 3BLEA 3UZ5A 4BF9A 1LTDA 4LUJA 3DFQA 3G18A 1DJQA 3QW3A 4JX5A 4YCOA 3W7NA 1M7PA 1KM0A 4WUIA 1OK6A 1SZNA 4CQAA 3IIOA 1WDWA 2CLOA 2DJXA 4MJMA 3N3MA 1W31A 2G95A 3SFKA 4FIQA 3N14A 2YR1A 4HSNA 1FWNA 1PS9A 2CLMA 3U8GA 3PVFA 1A5CA 3E12A 1OFPA 3GR8A 2V9DA 4A2SA 1YXDA 4ICNA 4NNAA 4PEKA 1YDOA 2EGZA 4IPIA 3O6YX 2X1RA 4MYXA 4MOZA 3IIXA 1W1ZA 3P61A 4DO5A 2X30A 1MEWA 3R8RA 1NF7A 2GVGA 1TTPA 3G1VA 4WOQA 2HS8A 3TROA 4K38A 1I2PA 1W3TA 3SJ3A 4GBUA 3TNOA 2VFFA 1RQEA 1ADOA 3G1FA 2Z6JA 1OX6A 4JXCA 3GAYA 2Q8LA 2QCLA 3EB2A 4QAIA 3RLVA 2B7PA 1GG0A 1XL9A 3P82A 1H7XA 2C18A 3QMTA 4NJGA 3TX9A 3UY8A 4M6QA 3Q37A 3S42A 4UTWC 1TPUA 1YXCA 1YTKA 3P62A 4AF0A 3A22A 3KHJA 1ZFJA 2YW4A 1TPH1 3EX3A 1QPQA 4LVAA 3MUXA 3W7GA 1IXOA 3STGA 1A5AA 1WBJA 3NA8A 3BG5A 3NQVA 4K39A 4UTJA 5LNWA 4P2VA 4A21A 2I14A 3NQDA 5LHEA 3C3NA 3FYOA 2Y6ZA 3ABRA 4ZVJA 3DI1A 5LGXA 2QCEA 3SIZA 3IVUA 3C61A 1KM5A 3W1TA 4YL2A 3A23A 1AG1O 5AHIA 1OYBA 3NM1A 4DBDA 2ZTJA 1QDSA 2J88A 2AQWA 3MWAA 4GUHA 3LHVA 1O4UA 2ISSA 4UTTC 1PV8A 1VYRA 5HNRA 3GLCA 3IGXA 5KTLA 4YLWA 5KINA 4QM1A 4JTIA 1RQHA 3LDVA 3H54A 3IVTA 4UC5A 3W1PA 3EX4A 3W1RA 3HG3A 3C0JA 1LORA 3UXDA 3ABSA 4L4MA 3QJAA 1KTCA 4YWIA 2E5BA 3G24A 5LNSA 4O1DA 3LI0A 4UTUA 3NZ1A 3NPVA 2JGYA 4LVFA 3NL5A 1ICQA 3UXAA 1M6JA 3EXTA 4ZQNA 1OABA 5FF7A 3HOJA 3CWNA 2Q8ZA 5AC6A 3GXPA 3TIMA 5FEWA 1JQVA 4XBSA 5F2LA 4PFMA 4X22A 4KFOA 1ZNNA 1X1ZA 1KTNA 5D02A 1R2SA 2RDWA 4KFNA 1A5BA 4GXMA 5EBUA 3LTSA 1A53A 3DHFA 3GDMA 4QJ1A 2QCDA 1ZALA 4FXSA 4Z1AA 5K7JA 3C6CA 2QCGA 5CSRA 2OX1A 4XQ6A 5LNUA 3W2NA 2VENA 3LB0A 5FI8A 1WYIA 3NQEA 2Z1BA 3CEPA 1K8XA 3B0VC 4JY8A 3PBWA 3W83A 1WXJA 1FY6A 4Q32A 5FESA 2AAMA 1SO3A 5C55A 1KM1A 5C54A 1G4PA 4JY9A 5MHBA 5TQLA 2YFNA 2VEIA 2A4AA 5EKYA 3UWWA 4HKPA 3P8IA 5CZ0A 3W1QA 1SR9A 1GWJA 1VQTA 1W5OA 5BOOA 4R7JA 3KVMA 1BTMA 3YPIA 2FFCA 1GYLA 2TYSA 4LRSA 1H50A 3M5ZA 4OV9A 3O63A 5KITA 2HMCA 5D38A 2X1UA 3W86A 2C0AA 1H63A 3KRZA 3OVRA 2NWSA 3LLFA 1Z48A 4JTEA 3S5YA 2DZTA 4O12A 5AC7A 3QQ1A 2V5BA 1FXQA 2YSWA 1YADA 3W72A 1WV2A 3NO5A 1VHNA 3FLUA 1BKSA 2FIQA 1GYNA 4I9AA 3O6DA 1FWRA 3LHZA 1KFBA 4OQVA 3STEA 3LV6A 1TPDA 4O52A 1VCVA 4R33A 1OFQA 4JD4A 4FO4A 2VEPA 3B03A 4WJEA 3NL6A 4BK9A 3W75A 4D2JA 5D37A 3TJLA 1HFBA 3BW2A 1QPNA 4OU1A 3VI2A 4XTIA 2A7PA 4PODA 4JNMA 3JS3A 4XBKA 5BNKA 2BTMA 3C52A 3EWYA 3P5ZA 3DGRA 4IMDA 3M44A 4EOUA 4JTLA 4RZ5A 3G1AA 1DV7A 5D03A 1WOAA 2C19A 1TQXA 3CTLA 1CI1A 3F03K 5DY3A 3BGJA 2E5CA 2J9YA 1YDNA 4ADUA 2ZCGA 1ZAIA 3W7KA 3W1AA 4WY0B 1HTIA 5HUOA 3UZJA 3ANYA 3D0CA 1B57A 4KKXA 1Q6OA 5L6UA 2ZBTA 1UJPA 1OFEA 2DZWA 3CWOX 4JTFA 5AB3A 1LCOA 4UR7A 4UNLA 2Y89A 5G4WA 2X1SA 1ZENA 5EYWA 5I3FA 2DZPA 4TU1A 3N9RA 1N7KA 4KFPA 4NXSA 5FEXA 3TKFA 3LCIA 3HQ1A 1L6WA 3FKRA 1SO6A 4NZFA 2CLFA 2RDUA 3ATZA 1R2TA 2LLEA 1KV8A 3MI3A 2QR6A 2G97A 3M6YA 3BPWA 5D32A 4N4QA 2E1DA 1P5BA 3PUEA 4YMZA 5LGZA 3GZ3A 3EX6A 4Z0JA 1S3HA 3RK8A 5CZSA 3HMJG 5IM51 2ATMA 1P4CA 3KVLA 2WV8A 3M47A 1LRQA 4M19A 1TRDA 3TUUA 4JTTA 3WJYA 3TV8A 1KBJA 3TCEA 1YLVA 2KZHA 4RV8A 3W7RA 4IX2A 3G1YA 4XWUA 4QISA 3NVTA 4AXKA 4IOTA 3W7LA 3G22A 4CQ8A 1EX5A 3W85A 1GVRA 1OYCA 4K8HA 3TQ0A 5AHFA 4NJKA 4O1BA 5FF3A 4NJJA 1OVDA 1H5YA 2QAPA 1GPWA 3PUDA 5C6MA 3TR2A 2ZA2A 2R8WA 5C2XA 3DZ1A 2E6DA 4AEOA 4UFHA 1TRIA 3PR2A 4WY0F 6ALDA 3W2KA 2P0OA 2ISVA 2E77A 4JX6A 5LNRA 3RLUA 1VJIA 3THAA 3SGUA 2HTMA 4AAJA 3C4UA 3OVPA 3PSVA 3DFTA 2RH9A 1VZWA 2TPSA 1QO2A 4ALDA 3UQNA 2FPYA 3S8HA 3MP5A 3G1XA 3LXAA 4IJBA 3HPZA 2A1YA 1GVQA 1PHQA 2CZDA 4FNUA 3S1VA 3BW3A 3FS2A 4FNTA 4RJEA 3HIJA 3TXVA 1P1XA 5BW6A 1F73A 5AYXA 5BMXA 1KLYA 4CLMA 3L66A 1OF8A 3IVSA 3ABOA 4QNWA 1RPXA 3TH6A 4DXVA 3MHUA 1ME8A 1EB3A 1W54A 5A8GA 2QDGA 3PB2A 3P7YA 5KMYA 2DZSA 3PG9A 2VXNA 1S5VA 5E93A 4MLJA 3L68A 3O07A 4HT3A 3MP4A 3L65A 1TYGA 3QPYA 1MSSA 2PRHA 2V8ZA 4IQLA 3W3OA 1HO1A 1EP3A 1F7BA 1ZJIA 5EPDA 4FNRA 3BG9A 2V82A 3QM3A 4C1LA 1BWKA 1VPXA 3BG3A 3NQFA 3Q58A 4MUZA 1H61A 2GQAA 3WJSA 3HGSA 4POCA 3QC3A 1VGAA 3PY2A 4RK8A 5G1TA 3LX9A 3T55A 2QF7A 4WOZA 3L0NA 2Y7GA 2QUTA 1SPQA 3O6CA 4RCXA 3LXCA 2ZRWA 3PBUA 3B06A 3TMQA 5AN7A 4RXGA 2VFGA 4Q33A 3PSWA 2ZYFA 5E0KA 1QR7A 5LKYA 1B4KA 2NX1A 1JR1A 2YDAA 1W8SA 4UCGA 4OGZA 4ML9A 3QSRA 4M5PA 2V2CA 3W7IA 4UTKA 4DF1A 3UYCA 3HG5A 3TC6A 2R14A 3L21A 3C56A 3M7WA 3G1SA 3DI0A 4O8RA 3WJZA 1J5TA 1LBMA 3O15A 4WX2A 1SW0A 5F1VA 3CM4A 3W22A 5BMWA 1YDVA 2I9EA 2QCCA 1T0OA 5U7SA 3M5VA 4MY9A 2GOUA 1TJPA 3MI2A 4P61A 1WQ5A 3IGSA 1XBXA 3A9IA 3QRHA 4UIOA 3LCLA 4AHQA 4FXRA 1GZGA 2NUXA 4M7TA 1GT8A 3UWQA 3KVKA 3OEXA 3GX9A 1DQXA 4IWWA 1SFLA 2VFHA 3WJXA 4TMCA 1RR2A 2DP3A 3LLDA 5G5IA 5AFDA 4PTNA 3I68A 1JQXA 2A7NA 4Y6GA 1LM1A 1I45A 2WKJA 4RZ4A 1JUKA 1U5JA 3KOFA 4NJHA 2FTPA 3GK0A 4O17A 2EAWA 1JCXA 1FCUA 2FQIA 4A22A 3TSMA 1IIGA 3USBA 2X1TA 1R47A 4JTKA 1KM6A 3CEUA 1VH7A 1TPB1 1GOXA 4C1KA 4B5NA 3GR7A 3QEZA 4YCPA 1TB3A 5DN1A 1G67A 1UCWA 1VLIA 3FJ6A 2QUVA 1SSGA 4LS2A 1XM3A 4BI7A 3NAVA 1JCLA 4O57A 1Q45A 5E1QA 2CWNA 1DQWA 5K9XA 4O50A 1LROA 4UUIA 1XC4A 2YZRA 2XFWA 3S6DA 5DXXA 3GXTA 1EPXA 4DO6A 3SZ8A 3NOEA 1I2NA 4UMCA 5AHMA 3FEMA 3CB8A 2GJLA 1DHPA 2ZZ5A 3IIZA 1RVGA 4N2YA 4OHQA 3TW7A 2R91A 1XUUA 2QCFA 1Z41A 1V5XA 3B0PA 1QOPA 3LM7A 4GRSA 4E0CA 1DOSA 3LERA 1WX0A 2A5HA 2B7NA 1C29A 1CX9A 1G7UA 3T7VA 3OIXA 1XFBA 2EPHA 2B7OA 1UUMA 3E9AA 4JYFA 2GVLA 3B05A 5TBOA 1P0KA 2WSYA 3NQAA 5CGQA 4HNVA 3CIWA 5AYYA 1AL8A 5K9CA 4CNOA 2YXGA 4UFKA 2QJHA 3NPUA 1XBYA 1K3UA 3W1LA 4Z1CA 4CNNA 1ME7A 2DZVA 3DAQA 1LLZA 2QJGA 3VFLA 3W6YA 1LRNA 1OYAA 3JR2A 1FWSA 3I65A 4IMEA 4HPJA 4JTHA 3LHYA 5K3VA 2BSLA 3MHGA 1HG3A 2CZFA 3NQCA 4FNQA 1JCYA 2C13A 3L5LA 4ONVA 1LBLA 4K7YA 3KAOA 4LV9A 1YPFA 4MPQA 5KZMA 4E38A 2V2DA 1FX6A 1K02A 4UFJA 4JTGA 4LS1A 3T78A 1GVFA 2P10A 1Z42A 3QZEA 3R12A 1F76A 3QQ0A 3U2OA 3FIGA 1V7YA 3HJZA 1R46A 3W70A 5ABTA 1NAL1 3ABQA 3UY7A 5J5DA 1B4EA 2DORA 2OT0A 4WY0A 1YPIA 1OHLA 1OFBA 1KM2A 1W0MA 3I7SA 4CCCA 2WJZA 1IIHA 3TFCA 4Z1BA 3NG3A 3HPXA 4EVZA 5GVJA 4PL1A 5F4SA 4FF7A 2Z2UA 3T4CA 1UBSA 3H53A 4Z1DA 3LTYA 4O28A 2PRMA 4JDYA 4PCFA 2FB3A 4LTSA 2A85A 3DKJA 3GIYA 1GVSA 2PRLA 2Y62A 3MO7A 1UASA 3NZRA 3STFA 1T8XA 4ORIA 3LCXA 1EIXA 1VCFA 1OF6A 3HO8A 4XUGA 4GUJA 5KSWA 4XKYA 4JS3A 1H1YA 4DELA 3LHUA 2VFEA 1TO3A 2QCMA 2YYUA 3L5AA 4WQ6A 1N55A 1AK5A 2QKFA 2CLEA 3DXIA 3SY5A 2OT1A 1TPVA 4A29A 3NPXA 1I2OA 1AW2A 3AJXA 3EEGA 4O4WA 3C2EA 3TDFA 4JR5A 1VR6A 1Q3NA 2V5LA 2HS6A 1TJRA 1HL2A 2ZFAA 1W5QA 2EKCA 4UTIA 3IIPA 4WXZA 4N9DA 5F2MA 3CPRA 1RQBA 4JTSA 2NV1A 3O16A 3P80A 3LRLA 4UNKA 4H4IA 2PC4A 1EWDA 4FX8A 4UMAA 3S1UA 3AO0A 1DL3A 3G0XA 3T40A 3QH2A 1SW7A 2WQPA 1ICSA 2J24A 3PM6A 4U28A 4DPPA 4ZQOA 4I7VA 3W88A 3HB9A 1O95A 1S5TA 2JKAA 3WJWA 1KTBA 4NNBA 1JULA 3RFAA 3PULA 3Q2DA 3M5YA 1H7OA 4MZ8A 4ZZ9A 5IBXA 1GTEA 4Y9AA 1L2UA 3W7OA 4HHPA 4JTUA 4MVAA 2O7QA 5HJLA 1TPFA 3E49A 5U4NA 2J9XA 3M43A 4HNTA 1KW1A 1QOQA 5EMUA 4Q4KA 1NF0A 3LBMA 2ZZ2A 3W7JA 4LW7A 3IRDA 1D3GA 4S2CA 1JVNA 3QMRA 5FEZA 3W23A 1F6KA 4BFAA 3C8FA 3DHDA 1TSIA 4HN4A 5D09A 1OJXA 1KM4A 1M7OA 4O54A 4EF8A 3G1HA 1H51A 2J6XA 3W9ZA 2YYTA 1F6PA 4YXGA 3W1XA 3P5YA 3QMSA 3LOTA 2ABAA 4O4VA 4GE8A 2Y7EA 1Y0EA 3P81A 1SW3A 3B8DA 3CC1A 3LGEA 4O15A 4GJ1A 2ZZ3A 3FOKA 3W2UA 3NR0A 3LCWA 4TO8A 3VCRA 3JRKA 2BWGA 2H8ZA 2XN0A 4RXFA 1RV8A 1LBFA 5CG7A 5HR7A 4GUFA 1LDCA 3ZR4A 2V30A 4JDBA 1EUNA 1OK4A 2A0NA 5F2GA 4AVFA 3DFOA 4HSOA 1KFJA 5D2WA 1FDYA 1FWWA 4MFDA 3SI9A 2VELA 3S0CA 2E6YA 5K2ZA 4CCDA 2AGKA 1OX4A 5I3IA 4NT0A 1KFKA 1ZAJA 3W7CA 1TIMA 2PE4A 4O1CA 3UWZA 1FCQA 3UPBA 2Y61A 4HNNA 4UFLA 1JCMP 2FDSA 4IGHA 3TAOA 4LRTA 1EP1A 1H7RA 1RZMA 2ZZ7A 4Y90A 1O5XA 4K36A 1BEUA 2WOQA 3PWAA 4KWVA 3NQ6A 1MXSA 2WSQA 3PBYA 4O13A 1K7XA 1YXYA 4QNEA 1FDJA 4TR9A 1AW1A 1SUXA 5CZTA 4CNPA 4ADTA 1LP6A 3HG4A 3VKJA 3R5EA 3G8EA 3V75A 3QW4B 1QAPA 4AHPA 3LRMA 2Y7DA 4X3ZA 2J9ZA 1X8FA 5CKSA 1G4EA 2C15A 1OX4B 3TQVA 5AHNA 4MFEA 2GPTA 3BW4A 1IGSA 3V1PA 3BARA 3WK3A 2CW6A 4BR1A 3I7QA 5HINA 3GDTA 3THQA 4GFSA 2E6FA 3GXNA 3KRSA 1QMLA 3MMTA 1PIIA 4UTWA 4PH6A 1H7NA 3LCFA 2FJKA 1ALDA 3BVJA 3NYZA 4N9EA 1DKWA 5EL1A 1WBHA 3ELFA 1LLWA 4NJIA 1ZY9A 3PBVA 1DBTA 3TJXA 3QYQA 3G0SA 1R30A 1PL9A 5DCBA 2I1OA 3N34A 1AL7A 3I7RA 2Q3OA 3FA5A 4M6VA 1ZCOA 1QNVA 3EXRA 4ZQMA 3SR7A 4JN6A 3G3DA 2H8XA 2TSYA 2QEZA 3NEVA 2H3BA 1VYPX 4NX5A 2GQ9A 1PCWA 2WNNA 3G1DA 2F84A 4RKAA 4UR8A 3S9YA 3STCA 1NFBA 1W5PA 3A5VA 1QPRA 4JYEA 2E68A 4HPXA 4DEFA 1FBAA 4JX4A 1DVJA 2E5DA 2DZXA 3TSDA 3PF3A 3B4UA 1K8ZA 2X16A 3R89A 3EWUA 3RMJA 4O53A 3CHVA 3CIXA 4LNYA 3EWZA 4ORMA 5H91A 1GQNA 3E02A 1JJKA 1QO5A 3H55A 5SWUA 2Y88A 3ZFHA 4EF9A 4LOCA 1THFD 3C2VA 4BWLC 4DQWA 1XCFA 4XKYB 3TXZA 1E51A 6TIMA 2JGQA 3NNTA 4X9SA 1IF2A 3HGOA 4OE7A 3NM3A 3W2MA 3W07A 1GEQA 2H6RA 5EA9A 1VHCA 4A2RA 1F5ZA 4JIPA 5HULA 3IV3A 4XZ9A 4FEZA 4O18A 3TE9A 3DFPA 1L9WA 4G1KA 4ZQPA 5G1YA 3M41A 3LCHA 1O94A 7TIMA 3TC7A 1XBZA 3INPA 1PHWA 3P84A 3BK0A 3OVQA 2R94A 5I3JA 1H62A 3QSTA 5G2HA 3TA6A 3NL3A 3HBLA 2YW3A 3LCGA 5DBTA 3UWYA 3GNDA 4QQ3A 1TV5A 5CPMA 4MJZA 2EF9A 4K37A 3S1WA 3B04A 4Y96A 1L6SA 5K4XA 4Z08A 1C9DA 1XDMA 2H90A 2ATSA 5AHEA 1RD5A 1YTEA 5FF4A 3S1XA 2XN2A 2VKZG 1H7WA 4LC8A 2GVJA 2RKXA 2CLIA 3TQKA 3LBCA 1SFJA 2GQ8A 1XUZA 3NXFA 3F4NA 5AC8A 2JKPA 2GJNA 1TTJA 1ML1A 4PL2A 4OV4A 1F74A 3RU6A 2CZEA 3LI1A 2Y85A 4O0ZA 2JKEA 2YPIA 2NXHA 4ZMGA 5DELA 3DFSA 3K30A 1K03A 1PCKA
chains in the Genus database with same CATH superfamily
4NNCA 3H2FA 4KW2A 1JNEA 5HA7A 2VC6A 1GTHA 1NFGA 2OX4A 1M5WA 4N6FA 3NWRA 4IUOA 4N6EA 5DLCA 3MP3A 4MB4A 1J5SA 5DRCA 3RILA 1GG1A 4AWTA 4ZQRA 2PDKA 5CZJA 3SCTA 3MTWA 4D8AA 1F3XA 4RNIA 5HK4A 2HBXA 1TJ0A 4Q6XA 3QY6A 5LZLA 3W2JA 3OHIA 8TIMA 5F4XA 2WZEA 4PCNA 1RJPA 3W7QA 4FB7A 3HPAA 4U4MA 1S2WA 5JU6A 4HN8A 1PEZA 3S5NA 3CUFA 4I7UA 1PAMA 3MW7A 5A1AA 3VE9A 5J8LA 3M0LA 4BQ4A 1CEOA 1E4MM 4AC1X 1K7FA 4EXBA 1G4TA 1J0YA 5HWJA 2YBVA 4MSSA 3HG2A 2WMFA 1MO0A 3DG6A 3W71A 1Y5XA 5BU6A 3CH9A 4J1OA 3HGRA 3WDRA 1QFEA 1C8YA 2CXGA 3LHWA 4AZHA 2ZA1A 4R53A 1QVBA 5A6AA 2WBGA 4JEQA 3PS7A 4TQTA 1K4GA 5LXXA 1SSDA 1CZ1A 4HNUA 3GXIA 2E09A 3KX6A 1BXCA 5EMJA 3KBMA 4YIWA 3CYVA 5I3KA 3RM4A 1O60A 3NPWA 1NWTA 2C16A 2JK2A 3LK6A 4UR9A 3SEPA 4GUIA 3SIMA 2ZXAA 4MLRA 3QV8A 4FHAA 3DFNA 1VS1A 2OO6A 2G3MA 2WHJA 5BWAA 4MKNA 1Y65A 3GH5A 3CHCA 4OUIA 4IMGA 4LVBA 2OGYA 4Y9MA 5EFFA 1WDDA 3A6OA 3OLIA 3C3UA 2B7QA 3ZMRA 1RHCA 3GDBA 2WMJA 4FALA 2J27A 2OGJA 3NVDA 4MAVA 4K7VA 3W82A 3V1HA 3VD3A 3G3MA 1GEHA 1OGGA 3B8TA 4MZYA 1I2QA 1M9HA 5AOUA 3ZS4A 3ARVA 3GG7A 1Z7AA 3CL7A 2PDHA 2G3NA 1JD7A 4JFVA 2WMHA 2C6QA 2PDXA 3RNDA 4PMUA 4Q8PA 4H6KA 4W88A 2AKMA 2OLAA 2NZLA 2CWXA 4P7RA 1OFDA 2TAAA 5CC5A 4OOUA 3SCVA 1QBAA 3D5HA 1W1PA 5FKYA 1FWFC 1GZ1A 4Q3MA 1JCJA 4V2XA 1ZZMA 5FJJA 1SZGA 2YGYA 2FMOA 4NF7A 5LNVA 4JICA 3GHRA 2IUZA 2PDIA 3E0IA 1P0NA 4ATDA 4JFWA 3CPGA 1FXPA 2PURA 1VRXA 5D9MA 4TMBA 1KBIA 1ZJAA 2NX3A 3O06A 3SGZA 2B0MA 5CZKA 3GAKA 3B9NA 1EP2A 3WQ5A 5DF0A 1HP5A 1SMDA 1ONRA 1XPGA 3NQGA 4XZHA 2PA6A 1JZ2A 4CVUA 4KCVA 3KEHA 1VC4A 1MQRA 3KS5A 1HUVA 1JZ3A 1GKPA 4HIBA 4JFSA 2CLPA 5HNNA 2DIJA 4E2DA 3AIEA 3L5MA 3LQGA 1F4HA 4HZ7A 1GOQA 2QYGA 3MJYA 1W17A 3AUOA 1C8VA 4GI6A 4HZ6A 3W76A 3WQ6A 3NQMA 3PC0A 4H01A 2QS8A 1BHGA 4H3DA 3LRKA 3ONCA 1LLOA 4GVHA 1DJYA 3W7EA 3GC2A 5L9FA 1EWEA 2XGIA 4TX9A 1X6UA 4NQ1A 1VBHA 2W3ZA 4AZIA 5C5YA 4L1WA 3L4VA 4MDPA 4ZXOA 1Q66A 3QFEA 3TK7A 1M7XA 3TN3A 3W87A 2ALDA 5T9CE 1NELA 1FWTA 1XIJA 3T8LA 5AC5A 2ZRXA 3ARTA 1HKVA 3U4AA 4AB4A 4AMAA 2UBPC 5D04C 2TRSA 5DO8A 3VDGA 1MZHA 4S1FA 4G7FA 1U83A 3OBKA 4ATLA 1RCXB 5D33A 4ZENA 3AHZA 3PAJA 1GVOA 1ISWA 2J13A 1RY8A 1I9CB 2EPOA 4MNJA 1H7PA 5HWNA 2A6LA 3KRUA 1E15A 3NJ3A 1VD6A 4IFKB 4GPNA 5T26A 3IK2A 4B5VA 3CQ0A 3T0AA 3W7HA 1GVEA 1E56A 5BRQA 2ZUNA 5CPSA 4IIDA 2RDTA 5DCDA 2ZRYA 4HPGA 5HJYA 3VOCA 1UWRA 3KL0A 3NQ8A 4FNPA 2J62A 1LYXA 3CT2A 4DF2A 4DJFC 2WNQA 2XZ7A 3BOFA 4TVCA 4LC6A 2A6NA 1T41A 2DJLA 4WEVX 3UR5A 3ZIZA 2D0FA 3VNKA 2B31A 1QXLA 1F07A 1PVNA 2OCZA 1G69A 3CPUA 4FXJA 3V5CA 3CASA 4OWGA 3EKLA 4MY8A 4PMQA 1H60A 3IAQA 1QCWA 1XYBA 4WKAA 3RF9A 1W5MA 1JNDA 5G2IA 4FIRA 4AWSA 4UQBA 3DBPA 3UF9A 3DHUA 4DUXA 1MUWA 2ZZ4A 4PRRA 2AL1A 1T40A 1XKYA 2DT2A 1M41A 2CYGA 1A5LC 2XHYA 2J7DA 2WLYA 4QLJA 2X8RA 2OJPA 2FPTA 3QTGA 1XR2A 4J2PA 1W56A 1VEMA 2A21A 3W01A 1EEPA 2IMRA 4PA8A 1K7EA 3EWBX 1H09A 1OFAA 3WMSA 4J9JA 1O5QA 3T81A 1YIXA 2Y8KA 3L2IA 3P60A 2YX0A 3RRXA 4WLCA 2V5JA 2ZZ1A 4LV4A 1FWBC 1ME9A 1W5NA 4KWOA 2Q01A 2BV9A 5HPOA 4G1NA 3W1NA 1TCDA 1TFVA 4E2BA 3T42A 2NX9A 3TFXA 2TMDA 4F79A 5ENLA 4AH7A 3O1NA 3NDOA 3K8LA 3AWNA 2PI6A 3TR9A 2W6RA 1KRAC 1XIIA 4NZCA 4TTGA 1DWAM 2C14A 1XXXA 3MUAA 3UG5A 1KLZA 1FDZA 3ZVIA 4C6MA 4E3VA 5H6HA 1Z8AA 1J4EA 4KS0A 3S3GA 2ZQ0A 4E4PA 4GA8A 3RRAA 1EBGA 4WVXA 4DUOA 3E2VA 3MI6A 3W24A 4PC8A 1OM0A 2CU0A 2CLLA 1DJNA 3S9IA 1UR8A 2E9MA 1Z89A 3LPOA 4LNCA 3GB6A 1NWSA 3AIWA 2WNZA 4BI5A 5EY5A 5HDRA 1JUBA 1M04A 1TV7A 3HURA 3FJLA 3W37A 1SU5A 4DM1A 2CPUA 1QTWA 3G1RA 5HMSA 4PCSA 2HSAA 1QW8A 3HGJA 1HKWA 4IXHA 1B1YA 2DGAA 2C8NA 2J75A 2GOKA 4B5WA 4U5IA 3H7VA 1LTDA 3B97A 3DFQA 4LUJA 1DJQA 3QW3A 4YCOA 3RXZA 4YS1A 1ZBWA 2HBVA 1SZNA 1D7KA 1OSEA 4C90A 4V1YA 1W31A 2G95A 5T91A 1EF3A 3HZ3A 4JL2A 4R7WA 1FWNA 3SN1A 1QK0A 1BLIA 1A5CA 3E12A 4C7DA 5KEZA 4IPIA 3UCQA 2D1ZA 1NY1A 4MOZA 3IIXA 1XYFA 1W1ZA 1CNVA 3I3DA 2X30A 3R8RA 1NF7A 1TTPA 4U5KA 1W3TA 4D6IA 2IKHA 3SJ3A 1CLXA 1LWHA 4H9XA 3TNOA 2PF0A 1OX6A 3QZ6A 3GZAA 4I5UA 2QCLA 1N2VA 4PB3A 3G6MA 3U2ZA 4HOZA 2PAJA 1YNQA 1H49A 4KRZA 1H7XA 3QMTA 4NJGA 3UY8A 2WHLA 3TZNA 2DUAA 4UTWC 1TPUA 1YXCA 5A3HA 3A22A 1QPQA 3MUXA 5AYIA 4FSAA 3STGA 3IJLA 4OBSA 3NA8A 3D47A 3NQVA 4K39A 2EQDA 4A21A 3T0DA 3C3NA 2Y6ZA 3ABRA 1KGXA 3NYDA 5LGXA 5A6BD 3IVUA 3W1TA 4W8LA 3VOFA 3A23A 4M51A 5AHIA 4FI4A 4DBDA 2V3DA 3ALGA 2J7GA 4L7ZA 3EWDA 4CD6A 3MWAA 4S23A 1PV8A 4KETA 3VOHA 3IGXA 4I9MA 1CCWB 1RQHA 3LDVA 3KLLA 4ZSTA 1BYCA 3PZGA 1QPKA 3C0JA 1LORA 3BCJA 5FAJA 3P3BA 1XH2A 3G77A 3G24A 4G2DA 1HP4A 1JDAA 2JGYA 2QXWA 3IJQA 4PMXA 4URIA 1R3TA 1ICQA 4EX4A 1UWUA 3UXAA 4KF1A 3GXPA 2VWTA 4XBSA 1PUDA 4ROQA 1FKWA 4X9YA 4K68A 4M1RA 1KTNA 3RO6A 1R2SA 1A5BA 2FTYA 1GNXA 2VC9A 2J7HA 3CAQA 5IFPA 5B7ZA 1ZALA 2E25A 3C6CA 2QCGA 1DWFM 5KETA 4H9UA 1UH4A 2Y4SA 4LUTA 3XINA 3W2NA 1B3YA 2R24A 4RDZA 2Z1BA 1QOXA 3CAKA 2W27A 4CGTA 3CEPA 4DB7A 3PBWA 2ZUWA 4J5NA 1P7TB 1JAKA 2OQYA 2PLCA 1R3VA 5FESA 1JYVA 3WUEA 1KM1A 2GJPA 2OSXA 5C54A 5E9AA 2OWCA 4EANA 5TQLA 2WQDA 2YFNA 3KUMA 2VEIA 3AXMA 2A4AA 1Q4WA 1U5HA 5C9ZA 4YVXA 5CZ0A 4GYPA 4INFA 5BOOA 1BTMA 3M5ZA 2PDWA 3O63A 4MG4A 2FFIA 5A2BA 3O7UA 3BE7A 3OG2A 1S38A 4AY7A 4JTCA 3WQGA 3W72A 1WV2A 5J04A 3NO5A 2J7CA 3FLUA 3S47A 1AA1B 1ADDA 4O52A 3T0CA 4DXXA 5GJMA 3V4BA 3LM3A 4FO4A 4W5UA 4RPPA 4H9YA 3IJ9A 1UWSA 3NL6A 4BK9A 1KB3A 3TJLA 1H4PA 1Q2RA 3BW2A 3GTXA 1PZ0A 4XBKA 2G37A 3DGRA 2J6VA 4D71A 3M44A 4EOUA 1JL8A 4F48A 2OXNA 2WB5A 1ECEA 2Q71A 4H04A 4OECA 4GOAA 4MNMA 5HANA 3GTHA 4GQBA 3V35A 1QATA 4C6EA 1HTIA 2Z2BA 3UG4A 1B57A 3C5QA 3M6DA 4BQ5A 2ZBTA 5LIWX 1OFEA 2DZWA 5AB3A 5I3FA 3PJTA 5FEXA 2C91A 1B0IA 1SO6A 2XSXA 2IS7A 3ATZA 2LLEA 1ECQA 2ZX8A 5M03A 5MKGB 1ISYA 3BPWA 4Q4RA 5D32A 4L4PA 4N4QA 1J0ZA 5A6JA 1C90A 5LGZA 4Z0JA 3RK8A 3GNOA 3MO4A 3KVLA 2WV8A 3M47A 1R38A 1TRDA 1FH7A 3WBWA 3U7BA 3W38A 2RUSA 4ZTXA 3TV8A 2PD5A 2I5QA 4P7LA 3F4CA 4LPCA 3W7RA 4IX2A 3UETA 4QISA 1PTGA 3W7LA 2ESCA 4JKKA 3FW6A 1KKOA 1OYCA 3N18A 4K8HA 1HKJA 4NJJA 1OVDA 1VIZA 2XIQA 4XZMX 2QAPA 4S3CA 4WGHA 4E8GA 4GBDA 5KZ6A 4WY0F 4PR4A 2IQDA 5CBBA 4JX6A 1PYMA 3OODA 3SFWA 1MRAA 2Q09A 4B90A 3ZJ6A 2DY3A 2XH0A 5AC4A 3UXLA 3KS6A 2NSOA 4WR3A 2WMIB 1ISXA 1KBLA 2FPYA 4XAYA 1EO7A 4HU4A 4L80A 3MP5A 5LXEA 2QGYA 4JCMA 2A1YA 2NLYA 4FNTA 1Z69A 3TXVA 1P1XA 5BW6A 5CG0A 5BMXA 1KLYA 1OF8A 5JIPA 4A8NA 3KOZA 1A4LA 1UR1A 2OWWA 1EB3A 1UD3A 1CGTA 5A8GA 2QDGA 2ACRA 3BMXA 4R7OA 3PB2A 5KMYA 4W7VA 2AL2A 3OPSA 3PG9A 3QC0A 2E9BA 3W28A 1S5VA 4MLJA 3MP4A 3L65A 2ZWYA 1WNOA 4UNIA 1MSSA 2V8ZA 4IQLA 5I24A 1ZJIA 1GOKA 2OYMA 1UUQA 2XTKA 3VKCA 4C1LA 2J74A 2Z25A 4B91A 4DNHA 4ACYA 2GGIA 3WJSA 4PGLA 3HGSA 3EEZA 3QC3A 3MWCA 1XGDA 1OIFA 1VGAA 4RK8A 1XV8A 2QF7A 2BB0A 1OD8A 3ZT6A 4WOZA 3L0NA 3WN6A 5E6ZA 2FJUB 3H22A 3N25A 3UJSA 4EXAA 3AMDA 3AMGA 4RCXA 3FY1A 3LXCA 3PZMA 2QUMA 5AN7A 5I03A 3WNMA 4Q33A 3CZEA 3QGVA 1XLHA 1B4KA 3GH7A 4ZFCA 1W8SA 1YW1A 2QIIA 1QNRA 4ML9A 4IP7A 3GE7A 1UD6A 3LMZA 1CTNA 3UYCA 3EAUA 2R14A 2QQ6A 1OG6A 3DI0A 3WJZA 1J5TA 1LBMA 3T0TA 3JVAA 3ITOA 1FTXA 1UPMB 4W7UA 1AZ1A 3CM4A 3EOLA 3VIPA 3T05A 3W22A 2DH3A 3MY9A 5BMWA 2QCCA 1PB0A 2GOUA 2INFA 3M46A 7REQB 1RVKA 4UIOA 3LCLA 1QI0A 3OEXA 3IK4A 1D3CA 3LZ3A 2ZVRA 3P6LA 5DMMA 3ARQA 4TMCA 3E1F1 4EPDC 3LLDA 3HFTA 5AFDA 4Y6GA 1C8XA 1LM1A 2A3BA 1KO0A 1H0IA 4RZ4A 1ONWA 1U5JA 1SFSA 7ODCA 4NJHA 2QUNA 3QLDA 2EAWA 3UESA 1CXIA 1FCUA 8RUCA 2NW0A 1S39A 1GOXA 5FJRA 1Q7QA 4C1KA 2REQB 2ZUMA 3QEZA 3E0LA 1G67A 3FJ6A 3H70A 3WD2A 5C9RA 4LQ1A 1OQFA 1XG3A 3IV8A 1JCLA 1Q45A 3I3BA 1DQWA 2GLKA 4LF1A 3J7HA 4O50A 2X0SA 1XIDA 1LROA 3ITTA 4UUIA 1QNQA 2XFWA 5DXXA 1SFTA 3SZ8A 2VO5A 3V5FA 2YOCA 4NKCA 4DWDA 5C9XA 1V77A 1DHPA 4U33A 4N2YA 4OHQA 3LPGA 3V0TA 3TW7A 5LA0A 2G41A 3P2VA 1XUUA 1V5XA 3MMUA 3LM7A 1DOSA 1XH0A 2A5HA 1ISVA 4C1NB 2O92A 1C29A 4HP5A 2PWHA 2WVTA 1XFBA 2EPHA 3Q65A 1EIBA 4JYFA 3USZA 2VGIA 2WSYA 3QR1A 3CIWA 5AYYA 1AL8A 3VUPA 2QJHA 1XBYA 3U7VA 3QHOA 2QJGA 3VFLA 4P8VA 1JAEA 1W9BM 4ZB5A 2O4MA 1LRNA 1KKRA 3VNYA 4IMEA 3VINA 1PIFA 3MHGA 2CZFA 2ISFA 4PTMA 3L5LA 5AYBA 4IH3A 4F2TA 4AXNA 4ONVA 4LB3A 1UP3A 2P3ZA 1UH2A 2VWSA 4E38A 3UBPC 4UFJA 4ZOCA 2CC0A 4JTGA 1WDRA 3WLTA 4LS1A 3OA5A 4QEEA 1NP0A 1Q63A 3QZEA 1F76A 3U2OA 1D8CA 1V7YA 3HJZA 1A5UA 3P93A 2DORA 2OT0A 3O9NA 1YPIA 3ZR5A 4H8HA 1GQIA 5C9WA 3FJ4A 2PWDA 1X8CA 3N4FA 3TFCA 4Z1BA 2V3GA 3GYCA 4GJIA 2O56A 4C65A 4Z1DA 4O28A 2JFEX 2HE8A 4LUYA 1E0XA 1FH8A 4NYYA 2EBNA 4HYVA 2PRLA 3IJIA 1EF2A 1UASA 4GACA 2ZDSA 2WJFA 3WLKX 1P0BA 3HO8A 1UA3A 3VKDA 3LHUA 2QCMA 2YYUA 2JF6A 3EA3A 5G1MA 4A29A 3NPXA 1AODA 1AW2A 3AJXA 3ERPA 1EPVA 3WNOA 4JR5A 2V5CA 5ABFA 3GFYA 1HL2A 4HA3A 4LYRA 5F2MA 5LIXX 6REQB 4J3ZA 5DFAA 9RUBA 3WF2A 4FX8A 3R8HA 1DL3A 1TE1A 4BF5A 3S4TA 1Q6DA 1XSIA 2WQPA 1LL4A 1BYBA 4I7VA 4DNMA 4LGXA 1X6LA 1TMLA 1S5TA 4GGHA 1JULA 3RFAA 3AALA 3Q2DA 1P6BA 3WH8A 4GH1A 4TV5A 1NQ6A 4YTSA 1L2UA 4HHPA 4LXFA 3E49A 3SRDA 4HNTA 1S1RA 1F3TA 1FFQA 4Q4KA 3UXKA 2EG6A 3AXKA 2X7WA 3MUCA 4WKHA 6TAAA 3IJDA 1JVNA 1E1FA 4BFAA 1OEPA 2QPSA 3DHDA 3UG8A 4O54A 3WEOA 2G3IA 2XFFA 3PZQA 1JDFA 3ZXWA 2DVTA 1CECA 2D0HA 1F6PA 4GZIA 1HVXA 3LOTA 3DECA 4JHMA 3OIHA 4GE8A 2Y7EA 3CC1A 1OCNA 1BVNP 4O15A 4GJ1A 4QJ5B 1KRCC 2VYOA 3VCRA 2BWGA 2G4JA 4E4UA 1LBFA 5CG7A 1RV8A 4BZYA 4GUFA 3OYZA 4S3FA 3ZR4A 1EZ2A 4F2BA 1OK4A 1JCTA 1XLDA 3W00A 4AU0A 2DT1A 3GU2A 3ARSA 4IIEA 3RJXA 1FWWA 4MFDA 1DP0A 6CGTA 5FA5A 2ASHA 2E6YA 2DV0A 4KRTA 4M6UA 3EDJA 3SURA 3B8SA 1Q65A 3U4FA 3S2LA 4ZOAA 3AZRA 3URBA 3W7CA 1TIMA 4LYKA 4HNNA 4UFLA 4IGHA 3UW6A 2H9AB 2PGWA 1BEUA 3EOEA 4V1XA 4O13A 2D2HA 1YXYA 7ENLA 3R6IA 3KWXA 4TR9A 5CZTA 2Z7KA 1FWCC 1OADA 5GQBA 4ADTA 4DJEC 3UT0A 4FOKA 3LRMA 1B3XA 5DMLA 4YU1A 1YBQB 3KP1A 2J9ZA 5LYRA 2WYSA 2C15A 3TQVA 2ZE3A 5AHNA 4MFEA 3G6LA 2C1IA 4UQDA 3HTWA 3WK3A 1U33A 2W61A 3CAVA 3GQYA 3THQA 3F5KA 2E6FA 4XD3A 2PC8A 1PIIA 4RW5A 1JZ7A 1JFXA 4JQ2A 4KWSA 2F61A 4N9EA 4GINA 4MTVA 2WC3A 2XH2A 1PKMA 2G0WA 2W63A 1XQKA 3ELFA 1LLWA 1R9YA 3TJXA 4S3EA 1AQFA 1HVQA 3G0SA 9XIMA 2G50A 1PL9A 5DCBA 1XGEA 3ITVA 5A8PA 3N34A 1AL7A 1C92A 1W9DM 3CV1A 4YJ5A 2Q3OA 2PFHA 4M6VA 3EXRA 1US0A 4QLLA 4JN6A 2DH2A 2HNHA 2R82A 2QEZA 3CJPA 2OYKA 2GQ9A 3EPMA 2F84A 4RKAA 4UR8A 2W5FA 3S9YA 4LF2A 1NFBA 1KBKA 3CGTA 4KPLA 4CD8A 1EJRC 3VMNA 2DZXA 5PTDA 3TSDA 2INEA 3B4UA 2HVMA 1K8ZA 2X16A 3HM7A 1E5NA 4ORMA 1XLFA 4LNYA 3EWZA 4QE5A 1JJKA 1QO5A 4U3AA 1NH6A 4N42A 4E2VA 1S5MA 4LOCA 3EYPA 4HSHA 4RNHA 4BWLC 4C91A 2JGQA 3NNTA 4PSRA 3NM3A 2ANUA 2XDFA 3W2MA 3SCSA 3KBNA 1RP9A 1JF6A 3GHSA 4IJCA 1VHCA 4A2RA 1RBOB 2V5DA 3BLPX 4PB4A 4XZ9A 3GU9A 1IEXA 4G1KA 1UWIA 5AECA 4KT2A 4RZBA 2POTA 3B9AA 3BWWA 3WLLA 5G1YA 5HMFA 1K9FA 3BK0A 5TD4A 5LA1A 7REQA 4LUTB 1F3EA 3QSTA 5G2HA 3NL3A 2YW3A 3K1GA 4DN1A 1M65A 3UWYA 1TV5A 4REQB 4MAZA 1X38A 2FVLA 2PBGA 3SCUA 3B04A 3SRKA 1FWGC 4Y96A 4A05A 3UA4A 5K4XA 8A3HA 1C9DA 2QDDA 3CYJA 1B54A 4YTUA 4UOJA 5ABEA 1H7WA 3SCOA 2GVJA 3WG6A 2RKXA 2VUNA 2CLIA 2C7FA 3LBCA 1K6AA 4JQ3A 3M0IA 3GG0A 1TTJA 4MUPA 3SUTA 4PL2A 1F74A 2CZEA 4IG2B 3EB4A 3I4EA 3LI1A 3TYZA 4O0ZA 3WQEA 1SGJA 3SUSA 2D24A 5DELA 3DFSA 4XUYA 5A94A 4LYPA 1K03A 1PCKA 3VIJA 4HU8A 4UTHA 1I2RA 1GORA 3DFHA 3NQ7A 1W8GA 4K3ZA 3N15A 3DESA 1OGBA 3K4DA 4NZ3A 3UZYA 1Q6LA 1W1A1 1C93A 1KFCA 1BQGA 1MXDA 5DQPA 1GJPA 4QAWA 3PZUA 4RNFA 4UTTA 3QZAA 2CBUA 1BTCA 3XISA 4WDTA 2FLIA 1FQ0A 1TQJA 3CXOA 2XIJA 1OC5A 1ENUA 1G6CA 2CBVA 4UTLA 2VCBA 3ARRA 1S2VA 2Q3RA 2Y7FA 4JL1A 5EB8A 4TOQA 3OGVA 3TLQA 1K8CA 4WZHA 5DX7A 3MVIA 1XYCA 1JCNA 3BAYA 1E9ZB 2ZRUA 4LEFA 4Z2GA 3EXSA 3LTPA 1A49A 4Y8FA 1Z9AA 4JHOA 2Z6IA 3CMJA 3H2OA 4F9DA 1TZZA 1KXQA 5F7UA 1E4NA 3UZWA 1POJA 3N2OA 1H11A 1CW2A 2PCQA 4NRSA 2A2IA 3LHTA 1Y8BA 3R2GA 1RA5A 2PBOA 3NTYA 1NTHA 2BVYA 2YJQA 2Y1HA 3H12A 4I5XA 4W8BA 3W7DA 5CSSA 4JTAA 1L6GA 3S1GA 4IMCA 3GS6A 2NV9A 1UIPA 3T2OA 3HN3A 4H7ZA 2GSJA 2YFOA 3QXBA 1T99A 3I4KA 3DG7A 1PPIA 1P43A 2XGZA 1F9CA 4GNVA 3R1ZA 3MYPA 2CLKA 2POZA 4JYDA 4F0HA 5FOOA 4D6EA 4QP0A 4LAKA 4N9BA 3G8RA 4X61A 3Q4DA 4LAZA 4CD4A 2NLIA 5FEPA 1J96A 3PTMA 2GSEA 1XYAA 2NUYA 4AW7A 3BLFA 4GZEA 2P8BA 5LHFA 4IX0A 1IXPA 4V27A 3GU1A 4EIVA 2H3DA 4L6DA 4JZ5A 3T4WA 1JDDA 5DANA 4OT7A 1WAWA 3MBFA 5XIAA 3H23A 2Y2WA 4AF0B 3EDFA 4F66A 1SJBA 2G5WA 3UFYA 2HE5A 4JTDA 3CQJA 1Z32X 1E55A 4OIFA 4C6IA 3WLPA 3M1ZA 1GKRA 3C2FA 2CLHA 2WM1A 3HA1A 4DJEA 5A5WA 3CNYA 4DXKA 3KFTA 2ZDRA 3AYRA 3UWVA 3FAWA 1XIEA 5C7HA 3EOOA 4ZQCA 1ZAHA 3DYMA 1XINA 1CLKA 4IPJA 2O7SA 3BZGA 2RGLA 2CZ5A 3GVGA 1R86A 3HJEA 3N2MA 4C7GA 5HPCA 4DJED 2CFFA 4IP5A 3G0UA 4DY1A 2QV5A 2WSPA 5IDZA 2DZUA 4M24A 5DBUA 4WDUA 3SRFA 4IJRA 1K8YA 1GK8A 2WNWA 4BKNA 1H1ZA 1RUSA 2VR2A 4C7FA 1V6WA 3T07A 1MXGA 1LRTA 5FL0A 1DPMA 5FF0A 3EWXA 4XZWA 3AIVA 1XIMA 3C2RA 2GVYA 2WVSA 1HL8A 3KDNA 4MYAA 1B3OA 3VTRA 3ES8A 2VZOA 3M0JA 1F4AA 4IQDA 4LFYA 2YLLA 3LEPA 3R8GA 4Y9NA 1I4NA 5LIKX 3R0DA 3M9YA 1WXYA 1PXGA 4RZ6A 3RITA 3WH7A 4P8XA 2R1KA 4UMBA 2L5HA 2VC5A 1IXNA 1TV3A 2QDHA 3PTKA 3CAWA 4C6JA 3W74A 2Z1WA 3N6QA 5I3DA 4IXXA 2P1FA 3N9SA 4BWLA 3ZWTA 1R3YA 1I8JA 5CPNA 1KXHA 4LS0A 3ZQ9A 2QGHA 1CB2A 4S3JA 2GUYA 3OJGA 5T9BG 1S2AA 3H2CA 3S5OA 4HD5A 4W86A 1R85A 4H19A 5GJNA 2Y63A 1RSCA 3FSUA 5J5RA 3SGGA 1J0JA 1SZEA 3QYSA 2QUUA 1PKLA 2D3NA 3ITXA 1VKFA 3CT7A 1R8LA 3BJTA 4B92A 1E5JA 2V68A 3BQ6A 4X0VA 4K6AA 5G4EA 2NXGA 3A24A 2YDSA 1TELA 1WA3A 3U5UA 3TW6A 4DYJA 4WXYA 1W2PA 3PJXA 3C0SA 2HEJA 4AG0A 3O8AA 1Q6RA 2NQ9A 4I9TA 1UHVA 2BFGA 4RX0A 3WD4A 1WOBA 3DKLA 2NXIA 1W37A 4ADSA 3O05A 2VOMA 1EGMA 3E96A 5EU9A 2GDUA 3A4XA 4HTYA 2DW6A 2ZUVA 1R2RA 3H2EA 4JTRA 3W2LA 4N7QA 3NEHA 3QPZA 1BGGA 2YDRA 4QROA 5DRIA 2BY2A 3Q94A 4UXDA 3W1MA 4UTMA 3MMDA 3TMLA 1N8FA 4S3AA 1OFRA 4TX8A 3DH7A 2BXVA 1TPC1 1J79A 4PBGA 1JPDX 4LUIA 2BOEX 1FUYA 3TAKA 4W8AA 4AY8A 4KEVA 1TTQA 4I90A 3W7MA 1WAUA 1UIOA 2BLEA 1JGIA 1TWZA 1V3IA 9XIAA 2X2GA 3W27A 3W1UA 2Z0IA 1JPIA 4UFMA 2H9AA 1VEPA 5FACA 4GVGA 1FFRA 1W3NA 5JBDA 2WSRA 4X2PA 4PMJA 5D2YA 3A21A 1YKWA 2HXTA 1ISZA 1RALA 1TMHA 2J77A 4W9TA 4JTJA 1G0CA 4HHMA 5I3GA 3LMYA 4CNSA 3TLLA 1S1PA 2XU2A 2FDMA 3BO9A 1ZBVA 3K4AA 2YCJA 3IIVA 3UZXA 2J4GA 1JUEA 2X1IA 3BLIA 1ZBCA 4O0QA 5EMYA 1SO4A 1ZHAA 3GKAA 4C6KA 2V0TA 1GGOA 3IEBA 3WK0A 1VLWA 3PWIA 1UZDA 2QCDB 5HNTA 2XFYA 5DCEA 4GC4A 2P53A 1VFUA 4DBEA 2XVKA 3QPEA 3PWGA 2ISWA 2UWFA 4K8EA 3L4YA 4DZHA 1IZCA 1L8PA 3M0ZA 1E0TA 3MSYA 4S2BA 1A5MC 3KXQA 1OT1A 3V5OA 1TIWA 1YTDA 5I3HA 1VENA 5JUVA 5BRPA 3UZ5A 1V0LA 1LWIA 4PE8A 5A6MA 4WUIA 1FHDA 1NDVA 4CQAA 1SM9A 3IIOA 2VUYA 1E3ZA 2DJXA 5C7VA 4IFKA 3WF1A 2PWFA 3LD5A 4BEUA 4J3SA 3N14A 2FGBA 2I5GA 4ATWA 4QCEA 5CBIA 4M8UA 1QHOA 1OFPA 4ICNA 5FJUA 4PEKA 5EMMA 1FHUA 3RMEA 2X1RA 1XGZA 2PDMA 1Q13A 3P61A 3W0KA 1EHAA 1MEWA 3MUIA 3WUBA 4AX7A 3GIPA 4WOQA 2HS8A 3TROA 1OINA 2DT0A 1RK5A 1VFMA 1KQYA 2FGLA 4ILSA 1ADOA 4TV6A 2Q8LA 3EB2A 1BWVA 3BLKA 3REQA 3RLVA 1GG0A 1XL9A 3GWQA 1X39A 4PMDA 4WDXA 1AMYA 3P62A 4AF0A 3EX3A 3NQBA 4ZTYA 5M2FX 3WO8A 1WBJA 3HMCA 2OPJA 3BG5A 4P2VA 2HPMA 3ZR6A 1JFHA 1MMFA 3NQDA 1XQLA 2YBUA 1K1DA 2QCEA 1TR1A 4YL2A 3VZYA 2YL9A 3NM1A 4AZ5A 3FNDA 2ZTJA 2VJXA 2YL5A 2BGNE 3ID7A 3MJMA 4YLWA 3LNPA 4C1NA 3EDEA 3GUWA 3IVTA 4MWAA 4UC5A 3W1PA 2G3JA 3RCMA 4L4MA 2XVPA 4DRSA 3CUZA 5LNSA 3WUFA 1E1EA 3TP4A 4LVFA 5BCAA 3S2MA 3H2MA 4IIGA 4WJ8A 2F8QA 3NL5A 1W3KA 1QHZA 3EXTA 5EBAA 1O1HA 2F6UA 4ZQNA 1OABA 5FF7A 3HOJA 3SAZA 4CU6A 2Q8ZA 5CXPA 3TIMA 4LBSA 5F2LA 4PFMA 4X22A 4KFOA 4AD5A 3CHDA 4B5UA 1RA0A 4KFNA 4HK7A 3RX4A 3GDMA 2XVGA 1IR1A 3VNLA 3R25A 5CJ5A 4FXSA 5K7JA 5CSRA 2GFTA 5C0QA 3MCOA 3LB0A 3THUA 1S2TA 1HF6A 4IL0A 1WYIA 3APTA 1GHRA 2HQAA 4HA1A 4NASA 2PEVA 1EL3A 4A3RA 3B0VC 1PSCA 4JY8A 1W3HA 2PGFA 3K8KA 3R0KA 3UGVA 1WXJA 1W6TA 1DHKA 1G4PA 5MHBA 4IQJA 3VO0A 5LIYX 4AD2A 3UWWA 4HKPA 2WZMA 3W1QA 3EMZA 4R7JA 2E0PA 1HN1A 1XCWA 1XHGA 1UOKA 3SDOA 1MDRA 1GYLA 1IR2A 2WM0A 4PTXA 2V63A 2HMCA 3TQPA 2X1UA 4JQAA 3AYSA 3QR3A 2O4QA 2V3EA 1GQKA 2NWSA 3VPLA 4JTEA 2ZX6A 3S5YA 4O12A 3WDPP 3GM8A 3R10A 2WCAA 1FXQA 2YSWA 1AUSL 1E6RA 3UPMA 1J6OA 1BKSA 1NDYA 1UC4A 1R87A 3O6DA 2FGZA 3LHZA 1KFBA 4OQVA 3STEA 1OFQA 4NYUA 1A4MA 2O9PA 1GW1A 3W75A 4PMNA 1AD1A 1HFBA 3S6OA 1XSJA 1ODZA 3RPMA 4XTIA 5BNKA 1XFCA 2BTMA 3P5ZA 4PBFA 4RZ5A 3G1AA 1AQMA 1R6WA 4IPLA 5D03A 2BHZA 4L56A 1TQXA 2E1WA 3FVDA 1DWGM 4HHHA 1PDZA 3RLGA 2GL5A 1YDNA 1FP9A 2OR2A 4HMCA 2YB1A 4B9ZA 1Q6OA 2DIKA 3CWOX 2D20A 2Y89A 1IEQA 2CNCA 3S46A 2O9OA 4J40A 4TU1A 3N9RA 4KFPA 2VX4A 5D4YA 1GYMA 4F3HA 3APGA 1J93A 4C6DA 4NZFA 2CLFA 2RDUA 3N4EA 1E6XM 1KV8A 1XSKA 2G97A 3M6YA 4LCRA 3K8MA 3LSCA 3VNMA 1IEVA 2E1DA 4UOQA 4YMZA 3F4VA 4AEEA 2VT0A 2ATMA 4A6GA 1LRQA 2J79A 4LAUA 4M19A 4JTTA 1VAHA 2KZHA 4RV8A 4Y9PA 4WGXA 4XWUA 4GKLA 4IOTA 4CQ8A 2EXOA 3TQ0A 3AHYA 5AHFA 3H8AA 3WF0A 3AIRA 1ZGDA 3EA2A 2DFAA 2CHNA 2R8WA 5C2XA 3DZ1A 2E6DA 4LSBA 4AEOA 1B5TA 3CQIA 3H2AA 3PR2A 3GC5A 4O8AA 6ALDA 3H4GA 2DQXA 3GC4A 4HQVA 1K77A 3THAA 1DXEA 2FZBA 2OOFA 2OO0A 2HTMA 3C4UA 3PSVA 1YX1A 3DFTA 4GX9A 1O7AA 1BGAA 2TPSA 1P0EA 3UERA 4QRNA 2OOGA 3UQNA 1JYNA 2DVUA 4BCEA 3S8HA 3QBUA 4GY0A 1U1JA 4GQ0A 4PZVA 1MZRA 1TV2A 1JF5A 3CUHA 4MJ2A 5E9XA 4RJEA 4LCQA 1OCJA 1F73A 3WD1A 4DBWA 3PNUA 4KIEA 3IVSA 4RW3A 3AYTA 4R85A 4IL2A 2OWXA 1TWDA 1XLIA 1UA7A 1R5YA 2PUZA 4DJFD 4C60A 1IT7A 3FK4A 2XIMA 4L64A 2E9LA 3KHDA 2VXNA 3GG8A 5E93A 1I75A 3O07A 2BVDA 1J0KA 3QHNA 3CWHA 1ESWA 2PRHA 1HO1A 1F7BA 1VP5A 3BG9A 2IXUA 1MVYA 4FZIA 1E1CB 3NQFA 3W81A 4IG2A 4O1FA 4POCA 3QGKC 4Y9OA 5BXPA 2B81A 2WBKA 1EOKA 2OKTA 1MRQA 4AZGA 5G1TA 2PGRA 5XIMA 4NL1A 2Y7GA 1XIFA 2PDJA 1T5AA 1AH3A 3O6CA 4QG6A 1U5VA 2E7FA 3UA3A 3UXIA 4HK5A 4RXGA 1KXTA 4E4FA 2ZYFA 3A4AA 2EPKX 3JZUA 3D6NA 1QJWA 4PTVA 1X6NA 4K8GA 3QSRA 2V2CA 1V3LA 4DF1A 2YXOA 2PB1A 1XLJA 3TCSA 1JDCA 3SCWA 1Q2SA 1N8IA 4XG1A 1AJ2A 3C56A 3P0WA 3AYVA 3G1SA 2XSAA 3VKAA 4IIHA 1ZSXA 3PHAA 1VBJA 1W1IE 4Q7IA 2J7EA 2DQWA 3ECQA 1VPQA 1T0OA 1DTNA 3M5VA 1TJPA 2E28A 3LNMA 3IUDA 3MI2A 2C1GA 4P61A 3IGSA 3RHGA 4HOWA 3QRHA 1XWYA 2AOSA 4M29A 3PAOA 1GVYA 1IT8A 3TN6A 4PMVA 4G7EB 3KVKA 1PBGA 3FXGA 1XS2A 4LBRA 2BMBA 3ANVA 1SFLA 4XZIA 4ZA0A 4PTNA 1JQXA 5C2CA 1MI3A 4AD0A 4C6BA 1NJJA 2I5IA 4M81A 4WDWA 4H00A 4O17A 1ITQA 2Z1KA 3EA1A 2I56A 4PMZA 3TSMA 3USBA 4HCDA 5GNZA 1KM6A 2V67A 3CEUA 3OGRA 3OOQA 3PBMA 3D3AA 4YCPA 1TB3A 5DN1A 3FN9A 4H7CA 1YHTA 1J0HA 3IS4A 3WKZA 3EBVA 4O57A 5E1QA 2CWNA 4MNKA 5K9XA 3VYLA 5AZ1A 4S3DA 1YE6A 3M0VA 1CBGA 1QASA 4XV0A 1ZUAX 5AHMA 3TWAA 2GJLA 2AMXA 4CVWA 1RVGA 2J66A 1IEIA 2IPJA 1DXFA 3EMCA 2YIHA 4IUGA 1TVPA 5IHSA 4E0CA 1O12A 3LERA 4WIWA 1CX9A 1G7UA 2MNRA 3A13A 3SUWA 1R3QA 4GI4A 4ZE4A 3OQ8A 2VRJA 3MZ2A 5B7YA 3B05A 5AY7A 4ZEPA 1P0KA 5CGQA 4HNVA 3PPGA 4NHVA 4DBUA 3M0KA 5K9CA 2YXGA 4B5XA 1TUXA 4Z1CA 2FKPA 4DI9A 4CNNA 3PZIA 4JBRA 2EPNA 1LLZA 3DAQA 5HXMA 1XLAA 4HPJA 2UY2A 4JTHA 3LHYA 3BLOA 5K3VA 2BSLA 1HG3A 2DW7A 2I9UA 4B2DA 2O9TA 3TYBA 1R9ZA 2EPLX 4UOZA 3KAOA 1A5KC 2HCVA 1PO9A 2V2DA 4Z2LA 3QOMA 1UR2A 3WDHA 2A3HA 3IJ7A 3R12A 3QQ0A 3FIGA 1KBBA 1PKYA 1CGXA 1UBPC 5ABTA 3ABQA 3UY7A 2BS9A 1ONEA 1A5NC 1V7AA 1BPLB 1US2A 4GKTA 4ENLA 3BSGA 4GQRA 2IQ0A 1KWKA 1OHLA 1OFBA 4GZ7A 4Q6JA 2VD9A 4CCCA 2WJZA 1KRBC 3VX0A 4EVZA 4HU0A 5I79A 4A8LA 5I5RA 3BH4A 1UZ4A 4R27A 5JIWA 4PCFA 4YVPA 1TA3A 4S3KA 2VDGA 3MPGA 1I0DA 3WF3A 4AIOA 4JTQA 1E9IA 3NGFA 4ORIA 1EIXA 1PJ9A 4GUJA 5KSWA 1CGUA 2D22A 1UQYA 4XKYA 4JS3A 2BHUA 2VFEA 4WQ6A 2OSYA 8XIAA 1N55A 2QKFA 1JPMA 3SY5A 3EEGA 3I6EA 4US5D 4ZOEA 2PU0A 1MNZA 1HT6A 4L9XA 1R3WA 3TC3A 1VR6A 2V5LA 1GW9A 1XD1A 4Z1YA 2BG5A 3B8WA 1E3XA 1QI5A 1NDWA 2CHRA 3IIPA 4UTIA 4QS5A 3P80A 3KL3A 3O16A 4JEJA 1GUVA 2IKJA 4UMAA 1WKEA 3S1UA 3AO0A 3AMLA 1GPFA 2VMFA 3QY8A 1Q8AA 1ICSA 1VFTA 4Q7NA 4DPPA 1OIMA 4ZQOA 3HB9A 5FSDC 4C6OA 2JKAA 2PDNA 1KTBA 2ZXDA 4ZO7A 1H7OA 3SRHA 3TJIA 4ZZ9A 1WDSA 3RUBL 5IBXA 4Y9AA 3B8VA 2DEPA 5A8QA 3W7OA 2YA0A 4JTUA 2C0HA 2PDQA 1KCZA 5U4NA 3GXDA 2P3EA 4GMEA 1F61A 3RGTA 5EMUA 3ZT7A 2CCRA 1NF0A 2ZZ2A 3F4DA 1GJWA 4W87A 3EDKA 3SJNA 3EOSA 1RD6A 1GZJA 2BVTA 3W23A 4DYEA 1OJXA 2VR5A 4KEUA 3G1HA 2J6XA 4QE1A 3W9ZA 3UJRA 4RUBA 4YXGA 3W1XA 3TN4A 3LG3A 4O4VA 1Y0EA 1SW3A 3P81A 4WSJA 2Y8VA 3FOKA 3W2UA 3NR0A 3LCWA 3JRKA 3KBWA 5C2GA 2ZUUA 1E6ZA 5HR7A 4S3GA 3B9EA 4JDBA 2A0NA 5F2GA 4AVFA 4R88A 5A95A 1QNSA 3BCDA 4NI3A 3FVMA 1FDYA 3SI9A 2XISA 3WQ8A 7PTDA 5K2ZA 3UWEA 3IAPA 4HHLA 5I3IA 1KFKA 2ZADA 4IPNB 1ITXA 2W62A 1C3FA 5D9NA 3TAOA 4LRTA 3S2CA 2DSUA 1EP1A 3LN3A 2ZZ7A 1Q6FA 3JW7A 3PBYA 1FDJA 2R6OA 2VEFA 1MUCA 1BVWA 3PZOA 1WZLA 3MUY1 3U9IA 3HG4A 4WSKA 3QW4B 1BAGA 2QMJA 4I8DA 4MWAE 1B2YA 2OLHA 4AHPA 2WXDM 3P0XA 2Z1SA 4DWSD 1X8FA 3NUKA 1G4EA 1FRBA 2V69A 1QW9A 3WMBA 4AVOA 3LPFA 3NFUA 2GPTA 4GJJA 4IZGA 4XBJA 1O5RA 3I7QA 1XICA 3GDTA 4D9PA 3KBVA 3GXNA 3P14A 1FWEC 1KFWA 3MMTA 2DIEA 3WLQA 3MANA 3NYZA 5EL1A 1OCQA 2OEJA 5CSYA 4QFUA 1B90A 1ZRQA 1DBTA 4JHZA 1UJQA 3ABXA 3VOGA 3G2GA 4W5ZA 4W7WA 3I7RA 5FJOA 3THCA 4NZ1A 2WC7A 3G3DA 2H8XA 3ENLA 5C70A 1PCWA 2WSKA 3MC5A 3G1DA 3PANA 3AU2A 1PTAA 3L4ZA 2QNEA 3GHUA 4HMNA 3STCA 1QPRA 2RGMA 1FBAA 1DVJA 3K5XA 4PBEA 3DGBA 4GQQA 3BL3A 1WPCA 5DT7A 3R89A 4Q4SA 3RMJA 5TF0A 1HNYA 4W93A 1GQNA 5D9OA 3ICJA 1CGWA 3CV7A 5SWUA 2Y88A 3ZVHB 2G4FA 2JEQA 3TTOA 3VUSA 2ACQA 2ZIDA 6TIMA 1NOFA 3TVAA 1OC7A 1IF2A 3W07A 1GEQA 5EA9A 1BD0A 1F5ZA 2FHCA 4W89A 4JIPA 3IV3A 3CQHA 4O18A 3DFPA 1XH1A 2OQLA 4ZB2A 3FSTA 2A3EA 3LCHA 1O94A 2AGTA 7TIMA 4LCSA 1XBZA 3INPA 3LS9A 3P84A 4ZO9A 2HXUA 1PX8A 5FJTA 1M01A 2VM8A 4V28A 1MFUA 3LCGA 3GNDA 2VP8A 2X09A 3AIUA 1P7TA 4K37A 4PTWA 1L6SA 5BXTA 1GQJA 2GJXB 1HIZA 1XLMA 5AHEA 3WNKA 5I78A 2VKZG 5HNUA 4LC8A 5I07A 3TQKA 2Y24A 3AISA 4PMRA 4LJ3A 3UCDA 1XUZA 2PCEA 2GJNA 2DZAA 4PULA 3AHXA 3RU6A 1UWQA 2YPIA 4QDWA 3CIVA 3VIIA 3PPCA 1ADSA 3UJ2A 5BOEA 5C8BB 3PZ9A 1FWAC 4B15A 1RK6A 2V2HA 1OFOA 1UW9A 3L0GA 1M68A 1Q6GA 4EACA 1XLGA 2HNEA 5M3WA 3FCPA 3GTIA 5D2XA 3WNLA 2BXYA 3D3FA 1YBQA 2DT3A 2BHYA 3M5XA 3GKFA 3DU0A 1WKYA 4DPQA 1JGMA 3W73A 4KWUA 3TYEA 3UYIA 3QTPA 1G01A 2XN1A 1XRSA 2UY4A 5CQ1A 3F2BA 3LGDA 4DZAA 5A6BA 4LVDA 3L4WA 1VIWA 1Y7VA 1VEOA 4GX8A 2YKKA 1PX3A 2C1HA 4KERA 3BMVA 3SADA 4M7SA 4M6PA 2ZZ6A 2ZRZA 2NQZA 3COTA 3KL5A 1ITUA 2Y70A 2NV2A 5CSUA 4IFOA 4X63A 4LT9A 1J2WA 2IQTA 4NP7A 2ZICA 1DYSA 3C2YA 3GHTA 3V36A 1VBRA 4FX6M 5IBXC 1R7AA 4NX0A 4BI6A 1W9VA 3P67A 4AZBA 4O1EA 1AJZA 2AQVA 1HO4A 3LZ5A 1PTDA 2JQXA 5CPOA 2PODA 3E2RA 2GVEA 6REQA 3A4WA 4MM1A 2HVOA 3L0KA 3IWPA 2FB2A 4H6RA 4C6CA 1DJZA 5A2AA 1KM3A 4CCEA 2YCLA 1JRBA 2WHKA 4RNJA 3EX2A 3SUVA 1G7VA 4XAZA 1UB3A 4FPSA 1OWQA 1Q6CA 1E0VA 3MDUA 3GH4A 4FLOA 1VFHA 3BV4A 3A64A 2UV8G 4J3VA 4JAWA 4US5A 3WIJA 3UVAA 3HF3A 4N9CA 5D2TA 1OX5A 1UC5A 1XI3A 2ABBA 2VFIA 4XX6A 4W85A 1ICPA 2XZ9A 5AKQA 3VD7A 4QS6A 3TN5A 4NAEA 4KCWA 4EPEC 3NQ2A 3GSMA 1Z6KA 3B9DA 4GC3A 1B9BA 4LX4A 5M5DA 1EJUC 3UNDA 1VFLA 1MNSA 2HK0A 1BVZA 3QVQA 1X96A 3WK1A 3WQDA 4PCTA 3C8NA 6XIMA 2EO7A 1PZ3A 3QV7A 4XK2A 3ZYZA 3O2LA 1V0NA 1A3WA 1TR9A 1EDGA 2D73A 1MEIA 2GUUA 1S3TC 1JI2A 2WCGA 3GDLA 4AWUA 4I5RA 4CQ9A 1RLCL 2XM2A 2ZWZA 4NVTA 3FFSA 5K9DA 2PDBA 4UFIA 5DXYA 2NT1A 5A8MA 4HK6A 3SQMA 1E0UA 4Q4QA 1UD5A 1XYLA 3L9CA 3P8JA 4HB7A 3R13A 1X7FA 1BG9A 4EPBC 5CEWA 1D2KA 1FHVA 3IJ8A 4J27A 3WNNA 4FNSA 2AAAA 3SN4A 2FHFA 4IICA 3GNNA 2PDYA 1W91A 1DJGA 2NVDA 1VCGA 1G4SA 1IE7C 4FX7A 4H9MA 4ZE5A 3FYPA 2XM1A 4PUUA 2NQ5A 3UP8A 1DJHA 3GDKA 2ZC1A 3DC8A 2CBIA 3BOXA 2QJNA 3POCA 3HFYA 5H8UA 1SJAA 1IWAA 1V6XA 4TIMA 4AMCA 2BP1A 3Q67A 5DY2A 3CL8A 3WK2A 5KZEA 4DO7A 3VD9A 1Q6QA 2WMGA 3PZNA 3QF0A 3T44A 1NWRA 1HKIA 4RPQA 3KCJA 3GFXA 4IFRA 1WDPA 3AS0A 2VZTA 2ZE0A 4OOZA 1VPYA 1DORA 2X7VA 4XVEA 1XRTA 4NUWA 4KBXA 4FAMA 1W3IA 2VQTA 3SB0A 2VVNA 3L67A 2W79A 3WELA 5CLWA 4R3UA 3SW6A 2V81A 5REQA 4EAYA 3GXFA 4G9PA 3PK7A 4GYPC 3L4XA 1DE6A 3M4HA 2OYLA 4UQAA 3GNPA 3PUOA 3VDBA 4Q8VA 3NDYA 3R43A 4CKQA 1A50A 1D9EA 1DQUA 1LQAA 4JGDA 3AXHA 2OZ0A 1AQHA 1GONA 4WRHA 4B9YA 3FX4A 2GGJA 3VNJA 3UD6A 3F4WA 3CZKA 1VYSX 1TV8A 1CT5A 1OB0A 2WC4A 4ASTA 1X1OA 3OLDA 4KIRA 1HW6A 1KGWA 1V51A 3SSJA 2REQA 2GWNA 4AD4A 4DZIA 2WPGA 1JZ5A 3CLWA 7TAAA 2VOTA 3VKKA 3HV8A 3CZJA 1EUAA 1VJSA 3PJWA 3MCMA 2PSNA 3B8IA 5AVHA 4DO4A 1EC9A 3GTNA 1JRCA 4PUNA 1Q85A 1MEHA 1HGYA 1Q5MA 5FF2A 2ZXQA 4AZ7A 3F1QA 5CPLA 5F1UA 3UPWA 3KW3A 1NP2A 2FZ9A 3UR7A 5GPRA 3G5EA 4WK9A 5K4ZA 3FKKA 1SZFA 1TV4A 4JIIX 2HV5A 3ITGA 4RL3A 1IZJA 5HMEA 3SCQA 4U2YA 4Z0SA 2CITA 3GVWA 3AUJA 3AZSA 5A2CA 2VFDA 5AYZA 4HA4A 3BJFA 1XBVA 3BICA 1RCOB 4ZBCA 2W0UA 3TNBA 1A5SA 3WLHA 4FP1A 4A8RA 4GNKB 3W25A 2WVVB 6ENLA 4MY1A 1KA9F 1P6CA 3E6EA 4CCZA 1T7LA 2DU2A 4XSMA 3GYEA 1BSLA 1SMAA 3LXBA 1QI4A 1SQ7A 3U6WA 2OELA 3C86A 1A47A 1E6SM 2DSWA 3WQCA 1DXIA 3C2OA 2ADAA 3IGHX 3MDWA 3DBNA 3DDMA 1TTIA 5ABGA 5C9UA 5H8PA 1UR3M 3MU7A 3BDKA 3R11A 2PP0A 1FWIC 3SN0A 4UTFA 2HVNA 3NL2A 4FR6A 4IMFA 5EMKA 2JIWA 3NGJA 4GFIA 4MNLA 4XAFA 2WVVA 3M0HA 4EWND 2WZHA 4MKVA 2W67A 2BZNA 3W6MA 2VDIA 4D6GA 3N19B 1FP8A 2SFPA 3BANA 1CIUA 2VEMA 3SY1A 4XIAA 5CCZA 3ARZA 3WD3A 3URAA 1BWLA 3P74A 3CZGA 4H1ZA 5D2VA 3DYPA 1OZQA 4GXWA 1V02A 1PZ2A 3MS8A 2HK1A 1NVMA 1NOWA 4GWEA 2ZRVA 1Z3NA 1Z44A 3TU9A 3EKGA 3CO4A 3HPFA 3BLEA 4BF9A 2PWVA 4MB3A 2XH4A 1LG1A 3G18A 3N9KA 3W7NA 1M7PA 3QHMA 5FIPA 1OK6A 4Y7EA 4MJMA 3APYA 3PUGA 3N3MA 3SFKA 4YN5A 2I57A 2YR1A 4HSNA 2CLMA 3K13A 3U8GA 4ICMA 2V9DA 4A2SA 4NNAA 2ZUTA 1JEZA 1UKOA 3H4XA 1KR0A 1OCBA 4MYXA 1C8QA 1YRRA 4DO5A 1EJTC 3E74A 2UY3A 3G1VA 3WBEA 2GUBA 3T08A 2VI0A 4GBUA 2W92A 4F40A 1RQEA 3G1FA 2Z6JA 5IOBA 4JXCA 4HMDA 2VX5A 2BY0A 3B8UA 5ECVA 3VCNA 4KRUA 3P82A 4H2HA 2C18A 4M6QA 3Q37A 3S42A 5D8WA 2IPGA 1YTKA 3GFZA 4GZJA 1ZFJA 2YW4A 2VL4A 4OFCA 4UBPC 1A5AA 4QG9A 3TYAA 1RJQA 2OTDA 2IXVA 4UQ9A 3U48A 1M3UA 1W1YA 3DI1A 2OQHA 3UJEA 3C61A 1KM5A 1OYBA 4JOMA 4CN4A 1QDSA 2J88A 2PDLA 2VC7A 1BG4A 1DIKA 5E0FA 4GUHA 3LHVA 3A3XA 3AQUA 3HU7A 1KR1A 5KTLA 1XDJA 4F0LA 3H54A 5GNYA 4CNTA 3EX4A 3B0YA 4AC7C 3GVRA 1IEWA 1V8EA 3QJAA 4YWIA 1MW1A 1A0EA 3LI0A 4UTUA 3NZ1A 4JQ1A 3CZLA 1N82A 1UKQA 5EFDA 3CWNA 5D8ZA 3R7MA 1FWJC 5FEWA 1JQVA 1YPXA 3CZ8A 4MB1A 3LUTA 1SVDA 1J9YA 3GR4A 2BNJA 4HPHA 3E0VA 3LTSA 3CV6A 4AIUA 2FZDA 1A53A 3DHFA 1JXKA 3URQA 3MB9A 2GYIA 3L2LA 4PN2A 2OX1A 2W4XA 3TTQA 5LNUA 3UU0A 5IHRA 1C9WA 5FAGA 4FR1A 3R4IA 2PTXA 3T8QA 2P5NA 5DEZA 4TVUA 1JPHA 3AXIA 3W83A 5E70A 4IMAA 3K1DA 1FY6A 3S9ZA 4Q32A 4UCFA 4P7OA 1E1CA 5C55A 3LSBA 3U3HA 2DSZA 2R1PA 2VURA 2Z24A 3VOIA 3U5YA 4BF7A 3P8IA 2EJAA 1PZ1A 1SR9A 1W5OA 1IYXA 5JBEA 1NOUA 2FFCA 2TYSA 2XIIA 4IPPA 4LRSA 1H50A 3OHMB 4M82A 1LT8A 4OV9A 5KITA 2ZX7A 1TA3B 4YPJA 3T2QA 5JMUA 2XWDA 2C0AA 5H8MA 3OVRA 3LLFA 5FL1A 1W9UA 5CJMA 4AZCB 5AC7A 1C91A 3TOPA 2V5BA 3GW0A 5ECUA 1YADA 1K4HA 2FIQA 1GYNA 2KX9A 3NZQA 1UZHA 3LV6A 3T09A 3M64A 1TPDA 2EG8A 1UD2A 1UKPA 3RG6A 2DZBA 1W1TA 1BQCA 3KZPA 1X7IA 3CV2A 3B03A 4WJEA 2NSXA 2OEMA 3RPDA 4D2JA 5D37A 1FHLA 4QCFA 5LIUX 1QPNA 4OU1A 3VI2A 4HBKA 1G9HA 2D23A 2AQOA 2A7PA 4OJYA 4PODA 4JNMA 2OVLA 3WBXA 3C52A 4BA0A 3FJNA 1DV7A 2BBFA 1WOAA 2C19A 2XVNA 4GD0A 1JG9A 1CI1A 3F03K 2E5CA 2J9YA 2ZCGA 3W7KA 5I6SA 4WY0B 2RJGA 5G4HC 2F9RA 2IPWA 5HUOA