1B57A

Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
358
structure length
346
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEELYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Escherichia coli class II fructose-1, 6-bisphosphate aldolase in complex with phosphoglycolohydroxamate reveals details of mechanism and specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
total genus 138
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b57A00
2GUUA 5BMXA 1FWTA 4O10A 5MHBA 4P2VA 4FF7A 5AHIA 6ALDA 4BI5A 5TQLA 4YMZA 1AL8A 1LDCA 2A0NA 3KRZA 3FA5A 3C6CA 3W2MA 5CZTA 3BG9A 4UTWA 1AL7A 4Q32A 4ZQMA 1KFLA 3M44A 3W1LA 4LVGA 2NV1A 3P74A 3A22A 4PL1A 4QQ3A 3TV8A 4MIMA 3OA3A 5CSSA 3EX6A 4R53A 3MI2A 1VH7A 4IMGA 1T99A 2CLFA 5GVJA 2EF9A 2Z1BA 3TDFA 1JUEA 4LS1A 4LS2A 3HMJG 5F1UA 4RX0A 3TROA 1WV2A 1H7OA 1H62A 3LI0A 4JIQA 1MEWA 1L6SA 3M5XA 4JR5A 3NR0A 3C3NA 3HG5A 5FF7A 4NJJA 4CCCA 3GR7A 4ZQRA 4OGZA 1IGSA 1QAPA 4UC5A 3I7QA 1N8FA 4LNYA 1QO5A 3T55A 4NQ1A 4AHQA 1B3OA 4JIPA 3TJLA 3W75A 4QNEA 3MWAA 2B4GA 3G1AA 3NVTA 1TV7A 5EPDA 4IMFA 1D3GA 5K9XA 1M6JA 3A23A 3WJSA 2FTPA 5D38A 1H5YA 3HF3A 3N9RA 3VFLA 3G8EA 4UIOA 4GBUA 4FIQA 3O05A 1FQ0A 1G4SA 4GJ1A 3M43A 1VYPX 3PY2A 1A5SA 3QF0A 1ICSA 3H53A 4O57A 2O7QA 1PV8A 4WY0B 1IXPA 4UMCA 5BMWA 5LNWA 3LTSA 2I1OA 3OVRA 1JJKA 1W5PA 4O8RA 1MXSA 4H3DA 2YDAA 4NUWA 3DAQA 4MFEA 1UUOA 3S9YA 3W7PA 4AWSA 5D30A 3HPSA 2GOUA 3DZ1A 3LCIA 3A5FA 4UTTC 3TUUA 1GG1A 1DL3A 1RPXA 4RZ5A 5TBOA 2X1SA 3BLEA 3P67A 2DZPA 2ZZ6A 2ZZ3A 4K38A 3WFAA 1TTQA 2B7PA 3E02A 4Y9AA 4TMCA 2CZ5A 1TMHA 4LV9A 1H1YA 3TXVA 4MVAA 4LS0A 1DV7A 3GLCA 5AOUA 4C1KA 4KFPA 5AHMA 1RD5A 2CLLA 4Z1AA 4PTNA 1PHWA 4Y8FA 3BK0A 1YDVA 2ATMA 5FF4A 3IGUA 3EXRA 1W1ZA 1TJPA 2YGYA 4M6QA 2NUWA 4JTTA 1TV5A 4CQAA 5AYYA 1H7XA 2NXGA 2CLEA 3B04A 1O4UA 1G69A 2BX7A 1JQVA 4BI6A 3TK7A 3CPRA 3W1RA 2O7SA 3T4CA 5BOOA 4O17A 3GXTA 1OFOA 4IXXA 4OT7A 3B06A 4RZ6A 4IWWA 5DY2A 1R30A 2FLIA 4X22A 1UJPA 2VOMA 3M47A 4QJ1A 4FX7A 3UXDA 1L9WA 2WSYA 1KM2A 4KWWA 2GVGA 1GYLA 4M5PA 1FWRA 1TPEA 4JTHA 3LCFA 4JTJA 3I68A 3OIXA 1YXDA 1F6KA 4JTIA 2QKFA 3HQ1A 4HNVA 1DBTA 5C6MA 4H4IA 3LM7A 5F4XA 5G4EA 1TJRA 1WYIA 2F7FA 5FEZA 5KZEA 1B4KA 3CB8A 3G1SA 3I6RA 4RLIA 4Y96A 3AO0A 4Z1CA 3F4NA 1HG3A 5F2IA 3W72A 2FFCA 1I2NA 5CGQA 2Q8LA 2NLIA 2J27A 4N9EA 3T78A 2E5DA 3W7QA 3HG4A 1VYSX 1F74A 5C2XA 1N7KA 1KBJA 1RR2A 4N4QA 3TFXA 2XN2A 5K9DA 2NZLA 5EY5A 1O60A 5G2IA 1P0NA 3W2JA 3TCEA 2EHHA 4PA8A 1W8SA 5AHFA 2Z6JA 4AHOA 1LOLA 2DZSA 1VGAA 2OT1A 3BLIA 1FUYA 4O1CA 3EWBX 2ZTJA 1SO5A 2NXHA 3DH7A 1H7PA 4DF2A 1KLZA 3PS7A 5G2WA 1OK4A 4IMCA 3ANYA 3W7HA 2X1RA 1C9DA 4ORMA 4O11A 4PH6A 2AQWA 1SPQA 5AC8A 3S1WA 2R8WA 1KW1A 2YYTA 2A7RA 3MBDA 4ADTA 3A5VA 2NX1A 2G95A 3M41A 5DBTA 1ICQA 2V0TA 1P5BA 3E49A 1G7VA 5AB3A 4DELA 2W6RA 1OX4B 1EUNA 2GPTA 1X8FA 1KTCA 2PRHA 1S5TA 1UBSA 1WBHA 4LC6A 2X1TA 2Y70A 3UWUA 2HSAA 1O94A 4IGHA 4U28A 4QNWA 5CPNA 3CIXA 4O54A 5D02A 3L9CA 2X16A 5FEPA 2TYSA 1GVOA 2FB2A 4CNPA 4NX5A 3PM6A 1G6CA 1WOAA 4UXDA 3P60A 1W5NA 4O4VA 2ZZ1A 1OX6A 1R2RA 3P8IA 2NWSA 2C18A 3IIZA 4Q4KA 1NF7A 1WBJA 3HO8A 4N4PA 3W1UA 4JYEA 2PRMA 2F84A 4N6EA 2A4AA 1JCLA 4UTHA 5AFDA 3D0CA 3IGSA 2UV8G 4NT0A 1LBMA 4TMBA 4YL2A 4K6AA 3QM3A 1TPB1 2CFFA 2QAFA 4GUIA 1X1ZA 2PE4A 4UFJA 3S1XA 4CQ9A 4IX0A 2V2CA 1GEQA 3DFSA 4M7TA 1AW5A 5G4WA 4UFMA 5E1QA 3GAYA 1RZMA 3FIGA 1PL9A 3KOFA 1Q6LA 4S1FA 3GDLA 2J6XA 5EMUA 1QFEA 3L66A 2JBMA 5DY3A 5U4NA 3N34A 1Z42A 4QM1A 3NPWA 2TSYA 1TPWA 2FDSA 4MYAA 1H63A 4LUJA 4O18A 1L6YA 1YTDA 1XL9A 2YCEA 4GNJA 4EF8A 1P4CA 2X2GA 3EX2A 2H3DA 3PUOA 1YTKA 4XWUA 3QZEA 4E0CA 3O6YX 4JY9A 2BZNA 3C8FA 3UWWA 4FNSA 1SO4A 3QMSA 2OMAA 2QCMA 4OV9A 5FI8A 5C5YA 4YCOA 1OHLA 5DCDA 2A2IA 4JTGA 5LHEA 1ME8A 4Z0SA 5C55A 1M5WA 5K3VA 3SIZA 4N6FA 5HJLA 5HMSA 1XBVA 1H51A 1ONRA 3P61A 3TAOA 3TC7A 4UFHA 3NQMA 3OVPA 3HGSA 4KKXA 5I3FA 1I4NA 3IGXA 4GRSA 1JCMP 3S1UA 2QEZA 3IIOA 2C14A 3O15A 2YPIA 3LTYA 3FYOA 4DPQA 3MP5A 5CPOA 3UPBA 4DF1A 2Z2UA 3TC6A 3UWYA 3DHDA 1TTJA 2Z6IA 4UTJA 2E5BA 4FXRA 1RQHA 3HG2A 2NWRA 3W83A 1OF6A 5D33A 1TQXA 3QFEA 2CZDA 3LXAA 2W79A 3GXPA 1GTHA 1OFPA 3GB6A 2JGQA 4HSNA 1XBZA 2CZFA 1AMKA 3PB2A 2RFGA 3V1PA 4HNTA 1FXPA 3PR2A 5D2YA 3W1TA 1ZENA 4HT3A 3ATYA 3G0XA 3EEGA 2QJGA 3O16A 3P82A 1L6WA 2XN0A 1FBAA 4FNPA 4O13A 5F2GA 3R8RA 3W07A 4ADSA 3EB2A 1LZOA 5KMYA 1TPVA 4O16A 3QC3A 1JVNA 4WD0A 5BRBA 3UYCA 2DORA 4YXGA 3NL2A 3K30A 1G67A 5K4ZA 1Q6OA 4AMAA 5FEXA 2NUXA 1KM4A 4LW7A 5AHLA 3F1QA 3JR2A 1BKSA 1QNVA 1W3NA 3FLUA 3OHIA 3W1MA 3O6CA 2Y61A 1ZJIA 4MUZA 1R2SA 1F73A 2PCQA 3NA8A 3E9AA 3EWWA 3LHUA 3ELFA 4I7VA 4ONVA 2I9EA 1KV8A 4UFIA 5SWUA 4RXGA 1MO0A 2BWGA 1R47A 3A24A 1QR7A 3MO7A 1KM1A 2B7OA 2WV8A 3W1QA 3PWAA 3ABRA 4CQ8A 3GVGA 1TPDA 3NQGA 2QJIA 4MFDA 1K7XA 4JTFA 2ZZ2A 2NX9A 3RK8A 1KFEA 2H6RA 3L21A 1DKWA 4UFKA 4L4LA 5L6UA 5TIMA 1K7EA 4NX0A 1LP6A 3T44A 4LVAA 2FIQA 5LSMA 4MJZA 2GQ8A 5AYZA 2GQAA 3I7SA 4O0KA 2TPSA 4HIBA 3NL3A 2RKXA 3MYOA 1HUVA 3E0IA 2CLOA 7TIMA 3P8JA 1F76A 3RMJA 2BTMA 4PL2A 3TQ0A 1X6UA 1SUXA 1SW3A 1G4PA 2A5HA 4JYFA 5G1TA 3W7OA 4CCEA 3TIMA 3BW3A 3GK0A 2V82A 4IOTA 2J9XA 3ZWTA 4LY8A 5AC7A 2VKZG 4JX6A 3MUXA 4HPJA 3G24A 4FIRA 2V8ZA 4HN4A 4R7JA 2QDHA 2P10A 4MZYA 2ZRZA 3CLMA 3P80A 2BXVA 3STFA 3DI1A 1YADA 1W3IA 4ZQNA 2V5BA 1KV5A 1ZHAA 1SW7A 2I14A 2J88A 3NO5A 3NQFA 4GE8A 1TCDA 3LERA 3W6YA 1CX9A 2X1UA 2QCGA 3WK2A 3G0UA 5K7JA 1EP2A 3LCXA 4D2JA 5DCBA 3EX4A 3FJLA 5K4XA 3CTLA 2C6QA 3TKFA 5LNRA 4PEKA 1IIHA 3OBKA 3TH6A 3IIVA 1VCGA 1RQBA 3LI1A 1OABA 5DXYA 3LV5A 4N9BA 1TTIA 3DFOA 1Q3NA 4K8EA 2QCDA 4LV4A 1OYCA 1FCUA 3ABOA 4ALDA 1W3TA 4BWLC 4NNAA 2WNZA 1J5TA 1SR9A 1SSGA 2V81A 4LWWA 4CNNA 3FKRA 3MHFA 4GFSA 1K7FA 3EKLA 3W7GA 1Q45A 2E6YA 1EEPA 3MHUA 3G3DA 5BW6A 1G7UA 2VEPA 3CT7A 4LVBA 4DO6A 3N73A 3ZR4A 4AAJA 3NL6A 3G8RA 1R2TA 3QSTA 3L67A 3W7MA 4NZJA 3U2OA 3HJZA 4UTMA 3STCA 2WSRA 4AEOA 6TIMA 3TQKA 2NXIA 5D2XA 3UZ5A 2VEMA 4JDBA 4ZVJA 2YW3A 1NSJA 1ZALA 1GYNA 2ZZ4A 2Q3RA 3S5YA 1VLWA 4AB4A 3UXAA 1JCYA 1QO2A 3LHWA 4IPJA 3UWQA 3W1NA 1H50A 3W2KA 3C4UA 3LRKA 3E96A 3CEUA 2VFEA 2B7NA 1UCWA 1DORA 3F03K 3AJXA 3N2XA 2ABAA 5HINA 5EBUA 1PVNA 2CU0A 3F4WA 3C0JA 3PBYA 2VEKA 3QPYA 4XBKA 2JKAA 2YW4A 4OU1A 1ZY9A 5G1YA 3NAVA 1F6PA 3TMLA 3S1VA 5CPMA 5ABTA 3NYZA 4QITA 3GAKA 1OVDA 1G4TA 1W56A 1OFEA 3EWUA 3DBPA 4LOCA 3LV6A 5I3KA 3G1DA 4JTEA 2ZZ5A 4EIVA 5LGZA 1CI1A 4WOQA 1HO1A 3ATZA 4MZ1A 5D03A 1EWEA 2G96A 5H2ZA 3FKKA 3W87A 3UD6A 3W7KA 4ZZ9A 2G97A 1H61A 1LBFA 3VI2A 3PB0A 4JEQA 3KRUA 3LXBA 4O19A 1GT8A 2VEIA 4ZQPA 4R33A 1IXQA 4BK9A 1BEUA 2BLEA 2B0MA 4FNRA 5LNVA 1GQNA 1F5ZA 2DZUA 1DVJA 4KWVA 1B9BA 2FJKA 3B4UA 3E12A 3USBA 1OFRA 1P0KA 3DGRA 3VNDA 2J24A 3DXIA 1KTBA 4JX4A 4IPIA 1LORA 2LLEA 4HHPA 5K9CA 2RDTA 5DN1A 4ZL1A 2WSQA 4LU0A 3LB0A 1MSSA 5CG7A 3DFTA 1T96A 4DPPA 3Q58A 4DO4A 4QAIA 4X3ZA 4JTKA 2OT0A 3CWNA 4AH7A 1OX5A 1WAUA 3CHVA 2TRSA 2WNQA 1FDZA 4O12A 4X2RA 4E38A 1FCQA 3BV4A 3V75A 1R46A 3ZFHA 5HWJA 3EKZA 1MEIA 4NXSA 2KZHA 1K8XA 4K7YA 1T8XA 2CW6A 3GYEA 3G1YA 1YYAA 4KFNA 2A6LA 5EA9A 2R14A 2A7NA 3SECA 3TXZA 3VKJA 3WK1A 2PRLA 3DI0A 4S2BA 2PC4A 3N9SA 1XBXA 1AG1O 2FB3A 3DKJA 1KBIA 1SW0A 3BG5A 1GWJA 3M0ZA 4GUHA 3A9IA 2WKJA 4WY0A 1A53A 4YWIA 1JRBA 1ME7A 3THAA 1ZAIA 1FCBA 2Z0IA 3LBCA 4UTUA 5L9FA 3L0NA 2YFNA 3QSRA 2DZVA 4O15A 2Q8ZA 5F4SA 2ZQ0A 1MZHA 2C0AA 1MEHA 4M6PA 3RLVA 2A85A 2GJLA 4A22A 1SSDA 4LC8A 1OJXA 4NU7A 3N19B 5AN7A 4JGDA 3KVLA 1LLZA 3C61A 3MHGA 1LRNA 1QOPA 2EGZA 1D3HA 2Y85A 3S8HA 3W2LA 2DZTA 2PURA 2QCDB 2IQTA 1PCKA 4RR4A 3S42A 4UTWC 3M6YA 1VRDA 1IF2A 2ZRVA 1EB3A 1HTIA 3HPXA 5A8GA 1TO3A 3PC0A 4Y6GA 4EOUA 5CZ0A 5DELA 2AAMA 1FDJA 4EVZA 3LLDA 3B03A 3HB9A 4DEFA 3GR8A 3L68A 5DLCA 2FPTA 3DU0A 4WXZA 4IX2A 2Y88A 3RFAA 3O1NA 1WX0A 3QMRA 2E6AA 2OZ0A 5E0KA 3SZ8A 4ZQCA 4MKNA 4YCPA 3DKLA 2C19A 4UTTA 2VFFA 1FWWA 3L5MA 4O0ZA 5AHEA 3IIPA 1ZAHA 1XBYA 2E77A 3G22A 3L0GA 5FF2A 3BGJA 2RH9A 3LOTA 2R94A 3WK0A 3C2FA 4Y90A 3ZS4A 1J2WA 4JX5A 1Z44A 2HS8A 4YLWA 2CZEA 5FF3A 3EXSA 1JUBA 3P81A 1G4EA 2VFGA 4LRSA 2RDUA 2WO5A 1U5JA 2C16A 2VENA 2D73A 5HWNA 2RDWA 2YFOA 3GXNA 3LRMA 3NQ8A 1DQXA 1QWGA 4O1BA 2QCFA 4BWLA 3IVSA 3S5OA 5HUPA 5HNRA 1JULA 2FPVA 1WQ5A 4P61A 3W23A 2YSWA 4UTKA 1OF8A 2GVJA 2GVLA 1GVQA 4A2RA 3KXQA 4QIUA 3P62A 3JS3A 1CW2A 4R34A 3MJYA 3O63A 3DHFA 1QDSA 1TPC1 1V7YA 1WXJA 5D04C 3GX9A 3NQ7A 1YTEA 1B4EA 1L2UA 3THQA 2V2DA 4ORIA 2P1FA 2H8ZA 4AF0A 1GVFA 3IV3A 1TPFA 1JUKA 1VPXA 5HQEA 4JY8A 2Y89A 2QAPA 3UY7A 1DOSA 1LLWA 3QYQA 4AVFA 2VC6A 1W54A 3HGJA 1BWLA 1FDYA 1QPNA 2P0OA 3GKAA 4DBDA 1SZGA 1KM3A 2GJNA 2QCHA 1F7BA 3NQEA 3W7JA 4WZHA 1XI3A 3BARA 1RQEA 2QR6A 2EKCA 5DBUA 1YPFA 4NJIA 1KA9F 4HKPA 1TQJA 3C2VA 1TSIA 2A1YA 4OE7A 4RCXA 2V2HA 1Z48A 3GDKA 1LOQA 5CKSA 3LHYA 3TFCA 3HG3A 1LYXA 1A5AA 4O53A 1DJQA 1SFJA 2CWNA 3GNDA 4A29A 3IVUA 3PBVA 3LGEA 3NM3A 4HNNA 4JS3A 3C52A 3Q2DA 4A2SA 3QH2A 3IEBA 5D2WA 3MP4A 4U4MA 3G18A 1C8VA 3R13A 1YXCA 1K3UA 1LRTA 3TA6A 4TIMA 4DQWA 4XTIA 1I45A 3P84A 2CLHA 1LBLA 2OCZA 3MYPA 3IIXA 1KLYA 3SI9A 1K03A 5D2TA 3QPZA 3NQAA 4RJEA 1NF0A 4IUOA 1Y0EA 3LCGA 4XBSA 3TW7A 2QCEA 4L4MA 3QW4B 2VFHA 2TMDA 1NEYA 4K37A 2YZRA 4TR9A 1K02A 4WOZA 3MI3A 3W1XA 4DO5A 4JICA 2Y6ZA 4QSHA 4UTLA 4OV4A 4UNKA 1DHPA 3I65A 1IXNA 5CZJA 2Y62A 1I2OA 2VFIA 4UMBA 3R89A 1RV8A 1A5CA 3N2MA 1E51A 5FESA 1F05A 3B8DA 4XZ9A 1UUMA 3WJZA 4E2DA 2ZFAA 1VHNA 4EWND 5LGXA 3VE9A 2BSLA 3M5YA 3GZ3A 3H55A 3TR2A 1AK5A 1FX6A 4KFOA 1HO4A 4E2BA 1X1OA 3RLUA 3CQ0A 2E5CA 1EPXA 3MP3A 3QMTA 2J9YA 1XFBA 4JDYA 4TX9A 1GOXA 4O14A 4RK8A 4RV8A 4FX8A 3W7IA 3LCLA 5F2MA 2QJHA 2ZA1A 2ZBTA 1WA3A 2JKEA 3N3MA 3B0UX 3TSMA 4JN6A 4LRTA 2C1HA 4UFLA 3EWZA 4ADUA 2Y7FA 4HSOA 2ISVA 4GXMA 1QPQA 3KRSA 1TYGA 1ICPA 1YLVA 2H90A 5G2HA 3LLFA 5CZSA 3LCHA 2ZRWA 1PHQA 3QQ0A 1XC4A 4IMDA 5FF0A 1GZGA 1S3HA 5I3GA 4UMAA 3LXCA 4GWEA 3W7RA 3TJXA 2ZRUA 3W2UA 5CPLA 5J5RA 3NQVA 3DENA 1S5VA 5D2VA 3CWOX 3LHVA 4I7WA 3W84A 1F2JA 5EYWA 3G1FA 4FO4A 2ZA2A 4RKAA 2ISSA 3HPZA 4IXHA 4LTSA 3W1PA 4JTLA 3GDRA 3VCRA 1A50A 1M7OA 3BO9A 2CLKA 2NV2A 4LVDA 2QCCA 2HMCA 2E09A 3P5ZA 5HR7A 3B05A 4OBTA 4MY8A 2A7PA 1WDWA 4MLJA 3WJXA 3RF9A 5T26A 1KM0A 2QCLA 2V30A 5LHFA 3SY5A 3W22A 4PC8A 4FNQA 3TE9A 3KVJA 1THFD 1NVMA 3UY8A 4MOZA 1KFKA 1TREA 3KVKA 2ISWA 3QW3A 3SSJA 3L5AA 1IXOA 3OG3A 2HS6A 3KVMA 1SZNA 4GUGA 1H1ZA 3UNDA 3NM1A 2E1DA 1OFAA 4K8HA 1VR6A 2NX3A 2Y7EA 3M5VA 4M7SA 4FNTA 1I8JA 3W7CA 3CIWA 3Q37A 3PAJA 4AWTA 4JD4A 3BG3A 1UASA 3LBMA 3SGZA 3DFNA 1UB3A 3NQ6A 1FWSA 3NNTA 5A5WA 3GDMA 2ZCGA 3LTPA 3M16A 1LTDA 4AWUA 2ZYFA 2WOQA 4UUIA 8TIMA 3U6WA 1VZWA 3QQ1A 3C56A 3T7VA 3W3OA 3LCWA 4N9DA 2XFWA 2YXGA 4Z08A 3LRLA 3G3MA 4UNLA 3BVJA 1SU5A 3CU2A 1KFBA 2HTMA 5LNSA 3NQDA 5KZDA 3R5EA 1VJIA 1SZFA 1KM5A 4O1DA 3IRDA 1TV8A 4MLRA 2DP3A 2ZRXA 3NOEA 3UWVA 4PFMA 2CLMA 4FHAA 1HFBA 3MW7A 1FXQA 3O8AA 2VXNA 4O50A 4LVFA 4WQ6A 3U8GA 1KFCA 4HNUA 1QMLA 2WNNA 5D09A 1GG0A 3NG3A 2OJPA 3DFQA 4S2CA 3NQCA 5F1VA 1ME9A 4H6KA 3W7EA 2Y63A 3PSVA 4GC4A 1VCFA 5KITA 4FNUA 1LCOA 1JQXA 3DFPA 1ALDA 1VYRA 3C2OA 3NPXA 3H54A 2X30A 3BLFA 1VS1A 1K8YA 4A3UA 3EXTA 1TIMA 4N2YA 3CC1A 2ABBA 3OEXA 2Q3OA 2DJXA 1O5KA 1EX5A 1VLIA 5IM51 3TQVA 1XUUA 1OYBA 1Q6QA 1HL2A 4NNBA 3KAOA 4B5NA 3TU9A 1TPUA 3NXFA 3SFKA 2DJLA 1EUAA 1DJNA 3O06A 4LT9A 1OG0A 4K7VA 5DCEA 4MY9A 5C54A 3A21A 1I2RA 4NJKA 4TO8A 1PS9A 3UWZA 3TMQA 3W2NA 1XKYA 2QUVA 1M7PA 1KFJA 2CLIA 3BW4A 3MBFA 4I7UA 3W73A 1W31A 3Q94A 2WJZA 3C2RA 4UTIA 4CCDA 4FXSA 3QEZA 3BGGA 3B0VC 3S0CA 4JTUA 4FEZA 1H7RA 3PULA 2ATSA 3RU6A 3W74A 1DQWA 2Y7DA 5U7SA 1WOBA 4POCA 5CSRA 1X7FA 1NAL1 2VFDA 3L0KA 3HOJA 3NZRA 1EA0A 2A21A 1J4EA 5D37A 1XCFA 2DZXA 3LDVA 4XKYB 2FQIA 3NPVA 4N9CA 2QF7A 1BTMA 3HGRA 1SO6A 3T40A 1SZEA 1P1XA 3W7LA 3EWYA 2DU2A 4OWGA 3M1ZA 3M7WA 3KHJA 4TU1A 4JNMA 5E93A 1EWDA 4UR8A 3MMTA 4MPQA 4BR1A 4RZ4A 1TRIA 4Z1BA 1JRCA 3R12A 3G1XA 1ZAJA 3PSWA 3LHZA 2QUUA 5BNKA 1Z41A 3FOKA 4EF9A 4IMEA 2ZDRA 2J9ZA 1ADOA 4XQ6A 3TAKA 3TNOA 3NDOA 4PCFA 2ALDA 3QJAA 4NJGA 3JRKA 3SJ3A 3L65A 4GUFA 3FYPA 3W1AA 4OHQA 4M19A 1IIGA 1XDLA 5G5IA 1YDNA 5K2ZA 5HULA 5D32A 4RXFA 1LROA 5HWMA 1C29A 3EX1A 1XXXA 2ZRYA 1JR1A 5AHNA 4J9JA 3OVQA 1ZNNA 3QRHA 4AHPA 1KM6A 2WQPA 4JYDA 3RNDA 2ZTKA 4NVTA 3UPWA 2C3ZA 4AF0B 4IQLA 3FJ6A 5HUOA 2QDGA 2WPBA 1OX4A 1FCVA 4ML9A 4NZFA 3PG9A 2W0UA 3ABSA 2ZZ7A 2DZWA 3NL5A 4PODA 1O5XA 2H8XA 3EX3A 3C2EA 1D9EA 2V5LA 3STGA 1JCNA 3W85A 1W37A 5EL1A 1H7WA 3LHTA 3WJYA 1EP3A 3W70A 3IVTA 4ICNA 1U83A 3G1VA 3SW6A 1LRQA 2ZA3A 3O07A 2AGKA 4NXKA 1TB3A 5H91A 3S6DA 2H3BA 4BI7A 5KZMA 3PUDA 4K39A 2YX0A 1TPH1 3CEPA 5LKYA 4FB7A 1XM3A 2FPYA 5KINA 1EIXA 5IBXA 1LOSA 1OFDA 3G0SA 4BF9A 3P5YA 3WJWA 5IBXC 2A6NA 4CLMA 1FWNA 1ZCOA 1VHCA 3FS2A 2XN1A 1OFBA 4MYXA 3NEVA 1GVSA 1JCXA 5I3IA 4GUJA 4UR7A 2E6DA 4XUGA 3STEA 2OX1A 1QCWA 1VCVA 5I3JA 1OFQA 1GJPA 3I7RA 5D05A 3VE7A 3YPIA 2G5WA 2RHGA 5LZLA 3M9YA 4ZQOA 3NQ2A 4M6VA 3HGOA 1GPWA 1GTEA 3SR7A 3UQNA 5AC6A 3L5LA 1SFLA 4K36A 1VC4A 1QPOA 1VQTA 4WX2A 4BFAA 3MI6A 2VELA 4X9SA 5HR6A 3GNNA 3W88A 1YPIA 1H7NA 4DXVA 4MY1A 4XKYA 4OQVA 1W5OA 1Q6RA 3P7YA 1JCJA 1BWKA 5AYXA 1QOQA 4MZ8A 3GDTA 1A5BA 1LM1A 3TSBA 3ZWSA 4C1LA 3G1HA 3O6DA 1K8ZA 3PBWA 4O52A 2QCNA 3FEMA 3NPUA 3WK3A 1SO3A 4FX6M 2V9DA 3LX9A 2C15A 3BPWA 3ABQA 1KTNA 4I9AA 3M5ZA 1ZFJA 3HBLA 4JXCA 1TRDA 4DBEA 3W76A 4Z0JA 3W7DA 3B0PA 1N55A 4WUIA 3PF3A 2JKPA 3W9ZA 4O28A 2YR1A 2Y7GA 5FEWA 4NJHA 1NFBA 3N14A 3PUEA 3CM4A 3TW6A 1B57A 4WY0F 3SGUA 2GQ9A 5KTLA 5I3HA 4A21A 4W9TA 1EP1A 4AXKA 2JK2A 3PBUA 5DXXA 4G1KA 4CNOA 4N02A 4WXYA 3BW2A 3PVFA 1YXYA 1V5XA 3TSDA 2JGYA 1T0OA 1PE1A 4HPXA 1GVRA 2C13A 3NZ1A 1ML1A 2NUYA 3S5ZA 1TTPA 1W5QA 3W71A 1RVGA 2QUTA 2EPHA 4ZMGA 3R2GA 3UZJA 3PG8A 4WJEA 3EWXA 1W0MA 3W7NA 2EAWA 5J5DA 2YYUA 1SQ7A 4Q33A 3L2IA 1FY6A 2B7QA 1PIIA 1S5WA 4QISA 1YDOA 3S5NA 1H60A 3GKFA 1OK6A 1QPRA 1XDMA 3TX9A 1OYAA 3W86A 1I2QA 5EKYA 1PCWA 3NGJA 4LUIA 1XUZA 4IJBA 1O95A 5F2LA 3INPA 4Z1DA 5KSWA 5LNUA 4DF0A 4MJMA 1AW1A 4JTSA 3KX6A 4NNCA 3GIYA 4XTDA 4UCGA 1I2PA 5F4WA 4O4WA 2E6FA 1W5MA 2E68A 4O1AA 3FFSA 2R91A 3HIJA 3KFTA 1AW2A
chains in the Genus database with same CATH superfamily
4EK7A 1FWTA 4E3TA 2Z7KA 4FF7A 5XIAA 5TQLA 4YMZA 2WSKA 5D9OA 3KRZA 5CZTA 3K8LA 2AL1A 5HOSA 1AL7A 4Q32A 3SRDA 1KFLA 3M44A 2FJUB 3P74A 4RDWA 4PUDA 4QQ3A 7PTDA 1VFLA 2A3HA 4C6LA 1RP9A 5I5RA 3CV6A 3URQA 5GVJA 1JUEA 4LS2A 5F1UA 2TODA 5FJUA 2C7FA 4LFYA 1L6SA 3M5XA 3NR0A 3FSTA 3HG5A 5FF7A 2QVNA 4OGZA 1QAPA 3U5UA 2OZ8A 1C93A 4IGMA 3T55A 3AYSA 4ROQA 4C7DA 2V5KA 5C7VA 4B5XA 1CXFA 3W75A 3WF0A 4V27A 2PMQA 3NVTA 3DECA 1UYQA 3GTNA 3RXZA 1UD4A 5IFPA 5EPDA 3S2MA 4DO7A 3MUIA 3N9KA 1D3GA 1J0IA 5K9XA 1M6JA 3A23A 4FS9A 1SZRA 1TA3A 3HF3A 3C86A 4W8AA 2RUSA 4UIOA 1XSIA 4GBUA 1FQ0A 1G4SA 4GZEA 1VYPX 3PY2A 4YTSA 1A5SA 2VC9A 4TVUA 4YS1A 4QJ3B 1R3QA 4O57A 4WY0B 1H41A 1R0MA 6TAAA 5BMWA 2VZOA 4TV6A 3SCTA 5I07A 5F7UA 4H6RA 1W5PA 1EZ2A 3WLQA 1J93A 1M7XA 4MNKA 1F3WA 1K6AA 3ARZA 3R6IA 5JMUA 1ODZA 4B15A 3LCIA 3WH5A 3GQYA 5A6AA 3TTQA 3T4WA 2X1SA 3BLEA 2VP8A 4W87A 4H9XA 2WMFA 4H01A 4NKCA 3WLIA 1TTQA 4GYPA 4F40A 3R1ZA 4JFWA 4S3BA 3EPNA 1EL3A 2CZ5A 3VCNA 1TMHA 1C7SA 4H2HA 3W82A 4C1KA 5AHMA 4PTNA 2R24A 3A4WA 4C1NB 3FDGA 4S3CA 3BK0A 4HZMA 2ZOXA 3IGUA 1P6CA 2O9OA 4M6QA 3VZZA 4JTTA 1TV5A 3EDDA 3IAQA 4CQAA 4Q6JA 4ZOBA 3ZJ8A 2BX7A 3CQJA 2O7SA 3GXTA 3VDBA 1Q6CA 3B06A 2UWFA 4RZ6A 3DBNA 1GUVA 2FLIA 4CNTA 2GLKA 4HHLA 3UXDA 2WSYA 1KM2A 2OO6A 4N42A 1JYNA 1GYLA 4NRSA 4UNIA 3M4HA 3OIXA 4RPPA 3IUHA 1F6KA 4JTIA 4HNVA 5EMMA 5F4XA 5G4EA 5BZAA 5A6KA 5FEZA 5KZEA 4Y2WA 4EAYA 1B4KA 5A6BD 1AVAA 4AIBA 3T0TA 4Y96A 2CXEA 3VNMA 3WF1A 4A35A 4D8ZA 3A9BA 1HG3A 1OB0A 3UCQA 1BVWA 4JTAA 2J27A 1XIEA 2PTZA 1LL4A 1VYSX 4H7CA 5C2XA 1BKHA 1N7KA 1W6TA 2I5GA 4NAEB 5K9DA 2NZLA 2Q71A 3SN4A 3UZWA 3W2JA 4B9ZA 2PDWA 2V5CA 3CUIA 4GYPC 4PMJA 1VENA 4L9YA 1SO5A 3DH7A 1JYWA 1H7PA 4DF2A 1I0BA 1KLZA 3PS7A 3S46A 4R9XA 2QHAA 1KXHA 3ONCA 3B9AA 3F4DA 4ORMA 3ARQA 1F8IA 4OVXA 3GNPA 1MZRA 5C71A 1S2CA 1A47A 4AEFA 3EWDA 3KTSA 1H3GA 2J79A 2PA6A 3A5VA 1E40A 3P0WA 2G95A 1ICQA 1P5BA 3MMDA 4W88A 5AB3A 5EMKA 3U4FA 1V0NA 1E1CB 2GPTA 2NT0A 4GVHA 2J77A 4F9JA 5ABEA 1WKFA 2O0TA 2X1TA 3ORWA 2Y70A 4MTVA 4H00A 3UWUA 3VMPA 3KZPA 1XYCA 2DV0A 2IXUA 5CPNA 3VK5A 4BZYA 3L9CA 1K9TA 5FEPA 2TYSA 4B92A 4M56A 2P76A 1U1HA 4ILSA 4NX5A 3PM6A 1RY0A 1BVNP 2WMGA 4UXDA 3I10A 1QWKA 4O4VA 3A3WA 5E9AA 1OX6A 1R2RA 2AL2A 4Q8OA 4Q4KA 2G3FA 3CUXA 3HO8A 4N4PA 5BU9A 4KRTA 5AFDA 4IH3A 5JXQA 3D0CA 1DXFA 4I6KA 2GZXA 5AZ1A 2G50A 4TMBA 1WAWA 2HWGA 4B3ZA 1GEQA 3BZJA 1AW5A 3E1F1 1CWYA 2YJQA 4A3HA 1RZMA 3KEHA 1PL9A 4IIHA 3KOFA 1Q6LA 1GJUA 5HK4A 4WDUA 1UA7A 1Q7QA 3L66A 4E4PA 5DY3A 3N34A 3N15A 4IP4A 4RDYA 4NIRA 2TSYA 1TPWA 4AD2A 1T40A 4HCHA 2VI0A 3FCPA 1V77A 1JPMA 1R9XA 1HQTA 2YCEA 4GNJA 1IHIA 2WKLA 2IPWA 4XD4A 1JZ4A 1YQ2A 1P4CA 4R5EA 2ZUVA 3EX2A 1K1DA 2KAUC 3CHEA 2DPEA 3PUOA 3DFHA 2Z25A 4E0CA 1U22A 4JY9A 3C8FA 4IIGA 4GG9A 2OMAA 1CLVA 2WHKA 2AL2B 3RG6A 4JFUA 4KPLA 2A2IA 3WD3A 1EGVA 4QXIA 4Z0SA 1ONRA 3TP4A 3TAOA 2C71A 1VPYA 4Z2KA 4UFHA 1LL6A 3NQMA 3OVPA 1I4NA 4L6OA 1JCMP 3LTYA 4DF1A 1B90A 3ZOAA 4DVOA 3DHDA 2Z6IA 3PZUA 3W00A 3HG2A 2ZX6A 4EPEC 1HKIA 3PZMA 1MQQA 2CZDA 1ZJHA 4I5RA 1OFPA 4W85A 3JVAA 2XU2A 2CZFA 1GVIA 3WX7A 4HNTA 4KGJA 5TD4A 1MVYA 4AG0A 2BNJA 3G0XA 3MQTA 1UZHA 5LA1A 3O16A 3D6NA 1E73M 2C1IA 1FBAA 4FNPA 2I16A 4B3KA 2AKMA 1JF5A 1AA1B 1TWZA 1W1TA 2GJXA 1NH6A 4WHBA 1LZOA 4C6BA 1UWRA 1R7AA 1E3XA 4AZ7A 3AS0A 1TG7A 4YXGA 4AD1A 3K30A 8RUCA 4D6FA 2OX4A 3UGVA 4LW7A 3JR2A 1M68A 2XIIA 4NAEA 1VD6A 4MSSA 1NOFA 4LJ3A 1KBLA 1O7AA 1E6RA 4I8YA 3VDHA 4C60A 4MUZA 2PI6A 4WDTA 1F73A 1OCQA 4HZ6A 3ELFA 1NIUA 3O0KA 1UH4A 4I7VA 1FP9A 1OY0A 3KTCA 1MO0A 4F3HA 2QGYA 1F4HA 3QQWA 1KM1A 3LPOA 2CCRA 4US5A 1JYXA 4GQGA 3KE0A 2QQ6A 1TPDA 4FI4A 4MFDA 4JTFA 4XZWA 3VKDA 2Y2WA 2ZZ2A 3V0TA 5LYRA 4GHRA 3ARVA 1IGWA 3U5YA 3CH0A 2CERA 1R6WA 2ODOA 3IK2A 1RA0A 4MJZA 3T08A 4O0KA 4HIBA 3T0CA 3RMJA 1FWEC 1SUXA 1JFHA 2R1KA 3EPMA 3TIMA 3BW3A 3GK0A 4ZODA 3ZWTA 4JX6A 3MUXA 4FIRA 2JE8A 3WQ8A 3DI1A 1XYBA 4RPQA 2AGTA 3ZO9A 4L65A 1KV5A 3GRIA 4Y9OA 4GE8A 1XLEA 4PRWA 4Y8EA 1TCDA 3LERA 2VCBA 1CX9A 4GISA 2QCGA 3WK2A 1EP2A 4D2JA 3EX4A 2EPNA 3FJLA 4GGBA 5K4XA 1IIHA 1VCGA 1FVPA 1OABA 5DXYA 4YTTA 4RW3A 3LV5A 3DFOA 3SAZA 1Q3NA 3VOIA 6REQA 3GW3A 2QCDA 1KBBA 3ABOA 4BWLC 2NQLA 1SR9A 2DH3A 3SCRA 4GC3A 3WQWA 4IHCA 1ZGDA 1EEPA 2V5DA 1O5QA 4Q6XA 3MHUA 3G3DA 5BW6A 3HQNA 1G7UA 4B91A 4LVBA 3N73A 3ZR4A 2J8TA 2XINA 2Y5JA 4DJDD 3L67A 1EO7A 3ZLFA 3PPFA 4LBUA 4PMQA 5D2XA 2VEMA 4ZVJA 3VDGA 2JALA 2VT0A 3PN8A 4QLLA 3IACA 3BDKA 2I9UA 3H12A 1V02E 3VUSA 3A3HA 1JCYA 1EA9C 3LHWA 3W2KA 1H50A 3MZ2A 3RCNA 1PYMA 3C4UA 3LRKA 3SUTA 2B7NA 1FWIC 3F03K 5HINA 4Q3MA 5EBUA 1PVNA 1J0JA 4QCFA 3F4WA 3QPYA 2QDEA 4AIOA 1P43A 3VNLA 4J3SA 4GH3A 1O66A 3GAKA 1DWIM 3EEZA 1FHDA 3DBPA 2O4MA 5BXPA 1ESWA 2ZZ5A 4EIVA 5LGZA 1HO1A 1EWEA 5D9NA 3QHOA 1MNZA 1AMYA 4QAWA 3UJ2A 3FKKA 4HMCA 4IGNA 3VD4A 3KCOA 3QY6A 1FWHC 3VC6A 3U48A 4HPHA 4GACA 1LBFA 1DPMA 3OG2A 3PB0A 3VI2A 3WNLA 3CQHA 4O19A 3ZMRA 2DW7A 2OSXA 1IXQA 3H21A 2BLEA 3VXGA 4UR9A 1NM9A 2V3FA 3GYCA 4MHBA 1CB7B 5DX7A 3E12A 1OWQA 2VURA 4U10A 2ZX9A 3D5HA 1P0KA 3DGRA 2J24A 1W9BM 3DXIA 4JX4A 1BAGA 1LORA 2F2KA 2LLEA 5K9CA 4ZL1A 2WSQA 4LU0A 4WIWA 3WLHA 2C91A 2PD5A 3GH4A 1T96A 4W8LA 3CGTA 3QN3A 3KP1A 4DO4A 3F2CA 2GJPA 3CWNA 3KBJA 1A5KC 4AH7A 1WAUA 3WUBA 3WQ5A 4X2RA 2QNEA 3BV4A 3P3BA 4NXSA 1HJWA 4W7VA 4L5ZA 2G3JA 3RM9A 2VD9A 1K8XA 2NVAA 3THCA 2Q01A 1F9CA 5CPSA 1HIZA 4CGTA 1YYAA 2IPGA 3IJQA 2A7NA 4S2BA 3AQUA 4MAZA 1MDLA 1DWHM 2EPOA 2FB3A 4B16A 1OSEA 4HJFA 3FEQA 4JQ4A 4W84A 3T09A 1FCBA 4UTUA 4S3FA 5L9FA 1A0CA 2YFNA 1WDQA 3SUWA 4LCQA 2V63A 4V2XA 2ZQ0A 4JL2A 3RLVA 2INFA 2A85A 4A22A 4MB4A 1NTHA 2BMBA 2ZADA 1R38A 4JGDA 2H9AB 1YKWA 1UD8A 3OYXA 1LRNA 1D3HA 2Y85A 4XO7A 3MWCA 1EGZA 2EEXA 3ZM8A 4BEQA 2IQTA 3E2VA 3VYLA 4HOXA 2UZ9A 2ZRVA 1HTIA 1JZ7A 1KKRA 2YDSA 4Y6GA 5KETA 3ARUA 3SADA 3MU7A 5REQA 3B03A 4WJXA 4AD4A 4PZVA 4JPGA 2FPTA 4WXZA 2CHRA 4IX2A 3RFAA 3QMRA 2E6AA 3D3FA 3SZ8A 4ICCX 1P6BA 4PSPA 3H7VA 3DKLA 1CT5A 2OZTA 2BGQA 1KFWA 4O0ZA 2FH8A 4ZTXA 4IF2A 2QDDA 5AHEA 3ZT7A 3AZSA 4DJFA 1ZTVA 3CYJA 2NVCA 3G22A 5ABFA 4GGHA 3BMVA 2W61A 1GVYA 2PDKA 2WZEA 4JX5A 1Z44A 1ITUA 4JKMA 3BAWA 2G3NA 1TKKA 1B3VA 4LRSA 4M51A 1RK5A 2QYGA 4GVFA 3AIEA 2WO5A 1KQZA 2C16A 3IV8A 2D73A 2YFOA 3NQ8A 1QWGA 4Q8VA 2QCFA 3G1RA 4BWLA 3IVSA 5HUPA 5HNRA 4L1WA 2FPVA 2OOFA 1WQ5A 2PLKA 4IP7A 1Q6DA 1TV3A 3H7UA 1EQCA 4C6DA 2GK1A 1GVQA 4H8HA 1UW9A 4QIUA 1XHGA 4C6KA 2DT0A 3QZ6A 3HURA 4XAZA 5AYIA 3HJEA 2J7DA 1WXJA 3GX9A 2ZUNA 1XCWA 1X6LA 1WKEA 1B4EA 1X6NA 3THQA 4AU0A 1EDGA 4CD5A 5CSUA 3OZOA 2F2HA 1OINA 3EMZA 2P1FA 3MKVA 3KLKA 3R8GA 2Z1KA 1TPFA 3I3BA 3UXLA 1DXEA 6CGTA 3W0KA 2P3ZA 4CKQA 2ACQA 3QOKA 4C6QA 4HU8A 1EX1A 1W54A 1OT1A 4CU6A 1S1RA 1A5UA 1FDYA 3GKAA 2VX7A 3WN6A 1JPKA 1KM3A 1ZL1A 3WDJA 4A6GA 3F2BA 5MF5A 4WZHA 4AYSA 2EKCA 3DESA 1YNYA 3ANUA 6ENLA 2A1YA 1RAKA 3EMQA 1X39A 2R9RA 5CKSA 1XP3A 2PF8A 2WBGA 4WSJA 3HG3A 3SURA 4A4AA 5M1TA 4O53A 1EJ7L 3OOQA 1SFJA 4HA1A 3QYSA 3AIRA 4RDVA 3IVUA 2AAAA 3LGEA 1UWAA 1L8NA 4P7RA 4J5NA 2G37A 4GI6A 3GHUA 1R8LA 1XR2A 1FWJC 1FHVA 1I45A 4X0NA 3AHVA 2OKOA 2OCZA 1EC9A 4XUYA 4C6MA 3S6OA 2BOEX 3F4CA 4XIMA 3IK4A 3NQAA 1DTNA 4Z17A 4IUOA 3LCGA 4XBSA 3TW7A 3GNOA 1OCJA 4L4MA 4R9OA 4B90A 3QW4B 2Z24A 3LS9A 5XIMA 3OYZA 3WLMA 1NEYA 1E6NA 4HCLA 4WOZA 3ZLHA 3CNYA 2QV4A 4DO5A 3B4YA 3VO0A 4UTLA 4OV4A 4UNKA 4PUEA 2XIOA 1AZ1A 1I2OA 1E51A 2QGHA 3B8DA 4WJ8A 4LUSB 2JQXA 1XYFA 5LGXA 1Y7VA 3VE9A 3VNKA 5HMEA 3H55A 3TR2A 2VGGA 3BLOA 4TOQA 1XH1A 1YPXA 3AICA 1X1OA 4HN8A 3R0DA 4JTDA 3RLUA 1ZSXA 3LD5A 4TX9A 4JDYA 2DVUA 1GOXA 2Q09A 3WFLA 4Z2LA 4C5YA 4JBRA 2ZA1A 1XYMA 3AS1A 3B0UX 5HNTA 4LRTA 2JFEX 4MDPA 1XLJA 3VX1A 4GXMA 1HGWA 1QPQA 3BSHA 1TYGA 3EOOA 3RX2A 3URNA 3W27A 3LLFA 3LCHA 2ZRWA 4OFCA 7A3HA 2ZX5A 5FF0A 1S3HA 3TJXA 2WBKA 9CGTA 3GG1A 1HKWA 3DENA 1S5VA 5D2VA 4I7WA 2J66A 5EYWA 4FO4A 2FH6A 2ZA2A 3DYMA 1BXNA 4WGXA 4Q7NA 5I77A 4PE8A 1PIFA 3OLIA 3HPZA 1BQGA 3BO9A 4FF5A 3RLGA 2HMCA 3B05A 2J8FA 4OBTA 2A7PA 4MLJA 1KM0A 5J8LA 3W22A 4AW7A 3TE9A 4DWSB 1THFD 1W2VA 2FZNA 1AQMA 3UY8A 3B9NA 1QK0A 1TJ0A 1TREA 1U1UA 1WE5A 3GXFA 1S5NA 5EFFA 4DUWA 1JDAA 3RJYA 4JEJA 1YNQA 3P93A 1HN1A 3SCWA 4DJEC 1VR6A 4M7SA 4FNTA 1UG6A 3UCCA 1C7TA 4JL1A 2CLPA 3CH9A 3Q37A 3Q4DA 4HQVA 5RUBA 1US3A 1UASA 2GFTA 1MRAA 1UB3A 3NNTA 3GDMA 1ZLPA 3PZ9A 3LTPA 4OZOA 2PDMA 2ZYFA 1IZJA 3QKEA 4JKKA 3U6WA 3IPWA 2FTYA 3MDUA 3C56A 1EYWA 2WZIA 2XFWA 3LRLA 4F79A 3OBAA 1TE1A 2BGNE 3AMGA 1TV2A 4QX4A 4D6JA 4WEVX 3MJMA 2J7FA 1VJIA 4O1DA 3IRDA 3M0MA 3BQ6A 2GVEA 4O1EA 3UWVA 1WKDA 3GC2A 4PFMA 4PTMA 1ZQ5A 4IQDA 4XO6A 2E40A 3C0LA 3O8AA 3U8GA 2VXNA 4HNUA 1RJQA 1REQB 2OJPA 3IAPA 1G9HA 3LMYA 2F61A 3CZ8A 2UY3A 3EMCA 1E4MM 3QGAC 2Y63A 1UR9A 1VCFA 2QJMA 3IWPA 4JZ5A 1VYRA 3CLWA 3DYOA 1VRXA 3NPXA 4EX4A 3DFYA 3BLFA 3CUGA 2J7GA 4A3UA 5AECA 1TIMA 4N2YA 1ZJBA 1XIGA 1KB3A 3WDPP 2BV9A 2DJXA 1O5KA 3BE7A 3F5JA 4QE1A 3R10A 1EFZA 4IQEA 2YCKX 2I17A 5DMNA 1XUUA 1WUFA 2GGEA 1V93A 1Q6QA 5A6SA 4B5NA 1G01A 1EUAA 1DJNA 2PU0A 1HP5A 3A4JA 4NJKA 1PS9A 1P0BA 2XGBA 2QUVA 1ZZMA 2X41A 5AKQA 1HP4A 1V02A 3MBFA 3IUIA 4EANA 3CPUA 3H8AA 4MB3A 3WBXA 3HQPA 4UTIA 1XS2A 3QEZA 3BGGA 3B0VC 4JFTA 1H7RA 4KCWA 4J7RA 2MUCA 4U3AA 1JXJA 2YLLA 2VFDA 2OYLA 3HOJA 3NZRA 4I9JA 1XYAA 3UWEA 4JNZA 3LQLA 4H9VA 2DZXA 3LDVA 1DXIA 3NPVA 4N9CA 2QUMA 1F6YA 2ANUA 4D6DA 3HGRA 5DQPA 3AIWA 4LSBA 1O12A 3CUHA 3EWYA 4MAVA 3M7WA 2GSJA 4JNMA 1EWDA 2HVMA 4Z1BA 3QC0A 3PSWA 1ZAJA 3WLPA 2QUUA 4PB4A 1M53A 1Z41A 3O6AA 1IEQA 1QW7A 3VNIA 1HF6A 3NDOA 4ASTA 4PCFA 2FGZA 3AYVA 4MUPA 1UC5A 5BYWA 3QJAA 1XD0A 1Z69A 3LM3A 4GUFA 4ERIA 1CBGA 1NWUA 5G5IA 3E0LA 3AMCA 1LROA 4L56A 3N11A 1QI0A 4FZIA 3OVQA 3QRHA 1MUCA 1FWDC 3ISIX 1M03A 1LQ0A 4JYDA 4NVTA 3UA3A 3UPWA 1XSKA 3VZYA 4AF0B 4MNLA 2J7HA 2PTWA 3FJ6A 1CGXA 1I9CB 5HUOA 2QDGA 3BMWA 4ML9A 2DQXA 5CQ1A 4HU4A 2W62A 3WDQA 2VQTA 1GONA 2V5LA 3STGA 1JCNA 4NF7A 3W85A 1W37A 3PJXA 2P0IA 3WJYA 4LAZA 1EP3A 1V6XA 3W70A 4ICNA 3SDOA 4GIRA 3SW6A 3O07A 5HMFA 1TB3A 4DWSC 1SMAA 4A8RA 1HNYA 5KZMA 3N2TA 1E56A 1DWFM 4D1JA 3FYYA 1PDZA 4OBRA 5JH2A 3G0SA 4BF9A 2CC0A 4XZMX 3P5YA 3C8NA 2A6NA 4CLMA 3B3DA 1ZCOA 2W27A 4MWAE 3EKGA 2XN1A 1OFBA 1XIDA 4X63A 4UR7A 1QCWA 3T42A 1VCVA 1JFXA 1CXHA 2JIEA 1GJPA 3YPIA 3FHQA 4V15A 3TN4A 1FWFC 1UWIA 4S38A 1UOZA 1JGMA 3CL8A 3UQNA 4XSLA 3L5LA 4JHOA 1SFLA 1VC4A 1DJWA 4MJ4A 1RLDA 4AC1X 2XM2A 4HMEA 3UFYA 1Z8AA 4OQVA 3Q65A 1HJQA 4AZCB 1MQPA 1US0A 4MZ8A 1M04A 1LM1A 2XGZA 1UP2A 4FA3A 2V9DA 3OTRA 1KTNA 4S39A 4DRSA 1DJXA 4MB5A 4XAFA 1XD1A 5TNVA 3B0PA 1N55A 5DF0A 2I57A 4PUKA 4QDPA 1QBAA 4O28A 2YR1A 3T07A 1BTCA 3S1GA 1R3SA 3N6JA 1NFBA 4PMUA 1FOBA 1DJYA 4UOJA 1OT2A 3VUPA 2GQ9A 5KTLA 4W9TA 1EP1A 4AXKA 3VKKA 3PBUA 3ZVHB 3R79A 3VKCA 4G1KA 3RX4A 3VGEA 1XGEA 5A69A 3W4RA 4K2SA 3RU8X 1YXYA 4IP5A 1V5XA 1T0OA 5GPRA 1PE1A 1GVRA 1XH0A 2QUTA 3UZJA 2PS2A 3EWXA 4QFUA 3GH5A 3TA9A 1XLBA 3L2IA 3PZNA 7TAAA 3UEQA 4J28A 4P5UA 1XDMA 1OYAA 1WPCA 5F2LA 1XUZA 4IJBA 1O95A 5J04A 3KX6A 4NNCA 3UERA 1SJCA 4WR3A 3PUGA 4YJ5A 5EMYA 4UCGA 2C8NA 1I2PA 5F4WA 3TQPA 2E6FA 3GWQA 2VWTA 3S2NA 4B4HA 4J3UA 4HNOA 3FVDA 1Q4WA 2GUUA 5BMXA 3EB4A 3TTEA 2YL9A 4GQ0A 4P2VA 4GY7A 1QUMA 4BI5A 2ZVIA 1AL8A 3W24A 4I9TA 3ERPA 3H24A 3SSZA 2SFPA 1UUQA 2NV1A 2D3NA 2WZMA 4XBJA 1FWGC 3BJTA 4MIMA 4QJ5B 2ZUMA 1P0DA 3EX6A 4R53A 3MI2A 4IMGA 1XLIA 2CLFA 3AYRA 5MKGA 4CNUA 4EP8C 3HPAA 2XVLA 2Z1BA 5GJNA 4LS1A 4RX0A 1H7OA 3LI0A 3GFYA 3TN5A 1MEWA 2WC4A 2PWVA 4DAIA 2PTYA 4CCCA 3GR7A 2QV5A 3QHNA 3KP0A 1N8FA 1QO5A 8XIAA 5B7YA 4TXEA 3WL1A 4NQ1A 4AHQA 4JIPA 1YW1A 1T6MA 4QNEA 3MWAA 1V6UA 3AALA 4KCTA 1POKA 1TV7A 3WQ6A 4C6EA 4IMFA 4GXPA 4F4RA 4PBFA 2DZAA 3WJSA 3WMSA 3G8EA 4FIQA 3DIPA 3ABZA 4DLMA 4QLKA 4Q8MA 4RL3A 1UIOA 2O7QA 3CK5A 4M8UA 3OGRA 3GXMA 3GD6A 4I5XA 3BAXA 1XRVA 5LNWA 1YDYA 1YMYA 3HZ3A 3LTSA 3VPLA 4DJED 3OVRA 4HCDA 5FJRA 2Z29A 2YDAA 4NUWA 4JIIX 3DAQA 3MZNA 1IR2A 4X60A 3HPSA 3DZ1A 1E0XA 1DL3A 3DCPA 3UGRA 2DZPA 2ZZ6A 2ZZ3A 3E02A 2OQLA 4TUFA 1W1IE 2YLAA 1KC7A 2YDQA 2OLSA 1H1YA 3TXVA 3W25A 1PX4A 4LS0A 1DV7A 3NJ3A 3GLCA 3AROA 5AOUA 4KFPA 2CLLA 3CMJA 4UCFA 2X40A 1J0YA 4IISA 5DMYA 4O0QA 4F0SA 2VNCA 1TJPA 4R7OA 1QPKA 5AYYA 1H7XA 1YBQA 2WVTA 3B04A 1E1FA 1G69A 1JNEA 1JQVA 1SGJA 3E38A 3W1RA 4AD5A 3WLJA 4GD0A 2G3IA 4YTUA 4OT7A 3S3GA 3H2EA 4KERA 1QW8A 4FX7A 1QNQA 3AZRA 1L9WA 2HROA 4KWWA 1CGWA 2XIMA 4M5PA 1TPEA 1W9DM 3LCFA 4IFOA 2QW5A 4A8LA 2BHYA 3SCOA 3HQ1A 1DTUA 4RNHA 1DBTA 1GQKA 1MW0A 3LPPA 1Y65A 5EBAA 1N82A 1CEOA 1HJUA 3CB8A 3L4ZA 3G1SA 4S3GA 3AO0A 2WJEA 2OG9A 3F4NA 2FTWA 1Z7AA 3PHAA 2FFCA 2ZE0A 1E15A 5CGQA 2DIKA 1XIBA 2NLIA 4N9EA 3W7QA 3SCQA 3O3RA 1RR2A 2XN2A 2J8GA 4AZBA 4Q8QA 2XH0A 4JCLA 1P0NA 2PD9A 5I03A 3OVGA 5EFDA 3PZOA 3TCEA 4UTFA 2EHHA 1W8SA 2BS9A 4BF5A 2OT1A 3V36A 4G56A 3EWBX 3NDYA 3O0FA 1BPLB 3CUJA 1XRFA 2ZDSA 4HTYA 3QBUA 3W29A 1TA3B 4IMCA 4E4FA 2FDMA 3W7HA 2X1RA 1GQIA 2BY1A 4AXNA 1OEPA 3T2PA 1BRLB 1XQKA 2OKTA 3A12A 2VOTA 3KDNA 3KOXA 1CLXA 1JZ8A 3S1WA 4L4OA 2R8WA 1KW1A 2YYTA 2OTDA 2WWDA 4ADTA 2J7CA 3WBYA 1GQLA 2V0TA 3E49A 1G7VA 4I6VA 3AYTA 3ZVHA 4V1YA 1OX4B 2GSEA 3M46A 2G0WA 1Q6FA 4MKSA 1S5TA 5ABGA 1QASA 2GUYA 3LNMA 4NI8A 2DUAA 3C5QA 4IGHA 4YVXA 2IPJA 1YNPA 2X8RA 2PDJA 5CXPA 3B9OA 5PTDA 5LA2A 4DJEA 4O54A 3SM0A 3CHCA 1AZ2A 2X16A 3NXLA 1XW8A 1GVOA 4DX3A 1IWAA 2YOCA 1G6CA 3D3AA 1MMFA 1XRTA 4EPBC 4UZUA 4NL1A 2ZZ1A 1ZRQA 3IGHX 4HBKA 1S2TA 1WBJA 3W1UA 4JYEA 2F84A 1JG9A 4UQ9A 4UQEA 3E2RA 4B5TA 1JCLA 3K4WA 2WB5A 5HXMA 3IGSA 2UV8G 4ZSTA 4QTGA 3LN3A 4K6AA 2X7WA 3LY0A 1GOOA 2QT3A 1E6PA 1X1ZA 3S1XA 4CQ9A 2WVVB 4IX0A 2V2CA 4FXJA 5G4WA 4UFMA 4LB3A 1BWVA 3ARXA 3NZPA 4WLCA 3GAYA 3RHGA 4DHGA 1I60A 2WMJA 3QR3A 3ZT6A 3VINA 4UQAA 3WBWA 1VEPA 3TR9A 1D3CA 3CMFA 4HK6A 4DI8A 1VFTA 3GDBA 3AOFA 1WXZA 4FPSA 3RGTA 1L6GA 4P7NA 4O18A 1L6YA 4GFIA 2PPGA 1VFFA 1XL9A 1UA3A 2DQWA 4AQLA 5CSYA 4UQBA 1B31A 4AY1A 1VPQA 4OTKA 1ADSA 3GBDA 2E9MA 4DY1A 1KXTA 1UKTA 1TVPA 3UWWA 2VR5A 3JU2A 3QMSA 4U3CA 2QIWA 2Z2AA 3L4YA 5FI8A 4QJ4B 3RRXA 3IANA 3L4XA 4PCNA 5LHEA 1ME8A 2F6KA 4MNJA 3SIZA 4MNMA 4N6FA 1ISVA 5HMSA 3IRSA 1OGBA 3M64A 2E1WA 3WLRA 3PZVA 3MV01 2G8ZA 5CAHA 3HGSA 3IGXA 3QXBA 2VC7A 2VRQA 5A8NA 4GRSA 4H8UA 3S1UA 3R0UA 3O15A 2YPIA 2RJHA 3MP5A 4J27A 2Z2UA 3TC6A 3N12A 1TTJA 2E5BA 4FXRA 2FVLA 2QVHA 4X0VA 2G4JA 5D33A 3W01A 2DDXA 4UZSA 4V1XA 4HSNA 1QXLA 4OIFA 1XBZA 3LPGA 3EA2A 4M29A 2VVSA 4A3RA 3V1PA 3PR2A 4IFKB 3EZ4A 1LG2A 3TJ4A 3EEGA 3IJIA 3EYPA 2QJGA 3P82A 1L6WA 3SJNA 2PB1A 1FH8A 5F2GA 3R8RA 3W07A 3GE7A 3NIYA 3MVIA 3EB2A 2ADAA 4MMWA 3VFCA 4S23A 1RJRA 4FR6A 4F2TA 4GO8A 1JVNA 3ANVA 1E6ZA 2AQOA 4GIEA 3UYCA 4Q8WA 3FGCA 2DORA 3UVAA 3D47A 3ITYA 3WQ4A 1Q6OA 4AMAA 2XWDA 3F1QA 3VD9A 1HGYA 3ARRA 2WVSA 3FA4A 3LUTA 2POZA 3WNKA 1JF6A 1ZJIA 4IZGA 1CNVA 2PCQA 3E9AA 1EQPA 2FVMA 3MVTA 3PJUA 2EPKX 1JYVA 2NQZA 4RXGA 4S3KA 1XCXA 2FHBA 1IZKA 4H83A 2QUNA 2WV8A 3FJNA 1HX0A 4JIEA 1NDZA 2CETA 2HNHA 3VGBA 4RW5A 1K7XA 1O6IA 2NX9A 1E9LA 2VVNA 3LPFA 3OIHA 1DKWA 5TIMA 1B5TA 4LVAA 1XINA 1AH3A 4KESA 1L2QA 3VTRA 2TPSA 3NL3A 1XIHA 3EB3A 4TVCA 7TIMA 3P8JA 3AU2A 3BAYA 3CQKA 2WC3A 1G4PA 2W4XA 5G1TA 3W7OA 4CCEA 3OZMA 4IOTA 2HVNA 5DRCA 2VKZG 3GXDA 1XG3A 4HPJA 4QG6A 3G24A 4R7JA 3M7SA 4KEZA 1VJSA 3QGVA 4MZYA 2ZRZA 1D7KA 1A4LA 2BXVA 3CLMA 3P80A 3STFA 3NO1A 1AJZA 2I5QA 3W53A 4ZQNA 2V5BA 5I7GA 3PPHA 3CV7A 2X1IA 5I00A 3USZA 2X1UA 4J3XA 4G1NA 4XZHA 1TFVA 3CTLA 2V38A 4PEKA 4I8DA 3LI1A 5ENLA 1TTIA 3WLKX 2ESCA 4LV4A 4RE3A 4AWEA 4GJJA 1J5TA 4HP5A 3I6TA 3T6CA 2G4FA 3L12A 3UG3A 4LWWA 4GKLA 3FKRA 1HVQA 3EKLA 3N18A 3W7GA 4W86A 4AEEA 2ZIDA 1TMQA 5C9UA 2VEPA 3CT7A 3ES8A 4IJCA 3H6OA 3GM8A 3KM8A 4JIRA 3OJGA 1R2TA 3QSTA 3QY7A 3LYEA 3H70A 1Y5WA 1NDWA 5DT5A 2WSRA 4C1NA 3TQKA 4JDBA 3CTTA 2YW3A 3WLTA 1NSJA 2VM8A 2ALRA 2QIIA 4HU0A 4NAFB 4AB4A 3UXAA 3ENLA 1QO2A 2UY4A 3E96A 3CEUA 2VFEA 1DORA 2UY5A 1F3XA 3WYZA 1ZP3A 3GUGA 3K4AA 4GIYA 1C90A 4A3YA 2VEKA 2ZUUA 3SY8A 4CN4A 4RE0A 1RHCA 2YW4A 2RJGA 4OU1A 3TVAA 3NAVA 2PF0A 1AFSA 1XX1A 5ABTA 4QDWA 2EQDA 1KRAC 1OVDA 2HZGA 4F2UA 3EWUA 2GSHA 4JTEA 3GBEA 3F2DA 3FSUA 3NVDA 3ITCA 3M0LA 3W7KA 4ZZ9A 3VIPA 1H61A 3WDRA 2PDPA 4JEQA 4KF1A 1EH9A 1Q13A 2VEIA 3CZEA 4R33A 4BK9A 4PUMA 4C65A 2B0MA 1DHKA 4FNRA 5LNVA 1GQNA 3UYIA 3T8LA 1Q63A 2OQHA 1B9BA 2FJKA 1DE6A 5HAOA 1KR1A 2VZTA 7REQB 4A8IA 2RDTA 2XH7A 2WHMA 1S2UA 3GHTA 4QHRA 3Q58A 4RNIA 4U2ZA 4QAIA 4X3ZA 4PEEA 3PTKA 3QY8A 1HKKA 3BWWA 4FK9A 4YNGA 2FKPA 4LEQA 3ZFHA 3I3DA 1X8CA 4H19A 1E0VA 1ISWA 1JZ3A 5T8GA 3SB0A 4DZAA 3IJLA 2CW6A 1NQ6A 5IHRA 5HMDA 2RGMA 3VKJA 3SECA 4AX6A 2R14A 3WK1A 2YCLA 1H5VA 1A49A 4EPKA 3WNPA 4AZIA 4E8DA 1XBXA 3CL7A 4PUUA 3EDKA 1HL8A 3DKJA 4EXAA 3MUZ1 3ITTA 1SW0A 2E8YA 1ITXA 1PDYA 3PNZA 4F0LA 4GUHA 4KBXA 2WKJA 1RBAA 1MUWA 4E8GA 4US6A 1ZAIA 3LBCA 4ZO9A 8CGTA 3BCFA 2X42A 3QSRA 4O15A 4BEUA 5F4SA 1W3LA 1MZHA 1EXPA 4J3TA 3N04A 3M0YA 4M6PA 1K77A 3ITXA 1KCZA 2Y5EA 3L4TA 4R7WA 3N19B 5CPQA 2EJ1A 1LLZA 2QJJA 3C61A 3T8QA 5HQMA 2RDXA 2EGZA 1E5NA 3S8HA 2DZTA 1WO2A 3ARWA 5A6TC 2Q02A 2BVTA 3GC5A 1SJDA 3TJIA 1DIDA 1IF2A 1PSCA 1LUCA 3WQEA 3HPXA 1L0PA 1EBHA 4EOUA 1FDJA 3VD5A 1PWMA 4BQ5A 4CU8A 2W5FA 3GO2A 3REQB 1IT8A 4DEFA 1A5OC 3GR8A 2HK0A 3L68A 4GVIA 2Y88A 3O1NA 1UZ1A 4CD4A 2OZ0A 3RX3A 4MKNA 2C19A 5IOBA 4GY1A 1GYMA 3PJTA 3L5MA 1P7TB 2YBTA 3IIPA 3WBEA 3E2SA 1ZAHA 2E77A 2A3CA 3UJEA 1JDFA 1ZUAX 5HBFA 4ACZB 3BAIA 3G2GA 4YTRA 4Y90A 2WSPA 4WDXA 4YLWA 4B5SA 2CZEA 3EXSA 1JUBA 2J25A 1G4EA 2V5JA 2VFGA 5AC4A 3TYCA 1U5JA 1TV4A 1R3WA 3AWOA 3LRMA 5FKYA 4O1BA 1A80A 3S5OA 1PZ0A 4PBEA 3VIOA 1UR0A 2WMKA 2V3GA 3CWHA 3AXXA 4P61A 3W23A 1OCNA 3E5BA 2GVJA 5C7HA 3SCSA 4A2RA 3T2QA 1JNDA 4R34A 3MJYA 5AVHA 3IJ6A 2OODA 2DFAA 4AVNA 1CGTA 1GJWA 1V51A 2ZICA 4JTQA 3BL3A 1YTEA 4BF7A 3JZEA 2PDHA 1ECEA 2OWXA 4Y7EA 2H8ZA 1GVFA 3IV3A 1UR8A 1VPXA 4PCSA 4JY8A 3UG8A 2Y89A 2QAPA 3UY7A 1ADDA 1NDVA 5FJJA 4AVFA 2VC6A 1BWLA 2GGGA 4DBDA 1SZGA 1E1EA 1V6YA 4MWAA 5CBBA 3W7JA 3H2AA 2QR6A 1YPFA 1KA9F 6PTDA 3C2VA 2A3AA 4RCXA 1WDPA 2Z28A 3WENA 3LHYA 4LYPA 3TFCA 3GHRA 3V0SA 1EOKA 2PP0A 3QR0A 1ONXA 1DJQA 3RCYA 1OIMA 3KLLA 2V69A 4MKVA 3SRHA 4DWDA 3QTGA 2D24A 4HNNA 2WVUA 2Z27A 1CXLA 3A47A 4JS3A 2IQDA 2ISFA 3QH2A 3MP4A 2HXUA 1X1NA 2DUXA 3NYDA 1K3UA 1LRTA 3N4EA 1UZ4A 2UY2A 4XTIA 2R1MA 2CHOA 3N3TA 3WG6A 3ZIZA 5A8QA 6XIMA 1KLYA 2Y1HA 3SI9A 3E74A 2E8ZA 5HPOA 1KCKA 1XDJA 1PTGA 2TMDA 3B8IA 4TR9A 1UWSA 1QRQA 1K70A 3LA4A 2Y6ZA 1DHPA 3I65A 4J40A 4NZ5A 2Y62A 2NQ9A 3PZIA 3R89A 1RV8A 1A5CA 2CIPA 1UUMA 1XSJA 2NQJA 1N2VA 3I4KA 1VHNA 1IQ8A 4C7GA 2CKSA 4ZO8A 2BSLA 2PCEA 1W1A1 3TTYA 1ZS2A 4NY2A 2EO7A 4G7FA 4E2BA 2E5CA 4GZJA 1EPXA 2V3EA 3OGVA 1EOMA 3DX5A 4FP1A 1IR1A 3RN6A 3W7IA 2Z7GA 4G2DA 4LUTB 2OWWA 5F2MA 2ZBTA 1WA3A 1BG9A 1XWYA 1BQCA 2GDQA 1YEYA 4HOWA 4JN6A 1QOXA 4S3AA 2Y7FA 3ZXWA 3LSBA 3MSRA 1YLVA 4B9YA 5G2HA 1VAHA 4RE4A 5CZSA 1PHQA 3QQ0A 4ZB5A 4GWEA 3NFUA 5IRPA 5J5RA 1W9UA 3CWOX 3KW3A 1F2JA 2ACSA 3TWBA 2X0SA 1VBRA 2ISSA 4JTRA 4LTSA 1A50A 2NV2A 1V03A 1BGGA 4GABA 2E09A 4D71A 3RF9A 4LF2A 1XLDA 4DJFD 5HQLA 5LHFA 3UBPC 4Q4MA 4PC8A 3WMCA 4FNQA 3KVJA 1HKVA 1UIPA 1VFOA 3B97A 1NVMA 1AH0A 3W28A 3CHFA 1KFKA 4KCUA 3QW3A 1J8VA 3W6LA 3SSJA 3WMLA 3L5AA 2HS6A 1A5LC 3KVMA 1VEOA 5HNNA 2PLMA 3AFBA 2MNRA 1OFAA 4PN2A 2YXXA 1UP0A 4QRNA 3CIWA 1WKYA 3FAXA 2P50A 1IE7C 3SCPA 5TAOA 1A4MA 9XIMA 2CBIA 4JD4A 3BG3A 1MUMA 3CAVA 3SGZA 2FMOA 3DFNA 2A3LA 2DW6A 2OGJA 3PPCA 3NQ6A 5BXTA 2Z26A 1LTDA 4H04A 4UUIA 1MRQA 2DT1A 4QDMA 2VJXA 1VZWA 3QQ1A 3MCOA 2BY2A 3T7VA 3THDA 3W3OA 3WQFA 2ZXQA 3UR8A 3WUEA 1SU5A 3NQDA 1ISXA 1ZPTA 3L7RA 4FXFA 1UWQA 1SZFA 1KM5A 4PTXA 2E7FA 2ZWZA 2ZRXA 2PGEA 3ZQ9A 4BQ3A 4FHAA 4M81A 1UD6A 3TYZA 1KFCA 3TYUA 3QR1A 5D09A 1GG0A 3NG3A 3WELA 2GOKA 3KCJA 1BXBA 4U5KA 3PBGA 1LJYA 4MWAC 2POTA 1OG6A 4H6KA 3PSVA 1R9YA 4GC4A 4LEFA 5KITA 1JQXA 1KXVA 1IWBA 3DFPA 3C2OA 2Z00A 3H54A 4CVUA 4TV5A 2QS8A 2PEVA 2NT1A 1GORA 3WLLA 1NQKA 2Y8VA 1VS1A 3HMCA 2IW0A 4R3UA 3CC1A 1TUXA 4DBWA 2ABBA 3OEXA 3KOYA 4QR6A 2VX4A 2A79A 3S2CA 2D20A 3TQVA 2BVWA 2XWEA 2JEQA 1Q6GA 1EEXA 3LBOA 5A6JA 3KAOA 3TU9A 5A2BA 3N2CA 3SFKA 3O06A 4LT9A 1OG0A 4X9YA 2VC5A 4TO8A 3TMQA 3W2NA 4HNLA 4GK8A 1KFJA 3BANA 1W31A 3M0KA 2WJZA 3Q94A 3MA8A 1GQJA 1ONWA 4FXSA 3S0CA 2Q8XA 4HYRA 2FFIA 3RU6A 1DQWA 5BRQA 1BYAA 3BOFA 3L0KA 1EA0A 5D37A 4GVGA 2FQIA 3B9EA 3OBEA 1JAEA 1K4HA 5EGRA 4MB1A 4XVDA 1P1XA 2DU2A 3CO4A 2HCVA 3ONBA 5AC5A 3G6LA 1UROA 3MMTA 4MPQA 4BR1A 3BLKA 3GG0A 4U2YA 1ZBKA 1JRCA 3WH8A 2A3EA 3FOKA 3H4WA 3E0FA 3H2MA 4JQ2A 4IMEA 2ZDRA 4DUXA 1W3HA 1J0HA 1XIJA 3BXWA 4GY0A 4XQ6A 5CZKA 3TAKA 1NOWA 1RALA 2XFYA 4ZXLA 1BYDA 1BGAA 3ZR5A 2ALDA 5BOEA 5JQ9A 4DJDA 3BOLA 3H2NA 2PWHA 4JFSA 5C0QA 1DWGM 3BV7A 1VFMA 5HULA 5D32A 4IG2B 5ECUA 1C29A 2QJNA 3VNZA 2HV5A 9XIAA 3MTWA 1KM6A 3VOFA 1FA2A 3RNDA 2C3ZA 4IQLA 1IEIA 2WPBA 2ZC8A 1OX4A 3PG9A 3P2VA 4PTVA 3BICA 2W0UA 2GGIA 3ABSA 2ZZ7A 1X7IA 3UT0A 5E5CA 1S5MA 2VCAA 1CDGA 1JL8A 1J9YA 3P6LA 3BAKA 3LHTA 5BU6A 4G9PA 3IVTA 1U83A 1A3WA 1GKPA 3CO8A 2ZA3A 2WHLA 3NZQA 4YTQA 5AYBA 3VNYA 3Q45A 3CZGA 2H3BA 2PLJA 3B8VA 3V5FA 3AUJA 1VBUA 1Y5XA 1X97A 4K39A 1TPH1 3B40A 4XISA 3HA1A 2FPYA 3KOZA 3NDZA 2JF6A 1LOSA 1AQ0A 1CZ1A 4BHYA 3ZJ6A 1FWCC 1XV8A 2ZVRA 4DB7A 4IL2A 4DYJA 5CJMA 1BSLA 4MYXA 1EC7A 2GJRA 4XUGA 3STEA 4QS5A 2OX1A 1D8WA 3WNNA 3I7RA 5H1WA 4US5D 2RHGA 4ENLA 4ZQOA 3GTXA 1GPWA 3SR7A 4Q8TA 4INFA 2FZ8A 1QPOA 4WX2A 4BFAA 1VIZA 1XG4A 2VELA 4X9SA 1XLKA 3W88A 1IT7A 1XRSA 4DXVA 2XUCA 4GMEA 1W5OA 1Q6RA 7XIMA 3P7YA 1BWKA 5AYXA 2BASA 1QOQA 3GDTA 3TSBA 3VMNA 3JZUA 5EMLA 3G1HA 1QNPA 3O6DA 3FHAA 5CLWA 3OLGA 2UBPC 4L64A 3CAWA 1TZ7A 3LX9A 1TWWA 4W5UA 4ZOCA 3M5ZA 4AZCA 5CEWA 1B2YA 4XB3A 3W7DA 2XDFA 2PODA 2JKPA 3W9ZA 1XIFA 3SEPA 1MFUA 3IJ7A 4NJHA 2DSVA 2DT3A 2I5IA 1I1XA 2HNEA 3AHXA 2X7VA 3DG6A 2QMKA 1B57A 1JZ6A 1UR1A 1UPMB 2OOGA 1QNSA 3BW2A 5DRIA 3VCCA 4QEEA 2C13A 3NZ1A 1ML1A 2VUNA 3S5ZA 3HPFA 1TTPA 3W71A 1BHGA 4GBDA 3R2GA 4R88A 4IQJA 3PG8A 2VZUA 5FL1A 2OLHA 3W7NA 4HK5A 4Q33A 3ECQA 2B7QA 1LG1A 1YDOA 1OK6A 1WCGA 1I2QA 5EKYA 5LNUA 4Z1DA 5CBJA 5KSWA 4DF0A 3PAOA 4JTSA 2W9MA 1J96A 2D2OA 4Q7BA 2YXOA 4IGSA 4ACYA 5T9BG 3L4UA 1XQLA 3FFSA 2HPMA 2ON3A 1EF3A 2D2GA 4O10A 5MHBA 1V08A 2PGFA 3CAKA 6ALDA 1LDCA 2PP3A 2A0NA 3GU2A 4ML4A 3FA5A 5M5DA 3C6CA 2W91A 3BG9A 4NI3A 3WH6A 3W1LA 4LVGA 3AISA 1YIXA 5FAGA 4K1WA 4CEUC 3VIIA 4PL1A 4G7EA 3K13A 1JIBA 4HGXA 5CSSA 3PANA 1VH7A 5D4YA 4F66A 1SJAA 1ECQA 2WW5A 1E70M 3GTHA 3TDFA 4UWMA 3HMJG 3TROA 4CEXC 1OIFA 1WV2A 1T5AA 2XH2A 4QS6A 4JIQA 1FFQA 1LUCB 1R7OA 3QV7A 1IGSA 2E25A 1VEMA 4LNYA 1C8XA 2HISA 3LU2A 3NO3A 1S39A 5DMMA 1B3OA 3TJLA 2O92A 2B4GA 2CEQA 3CZKA 3AC0A 1PO9A 3VIHA 4PR4A 3I6EA 4L1GA 2FTPA 3WD4A 1M1BA 5D38A 1H5YA 5IFTA 4ZOAA 2ACRA 4F9DA 3VGHA 1XC6A 4GJ1A 1FH7A 5CPTA 1E6QM 1ICSA 4MGGA 1QATA 1N8WA 3U2EA 4GZ7A 1AD1A 2WK2A 2VO5A 2PDBA 3BSMA 4UMCA 5TF0A 4B2DA 1ITQA 4CQBA 5CC7A 2I1OA 4TTGA 3OZYA 5CC3A 2WJFA 1JJKA 1QI5A 4O8RA 1MXSA 2VCCA 4MFEA 1RBLA 3W7PA 5D30A 3V5OA 3A5FA 1EO5A 4UTTC 3TUUA 4V28A 4HA0A 5JH1A 4LBSA 1O1HA 3VU2A 4B4FA 4Q4SA 5TBOA 4ATLA 1JGIA 1JZ2A 1V0KA 3ABXA 2XYLA 3WFAA 4K38A 4GLEA 2B7PA 3MUCA 4JOMA 2R1PA 1B54A 2INZA 4Y9AA 3N17A 4MVAA 1S3TC 2BP1A 1RD5A 3PK7A 1R9ZA 3CZJA 3T0BA 4N7QA 2ATMA 1KD0A 4WRHA 1K8CA 3EXRA 1M41A 3RJXA 4A3QA 1ONEA 2NUWA 2L5HA 4GX9A 2NXGA 2CLEA 4EPDC 5ABHA 1J10A 3PTDA 2B81A 4F0HA 1O4UA 1NWTA 2PWEA 3CPRA 4W5ZA 3T4CA 5BOOA 1OZQA 1UJQA 4JN7A 4O17A 2XIBA 1QJWA 3KTXA 3ES7A 3O2LA 2HK1A 4IWWA 5DY2A 1R30A 1UJPA 3N29A 3M47A 4I90A 3SQSA 4JTHA 2OLAA 3RDKA 2W63A 4JTJA 3C0QA 2FMNA 2I7GA 4V33A 5IHSA 1UQZA 2PUZA 3CBWA 4LY4A 5C6MA 3LM7A 3WLSA 1TJRA 2PWUA 2NQ5A 3UR2A 3AJ7A 5A6BA 1LQAA 3I6RA 1BXCA 4XV0A 1R87A 4Q7IA 3H2OA 3EA3A 4R85A 3W72A 4GX8A 4Q8NA 2Q8LA 3BSGA 2E5DA 3HG4A 1F74A 3H4GA 1E0WA 4ZA0A 1KBJA 2E9BA 3TFXA 3QTPA 1TVNA 5KEZA 2QULA 4EACA 1O60A 3E0VA 3BLLA 4JTCA 3QLLA 4GCXA 3WKZA 1PB0A 4FOUA 5AHFA 5XINA 3RM8A 4W93A 3PP7A 3BLIA 1FUYA 4M82A 1PTAA 1J5SA 1MI3A 1IEVA 2GYIA 3MDWA 3SCNA 3AZTA 1OK4A 2ONEA 1C9DA 4O11A 3VDCA 5AC8A 3G5EA 4AIUA 3II1A 3MBDA 1TWSA 3APGA 4L6DA 3FV9A 1PKLA 5DBTA 1PEZA 1A3XA 1RP8A 2YB1A 1YX1A 2WMHA 3UP8A 1M3UA 3ZVIA 1EUNA 4HZ7A 3OP2A 3L2LA 3VMOA 1UBSA 1WBHA 5C2GA 3WQDA 4LC6A 1OM0A 3DG7A 3A4XA 1O94A 2XZ7A 3WLNA 3GNRA 4QNWA 3IUDA 3CIXA 1UP3A 1RY8A 5D02A 1CIUA 2XTKA 2J47A 1R3VA 1GPFA 4ECLA 1XISA 2HRWA 1W2PA 3P60A 2WJDA 3GFZA 2IS7A 1W5NA 1IEXA 3LK6A 3SY1A 1LF1A 3P8IA 2NWSA 3IIZA 1RXOB 2XFFA 1NF7A 2WMIA 2XVGA 2PRMA 3RIKA 3WL0A 4ATDA 4A8NA 2O56A 4N6EA 3WQPA 2HQAA 4UTHA 5FIPA 2CXGA 2DVTA 5I09A 3UF9A 1LBMA 4BS0A 1H4PA 3QM3A 1TPB1 1XLAA 2CFFA 2O9TA 2PE4A 5GJMA 1ELSA 3W6MA 5E1QA 5ABFB 3KS5A 3FIGA 3VX0A 1EDQA 2PBOA 3GVWA 2OEJA 1PYFA 4H7VA 1QFEA 1IEWA 2JBMA 3N2OA 4Y9MA 3QV9A 3GG8A 4JHMA 4GH1A 4QM1A 1S46A 1Z6KA 3NPWA 2FDSA 3SBFA 4JQ1A 3MKKA 1SFTA 3URAA 1R3YA 3DC8A 3VVGA 4H8VA 1R85A 1S2WA 1V3IA 3QZEA 3WQGA 1MW1A 4HU3A 3O6YX 3S2LA 4YU1A 4FNSA 4HNCA 3N25A 3F4VA 2QCMA 2WMIB 4OV9A 4RZBA 3NZGA 4Y9NA 4JTGA 1HJVA 4ACZA 1RVKA 1VF8A 4PMDA 5K3VA 5HJLA 1XBVA 3P61A 2OU4A 2VYOA 3TC7A 4IMAA 5I3FA 4DJDC 4KKXA 3L4WA 1FTXA 4H6EA 2GVYA 3IIOA 3OQEA 3OLDA 1S2VA 5FJTA 3ARYA 3V7PA 3VAVA 2BHUA 1W17A 3VD3A 1RQHA 3PFRA 2X0YA 3BH4A 3W83A 5LIWX 1TQXA 3QFEA 3LXAA 4WCJA 1GW1A 1CENA 2W79A 3GB6A 3EDEA 1FFRA 2IKGA 1K6WA 4LBRA 1AMKA 4REQB 3PB2A 3KBVA 1ZENA 4HT3A 1QHPA 3XIMA 2YZ5A 1XIIA 4LB4A 1TCMA 2IUZA 1J6OA 3APYA 3GZAA 3UG5A 1P7TA 1G94A 4KH2A 4O16A 4REQA 4EXQA 3WDHA 3QC3A 4WD0A 5BRBA 4B5UA 5FD0A 1MWOA 5AZ0A 3NL2A 1L6FA 5K4ZA 4XD5A 3FA3A 1ENUA 1KM4A 3BCJA 3KL5A 3REQA 1BKSA 2ZX8A 5BWFA 1QNVA 1W3NA 3FLUA 3VKAA 3B0XA 3O6CA 2OXNA 5DMLA 2YCLB 3OW1A 1DQUA 2P53A 2I56A 1EKOA 1GOKA 3EWWA 4IPLA 4ONVA 3FW6A 3CL6A 2GK1B 4UFIA 2B31A 2Z2BA 1JXKA 2BWGA 1TMLA 2ZXAA 4KQNA 3MO7A 2B7OA 3W1QA 1EZWA 4U33A 3ABRA 4PMNA 3GVGA 3NQGA 4DWSA 3RK8A 1KFEA 2H6RA 1UMYA 1XLCA 3L21A 2QPSA 2FGLA 4L4LA 4XZIA 1K7EA 4NX0A 1LP6A 3T44A 2FIQA 1C92A 5AYZA 2GQAA 3I7SA 3MYOA 1HUVA 2CLOA 3B8TA 1F76A 2BTMA 1O1ZA 4PL2A 3TQ0A 1X6UA 1V7AA 1SW3A 2A5HA 4JYFA 3UXKA 3KWXA 2J9XA 5AC7A 5G4HC 2WCAA 2VEGA 2Y24A 3WF3A 2V8ZA 3E5PA 4HN4A 2QDHA 5H8UA 4PCPA 2XIJA 4G6CA 4QSFA 1W3IA 1U33A 1JDCA 4UBPC 3VIFA 3VIKA 1SW7A 2I14A 3NO5A 4OOZA 5EU9A 3KS6A 3MUAA 3LCXA 5DCBA 5IDZA 3WF4A 3TKFA 5LNRA 3TH6A 1EC8A 3IIVA 1RQBA 4JCMA 2HE5A 1WZLA 4N9BA 4K8EA 1TX0A 4QG9A 4ZENA 1OYCA 3AXHA 1FCUA 3MC5A 4W8BA 1IYXA 4ALDA 4NNAA 3RYSA 4S3DA 3K5XA 1RUSA 1X38A 3V16A 3MHFA 4GFSA 2V68A 1BVZA 2E6YA 1QBBA 4I3GA 5LXXA 2REQB 3AS3A 3A13A 2VGBA 1UR2A 4DO6A 5BXRA 2PZNA 1CCWB 4TTUA 3G8RA 4XVEA 4NZJA 1I6NA 4PB5A 3HJZA 3C3UA 3STCA 3FK4A 4AEOA 3UZ5A 1ZALA 5CJNA 1GYNA 2ZZ4A 2WAGA 3V0UA 2YA1A 3SFWA 2Q3RA 3S5YA 3UJSA 3VZXA 4LCSA 1US2A 3T0AA 4IPJA 3W1NA 1EJXC 4OECA 4HMNA 3ITLA 3N2XA 5E09A 4IUGA 4C91A 1OC7A 2JKAA 3THUA 1B3YA 5FSEC 1ZY9A 5G1YA 2R6OA 1PX3A 5A8OA 5LIXX 1F6PA 5CPMA 1X96A 1E1CA 1TJ1A 1W56A 4C6JA 4LOCA 2AMGA 2NQHA 5FA5A 1PX8A 2PLCA 1CI1A 3ATZA 1OZMA 3S9ZA