1B57A

Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
358
structure length
346
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEELYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Escherichia coli class II fructose-1, 6-bisphosphate aldolase in complex with phosphoglycolohydroxamate reveals details of mechanism and specificity.
pubmed doi rcsb
molecule keywords PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
molecule tags Lyase
source organism Escherichia coli
total genus 138
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b57A00
1HFBA 3G1HA 3GXNA 1LBFA 4O17A 1PIIA 4CNOA 2C15A 5EYWA 3TFCA 1K02A 2QUVA 3W07A 4DF1A 5K9DA 2ZZ4A 2WO5A 1EB3A 1FCQA 1IXOA 1OHLA 1S5TA 2VFEA 3WFAA 3EX3A 3LRMA 2P1FA 1KFLA 4UTHA 1PV8A 5EMUA 1G4TA 3MO7A 1D3GA 5KSWA 3RFAA 3H53A 3ZS4A 4EF8A 2E68A 1PL9A 1ZFJA 3W9ZA 5G1YA 2C0AA 1XUZA 3EXTA 1JCXA 2J6XA 2H3DA 3UWVA 3NDOA 1GVQA 2C14A 2V2DA 3R12A 3B0UX 4GUJA 3C3NA 4PCFA 2ISWA 5FF0A 5F4WA 3W75A 2W6RA 1XCFA 3NPWA 1LRTA 5J5DA 5A8GA 2AGKA 1SW3A 4CNPA 4FXSA 1RQHA 1ICPA 1LDCA 3NZ1A 1ZAHA 4IMCA 5U7SA 3VNDA 3TUUA 3LOTA 1HG3A 3L5AA 4CQAA 1LLWA 1EP3A 2Y61A 4JX5A 2ZQ0A 1KM2A 3CPRA 3UXAA 3UD6A 2VFGA 4MPQA 4UTUA 1KFEA 1ZAIA 3C8FA 3EWBX 1VCGA 1WX0A 4R53A 4NU7A 1KM4A 3UY8A 4ZQCA 4KFNA 4LV9A 3VKJA 1YXYA 3QPZA 3Q94A 2ISSA 2RDTA 5I3HA 2RDWA 2ZZ7A 5CSRA 3IIVA 1OYAA 3N2XA 5DN1A 3B8DA 4GUIA 2J88A 3DKJA 3LBMA 1OFDA 2B7QA 4FNTA 2RHGA 1CX9A 3MJYA 3NG3A 4I7WA 4BWLC 5G5IA 1H7OA 2QJGA 3TQVA 1SO5A 1LBLA 5H91A 1SSGA 4Z1CA 4KWVA 4RLIA 2Z6IA 3Q58A 3M9YA 8TIMA 5HNRA 3OHIA 2JKAA 1R2TA 1VCVA 1XXXA 2V5BA 4M6PA 4K8HA 1W31A 2FJKA 3FJ6A 3A5FA 2VELA 3BG5A 1CI1A 2W79A 5FF7A 2V82A 3SSJA 1QPRA 1YTKA 1KLZA 4O14A 4WY0B 1YDVA 1VHCA 1Z42A 3NQCA 3M5XA 2CFFA 2QKFA 4FNUA 3MP3A 2NXHA 2OZ0A 4AHQA 3LXAA 5K7JA 3NQDA 3C6CA 2B0MA 2J24A 2WNQA 3QSTA 4JXCA 4BF9A 3PBWA 5DLCA 1JVNA 1YADA 3MBFA 1ME8A 5EKYA 1DORA 1ZENA 5SWUA 4MY1A 5F2LA 3LRKA 1G4SA 5FEWA 1TO3A 4K37A 3HG3A 1OYBA 4LY8A 2QJHA 2VEIA 3B03A 1G7UA 2DZVA 1FUYA 5KMYA 5CGQA 1G4EA 3DAQA 1FDZA 1GYNA 3NQ8A 5FESA 4M7TA 5AHIA 2YR1A 3I68A 3SJ3A 2CU0A 2Y63A 3W1RA 3LGEA 5HINA 3S8HA 5FEXA 2NUYA 1R2RA 1XUUA 1ZAJA 3EWXA 3PBVA 5E0KA 2EPHA 1VLWA 2HS8A 1GYLA 2A4AA 1FXQA 3NOEA 3WJWA 4LVBA 5AHFA 4O4VA 2R14A 4MLJA 1QDSA 1WAUA 3TA6A 1GZGA 1OJXA 3FFSA 4LS2A 2QCNA 5HJLA 3O6DA 3LDVA 4WD0A 4K7YA 3DZ1A 3LHWA 4OHQA 2QCGA 3RK8A 2Z6JA 2JKPA 4O16A 1SR9A 3HG2A 4UTTC 1SW0A 3NGJA 1UB3A 3GNDA 3DFOA 2HMCA 2JKEA 4LC8A 3P60A 4JYEA 3ABRA 4EF9A 3D0CA 4XWUA 5AB3A 3EKLA 3RF9A 5AC6A 1EP1A 1W5QA 4DF0A 2OMAA 4HNUA 3GXTA 3WJYA 3W7NA 1GPWA 5HUOA 1VHNA 3ELFA 1TV5A 3LCFA 2A85A 3VE7A 1KTNA 4EIVA 3EXSA 4RV8A 4WY0A 2Y62A 3LERA 3THQA 2NWSA 2CZ5A 3CM4A 5DBTA 3PC0A 1MZHA 3UNDA 2C18A 5MHBA 3HF3A 2G96A 2ZRUA 2FIQA 3TFXA 3IEBA 4GXMA 1KFJA 1VGAA 3W7KA 2E5BA 1P0KA 3W7PA 1JCJA 4WY0F 5TIMA 4M7SA 1RV8A 2ZZ3A 2VFDA 3LV5A 4CLMA 4MY9A 3CWOX 3KVKA 4K39A 4O1BA 4QM1A 3W1UA 1OYCA 1P0NA 1DV7A 2ZZ6A 1QMLA 2H90A 2Y7GA 1KBIA 3NNTA 5AHNA 3S5OA 5D09A 4HN4A 2QUTA 5FEZA 3T40A 1JR1A 4DXVA 1TTQA 3QMSA 2C16A 4I9AA 3OBKA 4M6QA 3I6RA 1AG1O 5GVJA 3NQ6A 1UJPA 3HPSA 2QEZA 1RQBA 2V8ZA 1X7FA 1FCVA 4O28A 4QNWA 1H7RA 4B5NA 4LVFA 3H54A 3P74A 4PL1A 3CLMA 4X9SA 1X1ZA 4KFPA 1OF6A 1FWRA 4MYAA 5FF2A 1H5YA 1TTIA 4GNJA 2DJLA 3MW7A 5D2YA 1TB3A 3TSMA 5KITA 2NV2A 3LHUA 2DZPA 1WA3A 3SECA 3A5VA 3GZ3A 3EX6A 2NV1A 1MEHA 1H51A 5AYYA 4LW7A 3EWUA 3JRKA 3TC7A 1O4UA 1QCWA 1KFCA 3GX9A 4UR8A 3TU9A 1J4EA 4P2VA 1Q6QA 2A6LA 3L0GA 3T78A 5D38A 2V81A 2EKCA 3WK3A 3I65A 1FWTA 1XL9A 4L4MA 2X1TA 3N9SA 5EA9A 3QPYA 3FKKA 5LZLA 2FPYA 2H6RA 1KA9F 1VR6A 4JYDA 4FX7A 4Z0SA 2CWNA 4OWGA 3TC6A 2DP3A 4JY8A 4M19A 4FF7A 3WJZA 2X16A 4WOQA 2OJPA 1R46A 3LLDA 3E9AA 3BV4A 3MHFA 4U28A 3BLFA 2RKXA 4O53A 3DU0A 4QIUA 5D05A 1LTDA 5HWNA 2YCEA 1W3TA 1BEUA 1GWJA 2V5LA 1SO3A 5DXXA 3CTLA 1LRNA 4MKNA 3PUDA 3AO0A 5AFDA 5FF3A 5AC7A 4BI5A 4XTIA 1D3HA 3QW4B 1OX6A 4UMCA 1YYAA 1XI3A 3L67A 4ML9A 3TR2A 3W88A 2JK2A 2FB2A 1DJNA 2I14A 2PCQA 2WNZA 2J9YA 2GJLA 4JX4A 3R89A 3G1FA 1PHWA 3STEA 2WPBA 4R34A 3W2NA 3QEZA 2X2GA 1RD5A 1WOAA 3LCWA 1E51A 4WXZA 1TPWA 4JX6A 4HNVA 1G4PA 3BLEA 5CPOA 4UR7A 5LNSA 4MJZA 5DCEA 1FCUA 4ZVJA 3N2MA 3TSBA 2VOMA 1AW2A 2I1OA 4IXHA 2AQWA 2R91A 4DO6A 4QISA 2QDHA 3BW4A 1LOLA 1XKYA 2A7NA 4IX2A 4OE7A 2ZRZA 5F1UA 3TMQA 4WUIA 1BWLA 5EPDA 4GJ1A 4WXYA 1W54A 3NEVA 1OX4B 3MUXA 2DJXA 3KRUA 3DHDA 4JTTA 1ME7A 1OF8A 3H55A 3HQ1A 3NPXA 3W23A 3CEPA 1A53A 3W71A 5HR6A 2WQPA 1QOPA 2E1DA 3DH7A 4PA8A 2ZTKA 3UPBA 2GVJA 3NL3A 4RX0A 2VEKA 4G1KA 3BK0A 3TX9A 4NT0A 3EWYA 2FPTA 3ZR4A 2J9ZA 3PM6A 4WJEA 2J9XA 2WOQA 4BI6A 2BSLA 3BGGA 2DZSA 5HUPA 4XQ6A 1K8YA 4ZQMA 4O11A 3S5ZA 3TJXA 4JDBA 2GQAA 1MEIA 3U2OA 1VPXA 1N55A 4JR5A 3GK0A 4Y6GA 5KTLA 4RR4A 1LORA 3F03K 4O1CA 3DGRA 1B3OA 1P1XA 3WK0A 2X1RA 3P8JA 3UWWA 3NQEA 3GLCA 1AW5A 3LCIA 2TPSA 3DI1A 1YPFA 4JYFA 2PE4A 1W3NA 1SO4A 1K7XA 3G18A 3KFTA 5D2TA 2OX1A 2C19A 4YCPA 3CIXA 1TIMA 1DKWA 5AHEA 5KZEA 4UNLA 1QPNA 5K4XA 3M7WA 1HUVA 3QFEA 4YL2A 1F6KA 3GB6A 1WBHA 3F4WA 5LGZA 4XZ9A 4UFKA 1H63A 1M5WA 1F73A 3ABOA 3P80A 3W1XA 1TPH1 3BO9A 1Q6LA 1O5XA 1GT8A 3LCLA 4C1KA 3OG3A 4HIBA 3Q37A 3W2JA 2B7PA 5I3JA 4I7UA 2NZLA 1P4CA 1U83A 4ZQPA 4K36A 1OX4A 2G97A 4JTUA 4UUIA 1JQVA 3KX6A 2C3ZA 2P0OA 5CZJA 3UWUA 4FX8A 4HNNA 4JTIA 4PFMA 1VYPX 3TKFA 5HWJA 1TTPA 4UTJA 3N9RA 5DBUA 3FS2A 1V7YA 4O0ZA 3N73A 4DF2A 2JBMA 1G7VA 4RKAA 1H7NA 4M5PA 1RZMA 3W76A 1OX5A 1KM0A 2DZWA 3SGZA 1XM3A 6ALDA 4IGHA 1SZFA 3L65A 3TROA 1JULA 3JR2A 1NSJA 4LVAA 4WOZA 3JS3A 3W2UA 5AYXA 4LOCA 3TSDA 3K30A 1ICSA 1AW1A 1GG0A 1W1ZA 1F6PA 3TAOA 1WDWA 3WK2A 4EVZA 2Y7DA 3QQ1A 3R2GA 2GVGA 3PG8A 5E1QA 1GQNA 4N02A 4AHOA 1WV2A 3M43A 4IMDA 4IMEA 3G3MA 3O8AA 4R7JA 1A5SA 3LCHA 4ORMA 1LOQA 3KXQA 1LOSA 3P62A 2OT0A 4IPJA 5CZSA 3O15A 3O6CA 5D37A 1TPDA 3CHVA 1O94A 3O07A 4BWLA 2V9DA 4A29A 2VENA 3BW3A 3KRSA 2GVLA 2E5DA 3RMJA 1F2JA 2FDSA 4Z1AA 4MOZA 2CW6A 3P5ZA 3RLVA 2E5CA 3CIWA 2W0UA 4KWWA 1OABA 1H50A 4DBDA 4ZL1A 1KLYA 1NF0A 1I2QA 1C29A 5I3IA 5DY2A 4IMFA 1KFBA 4Y8FA 3SFKA 3CU2A 1OK6A 1MSSA 1VRDA 3G1SA 4IPIA 1GJPA 4UXDA 3HJZA 3UZ5A 5I3FA 3OVRA 1BTMA 3W1PA 3PY2A 1G6CA 3PWAA 1VYSX 3IGXA 4UTWA 3WJXA 1A5BA 2BTMA 1IXNA 3IIXA 4NX5A 2CLOA 5I3GA 1KTCA 4O13A 3GDLA 1DOSA 4RZ6A 3UPWA 3SI9A 1H1ZA 4L4LA 4ZQOA 4MJMA 3BPWA 5KZDA 3STGA 3PG9A 4HSNA 4O54A 3NQ2A 3U8GA 3W1MA 4LNYA 1FDJA 1IIGA 2D73A 1HL2A 2WV8A 3L5LA 4K7VA 2X1UA 4U4MA 2H3BA 1AK5A 3P67A 1OFEA 2GQ8A 4Y96A 1MO0A 1JCLA 1YLVA 3KAOA 4ICNA 3CEUA 4S2BA 2NUXA 2YYTA 3MP5A 4UFMA 5T26A 4X2RA 4ALDA 5CPMA 3USBA 2RFGA 3ZWTA 3LRLA 3PUOA 1QPOA 1RR2A 4K8EA 2VEMA 3O1NA 2GOUA 1NAL1 2QF7A 4WZHA 3DFSA 4D2JA 2Z1BA 3IIOA 1TQJA 2PURA 2E6YA 1YDOA 3G1VA 4O15A 4QNEA 2ZYFA 3S1VA 3G22A 1PCWA 1TV8A 2V2HA 1K8ZA 4GFSA 2VFIA 3MHGA 3E0IA 4RK8A 3SIZA 1BKSA 3HBLA 3V75A 1TPEA 1GVOA 2ZDRA 2NUWA 1TRDA 4UMAA 1R30A 3NQMA 5CKSA 5EY5A 2CLFA 2CLIA 1YTDA 1AL8A 2EHHA 3LTSA 4LVDA 3KRZA 4PL2A 5LNUA 4LVGA 1JJKA 1TQXA 4YMZA 3S5NA 3BGJA 1PE1A 3TXVA 4NJIA 4DO4A 4LU0A 2QCFA 4Q32A 1YXDA 1OFAA 3S42A 2VC6A 4UMBA 4QAIA 4W9TA 3LHVA 1Q45A 4XBSA 3G0UA 4DBEA 3L0NA 3WJSA 3TQ0A 3L66A 2A5HA 3GDRA 4LC6A 3P82A 1GTHA 3DFNA 5LHFA 3QM3A 3FEMA 5D2XA 3SR7A 2WJZA 3KHJA 5TQLA 3NL2A 1GEQA 1Y0EA 4A2SA 2QCMA 3GDKA 1V5XA 1W56A 3P84A 5CZ0A 1LZOA 1SZGA 5K9CA 1UBSA 3F4NA 2WSQA 1AMKA 3PAJA 4O50A 3W7JA 2XN1A 2Y89A 5AHLA 1HO4A 3W2LA 4TIMA 3B0VC 1OFOA 2FLIA 4MIMA 2ZBTA 3GKAA 5C54A 2QDGA 4H3DA 4UFIA 3W74A 3EX2A 5G1TA 4JTSA 4H4IA 3LI0A 3FOKA 5G4WA 4ADSA 1UUMA 4E0CA 4O52A 1L6YA 1FWWA 2GQ9A 3W22A 3IVSA 2QCEA 5F1VA 1I4NA 4AWTA 2ALDA 2Z0IA 3NQGA 4QSHA 1UUOA 1W8SA 3IIZA 2VEPA 3EX1A 3W72A 4AEOA 5C5YA 3S9YA 2V2CA 5DCDA 3W7GA 1L9WA 1B4KA 4FO4A 2YX0A 3F1QA 4FXRA 3NO5A 4NNAA 4PODA 2G5WA 5F2GA 4AF0B 1ZCOA 2YW3A 4JS3A 2KZHA 3W2KA 1XBVA 3FLUA 2ZRVA 4N9EA 4LS1A 1LYXA 4AXKA 4MZ8A 2NWRA 3DFTA 4QITA 1KW1A 5D03A 1QR7A 3NZRA 1RVGA 3E96A 2FQIA 1ADOA 1Z48A 1ME9A 3QJAA 2XFWA 1JUKA 4JIPA 5D32A 3W73A 1VYRA 4LS0A 4O12A 1GTEA 1TSIA 4NX0A 1DL3A 4JTHA 1LLZA 1SFLA 4LUJA 1S3HA 3WK1A 4BFAA 1DQXA 3QH2A 3NAVA 5BNKA 1G67A 3ZFHA 2CLEA 2EAWA 4JTEA 3PUEA 2C1HA 4NNCA 4PC8A 4MVAA 1FDYA 1IF2A 2XN2A 4IXXA 4LTSA 2ZCGA 3W1QA 3IGUA 2B7OA 1H60A 2PC4A 5D33A 2NX1A 3AJXA 2FFCA 4UFJA 2TMDA 2A7PA 2ATMA 1P5BA 1ZALA 4NJHA 2V0TA 5K4ZA 4NZJA 1YPIA 1TPFA 3KVLA 2X30A 4YXGA 3RNDA 3EWWA 3TW7A 3INPA 5IM51 1IXPA 4O10A 1NEYA 4OBTA 2EGZA 2ABAA 3B4UA 2E6AA 2A21A 3NQ7A 4OV9A 2XN0A 2CZEA 7TIMA 5C2XA 4JIQA 6TIMA 1H61A 2UV8G 3EEGA 3QMRA 4GC4A 1W0MA 2QCLA 4MZYA 1O5KA 1EIXA 3MYPA 3ATYA 4NXSA 4UTKA 5LKYA 3W86A 5DELA 2NX9A 3TE9A 3G1XA 3HOJA 2E77A 3N14A 3O06A 4AF0A 3UXDA 1EWDA 1XC4A 3IV3A 4MFDA 3LI1A 2BWGA 3NQAA 3TIMA 2ISVA 3LHYA 4KKXA 2Z2UA 4OQVA 2V30A 4CCEA 3QZEA 3CC1A 3HIJA 1EP2A 1SUXA 5C55A 3TCEA 3I7QA 3G1DA 2VFFA 5L9FA 4MYXA 3M5YA 3GR8A 3EKZA 1TRIA 4BK9A 1FCBA 1ML1A 1EUNA 1FWNA 4JN6A 5FI8A 1S5VA 5TBOA 3W2MA 1RPXA 4HKPA 2O7QA 1F76A 2RDUA 3B04A 4X22A 3LM7A 4HSOA 1D9EA 3W70A 2QAPA 3A24A 3P8IA 4HPJA 1FBAA 5E93A 4UCGA 4JTFA 2BLEA 3FIGA 1X1OA 1W5NA 3FYOA 1X8FA 3OEXA 4DPPA 4YWIA 2DU2A 1H7XA 5LSMA 3L2IA 4A3UA 3NQVA 3S5YA 4CQ8A 3M0ZA 2CLMA 3P5YA 2QR6A 1O95A 2ZRXA 2Q8LA 1SU5A 1HO1A 1SO6A 2CZDA 3L5MA 1TPUA 2NLIA 4E2DA 1I2OA 4N9CA 5HULA 4ONVA 1SW7A 1JQXA 3SZ8A 3L0KA 4N6EA 3G0XA 3QW3A 5IBXA 1H7WA 2QCDB 2R8WA 3M1ZA 1QFEA 4AWUA 2A2IA 3HGOA 1L6WA 4A2RA 1FXPA 2YGYA 3DHFA 3TK7A 5CZTA 3TXZA 1KM1A 2QAFA 3MI2A 2C13A 3P61A 1KV8A 1K7FA 3ZWSA 4JD4A 3PBYA 4DELA 4MZ1A 5F4SA 2Y6ZA 1VZWA 1G69A 3NA8A 3PBUA 3ANYA 5BMWA 1THFD 5D2WA 3TJLA 4JTGA 1W5PA 1BWKA 5HQEA 3LHTA 5ABTA 3THAA 4NNBA 2YFOA 1WOBA 4FNRA 1F7BA 3BG9A 3L68A 5LNVA 4AB4A 2B4GA 3W85A 3MP4A 1QNVA 4ORIA 3N34A 1DJQA 4HPXA 2Y7FA 1JCMP 5BOOA 1XDMA 3HMJG 2FPVA 3OVQA 5AOUA 3GDTA 1VQTA 2YDAA 3HPZA 2O7SA 1MXSA 1CW2A 2H8ZA 3B06A 3NXFA 1QAPA 2WNNA 2WSYA 1LP6A 3GR7A 4GWEA 1TTJA 5K9XA 4CCDA 4QJ1A 4K38A 4I7VA 2F84A 4CNNA 1WYIA 3FJLA 1C8VA 3QRHA 4DQWA 1TPC1 3M6YA 4MLRA 1C9DA 3C4UA 4O1AA 4PTNA 3GYEA 5HMSA 4RZ4A 1TPVA 1ZHAA 3O63A 3BVJA 3NQFA 4TMCA 3I7RA 2BX7A 3P7YA 2YFNA 2PRMA 3PB2A 2FB3A 2QCHA 4LUIA 1K8XA 2TYSA 5G2IA 5AC8A 3TNOA 4MFEA 4UC5A 4IWWA 4NQ1A 2GJNA 2C6QA 2QCDA 1NF7A 1OFPA 3S1XA 1FQ0A 3W7MA 4JICA 2NXGA 4ZQRA 5FF4A 2X1SA 3GKFA 2DORA 3GDMA 4H6KA 1OFQA 4GRSA 5EBUA 2YXGA 3T4CA 3G1YA 3NPUA 4LWWA 2YW4A 3DKLA 1VH7A 3GIYA 3GAYA 3W7IA 3A22A 5D2VA 1EA0A 4O4WA 4Z1BA 3TQKA 5DXYA 2PRHA 1KM5A 5F2MA 3CT7A 1YTEA 5J5RA 4BR1A 4RXFA 1LRQA 3W1AA 1VJIA 1EPXA 1VLIA 3E49A 2R94A 1KM3A 1L6SA 1F74A 1GVSA 2HTMA 4NUWA 3TH6A 3W7CA 1W37A 4KFOA 1W5OA 4K6AA 3W7LA 1K03A 3PSWA 1VS1A 1W5MA 4IMGA 5KZMA 4C1LA 2VXNA 4LRTA 5FEPA 2CLLA 2CLKA 4FNSA 4UTWC 3T7VA 4TMBA 3TW6A 1JRBA 5KINA 1H1YA 2JGYA 3DFPA 4ZZ9A 3MYOA 3S6DA 3NM1A 4JTKA 3MI3A 1KBJA 3DFQA 4UIOA 2DZXA 3NL5A 3GXPA 3A21A 3QMTA 4AWSA 3UY7A 2GUUA 3UWZA 4TX9A 3M5VA 2ZZ2A 4WQ6A 3NVTA 1B9BA 4ZMGA 2OT1A 4GUHA 3HG5A 2B7NA 3DENA 1R47A 5LNRA 3MWAA 3IGSA 3M5ZA 5DY3A 3EXRA 2ABBA 3OIXA 5G2HA 3W7QA 2ZRYA 5LGXA 1F05A 4O57A 4NJJA 1JCYA 5EL1A 3DBPA 3VCRA 1N8FA 2E6FA 2Q3RA 2BXVA 1Q6RA 2Y88A 1SQ7A 2VKZG 4NXKA 4AH7A 4UTTA 2A6NA 4IUOA 3NM3A 3L21A 4AAJA 3QF0A 3C2OA 4XTDA 5D02A 3SW6A 3LXCA 1EEPA 2JGQA 3R13A 2ZZ5A 3S0CA 1M7OA 4E38A 1XBZA 1JUBA 3LHZA 1NVMA 1EX5A 1TJRA 5AHMA 3B05A 3ABQA 1Q6OA 5D04C 3G24A 2FTPA 4GBUA 3LLFA 2CLHA 1GG1A 3QYQA 1I2RA 4M6VA 5A5WA 3PVFA 1A5CA 1H7PA 1W3IA 2E6DA 2WKJA 1EUAA 3P81A 1KFKA 5DCBA 3PULA 1TPB1 3SGUA 4WX2A 2A0NA 2WSRA 2Q3OA 1TREA 4IJBA 1ZNNA 3STFA 1AL7A 1B57A 3PR2A 4LT9A 4HT3A 4J9JA 1PVNA 1I8JA 4Y9AA 1T96A 5D30A 3TMLA 4MUZA 1M6JA 4UNKA 3W7DA 3IVTA 4DO5A 4IX0A 1XFBA 3ATZA 3O05A 3M47A 3EX4A 3BLIA 1Q3NA 3PB0A 4JGDA 1A5AA 1FWSA 1IXQA 4N4QA 1QWGA 1KTBA 2P10A 1TMHA 3UYCA 5BMXA 1KV5A 4O19A 2IQTA 4UTIA 4S2CA 5K2ZA 1EWEA 4LRSA 2ZZ1A 1A50A 5F4XA 1DHPA 4BI7A 1KM6A 3EWZA 4N9DA 3NR0A 4FIQA 3O16A 4JDYA 3V1PA 3QQ0A 2Q8ZA 1WBJA 2QCCA 3MBDA 1Z41A 1FY6A 3FYPA 3W7RA 4IOTA 3HO8A 4FNQA 3C61A 3HGRA 3R5EA 5C6MA 1ZY9A 4OGZA 3G8EA 3G8RA 2ZTJA 5G2WA 3GAKA 1QO2A 1GVFA 3G3DA 3W83A 4OU1A 3LB0A 4EWND 3E02A 3B0PA 3LTPA 1JCNA 4O0KA 3S1UA 3C2FA 4PH6A 2ZA3A 5L6UA 3UZJA 4TU1A 3GNNA 3IRDA 1I2PA 5CPLA 1LM1A 3UQNA 1DBTA 1ALDA 3C56A 3HB9A 4CQ9A 1SZEA 1QO5A 4YCOA 2HS6A 3PF3A 2LLEA 3M44A 4FB7A 1HTIA 1ICQA 1RQEA 1UASA 1NFBA 3PS7A 3HGJA 4ADUA 1Z44A 4EOUA 3RLUA 3CQ0A 5HR7A 4A21A 3NL6A 3TDFA 1LCOA 3OA3A 4RXGA 3HPXA 3C2RA 1JRCA 1YXCA 4PEKA 3BW2A 2HSAA 3FKRA 4N2YA 1T8XA 4O8RA 1GOXA 4MY8A 3W3OA 3W84A 4RJEA 1XDLA 4Z08A 2YPIA 4GUFA 3W7EA 3I7SA 2RH9A 4XBKA 2I9EA 4AHPA 3IIPA 1XBYA 2DZTA 2NXIA 3NPVA 3NYZA 1MEWA 3PSVA 3R8RA 5F2IA 3CB8A 4FNPA 4FHAA 5H2ZA 3YPIA 4N6FA 4TR9A 5CG7A 4JTLA 4JEQA 2TRSA 1OFBA 4DPQA 1SSDA 3W7OA 3MI6A 4OT7A 3L9CA 3RU6A 4NJKA 3W1TA 1PHQA 1VC4A 4AVFA 5BW6A 2PRLA 3BARA 5LHEA 4R33A 4TO8A 3TV8A 3ABSA 4Q4KA 1LBMA 3DXIA 1OVDA 4E2BA 4Z1DA 1K3UA 3HGSA 1SPQA 4IQLA 3VE9A 4ZQNA 2Y7EA 1R2SA 3Q2DA 3S1WA 2H8XA 2A1YA 2GPTA 1I2NA 3SY5A 1FX6A 5CSSA 1IGSA 4OV4A 3C2VA 4Y90A 1TYGA 5G4EA 5LNWA 2NX3A 3QSRA 1ONRA 3CWNA 1UCWA 2F7FA 4S1FA 2EF9A 3LV6A 4LV4A 4JTJA 3N3MA 1X6UA 4O18A 4UTLA 4XKYB 1JUEA 1DQWA 1L2UA 1OG0A 3FA5A 1F5ZA 3LTYA 1K7EA 1J5TA 5CPNA 4NVTA 5U4NA 4AMAA 2OCZA 3LCGA 1I45A 3QC3A 4GUGA 5I3KA 3N19B 2G95A 3KVJA 1PCKA 3GVGA 3VFLA 5K3VA 3LX9A 2ATSA 1YDNA 3M41A 2J27A 3A9IA 4XUGA 1N7KA 4FEZA 1TCDA 2ZRWA 3DI0A 1PS9A 3A23A 4DEFA 5BRBA 2ZA1A 3UWYA 1SFJA 2YSWA 3C0JA 1OK4A 3HG4A 3E12A 1O60A 4RCXA 1SZNA 1T0OA 4N4PA 1B4EA 1DVJA 1QPQA 2AAMA 1M7PA 5AYZA 4HHPA 3KOFA 3VI2A 3W7HA 4JNMA 3TAKA 2Y70A 3C52A 2TSYA 3LBCA 3G0SA 3BG3A 3C2EA 3M16A 3EB2A 4YLWA 2ZFAA 1VCFA 4Z0JA 3STCA 3T55A 1XBXA 2YYUA 4ADTA 1S5WA 2A7RA 1H62A 4NJGA 4QQ3A 2VFHA 4Q33A 4FX6M 3OVPA 4O1DA 3W1NA 2BZNA 2ZA2A 1IIHA 1ZJIA 4X3ZA 4A22A 4POCA 1T99A 2E09A 3T44A 4N9BA 2QUUA 5IBXC 4HNTA 4UFHA 3W87A 1WQ5A 2DZUA 3G1AA 1TV7A 3W6YA 2Y85A 1GVRA 4UTMA 1J2WA 3MMTA 3U6WA 1U5JA 4XKYA 3W1LA 4UFLA 4CCCA 5HWMA 2YZRA 3UWQA 4FIRA 4JY9A 4RZ5A 3IVUA 1QOQA 3MHUA 4NZFA 3O6YX 1LROA 1TJPA 4P61A 1OFRA 1WXJA 3LCXA 5AN7A 3KVMA 4GE8A 2CZFA 2QJIA 3LXBA
chains in the Genus database with same CATH superfamily
2SFPA 3GXNA 1LBFA 1UOZA 4U3AA 3TFCA 1MRAA 2QUVA 3W07A 1L6FA 4BS0A 3GXMA 3AQUA 3PJUA 1S5TA 4Z2KA 1AZ2A 3WDRA 3K4DA 2OYMA 2AMGA 3EX3A 3LRMA 3POCA 3ZR6A 3RUBL 1FWCC 1KFLA 1OM0A 3RJYA 3MO7A 4EF8A 3AFBA 4NAFB 2AL2B 1ZFJA 3W9ZA 1EYEA 1KRAC 4KT2A 1JCXA 2J6XA 1VF8A 3B0UX 1TZZA 3IUDA 2J7FA 3AS3A 2ISWA 3H6OA 3UJ2A 1ISYA 1EO7A 2CESA 1QHPA 4IICA 2Q01A 1OCBA 3LOTA 1XRSA 2Y61A 5FJOA 2ZQ0A 1KM2A 2C8NA 2D2GA 2HWGA 2VFGA 2GYIA 1RLDA 1T41A 4IGSA 3K4AA 1VCGA 4R53A 4NU7A 1XGEA 4ZQCA 8RUCA 4J28A 2OSWA 3QPZA 1BKHA 3A13A 2ISSA 1XWYA 2ZZ7A 4GVIA 1QUMA 1AUSL 4CVWA 1TUFA 5DN1A 2PSNA 2PS2A 4C6EA 1Y5XA 2V5DA 2B7QA 2CHNA 2EPKX 7ODCA 2CBVA 2P76A 1BVZA 1CX9A 2R24A 4U33A 2GUYA 1JGIA 3QV6A 1PIFA 1Q63A 2VP8A 2QJGA 4IP7A 1F8MA 5M5DA 4HCHA 4KWVA 3BTNA 4TUFA 2PLCA 1DE5A 1EGZA 3BICA 4TVUA 3CUXA 8TIMA 4HZMA 4YVVA 2VC9A 2BOGX 4YWSA 2V5BA 1IEVA 1DWGM 2QGYA 1W31A 3VU2A 1FWJC 5BXSA 1UMLA 5I09A 1AA1B 1FKWA 1KCZA 1QVBA 4J3XA 3RPMA 1UQYA 4WY0B 1PIGA 1YDVA 3M5XA 4XVEA 3ZM8A 2VO5A 1XX1A 2CFFA 3O0FA 4FNUA 2XUCA 2OZ0A 5K7JA 2WNQA 3QSTA 4JXCA 3KBVA 4BF9A 2INZA 3NQBA 3MBFA 1LG1A 1ME8A 4P8UA 5SWUA 4S23A 4WDXA 4PRTA 4K37A 3GTHA 1EOKA 2QJHA 3N6HA 3WUBA 1AQHA 5MKGA 1CXHA 3LQLA 4Q8MA 3NQ8A 1KCKA 4MNJA 4MWAA 2BY1A 2YB1A 1XUUA 1ZAJA 4F9DA 3EWXA 1E9LA 3PBVA 2EPHA 4GABA 3AIBA 6XIMA 4C6NA 4DYEA 4DBSA 1FXQA 2PF0A 3NOEA 3WJWA 4MLJA 4AZ5A 4E3TA 3UG3A 4HYVA 2WVVB 3LHWA 3LPFA 3EOLA 4UTTC 4GMEA 3NGJA 2HMCA 3RCMA 3ABRA 1IYXA 4EF9A 3D0CA 3S4TA 1EP1A 5AZ0A 1MW2A 5I00A 2OMAA 4HNUA 1W1TA 3SIMA 2EXOA 5A6TC 3F2CA 5HUOA 3RMEA 1MFUA 4EIVA 3EXSA 1NFGA 1G01A 3ARPA 1ZZMA 2NWSA 3OGRA 5IHSA 2ZRUA 4TOQA 3QFWA 3EB4A 3W7KA 3W7PA 3ZOAA 1C8YA 1VFFA 1CYGA 1LG2A 1RV8A 3LV5A 4H9TA 4MY9A 1W1IE 3KVKA 4QM1A 4O1BA 4QG6A 1T7LA 2Y7GA 2FH8A 1ZBVA 1W9PA 5AHNA 2VUNA 4HN4A 5FEZA 2OWWA 3BSGA 1HT6A 3T40A 5C9RA 5BXRA 5H8PA 4E5TA 2C16A 4DM2A 3OBKA 3CT2A 4C90A 3FK4A 3NQ6A 2HXUA 3LZ3A 3HPSA 4GYPA 4MB4A 4QXIA 1RQBA 1X7FA 1FCVA 4IL0A 1KXTA 4O28A 3H54A 4PCNA 1XIFA 1KBKA 5D8ZA 1O1HA 4MYAA 3R10A 1QNPA 2J77A 3UR7A 4GNJA 2OGJA 3MW7A 3LHUA 1WA3A 3DOPA 3ARQA 4D71A 2DEPA 4LW7A 3U9IA 3SDOA 3SO7A 3F4CA 4LAUA 3GHTA 1GVEA 4UR8A 4H7ZA 1J4EA 4P2VA 2A6LA 3SURA 1OZQA 3L0GA 5D38A 3ITOA 2ZOXA 2EKCA 2B81A 2NV9A 4NILA 3WQDA 1XL9A 4YPJA 2CNCA 4F0RA 5LA1A 1KA9F 4JYDA 1HIZA 4FX7A 4TV5A 2DP3A 1E6PA 3WJZA 3B3DA 4WOQA 3E9AA 2DZBA 4Y9PA 1GKQA 4JTDA 4O53A 4QIUA 4NI3A 1LTDA 1XH1A 4Q7IA 4FS9A 4N7QA 1SO3A 5DXXA 2PB1A 1KKRA 4RDVA 3AO0A 2CLPA 1MNSA 1TIWA 4G56A 5AC7A 2GZXA 4KERA 1X96A 3CXOA 1Q66A 1YYAA 1R8LA 3W88A 1YNYA 3S47A 2WNZA 5A95A 5CJNA 4JIIX 2BFGA 2GJLA 3FV9A 1CXFA 2Z1KA 1JI1A 3L2LA 1S2UA 3BZJA 4R34A 3REQA 1LL6A 1ZBCA 1DQUA 2NT0A 4IFRA 3BLEA 1JYNA 2PWDA 1VENA 4B9YA 5C2GA 1A5KC 1Q4NX 5DCEA 2G41A 4TVCA 3WLKX 2VOMA 1AW2A 4LY4A 4WUIA 5EPDA 5HXMA 4WXYA 1W54A 2FTYA 3NEVA 1EKOA 4H01A 3VDGA 4DIAA 4R85A 1SJCA 1FHUA 2DJXA 1ITXA 3SAZA 4JTTA 1OF8A 3LGDA 3RLGA 3KWSA 4HK5A 5CXPA 3OP2A 4FXJA 1XIEA 4RDYA 2AQVA 5JBEA 4PTWA 1K6WA 3V1HA 1KXQA 3DH7A 2ZTKA 3KBSA 4AEFA 4HOWA 2OLHA 2I5QA 4RX0A 2VEKA 3NCOA 3BK0A 4JNZA 3WX7A 1UIPA 3B8SA 1VFHA 2J9ZA 2WOQA 4BI6A 4M8UA 3AIQA 2DZSA 3IWPA 4ATDA 1M7JA 4JDBA 3QKZA 3POHA 3U2OA 1N55A 4JR5A 1ZP3A 4RR4A 1LORA 5H8UA 3PZIA 1E0TA 4O1CA 3T42A 4PEEA 1R3RA 3NQEA 2TPSA 3DI1A 1YPFA 4JYFA 1C8XA 1W3NA 1K7XA 5D2TA 3FXGA 5HNNA 2C19A 4YCPA 4JHZA 1TIMA 5KZEA 4UNLA 5FACA 2R1LA 3QFEA 1C91A 3P2VA 1M5WA 2PWGA 3NWRA 1TPH1 1WZLA 1E55A 1ZJHA 1Q6LA 3LCLA 4H9MA 3IUIA 1JD9A 3GG8A 2GDVA 4WEVX 5I3JA 2NZLA 4K36A 1FP8A 3CL8A 4I90A 4QE5A 4AD2A 1ZBKA 2R1MA 1EDGA 3B9OA 4R9OA 5CSUA 4XK2A 2KAUC 3LA4A 4RKAA 4M5PA 1EJWC 1E4MM 1KM0A 1XM3A 2A79A 4IGHA 2GDQA 3L65A 1X39A 1XLKA 1CLKA 4KEZA 4URIA 4LVAA 3K8MA 4WOZA 3JS3A 3VC6A 1POKA 4LOCA 3OG2A 2OU4A 1HJWA 2YCLB 1W1ZA 3TAOA 1WDWA 4UQ9A 2XVPA 1IR1A 1W2PA 3AZTA 2FJUB 4L64A 4DNHA 3CQHA 1UP0A 1XR2A 4IMDA 1K4GA 7REQB 1XG4A 1R6WA 3TTSA 2CBJA 4ZB5A 3PZOA 5D37A 3N04A 3CHVA 2PFHA 3UPMA 3UFYA 3CZEA 2OZ3A 2DPEA 3RMJA 1UD3A 1V3KA 4Z1AA 3P5ZA 4RE3A 2PF8A 1CWYA 2W0UA 7XIMA 1DIOA 4KQNA 1OABA 4DBDA 2W5FA 3PWIA 1EXBA 3PZNA 5DY2A 3I6TA 3CU2A 1J10A 1XYFA 1CPUA 1MSSA 3SY8A 5LA0A 1IEWA 2VGIA 1GJPA 3LU2A 4UXDA 1BTMA 3PY2A 2NQHA 3WNLA 1B5TA 3F2DA 1A5BA 1QI0A 1A49A 3VNIA 3S46A 1KTCA 3BLLA 2VJXA 1DOSA 3LENA 4RZ6A 1I60A 1T6MA 1V3LA 1H1ZA 3A3WA 5KZDA 3GS6A 2O9RA 4LUSB 4HA1A 4H9UA 4MAZA 3W1MA 2PDBA 4LNYA 1IIGA 3ITYA 3M0HA 3BSHA 4GCXA 3UJSA 4XZBA 3UWEA 3VUSA 1MO0A 1YLVA 1Y8BA 4Z2LA 5I7GA 4Q8OA 3UZYA 3UG8A 2NUXA 4MDPA 2YYTA 1BHGA 4UFMA 5T26A 1NDZA 4X2RA 4ALDA 2ISFA 4E8CA 1E6RA 4U31A 3ZWTA 3LRLA 3PUOA 4K8EA 2VEMA 3WEOA 1NAL1 2PZ0A 4LUTB 1X98A 5REQB 1QW9A 3IIOA 3UESA 1XRFA 4P8WA 4O15A 4I8DA 2ZX5A 3S1VA 3N1AA 1V3HA 5A2CA 3SN1A 3E0IA 1Z8AA 3HBLA 3PWGA 4FLSA 2V3GA 1TRDA 4DM1A 4UMAA 3NQMA 5CKSA 4A3HA 5EY5A 3VILA 2CLFA 3H8AA 4GXPA 2CLIA 5HMEA 4WLCA 4ICMA 1AL8A 3SCUA 2EHHA 1OINA 3UR5A 4F3HA 1CLVA 2PP3A 4YMZA 1CDGA 3BGJA 1PE1A 4NJIA 4ZXOA 4W85A 1F4HA 1E3XA 5KETA 1J93A 4QAIA 4JFUA 3WBYA 1Q45A 4XBSA 1EJTC 1ITUA 3GC2A 1GTHA 3DFNA 3FEMA 3WH6A 4WSKA 4CNTA 1V77A 4NYUA 5FJRA 4LBUA 1QT1A 2QCMA 3P84A 2XGBA 2D69A 2NQLA 2PDKA 3G5EA 1LZOA 1CT5A 3OGVA 2PDCA 1AMKA 1BLIA 3W7JA 2Y89A 3LY0A 1HO4A 2XH4A 3T8QA 1L2QA 3WQFA 4CEUC 1TWWA 3B8IA 1R3SA 1C90A 3SCPA 1NDWA 1Q6CA 2X0YA 3ICJA 3GKAA 4H3DA 4UFIA 3E0FA 6REQB 4E0CA 4CU6A 4DUOA 2CPUA 4AXNA 4ROPA 2Z0IA 1CGXA 3NQGA 4HYRA 4XZNX 3EX1A 5C5YA 3BH4A 3W7GA 3UG4A 4I5RA 2HVNA 2PP1A 2QYGA 4FO4A 4DO7A 1TJ2A 3NO5A 5CJMA 2CITA 3RPDA 1GQLA 3WDQA 2YW3A 2PWFA 3U3HA 2W92A 5DT7A 3VA8A 1AQMA 3VYLA 2GOKA 2ZRVA 4LS1A 1LYXA 1TELA 2NWRA 3WF2A 1US3A 3NZRA 4CNUA 1BGGA 3BLOA 3RXZA 2FQIA 4PUMA 2PWUA 2UY5A 4C6QA 1ADOA 1P7TA 2QUNA 4LYQA 3W73A 1VYRA 1P0EA 4LS0A 4O12A 1DL3A 5LYRA 5M17A 4LXFA 1SFLA 4LUJA 3UR2A 4GQ0A 3MCMA 1TWIA 4HBKA 4KWSA 3NAVA 3T2QA 4KW2A 2Y5EA 3E2RA 3CV1A 4LTSA 3W1QA 1IHIA 1A0EA 2W3ZA 2HBXA 1BRLA 2FMNA 3LG3A 3RGTA 2A7PA 2XHYA 4NZJA 2YBVA 1YPIA 2YLAA 3RDKA 4YXGA 4JQ2A 2FZ8A 1PZ2A 1E40A 3TW7A 5IM51 3VDCA 4N0RA 2DUXA 3T4WA 2RGMA 4C6PA 4OV9A 5H6HA 4JIQA 3AMDA 1E0WA 1VJSA 4GC4A 2I16A 3UW6A 4FPSA 1E1CA 2XH2A 3WELA 1EJVC 4UTKA 3W86A 3G1XA 2E77A 3EA2A 4AF0A 1DJGA 4UZUA 1MUMA 4YU1A 3LI1A 3LHYA 2G50A 2Z2UA 3MANA 2V30A 4CCEA 3QZEA 3C0QA 1J2BA 1EP2A 1SUXA 5C55A 1JYVA 2IKIA 1WE5A 2V3EA 1EBGA 1XLCA 2VFFA 2E9BA 3MUCA 2XIIA 1EL3A 3KL3A 1XYMA 4D6DA 4NZ1A 1UH2A 1GPFA 3EKZA 4I9TA 3R0DA 1FWNA 4P7QA 5TBOA 1WNOA 4LBRA 3LS9A 1Q7QA 5CAHA 3LM7A 4QROA 4KGLA 1C7TA 1R9YA 4TV6A 5BRPA 4JTFA 2BLEA 1X1OA 1W5NA 3FYOA 3OEXA 4UQCA 2V6AA 3M0ZA 4I6VA 3P5YA 5I78A 3L5MA 3N2TA 2VDHA 3WDIA 1I2OA 2FZ9A 2P50A 5M2FX 5HULA 3SQLA 3GIPA 4A8LA 3SZ8A 1XF0A 5DX7A 3TNBA 4HHHA 2BGQA 5EFFA 1Q8AA 2WVUA 1PZ0A 1XLBA 1L6WA 3SEPA 4A2RA 1UD5A 3TK7A 5CZTA 3A3HA 1V3IA 2ZUNA 2ZXBA 4PUJA 3C3UA 4Q22A 2BODX 1KCXA 5GQBA 1K7FA 3FGCA 4MZ1A 1DXIA 1REQA 2JEPA 3E2VA 4NZCA 4KCUA 2YA2A 2BVDA 4FALA 1W5PA 3LHTA 4W86A 1F7BA 1NIUA 2YKKA 1M04A 1QNQA 5LNVA 1NDYA 1IEIA 3W85A 4AB4A 3R7MA 3KS6A 3UGRA 3JW7A 1VEPA 1EZ2A 4GO8A 2OYKA 4QJ5B 1DJQA 2OOFA 5C2CA 2WNWA 3HPZA 2O7SA 1MXSA 1CW2A 3NXFA 3AZSA 5KZ6A 3E5BA 4B5VA 3GR7A 4A6GA 3PZVA 1GKPA 4HQVA 4AZIA 2F84A 4QR6A 3P93A 2A3HA 4CNNA 2DSVA 4DQWA 4C6KA 4MLRA 3KCLA 3GYEA 5HMSA 3BDKA 4HOZA 1TPVA 3WNPA 1ZHAA 2O9OA 3GU9A 4TMCA 3TYEA 1VFLA 5JIWA 2YFNA 4M1BA 3PB2A 3CL7A 5BROA 4LUIA 3RX2A 4YTSA 4HU8A 4LCQA 2OLAA 2WKLA 3RIKA 4MFEA 4L4OA 3WQOA 1UWAA 4IWWA 3ZT6A 3OHMB 3CGTA 1FOBA 2GJNA 4R27A 1U2YA 1FQ0A 3CIVA 4TVDA 2BB0A 5PTDA 2XIQA 3OODA 4A8IA 5IDZA 1A3XA 3QGVA 1HZYA 1C3FA 4YYFA 1OFQA 4GRSA 5C9WA 4X2PA 2YXGA 2DZAA 2R6OA 4H2CA 1KRBC 4L6DA 1JDFA 5D8WA 3WMBA 2ANUA 4OBSA 3W7IA 2RAGA 3AIEA 2XINA 1E6SM 1EA0A 4O4WA 3TQKA 3NOYA 1ZJBA 3DYPA 1L6GA 4NY2A 4DYKA 2DH2A 4M6UA 5J5RA 3P3BA 4WDWA 1LRQA 3VD3A 1VJIA 4IIEA 1F74A 4KFOA 4K6AA 4F2BA 1JZ4A 1TR1A 4GG9A 3VIMA 4MWAE 2OWCA 3PSWA 4DXKA 3APYA 2FGBA 1VS1A 1W5MA 4IMGA 5KZMA 4C1LA 2CLLA 3BLPX 2WC4A 3S3GA 4RPPA 1H1YA 5AYIA 3CB3A 3DFPA 4Y7EA 4LF2A 3NM1A 1T5AA 2VR4A 3U2EA 1KBJA 3DFQA 4GA8A 4H8VA 3NL5A 3KP0A 1RY8A 1CXLA 3ZYZA 3RX3A 4AIOA 2EJAA 3TONA 5I2UA 3M5VA 2ALRA 4R3UA 2ZZ2A 4WQ6A 5D9MA 5BU9A 5C0QA 2ZX8A 4GUHA 3D3FA 7CGTA 2B7NA 3L4ZA 2EKGA 4JTCA 5DMYA 1BYDA 3BSMA 3M5ZA 3Q45A 5EMMA 2ZRYA 3UYIA 4F40A 2D22A 3ARYA 4Q8WA 4HB7A 5CSYA 2Q3RA 2Y88A 1SQ7A 2VEFA 4BEQA 4AH7A 3MT1A 3SW6A 3BURA 4B92A 1PZ1A 3S0CA 4HVXA 1M7OA 3GNPA 1XBZA 1JZ2A 4MWAC 3ITCA 4D6HA 1TJRA 2ZUUA 3B05A 2JALA 2J8TA 5CPSA 3ABQA 1UA7A 1Q6OA 4ZFCA 4PRRA 4QS6A 3QYQA 2XH7A 1AJZA 1W3IA 2GQ3A 5A6BA 3P81A 3CAWA 3PULA 4WX2A 3VM7A 1EX1A 3OW1A 5M3WA 4XD6A 4GX8A 1ZNNA 3STFA 1GEHA 3A4XA 2WLYA 3FHAA 2YA0A 1YMYA 4RNHA 1B0IA 1CB2A 1ONEA 1I8JA 4Y9AA 4TTUA 2BY0A 1M6JA 1OGSA 1I1WA 3W7DA 2DH3A 3AMKA 4DO5A 1YQ2A 2VWSA 3EX4A 3BLIA 4JGDA 1IXQA 2Q02A 4N4QA 3A47A 1QWGA 4QBXA 3HJEA 5EGRA 3H2OA 1M7XA 5A6LA 3V36A 2IQTA 1TWSA 5K2ZA 4XZWA 3GBEA 4LRSA 3N15A 2ZZ1A 7ENLA 1UQZA 3EWZA 1UKQA 3O16A 3R94A 4RDWA 5REQA 4GJIA 1G5AA 3BAIA 4JDYA 3V0UA 1JDDA 3GXIA 4FLRA 4FLQA 2Q8ZA 1WBJA 2QCCA 3W7RA 4EE9A 3WUGA 4CU7A 1XFCA 3APGA 5C6MA 3G8EA 3GUWA 3GAKA 1GVFA 3W83A 3LB0A 4ILSA 3NDYA 4GI9A 4GYPC 3DC0A 1JCNA 4O0KA 3KOXA 3S1UA 1AH3A 1SJDA 3C2FA 2PDFA 3UZJA 1CLXA 1LQ2A 4TU1A 3DYMA 1O68A 2AGTA 4B5SA 2FHBA 1LQ0A 2IS7A 1LM1A 1DBTA 3C56A 1GONA 1TJ0A 3PTMA 4HP5A 3W37A 1QO5A 4M24A 2HS6A 2LLEA 5C71A 3VMNA 1S2AA 4AZHA 2QMJA 3NIYA 1D7FA 3B0YA 1H3GA 4EOUA 3PTKA 3TTOA 4RXGA 3HPXA 5FJUA 3FKRA 1T8XA 4O8RA 3HA1A 3W3OA 4RJEA 2XSAA 3CV7A 2QNEA 2F6XA 4XZMX 2I9EA 4Z1YA 4L1GA 3E1F1 4F66A 4HU4A 1ADDA 1RBLA 3ZLHA 3VD4A 5CGMA 3R8RA 1Q7MA 4N6FA 4W8AA 5CG7A 4HNCA 4GH1A 4JEQA 1JPHA 1SSDA 3MI6A 5GJNA 4F2TA 1IE7C 1RCXB 1E6ZA 3W1TA 1PHQA 4B3KA 4AVFA 1CNVA 4QDPA 3BARA 1UROA 5LHEA 4F4RA 3TV8A 3VKCA 3DXIA 1OVDA 1DEDA 1K3UA 1AZ1A 2QW5A 2RJGA 4O1FA 1OC6A 4PYSA 3OLGA 3S1WA 1I2NA 3AIUA 2YA1A 1EFZA 1UIOA 5CSSA 4MWAD 4LEFA 2PTWA 4OV4A 4OOUA 3AIRA 3ZLGA 1TYGA 4PMZA 5LNWA 3LYEA 1ONXA 3I4EA 4QG9A 5HMDA 3CWNA 3CMFA 3SUWA 1UCWA 2EF9A 1PWMA 4O18A 4GOAA 2YDRA 3C86A 3ZJ7A 1CECA 3JVAA 4P7LA 4GYFA 4NVTA 1I45A 3QC3A 4BQ5A 3AYTA 2O9TA 3WD1A 1EF3A 5DQPA 2BBFA 4ACZA 1Q2RA 3VFLA 2EG8A 3LX9A 1WKFA 2ATSA 1YDNA 3A9IA 3KOYA 3DI0A 4PUUA 3B0XA 5BRBA 4DEFA 2ZA1A 1SFJA 2YSWA 3EDEA 4HK7A 3KBNA 4HA0A 3A4JA 4KETA 4H6EA 1BXCA 2VUYA 4HJWA 3BC9A 1LUCA 2AAMA 3VOGA 3WZ0E 1SM9A 2GWNA 3VI2A 2J4GA 3TAKA 2Y70A 4Q8QA 3LBCA 3BG3A 3C2EA 1UH4A 4JIHA 2QVHA 4YLWA 4Z0JA 9CGTA 1JNDA 3ZXWA 3W1NA 2BZNA 5BOEA 1BQCA 1PDZA 4G6CA 1EGMA 1QW7A 3II1A 1MQPA 4A22A 4O8AA 1I0DA 4POCA 2E09A 4N9BA 1E1FA 4M82A 4I6KA 1WQ5A 3VGFA 4CN1A 4E6MA 4JFVA 3LK6A 1OB0A 3MMTA 4UZSA 1TMLA 4YVPA 4D8ZA 3WN6A 4ZOEA 2DIKA 5KEZA 2OB3A 4RZ5A 3KRBA 3VINA 4Z2JA 3MHUA 1XIDA 1WXJA 4V28A 2CZFA 1F6YA 5FSEC 2C71A 1HJUA 4O17A 1PIIA 5EYWA 3SUUA 4UQEA 2J79A 1JPMA 3K8KA 1PKYA 2ZZ4A 1GJWA 1EB3A 1FCQA 1IXOA 4PSPA 4NF7A 1X97A 2VFEA 4LAKA 5HNTA 5TD4A 1TZ7A 2P1FA 1PV8A 1G4TA 1D3GA 3RFAA 3H53A 3B8UA 3ZS4A 1GQKA 1PL9A 3EKGA 1FKXA 2ZXQA 2C0AA 3N2BA 1JEZA 4LBSA 2VCAA 4ZENA 4GZIA 3UWVA 1GCYA 1K9TA 5HMFA 2ZE3A 3C3NA 4KF1A 1EF2A 4ZO7A 2BOEX 3EB3A 1ITCA 4IQDA 3SFWA 3NPWA 3V0SA 2QDEA 1XD1A 4MB3A 2AGKA 1SW3A 4CNPA 4FXSA 4Q7BA 5A8QA 1RQHA 4ZEPA 1LDCA 3IJIA 5U7SA 1YEYA 3K13A 5I06A 3WLLA 3L5AA 2VDGA 1FWEC 4JX5A 3XISA 5XINA 4ZO6A 1CB7B 5LIWX 4NKCA 3E0LA 1EA9C 1UHVA 1KFEA 2WZHA 3C8FA 1W17A 4BQ4A 5LXXA 4F0SA 3KBMA 3Q94A 3EDFA 4I9MA 4H7CA 2E1WA 2FZNA 3IIVA 4EPDC 3ECQA 3B8DA 3IJDA 1ODUA 3LPGA 3U5YA 3DKJA 2Z29A 4ASTA 3LBMA 4PR4A 2HNHA 1PYMA 4W8LA 1H7OA 2V68A 3TJ4A 2INFA 1SSGA 2ZDSA 5FIPA 3COTA 1KB3A 4PTVA 3Q58A 2JKAA 1R2TA 3M7SA 1VCVA 2IXVA 3SRDA 1F4AA 1E9YB 4M6PA 4WF7A 3WNOA 3NZQA 1UW9A 2VELA 3BG5A 3QTGA 5FF7A 3KBJA 5IDIA 1K1DA 4PBGA 4AVNA 1VHCA 1Z42A 3ERPA 3RM8A 2PDQA 3MKCA 2Z2BA 2NXHA 2YOCA 1NELA 1O5RA 1GVYA 2B0MA 2J24A 4DVOA 5DLCA 1ONWA 5GJPA 3WO8A 4B90A 2P3EA 2QVNA 1TO3A 1Q5MA 4A3QA 5FL1A 1FUYA 1GZ1A 5CGQA 1GYNA 2Q09A 3SUTA 4ZTXA 5FESA 4M7TA 5AHIA 1FH9A 1R38A 2YR1A 4PMUA 4I9JA 2Y63A 4GYJA 2IXUA 3TYDA 1R2RA 4W93A 3RILA 4ZB2A 2HS8A 1GYLA 3BCFA 2A4AA 3RRAA 4HTBA 3CAQA 5AHFA 2HPMA 3VNJA 1KXVA 1OJXA 1QI4A 2QCNA 4JOMA 2C79A 1N8IA 3D3AA 4OHQA 1OT2A 3RK8A 1KGUA 4O16A 1QHZA 3UCCA 4BF5A 1IZCA 3HG2A 3W02A 3GNDA 3DFOA 2JKEA 4C6OA 2AQOA 5A3HA 3EKLA 4HMNA 3VMPA 4DF0A 2OSYA 3GXTA 3WJYA 2WVSA 1B90A 1KKOA 1VHNA 3ELFA 1E0UA 2PDNA 1KTNA 4NASA 4RV8A 3THQA 3EWDA 1OIFA 2C18A 3WFLA 2FIQA 3IEBA 4GXMA 2YXXA 3G1RA 4WIWA 3GVVA 3C5QA 5TIMA 3WH9A 2NQJA 4N42A 5IFPA 2CC0A 1BD0A 3CWOX 2OXNA 1P0NA 2H90A 1DJIA 4ZA0A 3S5OA 2PEVA 2P8BA 5D09A 1FRBA 3FN9A 4DXVA 2Y8UA 1TTQA 2PA6A 1ZPTA 4QCEA 3PZUA 4B91A 4I9AA 3I6RA 4L6OA 1JCTA 4CN6A 3L2MA 5CC5A 2V8ZA 3T0AA 4QNWA 3FHQA 1V4YA 4WSJA 3L4TA 3E2QA 3EGJA 4WCJA 4PL1A 3CLMA 4X9SA 2H9AA 2GLKA 2BHUA 3CK5A 4DWSA 2GJXA 2WJFA 1TTIA 3VDBA 2IKHA 2Z25A 3BE7A 4IIDA 4KPLA 5D2YA 1TB3A 3H2FA 1XCWA 3WENA 4D8AA 1MEHA 5AYYA 1O4UA 2NSXA 3OYZA 4D8LA 1J11A 3PBGA 3W38A 4CKQA 3T78A 3WQWA 4QAWA 4DUWA 2E8YA 1FWTA 1OT1A 2PWVA 4HA3A 2VX7A 2VM8A 3N9SA 3QPYA 3FKKA 5LZLA 2FPYA 3LQGA 4J3VA 3CO4A 1VR6A 1JFHA 2CWNA 4JY8A 4M19A 3ZVHB 3WKZA 2PGFA 2PU1A 1S1PA 1W1A1 2OJPA 1CIUA 4RNJA 4ZOCA 5LIXX 1YKWA 3R0UA 3MHFA 4U28A 2QGHA 3IPWA 4L9YA 1GOQA 5D05A 3AXIA 1BEUA 3APTA 4MKNA 1WO2A 4H8UA 4A3RA 1PDYA 3EZ4A 1Z9AA 5D9OA 1IT0A 4BI5A 1XLEA 3WQ6A 4GYKA 4XZHA 4RNIA 1V6VA 4ROQA 4XG1A 1DJWA 4QLLA 5BRQA 4ML9A 2X8RA 3O6AA 1DJNA 2PCQA 1O5QA 5HPOA 2YCJA 1BQGA 2PDHA 1ZLPA 4MPKA 3STEA 3W2NA 2X2GA 1RD5A 1WOAA 1E51A 2G3JA 5AC5A 4JX6A 3S2LA 4HNVA 2ZXDA 2PD5A 4YTTA 3M6DA 4X9YA 3QY7A 4UR7A 4S3KA 1YE6A 1WDRA 2C7FA 1HKKA 3AHXA 4A35A 4IXHA 2VNCA 2AQWA 2XWDA 3HZ3A 2R91A 3KW3A 4NAEB 4QISA 5ABGA 2A7NA 4IX2A 4DBWA 5F1UA 3TMQA 1S2TA 1PX8A 3P6LA 3ABZA 1BWLA 4YS1A 3BLDA 2V3DA 4HZ6A 3VOCA 3D5HA 4XV0A 1UKSA 1OX4B 3UZZA 1OWQA 2GK1B 1J6OA 2A3LA 3KRUA 3TA9A 4QG8A 3DHDA 1A5OC 3H55A 3VOHA 3NZPA 3W23A 2VZVA 3T05A 1A53A 1R3TA 1ZB5A 3W71A 5J04A 4ACYA 5HR6A 3MMWA 1AJ0A 4PA8A 3UPBA 2DIEA 4G7EB 1TJ1A 3F5JA 4ERGA 2PP0A 3OQ8A 4WJEA 2YIHA 3O0KA 2X09A 1S38A 5HUPA 4F79A 4P8XA 4XQ6A 4ZBCA 1K8YA 3UA4A 1R0MA 2DSZA 3DDMA 2VOTA 4O11A 3QV9A 3UZWA 3AS0A 2GQAA 1MEIA 2CWXA 3AI0A 3ITLA 2BNJA 5FKYA 4Y6GA 5KTLA 3MMUA 4KEUA 1C93A 1B3OA 3OYXA 1P1XA 3UWWA 3W0KA 4PCSA 2QUMA 5FAJA 1IEXA 1PZ3A 2ZUMA 1F9CA 3WLMA 1P0BA 3R6IA 3DEQA 2QMKA 3WUFA 2NT1A 1E6QM 1QPNA 4PZVA 4OUEA 4AY8A 1I9CB 4JCMA 1QNSA 3BOLA 4IM4A 4XZ9A 5HQLA 4UFKA 1H63A 3U2ZA 1NOWA 1KGWA 3WLPA 3FDGA 3LN3A 3GHUA 3QKEA 1GOKA 4PE8A 5LA2A 4C1KA 3OG3A 3R4IA 3Q37A 4IGMA 1QNOA 3W2JA 5CPQA 4A4AA 4I7UA 1P4CA 4ZQPA 3GH5A 4GIEA 2GFTA 4F9JA 2CIPA 3UJEA 4UUIA 3MSRA 1JQVA 2ADAA 2E3ZA 2P0OA 4NG3A 4FX8A 1VYPX 3TKFA 1TTPA 2YZ5A 4O0ZA 4DF2A 2D24A 4DJEA 2R1PA 1X1NA 1RZMA 3LPPA 3HQNA 3DG7A 3E3HA 4AYSA 3AUJA 2OR2A 4X0NA 3TROA 4ZCWA 4ATLA 2Z28A 3K46A 1JULA 3JR2A 1BG9A 2J7CA 3T9PA 2ZC8A 1WAWA 3W2UA 3PFMA 3K30A 5EMJA 3KLKA 4WGXA 1GG0A 1F6PA 3UEQA 3CZGA 1J0JA 3WK2A 3QQ1A 2E0PA 4BQ2A 4B15A 1YE4A 5E1QA 3M4HA 4BKNA 1GQNA 4N02A 4AHOA 1UWSA 4R9XA 4IMEA 2GJPA 4ORMA 4F0MA 3KXQA 1OC7A 2EG7A 3P62A 4IPJA 1W9BM 2OEJA 5CZSA 5E6ZA 3O6CA 1TPDA 1O94A 4XIAA 1NTHA 4A29A 2VENA 2E5DA 1F2JA 2FDSA 4AC1X 3AMCA 4HZ7A 1CTNA 3RLVA 2GGEA 3SCNA 1H50A 1KLYA 1NF0A 5I3IA 1CXIA 2EJ1A 1KBBA 4IMFA 1KFBA 3SFKA 1OK6A 3M0XA 4IPIA 3ZT5A 4XUYA 3HJZA 3OVRA 9RUBA 1HGWA 1VPYA 1A0DA 2W9MA 1VYSX 1XINA 4UTWA 3URNA 4NX5A 4I5XA 3WQ8A 2CLOA 2IQ0A 1M68A 2VT0A 3V5CA 4O13A 2EPOA 5HJYA 2VL4A 1FWAC 3SI9A 1TV3A 3SQSA 1W2VA 2HDJA 3PG9A 4HSNA 1HQTA 3U8GA 4PB3A 1YDYA 3U7VA 1ZP4A 1FDJA 3GXFA 2D73A 1HL2A 4M0XA 3CMGA 4G9PA 4D6JA 2H3BA 3QR3A 1VB9A 2Z27A 5CC6A 3N2OA 2HRWA 2QLYA 4Y96A 4DZIA 1XLGA 2XZ9A 1H4PA 2PUZA 3AYRA 3ES8A 2FYMA 1K6AA 4S2BA 3M0KA 2VRJA 1XIIA 3T0CA 3DUGA 2V67A 4H9XA 3NUKA 1RR2A 4MDOA 2ZXAA 1M65A 1XLJA 2GOUA 3GBDA 1TQJA 2J7DA 2E6YA 4HOXA 1YDOA 1KBLA 4REQB 2ZYFA 3QGKC 3UETA 2HVMA 3SBFA 1PCWA 2V2HA 1K8ZA 1RY0A 4MKSA 2VFIA 4RK8A 3WL1A 3SIZA 3VXGA 3GW3A 3P0WA 3GG0A 3H22A 1XGZA 5JBFA 2X0SA 3DG6A 2VHLA 4NZ5A 4PL2A 5LNUA 3QHNA 4HCLA 3S5NA 4GQRA 3AXKA 4DO4A 1LL4A 4LU0A 3MUAA 5A6SA 3L12A 3S42A 1EHAA 4AZGA 4OZOA 2CEQA 1FHVA 3LHVA 2BHZA 2XTKA 1Q13A 3L0NA 5AYBA 2VVSA 3EDKA 3TQ0A 3AMLA 3WQ5A 1IWAA 2VMFA 4AVOA 4LC6A 3P82A 5LHFA 3QM3A 2DSUA 4BJHA 3TR9A 3SR7A 5IHRA 3M0IA 2W4XA 1PUDA 3OZPA 2YL8A 3A3XA 3CUFA 3KTSA 1E0XA 4DRSA 1W56A 1G0CA 3MZNA 1XW8A 1SZGA 4FOUA 5BXTA 3AHYA 2GL5A 3F4NA 3UP8A 4BF7A 3VKKA 3H21A 4O50A 1DJXA 3QLLA 1V3JA 4S3JA 3WQPA 4G8TA 3T09A 1DJHA 3FNDA 3W2LA 1HKJA 2OLSA 5EB8A 1XLAA 2QDGA 3IJQA 3W74A 4XIMA 4W89A 5G1TA 1W9VA 3VPLA 3LI0A 5G4WA 4ADSA 1EO5A 1UUMA 4IFKA 1IEQA 1L6YA 3ZO9A 1I4NA 3WD2A 1U1HA 3TYZA 4QSHA 3IIZA 2VEPA 4IPPA 3B9DA 4DNMA 3FVDA 2V2CA 3GSMA 1L9WA 5CBBA 2YX0A 4BHYA 3MA8A 3PFRA 2OQHA 3S2MA 3N4AA 2G5WA 5LIYX 1XBVA 4D6EA 3FLUA 3ID7A 4N9EA 2YDSA 4X63A 3PPHA 3ZJKA 1FP9A 3DFTA 1ZL1A 2VRKA 1JZ5A 3TEVA 6ENLA 4CUCA 2WW5A 2XFWA 5A94A 4JIPA 2PU0A 1TSIA 5CH9A 3ITGA 4JTHA 5AZ1A 4W5UA 3FYYA 1S3HA 1D2KA 3BAKA 4LQ1A 2CLEA 3PUEA 4MVAA 2FFIA 3EWCA 1FDYA 2ZCGA 1XYZA 2B7OA 2WCGA 4H6RA 1H60A 2OWXA 5HA7A 5A1AA 3PTQA 1G94A 5D33A 2NX1A 4GBDA 4Q8UA 2BP1A 2FFCA 1PKLA 2G3IA 2ATMA 3D47A 4H41A 3BQ5A 1ZALA 3N9KA 2PMQA 4NJHA 3UG5A 1RK5A 1DIEA 5K4ZA 1U22A 4DLMA 3T0TA 3KVLA 2X30A 4CGTA 1R9ZA 1EJXC 3INPA 3VD5A 1U33A 3N4FA 3VOFA 1NEYA 1QNRA 3WNNA 4H6QA 2A21A 3NQ7A 1U30A 2CZEA 7TIMA 3WQEA 4IL2A 2UV8G 3QMRA 2IPJA 4OFCA 1W0MA 2GVYA 2VZOA 4MZYA 3N18A 5CLWA 1EIXA 2QIIA 3ATYA 5LKYA 4JIRA 5DELA 2NX9A 4S3CA 3HOJA 4LYPA 2D0GA 4IG2B 5CPTA 4TTGA 3XINA 3LD5A 3IV3A 4MFDA 3WQ4A 2BWGA 3TIMA 1A5MC 2ISVA 4KKXA 3FSTA 3CC1A 1UR9A 3R0KA 3I7QA 3G1DA 5A6BD 4S3BA 2PCEA 1CXEA 5GPRA 1GNXA 4MYXA 4FP1A 5FA5A 3GR8A 1TRIA 1S5VA 3W2MA 2DGAA 4HKPA 2RDUA 1E15A 4X22A 5DT5A 1WCGA 2R9RA 2CBIA 3P8IA 1FBAA 1YX1A 5E93A 1UR0A 3FY1A 4D1JA 1X8FA 3WBAA 1W3HA 1QK0A 4YWIA 3N11A 2PGRA 4C5YA 1PWLA 3OLEA 1O95A 2Q8LA 1SO6A 1Q4WA 4CD7A 1H09A 2NLIA 2ACRA 4JTQA 4OIFA 4C1NB 1JQXA 3L0KA 4LB4A 3G0XA 1WDSA 5IBXA 1H7WA 2QT3A 2QCDB 1DXEA 3GY1A 3B8VA 3U0HA 4AWUA 2A2IA 1XSJA 3UGVA 1FXPA 2YGYA 3IANA 4ES4A 2FDMA 3TXZA 1KM1A 2QAFA 5IXEA 3MI2A 3V35A 4QGCA 1KV8A 1SJBA 2Q6ZA 1CGVA 4JN8A 4DELA 2Y6ZA 1VZWA 2FZBA 3PZTA 3PBUA 3WD3A 4G1NA 1MXGA 5D2WA 1V6YA 5I77A 5HQEA 3MTWA 4XO7A 2RGLA 5DO8A 3THAA 2YFOA 1WOBA 1KO0A 3L68A 3NSNA 4FA3A 3AS1A 1QNVA 4NAEA 3CHEA 1B54A 1JPIA 1NWSA 3B9EA 1P48A 3AC0A 1OGBA 4PMDA 3TLLA 1YBQB 4AG0A 3N34A 1UR1A 2Y7FA 3ZVIA 3HMJG 3GDTA 1VQTA 3H70A 5AVNA 1VIWA 3VTRA 5FJJA 3B06A 4J3WA 3DECA 3GDBA 4GWEA 1TTJA 1XH0A 3CYVA 1FFQA 2I5IA 1WYIA 4KCWA 2PI6A 3FJLA 3QRHA 2Z2AA 3M6YA 1C9DA 3C4UA 4O1AA 4PTNA 1IWBA 1HJSA 1R9XA 1DJZA 3NQFA 4M80A 1PTGA 2J7GA 3SSZA 2CCRA 1E71M 2XH0A 1K8XA 2YCIX 3VNKA 1A0CA 1IV8A 3TNOA 3DESA 4WKFA 4OBRA 3TN4A 2XWEA 3F7JA 1M03A 4B9ZA 1F61A 1ISVA 3W7MA 4HSHA 1ZUAX 2WZEA 4Y2WA 4ZQRA 3VIKA 2VEGA 4H6KA 4B16A 4HNLA 1ZBWA 5EBUA 1MQQA 3NPUA 3ARTA 4LWWA 2OKOA 1M01A 1WDPA 1NOFA 2ZWYA 4OKDA 3HFYA 3VIJA 5CAKA 3AJ7A 2DVXA 4U5IA 5D2VA 3VNYA 1XP3A 4Z1BA 4Q8VA 2PRHA 1Q2SA 4L80A 3N2CA 1K9FA 4QSFA 4YIWA 3OA5A 2HE5A 3MB9A 4RXFA 1B3ZA 4BR1A 3BV7A 2HZGA 1QPKA 1KM3A 5A69A 1L6SA 1GVSA 4NUWA 3FEQA 2PDLA 2VGFA 4HZ8A 1LWIA 4LAZA 2BXYA 1WZMA 2KX9A 1ESWA 1UG6A 5KINA 1V02A 3QPEA 2JGYA 4ZZ9A 4JTKA 3MI3A 2YCKX 3QMTA 2GUUA 3WF0A 3OZMA 3NVTA 1B9BA 3M0LA 4ZMGA 3BUVA 2OT1A 1CEOA 4P7NA 3GU1A 4WGHA 2E7FA 3BOFA 5CGTA 1R47A 5LNRA 1UR8A 3EXRA 2ABBA 3OIXA 3W7QA 5D4YA 3O3RA 4RE4A 4NJJA 1JCYA 3DBPA 1N8FA 2Y5SA 1KXHA 1E9IA 2E6FA 5BWFA 1Q6RA 1QOXA 1RUSA 2ZX7A 2WB5A 4MAVA 4UTTA 5A2AA 2YL6A 4IUOA 3QF0A 4XTDA 4X61A 1WZKA 2JGQA 1S46A 2QJJA 2ZZ5A 2PD9A 3QYSA 2YXOA 3LHZA 2OO0A 3L4VA 1S2WA 2FTPA 4GBUA 3LLFA 2CLHA 1N82A 3AIWA 3SM0A 1XIHA 5A5WA 1A5CA 1H7PA 4JZ5A 3ES7A 3SGUA 3IK2A 2A0NA 4IQJA 1OY0A 2Q3OA 1TREA 1XLLA 2WSRA 1ZGDA 1TE1A 4FR6A 4Z2IA 1DHKA 4IUGA 5A6KA 3BANA 4LT9A 4ZR8A 1UPPA 1L8PA 2Z7KA 1PVNA 3ALGA 1T96A 5J8LA 1BWVA 1EC7A 3A9BA 4MUZA 4YTRA 1OEPA 3FA4A 3VD9A 4IX0A 4LGXA 3TTQA 3LNPA 3EDDA 3EOSA 3O05A 4AMCA 4CCZA 5HBFA 3PB0A 3W24A 3WLTA 1A5AA 2P10A 3WQCA 1NWUA 3TWAA 4EPBC 1EWEA 4IP4A 1A50A 5F4XA 2JQXA 4GQBA 3PZ9A 3QZ6A 4O1EA 4D1IA 1OSEA 4A8RA 3URBA 4IOTA 1J0YA 3C61A 3HGRA 3R5EA 2ZTJA 1ISZA 4K68A 1QO2A 1V6XA 3OQEA 4EWND 1PAMA 1W6TA 2W62A 3WH7A 2CXEA 4XD4A 4DZ5A 3TN5A 4PH6A 4XD3A 2P3ZA 3GNNA 4PMRA 3IRDA 3QV7A 3RO8A 4DAFA 3A12A 1VFMA 1ALDA 1UYQA 3HB9A 3MDUA 4CQ9A 2OOGA 4DWSC 1SZEA 4YCOA 4J27A 2ZVRA 1NQ6A 2O92A 3SCQA 4FB7A 5T9CE 1HTIA 4Q6XA 1U1JA 1UASA 3DYOA 2DT1A 7PTDA 4PTDA 4E8DA 1Z7AA 1QW8A 3BAJA 3RLUA 3CQ0A 3E0WA 3OA3A 4XAFA 4GX9A 1MVYA 3C2RA 1JRCA 4J2MA 2WKGA 4N2YA 4QJ3B 1JZ6A 1Q8JA 4XBKA 2Y8KA 1XBYA 2DZTA 3NPVA 5JVLA 1NDVA 4HJFA 4OOZA 2OYLA 1UC4A 3ITVA 3N4EA 2TRSA 1OFBA 2X05A 4M3PA 1LLOA 2CKSA 3W7OA 2F61A 3SY1A 3W82A 1VC4A 4WKHA 2PRLA 3DHPA 4TO8A 4GISA 3DERA 4E2BA 2DVUA 1XGDA 4BEUA 5ECUA 3E0VA 1V6TA 3N25A 4H2HA 2Z1VA 2UY4A 3SY5A 1H11A 1DTNA 3CZKA 1FX6A 1IGSA 3VZXA 2G3MA 2I7GA 4GZJA 2FZDA 3WLRA 1L0PA 2WM1A 4YVXA 3T0BA 1ONRA 1GQJA 1M1BA 3CL6A 5XIMA 4JTJA 1QI2A 2AL1A 1XYLA 1JYWA 1DQWA 1OG0A 2A3CA 3FA5A 3W53A 4AIEA 3SQMA 3OO2A 4U3CA 1K7EA 1QASA 5CPNA 5U4NA 4AMAA 2OCZA 3LCGA 4P5UA 3AU2A 3N19B 2DSKA 3KVJA 4AZ6A 1S3TC 3GTXA 3D46A 1XH2A 3M41A 1N7KA 4IJRA 1YNQA 3EOEA 3UWYA 2OPJA 3C0JA 1J9YA 3TCSA 3E12A 3CUZA 3H24A 3WH8A 2W67A 1E6NA 2HXTA 1SZNA 3L4WA 4RCXA 1T0OA 3GTFA 4N4PA 1XG3A 2XIBA 1B4EA 2VQTA 1DVJA 2A3EA 3U2CA 1M7PA 1OC5A 4HHPA 2NVAA 3W7HA 3VZYA 3KOWA 3RRXA 1XISA 3B9NA 1VBGA 3G0SA 3NXLA 4H9VA 3WD4A 1A80A 1PX3A 3NO3A 2ZFAA 3T55A 3STCA 2XZ7A 1S5WA 4AFYA 1RBAA 2I9UA 3H7UA 3SRFA 5EMYA 3ZSTA 1LJYA 4JFWA 1PJ9A 1GHSA 4KEVA 3OLIA 3BLKA 1OZMA 4DLFA 4XAZA 4WDTA 2QUUA 3BAXA 3W87A 2Y1HA 3CJPA 3G1AA 3H7VA 3NDZA 3LPOA 3W6YA 2Y85A 1J2WA 1FWFC 1UPMB 4JCLA 4DWSD 4IISA 4XKYA 4DJDA 1O66A 5FOOA 2YZRA 4H1ZA 1NOUA 1RD6A 4AYGA 5AN7A 4Q4SA 2QJIA 3CZJA 3LXBA 3VABA 1HFBA 3G1HA 3K4WA 4FAMA 1UD6A 5K9DA 2PDMA 4E2OA 2WO5A 2X7WA 2HE8A 2ONEA 1OHLA 4Q7NA 2WC7A 1RHCA 3RU8X 1XLMA 2PZNA 1AFSA 1HXJA 2D20A 4EWJA 5LIUX 1XUZA 3EXTA 5HANA 2C14A 2EEXA 3I3EA 3R12A 2NW0A 4B2DA 1A5LC 4PCFA 2W6RA 2W91A 5A6AA 1LRTA 1S5MA 4DJEC 4Q4OA 3CQIA 1ICPA 4L61A 3NZ1A 3PUGA 2WSPA 3CWHA 3E38A 3TUUA 3SN4A 3OVGA 2J8GA 1HG3A 1LWHA 1LLWA 1EP3A 5F7UA 4IT1A 3UXAA 3URQA 1WKDA 1J0ZA 1M3UA 2J62A 4HGXA 1SMAA 3KP1A 1EHNA 4GQGA 4UTUA 4LSBA 5EFDA 1ZAIA 4JQ4A 5DMLA 1WX0A 1MYRA 1KM4A 3UY8A 3VKJA 2RDTA 4MWAB 2RDWA 1J0HA 3K1DA 3MPGA 1OYAA 3N2XA 3WBXA 3VZZA 4GUIA 3QHOA 3BOXA 1HL9A 1OFDA 2RHGA 3GZAA 4I7WA 1A4LA 7TAAA 2VD8A 3L7RA 1BF2A 2ASHA 2WMIA 5G5IA 3SADA 3TQVA 1BGAA 2XSBA 4S39A 3WNMA 1MUWA 3NYDA 4S3AA 1Z32X 4Z1CA 2O0TA 1AQFA 3B40A 2IKJA 1PEZA 3QN3A 5C7VA 3OHIA 3BCJA 3S83A 1VPQA 1MXDA 3T08A 1V93A 4FR1A 4NAFA 2AL2A 6TAAA 1K77A 1XXXA 2I57A 4XZLX 2XM1A 3GTNA 4K8HA 2FJKA 2J25A 2GJRA 2HQAA 3A5FA 2NLYA 4AZ7A 1NH6A 4XD5A 1CI1A 1D7KA 1QPRA 3SB0A 1YTKA 1UA3A 2BDQA 4W8BA 5JIPA 4B5TA 4KCTA 3EA3A 4RDZA 3UXLA 4AHQA 4B3ZA 2I5GA 4AIBA 4UCFA 4ZTYA 1JVNA 1YADA 4JKLA 1ZENA 4W4QA 1VD6A 1VRXA 5F2LA 3LRKA 4DI9A 1OYBA 4MNKA 1AODA 2P53A 2VEIA 1G7UA 4MGGA 3TW9A 3WFZA 5KMYA 3AZRA 3DAQA 3SJ3A 2CU0A 4GKTA 3W1RA 3LGEA 1TWDA 5HINA 3NZGA 2NUYA 4R88A 1BSLA 3QOMA 4MTVA 6PTDA 5E0KA 1HKVA 1VLWA 2ZUWA 1KWGA 2OKTA 1GVIA 1E43A 4JTRA 4LVBA 4D6GA 4O4VA 2R14A 2OG9A 4K8GA 1RCOB 1WAUA 1GZGA 4XX6A 1XIGA 5HJLA 1FTXA 4WD0A 4K7YA 3MQTA 1VFTA 3DZ1A 2QDDA 4W88A 4C6IA 2QCGA 4PUNA 1E4NA 4DY1A 4MNMA 2JKPA 1B2YA 3UT0A 5EMLA 4WVXA 1XV8A 1SW0A 3GFXA 4LC8A 2XVKA 2EPLX 3R11A 3L4UA 5AB3A 5AC6A 2V5JA 1W5QA 3GM8A 5I03A 3H2MA 1RSCA 3VIHA 2A3BA 4AWEA 1GPWA 3WDHA 1TV5A 3LCFA 3I10A 1V0LA 4PMOA 2XJ7A 3VE7A 1F07A 3DC8A 2O4MA 4DJED 3RX4A 4WY0A 1UZDA 2Y62A 3WL0A 5DBTA 3VNZA 1MZHA 1HL8A 3UNDA 2G96A 1KFJA 1VGAA 4RE2A 4GHRA 1P0KA 1JCJA 4WY0F 4M7SA 4C91A 2BY2A 3AXXA 1UWTA 4LCSA 2IUZA 4PMXA 1PTDA 4K39A 3VM5A 1OYCA 4UR9A 1RCQA 2ZZ6A 3NURA 2BOFX 1JR1A 1HW6A 1TZ9A 3QMSA 2PDWA 4US5A 4FZIA 4M6QA 5GVJA 3ZZ1A 1TWZA 1GJUA 2QEZA 1KD0A 5B80A 1QBAA 3M0JA 4J2PA 3ARSA 1H7RA 3KCJA 4CD4A 4B5NA 4LVFA 3TZNA 3GC5A 3N6QA 3P74A 1UR2A 4RPQA 5G4HC 3I4KA 3M0MA 4KFPA 1FWRA 4ZE5A 1V79A 4QDWA 1W32A 2AMXA 4AY1A 3GVQA 2WVVA 4LYKA 2NV2A 2DZPA 1GORA 4IIHA 1ENUA 1V0KA 3THCA 3JRKA 3TC7A 1QCWA 1XRTA 2VURA 3GX9A 3TU9A 5B7YA 3WY1A 4JFTA 1RP9A 2X2YA 3ARRA 2AKZA 3CHDA 2Z24A 4B5UA 3VK5A 1BYAA 2X1TA 5FJIA 1XC6A 2ZE0A 1W3JA 2ZKMX 4E2VA 5DFAA 1T40A 4FF7A 4KEMA 1JPDX 1XLIA 3BAWA 3CQJA 1I6NA 2X16A 1Q65A 4MJ2A 4LH8A 3BLFA 2RKXA 3N6JA 2G37A 1K8CA 2WAGA 4E4PA 5HWNA 2VGGA 1W3TA 4Q4QA 1GWJA 2V5LA 4J3UA 3CTLA 3G2GA 1P1MA 5AFDA 4XB3A 4HNOA 4XTIA 1D3HA 3QW4B 3WDJA 4UMCA 3TR2A 2JK2A 5HOSA 4DJFA 4MF4A 1UZHA 5C9XA 2J9YA 4QTGA 3RPTA 3G1FA 4XBJA 3W26A 3QEZA 3LCWA 1S2VA 4WXZA 4HCDA 2RDXA 4K1GA 3MY9A 4H8NA 4QE1A 1HNYA 4NRSA 3LM3A 1WUFA 5CPOA 5LNSA 4MJZA 3JZUA 3AYSA 2V3FA 3V16A 3N2MA 4PCTA 2C0HA 4KCVA 2OGYA 1M53A 3MDWA 2QDHA 1XKYA 4AIUA 4OE7A 2ZRZA 1GK8A 4GJ1A 1GW9A 1UR3M 4F2UA 1VBUA 2QPUA 4OECA 1ME7A 2C91A 2QXWA 3HQ1A 4S3FA 3WCZA 4IPLA 3R8GA 4DHGA 2J74A 2WQPA 4LNCA 1QOPA 3KE0A 4H04A 3NL3A 4C5ZA 2WJEA 3TX9A 1SMDA 4NT0A 3EWYA 2FPTA 2FZMA 3ZR4A 1AMYA 1DWFM 3PM6A 1R3QA 3BGGA 3FAWA 3KLLA 3S5ZA 2ESCA 4MG4A 3OJGA 4TX6A 2NSOA 4DX3A 4GXWA 3ITXA 1EYWA 1K9DA 4DN1A 2VX5A 3WK0A 3C2YA 2X1RA 1T8QA 2A3AA 3GLCA 4NRRA 2OQYA 3GFZA 1MDRA 1SGJA 1JDAA 4P8VA 2PE4A 4UTFA 5JBDA 3G18A 3KFTA 2RJHA 3KUMA 3CIXA 1DKWA 1J12A 5K4XA 1HUVA 2EPMX 4YL2A 1F6KA 1LL7A 2BVTA 3WF1A 1WBHA 2V63A 4UWMA 3NEHA 3UVIA 1B3XA 5DF0A 1UKPA 5I3DA 1V6WA 3EPMA 1PYFA 2J78A 1GT8A 4KGJA 1DWAM 4HIBA 1UWQA 2B7PA 2E25A 3VO0A 3TVAA 2G97A 4JTUA 1HJVA 1XYCA 1EJSC 2NQ5A 2XM2A 1AJ2A 4LAMA 2C3ZA 5CZJA 1JZ7A 4RW5A 1J0IA 4DZAA 3N9RA 3HM7A 4NIRA 3FS2A 3Q65A 1V7YA 4FLOA 2G8ZA 1H1NA 1I0BA 1PKNA 1G7VA 1CGTA 3UA3A 3HURA 3QY8A 3FDKA 2Q8XA 4ICCX 4PBFA 3SGZA 2WBKA 5JMUA 6ALDA 1FWGC 1SZFA 4YYCA 5BXPA 3H23A 1DIDA 1E73M 3HV8A 2F38A 3VIIA 1GKRA 1NSJA 3MSGA 3VOIA 1KRCC 3W00A 5HJXA 1AW1A 4V1XA 1HGYA 2VCBA 1A3WA 5CG0A 5JU6A 4EVZA 1FHDA 1NWTA 3R2GA 5LIKX 3EYPA 4Q4PA 3BQ6A 1DWJM 2D2OA 3EPOA 3LMZA 1WZAA 3MWCA 3M43A 3GNRA 3O8AA 4R7JA 4MJ4A 1A5SA 1LOQA 4BY3A 2OT0A 3O15A 1PSCA 4BWLA 2V9DA 3BW3A 2GVLA 4QE4A 1V02E 3NJ3A 3AHVA 4MOZA 2E5CA 5G1MA 3CIWA 3K2GA 5HNUA 3SCRA 1C29A 5BOFA 4R7WA 3GHSA 4Y8FA 4S3DA 1VRDA 3G1SA 5E9AA 5I3FA 1J6PA 3UZ5A 3W1PA 2GWGA 3PWAA 4IIFA 3IGXA 2ZUTA 4DI8A 3WJXA 3BWWA 2WHMA 3IJ7A 2BTMA 4HMDA 1EEXA 3LLXA 3UPWA 3TN6A 3RYSA 4J3TA 2GGGA 3W25A 4PGLA 1HN1A 3STGA 2WHKA 3KDNA 4O54A 3NQ2A 1VFOA 3U57A 3XIMA 3CQKA 3MC5A 1V51A 2PTYA 2WV8A 3L5LA 4K7VA 4X0VA 1SVDA 5LXEA 2CZVA 1F3EA 4GY1A 2YCLA 1AK5A 3P67A 4DAIA 1OFEA 1EDQA 2GQ8A 4EANA 3KZPA 4AD4A 3OGSA 4Y9OA 1JCLA 4HU3A 8CGTA 3RITA 4LUYA 1DPMA 3MP5A 4TX8A