1B57A

Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
358
structure length
346
Chain Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEELYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
publication title The crystal structure of Escherichia coli class II fructose-1, 6-bisphosphate aldolase in complex with phosphoglycolohydroxamate reveals details of mechanism and specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 138
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b57A00
5T26A 5CG7A 4D2JA 1F05A 4RR4A 4WZHA 3W7EA 1O60A 4MY8A 3O8AA 2H3BA 5G4WA 3HPZA 1RZMA 1OYCA 3NL3A 3QC3A 4JYDA 1QO5A 4W9TA 1B57A 3P61A 2WNQA 2ATMA 1I2RA 4AMAA 4GRSA 3EXTA 2Z0IA 3NPWA 3BV4A 4A3UA 3UZ5A 4Y8FA 3KRZA 4RZ6A 2TRSA 1EPXA 3YPIA 2RHGA 2C15A 3CU2A 4Z1DA 2VXNA 2WV8A 3FOKA 2WO5A 4K7YA 5KMYA 2CW6A 4JDYA 1AW1A 3EX4A 3C4UA 1KTNA 4E0CA 1ME9A 1ZALA 5D03A 3TX9A 1RQHA 3PM6A 1C8VA 2V2HA 3P84A 1G7VA 3MP3A 4K37A 2JKPA 1GYNA 2NX1A 4RV8A 3W2NA 1NF0A 1IXQA 5AOUA 3C2OA 3SSJA 2CZFA 2OJPA 4ZQNA 3HGJA 4PC8A 2CLFA 3SIZA 1B4KA 2QCLA 1PHWA 1ICPA 3EKLA 4GBUA 3GLCA 1QAPA 4ADTA 4UMCA 3G1HA 2DZUA 4QITA 1VYRA 3QSTA 2TMDA 4UFKA 3UWUA 1EX5A 4QNWA 3N19B 3WK1A 4NNAA 2YXGA 4G1KA 3I65A 4AAJA 1LORA 2QF7A 3UPWA 5D2VA 1KM4A 3OHIA 1K8YA 4MLJA 1DKWA 3M9YA 2C3ZA 1TPWA 2AAMA 3HBLA 3N73A 4IWWA 1NVMA 1TPB1 3C2VA 3H53A 4HNTA 4AEOA 3GNNA 4R34A 2O7QA 5FI8A 4ZQMA 3DHFA 3W1TA 1XBVA 3GK0A 3DFNA 4ORIA 5AFDA 1UASA 2V2CA 1I2QA 3G22A 1EA0A 2O7SA 2RFGA 3FA5A 2FDSA 1V5XA 1P0KA 4P61A 1FCQA 3I7SA 3LGEA 2RDUA 4FNPA 3AO0A 4ML9A 2GJLA 4IMFA 5DXXA 5D30A 4O50A 1GTHA 3W72A 2CWNA 4ADSA 4HNUA 4YCOA 4PL1A 1F73A 3MYOA 5I3IA 1ZCOA 3T7VA 3DKLA 3MUXA 3W9ZA 4DPPA 3GR7A 3R12A 7TIMA 1R47A 3BLIA 3VKJA 4MVAA 1SO5A 1UBSA 4MYXA 3LX9A 2HTMA 4MUZA 4KKXA 2E5CA 2C14A 3BW4A 2E6FA 2VEPA 4IOTA 1YXDA 1L6SA 3PAJA 2CZDA 4N9DA 3T40A 1TV5A 4LT9A 1FXQA 3GDKA 4O14A 3WJXA 3O05A 2BWGA 3OVPA 3W73A 1GZGA 3VE7A 3UY8A 4S2BA 2JK2A 3ATZA 1D3GA 3H55A 1FWSA 5IBXA 2B7NA 4UCGA 1I2NA 3P8IA 5A5WA 1XBYA 1F6KA 3F03K 4DQWA 2YW4A 3CQ0A 4LS2A 1G4EA 2QCEA 2DZPA 1HUVA 4GUHA 2G97A 3G1DA 4QAIA 5DBTA 4NJHA 1U5JA 1SO3A 4M5PA 4NJJA 4RJEA 4OU1A 3W7NA 5CPNA 3L5LA 1TSIA 4O12A 4EIVA 1OX4A 1WBHA 4QM1A 1GVQA 3GAYA 2Y7DA 3MJYA 3BW3A 5E93A 3R89A 1ALDA 3G3DA 5EYWA 5D2WA 2B0MA 4U28A 1LOQA 4GJ1A 3KVJA 3L5AA 2FIQA 2VFGA 3CIWA 4J9JA 2ISSA 4HSOA 4JTUA 4WY0B 3C0JA 3W23A 2YYUA 4YWIA 5HWJA 1JCMP 5MHBA 4HSNA 2Z1BA 4DPQA 3N3MA 1FY6A 4JEQA 3W1LA 1TTQA 4JYFA 5BRBA 6ALDA 1EWDA 1GEQA 4MY1A 5G2IA 2A1YA 4JY9A 3MBFA 4XBSA 1WA3A 4JTEA 4JN6A 2ISVA 2J9ZA 3DZ1A 4JTIA 2ZZ3A 5F2LA 3A21A 1LTDA 1T0OA 5DELA 1RQEA 1FX6A 2YCEA 3FFSA 1OX4B 3VCRA 1KBIA 4NXSA 1AMKA 1H1YA 5K3VA 2P1FA 4IXHA 1KFBA 1XM3A 1W5QA 3SGZA 3HG2A 1YXCA 5AN7A 5AYZA 4TO8A 3S1WA 4GUFA 3MHGA 5AHIA 1CX9A 3SY5A 4C1KA 3PR2A 4HPJA 3LRLA 3PULA 1Z41A 3DFSA 4XQ6A 3BGJA 4JTGA 1VRDA 1TIMA 3EKZA 5CPOA 4UC5A 1NF7A 3BLEA 5EKYA 3EWBX 3W1RA 5D02A 3CPRA 1QCWA 3I6RA 1LDCA 3C8FA 2YZRA 1QR7A 1XKYA 3NOEA 1BTMA 1R2SA 2NUXA 3IIZA 4DO6A 1YXYA 2OZ0A 5AB3A 5AHMA 1GVOA 2FJKA 5F1UA 3LCWA 3NM1A 1Q6QA 1SW0A 4FB7A 2C1HA 3NAVA 3SI9A 1H7OA 1W0MA 4CNPA 1VH7A 4L4LA 4GNJA 4RK8A 2DZVA 5G4EA 2B7QA 3GDLA 3G8EA 3WK3A 2Q8LA 4A21A 1XBXA 1TPDA 2AGKA 4Y90A 1CW2A 1XUUA 4BF9A 1AW2A 2ZZ4A 3KVKA 3W1UA 3W7GA 3CIXA 1W5OA 1OF8A 4X9SA 4QJ1A 5F4XA 4LWWA 1W3NA 3N9RA 2H90A 1ZHAA 4POCA 2I14A 3L0KA 1WYIA 3W84A 2ZRXA 3W87A 2A7NA 1WV2A 3HB9A 3W75A 2ZZ7A 1LZOA 3LRMA 3LRKA 3UZJA 1ME7A 3L0GA 4QSHA 1RQBA 3NQCA 3B0UX 2C16A 4GXMA 3G1FA 4BI5A 3O16A 1YDOA 3NL6A 3P7YA 3PB0A 1JULA 3PG9A 4CQ8A 1RV8A 1JCXA 1SZEA 4PH6A 2EAWA 4Z0JA 1JCYA 1THFD 3DBPA 1W8SA 4IMGA 2BX7A 3W7IA 1WDWA 1SPQA 3CC1A 3PF3A 3C56A 3CTLA 3K30A 3Q58A 4N4QA 5HJLA 5AHNA 4O15A 1JR1A 4O57A 2Y88A 1J2WA 1LOSA 2Y89A 4ICNA 5HWMA 3EWUA 3KRSA 1VR6A 1YYAA 2X1SA 3THQA 3QPYA 3CWNA 4XUGA 2R14A 3RMJA 4EF9A 2R8WA 3EX1A 3OBKA 1TRIA 3S1VA 1ZAHA 4XTDA 1P1XA 4OE7A 3DENA 1H60A 2VKZG 5KZEA 3B04A 2X30A 1X6UA 2QAFA 2Z6IA 2E6AA 4IMEA 4WJEA 5C6MA 6TIMA 3W2MA 3H54A 1H7PA 2DZXA 5G1YA 2RKXA 3ABOA 1W31A 1K8ZA 2ZCGA 5D05A 4O10A 2PURA 3NEVA 5I3KA 5G2WA 1Q3NA 4MIMA 1G4PA 2BTMA 3HGSA 3NQ2A 3LI1A 3SJ3A 4YCPA 3HG5A 1OFEA 1YLVA 3ANYA 5HR7A 4LY8A 4HHPA 4OV9A 2B7OA 3O6DA 1R2TA 3TQ0A 4DBEA 3W86A 2V30A 3CWOX 3HG4A 2NXGA 1EP2A 2A85A 3G1AA 4FIQA 2G5WA 3C52A 4DF0A 3NXFA 4L4MA 2ZRYA 3ZWSA 2QJIA 3B06A 3M6YA 3WJWA 5EMUA 4UFJA 4HNVA 1WX0A 1F74A 3UXAA 4ALDA 4R33A 1VC4A 3W7DA 1KLZA 3LB0A 5FF0A 2A2IA 1VS1A 4FX6M 4I9AA 3UQNA 3LXBA 2CZ5A 3T55A 1TJRA 3VI2A 4XKYA 3QH2A 1TREA 3GDMA 2OT1A 1C29A 4CNOA 3LERA 1UB3A 1L9WA 4S2CA 1K03A 4MJMA 4JNMA 2VFFA 2GQAA 1P4CA 4ZQPA 3JRKA 5KSWA 5LNUA 1TTIA 3LCFA 4AXKA 4Q32A 1SSGA 4GUGA 3PBUA 3BG5A 4ZQOA 1VLIA 3CEUA 1BEUA 5L9FA 1I8JA 1QPRA 3VFLA 2ZDRA 4I7VA 2FB3A 3W7OA 3G1SA 5KZDA 1EP1A 2ABAA 2QCHA 2VENA 3M43A 1WQ5A 3ABQA 3BGGA 2GVGA 3TMQA 1ZNNA 3V75A 4ZQCA 1GVRA 1LRQA 4H3DA 4MPQA 3L5MA 3G24A 4FF7A 5J5RA 3F4NA 5I3HA 2QDHA 1JCNA 2R91A 2VFDA 3C3NA 4O19A 1WBJA 1XBZA 5D09A 4PODA 2YPIA 3TDFA 5I3JA 1NAL1 3GIYA 4O0ZA 5G1TA 2VFEA 4E2BA 3LM7A 4IQLA 4UTJA 1VGAA 4CNNA 2ZZ5A 4N02A 3GKAA 1X8FA 1OX5A 1QWGA 3I7RA 5DCEA 3ZR4A 5AC7A 4AWSA 4HN4A 1TQJA 2HS6A 3NYZA 1KM2A 1QPOA 3Q2DA 1GJPA 4FXSA 3G0UA 1AW5A 4CLMA 1UJPA 1A50A 3E0IA 3P67A 3B05A 5TQLA 1VZWA 3PBWA 4PL2A 2E1DA 3IEBA 2XN2A 3HG3A 3TKFA 5D32A 1XI3A 1PCWA 1TPVA 2Y62A 4P2VA 3CM4A 1ONRA 5I3GA 1XUZA 2G95A 2ZRVA 3P5ZA 3KOFA 3W3OA 5DY3A 4NJGA 1QNVA 2BLEA 2QJHA 3TXVA 1MO0A 3QYQA 4X22A 1LBFA 3DI1A 5HR6A 1JRCA 3ZWTA 3L67A 5K9CA 1AG1O 1KFKA 1TRDA 3TE9A 1VJIA 1QOQA 3O1NA 1W1ZA 2TYSA 3L2IA 3PVFA 4EF8A 1YTEA 3LLFA 2CLKA 3TCEA 4GUIA 1ML1A 1OFPA 1QMLA 3A23A 2DZTA 1HL2A 5CSRA 3N2XA 4EOUA 2QAPA 3W7JA 2QJGA 3E96A 1XC4A 2GJNA 2E77A 4UTTA 3WJYA 3M41A 2F84A 3W1QA 2DJXA 4AB4A 2ISWA 3OVRA 4FEZA 5HQEA 3NGJA 1I45A 2W0UA 4OBTA 4JX6A 1L2UA 1TPH1 3DAQA 5LGZA 3TROA 4YMZA 2RH9A 5TBOA 3LTPA 1YADA 1W54A 1A5AA 2Y7GA 3W7HA 1LOLA 5F1VA 4LVAA 3TC6A 1KFCA 1ZAJA 3GNDA 3DFPA 2GUUA 3NQEA 3LHVA 5DCDA 5CZTA 3BG3A 3FJ6A 1W5MA 2WOQA 2C19A 3ABRA 4MKNA 1YDNA 4LVGA 2D73A 3NG3A 1GTEA 5HULA 3HJZA 5IBXC 1FDJA 2J27A 1L6WA 3USBA 3NM3A 3NDOA 2Y7FA 2IQTA 1KM3A 1SO4A 4K6AA 3FYPA 2CLHA 2QCNA 1WAUA 4LV4A 1IXOA 5H2ZA 4MYAA 3TSDA 3ZS4A 2DORA 3BVJA 3NR0A 2OT0A 3LHWA 5F2IA 1M5WA 3GKFA 3HO8A 5A8GA 3TQKA 4NUWA 1WOBA 3UXDA 1ADOA 1F76A 3I7QA 4O17A 4FNUA 4IPIA 3MI3A 2V81A 3LV6A 3W22A 3BW2A 4N4PA 5LKYA 3Q94A 3HGOA 4X2RA 1N55A 5HUPA 4UTWA 2ZZ6A 2GVJA 4LRTA 3P82A 3NNTA 1IIHA 1QFEA 3M16A 3GAKA 3MHUA 3ABSA 3EWYA 1DBTA 1LLWA 3M44A 3W7KA 1IIGA 2RDWA 2YDAA 4CQAA 5HNRA 1PVNA 4OHQA 2LLEA 3LHTA 4UMBA 3PWAA 4AHOA 3UWVA 5CKSA 3UNDA 1SW3A 4NJIA 4XKYB 4AWTA 4JR5A 4MY9A 4PFMA 4UNKA 4I7UA 2PC4A 1ICSA 1FXPA 3E12A 3LXCA 2Q3OA 3M0ZA 1ZENA 3RLUA 1ME8A 1K7FA 5D2YA 5E0KA 4TIMA 2X16A 4PEKA 3TW6A 1VPXA 1GPWA 3C61A 4JYEA 1LROA 3S6DA 3RLVA 1KW1A 3R8RA 5BMWA 1EUAA 1Q6RA 1HTIA 1TPFA 4FNTA 3W74A 4OQVA 3NL5A 3MBDA 5G2HA 4HPXA 5FEZA 4CCEA 2F7FA 3LXAA 5D37A 3INPA 2V5BA 3S9YA 2VFHA 1F5ZA 2VC6A 2V0TA 1IXPA 4Z1CA 2BSLA 2KZHA 2A6NA 4OT7A 3STCA 1V7YA 3MI6A 5KZMA 2H8ZA 3S5OA 4UFLA 4AH7A 1JUBA 5BMXA 2DZSA 1OVDA 1R30A 2HS8A 5C2XA 4NXKA 1X1OA 2QCGA 5C5YA 3TA6A 4NZJA 4S1FA 2WSQA 3W2JA 3MP5A 1K8XA 1LCOA 1NFBA 1XFBA 3TC7A 4TX9A 4R7JA 3GZ3A 3HQ1A 3KHJA 5L6UA 1QO2A 4LUIA 4WXZA 3MP4A 3L9CA 5IM51 1OG0A 2CLLA 4Y6GA 4LS0A 4BWLA 4NNBA 3IGUA 3N2MA 1PCKA 5EL1A 1HO1A 4LW7A 3E49A 3KX6A 1GG1A 2E68A 1OFOA 4DEFA 1G4SA 1N8FA 2P10A 1A5SA 1JJKA 3EX3A 5LHEA 2ZTJA 1RD5A 5D33A 3GDRA 5HINA 1OFQA 1GOXA 3SGUA 3B0VC 3HOJA 1OYBA 5FESA 2PE4A 3KVLA 4UR8A 2HSAA 5D04C 4RKAA 1S3HA 4BFAA 4MZ8A 3FJLA 3TU9A 2QCDB 2EKCA 2EF9A 3IRDA 4XTIA 1DQXA 5F2GA 1GVSA 2FLIA 4Y9AA 4AWUA 1OK4A 3O07A 4DF2A 1FBAA 2V82A 4FX7A 3TV8A 3M5ZA 4PCFA 2WSYA 2ZQ0A 1IF2A 5DXYA 3QPZA 4UFMA 4U4MA 4XZ9A 5AYXA 1ZAIA 3PBVA 2NXIA 3DI0A 4OWGA 5DN1A 3WK0A 5K9DA 2TPSA 2C6QA 3TJXA 4LRSA 4UXDA 4AHQA 3WJZA 2E09A 3LHYA 3NQ6A 1PV8A 3F4WA 3R5EA 2JBMA 1Z42A 1H63A 1W3TA 3LHZA 1TYGA 4JDBA 1NEYA 1UCWA 1SU5A 3BLFA 2ZYFA 3IIPA 5U7SA 1E51A 4JTHA 1DV7A 4ADUA 2VEMA 1QPQA 1VCGA 3W6YA 5CZSA 3DH7A 3NZRA 1DJQA 4O53A 4QISA 4QNEA 3STFA 1PL9A 4Q4KA 3TMLA 2YFOA 3W7MA 3FS2A 1TCDA 4MJZA 2Q3RA 4M6VA 3MMTA 2X2GA 4HKPA 5EA9A 2NX9A 1GG0A 1SZFA 4JXCA 1R46A 4HT3A 4ZQRA 3KXQA 3DFTA 1F7BA 1SQ7A 3EWWA 3NZ1A 3NVTA 5D2XA 1AL8A 1D3HA 3PUEA 4UTMA 1FWNA 3LV5A 2ZRUA 2A7RA 1PS9A 2XN0A 3V1PA 3RF9A 3GDTA 3SFKA 1EIXA 1KM5A 5KINA 3QEZA 4O13A 1UUMA 4WD0A 3QMRA 4GE8A 2Y85A 1DOSA 1Q6LA 3DU0A 2EGZA 4RZ4A 4K39A 5FF3A 4JTFA 3W85A 1DORA 1W3IA 4O4WA 5K7JA 1YPFA 3VE9A 3S5NA 4O1CA 1J5TA 1JUEA 3ATYA 4JTLA 1SFJA 4RZ5A 3W76A 2Y61A 3TSMA 3TSBA 3B4UA 2YFNA 4XBKA 1D9EA 1VYPX 3PSWA 3P80A 1H61A 3KRUA 4BR1A 1KLYA 3STGA 2ZZ1A 1VYSX 1G67A 3W1PA 4CQ9A 3NQFA 3FYOA 2ZFAA 4UTKA 4LOCA 3A9IA 4DELA 4UTLA 3WFAA 4WQ6A 1FWRA 1LRNA 1SW7A 1TTJA 1TQXA 1SR9A 1FCVA 2XN1A 4O16A 3RNDA 4MOZA 1O4UA 3NQDA 3PUOA 4RCXA 1KM6A 4NX0A 3CHVA 3TAOA 1R2RA 3G1YA 3M1ZA 1OX6A 3EXRA 2QCFA 2ALDA 4O0KA 1BWLA 3LBMA 2YYTA 1K3UA 2Y7EA 1H62A 3M7WA 3G18A 2A0NA 3TFXA 3RU6A 3LTYA 3S5YA 3GYEA 1M7PA 3OEXA 1H51A 1AK5A 4UFIA 2QUTA 4DBDA 5FEPA 3SW6A 3IV3A 3TQVA 1DL3A 3JS3A 3PS7A 3W7CA 5U4NA 1TV8A 5F2MA 3RK8A 2ZZ2A 3U8GA 4Z1AA 1OFAA 3M5YA 3IIOA 4AF0B 1FCUA 3QSRA 1SZGA 4PTNA 3EX6A 4A22A 1WOAA 1DVJA 2QUVA 5CZ0A 3WK2A 4AVFA 2WNZA 3M5XA 5J5DA 3NPXA 3OG3A 3N9SA 4Q33A 4E38A 2CLOA 1VHNA 1KM1A 1OK6A 2QEZA 4ORMA 2Z6JA 4KFNA 3QJAA 3TNOA 3PC0A 1Q6OA 5LNVA 1HG3A 3S0CA 3MWAA 2V5LA 3NPUA 1XDLA 1Z44A 2ZBTA 3DGRA 4O4VA 1SZNA 4RXGA 5ABTA 2WJZA 1H7XA 3TJLA 3NQ8A 1KV5A 5TIMA 3C6CA 1T8XA 3TUUA 3EEGA 5FEXA 5GVJA 4UTTC 1H50A 4X3ZA 1S5TA 3NQ7A 2QDGA 4IMCA 1FWTA 1BKSA 4O1DA 3B0PA 4M6QA 3WJSA 1OHLA 1T96A 1DHPA 3QM3A 1SFLA 3DKJA 4FNRA 3EB2A 2PCQA 4XWUA 2NX3A 3TAKA 3G0SA 3W7QA 3QFEA 3THAA 2PRLA 2J6XA 3T44A 2FTPA 3W1AA 3G8RA 4Z1BA 3O6CA 5D38A 3FLUA 3P81A 2X1TA 4WXYA 3ELFA 2QCDA 2HMCA 3W71A 2CFFA 2A7PA 3LOTA 4KFPA 1YPIA 1ICQA 3SR7A 4FX8A 2JKEA 5CPMA 4B5NA 3S1XA 4BI7A 1GT8A 4YL2A 5CZJA 3W2UA 3O06A 5LNRA 1LYXA 5CPLA 1O94A 4R53A 3GX9A 4O1BA 4LC8A 1S5WA 3N14A 4MFDA 5KITA 4FIRA 1H7NA 2PRMA 4YLWA 3W70A 4Y96A 2V9DA 3BO9A 4TR9A 1YTDA 4JICA 1FQ0A 2VELA 2C18A 4UTWC 1FUYA 2H6RA 4FO4A 4H4IA 4EVZA 2Y6ZA 2CLIA 3W7PA 2QUUA 5D2TA 5LZLA 3P5YA 4A2RA 1HO4A 5EBUA 4IUOA 2FPTA 4N9CA 5KTLA 5K9XA 3NQVA 2AQWA 2QR6A 2NV1A 3ZFHA 4UMAA 3MI2A 3A22A 1LM1A 5K2ZA 3QW3A 4ZMGA 1T99A 3GR8A 2WSRA 2ZA2A 4QQ3A 3HPXA 1EB3A 3DXIA 3BG9A 3G1VA 3TW7A 3NQMA 4O52A 1I2PA 3L66A 2NZLA 3S1UA 3F1QA 1ZY9A 4WUIA 2BXVA 2A4AA 3OVQA 3UWQA 3P74A 2WQPA 3BPWA 4WOQA 2J9XA 4TMCA 1H1ZA 1H7WA 1GWJA 1TPC1 3U2OA 4K8HA 4JIQA 5G5IA 2DP3A 2H8XA 4OV4A 2NXHA 4ZZ9A 1NSJA 2ZRWA 3CEPA 2CLEA 3W2LA 1L6YA 4M19A 2FPVA 5DLCA 2I1OA 4MZYA 5AC6A 1J4EA 4QIUA 3W1XA 4LC6A 4KWWA 1G6CA 5LGXA 3UY7A 1SO6A 3UWWA 2WKJA 1VLWA 2VEKA 2NUWA 2OMAA 1C9DA 2YW3A 2NWRA 4JIPA 4NNCA 1TJPA 3P62A 4PA8A 3SECA 2A5HA 1TPEA 3IVUA 1TMHA 2VOMA 4DO4A 1XXXA 4GUJA 4MLRA 2WPBA 2EHHA 5EPDA 1SSDA 1PIIA 4YXGA 3LCXA 2J88A 1B4EA 2H3DA 1Z48A 4IGHA 4A29A 1FDYA 3QZEA 4BWLC 1OF6A 4RXFA 4IMDA 4ZL1A 3O63A 3PB2A 5I3FA 1M6JA 3OIXA 3PY2A 4MFEA 2JGYA 3KAOA 1MEWA 3TFCA 2E6YA 2NLIA 3IVSA 3S5ZA 1W56A 3R2GA 1OJXA 2V8ZA 1KV8A 1OABA 1JCLA 4NZFA 5F4SA 3W07A 1VQTA 2B7PA 1GQNA 5HMSA 1BWKA 4CCDA 3SZ8A 1KFJA 3VNDA 3NQAA 3TR2A 3MW7A 5LHFA 3MO7A 1GVFA 2NV2A 2Z2UA 3OA3A 2ZTKA 3GXPA 3PG8A 1Q45A 3HF3A 4IX0A 2X1UA 4O8RA 3A5FA 5CSSA 1FDZA 3QRHA 5AHFA 4UTIA 2X1RA 2Y63A 2A6LA 2GQ8A 3G1XA 1O5KA 2GPTA 1W5PA 4AF0A 1I4NA 3FIGA 1I2OA 2CLMA 4NX5A 1JQXA 3KVMA 1MXSA 1H7RA 4N6FA 5C54A 3IIXA 2ZRZA 4RLIA 1X7FA 5AHLA 3TH6A 3BARA 2E5BA 1IXNA 3STEA 5BOOA 3W2KA 5CGQA 3N34A 4DXVA 3LCLA 4UUIA 3UYCA 4KFOA 3HGRA 3Q37A 5LSMA 3CT7A 4FNSA 2Q8ZA 1QOPA 4BK9A 1OFDA 2ZA1A 1TPUA 3AJXA 1ZFJA 2W6RA 3W7LA 1O95A 1KA9F 5DY2A 4DF1A 1M7OA 1TB3A 1S5VA 4ONVA 1XL9A 4RX0A 4OGZA 1YDVA 5FF2A 3T78A 4JX4A 1F2JA 5AHEA 1LBMA 3IGSA 2DU2A 2FQIA 3C2EA 4IXXA 2NUYA 1MEIA 2J24A 2ZA3A 2Y70A 2RDTA 5LNSA 1VCVA 1MEHA 3EX2A 3IGXA 3C2FA 1K02A 3TXZA 3U6WA 2ABBA 2DZWA 5HUOA 4K38A 2YX0A 3PUDA 3LHUA 2R94A 1KFEA 2WNNA 4UFHA 5SWUA 2FPYA 3FEMA 3P8JA 4JX5A 4UR7A 1OFRA 1JVNA 1B3OA 3M5VA 4NVTA 1KTCA 1YTKA 1JCJA 4CCCA 3B03A 3E9AA 5F4WA 3C2RA 4JTKA 4LNYA 1EWEA 4O28A 4O54A 4UTHA 1VHCA 1Y0EA 1OFBA 2XFWA 3IVTA 4LTSA 3L21A 4LVBA 3PSVA 5LNWA 2QCCA 2CZEA 2FB2A 3QMTA 3A24A 3LI0A 3NL2A 4FNQA 3GXNA 2VEIA 3JR2A 4LS1A 3CLMA 1LLZA 5K4XA 3LCGA 2YR1A 3UWZA 5FF4A 3W83A 1A5BA 4HNNA 1CI1A 3DFQA 1DJNA 3FKKA 5BNKA 3MHFA 4I7WA 1EUNA 3QQ0A 1X1ZA 3TK7A 4JS3A 3LBCA 4K8EA 4MZ1A 1SUXA 4TU1A 2GQ9A 4IX2A 1TV7A 3M47A 3EWZA 3QQ1A 3UPBA 1RR2A 3DHDA 1KFLA 3LCHA 3LDVA 3LTSA 3IIVA 3NA8A 4A2SA 1N7KA 1LP6A 2JGQA 1RPXA 1P0NA 3GVGA 4O1AA 1FCBA 1PE1A 3L65A 3L68A 4JY8A 4Z08A 1W37A 5BW6A 1DQWA 1LBLA 5H91A 3QF0A 4NU7A 4NQ1A 1G7UA 4LU0A 1JRBA 1EEPA 4GFSA 1QDSA 3NPVA 1XDMA 4GC4A 3S8HA 2ATSA 3L0NA 1KTBA 1B9BA 3GB6A 4E2DA 2JKAA 4M7TA 1K7EA 3HIJA 2YSWA 2C13A 3W1NA 4M6PA 3CB8A 3R13A 3W88A 4LUJA 1EP3A 4LVFA 4JD4A 1U83A 1ZJIA 3G3MA 3S42A 1K7XA 4K36A 4TMBA 3GXTA 2I9EA 4Z0SA 2P0OA 3KFTA 4UNLA 1OYAA 3E02A 1O5XA 1JUKA 4K7VA 3W1MA 4JTSA 2J9YA 4JTJA 2TSYA 4LVDA 3TIMA 1LRTA 4GWEA 4WY0F 1PHQA 3O15A 4JTTA 1MSSA 3UWYA 2W79A 4JGDA 2QCMA 2EPHA 1GYLA 1A5CA 1F6PA 1AL7A 1G69A 1VCFA 2C0AA 3NQGA 4N9EA 4NT0A 3P60A 5FF7A 5C55A 1WXJA 4AHPA 1KBJA 5DBUA 5HWNA 2NWSA 3LCIA 2GVLA 2DJLA 3I68A 4EWND 3G0XA 4KWVA 1H5YA 5E1QA 2VFIA 1KM0A 1JQVA 3B8DA 2FFCA 5FEWA 4UIOA 2CU0A 4WX2A 4IJBA 5EY5A 2E5DA 5AC8A 3HMJG 1W5NA 3BK0A 8TIMA 3O6YX 2B4GA 3QMSA 3EXSA 4N9BA 4HIBA 4IPJA 1RVGA 1P5BA 2A21A 4FHAA 3HPSA 4UTUA 4DO5A 4H6KA 3LLDA 1FWWA 1TO3A 2BZNA 2OCZA 4WY0A 5K4ZA 1UUOA 2V2DA 4C1LA 1TTPA 3A5VA 3NO5A 5DCBA 3W7RA 2PRHA 3EWXA 3RFAA 3T4CA 2OX1A 1HFBA 2GOUA 2YGYA 1IGSA 3DFOA 4FXRA 3PBYA 3UD6A 3MYPA 4O11A 4LV9A 4O18A 1A53A 3D0CA 4M7SA 2UV8G 4NJKA 4N6EA 4ZVJA 1XCFA 4N2YA 5AYYA 4BI6A 1QPNA 1MZHA 4WOZA 3FKRA 2G96A 3QW4B 2QKFA 2E6DA 1G4TA
chains in the Genus database with same CATH superfamily
5T26A 1M04A 1Q85A 5I7GA 3LK6A 1O60A 2H9AA 3C86A 3O8AA 4RZBA 1B3YA 5G4WA 1XDJA 4DJFC 3HPZA 1RZMA 1Q6DA 4FAMA 4UWMA 1V93A 1XLGA 5AKQA 3QC3A 4JYDA 3BZGA 4W9TA 5A6AA 3GWQA 2AQVA 2ADAA 4D1JA 2Y5SA 3GO2A 3NZQA 2WNQA 1UR8A 1I2RA 2ZX7A 4MGGA 4AMAA 3FJNA 2P3EA 1JF5A 3VC6A 1UWTA 3UZ5A 7CGTA 2OWCA 5HJXA 4GG9A 3S2JA 5E6YA 2JFEX 4RZ6A 1EPXA 3LPGA 2RHGA 1C7SA 3U4FA 2WO5A 1XSIA 2OODA 3KE0A 4B91A 4H9ZA 3CL8A 4LCRA 3CMJA 2CW6A 3HM7A 1E71M 1E72M 2W4XA 3NURA 1DJIA 3K1DA 3A3WA 4ML4A 3PM6A 1FHUA 4XG1A 2V2HA 1TWZA 4YVPA 3T1GA 3UVIA 4NZCA 1ZBKA 1NF0A 4JFTA 1IXQA 3C2OA 3F2BA 4ZQNA 3HGJA 2DUZA 4PC8A 1QPKA 3SIZA 4CD5A 4U10A 1I0DA 3VIHA 1CGWA 4ADTA 2PDNA 1QHZA 1XIGA 1NWUA 4P7RA 1VYRA 1R3QA 4DBUA 3UWUA 3N19B 4NNAA 3VOFA 4LUYA 4AAJA 1EGZA 4PTMA 3LLXA 4ZB5A 3M9YA 4DHGA 4ZEPA 3VNYA 4IWWA 3USZA 3H53A 1TPB1 1A5NC 3IARA 4K1WA 3IS4A 4MADA 4ZQMA 3LSCA 4B9YA 3R43A 4XD3A 3E38A 1ODUA 3WF4A 2C7FA 3WIJA 1BVZA 2PDGA 2O7SA 4HU0A 4LQ1A 5CXPA 5JBEA 1FCQA 3I7SA 3LGEA 2RDUA 3AMCA 4ML9A 7REQA 4DYJA 1KB3A 5DXXA 5TNVA 2CWNA 4ADSA 4GZJA 3QYSA 4EPEC 4YCOA 3I6EA 3T7VA 3DKLA 2PBOA 5HJYA 3I4EA 7TIMA 4MVAA 6XIAA 1G0CA 2HTMA 5IDIA 3SO7A 5LA1A 2WC7A 2E5CA 3BW4A 4HA1A 4U5KA 2NV9A 3PAJA 2CZDA 2HZGA 2PTWA 4N9DA 1JZ8A 3VZYA 4LT9A 5FL1A 3GDKA 1HT6A 4O14A 1DIKA 3UW6A 2XGZA 3MUAA 3UY8A 3IJ7A 4S2BA 2DVTA 4JTQA 3H55A 3VKKA 3R0DA 4DJEC 1XIEA 1GORA 2NVDA 1XBYA 3VNJA 5EFDA 1F6KA 3F03K 5HMEA 4IL2A 1NDYA 1G4EA 1UH3A 1VRXA 2DZPA 2IW0A 4PYSA 5DBTA 3VKBA 1EC7A 4I90A 2D0GA 2P0IA 2VO5A 4RJEA 2CNCA 2HE5A 4EIVA 3NDYA 4L65A 1B90A 3MU7A 4GD0A 5BOEA 1GVQA 3GAYA 2Y7DA 3I6TA 4HK5A 2EQDA 5E93A 2GOKA 3G3DA 2G4FA 3WF1A 2B0MA 2OOGA 1ECQA 1LOQA 3B8VA 4HNCA 4U2YA 5IFTA 4J9JA 4FI4A 4E6MA 2ISSA 3SQSA 1SFTA 4KRZA 3W23A 5HWJA 5MHBA 4P8UA 1FY6A 2IQDA 1EWDA 1KXTA 4H19A 5EB8A 4JN6A 1RHCA 2J9ZA 4JTIA 5I23A 5F2LA 3A21A 3OZPA 3OO2A 1LTDA 2YLAA 3SN1A 2YCEA 3FFSA 1KBIA 1H1YA 1BYCA 1TWIA 4GI6A 1KR1A 3RDKA 1XM3A 1XD1A 4DN1A 2J8GA 1W3KA 1Q63A 4ZR8A 2YKKA 4GUFA 1CX9A 3FYYA 4HPJA 2CBJA 3PULA 4XQ6A 3BGJA 3I3EA 1RK6A 3EWBX 5D02A 2F6UA 2WJEA 1QCWA 1LDCA 3UETA 2OXNA 1QR7A 4RPQA 4M24A 3NOEA 3OTRA 4S3BA 3WX7A 3AYTA 1Q6QA 3NAVA 1FVPA 2OFJA 4RDZA 3I3DA 1VH7A 4MNKA 3WQPA 4GNJA 2DZVA 2VWTA 2YB1A 3LQLA 4E4UA 2B7QA 1PKLA 3G8EA 2Q8LA 3VGEA 4WHBA 2AGKA 2BDQA 4Y90A 3F5KA 3VNIA 2OKTA 3IGHX 1IGWA 3CZLA 4I8YA 3KM8A 1DJHA 1JPHA 4HJWA 5GJMA 2YL8A 4PGLA 3N9RA 4POCA 2C8NA 4C6CA 3UZJA 4B2DA 4QSHA 2C16A 3G1FA 4BI5A 3MMDA 1YDOA 2ZUUA 4CQ8A 4JHMA 1SZEA 3NDZA 1V4YA 3DFYA 3W28A 1JCYA 3DBPA 2IKHA 2PDHA 3SRHA 2O9OA 2XISA 1JFHA 2INZA 3CAWA 3C56A 2VDHA 3CTLA 4MF4A 1OQFA 3OYXA 3Q58A 4N4QA 4Y8EA 1QATA 5AHNA 3T2QA 3AISA 4W88A 2Y88A 3AZSA 3EWUA 2X7WA 3THQA 3QPYA 2C1GA 3CWNA 4ATLA 1XRTA 4EF9A 4DX3A 3EX1A 4OE7A 3N11A 2PDJA 4LF1A 4A3HA 3DENA 2MUCA 1ZGDA 3KDOA 4WJEA 6TIMA 3FDKA 3M07A 3W2MA 2QV5A 3H54A 4QEHA 4BCEA 3BAKA 1W31A 1W9VA 5D05A 4RNJA 1Q3NA 4MIMA 1MRQA 3HGSA 3NQ2A 2E8YA 3L4TA 1OFEA 1YLVA 4M29A 3BXWA 1DWGM 4JHZA 1JYXA 3QPEA 1E1EA 3O6DA 1CYGA 1R2TA 3JVAA 2XM1A 1W9UA 2XJ7A 1K9FA 4IPPA 1EP2A 3E2SA 5AY7A 1M3UA 3G1AA 4FIQA 3HV9A 3NXFA 3QN3A 2V5KA 4PBEA 3UZWA 2GQ3A 2OQHA 5H8PA 3B06A 5I5RA 1KNWA 3WLLA 3OA5A 4H7VA 1VC4A 3W7DA 2A2IA 1VS1A 3DEQA 1A47A 2IPWA 1Y5VA 4DNMA 1H09A 1VFTA 4RE3A 3T55A 2Z1SA 1TJRA 3MKKA 1F4AA 2PPGA 1TREA 4L6DA 3L4ZA 3LERA 3GW3A 3L4VA 4LANA 2J78A 3H2AA 2GQAA 3JRKA 4ACZB 1BFNA 3OJGA 2P50A 3OG2A 4FXFA 4C6EA 4KPLA 5B7ZA 3WMCA 4YTTA 3P14A 5FIPA 1QK0A 3VD3A 5CLWA 5CBIA 1OEPA 2FB3A 1FHDA 4AFYA 5KZDA 2QCHA 2VENA 4MNMA 4X61A 1QHOA 3ABQA 3F2DA 3A3HA 4DJFD 1XLBA 5AC4A 4H3DA 1TG7A 3VX0A 3LSBA 5J5RA 3NSXA 1WDDA 2QDHA 1JCNA 2R91A 4TUFA 3C3NA 4JQ3A 3KLKA 1XBZA 5I3JA 4V28A 3TDFA 4E2BA 1VGAA 2XVLA 3PZMA 4NYYA 4N02A 1FWEC 1OX5A 1V51A 2RJHA 3I7RA 1E40A 1FWFC 3EOEA 3NYZA 4H8VA 4FXSA 1RSCA 3K1GA 4HA3A 2WMKA 1A5LC 1WDRA 5ECVA 1HL9A 2J8FA 4DZ5A 4XO6A 2DSVA 3MUY1 3TKFA 5CEWA 1I1XA 4IISA 1FFRA 2G95A 1Q4NX 3BUVA 3W3OA 4NJGA 2BLEA 2QJHA 4ZOAA 3TR9A 5FD0A 1MO0A 5A1AA 3FHQA 1XLKA 3QV7A 3ZWTA 1PIGA 4MMWA 6XIMA 2WMJA 1B2YA 4E5TA 3V0UA 2WKLA 2Z4GA 4IQDA 4M51A 5LA0A 4AYGA 1NFPA 4ES4A 4WSJA 3Q65A 3WELA 7PTDA 2F9RA 3PVFA 4EF8A 2CHNA 1ENUA 1E3ZA 1YTEA 2CLKA 3WQDA 3TCEA 1OFPA 1ZJHA 3A23A 2DZTA 1HL2A 2EO7A 1ISXA 1R0MA 4DWSA 3UZXA 3W7JA 1XC4A 2GWNA 2E77A 5GPRA 2F84A 2ISWA 1RUSA 4RW3A 5HQEA 3WUGA 1I45A 2W0UA 3GXMA 3PPGA 1NDVA 4JX6A 5C71A 1W3HA 3VD7A 1W54A 1A5AA 4KQNA 4Q22A 3VIJA 4AXNA 4LAZA 4UQAA 3SUWA 3QXBA 4GLEA 1H4PA 2WC4A 3TC6A 1KFCA 3GC5A 3GNDA 3DFPA 2WBGA 3ITVA 5ABHA 3BG3A 3FJ6A 1M03A 2PP3A 3ABRA 3PWGA 1GTEA 2CWXA 2YLLA 2XU2A 1L6WA 3USBA 5E5CA 4GYKA 4IJRA 1JIBA 1SO4A 1VBJA 1E6XM 3WENA 3SDOA 1WAUA 3TSDA 4HMEA 3BVJA 3FVMA 2OT0A 2BXZA 3GKFA 1WOBA 3UXDA 1F76A 4DJED 4O17A 3CMGA 1ADDA 4FNUA 1J8VA 4IPIA 3MI3A 2Y24A 3BQ5A 4N4PA 4X2RA 3PN8A 5HUPA 3QTPA 2GVJA 1T6MA 1PB0A 3HQPA 2FZDA 1IIHA 3TYCA 1BSLA 1R3TA 2G0WA 3BICA 2WANA 1IIGA 3T0AA 4L1XA 4PTWA 4NZ1A 3KP0A 4DXKA 3T2OA 4OHQA 3MANA 3OLIA 3WQWA 1QI5A 4HQVA 4C6QA 2JF6A 4AHOA 3VOJA 3AYVA 1RLDA 3KRBA 5T8GA 2AGTA 4MY9A 4PFMA 4I7UA 2EPOA 4D6FA 3SQMA 3RLUA 3MT1A 5E0KA 2Z1VA 3Q45A 4HZ7A 4JYEA 2PP1A 3K4WA 3S6DA 2VWSA 3OZYA 1VP5A 4EXQA 4NAFB 1TV2A 2ZUMA 1TPFA 4FNTA 3W74A 4ROPA 1B0IA 4AEFA 1SM9A 4H7CA 5G2HA 2J7HA 4ECLA 4QGCA 4JQ1A 2F7FA 2PDKA 3S9YA 3GH7A 2VC6A 2V0TA 1XIJA 3OLEA 1BRLA 2BSLA 2DVUA 3STCA 1V7YA 3MI6A 5KZMA 4ICCX 3CL6A 1JXKA 3S5OA 4UFLA 3THUA 2CC0A 2J13A 1OVDA 1R30A 2R1PA 2X42A 5C2XA 4A05A 4YTRA 2QDEA 4W89A 4US5A 4NZJA 2WYSA 3UZYA 3GZ3A 2X05A 3ZO9A 2GL5A 5L6UA 4WXZA 2A3CA 4XZIA 3FGCB 1UKTA 5GJPA 3IGUA 3N2MA 4HZ8A 1Y65A 1PCKA 5EL1A 3UNTA 4LW7A 3E49A 5A6JA 1VEOA 1YRRA 3AC0A 3CTTA 2YDRA 3FW6A 4DEFA 1G4SA 1N8FA 3LNMA 2EJ1A 5HMFA 5LHEA 4LNCA 2ZTJA 1W9XA 3AI0A 4GYJA 5FESA 1OGGA 3W01A 4YHEA 3I10A 2QCDB 4S3GA 1YHTA 1EOKA 1J93A 1GVSA 3ARVA 4JZ5A 5I78A 1OK4A 4DF2A 4FX7A 1K6AA 3EDKA 3MVIA 4IIGA 1E9LA 2ZQ0A 3B0YA 3QPZA 4DLFA 1Z8AA 1JPMA 1VF8A 4GVHA 3W6MA 4PEEA 4F0SA 5HANA 4DLMA 2PWGA 3BURA 3WJZA 2E09A 1R7OA 3JW7A 3R5EA 2QULA 5JH1A 1VFMA 2A3BA 4OBSA 2VCBA 1Q4WA 3TYDA 4V2XA 3NZRA 1GQLA 1DJQA 4QISA 1OGBA 4PBFA 2PSNA 1HGWA 2WMIB 1JYWA 1TCDA 1A5MC 1GHRA 1XP3A 4MJZA 3MMTA 2ACUA 2RAGA 2Y2WA 1PUDA 1M41A 3R94A 2NQJA 1KGXA 4ZQRA 3DFTA 1RBLA 3EWWA 3WH9A 3EPOA 5D2XA 1UD8A 3VNKA 4UTMA 4CU8A 4PB4A 3WF0A 3APYA 3ZLGA 4LY4A 1PS9A 5C7VA 3F2CA 3V1PA 2BGNE 3UGRA 3GDTA 4TV6A 3TN5A 3VOCA 4QRNA 2YA2A 2BOGX 4MG4A 3MMWA 4AMCA 1LUCB 3QMRA 1CNVA 1UQZA 4ERGA 4AW7A 1UWAA 3VM7A 4K39A 2AMGA 4NZ5A 5FF3A 1RPKA 2GGGA 5CBBA 1PTAA 4NASA 1P0DA 2CETA 5MKGB 1PJ9A 2AKZA 3MVTA 3PZQA 4C6PA 1J5TA 1JUEA 4OBRA 4JTLA 1TX0A 2DV0A 4B92A 3TSBA 5REQA 1NH6A 1E70M 2ZZ1A 3W1PA 3O0FA 3NQFA 4EE9A 3KTCA 4CQCA 3A9IA 4NI3A 2FHCA 4QE5A 3WFAA 1EQPA 2BASA 2VHLA 3TYBA 1FWRA 1XIBA 1BPLB 2ZUTA 1SR9A 5JH2A 3D3FA 4O16A 4IT1A 1C8YA 3WMLA 3NQDA 3PUOA 3ZSTA 4PUKA 3HURA 4W8AA 4H8HA 2PGRA 4HJFA 2Z7KA 3M1ZA 5CH9A 1OX6A 2P76A 2QCFA 4D71A 3VO0A 4O0KA 1K8CA 3LBMA 6ENLA 2AKMA 2YYTA 3WH5A 2POTA 5HAOA 3BJSA 3G18A 2A0NA 2YCJA 5FKYA 3OW1A 4YVXA 1WKYA 1H0GA 4UR9A 1M7PA 3OEXA 4RL3A 4TX8A 1SJAA 4KGLA 4KH2A 1J96A 1KBLA 2X2YA 3JS3A 3FNDA 5F2MA 2ZZ2A 4GVFA 1OFAA 2QJJA 1FCUA 4PTNA 1E1CB 4A22A 2QUVA 4AVFA 3M5XA 4HB7A 3N9SA 5AVHA 1VHNA 2QEZA 4ORMA 1R3WA 4KFNA 2OEJA 3QJAA 8XIAA 3BE7A 3PC0A 4J2PA 1WCGA 3GTHA 2V5LA 3NPUA 1Z44A 5EMKA 3WQ6A 3QV8A 1WB0A 3ZLFA 4RXGA 1SYTA 5ABTA 2WJZA 1F3EA 3GM8A 1OWQA 3CLWA 4Q4MA 1SJBA 5LA2A 1EO5A 1AVAA 1RY8A 4X3ZA 2FZNA 4E8GA 3NQ7A 4PUEA 4IMCA 3E0FA 1BKSA 2JIEA 4O1DA 3B0PA 3WD3A 3R10A 4KBXA 4HA4A 1SFLA 4GO9A 3EB2A 5I3DA 3VGHA 2IPFA 3THAA 3T44A 4IM4A 2VCCA 3CAVA 3FLUA 2G3IA 4WXYA 4AD3A 3IUIA 4KFPA 4DUVA 2WJDA 1EKOA 4D6JA 4PTVA 4CEXC 4FX8A 5CPMA 5CJMA 3S1XA 4MDPA 2ZVRA 3O06A 5LNRA 5CPLA 3T6CA 3A12A 3H4WA 3CAKA 3WD1A 1RH9A 1MVYA 5AC5A 3GX9A 4O1BA 4QS6A 1PZ3A 1AQ0A 3GU2A 1X97A 5KITA 1QW7A 4ATDA 3GTFA 3EAUA 2J7DA 1EZWA 1YTDA 2UY2A 3UYIA 4XAGA 3VX1A 4AZCA 4H4IA 4L80A 1GHSA 4QFUA 1E0XA 1XLFA 1NP2A 5AVNA 1JPKA 3W0KA 3T0TA 3UFYA 3P5YA 4A2RA 3WNKA 4N9CA 5KTLA 4QDMA 1TV4A 2AQWA 4REQB 2NV1A 2W9MA 1LM1A 4Z2JA 1LT7A 3S2LA 1G9HA 1CB7B 4TTGA 2P53A 3DXIA 4EACA 2ZUNA 3AMKA 3G1VA 3TW7A 3CPGA 4O52A 3VU2A 3S1UA 1ZY9A 3PFRA 4C6NA 4EPKA 2NVAA 3KTXA 1TJ0A 1H7WA 1F9CA 3CYVA 1D7FA 4AD0A 3EDEA 1CGVA 1A3HA 4K8HA 1KCZA 3N15A 1W3LA 4OV4A 3ZJKA 2PDUA 3GTXA 5M1TA 5XIAA 2B31A 3W2LA 3OB8A 4YTUA 1BKHA 3S4TA 2DIEA 1E56A 1WKFA 5AZ0A 1GQKA 1HJWA 4B90A 3SUUA 5HQMA 3GVVA 5EGRA 4PMRA 1XG3A 2OZ8A 4ZOEA 2DQWA 2EXOA 1XICA 2UY4A 1PYMA 3CASA 1IEXA 4MSSA 1TPEA 3WL0A 4MLRA 1PX3A 4I5UA 5JQ9A 2WPBA 2F8QA 3BLOA 3T09A 1ECEA 1D8CA 4ZSTA 2J88A 5EMJA 1XYAA 2H3DA 1XLCA 4HMDA 3D47A 4HU3A 4JKKA 5CC6A 4R5EA 3R4IA 2CXGA 2BMBA 4BQ3A 1HJVA 3R2GA 4MNLA 4W4QA 2VZOA 2NQZA 4Q4OA 3V0SA 3R0KA 3E2RA 1A0CA 3W07A 1VQTA 2B7PA 1KFJA 4QJ3B 4Y2WA 2VOTA 3BWWA 3NQAA 1J79A 5LHFA 3MO7A 3NEHA 2Z2UA 3RXZA 5LXEA 1C9WA 1Q45A 5CSSA 1HGYA 3KS5A 1GQIA 2ISDA 2Y63A 4A3RA 3VGDA 1ZLPA 3PZIA 2GPTA 2WLZA 1I4NA 3FIGA 1MXDA 4NX5A 4MTVA 1H7RA 4FMVA 1FKXA 2XIMA 2ZRZA 1CECA 1J10A 3UJRA 2E5BA 1IXNA 3ID7A 3DUGA 3EPNA 1F3XA 3UYCA 4KFOA 2X0YA 3HGRA 3Q37A 2HCVA 3VOHA 3F4CA 5LSMA 3CT7A 2CBUA 2D0FA 2ZC1A 1R86A 4BK9A 2V63A 1PYFA 2W6RA 1OADA 1BXCA 1VFSA 3W7LA 1O95A 3DYOA 3AWOA 5LIWX 2D2GA 1TB3A 1DIEA 3VFCA 1FWDC 4RX0A 1YDVA 5FF2A 2ACSA 4M8UA 3ZSSA 2WQDA 2DU2A 4IXXA 5EBAA 2J24A 5BRQA 4LFYA 4LPCA 1ZQ5A 3O7UA 3CUXA 2XUCA 1ZJBA 1Y7VA 2NQHA 4K38A 4GQ0A 3DYMA 1EL3A 3U57A 2R94A 2WNNA 5SWUA 2FPYA 1OFRA 4NVTA 1OG6A 4BQ4A 3C2RA 1W9DM 1Y0EA 2I57A 3VDHA 4LTSA 3L21A 4TTUA 3VGFA 2CZEA 3A24A 4IIEA 3QR1A 3BOXA 4OIFA 3WLRA 3CO4A 3WO8A 3JR2A 1G1YA 3ALGA 3CLMA 3RPDA 3W83A 2D0HA 1A5BA 1CI1A 1WNOA 4FSAA 3LMZA 3T2PA 4XV0A 3MHFA 5A2BA 4G1NA 4I7WA 4GZ7A 1M65A 1CT5A 1U33A 4JS3A 4N42A 3LBCA 4K8EA 3ME3A 3RCNA 3BLKA 4XBJA 2BFGA 4TU1A 4AY1A 2X41A 3M47A 4F0RA 3EWZA 3MC5A 3UPBA 1RR2A 1PSCA 1GPFA 2FHFA 1QNQA 3TLQA 7REQB 3LTSA 1N7KA 1LP6A 1MW2A 3L65A 1QBBA 4IF2A 2W5FA 1C8XA 4GY0A 4PUNA 3UJSA 3TONA 4NQ1A 1JRBA 3T8LA 4GHRA 1QDSA 1KTBA 3GC2A 3AXIA 3GB6A 2YSWA 3AAMA 1PWMA 3R13A 2KAUC 3L23A 4IICA 4LVFA 4JD4A 5ABEA 4K1GA 1V6TA 3G3MA 4ZOCA 1CENA 2C79A 1K7XA 3H6OA 2GGEA 5IDZA 5RUBA 3GXTA 4A4AA 2P0OA 1OYAA 3E02A 3W1MA 5JBDA 4RNHA 2JF7A 2J9YA 3TIMA 1LRTA 3MMUA 2ZE0A 1QK2A 4KERA 1MSSA 3UWYA 2W79A 2QCMA 4C6LA 4GIYA 1OZQA 1US0A 1F6PA 1F61A 4PMNA 3NQGA 1KFWA 1LL7A 2JALA 1XR2A 4XD6A 3P60A 3DC0A 3GU9A 5DBUA 5HWNA 2NWSA 1UKSA 3LCIA 2DJLA 3I68A 4LYPA 5E1QA 2FTWA 2HEJA 1JQVA 3SCQA 3EZ4A 4Q8OA 3IACA 4WX2A 2BY3A 5AC8A 1RA5A 3MQTA 2XFRA 3O6YX 1XH0A 4D6EA 4N9BA 1GUVA 3VIGA 4HIBA 1TUFA 1UH2A 1OCBA 1RVGA 3MDWA 4PCTA 2UZ9A 5D4YA 3FAXA 2VQTA 4FHAA 4ZB0A 4J3UA 3PZUA 4DO5A 4C65A 4DWSD 2VX7A 1XS2A 2BZNA 3N6HA 2O92A 2V2DA 4H6EA 3A5VA 1YPXA 1M01A 3RFAA 5A8NA 2FYMA 3TYAA 4FXRA 4O11A 3ZR6A 4O18A 3WNNA 1S2TA 1MWOA 3MO4A 3VOGA 3L7RA 1XCFA 4N2YA 2C0HA 1ZZMA 2E6DA 1GK8A 5CG7A 3T08A 4D2JA 5DX7A 2WSPA 3W7EA 4MY8A 2H3BA 1EO7A 1UWUA 4NG3A 4GKTA 1QO5A 3WNLA 2GDVA 1B3XA 1JNDA 5TF0A 5XINA 5G4HC 5CC5A 2DIJA 2ESCA 2Z0IA 3NPWA 3BV4A 4A3UA 2Z26A 2YJQA 3AIRA 3KRZA 2TRSA 1AJ2A 3OBAA 1PPIA 2VYOA 2Y4SA 3BAJA 5KMYA 4CN4A 3ABXA 1CGUA 3RJYA 3C4UA 1KTNA 1DTUA 4E0CA 4NIRA 4C7DA 1RQHA 3MKVA 4WRHA 1S2WA 3KOZA 3P84A 1GYNA 3T0CA 3CUFA 3W2NA 3BQ6A 1QTWA 2PWHA 4L6HA 3SSJA 2CZFA 1B4KA 3N29A 1PHWA 3TWBA 3EKLA 4LEQA 4GBUA 1LQAA 3GZAA 3GLCA 4L9ZA 4IP7A 4JIRA 4UMCA 2O9PA 3QSTA 3A47A 1DWHM 2HWGA 3A4XA 4UFKA 3C5QA 4G2DA 1QRQA 1EX5A 1QI2A 3WK1A 4J40A 2YXGA 2ZXQA 3VUPA 4MWAC 2QF7A 5D2VA 4BHYA 3FSTA 4MLJA 2XH0A 3N73A 2XDFA 1B9ZA 4X0NA 4HNTA 4AEOA 3GNNA 2ZWZA 2O7QA 5FI8A 1VJZA 3W1TA 1XBVA 1EH9A 3H4XA 3GK0A 3DFNA 4ORIA 1Z89A 1SZRA 3COTA 4C6JA 1FKWA 4C1NB 2RFGA 4KEMA 3FA5A 1DEDA 2E67A 1V5XA 1AH4A 1P0KA 3HTWA 2GJLA 4US5D 1W1B1 4IMFA 4QEEA 3LMYA 1F73A 2WZMA 3AMLA 2V3DA 5I3IA 1ZCOA 3W9ZA 4PRRA 1UBSA 2R1KA 2G3MA 3LX9A 4MUZA 5DT7A 4W85A 3E2QA 2E6FA 4IOTA 4ACYA 1YXDA 2V38A 1W1YA 1CWYA 4E8CA 1U1JA 2P88A 3CZJA 1W8GA 3CS2A 1X98A 4O1EA 1B3VA 3O05A 5TD4A 3OVPA 1DP0A 1V79A 1GZGA 3VE7A 2PDXA 3ATZA 3PPHA 3NTYA 3P8IA 5BOFA 1UR1A 3VNZA 3ISIX 3UXLA 2ZXBA 2YW4A 4E8DA 1UQYA 1XSKA 3RLHA 3SAZA 4NJHA 1E6QM 3NQBA 3CH9A 3CK5A 3OOQA 3WQGA 4QM1A 1W6TA 4QG9A 3R89A 1Z7AA 1PTGA 1V8EA 5A6TC 4GJ1A 3ARTA 1DWFM 3SUTA 2DY3A 2PDYA 5GNYA 2EPLX 2FIQA 2HXUA 3LEPA 3T05A 1U5HA 1P0EA 1I9CB 3WLMA 2CERA 4A8LA 4UCFA 4WSHA 4YWIA 8RUCA 4TOQA 3WMSA 1UIPA 1GW1A 3WLQA 5DRIA 4C90A 3W1LA 1TTQA 3HU7A 4JYFA 4IFKB 6ALDA 4EK7A 5G2IA 2P8BA 3MBFA 4LYRA 1N8IA 1WA3A 2J25A 2W27A 5HMDA 4B16A 1V0LA 3ITXA 1YNPA 1T0OA 3KBMA 4GFIA 5DELA 1FX6A 3CO8A 5K3VA 2P1FA 1QJWA 1AMYA 1UD4A 4IXHA 4CD6A 1TUXA 1XLHA 3LQGA 3POHA 4GQGA 4GXPA 1SR0A 1UWIA 3S1WA 1UC5A 3GBEA 3MHGA 3N3TA 3SY5A 5A6LA 2YBTA 1Z41A 1V3MA 1J5SA 2ZIDA 4AIOA 1NF7A 5EKYA 1JXJA 3WBEA 1OSEA 3C8FA 3I6RA 2YZRA 3BMXA 3UR2A 1UMLA 1ZBVA 4FLRA 1BTMA 2ACRA 3L4YA 3Q4DA 3QGAC 1YXYA 2OZ0A 4WR3A 2DFAA 5AHMA 1GVOA 5F1UA 4YTQA 1LL4A 2C1HA 3GUWA 3EWDA 4D6CA 1H7OA 3U7BA 2OEKA 1RP8A 4OECA 2BOFX 4GI8A 3WK3A 4A21A 1XBXA 4Q8PA 1CW2A 1XUUA 4J2MA 4R7WA 2QPUA 1MMFA 3KL0A 1JZ2A 3W7GA 3CIXA 3KBSA 4DIAA 1OF8A 4KW2A 4QJ1A 2BVDA 5F4XA 4LWWA 4DWSB 3AZTA 4JTCA 1ZHAA 1QWKA 5BCAA 1WYIA 2ZRXA 3NIYA 3W87A 2A7NA 1WV2A 3HB9A 2DH3A 5GNXA 3RRXA 2ZZ7A 5FL0A 4GBDA 3LRMA 1ZS2A 1FWCC 3OLDA 3QHOA 5LXXA 2QJMA 3L0GA 3B0UX 1VBGA 3N2OA 3P7YA 3NL6A 1GZJA 3PG9A 3D46A 3IAPA 1RV8A 5JUVA 2BVWA 4PH6A 4Z0JA 1UD3A 1THFD 3H26A 1W8SA 4V1XA 4I8DA 1XRVA 2XFFA 1HP5A 1ZRQA 2WSKA 4F8XA 3GTNA 3SUVA 1J2WA 2Y89A 1ZB5A 1P6WA 1YYAA 2X1SA 2PF8A 3N2CA 4L64A 3S1VA 1ZAHA 1TA3A 2QQ6A 2FH6A 4XZMX 1X38A 1H60A 2VKZG 3B04A 4B3LA 2Q71A 2Z6IA 2E6AA 4IMEA 3CBWA 2D2HA 5D8WA 2A3AA 3EMCA 1H7PA 3UU0A 2RKXA 3ABOA 2QXWA 5A2CA 3VGGA 3TVAA 1G4PA 2BTMA 4XAYA 2ZX5A 4OOZA 3PTDA 1MUMA 1IR2A 4FOUA 3CV6A 5HR7A 1VB9A 2DW6A 4OZOA 4GOAA 4FR1A 1XX1A 1GKPA 4DBEA 4Z2IA 2V30A 2I5IA 4JIIX 1XH1A 3FK4A 3C52A 3UXIA 2IKJA 3VDAA 4UFJA 4HNVA 1WX0A 4ALDA 4R33A 3LB0A 4AIEA 4CD4A 1BSIA 4I9AA 3UQNA 1F3WA 4JQAA 3RHGA 4JFUA 3GDMA 1C29A 3SADA 2DDXA 1L9WA 3KCJA 4S2CA 1UKPA 3HQOA 2VVNA 2E28A 1M9HA 1XINA 5KSWA 2VC5A 2EPNA 3XISA 1TTIA 1HF6A 4AXKA 4Q32A 1FA2A 3ORWA 2QDDA 1VLIA 4NAFA 1BEUA 3TOPA 7ENLA 3VFLA 3ZZ1A 2FVMA 3QOMA 1EP1A 4QS5A 3M43A 1KQYA 3MTWA 3WNMA 2XH7A 3G2GA 2IKGA 4PCPA 2J8TA 1KKRA 2GVGA 3V75A 5C2CA 4PB5A 4ZO9A 2QZRA 3GBDA 4Q8UA 1XYBA 3F4NA 2VFDA 4DVOA 4WDWA 1WBJA 2NLYA 2QS8A 4PODA 3NSNA 1NAL1 4YJ5A 4CNNA 1X8CA 4CVUA 4KIRA 2ZZ5A 4HCHA 1XCWA 2ZX8A 3ONBA 2HS6A 1OCQA 1QPOA 3FGCA 1UJPA 1A50A 3E0IA 2QPXA 4LB3A 2R82A 3P67A 3B05A 4Q8NA 5AYIA 5TQLA 3FJ4A 4PL2A 4S38A 2XN2A 3HG3A 1M68A 3I4KA 4XAFA 4QXIA 1PCWA 1TPVA 2Y62A 1EHNA 1Q7ZA 3N6JA 1MUCA 5I3GA 1XUZA 4HU8A 3WQ5A 3KOFA 3AYRA 4GZEA 1RALA 1O12A 3CJPA 2V5CA 3QYQA 4X22A 1XV8A 1QI3A 1AG1O 3KZPA 1KFKA 3TE9A 1QOQA 3OZOA 3AHTA 4Q3MA 3O1NA 5HQLA 4PUWA 4GUIA 1QMLA 1NDZA 1PXGA 4C6KA 5CSRA 3V5CA 1MDLA 2ONEA 2J7GA 4KETA 4QROA 3E96A 2GJNA 4Q4PA 3EMZA 2XINA 3R58A 3VXGA 3DAQA 1BHGA 3QV6A 4TX6A 3TROA 4YMZA 3QOKA 2RH9A 4JKMA 3LTPA 1Q8AA 1CCWB 1JZ7A 4GZIA 1NARA 4Q4SA 4RNFA 3W7HA 3GC4A 1ZAJA 2Q09A 2GUUA 3WNPA 4C5ZA 3ICJA 5DCDA 2WHLA 2G3NA 1A80A 2X09A 4JFSA 1W5MA 4MKNA 4LVGA 2W66A 1DHKA 2G8ZA 4W8LA 1Q2SA 3NDOA 2HDJA 3E2VA 1KM3A 2PLKA 1DIDA 2QCNA 1K9TA 4LV4A 4MYAA 3ZS4A 1EX1A 2DORA 3NR0A 1DXEA 3LHWA 1L2QA 4CEUC 4GKLA 1Y8BA 4NUWA 3VOIA 1EQCA 3WYZA 3GQYA 5LKYA 3Q94A 3EYPA 1GYMA 1ZP4A 2BGQA 1E73M 4UTWA 3K13A 2Q01A 2YL6A 3VNMA 4Y9OA 3P82A 1LUCA 2GVEA 2CHOA 4GA8A 2MNRA 1QFEA 3M16A 4O0QA 3WD4A 4BS0A 5REQB 3ABSA 3EWYA 1MNSA 2WVSA 1UZ4A 5MKGA 3M44A 2RDWA 2YDAA 5AYBA 5JIPA 1KWKA 2XWEA 3R8GA 5A6BA 1QNPA 3LHTA 3PWAA 3M0XA 3UNDA 4XKYB 4W7UA 3DDMA 4HBKA 3KLLA 3W4RA 4UNKA 4QAWA 1ZUAX 1OINA 4CCZA 4L4PA 3LXCA 2QW5A 1ME8A 1JGMA 4PEKA 4MAVA 2E9LA 2TAAA 1GPWA 1LROA 1YMYA 3RLVA 5BMWA 4XSMA 1EUAA 1Q6RA 3NL5A 2WMFA 2FZMA 1MFVA 4NI8A 5FEZA 4CCEA 1GJUA 3GXIA 5D37A 2VFHA 3SCTA 4EKJA 2WPGA 3QTGA 3N4AA 2XPKA 2A6NA 2VZSA 4BZYA 4WDTA 3T4WA 1C92A 3SSZA 1JUBA 5BMXA 2DZSA 3GSMA 2HS8A 1V3LA 5G1MA 1HQTA 4GACA 3CGTA 3UBPC 1C93A 2PD5A 3IRSA 4IIHA 4MPKA 1TJ2A 3AIWA 4TX9A 1W91A 4R7JA 3HQ1A 2VD8A 1QO2A 3UR7A 3AHVA 3HQNA 3L9CA 1DYSA 2CLLA 2X40A 1VIWA 3H7VA 2REQA 2PD9A 4ZTYA 3KX6A 1GG1A 1IWAA 4PTXA 2PB1A 2WCSA 2VRQA 4HN8A 3HN3A 3G6MA 1A3XA 4FP1A 5HINA 5D33A 4PB3A 3GRIA 1OFQA 1J01A 1ZSXA 3N17A 3VCNA 1OYBA 2VP8A 3ALFA 4QHRA 4UR8A 1R5YA 4RKAA 3SCVA 4BFAA 4MZ8A 3FJLA 2EBNA 3UGVA 3IRDA 1E43A 1IEIA 4XTIA 1KQZA 5T9CE 2IPJA 2XIQA 1DQXA 4HA0A 4H9MA 2OLAA 3WUFA 3CH0A 3TV8A 1P7TB 4WJXA 5CBJA 3M5ZA 4PCFA 3ARUA 1XLIA 4JFVA 2NXIA 1GQJA 3DI0A 2Z25A 1Y5XA 4OWGA 3WBWA 5DN1A 5K9DA 4HOWA 2C6QA 3EA2A 3TLLA 4NY2A 3NQ6A 3F4WA 1Z42A 8XIMA 1NEYA 2WZTA 4G9PA 1SU5A 4PMVA 3ZVHB 3IIPA 1E51A 1H49A 4ZSUA 1I75A 1K4HA 3PJUA 1PZ1A 4GYPA 5CCZA 5CZSA 1EJ7L 4O53A 4M6UA 4QNEA 3STFA 3E5BA 3OU8A 3QR0A 3CZGA 4IPNB 5CGTA 3WH7A 2D23A 1EXPA 4DM1A 3KCOA 3ONCA 3VKAA 3R1ZA 4HKPA 2AAAA 4B3KA 3W82A 1REQA 1SZFA 3ARPA 2W61A 1TJ1A 3M0LA 2OZTA 3UCQA 4REQA 4DZHA 1D3HA 2GJXB 1RCOB 5DMNA 4DZAA 2XN0A 3RF9A 1BXNA 5KINA 3II1A 3BTNA 4GIAA 1DE6A 4D6GA 4GE8A 3CWHA 2Y85A 4R85A 4HNOA 4PZVA 2EGZA 4PUDA 3OP2A 4JTFA 3VDCA 2PDBA 1HL8A 5K7JA 4XB3A 1YPFA 3NYDA 3VE9A 4AG0A 1JDAA 3PZ9A 3P3BA 2FGBA 1HKWA 1SFJA 3BLDA 3W76A 9XIMA 3TSMA 2JEQA 1CGTA 4AC1X 2VEGA 1D9EA 1VYPX 3P80A 1H61A 3KRUA 1KLYA 4C5YA 1G67A 4CQ9A 4HPNA 4UTKA 4LOCA 4DELA 4UTLA 4WQ6A 4HVXA 1K9DA 4NYUA 3VDGA 4ZO6A 1L8NA 5FJRA 4QX4A 4PCNA 1TWSA 5I03A 1XH2A 3EXRA 1T8QA 1TV3A 2VZTA 2RDXA 5C9UA 1BWLA 1UWRA 1V7AA 3NSMA 4WKAA 1EA9C 4E2VA 1BAGA 4MAZA 4HMCA 4W86A 4IPLA 3BCDA 1S39A 3WD0A 1H62A 1KR0A 3ARZA 5HDRA 4UZUA 1H51A 3L4WA 4UFIA 1GGOA 3SW6A 2BODX 3IV3A 3PJWA 3PS7A 3M5YA 1Q6GA 1BYBA 4DUWA 1UP2A 1WOAA 4BA0A 2WNZA 2XIJA 3TJ4A 4H8UA 3OG3A 2CLOA 6CGTA 2OO0A 1OK6A 3WG6A 3VIOA 4M1RA 2Z6JA 1Q6OA 5LNVA 3U2CA 3R6IA 5DMMA 3S0CA 3LM3A 1XDLA 2ZBTA 4O4VA 4RE4A 2QIWA 3JU2A 2ANUA 1KV5A 1YBQB 5TIMA 3C6CA 4X0VA 3TUUA 2PGEA 5FEXA 1OCNA 1Q6CA 1FWTA 1CTNA 2I9UA 4BY3A 2ZUVA 1OHLA 1LWJA 4FNRA 4XWUA 5FJUA 2NX3A 3W7QA 3G0SA 1K4GA 1A3WA 2J6XA 3W1AA 2FTPA 1DXIA 3G8RA 1TMQA 3O6CA 1R9XA 3QLLA 1VFLA 2X1TA 3VUSA 2HMCA 3W71A 1BLIA 3SR7A 4GJIA 3WLPA 3C8NA 2JKEA 1YW1A 1B30A 1LYXA 1O94A 2OYKA 2YOCA 4D8LA 4JFWA 1S5WA 3RO8A 1H7NA 2PRMA 4YLWA 1EGMA 4FXJA 3PBMA 4WDUA 1SMDA 3BO9A 3DG6A 4N7QA 4TR9A 4JICA 1XIDA 1CB2A 4UTWC 1E1FA 1QI0A 2H6RA 1F3TA 4FO4A 1UD6A 4EVZA 2WVUA 2Y6ZA 3E6EA 4ZCWA 3W7PA 2OLSA 2QUUA 4WIWA 5LZLA 1HO4A 1BF6A 4LYKA 3NQVA 1SGJA 2QR6A 3ZFHA 5BXPA 3MI2A 5K2ZA 4S3FA 1NELA 1T99A 3ZYZA 2WSRA 2ZA2A 3DHUA 3RCMA 3HPXA 1EB3A 4WUIA 1K6WA 2BXVA 5I00A 3UWQA 3GIPA 4URIA 3LD5A 3BPWA 3ZJ6A 2J9XA 4TMCA 1H1ZA 2AQOA 2P8CA 4OUEA 2CYGA 1RA0A 1TPC1 4P5UA 3TYEA 2QMJA 5G5IA 3PAOA 1HKIA 4WCJA 2D1ZA 3PFMA 1PBGA 1XIFA 1NSJA 1U30A 2ZRWA 4H9YA 3B40A 2FPVA 1V3HA 1ITQA 4S23A 4P7OA 4W7VA 4XAPA 2HK0A 3VINA 3V5FA 2L5HA 4KWWA 1G6CA 5LGXA 2WKJA 3WSUA 3AIEA 2VEKA 2OMAA 3W38A 1YQ2A 2NQLA 1C9DA 2YW3A 3P62A 3G1RA 2A5HA 1PKMA 2QYGA 4DO4A 3PZVA 4HPHA 4CD8A 3LG3A 3SCSA 3GS6A 3RILA 1XPYA 4QLJA 4ZODA 4FR6A 1UHVA 4IGHA 2D20A 4H1ZA 4A29A 3QZEA 5AZ1A 4J27A 4D6IA 1OF6A 1VPYA 1J6PA 3SCUA 1O68A 2ZUSA 4ZL1A 3PB2A 1ITUA 5I3FA 1WXZA 4MFEA 2BS9A 5ABFA 4B5VA 1MEWA 1ZBWA 2SFPA 3TFCA 1ZJAA 4QQUA 4UQCA 5M3WA 2E6YA 2NLIA 3IVSA 4Z2HA 1OJXA 3HPFA 2V8ZA 1KV8A 4ZFMA 1BYDA 1JCLA 4NZFA 5F4SA 3MDUA 2VR5A 5D8ZA 1AH0A 4HOXA 1BWKA 4HU4A 3MKCA 1OC5A 1RBOB 1GKQA 3VNDA 3TR2A 2NV2A 5CZKA 1OT2A 2OX4A 1XCXA 1KKOA 4IX0A 5C8BB 3A5FA 3GE7A 2F61A 1A0DA 4UTIA 1FFQA 2PLCA 5CPTA 1AQFA 3G1XA 4MKSA 1FH9A 1E4NA 1O5KA 1O1ZA 4Q4QA 3UR5A 5C54A 4C6MA 3BOLA 3APTA 4EWJA 3BARA 4KRTA 4MB4A 1P6BA 1BTCA 3ZT6A 3OBEA 3ZIZA 5ABGA 1JGIA 4JTRA 1ZP3A 1QOPA 3AJXA 4HOZA 1KGUA 4JN8A 4GYPC 4WLCA 2V3GA 4EAMA 4C6BA 1M7OA 1S5VA 4MDOA 3VKDA 2ALRA 4DJDA 1IV8A 1LBMA 1Z69A 2XH2A 2FQIA 3OGVA 5HOSA 1TE6A 2OZ3A 4HTBA 4P7LA 2ZA3A 2RDTA 1M7XA 4QLLA 3LENA 2PS2A 3EX2A 3IGXA 4MWAE 4LYQA 3GVWA 3U6WA 2DZWA 2ZVIA 1SFSA 2YX0A 3SEPA 5EU9A 1KFEA 2HISA 4JX5A 3P8JA 1JVNA 1B3OA 3CUIA 4NAEB 1JCJA 4CCCA 2YXOA 4JTKA 3V16A 2CBVA 1EWEA 4QJ4B 4UTHA 1OFBA 1S5NA 1KGWA 5BXRA 2XFWA 2WHJA 3IVTA 1A0EA 3RCYA 3PSVA 5LNWA 2FB2A 3RU8X 3AFBA 5I02A 1LQ2A 4H6QA 3EOSA 4FNQA 4N0RA 3GXNA 4JNYA 4EAYA 4LS1A 3EEZA 5K4XA 3GG1A 4HZMA 2J74A 1DJNA 1MFUA 3W26A 4RNIA 5D9OA 1FWBC 1JG9A 1S3TC 1X1ZA 4RE0A 4EPDC 1EYEA 3GHSA 3C3UA 1HJUA 3UR8A 4Q6XA 3WLIA 2VR4A 3PZNA 4Y9PA 2GQ9A 3A4JA 4DB7A 4NF7A 2YIHA 1KFLA 3LCHA 2CZVA 4FK9A 2BHZA 4G7EA 1OY0A 3NA8A 3FXYA 3VABA 4R27A 3R11A 2GJPA 4XZNX 1I0BA 3VIFA 4C1NA 1EDTA 5BW6A 1DQWA 3EKGA 2F6KA 4NU7A 4KESA 1EEPA 4GINA 1K70A 2D3NA 3S8HA 2ATSA 1PWLA 1VFHA 5I2UA 1AFSA 1TR1A 3NJ3A 2EPKX 4UBPC 2C13A 3W1NA 1UW9A 2DSZA 2PEVA 1WZMA 4M6PA 3CB8A 3EWCA 1UPPA 4XK2A 4R7OA 1U83A 3E0WA 3W00A 3ZM8A 3FVDA 4K36A 4QR6A 3IJLA 4UNLA 2J75A 3WBAA 4RV3A 1GOIA 4JTJA 4LVDA 3URQA 3ANVA 3KW3A 2EPHA 1A5CA 2MANA 1PAMA 2C0AA 1AL7A 4LALA 3ITYA 2HPMA 3ARRA 5E9XA 3H8AA 4MHBA 5FF7A 5C55A 1KBJA 4L1WA 2A3HA 1JI2A 3B8TA 2GVLA 4Z2KA 4W93A 3G0XA 4KWVA 1YNYA 2VFIA 3N9KA 3NUKA 3WBYA 1XLEA 1ODZA 4UIOA 5EY5A 2E5DA 1BVWA 4ILSA 8TIMA 3QMSA 1E15A 3EXSA 4XIMA 4MUPA 3R8HA 4D8ZA 3GH5A 1GCYA 4EPBC 2NW0A 6TAAA 3HPSA 4UTUA 2WM0A 4H6KA 3LLDA 5TAOA 1DE5A 4AX6A 2EG7A 1FWWA 1UUOA 4LBSA 1FOBA 4YU1A 2PRHA 3T4CA 3M0MA 1HFBA 1IGSA 5A6MA 1KCKA 2QVNA 3CIVA 1POKA 2EJAA 4IFKA 4UOQA 4GVIA 1C91A 4U33A 4GIRA 1I6NA 1P43A 1UUQA 4BI6A 1QPNA 1MZHA 3FKRA 1U5VA 1U2YA 3BLPX 1QUMA 3CHFA 4L61A 1F05A 2XYLA 4WZHA 1V0MA 4ASTA 2IUZA 4X2PA 4C60A 1H11A 3BJFA 4U3CA 5A69A 3P61A 2ATMA 3GDBA 4PFHA 3EXTA 4E3VA 2VZUA 2PF0A 1W17A 4Y8FA 1FH7A 4LX4A 1KXHA 1BG9A 1J18A 3SCPA 3CU2A 4Z1DA 3QV9A 2VXNA 3CXOA 1BYAA 3SCOA 4B4HA 3NFUA 4JDYA 1AW1A 1AQMA 3EX4A 4PULA 4Z2GA 1UJQA 1ME9A 3CQKA 1ZALA 5D03A 3TX9A 3CZKA 1CXHA 1C8VA 2OU4A 4IL0A 2JKPA 2NX1A 4RV8A 5I0DA 5B80A 2YZ5A 5AOUA 2OJPA 2ZE3A 1C90A 3RN6A 2CLFA 5EFFA 1IWPA 2QCLA 3Q67A 2VCAA 3P0WA 1KRAC 3G1HA 4QITA 2A3EA 4A6GA 5H8UA 1E6PA 2CIPA 4QNWA 3AXXA 3H23A 1WZKA 3I65A 2ISFA 1LORA 7A3HA 3DX5A 2E8ZA 3CYJA 4CVWA 1XYZA 3OHIA 4XVDA 4GPNA 4PMXA 3SURA 2C3ZA 3MV11 3TOYA 1TPWA 2AAMA 3HBLA 2JEPA 3S6TA 1NVMA 4F0KA 5IOBA 4R34A 3NCOA 3S9IA 1TA3B 3WBXA 4Z1YA 1E3XA 4LAOA 1JAEA 3GFXA 4B15A 4FS9A 1AJ0A 4G8TA 7ODCA 1UASA 2V2CA 3G22A 1EA0A 2FDSA 4P61A 4FNPA 3LY0A 5D30A 4O50A 1XISA 3W72A 4IIDA 1JI1A 4PL1A 2Q8XA 3A3XA 3GFYA 3MUXA 4DPPA 3BLIA 2V3EA 1SO5A 3VPLA 4MYXA 4GH1A 3GG7A 3AROA 3SCWA 4KKXA 1PZ0A 2FMNA 2C14A 5CC7A 1HJSA 4WKFA 1L6SA 1A4LA 3T40A 4HD5A 2W92A 4YS1A 3GNRA 3B9DA 2JK2A 1X96A 3BAXA 2W3ZA 3RR1A 2D2JA 1FWSA 1AA1B 2B7NA 4UCGA 1I2NA 1Q13A 2A3LA 4BF5A 3OHMB 2PI6A 2VQUA 4DQWA 3ITGA 3REQA 3CQ0A 4LS2A 5DEZA 2QCEA 1HUVA 4LBRA 1MUWA 4F66A 1U5JA 2FGZA 3B3DA 3H2CA 4M5PA 1EHAA 3W7NA 1O5QA 3APGA 1GEHA 3UWEA 4D6DA 4O12A 1WBHA 4PRWA 1KXQA 3PZGA 1VEMA 3MJYA 3BW3A 4Q8MA 2IMRA 1KO0A 1ALDA 5D2WA 1GZ1A 4AISA 5KEZA 1GVEA 3KVJA 3L5AA 3N4EA 2OPJA 4C6IA 3CIWA 3GXFA 4JTUA 4WY0B 1IT0A 3K46A 1IT8A 4FA3A 1XLMA 4DJDC 4HSNA 3CUJA 1E6NA 1FP9A 1UMYA 4MY1A 2A1YA 4JTEA 1LJYA 2ZZ3A 5I6SA 5A8PA 1U22A 4PUUA 1EBHA 3DG3A 3RITA 3JZEA 3VCRA 3QKEA 4ICMA 3FEQA 2J4GA 4Q8TA 2ODOA 2HRWA 3ABZA 4LF2A 1W5QA 3SGZA 3HG2A 1YXCA 4IH3A 5AN7A 3UJEA 4E2OA 3T0DA 2YA1A 2WZEA 4TO8A 4AY7A 1NTHA 5AHIA 4C1KA 4DUXA 1B54A 3LRLA 1EJTC 4JTGA 1TIMA 2HVMA 4UC5A 3BLEA 3W1RA 2VJXA 3FAWA 3RLGA 4FZIA 1DWIM 3CPRA 2G4JA 4Y9MA 2OLHA 3RAOA 5ECUA 1R2SA 4HP5A 2NUXA 4DO6A 3SRFA 5AB3A 3NO1A 3OGSA 4QP0A 2FJKA 4JBRA 4CN6A 3LCWA 3NM1A 3PJXA 4HZ6A 3CV7A 1WUFA 1SW0A 4I6VA 1NIUA 2AL2A 3CHDA 3SI9A 4L4LA 1EYWA 3TN3A 1S46A 2XFYA 3CT2A 4UOJA 1QNRA 1TPDA 1V0KA 4G6CA 3EA1A 4BF9A 1AW2A 4UQDA 1W9PA 2ZZ4A 3KVKA 3WDPP 5H6HA 4LSBA 2ACQA 3N2TA 2J7EA 3L0KA 3W84A 3QZAA 4XD4A 3W75A 3H70A 1LZOA 3ZR5A 3LRKA 3GHUA 3RM4A 1RQBA 4NSBA 4GXMA 1I1WA 1IZJA 2EG8A 3O16A 4M81A 3PB0A 1NU5A 4M0XA 2EAWA 4I6KA 2OVLA 4GK8A 2AMXA 4IMGA 5FJOA 4B5UA 4S3EA 2BX7A 4WJ8A 1SPQA 3IAQA 3CPUA 1AZ1A 1NOWA 1OT1A 3LPFA 1O7AA 3K30A 1GVIA 4WGXA 2WNWA 1JR1A 4O57A 3U9IA 4D1IA 4ICNA 3AIQA 4XUGA 2R14A 1M1BA 3RMJA 3SRKA 3VCCA 4J3XA 3OBKA 1P1XA 2AOSA 3AU6A 2WMGA 3PNZA 3IK2A 1X6UA 3CMFA 3M0HA 4I9MA 3PPCA 3E3HA 3DYPA 2FVKA 3S47A 3P2VA 3PP7A 1WDPA 4LUSA 2GVYA 5G1YA 3A6OA 1B5TA 1NWTA 3EDDA 3M46A 2PURA 5I3KA 3ZJ7A 4W84A 5G2WA 3IANA 1GOMA 3WUEA 3LI1A 3DESA 2PUZA 4MJ2A 1E9YB 3ANYA 4C6DA 4LY8A 4AZ5A 2B7OA 2WVVA 3TQ0A 2PA6A 1B3ZA 1UR0A 2YCLA 3W86A 1V6WA 3HG4A 3KUMA 1XGZA 1GNXA 2G5WA 4DF0A 4L4MA 3N2BA 2ZRYA 3ZWSA 3BC9A 1JDFA 3FHAA 2DZAA 5A95A 5EMUA 1F74A 3C0LA 4NKCA 1FHVA 3N04A 1GOQA 1V6XA 4UZSA 3H7RA 5FF0A 3EOUA 4YN5A 2XVPA 4KT2A 2FMOA 2V5DA 4CN1A 2CCRA 3LU2A 4XKYA 3CQIA 4AQLA 2GGJA 3QH2A 4AZBA 4CNOA 1UB3A 4LBUA 3VA8A 4JNMA 1XWYA 2VFFA 3TW9A 4J35A 5LNUA 3KOWA 4BJHA 3M4HA 3LCFA 1SSGA 3WLTA 1BF2A 2CITA 4GUGA 3BG5A 4ZQOA 3B9EA 3OQEA 5L9FA 1A49A 1I8JA 4I5XA 1QPRA 1BXBA 2ZDRA 3ECQA 3KBNA 2VVSA 3W7OA 1C7TA 1S1RA 1KCLA 1WQ5A 3U0HA 3AMDA 5HPOA 2BNJA 4ZQCA 1LRQA 4HCLA 3S2NA 3L5MA 4PMUA 3UT0A 3G24A 1TX2A 2EG6A 1JAKA 1VD6A 1Z3NA 2ZKMX 4H9XA 1TIWA 2YPIA 5A8OA 3GIYA 1BVNP 2WXDM 4QBXA 4O0ZA 5G1TA 2BVTA 4F48A 4XZBA 3LM7A 2REQB 4IQLA 4UTJA 3V7PA 4AZIA 1X8FA 2PLMA 1NQKA 1B3WA 2HBVA 2OTDA 3H22A 4AWSA 1TQJA 3VILA 2UY5A 3Q2DA 1GJPA 1R3VA 3JUGA 5FJIA 5C9WA 4IFRA 3GVQA 1NQ6A 2PZNA 4IQEA 2PDWA 2E1DA 1XLLA 4DWSC 1JPDX 4L7ZA 4XVEA 3ZQ9A 4RDVA 3WF3A 4DNHA 2HV5A 1ONRA 3PBGA 4FOJA 1ELSA 1EJSC 3JZUA 3GR4A 3SCNA 3B8IA 1UH4A 1LBFA 3DI1A 1R9ZA 1JRCA 1J0HA 5K9CA 4S3DA 3C2YA 1VJIA 3ARQA 1AD4A 2PDPA 3VDBA 4CKQA 1XD0A 2VZVA 3A4AA 1W1ZA 4CU7A 5DF0A 1XYMA 2TYSA 1P7TA 4NL1A 4BQ2A 3L2IA 3WQ8A 2Y0FA 5BYWA 1CLVA 4RDYA 4CQDA 5KZ6A 2QAPA 3GVRA 1BWVA 3M41A 1UWSA 2WWDA 3W1QA 2XVGA 2DJXA 4UNIA 1N8WA 2XZ9A 3OVRA 4FEZA 2OR2A 3KZSA 4P8WA 1L2UA 1TPH1 3TQPA 5LGZA 5XIMA 3ZVHA 4B3ZA 4BKNA 5M17A 2VMFA 4GNVA 3OIHA 4CGTA 1RXOB 2Y7GA 4J28A 1REQB 3ITLA 1AH3A 2GSJA 2WB5A 2J6VA 3NQEA 5CZTA 3QHMA 3KDNA 4E3TA 2C19A 1YDNA 2BHUA 3NG3A 1FDJA 1E0TA 3IV8A 3W81A 1VFOA 1X6NA 4S3JA 4L56A 2CBIA 2Y7FA 2IQTA 4KIEA 4NZ4A 5IXEA 2ON3A 2CLHA 3OLGA 5H2ZA 1IXOA 8A3HA 1E4IA 5A8GA 2GJXA 4AVNA 1ADOA 3I7QA 4CNUA 2R9RA 3WL1A 2NT1A 4Y7EA 3W22A 4L4OA 3HGOA 2OELA 3UVAA 2D69A 5J8LA 1AD1A 3AMGA 4LRTA 3WCZA 3XIMA 4LAKA 9XIAA 4D72A 1CXEA 3M0YA 3MHUA 4X60A 1NJJA 1DBTA 4DY1A 4Z42C 4JKLA 1EGVA 5HNTA 3W7KA 2DSUA 4V27A 4CQAA 4AVOA 1FHLA 1PVNA 4OVXA 1YE4A 4FLOA 3MZNA 1J0ZA 5CKSA 4NJIA 4P7QA 5FJTA 4AWTA 3AS3A 3KWSA 3KBJA 1E0VA 2V6AA 1JDDA 1TVPA 2BOEX 5FA5A 3KHDA 2Q3OA 3M0ZA 4DJDD 3SIMA 3LS9A 4GIEA 5JU6A 1LT8A 1K7FA 3IJQA 3PZTA 2X8RA 4TIMA 3SM0A 4I9JA 3TW6A 1G01A 1PZ2A 1VPXA 2WK2A 3C61A 4B4FA 1QHPA 1KW1A 3R8RA 2HQAA 1Z9AA 4ZENA 1HTIA 4GYF