1B57A

Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
358
structure length
346
Chain Sequence
b'SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEELYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRUCTOSE-BISPHOSPHATE ALDOLASE II)
molecule tags Lyase
source organism Escherichia coli
publication title The crystal structure of Escherichia coli class II fructose-1, 6-bisphosphate aldolase in complex with phosphoglycolohydroxamate reveals details of mechanism and specificity.
pubmed doi rcsb
total genus 138
structure length 346
sequence length 358
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 1999-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1b57A00
2RDWA 3UXAA 1UUOA 2C1HA 1DL3A 1XBXA 3AJXA 3L5MA 1QPOA 3BPWA 2V30A 3P67A 1X8FA 3TE9A 1IF2A 5FI8A 4X2RA 1K03A 1LBMA 3TR2A 2X2GA 3G1SA 4EIVA 2G96A 3EX6A 5AB3A 1EWEA 1TSIA 2VKZG 2J6XA 1G4TA 4DEFA 3N19B 4JYDA 4EF8A 1GVFA 4N4PA 1JUKA 1KLYA 4Y96A 3I7RA 3W7JA 1DBTA 3WJYA 3S9YA 1O60A 2Z1BA 4POCA 2C16A 3DFQA 1KBIA 3TIMA 5C55A 2H90A 3M6YA 4UC5A 1H7OA 4XQ6A 3UZJA 1HUVA 1WBJA 4S1FA 3W1MA 4WXYA 3BV4A 1KM1A 4Z0JA 4O8RA 1PIIA 4UFKA 3CIWA 3T55A 3S6DA 4UFIA 1T0OA 4MFDA 2X1TA 3QSRA 3FA5A 2A0NA 4O1DA 4QISA 4HNNA 3W7EA 1MO0A 1XFBA 3M7WA 2ZTJA 5G4EA 2B4GA 5D33A 3CC1A 2OT1A 5EBUA 3G8RA 5D38A 5AYYA 1KTCA 5G2HA 3EWYA 1RQBA 1KFKA 4EVZA 3NPWA 3NQ7A 4TIMA 2DP3A 2WV8A 1KTNA 2NWRA 2VEKA 1RPXA 2VFEA 4WJEA 1ONRA 3P60A 2Y62A 1KM6A 3GDKA 2CLHA 4PTNA 1OX5A 2V8ZA 1AL7A 3FOKA 3S0CA 3NO5A 2NUXA 3CWNA 1A53A 4AAJA 5BRBA 1O95A 1G7VA 5HINA 1SZEA 3O15A 3UD6A 3G1AA 3NNTA 1OF8A 1CW2A 2YSWA 1HG3A 3N3MA 4Y9AA 1B4EA 3FIGA 3I65A 2WSQA 4M6VA 3VCRA 4MJZA 4JTJA 3B04A 1SUXA 4DF0A 1BEUA 4ORIA 2YCEA 3HMJG 4FO4A 1SO5A 3W7CA 1J2WA 4CCEA 3HQ1A 4AB4A 4YWIA 1CX9A 2QCDB 4HT3A 3FS2A 1Q6LA 3TMQA 3LHZA 3NL3A 1U5JA 3EX4A 5G1YA 4O4VA 3G1XA 1TTJA 3U2OA 1JJKA 1KA9F 3TW7A 4P61A 3PG8A 2QJIA 4RV8A 3M0ZA 5AHFA 1RQEA 3STGA 3UWWA 1OX4A 3GX9A 2ZA3A 4BR1A 1GVQA 3L67A 3BG3A 5IBXA 5AHIA 1W5PA 2B7QA 4O19A 3W2JA 4K38A 3TQKA 3MWAA 1K7FA 1TO3A 2DZXA 5D2VA 2CZFA 4IMCA 3RLUA 3RLVA 1QR7A 3KRSA 5DELA 1TQJA 4XKYA 5D2XA 1PE1A 3NQFA 4O17A 3UWQA 2A2IA 2WSRA 3NPXA 1FCQA 3GXNA 4O11A 5CZ0A 4RZ4A 2VENA 2Y7DA 2QCFA 4NJIA 1WDWA 2Q8ZA 4I7WA 4RJEA 1T96A 3L5LA 2E6YA 5J5RA 1JCJA 4Q4KA 3QMRA 1JCYA 1GOXA 5CPLA 5AN7A 4IWWA 1W56A 2GOUA 4WOQA 3LHVA 4DF1A 2NV1A 4LS0A 1KFLA 4O54A 5G4WA 3NPUA 3PM6A 3KX6A 1YTEA 2YYTA 3GNDA 5U7SA 3OHIA 2HS6A 3EKZA 2EF9A 4HSOA 1QMLA 4ADUA 3W87A 3IVTA 5CPNA 3TSBA 3IIOA 3TMLA 1IXQA 2I9EA 1R2SA 3UWVA 4AXKA 1OYCA 3I7QA 4KFNA 4TR9A 3W07A 3W1PA 4CNNA 3DHFA 4QJ1A 3P82A 4Z1DA 4BI6A 4NU7A 2DJLA 5FEZA 4RXFA 3BO9A 3QSTA 2YGYA 3DFSA 3LOTA 3E9AA 3L5AA 1Q6OA 1VC4A 1O5XA 1YXCA 3PWAA 1ZCOA 2QKFA 5D2YA 2FDSA 1FUYA 5SWUA 4IQLA 1VR6A 4AWSA 3M43A 3NQEA 1LRTA 3C56A 3ABQA 4UTTC 3NZRA 3EWBX 3KRZA 4DBDA 2OCZA 1WBHA 2QR6A 3SECA 1FWNA 3MP3A 1EUNA 2NUWA 5EA9A 3S5OA 2W79A 3N73A 4O57A 3NQ8A 5CGQA 5LSMA 3TU9A 3BW4A 1C8VA 4E2BA 5AYXA 1PHWA 1GTEA 3L66A 3M44A 2YX0A 3YPIA 3ABRA 3BVJA 4Y6GA 5D04C 3LXBA 4I9AA 4IUOA 3WJSA 3LRKA 4Z0SA 4JX6A 4ZQMA 5D02A 1G6CA 4PCFA 3W75A 4GUJA 2GQAA 2V2CA 3PBWA 4NJGA 1H7PA 2JK2A 4PODA 3W3OA 4HHPA 2E09A 4JN6A 3L2IA 1QWGA 3WJWA 3UPWA 1V7YA 2JKPA 3ABOA 1OX4B 3PUDA 2V9DA 3S8HA 2VELA 2W0UA 5CPOA 1NSJA 1G67A 2GVJA 1IIHA 3SI9A 3STCA 2ZRUA 2XN2A 3LXAA 5LNUA 2QJHA 3W7PA 3BLEA 1ADOA 1AW1A 4OQVA 2E5BA 1ME9A 2WQPA 3QMTA 3C2FA 3NYZA 1VRDA 4FNTA 2DZPA 2WJZA 3PUOA 5KZMA 1L6SA 3TA6A 4HNVA 2ZCGA 5KMYA 1SPQA 3B4UA 1FCBA 5ABTA 2C6QA 3EXRA 4JX4A 5E1QA 1L6YA 2NV2A 1WA3A 5D2TA 2A4AA 1LZOA 1CI1A 3DXIA 4UIOA 3O1NA 1BWKA 2QDGA 2PRMA 1ML1A 3LI0A 1W3NA 4K37A 5DLCA 2HTMA 4NNAA 4AF0B 2TPSA 3LDVA 1LRQA 3QM3A 3PB2A 1XUUA 4X22A 2F7FA 2PURA 1AG1O 1S5TA 2VOMA 3TKFA 3NQCA 1P0NA 3FFSA 4QM1A 5HUOA 4ALDA 3GKAA 1A50A 1GVRA 4MJMA 5KZEA 1H7RA 4XTIA 2Y61A 1S5VA 3Q58A 1VYSX 3LBMA 3LTSA 1N55A 2AGKA 2F84A 4JR5A 4LVBA 3UWUA 1W31A 1UB3A 4JD4A 3DU0A 2Y7EA 2CZ5A 5BMXA 4W9TA 3RF9A 3IGUA 4IPIA 4TMCA 2HMCA 2OJPA 5E93A 4LVDA 2GQ9A 5L9FA 1H1ZA 2ATSA 5AHEA 4NZFA 4FXSA 4HN4A 3UYCA 3BLFA 4GUFA 1GVSA 3E0IA 3KXQA 1WOAA 4YCOA 4UMCA 1KM0A 5G2IA 5DBUA 1YPIA 4LOCA 3TNOA 3IVSA 1TMHA 3P80A 3EXTA 2YYUA 2KZHA 4R34A 2NXHA 4NJJA 4MZ8A 1H7XA 1XXXA 3RFAA 1ZAHA 3LB0A 5HR7A 3HB9A 7TIMA 2QUVA 1XDMA 1KV8A 3UY8A 3O07A 2WNNA 4HSNA 2V82A 4XKYB 1SSGA 1EX5A 3TSDA 3EB2A 5LHEA 4WZHA 2DZWA 3SW6A 4MY8A 2I14A 1LLZA 3N9RA 4NQ1A 2E6FA 1VLWA 3L68A 4LW7A 3OG3A 4LV4A 1J4EA 4Y8FA 3MHUA 3GAKA 1F6KA 4WY0B 3BARA 3CB8A 4LS2A 4QAIA 3OEXA 4LC8A 1LTDA 4ZVJA 2QEZA 2ZTKA 3ATYA 1HTIA 1A5CA 1IGSA 1NVMA 4IOTA 1FDYA 5AOUA 5E0KA 3Q37A 1L2UA 3LBCA 1ZALA 4YL2A 4U4MA 4IX2A 1KM3A 3S1UA 4BFAA 2NXGA 3E12A 3S1WA 3DFTA 3DENA 2VFFA 3MBDA 1K02A 3DI0A 4YLWA 1BWLA 3P74A 2YFOA 5FEPA 3E02A 1MEIA 2Y7FA 2ZRYA 4JEQA 3NQAA 4PFMA 3VNDA 1I8JA 2B7PA 3W2KA 4UTMA 4IGHA 2A7RA 3TC7A 3SZ8A 2RDUA 3VE9A 2C13A 1KFCA 4ZL1A 1FWTA 1KLZA 4JICA 2JKAA 5D05A 4K36A 1SFLA 1K3UA 3D0CA 1KM5A 3ATZA 4UTKA 3M1ZA 1LOSA 2W6RA 1EEPA 2JGQA 1QDSA 2AQWA 2H3DA 2NWSA 3KRUA 1VCGA 3W23A 5DY3A 2C14A 1O4UA 4K7VA 1AMKA 2Y7GA 4Q33A 3RK8A 1JQVA 4CNPA 2ZZ5A 4KKXA 3I68A 2V2DA 1TPUA 2TMDA 1QO5A 1A5SA 4X9SA 2D73A 2BTMA 3TW6A 3HPXA 3TROA 3MHFA 4CQ8A 1L9WA 4M7TA 3EX3A 3RNDA 1PCKA 1W5NA 3SJ3A 1LLWA 2GJLA 2E5CA 4WD0A 1WX0A 1GJPA 1NEYA 3PF3A 1YDNA 1R2RA 4BWLA 2PCQA 3P8IA 4DQWA 2E5DA 3C2OA 1X1ZA 3W1LA 2J27A 5DCDA 3P84A 1D3HA 1VHNA 4G1KA 3TAKA 1KV5A 3TH6A 3C4UA 3CEPA 1TPDA 4MLRA 4NJKA 1QOQA 2WNQA 1NAL1 3STFA 1KFEA 1H7NA 2QAFA 2YPIA 5IM51 3G18A 1N7KA 1LOLA 4ZMGA 5LHFA 1TPB1 2GPTA 3GB6A 3FJ6A 3EWWA 4R33A 5LNWA 2Z6IA 2RKXA 1ZAJA 2CWNA 3VE7A 2Q8LA 4JYFA 4JX5A 1B3OA 4AEOA 2FPYA 3TJLA 4OV4A 1YPFA 5G5IA 4LVAA 4WY0A 4XWUA 3LRLA 1G4EA 3GVGA 1F6PA 1W37A 4ZZ9A 4TU1A 1G4PA 3A5FA 3LHUA 3A22A 1OK4A 4JTHA 3R13A 4O1CA 3NOEA 1K8ZA 1TV5A 1TPC1 5FEWA 1X1OA 3G1DA 2A21A 3LCWA 1GQNA 2H3BA 1XBZA 1OABA 2WSYA 3W7QA 4DPQA 3F1QA 1XL9A 3QQ1A 3HJZA 2X1SA 4TMBA 4LUIA 3M5YA 3ABSA 3NQVA 3TXZA 1G69A 3L9CA 3CHVA 6ALDA 3K30A 2CZDA 3W7DA 2R94A 3DZ1A 4LVGA 1VS1A 3C61A 1W0MA 4JY9A 4CCDA 1JUBA 2A6LA 3LLFA 3A23A 1ICSA 4GWEA 1PCWA 4MKNA 4FX6M 3IIXA 3CT7A 4K8EA 4PC8A 5LNSA 4AVFA 3V1PA 2OMAA 1TTIA 3G3MA 3NXFA 3THQA 1OFDA 2Z2UA 3TV8A 4UNLA 5CZTA 2V5BA 1VQTA 3QEZA 2B0MA 5BW6A 3P8JA 3VI2A 1KFBA 1WXJA 1LBLA 1ZAIA 4LS1A 3W1RA 1R46A 4O50A 1OG0A 3SGZA 5HMSA 5LGXA 2OZ0A 4JTGA 4ADSA 3LCXA 1KTBA 2QUUA 4QNWA 1FBAA 3UWZA 2NZLA 4N9CA 2Z0IA 2P1FA 3T78A 1SZNA 2NXIA 1EP1A 4LC6A 3HPZA 2CLKA 4GUIA 1XM3A 4S2CA 4EWND 4BK9A 4M19A 3E49A 1WOBA 4NX0A 2H8ZA 4UUIA 5U4NA 1ALDA 3LHTA 4MFEA 1OYAA 3USBA 2JGYA 5K7JA 3OBKA 1P4CA 3IGSA 4UR7A 4FB7A 1ZHAA 2ZZ4A 3B0PA 5C54A 2B7OA 4ZQOA 5I3FA 4UMAA 1ICPA 4NX5A 5K9CA 1SQ7A 4FIQA 4A2RA 4LRTA 3DKLA 3RMJA 1B9BA 1KFJA 1TV8A 4N9DA 2VFHA 4O28A 4LY8A 3CU2A 4MY1A 2EKCA 3OA3A 1W3IA 3GAYA 5EMUA 1DQXA 5LZLA 1DQWA 1YDOA 1LOQA 4OBTA 2G97A 3W1XA 3W84A 3LV6A 2DZUA 3DAQA 3PBUA 1O94A 2QCDA 3C2EA 5D09A 1I2OA 3N2MA 5F2LA 1OFOA 1IXOA 1VYPX 2LLEA 4JTEA 4PL2A 3ZFHA 1LP6A 3QZEA 1TV7A 2QCEA 3P61A 1HFBA 1B4KA 2WO5A 4NT0A 1P0KA 1Q6RA 3NL5A 3NPVA 3PBYA 4JYEA 1TPVA 2GVLA 1YYAA 2PRHA 3W2UA 1Q3NA 1QOPA 4YCPA 2B7NA 3TDFA 4CQAA 1VZWA 2GQ8A 4MYXA 4ZQRA 4N4QA 3QMSA 1X6UA 3LCIA 5F2IA 3W1TA 4O52A 1FWSA 2CZEA 1RV8A 1JUEA 3NQDA 3DHDA 2EAWA 4GUGA 1SO6A 3MW7A 4N9EA 3BLIA 3O05A 4GE8A 4BF9A 2X1UA 2FB2A 5DXYA 5D03A 4UTTA 1LRNA 3MHGA 3U6WA 3HG5A 3FYPA 4LVFA 2E6DA 5GVJA 2YZRA 3TQVA 1F05A 3QRHA 3W86A 5K2ZA 4AWUA 5DCBA 3B06A 3LTYA 4RZ5A 4UFLA 1GZGA 4CQ9A 3GYEA 3NAVA 5CSRA 3GXPA 1TRDA 1SU5A 3S1XA 4HKPA 1H1YA 3CM4A 1RVGA 5EL1A 4JTLA 5AC7A 1H51A 4DBEA 1R30A 1SO3A 5D37A 4FNUA 3HG2A 3UZ5A 3W2LA 4UTUA 1FDJA 1HL2A 4JS3A 3LHYA 1QFEA 4DELA 5I3KA 3C6CA 5G1TA 3GR7A 2EHHA 1QAPA 3FKRA 3R8RA 5KTLA 3BG9A 3IIPA 2WPBA 3FLUA 1IIGA 3EXSA 4K7YA 5I3JA 3ZR4A 1TREA 1QPQA 1M7PA 1U83A 3P5YA 3L0GA 2UV8G 3SGUA 5KITA 5A8GA 1XDLA 4JXCA 2BXVA 3NG3A 2A6NA 4JTFA 1JCNA 2YW4A 3RU6A 1L6WA 5AYZA 4Z1CA 1D3GA 4MIMA 3EWXA 8TIMA 2QAPA 4UTWA 1W5MA 1K8XA 4UNKA 2HS8A 3GZ3A 5F4SA 4O10A 3QH2A 5AHLA 3DFNA 3S42A 2ZA2A 3I7SA 3W7GA 3EKLA 5D32A 2QJGA 3ZS4A 2RH9A 2WKJA 4M6QA 3KAOA 2QCMA 1ZFJA 3IRDA 3H53A 4BWLC 1IXPA 2ZRWA 1M7OA 3NQMA 3T7VA 4JGDA 3LCFA 1JCMP 1KBJA 1OFPA 4JDYA 4K6AA 4QNEA 4O13A 5AHNA 3W1UA 1G7UA 2EGZA 3QYQA 4WOZA 3F4WA 4A2SA 3O6CA 3A21A 3PVFA 1Q45A 3INPA 5LGZA 3B8DA 2ZZ6A 4GC4A 4QIUA 3TQ0A 3U8GA 4AF0A 2CLOA 1AK5A 3HIJA 1DVJA 3WK3A 4NVTA 2H6RA 2ISVA 3NA8A 4TO8A 3N34A 1I45A 1I2QA 3DGRA 5FF0A 3IEBA 4OU1A 1YTKA 2NLIA 3W70A 1DHPA 4LNYA 3W74A 2A85A 5EKYA 4R53A 4UTJA 3PSVA 3HGJA 3ELFA 1AW5A 5HULA 4FNSA 3MP4A 3IV3A 2DZTA 3O6DA 2A7NA 1GYNA 3GXTA 2HSAA 1OVDA 2XFWA 4IXHA 4GBUA 3NR0A 3F4NA 1EA0A 2FFCA 4ONVA 3PR2A 2QCGA 4O12A 4RX0A 4EOUA 1TYGA 4WUIA 1FXPA 3O8AA 4XTDA 1GPWA 3TUUA 4JTIA 2BWGA 3OVQA 2Q3RA 3S5ZA 4BI7A 1EUAA 3SFKA 4HPXA 1C29A 1S3HA 4GRSA 4WQ6A 4O0ZA 3G3DA 4Y90A 1K7XA 3VKJA 5FF7A 3N2XA 1EPXA 1TTQA 4IXXA 2J24A 3PBVA 4O53A 4RZ6A 3EWUA 3VFLA 1H62A 3LCHA 3KVMA 3W7LA 2C18A 3G1VA 2ZZ2A 3CPRA 4RK8A 4RXGA 1SW7A 2Y6ZA 4AHPA 4UXDA 3W7OA 5AFDA 3SY5A 3W83A 3WK1A 3NM1A 1HO1A 5H91A 4KFOA 3GR8A 2E77A 5K3VA 2IQTA 2G5WA 1QNVA 1RQHA 5K4ZA 4U28A 3W7HA 5A5WA 5EYWA 1XI3A 4ML9A 3F03K 3M5XA 3CTLA 1JCXA 3UQNA 2Y89A 3C3NA 5HWNA 2NX3A 1XKYA 3FKKA 1FWWA 1P5BA 4O15A 3MBFA 3Q2DA 4LT9A 3C52A 3QQ0A 2DU2A 3KFTA 2CLMA 4GNJA 1PHQA 3LCGA 5AHMA 2CU0A 4A22A 2CLLA 5CSSA 2V81A 3H55A 3QF0A 3OIXA 4LRSA 3MMTA 3I6RA 2J9YA 1VJIA 3MP5A 3S5YA 5BNKA 1EWDA 5H2ZA 2ABBA 1EB3A 3B0UX 2C0AA 3MJYA 3LXCA 1XCFA 4Z1AA 2RDTA 1TQXA 4Q32A 3GLCA 3R89A 3PY2A 1DJQA 1OHLA 2P10A 3W6YA 1MZHA 3G0SA 3B05A 3LX9A 1R2TA 3P81A 3BG5A 3CWOX 2GVGA 3LGEA 2DZSA 2FIQA 2OT0A 2FQIA 4P2VA 1ZNNA 4MUZA 3KOFA 1JQXA 5IBXC 3QC3A 4O1AA 1UUMA 2YDAA 1XBYA 4RR4A 3STEA 5DN1A 3E96A 3C2RA 1ZJIA 1XUZA 2C19A 3PSWA 4DO4A 1THFD 2A5HA 2DORA 4K8HA 1DJNA 1WQ5A 5CZSA 4D2JA 3WJZA 3GK0A 3GDTA 1H5YA 1TPFA 4IX0A 1SO4A 4ORMA 3UY7A 2VEPA 1TCDA 3NVTA 2Y63A 1WAUA 3GNNA 3JS3A 2BZNA 4O0KA 1OF6A 3W85A 1LCOA 1TPH1 1MSSA 4Z1BA 3LI1A 3W76A 1BKSA 1YXYA 4JY8A 2R14A 2X16A 3THAA 1AL8A 1F5ZA 1W3TA 2ISSA 1F74A 3G24A 5I3HA 3DBPA 4X3ZA 1NFBA 3HBLA 1YADA 5T26A 1FCVA 5I3GA 3L65A 5HWJA 2CLFA 4LUJA 5I3IA 2BSLA 2PE4A 3AO0A 5HNRA 1MEWA 4FNRA 2PC4A 4UTLA 2H8XA 2CFFA 5DBTA 1TRIA 3LCLA 1B57A 5BMWA 3TCEA 3GKFA 2PRLA 3OVRA 1W5OA 1RR2A 3KVLA 3PB0A 1JULA 2ZRZA 2ZBTA 1OFBA 2J88A 4IMGA 4OHQA 1OYBA 1QPNA 5LNVA 3SR7A 5KINA 2YXGA 1F7BA 2NUYA 4NJHA 2E68A 3EWZA 4JTTA 4OT7A 1R47A 2A7PA 4MZ1A 1XBVA 1Y0EA 2Q3OA 4KFPA 4KWWA 1KM2A 4NZJA 1GEQA 3FJLA 4JNMA 3LM7A 1OFRA 2XN1A 2YW3A 3HGOA 5KZDA 2J9XA 1D9EA 3IGXA 5F4WA 4UFJA 1KM4A 4S2BA 2C3ZA 1SW0A 4O18A 2EPHA 4M5PA 3TFXA 4GFSA 3B03A 3DH7A 1JRCA 3NM3A 1Z42A 2ABAA 4KWVA 4XBKA 1FCUA 3W1QA 4PA8A 5TBOA 3C0JA 3R5EA 4I7VA 4O1BA 1ICQA 1EP2A 2AAMA 1DKWA 1TJRA 2NX1A 5BOOA 2G95A 4L4MA 3ZWSA 3W7IA 4MZYA 3O06A 1FX6A 2V0TA 1UJPA 3QPYA 4E0CA 3G0XA 1FDZA 4QQ3A 3L0KA 3W1AA 3LTPA 2VFIA 2QCHA 3SSJA 3W88A 6TIMA 4IMDA 4AH7A 1ME8A 3M5VA 3GIYA 3MYOA 3O63A 2ZYFA 1VPXA 1JR1A 4UFMA 4IPJA 2VFGA 4A3UA 1FWRA 3W1NA 1Z48A 2WNZA 3PC0A 4E2DA 2VC6A 4XUGA 3PULA 4GXMA 2YFNA 4IJBA 4LWWA 3W7RA 1QO2A 1FXQA 3P62A 5MHBA 3FYOA 3P5ZA 1A5BA 1MEHA 3R2GA 4ADTA 4N6FA 4M6PA 4CNOA 1PV8A 2CLEA 5TIMA 3S5NA 4UTWC 1G4SA 1H63A 3N9SA 5HJLA 5FEXA 4GUHA 2CW6A 3GDMA 2Y88A 2C15A 4LU0A 3QPZA 1PS9A 5F2GA 3V75A 4PH6A 1P1XA 4FHAA 3WJXA 1M5WA 3DKJA 3L0NA 1W5QA 4XBSA 3TFCA 3N14A 1YDVA 4QITA 1TPEA 1N8FA 4A21A 3B0VC 5EPDA 2Z6JA 5HWMA 3TC6A 3C8FA 3ANYA 4FX7A 5AC6A 1SR9A 3LRMA 4PL1A 4N9BA 3TJXA 3PAJA 1NF7A 4JDBA 4UTHA 5AC8A 3Q94A 3W7NA 1OFQA 3T4CA 1QPRA 1VH7A 4FEZA 2J9ZA 3TK7A 5KSWA 1LM1A 3P7YA 1AW2A 1LROA 2A1YA 1GYLA 2CLIA 4FNPA 2FTPA 3R12A 1Z41A 1PL9A 2FLIA 3BGJA 2VXNA 3QW3A 2ZA1A 2ZRXA 4WXZA 1A5AA 3W72A 4QSHA 3W73A 1GT8A 1GTHA 3HF3A 1SZFA 5F1UA 1UASA 3MI2A 3DFPA 3UPBA 3G8EA 5F4XA 4A29A 1I4NA 4OWGA 1FY6A 3CLMA 2TRSA 2ZQ0A 2YR1A 2R91A 3PUEA 4MY9A 1GG1A 4NNBA 4ZQNA 1H7WA 4BI5A 2JKEA 3LERA 3IIZA 4M7SA 1DV7A 1F73A 1H60A 3L21A 4J9JA 3ZWTA 3C2VA 4L4LA 4FIRA 2DZVA 2JBMA 3TX9A 4RKAA 5FF2A 4JIQA 3M5ZA 5CPMA 4NXKA 3DI1A 3G1YA 1LDCA 4K39A 3HO8A 4LV9A 2ALDA 3H54A 3CEUA 3GDRA 2BX7A 4N6EA 3UXDA 1SW3A 4H6KA 1K8YA 4R7JA 4DO6A 3TAOA 2I1OA 4GJ1A 4O14A 1F2JA 1DORA 2NX9A 3G1HA 3QFEA 3G1FA 4JIPA 4UMBA 4NXSA 4I7UA 1XC4A 2TYSA 1I2NA 2RHGA 2QCNA 3T44A 4H4IA 1K7EA 5CG7A 4WX2A 2VFDA 1TPWA 5DCEA 5F1VA 1OFAA 3W2NA 3G0UA 1JVNA 4LTSA 1TB3A 2X1RA 1BTMA 5K4XA 2ATMA 1M6JA 1OK6A 4HPJA 4DF2A 1WV2A 3KHJA 4YXGA 1VHCA 4UTIA 2ZFAA 3BW2A 3IIVA 5K9XA 2ISWA 2ZZ3A 3UWYA 4MVAA 3WK2A 1ME7A 2QCLA 4NNCA 5HR6A 4N2YA 5FESA 3MO7A 1ZY9A 4JTUA 3PS7A 4XZ9A 4O16A 1GWJA 2R8WA 4IMFA 1LBFA 1ZENA 4C1LA 3LLDA 4JTKA 1W8SA 2DJXA 4DXVA 1RZMA 1W1ZA 3W7KA 3M16A 1RD5A 3CQ0A 3M41A 1UCWA 3NQ6A 3M9YA 4AHQA 2ZZ7A 3T40A 3BW3A 1X7FA 1OJXA 1YTDA 4UFHA 3HG3A 4DO5A 1VGAA 5J5DA 1JRBA 4MYAA 1GG0A 1MXSA 1Z44A 1NF0A 4IMEA 5LNRA 1PVNA 3GDLA 3MI6A 5G2WA 3S1VA 2FJKA 3KVKA 2XN0A 1H50A 2FPVA 3A5VA 5CKSA 4UCGA 1W54A 2VEIA 2FB3A 4OE7A 5C2XA 1TJPA 1KW1A 2RFGA 4TX9A 3SIZA 3DFOA 1E51A 3WFAA 1LORA 2ZDRA 3NGJA 3PG9A 1EIXA 3UNDA 2WOQA 4YMZA 4JTSA 3A9IA 1I2RA 1TIMA 1VLIA 4FXRA 1C9DA 1T99A 3NL6A 3W71A 3W2MA 1SZGA 4NUWA 3EX1A 4MPQA 1I2PA 3CIXA 5K9DA 4DPPA 3NDOA 4MLJA 1F76A 3TSMA 4CLMA 3O16A 2GUUA 1VCFA 4CCCA 4ZQPA 4N02A 4RLIA 4FX8A 3HPSA 3LV5A 3HG4A 1O5KA 2Y70A 3MYPA 3A24A 3NEVA 4EF9A 1WYIA 5HUPA 4PEKA 2Y85A 1HO4A 4RCXA 4UR8A 1LYXA 2FPTA 3TXVA 3W22A 4HIBA 5C6MA 2OX1A 1FQ0A 5L6UA 5DXXA 2V2HA 5FF3A 3MUXA 3O6YX 1IXNA 4OV9A 1VYRA 1VCVA 4MOZA 1Q6QA 3JR2A 5F2MA 4AWTA 4E38A 5LKYA 3QJAA 1V5XA 2QF7A 2QDHA 3OVPA 5HQEA 3KVJA 3W7MA 4FF7A 2GJNA 5D2WA 2QUTA 3HOJA 2X30A 3WK0A 3JRKA 3NL2A 2P0OA 3NQGA 1QCWA 2TSYA 5C5YA 1T8XA 2E1DA 1DOSA 4O4WA 4WY0F 5DY2A 2QCCA 3LHWA 3W9ZA 1YXDA 4ICNA 1UBSA 1SSDA 1YLVA 3M47A 1GVOA 5TQLA 4HNTA 4H3DA 1S5WA 3BGGA 4OGZA 3G22A 3BK0A 1SFJA 3NQ2A 2ZZ1A 3FEMA 1H61A 2ZRVA 3QW4B 1EP3A 4Z08A 1TTPA 4AMAA 3NZ1A 1JCLA 3EEGA 2BLEA 2O7QA 3HGSA 2O7SA 4ZQCA 5CZJA 4B5NA 1J5TA 4FNQA 3MI3A 5D30A 5FF4A 1OX6A 3IVUA 4AHOA 4HNUA 4C1KA 2E6AA 2V5LA 3HGRA 1OFEA 3EX2A 5EY5A 2VEMA
chains in the Genus database with same CATH superfamily
1R9ZA 3UXAA 4F79A 2C1HA 1R3WA 1UWIA 1M3UA 1QPOA 3BPWA 3MSGA 4NRSA 3P67A 3TE9A 5FI8A 3TR2A 4QJ5B 3L4XA 2X2GA 5DRIA 3FSTA 2G96A 1EWEA 1TSIA 1E6NA 1RK5A 1G4TA 4DEFA 1HQTA 4JYDA 4QS5A 4Y96A 3I7RA 1N8WA 1DE6A 3GO2A 3WJYA 1W8GA 2WHKA 1P7TA 4J2PA 4QEEA 2Z1BA 2C16A 1EHNA 2VJXA 3O7UA 3TIMA 5C55A 3U2ZA 3APGA 1Q6DA 4BHYA 3UZJA 5A8NA 1WBJA 1PUDA 3W1MA 3MUIA 4XZIA 2QXWA 4WXYA 3BV4A 4LALA 4O8RA 1PIIA 1VB9A 4IFKB 4L80A 3N6QA 4JN8A 1PAMA 1UYQA 4ZE4A 1R7AA 4HA4A 4GKTA 3FA5A 1QI2A 1RJRA 3CO8A 4QISA 1MO0A 2B4GA 3T8LA 3CAWA 3CZJA 1VFFA 3SCNA 4TV5A 1RPXA 1JAEA 1H41A 5KZ6A 2VFEA 4Z17A 3P60A 4ZO9A 1PXGA 2XIOA 2CLHA 4WSJA 3E5BA 3VIOA 1AL7A 3H22A 4ML4A 4B9ZA 3NO5A 2NUXA 3GC4A 4AAJA 4J3WA 4NP7A 5LIWX 1SZEA 4Q8OA 3KP1A 1L2QA 4A8IA 4CQCA 4A35A 1LL4A 1WDQA 3COTA 2YSWA 3CL8A 3MPGA 4ZO6A 3VTRA 5CAKA 3I65A 4CN1A 4M6VA 5JBEA 4ZBCA 4MJZA 3WL1A 1F8MA 1SUXA 3IJDA 4AZBA 4DF0A 5BRPA 1WZAA 1BEUA 2YCEA 3HMJG 4AIBA 1SO5A 1J2WA 3HQ1A 1N82A 1CT5A 1J0IA 1XCXA 1Q6LA 3LHZA 4M81A 3U2OA 1JJKA 1KA9F 1P0EA 1C91A 3M0ZA 2XM2A 3H2CA 4EX4A 3URQA 1GVQA 1G5AA 3W2JA 4K38A 3MWAA 5C9ZA 3OZPA 4PRRA 4IMCA 3RLVA 2UZ9A 2OEJA 2XG9A 4DI9A 3FHAA 5DELA 3E38A 1TQJA 3GC5A 2PDHA 1NDVA 5BXTA 5H6HA 2WSRA 5EU9A 4ENLA 1DYSA 1FCQA 4O11A 1FWEC 2Y7DA 1H09A 4H2CA 2CC0A 2ZUNA 2XPKA 4AYGA 2ZXDA 1ZJHA 1HKJA 2E6YA 1W1YA 3KCOA 3QMRA 3H70A 1GOXA 3OU8A 2WWDA 1V3JA 3A4XA 4LS0A 1KFLA 2FZMA 5G4WA 1VJSA 2EG6A 4PUDA 2YYTA 3E0FA 2BG5A 4WLCA 2VMFA 1UR2A 4PMUA 2WBKA 4ADUA 3TSBA 3TMLA 2YA0A 1ADSA 5A6MA 3W1PA 4TR9A 3GIQA 4QJ1A 2DJLA 4RXFA 3BO9A 3WDRA 2YGYA 3JZEA 4Y9NA 4QCFA 2Y8KA 2YCIX 4OUIA 1GQJA 1QTWA 1YXCA 1O1HA 3PWAA 1ZCOA 2MANA 2QT3A 5FCZA 5D2YA 2FDSA 1B30A 4IQLA 3DYPA 1LRTA 1JNEA 3N17A 3ABQA 4UTTC 3VCCA 1VFSA 1UOKA 2PDQA 1R3QA 1JD9A 3D3FA 4O57A 3NQ8A 3NIYA 4E2BA 4KWSA 1J12A 3NO3A 1ONXA 2OKOA 3N04A 3M44A 2YX0A 3ABRA 3BVJA 5D04C 3WJSA 4JX6A 4H7VA 5D02A 3VUPA 3TP4A 1F3XA 4NJGA 3W3OA 3SQLA 2E09A 3L2IA 1QWGA 1R3SA 2PDBA 4IHCA 4MB5A 3PUDA 5CPOA 2JFEX 4QBXA 1T6MA 1UKQA 3STCA 5M2FX 1PTDA 3LXAA 1W9XA 4XAGA 2GZXA 2QJHA 3KP0A 3W7PA 2ZX5A 1AW1A 1M1BA 4FLQA 2E5BA 1B3ZA 3QMTA 1A0EA 3BWWA 2DIKA 3TA6A 2FYMA 1XGEA 4LYPA 1PKYA 1XPYA 4E4UA 3EXRA 4M29A 5JUVA 4HZMA 4B92A 4C6EA 4TTGA 1BWKA 2PRMA 1ML1A 4ZA0A 5AZ0A 1XRSA 4G2DA 2J79A 1XIEA 3QM3A 1BSIA 1XUUA 1G9HA 3GHTA 2JALA 2DZBA 3URAA 1S5TA 1E71M 3TKFA 3NQCA 3OLIA 3ZT6A 1NJJA 4AD4A 4QM1A 5C2CA 3GKAA 1A50A 4MJMA 2Y61A 1VYSX 3LTSA 4PB5A 2OPJA 4LAZA 3STPA 4AD5A 4DJFA 3VYLA 4A05A 4W9TA 4XG1A 3LQGA 1OD8A 2PDKA 2OJPA 3CMJA 2D22A 5L9FA 1H1ZA 4FXSA 4HN4A 3BLFA 4ASTA 3E0IA 3S2NA 4FXJA 3AZTA 1WOAA 3GR4A 4R9XA 3N4EA 4UQAA 1VFLA 3LPGA 2GUBA 5KETA 4YVXA 4XK2A 1XIGA 1GONA 4XBJA 4XIAA 4NJJA 4MZ8A 1DJHA 4G8TA 3SUWA 3L4WA 4MB3A 3UZWA 5HR7A 3T42A 1KV8A 3A4AA 1EGVA 4EK7A 3UY8A 2D0FA 3TSDA 3VIJA 1OINA 3ZSSA 4WZHA 4NYUA 4MY8A 2PGFA 1TA3A 3PPHA 1VLWA 4U2YA 4KW2A 3PZQA 2VRKA 3BMXA 2V6AA 3VX0A 4UWMA 1DE5A 4RNJA 1CGUA 5E0KA 4M0XA 4U3CA 4ZOCA 5JH2A 4U4MA 3GHSA 3EOEA 4IX2A 2WANA 4IM4A 1OGSA 4X63A 3IJ7A 4QR6A 3WG6A 1DJWA 4YLWA 3BV7A 2CCRA 2J4GA 1XSJA 3VDGA 2CETA 3NQAA 4LCSA 3VNDA 2B7PA 4NZ1A 3W2KA 3FEQA 4F8XA 4XO7A 4V15A 2G37A 2A7RA 5FJUA 2RDUA 2FGZA 2VGFA 6PTDA 3UGRA 5D05A 1UWSA 3WQ4A 1KM5A 3ATZA 3MB9A 3MSDA 3CYVA 2JGQA 2AQWA 3GFYA 1OIFA 3VXGA 3GXIA 2XVNA 2VD8A 1O4UA 4K7VA 4YJ5A 1V7AA 1H49A 4Q33A 2ZZ5A 5BROA 1CXEA 4E8CA 8CGTA 5CPSA 1UD4A 2V2DA 2TMDA 4W7VA 1DJGA 5IHRA 1K9DA 1S46A 2HWGA 4GXWA 3TROA 2BY2A 1JL8A 2V3GA 3EX3A 4NZCA 1W5NA 1XH0A 3SJ3A 4B5VA 2GJLA 3SAZA 9XIMA 1GJPA 2TAAA 3WBXA 1JDDA 4IP7A 3FX4A 4CD8A 3L4UA 4DQWA 3ABZA 3M0HA 3UBPC 3L12A 1EQCA 1VHNA 3T05A 4GZIA 2HNEA 3C4UA 2QULA 1TWDA 4HZ6A 4NJKA 1QOQA 1OGBA 1NAL1 4H9XA 1H7NA 1SVDA 4DI8A 1BXNA 4JTDA 3VZXA 5IFPA 3EWWA 2X41A 5I0DA 3AHXA 2RKXA 2YKKA 4JFWA 5F7UA 4JYFA 2AAAA 4AEOA 1SGJA 1XV8A 4L6DA 1YPFA 4LAUA 1PKNA 2DT2A 4E3TA 3PJTA 1R0MA 4TU1A 4ZTYA 3A22A 2ZUMA 4JTHA 4O1CA 2VZSA 4XZBA 1TV5A 1X1OA 3G1DA 1LQAA 3NXLA 1DJIA 1XIHA 1XBZA 1OABA 4IPLA 1ISXA 3VMOA 1UWQA 3QQ1A 5REQA 3F2CA 4KPLA 2CBUA 4PE8A 4LUIA 3WD2A 1DWAM 3KZSA 4PSRA 3NQVA 1UH4A 1ZCCA 1G69A 3L9CA 3CHVA 3AXIA 3W7DA 1LWIA 4LVGA 2R1PA 3H7RA 1AD1A 2PTZA 3QOKA 1BRLA 1T8QA 2A6LA 4JIHA 3A23A 3AIQA 3CGTA 2OQLA 4AVFA 5J04A 2WBGA 3V1PA 3LSCA 4CU8A 4YNGA 2Z2UA 3TV8A 4NF7A 4GYFA 4J4KA 1VQTA 1AH0A 4O1FA 5AKQA 2B0MA 5LIUX 4DYJA 5ABFA 3VI2A 2AKMA 2I57A 1ZAIA 1M03A 3W1RA 5HMSA 4Y7EA 5LGXA 2XFYA 3EOLA 3HU7A 4ES4A 1FBAA 2Z0IA 4AW7A 2NQJA 2J8FA 2CLKA 4ZENA 4BK9A 1WOBA 1UW9A 1ALDA 1OYAA 2CBVA 2HISA 3WYZA 3VIKA 1P6CA 1VIZA 2OQYA 4P7OA 4FB7A 1C3FA 2WC4A 3V0SA 4ECLA 4LUTB 1XH2A 4ZQOA 2HPIA 5I3FA 1FWIC 1ICPA 4NX5A 3F4VA 5K9CA 4FP1A 3GHUA 1XGZA 4FIQA 2VC7A 3RMJA 2Z29A 3CV1A 3II1A 3CU2A 4GQRA 2J7BA 3EMZA 5HQMA 4OIFA 2EJAA 3GAYA 4OECA 1XDJA 2DIJA 1UROA 2YCJA 3LV6A 2DZUA 3KBVA 5A8OA 1XLLA 5D09A 3N2MA 1O68A 3ZO9A 3ZFHA 3UT0A 3S6TA 1LP6A 3QZEA 2V69A 3DESA 2CKSA 1P0KA 5LXEA 3GNOA 4JYEA 1L0PA 4FOUA 3W2UA 4FA3A 3CPGA 4DUOA 2YDRA 3TDFA 4CQAA 1VZWA 3CIVA 1GZJA 4XAZA 4FS9A 2QPSA 1X6UA 4M51A 4O52A 1RV8A 2BP1A 3UCQA 1XYBA 1JUEA 3DHDA 3ENLA 1UMYA 2YL6A 4BS0A 5CLWA 4N9EA 1XHGA 3UFYA 1ONEA 3ZSTA 3BLIA 3O05A 5E70A 4XSLA 2W5FA 1FOBA 2JEPA 4F0KA 2DVTA 3H2NA 1TIWA 1PDYA 1A3HA 2PGRA 3WLJA 3WDJA 3AJ7A 2AQVA 4HK5A 5C0QA 5GVJA 2GGEA 1RCXB 3B06A 4UFLA 1GZGA 1RD6A 4CQ9A 1K4HA 3GYEA 1Q6CA 4JZ5A 4L56A 3CWHA 3QLDA 3WF3A 4E8GA 5EL1A 1W9DM 4DBEA 3HFYA 1DIKA 2XGBA 1NY1A 3MC5A 1Y65A 5FACA 1ZTVA 2PWGA 4KIEA 4JS3A 3E2QA 1QFEA 1Z32X 3PN8A 4MUPA 3QY7A 2Z26A 3MUZ1 3C6CA 4DWDA 4M56A 2WPGA 5G1TA 2GJPA 3S3GA 5CSUA 3GR7A 2EHHA 2EPMX 3BG9A 5A8QA 4D6FA 4UOZA 4C6IA 4LYRA 1NQ6A 4F48A 4RDYA 5T9CE 5BXSA 2UV8G 3SGUA 1WXZA 3WIJA 1NTHA 3TYCA 3WQGA 1W91A 2YW4A 3DIPA 4D8ZA 5DFAA 1L6WA 4MIMA 3VGFA 4OZOA 2OZTA 2PF8A 3WBEA 3A6OA 1W5MA 1K8XA 4UNKA 2HS8A 3GZ3A 4O10A 4RDZA 3VZZA 3UVAA 1VBGA 3KE0A 3DUGA 2DUXA 1IWBA 2PDNA 1ZFJA 1IXPA 1M7OA 3N9KA 3NQMA 1OFPA 4J3VA 5CXPA 5AHNA 2REQA 2VWSA 3BQ5A 4WOZA 1KRMA 1IR2A 3M64A 4DXKA 3O6CA 3ONCA 4LUYA 1BF2A 1I0BA 4GI4A 2FVKA 4QIUA 1YNYA 5GNZA 2OKTA 6REQA 4ZGYA 3U8GA 4PMZA 3TYEA 1NH6A 3ES8A 1DVJA 4HD5A 4NASA 2O56A 3TTQA 4ATLA 2ISVA 4CNUA 2J6VA 1RLDA 3W24A 3E74A 1I45A 2JF6A 5FF0A 3K4DA 4OU1A 1CXFA 4YHGA 5JMUA 4LNYA 2C1GA 2FH8A 1EDTA 2PTYA 3O6DA 1D8WA 3U2EA 1MXDA 4D6CA 2HSAA 1GPFA 4E5TA 4QAWA 2D2GA 3UCCA 4U3AA 3BMVA 2HEJA 3PR2A 4S3DA 1TG7A 4RX0A 2O0TA 3O8AA 4XTDA 1TFVA 1GPWA 4HYRA 4Z1YA 4JTIA 2BWGA 4HPXA 1C29A 1S3HA 2CXEA 4GACA 1EPXA 3VFLA 4RZ6A 2J24A 4Q8NA 1W3LA 1A5LC 2VC5A 1H62A 1RK6A 3LCHA 3QGVA 3KVMA 2GYIA 2C18A 2WXDM 5EMLA 3RIKA 1U5VA 2G3NA 1S3TC 4HPNA 4Y9OA 4LYKA 5C9XA 3M0LA 2I7GA 5AFDA 4EAMA 2BY3A 5GJMA 1EF2A 5K3VA 2EEXA 2IQTA 4FAMA 2HV5A 1Q7QA 1RQHA 3PZMA 1BWVA 3W7HA 2WMGA 3F03K 1JCXA 4JIRA 4RW5A 2Y89A 3NZGA 4AX7A 2I56A 4L61A 3OYXA 3QQ0A 2DU2A 2CLMA 1H2JA 4GNJA 3LCGA 3RHGA 2CU0A 2ACRA 3UXIA 3AWOA 2E9LA 3MMTA 2WM1A 2J9YA 2VZVA 1KRCC 3PPFA 1VJIA 1H3GA 3MP5A 3S5YA 3VIFA 4KCUA 4D6GA 4L7ZA 3ID7A 3E2RA 1DP0A 1GGOA 1FWGC 2C0AA 3MJYA 3LXCA 1XCFA 1KXVA 1TQXA 1POJA 2ZXAA 3R89A 1DJQA 1OHLA 4NILA 3S9ZA 3LX9A 1R2TA 3AIEA 3BG5A 2GVGA 2OT0A 3BSGA 2NQLA 3I4EA 1E0VA 1B3VA 3UZYA 4JHOA 4MUZA 3KOFA 2Z1VA 3WH9A 1UUMA 5EMMA 1XBYA 3K8LA 4RR4A 3STEA 3ZVHB 4ATDA 2XVGA 4DO4A 2FHBA 2A5HA 1B2YA 4L6OA 3VCNA 2P0IA 3WQ6A 4C6LA 4D8AA 4L5ZA 3DN5A 4ZXLA 4JFUA 2PTXA 1H5YA 1V4YA 2ACSA 4GQGA 3LBOA 4ORMA 5I00A 1R87A 3VGHA 2AMXA 1TCDA 4C1NA 4F2UA 5B7ZA 2Y63A 3GNNA 2GJXB 2VX7A 3JS3A 2BZNA 3W85A 1D8CA 3F4DA 2ZUUA 2X16A 4KWOA 2QJNA 3S2LA 1VRXA 1UJQA 1QWKA 1IWPA 1FH7A 1FCVA 3TCSA 4L9ZA 3GY1A 5I3GA 3SUSA 3L65A 5HWJA 3C8NA 4LUJA 3LNPA 5I3IA 5CJ5A 3M07A 5LIXX 3AO0A 4FNRA 2DSVA 3CBWA 5FL0A 1TRIA 2X05A 2VVNA 4NAEA 1UC4A 3TCEA 3GKFA 2PRLA 4LY4A 4LNCA 3PB0A 4HHLA 4Q8TA 4KEMA 1KCZA 2J88A 4IMGA 3SCQA 4OHQA 3SR7A 3M4HA 4XISA 4C6DA 4OT7A 4U33A 3ANVA 4MZ1A 3GG0A 2D3LA 4RPPA 4JTRA 2W66A 4NZJA 3R0UA 5AVHA 3FJLA 1E0TA 1M7XA 3SCRA 3FSUA 4EXBA 3FGCB 4OFCA 3S2CA 1V6XA 2Z00A 4GOAA 2BFGA 3FHQA 1KXTA 4O18A 3RN6A 6ENLA 2GSEA 3H4GA 4M5PA 3TFXA 4JIEA 3B03A 2EPOA 1NDYA 1JRCA 5HANA 3WDQA 2YCKX 3CV2A 1Z42A 1JZ6A 4L4OA 3NCOA 5REQB 5TBOA 3R5EA 3WEMA 1EP2A 2AAMA 1NDWA 1WKDA 1DKWA 2G3JA 3OLGA 1JF6A 2YLAA 2VEGA 1FX6A 4DUWA 4E0CA 1FDZA 3W1AA 4CQBA 2FGLA 5I7GA 2QCHA 3SGGA 4IMDA 4AH7A 1RAKA 2GWGA 1Q7MA 2AOSA 2PDLA 7REQB 3N29A 1VPXA 2DT1A 1XX1A 1XLMA 1FWRA 1TV4A 4J3ZA 4FLOA 3WNOA 2C91A 2VC6A 3SRHA 3NTYA 3PULA 4GXMA 3W7RA 5CPQA 3P62A 2XSXA 3FYOA 3P5ZA 2YBVA 1A5BA 1J9YA 1XYZA 3KOWA 3R2GA 5EFFA 4DZIA 4N6FA 2YXOA 1PV8A 5TIMA 1G4SA 3BH4A 3N9SA 1KQZA 2ACQA 1TZZA 2CW6A 3WKZA 3C3UA 2Y88A 3IV8A 3R11A 3V75A 3M0IA 1UQZA 2DVUA 5D9MA 3VIMA 3WJXA 1M5WA 4PBFA 1QNQA 1GUVA 3Q45A 3N14A 3TFCA 1YDVA 1N8FA 4WGHA 4WHBA 4A21A 3S83A 3HQNA 2Z6JA 3C8FA 1B1YA 4S3JA 2GGGA 2WJEA 4F3HA 4P8UA 5AC6A 1E0UA 4N9BA 1OCJA 3VDHA 4JDBA 2WKLA 3ISIX 2A79A 3VGGA 1QPRA 1IEIA 4QLKA 2P88A 3FYYA 3BLKA 3VD7A 1BHGA 4NAEB 4S39A 1LROA 1J6PA 1MVYA 3WF4A 1Z41A 4C6CA 1VPQA 3QW3A 2OWCA 2ZA1A 3U3HA 2ZRXA 1QUMA 1CB2A 4PMOA 4NSBA 5IDZA 2OX4A 3LY0A 1C90A 3HF3A 1SZFA 3KLKA 1UASA 3WEOA 3UPBA 4A29A 1IR1A 2Z7GA 3CLMA 2X40A 2R91A 2JKEA 3AI0A 3PTDA 3V5OA 4EACA 1WDSA 3N2OA 3MKKA 2HNHA 2DEPA 1Q2RA 1W2PA 1RHCA 2VDIA 3HO8A 4LV9A 4KRZA 3B9DA 4N6EA 4C6QA 3Q67A 5JQ9A 2YIHA 2PDYA 4O14A 1V03A 3T0DA 4FLSA 3IK4A 1G01A 3ITXA 3WENA 5BXPA 2QGYA 1V08A 2RHGA 2PWHA 3LPFA 4ZOBA 3T44A 3QC0A 1BLIA 1OEPA 1K7EA 2QS8A 2NT0A 3S5SA 2VFDA 3V5CA 2EJ1A 2HXUA 3EOSA 4LTSA 4GBDA 1BTMA 5K4XA 2O9PA 1F9CA 4HCLA 1OK6A 4HPJA 1WV2A 3AHZA 2POZA 4JNZA 4UTIA 3HFTA 2INFA 3IUHA 3MUY1 3IIVA 1QJWA 2XWDA 5JBFA 2ZZ3A 3SCTA 5FESA 6CGTA 3IWPA 2ISDA 3KOYA 3GVVA 4O16A 1SJCA 3T0BA 1CXIA 2J75A 4TV6A 5A2AA 5DMLA 3MSRA 1W8SA 5JVLA 1A5KC 1W1ZA 2QVHA 4HJWA 1WPCA 2PMQA 3BW3A 1LQ0A 2XFFA 4F0MA 1YTDA 1E6ZA 4GVHA 3LM3A 3GXFA 5LA0A 3BZGA 1GG0A 5FAJA 2OU4A 4AMCA 4S3CA 1Z44A 1NF0A 1PVNA 4LYQA 4H6EA 2XN0A 2POTA 4MG4A 1B3YA 2OELA 2VQTA 3PNZA 2G8ZA 2FB3A 3U7VA 1TJPA 3TOPA 2JQXA 3H2EA 1E51A 2GDQA 2ZDRA 3WEZA 3ZOAA 3PG9A 2CBIA 1SFTA 3WLKX 3VM7A 4J3XA 1WKYA 1ECQA 3W71A 2EQDA 1SZGA 4NUWA 4KRTA 1AUSL 2VOTA 1MXGA 4G7FA 2P5NA 1F76A 3TSMA 4K2SA 2AGTA 1E9YB 4DLMA 5KEZA 3HG4A 2D69A 3GTXA 2Y70A 2VP8A 3MYPA 5HUPA 1F3TA 3APTA 2IPGA 4Q4QA 2O92A 5C6MA 1FQ0A 5L6UA 3SUVA 3OVGA 4GQBA 5EB8A 4LUSA 3SN0A 4QDPA 5A94A 4OV9A 1S1RA 4IJRA 1VCVA 3H23A 8RUCA 1UA3A 1P43A 2DW6A 2V3EA 3R0DA 3R10A 1MRQA 1V51A 3WK0A 2E8YA 3JRKA 3NL2A 5MKGB 5C5YA 1T8XA 1BGGA 2BVWA 2E1DA 4OOZA 1UR4A 3BAJA 2ZICA 4JL1A 1J93A 2QCCA 1AQMA 5BOFA 3LD5A 3WBAA 2XGIA 2DSZA 3M47A 1XR2A 2QV4A 4HNTA 3BGGA 4D72A 3BK0A 4C91A 2ZZ1A 1GKPA 1IE7C 4XSMA 3DBNA 3P6LA 2ZRVA 1B3WA 4AMAA 1F3EA 3NSXA 3HGSA 1TMLA 2J78A 9RUBA 1MUWA 1J5TA 2OZ8A 4FNQA 1RJPA 2G4FA 3USZA 5FF4A 1OX6A 4AHOA 2E6AA 2QYGA 3EX2A 3GVWA 1CXLA 1BQGA 2ZE0A 2IKGA 1UG6A 1UUOA 1DL3A 1DWGM 1UPMB 4M24A 2W91A 2XINA 1M7JA 2FZBA 1X8FA 2Z1SA 1UZ4A 1K03A 1GW9A 2PS2A 5AB3A 3P2VA 2J6XA 1TUXA 3CZ8A 1GVFA 2IKJA 2VR5A 1KLYA 4GH1A 2F6KA 5A6BA 2CERA 4MWAE 1KWKA 4PCPA 1US2A 3W7JA 1DBTA 4PMDA 1XLFA 4EXAA 3S9YA 2BB0A 4J40A 4POCA 1KBIA 3ZM8A 2H90A 4GMEA 1HUVA 2VURA 4JIIX 4S1FA 3O3RA 3TA9A 1PDZA 3T55A 3AHYA 1EYWA 1Z8AA 1YPXA 4UFIA 1RH9A 1WNOA 3GHRA 4HNNA 3W7EA 4JQAA 5D33A 1B9ZA 3ITGA 1RQBA 1KFKA 4EXQA 4EVZA 4HGXA 1O12A 2L5HA 1KTNA 3BGAA 3OP2A 1XIJA 3GTIA 3BOLA 1XPGA 2WSPA 3LYEA 1A49A 1CLKA 1KM6A 1W1A1 1CLXA 1XLGA 3GDKA 2XIJA 3VINA 1OX5A 2FZNA 3WMSA 1GQIA 3FOKA 3S0CA 1R3VA 2ZX6A 3IJLA 5C9RA 4JTCA 4TX6A 5IOBA 2FDMA 1UD8A 3G1AA 2BBFA 2PBOA 5A6KA 4E4PA 5HBFA 1EPVA 1UR0A 1HG3A 1CZ1A 3N3MA 3L2MA 4L64A 2WSQA 1WP6A 4N0RA 2KX9A 3CPUA 3B04A 3KW3A 4QLJA 3A3XA 1JAKA 4EE9A 4ORIA 1EC9A 2ALRA 4IIFA 5XINA 5LA2A 1ZQ5A 4OVXA 3TMQA 1J0JA 3V3WA 4O4VA 4JHZA 2XH7A 2GL5A 2QJIA 4RV8A 1JEZA 1QW9A 1J2BA 4R9OA 3STGA 4G6CA 1ZB5A 4HU4A 3L67A 3GG1A 3BG3A 1U1JA 1FH9A 5AHIA 3SCUA 2B7QA 2OVLA 4O19A 1K7FA 3VZYA 2Y5SA 3PZOA 3VD5A 7REQA 1FRBA 1QR7A 3KRSA 4GX9A 4XKYA 2PDGA 1QK0A 3NQFA 1EQPA 3UWQA 3I6EA 4MWAC 2A2IA 3NPXA 4WSKA 1V77A 3OZYA 4KGLA 3THCA 3GXNA 5CZ0A 4F40A 1M01A 3SEPA 1Z6KA 4I7WA 1JCJA 1ISZA 4PB3A 4Q4KA 2G4JA 3BAKA 5AN7A 4DF1A 4O54A 3IANA 5DT7A 4HOZA 2IUZA 3AXHA 1R38A 1JZ2A 3GNDA 2FMOA 2EF9A 3LPOA 3W87A 2CEQA 3IVTA 4REQB 1BVZA 3AYVA 1BYBA 3AIBA 4X2PA 3I7QA 1BQCA 4CNNA 2OYMA 4DVOA 5EMKA 2DW7A 4NU7A 4Q4RA 1WXYA 3U57A 4F0HA 2GGHA 3C5QA 1WAWA 3L5AA 1YRRA 4L1GA 1VBUA 3O9NA 1V3KA 1KXHA 3ICJA 4N42A 2E9MA 4GO9A 2I16A 2XIQA 2FHFA 1FUYA 1XYLA 1UHVA 2OTDA 3F2BA 1KCLA 2BASA 1U33A 4E4FA 4KCTA 3NQEA 1KXQA 1FWFC 3GM8A 1RALA 1FHDA 1WUFA 2VWTA 3EWBX 4DBDA 4TVDA 2WLZA 1UBPC 1WBHA 3SECA 3KL5A 1ZBCA 2NUWA 5HNUA 2XVKA 2W79A 1XW8A 5CGQA 1YQ2A 1DWJM 1C8VA 1G1YA 2XWEA 4WDXA 4AWEA 4Z2LA 3O0KA 4Y6GA 3AC0A 4I9AA 3NGFA 4IUOA 1EJWC 1P0BA 1MWOA 3OO2A 3AIRA 4GZJA 3PBWA 4PODA 2OWWA 2WHJA 4W7UA 3MA8A 1V7YA 3QZ6A 1OX4B 3HTWA 3R6IA 3WCZA 1SJAA 2W0UA 3AAMA 5HATA 5MKGA 2GVJA 1PSCA 1UD3A 4XUYA 2PWUA 5HXMA 3BLEA 3GIPA 1ME9A 3VX1A 3MY9A 1VRDA 2OOFA 2DZPA 2WJZA 3PUOA 5KZMA 4XD6A 1L6SA 1SPQA 3AYSA 2E9BA 3RJYA 1E73M 3BSMA 4GI8A 2A4AA 1JYVA 1C8XA 2RDXA 5M1TA 1LZOA 4GYKA 3K13A 3O1NA 3LI0A 5LA1A 2Y5JA 3ANUA 2HTMA 2WZHA 1PX3A 3BMWA 4H00A 3BLPX 3N1AA 3K4AA 1A5OC 4O8AA 1QT1A 1UWAA 5BWAA 2F7FA 1AG1O 2YBUA 3LNMA 5AYBA 5GPRA 2DH3A 3MV01 3FFSA 1MQRA 2OFJA 2WK2A 2B81A 2WYSA 3LSBA 3LN3A 3G77A 3SRKA 3DERA 3VOIA 1AH4A 3Q58A 4DWSB 2AGKA 2F84A 1W1IE 4JR5A 4LVBA 2YA2A 3UWUA 3EMQA 3CHDA 4C6NA 4IL2A 5BMXA 1CBGA 3RF9A 3U7BA 3FNDA 1CYGA 4IIEA 1R3TA 2HRWA 4FPSA 5E93A 2QZRA 3LK6A 4NZFA 1TE6A 4GUFA 4L9YA 5EBAA 1GVSA 4A8LA 4YCOA 4Y8EA 3DFHA 4UMCA 2J7EA 3MUAA 3MT1A 4J3UA 1QNSA 4IG2A 3TNOA 1OCNA 1KBBA 1TMHA 3KWSA 1BXBA 1ODZA 2R1KA 4GJJA 4MB1A 2QDDA 3CLWA 1JXKA 3I3BA 1EYEA 2CWXA 2E67A 3ARZA 2ZWZA 3VAVA 5H8PA 3R25A 3I4KA 5T9BG 3SW6A 3TYAA 2PODA 4NQ1A 3L68A 4Q7BA 1QNOA 3K8MA 4LV4A 1J4EA 4H7CA 7XIMA 1WE5A 1F6KA 3CB8A 3OEXA 1HTIA 4P8VA 1JZ8A 1NVMA 3ZJKA 3OJGA 5AOUA 3Q37A 1WZMA 1ZALA 1GEHA 1HKMA 3HZ3A 3RPDA 1A3XA 3DENA 4IQJA 5XIMA 3SM0A 2VFFA 2VUYA 2QMJA 1PWLA 4B9YA 1AQ0A 2Y8VA 3E02A 1MEIA 2W3ZA 2ZRYA 3L23A 4PFMA 1RLCL 2G41A 5I78A 5M5DA 2CITA 4C7DA 5A1AA 3RMEA 3MZ2A 3TC7A 3SZ8A 5M17A 3WQDA 4KMQA 1FWTA 4JICA 1QATA 4R3UA 2WMFA 3OLDA 1IV8A 4UTKA 3M1ZA 4DJDA 3ARYA 3HV8A 4J5NA 1EEPA 2ZIDA 2PI6A 1NWUA 2Y7GA 1QASA 4WSHA 4CNPA 1OC6A 3W26A 3WH8A 3H4WA 3M7SA 1XD0A 1QO5A 4X9SA 4LANA 3RR4A 2D73A 4QE1A 2BTMA 5CLTA 3TW6A 1HNYA 1L9WA 4AQLA 2OSWA 1PCKA 2E3ZA 1LLWA 3R7MA 2E5CA 4WD0A 1OBAA 1WX0A 1WKEA 3PF3A 1PZ3A 4H83A 4HU0A 2PCQA 2PGWA 3W1LA 1YBQA 5DCDA 3P84A 1D3HA 3SJNA 1KV5A 3VMPA 3CEPA 1V0KA 1XG4A 4GLEA 3C86A 4MLRA 2D0GA 1EOKA 1AFSA 2A3HA 2QAFA 2YPIA 3G18A 1MQPA 2GGJA 1N7KA 2WNWA 1HKWA 4ZMGA 1TPB1 2I17A 1W6TA 4MNKA 4AD0A 3W00A 4DN1A 2EG8A 4YHEA 4EWJA 1ZAJA 5G4HC 3RO8A 4C6OA 2OYKA 2NVDA 5FOOA 3NQBA 1ZP3A 2PZNA 4LVAA 1VAHA 4XO6A 3LRLA 3GVGA 1F6PA 3B40A 4IT1A 3DFYA 2QQ6A 2O4MA 3TJ4A 3A5FA 3HPAA 3LHUA 4HCHA 1XS2A 3URNA 3LUTA 5FEWA 3W6MA 4FSAA 3LCWA 2OGYA 1GQNA 2J74A 3V16A 4RNIA 3SCPA 3W7QA 3F1QA 1XL9A 2GK1B 2J7DA 3T0TA 2X1SA 1E5NA 3M5YA 6ALDA 3K30A 2ZX8A 5MF5A 2R94A 3DZ1A 1X7IA 1VS1A 1W0MA 4JY9A 3SURA 2ZX7A 4CCDA 1JUBA 4A3QA 1W32A 2E25A 5GNXA 2Z1KA 4GWEA 4MKNA 1IZCA 3GUWA 3ZLHA 4NY2A 3NXFA 4P8XA 4AIUA 1XRFA 5CZTA 4NYYA 1LF1A 1RBOB 2V5BA 2OLSA 4HSHA 3KS6A 1WXJA 3ITVA 3LMZA 1LBLA 2F6UA 3WLRA 1R46A 4O50A 3SGZA 4QFUA 2OZ0A 1V02E 3BOXA 4ADSA 2RAGA 4N9CA 4BA0A 1F8IA 1SZNA 3HPZA 2QV5A 4EWND 4M19A 3E49A 4HTBA 1JDFA 2H8ZA 5U4NA 3LHTA 4MFEA 1VENA 3BQ6A 3USBA 3AMDA 1ZSXA 1KD0A 4YVPA 4UR7A 3W53A 2ZXBA 4PMXA 2XM1A 4B2DD 3D5HA 1RCQA 1DIDA 1Q63A 1I0DA 2YL8A 3P0XA 4V27A 4UMAA 2OSXA 3SCSA 3BJTA 1KFJA 1TV8A 4N9DA 2C8NA 1JDEA 4LY8A 1IT7A 4XZNX 2EKCA 3WDPP 1UWRA 5H8MA 3I3EA 1XISA 1S2TA 1YDOA 4MAVA 4D6JA 3F4CA 5DF0A 4I3GA 1E55A 3W84A 3DAQA 1O94A 2CIPA 4Q8QA 1YDYA 3P93A 1IXOA 4PL2A 1XLDA 4MAZA 1L6GA 1TV7A 4XV0A 3VDBA 3GRIA 2WHMA 3NL5A 3OOQA 2V3FA 3LGGA 1MMFA 3CAQA 2VI0A 4GIYA 4YCPA 3QR3A 1LUCB 2DH2A 2WC3A 4XVDA 4ZQRA 5E9AA 3GW0A 4N4QA 3QMSA 3W1TA 2CZEA 3GNPA 4PUJA 1SO6A 4EPKA 3OQEA 1FVPA 3WUFA 3T0CA 3QTGA 2CXGA 4BZYA 1A80A 2X1UA 3UG5A 3G6MA 4U5IA 4UTTA 4I9MA 1LRNA 1BVWA 3KM8A 3MHGA 5BXRA 1RA5A 3O0FA 2D1ZA 3U48A 2GJXA 1F05A 3DYOA 3W86A 3IUIA 1XKJA 3KL0A 3LTYA 3CTTA 4RZ5A 3WDIA 4MNJA 2INEA 2PEVA 3NAVA 5CSRA 2PA6A 1TRDA 1SU5A 4LAKA 2WMHA 3S1XA 2DIEA 4IUGA 3K1DA 4JTLA 5AC7A 1H51A 3VPLA 2AL1A 4FNUA 3LZ3A 1GOOA 3UZ5A 3QFWA 4LX4A 6A3HA 1VFUA 2IXUA 4DELA 3WUBA 6XIMA 5I09A 4KBXA 1GK8A 2VZUA 1R86A 3FKRA 5KTLA 3IIPA 3FW6A 4DJED 4P7LA 3FLUA 1IIGA 2J62A 3CUJA 3CQKA 5I3JA 3ZR4A 1QPQA 4A4AA 4DJDC 1U83A 3PBMA 1F3WA 3W37A 5A6SA 2HE5A 4K8GA 3MMDA 3R0KA 3NG3A 4K1GA 2A6NA 4JTFA 3S9IA 3KCJA 1JCNA 3WLMA 3RU6A 3WQCA 1N2VA 3VD4A 4Z1CA 4WDWA 4D71A 4UTWA 1EA9C 5F4SA 3DFNA 3KBNA 2ZA2A 4DM1A 3H4XA 3W7GA 3EKLA 1TV3A 3ONBA 2VC9A 3KAOA 3GTNA 2QCMA 3IRDA 3H53A 1DQUA 2ZRWA 3T7VA 3LCFA 2HDJA 1GW1A 4WIWA 3CAKA 4IGSA 4KERA 2WVTA 4JDYA 3HMCA 4B16A 2P3EA 4R5EA 1BVNP 2EGZA 3QYQA 3PP7A 3PPCA 3PVFA 4W5UA 2BOFX 3INPA 3B8DA 1ZJAA 3BJSA 3EWDA 4GVGA 3KDNA 3KS5A 2AL2A 3CMFA 2XIMA 2CLOA 3WQPA 5DMMA 2EPNA 2BHUA 2H6RA 4JOMA 2JIWA 3NA8A 4EKJA 1CNVA 3N34A 1XP3A 1I2QA 2NLIA 3W70A 1DHPA 3W74A 4GHRA 4UTJA 3PSVA 1TE1A 5HULA 4FNSA 4KEVA 2A7NA 3QHNA 5DANA 2ACUA 5JBDA 1S5MA 1W9PA 2JF7A 4AZ6A 4DYEA 1F4AA 1KBKA 1Q85A 5DEZA 1R8LA 3GBDA 4AZCB 2W63A 4PMNA 3MDUA 5FJJA 1TR1A 1J6OA 3OVQA 4QXIA 2Q3RA 4AISA 1EUAA 3EOUA 1EJXC 4HK7A 2J66A 1N8IA 1K7XA 3EGJA 2PLJA 2D2OA 4IXXA 3NEHA 3PBVA 4EP8C 4WJXA 3B3DA 1CIUA 3ZVIA 4ZFCA 2ZZ2A 4ZO8A 1KGWA 4RXGA 2CNCA 5JXQA 5A6LA 4Y9MA 4AHPA 1BFNA 1V3LA 5T8GA 3W83A 3WK1A 3TTSA 2ONEA 4Q6XA 5C9UA 3HQOA 3GQYA 4DNHA 2Z24A 4J28A 3ME3A 2QUNA 5A5WA 1XI3A 4ML9A 3M5XA 5AC5A 5HWNA 3V18A 1XKYA 1M53A 1FWWA 1JYXA 3MBFA 3Q2DA 4GYPC 3WH5A 2C79A 1CGWA 4A22A 4IMAA 4MHBA 1HKKA 2CLLA 3QF0A 4Z2KA 1Z89A 2CBJA 3OIXA 1J01A 1IZJA 1XGDA 3I6RA 4V33A 5LYRA 4XKMA 3RM8A 3T2QA 4B4HA 1GOMA 3ARQA 5M3WA 3PTMA 5BNKA 1EWDA 3B0UX 1DEDA 2RDTA 4Q32A 2VRJA 3G0SA 2VGIA 5I79A 4RE0A 2D0HA 2DZSA 3SCWA 2FIQA 1K77A 4P2VA 3MCMA 1ZNNA 4LFYA 3DCPA 4JFTA 1UD2A 3VOFA 5IBXC 3WSUA 2YDAA 3AUOA 1V8EA 2NW0A 3E96A 5DN1A 3I10A 2YDQA 4HA1A 4GNVA 4IPNB 4AEFA 1RBAA 1ZLPA 1DJNA 1GVEA 4R7OA 1WQ5A 1DXIA 5CZSA 3WJZA 2EXOA 4QG9A 2ANUA 3CJPA 3UY7A 2G3IA 2GJRA 4ZOAA 3MVIA 4KS0A 3UPMA 1LCOA 1TPH1 1MSSA 1T7LA 3BCDA 4S3FA 3W76A 4HZ8A 5C70A 3A3WA 3UJFA 3QV7A 2R14A 3G24A 1REQA 1NFBA 1H11A 4BJHA 4IGNA 3B0YA 1YADA 3TLLA 4D6IA 4DZHA 1V3MA 2CLFA 4JQ4A 1GNXA 3AICA 3L4YA 2PE4A 3QTPA 2PC4A 3W6LA 1FHVA 2PLMA 1B57A 5BMWA 1Z3NA 1W5OA 3WMBA 4R27A 3KVLA 4HNCA 5IDIA 2BY0A 1OFBA 2NQ9A 9CGTA 3OYZA 4LXFA 3MS8A 4P8WA 3QVQA 4PUUA 4HB7A 1ZBKA 1XBVA 4H41A 4KFPA 3T09A 2QVNA 4KWWA 3OB8A 2BVTA 1GEQA 2GQ3A 4D6EA 1EH9A 2PTWA 3HGOA 1OADA 3UETA 2J9XA 1SFSA 3IGXA 1FWDC 4UQ9A 5FJOA 4PULA 5I06A 4GFSA 3DH7A 4Q4OA 2VZTA 3ARTA 4XBKA 1TMQA 3U2CA 1FHLA 4I7VA 4O1BA 4AD1A 2PWFA 7ENLA 4H6QA 4NRRA 2IPWA 2Q09A 3K46A 1V0MA 4KIRA 2O9TA 4LEQA 1B31A 3VIHA 3O06A 3QPYA 2VFIA 1E6PA 3W88A 2X1IA 4HBKA 1Z7AA 3GE7A 3M5VA 3EB3A 1GOWA 4UFMA 4IPJA 2VFGA 3SCVA 5D9OA 4HNOA 3VNIA 4A3UA 3KCLA 2PP1A 4YN5A 1IEXA 4KCVA 4H9VA 4DJFD 2YFNA 4AZ5A 3FA3A 4HN8A 3TN3A 5MHBA 5A6BD 4HMNA 1AJZA 3AOFA 2YA1A 2FZ8A 2PFHA 3QPEA 5HJLA 4GUHA 1J18A 3GDMA 3T81A 5F2GA 1M04A 4PH6A 2FZDA 1PPIA 3WO8A 4HMDA 3DKJA 4WGXA 4GXPA 2ZDSA 1GOKA 3B0VC 3V36A 1VF8A 3ANYA 4FX7A 3MMWA 1TWWA 4PL1A 1XYFA 1NIUA 3TJXA 4EPDC 4UTHA 4MKVA 1XICA 1BD0A 1US3A 5AC8A 1VH7A 3DOPA 1LM1A 3KL3A 1GYLA 4HK6A 3MV11 3EB4A 4FNPA 5AECA 3R12A 3CH0A 2WLYA 1FWJC 2FLIA 3BGJA 3EA3A 4XD5A 2PDJA 2VXNA 3LZ5A 1A5AA 1X1NA 1X97A 4UQEA 1GTHA 3PZIA 4HTYA 3RO6A 2GOKA 3B9NA 3G8EA 5F4XA 2TRSA 1Q4WA 2YR1A 3PUEA 1GG1A 4ZQNA 1B54A 3LERA 3IIZA 2PDPA 2BY1A 5HA7A 2GDVA 4LCRA 1LWHA 5I23A 2JBMA 4RKAA 5CPMA 2HXTA 2ZE3A 4BQ5A 2OODA 1LDCA 4E8DA 1J0KA 2Q8XA 5DO8A 3GDRA 1SW3A 5XIAA 1K8YA 1X39A 2VT0A 3G6LA 1J0YA 3T08A 1F2JA 3G1HA 1BF6A 1KQYA 4UMBA 4R88A 3V35A 2PCEA 4NXSA 5BWFA 1XYAA 3BAIA 1ISYA 2TYSA 2QCNA 5FAGA 1B5TA 4H4IA 1TR9A 3CK5A 3AIWA 1W3KA 5DCEA 4KEUA 4BKNA 4E2OA 1JYWA 3S2MA 3T9PA 5PTDA 3TZFA 1R5YA 4YXGA 1XIIA 1EZ2A 4AG0A 3H2MA 5FKYA 3BW2A 2ISWA 3UWYA 1E6QM 1ME7A 3W4RA 2Z27A 5HR6A 1A4MA 2QHAA 4FOKA 3AZRA 1ZY9A 2NVCA 3VKCA 4JTUA 3PS7A 4PUEA 1GWJA 1LBFA 3REQB 1FKXA 1E0XA 1ZENA 1YX1A 4Q22A 2HCVA 3BC9A 2VX5A 3BSHA 4PUWA 5AC4A 4HPGA 1UCWA 4AHQA 3MSYA 4YTQA 1OJXA 1VGAA 3WQEA 4QLLA 5GQBA 1Q7ZA 4MYAA 4LUSB 4F2BA 3SADA 1JDAA 5LNRA 3UXLA 1KRAC 3XINA 2VR4A 5E5CA 4BY3A 3GDLA 5G2WA 2FJKA 3KVKA 1C8QA 2J7FA 4HU3A 1W54A 1DIOA 1QI5A 5CG0A 3EDDA 3CHFA 2RFGA 2RJHA 4F9JA 3ARWA 4ACZA 1ZL1A 4EAYA 1XQKA 1D2KA 3UNDA 3NYDA 3A9IA 4YTUA 1TIMA 2XDFA 1JFHA 1T99A 3FXGA 3RG6A 3TLQA 1W1B1 1ZPTA 4IIDA 4BF5A 5K9DA 4PZVA 1AMYA 3NDOA 4AYSA 4CLMA 1UR8A 4FF5A 3WLTA 1HT6A 1XYCA 1VCFA 5CC5A 3E3HA 4N02A 4W87A 5TD4A 4GVIA 3NEVA 4EF9A 3D3AA 1WYIA 4RCXA 2BNJA 4R85A 2FPTA 3W22A 4ZCWA 4HIBA 4J3SA 5DMYA 3TR9A 1XLKA 3MUXA 2VEFA 5EFDA 1IXNA 1TVNA 4MOZA 2DQXA 1Q6QA 4XZHA 4AWTA 3NDZA 1DWIM 2QF7A 2VZOA 3AS2A 2G3FA 2WC7A 1M41A 4DWSC 4E3VA 1HGWA 3AXXA 1DOSA 3VC6A 2WZTA 3HM7A 5DY2A 1KO0A 1O1ZA 1SSDA 5ABHA 3WNLA 1YLVA 1J96A 5TQLA 2DUZA 5I5RA 1S5WA 3P0WA 3W27A 2GUYA 4IP4A 3ITTA 3FEMA 4GX8A 2HZGA 1H61A 3VKBA 1AH3A 2AQOA 4GVFA 2XSAA 1TTPA 5CQ1A 1E43A 4WKFA 3N2TA 4ZQCA 1NOFA 5CZJA 1W17A 1RP8A 5EMYA 3MI3A 1DTUA 4HNUA 1WO2A 2V5LA 1BRLB 4ZSTA 1XBXA 1BYCA 2Z1WA 4JKKA 5A8PA 1IF2A 1NWTA 1LBMA 3WBWA 3UU0A 3MCNA 4P7QA 1Q8JA 4HHMA 4HJFA 1E3XA 1K9FA 2WZEA 3DX5A 4UB9A 2VKZG 4GK8A 1EDQA 4EF8A 1IWAA 4N4PA 1JUKA 2P76A 3A3HA 1EJ7L 7A3HA 1JXJA 1F07A 4W8BA 2X42A 3UR5A 5HK4A 3DFQA 3R94A 4UC5A 4UQBA 4XQ6A 2H9AA 2Y1HA 3MKCA 4Z0JA 4RL3A 4KF1A 1YNPA 4UFKA 3CIWA 3WELA 3U4AA 2WMIA 3WMCA 1GOQA 1D3CA 2PU0A 3DGBA 2X1TA 3SBFA 3QSRA 5BYWA 3QKEA 3QQWA 3TYZA 2A0NA 3CASA 1XFBA 3M7WA 2ZTJA 3UF9A 4AZIA 3CC1A 5CJMA 5EBUA 1KB3A 3LPPA 5D38A 5G2HA 4Q4PA 3NPWA 2DP3A 6XIAA 2VEKA 1IT0A 1M9HA 1JG9A 4WJEA 1VFTA 4J7RA 1XIBA 3M0XA 2ISFA 2ASHA 2Y62A 1S2AA 2Y2WA 1OCQA 1V3HA 3PAOA 2V38A 4W86A 3WQVA 3MZNA 4UQCA 2XH4A 2ZKMX 1FWHC 4NI3A 5A6AA 1A53A 5CGTA 3FVMA 1XINA 4DAFA 5BRBA 4AY7A 1O95A 2ADAA 3O15A 2XH2A 3QR0A 4QG6A 3M46A 1OWQA 4UTFA 3NNTA 4I8YA 4C65A 4KGJA 4YWSA 1DTNA 4Y9AA 1B4EA 3EOOA 1F4HA 4Z2GA 5DX7A 4AY8A 4FO4A 3W7CA 5G1MA 4CCEA 1ZU8A 2ZVRA 3UA3A 2X0HA 4U10A 2QCDB 1U5JA 3EX4A 1T41A 4DZAA 3TW7A 1EHAA 4P61A 5CC7A 3WF1A 1RQEA 5HPCA 1I1WA 5DMNA 3GX9A 2FTWA 4BR1A 4AX6A 5IBXA 5A2CA 4CCZA 1XRVA 2GDUA 4D6HA 1MYRA 1PZ2A 3D47A 1ODUA 1TO3A 3WLNA 4HYVA 3W82A 2CZFA 3RLUA 4V28A 2V68A 4IP5A 4INFA 1JPIA 5ENLA 5D2XA 1PE1A 4YTRA 1PZ1A 4O17A 4HNLA 2CHNA 3H2FA 5CC3A 2VENA 1MFUA 4NJIA 1WDWA 2Q8ZA 1LT7A 2X0YA 4RJEA 4CKQA 1T96A 3KHDA 1VEMA 3VDCA 3CZKA 2IW0A 3ARVA 4NHVA 5CPLA 5A95A 2A3LA 4OBSA 1UKOA 5I6SA 3KBJA 4WOQA 4H2HA 1J11A 4US5D 3PM6A 3KX6A 3V0TA 3EKZA 3WX7A 4IZGA 4ERAA 4C6PA 1PTAA 1CEOA 5CPNA 1Q4NX 3IIOA 1JZ5A 1IXQA 2I9EA 1R2SA 5BOEA 1SR0A 1YE4A 1OYCA 4KFNA 3W07A 1U2YA 1VKFA 3DHFA 3WNKA 4BI6A 4FR1A 1YMYA 3DFSA 1PYMA 3LOTA 4GI6A 4PMQA 1VC4A 2W4XA 1AVAA 2QKFA 4XB3A 5D9NA 2Y4SA 3P14A 1ISVA 2HPMA 3WY1A 4LEFA 4CNTA 4IIHA 4DJFC 1MW1A 3ARXA 1EEXA 5GJNA 3KRZA 2OCZA 2D23A 3PWIA 4Q8MA 5CBBA 3MP3A 5EA9A 3SIMA 3S5OA 1V0NA 1AD4A 3N73A 2FTYA 2X8RA 3TU9A 5LSMA 3WNMA 1XLAA 5AYXA 4GABA 2CESA 3VIPA 5C71A 1HX0A 4RE2A 1GTEA 2DQWA 4JL2A 1OIMA 1E15A 1GKQA 4HP5A 3LRKA 2XUCA 3BICA 3UJSA 4AFYA 4YIWA 4PCFA 3W75A 2GQAA 2PTDA 2V2CA 1GHSA 1H7PA 1TX2A 1ITUA 4LB3A 3ABOA 2Z2BA 1NQKA 2ZUTA 2V9DA 4B3ZA 6REQB 4JNYA 3S8HA 2VELA 3UG4A 2XN2A 5LNUA 2OB3A 3UNTA 4XD4A 1ADOA 2RGLA 3AIUA 3C2FA 2IMRA 1FA2A 1K8CA 3RITA 1Q8AA 3CUZA 2ZCGA 5KMYA 5ABTA 2C6QA 1AZ1A 4JX4A 1IQ8A 2NV2A 1KWGA 5D2TA 1CI1A 2RUSA 3DXIA 4HZ7A 4K37A 2PP0A 3WMLA 4NNAA 4J3TA 3CNYA 1CXHA 1KCXA 3OZMA 4ATWA 1HJVA 1WDDA 4LUTA 1OT2A 2PP3A 2PURA 5I77A 4PCNA 4KRUA 4P7NA 1GVRA 1H7RA 4XTIA 4JKLA 1S5VA 4GJIA 4YU1A 5TNVA 4QEHA 1W31A 1UB3A 3GTFA 3N2BA 4JD4A 3DU0A 2Y7EA 3GD6A 1KBLA 4NAFA 4IPIA 5GJPA 4HYWA 2HMCA 2EKGA 1GYMA 4DRSA 4CD5A 5AHEA 3WUGA 5DRCA 5CJNA 3KXQA 3GNRA 3L2LA 4IIBA 4GCAA 3CUXA 3IK2A 3D46A 1KM0A 5G2IA 4QCEA 3IVSA 3P80A 1IGWA 3EXTA 2YYUA 2KZHA 1H7XA 2UY3A 3VKAA 3LB0A 1A4LA 3HB9A 7TIMA 5C7VA 2I5QA 2QUVA 1TJ0A 1XDMA 4NZ3A 3RILA 1E5JA 1S2CA 5M03A 3O07A 4HSNA 2V82A 4XKYB 3PFRA 3EB2A 5LHEA 2WZIA 1UWTA 4C5ZA 1P6WA 4EPEC 2I14A 1LLZA 3VDAA 3FJ4A 3JVAA 2XVPA 4BCEA 4LW7A 2EPLX 2WVVA 4LBSA 3V4BA 4WY0B 3PBGA 4QAIA 2QEZA 2ZTKA 1GCYA 1A5CA 1NDZA 1IGSA 1XIDA 4IOTA 4G7EA 1L2UA 4YL2A 2VGGA 4RDVA 3E6EA 3S1UA 1SMDA 3E12A 3S1WA 3DFTA 3VILA 3CZGA 3QLLA 2GK1A 3UCDA 3P74A 5FEPA 2G50A 1AJ2A 4K68A 1I8JA 1GJUA 4PUMA 1UZ1A 3CT2A 4UTMA 2GFTA 4IGHA 1CXKA 2W9MA 3VE9A 1W1PA 1JI1A 2OXNA 3A9BA 1ZS2A 3N3TA 1SFLA 2GVEA 1K3UA 3AIVA 2Z4GA 3D0CA 4FI4A 4U31A 3S6OA 3RR1A 3NO1A 3QR1A 2W6RA 5DT5A 1XYMA 1XC6A 2H3DA 1BXCA 2NWSA 3QY8A 5DY3A 2C14A 2DSWA 5CSYA 3LLXA 4Q8WA 1JQVA 1XLIA 2F2KA 4KKXA 3I68A 1TWIA 1TPUA 1A5SA 1FTXA 3IUDA 2X2YA 2OGJA 5TAOA 1R9YA 3DHUA 2YBTA 4NI8A 2GLKA 3RNDA 4QE4A 3THUA 3WZ0E 1OC7A 1YDNA 3ALFA 4PTWA 4BWLA 3S4TA 3P8IA 1JPDX 2V5KA 4JQ2A 1KGUA 4GG9A 2YL9A 2ICSA 4G1KA 4G1NA 3TAKA 5B7YA 1OB0A 3UG8A 1H0IA 4H8NA 3E0VA 4GZEA 1TPDA 1Q66A 4C1NB 1KFEA 4B5SA 5IM51 3WLQA 3GU1A 4X60A 3VKDA 1NWRA 4B5XA 1MW2A 2MNRA 1E0WA 3GVRA 3GB6A 4MB4A 3FJ6A 4R33A 2OEMA 5LNWA 2Z6IA 5T91A 4PTVA 1TA3B 3VE7A 2Q8LA 1UH3A 4JX5A 1B3OA 5AZ1A 3E0WA 4JPGA 3WLIA 5G5IA 5EGRA 2QW5A 3GW3A 1X38A 3NZQA 4WRHA 4XWUA 4BEUA 1W37A 4ZZ9A 8XIAA 4I5XA 3ZR6A 4PBEA 1OK4A 2J13A 2ZOXA 1UZDA 3R13A 3NOEA 4ACZB 1K8ZA 4HU8A 1TPC1 3TTYA 1O5QA 2A21A 3H2AA 1Y5WA 5A8MA 3S47A 3R8HA 2H3BA 4B3KA 2WSYA 4DPQA 3T2PA 3AMCA 4IF2A 3HJZA 3RDKA 4A3YA 3U0HA 2XYLA 1F6YA 4TMBA 3MUCA 3ABSA 4RPQA 1JGIA 5I2UA 3TXZA 3M6DA 3GTHA 3H8AA 2CZDA 3E2VA 1QI4A 1XIMA 4AD2A 4GNKB 3OGSA 3CH9A 3LLFA 2F2HA 1P6BA 3UZZA 4UZUA 4PC8A 3W29A 3VK5A 3TN6A 4F0RA 5LNSA 2PC8A 2OMAA 3WLLA 2YCLB 1TTIA 3THQA 4FXFA 4AZCA 2PLKA 2VCCA 1OFDA 3REQA 2VQUA 5BW6A 3P8JA 2J8GA 1KFBA 4J35A 1OG0A 4JBRA 2IKHA 4KESA 4AZGA 4JTGA 4PCSA 1NFPA 3LCXA 3L4VA 3M0MA 1KTBA 4QNWA 2NZLA 3H7VA 4PGLA 2P1FA 3T78A 2NXIA 1EP1A 4GUIA 1EIBA 1PTGA 1XM3A 1A5MC 3NJ3A 4Q8VA 5E6YA 2PF0A 4UUIA 1RVKA 2G0WA 1EJVC 5HJXA 3CS2A 2JGYA 3FA4A 3OBKA 1P4CA 4JN7A 1HN1A 1KGXA 2X7VA 5BRQA 1ZHAA 3B0PA 4WDUA 4OKDA 2B7OA 1FWCC 3M0JA 2W27A 2D20A 1MUCA 4LRTA 3DKLA 2VFHA 4W7WA 4MY1A 1W3IA 2E7FA 1CGVA 3CB3A 1DJYA 5EMUA 1DQXA 4MDPA 1QRQA 3M0KA 1LOQA 4OBTA 2G97A 3W1XA 1RY0A 1REQB 3C2EA 3OZOA 4C6BA 1I2OA 1XLHA 4JTEA 1VYPX 2F38A 4TTUA 3P61A 1NOUA 1JZ3A 2HK0A 5CH9A 1VBHA 1FKWA 4NT0A 4WF7A 3VOJA 1JPKA 3NPVA 4OOUA 1TPVA 2GVLA 1YYAA 2PRHA 3CUHA 4XZLX 1S1PA 1Q3NA <