1VFLA

Adenosine deaminase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Structural Basis of Compound Recognition by Adenosine Deaminase
pubmed doi rcsb
total genus 148
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1vflA00
2UZ9A 3LSBA 2OGJA 3IGHX 3GRIA 2FFIA 3DCPA 3IARA 1V77A 4HA0A 4F0RA 4RDZA 4C6QA 3FDKA 1EJSC 3UF9A 4E3TA 4LFYA 1IE7C 1S3TC 3MVTA 2G3FA 4XD5A 4J35A 2R1LA 1YRRA 1YIXA 1ADDA 1A4MA 4H01A 4IGMA 4I6VA 4ICMA 1J6OA 1KCXA 3EWDA 2WJEA 1A4LA 4GYFA 3QY8A 4H9MA 3MVIA 1ONWA 2I9UA 3MPGA 2BGNE 3FEQA 3IACA 1EJUC 2Z4GA 1JGMA 2PGFA 4Z42C 1KRMA 2O4MA 2ZC1A 2FTYA 3RHGA 2BB0A 3GIPA 1FWJC 4EPDC 4J2MA 4QTGA 4NI8A 1ZZMA 4C6PA 3OU8A 1EF2A 4HJWA 4QRNA 4KETA 3DUGA 4DZHA 2GWNA 3S4TA 3SFWA 4IFKA 2GZXA 5HMFA 4CQCA 1FWEC 2YXOA 2E25A 3GU9A 1YBQA 1J79A 2VM8A 4XAFA 3TN4A 1RA5A 4R88A 2PAJA 4WHBA 3MDUA 1FWFC 3UBPC 4XAGA 4EPKA 3CJPA 2AMXA 1FWDC 2R1MA 4R85A 3A4JA 3HTWA 2Z7GA 1NDYA 3PANA 2DVXA 4QROA 2CZVA 4AQLA 4C65A 3GU2A 2A3LA 1O5RA 1PTAA 2PLMA 2QS8A 4P5UA 4B92A 2Z2AA 1RA0A 5HMDA 4CEUC 3PNUA 1I0DA 3WZ0E 1PSCA 4LEFA 3S2NA 1EJXC 4INFA 1K1DA 1P6CA 4LAKA 1P1MA 2QVNA 3LGDA 1POJA 1O12A 2I5GA 4KERA 3GTIA 1ITUA 1FKWA 4KQNA 3AU6A 2R1NA 4LAOA 1M65A 1W1IE 2O4QA 3E0FA 4LCRA 1ONXA 1HZYA 2HPMA 4GBDA 3FDGA 3V7PA 2Z00A 1K6WA 3IPWA 5G4HC 4DO7A 4NG3A 3E74A 2RAGA 4EP8C 4XD3A 4C60A 2Z29A 5FSEC 1FWIC 4KEUA 4LCQA 4RDYA 4J5NA 2R1PA 4UBPC 2HBXA 2OOFA 1EZ2A 1WXYA 4IG2B 3UPMA 2OB3A 4B90A 4R7WA 2FVMA 4ERGA 3T1GA 2Z26A 2VUNA 3S2LA 3TN3A 2OODA 1A5LC 4OFCA 3CAKA 4LALA 3OODA 4KF1A 1VFLA 2GOKA 4CEXC 4C6LA 2DVTA 4BJHA 2R1KA 4F0LA 4IGNA 3E38A 3TNBA 3AU2A 3E3HA 1A5OC 3A3XA 4PCNA 3S2MA 1EJVC 1NDWA 2Z2BA 4H9VA 3MDWA 2IMRA 4HK7A 4C6OA 4TQTA 4C6CA 2PUZA 4DYKA 3OJGA 2Z27A 4PBEA 4GY1A 3RCMA 2Y1HA 2HPIA 4IQJA 4H00A 3E2VA 3LNPA 2HBVA 3EGJA 2P53A 4KESA 1I0BA 1PO9A 3OQEA 2ICSA 3ICJA 3URQA 4C6DA 3URNA 1J5SA 1KRBC 4PCPA 1XWYA 4H9ZA 3RYSA 2XIOA 4DLFA 3NEHA 4ZSTA 3SO7A 3EWCA 4JOMA 4QS5A 4RE0A 1YMYA 4GX9A 3B40A 4C6BA 5FSDC 4ERAA 1YNYA 3URBA 2D2GA 1UIPA 3ITCA 4EPBC 3IJ6A 4G7EB 4GX8A 3BE7A 4C6IA 4L6DA 4MUPA 4EPEC 3GTFA 1RAKA 3S2JA 4XD6A 1NDZA 3A3WA 1EJWC 3ORWA 1V79A 2Z24A 4C6JA 3MTWA 3LY0A 5HMEA 1P6BA 1RJQA 3K5XA 1FWCC 4I6KA 1RJRA 2W9MA 3AUOA 1NFGA 4C6KA 4DLMA 1A5NC 3IV8A 2D2HA 4BKNA 4GC3A 3WMLA 3OVGA 4IFOA 1V7AA 3B0XA 3T8LA 2GWGA 2E1WA 4IG2A 3NQBA 2VHLA 4AC7C 4CQDA 4L9XA 4V1YA 4XAYA 4DNMA 3URAA 4DIAA 3LA4A 1GKQA 4LAMA 1R9XA 2EG7A 5LXXA 4DZIA 4DI9A 3GG7A 1ITQA 3PAOA 2ANUA 4ERIA 3TN6A 1POKA 4NP7A 5CH9A 1BF6A 4C6NA 3F2CA 3LSCA 4HK5A 2P50A 3NURA 4G2DA 3IRSA 4KIRA 3O0FA 3K4WA 4B3ZA 1PB0A 1UBPC 3D6NA 2Z25A 1RJPA 4C6FA 2PGRA 3OOQA 4CQBA 1DPMA 1FKXA 1EJRC 3LGGA 3MSRA 1GKRA 4PBFA 3KM8A 2F6KA 1FWAC 4QS6A 3T81A 4C5ZA 1UIOA 4YIWA 4LANA 1EYWA 4IH3A 1E9YB 4C6EA 2Q09A 1KRAC 2ADAA 3JZEA 3TN5A 3DC8A 4ZSUA 1EJTC 5AKQA 4XD4A 3MKVA 2YB4A 1R9ZA 3B0YA 1UMLA 4H9UA 3G77A 2EG8A 2WM1A 3F4DA 2WJDA 3UR2A 4LH8A 2FVKA 2VC5A 2Z28A 4M51A 3HM7A 3UR5A 2EG6A 3O7UA 3RN6A 1RK5A 2DVUA 3QGAC 4CNSA 2VC7A 4QSFA 4CNTA 4WGXA 4GXWA 4G7EA 2HNHA 4H9YA 4H9XA 4DI8A 4RDWA 2AQOA 5A6TC 3QY6A 2GSEA 2OQLA 4F0SA 3QY7A 1V51A 3R0DA 4C6MA 3GTXA 4LCSA 2FTWA 4GK8A 3C86A 4IFKB 3F2DA 4GOAA 1RK6A 1WXZA 3GU1A 1YBQB 1K70A 3LS9A 2WJFA 2D2JA 4C5YA 1XGEA 1A5KC 3E0LA 4RDVA 1NDVA 3WYZA 4RZBA 2YB1A 1V4YA 5E5CA 2UBPC 4GY0A 4BY3A 1M68A 3F2BA 2YZ5A 4WVXA 3PBMA 1FWBC 4HK6A 3K2GA 3GTHA 3ID7A 4IF2A 4GZ7A 3MJMA 4UB9A 1XRFA 2KAUC 4GY7A 4KEZA 4IFRA 2Q01A 3LU2A 1E9ZB 1FWGC 1M7JA 4D8LA 3PNZA 2VR2A 1FWHC 2HQAA 3F4CA 3ISIX 1QXLA 4PE8A 4B91A 2AQVA 1A5MC 4V1XA 1KRCC 3GIQA 3GUWA 4KEVA 1R9YA 1GKPA 4H9TA 1J6PA 3QGKC 2QPXA 3HPAA 3N2CA 4XAZA 1XRTA 1QW7A 2QT3A 3CS2A 4CNUA
chains in the Genus database with same CATH superfamily
2PDMA 1R8LA 4PRWA 3GE7A 1MXDA 4LUTB 2GFTA 3M0MA 5J5DA 1PDYA 4IPJA 3ZVHB 1AD4A 3K13A 1LG1A 4KIEA 2W62A 4H19A 4E3TA 1WQ5A 4IJRA 3G1FA 5REQB 5CCZA 1E1CA 2JIEA 5AHFA 1Q6EA 3N3MA 4J35A 4O14A 2R1LA 1ZBKA 5LIWX 3IGUA 1JG9A 2VEPA 4H01A 3U9IA 3L7RA 3NPWA 2PWUA 3DYOA 2PWVA 3TTSA 4F2BA 4O18A 3UWEA 1VPYA 2I17A 3M5VA 1OX6A 4N9BA 1S2VA 5GNXA 3OLGA 4FOKA 3JUGA 2V5CA 1I2RA 1S39A 1OT2A 3DUGA 3VA8A 4N4PA 1ZENA 3SFWA 1EGMA 4IFKA 2V2HA 4IOTA 1JCJA 5JIPA 3KOWA 4QE1A 3SM0A 1OM0A 4A8IA 3EPNA 3MP5A 4DJFC 2DVXA 3VVGA 3CL6A 1BYCA 3NDYA 3N13A 1JDEA 4Q6XA 2A3LA 5LNUA 2V81A 3T2QA 3WLSA 1CGWA 3ZR5A 1QMLA 2Z2AA 1CB2A 4GJJA 3MMWA 2C19A 3VDCA 1TA3B 3ARQA 3B03A 4NIRA 5AHNA 4RE4A 5IBXA 1EF3A 1ZAHA 2CCRA 3LB0A 3UETA 2ESCA 1I6NA 3PP7A 4ES4A 2A3AA 3E0FA 2DT3A 1AQMA 1Q6QA 5C9WA 2W92A 5HJXA 1FHDA 2CIPA 2TMDA 2A7RA 3AIVA 4O1CA 4BI6A 1RVKA 3W70A 3IJ7A 4I5RA 3IPWA 1JXKA 3O15A 4ZOEA 2WKJA 4LUTA 1XYFA 4IJCA 2W63A 2RAGA 4L6HA 3ZVHA 4LBUA 3WF0A 4IPLA 3RO6A 1XQLA 2YYUA 4PBGA 5REQA 3TN3A 2V5KA 1ME9A 2Z1WA 1JFHA 5I3FA 3GFXA 1H51A 2VOMA 3FXGA 2YDRA 4K8GA 2XIIA 4HVXA 3WNPA 1CGXA 5BZAA 4GVFA 3O6CA 3EXRA 1NDWA 1S1RA 2CLFA 4PSPA 1DEDA 1K7FA 4X3ZA 5HWNA 1UP3A 3S1XA 2DT2A 2Q3OA 4QG6A 5JH2A 1EYEA 3JVAA 4B3KA 1X98A 4Q8PA 4UNIA 1H3GA 1GZ1A 2NQHA 4FAMA 1XF0A 3BCJA 3L4XA 1XYZA 1VYRA 4DLFA 4ZSTA 2D2OA 1JZ6A 1F73A 1VIWA 3ARRA 1X97A 8TIMA 3NL5A 1VFFA 2JBMA 1YMYA 3W7EA 4UTHA 1IV8A 3BAKA 2J7HA 4LWWA 1NY1A 5KETA 4HZ6A 4C6IA 4MUPA 3TTOA 3S2JA 1TA3A 2G96A 1G4SA 1R3YA 3A3WA 1EP1A 5CZKA 3ORWA 7ODCA 4C6JA 3W37A 1Z9AA 1FWWA 1SO4A 3G1XA 1TR1A 3UEQA 5IRPA 3XISA 2G4FA 2WVUA 1FVPA 2DIKA 3T8QA 4GC3A 4JICA 1UKPA 2NX3A 3W7NA 1DWHM 1FCVA 2PTZA 4PFHA 4AC7C 3A3HA 4V1YA 4LAMA 4GC4A 4IL2A 3SQSA 4RE2A 1GHRA 4UTJA 1RP8A 3NZGA 1W2PA 3QPYA 1MXSA 3VOGA 4TOQA 1E15A 4UMAA 4JKLA 3OBAA 4IMAA 3ARXA 1EDGA 1Y5WA 2V82A 3BAXA 2I7GA 5FJJA 3OPSA 3BOFA 1V03A 1U30A 3LHZA 2ZX9A 4HN4A 1EYWA 2CHNA 3MCNA 2J8GA 1Y5VA 3TMQA 4D6CA 1TV8A 2PDIA 1K9TA 4XBJA 1BG9A 3B0VC 2NWRA 3PN8A 4GI8A 4XZBA 4XKMA 3VIHA 3VGBA 1I1WA 2YB4A 3VGDA 2PDHA 1CNVA 4UCFA 5FD0A 4A3YA 4AZHA 1XLMA 4CQAA 2EG8A 5EA9A 3VGGA 2J7EA 5AC8A 1FHLA 4I5UA 2FVKA 2VC5A 2DZTA 1NWSA 3O8AA 2NX1A 1E5NA 2BXZA 3ZQ9A 3I10A 5H91A 3BSMA 1NWTA 1RY0A 4UQBA 4B15A 1BSIA 5AY7A 5A8QA 4UOZA 4H1ZA 3SGZA 1QWGA 1XYBA 4DJDA 3WLOA 3FEMA 2VT0A 3R0DA 1XSKA 2XYLA 4Q8MA 1XIGA 3I6RA 1AH4A 1W9PA 4H8HA 1YBQB 2QHAA 4JYFA 3CM4A 1TVNA 3FKKA 3VMOA 4ATWA 3ATZA 4D72A 4ICNA 4ONVA 1ZCOA 1V6YA 1MUMA 3G8RA 4KRUA 3BURA 2J27A 3IV3A 1V8EA 4N4QA 5KZ6A 5A6BA 5JQ9A 5AHMA 3RDKA 2FPYA 3ANUA 2QUMA 3UY7A 3PK7A 3W1QA 1V3LA 8XIAA 4H2CA 4Q22A 1E70M 3IANA 5D2WA 3UXAA 4MZ1A 1D8CA 3BVJA 2DSWA 2VI0A 3KBSA 4MWAB 1BGAA 3G0XA 3POHA 1LOQA 1R5YA 4KEMA 1PV8A 2WCAA 3V35A 1P48A 4U28A 4L4OA 3IARA 4M6UA 1OFOA 1JL8A 1MW3A 1W1TA 3TK7A 3ITTA 2XH2A 4F3HA 3PUEA 2WNWA 3KRUA 1UUQA 3E49A 3WD1A 4YPJA 3MB9A 5F2LA 4K8EA 2X30A 1YXCA 2WJZA 4ICMA 3LBOA 3WF4A 2JEPA 4X9YA 3AICA 1V02A 5DY2A 4HOWA 2PA6A 3ZWSA 3AXKA 1JGMA 1VPXA 3HB9A 3H53A 3KDOA 3R6IA 1YDNA 3CIVA 5AYYA 2J77A 3FGCB 3QPZA 3SUVA 4CU7A 3BLEA 9XIMA 5HMFA 1YBQA 3VIIA 1FBAA 1OZMA 1FWFC 3M7WA 5LGXA 1J0HA 2QJGA 3A9BA 1FWDC 4Q3MA 4R85A 2PDYA 1F3EA 2QCDB 3GSMA 4G1NA 4GH1A 2D0GA 2V8ZA 4GMEA 3G3DA 3B04A 1J8VA 3KVJA 1YLVA 2ZUUA 2G41A 3OZYA 3BJSA 3HA1A 4RW5A 5HK4A 1CTNA 1RQBA 2KZHA 4Z1AA 4KFPA 4PUMA 1A49A 1FKWA 1R2TA 1PUDA 4MWAA 4Q4MA 3WQ4A 1E55A 3AMDA 3ITGA 1NP2A 1QK2A 1O5KA 3V7PA 4JGDA 4UC5A 1AUSL 1GQLA 3AHZA 3WK0A 3KBWA 3E74A 4A35A 1B4KA 2Z29A 1DIKA 2OB3A 1NP0A 3ONBA 3GG0A 2QEZA 1UHVA 3EEGA 1JZ2A 3QQWA 1DV7A 2PZ0A 2B7PA 4KF1A 2GOKA 4GQBA 4BJHA 4PUEA 3OZMA 1VEOA 4NNCA 4J3WA 1OCBA 5CPSA 1VKFA 4GVGA 5E1QA 4YWIA 3GNDA 4BQ3A 3KRSA 1MUWA 3LRKA 3FGCA 3QQ0A 1BLIA 4EACA 1ODUA 3E2VA 5CEWA 3O07A 2XH0A 5A6MA 1Q3NA 2JE8A 2VZOA 2VGBA 2QCGA 1H63A 4HMNA 3ICJA 1L6WA 1J11A 3SUSA 3PG9A 1MWOA 4FNRA 2NVDA 1M03A 4NJKA 5HR7A 2I14A 3IJQA 2QCDA 4QS5A 5I07A 3P0WA 1H60A 1ZBWA 4RE0A 1W56A 3QM3A 2FPTA 4GKTA 3LM3A 3LCGA 4GO9A 4YHEA 3CHDA 3S9ZA 2G37A 3TDFA 5FJOA 3CASA 1BKHA 1V79A 2XSAA 4WSKA 2Y5EA 1ESWA 1ZJBA 1AQHA 3WH6A 3L21A 1JDFA 2BODX 1B4EA 2ZVIA 1A50A 3QLLA 5M3WA 3NQMA 1OVDA 1W3JA 1A5NC 3IV8A 4OZOA 3F03K 1GEQA 2CLIA 3L0NA 1JCNA 3T8LA 2A0NA 3S5NA 4Q4QA 2FQIA 4KBXA 5JIWA 3TXZA 3VUPA 5AYZA 1JDAA 1GOOA 5CC6A 5FEZA 3XIMA 1TPDA 4MSSA 4L5ZA 2VX4A 1E71M 4LVGA 4LSBA 5C6MA 1QVBA 4JTJA 1C8VA 2PRLA 3K4WA 3CK5A 1FRBA 4HSOA 2YL8A 3PWAA 3OOQA 4IIBA 3THDA 2ISFA 1EJRC 3CUZA 3J7HA 4LC8A 1FWAC 3ZWTA 3W73A 5CKSA 4L4MA 1OFEA 3W7LA 2Q09A 4P8XA 1R3SA 1UKOA 1LLZA 4JQ1A 3N9KA 3SSJA 4E4UA 4GLEA 1R2SA 3R10A 3ZJ6A 1G4TA 3BMVA 3UVAA 4X0VA 4DVOA 2E8ZA 1Q5MA 2WJDA 3OP2A 3HM7A 4A3RA 3GH4A 4F9DA 1BRLB 1TV7A 3A21A 3UA4A 2CLLA 4O1BA 4OTKA 3IK4A 3L5LA 4WGXA 4DJFA 2J79A 1H4PA 4EOUA 2R91A 3RNDA 1KM6A 4L6OA 3UPWA 3KW3A 3WQPA 2Q02A 6XIMA 1RCQA 1Z42A 3JZUA 2ON3A 2ZVRA 3M46A 2NT1A 4MLJA 3NVDA 4J3SA 1P4CA 5EBAA 4NRSA 1SO5A 1ZGDA 3W53A 2D2JA 3I3BA 4C5YA 4ATDA 1BTCA 1OX5A 4FK9A 3WQ6A 3ZLHA 2Y85A 3NGFA 1EOKA 3QV8A 1OINA 4FNQA 1JRCA 2PODA 1KC7A 4RXGA 3H7UA 1XLAA 3MHGA 5DCBA 4I9MA 1NWUA 1HKMA 1KTCA 2Z1VA 2V5JA 3TMLA 4IFRA 4QLLA 4R33A 3MYPA 3PPCA 3R43A 3IIVA 3VIKA 1WPCA 3N25A 1CGYA 3EWBX 1OGSA 4Q8TA 3RX4A 1EB3A 1VYPX 2HS8A 1ZAJA 3UYCA 1PCKA 1M7PA 4XK2A 3GXPA 4ZQMA 1IEXA 2XSBA 3CTLA 1TX2A 4RZ4A 4LF1A 4UZSA 1A53A 1REQB 3MSYA 3QOKA 1HTIA 3WBAA 3PF3A 1E1EA 4I8YA 1XLDA 1H1NA 1PX3A 3AIRA 2VCAA 4X63A 3NO1A 4NJHA 4PODA 4ZXOA 1UG6A 3SY1A 1ADDA 4S3BA 1BRLA 4AY8A 4IP7A 1IWAA 4OWGA 1F3TA 4R53A 2FB3A 4AYGA 5D9OA 3P5ZA 4TU1A 3QC3A 3VABA 3UGRA 1UC5A 3W38A 4E8GA 3CV7A 2RDWA 1WOBA 1XD0A 1ZJAA 1EP2A 3M47A 3LCWA 4BI5A 3UXLA 1D3CA 4BQ5A 2WCGA 2J66A 1TV2A 2J6VA 3UFYA 1RA5A 3DBNA 3ERPA 3GIYA 1Y8BA 3QMRA 4EPKA 3U4AA 1K03A 3M5XA 3P2VA 2Z7GA 2ATMA 4QROA 3ARSA 2CZVA 4C65A 4HQVA 4NX5A 1XCXA 4Y90A 1RSCA 3QVQA 2W91A 3BLDA 4GJIA 3AAMA 1J2BA 1E6SM 1S5TA 2NUYA 4DM1A 1YADA 2YLLA 4M0XA 4P7NA 1UB3A 3AMLA 4IGSA 1P6CA 4H6EA 4LAKA 2I5GA 1UQYA 2MANA 3AU6A 1WKEA 5J04A 3WBEA 3KTXA 1QU4A 3WBXA 1QTWA 3CLWA 3AHVA 3MYOA 5EKYA 2H90A 4MUZA 4PUJA 1QPNA 3S9IA 2CKSA 3DEQA 1TTJA 4DO7A 3FA5A 1BG4A 4FOJA 1YPXA 2G50A 1PIIA 1REQA 4ERGA 2E67A 1A3WA 1YDVA 2OODA 1XFBA 3OYXA 1V0MA 1TYGA 1VFLA 4Q8WA 1DTNA 3GX9A 2R1KA 4FX8A 3O06A 3ZM8A 4M6PA 5IDIA 2QCEA 1A5OC 3O16A 3SN0A 1SW7A 2Q8XA 3W00A 4GUHA 2VX6A 4H83A 5K9XA 3RXZA 3W29A 3NIYA 2ZRVA 3UZYA 4H04A 4LF2A 4DYKA 4LNCA 1XBZA 3THAA 4IUGA 3AXIA 1I0BA 1Z32X 4YL2A 4MNMA 4R9OA 2ZDSA 3L68A 1KM4A 3I6EA 1G01A 4E38A 1X7FA 4JFTA 3BW3A 4M3PA 3OGVA 3S47A 4Y9MA 1W0MA 1XWYA 3RPDA 1BQGA 2VGIA 1EPXA 3B0UX 2ASHA 3DN5A 4OT7A 3NNTA 3ZLFA 4GX9A 1XYMA 3GTNA 1MNSA 4L65A 4RPQA 3NZ1A 2VWTA 5CSUA 3URBA 3WQ5A 4G7EB 2J9XA 2VZTA 1J9YA 4H8NA 3NG3A 3TJ4A 4DUXA 5H2ZA 4NKCA 4U3AA 1Q7ZA 1EJWC 1PTGA 4B4HA 2J4GA 3UP8A 4FO4A 3BL3A 3KDNA 2OO0A 1KFLA 3EDFA 2BVTA 3K5XA 4ROPA 4JPGA 4Y2WA 2DQWA 4AIOA 3TW7A 1EC7A 1FXPA 2G8ZA 4OJYA 1Z89A 4DAIA 1HL9A 1YDOA 3G1AA 3VNDA 1KTBA 4GI9A 4IFOA 1Q2SA 2C7FA 3UWVA 2ZRXA 1ZFJA 4HHPA 2GJRA 1XISA 4DZIA 4Q4SA 1ZU8A 2VTFA 2WPGA 4DJEC 4AF0B 1E3ZA 4FLQA 3TN6A 3U2ZA 2IKJA 5HXMA 4J3TA 3WDRA 4IISA 2E5DA 5E09A 3AHXA 1IYXA 2YA1A 2VP8A 3FIGA 3M6DA 4HYWA 4CQBA 2GQ3A 4D6HA 1J93A 3WNMA 3BZGA 1DJZA 4GIAA 3S3GA 1UIOA 4LANA 4FA3A 3N15A 5GJNA 4IMEA 4P7LA 2XWDA 4QG9A 3JZEA 3TH6A 1TO3A 4J4KA 3HMJG 1JUKA 1ZTVA 2Z2UA 1VFTA 2PDNA 4RX0A 4CNNA 3QR1A 1T5AA 2F6XA 4UTUA 4UTTC 3O7UA 4RR4A 3M41A 1PX4A 2AAMA 5JBFA 2DVUA 4LS2A 4QSFA 1KM3A 2CZEA 4O12A 3R4IA 4G7EA 2OQHA 4IP4A 2CW6A 1I9CB 3OB8A 3GXFA 3KVMA 1JCMP 2GUYA 3E12A 4LBSA 1F7BA 2GSEA 2Q3RA 3U7VA 4DUOA 2YCLB 3WDHA 3LHTA 1AZ1A 3QRHA 1FP9A 1XC4A 4AIEA 3WK1A 1D3GA 1ICQA 3SW6A 2FZMA 4UCGA 3W7HA 3MBFA 1XGEA 3E0LA 3DAQA 3TYDA 4JIHA 5E5CA 1HKIA 2OOGA 4IIFA 3W23A 4JTRA 5C5YA 4CNOA 3WJZA 4FNPA 1NWRA 1F3WA 4AX7A 1HG3A 1XKJA 2XHYA 3N2MA 4AD1A 1TPB1 2DJXA 3NSNA 4AF0A 4ZO9A 3BCFA 3RUBL 3CH0A 3LTYA 1RHCA 4M7TA 3I7SA 2WVVB 4LEQA 3K8KA 4A8NA 3QBUA 1M53A 2G3IA 1JQXA 3DENA 4ZCWA 3LENA 3QGKC 1C92A 2WANA 3D3FA 4WIWA 4Q6JA 4AHQA 5HATA 3M5ZA 1EDTA 5EBUA 3OW1A 3MV01 1RCXB 4AZCB 1FCBA 1W1A1 4HA1A 3CLMA 3KBMA 1JCXA 3EWUA 1E6RA 3MCOA 4HPJA 3TC7A 3AS0A 3R58A 3NTYA 4KWUA 3SCWA 4MPKA 3B3DA 1YIXA 5EMJA 4CKQA 4NSBA 1KQZA 3FK4A 3VC6A 4U5IA 3HIJA 4H9MA 3GR7A 1NAL1 1QI5A 1FP8A 5CC7A 4Z17A 3RITA 4AISA 1ISXA 2ZC1A 5AOUA 4GXMA 1XQKA 1ZZMA 2NXGA 2V3DA 4YVVA 2JQXA 1GYLA 1WKYA 2GWNA 2NV9A 4DUWA 2ISDA 2YCLA 4BZYA 1DQWA 2POTA 1E0VA 7TAAA 3IRDA 3TONA 1Q13A 1LT7A 3AO0A 1VENA 1GOKA 1W1PA 3EOUA 1OWQA 4LS0A 5D2TA 2AMXA 1VCFA 2VR5A 2YW4A 1JJKA 2P5NA 2FYMA 3T55A 2RGMA 1J2WA 2VEFA 2VVSA 1OD0A 5EFFA 2OPJA 4QM1A 1R7OA 1KM2A 4J3VA 2WVVA 3PNUA 3DESA 2OMAA 4QSHA 4HYVA 1W9UA 4ASTA 1O12A 2YBTA 3NJ3A 1TV5A 3NOEA 4RE3A 4A3QA 4ZB5A 1OFDA 4W5ZA 4GJ1A 2JKEA 2CXGA 2HPMA 3WLLA 2CXEA 3NVTA 4LY8A 2HZGA 4AZCA 1AVAA 4R9XA 1KBKA 4RDYA 2PGWA 2PWDA 1C9WA 4LCQA 3PHAA 3TIMA 2OOFA 4JBRA 2WHMA 1ICPA 2Y5JA 4DX3A 3T1GA 3AJ7A 2VZUA 1JAKA 4L9ZA 2OEKA 2HISA 4PUDA 4Z2KA 3GVRA 1I1XA 3F5LA 1TJPA 5AECA 4OGZA 1GVRA 1QHOA 4WXYA 4HCDA 4FNSA 5K3VA 2GL5A 1BHGA 3RLVA 3CGTA 4AMAA 1XLEA 7XIMA 5AC7A 3M44A 3ARYA 1MQPA 4DBEA 4JFUA 5CJMA 2PUZA 3OJGA 2CETA 1D7KA 3B8IA 4XAPA 1K9DA 5HULA 3DYMA 4XWUA 2VQUA 3LNPA 3BV7A 1C7SA 2ODOA 3TOYA 2DSVA 3WQDA 4DNHA 2H8XA 2FH6A 2V68A 2TYSA 3LLFA 1H50A 4BQ4A 2YA2A 3TFXA 1A0CA 2C0HA 5D33A 5U4NA 2DZSA 3V0UA 4NY2A 4H7VA 4XSMA 3B40A 1OCJA 3R5EA 1GQJA 3VM5A 2VX7A 3RK8A 1KFKA 1QNPA 3WLNA 3VDGA 2E1DA 1EQPA 5AC5A 3DFSA 3W75A 2GPTA 3NYDA 4XD6A 3EX4A 4QAIA 3NA8A 4B5UA 7ENLA 3BO9A 3MTWA 3UXKA 2C1IA 2EPKX 3T0BA 2F84A 2VC6A 2C15A 1RJRA 1OYAA 3GZ3A 1K9FA 1W17A 1E51A 2YW3A 4F66A 2WKGA 4J2PA 3TZNA 1UP0A 1VAHA 1F6KA 2WSYA 4JN7A 1QO5A 2ZA3A 2PTWA 3W72A 3Q4DA 3VD4A 2VHLA 3N04A 1HKKA 3URAA 4D1JA 2EG7A 3CWOX 1CIUA 4W5UA 1JZ3A 3EZ4A 3Q94A 3NQAA 7PTDA 1DJIA 2VNCA 3GDTA 4ERIA 3WN6A 3TVAA 4OUEA 5C55A 1ISZA 3P74A 1DXIA 2DUZA 3O0FA 3QHNA 1PB0A 1IGSA 3HF3A 2KX9A 1CXEA 4F40A 5FF0A 2A1YA 3DFPA 1ZBVA 3E0WA 3VIMA 4RPPA 4YIWA 4GCAA 3RMJA 3SZ8A 1ENUA 4C6EA 3ZIZA 4GQ0A 2QUNA 4AIBA 5HPOA 2PRHA 1YPFA 3TN5A 1EJTC 4IP5A 3CT7A 3K4DA 3G6MA 4OHQA 4GHRA 4S3JA 1UWQA 3P6LA 4JXCA 5HNUA 4IHCA 3UR5A 2C14A 5T8GA 3VD7A 2JALA 1N8FA 4D71A 1GPFA 1H62A 2VC7A 3R8GA 1AMYA 3C2EA 3M0LA 5BROA 3UXIA 1EHNA 4PEEA 3BDKA 3HURA 4L56A 4C7GA 2OTDA 2QGHA 3UPBA 3I3DA 3P80A 2HXTA 5I6SA 1S3HA 2ONEA 1FWRA 3OIXA 2NQJA 1C91A 2Y24A 1E4NA 4LAUA 5FACA 1KFBA 1BAGA 4NAFB 1PIGA 2DGAA 2HNEA 3APTA 4HSHA 3GY1A 4GY0A 1JD7A 3VPLA 5JU6A 3FHQA 2C79A 3C5QA 4PTDA 2IPWA 3SGUA 3M0ZA 1VJIA 2VL4A 5I09A 3NCOA 5HAOA 1FWHC 3G1SA 1W37A 1FX6A 1MW2A 1A5MC 4E3VA 2H8ZA 3R13A 1ALDA 5CPQA 3SQMA 1UKTA 4GIEA 5D4YA 4UXDA 4JQ3A 3GXIA 1EUNA 3JR2A 1NJJA 1UROA 2DZVA 2HCVA 1GQNA 1EZWA 1L9WA 3MI6A 1KGUA 2DZWA 4UR8A 3SQLA 7REQB 3STPA 4LC6A 1UJQA 1FUYA 4FF5A 1TE6A 3T4CA 3HG4A 1Q65A 1D3HA 2OG9A 1OABA 2VQTA 3VO0A 3IIOA 4R5EA 3CUGA 3TZFA 3OEXA 5D03A 3S5OA 3IIPA 3D46A 2BLEA 2O4MA 1JR1A 4NI8A 2GOUA 5A8MA 5E93A 1AG1O 1SJAA 4PMVA 1MUCA 3ZFHA 2JEQA 3WLTA 3W84A 1J79A 1E0UA 3R8RA 3MMUA 2PAJA 3WNKA 1DE5A 4DXXA 4NAFA 3BOLA 4IL0A 3T9PA 2R1MA 1Y65A 4UIOA 1EIBA 1G4PA 4ZGYA 2FFCA 1OC5A 4GUFA 4QQ3A 4HPGA 2C91A 4K7VA 1HFBA 4DELA 3MKKA 1XLHA 1DL3A 1IT8A 5K4ZA 3EMCA 3C8NA 2QMJA 3UERA 3ZYZA 2WZMA 2VMFA 2J78A 1GPWA 3WQ8A 4Z1BA 3AYRA 4JKMA 4KQNA 4ZQNA 2G0WA 4DJEA 3S1VA 1XIHA 2Y4SA 1W1IE 1XG3A 2VFIA 4NL1A 3SUWA 3WMSA 4YJ5A 3A4AA 2R9RA 3ABSA 2B31A 5DO8A 3BAJA 1FWIC 7REQA 3W6LA 4QITA 4DUVA 1TV3A 4BCEA 2NZLA 2G3MA 3QZAA 3E2SA 3QSTA 5HJLA 4KH2A 4U5KA 2CITA 3DXIA 1HN1A 1HF6A 2D3NA 3W1TA 3ITVA 3FX4A 3V16A 1GYMA 1AA1B 3YPIA 3U8GA 1F4HA 3EX3A 4IGNA 4PZVA 3EDJA 3L0GA 4O0KA 1QI0A 1DHPA 3BH4A 1HJSA 4PUNA 1L6SA 1ECQA 2OKOA 3RG6A 3UXDA 1Q2RA 1GZJA 2EPLX 1ML1A 4OU1A 3WLQA 3A5FA 2SFPA 3QMTA 3S6DA 2NVCA 1VEPA 5DT7A 4X60A 2PBOA 3MMTA 2ICSA 3URQA 1XICA 1EUAA 3MCMA 1QW8A 3WF2A 3WQFA 4ZENA 4JTTA 3RYSA 1XH2A 5TBOA 4JZ5A 4K39A 4L64A 4O4VA 1B1YA 1C29A 3DC0A 4AD5A 1Q6OA 1Q85A 4E4PA 3RIKA 4DYJA 2DZAA 2NV1A 3MY9A 3D47A 3MUCA 1UIPA 4ZL1A 2ZTKA 1U1JA 2ABBA 3HQOA 1TE1A 2WSQA 1NDZA 2WB5A 1OGGA 1V93A 2OR2A 2Z24A 2AGTA 1UWUA 2GVLA 3UJ2A 4GD0A 1JRBA 3ZR4A 2O7QA 1Q8JA 4YLWA 5D8ZA 2A79A 2H3DA 4FEZA 2OEJA 5JH1A 3CYVA 2DORA 4ZB2A 2VURA 3HOJA 4QCFA 3EWWA 2F61A 1X39A 2XVPA 2ZDRA 3VGEA 2XPKA 1UH3A 4YTSA 3PZGA 5DXYA 1R9XA 3V0TA 1YHTA 2BV9A 3GG7A 3P3BA 3S5SA 3W7JA 2D0FA 2EXOA 2R14A 4AW7A 3UZ5A 3LLDA 3L2LA 4HK5A 2NT0A 1KXTA 4O1AA 3PZOA 3ZS4A 2EPHA 4XO6A 2DH2A 4DRSA 6ENLA 1H0GA 1PXGA 6REQB 3HG3A 4LTSA 2QUTA 3LEPA 3WUBA 1QO2A 2BG5A 5AN7A 3ZJ8A 3DFYA 2EPMX 2V2CA 2ZTJA 1EHAA 4PTMA 4XZWA 3DC8A 3PZNA 1OF6A 4ZSUA 4G9PA 4XD4A 2HDJA 2WNQA 5ECVA 1G6CA 1XSIA 1IZJA 4LH8A 5ABHA 3W1RA 3WFZA 2DY3A 1E72M 4MNKA 2Q71A 3BG9A 1PAMA 3WENA 5A69A 3QGAC 4AHOA 1S2WA 3QTGA 3PWIA 1JAEA 1QFEA 3VOFA 4QLJA 5CBIA 2WNNA 2CYGA 1LLOA 3AZRA 2I16A 3KVLA 5A6TC 5HUPA 2P8CA 3QY6A 1JYWA 1XX1A 3TR9A 5DFAA 1JIBA 1EGVA 1U5JA 4QIUA 1VBRA 1UYQA 4EVZA 2C6QA 1PHQA 1T40A 2NUWA 2OX4A 1JYNA 1CPUA 3KL5A 4RDVA 1GOWA 1IEVA 3BLIA 2ZCGA 3MU7A 3WH9A 2UBPC 4P8VA 3TJIA 2YZ5A 3RX2A 1DHKA 1SM9A 2WMIB 1H09A 2VCBA 3ZT7A 4L80A 4UQEA 3AS3A 5I3GA 4RNHA 1W9VA 1B57A 2W27A 1NIUA 1SO6A 1G9HA 2AKMA 4AVNA 2XVLA 1IWBA 5CJNA 1OFBA 3CHFA 5BXRA 3EB2A 3GDBA 1R9YA 3W7DA 4YCOA 2FGLA 4TVUA 6REQA 3N19B 1QI3A 4MVAA 4A2SA 4CNUA 1DKWA 3R0UA 5G4WA 4E2DA 2WQDA 3UVIA 3DCPA 3QTPA 3UZZA 1WZKA 1THFD 3DFOA 2DSKA 4EIVA 1RALA 1Z6KA 1LQ0A 3EWZA 1S3TC 1SUXA 4XD5A 4BS0A 4KCVA 5A8NA 3GNPA 4ACYA 3EKLA 2X2GA 4JKKA 1VP5A 3FS2A 3M16A 4X9SA 2YLAA 4J7RA 6XIAA 5T26A 4C91A 3F4WA 1KBLA 2UV8G 4N7QA 4IPIA 3CWHA 4HCLA 5BOEA 1TX0A 1EF2A 3PS7A 2V30A 1EKOA 1HO4A 2ZRUA 4KWWA 2XH4A 4XAFA 5T9BG 2XGBA 3N6JA 4WHBA 2HS6A 4Q8UA 4LVFA 2BVDA 4LW7A 3P81A 1O6IA 4TTUA 4O1FA 4JX6A 3HTWA 5K9CA 1FWSA 1DWJM 5L9FA 3LX9A 1P0NA 2WMIA 2Y2WA 3T05A 3PTQA 2WBGA 2QIWA 3C2RA 4CU6A 5CGMA 2EKCA 2HK0A 2Z1BA 4AD2A 1OX4B 4ZB0A 1M6JA 5C2CA 2GQAA 1EIXA 2X05A 2HXUA 3GTIA 2HROA 3W7PA 3FA4A 3GBDA 4RZ5A 3EYPA 2AL2B 5LYRA 3K8MA 4KWVA 4W8BA 4W8AA 4MG4A 3KCOA 4PULA 2QZRA 1IF2A 2PTXA 4HNTA 1TUFA 4FI4A 1JF5A 4FSAA 1VH7A 1WXYA 2ZADA 2YJQA 2BHZA 4PH6A 3W7CA 1KXQA 1O1HA 3ANYA 1M04A 5J5RA 1HP5A 2WMGA 4MJ4A 4JYDA 2J62A 3PJUA 4TO8A 3QYQA 3UZJA 3OODA 5IHRA 4WDTA 3CEUA 2QGYA 4AWTA 4JR5A 1QPKA 3MHUA 3E38A 3V1PA 2XZ9A 3A3XA 3S2MA 4XVDA 2Z2BA 4WD0A 4N9CA 2IMRA 2P0OA 1UKQA 4DO5A 5BRPA 3K46A 3P67A 3G24A 4FPSA 3GC4A 4Y7EA 5KZDA 2E6AA 1GW1A 1R38A 3T0AA 1K8YA 1H7XA 3QYSA 1PKLA 1I2QA 2O55A 3GLCA 3BZJA 3RO8A 4IQDA 2WZIA 5AC6A 4Q8NA 3FY1A 5M1TA 3UT0A 5LNRA 2ZXBA 4AY7A 3URNA 2ZZ3A 1F07A 3RILA 1XBVA 5M03A 4YU1A 3DGRA 4GVHA 3SO7A 3EWCA 2CBVA 5JXQA 4IPNB 2J9ZA 4GI4A 4IZGA 4HMEA 2X7WA 3L4ZA 3COTA 3QEZA 2CEQA 2UY4A 3LGEA 4MNJA 2D2GA 3B05A 1FDJA 1OX4A 1ZNNA 5LGZA 2WSKA 1Q4NX 3TAKA 4CN4A 3O2LA 1NVMA 4HHMA 5D09A 1GOIA 1KBJA 4CQ9A 1Y7VA 2AL2A 3E96A 2Z1KA 4DBSA 1R6WA 3CUHA 1OG6A 3L66A 4LX4A 1AD1A 4UFKA 3SEPA 2PSNA 3WQWA 1EL3A 3MUY1 2D3LA 1WUFA 1X8FA 3NQBA 4ZODA 4D2JA 5BNKA 1NTHA 3GUGA 5CPTA 3QXBA 3JU2A 3LXBA 4MDOA 2DZBA 1BTMA 4KGLA 1M7XA 4REQB 4HKPA 5KEZA 2P0IA 1FWTA 3GS6A 3SRKA 5M5DA 3VCNA 5LNVA 2VDHA 1CW2A 4E5TA 1OC7A 3TYEA 5EU9A 4B5WA 4RZ6A 1G5AA 4S2BA 4KT2A 1TELA 5BMXA 3R0KA 3HGRA 3SAZA 1YTDA 2FZ8A 3VNIA 2X1UA 4AAJA 4UR7A 2FHFA 4NZ3A 3V75A 4W93A 3OGRA 3I3EA 1XINA 1OF8A 1F3XA 4O54A 2QMKA 4DEFA 4ORIA 1J96A 4YN5A 3HBLA 2O9OA 4B4FA 1VBUA 3FJLA 4WDUA 3VMPA 3FYPA 1OFQA 1F2JA 4JQAA 4PB4A 2QF7A 4C6MA 4NI3A 4ZQOA 4QGCA 4N0RA 2OT1A 2XN2A 4IICA 2D1ZA 1PYMA 2OX1A 3BW2A 3S8HA 3CZGA 1V6WA 1CGTA 1H61A 2VFFA 4H8UA 5C54A 3S9YA 4RZBA 5BOFA 2X0SA 4U2YA 1Q7MA 3VNKA 5IM51 4HK6A 5F1VA 1DP0A 1B3YA 1YQ2A 4EF8A 2QCCA 3EA3A 2PTDA 3VD5A 5D02A 5BXSA 4REQA 1U33A 4P7QA 5FCZA 3CAVA 3DHDA 3SURA 3A9IA 3EOEA 3ZOAA 3H2EA 1OGBA 1D2KA 1TJRA 3LXAA 4DBUA 5BU6A 2GJLA 1CXHA 2DP3A 1MQQA 3E2RA 4B2DD 1KBBA 1UW9A 5AHIA 2XDFA 3HPAA 4XAZA 1SFTA 1DYSA 2PFHA 5DY3A 3CT2A 2OGYA 4NF7A 2XIJA 2UZ9A 2OGJA 1D9EA 1MFUA 3CO8A 1KFEA 1CXLA 3II1A 1Q66A 2F7FA 2NSOA 5HQMA 4YHGA 4HNVA 3UF9A 3NQ7A 1AJ0A 2V2DA 4NRRA 4WRHA 3E6EA 1YRRA 2Z6IA 1VLIA 3AYVA 5KINA 4Q8VA 3PM6A 1EP3A 2GJXB 3N6HA 2FPVA 3BLKA 3P8IA 1QI4A 2I9UA 1E0XA 4MZYA 4J3ZA 2Y8UA 3SUUA 1JPDX 3B06A 2W66A 3B0PA 5CBBA 1GJPA 4LT9A 2YXOA 5DN1A 3GVGA 1JCTA 3BQ5A 4FX6M 4CN1A 2VVNA 1EEXA 3EKGA 1DBTA 3N17A 2VYOA 4FP1A 3VM7A 2CZDA 2C1HA 4JX5A 3TEVA 1FFRA 2WLYA 3BOXA 5EB8A 3NL2A 3L4YA 4NT0A 3G22A 3DU0A 2W3ZA 4A21A 3UA3A 2BTMA 4WKHA 4W86A 4XTIA 4BK9A 5XIAA 1WKFA 1EEPA 3DKLA 2G5WA 4XX6A 5BWFA 1RLCL 3LGDA 1VHCA 3VGHA 4DZ5A 4ZZ9A 2OJPA 3M1ZA 2WC4A 1G94A 2GK1B 3H4XA 3UWWA 4HA4A 2YOCA 5DCEA 4W7UA 1VS1A 4S3CA 3WUGA 3W2NA 1PKYA 5AYXA 4LVDA 5IFPA 4PGLA 2BVWA 4IWWA 1PPIA 3GVQA 2QUUA 4F0HA 4GO8A 2ZUTA 1TMLA 4IJBA 4KEUA 3MP4A 3H4GA 3P61A 4WF7A 3VIFA 4R7WA 1W31A 1T0OA 3NUKA 4JD4A 3REQB 1JPMA 4JIPA 2I56A 1LLWA 1WOAA 1A5LC 1ECEA 2D20A 3LYEA 2J7DA 1IR2A 4HGXA 4M1BA 3W1LA 3C2OA 3O0KA 3W7MA 2OZ8A 3BICA 4QEEA 4ECLA 2GJXA 4NAEB 3VKDA 1V6VA 3OLEA 1CWYA 3LXCA 3C2VA 2PDCA 1IWPA 3NR0A 2FGZA 4HK7A 3W0KA 2DV0A 2JFEX 2DFAA 2GSJA 3F5KA 3S5ZA 1V5XA 5DQPA 4IQJA 4YTRA 1PL9A 2HBVA 3OVPA 1NOUA 1NFBA 2EAWA 1PO9A 3V5CA 3NQGA 3FSTA 4CCCA 1MRQA 2HMCA 1XSJA 4FALA 3T2OA 5A2BA 1B9ZA 2Q8LA 3S83A 5BXTA 1T8QA 1W9DM 1YE6A 2VZSA 1TUXA 4JCLA 1TRIA 4GXPA 3KFTA 5JBDA 1TPC1 3VFLA 4Z0JA 2JGQA 1EQCA 3FKRA 5D05A 1BFNA 4N42A 3GTFA 2W5FA 1J4EA 5FL0A 3N4FA 1ZLPA 2DW7A 1EGZA 1YNPA 3SCTA 3WQGA 4FLSA 3XINA 3SDOA 1VFUA 2GK1A 3ARZA 3ELFA 1XFCA 3B8TA 1H11A 3W26A 2WWDA 3W02A 5HPCA 1F8IA 1LBFA 2CLEA 4WOZA 1DJGA 4PMJA 2ZXQA 2O0TA 3PPFA 4QDPA 3OVGA 1UP2A 1AZ2A 1V7AA 3IEBA 9RUBA 3BMXA 4L9XA 1T99A 3REQA 5GVJA 1XLCA 1ITQA 3KZPA 2GDVA 1LDCA 2YGYA 2XVKA 2RUSA 3TW6A 4JFSA 2GQ9A 3LSCA 3NURA 4NAEA 2QJJA 4XZIA 2QJHA 1AJZA 3E0VA 3SSZA 3VC5A 2CWXA 5LA2A 2C1GA 1RBLA 5KITA 4D6EA 3SUTA 4QG8A 4ZA0A 4IIDA 4GQRA 1S2TA 5EL1A 3BXWA 1ME7A 4UTIA 3QZ6A 2J8FA 3EOOA 1KRAC 2QCFA 1ELSA 2DUXA 4HPXA 3EAUA 1OFRA 3K8LA 3M64A 5EY5A 3NO3A 4GIRA 2WM1A 2HVNA 4MNLA 3QKZA 5AHLA 4GISA 2YCIX 2PDUA 1JEZA 3WUFA 2XFRA 4IIGA 1UZ4A 2PF8A 3KOZA 3QN3A 2Z0IA 3DYPA 4HT3A 1PZ0A 4LU0A 4KWOA 1DJXA 4LUIA 2IPFA 4B9ZA 2VZVA 1I60A 2IS7A 1LZOA 4I9JA 2NVAA 3QFWA 5CXPA 2PMQA 2PDBA 3PPGA 5I7GA 1GORA 4GOAA 4ADUA 2FHCA 2CHRA 3VDHA 2VDGA 3ABQA 2YBUA 4CCDA 1BEUA 4UFLA 2QIIA 3GQYA 5K9DA 1W3NA 3K1GA 4V15A 3DI0A 3FVDA 1UR0A 4Z2JA 1KLYA 2P3ZA 1T7LA 8CGTA 3UJSA 2GDUA 4US6A 5LIKX 3KHJA 3R8HA 2NXIA 1LG2A 4GZ7A 4UB9A 3M0HA 3MO7A 4CU8A 2OLSA 4KEZA 5E9XA 3WQOA 3H6OA 1OIMA 3OHMB 3PNZA 5DRIA 3F4CA 3SIMA 2HE8A 3RF9A 3H2MA 4CCZA 1DJYA 1KRCC 3NQ2A 4IPPA 4QX4A 1B90A 2QPSA 3WCZA 3V18A 4A29A 1SJDA 4WLCA 3U7BA 4XB3A 3MI3A 3VKKA 1V77A 1PZ3A 3W87A 4HA0A 2GJPA 4C6QA 6ALDA 1C90A 2PDQA 3FJ6A 3TC6A 8XIMA 4KS0A 1FFQA 1NM9A 3Q58A 2WMKA 4MGGA 3CXOA 1VBJA 3WNOA 1MYRA 2R6OA 4GNKB 3MSGA 1K7XA 3RAOA 1MXGA 2JIWA 4HSNA 3S6TA 3I6TA 3VNLA 2OQYA 4L9YA 1JNEA 1I8JA 4HYRA 4E8CA 3H2FA 1BXBA 4FXJA 4M80A 4JIQA 1Q6CA 1UUMA 4UTLA 4KETA 2XISA 2VGGA 3RCYA 1ODZA 1TREA 3OIHA 4LVBA 4JL2A 3WEZA 3I7QA 3G1DA 4RK8A 2A6NA 3LOTA 3IJIA 2C0AA 1KXHA 3U57A 1ME8A 4DZAA 2BS9A 3BGAA 1NDYA 2RH9A 1RPXA 3RLGA 2PU1A 3PUGA 3INPA 1EOMA 2WC7A 1OJXA 1S2CA 2PCQA 2PDGA 3RPMA 1RA0A 1AW2A 8A3HA 3MMDA 1OEPA 2ZUWA 4V28A 1W9BM 1V3KA 3R25A 1G0CA 3MUXA 3C0QA 4F48A 3NO5A 3H2CA 1SFJA 2ZX8A 4J1OA 4OV4A 1HZYA 5A94A 3TQ0A 5D37A 2BASA 3BWWA 2J74A 2VRJA 3VD9A 4WKAA 2PDLA 3CV1A 4KGJA 1VQTA 5G4HC 2ALRA 3WQCA 1GG1A 2INFA 4R7JA 3W7QA 5GJMA 1OC6A 5DELA 5CQ1A 1NFPA 4IG2B 4WSJA 3OLDA 3N2OA 1R7AA 2VUNA 4UQCA 1AL7A 2RKXA 4Z2HA 4V27A 3G0UA 2OYKA 5I77A 4XBSA 3LPFA 3GDLA 3DI1A 4JNMA 2E7FA 4C90A 1Q8AA 2DJLA 4ZXLA 1L6YA 1FDZA 2B7OA 2ZYFA 2F8QA 3TNBA 2Y61A 4PCNA 3P0XA 1SFSA 1EJVC 2WW5A 1P7TB 7TIMA 3U3HA 3C2YA 3UNTA 4WJEA 4E8DA 4MIMA 4Q7IA 4S3FA 4D6DA 1GCYA 5FOOA 2VOTA 3EEZA 1F9CA 3PBUA 3S2CA 1BVNP 1EC8A 1RBAA 2WMHA 3TXVA 2XN1A 4GUIA 5LZLA 2O9TA 1MSSA 1TWDA 1MZRA 4TVCA 4JS3A 1GVSA 5H1WA 5C9XA 4KKXA 4C6DA 3NPVA 3WK2A 4G6CA 2XTKA 1JD9A 2YDSA 3IIXA 3S1UA 4CNPA 2FKPA 3FJNA 1KB3A 4ML9A 5LIUX 1HL2A 3UU0A 3OHIA 4PMUA 1BQCA 3ITCA 1UD8A 1PIFA 3IAQA 1RLDA 2CPUA 1FH7A 1ZUAX 4MKSA 5EMKA 4J40A 3IVTA 1FWNA 3V36A 1UPMB 2NQ5A 5FAJA 3TKFA 4CUCA 1BGGA 2XVNA 5G1YA 1N55A 4WJXA 3LY0A 3WJWA 1ICSA 2WV8A 1UWIA 3LTPA 4OBTA 3W9ZA 1XRSA 2E3ZA 4FNTA 3TYBA 2PC4A 3AZTA 2W9MA 2F2KA 2UY5A 4AZGA 1JDCA 5F1UA 4AX6A 1QPRA 2ZXAA 2J13A 4O52A 1CLKA 3IVSA 2YL9A 4W7VA 4IG2A 1EDQA 1ZCCA 3LA4A 1GKQA 4OQVA 1NH6A 3GG8A 4HNOA 4DI9A 3GR4A 3W1PA 4RJEA 4B5NA 3WLHA 2PEVA 3VNMA 1MNZA 3OGSA 1K8XA 3L9CA 5RUBA 4C6NA 5ABGA 3EDKA 3WLIA 3IRSA 2VRQA 3QW3A 4B3ZA 3S42A 1XI3A 1IT0A 3D6NA 3U0HA 1P7TA 3QLDA 4CD6A 1TG7A 2X0HA 3KM8A 4PL1A 4ZR8A 2F6KA 2ACQA 1AODA 3MBDA 1PWLA 1QBBA 2BWGA 1E5JA 4IXHA 3IGSA 2AOSA 4HU0A 3V3WA 5LA1A 5M2FX 4AUBA 3MKVA 3VOJA 3DERA 4NJGA 4Z2GA 5HWJA 3W6YA 2E40A 4KMQA 2J8TA 2ZUNA 3DHUA 4PCTA 1N8IA 2PDKA 5BRQA 2B0MA 4CNTA 1GJUA 3MWCA 3LMYA 3S6OA 3ZZ1A 4G56A 1IXPA 4R34A 4S1FA 3DH7A 2WZEA 2QCMA 4NZJA 3WUEA 3S0CA 4ZE4A 1B2YA 1A0DA 3TA9A 1MEIA 2DIJA 4U4MA 2A21A 1K70A 2JKAA 3KHDA 4TX9A 2WJFA 4NUWA 1C9DA 1RUSA 2O56A 3A24A 4HA3A 1A5KC 1X8CA 2DW6A 1YXYA 3HO8A 3UJEA 1FA2A 2V5DA 4QISA 2ATSA 3IJDA 2W67A 2AKZA 3K2GA 1L0PA 4IMCA 3MJMA 3F4NA 3CO4A 2HE5A 1FHVA 4JTLA 1P5BA 1HJXA 5FF2A 3VNJA 3U4FA 1U1HA 1JPHA 1CBGA 1H7RA 3BAYA 1E56A 5HNTA 4A05A 4K37A 4JYEA 3SJ3A 3GIQA 3W7GA 3QSRA 3F5JA 3OBKA 4H9TA 3QV7A 1KD0A 1QPQA 2PP1A 3W7OA 1QW7A 1W3TA 3AIWA 1QNSA 1K6AA 3N9SA 3M0XA 1ISYA 2X8RA 1WXJA 3DECA 3GC2A 3W81A 3AHTA 3VX0A 3DFQA 3PR2A 3Q67A 1I75A 4CD5A 4NQ1A 2DUAA 2WPBA 1H2JA 3MZ2A 1UR1A 4AHPA 1A4MA 1XIDA 1IEWA 4I6VA 1MO0A 3CAQA 4GYFA 1TPVA 2BSLA 1JNDA 3BK0A 5C2XA 5C2GA 3U48A 3U2EA 3AMKA 3FEQA 1R3RA 2D24A 4RUBA 4DWSD 4DO4A 3O6YX 3RLUA 3A4WA 1TSIA 4QHRA 1Y0EA 2P76A 5K7JA 3A13A 7A3HA 3D0CA 4Q4RA 2P8BA 1WE5A 1QCWA 2Z6JA 1FTXA 3STFA 1HVXA 1GK8A 2E25A 3GU9A 1YE4A 2OSWA 1WDQA 3ENLA 2FH8A 3L4UA 3P8JA 4XAGA 1IHIA 2IQDA 1TIWA 2V3GA 3H55A 1O4UA 3LPPA 5LNSA 2ISWA 4FX7A 3CQKA 1JZ5A 4AIUA 3W3OA 5JUVA 3B9OA 3TU9A 1M9HA 3E9AA 2DZXA 2P88A 2P10A 1UR2A 2W6RA 3T2PA 1HX0A 3ZMRA 2EPNA 3S46A 2QF8A 4MYAA 2ZE3A 4PUWA 1GVYA 2XU2A 5LXEA 4OIFA 3GYCA 4JCMA 4GH3A 4PMNA 1PSCA 3USZA 4A22A 4MY8A 1W5OA 1ITUA 1IGWA 2X7VA 1KCKA 3NOYA 1Q6RA 2RJGA 6A3HA 1JFXA 1C93A 5MKGB 1ONXA 3DFNA 3KBNA 4XO7A 3BJTA 4BEUA 3EWXA 5A6JA 3WY1A 3TX9A 1IR1A 3QV9A 4EP8C 5AHEA 4J3UA 5G1TA 3I4KA 1QPOA 3SJNA 3UPMA 4E0CA 3IS4A 1TTIA 2FB2A 2A3HA 3GW3A 4K3ZA 1AJ2A 1KFJA 2XG9A 1KA9F 3EWYA 4K38A 2I9EA 3B9DA 4NZ5A 3WSUA 4BR1A 3FVMA 4C6LA 5CPMA 4KPLA 5B80A 3SCVA 1LM1A 3L4WA 4S23A 4UMBA 4XVEA 5A6KA 2WBKA 3GHUA 1YTKA 4H9VA 4JY9A 2X2YA 2GGJA 4K6AA 3I4EA 1S5VA 2IQ0A 4KCWA 3F1QA 3VX1A 1B3ZA 1DXEA 4Y96A 3VIJA 1LF1A 1BYBA 3U5YA 3TSMA 1E4MM 3AMCA 3G6LA 2NUXA 2C18A 3HGOA 5FA5A 1XIBA 1KM0A 2Y89A 1N8WA 4HZ7A 5CSSA 2JGYA 2PZNA 3GBEA 3KTCA 4UTWC 2HV5A 3PB2A 2GVGA 4L1WA 4PN2A 1JCYA 2QYGA 3QGVA 3VK5A 3ES8A 3VGFA 5H8PA 1XDLA 2JKPA 3BARA 3RMEA 4ERAA 1VD6A 2XJ7A 1YNYA 4KW2A 3W2JA 3BLFA 4EPBC 4GX8A 4ZOBA 1RV8A 4UTMA 4I7UA 1SGJA 3GO2A 1DTUA 1W3IA 1QNOA 1YDYA 2FJUB 2QNEA 1J0KA 3H2AA 3EMQA 5MKGA 3H70A 4YWSA 4S2CA 2EKGA 4XQ6A 3WKZA 3QC0A 4Z1CA 3LBCA 4ZOCA 4C6KA 1LL4A 1LQ2A 3GZAA 4NJJA 1TB3A 2D2HA 3LRLA 1BD0A 1RY8A 3MKCA 3O3RA 3GVWA 1TJ1A 2V67A 4IGHA 1W3LA 4XAYA 1CI1A 2J6XA 2O9PA 4QDMA 4F9JA 2EJ1A 3FOKA 4R3UA 3EDEA 1EX5A 2OSYA 1UD5A 5CH9A 2DZPA 4RW3A 4Z2IA 2P50A 1JI1A 4QJ4B 4NHVA 1UC4A 1UBPC 3RM8A 1F05A 3VE7A 1TVPA 1FH8A 5MHBA 1TJ0A 1JQVA 4FLRA 3MJYA 4AWSA 2J47A 2CLOA 4QS6A 2HEJA 3KS5A 4ENLA 3PTMA 2WAGA 1KGXA 2IKGA 3TYUA 4AZ5A 3NPXA 2EF9A 1B3OA 1X96A 1XLFA 1R9ZA 3B0YA 1XIJA 1B3WA 3GR8A 4H9UA 3QR3A 3UY8A 1V6TA 2VEMA 2E09A 1XR2A 2Y5SA 3GXMA 4A3HA 4H8VA 3DG6A 2PP3A 1RK5A 4WZHA 2PWFA 2EEXA 5XINA 2G3NA 1L2UA 2HVMA 2H6RA 3R2GA 1B5TA 3QH2A 2YX0A 3MP3A 1HNYA 4A3UA 4GXWA 2OVLA 4GGHA 1XKYA 2VD8A 2RDUA 3PZTA 2AQOA 2QJIA 2DSZA 4TXEA 3TCSA 2O92A 4AZ7A 4LCSA 3LPOA 4W4QA 1WXZA 3NDZA 4I90A 1GHSA 5D32A 2ZUVA 1ZRQA 3PBYA 1E6ZA 1V4YA 3RJXA 3SI9A 2OZ3A 1QHPA 3UQNA 3FW6A 3ZO9A 1WUEA 2J25A 4IF2A 1XRFA 3PZIA 3WF1A 3MT1A 2IKIA 1UA7A 4Q7BA 4LYKA 3UWYA 3AIUA 4U33A 2OCZA 1IEIA 1S46A 4H6KA 4M6VA 4B91A 1P6WA 1B9BA 1UZDA 1QWKA 3V0SA 4S3GA 4YMZA 5C9UA 3SY5A 1EH9A 4POCA 4Z1YA 1CYGA 1BWVA 4BF9A 3TQPA 1TPUA 1JDDA 3G0SA 4EANA 5BW6A 1SVDA 1BVWA 3GRIA 2FFIA 4J27A 2IW0A 4PTWA 3ATYA 3L2IA 4ML4A 1O7AA 4C7DA 1VF8A 4RV3A 3WLPA 1EO7A 3B8VA 3DDMA 1KV5A 4FR6A 3I65A 3LZ5A 4NXSA 3RGTA 1IZCA 4AEEA 2G3FA 2OYLA 4FXRA 4AD3A 1GG0A 1KKRA 1X6UA 4O28A 5AVNA 1J0ZA 1S38A 3G1YA 4O8AA 3EWDA 4GRSA 1JZ8A 3B4YA 3GHTA 2QULA 3DIPA 4UZUA 1V0KA 3B4UA 4GPNA 2BB0A 4XTDA 5CPNA 2ACRA 4WX2A 2OWXA 1BKSA 2ZUSA 5CJ5A 4HJWA 4UR9A 3WD0A 5TNVA 3WL0A 2B7QA 4HD5A 5C70A 3GD6A 3MA8A 4LGXA 3SN1A 4QJ5B 5I79A 1J0JA 3MDUA 1GYNA 4GQGA 2PD5A 3A4JA 4TR9A 3PANA 4H41A 1NF7A 1A3XA 4MB4A 5KTLA 1WP6A 4I9TA 2AQWA 3VINA 5G2WA 1XIIA 4B92A 1JPIA 2V3FA 2NV2A 3VE9A 7CGTA 4PRRA 3VKCA 1GOQA 2IXUA 2QVNA 1POJA 1JXJA 4GABA 4GINA 4LCRA 1RP9A 3NSMA 4Y9NA 4AWUA 3LBMA 2OZ0A 3FDGA 2CBUA 3ECQA 1XIMA 4ROQA 4QLKA 1C7TA 1XLGA 2XSXA 3AMGA 2QJNA 4NG3A 1KBIA 4PMXA 4YXGA 2V5LA 2HBXA 4GCXA 4YTQA 4HZ8A 3B8DA 5TD4A 4GFSA 2RDXA 3GAYA 3TTYA 1M5WA 5DT5A 1P0EA 1E43A 1OG0A 4XZNX 1AW1A 3TNOA 4LALA 3Q37A 1XM3A 4LV9A 2GVYA 1ZP3A 3UESA 1XBYA 3PY2A 5FI8A 3GNOA 4S3KA 3CBWA 3LCXA 3AYTA 4JDBA 3CWNA 3BGGA 3BSHA 3OZOA 1G7VA 9XIAA 1MDLA 3BLPX 3OYZA 4RL3A 1TZ7A 2L5HA 2WNZA 4Z1DA 4NVTA 3PZ9A 4DN1A 3UWZA 3W1NA 2P53A 4BWLC 2E6YA 2P1FA 4H3DA 1MFVA 3EX1A 3WK3A 1GQIA 3UZXA 3L0KA 1TPFA 1ZY9A 1OIFA 4H9ZA 4XZMX 4GACA 4PB5A 3MC5A 4JL1A 4O16A 2CLHA 1PCWA 1TIMA 3LDVA 3CPUA 4WK9A 3STGA 1AH3A 3UG8A 2OYMA 1VZWA 2X0YA 1KV8A 2BHYA 4PUUA 2BGSA 1XDJA 1DJWA 1OT1A 2PS2A 3CZLA 4AXKA 2CU0A 4L4PA 1P43A 1SJCA 4NASA 4FXFA 4AZIA 4NX0A 2W79A 1FQ0A 2X40A 4ILSA 4LXFA 1CENA 3W7KA 2WWCA 3WDJA 2E5CA 3P84A 3CUIA 4BKNA 3PTDA 3WMLA 4AH7A 4AB4A 1IXNA 3CUJA 1WYIA 1GZGA 2ZXDA 1UWRA 3BUVA 1A5SA 1Q63A 8RUCA 4DIAA 1J12A 3FXYA 5C7VA 5LSMA 2TODA 3PUOA 4PB3A 4MJMA 5FJRA 2ANUA 5HJYA 3HZ3A 2INEA 4GGBA 5A3HA 4TMCA 2FLIA 1RZMA 3GNNA 1GVOA 2UWFA 4AEOA 3CHVA 1GVEA 4PC8A 5IOBA 4FNUA 3BV4A 4DM2A 1F5ZA 2QUVA 2J7FA 2J7GA 4R7OA 5DANA 3HPXA 1MQRA 3QW4B 4C5ZA 3OBEA 3QQ1A 3OG2A 4MOZA 1IEQA 2EQDA 3QJAA 4MJZA 2J24A 1BXCA 1J5TA 3IUIA 4US5D 1PBGA 3MANA 4M7SA 2VC9A 3ITOA 3W7IA 3G77A 4U31A 4YTTA 2ZZ5A 3F4DA 4TUFA 4NU7A 1H7WA 1GOMA 1XYLA 2Z28A 3ARWA 3S1WA 5F2GA 3HJEA 1Z69A 1LRNA 2IPGA 4QDWA 4AWEA 1I45A 4PMDA 4IM4A 2WHLA 2NLIA 4EK7A 2Z1XA 2YPIA 3OTRA 4H4IA 2GUBA 3GTXA 3VZZA 2FTWA 2H3BA 1F4AA 5DXXA 5E6ZA 1EWEA 1VBHA 4S3EA 1XJBA 2VENA 4OBSA 2V69A 2PCEA 3CQ0A 4CGTA 2YXXA 3ABOA 4N02A 1LROA 1DIOA 1JPKA 2ZUMA 3RJYA 2X1RA 1FY6A 1UOKA 3GTHA 3ID7A 1F61A 3HPSA 1S2AA 4F79A 1CEOA 1JULA 3HU7A 3NM1A 3HPZA 4GFIA 4UOJA 4EXBA 1SZFA 4DHGA 4GZIA 1FXQA 5FF3A 2X1SA 3W1XA 5C71A 2QDHA 3PZUA 2QCHA 1EX1A 4DPQA 3EB4A 3R89A 1DORA 2A3EA 3NXLA 4RCXA 2PWEA 3LQGA 3D5HA 1D8WA 5CGQA 3P93A 3GHSA 3W85A 4JEJA 3C6CA 2Z7KA 4F0RA 1AFSA 3AI0A 3PBGA 4RDZA 3FSUA 4FOUA 3W1MA 5FL1A 5J8LA 2WKLA 5D2YA 4HZMA 3IVUA 3EDDA 5DLCA 3TWAA 1R46A 4MB5A 1SR9A 3NPUA 3NQCA 3ARPA 4IGMA 3TLQA 1KCXA 2VO5A 3NFUA 1PE1A 1W54A 2E8YA 2WJEA 1PZ1A 4UTWA 1O60A 4LV4A 4E4FA 4W84A 5HOSA 3IWPA 4HB7A 5I0DA 3NQFA 1CDGA 1ONWA 5I3JA 3MPGA 5FJUA 2ZKMX 4WKFA 5ABTA 3LHVA 3ZVIA 3PFRA 2X41A 3CIWA 1WBHA 2YXGA 1R3VA 5T91A 1LT8A 3AJXA 2A3BA 4XG1A 1ISWA 3POCA 1ZAIA 2VM8A 4WDXA 3TN4A 2QDGA 4R88A 4CN6A 4MPQA 1XS2A 4IQEA 1KFWA 3AIQA 3TP4A 2ZOXA 1XBXA 1Y5XA 5C0QA 3RFAA 1M41A 1TPWA 4AQLA 3C0SA 1K4GA 1WO2A 4IX0A 2DT0A 2XFYA 4EXAA 5AC4A 2PPGA 3GB6A 3LD5A 1IZKA 3U6WA 2QS8A 4PCFA 4ZO8A 4Q32A 4UQAA 3TCEA 3THUA 1H5VA 4PSRA 1PJ9A 1KM5A 3T44A 3WZ0E 3AXMA 4LEFA 2WHJA 3UG4A 4INFA 1KR0A 3TA6A 4U2ZA 4PYSA 2FJKA 1JZ7A 4M56A 1M01A 1KGWA 2R1NA 3MUIA 2E9LA 5F4SA 1KWKA 1SO3A 1J01A 5DCDA 3FFSA 2Z00A 2ZIDA 2ZRZA 4HBKA 5L6UA 2WVTA 1M7OA 1XLLA 2OWWA 1EO5A 3VFCA 4UBPC 2Y8VA 1E0TA 4AYSA 4B90A 4DO6A 3KTSA 1IXOA 3MWAA 1H49A 3MUZ1 1TQJA 1JZ4A 1AL8A 3WLJA 2G3JA 3UG5A 5CZTA 3UWUA 4HPHA 9CGTA 2DVTA 2XWEA 2AMGA 3BCDA 1UKSA 4FIQA 5I3DA 2BP1A 3E3HA 1O68A 4QBXA 4N6EA 3WLMA 5IXEA 1VIZA 2B81A 2VEIA 4FIRA 3WJXA 5A5WA 1HGYA 3AIBA 3SBFA 3UCQA 1X7IA 2TPSA 2BMBA 1Q6DA 4HMDA 1QAPA 4JIIX 2WSPA 3EGJA 4UMCA 2XGIA 3R94A 3WJSA 3RCNA 4ADTA 4JQ4A 1WAWA 4EWJA 1Z44A 4PCPA 1VFSA 4P61A 3P14A 1GTHA 3GC5A 2UY3A 4NZ4A 3GVVA 3RU6A 2EHHA 1HJQA 3M43A 5DMYA 4UFMA 1OK6A 3C2FA 3M0JA 1A5UA 4BA0A 4MJ2A 3W82A 3IJ6A 2E6FA 2YKKA 3AXHA 4EPEC 3KCJA 3PBWA 4H7CA 4PMYA 1FCUA 2PTYA 1OCNA 5HMEA 1P6BA 3VZXA 1MI3A 4QJ3B 4HNUA 1LOLA 1OK4A 3NGJA 3CZ8A 2XZ7A 1M1BA 5BRBA 4MDPA 1E4IA 4DLMA 1R85A 1P0BA 4XZLX 1QDSA 1R30A 2GWGA 5FEWA 2E1WA 5FJTA 4AU0A 4Q8OA 5I03A 2BOGX 3P82A 1XXXA 4CQ8A 3R11A 4G1KA 3WH8A 4JN6A 5A6AA 2WC3A 2V6AA 1IIHA 5FIPA 1HP4A 1NARA 1TJ2A 4NP7A 4EF9A 3NQDA 3F2CA 3DKJA 2Y8KA 1F6PA 3SB0A 4EE9A 4CD7A 1XLKA 4C6FA 3ALGA 3AS1A 1UOZA 4JN8A 1SPQA 1H1ZA 1K4HA 3U5UA 4D1IA 1OYCA 1XHGA 3LUTA 3PZQA 1SU5A 2R94A 5HUOA 4IT1A 1L6FA 3CMGA 1E9YB 3TJLA 2ACUA 3AALA 3TYAA 4RXFA 3P7YA 1GNXA 4E2BA 3A12A 2ZRYA 3UR2A 2PWHA 2BXVA 2GLKA 2EGZA 1VRDA 5DEZA 3AROA 4M29A 5LHFA 4YNGA 3LK6A 2B4GA 3VCRA 1CXKA 1W9XA 3LNMA 3AWNA 3SN4A 1ADOA 4JTDA 4S39A 1UR8A 1VB9A 1Q4WA 1LJYA 4A6GA 3QY7A 3TWBA 4QNWA 4JTAA 4DXVA 1HQTA 3IJ9A 4GK8A 5BXPA 2BZNA 4JTCA 5LNWA 4OOZA 4BF5A 4O53A 3PULA 1JCLA 2GDQA 3KRZA 3VUSA 2Y7FA 2PRMA 3VZYA 1NDVA 3WYZA 1VFOA 3DX5A 3H2NA 2QXWA 1QT1A 4F4RA 4QEHA 3N1AA 1Q6FA 3NXFA 3WFAA 4KCTA 3APYA 4WVXA 3W88A 2E5BA 1CGVA 4F2TA 5C9ZA 1EBHA 2CBJA 2XM1A 3N34A 1MDRA 3L5AA 3LQLA 3PFMA 3LM7A 2FDSA 1SZEA 1E9ZB 3LV5A 3LHYA 4DJDD 3BANA 3GDRA 5CSRA 4K7YA 1SFLA 3GUWA 3CV2A 3Q2DA 3O05A 1U5VA 3VOIA 1J6PA 3NZPA 3L5MA 3BMWA 1L8NA 4HNLA 1QOXA 1TZZA 3GXTA 1VC4A 4XUYA 1CLXA 3PVFA 5HDRA 3HFTA 3FDKA 3M4HA 4LFYA 1YNQA 5A6BD 4LY4A 4BWLA 3C52A 1EC9A 3OA5A 1XL9A 3W2KA 4HU3A 4UTTA 3AQUA 3IACA 2CLKA 2Z4GA 5K2ZA 1Q7QA 4ZEPA 1ZJIA 1DIDA 1FWJC 1X6NA 4ZQCA 4A8LA 3FA3A 3FHAA 4DZHA 1W1YA 1TWWA 3GAKA 3LLXA 1KKOA 1UR4A 5DMLA 1LORA 4ZOAA 5DBTA 3WH7A 5MF5A 3ALFA 2NLYA 2QVHA 4JY8A 3UBPC 1XG4A 4JIRA 3CJPA 1GTEA 2E4TA 4HHLA 4H2HA 1FHUA 1KW1A 4FHAA 2PBGA 3EXSA 3FCPA 3HQ1A 4GI6A 4GVIA 4WUIA 1W8GA 3VDBA 3GHRA 4I7WA 1SYTA 5LIYX 3W4RA 1PS9A 4DAFA 3LN3A 1JGIA 2DQXA 3W24A 3V1HA 4MFDA 4Y6GA 2VDIA 1WDSA 2O4QA 1E4LA 4HU8A 4GNVA 3ZSTA 1T6MA 4GBDA 3TR2A 3PB0A 2G97A 1J0YA 3SECA 3GYEA 3B9AA 3OLIA 1K6WA 2CC0A 4Q8QA 3PTKA 1DXFA 1GGOA 1Q6GA 4LB3A 4Y9PA 4C1NB 2OO6A 1O1ZA 5DX7A 2BGQA 4D8AA 3GW0A 4HPNA 3LCIA 4WQ6A 3CAKA 1RD5A 3EXTA 4FXSA 1S5WA 4CEXC 1R3QA 4DYEA 4NJIA 3T78A 3N4EA 1C8XA 4ZQPA 1DJNA 4M19A 3BW4A 1NQ6A 1W1B1 1F74A 1AQ0A 2YA0A 3MDWA 1VGAA 4MWAD 3BSGA 2FTPA 2BHUA 1AK5A 2PI6A 3WD4A 2DH3A 3JW7A 2XINA 3L4TA 1E40A 2OELA 2Z27A 4PBEA 3PC0A 4H00A 2YBVA 3DGBA 2DT1A 4LS1A 2HWGA 5KZEA 1ZS2A 5H6HA 1K02A 1KRBC 4UNKA 2A4AA 3WEMA 1R86A 3KL3A 1LWJA 1TZ9A 3MQTA 5JBEA 3ABXA 4I3GA 1PTDA 5EMUA 4QP0A 4OOUA 3RX3A 3THCA 1H7OA 3VAVA 2WXDM 4ZTXA 2E0PA 3QZEA 4B3LA 1XH1A 4IMDA 2W4XA 4L6DA 2ZFAA 1B30A 3SCNA 4OVXA 1DWFM 4L1XA 5D2VA 4TV5A 1GOXA 5D8WA 1XH0A 3GM8A 3G3MA 1NSJA 3TROA 1N2VA 3F4VA 5G2HA 1B31A 5HQLA 1VRXA 4OV9A 1UR9A 4HOXA 4I6KA 4X0NA 3PJWA 3AUOA 2DPEA 1CGUA 1Q45A 1QATA 2HRWA 3W07A 4C1NA 4PR4A 1KXVA 1ZSXA 4CQDA 2V3EA 1WAUA 5AZ0A 5I3KA 3NSXA 1TWIA 5LXXA 4IMFA 2PF0A 2JF6A 5AYIA 3N2TA 2H9AB 3CB3A 3SRHA 1PHWA 1W5QA 3FNDA 3KRBA 4DF1A 4ICCX 1BF6A 3U2CA 3HGJA 5I2UA 1GVQA 4V2XA 3UZWA 2PDJA 1LQAA 2BXYA 2HSAA 1DPMA 4H6RA 5HNNA 1O66A 1FKXA 2XVGA 3KAOA 2POZA 4ADSA 1V7YA 2QDEA 4WXZA 1XYCA 1UJPA 3WD2A 1WBJA 3CL7A 3N12A 4DBDA 4N2YA 1KLZA 2OZTA 3IK2A 4OKDA 3G1RA 4HIBA 1YYAA 1UR3M 5A95A 1K8CA 3RR4A 2BNJA 2EJAA 1BWKA 1UMLA 2P3EA 4Z2LA 2VFGA 3CZKA 3C3UA 3MW7A 1I4NA 3FAWA 2GSHA 4EXQA 2CFFA 4B5XA 3E2QA 3BG3A 2EG6A 2DIEA 4WY0B 1KNWA 2PD9A 2XIMA 3JRKA 1PKNA 3OA3A 2FDMA 4H9YA 1LUCB 3GK0A 3B9NA 1T96A 1WDDA 4ZVJA 3EA2A 3VI2A 4AVOA 3NWRA 1CX9A 3F2DA 3TJXA 3AHYA 3QV6A 1W1VA 3GH5A 4B2DA 1FDYA 2C16A 1IXQA 4N9EA 1SMAA 2Q6ZA 4YVXA 3QHOA 3CUFA 4K8HA 4P7OA 3KXQA 1CLVA 4O0QA 5DMNA 1DWAM 1XCFA 3BAWA 4M24A 2EO7A 1FWBC 1TPH1 4MMWA 3N3TA 2NQLA 4Q4OA 1RPKA 2H9AA 3LZ3A 4UOQA 1NU5A 1F6YA 3GDMA 2F9RA 3VKJA 4RNFA 2KAUC 4PTVA 4DJFD 3DG3A 2Q01A 3H54A 1AQFA 3WLKX 2HQAA 3ONCA 1QOPA 1QUMA 3VD3A 1GKPA 3VIOA 4LAZA 5KMYA 3N2CA 2XN0A 4OECA 2DZUA 2YCEA 3TQKA 4HTYA 2WQPA 5HINA 3SFKA 3SCQA 5I06A 2C8NA 1KFCA 4EWND 1WNOA 3KOFA 3N18A 1EJSC 3BC9A 4LNYA 1MZHA 3MVTA 1QNVA 4BEQA 4IXXA 1LP6A 3EA1A 4UTKA 3SRDA 3UJFA 4JFVA 2E28A 4GYPC 1J6OA 4WY0A 5HBFA 4D6JA 3BGJA 3QY8A 4OUIA 1B54A 3EPOA 4Y9OA 1T8XA 3M5YA 4D9PA 2BGNE 1TCMA 1US0A 2Y7GA 1VEMA 2ZX6A 3KP1A 3THQA 1LUCA 4E2VA 2FTYA 3UWQA 1CECA 4C6PA 1XYAA 2ZICA 3CZJA 4CVWA 1O94A 3DZ1A 4L7ZA 4CQCA 1DOSA 2QKFA 1A3HA 1O95A 2WK2A 3AIEA 5EPDA 5DBUA 1GQKA 1E6QM 4E2OA 3NYZA 3PG8A 1X1NA 3ZSSA 4ZO6A 3O63A 1V3MA 5IHSA 2WM0A 3K1DA 4A2RA 5D9NA 2PLCA 5FEXA 1DQXA 2WHKA 4TX6A 4I7VA 2QQ6A 4LOCA 3C61A 2CWNA 1JF6A 3WNNA 2OLAA 4X2RA 4G8TA 1EJXC 3GFZA 1K1DA 1B3VA 3H2OA 4O13A 4KERA 5CZJA 1XIFA 1V6XA 2REQB 3H7RA 3PZMA 1M65A 2ZA1A 1UZHA 2VEGA 1WCGA 3TTQA 3V5FA 3IIZA 4AG0A 4UFJA 2OLHA 4XD3A 4I9AA 5FSEC 4AMCA 5SWUA 2VUYA 4BQ2A 3KS6A 1EZ2A 2OXNA 1XCWA 5E0FA 3T0CA 1A80A 1VCGA 5BOOA 2Z26A 2XFWA 2ZZ2A 4DWSC 3DBPA 3UD6A 4YVPA 2J75A 2R82A 2DDXA 3ZXWA 3PZVA 3T07A 2GQ8A 2Y88A 4FZIA 2DEPA 4L1GA 4GBUA 2VWSA 4Z08A 1I2OA 3C3NA 1SZNA 5F2MA 2FHBA 3KX6A 1HJVA 2BY1A 4C1KA 3UR8A 2Y1HA 3WBYA 4KESA 3ZLGA 3APGA 3UCDA 3CNYA 2OT0A 3TYCA 1E9LA 1WB0A 4B16A 1RH9A 1L6GA 3SY8A 3T0TA 3I7RA 3TW9A 5AB3A 1D7FA 3NEHA 4LUYA 4D6FA 1W3KA 2Z1SA 5AVHA 3PJXA 4XZ9A 3OVRA 4S3DA 1DWIM 2JF7A 1A5AA 5GJPA 1BSLA 4LUJA 1A5BA 3KLLA 2BBFA 1ITCA 1US3A 1X1ZA 4Y9AA 4PTXA 3CZEA 2REQA 1RQEA 2WYSA 4UFIA 1XUUA 2IKHA 3CUXA 1DE6A 1FWCC 3STEA 3NEVA 3T0DA 1V3IA 4WY0F 3T7VA 4GG9A 3ZJ7A 4JIEA 4C1LA 4PL2A 3A64A 2CLPA 1OQFA 2ZA2A 3B0XA 3FYYA 4GUGA 4TIMA 3T4WA 1QNQA 3GH7A 3MI2A 3LRMA 4B5TA 1XIEA 5A8OA 1EA9C 3L67A 4KFOA 4LQ1A 4O10A 1POKA 2EBNA 1XDMA 2A2IA 2BY2A 2NQ9A 4G2DA 2CHOA 5DRCA 1J10A 5I00A 1R47A 4W87A 3KBVA 5GNZA 2X16A 4XIMA 1RJPA 2A6LA 1XGZA 4TV6A 1MMFA 4GQQA 2UY2A 3LGGA 2ZQ0A 2AGKA 1U2YA 5CZSA 5DF0A 1Z41A 3E5PA 1WA3A 2CESA 2WZTA 4HP5A 5F4WA 2INZA 2ADAA 2E68A 1L2QA 1WDRA 2FZNA 3MZNA 1BPLB 4RLIA 3BJFA 3B97A 3GKAA 1NOFA 5EMMA 4CD4A 2O9RA 1E6NA 4TVDA 4V33A 3A47A 1LOSA 4K1WA 3T09A 5D30A 3AZSA 3H23A 3RPTA 3GDKA 4W88A 2R24A 3GXDA 1SW0A 2YIHA 2HNHA 3VKAA 3QFEA 4H9XA 3H22A 1H5YA 1DJHA 5KZMA 4S38A 5FKYA 1PKMA 2XH7A 3TE9A 2C3ZA 1UH4A 3S5YA 4KRTA 2YL6A 1SZGA 1W3HA 2V0TA 1TKKA 4W85A 5HWMA 1UPPA 2VFEA 4X22A 4U10A 1LWHA 4NZCA 3PJTA 4JDYA 1VJSA 2V9DA 4B9YA 2F2HA 3M07A 5E70A 3EBVA 3VIPA 2YB1A 1OCQA 1OB0A 4RKAA 3F2BA 1WZMA 1JUBA 3TQVA 3PBMA 1I2PA 1YX1A 3IGXA 4GUJA 4ALDA 4JTSA 1XRVA 4JNZA 1GUVA 4HCHA 3BLOA 3FAXA 3MV11 3ABZA 3KP0A 1HVQA 2J9YA 1TQXA 3LU2A 4BF7A 2TRSA 5CGTA 3ISIX 2GVEA 4TX8A 1QXLA 2IPJA 1VR6A 1W1ZA 1ONEA 4Q4PA 1BYAA 3W71A 1QI2A 4DXKA 1EJ7L 1GT8A 1OADA 4XZHA 1W8SA 1K9EA 1XRTA 2WLZA 3B8WA 3USBA 3ZR6A 3WLRA 4P8WA 1ISVA 3IGHX 3VCCA 5BMWA 1AW5A 1W91A 5F4XA 3R12A 1QOQA 3TSBA 1TMQA 3GFYA 1QR7A 1HIZA 3AISA 2RHGA 1T41A 2ZC8A 3KEHA 2Q8ZA 1XLBA 3GKFA 2B7NA 1R0MA 1RXOB 1K8ZA 1TFVA 3G8EA 3M9YA 2TSYA 2QV5A 2Y62A 1EJUC 5BWAA 5A8GA 2PGFA 3RM9A 4Z42C 3WELA 1XLJA 4YCPA 4D6IA 3RHGA 1E6PA 1XLIA 4BI7A 2J7BA 1RVGA 3WIJA 3PSWA 3QF0A 3R79A 2XIBA 3S4TA 3T40A 4Y8FA 1I2NA 2I57A 4A4AA 1JYVA 1FWEC 5CBJA 1VJZA 1MVYA 1ONRA 1QBAA 4W7WA 4MB1A 1RD6A 2MNRA 1VFHA 1ZQ5A 4XUGA 1EA0A 1MW1A 1OHLA 1IIGA 1TTQA 4HNNA 1QASA 4GYJA 1E3XA 1ZALA 2PLJA 1MW0A 4GZEA 4JTGA 1S2UA 1F76A 4MFEA 3FJ4A 5E9AA 3DHPA 3ITLA 3KVKA 1O5RA 1PTAA 5B7YA 5G2IA 1ZHAA 4CEUC 1I0DA 4OBRA 5GQBA 3S2NA 4M81A 4F0KA 3UCCA 3ZJKA 1ADSA 4LAOA 1NOWA 1UWSA 1TR9A 2PP0A 1G7UA 3TYZA 3QKEA 2IUZA 3KOXA 3EKZA 4GYKA 5ABEA 4PTNA 3M0IA 3T08A 3SGGA 4JTHA 4R27A 2MUCA 4J5NA 3KZSA 3LI1A 3VYLA 3JS3A 1XPGA 2V38A 1HW6A 1C8YA 3S2LA 5EGRA 3TC3A 1TV4A 3A23A 4WR3A 3KE0A 5BU9A 5FF7A 5C9RA 1O5QA 1XPYA 1XW8A 4QE5A 2E9BA 3MHFA 2PLKA 3CAWA 4OE7A 2QV4A 2FZBA 4LBRA 3HV9A 3HPFA 4O4WA 1K3UA 4C6OA 4C6CA 4PRTA 2Y63A 4KRZA 2IQTA 3IAPA 4GY1A 2HPIA 3W22A 4XIAA 2GUUA 2D73A 5I3IA 2J7CA 2WMFA 4IQLA 3CU2A 1K7EA 1KM1A 3W6MA 5HR6A 4PA8A 5G4EA 1EBGA 5IDZA 2OWCA 3WQVA 5CAKA 3QPEA 2NQZA 3BLLA 2QAFA 3HJZA 3VOCA 4C6BA 1U1UA 1NEYA 3WD3A 4M6QA 1GEHA 2BOFX 4G5DA 3G2GA 4ZQRA 4DF2A 4DBWA 3EMZA 4MTVA 2OEMA 2WVSA 3W2MA 4UQ9A 4IUOA 4CVUA 1O5XA 3A5VA 1EPVA 3H12A 4PMQA 4JHOA 5CC5A 1TCDA 3OG3A 3N29A 4RV8A 2FGBA 1ZJHA 2YR1A 3CB8A 2NSXA 3VOHA 2WCSA 4M8UA 3RM4A 2C71A 3M0KA 1XV8A 5A2CA 3TOPA 3L2MA 1VYSX 4K1GA 1U83A 2YZRA 4EKJA 3CL8A 1BXNA 3KLKA 4K68A 3A4XA 3PAOA 1OSEA 1PEZA 4DB7A 1EFZA 3C8FA <