1VFLA

Adenosine deaminase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title Structural Basis of Compound Recognition by Adenosine Deaminase
pubmed doi rcsb
molecule tags Hydrolase
total genus 148
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2004-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1vflA00
1HZYA 4C6QA 3LNPA 4XAGA 2BB0A 3HM7A 4P5UA 1V7AA 4HK5A 2Z27A 5G4HC 3DC8A 2HNHA 1ITUA 2DVTA 3E38A 3GU1A 2VC7A 3RHGA 3B40A 2O4MA 2DVXA 2WJEA 2Z2BA 1EJWC 4QROA 3DCPA 1YBQA 3E2VA 4B91A 2Z7GA 3UBPC 1FWDC 4DI9A 4RDYA 3OVGA 3FDGA 2P50A 3S2NA 4H9UA 3F4CA 4LCSA 2Z28A 4RZBA 1GKRA 3A3XA 4F0RA 1J6PA 4HA0A 5E5CA 3PANA 2A3LA 4AC7C 2AQOA 1E9ZB 4B90A 3AUOA 1IE7C 4QRNA 1ZZMA 1RA0A 2WJDA 2F6KA 2O4QA 3S2LA 3PAOA 4DO7A 4DI8A 2ZC1A 1ONWA 3MKVA 4AQLA 4Z42C 4HJWA 4PBFA 3URAA 2HBVA 4WHBA 4CEUC 1XGEA 2PLMA 1R9XA 2VM8A 1K1DA 1O5RA 3EGJA 4LAKA 3LGDA 4KEVA 4IGMA 3WYZA 3A3WA 4IG2B 5HMDA 5FSEC 5CH9A 3JZEA 2G3FA 1EZ2A 1M68A 1J6OA 4D8LA 4IFKB 2VC5A 2D2JA 4GBDA 1EJXC 2OGJA 3WZ0E 1NDYA 3LY0A 3B0YA 2RAGA 1BF6A 3QY8A 3TN3A 1FWHC 3SFWA 1A4LA 2R1PA 1A5MC 4GOAA 1P6BA 3GRIA 4MUPA 3MPGA 4XD4A 4GX8A 4ICMA 3TNBA 2Q09A 4WGXA 1UIPA 2QVNA 2PGRA 3DUGA 3OU8A 4L9XA 1J79A 3C86A 3D6NA 4PCPA 1A5NC 4G7EA 2Z25A 4H9TA 2FVKA 1PSCA 3LS9A 4EP8C 4GK8A 3AU6A 3A4JA 3T81A 2YZ5A 3F2BA 1FWJC 1NDVA 3SO7A 4C5YA 4C6EA 1PTAA 2QS8A 4G7EB 4DIAA 4UB9A 2R1NA 4I6VA 4H9YA 5HMFA 4J5NA 4GYFA 4GC3A 3RCMA 1R9YA 3QY7A 4XAFA 3O0FA 3TN5A 2UBPC 3S2JA 5LXXA 2YXOA 1POJA 3MJMA 3URQA 2PGFA 3BE7A 4IGNA 3UR2A 3F2CA 3F4DA 3E0FA 3IRSA 3ORWA 2HQAA 2R1MA 4IFOA 1YIXA 2I5GA 1KRAC 1YMYA 3K4WA 1EF2A 5AKQA 2AMXA 3GIQA 1FWBC 3LGGA 1POKA 2I9UA 3ITCA 3QGAC 1KCXA 4QSFA 4LEFA 4LCRA 4C6LA 4TQTA 4V1YA 1YBQB 4CNSA 2Y1HA 4C6DA 2Z2AA 3ID7A 2D2HA 1RK6A 2E25A 4GX9A 3OJGA 3UPMA 3LA4A 1UIOA 4ERAA 4C6NA 2R1KA 4PE8A 3F2DA 1YRRA 3B0XA 2VHLA 2Z26A 3WMLA 4LFYA 3T8LA 3N2CA 4KERA 4H9VA 3UF9A 3HTWA 4RE0A 4H9ZA 2ADAA 1M65A 3MVIA 1S3TC 3PNUA 4J2MA 2Z4GA 1WXYA 1FWCC 3GTFA 4E3TA 2EG6A 4XD5A 3LU2A 4PCNA 1K6WA 2OODA 4C6CA 4EPKA 4LANA 3HPAA 1FWFC 4YIWA 4ERGA 4OFCA 1JGMA 3AU2A 2GWGA 4LCQA 4IF2A 4KEZA 2GSEA 4DLFA 4LH8A 5HMEA 1EJSC 1V51A 3E3HA 1RJRA 3TN4A 4H00A 4B3ZA 1M7JA 1V79A 2FVMA 3LSCA 4JOMA 3KM8A 1QW7A 2XIOA 2P53A 4J35A 3IJ6A 1J5SA 3E0LA 3GUWA 3T1GA 1UBPC 4H9XA 4LALA 4WVXA 3URNA 1YNYA 1KRBC 4RDWA 4M51A 4RDVA 1RK5A 1FKWA 2UZ9A 2AQVA 4CNTA 1DPMA 1I0DA 4ZSTA 4CQCA 1WXZA 1QXLA 4DNMA 2EG8A 1UMLA 4GY1A 1RJQA 3MDWA 4C6IA 4CEXC 4I6KA 3ICJA 4C6JA 2YB1A 4QTGA 3S4TA 2IMRA 2PAJA 4C6PA 3QGKC 4NP7A 2PUZA 2E1WA 4LAOA 4GZ7A 4KEUA 1P1MA 4HK6A 2QT3A 4C6KA 3OOQA 1NFGA 4R85A 4BJHA 2Z24A 4C6MA 3IPWA 2QPXA 4XD3A 2HPMA 3PNZA 3GTHA 3GTIA 1EJRC 4ERIA 1GKQA 2GWNA 1FWGC 3V7PA 3RYSA 2HBXA 2WM1A 4GY7A 3OQEA 4KETA 4DZIA 3MTWA 4GY0A 2WJFA 3IGHX 2Z29A 2ANUA 2Z00A 3MSRA 4EPBC 1W1IE 1EJTC 3GU2A 3NEHA 3E74A 1A5LC 2CZVA 3GIPA 4QS6A 2OB3A 3EWCA 1KRCC 1KRMA 3QY6A 4KIRA 1PO9A 1RA5A 4GXWA 4BY3A 2FTYA 4G2DA 4ZSUA 4NI8A 1FWIC 2FTWA 3FDKA 4IH3A 1V77A 4DLMA 4C5ZA 4DYKA 1XRFA 4IG2A 1A5KC 1E9YB 4KQNA 2HPIA 3CJPA 3NURA 4F0LA 1K70A 3G77A 3OODA 2GZXA 4IFKA 2KAUC 3MVTA 4NG3A 3NQBA 3PBMA 4R7WA 2VR2A 3IACA 1ITQA 1XWYA 4INFA 5A6TC 3CS2A 4KF1A 3O7UA 3URBA 1R9ZA 1P6CA 1RJPA 3GU9A 1XRTA 3R0DA 1PB0A 4C65A 4EPEC 4LAMA 3LSBA 1V4YA 1O12A 2ICSA 3MDUA 3TN6A 2D2GA 4IFRA 2EG7A 3RN6A 4PBEA 1A5OC 4C6FA 4V1XA 1EJVC 4HK7A 2YB4A 4XAZA 3CAKA 4RDZA 4R88A 2DVUA 3K2GA 2FFIA 1EJUC 4BKNA 1FWAC 4CNUA 4XAYA 1NDZA 4F0SA 1VFLA 3ISIX 4IQJA 1EYWA 2BGNE 5FSDC 4CQDA 3FEQA 1GKPA 1I0BA 1FKXA 4H01A 2W9MA 1NDWA 3GG7A 3K5XA 2VUNA 3GTXA 4C60A 4DZHA 4C6BA 2Q01A 1ADDA 2R1LA 4EPDC 3IARA 4KESA 4L6DA 4UBPC 3EWDA 4XD6A 1ONXA 1FWEC 3IV8A 1A4MA 4QS5A 4H9MA 3UR5A 4C6OA 4CQBA 4B92A 2OOFA 2GOKA 1RAKA 3S2MA 2OQLA
chains in the Genus database with same CATH superfamily
2H3BA 2VELA 2XUCA 3PBUA 4LBRA 3GE7A 2A0NA 2E6FA 2C15A 3VZYA 3W7JA 3TQKA 3TW7A 3B06A 1E1CA 1ISXA 4WSKA 1WUEA 2WSQA 2QNEA 2QCDA 3ARTA 1VRXA 1KW1A 3GO2A 4MJ2A 3CIXA 1SU5A 1FCBA 3GUGA 3G8RA 1JPKA 4F0RA 3BSHA 4QEEA 3TC3A 4DM2A 1WDPA 2ISDA 3K1DA 4O17A 3WLPA 4DJFD 3BH4A 1CXIA 2WJDA 3U7BA 3AIVA 3PAOA 1LF1A 3VD3A 2HMCA 2CZEA 3MKVA 1VBGA 4IP5A 3TJLA 1AUSL 4Z42C 4HJWA 3URAA 4AB4A 1XUZA 3D46A 1K7EA 3BOFA 1XCWA 4MDPA 4HOWA 4TX6A 2VEPA 4FF7A 4MPKA 2V82A 3EWBX 3PZNA 4Y8FA 1EJXC 4AIOA 2XIMA 3ABSA 2VZVA 5I6SA 1VFTA 4A3RA 2FZ8A 3V5CA 5GVJA 4R33A 1CB7B 4DJFA 4NRRA 4HQVA 4JR5A 4GFIA 3EPMA 3PUEA 1S2WA 1X38A 2INFA 5E0FA 5BOFA 5T9CE 2GQAA 1YX1A 4XZ9A 2CETA 5HDRA 2ZRWA 3GYEA 2GGJA 3MBFA 1NDVA 4NKCA 2C14A 1XG3A 3T0AA 1GCYA 3VZXA 1F4AA 1I2NA 5DLCA 2W27A 4TVDA 2O9OA 3SB0A 3UEQA 2GQ3A 5E70A 3H22A 3NAVA 3GHTA 4MY9A 4O52A 1CXEA 1EH9A 4P7RA 4K6AA 4N6EA 3W9ZA 4C7GA 1GVEA 2QJHA 5E0CA 2X1UA 1H50A 1OX6A 2XH4A 1JZ4A 2AMGA 3BOXA 4Q8VA 5C7VA 1DJHA 4XIMA 4IGNA 4A2SA 1RUSA 2ZZ2A 4O12A 4AYGA 3WH8A 3LI1A 2OT1A 3KCLA 1OADA 3E0IA 4FNTA 4D72A 5D4YA 5CCZA 5TIMA 4HNUA 1UA3A 2OSXA 3CZKA 4FOUA 4Q8OA 5FAJA 4QSFA 2A2IA 4LEFA 2ZTKA 2QGHA 3P80A 3VDHA 3FHQA 2GJRA 1K9DA 1EGVA 1XF0A 4FSAA 3MMDA 4O1EA 4W4QA 1KV5A 2BXVA 1VD6A 3F5JA 1O5QA 3N19B 1XIBA 1DWAM 4J3UA 2PSNA 1AW1A 4BI6A 3CHVA 3ZOAA 4ADUA 4J2MA 4LUIA 1FOBA 1PZ2A 4XD5A 4ZB5A 2G3NA 1VIWA 5GJPA 4MYAA 1HF6A 1PZ3A 2NQLA 5G5IA 4HNVA 3EA3A 2W4XA 2VUYA 1W31A 4IQEA 3PP7A 3COTA 3IJ8A 1WBJA 1JCNA 1NP2A 4N4PA 2Q8XA 1C8XA 3MU7A 4M1RA 1E43A 3TFXA 5B7ZA 4AMCA 3RO6A 2B0MA 1HGWA 2C1HA 1P5BA 2CWXA 1XLEA 4QE4A 4IMDA 3WN6A 4KBXA 1YNYA 1HFBA 1LUCA 1PAMA 3KWSA 4QEHA 3VKCA 4V15A 1VFHA 3GB6A 3VUPA 1QXLA 3LXCA 3PBWA 1ML1A 2B4GA 5AC6A 2AOSA 1E6PA 1R87A 4TXEA 5EBAA 2E1WA 2ISWA 3WFLA 4GI8A 5DELA 2EKCA 4H41A 3N2MA 2Z7KA 3UYIA 3KHJA 4LUJA 2QPXA 4XZIA 3GTHA 1JJKA 3A4WA 2E28A 4Q8QA 1ZGDA 2C18A 4HTBA 3RYSA 2TMDA 2WJFA 1AMYA 3IGHX 1IWAA 4PEEA 1DOSA 1X8FA 4PUJA 4GYPA 4JQ1A 2QAPA 3WNNA 1BHGA 1ICPA 4J3WA 2DPEA 2Y62A 2PC4A 4FO4A 3BLLA 4FXFA 5D05A 4N42A 4ILSA 2ZUTA 1TV2A 2VEKA 1T40A 5JH1A 4LC6A 4XB3A 3KS5A 3CAWA 3CQHA 1W17A 3RM9A 1Q6FA 1GQKA 1LWHA 3TZFA 4P7NA 3AALA 5DCDA 1FWTA 1N2VA 5DMNA 5GPRA 2XN0A 3SCWA 1BAGA 4HMEA 3S42A 3MKCA 3S6OA 3C2YA 1ZNNA 2QUNA 1QDSA 2XINA 6TAAA 1HT6A 1NSJA 1UQZA 1JVNA 1H3GA 4KT2A 5FF4A 1Y0EA 3D47A 4O13A 1ZENA 1NOWA 1C8VA 1ITXA 4CCZA 4CD7A 2O7QA 4Z2JA 2Q3RA 3KTSA 5AHLA 2D2GA 7PTDA 1G4SA 1W37A 2YBUA 4HMCA 4GD0A 3AMGA 1YEYA 3IUIA 4RDZA 4LV4A 4HPNA 1JAKA 3ALFA 1H4PA 3GBDA 3LB0A 3ABZA 3NPUA 1SMAA 2O56A 1QO5A 3TMLA 1HP5A 3QTGA 3A9BA 5I0DA 1LOSA 4NAEA 1L9WA 3NXLA 5F1UA 3BAKA 2WVUA 5EBUA 4O8AA 3N11A 1VAHA 2PDKA 4CQBA 3VGEA 4CUCA 5AVNA 1XLKA 1IR2A 3R8HA 3RPMA 1T6MA 1EF3A 3CQJA 4K38A 4XAGA 1XLIA 4PTXA 4P5UA 3E2SA 5G2HA 2OX4A 3ZLHA 4HNOA 5C0QA 4K68A 3TCEA 3KOWA 1KTCA 2WOQA 2Q6ZA 4JICA 5F4XA 3AIQA 3VOGA 1YW1A 4ML9A 1TWZA 1H7OA 3REQB 3W73A 3PS7A 3BLFA 3RF9A 2NSOA 3MW7A 5EU9A 1EQCA 1I6NA 1I8JA 3AAMA 3S2LA 3A3HA 2XDFA 1LL6A 2GVLA 3CQKA 4YHGA 3WMSA 3TWAA 1KD0A 3LPOA 1K1DA 1O5RA 3DBPA 5FSEC 3NTYA 2WQPA 3AJ7A 4QLKA 4XSMA 1J11A 2OEJA 1W0MA 4EWJA 4B4HA 1ITCA 3WZ0E 3NJ3A 2V63A 4IGSA 3I7SA 3F7JA 1T7LA 1V3JA 1P0EA 1CLXA 4FOKA 4GOAA 3FAXA 4MUPA 3CUGA 1W9XA 1BYBA 3CWOX 1W3LA 1UZHA 2Q09A 2WKGA 2YCJA 3VM7A 1K6AA 2WMHA 4L9XA 1W5QA 3B4YA 4YMZA 3ZR5A 1NEYA 4HA4A 4HZ8A 1PSCA 4EP8C 4GK8A 3Q45A 1DQXA 3EOOA 3SO7A 1KM3A 4MZ8A 4PTMA 3NSNA 3GC4A 3TE9A 1UG6A 2D0HA 1Q6OA 1MRQA 3VX0A 3K8KA 2EO7A 3TYZA 4GC3A 4J4KA 3Q37A 1PX8A 3TU9A 1LCOA 3ZJ7A 1R30A 4UCGA 1JUEA 4W8LA 3LRMA 1OT2A 4JKLA 3VOCA 2HQAA 3PB2A 3VIPA 4JTFA 3NR0A 1TTIA 1PTDA 2YL9A 1ZBWA 3PWIA 2XVLA 4GABA 4M6PA 3OQ8A 1V6XA 3AZTA 3UPMA 1TG7A 2OGYA 2JGYA 2CCRA 4BQ4A 3F2DA 4LUTA 3MP4A 4FLQA 1E15A 2AL1A 2XHYA 2XVNA 1IIHA 4H9VA 3BTNA 4UQEA 1BGGA 4RE0A 1RQHA 4MNKA 1QNQA 4K2SA 3NL3A 2QCFA 1AJ2A 1E9LA 2NV1A 1E3ZA 4C1NB 4HGXA 3C6CA 3ZYZA 2D2OA 3QV8A 3MCOA 3T2QA 1HG3A 1PCWA 2QW5A 5LA2A 4OFCA 2J79A 4PEKA 1OCBA 4LEQA 1HJXA 1R5YA 4AZIA 3GAYA 2P3EA 2PU1A 5RUBA 2V5JA 4MTVA 2XM2A 1U5HA 2X05A 1YLVA 1LWIA 3G3MA 4KWOA 1B5TA 3URNA 3AXHA 2DP3A 3EB3A 3WUBA 5BXPA 2Q8ZA 1OFDA 3SUWA 3B4UA 3UXAA 2D0FA 4E2OA 3KL5A 2UY4A 1DXFA 1RLDA 1X1OA 5M5DA 1O5KA 4Q4PA 2HWGA 3IJIA 2IMRA 4QISA 2J9YA 2PLJA 1F8MA 1W1B1 5D2WA 4CVWA 1QK0A 4HNCA 3NSXA 1LT7A 2OEKA 4N4QA 5D02A 4HK6A 5G2IA 1VGAA 3M0HA 3OPSA 4BJHA 4CD6A 4AY8A 3WQPA 3H21A 3PNZA 1O6IA 5T91A 1QI0A 3PFMA 2V30A 2OO6A 5JUVA 3BCFA 1SFSA 5A6MA 1LTDA 3MTWA 3WLMA 3WBXA 2Y6ZA 4HIBA 4O4WA 3KDNA 3HMCA 2W62A 1QRQA 5BRPA 4N02A 1Q65A 5FL1A 3U2OA 1R7AA 1LBMA 3FKRA 1HL8A 2QPSA 4M24A 4ACYA 3H4XA 5FAGA 3M0JA 2YIHA 4ZXLA 4WXYA 4H2CA 1KA9F 4GXWA 1JRCA 4LVDA 3N6JA 1A3HA 3CHDA 4ZSUA 1QI5A 1M7OA 3I3BA 1XIEA 2PRMA 4NZ1A 1C29A 3U0HA 2J24A 1ZS2A 4NXKA 3WF2A 1QPRA 4IG2A 3VNMA 3IIVA 5BXTA 1VFSA 2H90A 2Y70A 5LNWA 2GZXA 3VOFA 3RPTA 2BOEX 3MVTA 2ABAA 4MY8A 4B4FA 1MW0A 1VPQA 4D6EA 3SCUA 3IACA 3RO8A 3BLDA 1J8VA 1KXVA 3PSWA 1UC4A 1OABA 2WMIA 2ACRA 4EF9A 1TVNA 2J6XA 5IHSA 2QJMA 4EF8A 1Z6KA 4MJ4A 5F7UA 3TTQA 1J4EA 5I3HA 4HK7A 3UJSA 4CCEA 3UZXA 3J7HA 1EJUC 1HN1A 3DHDA 4TMCA 2EPHA 3G6MA 1ALDA 1UKQA 3B03A 3P93A 3W2JA 4Z1AA 4M3PA 3SCOA 1GKPA 3LI0A 4DNHA 3HG5A 3NL5A 5JH2A 4K7VA 2DIJA 3STEA 3S5SA 2R82A 1PEZA 5FF3A 2E5CA 2BASA 3G1DA 1W3JA 3L4UA 4NJJA 3MSYA 3NPWA 5AZ0A 4HU8A 1JPMA 3LOTA 1JXKA 1QPKA 3NL6A 4X3ZA 3SW6A 3DXIA 3Q58A 2PTXA 7ODCA 1PCKA 3LXBA 1L2UA 4DY1A 1XCXA 4UQBA 4K36A 2DVXA 3GTNA 1RBAA 3DCPA 1P0NA 1QU4A 3E2VA 3KS6A 2Z7GA 3N2TA 3BMWA 4RDYA 4XBSA 2ZIDA 1CCWB 1E1CB 1XIJA 4UTJA 1QAPA 2Z28A 4Q6JA 4C91A 1ADSA 2B7PA 1HUVA 2A3LA 2QCDB 4ZENA 3WD3A 4ZVJA 3GHUA 2P5NA 3CMGA 4JTCA 2ZC1A 5FL0A 4PZVA 3TTYA 2FGLA 4JQAA 4FEZA 2J75A 5E93A 1XYZA 3VC5A 1RY0A 4KCVA 4IFKB 2NX3A 3IK4A 3LY0A 4M6VA 4NUWA 3VIGA 1BF6A 3GDTA 2BVTA 5LYRA 4PRRA 4S38A 3WFZA 4RCXA 1HKVA 3RNDA 4AZCB 3V1PA 2EPNA 2VGBA 4JDBA 1GJUA 3AIWA 3G5EA 1V7YA 3ALGA 4DHGA 4PCSA 3EX3A 3ARWA 5I00A 2IKHA 2QVNA 1W56A 3ANYA 4GLEA 1J96A 1F3TA 1XLLA 2J4GA 1TV8A 1MW1A 3LTSA 2XTKA 1W5OA 4IUGA 1CXKA 4LYKA 1DIOA 5M2FX 4O15A 1SSGA 3TC6A 2E5BA 1RCOB 3HURA 3B05A 4ZTYA 4Y9MA 5A6BD 3RRAA 3RG6A 3CH0A 2J8FA 3PJUA 1K03A 3UWYA 5FEXA 1JD9A 3W25A 3VI2A 5JXQA 1Z41A 3URQA 1LZOA 5IM51 3BE7A 3RR1A 1JF5A 1MZRA 3VIIA 3IVTA 3AOFA 3C2OA 1V0NA 4AXKA 1UWIA 2AMXA 1UKTA 1MUCA 3HMJG 4JTGA 4P7QA 3I6EA 7ENLA 1KCXA 4OTKA 3OLIA 3PK7A 1JNDA 1VPYA 4JX6A 3KTCA 1RK6A 1VLWA 4AWSA 1GJPA 3FN9A 2CXGA 4C6NA 1B3YA 3OZMA 3WMLA 1RPKA 2E9LA 2ZUUA 4ATDA 3ABQA 3CMFA 3UXIA 2YZRA 2BXZA 4OKDA 1UWAA 3O9NA 1BG4A 3HQ1A 4AHQA 3B9DA 1B0IA 3IVUA 2Y7GA 1OD8A 1CTNA 3WBWA 2X1IA 1H60A 4LTSA 2OODA 4JTLA 2WSKA 1EQPA 2C1GA 3ITLA 1S5TA 5U4NA 4UTMA 2WNNA 1E55A 4HNLA 5LA0A 2JALA 5LKYA 3MY9A 5D9MA 3HB9A 3PPCA 1IXQA 4D8ZA 2J88A 3FVMA 3UWVA 3NSMA 1JNEA 1F8IA 4O0QA 3EDKA 4GQGA 2RGLA 5CPOA 5A8GA 6ALDA 3GUWA 4US6A 1VYSX 3WELA 1AJZA 1O1HA 2Y8UA 3V4BA 3FX4A 1GHRA 1S5NA 1TV3A 2I5IA 3WNOA 1XC4A 1DJIA 3C61A 4ZEPA 5BYWA 5T8GA 5HWJA 4H2HA 2XGIA 1LUCB 3AWOA 3GDBA 3CYVA 3S1VA 2WAGA 4A3QA 4B9ZA 2I14A 4JFVA 4RXFA 3W1NA 3LBCA 1CNVA 3V75A 4GZ7A 3OOQA 4HNNA 3RDKA 4NL1A 1H51A 4C6MA 2GPTA 1L6FA 1XD0A 2QMKA 3H55A 1FWSA 3NDYA 4S3CA 5I07A 1Z8AA 1KFKA 3W70A 4GY7A 3H53A 3PTKA 5LA1A 4E4FA 3AI0A 3QHOA 1Q6EA 2J7FA 4EPBC 3IGXA 1ISWA 3E74A 1H1ZA 4JTJA 2UY2A 2LLEA 1G4PA 4J1OA 2PB1A 2GGIA 3L4ZA 4S3DA 3OLEA 1XICA 1KRCC 3NO5A 3LM7A 4JEQA 2ESCA 1KCLA 4QNWA 2XN2A 4CNNA 5HK4A 2FFCA 2I5QA 2PDBA 3CLWA 2PMQA 3GXIA 4GGBA 1QHPA 3BAWA 4JYDA 1Z89A 3CBWA 1SW7A 3P60A 5FJRA 4MLRA 5GJMA 4FP1A 3T2PA 1Z3NA 1H2JA 2GL5A 4HVXA 4UUIA 2H8ZA 2YYTA 2XPKA 3WQGA 3AYSA 1GG1A 2A6LA 4NG3A 1N8IA 2NUXA 5EA9A 4A4AA 1FCQA 3CS2A 1C92A 3O7UA 1K7FA 5JIWA 1EDTA 4NNCA 4HU0A 3GXFA 1X96A 4ZQRA 2Q3OA 2VO5A 1TRIA 4S3JA 3S9IA 3UVAA 1U83A 4ZE4A 2NQ5A 3THQA 3WJZA 3O1NA 4XK2A 3IJLA 1VFLA 1EIBA 3N29A 1A0EA 1D8CA 1EYWA 3EX2A 3JS3A 1PWMA 2BHZA 1TE6A 3EWUA 4KRTA 1UPPA 4GCXA 5DT7A 3RRXA 1TUFA 2D73A 2ZX8A 4C60A 3TWBA 1OFEA 1M5WA 2WPGA 5CPSA 2OLAA 3T2OA 3VDCA 5I3FA 4AZHA 3RX2A 2GJPA 1FWEC 1TQXA 3ITTA 3C0SA 2CLOA 1K02A 3W7CA 3GG1A 1SM9A 2X09A 4K37A 2D22A 3BJSA 4FXSA 2Z27A 3L66A 5LHEA 3DC8A 1EP2A 4DJFC 4UTTA 2QCCA 3CPGA 3PUDA 2BOFX 2VENA 3B9OA 3AYVA 3PZIA 3VAVA 1JDFA 3DI0A 3NIYA 3MWAA 4CQAA 3WBEA 4EXAA 3A23A 3E5BA 2YA0A 3N14A 3QRHA 5ECVA 3IIZA 5XIMA 4EAMA 4ATWA 3B9AA 1IWPA 1JYNA 1WZAA 2OQYA 2Q71A 3PWGA 4JTUA 4M19A 4U10A 1UKSA 3QEZA 3W1MA 3DEQA 3O15A 3W22A 1ZZMA 1XS2A 4GYKA 3FEMA 4B2DA 2JGQA 1H7RA 2NWSA 3CTLA 4AQLA 2W6RA 3KZSA 4NZFA 2NLIA 1XGEA 3VIJA 3HJEA 3E6EA 3EXSA 2BHYA 2IXUA 3N9RA 4DUXA 2HISA 1H1NA 2CLFA 1JDAA 3CB8A 2Y7FA 4Q4OA 3OLDA 4AAJA 1FWHC 5F2GA 1J0IA 4YWIA 4NASA 2PF0A 2QQ6A 1FWNA 4NZ3A 4DN1A 3OZOA 2FPTA 1UUOA 1U1JA 1W8GA 3W23A 2F7FA 2JBMA 4M6UA 3BMVA 1GT8A 4M81A 4GI4A 4BEUA 2VNCA 5D03A 3B8IA 4UFHA 4NI3A 2J77A 3WQOA 4EE9A 2HTMA 6REQA 4EXQA 1YNQA 2I7GA 2WC3A 1BYDA 3QH2A 4D6GA 3DC0A 4YL2A 4MKNA 4AFYA 1TKKA 2VFIA 2XVKA 1OFQA 2DV0A 1VLIA 4JL2A 2ZE3A 4WJXA 1TJRA 2FVLA 2QMJA 2INEA 1VF8A 1REQA 5AY7A 3IGSA 4L64A 5HA7A 1IEWA 3M41A 4YN5A 1R9YA 2BV9A 1NP0A 4EKJA 3IJ7A 4GJ1A 1WDRA 3N2XA 3EOLA 1HL9A 2QUVA 4Q7NA 1NU5A 2DGAA 5IFPA 2E77A 2ZZ6A 2YA1A 2ZA2A 4BF5A 4KEMA 1UKOA 2FGBA 2AAAA 1L6GA 4EWND 1YIXA 4JFWA 1W2PA 1YMYA 1XBXA 1J0JA 3W1UA 1WKYA 2HS8A 3UNDA 2Z6JA 1UR0A 3K30A 3GX9A 4XZBA 3HQOA 2YDSA 3UWQA 1ZP3A 3ARZA 3S47A 3NQ8A 3ID7A 5CPNA 1W3KA 5LIWX 2QCHA 4DYJA 4ERAA 3SRDA 1TR1A 5A8QA 1JUKA 3B9NA 4N9DA 1XQLA 3H24A 2GJXA 3P67A 1QUMA 1TYGA 4XKYA 2PURA 1ZSXA 2WZIA 4LUTB 3EAUA 2MNRA 1QPOA 3DN5A 4F9DA 1KFWA 4TTUA 2ZVIA 3PNUA 4HCHA 4ZO8A 3DGRA 5HULA 2PC8A 3EDEA 1CECA 4LAUA 3T09A 4AD2A 3WK2A 7TAAA 3HPAA 3STFA 1R3SA 2A79A 4FAMA 9CGTA 3H4GA 4G1NA 2PDFA 2YKKA 4QM1A 3GG8A 5CBIA 1VFUA 4AX6A 4FLSA 4N9CA 4Y7EA 4AIEA 1O68A 4GYPC 3W7NA 1D3GA 3S5NA 5H8MA 4HZ7A 5AYBA 3G0UA 3L4TA 2GSJA 3T55A 4ROPA 1U22A 4CN4A 1TWDA 2PU0A 2EQDA 5KMYA 3WKZA 1CGVA 2WV8A 1SO4A 3CUJA 1WOAA 4DX3A 5I3DA 1PV8A 2FB2A 1BTMA 3WG6A 3W1TA 3ATYA 4DJDD 3LX9A 2PGEA 2AAMA 1QO2A 2FIQA 4QTGA 4NX5A 1MQRA 4LAOA 3SY8A 4PCFA 2YXXA 1AW2A 3BW3A 5I2UA 2YDAA 5FJJA 3WQ6A 4LS0A 1UJPA 4MADA 4ADTA 4KFOA 4WDUA 3H26A 3GTIA 4IPNB 4Z17A 3RLVA 2J78A 4ERIA 3ANVA 5CLWA 2WM1A 1S2UA 3VK5A 2WLYA 2X2YA 1NWRA 2WLZA 2WVVB 3MMTA 3L4VA 2PP0A 3AXKA 2WC7A 4UTFA 1TTJA 1C3FA 3BW2A 1ZLPA 4Q8UA 4POCA 5AFDA 3AJXA 1VP5A 3NVDA 2VP8A 1GVQA 4J3TA 4QP0A 2FTYA 1T8XA 1CIUA 4NI8A 4CN1A 4K8EA 3N2BA 2Z1BA 3GHSA 1US3A 1V77A 5F2IA 2BXYA 5IDZA 4ZOBA 5A95A 2X30A 3HGOA 4LV9A 3WLSA 3TH6A 4LC8A 2HE8A 3PZMA 5HR7A 4R7WA 3GG0A 2VC6A 3NQVA 1XWYA 3SADA 1RR2A 1S3HA 3W71A 3WCZA 5EFDA 3G6LA 2QVHA 3LV6A 4GVHA 2OKOA 4I5XA 1IZCA 2DZXA 3LLDA 4RK8A 1AZ2A 3W7QA 1R8LA 3U2ZA 1R2TA 4FA3A 3GQYA 2WMIB 3ZMRA 4AZBA 3UY7A 3S6DA 4BKNA 1W5NA 4DB7A 5A2CA 3U2CA 3TZNA 3WO8A 4Q4SA 4LF2A 3SN0A 3VNIA 1I0BA 2A7RA 2Y5EA 1NDWA 4GWEA 4V28A 2P8BA 1Q13A 2JFEX 1WKFA 2Q01A 1E71M 3H8AA 1JZ2A 4KESA 2WSPA 4U4MA 4UMCA 4PMYA 2WB5A 4MLJA 4RLIA 2CW6A 4CNPA 4H04A 1Q63A 1N55A 1ZAIA 3V5FA 1IT8A 1UBSA 5A8OA 3W2LA 3C2VA 1OIFA 3CM4A 3DKLA 5A6LA 1O94A 4GG9A 1AQHA 2X7WA 1OHLA 4ZB0A 3UA4A 1FHDA 1B54A 4JKMA 4WK9A 1UD8A 3LLXA 4IJCA 3T9PA 3OVGA 1FDJA 2DQWA 2RHGA 3DECA 5HPOA 1Q7QA 1NOUA 3H70A 1GOQA 4JTTA 2XJ7A 2INZA 4ZB2A 4AC7C 2DIEA 3UP8A 3L0GA 2DT3A 2O4QA 1A5CA 1KBJA 3EWZA 3HGRA 4KMQA 2RFGA 2IQTA 3QTPA 4J2PA 1QI4A 3VNZA 3W2UA 1JFHA 2VM8A 3POCA 4KEVA 4AWUA 3A3WA 3PZUA 1C91A 3VD9A 3P8IA 1O60A 3M5ZA 3JZEA 1VEOA 4M82A 4WR3A 1A0CA 1LT8A 1TIMA 1IZKA 3IJ9A 4JY9A 3ITYA 3SFWA 1EWDA 3U8GA 4AEFA 2VRKA 1ZCCA 1CGTA 1KFJA 5I03A 3G24A 5AHNA 4WOZA 4O19A 5ENLA 4LU0A 5BWFA 3E02A 2E67A 5E0KA 1W1ZA 4MPQA 5DF0A 1L6YA 4Q33A 1J79A 4FNSA 1CGUA 5IXEA 5D2TA 2Z25A 4KGJA 2FZ9A 5C2GA 4MSSA 1HQTA 3TVAA 3DX5A 5K4XA 4UOQA 4C6EA 3TYBA 1X7IA 3CZEA 1V02A 2I17A 1YDNA 1DJGA 2V3DA 2WMKA 1D8WA 2VX4A 2AGKA 5BXSA 2JEPA 4ZQOA 3O2LA 2NVAA 3QMTA 3B0VC 4QHRA 5EYWA 2ZRZA 4XAFA 4IQLA 3GYCA 1RP8A 2PDCA 3H2AA 6PTDA 4BWLA 1YXCA 3AMLA 4NNBA 1WOBA 2DT0A 2EHHA 4HKPA 2VDHA 3WJYA 3U4FA 1EBHA 3NNTA 3MO4A 2HVMA 4HOZA 1BKHA 4L7ZA 3GXPA 4FIRA 1NFPA 3W1PA 1KBBA 2YPIA 4HN4A 2G95A 4UR7A 4GUIA 4AF0A 3M5YA 1SJDA 8XIAA 2DZWA 3GXNA 3N2CA 3NZGA 5CC7A 3WX7A 4B5XA 1FY6A 1AL7A 4RE3A 4F0HA 3ARXA 3L23A 3G8EA 3FOKA 3KOYA 3W7EA 4Q8TA 2CLEA 1X6LA 3GTFA 4XIAA 2PEVA 3LU2A 4ZO6A 3DYPA 3LZ3A 3GWQA 4L6HA 1XV8A 3S2CA 3WUFA 3K13A 1FWRA 3C0LA 1R86A 3QQWA 3ZFHA 1JGMA 2YFOA 3WQWA 1JCTA 3E3HA 1IZJA 1SZFA 1S5MA 2OR2A 4IT1A 4EAYA 2QCEA 3GFZA 3TTEA 1SO6A 4MNMA 3ARYA 1Q45A 1W9BM 5LNSA 1JI2A 1Q6QA 3GFYA 4LALA 4GVFA 4MB3A 3MP3A 2AQVA 3EKLA 3NQGA 1I0DA 1EC8A 3CTTA 1WCGA 3TUUA 3EKGA 1WV2A 1SW3A 1D2KA 3N34A 4QDWA 3PZOA 5TBOA 3EBVA 3ICJA 1UD3A 4UNKA 4B9YA 2ZX6A 3MCNA 1JYVA 4XSLA 3BJTA 3UCQA 3W26A 3ZWSA 1TJ2A 3NM3A 2C19A 3WJWA 1MZHA 2OWXA 4JTQA 1GOIA 1I2PA 3G3DA 3GZAA 1OF8A 2DZTA 3BGJA 5B7YA 2HVNA 3FXYA 4UZUA 2HBXA 4PTWA 3H23A 2ATSA 5C2CA 4TX9A 4PGLA 3WK0A 3FY1A 4JS3A 1RQEA 2I16A 1W5PA 2QDHA 3DHFA 3HIJA 3PAJA 3TNOA 2C8NA 2PDGA 1EPVA 1V0LA 2A3EA 3QY6A 1XSKA 3A24A 2HXUA 1EOMA 3C4UA 4G2DA 2J9XA 8TIMA 3SCNA 1EPXA 2QV5A 3T78A 3MBDA 3SCVA 4UC5A 4DLMA 4W89A 3EA2A 2NT1A 2WKJA 5FF7A 2XVPA 1QT1A 1FXPA 2D23A 4ECLA 1WQ5A 4YTTA 3QV9A 1YNPA 5XINA 2KAUC 4JCLA 1S2CA 3FIGA 3N1AA 2NUYA 2O9PA 3L0NA 5J8LA 2WNWA 4XVEA 3W2NA 1NVMA 3GDKA 3M0VA 3GU9A 1A3WA 3I4KA 3M07A 1NH6A 4ICCX 4GUFA 1EGMA 5FJPA 4I7UA 1NF7A 1YDOA 2JKEA 4ENLA 1AH0A 3E96A 2QF8A 3OYXA 3C5QA 2X1RA 4Z2LA 3S9YA 1XRSA 2BY3A 3S8HA 1CGYA 1B4EA 3BZGA 2WSYA 3KBMA 3KLLA 4MIMA 4F0SA 1YPXA 3H6OA 3TSMA 1L8NA 3WL1A 5HNTA 1HJQA 2NV2A 4JDYA 1I2OA 4JTEA 1UMYA 4UFIA 2W9MA 4X2RA 1K8ZA 3GTXA 2IQ0A 4NZ5A 3OO2A 3MA8A 4KW2A 3WJSA 2BZNA 3A9IA 1KWKA 4NZCA 4IJBA 5HUOA 4CCDA 1GZ1A 2ZZ5A 1CEOA 3O8AA 4JY8A 3HFTA 2X41A 1OINA 3LBMA 1G7VA 5DMYA 2HSAA 3LNPA 3HM7A 4NAFA 2W79A 4JNYA 1G9HA 3SFKA 3WBAA 1KM5A 3GDLA 3LGEA 3PTDA 1XFCA 5EMYA 5H8PA 3AXIA 3P5YA 4PMZA 4I7WA 1IHIA 4REQA 2VZTA 5HNRA 3N15A 1PDYA 4N9EA 2ZZ4A 5E9XA 4XZNX 1TA3A 2R24A 3GR7A 1X98A 1OG0A 5CZTA 1X6UA 1GVSA 4Y6GA 1PIGA 3O63A 1FP9A 1WZLA 4RJEA 1SZGA 4H7VA 3AS0A 4HTYA 4F66A 1MSSA 1EKOA 1J18A 1IXOA 1MQPA 3TV8A 1B3ZA 3RMEA 4GIYA 1ZTVA 1TX0A 1LM1A 1SGJA 2PTDA 4Z2HA 3LGDA 3AHTA 4JTHA 5DMLA 3V36A 1OX5A 3K1GA 5CH9A 1PXGA 4IXHA 5HNNA 1J6OA 3SJ3A 1T5AA 4MMWA 1OGSA 3E0WA 1K8CA 4HT3A 3O16A 2DZVA 3WQ8A 3POHA 3IWPA 5CZ0A 3GRIA 3LG3A 3A5VA 2Z0IA 2BOGX 3UJ2A 1UIPA 3NCOA 3B0UX 3BLIA 4IIEA 2I57A 3R6IA 1SMDA 2ZKMX 1U5JA 1J10A 3EOSA 4G7EA 4GNJA 1KM1A 3WH7A 3JRKA 2ABBA 5TQLA 4NYYA 3RM8A 1TWWA 4M8UA 1XXXA 6REQB 3HPZA 1LLOA 3TA6A 2EPLX 4XO7A 2H3DA 4J5NA 4HNTA 1ODUA 2BWGA 3O06A 5LIKX 1REQB 1XJBA 4WKAA 3W7IA 2EJ1A 5I79A 3M0MA 3VTRA 3WDIA 4H6RA 3EKZA 3HG3A 3TLLA 3IRSA 3NPXA 1VS1A 3DENA 3SI9A 4GMEA 3W81A 3K4WA 1KGUA 3SCSA 1RY8A 2VCAA 1PKYA 3GIQA 3V1HA 2BVDA 3KRBA 4M7TA 5BMWA 2Q8LA 1F73A 3G1VA 3KP1A 2G3IA 3LMYA 5DXYA 8XIMA 4H6EA 3GKFA 4F2UA 1GVRA 4QSHA 4PSRA 4LF1A 4RNFA 4EVZA 4KERA 6XIMA 3W01A 1XLJA 1RD6A 1DHPA 1BWVA 2GJXB 1VZWA 5J04A 1E4NA 2BTMA 2C0HA 4XKYB 1AZ1A 2RJGA 3WDRA 3N3TA 1FWCC 4AD0A 5FF0A 4PYSA 5F2MA 2PDQA 3GVQA 4L1GA 4GH3A 4EPKA 4NIRA 4N9BA 3WBYA 1EL3A 4DQWA 3QW3A 1PDZA 4FR6A 3W84A 4YIWA 1LRTA 1UR4A 5EFFA 2ZZ3A 4IF2A 3GH7A 4PA8A 1F6KA 3WIJA 4B3ZA 4FZIA 4FNRA 4UFLA 3IJ6A 4GZIA 1JEZA 5DCEA 3FNDA 4RPQA 1XPYA 3P2VA 3QR3A 4RDVA 3K4AA 1OJXA 1DPMA 1UUQA 4ZO7A 3GD6A 1ZQ5A 4AD1A 3OP2A 4QCEA 3H7UA 4P8VA 4AD5A 3SAZA 1ZL1A 4ZOEA 3G1RA 3UXDA 5FKYA 2WM0A 1J01A 4WXZA 4WY0F 3NZRA 3TYCA 5C70A 2R14A 2PI6A 4I6KA 5MKGA 2ZCGA 1O66A 4HYWA 3EXTA 4NP7A 3W4RA 5ABFA 5IHRA 4R3UA 1ZBVA 3HV9A 1MVYA 3GK0A 8A3HA 5M1TA 1JG9A 1B3WA 2WK2A 4IL0A 2ISSA 3E5PA 1EDGA 4KETA 4DZIA 5KZEA 2WCAA 2XGZA 3T05A 1S2TA 1CLKA 2VFDA 1UWRA 5A8MA 2PTZA 1XSJA 1BQGA 3GIPA 1HJSA 1XIFA 1PS9A 3BV4A 4V27A 4WY0B 1PKMA 2FHFA 1U1HA 3JW7A 1D7FA 3AIUA 2ZADA 1XPGA 4N7QA 1V08A 2CZFA 1O7AA 5M17A 3D3AA 1B3XA 4DZ5A 3UU0A 4LVAA 4JKKA 3L4WA 1QASA 3LEPA 1E3XA 4LS2A 2DT2A 4JIHA 1DKWA 2X0SA 4URIA 1A5AA 4GQRA 5KSWA 1T96A 2HS6A 4HBKA 1ODZA 4GZJA 4QJ4B 1N8WA 1J0KA 4UTIA 4S3AA 4QG9A 3B8SA 1XM3A 3O3RA 3ZT7A 1SFJA 3TTOA 4INFA 3VGDA 2GLKA 3FA3A 1F6YA 5C9UA 2Z6IA 4U3CA 1B4KA 4H8VA 4EPEC 3MHFA 4ZR8A 3VYLA 1KKRA 4UTTC 4YLWA 4ZBCA 1O12A 2E3ZA 3B8UA 1A5OC 4A3HA 3RCYA 1PVNA 3OBEA 5T9BG 3W2MA 4AYSA 4CNUA 1NDZA 2J7BA 3VFLA 3VKBA 5D8WA 2XIJA 1B2YA 3DIPA 4J3VA 2BGNE 2ZICA 4DO6A 3LHUA 4CQ8A 2O7SA 4Z1CA 3UERA 4Z2GA 1AQMA 5I09A 2WSRA 1TZ7A 4S3EA 1KR1A 1QR7A 3CEPA 3UCCA 1KNWA 5LSMA 1W32A 1RPXA 4GE8A 4CU8A 3MYPA 1A4MA 4QS5A 3EX4A 2OELA 1A47A 5G4WA 2PWUA 1ZJBA 3E1F1 4RL3A 5DQPA 3NXFA 2YCLA 1NAL1 4L6OA 3BLKA 3VMNA 5BWAA 4RE4A 5G4HC 4F4RA 4JGDA 3E38A 4BQ2A 3ZWTA 1PIIA 3RHGA 1JUBA 3ITXA 2O4MA 3BJFA 4LNCA 1QW9A 3OIXA 3BW4A 1UW9A 1UWQA 4CCCA 4IX2A 2E5DA 5CPMA 1MMFA 2J6VA 3GXDA 4TV5A 5AHFA 3NGFA 3SGUA 2NLYA 4RZBA 1J6PA 3PANA 3MZ2A 1XGDA 3USBA 3R12A 3S1XA 1CYGA 1GK8A 1W5MA 3Q94A 4HSNA 2V81A 5I77A 3NQ6A 4A8IA 2YLAA 3N4FA 1GQJA 4Z0JA 2D20A 3SURA 4JCMA 4WKFA 1L8PA 1LROA 1ICQA 1PHQA 4PBFA 2JKPA 4DUOA 3P81A 4U3AA 3GW0A 5CGMA 3MS8A 5D33A 4TTGA 1UR3M 3VDGA 3AZSA 4AVFA 5TF0A 4GBDA 3PUGA 1QWKA 1MUWA 1EEPA 2E9MA 1FUYA 4ORIA 2VX5A 4UTKA 3M0IA 1A5MC 3K8MA 4I9TA 3CU2A 2X8RA 4B3LA 3N3MA 1TELA 2HZGA 2OX1A 5JIPA 1E5NA 3THDA 3EOEA 4ZA0A 4GFSA 1W3NA 2BDQA 3B8DA 4WIWA 3WEMA 4WOQA 3RMJA 1JDDA 3EDJA 4C5YA 1H49A 2DZUA 1HJVA 1QPNA 3OB8A 3SGZA 1VH7A 2R1NA 1XUUA 3AYRA 1UWUA 5A8NA 2NXGA 4H9YA 1LJYA 5G2WA 1ZAJA 1EP3A 3AIEA 3OHIA 4YWSA 4NY2A 1LLZA 2QDDA 5AC8A 4R9OA 2UBPC 2QLYA 1POJA 4DF0A 2V69A 2H6RA 1HGYA 2PWVA 3ZQ9A 2Z2UA 1GGOA 4ORMA 1XDMA 4L56A 2I5GA 2CBIA 4MYXA 1DQUA 2QCLA 5FEPA 3GNXA 4PRTA 2BVWA 4UOZA 4HZMA 1L0PA 1WA3A 1VCVA 2RDWA 2DIKA 3B8VA 4K1GA 5I3JA 1DYSA 3BSMA 4TO8A 4KFNA 4Q8NA 4TVCA 3KEHA 3ZM8A 2PWFA 4U5IA 3BC9A 3CL8A 1DWIM 4H19A 1QNVA 3TIMA 3UF9A 3HTWA 2XZ7A 1QOXA 1NIUA 1XFBA 4AF0B 5CSUA 3LCLA 1S3TC 3OZYA 1OC7A 3KL0A 1KXTA 3DZ1A 2W66A 3H54A 5BNKA 1XH2A 5KZ6A 2CLMA 4DPPA 4Z2KA 3AROA 1A49A 3CK5A 2XG9A 2HK1A 3F03K 5BCAA 2WZHA 1TJPA 3NQEA 2V5BA 1M1BA 4LBSA 5D8ZA 1UH3A 4YVVA 4PMDA 4KCTA 2ALDA 1QBBA 3KOXA 3O6YX 3FW6A 1F3XA 4HD5A 3T4CA 3T1GA 2PLCA 4AY1A 2E40A 1KLZA 5KEZA 3SQMA 3P14A 4Z0SA 1XR2A 4GQBA 1EHNA 3NQ7A 2ZC8A 4H4IA 2RDUA 2IKJA 2VFFA 4NVTA 3VKDA 3R4IA 5HNUA 5A6SA 7REQB 3B3DA 3LM3A 1KBIA 1R7OA 3M7SA 2RJHA 5EB8A 5CBBA 4GYJA 4X9SA 3TAOA 3SUSA 5FACA 4BQ5A 1LBFA 2ALRA 2ZYFA 3BG9A 3H2FA 2A3BA 1C90A 4GPNA 3RK8A 2R9RA 1AW5A 2PRLA 2VYOA 3BGGA 1WBHA 4GKLA 3C0JA 1LDCA 4NHVA 2WZEA 3EWYA 1Q4NX 2VCBA 2GVJA 3IIPA 3STCA 1J2WA 1V02E 2OZTA 1XI3A 4YCOA 3BAXA 4QS6A 1FH9A 2HE5A 3UZ5A 1TMQA 3ZXWA 3CYJA 1GW1A 4A8RA 4CLMA 1E0TA 1GQLA 3GNPA 4BY3A 3Q4DA 5BZAA 2PP3A 2DH3A 2FTWA 1BXBA 3OW1A 3NYZA 4H6QA 2PRHA 2YBVA 2SFPA 2IPJA 5KZDA 4HA3A 3CUXA 1F2JA 1CBGA 3KBJA 3OODA 4IFKA 1TE1A 2C13A 3B97A 3W1LA 1TPDA 4F2TA 2DUZA 3BAIA 2F38A 3UZYA 1GVOA 3URBA 5CC6A 4G9PA 4AHOA 4Q8WA 1RJPA 2YL8A 3R0DA 4AZCA 4IMAA 1UR9A 3CZJA 1JPIA 3LTYA 3M9YA 3I7QA 3LSBA 3H2CA 2DORA 4JTDA 2G3MA 3L5LA 2ICSA 1GQIA 3OEXA 4XAZA 3UJEA 1FWAC 2BY1A 1TZZA 3MO7A 3QM3A 1KFLA 1GOXA 2VX6A 2OCZA 1R3VA 1WX0A 1SZRA 3BAYA 1FKXA 4XVDA 2NQZA 1NTHA 3EPOA 2V67A 4O1FA 3MSDA 3LPPA 3GG7A 2VUNA 3KVLA 1EB3A 3BPWA 5HPCA 4DO4A 3TCSA 1KB3A 2P0IA 4ZZ9A 3F5LA 1EJ7L 5DEZA 2XSXA 3PULA 4L4LA 2OOFA 4BHYA 5LGXA 4S1FA 3SECA 1QOPA 5I3IA 2QIWA 3Q2DA 2P3ZA 3M5XA 4HK5A 4BZYA 3TR2A 4PR4A 2V5CA 3NA8A 4RW5A 3RILA 3U57A 2FQIA 4NF7A 2WJEA 3IGUA 3R10A 4NAFB 1XRVA 3UQNA 4Q4KA 3KBVA 4PB5A 4R7JA 1CB2A 3MV01 4REQB 3P0WA 3PPHA 1A53A 3QOKA 3WDPP 2OEMA 3OG3A 2Y7DA 4N6FA 1SR0A 2VGGA 2C79A 3LK6A 1TA3B 1E9ZB 3AUOA 1IE7C 4QRNA 4S3BA 3ES8A 1Z69A 1RA0A 1HJUA 1SSDA 1XSIA 9XIAA 3WMCA 4MG4A 3PZVA 1OGGA 6CGTA 3M0KA 2QULA 3GFXA 1UASA 3P3BA 1DWFM 3EGJA 2G50A 4LAKA 3G1AA 1RCQA 3RIKA 4Y9NA 2P10A 2OZ0A 3SIZA 2R94A 3BICA 4BWLC 1UH2A 1QTWA 2D2JA 1BFNA 4NSBA 4XTIA 3R8RA 3A21A 3AWNA 2RAGA 1WKEA 1A4LA 1KTBA 2G97A 1N82A 2J74A 1XQKA 3VFCA 1Q6GA 2VEMA 1PE1A 2E68A 1M03A 4B5NA 4ICMA 4W8BA 4WJEA 1E9IA 2QYGA 3ENLA 3SQLA 1A5NC 2E9BA 3M6YA 1OF6A 3GC2A 3SCQA 1LL7A 3T0BA 5CGQA 1FWJC 3C56A 2FHBA 5CZSA 4JFSA 2QS8A 4G7EB 2DUAA 4J27A 4JHZA 1V8EA 1R85A 4CD5A 5AYIA 3MHUA 2IPGA 3SN1A 5BROA 1OCQA 3QY7A 1XBVA 3GXTA 2BGQA 5G1MA 2WBGA 3UWUA 3CHFA 5CG7A 2DZAA 1EZWA 4DUVA 1K9FA 4JTSA 3WUEA 4X9YA 3W28A 4DELA 3PZQA 4QITA 1W3TA 1ZCOA 2X1TA 2NVDA 2WC4A 4RV8A 1FDZA 4RNHA 5C9ZA 4QXIA 3ABRA 3R1ZA 5JU6A 4MDOA 4OJYA 4G8TA 3NL2A 3BQ6A 4Y2WA 1LG2A 3KTXA 3TQVA 4NNAA 4RZ6A 1TPH1 2BG5A 1CGWA 1TPEA 4AX7A 4DYEA 2Z26A 2YW4A 4KFPA 4U2ZA 2A7PA 1PZ0A 1EC7A 2VI0A 2GK1B 2EAWA 2CWNA 1RBOB 3CO4A 1SPQA 3L67A 2D3NA 1IEQA 1K6WA 1T8QA 2ZX9A 3N04A 2ZUNA 3H12A 4LANA 2G8ZA 5M03A 1PIFA 1IYXA 2CHOA 5CKSA 1OGBA 4IMEA 4LVFA 1UP3A 2GWGA 4UOJA 4EACA 2V38A 4FX6M 4CU7A 5GNZA 4B5TA 3NZQA 1OZMA 1OBAA 3PG8A 2YL6A 1CWYA 3GNRA 4XV0A 3FV9A 4J3ZA 3ZT6A 2E0PA 2OFJA 3K46A 3G1SA 4D9PA 4W87A 3LCIA 5MF5A 5AYXA 1IEVA 2FB3A 5A8PA 5EGRA 4CQCA 1YXDA 3WD0A 4DNMA 1UD5A 4OHQA 3KVMA 4P8UA 2A3CA 1HVXA 4AEOA 1WDDA 1M01A 3HJZA 3LXAA 4RXGA 3CV1A 2FZBA 3ZJ6A 1FCUA 2GOUA 3L5AA 4YU1A 2J7DA 4UIOA 3MMUA 5MKGB 1V6UA 4RW3A 1OFBA 5ABFB 3PWAA 4LPCA 2NW0A 5CEWA 1XLHA 4OT7A 4JQ4A 2B31A 4S23A 7A3HA 4OBSA 3G18A 4IMGA 1B3VA 3GZ3A 2WWCA 2OB3A 3ITOA 1VJSA 3MZNA 4GHRA 2XZ9A 3NZPA 5D2VA 4M0XA 2NQHA 2OSYA 2WHLA 2WQDA 1VR6A 4E5TA 4LRTA 3HO8A 1CLVA 1G4EA 4PH6A 2GJNA 4DZAA 4PUKA 3OBAA 2O0TA 2YX0A 4IQDA 3VVGA 3SQSA 1TFVA 4DWSB 1E51A 3T6CA 4HN8A 1XDJA 1OFOA 3FKKA 3T44A 3LZ5A 2G4JA 3NQBA 3W1XA 1OFPA 2ZXDA 4I8DA 2D1ZA 2YYUA 3FXGA 4JEJA 3G22A 4GINA 3ATZA 3PY2A 4TVUA 1P6CA 3CL7A 1F7BA 3C3UA 1GVFA 4QJ1A 4X22A 2B7QA 3SRHA 4PBEA 1QHOA 2PWEA 4C6FA 4YJ5A 3WEZA 1BGAA 1VBRA 3QN3A 3N6HA 2A21A 4AVOA 4LYPA 3ISIX 4UR9A 2PDUA 3E2QA 5DO8A 3N9KA 4ZODA 3E12A 3N6QA 3FEQA 4RPPA 2CITA 4MM1A 1OSEA 1CZ1A 1A80A 2AQWA 1GYNA 3PG9A 3N13A 3OZPA 3W75A 3GH5A 4YCPA 1MDLA 2C3ZA 3G1XA 1VRDA 3HQNA 2YGYA 1I9CB 4XD6A 1ONXA 4ZQCA 3WLHA 4LRSA 3L4YA 3WLJA 3UZJA 1YADA 1E0UA 2XIBA 3VNYA 4O1DA 4UTLA 1GYMA 2ZA1A 1RD5A 3NEVA 1JPDX 5DBTA 1WAUA 4DF2A 4QE1A 3ES7A 3W1AA 2YCLB 4FPSA 3DG3A 2NUWA 3CZGA 4Y8EA 1DXIA 1HO4A 3FDGA 2E1DA 1H0GA 3H2OA 1JCMP 3AYTA 2J25A 2ZUVA 1GKRA 1W54A 1UP0A 2W61A 3VNKA 2HEJA 1LQ0A 5JQ9A 5C71A 4B90A 3H2EA 2X1SA 4DXXA 4DO7A 3U7VA 4PTDA 5H1WA 3EWXA 1QI2A 4GNKB 5CPLA 2HBVA 1JDCA 4WHBA 2PLMA 3KW3A 1BWLA 4DJEA 3DOPA 5CSSA 5HMDA 1R3RA 1G94A 5K3VA 1AFSA 2XN1A 4G7FA 1JAEA 5DRCA 1QHZA 4Y9AA 4GH1A 3CB3A 1U1UA 2YCKX 4HZ6A 1NJJA 1Z7AA 2XSBA 2VDIA 1XYAA 5KTLA 2QJNA 1R2SA 1BF2A 2P88A 4PUEA 3MV11 2OZ3A 3EA1A 3B04A 3ZT5A 1BTCA 3TNBA 7TIMA 4R53A 1ONEA 1K9EA 1W9PA 3UR8A 1KM6A 3DUGA 2FZDA 3P84A 3D6NA 3NG3A 3W7HA 4Z2IA 2V2DA 3LS9A 1KM4A 2FYMA 4BF9A 3JZUA 3NM1A 3EMZA 1WO2A 3RAOA 5D9OA 4MNJA 3VMPA 3BXWA 1VYPX 3KVKA 3VILA 4S3KA 3O0FA 1E1EA 3M5VA 5LXXA 3IIOA 3GW3A 4L5ZA 1AH3A 3IANA 3QW4B 4IP7A 1HJWA 4U5KA 3ORWA 4UNLA 3U9IA 3AS1A 3UESA 2PBGA 4IFOA 3B0PA 2WVVA 1I45A 5HXMA 5SWUA 3LGGA 5EMLA 2I9UA 3BUVA 3R11A 3DFNA 2BSLA 1TV7A 1YPIA 3KDOA 2OKTA 4AWEA 1Q6DA 4LB4A 4OU1A 4EX4A 1EFZA 1SZEA 4MWAA 5BMXA 2YR1A 3C2EA 3VKKA 3FVDA 4JZ5A 3UJFA 1FRBA 1YDYA 3RITA 1BQCA 3YPIA 1HP4A 1CW2A 2GGHA 1UB3A 3GAKA 1D9EA 4IIDA 3GIYA 4W5UA 3W2KA 1XIDA 3QSTA 2XH7A 1QOQA 3BCJA 3MI3A 4HHLA 3VMOA 4CU6A 1E72M 2W63A 4I90A 1WXYA 4W9TA 3LPGA 3PBGA 3PZGA 4DBSA 4A6GA 1EWEA 1WUFA 2QZRA 3TXVA 1E1FA 1DVJA 4KWWA 5M3WA 5DFAA 4R7OA 1C9DA 1JDEA 2POZA 3GSMA 3ARSA 2VR4A 2PZNA 2X0HA 1XYBA 2J8GA 3PSVA 3TQPA 2OTDA 2RKXA 1V79A 1E4MM 3APGA 1B31A 4GQQA 1JPHA 3FJ6A 5CC3A 4WVXA 2DJXA 1PL9A 1W1VA 1X97A 1B9ZA 1JCYA 1FKWA 5I02A 3RX3A 2D69A 1UZDA 3VDAA 1XLDA 1XIHA 2YDRA 3BO9A 3NQAA 4C6IA 3F5KA 3CIVA 2J47A 3KOFA 4C6PA 2Y2WA 3WD1A 4E8DA 4MB5A 4ACZA 1GQNA 1BKSA 4MHBA 4Q7BA 1P1MA 3DU0A 1NFGA 3AHXA 3VKJA 4IIBA 1DTNA 1KV8A 4KCUA 2Z24A 4AWTA 3IPWA 3DG7A 4BI5A 1QW8A 4L4OA 1QCWA 1OG6A 1QATA 2QR6A 1FWGC 3WQ5A 2B7OA 3M44A 3W6YA 5K9DA 1Y65A 4LUSA 3EOUA 3ARUA 1EJTC 3TSDA 3NO3A 2Y5SA 2ZRYA 3AS3A 3HF3A 4LY8A 1LQAA 3EWCA 5E9AA 4FXJA 2A3AA 3LLFA 2FLIA 4GO8A 2YXGA 3LD5A 3OHMB 2TSYA 3WUGA 1OCJA 3TDFA 1KFCA 2KZHA 3THCA 2JIEA 4ADSA 1TVLA 1C8YA 3EYPA 3TC7A 4C5ZA 3BSGA 2ZZ7A 3TKFA 5C6MA 1SO5A 4OGZA 3W7DA 1A5KC 4YS1A 1L2QA 5K4ZA 5EL1A 1KCZA 5DANA 2XFWA 1W91A 1H7WA 1XP3A 1K4GA 1DJNA 2NQ9A 4GGHA 2ZXAA 5F2LA 4N0RA 1SFLA 4F79A 4BEQA 4JBRA 3KFTA 3F4WA 3IEBA 5ABGA 4D2JA 1GZJA 1EX1A 3AZRA 5F4SA 3NO1A 4D71A 3FCPA 4GA8A 3R7MA 1KLYA 1Q8JA 2HNEA 4ZXOA 3BK0A 3VE7A 1TRDA 4O53A 4US5D 3MKKA 1EEXA 1JXJA 1CXLA 1KQZA 3UGVA 3VX1A 3THAA 4O0KA 1NWUA 3C8FA 4QGCA 1OYCA 1S1PA 1A50A 1ADDA 3TYDA 4H1ZA 4EPDC 3IS4A 3R5EA 4UBPC 1LOLA 2QUMA 5AC5A 3FJ4A 1GUVA 2VGFA 2PDWA 3QOMA 4LVBA 1U5VA 4L1WA 2CLLA 1Q6CA 5REQB 2Y0FA 5AHEA 1VCGA 3PF3A 1KQYA 1PHWA 3RJXA 1RP9A 3GU1A 3A4XA 4US5A 3RFAA 3TOYA 1R38A 4UXDA 2BLEA 3DERA 5LIUX 2VD8A 5D9NA 4M1BA 5CC5A 4H9UA 5EMUA 2C91A 3ITVA 4HA0A 3CH9A 2HXTA 5E5CA 3XISA 2QUUA 1PPIA 2DSUA 4HHHA 2V8ZA 4BR1A 4PBGA 4RNJA 1EBGA 2VWSA 3A47A 1DIEA 1AL8A 2GSHA 3TOPA 4ES4A 1OFRA 1JZ7A 4D1IA 4L4PA 1R9XA 4O14A 1GTEA 1RCXB 5AHIA 2OJPA 1V5XA 4IGMA 1H7NA 3M47A 4QX4A 4XZHA 3N4EA 5HATA 4K8HA 2HROA 2GGEA 2G3FA 1FBAA 4DRSA 4IPPA 1CX9A 3KVJA 2OGJA 2VWTA 4ML4A 1OEPA 5HOSA 3S0CA 5D2YA 3N12A 2GUBA 6TIMA 4P7LA 3LTPA 1P4CA 1P6BA 4Z1BA 3SUTA 3KLKA 3MPGA 1VIZA 1FTXA 1YTKA 4JNZA 4MB4A 5FJIA 1ZRQA 3QKZA 3VZZA 1GVIA 4LXFA 5AB3A 3BLOA 3AU6A 1OX4A 5C9WA 1ME8A 4F8XA 3M0ZA 4WCJA 1BEUA 2NX9A 3SUUA 1F61A 4I6VA 5CXPA 2H8XA 2QKFA 5HMFA 1P43A 1JGIA 4QJ3B 2VEFA 3PZTA 3FAWA 2Z1KA 4PTNA 1ZP4A 2XH0A 6A3HA 4JD4A 3F4DA 1UKPA 4YYCA 1LYXA 3TSBA 1PZ1A 3QQ1A 3KP0A 3KCJA 4UR8A 1SFTA 4Q6XA 1FQ0A 2IPFA 2P1FA 2GQ9A 3CZ8A 2BODX 4LUYA 4C6LA 5FJTA 2Y1HA 4NJGA 2WXDM 5FI8A 1DXEA 1WYIA 1ADOA 1HVQA 3WNPA 3SZ8A 2FH6A 4PE8A 3B0XA 1R6WA 3USZA 3VIFA 3VD5A 4WQ6A 2QAFA 3C52A 2CXEA 3P5ZA 3GNOA 1UR1A 1Q6RA 1HNYA 2XISA 3M0YA 4PN2A 3L7RA 4BA0A 1EX5A 4O50A 3EMCA 4O18A 1V6YA 3CO8A 1GYLA 3WLKX 1DHKA 4PCNA 1WXJA 1UR2A 3FYOA 1FWFC 2WW5A 1F07A 2GYIA 5IOBA 4HA1A 3E9AA 4ERGA 2DFAA 4R34A 4QLJA 1F3WA 1E73M 3E0VA 4LH8A 3ARVA 3WDQA 2BY0A 4FNQA 1E0VA 1PKLA 4X60A 1W9DM 3GXMA 1X39A 2XIOA 5HQMA 1D7KA 4QG8A 1HIZA 4GNVA 2CHNA 4M5PA 4KKXA 3XIMA 1YE4A 2AKZA 1GG0A 2C1IA 4HP5A 2Y8KA 1TPUA 3EXRA 1H41A 2PAJA 2ZRUA 3I68A 4KEUA 4JPGA 3QR0A 1DQWA 5JBEA 3AC0A 1PYMA 5FD0A 2Z1XA 4BQ3A 2YJQA 5LHFA 2PP1A 1NY1A 1YE6A 1SZNA 1JZ6A 1NF0A 3FGCB 1KM0A 2GWNA 1FFRA 5EMKA 2JQXA 4B2DD 3LDVA 3OQEA 3SR7A 4GY0A 4AZ7A 4PB4A 4CKQA 3L21A 3W82A 3GC5A 2Z00A 1ECQA 1W1IE 3V5OA 4D6JA 2PTWA 3HGSA 2D24A 1V3IA 3ZO9A 1OM0A 4KWUA 4UTWA 4PUDA 5I06A 3PHAA 3T40A 3H2MA 5A6KA 1RA5A 2PCEA 5DY2A 5I7GA 1XX1A 2XU2A 4XISA 3CLMA 5LZLA 5L6UA 2ZOXA 3KL3A 5CAHA 3UY8A 1XRFA 2ACUA 1PWLA 2X42A 4AUBA 2POTA 4Q3MA 1EO7A 3G77A 3GHRA 3MYOA 3N2OA 1DJQA 2ZUMA 3UPWA 3PBVA 4FIQA 2OU4A 3WQVA 1V0MA 2Z1SA 3LCFA 1LG1A 3VCRA 5HQEA 4JQ2A 4JTKA 4IM4A 2QJIA 4ALDA 1G67A 3U3HA 4GXPA 1XRTA 4W8AA 3CV2A 3ZLFA 1EJVC 2CBVA 1NWTA 1MEHA 4PMJA 1KXQA 1K3UA 3PJTA 1TIWA 4XBJA 5L9FA 3LUTA 4H7ZA 3UT0A 3ONBA 1RH9A 3A22A 3R58A 1TPC1 1DWHM 1UCWA 3W00A 1EA9C 3SN4A 2VVSA 5J5RA 1ZU8A 1QI3A 1W1TA 2VDGA 3CQ0A 3TP4A 3IRDA 1H61A 3PPGA 4RUBA 2NXIA 1RLCL 5BW6A 2EEXA 3GDMA 4I5RA 5A6JA 4JX4A 4NX0A 5D37A 2PODA 4PTVA 4K39A 4MOZA 2WKLA 1H09A 1Z44A 2GOKA 1GPWA 3BMXA 5C5YA 2DVTA 3NZ1A 1WDQA 1YTEA 2VC7A 4KWVA 5AOUA 3S83A 4CNOA 3B40A 2ONEA 2Z2BA 1KKOA 3KBNA 1R3YA 1FWWA 2WMJA 1P7TA 1AVAA 3BDKA 3OA5A 4DI9A 3CUFA 4IX0A 1V93A 5CLTA 3S2NA 1XIGA 2RUSA 4D6IA 1DORA 4AHPA 3A3XA 3AIRA 3EDFA 2QEZA 4I9JA 3TLQA 3HPSA 5GJNA 1AQ0A 1PKNA 3U4AA 4A3UA 1ONWA 4OVXA 4UTHA 1H5VA 3TROA 2VOMA 1TV4A 2P0OA 5A69A 3HV8A 4IISA 4M29A 3WYZA 4PUUA 1W3HA 1E6NA 1DL3A 1M68A 1TB3A 4D8LA 4WSHA 3CPRA 4OE7A 2CYGA 3SJNA 1W9VA 1IEIA 1BRLA 3ERPA 3VD7A 4XKMA 4GO9A 2C71A 1F3EA 1XBZA 3NDOA 4X63A 1VENA 3DYOA 4HYVA 1YDVA 2EJAA 5AVHA 2EF9A 3CUIA 3A12A 5DN1A 3OU8A 3VD4A 1N8FA 1BYAA 2J7HA 1H11A 3QLLA 1O5XA 2W91A 1DTUA 2X7VA 4UFKA 4H7CA 3T81A 5LNUA 1ECEA 1IIGA 2AGTA 3DH7A 3M0LA 1ZFJA 1XH0A 4IIFA 3AISA 4WDTA 1FVPA 1AJ0A 3QQ0A 1TCMA 4GUJA 5F1VA 2A7NA 3TYEA 5HJLA 1NWSA 2OYMA 4LBUA 3S2JA 1X8CA 4EANA 4A8NA 3AIBA 2ASHA 3F2CA 2WCSA 3AXXA 4IXXA 3MUAA 3VABA 1GNXA 5T26A 3A6OA 3N17A 2R1MA 3C0QA 1KRAC 1EF2A 1YYAA 5JBDA 4TUFA 4LQ1A 1M53A 3AS2A 2EGZA 3OYZA 2HDJA 3ITCA 2ZX5A 4V1YA 3SY5A 1YBQB 4WY0A 1BLIA 4ASTA 4GX9A 1XLCA 4HU4A 1OWQA 4LWWA 3MCMA 1W1YA 4AG0A 1XW8A 4MWAB 4MKVA 1DE5A 5I3GA 2CBUA 3MVIA 4KRZA 3ZVIA 1T41A 1V3KA 2Z4GA 2FMNA 4ZOCA 2VC9A 4PC8A 3WLLA 1UOZA 3VKAA 3ZIZA 3LCWA 1BYCA 3V3WA 4LW7A 2H9AB 2VVNA 4ZGYA 2IKIA 4RKAA 4GVIA 5LXEA 3QJAA 4HHPA 4DLFA 3WQ4A 1OD0A 2W92A 4V33A 3BG3A 3I6RA 5FOOA 3HG4A 1AH4A 3HA1A 4UTUA 1W9UA 1UBPC 4R9XA 4I9AA 3N4AA 3QHMA 4EK7A 1E0XA 4PUWA 3M6DA 3BWWA 1THFD 4ZSTA 3WDJA 5FJUA 2BMBA 2ISVA 1CGXA 1CXHA 4HCLA 3PTQA 2D0GA 2VZOA 4IL2A 1G01A 1KBLA 1J5TA 3R13A 3TW9A 1TUXA 2A85A 2PGWA 2QPUA 3OBKA 3W85A 3V18A 4QQ3A 3NGJA 4CD4A 2C16A 1BWKA 2TAAA 1BVNP 2OWCA 2QCGA 1AA1B 3PJXA 4WDWA 5CQ1A 2CLHA 5E1QA 4ACZB 1EJRC 3CV7A 1V0KA 3UG5A 3BGAA 3V16A 2FJUB 1AD1A 3VUSA 3W7LA 3KRZA 2PDXA 1ISYA 3I3DA 3MSRA 4GJIA 1UOKA 1VB9A 3CUZA 4G1KA 3G0XA 3HPFA 1F6PA 4LUSB 3PFRA 3HU7A 1WDSA 2CC0A 4KIRA 2HVOA 3CZLA 3GBEA 3TJ4A 2ZXQA 1Y7VA 3GS6A 3QZEA 1NELA 5E09A 3IAPA 1GTHA 1E6RA 3STPA 1RALA 3AMDA 2F6UA 5D9PA 4A8LA 1M3UA 3IK2A 1QNRA 3FK4A 4QR6A 3GNNA 1KO0A 4F0LA 2ATMA 4YXGA 1QMLA 4XTDA 3T08A 2O92A 3PBMA 3WLNA 2VR2A 1SUXA 1XKJA 4QCFA 3GKAA 4KF1A 3S46A 1JYXA 3U48A 4MWAE 4W7VA 3S5YA 3N9SA 2WZMA 4C65A 4U31A 5A1AA 5FEZA 2JKAA 2NSXA 3W7GA 4IFRA 3RX4A 4K8GA 4OBRA 1O4UA 3DFOA 3H7VA 3QV6A 5D09A 5IFTA 1HXJA 2FFIA 1A3XA 3IV3A 1SVDA 1W1PA 1IF2A 2DSWA 4AISA 4PCTA 2WHMA 1AK5A 2PDHA 4XZLX 3G1YA 4C1LA 4CQDA 5HQLA 2XIQA 4ZL1A 1BSIA 5B80A 3NOEA 3QKEA 4H01A 4M80A 2ZWYA 3K5XA 3LHVA 2FPYA 2IKGA 3HPXA 7CGTA 5EMJA 1Q2RA 3G2GA 3MQTA 2CFFA 4DJEC 2C6QA 5A3HA 1DJWA 4H9MA 2AL2A 2YW3A 4U33A 3OIHA 4JN6A 5HWMA 1JF6A 3S2MA 1HZYA 3MI6A 4I7VA 1UPMB 2WCGA 3T8QA 5CJ5A 1FCVA 2W3ZA 3KX6A 1RVKA 3BQ5A 3OA3A 1EJWC 3WNMA 3FFSA 4LAZA 5LGZA 4X2PA 1ZB5A 3CASA 2NVCA 3VGHA 1H1YA 4Q4MA 4EOUA 5FJOA 4TV6A 5CZJA 2R6OA 2I9EA 5CPQA 1AODA 1WE5A 1OC5A 1MEIA 1ESWA 3WENA 5FA5A 2BBFA 1VBJA 2C0AA 3FA4A 3K4DA 3QPYA 4O28A 2DUXA 1MXSA 2BVYA 2PS2A 3UGRA 2E4TA 3FHAA 3PZ9A 4L80A 5C54A 4MJMA 1KXHA 1EZ2A 3SRFA 1KGWA 4Q4RA 3VDBA 2WVTA 1RVGA 2REQB 3B0YA 3TMQA 3F1QA 3BZJA 1Z9AA 3QFEA 4I9MA 3IUHA 4UFMA 2NXHA 4FOJA 4AXNA 2UV8G 4IUOA 4JYEA 3W37A 2ISFA 1MNZA 1WAWA 2PGRA 3EEZA 3ELFA 3NFUA 4IPIA 4MWAC 2V5DA 3UG3A 4QFUA 4HJFA 5AZ1A 7REQA 1O1ZA 1BPLB 3FYPA 4JIPA 1TO3A 5CG0A 1OX4B 1QNSA 4PODA 1Q66A 1UQYA 2TODA 2Y5JA 4Z08A 3RCMA 2YCEA 3W38A 1ICSA 4H8NA 3WD4A 1VHNA 1VJIA 4MB1A 2O55A 2OG9A 2ZBTA 1S2AA 1UJQA 2VX7A 1EIXA 1SYTA 3GVRA 1MWOA 5GQBA 3VIHA 3QMRA 5AN7A 2ZWZA 2VXNA 2VT0A 1OK6A 3LCHA 3GM8A 4LVGA 1TR9A 1OQFA 3UPBA 1WZKA 4LCRA 2F61A 3SSZA 4C6DA 4OWGA 2V3FA 2UWFA 3OJGA 1MW2A 2WWDA 3LA4A 4FB7A 5KZMA 5KINA 3VNLA 4ZFCA 1XLAA 3SCRA 1EGZA 4LFYA 4PRWA 1G1YA 1G6CA 4Q8MA 4XQ6A 2GDUA 1XD1A 2W0UA 5E6ZA 1M65A 3DGBA 1P6WA 4CN6A 1ME9A 2IPWA 1Z42A 3GNDA 1I2QA 1TVPA 4NU7A 2J62A 3WLRA 2VL4A 5GNXA 4B5SA 1ISZA 4QIUA 1US0A 4LYRA 1GJWA 3WSUA 4HMNA 4XG1A 3AU2A 2VKZG 1PX4A 1VFFA 3QPZA 2TRSA 1J9YA 2PBOA 3DHPA 3T0DA 5I78A 3TN4A 1M41A 3O07A 1M7JA 1GOKA 3QR1A 2G5WA 4J28A 3W86A 3GVWA 3W1QA 2B81A 3KZPA 2VJXA 3UWWA 4DPQA 3RCNA 1WP6A 1R0MA 1H7PA 2UZ9A 2V3GA 3ZZ1A 4P8XA 4XZWA 4Q7IA 4XO6A 1XIMA 4BFAA 4F0MA 1I60A 4P8WA 4ICNA 4DO5A 3W1RA 1ZJIA 1RJQA 3MDWA 4CEXC 5ABHA 1DEDA 3H2NA 5DT5A 2OWWA 4S2BA 4EXBA 4G5DA 3P6LA 2ZUWA 5CGTA 4YNGA 2VMFA 3EPNA 3WL0A 3TXZA 4A2RA 4HMDA 1ZJHA 1UH4A 4JAWA 4KRUA 1RV8A 4Q4QA 4QDPA 3ZSTA 3CPUA 3RLGA 2E8ZA 1GKQA 2DZPA 1RHCA 2VGIA 3LYEA 3CNYA 1TMHA 9RUBA 4E2DA 4UMAA 1J0HA 4O57A 3WJXA 5A6BA 2FJKA 2Z29A 2GGGA 1BVZA 2ANUA 3S5OA 5TD4A 3TK7A 3CL6A 3M64A 4DBEA 1H7XA 2FKPA 2P76A 2ZE0A 1DV7A 1ZY9A 1LRQA 5HINA 2J7CA 3WEOA 4OOZA 3TYAA 3LHYA 2EPMX 4IZGA 5AC4A 5DRIA 2E6AA 4YTUA 4GZEA 2WYSA 1FHLA 2GVEA 3STGA 2QIIA 4UQ9A 5DX7A 1C8QA 4IH3A 4FALA 2B7NA 4Q22A 2QCNA 1Y5WA 2F8QA 3WH6A 5FF2A 3L9CA 1KC7A 1JZ5A 4Z1YA 4HPHA 2JIWA 1Z48A 4L9YA 5HMSA 4DAIA 3NURA 1TTPA 3VCNA 4F48A 3LCGA 1KBKA 1FDYA 4BK9A 2EKGA 4PL2A 4B16A 5A6TC 1E4IA 4KWSA 3UJRA 1R9ZA 4P2VA 4HCDA 4JTIA 1RZMA 7XIMA 3V0TA 1X6NA 3VE9A 4HPJA 4MUZA 3WNKA 4Q8PA 1FH7A 1QVBA 4AEEA 4A29A 2YL5A 4E4PA 5JBFA 2E6YA 4L4MA 2GDQA 4XAYA 2BS9A 1G5AA 2PDPA 1IWBA 2NWRA 3C2RA 1RQBA 3TJIA 1IEXA 1X1ZA 3S1UA 4D6FA 3I7RA 1F05A 3CIWA 4MNLA 2YBTA 4FXRA 4IWWA 2OT0A 3V35A 2DZSA 4H83A 4Y90A 1X7FA 1SJBA 3OG2A 1ONRA 1K8YA 4ZFMA 3WFAA 3UR5A 1MI3A 3L2LA 3PN8A 4O1CA 3L0KA 1WPCA 3T0TA 2OQLA 3FSUA 3BLEA 1MO0A 4B3KA 3EMQA 4J40A 1V6WA 2DT1A 3WK3A 4GI6A 1ITUA 3WY1A 3MANA 3SY1A 3HN3A 4GXMA 5C8BB 4DXKA 2CZ5A 4MGGA 4DM1A 4BS0A 4WLCA 3PJWA 4QROA 1W6TA 2Q02A 4LS1A 1EO5A 1HKKA 3NQCA 5AC7A 1JZ3A 3UBPC 1NQ6A 1VCFA 1FWDC 2XWEA 3KBWA 4IMCA 1TSIA 1AD4A 4R27A 1P7TB 5H2ZA 4FX8A 2OZ8A 3M0XA 3P82A 1UP2A 2D3LA 2F6KA 1OK4A 1XLGA 2GK1A 2QDGA 1H0IA 2FDSA 3G1HA 4U2YA 4DI8A 3TR9A 2VZSA 2QDEA 4GCAA 5BOOA 1HX0A 2YLLA 2WVSA 3IVSA 1JCLA 4GISA 1UWSA 1EXPA 3KUMA 5IBXA 4G56A 4AZGA 4GBUA 3DFSA 3OVRA 3WF3A 3TN3A 4B15A 2F6XA 4YVPA 1E6XM 5D38A 1OYBA 4NZ4A 1P0DA 3MUZ1 4KIEA 1BRLB 5LIXX 3GVVA 4PFMA 5K7JA 1XYCA 3I3EA 4XD4A 3WLTA 4H8HA 3W7KA 2CIPA 1DWJM 4WGXA 1TJ0A 1GEQA 4FI4A 1LBLA 4MY1A 2A5HA 5D32A 3NQFA 4X0VA 1S46A 2TPSA 5GNYA 3QBUA 3R0KA 4UB9A 1OY0A 3VU2A 1MXGA 4ROQA 4NAEB 2FMOA 1EP1A 3P61A 4JIRA 1XKYA 1PJ9A 4S3FA 4GYFA 3HBLA 3HGJA 3IJQA 4AD4A 3TN5A 1IXNA 2YXOA 4J3XA 1JR1A 5TNVA 1UUMA 1VC4A 3OVPA 3VXGA 4DWSD 3W53A 3BL3A 1BG9A 2FH8A 2PDIA 4FR1A 3TTSA 3IJDA 5AYZA 4XZMX 3T07A 2XFFA 4D8AA 3QGAC 3UXLA 4WSJA 3QFWA 4FLOA 2FZMA 1ZBCA 2D2HA 3UETA 1R2RA 2EPOA 1MNSA 4NQ1A 3MUXA 1YRRA 3L2IA 3NQDA 4O8RA 3VNJA 3W02A 5C9RA 1MYRA 3EX1A 2OPJA 1TWIA 4JTAA 3HG2A 4DWSA 1LP6A 2JEQA 2G37A 1VQTA 1MFUA 4JIIX 3FJLA 4E3TA 2EG6A 4F40A 2PWGA 5H6HA 3LNMA 4AZ6A 1US2A 1FHUA 3ZVHA 3VOJA 2HV5A 5CJNA 4AD3A 2ZDSA 3RGTA 3EWWA 3EX6A 3SCTA 3MB9A 2GSEA 1TV5A 2V6AA 1VEMA 2XIIA 4A05A 3QPEA 1QK2A 4O4VA 4YYFA 3KM8A 4S3GA 2P53A 2VRQA 3QV7A 4ATLA 3UCDA 3BG5A 3AFBA 3VGBA 4UTWC 1LL4A 4RDWA 2XM1A 1IV8A 3EB2A 3TQ0A 3QVQA 2QXWA 3N18A 4AZ5A 3C8NA 1G0CA 1EUNA 4GY1A 4XUYA 2YB1A 3V0UA 2GQ8A 2XFRA 1S1RA 1AMKA 3ARRA 1VFMA 1E6QM 2J8TA 3BV7A 4ZOAA 1QBAA 4GACA 4KH2A 4DAFA 1HW6A 1NQKA 3L12A 4Y9OA 3LRLA 2BY2A 3P74A 2DSZA 1J93A 4IMFA 3ZS4A 2E7FA 2HPMA 1IT0A 4Q32A 2GJLA 1JRBA 4U28A 3LPFA 3KOZA 4QDMA 1VFOA 4QQUA 3WNLA 4IJRA 4CGTA 3BAJA 2CLKA 3CXOA 3LMZA 1F4HA 1A5LC 2CZVA 3CWHA 3TONA 4OBTA 4W86A 4P61A 2VRJA 4I8YA 4YTSA 2OXNA 3DHUA 5FEWA 2G0WA 4PMNA 5HR6A 3DBNA 2J66A 2V3EA 3PB0A 3FDKA 1SJAA 2BX7A 1D3HA 5BOEA 3WH9A 3ANUA 4DYKA 1UD2A 3P7YA 4GIAA 3U5YA 1DBTA 4YPJA 3RPDA 3BANA 3W87A 1XCFA 1K8XA 2ODOA 2DY3A 1B1YA 4QBXA 1XGZA 1UYQA 1D3CA 3DFHA 2C7FA 1G69A 1OIMA 4GC4A 4RZ4A 3W7MA 4JN8A 4CQ9A 4FK9A 3BCDA 1PB0A 3AMKA 4LAMA 3L5MA 2IS7A 3R25A 1YQ2A 3TN6A 3WQCA 3II1A 1GPFA 1SO3A 3S5ZA 2EBNA 3R79A 1Q2SA 3MUIA 4IQJA 4JXCA 2G4FA 2UY5A 1X1NA 3CGTA 1FA2A 3MJYA 4RE2A 3NUKA 3WF4A 4YTQA 4NJIA 2GVGA 2VFGA 1F5ZA 2L5HA 5ECUA 1DE6A 3SRKA 4E0CA 1J12A 3D3FA 3IV8A 1KFBA 1PBGA 2VFHA 1P0BA 2PLKA 1RAKA 3LCXA 1IQ8A 1Y5XA 4WGHA 2AL2B 4BI7A 1V7AA 1VKFA 2HNHA 2WHJA 4DJDA 3UG4A 5TAOA 3UWZA 3VPLA 4PMUA 4PMQA 3MI2A 2A6NA 4B91A 2VURA 1M9HA 3D5HA 3PPFA 2A3HA 4TU1A 1VPXA 4NJHA 4W85A 1E6SM 1SJCA 1XH1A 2P50A 4ZQMA 3TW6A 3NQMA 4GJJA 1GHSA 3O6DA 4F3HA 3MUY1 2KX9A 4PSPA 1ZAHA 2X0YA 4JQ3A 6ENLA 1W3IA 1HO1A 1OFAA 3QZAA 4NYUA 5BXRA 4UQCA 3MMWA 1K7XA 3M4HA 4GIEA 4IIHA 3GR4A 4CEUC 2ZDRA 3R0UA 3AMCA 4IG2B 3W3OA 1ZBKA 3CWNA 1OVDA 4JN7A 1TQJA 1NDYA 5AECA 2DU2A 4UFJA 5A94A 1VBUA 2JF7A 3UG8A 2FTPA 2R1PA 2BGSA 3BARA 2X2GA 4L61A 3CT7A 2V0TA 1T0OA 2HCVA 2V2HA 1TX2A 1A0DA 3SSJA 2YSWA 2P8CA 1Y5VA 1K9TA 3ZJKA 2YZ5A 1L6WA 3CUHA 3OGVA 4G6CA 1IR1A 4W7UA 3VINA 2ZA3A 3VGFA 2OQHA 3EZ4A 2RDXA 2R8WA 3KRUA 2GFTA 2IXVA 1S5WA 3SEPA 3WDHA 4OV9A 3MP5A 3ZLGA 5F4WA 4HB7A 3ITGA 2WMFA 3OVQA 4OECA 3MWCA 3TAKA 1DP0A 1R47A 3DAQA 2Z1WA 3W24A 2QGYA 4DBDA 5C55A 1VBHA 1YPFA 1EXBA 2CBJA 3PR2A 5KITA 5CBJA 1FWBC 4AY7A 3TA9A 3GLCA 4JIEA 2QJJA 5AHMA 1JCJA 5H8UA 1XC6A 2FGZA 8RUCA 1CT5A 1U2YA 1BXCA 3S9ZA 2WNZA 1C93A 4RV3A 3PC0A 2VHLA 5CSYA 5EY5A 3RU6A 3ABOA 4H3DA 3Q65A 2JK2A 3L4XA 3P0XA 1Q85A 3V0SA 4MAZA 4X61A 3KCOA 4DWDA 2DSKA 3VIMA 5A2BA 1PUDA 3NWRA 3K8LA 1ISVA 5CAKA 5HANA 1JQVA 4M56A 4IGHA 3ABXA 2Y24A 4LCQA 4KEZA 4PMRA 1GW9A 4W93A 2VCCA 1EC9A 1XYLA 4LX4A 2CKSA 3B8WA 4GVGA 2ZVRA 4JOMA 2FVMA 3LSCA 3HZ3A 3R43A 3JU2A 1HKWA 3SIMA 5G1YA 3W83A 1RXOB 4H9XA 4JFTA 1H63A 3SGGA 4DBUA 1XYMA 3RLHA 3VOIA 4ZQPA 2DEPA 1WXZA 2FDMA 3ME3A 4WUIA 4N2YA 1UMLA 2RDTA 4FS9A 4R5EA 2PDJA 3S4TA 4PMOA 4XWUA 4RR4A 3O05A 3ONCA