2OU4A

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 115
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2ou4A00
4X63A 4YTUA 3C0SA 1YX1A 4PFHA 1XLDA 4ZB0A 4A8NA 1A0DA 3QZAA 5H1WA 4XSMA 1XLAA 1XIFA 4XIMA 1XLBA 3KBVA 4EAYA 2I57A 5I7GA 2HK1A 3CNYA 4YTRA 1A0EA 5AVHA 5J8LA 4A8IA 2I56A 1DXIA 2XIMA 4ZBCA 3CQKA 3CQJA 1XIGA 4K3ZA 4GJJA 3KCLA 5AVNA 1BXCA 1XIIA 3KBJA 1DE6A 3OBEA 4X60A 4DUOA 3ITLA 1XIJA 5EMLA 5EMMA 5EMJA 3U3HA 1XYLA 3ITTA 3C0QA 4QEHA 3VYLA 3AYVA 2G4JA 3GNXA 3KBNA 3BDKA 3UU0A 2GYIA 4YTSA 4QE5A 4HNOA 4X61A 2NQJA 2ZVRA 9XIAA 3IUIA 4PGLA 3CWHA 4GQBA 3BANA 3KBWA 1A0CA 4G56A 1XYCA 4A8LA 1DE5A 4LNCA 1XIEA 5B7ZA 1D8WA 4KW2A 1XIHA 1I6NA 1S5MA 3M0LA 1MNZA 3ITXA 5FA5A 3BZJA 4QE1A 3M0VA 4W4QA 1XLLA 3XISA 3AAMA 3AALA 1BXBA 1XP3A 4GLEA 1XYAA 3M0HA 3JU2A 2QUNA 3KWSA 3KBMA 1K77A 3XIMA 2QULA 2XISA 3KBSA 4XKMA 3QC0A 1XLCA 4J4KA 1S5NA 3UA3A 6XIAA 3UA4A 3M0MA 3QYSA 3VNMA 2GUBA 5XINA 4XIAA 3L23A 2QW5A 1QUMA 3P6LA 3VNJA 8XIMA 3TC3A 1XLHA 2GVEA 3CQHA 4YTQA 2HCVA 1XLFA 4XISA 2NQ9A 3C0LA 1XLEA 2J6VA 3IUHA 2Q02A 4E3VA 3DBNA 1XYMA 2GLKA 3ITVA 3VNLA 7XIMA 3VNIA 4ZB2A 1XIDA 4K1GA 1TZ9A 4HGXA 3VNKA 1DIDA 3QXBA 4QDPA 3WQOA 2G0WA 1XLIA 3M0XA 1XISA 3IUDA 4US6A 3UXIA 3KTCA 4EACA 1XLJA 4OVXA 1OADA 6XIMA 1XICA 1DIEA 1GW9A 3DX5A 4QEEA 5XIMA 3KCOA 4ZB5A 1XIMA 1XIBA 4A8RA 3BWWA 3ITOA 3N4AA 1XLGA 3M0YA 2X7WA 4HHLA 3CQIA 3NGFA 4QE4A 2OU4A 1O1HA 1QTWA 1QT1A 3XINA 5XIAA 3U0HA 3LMZA 4XSLA 1XYBA 8XIAA 3FVMA 5B7YA 1CLKA 1XLMA 2X7VA 3KCJA 2HK0A 5B80A 5TNVA 2NQHA 5EMKA 1XLKA 3AYTA 4GJIA 1I60A 3TVAA 5C9ZA 3UVAA 4HHMA 4QDWA 4YTTA 3ITYA 2ZDSA 3P14A 5H6HA 9XIMA 2XINA 4DVOA 3BZGA 4Q7IA 1MUWA 2QUMA 1XINA
chains in the Genus database with same CATH superfamily
3M0JA 1NAL1 2PWHA 3EEGA 1UD8A 1F6PA 1JZ4A 3S5YA 1A5NC 5BU6A 2QPXA 3Q67A 2CHOA 1VBRA 2HWGA 3PBYA 3MVIA 4KIRA 4MYAA 2WHMA 2INEA 4Q4OA 3H4WA 4H00A 5LKYA 1PHQA 2VO5A 4L9ZA 2OYLA 1JCNA 5G2IA 4DB7A 1E70M 1W3IA 3O2LA 3OBAA 2IPWA 4XVDA 4ENLA 4KESA 2CCRA 3ZS4A 4DZAA 5FL0A 3OO2A 1OD0A 3N1AA 1OCQA 4FK9A 4CN4A 3P61A 1TA3A 4GCAA 4C6MA 3RLUA 4OHQA 2JALA 3S1XA 4PEEA 1QPNA 1KTCA 4DI9A 4ZR8A 2DVTA 1SW3A 4P5UA 2J9YA 3RLGA 4RZ6A 3VKDA 1V5XA 5C2XA 3KTXA 4IJBA 1VYRA 2GOUA 1EXPA 1OCBA 2Q71A 2VWSA 4AVFA 5ABTA 3WF1A 1EBHA 3RHGA 2MNRA 3FYOA 4US5A 2VFHA 4M51A 5CPMA 3BOXA 4MFDA 2XIQA 3P80A 3XINA 5HMSA 4MLRA 1YQ2A 2G37A 3M0KA 5TBOA 4NJHA 1ONXA 3OGSA 3WY1A 3LLXA 5D30A 4U5IA 3F5LA 5HMDA 4DBUA 1M7JA 3PBMA 4OUIA 1A0DA 3PAOA 3UZYA 4C1NB 3VIFA 1GT8A 1XUZA 4MY8A 4NI8A 4M24A 2XWDA 2BGQA 3OODA 5DY3A 4NL1A 4GQQA 3WDHA 2I14A 4ZCWA 3UJFA 1JZ3A 3V1PA 1T41A 2YYUA 3H2AA 3DI0A 1O5RA 3C2OA 3EAUA 5DN1A 1ZBWA 1F4HA 1Q7MA 2PAJA 1NWSA 7ENLA 1CX9A 5HMFA 5BRQA 2YXXA 1AQHA 1H61A 5B7ZA 3N12A 4Q8TA 4UOJA 3WLQA 1GOXA 3NTYA 1ICQA 2PDMA 4FAMA 2ZWZA 2OEKA 3TH6A 1EGMA 1BF2A 1ZHAA 3SGUA 1D8CA 4IH3A 6XIAA 1DJGA 1BWVA 3S4TA 4X22A 1ISVA 1RHCA 4EPKA 1HL9A 2ABBA 4IIGA 3KEHA 1R2TA 3GXIA 3LPPA 2V81A 1VEMA 4GPNA 5E6YA 4DXXA 2JEPA 4YXGA 1PBGA 1W1VA 1JF5A 3W7QA 4JQ1A 1MEIA 4PMNA 4PEKA 1M3UA 4F2TA 5HNRA 1GPWA 4PMXA 4UWMA 2ABAA 1CLXA 3CM4A 2E8ZA 4NRSA 4LY4A 1EGZA 1NF0A 4OBRA 5DRCA 3V3WA 3EZ4A 1CCWB 5F2IA 1FDYA 4H04A 1OHLA 3JUGA 4JCMA 1F3EA 2QCCA 2EXOA 1F73A 1DWGM 3OZMA 1NJJA 1TPC1 4WDWA 5AVHA 5HJYA 2VVNA 3DHDA 4V2XA 5D2YA 3QGAC 4I7VA 4MMWA 2GZXA 1X7IA 3DYOA 3HMCA 2E67A 4TQTA 3TR9A 2PU0A 1N2VA 2ZVRA 4WKFA 4F0HA 2O55A 4LWWA 4AQLA 5LYRA 5AHNA 1U5JA 1E56A 3OVRA 4CQDA 3S9ZA 2A3CA 1PYMA 1SJCA 3AAMA 1UWIA 4GLEA 3L67A 3L66A 5ABFA 2WMGA 4EXBA 3EB4A 4WJEA 1G1YA 5D37A 1HP5A 1WXZA 3AHXA 2LLEA 3EX4A 4E0CA 4PRRA 1I45A 1VEPA 4CCZA 3R2GA 3B06A 4ZE4A 4U2YA 1KLZA 4US6A 4G2DA 3AROA 3KL5A 1JRBA 2YIHA 3W81A 1XDLA 1UKQA 1XCXA 2FZ9A 1DPMA 1F7BA 2HROA 1LUCA 1DTUA 3L65A 3KM8A 2QGHA 1DYSA 1B3OA 1AL8A 1QASA 1V4YA 2FZMA 4Q3MA 3BOLA 2DDXA 2OXNA 3BL3A 4ZXOA 2OWXA 2WBGA 2R14A 2NZLA 1E6QM 3N9KA 1VJIA 3QV7A 1RH9A 4ALDA 1H1ZA 3QR0A 3TA6A 4RL3A 3TW7A 3VOGA 3EKZA 5ABGA 4OECA 5DELA 2IPJA 3REQA 2WNWA 3J7HA 5AKQA 3N3MA 1FWRA 4POCA 1SMDA 2V9DA 4IGMA 4WVXA 1WZLA 1ONWA 4WDTA 3S5SA 2F6KA 1H7XA 1K7FA 3SN4A 4D1JA 4JOMA 1ZNNA 3AFBA 3QKEA 2DSZA 2YDAA 1CB7B 2C79A 3W1MA 1S2WA 3GH7A 3LCHA 4N9EA 3WL1A 4O54A 4DY1A 2UY4A 4PC8A 4R7OA 1K6WA 3LNPA 2VMFA 4FA3A 4FI4A 1JJKA 3EA1A 2CLLA 2Q01A 2PWVA 7XIMA 2NW0A 1HKVA 1RY8A 3PZTA 1CEOA 1EJXC 3ZWSA 4FR6A 5EL1A 2DSWA 1PJ9A 1PX8A 1OF6A 4OGZA 2QJIA 4P7OA 1YXCA 2PRHA 1IV8A 3TN3A 4QITA 5AC5A 4PUMA 3BCJA 2OFJA 3ISIX 3QR1A 4G9PA 4AWUA 4JNMA 2V82A 1VJZA 2NXHA 3B8WA 1UQZA 2Z1WA 4Q4PA 1K8CA 3MI3A 1KBBA 1E40A 1H63A 1MRQA 3OIHA 1JCMP 3RPDA 2ALDA 4ZFMA 5EBAA 2G3FA 4LVAA 4KEZA 2PWDA 4KWSA 3HPAA 3CAKA 2E9BA 1SZNA 1AD4A 1E0XA 4O14A 1OCJA 3FK4A 1BAGA 1TYGA 4RE4A 1SQ7A 3HJZA 2GJLA 2ZDRA 4U33A 2J9XA 2Z25A 1AJ2A 3BAXA 2YB1A 4W93A 3M0HA 4DZHA 5I3IA 2J74A 4IISA 1A50A 2RDUA 1OFPA 1SO5A 3D47A 4JAWA 4LQ1A 3DAQA 2ZOXA 1MFUA 3WDPP 3T2PA 5RUBA 3ZT6A 2GQAA 1VZWA 2GVEA 4IZGA 3OQ8A 4UFKA 3KVLA 3N9SA 1XCWA 3QRHA 3QLLA 5F4XA 1JCYA 1LQ2A 3BICA 1WBJA 4UNKA 1NELA 1G4SA 1W32A 2PTDA 4WHBA 1TZZA 2YOCA 4ADTA 1YDYA 1TA3B 4QAWA 3UCQA 3QM3A 1H09A 3I6TA 4KPLA 1CI1A 1IQ8A 3SZ8A 1E3ZA 4D6FA 2V69A 1E71M 3MV11 3LHVA 4XZBA 1M03A 4MVAA 2OO0A 1ECEA 1VCVA 5FSDC 3VMNA 3CTTA 1J0ZA 3TTQA 4HU3A 4L80A 1FWNA 1QPOA 2BDQA 2ZA3A 1VFFA 1MXDA 4PTDA 4DWSA 1WAWA 5F1UA 2CLPA 4O12A 5D38A 2GGJA 1BKHA 3AIVA 4CQBA 1LWHA 1OVDA 3LCIA 3IIZA 3T0DA 1POKA 4XG1A 1PDYA 2Y8KA 3INPA 4GINA 3WUEA 1Q7QA 4JHMA 3O6CA 2VRKA 1E1FA 4KWOA 3CUHA 4S23A 4O8RA 1VBJA 4RXGA 2ICSA 1VCGA 2V67A 3M47A 5AFDA 3M7WA 2V38A 2C15A 2VX6A 2VWTA 4H83A 2PI6A 4C6CA 2PP0A 5DCDA 3MSRA 3NURA 1XFBA 4TU1A 4MWAB 4KGJA 1AMKA 1E43A 2QMJA 4LPCA 2DSKA 3CWNA 3MSGA 4TOQA 4PUEA 4MAZA 5J5RA 1DXEA 1B4EA 1J5TA 4Q4MA 4QJ1A 3LCFA 1ISYA 4XUGA 3S5OA 5TIMA 2L5HA 5B7YA 2QUTA 3MYOA 1PZ0A 5CZKA 1UWQA 3I3DA 2ZUWA 3AZRA 3NZQA 1XLKA 4R53A 4FSAA 3KVKA 4LB4A 4JEQA 1UMYA 2ZZ3A 3BW4A 3IAQA 2CBUA 3T6CA 1N7KA 1BWKA 2Q3RA 4LVDA 3NZRA 1KFBA 5LSMA 2JIEA 4IOTA 2AQOA 5HAOA 4FOUA 4ZSUA 1HN1A 2CWNA 1EDTA 4H8VA 3OPSA 3A9BA 2VZTA 1S2AA 3NO5A 4A8LA 4HZMA 1J11A 4FOKA 3M9YA 4IMEA 1MEWA 1BLIA 1TTPA 1D9EA 3WG6A 1Q85A 3CLMA 4UFHA 2V5JA 3EWCA 2WV8A 1ZAHA 4JFVA 9CGTA 1KRBC 1JUBA 3EWWA 5JUVA 3ZZ1A 3M0MA 4B9YA 2HTMA 4JQAA 4DXKA 3MI2A 4Y8EA 3JW7A 2I9EA 2J8FA 1SYTA 1XLIA 2QLYA 3MCMA 4HNTA 3NAVA 1OFOA 2Z27A 3G1HA 1NVMA 1V0MA 3L4YA 3S8HA 4H6KA 3UJ2A 3B04A 4MJZA 4PTXA 4BF5A 3SN1A 1OX4A 4N4QA 5ABFB 1R3TA 3SCWA 3I7QA 4AB4A 3TYAA 4BZYA 2XVLA 3HTWA 9XIMA 4JL2A 2XJ7A 2CLMA 1P5BA 1TRDA 5KZEA 2WMHA 4JTDA 2YSWA 1AQ0A 2QDGA 3WD1A 1JI1A 1TTIA 3OVQA 5ECUA 5T9CE 5BWFA 2GQ8A 2QCHA 1DP0A 3EX6A 4LV4A 5AYZA 1UH2A 1KGUA 2ZZ7A 2WSYA 3NSMA 4D2JA 2WBKA 4HNLA 4U31A 4S3EA 4G1KA 4HNOA 5H8MA 1KM1A 3TNBA 1QOXA 3LBMA 3ORWA 1LUCB 2OGYA 2Z6IA 3L5AA 3VA8A 2GVLA 1QBBA 8A3HA 3DHFA 1FX6A 4TVDA 3LPGA 2QUNA 1I2QA 3O3RA 1CXHA 4W5UA 2J8TA 4Q6XA 5DXYA 3W86A 5G4EA 4P2VA 4B4HA 4H9XA 1LOLA 3CWOX 4M7SA 4EX4A 3VIPA 2WCGA 2WXDM 1ONRA 3KE0A 1H5YA 4JR5A 3W70A 4QSFA 4AY7A 4AZHA 1KV5A 1DIDA 3R8GA 3REQB 3ARQA 4DPPA 2IQ0A 2B7NA 4JYEA 4S2BA 3G1XA 2AAMA 2WW5A 5A2AA 2EF9A 3NL2A 3NEVA 4C6QA 5D04C 4JEJA 3TXZA 1Y0EA 4HVXA 1JCJA 4AMCA 4DM2A 1O60A 3E0IA 1QOQA 1FQ0A 2XPKA 3VUSA 3C2EA 1PWLA 4PB4A 4P7RA 2QCDA 3FNDA 1XLDA 3LD5A 3OA5A 3VU2A 3PJUA 3VD9A 3UFYA 4S3JA 3TYDA 1A47A 5AECA 4GA8A 4G6CA 5FJRA 1ENUA 3VOCA 3MUIA 1L6GA 1K03A 1TX0A 3PVFA 4JYDA 3PUDA 4FXJA 1E6XM 3IRDA 3GXDA 3B8UA 1O66A 8TIMA 3LBOA 1Z7AA 3KBWA 3N13A 1O5XA 4FNUA 3IGSA 1H4PA 1TMQA 1Q7ZA 2ZCGA 1UMLA 2A85A 4BFAA 3HA1A 1LWIA 4HD5A 1VYSX 3ITGA 4O1EA 3A4XA 4GFSA 4AZGA 1UKPA 3W7NA 3UWQA 3L23A 1LG2A 4N9DA 4NIRA 4W87A 4XVEA 1XSKA 1BVZA 3DCPA 1WKYA 3M41A 2QPUA 2Y2WA 1L2UA 4LVGA 3SCPA 3WQOA 3L4TA 1DJZA 3TLQA 3BPWA 1OGGA 3AOFA 4MJMA 5J5DA 5HANA 2GDUA 3L0KA 4NQ1A 1KCZA 4UR9A 1MRAA 3GNDA 3UT0A 1H1YA 4GE8A 4WX2A 5EYWA 4UFJA 3EOSA 3W38A 5AC8A 4H7VA 1EFZA 4L6OA 3TFXA 3DI1A 3OBKA 3UJSA 2Z4GA 4GY0A 1VQTA 2G3JA 4GUJA 4GBUA 4AHQA 3RG6A 5BCAA 3O15A 4WSHA 1LBLA 2J7CA 3GR7A 4S3BA 3T2OA 3URNA 2Q09A 4B2DD 3IANA 3KBJA 2WZTA 3GTNA 4AWSA 1EOKA 4KCTA 4AY8A 2PTZA 1TZ7A 3FXGA 1QR7A 3KDOA 1J0YA 4BKNA 3GUWA 5HQMA 4FPSA 3MO7A 1GQKA 3K13A 3FN9A 5HNNA 5I3KA 2J7HA 3EWBX 3P60A 4GGBA 2HZGA 4KCUA 4UTJA 4H6EA 4WSKA 1DKWA 1LLWA 3W07A 2ZUTA 3BMWA 1FH9A 5F4SA 3GC4A 4QX4A 2VEIA 3EPNA 4Q7NA 1CXEA 4Q7BA 1XJBA 5E5CA 3GHSA 1B54A 1H49A 3RN6A 2OQHA 3HQ1A 2VEGA 3W6LA 4DWSB 3U2EA 4FIQA 1FH8A 4KBXA 4CU7A 2Z7GA 3UR2A 1JGIA 1R3YA 3K4WA 2Y7DA 1AL7A 4C6KA 3MUZ1 1LRNA 2HS8A 4AIOA 7CGTA 1GVEA 3E0WA 4M19A 3QMTA 2YFOA 4X2PA 1QI4A 3WK0A 3N3TA 2D0HA 2G4FA 4RDWA 1F74A 4M5PA 2V3DA 3MJMA 4L61A 4PN2A 4FEZA 1GVOA 4JTJA 1HG3A 1FOBA 4XIMA 2F38A 3FJNA 4YMZA 1EKOA 5TQLA 1E3XA 4WQ6A 4GK8A 4QFUA 3DERA 5D9NA 4RE0A 1KO0A 3W28A 3WQPA 3WNOA 3G0XA 4HOWA 5CBBA 3AHZA 5C2GA 1AK5A 4KRTA 3RM4A 1UZDA 3ZIZA 3BLKA 2O92A 3MWAA 5KSWA 5EFDA 3UG5A 3RUBL 3V0SA 5M17A 2QCFA 4GIYA 2VT0A 2PDLA 4NAEA 1JDFA 1HJSA 4GWEA 1KCKA 1IT0A 3BLLA 3M07A 5FJUA 1C8YA 4XAZA 3TFCA 2I16A 4FX6M 4YLWA 4RXFA 2DUZA 3ITCA 1B1YA 1UR0A 2FJKA 3GHTA 1HW6A 1TPWA 3V75A 2X8RA 1A5UA 3IIPA 2RDXA 1XICA 2QCMA 3D3AA 3PZUA 3R4IA 3WLLA 2ISDA 3GC5A 2P53A 2VYOA 2QV4A 1MZHA 1Q65A 1EC8A 3BQ6A 5D2VA 3WMSA 1OT1A 5JQ9A 3LTYA 5REQA 3U9IA 3S6DA 3KDNA 1W56A 3C0SA 2DFAA 2PRMA 4S3KA 3LRMA 3A3WA 5EA9A 3S3GA 5KMYA 5JMUA 4GXPA 1CGYA 4LBUA 1WE5A 5C9RA 4XUYA 2GYIA 1RJPA 3WH5A 3R11A 3H2OA 2FIQA 3PR2A 4AZ5A 5LXXA 1LYXA 3W1PA 2HXUA 3CHVA 1OX4B 4YWIA 5CG7A 5FA5A 2O4QA 5HWMA 7PTDA 3CHDA 2O9PA 1XYAA 1IXQA 4H9YA 3LENA 4E38A 2DUAA 4V33A 3T0CA 1JD7A 1MVYA 4PFMA 1ZLPA 4AZCA 1EX1A 1XRFA 4MB4A 5LIYX 1WDPA 5FJOA 2G3MA 3WNLA 5KETA 3AYRA 4UZSA 3F4CA 1FH7A 2D22A 3GHUA 4DELA 3NWRA 2J24A 2NX1A 4HA0A 3OGRA 4UCFA 4QEEA 4BQ3A 3BWWA 1DWAM 3THAA 1GYLA 1QFEA 3EX3A 4MY1A 4TX6A 3W0KA 5I23A 1PCKA 4IPLA 4WXZA 3EB2A 1B31A 4NYUA 4JTLA 4MHBA 3PNZA 1B3XA 5EKYA 5DT5A 1EHNA 2WM0A 2WPBA 4CNTA 1I2PA 1CDGA 4LBSA 2FJUB 3PJWA 4AD1A 4DO5A 5FL1A 5CBIA 2OPJA 1HIZA 1E1CA 4AD0A 1ODZA 1T8XA 1UJPA 3M7SA 4FX7A 1BXCA 4EF8A 1MUCA 3WJWA 4CVUA 5EGRA 3UEQA 3JZUA 2C71A 4AH7A 4MTVA 4YTSA 1WO2A 3CL6A 3TONA 3BANA 1UKSA 3ATZA 1XIEA 1M9HA 3O0KA 4V15A 3VOFA 2NUXA 3VIIA 5D33A 2E4TA 4TV5A 5E1QA 4J3TA 3VNZA 4HA4A 2Z00A 3OZPA 4FX8A 1YKWA 3BMXA 4PMRA 2W91A 2QCDB 5A6BA 1ZCOA 3W53A 4PULA 3DG7A 2VGBA 4UTLA 1HO1A 2OG9A 4HPHA 1S1RA 2BS9A 2YJQA 3VGEA 4G7FA 3TJ4A 4A3HA 1ZQ5A 3NZGA 4FLSA 2XTKA 4ONVA 4P7LA 3DBNA 1GG0A 1UR8A 2Z1VA 3C2YA 1PE1A 2WJFA 4CU8A 2VRQA 3AXHA 2OCZA 2J47A 1OADA 4OJYA 1PS9A 2C8NA 2OLAA 1FP8A 3APGA 3WUGA 4HNCA 3O6AA 4R7JA 1HUVA 1GZGA 1TELA 4E6MA 3I4EA 4D6IA 1V02A 3WD2A 1PIFA 5HJLA 4GBDA 1IXOA 1UP3A 1VB9A 1O95A 3LHYA 3G18A 1EWDA 3WQ5A 1LQAA 3DYPA 1D3HA 5I7GA 2WHLA 4UTTC 4N9BA 5HK4A 3ARUA 2HE8A 1O12A 2VP8A 1XIGA 1EF2A 1GK8A 2F2HA 4Q4RA 3RMJA 3E96A 2DZUA 1J5SA 2A7NA 5DLCA 3NQAA 2QKFA 2PLKA 2ZA2A 1HJQA 4IFRA 3SCNA 1XIHA 2OZ3A 1MNZA 2I1OA 5CSRA 4NY2A 1WAUA 1LDCA 3L7RA 1NSJA 4RZ5A 1FUYA 1U22A 3LHTA 4CLMA 4TTGA 1TPH1 2FZ8A 4XIAA 1OX6A 3IK2A 1IR1A 1Q6LA 3W7MA 3WLPA 2FDSA 5AYIA 3S83A 3P62A 1MWOA 3HPZA 3EDJA 3F4NA 3K1GA 4H1ZA 1KFCA 1T6MA 4A29A 4UFMA 3B8IA 2E5CA 2RDWA 3T4CA 2WVSA 4KEMA 3JZEA 1US0A 2WNQA 4B2DA 4QROA 1B9ZA 2Y85A 1QNVA 3QZ6A 3WQWA 3DKJA 3IJ9A 3V5OA 1W3KA 1G4EA 3QTGA 4PMOA 1DWIM 1XS2A 3UVAA 1WDSA 2WKLA 1CXIA 4S2CA 2IPGA 4F0MA 5CG0A 3M44A 3QC3A 4ILSA 1A80A 1DE6A 4NNBA 5LIWX 2C18A 2HPMA 3TN6A 2AOSA 3HQOA 2I5IA 1XGDA 3EOLA 2VJXA 4IGSA 2XHYA 3R8HA 3VCCA 4LF2A 1TQXA 4TX9A 1EH9A 4JFUA 3B8VA 4PUJA 3S9YA 2AGTA 3WDRA 1YXDA 3TAOA 1RCQA 3HV9A 2E6YA 3WQEA 1TV5A 4MB3A 1LL7A 2XGIA 1XLCA 1ALDA 4FXFA 1SVDA 2IKJA 3WIJA 4OUEA 3IK4A 4Z0SA 5CC6A 3B0YA 3PF3A 5AZ0A 3MANA 3FDKA 2WANA 1NOUA 3CHFA 3BG9A 2VDHA 4C7GA 1UR2A 1QPQA 1LTDA 2IW0A 1T5AA 4AEOA 3VIJA 3S2NA 3UR5A 1X97A 1GPFA 1TIWA 2WVVA 3VD7A 1DVJA 1F3TA 1DQXA 1BGGA 3E0VA 4NAEB 4KWUA 4YTTA 3P14A 4DF2A 1W5NA 4OV4A 4XSMA 1J0HA 2VX4A 2O9OA 3N2MA 2PDUA 3OU8A 1CGVA 4D9PA 2FGZA 4NYYA 1JZ6A 2J78A 3TDFA 3E2RA 3DC8A 4ICCX 3QSTA 2OX1A 3W1RA 3AJXA 4PL2A 3BSHA 4R9OA 1W9VA 1UD5A 2GJNA 4GH3A 5J04A 1QI2A 3P0XA 1JNDA 4ACYA 3WLMA 4QE1A 3CQ0A 5REQB 3BLDA 2ZUMA 2FZDA 3KL3A 5CPNA 1AQMA 2E1WA 1U5HA 4YVVA 3CBWA 3VE7A 1ZP4A 3KOXA 3LU2A 4MPQA 1G4PA 4AVNA 3P8IA 1DJWA 2XZ7A 2DQWA 3RX3A 3BK0A 3TQ0A 1B3YA 4I5RA 1DQUA 1ZAJA 3U8GA 4JTEA 2P3ZA 3M0IA 2BODX 2YB4A 4MNJA 3WNNA 3VX0A 1WA3A 5A8MA 1OC6A 1IHIA 3VILA 1TMHA 4Z1CA 2KZHA 3FVMA 3HFTA 4LCQA 1VD6A 3PP7A 3HFYA 3AU2A 3G77A 2HK0A 3WBEA 3FXYA 4JQ2A 3VKAA 5ECVA 7TAAA 3NDZA 3RM8A 1CIUA 4D6CA 1OQFA 2PD5A 2A79A 4FB7A 1SJDA 2PE4A 3OHIA 1O1ZA 4AZCB 1R30A 4XAYA 2PF8A 3S1UA 4H41A 3VM5A 4UMCA 3LGGA 2GGGA 3ANVA 1KM5A 3M46A 3B8TA 1I9CB 3F4VA 4X3ZA 5CGQA 1YNYA 5K9CA 3L2IA 9XIAA 3CH0A 4TIMA 4L7ZA 2DPEA 1F2JA 3BQ5A 3NG3A 3VD5A 1UW9A 4QQ3A 5FI8A 4DLFA 4UQBA 4UFLA 3ARTA 4B3KA 1TE6A 1VFTA 4MZ8A 3CZLA 1E1EA 1RCXB 2PODA 3N2TA 4UBPC 3H4GA 1WYIA 3MUXA 3E2QA 2P8CA 4TR9A 3AQUA 4FIRA 4R34A 3NZ1A 1E1CB 3ZQ9A 4RUBA 1W1A1 1SJAA 3EOEA 4DX3A 3WD0A 2AAAA 2ZUUA 3S42A 3QOKA 2QCEA 1ZCCA 1ZS2A 2PGWA 4XBJA 1VFOA 1FRBA 4B5SA 4GZJA 2CXGA 3BARA 1OC5A 1ZB5A 4JN8A 1CWYA 4PTWA 4DJDD 1QTWA 1W1YA 2W67A 3SSZA 1NM9A 3PTDA 4IMDA 3LMZA 3G3DA 1TV3A 2BY3A 2ADAA 3F2BA 5CPSA 1PTAA 3FJ6A 1N8WA 3OG2A 3N6HA 3GG7A 4LXFA 4GZIA 5D2XA 1P0EA 3WQGA 4Q8QA 3MMDA 1FA2A 3MJYA 2R6OA 1BTCA 3R0DA 1MSSA 2VQUA 4LYRA 5A6LA 1B3VA 1VR6A 2XSBA 3WFAA 1FWWA 2BHUA 5DT7A 1P6CA 1ECQA 5TF0A 3UJRA 5LHEA 4YCOA 1K4GA 1W1PA 2R24A 5I02A 2ZVIA 2PC4A 3GNPA 2C13A 3BW2A 4LU0A 1GJUA 5IM51 2RJGA 2ACRA 1QW8A 3VGBA 1XKYA 4LAKA 2F61A 2XIOA 3KXQA 1W0MA 2X1TA 1C9WA 3BOFA 1JZ7A 4YYFA 4J4KA 4R5EA 1KTBA 2R94A 1IYXA 2RAGA 3CASA 2YYTA 4HYRA 3W7DA 3BAKA 2GLKA 3CPGA 4N02A 3IACA 2ATMA 2EPMX 5LZLA 1IEVA 3VGFA 4Z2JA 4CN6A 4ZENA 3E5BA 3AS3A 3NO3A 1W2PA 1OFDA 4Q8MA 1GQLA 1SMAA 1EA9C 4W9TA 3VMPA 1RP9A 5HWJA 5HUPA 5CLWA 2NXGA 3NXFA 4EK7A 2OYKA 2ZDSA 4J1OA 4E2OA 4MF4A 3QV8A 3ABOA 3QV9A 5FJIA 5A6TC 2CZEA 4HMEA 4HSOA 3GDBA 2VCBA 4RV3A 3H2EA 2XVKA 3B05A 1IXNA 3GU2A 1E6RA 5DMMA 4K8HA 1KC7A 1OFBA 2R1LA 2DZVA 3UU0A 3T55A 2NQ5A 1Q6OA 3LNMA 4H2HA 5CJNA 1FWDC 3QJAA 2PZ0A 2DH3A 3I6EA 1GOKA 1PVNA 3PPHA 4R3UA 3H8AA 5JH1A 3PJTA 3GWQA 5A8QA 4ZQNA 3UZ5A 4L4LA 3W7KA 5I0DA 4MKVA 1MFVA 1R87A 3WLIA 3I6RA 3P8JA 3V0TA 3KRUA 4A4AA 2W4XA 1WDWA 1AW1A 1GORA 3W2KA 2D73A 4UQCA 2Y0FA 4MY9A 4C6LA 3POCA 3NQEA 2Z1SA 3ABSA 3PZMA 1ICPA 3WK1A 1RR2A 3NZPA 5D9OA 1Q13A 2FMOA 1H7NA 3N29A 3UZWA 2HNHA 1L0PA 1WZAA 4GUGA 3LZ5A 1TSIA 4FNRA 2QCGA 4NU7A 2TODA 3KCJA 1XLMA 3A23A 1EDGA 3IJIA 1JXKA 2A6LA 1XCFA 2WC3A 2QCLA 2PDCA 1IEIA 1SSGA 3L68A 2AGKA 2C14A 5A8GA 3B0VC 1KQYA 2WHKA 1ISWA 1ODUA 1SPQA 2DORA 2CLKA 3CEUA 4F3HA 1W3LA 3H21A 3WLKX 4QCFA 1S38A 3APYA 3GDRA 2PGRA 3SIMA 3WJSA 4HYWA 3MO4A 3R10A 1AZ2A 2WVVB 3SY5A 1NWUA 1BVNP 3QY8A 1SFLA 2Y62A 1QO2A 1QNPA 4O13A 3PPGA 1UH3A 2V6AA 4GX8A 3PFRA 4K38A 4WSJA 3NXLA 2DSVA 1R2SA 3E3HA 3UERA 3LTSA 4B9ZA 7TIMA 3KLKA 3HQPA 4GFIA 1EHAA 2PP3A 4DWDA 1VBGA 3S6TA 3NIYA 4K68A 4AZIA 1JAEA 2OWCA 4GYKA 3N4AA 2NUYA 1PL9A 4CD7A 4HQVA 5DQPA 2YLAA 5LA0A 3GY1A 3MUY1 4YL2A 1M1BA 2H8ZA 2VZVA 1K9EA 1J79A 1CPUA 3NPWA 1EEXA 3W00A 2RHGA 1C91A 3I68A 4BS0A 4N9CA 3ES7A 4Q8WA 4JY9A 1TPVA 6REQA 3WQ4A 1TX2A 3R0KA 2R1KA 4MJ2A 3WLJA 3FCPA 3N15A 1UUQA 2WSQA 2WSPA 2E5DA 1MUMA 3EWXA 1EDQA 4BWLA 2D2HA 1N8IA 4GX9A 3ARRA 3IARA 4UR7A 1KA9F 1K7XA 3AC0A 1ZU8A 2VDIA 4PE8A 2Y63A 1QDSA 3RNDA 2J79A 3U7BA 3JRKA 1QNOA 3QMRA 3MW7A 1TO3A 1U1JA 3DDMA 2ZXDA 2YW4A 1SGJA 4ZOBA 2J7BA 3IUDA 1ME7A 3PG9A 1DIEA 1VIWA 1PKLA 3PB0A 1DJNA 4V1XA 4NI3A 1N55A 5I79A 3ZO9A 1J12A 1TUFA 4MADA 3WLNA 3VABA 3W1QA 5C9ZA 1J0IA 3U4AA 3RR4A 2PDGA 3UWWA 1VGAA 5LHFA 4IIBA 2VD8A 4AX6A 3H2FA 2C16A 4IMGA 1V8EA 1EL3A 2VENA 1AZ1A 1B4KA 2VR2A 4M6UA 2VDGA 1WUEA 2OLHA 4QLKA 1MQPA 3O0FA 4F0RA 5JH2A 1XYCA 4Z1BA 3DFTA 5BW6A 4EWND 1W5OA 1L6FA 4M8UA 1W9DM 4GGHA 1J6OA 4X9YA 3AMKA 1Q6RA 1W6TA 3MHGA 3EKGA 4C6OA 4DJDA 1VIZA 1OJXA 1W2VA 3FHAA 3RK8A 2BXZA 3ZR5A 3WBYA 2WZEA 3EGJA 3V36A 3SADA 3A24A 2B81A 5EU9A 4AEFA 2CXEA 3H4XA 1Y5WA 4LAUA 3VC6A 4Q33A 2Z1KA 1I0BA 2C0HA 4EXQA 1IR2A 1R0MA 3AZTA 2HQAA 3AIEA 4LGXA 6XIMA 2BVDA 3GDLA 2VEKA 1XIBA 1NTHA 5I3HA 2NV2A 3CQIA 2JGYA 4Y90A 2PP1A 4IMFA 3QBUA 1HZYA 1N82A 3HB9A 1CXLA 1EJRC 1DWHM 4MKNA 3RLVA 4RNJA 1AW2A 3RX2A 4XZ9A 4AD3A 2NVAA 3AIRA 2D3LA 1KFJA 4JY8A 4REQA 3MUCA 3CQJA 1P0KA 3QGVA 4N6EA 4H2CA 4A35A 2GWNA 1OK4A 1U83A 4FNPA 5CSUA 3GK0A 2BVTA 4J9JA 3TSBA 3QW3A 2YBTA 2OX4A 2VGIA 3STPA 2PDFA 1YPXA 2BHYA 1FWTA 2BP1A 1EF3A 4CD5A 4GMEA 1QNQA 3AS2A 2GOKA 3TYEA 3WUBA 3PZ9A 1IGWA 4JDBA 4BK9A 1BXBA 3EX1A 3W73A 1ELSA 4YPJA 4KEVA 1HVXA 4C6IA 4A22A 1S2TA 5DCBA 5CBJA 3LGDA 2HISA 1L6YA 1J2BA 3W7HA 1VLWA 3MUAA 2NQ9A 4TTUA 3VINA 3TXVA 1GONA 1GWJA 3W3OA 4LAOA 1RXOB 2YZ5A 1A3HA 4DF1A 2YL8A 4JKMA 1CENA 4JX4A 2WB5A 2WVTA 4HIBA 3WD4A 4ROQA 3ENLA 3T0BA 2W9MA 3GNRA 4LX4A 3GXMA 4C91A 3S6OA 4JZ5A 2Z1XA 2PDWA 2ZZ6A 4JFSA 1I4NA 3A3XA 3KUMA 1UA3A 3PWGA 4H6QA 1UB3A 2ZYFA 4Q7IA 4EP8C 2FTWA 4H8HA 4ZB0A 5T9BG 1GTHA 1JGMA 2NT0A 3JVAA 3TYCA 1TWWA 4A8IA 3BTNA 2TPSA 3NJ3A 1UR4A 3GU1A 5AC4A 3GR4A 4HHHA 3EXRA 3PANA 4A3RA 3W9ZA 5LIKX 1VCFA 4OT7A 4JTKA 2FTPA 2P0IA 3SBFA 3BAYA 4KGLA 3U5YA 4O0KA 3D3FA 5LA1A 3AS1A 1OG6A 1EJTC 2BFGA 2JKAA 3M5VA 4FMVA 5I77A 1VC4A 2V5BA 4OV9A 3GS6A 1NDZA 4M1RA 1W3JA 3NFUA 1XRVA 4HNUA 1QUMA 2NX3A 4Z2HA 1UOZA 3N2BA 1HFBA 3VXGA 4D6EA 2A2IA 3ZVIA 3BLOA 3QXBA 3PJXA 3L2LA 1Q4WA 1JFXA 3DX5A 3B9OA 2NV1A 3KVMA 4LFYA 1DWFM 3NGFA 2XN1A 4UMBA 4A05A 5XIAA 5IFPA 2G3IA 2ANUA 4DHGA 5BYWA 4Y9OA 2ACQA 4X0NA 5AHLA 1Q6GA 1RQBA 4KKXA 1DORA 2WYSA 4GIRA 1LQ0A 5AYBA 2BBFA 4GACA 3SO7A 3UP8A 3P2VA 3LV6A 3R13A 5JBFA 3C52A 3DFPA 1SSDA 4GNKB 4QE5A 2Z24A 1OFAA 3IAPA 3BAJA 2W3ZA 3M6YA 4ACZA 5LNWA 3W2NA 2XN0A 3QKZA 1TPFA 3RCYA 2W63A 2Y61A 4WZHA 1YTDA 2V63A 3W71A 3AU6A 2OR2A 1DHKA 3SR7A 2WSKA 4LS0A 4OQVA 1QJWA 3KWSA 4G1NA 3TWBA 3S2CA 1LZOA 1O5QA 2EQDA 4AF0A 2PEVA 3AWOA 4LYQA 3TQVA 2FPYA 2WMJA 5GNZA 1QWKA 3MMTA 3P93A 1EB3A 4GH1A 3G2GA 3NQVA 3KAOA 1XLFA 3NVDA 3PM6A 3VD4A 2NSXA 1OINA 3EMZA 2GGHA 5TAOA 4G5DA 4AIEA 2VOTA 4GXMA 1GKRA 4NX0A 1Z6KA 3LSCA 4MZ1A 3PBGA 1C7SA 3WCZA 2R8WA 1SFJA 3ONCA 3SSJA 1IT8A 4XO7A 4XSLA 5C6MA 5EB8A 4RNFA 2PTYA 2TMDA 3ABZA 3O16A 4LVFA 3N11A 3UG4A 4GC4A 1TR9A 2BY1A 5D32A 1ZUAX 3QR3A 2OYMA 4HOZA 4E4PA 4IIEA 3HOJA 4ZO6A 4PMZA 1WOAA 4IX2A 3A47A 5E0CA 2D23A 1HJWA 3VZYA 1JPHA 4PMDA 5G4HC 1V6VA 3O8AA 2H3DA 3PWAA 5DMYA 1I2NA 3BUVA 1PTGA 3APTA 1D8WA 3U4FA 4MYXA 1QCWA 2DZPA 4OIFA 4N6FA 4FALA 2QIWA 1KB3A 4MPKA 1PIIA 1UASA 2O7QA 3R43A 3LYEA 4JYFA 4KS0A 1Z32X 2GJXA 2DZAA 3TUUA 4PTMA 3GZ3A 3VNLA 1K8ZA 3OZOA 2VFGA 4Y2WA 3N17A 4NXKA 5FJPA 1QHOA 5A6MA 1FWJC 1M7PA 4NZJA 3DECA 2W92A 3VGDA 2WKJA 5FAJA 5A2BA 1KM0A 2QYGA 3DENA 3N73A 3W7GA 3HGSA 3UXLA 2YCIX 1RJRA 2NT1A 1HT6A 4DBWA 4B3LA 1E4LA 4HYVA 5F7UA 3B0XA 1W5PA 1XM3A 3O7UA 2ONEA 3FA5A 1V0NA 1BRLA 3K2GA 3T0TA 2HV5A 2R9RA 3PC0A 4GJJA 4FNQA 4PYSA 5JU6A 1NQKA 4ZQRA 5EMLA 4WIWA 5EMMA 5D9PA 5L9FA 1XYLA 3R1ZA 3H54A 3HM7A 4K7VA 1W91A 4GG9A 3WBXA 4B5TA 2FHBA 5KZ6A 5H8UA 3TZNA 1F3WA 1JG9A 3S2MA 5AN7A 4MWAE 3R6IA 1EQCA 1HJXA 2XFRA 3UWYA 1T99A 3CLWA 4HTYA 1TWSA 3U2ZA 4XKMA 4PSRA 4REQB 4LANA 4U2ZA 2VC9A 3ABXA 3CHCA 3UWZA 1EJSC 4AAJA 1TVPA 1JDDA 1Q2RA 2YR1A 1C29A 3SQMA 4DF0A 1WNOA 3S1VA 5A1AA 4RCXA 5CGTA 3A13A 1A3WA 1RQHA 3SJNA 2P3EA 4JKKA 1E6NA 1EIXA 3B9AA 5A2CA 3VKKA 1GUVA 3LBCA 4IL0A 3DN5A 1QNRA 2CW6A 3PUEA 1M7OA 1FWAC 3UXAA 3MMUA 4NG3A 4JNYA 1DWJM 3W2MA 1YE4A 1I60A 1MYRA 3V5CA 1JEZA 5H2ZA 2V5KA 5H1WA 1VEOA 1K70A 2D20A 2CBIA 2V2DA 1XBZA 3N2XA 3R94A 3VOJA 4PUKA 2D0GA 3VDHA 3TWAA 4C6PA 1S3TC 2ESCA 1V08A 3UPMA 3W72A 3V0UA 1I1WA 3LCXA 3HJEA 3BDKA 2J7EA 1SU5A 4ZZ9A 4B5XA 5EBUA 5E6ZA 5IOBA 1VF8A 3ATYA 1V51A 3TK7A 3EOUA 3LCGA 1XG4A 4DYKA 3TU9A 1CNVA 4NP7A 1RVGA 3MDUA 4J35A 2E09A 2Y8VA 1U5VA 3G1RA 3LV5A 2Z0IA 4RNHA 3VNMA 4LC8A 4XQ6A 4E2BA 4AHOA 3CUIA 4ZOCA 2B7PA 2GQ9A 3GKFA 1HJVA 3E74A 1XXXA 3N9RA 3RCNA 3SDOA 1ZPTA 2XM1A 3LLDA 1EWEA 3T1GA 3W83A 1E72M 4WLCA 1AH4A 1Y7VA 4M80A 1DXFA 3Q65A 1UR9A 2WO5A 3C2RA 3FDGA 3UZZA 3UZXA 2DSUA 4RDZA 2NQLA 4H8UA 4Q4SA 2QUMA 4HSHA 4BQ2A 2XG9A 1Q4NX 4FNTA 4UTTA 1R8LA 1T7LA 2DJLA 1LOSA 4Q8OA 1K9TA 4PUDA 5HJXA 3NEHA 3VIGA 2XYLA 3K4AA 3URAA 4XB3A 2X40A 5JVLA 1CGUA 5K4ZA 1XSJA 4YN5A 4S39A 3TROA 3BLIA 1KXVA 2YFNA 4H7CA 1XI3A 5A6AA 2PDXA 3IVSA 3GTFA 3FOKA 4GC3A 4O1AA 3STGA 2XH0A 4GY7A 3VIOA 3PBVA 1PTDA 5KTLA 1US2A 3EEZA 3PZOA 1P6WA 1THFD 3R89A 5FF0A 3THCA 2ZRZA 1I8JA 2RKXA 2FGLA 1REQA 2C0AA 2ZRVA 2PB1A 1LF1A 3VI2A 2IKHA 1LRTA 5MF5A 1AFSA 1NP2A 3DUGA 5GVJA 4PUUA 3RIKA 1GOIA 2XH7A 1FY6A 3KL0A 3LS9A 1JQVA 4ACZB 2NXIA 1P1XA 3G0SA 3DGBA 3MHUA 4C7FA 3MZNA 3CUZA 1ITXA 4P8UA 3TNOA 2CNCA 3D5HA 1QMLA 2H8XA 2ZXAA 2X7VA 1R85A 1EOMA 4H8NA 4HZ7A 4AF0B 3R0UA 1GHSA 4CVWA 4XZIA 1OC7A 4E8GA 4J3UA 1JUEA 3UCCA 4UTUA 1BYCA 1JZ2A 1Q8AA 2Z2AA 5FD0A 3CHEA 3NVTA 4GIEA 4YYCA 1UWSA 3AMLA 1PDZA 4ECLA 1AODA 1KM3A 2Y70A 4GI9A 3HPSA 3ITLA 1WV2A 1QXLA 4UOQA 4DRSA 4GO8A 3SFWA 3LPOA 5DCEA 3S0CA 1X1OA 1J0JA 4JIQA 4HZ8A 3L4UA 2YKKA 4QLJA 4MNKA 3F4DA 1UUMA 4EIVA 3TA9A 5K3VA 3LQLA 4GYPC 4JTTA 2VUNA 4J2PA 1C8VA 2ZWYA 1EC7A 2J27A 3MB9A 5PTDA 1TJ2A 3OP2A 3UA3A 1OFRA 3W1TA 3SW6A 3RRAA 4E5TA 3MP4A 2FGBA 2QF7A 2OQLA 1P7TA 4JIRA 3VNIA 1RZMA 1O94A 2OB3A 3WH9A 1X7FA 2E28A 3OLEA 1YE6A 1ITUA 1FWIC 4KFPA 3BV4A 1XQLA 1EYWA 1F07A 2ZUNA 1KFLA 4L1WA 2XVNA 4NZ4A 3UF9A 3NQFA 1D2KA 2XSXA 4NXSA 3DFHA 2FVKA 6ENLA 3CUJA 1J96A 3W1AA 1DJXA 2GJXB 1NARA 4HA3A 3WSUA 3DFOA 2WCSA 4LUSB 3RYSA 1TWIA 4L9YA 4N42A 2WPGA 1JYVA 1AH0A 1E6ZA 3PULA 1XIIA 1XIJA 5CCZA 3BO9A 4QEHA 5D9MA 4IMCA 4Y7EA 4PB5A 4P7NA 1S2CA 2QAFA 4CU6A 3OHMB 1WB0A 2O7SA 2Q3OA 1C8QA 3CZJA 1WXJA 3AXKA 3O6DA 1YHTA 3VDCA 5D05A 3A6OA 3I7RA 2J88A 4ORMA 4IPNB 3T81A 2BXYA 3B3DA 3POHA 1MMFA 3VPLA 5XINA 1BRLB 5JXQA 4I9AA 4CD8A 4WF7A 1WP6A 2EO7A 1IWAA 1OK6A 3EOOA 3EWYA 1L9WA 1UR1A 5HR6A 4JS3A 3IGUA 4RPPA 3GXNA 5F2MA 4A6GA 4Z1YA 4J3WA 2X1RA 1GJWA 2IQTA 3U0HA 3UGVA 2VR5A 3HPFA 1W9UA 3T07A 3H7UA 3G8RA 5AY7A 4Q22A 3RDKA 1TJ1A 2GL5A 1F5ZA 3LHZA 4HHMA 3ITYA 2WC7A 4X2RA 2H3BA 5H6HA 3VTRA 2CHRA 4AHPA 2P76A 1PKYA 2EJAA 2DZSA 2X05A 2XSAA 4Y9PA 4JCLA 4JIEA 4DLMA 4X0VA 3OQEA 1KRMA 1XYFA 3PK7A 4XO6A 3SEPA 4OBTA 1H3GA 1ZFJA 1HF6A 3GIPA 4N7QA 1JYXA 4TXEA 3ARPA 3PHAA 4O0QA 1JD9A 2QDDA 1Q6DA 4INFA 3B0UX 4W88A 1GYMA 3I10A 3U7VA 3CK5A 1JIBA 2PC8A 3EBVA 4WEVX 3K46A 2VC6A 1YYAA 4MJ4A 2ISSA 4IP4A 2PGFA 4NUWA 4H9ZA 4TO8A 1X8CA 4N0RA 1R2RA 3QQ1A 5EPDA 1C8XA 2ZRWA 1EC9A 6ALDA 3B8DA 1DOSA 4UB9A 1IE7C 2V3FA 2H90A 5FEXA 1XL9A 3TC3A 1R9ZA 3U2OA 3IIVA 4O57A 1MNSA 1RPKA 3T8LA 5JBDA 1Z42A 3PAJA 3W6MA 3S2JA 4MG4A 4A2RA 1M65A 3GHRA 2YPIA 4QM1A 2J8GA 2ISFA 5M2FX 1ISZA 1H5VA 5LNSA 2P1FA 3DC0A 4CEXC 2TYSA 1KCLA 3VD3A 3M43A 4OFCA 4Q6JA 4XD6A 2F84A 3BLPX 3NQBA 3LG3A 2PCEA 2PBGA 4URIA 4H4IA 2DZXA 2TAAA 3EKLA 3W26A 2YW3A 1Q8JA 1TJ0A 3BLEA 4LYKA 4O10A 2RGLA 4BWLC 4NSBA 2OJPA 2YGYA 2OTDA 3OBEA 4QBXA 4DJFD 2ASHA 3WF3A 2EPHA 1K4HA 4D1IA 3MDWA 3SI9A 5CZJA 4B91A 1GEQA 7A3HA 1OM0A 2XU2A 1KD0A 2UWFA 1G9HA 3G5EA 4Z2KA 2PDQA 3EMCA 4Z42C 3A4JA 4AC1X 4YIWA 5L6UA 4HPGA 4WRHA 3LHWA 1W54A 3LEPA 4CGTA 1DBTA 4RV8A 3T8QA 2A1YA 3QC0A 2G97A 3P3BA 1X1ZA 4HSNA 1R3QA 4FP1A 1F05A 4F4RA 4PMYA 3NR0A 3ZJ7A 2Q02A 3MS8A 2FQIA 3I65A 5HQEA 4LJ3A 1IF2A 3A9IA 4S3FA 1Z89A 2ZC8A 3DXIA 4HKPA 1TV2A 1UBPC 1NEYA 4CN1A 3GLCA 4EAMA 4M6VA 1M01A 4CNNA 4D6DA 1KXHA 1YEYA 1VHNA 3DOPA 3W1LA 2PLCA 3W25A 4ADSA 3VNDA 1BXNA 3NOEA 1TTQA 1XG3A 1REQB 1OFEA 4WKAA 2BV9A 2EKGA 2Y88A 1A5OC 3W7LA 4L1XA 3FAWA 3SY8A 4HBKA 5CSSA 2GGEA 2XWEA 1MW3A 3T78A 3CL7A 1X6NA 3F03K 4NNAA 3W7EA 2GJRA 2PLMA 4NJJA 2NX9A 2Y7FA 1A5BA 1TWZA 3W6YA 4U5KA 2VC5A 4QJ4B 4DJDC 2DJXA 4OOZA 5CSYA 1UPMB 1EX5A 2WKGA 2V30A 4IQDA 3GKAA 1XBVA 1U2YA 2XGBA 1QW9A 3RGTA 3THDA 4DXVA 1LM1A 2HPIA 2PU1A 1CGWA 3R8RA 1RSCA 3EMQA 3ABQA 5GNYA 4GY1A 4Q4QA 3SN0A 3P5ZA 3TKFA 3MY9A 3PSWA 3S5NA 2J25A 1RA0A 3BG3A 4RK8A 2GQ3A 3HGOA 2VKZG 5D09A 4HNVA 2A3LA 2AL2A 3LUTA 4WJ8A 3QZEA 3CT7A 3RJYA 5HQLA 2PLJA 1OYBA 3IGXA 4OWGA 3SY1A 3YPIA 1KFEA 3UXKA 3IIXA 2G0WA 2E40A 2W79A 2Y4SA 4KWVA 5CJMA 4ML4A 3V16A 2X41A 3Q37A 5C70A 3UR7A 3EPMA 5D8WA 1KV8A 3IWPA 1GYNA 2OU4A 3LB0A 4TX8A 2WCAA 2OO6A 3FY1A 4MWAD 3C3UA 2EJ1A 2DZWA 1EBGA 1V3HA 2DQXA 4DYEA 4LW7A 5IHRA 2DZTA 1Y65A 1TG7A 5I3JA 3B4YA 2PWFA 5FOOA 4RKAA 1QPKA 4LY8A 4KIEA 1TRIA 3CQKA 4DO4A 2PZNA 1HO4A 5AVNA 4B15A 1A5KC 3GH5A 3ITTA 3HV8A 3B9NA 4QGCA 3UWVA 2GGIA 2CZ5A 2F9RA 5IRPA 1DL3A 5A94A 4GNVA 1E55A 4KRUA 1W5QA 3LCWA 3VKBA 4UTWA 4ASTA 3QHOA 4ZQOA 4O19A 5GQBA 2WLYA 2VCAA 1PEZA 3RITA 4ERAA 2CLFA 2D2GA 4JL1A 1BQGA 3N19B 3SFKA 4I7WA 1IIGA 2CERA 2JBMA 4PMQA 3N4FA 3Q45A 4M56A 3WENA 4JHZA 3IUHA 1OYAA 1DIOA 2J66A 3H6OA 2A0NA 4DJED 2O0TA 1EZ2A 3O9NA 3II1A 4PUWA 1V6YA 2UY2A 3UW6A 4AFYA 2A3HA 1NFGA 1V3IA 3NSXA 4JIIX 4NJIA 5I00A 4IHCA 1FCBA 1OWQA 3G0UA 3N18A 1VHCA 2IXVA 2PBOA 3WEOA 3VDAA 4XD4A 1OEPA 1E9ZB 1DJQA 3N25A 1KM6A 3H24A 1SW0A 3M64A 1EJUC 3BJFA 1B3WA 3SUWA 8RUCA 2CESA 3G1FA 1X98A 3PZVA 3MKCA 2UZ9A 5J8LA 4JTCA 3CGTA 1GVYA 1VRXA 3NM1A 2JQXA 1HKIA 1BQCA 1WKEA 4HP5A 5EMJA 1JCTA 2Z2BA 3ARYA 3GM8A 4FLOA 4JTFA 2E6DA 1C90A 1NDWA 1CZ1A 4NJKA 1SO6A 4QIUA 4NNCA 3QLDA 3T0AA 4S3CA 1FHDA 3WLOA 2VRJA 1H0IA 4DIAA 5I24A 3LCLA 3JU2A 1Z48A 4KFOA 3S9IA 3SJ3A 5HXMA 3KLLA 3LI0A 1TREA 4QG9A 1UQYA 2QNEA 4UCGA 3HO8A 1C92A 5G2WA 4XTDA 1Y8BA 5BROA 2DT0A 3ARWA 5CJ5A 4QDPA 3TC7A 3UXIA 1VH7A 5KZMA 4RR4A 1XLGA 2X7WA 2OEMA 1T40A 2BG5A 2C6QA 3QPZA 1AW5A 3FA3A 5I2UA 4LF1A 2XGZA 3GR8A 3A64A 3W7JA 2C1HA 2YBVA 4R9XA 4ZXLA 4ZTXA 2Z6JA 2OZTA 3EYPA 2QVHA 4HPJA 3ANYA 4XZLX 1GEHA 3RFAA 1EUNA 2NVDA 5LNUA 3MQTA 4IXHA 1DTNA 4LUYA 4U3AA 3CZGA 4I9JA 3G1DA 1QWGA 2XN2A 1LBMA 3EWDA 3VIMA 3U48A 3W75A 1X96A 2PCQA 3WJXA 1H51A 5CXPA 1V6WA 3LSBA 3LK6A 5A6JA 4QS5A 4M7TA 3UG8A 4LUTA 3W7IA 3EWZA 1H7PA 4O15A 1P6BA 4ZTYA 4YCPA 2GDQA 3XIMA 3KBSA 3GDKA 2OZ8A 4J3XA 1F4AA 5I09A 2GVJA 2W61A 3H70A 2BB0A 2HVMA 1LL4A 4JTHA 2BZNA 1W3TA 1TE1A 2JE8A 4DAFA 3TYZA 4MFEA 4L4OA 1VFSA 2QZRA 4YNGA 4LCRA 3MP3A 2GPTA 2IPFA 2DW7A 2YL9A 4U4MA 4P8XA 1LOQA 1RY0A 4HCLA 3KCOA 4NVTA 4LSBA 2ZIDA 4CQCA 3TTOA 2E9MA 4DJFA 2B0MA 2B31A 1EQPA 2PTXA 2V8ZA 4TUFA 4ZSTA 4AWTA 3CU2A 1AJ0A 2Y1HA 4GOAA 1CLKA 1TJPA 5FACA 3SGGA 2A7RA 3ZYZA 1YXYA 1TKKA 3DFYA 1KM2A 3NQMA 1KQZA 1P48A 1PYFA 3RU8X 2F6XA 2A3EA 2CWXA 1A0EA 3WNPA 1O6IA 4DZ5A 1K8YA 2FVMA 1YNQA 3IJQA 4X60A 3LRKA 3W23A 3UBPC 2POTA 3CO8A 1XR2A 2J4GA 3WQCA 2YXGA 4WD0A 1KFKA 1L2QA 3W85A 3TMQA 1DE5A 1W17A 3AUOA 1HKKA 3G3MA 3B8SA 4LAMA 3TW9A 5CZ0A 3NQ6A 1KXTA 3WX7A 1XSIA 3UWUA 4BR1A 4K7YA 2R82A 2XIBA 4MNMA 1NOWA 4CQ9A 3ECQA 2DGAA 2BXVA 1OZQA 3GUGA 4FR1A 5BZAA 5E9AA 3NL5A 4FOJA 4MDOA 1UZHA 3LM7A 1ZY9A 1TV7A 4KT2A 4FZIA 3Q4DA 1FWFC 3STCA 4AW7A 2R1PA 2WHJA 1JZ5A 1MZRA 4PA8A 3BGJA 2X0HA 3W22A 1L8NA 5C2CA 1W37A 1Q6QA 1SFTA 1K1DA 4DWSD 3I4KA 4UNLA 4IUGA 4W8BA 3WFZA 1RD5A 2X30A 4EPEC 3NQCA 3ES8A 1QK0A 3GFYA 4XTIA 5BOFA 1NWTA 4K36A 4I6VA 4UC5A 1QVBA 2AL2B 1G4TA 5ABHA 1V02E 4FHAA 5I3FA 1GQIA 2EPOA 3VVGA 1LT8A 1QK2A 2WZIA 1X6LA 3FFSA 5DANA 3W7CA 5TD4A 5FIPA 5U7SA 1KGWA 2E3ZA 3R5EA 4DUOA 1UWTA 4GCXA 4F2UA 4H9TA 9RUBA 1LG1A 1H41A 1MW2A 4ZODA 4LNCA 1I75A 1E9YB 2QUUA 1S5MA 1H60A 4ERGA 3FYYA 4WUIA 2IKIA 5BXPA 4ML9A 2J62A 4H19A 4MWAA 2XZ9A 4YVXA 2OMAA 2PD9A 1I0DA 1NFPA 3RAOA 3KOWA 1SO4A 4GIAA 4LT9A 3FSTA 2JFEX 3R25A 1T8QA 2GSJA 1TPDA 2SFPA 4UOZA 1TZ9A 1V03A 1NWRA 1W8GA 3LN3A 5MHBA 1FFQA 2DT2A 3WF0A 2Y7EA 2B7QA 2YA2A 1OIMA 5CH9A 2Q8ZA 2QT3A 2VTFA 1QOPA 3E9AA 4C60A 2QR6A 4F8XA 3H55A 3W2JA 1NFBA 3MBFA 2D0FA 2UY5A 1JDEA 1UKTA 3HURA 4GI8A 4KWWA 5IXEA 3ERPA 3GDMA 1XRSA 3N2CA 3FEQA 1XINA 3NOYA 3WF4A 3V18A 4QG6A 3QYQA 1FWCC 3H7RA 1JCXA 1G01A 3CIWA 4IPPA 3ARXA 1ZBVA 3SRFA 1UHVA 2CZDA 3SECA 1M53A 2XM2A 1GG1A 4G7EA 3M5YA 4Y9MA 3GIYA 1GZ1A 1W5MA 4DJEA 5CAHA 3P81A 1V0LA 1UD2A 2WLZA 1YIXA 3VUPA 2AMXA 3T2QA 1KLYA 3XISA 3E49A 4LBRA 2HS6A 1Q3NA 3GX9A 3HMJG 5LNVA 1BFNA 2CZVA 4PCTA 1HL8A 5DY2A 4P61A 4DNMA 2BMBA 2AL1A 3RPMA 4JQ3A 3T4WA 1DQWA 3EDKA 4O50A 5LGXA 1KWKA 1XYMA 1K9DA 1RK6A 4QDMA 4K1GA 3OW1A 3VGHA 2YLLA 1TV4A 2ZRUA 3LRLA 1XLJA 4Q8NA 5KITA 4D8ZA 4L6DA 3ICJA 3UGRA 3AHTA 3OIXA 3OVGA 1XYBA 4F9DA 4WXYA 4GRSA 1KR0A 3RILA 4QS6A 4D6GA 2E0PA 3QN3A 1SZFA 1JYWA 4PODA 2DV0A 2ZICA 3B40A 2YX0A 1PO9A 5C55A 4AWEA 4MGGA 1XC6A 1A5MC 3BVJA 2HVOA 1ZJHA 2W5FA 2GDVA 2QIIA 3SUTA 4UQ9A 3G24A 4H7ZA 1XWYA 5AYXA 2IQDA 1YPFA 1TUXA 2HSAA 1FTXA 4LOCA 3CIVA 2UV8G 3TZFA 2QDEA 1Q6EA 3DU0A 4JGDA 1KKOA 2ISWA 1I6NA 1P4CA 1M04A 2E1DA 2F8QA 3KRSA 3ZSTA 2Z28A 4GXWA 5IHSA 2E5BA 1H7WA 5IDZA 3PS7A 4JTAA 3ANUA 1FWEC 3GVRA 1JPDX 3TN4A 5BOOA 1RJQA 1ZGDA 3KRBA 5FEWA 4MKSA 4IL2A 3KWXA 2VZUA 1Z44A 4MB5A 2E9LA 2Z7KA 3EA3A 3H2MA 3RLHA 3NSNA 1AG1O 1XLEA 4EANA 2V2CA 4NKCA 2O56A 5HULA 3WK2A 2ZKMX 5K2ZA 2GSEA 6CGTA 3GDTA 3M0YA 4UZUA 1TFVA 1SR9A 4KCVA 3I7SA 3PY2A 4NAFA 3ARVA 4LUTB 2CC0A 3CUXA 2IMRA 3TX9A 4J3VA 5U4NA 4QDWA 3NQ7A 3QQWA 5M3WA 2VL4A 2FFIA 1ITCA 3F5JA 4EAYA 3GE7A 4I9TA 1UROA 2GUUA 1Q66A 1WZMA 3AMGA 2V3GA 4CCEA 1FXQA 3LY0A 3HG5A 4JQ4A 1PX4A 1QI0A 3SIZA 2P10A 3GTXA 5D4YA 3R7MA 3TTYA 3TTSA 4PB3A 4PRWA 1VLIA 4WGXA 4BI7A 1V7YA 3RM9A 2X42A 1IZCA 3B0PA 2C7FA 5A95A 4Z17A 2E6AA 3M0VA 1XLLA 1JQXA 3SCQA 2HDJA 3LXBA 2WZHA 1WKDA 4LS1A 3COTA 3E0LA 4YHGA 3CV1A 3QFEA 2Y6ZA 5AHFA 5F4WA 3THQA 2CBJA 5C71A 1DJYA 1KBJA 4F40A 3CUGA 4IIDA 3PTKA 1C7TA 3GAKA 1IZKA 1G69A 3IJLA 1J01A 3ME3A 7REQA 2YDQA 4MSSA 3CZKA 4ORIA 5DBUA 2UBPC 2ZUSA 4GKTA 3UPBA 4ZB5A 4J5NA 3GXTA 4UUIA 5CC5A 3BJTA 3DKLA 4JTUA 2X1UA 1JDCA 5CLTA 2J7GA 1TTJA 3ZJKA 2DIKA 2X2GA 1NIUA 2VQTA 4YTUA 3R58A 2CIPA 3PPFA 1XLAA 3W27A 4LC6A 2MUCA 2C91A 4Q8PA 3TJIA 1E51A 4GUIA 3UYIA 2YCEA 4HMDA 1P0BA 3IEBA 1TQJA 4QCEA 3PPCA 4IT1A 3RR1A 1R9YA 4DO6A 3QW4B 1I2RA 3MCOA 3SQSA 1SR0A 3HQNA 2YA1A 1RD6A 2Y5EA 4M29A 3MYPA 3BCDA 2DH2A 2DT3A 3CV7A 4BY3A 5HNTA 4QISA 2F2KA 4CKQA 3AHYA 2YL6A 5EMYA 4XD5A 2WJZA 4MB1A 1UA7A 4WR3A 2ODOA 1LL6A 3TAKA 3SCUA 4V1YA 3QVQA 2XFYA 3RF9A 1HKJA 3PZIA 3QHNA 2OZ0A 4QJ5B 1M7XA 3URBA 1EXBA 3GIQA 3OLDA 1BYAA 1YTKA 2W62A 3OTRA 1A5SA 4O16A 1ZZMA 3EA2A 1Q6CA 5HDRA 1E0TA 3IRSA 1E4IA 1B0IA 5HBFA 1JNEA 5I06A 2VGFA 4N4PA 4DO7A 1J0KA 2EHHA 4M3PA 3O07A 3KHDA 4OE7A 4F66A 3DZ1A 3AYTA 1UWRA 4IM4A 4HA1A 2Y5SA 4J40A 1YADA 2NQJA 4LCSA 1PZ3A 1M68A 1YX1A 1X1NA 4PCSA 3NUKA 1BD0A 3NDOA 3CNYA 1OY0A 4AISA 1F3XA 1FHVA 1U30A 1TR1A 2XIMA 5M03A 1T0OA 3DFQA 3QFWA 3BMVA 4OZOA 1ML1A 2QV5A 4PTNA 4JN7A 2YCKX 3BW3A 2VD9A 3GYEA 4QRNA 2E6FA 1S5VA 3NQ2A 4AUBA 3UXDA 1V3KA 1HP4A 2PSNA 4H9MA 4IX0A 3M0LA 2VFIA 3PSVA 4I3GA 3DIPA 1EPVA 4O1FA 5KINA 3UNDA 2PF0A 1VFUA 3UA4A 5HWNA 4PRTA 3TCEA 4Z2GA 2XIIA 1Q45A 1D3CA 2BTMA 3UVIA 3LHUA 3G22A 4QNEA 2WK2A 4WY0F 3CQHA 4G7EB 4JHOA 4M82A 1L8PA 5FF7A 4BF9A 3C0LA 4XX6A 5K9XA 4NZ3A 2Z1BA 4XAFA 1SFSA 2ZZ1A 4HGXA 1LBFA 3AUJA 3M0XA 2G3NA 4KETA 2DU2A 5E0KA 4GO9A 4QE4A 3USZA 4JBRA 2TRSA 1XV8A 4Q4KA 5KEZA 1W9PA 4KRZA 1CECA 4AMAA 3DBPA 1E15A 3CO4A 1R3RA 4EF9A 3S2LA 1WOBA 1PWMA 4E8DA 2O4MA 4B3ZA 2WNZA 4W8AA 2Y5JA 1ZENA 3WF2A 5IFTA 3AO0A 1JUKA 4AEEA 1CLVA 3PB2A 2X2YA 2G96A 5IBXA 5A69A 4C6NA 1KM4A 1ZSXA 4OOUA 3EDFA 3L9CA 4GZ7A 4BQ5A 4HHPA 1H7OA 3S47A 2CZFA 1WKFA 4UTMA 3TYBA 1KKRA 1V77A 2X16A 3W7RA 2J6XA 4LALA 4Y96A 3KOYA 4GYPA 2A3BA 3WD3A 1W1IE 2HEJA 1JZ8A 4M81A 2B4GA 4AXKA 4GNJA 3EX2A 3W4RA 4B5WA 2ZFAA 3WDQA 3AYSA 2XVPA 2GK1A 4K39A 4HJWA 4Z08A 2QULA 3TQKA 5HUOA 2BLEA 4NZFA 3CMGA 2OKTA 3VCRA 1TVLA 3EXTA 5M5DA 1ZALA 3PNUA 3TLLA 4NZCA 4U3CA 2EBNA 1ME8A 3ITVA 1PAMA 5DEZA 1NP0A 3TR2A 4WKHA 2QEZA 2VCCA 4OVXA 4E2DA 1SZGA 1XW8A 2RFGA 4R33A 3FV9A 1R47A 4JDYA 1IEXA 2QJNA 4JTSA 1A5AA 4Q32A 4ES4A 3QTPA 1XD1A 4ATLA 4XBKA 1GVFA 4Q8UA 3SUSA 2FHFA 1E9IA 3IS4A 2VVSA 2ZTJA 4ZFCA 1HNYA 1MQRA 5HR7A 1BPLB 1OZMA 4GVGA 2CFFA 2BOEX 3WQ6A 5A6BD 4W8LA 1L6SA 3C8NA 3FKKA 4EPBC 6PTDA 3KCLA 4D6JA 1QPRA 1F61A 1SW7A 4UQDA 1VPYA 5F1VA 4NASA 3T9PA 4L5ZA 3L5LA 4GVFA 3FS2A 1TV8A 4H9VA 4NAFB 1H11A 4IQLA 3ARZA 3BG5A 1EGVA 2INZA 4F48A 1ITQA 1E6SM 3NL3A 3RX4A 1A53A 4P7QA 4XAGA 1FWGC 3CT2A 4RNIA 5CPTA 1F76A 2V5CA 2H6RA 1X8FA 2QW5A 1TJRA 1GGOA 4UNIA 1WUFA 3BAIA 3EB3A 4DAIA 3NNTA 3QPYA 1HGYA 3DEQA 1F8IA 1UIOA 3UYCA 2QHAA 3PBUA 2EGZA 1XHGA 4XZMX 1OABA 4RE2A 1GKPA 1O4UA 1Z8AA 2G95A 2GFTA 3RRXA 1KFWA 2TSYA 4AXNA 4C5ZA 3E02A 1M41A 3MWCA 5DO8A 3C6CA 4KMQA 2NQHA 3P84A 4JIPA 2FZBA 4XV0A 2VI0A 2OODA 4O4VA 1S1PA 4MIMA 1G7VA 5MKGA 4B90A 2JEQA 1XBYA 2EG6A 3OLGA 1B9BA 1U33A 1W1TA 4IMAA 4FF7A 4O1CA 2ZX6A 1V6TA 1ZL1A 3HPXA 3TCSA 7REQB 2BSLA 3WH7A 4UTWC 1PZ2A 2VUYA 4FF5A 3NDYA 4R88A 2CHNA 1KCXA 6A3HA 1J9YA 4K6AA 4S38A 2A6NA 2A21A 3CAVA 3NGJA 4K1WA 3LDVA 4MZYA 5AHIA 2WC4A 5BMWA 3FSUA 1NY1A 3MSDA 1GOWA 4W4QA 1DEDA 4AU0A 3IVTA 3ZOAA 3SRKA 1BG4A 4DEFA 3SCTA 1JULA 4JX5A 3N4EA 2E8YA 3GFZA 3QYSA 5D2TA 1FBAA 2HRWA 8XIMA 3FGCA 5BXTA 1H50A 1CGXA 3HG4A 5FF4A 3VOIA 3W87A 4I8YA 2Y7GA 1V6UA 4DNHA 4S3GA 3S46A 1VBHA 4UTIA 2Q6ZA 1OYCA 3NQ8A 5FESA 3M5XA 1BKSA 3GG8A 5FJTA 4J3SA 1RUSA 4XZWA 2WMFA 8XIAA 2BVWA 3SGZA 1QRQA 3NQGA 1TPB1 5CAKA 1PKMA 2ZTKA 4QHRA 5EMKA 1V0KA 3LPFA 1O68A 5G2HA 4JTGA 3WJZA 2XINA 4XBSA 3P5YA 3GVVA 3WBAA 3AIBA 3BAWA 4G8TA 1CW2A 1RP8A 4IJRA 4BI6A 1WBHA 2JIWA 4HU0A 1BSLA 2I56A 4FXRA 1OG0A 4Q8VA 2X09A 3TC6A 2QJMA 4CCCA 3OVPA 5G1YA 4CNUA 1UCWA 1WXYA 3AMCA 4GI6A 4O8AA 1ZRQA 2IUZA 4ZGYA 3H7VA 2ATSA 3A5FA 3GW3A 5LIUX 3GG0A 4BQ4A 5HPCA 4B4FA 4H01A 3NO1A 5D02A 3MBDA 4ZMGA 1LP6A 4AZBA 1D7KA 4WCJA 3T7VA 2ACSA 3S5ZA 3PTQA 2JGQA 4IPIA 2GWGA 1A3XA 1CXKA 3RO8A 1CXFA 1NDVA 1W1B1 4YWSA 3MA8A 4HN4A 4UXDA 1AUSL 2PWUA 1ZBKA 1IIHA 4C6DA 4IJCA 4YTQA 1R7AA 4JKLA 4IP5A 3CYJA 1UD4A 4S3AA 2NLIA 5JIPA 1UJQA 2YXOA 4FS9A 1UWAA 4BEQA 3VFLA 5CPLA 4Y9AA 1OGBA 1GW9A 4NILA 1ADSA 1CB2A 1PKNA 2P50A 4GUHA 3VZXA 3WJYA 1UKOA 3QV6A 5H91A 5DMNA 2QMKA 3HG3A 4HMCA 1J4EA 5BXSA 2V0TA 1P0NA 2HNEA 4I7UA 3C2VA 1CGTA 5EMUA 1XGZA 1HX0A 1XYZA 3LA4A 1QBAA 1GJPA 3WZ0E 4HU4A 3W84A 3BH4A 4F2BA 3KBVA 1KBLA 2GUYA 3LGEA 1YMYA 2REQA 4HB7A 4LH8A 4DM1A 1GOOA 1S3HA 1YRRA 3EDEA 1RPXA 4QXIA 4IIHA 3ZSSA 3CYVA 3AYVA 4O28A 1UBSA 1E0VA 3BGGA 2ON3A 4I5UA 4CD6A 3BGAA 2GSHA 3GRIA 1NQ6A 2VEFA 4ROPA 4Y9NA 5E0FA 3SUVA 3THUA 4JNZA 2AQWA 3AALA 3NM3A 4Z1AA 1MXGA 2CLIA 3TP4A 1YLVA 2WQPA 2O9TA 5I3DA 3G1SA 1JF6A 1G0CA 5DF0A 2J7FA 3NA8A 4WJXA 2UY3A 4WOZA 2ZBTA 1E6PA 4DJFC 3W7PA 1LLOA 1UUOA 3BC9A 1BVWA 4S1FA 3ZVHA 4C5YA 1XISA 4EACA 2OT0A 2POZA 2WOQA 2RJHA 3M5ZA 4QP0A 4MOZA 1DJHA 3DHPA 2PWEA 3GC2A 4HCDA 1WDRA 1FCQA 1Z9AA 3F4WA 1S5TA 3U5UA 1LCOA 4JN6A 4AZ6A 4J7RA 2GK1B 5B80A 1GZJA 4GJIA 4AD2A 3A5VA 3VFCA 4LS2A 5A5WA 1H7RA 5CC7A 3DGRA 1VFHA 3WQDA 1OBAA 4J27A 2VXNA 1XF0A 2RDTA 1H2JA 1TWDA 3W29A 5JBEA 5T8GA 3WNMA 3G6LA 5E70A 5A6KA 4DYJA 2C1IA 4CNPA 3CH9A 3HBLA 1GVSA 4GUFA 1P1MA 3GVWA 3CEPA 4PGLA 2EEXA 4S3DA 3MV01 3TW6A 1FWBC 3WMCA 3NQDA 1I1XA 3W82A 3VX1A 3SRDA 3VDBA 1KRAC 4HU8A 2I5QA 3O06A 1RBAA 3ZR6A 2Y89A 3IJ6A 4CQAA 1EA0A 1H1NA 1KWGA 4Z1DA 4R85A 1ICSA 2QVNA 2NQZA 2W0UA 6TAAA 4UIOA 1PPIA 2PDYA 2VURA 3HU7A 2YCLA 4PBFA 3M0ZA 1V79A 3E2VA 3TN5A 4QLLA 1D7FA 5FJJA 4HMNA 5G5IA 3WBWA 4GABA 1ONEA 3N34A 3NYZA 3W1NA 3ITOA 3B03A 4L1GA 5AHEA 3CIXA 4F9JA 1J6PA 4AD4A 4XKYA 1R9XA 2OKOA 3CB3A 1W3HA 2FVLA 4UFIA 2FTYA 1E73M 3L4ZA 2G8ZA 1HKMA 4L6HA 4QG8A 4EXAA 3STEA 1YPIA 4B5UA 1GTEA 3T08A 4RW3A 3N04A 1E0UA 4JTIA 2X0YA 2ZZ4A 5AC6A 2P5NA 5C54A 4J28A 2FH8A 4UTHA 5H8PA 2HK1A 4YTRA 2KX9A 1GOQA 4B92A 2F7FA 3FJ4A 3L4XA 1ZP3A 2BNJA 1XQKA 1M5WA 4TMBA 3VOHA 1HXJA 3W2LA 4KQNA 1BSIA 4C7DA 3F5KA 2ALRA 4MWAC 4CNOA 3NPVA 1YBQA 4RZBA 3A22A 3C8FA 3OEXA 1OD8A 4TVUA 3VZZA 1CYGA 3QMSA 4PH6A 3UZJA 4NRRA 3K8MA 5K9DA 2YBUA 1JPKA 5MKGB 3PUGA 3HN3A 4B5NA 1VPQA 2OOFA 4U28A 4ICNA 3ALGA 2J75A 5A8PA 1AVAA 2ZX7A 4ZA0A 2ZADA 1UC4A 5D03A 3UWEA 4MUZA 1OX5A 1JPIA 5JIWA 1JL8A 3OZYA 3V35A 3WQ8A 4I9MA 3QY6A 1AMYA 2A7PA 4LYPA 4F0LA 3ZJ6A 2PS2A 2OWWA 1IT7A 3C3NA 3GXPA 4K8GA 4HK6A 3SRHA 4GHRA 3BCFA 2I7GA 3NYDA 1GVRA 1UZ1A 3QZAA 3FGCB 3C0JA 2EG8A 5AYYA 2NVCA 3DG3A 3UY8A 3A21A 4DJEC 3PFMA 4PCFA 1S39A 3C61A 2W66A 4NJGA 3IIOA 4AYSA 4UQEA 3OYXA 1RQEA 4AG0A 2DT1A 3QPEA 5GJPA 1KBKA 3ZJ8A 3KX6A 1QAPA 4X61A 5DRIA 4WY0A 4Z2LA 4GI4A 3E0FA 4KF1A 2QXWA 2VFEA 4AIUA 2QCNA 1FXPA 6REQB 3B97A 2G41A 3CAQA 3MVTA 1YW1A 1Z3NA 2QDHA 3P0WA 2W27A 1BTMA 5C7HA 4AVOA 5F2LA 3PUOA 4OTKA 3UESA 1OSEA 1NOFA 5GJNA 3W37A 1BEUA 3DHUA 2FB2A 3L12A 1UD6A 1X6UA 1A49A 4ZEPA 2E7FA 4V27A 2PDIA 1GVIA 1D3GA 3ZT7A 3L4VA 3WLRA 4DBDA 1RBOB 3GTIA 1QNSA 3ID7A 2HVNA 2JF7A 5C7VA 1IEQA 3ZWTA 4WK9A 3KZPA 1XH0A 1EP3A 1K6AA 1AQFA 3MHFA 4HHLA 1O1HA 3WEZA 2DZBA 3RO6A 3P7YA 1TCMA 1AJZA 4IWWA 1EP2A 4HCHA 1MQQA 3ZM8A 1VKFA 3B4UA 4ZE5A 4D8AA 1BGAA 4YS1A 1LWJA 1LRQA 1XGEA 4EPDC 1Z69A 3D46A 1RALA 4XZHA 2WWDA 1XIFA 5ENLA 1LORA 4ZL1A 4A2SA 2PDPA 3BLFA 3K8LA 3AMDA 3R79A 2YL5A 1SZRA 3TE9A 2DUXA 1MDLA 1KGXA 4KFNA 4AIBA 3KBNA 1IZJA 1R38A 4QNWA 4X9SA 3FHQA 1TCDA 2ZE0A 4UQAA 4J2MA 5C9WA 1R5YA 5BXRA 4V28A 4LNYA 3KRZA 3SURA 3HF3A 2AKMA 4JX6A 5CZSA 5LXEA 4ZOAA 1FHUA 2REQB 5FKYA 3P6LA 3TEVA 3ALFA 2FLIA 2BVYA 2CITA 4QJ3B 2CLHA 3QQ0A 2X1IA 4ATDA 4ERIA 2QPSA 3KW3A 4AZ7A 1VAHA 1HJUA 4RZ4A 1OF8A 1V3JA 3LX9A 4MLJA 1K02A 2HXTA 4HPNA 3GFXA 2GVGA 1QHZA 4DI8A 2HMCA 3MU7A 4W85A 3ZMRA 5DBTA 3AXXA 3HGJA 4GVHA 3MZ2A 4X63A 1E9LA 4PBEA 3SUUA 2JKPA 3FEMA 5C9UA 3MI6A 2WMKA 2PRLA 4P8VA 3RCMA 3ZVHB 3T05A 4JXCA 4HT3A 5E93A 2YZRA 3GO2A 4H6RA 1Q2SA 1EPXA 1EP1A 1P0DA 1FHLA 1J2WA 1PUDA 5LNRA 4TMCA 2I9UA 2Q8LA 4GQBA 2MANA 2Z26A 3KVJA 4DBSA 3IV3A 3AS0A 4KH2A 4OBSA 1XBXA 4PR4A 3ARSA 1E5NA 4ZQCA 3W01A 3I3BA 5CC3A 3CV2A 2CKSA 1W9XA 3K8KA 4W5ZA 3ONBA 4H9UA 5F2GA 2QF8A 4BF7A 3Q94A 3FIGA 1JVNA 3WL0A 2DVXA 2ZUVA 2WJDA 1G94A 1K8XA 2CEQA 2P88A 4HN8A 4LTSA 2Y8UA 4E2VA 1FKXA 3VNJA 1W1ZA 2AKZA 1T96A 3H53A 5I78A 4IFKA 4XISA 2FHCA 3FAXA 5HNUA 1H0GA 1XPGA 4IQJA 4ZB2A 4ZO7A 1CT5A 3CZ8A 1LT7A 4W7VA 2XFWA 5CEWA 4A3UA 1OB0A 1KNWA 3SM0A 1EEPA 3GAYA 3CJPA 3H26A 1M6JA 4O52A 4L64A 3UQNA 4HJFA 3LLFA 1VS1A 2WJEA 4ADUA 1XH1A 3OLIA 2VX7A 3F1QA 5K7JA 4AYGA 1FVPA 3VKCA 4DVOA 1XD0A 1FKWA 4HNNA 1KW1A 5FAGA 3L4WA 1JFHA 1XLBA 4A3QA 3T44A 5FF2A 2I57A 4W7WA 2RUSA 2YCLB 2J7DA 4GZEA 2WMIA 3WLTA 1WCGA 2ZC1A 2ZX5A 3TYUA 2V2HA 3GQYA 3ZLHA 3ABRA 3AIQA 3OB8A 2ZRYA 2OSWA 1U1UA 3OA3A 1AH3A 1B3ZA 4PL1A 4CD4A 2PGEA 4DWSC 4XKYB 3UCDA 4DUWA 3B9DA 2VEMA 1TPEA 3FA4A 3BSGA 1E4MM 2CLEA 1VFLA 3IJ8A 1FDJA 1BYDA 3AIWA 5G1MA 1V6XA 4HOXA 5HOSA 2A4AA 3CUFA 1S5WA 2EAWA 2E25A 4KERA 3KHJA 5CQ1A 3UG3A 1UG6A 1IEWA 3TOPA 3K4DA 3CV6A 1R46A 3KOZA 1A5LC 2ZXQA 2WVUA 4E3VA 3WH6A 2XUCA 3W1UA 2FH6A 4Y8FA 2C1GA 3NCOA 2FYMA 4H3DA 1YBQB 2R91A 2ISVA 3M6DA 4N2YA 1YDOA 3VIHA 3TOYA 1HVQA 1YDVA 2FZNA 2YDRA 3G1YA 1EUAA 1R86A 4Z2IA 1QW7A 2NWSA 2NWRA 3G6MA 5IDIA 1R7OA 4HZ6A 3KS6A 5T91A 3PTMA 1SZEA 1ESWA 1UC5A 3TMLA 5TNVA 4RW5A 3T09A 3TIMA 1DV7A 3L0NA 3GZAA 2IS7A 4RJEA 2D3NA 3MKVA 3G8EA 3MMWA 2CETA 2DEPA 1DIKA 4QAIA 3KFTA 3GVQA 1S2VA 4QTGA 2QJGA 4GKLA 3AWNA 3PZGA 3T42A 2OEJA 1CTNA 3A4WA 4R27A 4CUCA 1LLZA 3LXCA 1UP0A 1G67A 1S2UA 3E12A 4XWUA 4NT0A 3U57A 4C65A 3MTWA 3DH7A 1MO0A 1QI5A 1Q5MA 2PDKA 4A3YA 3AI0A 5I6SA 1ADOA 4C6JA 5CKSA 1K7EA 4Z0JA 4C6EA 1FCUA 3GNNA 1SUXA 3MPGA 1A5CA 2QS8A 2ZX8A 3MCNA 3QY7A 1O5KA 3WQFA 1UYQA 1B90A 3KBMA 2BY0A 5AC7A 3OGVA 3QGKC 4LVBA 4IGNA 5G1TA 1PV8A 3GG1A 2B7OA 4IG2A 1GKQA 4WDUA 4EOUA 5LIXX 5C0QA 3H22A 3FLUA 2DY3A 1ISXA 1WQ5A 3EXSA 4WY0B 2J9ZA 3VIKA 3UD6A 3GB6A 5XIMA 4D72A 4O17A 3A12A 5BWAA 4O0ZA 1L6WA 5HINA 5IBXC 1KR1A 3WK3A 5DXXA 1MEHA 3PN8A 3RU6A 1JDAA 4PUNA 3PZNA 3ELFA 1JYNA 2OOGA 3CAWA 2Z2UA 1MUWA 3PWIA 5FF3A 3AHVA 3W1XA 3AXIA 3ZLFA 3K5XA 3GH4A 5HATA 3V1HA 1UD3A 1UZ4A 3G1AA 5GNXA 2R1NA 2OT1A 4K3ZA 3IGHX 1GHRA 1HTIA 4EKJA 1FFRA 2IKGA 1ME9A 1JXJA 4U10A 1QI3A 2ZRXA 4MNLA 2IXUA 3HG2A 3AJ7A 3IUIA 4LEFA 2FB3A 3GNOA 3DYMA 3V5FA 1XH2A 4LEQA 4RE3A 2V68A 4YJ5A 1E0WA 3QOMA 2WM1A 4PSPA 2XH4A 1PZ1A 4IXXA 1RVKA 2ZQ0A 3W7OA 1Q6FA 1Q63A 4YVPA 3BJSA 2QGYA 1PB0A 3U6WA 5EFFA 4UR8A 4ZO8A 1MDRA 1QO5A 1HQTA 3GVGA 3L0GA 1NU5A 3QEZA 1E5JA 1PHWA 3T40A 3GYCA 1SM9A 3EPOA 1A4MA 2AQVA 5GPRA 1A4LA 2W6RA 3CXOA 1U1HA 3VAVA 1XIDA 3CS2A 3MKKA 3HGRA 3JS3A 3UY7A 1FDZA 3H12A 5BRPA 5E09A 4C6FA 4O18A 5HMEA 3WELA 3D0CA 1TB3A 2PFHA 1Y5VA 5CPOA 3TSMA 5HA7A 4F79A 1PIGA 4O1DA 3UR8A 5C9XA 5A8NA 3FW6A 1F9CA 1JI2A 1KBIA 1HL2A 3HIJA 3LM3A 4AY1A 4IF2A 3VO0A 1VPXA 3CL8A 2CBVA 1O7AA 1J18A 1NH6A 5DMLA 2JKEA 4ZBCA 4DUVA 2HBVA 7ODCA 3LXAA 4PBGA 3WUFA 3H2CA 1K9FA 5T26A 4LUJA 4JFWA 1W3NA 1NF7A 3IVUA 4Y6GA