2OU4A

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 115
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2ou4A00
3CQKA 4K3ZA 2QULA 3KWSA 4QE1A 2G4JA 3P6LA 4QE4A 1DE6A 1GW9A 1XYCA 4QDWA 3DBNA 3BZJA 3KBNA 1QT1A 4EAYA 1TZ9A 1DE5A 3DX5A 4E3VA 6XIMA 3BWWA 4YTQA 5FA5A 1S5MA 1XIMA 3IUHA 3KBJA 1XIFA 4QDPA 4QEHA 4US6A 5B7ZA 3ITTA 4EACA 2GYIA 4ZBCA 9XIMA 4LNCA 1XLKA 2HK1A 3ITLA 8XIMA 3C0LA 1XYLA 3ITOA 3UA3A 1A0EA 3QXBA 5J8LA 4J4KA 1XIGA 3AYVA 4HHMA 4GLEA 2XINA 4YTUA 3XIMA 5H6HA 2HK0A 3KBMA 4Q7IA 2X7VA 3XISA 1S5NA 3C0QA 5EMJA 1XYMA 3U0HA 1A0CA 5B7YA 5TNVA 3QYSA 3UU0A 1XIDA 1YX1A 1XLHA 1XLBA 2ZDSA 3BANA 4X61A 5AVNA 3ITVA 3M0LA 4DUOA 4QEEA 1XLGA 3OBEA 4GQBA 4QE5A 7XIMA 1QUMA 4W4QA 3KBVA 1BXBA 4OVXA 3UXIA 1XLCA 3IUIA 2ZVRA 3M0HA 2HCVA 1XYBA 1I60A 1DIEA 2GLKA 3BZGA 4HGXA 4GJIA 4HNOA 4XKMA 5B80A 9XIAA 3C0SA 3P14A 3AAMA 3KBSA 4ZB2A 5C9ZA 1I6NA 3CNYA 1MUWA 2XISA 4ZB0A 3CQIA 3KCJA 1XLEA 3VNLA 5H1WA 4HHLA 3TC3A 2G0WA 1XLIA 4DVOA 3QC0A 4X60A 1OADA 3UA4A 4XISA 1XIBA 1XLJA 1XYAA 3KBWA 1XISA 2QW5A 4A8LA 4A8RA 4YTSA 5XIAA 3CWHA 2Q02A 2QUMA 1XICA 1XLFA 3M0XA 4A8IA 1DXIA 3JU2A 5EMLA 4PFHA 3QZAA 2QUNA 3M0MA 1MNZA 3M0VA 3VYLA 3IUDA 1QTWA 6XIAA 3U3HA 4YTRA 3KCLA 1XIEA 3VNMA 1O1HA 4YTTA 5I7GA 4K1GA 3AYTA 3VNKA 4G56A 4GJJA 3CQJA 2X7WA 3M0YA 4A8NA 3VNJA 5EMMA 3L23A 2NQ9A 4X63A 3WQOA 4XIMA 1XIIA 4XIAA 5XINA 1BXCA 5AVHA 3BDKA 1XLAA 2XIMA 1DIDA 2J6VA 3ITYA 4XSMA 1XP3A 1A0DA 2I56A 3VNIA 3NGFA 5XIMA 3N4AA 1XLMA 3AALA 1XLLA 1CLKA 1XIJA 1XINA 1XIHA 3KTCA 4XSLA 4ZB5A 1XLDA 3UVAA 2NQHA 3XINA 3ITXA 1D8WA 4KW2A 3CQHA 4PGLA 8XIAA 2NQJA 3LMZA 1K77A 2I57A 2OU4A 2GUBA 3GNXA 2GVEA 3KCOA 5EMKA 3TVAA 3FVMA
chains in the Genus database with same CATH superfamily
3DU0A 1R6WA 4ONVA 4QE1A 1KW1A 1P4CA 2QAFA 3MUAA 4GIAA 4LVAA 2E68A 2FGBA 3F03K 3G8RA 4UTLA 5CSUA 1B3XA 4NZ1A 5J5DA 3VIFA 1YMYA 4UBPC 1QI5A 1EH9A 1AJZA 3VCCA 3IPWA 1YDOA 4RK8A 3GSMA 4DUVA 3U0HA 3LV6A 1EL3A 4M0XA 1DXFA 1GQKA 1OB0A 3PVFA 3O2LA 3FJNA 2H9AA 1I60A 2V38A 2XVNA 3Q94A 3DECA 1I4NA 4GIYA 3GG8A 2DQWA 2OWXA 2C6QA 4MOZA 3RU6A 4FOUA 4KIRA 2FZDA 2ZZ6A 1ITUA 4IIFA 4FX6M 3WH9A 1K9TA 2DY3A 5HR7A 3JRKA 3WD1A 1W8SA 3DHFA 2Z1SA 3G0SA 3T0BA 4S3BA 5JIPA 3S9YA 1IIHA 4PMYA 4XAPA 2A3HA 2DVTA 1JZ7A 3P62A 4PUKA 2C1IA 3I7SA 4BFAA 3NQFA 5LIXX 4GH1A 1UWRA 2OEJA 5DXYA 1AH3A 1L6WA 1JCNA 1XL9A 3L66A 4OOZA 4O1EA 3TWAA 3W1RA 3DI0A 3K8KA 3ATYA 4HHPA 3BG5A 4PMDA 5C7VA 1U5VA 5IXEA 2J4GA 1EWDA 3GFXA 1B3YA 5DBTA 3W84A 1XYFA 1LBLA 3N19B 2GSJA 3WBYA 1W56A 3VC6A 1Q2SA 2JGQA 3T4WA 3L2MA 9RUBA 4Q7IA 4IMGA 4RL3A 1CCWB 1POKA 1QI4A 2DVUA 4MPQA 4U3CA 3TFXA 1PKNA 4ERAA 2AL2B 3MI3A 4IIDA 4S3FA 3MV01 3BMWA 1UC5A 3AIWA 4GH3A 1O5XA 1EGVA 1DOSA 3AS0A 1P0EA 4NY2A 4MWAE 3GDRA 3BW2A 4MKVA 3R8HA 3BGJA 3S5OA 1XLIA 3U4AA 3GHUA 1YRRA 4W8AA 1GOOA 3QOMA 3M5YA 4FX7A 3TQKA 1Q4WA 2Z24A 2EBNA 3AUOA 1NOUA 1WXYA 3ECQA 3WJWA 4MZYA 1SO5A 3AYSA 1HX0A 3KVMA 1FWTA 4TMBA 3WLHA 4HNLA 1K9EA 1KKOA 3MV11 4B91A 1S5WA 1ADDA 3KOFA 3F4WA 3IEBA 4KWOA 2V9DA 1P0DA 3K1GA 3VIGA 1DWJM 2DZXA 4K6AA 4B3ZA 2O92A 4KWWA 2V5KA 3MT1A 2DUZA 1QNQA 2BDQA 3NO3A 4PTNA 4JS3A 3HM7A 1OC6A 1P48A 4O4WA 6TIMA 4EAYA 1K8YA 3MSGA 4MYXA 3H4WA 3PPGA 4ORIA 2YBUA 2BXZA 4ML9A 1XBVA 3MP4A 1TWDA 2A3LA 2YGYA 3PM6A 4BF5A 3BVJA 4ZODA 4AIOA 2OWWA 4Z2IA 2FB2A 2XGBA 1ALDA 4Z1BA 3A5FA 1VEOA 4I5UA 3W2NA 1UD6A 2W67A 4WKHA 4BQ3A 4HSOA 1IXPA 1Q6EA 2HS8A 3CHFA 4KFOA 1NWTA 3MI6A 3ARQA 1XBZA 1XWYA 1LRNA 3E3HA 4OUIA 3PZ9A 4JEJA 3IV8A 2CWNA 2DV0A 2X1RA 1FDYA 4JHOA 2WMFA 5AFDA 1BYBA 2X40A 4Q6XA 2O0TA 4GY1A 2CLPA 3BQ5A 3E5PA 3TJ4A 3NTYA 1M68A 1S2CA 1XDLA 4G2DA 1ZSXA 3V0TA 3T1GA 1XUZA 2VDHA 2D22A 3RLGA 4C6NA 1QASA 1TJPA 1JXKA 3FDGA 3XINA 1PV8A 3HOJA 4GKTA 1F3WA 1CXFA 4W7WA 2Y5SA 3QLDA 4GABA 3CIXA 3NSXA 4PH6A 3TVAA 4NKCA 2IUZA 2J7CA 1TV5A 4P2VA 1P6CA 1MFUA 2HQAA 4J27A 2WVUA 4Y9NA 2YA1A 3H7RA 3HMCA 4K37A 1MQQA 2ZXBA 4X2RA 1K7FA 3S42A 3WLMA 2FTYA 1XIGA 3PC0A 2YIHA 1BRLA 2XINA 1YTKA 2PWGA 4RE4A 1E9YB 3VPLA 1RAKA 3GTIA 1KWGA 1BWLA 3TONA 5B80A 5FD0A 3CNYA 3U5UA 4C6JA 3KLKA 4HU0A 1UMLA 3LY0A 1OX5A 2Q8XA 1Q66A 1HIZA 1JYWA 1UQZA 1SUXA 2EG8A 4O0QA 5F2LA 3E6EA 3VD4A 2VD8A 2INEA 3O1NA 5CPTA 5LSMA 4CQ8A 3PZUA 5AC5A 4BHYA 4QCEA 3H23A 4D6GA 3FLUA 3EDJA 3OHMB 1HL9A 1Q6GA 5CG0A 4HMNA 3JVAA 4I5RA 3T4CA 4F4RA 3QC3A 4MFDA 2A7RA 1BG4A 1R2SA 3IRDA 2J66A 2OFJA 2NQHA 1YPIA 2NSOA 3TTQA 4JX5A 3C0JA 3V7PA 5ABFB 4JFTA 1DTUA 1HN1A 3I10A 1NFBA 4YLWA 4FMVA 1W9VA 4MUZA 4IFOA 5DCBA 5EMYA 3MVIA 5F2MA 5K9CA 4LCQA 3TNBA 1C8QA 1LTDA 2C91A 2HXTA 5RUBA 1TPDA 1XC4A 2W4XA 3E2VA 4O8AA 2CERA 4HNCA 2Z4GA 1IYXA 1IT7A 1E0XA 1LG1A 2YBTA 1Q6DA 1FFQA 4HIBA 1I2OA 1TUXA 6CGTA 2DJLA 2WYSA 1W0MA 4D2JA 1ZNNA 4JKKA 3STEA 4RZ5A 3UG3A 4H7VA 3A12A 1OEPA 3MUZ1 2O4MA 4K1WA 4BI6A 4L4LA 2E9LA 4L4OA 2PD9A 2W6RA 1JNDA 3TXZA 3UFYA 3E2SA 1ONXA 3PTQA 1CIUA 1DBTA 4UMAA 1VJIA 3WJSA 2Y8VA 5IDZA 4XZLX 3WH6A 4AMAA 3VIIA 3N6QA 2ODOA 4ROQA 2WHLA 2J9XA 1SO3A 3L2LA 1GOWA 2OG9A 2VZOA 3MMUA 1MWOA 1YE6A 2BGQA 2R1MA 3W7LA 4AC1X 1N8WA 4GKLA 1XIIA 4UTUA 4OV9A 1A5MC 3C2YA 2YW3A 3WNPA 4JHMA 3M47A 1CXHA 1UIOA 1JI2A 3WUEA 1E9LA 1YPXA 4ML4A 4GISA 5FJRA 4XD4A 1KBLA 1B3VA 4PUNA 4IPLA 3LI0A 4NAFA 1PPIA 4ZMGA 2GUBA 1TPB1 3GZ3A 3BMXA 4JL1A 5A6BA 2XN1A 2Z7KA 4WK9A 3UXLA 3THDA 4O52A 1PS9A 1UASA 3EKGA 1R0MA 4C7DA 3JR2A 1WKYA 3P3BA 4KGLA 3C2EA 1UD5A 4UTJA 3OJGA 1JCMP 1MW1A 1BVNP 3GWQA 3TA9A 1OX4A 3N9KA 3W7NA 4F0HA 4LUTA 1XH2A 4NNAA 3BO9A 2OSXA 3E96A 4PZVA 3NL6A 3ZT7A 4Y96A 4WSKA 3WLSA 4D6EA 1RLCL 4XKYA 5FL1A 3SUVA 4IH3A 4F66A 3DFHA 3PULA 3Q2DA 4PB5A 1F74A 4M6PA 2XGZA 3PF3A 3W7IA 4JQ4A 1TTIA 1H0GA 2FHCA 4NJIA 4UR7A 3UXDA 4A2RA 5D2VA 3CJPA 1TPC1 4NX5A 1H7RA 3IS4A 3AO0A 4X9SA 1XLLA 2VP8A 4S3AA 1VCGA 1EEXA 4Y7EA 1ZTVA 4E3TA 1S3HA 3U4FA 3ID7A 3NUKA 4PMJA 3W1UA 1X1OA 1BYDA 4H8UA 3W83A 2XHYA 2OOGA 5DY2A 1KBKA 4JTCA 1TIMA 4LS2A 4B16A 3WG6A 3BAXA 2HV5A 3C86A 3R58A 1RPXA 1IR1A 1OT1A 3N3MA 7REQA 1ZCOA 2R1NA 3T05A 4S2CA 3RPDA 3LSCA 5HBFA 2ZC8A 4I7VA 2CLIA 2X1IA 3RR4A 2NZLA 5MKGB 5HJXA 1VQTA 3M6YA 3CXOA 4O54A 5A6BD 2PUZA 3MDUA 2V2HA 1EHAA 1OIFA 1U22A 2DU2A 4JFUA 4P7QA 1EC8A 4NU7A 3TZNA 1OCBA 3GC4A 2PCQA 3IGHX 4H2HA 5CGMA 2ZXDA 4FX8A 4ZCWA 4YL2A 1VP5A 3B8IA 3W81A 4Y2WA 1ME8A 2OSWA 3IJ6A 5MKGA 2YA2A 1ICPA 3LHYA 4AIBA 3PK7A 2XVLA 4ADSA 5KMYA 2GDVA 3T2PA 2A6NA 5AY7A 1R30A 2SFPA 1ICQA 3NQBA 4UQ9A 1KFWA 1E6SM 1EUAA 4K68A 1H7NA 3C61A 4DJDD 1XP3A 4LCSA 3W7QA 2HWGA 2BSLA 5DT5A 4W89A 1HJUA 3F2DA 1QW8A 4LOCA 3GS6A 4Q4PA 5FJUA 5K4XA 1OGGA 5AZ1A 3WF4A 3ZLGA 2GVEA 4RE3A 2IPWA 1IZCA 3KRSA 1XX1A 1TUFA 4DJFA 3C8FA 1JD9A 3OYZA 2Y8UA 1G69A 3B0UX 3ELFA 2O9PA 3QW3A 3GG0A 3UJRA 2EF9A 3MTWA 2HEJA 2Q09A 4HOZA 3GTHA 2X2YA 4NXKA 4NL1A 1JAEA 4TVCA 1C8VA 4FXJA 1XIDA 3N14A 3TUUA 5BXPA 2ZRVA 3UVIA 2IXVA 3VE7A 5DLCA 4GINA 5EU9A 1SR9A 4MLRA 3EX2A 1KCXA 3I7RA 2G5WA 1HW6A 1GOKA 3PZIA 2OODA 4FXSA 5CBJA 3IVUA 3T42A 1ZU8A 4MY8A 2VX6A 1F5ZA 2QW5A 3BLIA 2YZ5A 3C56A 1XBXA 3M0XA 2EPNA 3QY7A 1BGAA 4XG1A 3N17A 3SRHA 1W3JA 5FOOA 3OA5A 3LNMA 3NL5A 4YTTA 5EMUA 3BGAA 4H7CA 1SW3A 3CT2A 1G4PA 1VFHA 3V3WA 3L23A 2QCGA 5FSDC 3W0KA 7CGTA 3O0FA 1SVDA 5HNUA 4YXGA 1JUBA 3WLPA 2JALA 2WVVB 3R6IA 4UC5A 4WXYA 3L21A 4AHPA 4HA3A 1OCQA 1F6PA 4NZCA 3LGGA 2Z26A 2VO5A 3MCNA 1VFLA 4GPNA 1W32A 2OZ8A 2IQTA 2O4QA 4RW5A 1QMLA 3W1MA 4LC6A 3ITLA 2WK2A 3RX3A 4L7ZA 3XIMA 3VCRA 2J7EA 3W73A 1BTCA 1IEXA 2JIWA 1UP2A 4MUPA 1EBGA 4NZ4A 1GQNA 4I6KA 5FEZA 4GYPC 3KBVA 7ENLA 4X22A 4TTUA 1TJRA 2DIJA 3PJXA 2XM1A 3P14A 1YDVA 2O7QA 4JZ5A 5M03A 1XG4A 1XR2A 2CITA 4O4VA 6REQA 2ZUMA 3O15A 4E2OA 4Q8WA 3V75A 4QLKA 3R25A 2ZA2A 1F76A 4ENLA 1GWJA 4GJJA 2Z00A 2AQOA 3Q65A 2YFOA 5AKQA 2HBVA 4DBSA 3QR3A 4MWAD 1VPYA 2E09A 3FSTA 1OQFA 5G4WA 1EB3A 3M64A 1V3IA 3L5AA 1VFSA 1ODUA 4LWWA 4JTJA 4WD0A 2VNCA 1A5SA 2R1PA 2YYUA 1B1YA 1SZFA 3LI1A 4MF4A 3UY8A 4MLJA 1YNPA 3IRSA 4JTEA 3KTXA 4NJGA 3IIPA 4PFMA 4JIHA 3C0LA 1E40A 3SY5A 1OGSA 5TBOA 3QXBA 4RXGA 1ZFJA 3NYDA 2X41A 1ADOA 1GHSA 1JD7A 2G41A 2OT0A 3C2FA 1U1UA 3MHUA 4PA8A 1XSJA 3POHA 3SY1A 1VYRA 4CQCA 3QY8A 1BXBA 4WSJA 3GNPA 3P7YA 1EOKA 3O6AA 3RCMA 1B9BA 2WJZA 1KFJA 3GW3A 4HHLA 1MXGA 3TWBA 3UA4A 4F3HA 5H8PA 3GH7A 4B9YA 4XQ6A 4Y9OA 1KRMA 1M7OA 1WXJA 3LCGA 3B0YA 3NCOA 1K9DA 4C1KA 1Q13A 1C9WA 3NL3A 3OLGA 4S3EA 1NSJA 4RXFA 3ZFHA 3WLRA 1SFLA 1UBSA 1XSKA 5ENLA 4DZAA 1PHWA 4NZ3A 4F0LA 3S4TA 5LA1A 2XU2A 1U5HA 3BLEA 2VCCA 1WPCA 1OF6A 4MPKA 4MY1A 1XLDA 2RFGA 1NDZA 1G4EA 5C9WA 1ONWA 1V3JA 4GGHA 2WPBA 4IFKA 3KCOA 1RH9A 3CQKA 2W92A 4HBKA 2E9BA 2ZX6A 4E4FA 3F7JA 1MUMA 2GWNA 3KBNA 4GQ0A 5E5CA 1KBIA 2XH7A 3B03A 2WMHA 4I6VA 2XUCA 2YPIA 3GVGA 1TIWA 3M4HA 4AD5A 3RXZA 3E0LA 3AYVA 4H9UA 2ZKMX 3K4AA 3CTLA 4QAWA 3M0ZA 2PWFA 2NUWA 3WLIA 1WDQA 3WUFA 5I00A 1QUMA 2PDFA 5BRBA 3HV9A 3GU2A 4LUIA 3KL5A 1US2A 4KCUA 3ABZA 3RCYA 3ZZ1A 1UUMA 4E6MA 1XM3A 3QC0A 3F5JA 3SUWA 4PBGA 4DXVA 1M9HA 3KOXA 1BPLB 1R7AA 3UZWA 5D9OA 1OCNA 3ORWA 1QOPA 5LHFA 4W93A 4MB1A 1QBAA 5JBFA 4FK9A 2XVKA 3HN3A 1KTNA 5MF5A 1S2AA 1BHGA 2VVNA 3L12A 2G96A 2GVGA 3STCA 3UPMA 3K4DA 4B5TA 5FF3A 4QBXA 4AVFA 3NQEA 3KEHA 4QG8A 1VFMA 1HGWA 3ARXA 5F4XA 2UY2A 4QIUA 1D8WA 4Q4RA 5EMKA 1GVSA 1JVNA 2H3BA 2H8XA 2BG5A 3H6OA 1LT7A 1K7EA 4PL1A 4UQAA 1J6PA 1RUSA 3VA8A 3N25A 4LRTA 3G6MA 1Y0EA 1HZYA 1HO1A 2VL4A 1HVQA 2OSYA 1F9CA 3DG3A 5E0FA 2WJEA 1H1YA 4IP5A 1L6FA 2BWGA 4HYVA 5DN1A 3EB2A 2F7FA 3VGHA 4N9DA 3FJLA 4BKNA 3KS5A 4S39A 1W1PA 1HKMA 3JZUA 4FLQA 2VFGA 1XKJA 4F79A 1Q6RA 1R85A 4FNQA 4MFEA 3BLFA 2OEMA 3UF9A 1FX6A 1F3EA 3FV9A 1JPIA 4IZGA 2BNJA 3AXKA 4CD6A 1VPQA 1E1CB 1EHNA 4IL0A 4IG2B 2VYOA 2YCJA 4IIHA 3U9IA 4IIBA 4D1IA 1PKLA 4HHHA 2ABAA 3M0YA 5G2HA 1JCTA 1SJAA 3URNA 4EPBC 4CLMA 1EIXA 1AH0A 2DZSA 3W7CA 4QG9A 3UJEA 1KXTA 4PCPA 3T0TA 1EO5A 3R8GA 5CZ0A 2D69A 4YN5A 3VNDA 1UOZA 2IPJA 2A2IA 2O9TA 2DQXA 3NO5A 1UZDA 2G3JA 3WL1A 2ZE3A 4NI3A 2FIQA 4GVIA 1VAHA 1W3NA 2ZQ0A 4MWAB 2VD9A 4LYKA 4PEEA 5A69A 1EIBA 5A2CA 3WUBA 3CUIA 4WHBA 4ADTA 5M17A 3W75A 1B3OA 1FHLA 5G2IA 1CECA 4K2SA 1KWKA 3K8LA 3UYCA 3W72A 5I03A 2VC9A 5BRQA 1X39A 3WNKA 2IXUA 2PC4A 5C2CA 1F07A 2A3CA 3S2JA 5EBUA 5JIWA 2QF7A 1R3SA 2RJGA 3TYZA 1SYTA 2QPUA 4DBDA 2BODX 2XFWA 3ZYZA 1EQPA 4DVOA 2G0WA 4QLLA 3PNUA 1IF2A 2E7FA 2WWDA 2QXWA 4X0NA 1PEZA 1OZMA 4P7OA 3ITCA 2Y5EA 3AOFA 1Q7MA 3TCEA 1JDFA 4PN2A 3VZZA 1ISVA 1SMDA 3L4XA 4MB5A 3W7MA 4UNKA 3KCLA 2VGBA 2OLSA 3S6OA 2OQLA 1EA9C 2PP0A 4U5KA 4MG4A 4R88A 5U7SA 3P8JA 2W63A 4TX8A 1L6GA 5HJLA 3S46A 1ZBKA 4D6FA 3M5VA 3WQ4A 1W1B1 1DQUA 3ZIZA 1ZP4A 5LIYX 2J25A 2F8QA 3QZEA 1K77A 4QM1A 3ENLA 3I68A 4H00A 1E72M 3D5HA 3DBNA 2UBPC 1DHPA 1JZ2A 3T40A 2EG7A 2X30A 2XSAA 1GZGA 3B8UA 3FYPA 5C55A 1HG3A 1US0A 3W2LA 3L0NA 4XWUA 3ITOA 1RV8A 2D20A 3HF3A 4ILSA 3R43A 3MCOA 1M01A 3MYPA 2GJXB 1ZS2A 5C54A 1Q7ZA 2JEQA 2WSQA 4BEQA 1V0LA 1E0VA 2C3ZA 3GXDA 1OJXA 3GDTA 3PUGA 1UKOA 4QJ4B 2BLEA 3QBUA 3FSUA 5ABGA 5LA2A 1XIBA 1AZ1A 1GYLA 4HPHA 3PBVA 2BVWA 1X7IA 4DWSC 1Z69A 2WJFA 2OELA 1LWIA 2LLEA 1VFUA 2TSYA 4MWAA 2UY3A 4UCFA 4MJ2A 1O5QA 3VABA 3BG3A 5A6AA 3ZR6A 4H3DA 1M04A 2E6DA 1PTGA 4CVUA 4NZFA 2BXVA 3M46A 4BF9A 5HNRA 4BK9A 1G4SA 4AD4A 2WMJA 3GTXA 1LL4A 3I3DA 4GXWA 4C7GA 1H1ZA 3ZVHA 1UKPA 3W71A 3DGRA 3B8DA 1S1RA 2HZGA 3TTOA 4ATDA 3R1ZA 1C9DA 5DEZA 1PX8A 1PZ1A 3GY1A 3W2MA 1CEOA 3WF3A 3GVRA 4ES4A 4WEVX 3CH9A 3TMQA 4E8DA 3F4NA 4ROPA 3P8IA 3EXRA 3RM4A 3MBDA 1FWSA 1UUQA 3LSBA 1C8YA 4EPEC 1J93A 5CZKA 5ABEA 4LVGA 1UQYA 1BTMA 3NVDA 1ZAHA 3V1PA 3LTPA 1YKWA 4JQ3A 4DAFA 3QZ6A 2CZ5A 5IBXA 2DT3A 4EE9A 1N8FA 2NQZA 1TRIA 4FOKA 2X1TA 3ES8A 3W6MA 4FNPA 1J5SA 3K5XA 4ZXLA 4NJKA 4Q33A 3S3GA 5FJTA 2O55A 4GI8A 2C0AA 1UZ4A 3LLXA 1EJVC 1TZZA 4H8VA 3AXXA 4C1LA 2YXGA 1UJPA 5I3KA 3M5XA 3W3OA 4CQ9A 3G6LA 1F4HA 3PHAA 4HYRA 3V5FA 3FEQA 1FWIC 4UOZA 1BWKA 5D05A 1W1A1 1ITCA 2BOGX 2ISVA 3AALA 5CLTA 4QX4A 4WKAA 4LBRA 5CC3A 4UMBA 5HINA 5I3DA 4GUGA 2GUYA 4NILA 3NOEA 3PPHA 3THAA 1FXPA 1ZAIA 2EJAA 3K46A 1D3HA 1F6YA 2RDXA 3B8WA 2PMQA 2GPTA 2VHLA 4IF2A 3NQMA 1LT8A 5JQ9A 4DAIA 4HP5A 4DELA 5EB8A 1DE5A 4N9BA 4AW7A 1KCKA 5LZLA 3UCQA 5CAHA 4E4UA 3VGEA 2POZA 1EXPA 4DBWA 5LYRA 1M65A 3T2QA 1NELA 3LMYA 1O4UA 3LBCA 1WUFA 5GNXA 3WQ8A 2QUTA 3P61A 4JQ1A 2PGFA 1PYFA 1V7AA 1KM2A 3WH8A 4HNVA 3W82A 5I09A 5E09A 3CAWA 3V18A 3RLUA 4XD3A 4C6OA 3C0SA 2FLIA 3AZRA 1QCWA 4HSNA 2PWDA 5HK4A 1NWSA 1HKIA 3CAVA 1LQAA 4FIQA 2NV1A 1GNXA 1YADA 4A8RA 4DJDA 2BY1A 4FPSA 3PBUA 3MC5A 3QPEA 2QEZA 4RNJA 5G4EA 1XS2A 4D6IA 1J0YA 3ABOA 3FFSA 3WNNA 3SZ8A 1L6YA 2QUNA 4H01A 3T78A 3HBLA 1JJKA 2GGGA 2V8ZA 5JH1A 4EXBA 4JHZA 1RBLA 3VMNA 3IVSA 1T0OA 4K39A 3WBEA 4AZ6A 2Z2BA 1U1HA 3NYZA 4BEUA 4ZTXA 3GU1A 1IEQA 1IV8A 2WV8A 3VFCA 3KVKA 3H70A 4BCEA 3LLFA 1MNSA 1Q85A 2ABBA 2XJ7A 2PF0A 3RDKA 5FAJA 4GCXA 2VDGA 1Q3NA 1V79A 5T9CE 1M6JA 4U2YA 4JQ2A 3H2EA 4KFPA 4PMUA 1ZJAA 5DXXA 1W3LA 1TZ9A 4G9PA 4DO6A 4OWGA 3BW3A 3H24A 4KPLA 2ZX9A 1VJZA 4YNGA 4ZBCA 2GSHA 4BS0A 4J3WA 5EFFA 2CLFA 4YS1A 1UKQA 2A21A 2ISFA 4WOQA 1W1YA 2QGHA 1A49A 4S38A 2OX4A 2VQTA 2ZDSA 3I4KA 4GBDA 1PX3A 1VZWA 4M81A 4J2PA 7XIMA 1EJTC 2XFYA 2D24A 1KRAC 5HMFA 3PB2A 3AMGA 2RH9A 1RJRA 1C7TA 1CGUA 3CU2A 3N3TA 4TR9A 1GCYA 1KKRA 1V6XA 5HQMA 4BJHA 3VKDA 3H2MA 1X7FA 2GDUA 1NDYA 3NQ8A 1R3VA 3PFRA 4WRHA 4YWIA 3SUSA 3AWOA 1ENUA 3QGAC 1EBHA 1YQ2A 3IAQA 3VDAA 4FLRA 5BWFA 3BUVA 4ZOCA 3DYMA 2VEGA 3G5EA 3BAYA 4WKFA 2VEIA 3IANA 4MJ4A 3S6DA 1AQMA 1WDSA 2H90A 5T9BG 3INPA 3AYRA 3TOPA 1RJQA 3I3BA 2ZDRA 5CQ1A 2CZEA 3IJLA 4TU1A 1AZ2A 3OP2A 4BQ2A 4G5DA 1EP2A 3GUWA 2GK1B 2PDCA 4QDWA 3V16A 3MPGA 4FP1A 4YTQA 1S5MA 3HQNA 1Z48A 1T8XA 3ITTA 3G1YA 1IEWA 3W1XA 3RMJA 1L2UA 2J9YA 4L5ZA 5DRIA 2AQVA 2WXDM 1BF2A 4C6KA 4HHMA 1FBAA 2GL5A 3I7QA 3LS9A 3P5ZA 2ZWZA 5TNVA 1TX2A 4R5EA 3BANA 1Q6QA 4JIIX 4MTVA 2ZX7A 1LM1A 4XZHA 3L67A 1UA7A 3M0HA 4DWSA 4AG0A 3OLEA 4RV8A 4EWND 2XIOA 5HANA 4EANA 2REQA 1OD0A 2ZZ5A 3HPSA 3SCQA 1E6NA 4NYYA 1GEQA 2V6AA 2QCFA 1UWQA 5CPNA 3LNPA 3EZ4A 1VD6A 3TQVA 1JPDX 4XZNX 3PS7A 4O17A 1OFDA 1YBQB 3AMKA 3UWUA 3A4WA 3GYCA 1MQPA 1VKFA 2QV4A 1VPXA 3O05A 2WKLA 4IMAA 2P3EA 4XIMA 4AIEA 1FWGC 4NT0A 4NRRA 4PR4A 3E1F1 3LXCA 4AIUA 6ALDA 1V93A 1WXZA 4CQDA 3TTYA 1F73A 1IGSA 1D8CA 2PFHA 2H6RA 4HA4A 3JUGA 3ZJKA 3SRFA 1YE4A 3CV1A 3OTRA 1Z3NA 5BOEA 1XI3A 3SGZA 2J88A 2VEKA 1I1WA 4N42A 4E3VA 1AW1A 4OBSA 4MNKA 4HCDA 1G67A 2BY0A 3LZ5A 2V30A 5AHLA 3CUGA 4LW7A 3N2TA 2E3ZA 3LXBA 4Q6JA 4HTYA 5PTDA 1VFTA 5EKYA 1WB0A 1EUNA 4ZE5A 3SR7A 5C71A 3CPUA 3EXTA 1NFGA 1OZQA 4P5UA 1C91A 3H22A 3GH5A 3URBA 1XPGA 1LG2A 2Y5JA 3D46A 5AC6A 5CEWA 1P43A 1R2RA 1JGMA 4O1FA 2PDHA 1HKKA 4JIEA 2WO5A 5CPLA 2A0NA 3N4EA 4MZ1A 5G2WA 4X60A 1LBFA 4GG9A 2J79A 1U83A 4WF7A 2VDIA 2W62A 1JZ8A 3F4VA 4HYWA 3EWXA 2C18A 3UWYA 3RILA 3TXVA 4UOJA 4CD8A 3OG3A 1H5YA 1BQCA 2D3LA 3B05A 3TA6A 5T91A 2W3ZA 4I8YA 4HOXA 5TF0A 2R82A 4KGJA 3WY1A 4GNVA 1OBAA 1VS1A 4KRTA 1CDGA 4H8NA 3ITYA 3MVTA 3UJSA 4ZSUA 5T8GA 4J35A 3REQB 4EX4A 4XUGA 1XINA 3GR8A 2A85A 2V2DA 1ODZA 3GD6A 3QR0A 2DSVA 1GJPA 1FKWA 2TRSA 5KZDA 5I79A 2B31A 2PTZA 2ESCA 4P7RA 3L7RA 1VRDA 1TMHA 2QJIA 1CGXA 1B3WA 3GIYA 1ZBWA 5BROA 3UG5A 1F7BA 3EAUA 1WKFA 3VKBA 2RAGA 4PRWA 3CWOX 3MYOA 1DHKA 3NFUA 1QNSA 3WEMA 2EKCA 1OCJA 4GYFA 1NQ6A 4UQCA 1DJWA 2Z7GA 1FUYA 5HA7A 5BXTA 4H9MA 1TTJA 3KRUA 1U33A 4H41A 2GVJA 3KRZA 2Y7DA 5CG7A 1GW1A 4HN8A 2E9MA 5J5RA 1DJZA 3N12A 2GUUA 3EPOA 5DANA 4JIPA 3EWCA 1FWWA 1NY1A 4CCZA 3OEXA 2FKPA 2Z6JA 3LERA 1KFKA 1NDVA 2D2JA 4OV4A 4B4FA 3M1ZA 2TAAA 4DJEC 2RDWA 4JPGA 4PUUA 3GUGA 4AB4A 3L2IA 1Q8AA 4JQAA 2DUXA 3AYTA 3COTA 2PP1A 3ARWA 2YZRA 1J0KA 1EDGA 4JGDA 1GORA 1ICSA 5FSEC 1FCVA 4RR4A 2EPOA 5CSSA 3WK1A 1TV7A 1Q7QA 3BLOA 1DEDA 1KM1A 2PRMA 3HPZA 3R12A 4S3KA 3W6LA 2PEVA 3TYCA 4U2ZA 4K3ZA 1I8JA 2PDPA 4Q4SA 4YVPA 3L9CA 3T8LA 3GYEA 3VVGA 2X1UA 4A3YA 1D9EA 1KCLA 5D9NA 2WVVA 1OFAA 3UXAA 1ZZMA 4GBUA 3E38A 4DF1A 2P3ZA 1FKXA 4RUBA 2CLEA 1A5UA 1GG1A 3UGVA 3VOHA 5CSRA 1WZLA 1S39A 3WBXA 4GIEA 3ABRA 2WHMA 3LX9A 1CB7B 3P82A 4JDYA 1RY8A 5DELA 4V27A 3UR8A 4UR9A 1HNYA 4XZ9A 4JR5A 2VMFA 1K02A 4XBKA 2ONEA 4N6FA 3CZJA 1P7TB 1V03A 5E70A 3RG6A 3NZQA 5M5DA 3KHDA 5GVJA 2WANA 1XISA 3SURA 4S3CA 4DQWA 1PZ0A 2EXOA 2INFA 4HZ6A 3GAKA 2ZRYA 4A8IA 2Y85A 1XH0A 3NQDA 1GQIA 2ACUA 1OFPA 3ZMRA 3GNRA 2HDJA 2YLLA 2YKKA 4OFCA 1TV4A 2G3MA 3N9SA 4J28A 3N18A 2PPGA 3TX9A 1US3A 1CNVA 2NUXA 4IFKB 1GVRA 3SIZA 5I07A 1UOKA 1CX9A 4F0MA 2BY2A 4J5NA 1UH3A 3DKLA 4I5XA 3CWHA 3VIMA 5LA0A 3O9NA 3CUXA 3T44A 1OHLA 4HT3A 4WX2A 3WFAA 3TN6A 4U4MA 1SJBA 2F61A 4OUEA 1KM5A 3LYEA 2AL2A 3W86A 2PTDA 2QPXA 4JN7A 3PJUA 2DP3A 1VHCA 1QRQA 2R14A 1LWHA 5LGXA 1ZAJA 3STFA 3GXPA 1KLYA 2V68A 3NVTA 4WJEA 3F2CA 2VX7A 4GACA 4Z1AA 4K8HA 1R46A 1UWUA 1H09A 1DJNA 1LOQA 4CN6A 1JF6A 3WD2A 2PBGA 3S5SA 3FYYA 1F8IA 2ZZ4A 4B4HA 4O28A 3UZYA 4PFHA 3EWZA 4JL2A 4Q8MA 2QAPA 2XH2A 4XAYA 1GHRA 4HU4A 4QG6A 1J4EA 1A3HA 1GYMA 4A8NA 4NG3A 5K7JA 3BURA 2PLKA 3KW3A 2C8NA 2Y63A 1PUDA 2ISWA 2Y61A 3KP1A 4H19A 4IPIA 4O1BA 1EJRC 3M44A 4NRSA 4QJ5B 3CMGA 1KXQA 1OFRA 4B2DD 1V6TA 4HZ7A 1Z89A 2BP1A 2IQDA 4FOJA 2PAJA 1WA3A 1WUEA 1P7TA 3B9AA 3ABQA 1BD0A 1J01A 1BSIA 5F4WA 2E0PA 3W07A 4Z42C 1G9HA 2DH2A 3IJ7A 2G3FA 2CHNA 3TW7A 1C92A 1XD0A 3EDDA 4JOMA 4LVFA 3GXIA 1V3LA 5DX7A 2FH8A 4R34A 3SCSA 4JNZA 2X09A 2V2CA 5CZSA 3M6DA 4J3VA 4GZJA 1IGWA 5B7YA 2FVMA 3TW6A 4UFKA 3GW0A 2GSEA 1XKYA 1Z41A 1WDRA 1QVBA 4GGBA 3QW4B 3VM7A 2XYLA 5J04A 4GOAA 4W84A 3PUOA 2PP3A 2GVLA 3UNDA 1VBHA 4I9MA 5D02A 2I5GA 1EGZA 1EXBA 2X8RA 1JUKA 1JYXA 1X38A 3Q58A 1E1CA 1UUOA 3ARYA 4CU7A 2PLMA 3TTEA 2Z1KA 4FB7A 4LV4A 1HVXA 2DPEA 1Q45A 1XH1A 1H51A 4BI7A 3ZSTA 3PUDA 1H60A 3VNMA 4K1GA 4FF5A 3TJLA 1IE7C 2JE8A 1LUCA 1TV2A 3HPFA 4DYKA 1EDQA 4XZIA 4ZQOA 5K4ZA 1DYSA 2Y7FA 1KV5A 1MXDA 4WXZA 4GC3A 4BI5A 4TX6A 3OVGA 2ZXAA 3N2MA 3PAOA 1UP3A 3HG4A 1UROA 2NT1A 3LM7A 1PAMA 2VRKA 3S5ZA 2CLOA 4C60A 3KWSA 3LLDA 5AYIA 1TPEA 2F2KA 3TYEA 2RUSA 4C6IA 2V5LA 3IWPA 1K1DA 4JTIA 3WQGA 1YEYA 5KETA 4U5IA 4H8HA 1OINA 5D04C 3QHMA 2WSYA 4UFJA 4HD5A 4FLSA 4PL2A 3OW1A 1HKVA 8RUCA 1YTDA 2Q01A 4DO7A 2CXGA 1NP0A 1V77A 2JKEA 3VK5A 1WP6A 1XRFA 1VGAA 3W01A 3N04A 3ZWTA 3NQ7A 1X97A 3KBSA 1G7VA 5CZJA 4J3ZA 2EPKX 3TC3A 3NPVA 1V3HA 2VOTA 2X16A 3EX4A 3HGJA 3EWDA 3WD3A 3BARA 3BAIA 4C6DA 4CN1A 3SW6A 3BLDA 2QCLA 1XLFA 1WOAA 3S6TA 1ISYA 2OMAA 4LBUA 5JMUA 3CAQA 1FWJC 4MY9A 4UNLA 3M0MA 3ARRA 4XAZA 4B90A 4JTUA 3SJNA 4K7VA 3POCA 3UZJA 3R8RA 3VNJA 3M41A 4AC7C 4KWSA 3RO6A 4XSMA 2C0HA 4H6EA 4A2SA 1F4AA 2J6XA 4N4QA 3WLLA 2BXYA 1TE6A 1OWQA 3NJ3A 2P8BA 3WLKX 3LEPA 3H2OA 5FESA 4S3GA 5GJPA 1J0IA 2E8ZA 3VGGA 3DC8A 3H53A 5CBIA 2G4JA 3D6NA 1GVQA 4R33A 4CCDA 1XYCA 2ASHA 1K3UA 5M3WA 3UEQA 5GPRA 3OQ8A 4LVDA 4YWSA 3EOSA 4Q4MA 5HULA 1W17A 4HPJA 4JTKA 4AZCB 3USBA 1TWSA 1A0CA 3VMPA 3HFYA 2DW6A 3M0LA 2V0TA 2E40A 3LBMA 4G1NA 4R7JA 1JNEA 2VGFA 5I02A 4MSSA 4MB4A 3M16A 4UQEA 3MWAA 1GYNA 1LQ2A 1R5YA 3FX4A 3TAKA 3QV6A 4GD0A 4RE2A 5AYZA 3N6JA 4TV6A 2E4TA 5XIAA 3HG5A 3GFZA 1J79A 2G37A 5LHEA 1EP3A 4IQLA 3R10A 3HQOA 5D2TA 3FA4A 4O1DA 1I2RA 2QCDB 1X6NA 5BNKA 3QMRA 1IT0A 3NGFA 3L0GA 1BAGA 1LZOA 1G4TA 1TZ7A 2A6LA 3JZEA 1I0BA 1DJYA 1XW8A 4H9YA 3M9YA 4UXDA 4AISA 3QR1A 1ZRQA 4H83A 3MMTA 5H91A 3I6RA 3MY9A 4XKYB 3DFNA 4XZBA 1GW9A 1RVKA 1ESWA 1TJ1A 2NXGA 3G1AA 3MMWA 2VUNA 3C6CA 4AEEA 4U31A 3QSRA 4EOUA 5EY5A 3Q4DA 2WSKA 3R11A 3S0CA 1KTCA 4ZR8A 1E9IA 1QXLA 4FS9A 1IT8A 3W28A 4BWLC 2Z28A 5C0QA 1QDSA 4MDOA 2GJRA 2PDUA 3MHGA 1O60A 3HTWA 4J1OA 5HQEA 1RCXB 3RN6A 1W5NA 3SSZA 3N11A 3KL3A 1B57A 4CCCA 4V33A 2DORA 4PCFA 1X8FA 1UCWA 3UW6A 4IP4A 3LB0A 1KGWA 4AF0B 5E6ZA 3EXSA 5E9XA 3EWBX 1RLDA 4FXFA 3A64A 3AMCA 3IJIA 2V5BA 1QO2A 1FRBA 1UMYA 4KWVA 4XTDA 2NXHA 5LNSA 3WMLA 4GYKA 4PMNA 3GE7A 4FNTA 4IQDA 1JIBA 3Q45A 3N4AA 3ZJ7A 3VINA 1CLKA 3UD6A 4C6CA 1CLXA 3WCZA 1FWFC 3LK6A 1PIIA 5AECA 2YA0A 4PMZA 1W6TA 2G50A 5EFDA 2EJ1A 1V7YA 3T07A 2GGHA 3ALFA 4C6LA 3PPCA 1MW3A 2CNCA 3GXTA 3TR9A 4TX9A 1BXNA 1QK2A 3ZVHB 1DVJA 4ECLA 3CBWA 3NPUA 7PTDA 3NZ1A 2MANA 5ECUA 3CGTA 4WZHA 3HZ3A 4EF8A 3II1A 2NQ5A 3CWNA 3PG8A 3CZKA 3TZFA 5FJPA 2VVSA 3AZTA 1GTEA 3T08A 5IBXC 4IM4A 1IR2A 5CCZA 2YDSA 1MFVA 4TTGA 3GG1A 5CZTA 2FPYA 3W2JA 3RFAA 3R0UA 1REQA 1Z9AA 1EA0A 4M5PA 3T8QA 1EJWC 3VGBA 4DF0A 3LN3A 3H2FA 5AC8A 3UZXA 1KM6A 1E4LA 1GPFA 3GK0A 2GVYA 3VD7A 1YYAA 4Q8TA 2VT0A 3MQTA 1AL7A 4H1ZA 5AOUA 1H62A 3DFSA 2AOSA 4MM1A 3LENA 3AQUA 4CNSA 4LH8A 1TSIA 2WSPA 4L65A 4FNUA 1XQKA 1YIXA 4XO7A 2FPVA 2VELA 1RK6A 3G0XA 1S2VA 3AZSA 1VH7A 5HWNA 3W4RA 4IP7A 1EDTA 1F3TA 4D1JA 3RJXA 3P5YA 3HJZA 3U2OA 5BMXA 3F5KA 4YTUA 4ATLA 1NOFA 4KCTA 3VIKA 4I3GA 2WC4A 3DKJA 4REQB 3D47A 4DWDA 1VFOA 3M7SA 5CSYA 3RLHA 4L1WA 3RYSA 2OZ0A 2DT1A 1UR2A 4M6VA 2OYKA 2HVNA 5E6YA 5A8NA 3OZOA 3M5ZA 3IK4A 3W76A 2GQ8A 3EB3A 3A47A 1BYCA 3CASA 2EHHA 1GZJA 3KBWA 2XSBA 1NM9A 1HXJA 2D0GA 2FHBA 4O18A 2HE8A 1Y65A 1KFBA 3RM9A 1RXOB 3DIPA 2GJNA 3OB8A 1O94A 4I8DA 4MZ8A 3I6TA 4PBFA 4H9TA 3GU9A 4JBRA 2NQ9A 5HR6A 3C52A 1XC6A 3VNYA 2DIKA 1KD0A 1W9DM 3UESA 3G1HA 4KEUA 5H2ZA 2VEPA 3CL7A 3ZWSA 3HG2A 4Q4QA 3CEUA 2WCGA 5BZAA 3LCXA 3CUFA 3MSYA 3L4UA 3UJFA 4GK8A 4MKNA 4QE4A 3W37A 1SFJA 2PDMA 5JH2A 3TLQA 4Y9AA 4CD5A 1LL7A 1DJQA 4M19A 5FIPA 1VBRA 2C13A 3GX9A 1TV3A 3G1RA 1OYAA 3WMSA 1IXQA 1D3GA 1MEHA 1XYZA 1NH6A 1DORA 1E4NA 1YDYA 4J3SA 2HVMA 3N9RA 2AMGA 3UYIA 2MNRA 1UPPA 3M0KA 2XGIA 4ZFMA 4RDYA 4PB3A 2Y7EA 4PE8A 3CYJA 3BCJA 3W24A 1DIEA 1MDLA 3TFCA 4U33A 4AXKA 4CEXC 2H3DA 1S2WA 3FKKA 3RGTA 3PPFA 4P7LA 1GOQA 3UWQA 2CIPA 1LP6A 2B7QA 4Q7BA 3H2NA 4I9AA 3E2QA 1LWJA 1FXQA 2J77A 2O56A 3MHFA 3KVLA 3P0WA 3QRHA 3PP7A 2J24A 2X7WA 1QWKA 2WKJA 1JQVA 9CGTA 4H6KA 2WNNA 1R9XA 2FYMA 3VC5A 3G18A 3CZLA 4X3ZA 4GUIA 5EYWA 3HURA 2XVPA 1TV8A 5BOFA 4GCAA 3GR4A 3HPAA 3H2AA 1A5AA 1OIMA 1A47A 2NSXA 1V08A 3WKZA 2QYGA 2GYIA 1O66A 3NM3A 3WQ5A 3H26A 4LTSA 1T41A 4DNMA 1RD5A 4A3RA 4KEMA 1XGEA 1EC7A 3AHXA 3BW4A 4GI4A 1R3QA 4GIRA 4GZ7A 4JDBA 3KM8A 2W9MA 2QR6A 3G24A 3L4WA 4K8EA 2X05A 1WX0A 1FWAC 4V2XA 1NIUA 1F61A 5LNWA 2E6YA 3RU8X 3MUY1 2Z1WA 3GDKA 1UH2A 2OKTA 1H49A 2V67A 4XV0A 3UT0A 8CGTA 2O9RA 3TK7A 4DNHA 1Q5MA 2I5IA 1E0WA 1YXCA 4D8AA 2XTKA 4JTRA 2DZBA 5FEXA 5D9MA 1TMLA 4GI9A 2WKGA 4C91A 4N02A 1Q6CA 1Y5VA 3PZGA 3WLOA 4B15A 1EYEA 3B97A 3PNZA 3VOGA 3W2KA 1G5AA 1QI2A 3VOIA 1JYNA 4H6RA 1TELA 3MKCA 4FXRA 5AHEA 8XIAA 4NUWA 1GZ1A 1V6YA 2CU0A 4O50A 3SGUA 1VLIA 3TQPA 4XBJA 3TU9A 1QT1A 1T6MA 2PSNA 6XIMA 3CT7A 1DPMA 1JZ4A 5AN7A 2VZTA 2BTMA 5E0KA 1DP0A 3W7GA 1EWEA 5D03A 3IIVA 3QLLA 3JS3A 2JKAA 1RJPA 5KSWA 2XM2A 4AD0A 3FDKA 1O7AA 3EOLA 3W7EA 3GKFA 3TSDA 1B2YA 1JZ3A 4NZ5A 4LFYA 3G22A 2QDHA 4OZOA 3WQFA 2ZXQA 3KXQA 1QPKA 4AZCA 1XYBA 4KS0A 3LTYA 4D6DA 1HP4A 5LXEA 2EO7A 2YL6A 1TPFA 3PBYA 5FJIA 1RA5A 4P8UA 1AD4A 4ZQNA 4RZBA 1T40A 4ZXOA 4Z1YA 4Q4OA 3PG9A 5BXRA 1TQXA 4LAUA 3WUGA 3ZT6A 1CGYA 1DQWA 3MZNA 5I77A 4PCSA 4K7YA 1JYVA 3W1NA 1WKDA 2VJXA 3S1GA 4YVVA 1TFVA 1H7WA 1ZCCA 4IGSA 4IMFA 4PUJA 3WQWA 1DIKA 5LIUX 3KL0A 3QY6A 4L6DA 1XCWA 4EAMA 1IIGA 2EG6A 4WVXA 1BXCA 4LUSB 3LPFA 1XLAA 2QUUA 3EGJA 3LPPA 5K9DA 1JF5A 4RLIA 4W85A 1NFPA 2OGYA 4PB4A 1EJUC 3GR7A 3UY7A 2WHKA 3CMJA 3AHYA 5HWJA 5LXXA 2OB3A 3ONBA 4UIOA 1LCOA 3OGSA 3PUEA 1K4HA 1XRVA 4AU0A 4AAJA 5I3JA 1TWZA 4UTHA 3PFMA 4K38A 7ODCA 3CUZA 4B5UA 2DGAA 4GC4A 1AG1O 3SDOA 1QWGA 5LIWX 2JGYA 6A3HA 3L5MA 1QBBA 5IRPA 1ML1A 2CFFA 4IFRA 3REQA 1GEHA 1NEYA 2HK1A 2P88A 3FYOA 1DJHA 3ANYA 5DMLA 4GQRA 4US5A 1YX1A 2QCCA 2POTA 3EKZA 4TXEA 4E2BA 1ISWA 1OC5A 4NJJA 4KWUA 1N8IA 1QNRA 5IHRA 5IDIA 4W5UA 5GJNA 3B9EA 3E49A 3QGVA 4I9JA 5ABHA 3QGKC 1DWFM 3FW6A 4L9YA 3B4UA 3DEQA 2E67A 4QHRA 3PWGA 1TX0A 1BVWA 5I3HA 3W70A 3PTMA 1SZEA 4CCEA 3VMOA 4QCFA 1AK5A 5A8MA 2BB0A 4P8VA 4W8BA 2V5JA 4DYJA 2P5NA 2ZZ1A 3PB0A 2Y24A 1VBGA 2VWSA 4M56A 5AVHA 1HJXA 4AVOA 4DLFA 3VGDA 3DCPA 3N34A 1TR9A 2PS2A 1OFBA 3DERA 3TJXA 3E5BA 3IJDA 1YTEA 2WNQA 2WVSA 4Q3MA 5C5YA 4W7UA 4P7NA 1NF7A 1IXOA 5AZ0A 3EWWA 3A9IA 4CGTA 1K6WA 1OC7A 1EPVA 2A79A 3HMJG 3UG8A 4EVZA 3HGOA 3WSUA 1ECQA 4FR1A 5A94A 1R86A 4FIRA 2X0SA 3EA2A 2CBIA 4HCLA 1HKJA 2B7NA 1DV7A 2OO6A 3DFYA 4LAOA 1J8VA 2PU1A 2KX9A 3CHEA 5AC4A 1XHGA 2WZTA 2W79A 3WDPP 2QIWA 3QQ0A 4GYPA 4AX7A 4E2DA 4IMDA 4AHOA 3PWAA 4POCA 1OFOA 1Q2RA 1MUWA 1E0TA 2NLIA 2WB5A 3PZVA 3NURA 1XLJA 2X0HA 3G1FA 1U1JA 4M6UA 3H8AA 1V3MA 2QCDA 5GQBA 3RNDA 2CETA 3T0CA 3CM4A 1HL8A 3LCLA 4XUYA 2CZFA 1W54A 2Q8LA 1P1XA 5TQLA 2PF8A 3SM0A 2ZX8A 1DJXA 1AODA 3DG6A 1EO7A 1PIFA 1DIDA 3VI2A 3FOKA 2R94A 3W7PA 1C7SA 5HOSA 2Y89A 4D6JA 2CKSA 3ITXA 4JYDA 4E5TA 5K3VA 2NX9A 3E74A 4H9ZA 1NWUA 3K4WA 2QJGA 3DYOA 2GJXA 3J7HA 3N15A 3BAWA 1J9YA 2OZ3A 1ME9A 4CD4A 5KZEA 4PMRA 3U57A 4AY7A 1FWHC 3GIQA 1Z8AA 2VR2A 2CC0A 3A23A 2Z2UA 4KRUA 1NAL1 2DH3A 3V5CA 2XFRA 2XIBA 2F2HA 1FCQA 5D33A 1OK4A 4X61A 4CU8A 4MVAA 1BG9A 3PY2A 4KQNA 3DHUA 1EP1A 1TTPA 2AGKA 2YCLB 3P80A 4HMCA 4FHAA 3WH5A 3R89A 3KCJA 4GNJA 3SFWA 1RQHA 2IQ0A 1OADA 3RIKA 4PMXA 4IICA 3NDZA 2R6OA 3DENA 2OCZA 1AA1B 3EMQA 5D9PA 1E3XA 5LKYA 3LQGA 3FHQA 5F7UA 3O7UA 1GJWA 1JPKA 3EX3A 1EGMA 4UQDA 4Z2JA 1OG6A 4AZIA 5D38A 4O8RA 4H9XA 4MJMA 3R0DA 2VEFA 2I17A 3GFYA 1OD8A 4HK7A 1V6WA 2DZPA 4AXNA 3W26A 5CC6A 3A4AA 1OYBA 3WLNA 1JAKA 4DWSD 3N73A 3WFLA 2DSZA 1PIGA 2QCEA 4AEFA 4FEZA 3L4YA 5FA5A 1XIMA 1XFCA 1ZP3A 3STGA 3TP4A 2FMOA 2ZWYA 3G2GA 4H04A 1G01A 2OYLA 4QQ3A 3MU7A 3L4TA 1LBMA 3MWCA 1QJWA 2HJPA 3MI2A 3NQ6A 2D2HA 4DBUA 1V0NA 1JCJA 3UJ2A 3QQ1A 4AD2A 4KETA 3WQ6A 4RV3A 4AY1A 1AL8A 4LANA 4HN4A 1CXIA 5AB3A 3KAOA 1J0JA 3K8MA 1EJSC 3B4YA 4UFMA 5E9AA 3SCUA 1W5QA 5A8QA 2VOMA 3A24A 3URQA 2D2OA 1B90A 2V3GA 4IGMA 5E93A 1CBGA 3VIOA 1GQLA 4G56A 4HTBA 1K8CA 1K70A 1P0KA 4US5D 2PGEA 3TE9A 2VXNA 1E70M 4RE0A 1GONA 1YDNA 2BVTA 1A0DA 4QSFA 4XD5A 3W74A 3CZGA 3WEZA 2EPHA 1R7OA 3HO8A 3CHCA 2C79A 4LQ1A 4DJFC 1IWAA 5AYBA 4XBSA 4LF1A 2QCMA 5A95A 5KITA 1E5NA 4KCVA 4UCGA 1V8EA 1BF6A 2VFEA 1PKMA 2FMNA 3ZQ9A 1TMQA 2AKMA 2O7SA 4HZ8A 2A7NA 2ZRUA 4RJEA 1HF6A 1M41A 5C9RA 2ZZ3A 2OLHA 3VUPA 2B81A 1P6BA 1I75A 3ZT5A 4GE8A 4R85A 3KOZA 4AZ7A 2FQIA 3AHVA 5CC7A 4F0KA 2OEKA 1QPQA 2Z25A 5HMDA 5M2FX 4QJ3B 3S9ZA 4ICMA 5A6SA 3S2MA 2F6XA 1RA0A 3CB3A 2NV9A 1E6QM 5AHIA 2ZE0A 3VTRA 5D09A 4W7VA 1W9BM 4M7TA 1S46A 3WJXA 2V69A 1XBYA 2Q3OA 1UR9A 2W66A 5BRPA 4R27A 3ES7A 2P53A 3GLCA 3TEVA 3W27A 1EF3A 2J78A 3WBAA 1ZALA 2JK2A 2HISA 3AU2A 3SCPA 1U2YA 3Q37A 4CQBA 4PSPA 1OT2A 3B9OA 3DZ1A 5TD4A 4NI8A 3SIMA 3N1AA 2GZXA 1UD4A 3N4FA 3UG4A 4Y9PA 1GPWA 5DF0A 2CXEA 4WDXA 1UYQA 3KZSA 2DSUA 4GXPA 2DSKA 2QLYA 2ZTKA 5MHBA 3FVMA 3SJ3A 1EX5A 2E1DA 3MUIA 1LLOA 4F9DA 5AC7A 4PRRA 3ANUA 4DB7A 1EJ7L 2HE5A 1ITQA 8XIMA 3AI0A 5EA9A 3BPWA 2GGJA 5A8PA 1MVYA 2VENA 2A3BA 4Q7NA 4FALA 4ZEPA 1E6ZA 2B7PA 1KFCA 1LLZA 4ASTA 3KZPA 2DDXA 1NDWA 3V0SA 4UFHA 1RALA 5H1WA 4GY0A 4OIFA 3QN3A 4HK5A 3S1XA 3OO2A 1Y8BA 3WL0A 1IEIA 1R9ZA 5KZMA 3LUTA 2QQ6A 2UY4A 3MUXA 2YDAA 1E56A 5D4YA 1MNZA 5BU6A 1UP0A 1V0KA 2G4FA 2HPMA 1PBGA 3USZA 2WCSA 5CJNA 1UH4A 4RNFA 2WCAA 1R3YA 3VUSA 4GYJA 3OG2A 2J74A 1JR1A 2D0FA 1O12A 3C2OA 4DRSA 4PMVA 3UGRA 1TQJA 2OU4A 4QXIA 3M07A 3LCIA 4O0KA 3VGFA 2XH0A 3BSMA 3VM5A 4AWUA 4INFA 3HV8A 4V1YA 1UZ1A 3LBOA 1ELSA 4NF7A 4O13A 3W88A 3SGGA 4C6FA 1FTXA 5IFTA 1YBQA 3SBFA 5C2GA 1A0EA 2C71A 1Z32X 2V3EA 4Q32A 3NL2A 5BOOA 1KV8A 3DYPA 4GFIA 4HPXA 1I2QA 3YPIA 4DWSB 5G4HC 2XZ7A 3W7KA 2REQB 1FVPA 3KHJA 4CVWA 5K2ZA 1D7FA 1MRAA 2H8ZA 2DIEA 3HJEA 4H7ZA 4R7WA 3RCNA 1XLEA 3CH0A 4AY8A 2BZNA 3VOJA 3UP8A 1ADSA 3ZO9A 4N2YA 4IOTA 4GUHA 2CESA 1MI3A 5FEPA 1SM9A 1LDCA 1R3TA 1R47A 1M7PA 4NJHA 4BF7A 4KF1A 1TREA 4EPDC 3RMEA 3QJAA 1KB3A 1JXJA 3GRIA 2F9RA 3DI1A 3U7VA 1WZMA 3ARTA 3CMFA 4UFIA 3AS3A 3TH6A 2V5CA 3WJZA 1VJSA 1JGIA 4C1NA 4TV5A 3EX6A 1DJGA 3NQ2A 5A8GA 1XIHA 5KZ6A 1XSIA 3B40A 1TE1A 4Z1DA 5DMYA 4AYGA 2GJPA 1S2UA 1ZJIA 3BOFA 4RZ6A 3IIXA 4CEUC 1A80A 5I06A 4L4MA 1PWLA 1FWDC 2WMIB 1CENA 4C6EA 2IKJA 3R7MA 2RJHA 3F1QA 2NW0A 1M7XA 4E8CA 3H12A 4JEQA 3M0JA 3NDOA 1CXKA 4HPNA 4GX8A 3XISA 4A29A 3OVPA 4LVBA 5A6TC 4MAZA 2J7FA 1ZBCA 3M7WA 1UWIA 4C90A 1NF0A 2ACRA 4DX3A 3QEZA 4PUEA 3WNOA 5L9FA 3VNLA 1V02E 5SWUA 4NASA 3CLWA 1UHVA 1TPVA 4JKMA 1BKHA 3TC6A 1E15A 3PZQA 4KEVA 4DEFA 1ONEA 4LALA 4R9OA 2PCEA 3WIJA 1WE5A 4JTFA 3MO4A 4GO9A 4HK6A 3APTA 2PDIA 4AZBA 4FZIA 1PB0A 4L4PA 3AMLA 4NX0A 4JFVA 1NARA 4NHVA 2I1OA 3LGEA 1OX4B 4ZL1A 4LF2A 1H2JA 4JYFA 4IXXA 2I9EA 2B0MA 1BSLA 2YR1A 1O6IA 2B7OA 2G3IA 3UVAA 3U2CA 3CO4A 4DY1A 4MB3A 1LLWA 4JTSA 4IXHA 5M1TA 1W2VA 3MZ2A 3T81A 5F2GA 4N4PA 4M29A 1KFLA 1TJ0A 3BZJA 3IGSA 3CC1A 1VENA 1FH8A 4HKPA 3GVQA 2ALRA 2XWDA 2QCNA 5C70A 1FCBA 3B8TA 2CW6A 1NU5A 2EAWA 5JVLA 3WQEA 2PRHA 1XYMA 3QYSA 2C19A 2GGEA 5F1UA 1UWTA 4DUOA 1XDJA 3LHUA 3IJ9A 1EEPA 3GAYA 1GGOA 2QNEA 2Y7GA 2JQXA 2PB1A 1QHPA 4W87A 1Z6KA 4O53A 4QDMA 4IUGA 3QPZA 3W25A 1VIZA 1NQKA 4LEQA 2FVLA 4F48A 3TN5A 2ZVIA 3LM3A 3ZM8A 1VC4A 1L8NA 4A8LA 4AZ5A 3W1PA 4OHQA 2HPIA 4IGHA 4JTDA 1KLZA 4ZFCA 1TCMA 1RCQA 1B3ZA 1EOMA 4JN8A 4J3XA 3VYLA 1THFD 4WJ8A 1PL9A 2QJNA 3KS6A 2BMBA 3CQJA 5LNUA 1YXYA 3K1DA 4AVNA 3L4ZA 1RR2A 2E6AA 3WELA 1P0BA 3F4DA 4LU0A 3PR2A 3V4BA 3RHGA 4IJCA 1TG7A 1H5VA 4QRNA 3KLLA 5DMMA 4JIQA 5I3GA 3ARUA 3UR5A 1RPKA 3ZS4A 1P5BA 4ZVJA 2Y1HA 3IV3A 2BOEX 3GB6A 3WQDA 2OGJA 3E0WA 4QFUA 2ZA1A 3WDHA 3O06A 3CHVA 5T26A 3W2UA 4GLEA 2FHFA 1ZGDA 1M3UA 3DN5A 4PTVA 1X98A 4HPGA 3NZGA 3R13A 3HGSA 1UZHA 2GQ9A 4L1XA 3CS2A 1KC7A 2I7GA 5KEZA 3VOCA 4IHCA 1ISXA 1G7UA 2PDYA 3RF9A 1I6NA 1REQB 3GHTA 3URAA 3R94A 2PI6A 2ZTJA 1H11A 1KO0A 2I16A 3V0UA 1PSCA 2HROA 2PD5A 1J0HA 1KA9F 3WN6A 3LPGA 2JFEX 4J3UA 3GBDA 4QGCA 4YU1A 4V28A 3NEVA 3SCWA 3JU2A 3W22A 4MGGA 1PTDA 1ZUAX 1W91A 1CLVA 1B4EA 1SMAA 1S5VA 3IJQA 2XSXA 1CGVA 1V4YA 3GVWA 4MYAA 4FI4A 4J7RA 4MMWA 4Y6GA 2ZUUA 4ZO8A 3MB9A 1ZL1A 2I5QA 2OO0A 1TTQA 4ZO9A 3P74A 4XSLA 1W3HA 4PUWA 1XD1A 2PDWA 3SB0A 4LCRA 4D71A 4EXQA 3WENA 2WWCA 3AWNA 2FPTA 3DHDA 3DHPA 3T09A 2Y6ZA 4QDPA 4Q8VA 3T2OA 1O68A 4RNIA 1Q63A 3L65A 1OY0A 1GKRA 4EF9A 1EQCA 4BQ4A 1I45A 5HJYA 3A3XA 5H8MA 3RM8A 3EEZA 4RNHA 4RPQA 1G94A 1TA3A 3H7VA 1B0IA 1JDCA 4UFLA 3LHZA 1RBAA 2Z29A 4OVXA 1WBJA 3W6YA 2FJUB 4F2BA 5FF2A 4X0VA 5FF7A 2FZBA 2DUAA 1A5LC 3QVQA 4DPQA 1EYWA 4XISA 1XYAA 1OSEA 4KT2A 2ZUVA 4ZQRA 1RHCA 3W87A 1B4KA 1IEVA 3H54A 5EMLA 1W2PA 3WQVA 2Y70A 3AUJA 2WAGA 3GIPA 3AXHA 1TWWA 2ALDA 5FF4A 5HPCA 3WLTA 2FH6A 1DWGM 4QS6A 1UR8A 3EA1A 5BU9A 4HOWA 3QSTA 5XIMA 1MXSA 1JDAA 2WQPA 4MNMA 1A3XA 3QFWA 1FDJA 5HATA 3BSGA 3TYUA 5FI8A 4CN4A 1ECEA 2GGIA 2TMDA 4YCPA 3TLLA 4HNTA 4L56A 2HS6A 4MDPA 2Y8KA 4EACA 3G3MA 4UTWA 4A4AA 1JDDA 3NDYA 3B8VA 2P1FA 5EMJA 3K30A 3RR1A 3PANA 1A5KC 3GXMA 4PYSA 4QEEA 4WUIA 2GWGA 2Q71A 5JUVA 1K4GA 3WX7A 2J75A 3WEOA 1JI1A 3EMZA 2JKPA 2GLKA 4Q22A 1WDWA 5C9ZA 3UPWA 2NX1A 2EGZA 4KRZA 3QKEA 3EDKA 3AIRA 3MP3A 4Q8UA 4ORMA 1Q6OA 4UTFA 4ERIA 4BY3A 3WF2A 2VRQA 3NEHA 3TJIA 2G8ZA 4OBRA 2CLKA 1FWBC 2WVTA 2RKXA 4OKDA 3MKVA 2OKOA 3FGCA 3OHIA 1QPOA 1B31A 4NAEB 4JY8A 3RK8A 4JX4A 1R9YA 1VBUA 2R1LA 3PJWA 4JCLA 4A6GA 3LV5A 1KGUA 1TVLA 3TV8A 3TR2A 1SSDA 3KOWA 4IUOA 2C14A 3PBWA 1ME7A 4GWEA 3EWUA 4M80A 4A35A 1OABA 1HJQA 1U5JA 5AHMA 3IIOA 2PWUA 4I90A 2QIIA 4KIEA 5I3FA 3BWWA 1UBPC 3DFPA 4UR8A 4O57A 1BYAA 1XJBA 4JTTA 3GH4A 3KFTA 2OQHA 1J0ZA 1PDZA 1UD3A 3ISIX 1PE1A 1BVZA 4GY7A 2G97A 1MDRA 1BQGA 1E55A 1SFSA 1XXXA 4JFWA 2ZVRA 3OZMA 1HJSA 2OZTA 1QATA 4QROA 4OGZA 3SFKA 3W1QA 1PO9A 2PWVA 1IHIA 2WZHA 3JW7A 4WY0B 1E6RA 1X96A 1JPMA 4Q8OA 5I3IA 1ZB5A 4LNYA 3ARSA 1MW2A 4GZIA 1AQ0A 3C4UA 1WDPA 1GKQA 4G7EB 1V51A 4IIEA 4GJ1A 4B5SA 5DT7A 4WR3A 4AYSA 3LXAA 2CEQA 3F2BA 3CIWA 2L5HA 3GNNA 4NAEA 2GFTA 1QNOA 1TVNA 4WQ6A 4M1RA 3U5YA 1W3KA 4ZO6A 5BW6A 1E9ZB 4L9XA 3WF1A 1PZ2A 1FWEC 5FACA 2E28A 4WGHA 4XTIA 2YCIX 1VHNA 3W1LA 1K6AA 4KCWA 4M6QA 1HFBA 4A05A 4JN6A 3NPXA 4L6HA 4LNCA 3RX4A 4BQ5A 1FCUA 4J40A 1A3WA 1IWPA 1HL2A 3TW9A 1HQTA 2X7VA 1JDEA 1KM4A 2HSAA 4XAFA 1OVDA 2BX7A 5DBUA 1JQXA 3H2CA 4JYEA 4F0SA 3P2VA 4QSHA 3I6EA 4LAZA 2RGMA 1VLWA 4EWJA 3AMDA 3IUIA 3EA3A 4DIAA 1WZKA 3W7OA 4ACYA 4WSHA 1L2QA 2YL8A 4LYRA 3KOYA 2NV2A 2VRJA 1DJIA 5FJOA 4A3QA 4QISA 4WGXA 1W9UA 1T96A 3TAOA 3V36A 5HPOA 3O07A 5BXSA 5I78A 4M51A 2XIJA 4LEFA 4TO8A 2QGYA 4JNMA 4OBTA 1CGWA 1LOLA 3BTNA 3VAVA 1W3TA 2IKHA 4PUDA 3BSHA 3LZ3A 4IG2A 3GDMA 1TKKA 4LC8A 2ZRXA 4M1BA 7TIMA 2VX5A 1H50A 4QJ1A 4TMCA 2PDJA 2JF6A 1W5OA 3LCHA 2P50A 2VC7A 4B5XA 3GO2A 2HVOA 4PTDA 3S2CA 2PODA 3OZYA 2VFIA 1LROA 3P60A 4CD7A 3NZRA 4X9YA 2YXOA 1QNVA 3DG7A 3IJ8A 1JZ6A 3ERPA 3UWWA 1EC9A 4MIMA 1CYGA 3EPNA 4IL2A 3P93A 2ZZ7A 2ADAA 1LQ0A 1NVMA 3U8GA 2YL9A 3CQ0A 3HQ1A 3NQCA 4DZHA 2QDGA 2VEMA 1LORA 4DN1A 2VM8A 3LOTA 1S5NA 1JCXA 3MKKA 4C6BA 4D6HA 1A5CA 2OT1A 5EGRA 2CKRA 1H3GA 4J9JA 3SUTA 4UTKA 3T55A 3UR7A 1GOXA 2V81A 3OBEA 3ZLFA 2I14A 4E2VA 3EPMA 1N55A 3O8AA 3ATZA 5DQPA 3L0KA 2D1ZA 3RJYA 1PKYA 3AAMA 3NIYA 3WD0A 1H63A 3WLQA 4U28A 4UB9A 4NZJA 2A3EA 1V6UA 2JIEA 4DZ5A 5A6KA 1KXHA 4NVTA 3VIJA 4PCNA 3FA5A 2Q6ZA 1D3CA 1GK8A 5BMWA 4QTGA 2PTXA 2C1GA 2VR5A 3NOYA 2VC5A 2QUVA 3GXFA 2OWCA 4F2UA 1WV2A 3PBMA 2GQAA 2WLYA 2YCLA 3VX0A 1O1HA 1VRXA 1PCKA 1QHOA 1RSCA 1AFSA 4NNCA 2PC8A 3WQOA 2NLYA 4XIAA 3UWZA 3LD5A 4QAIA 3GC2A 2NUYA 4IX0A 3S9IA 1X8CA 3NM1A 3WK3A 4AFYA 2CLMA 1E6PA 3BH4A 5FAGA 3CQHA 2Y62A 3H55A 4XKMA 1VYSX 2IW0A 2E6FA 3TDFA 3TSMA 2F6UA 3MO7A 4OQVA 4WDUA 5IHSA 5I5RA 1GG0A 3VO0A 1U30A 4PBEA 2BHZA 2ZYFA 3SECA 4Z0SA 4UZUA 4ERGA 4RDZA 1SZRA 1CXLA 2WZMA 4FR6A 1Z7AA 1J18A 4IJRA 2D2GA 4LRSA 2QDDA 3V35A 2Q8ZA 3PTKA 5A6LA 4O10A 1W5MA 2OXNA 4DJEA 2EQDA 5L6UA 2CHRA 3O63A 2V82A 3UXIA 2J7DA 1LF1A 5E0CA 4M3PA 4AWEA 2GQ3A 3UZ5A 2R8WA 1OF8A 2J9ZA 1UC4A 3VKJA 2J27A 3CQIA 1H7OA 4MKSA 2A4AA 4LYQA 1DTNA 4ZO7A 1CB2A 2QMKA 4F40A 1XGZA 3WLJA 2AL1A 3CZ8A 3OLIA 3W23A 3SY8A 1T7LA 5GNZA 1S1PA 2F6KA 4GNKB 3AU6A 1SJDA 1H1NA 1D7KA 3TYAA 2AMXA 3CIVA 4JX6A 3QQWA 1BEUA 1UPMB 3WFZA 2WZEA 5XINA 3RUBL 3BDKA 3E0VA 3FJ6A 3VNIA 4YHGA 2Z0IA 1F8MA 2R24A 1XLMA 3LRKA 4TVUA 4Z1CA 3S1VA 4OJYA 1VBJA 1O5RA 5CBBA 4IX2A 1F2JA 4DF2A 2YYTA 5C6MA 4ADUA 1I1XA 3A4JA 4QITA 4O12A 2WM0A 3TSBA 2UY5A 3G8EA 3GC5A 1MO0A 3I3EA 4IMCA 4QEHA 5D2WA 1BWVA 4CQAA 3OPSA 3DOPA 5DCDA 2G95A 3AIQA 2IPFA 2OJPA 4JFSA 1P1MA 3A3HA 1XLHA 4ZZ9A 5A3HA 3OGRA 3WNMA 1A53A 3FXYA 2TODA 5TAOA 1KBJA 1MSSA 3IGXA 4Z2HA 3ZXWA 3BV4A 1J96A 3ARZA 4HNOA 3WDRA 1EKOA 4W88A 4C5YA 3VCNA 1LOSA 3QTPA 3WD4A 5FJJA 2XISA 3SCRA 5I6SA 4WY0F 4JICA 2AQWA 3AS1A 1VB9A 2VTFA 3HU7A 3LPOA 3QHNA 1IZJA 4H6QA 4PRTA 4MAVA 3O16A 4A3UA 1J5TA 2Z2AA 1M03A 1CPUA 4G8TA 1S5TA 1FHVA 1QFEA 1SU5A 4ICNA 2P8CA 3SCNA 4A22A 4NXSA 1VF8A 2EKGA 1GTHA 3R2GA 1XCFA 1DQXA 2FGZA 2VFFA 3STPA 1E43A 1JZ5A 2ZA3A 2VFHA 3RPMA 4FF7A 1MZHA 3VKKA 3UBPC 1KM3A 4D6CA 1WZAA 5G1YA 5HQLA 5C9XA 1J10A 4DXKA 4JTLA 3TYDA 2X1SA 3PSVA 3VILA 5IFPA 4NIRA 3ITVA 3U7BA 4LB4A 4JKLA 1QR7A 4ACZA 1WDDA 4UUIA 2FVKA 1JCYA 3FGCB 5U4NA 1TJ2A 2O9OA 3QHOA 1X6UA 2EPMX 2DZVA 1W3IA 1E71M 3FS2A 1OK6A 2J8GA 3ZR5A 4UZSA 4DO5A 3VKAA 2Q3RA 2PDXA 4DJED 5CGQA 1QTWA 3DFOA 1LRTA 1PDYA 3WDIA 1CZ1A 3O6YX 1R87A 5DFAA 4JD4A 2AKZA 4E0CA 4FA3A 1VYPX 4FSAA 3N2OA 3CUHA 1A4MA 1PCWA 2YDRA 1XFBA 4GUJA 1HP5A 2WMGA 4QLJA 1C90A 2E77A 3FY1A 4ZENA 2WBKA 2ACSA 1W31A 3SO7A 1Q8JA 1UIPA 4OE7A 1QU4A 1KNWA 4ZB0A 3OYXA 4L80A 1WOBA 3GM8A 1E1EA 1B9ZA 2DFAA 4DBEA 4A3HA 2RDUA 1J12A 4Y90A 1GKPA 3M0IA 4B2DA 1W9PA 3AIVA 1RCOB 1P6WA 5KINA 2ATMA 4DYEA 4XD6A 2NVAA 1ITXA 3C2RA 3S8HA 2FDMA 4PTWA 4N6EA 2HK0A 2J47A 3FIGA 3C0QA 3C3NA 6ENLA 4W8LA 5DMNA 4H4IA 2E25A 2GDQA 4KESA 4IIGA 2YCEA 3QMTA 1YPFA 3HIJA 3SCVA 3CL6A 3OBKA 4DM1A 3LQLA 3VDHA 5LIKX 5CLWA 3NSNA 2XIIA 3S47A 1V5XA 1WAWA 5F2IA 3NQAA 2YSWA 4R3UA 5A6JA 4BZYA 4XZMX 3BK0A 3EOOA 3ZJ6A 2C16A 4AX6A 3MSDA 3G1DA 4B3LA 2XN0A 2PTWA 1KRBC 2DJXA 1V3KA 4TIMA 3LHTA 3SCTA 1S2TA 2VQUA 1AJ0A 3K13A 3BLPX 2P10A 1K8XA 1R2TA 3FNDA 1YW1A 5LNRA 1QK0A 2YB1A 4L64A 1ZJBA 3CHDA 3FHAA 1PX4A 2KAUC 3B06A 3LHWA 1PXGA 1AMKA 2QT3A 3R4IA 4DI9A 4I7UA 2NT0A 3EYPA 1W1ZA 4S1FA 3LRMA 2PDKA 2INZA 1IZKA 2E1WA 4LUJA 4U10A 3RX2A 3OBAA 4J2MA 1F6KA 3OA3A 4RCXA 3RAOA 1B30A 1MUCA 4D72A 3PJTA 3OVRA 5D2XA 1CXEA 3W7JA 1KQYA 3BV7A 1OFEA 1FH7A 4GO8A 1P0NA 4I7WA 3VD5A 3GNOA 5AYYA 3WZ0E 4W86A 5A2BA 1TWIA 4JNYA 4HJFA 4KEZA 4P8XA 3KDOA 1ZLPA 2WOQA 5C7HA 4OECA 4X2PA 1UKTA 3B9NA 1K9FA 4UOQA 3C2VA 2VC6A 3TYBA 5A5WA 3DFQA 5KTLA 4XK2A 1YHTA 2PGWA 1QO5A 3FN9A 1M53A 4PTXA 2WW5A 1E1FA 1E51A 3SCOA 3CB8A 5C8BB 2ZRWA 4DM2A 4GFSA 4RX0A 5IM51 3KTCA 1TO3A 3LTSA 5AHFA 3TC7A 1L6SA 5FF0A 3NR0A 5HNNA 1K03A 2WHJA 4IMEA 4OT7A 3KP0A 7A3HA 2QULA 3MP5A 3FK4A 1L9WA 4AD1A 3ZSSA 1VFFA 3DBPA 1KTBA 5EBAA 3OIHA 4AZGA 2FZ9A 4XAGA 4WDWA 2OX1A 2NWSA 3RPTA 4CUCA 5AHNA 2WBGA 3KBMA 3APYA 1UG6A 2UV8G 4B9ZA 2AAMA 1J2BA 4K36A 1PWMA 1XUUA 2CBJA 3VZYA 5CJ5A 4N9CA 1AD1A 3S5YA 3TTSA 2W61A 4M7SA 2V63A 3S83A 4HB7A 3N13A 1QHZA 4JTGA 1FA2A 3WJYA 3KWXA 1A5NC 3VKCA 1E3ZA 1XRTA 3EBVA 1K8ZA 3PWIA 5D32A 5A2AA 2FB3A 1SQ7A 3AS2A 3O3RA 6PTDA 4REQA 2PE4A 3BJFA 2NVDA 3BLKA 3PZTA 4XVEA 3BJSA 4HQVA 3MA8A 1N7KA 2YCKX 2WLZA 3NXLA 5DY3A 4Y8EA 2C7FA 1T8QA 3GG7A 4B92A 4LY8A 5LGZA 1PVNA 5I0DA 3DDMA 3EMCA 1WQ5A 2I57A 4L1GA 4TVDA 4Z08A 3SUUA 1YXDA 1JRCA 2WZIA 1FFRA 4IQJA 3DX5A 4QQUA 4BR1A 1MEIA 1EFZA 4FNSA 4N0RA 1EX1A 2TYSA 4AMCA 3KDNA 1TB3A 3BAKA 2ZOXA 4ZOEA 4UTTA 4MWAC 4D8ZA 2RGLA 4W4QA 3AXMA 3THQA 2X42A 1X6LA 4DHGA 3H21A 4RDWA 2ZZ2A 5IOBA 4NP7A 4ZA0A 4HCHA 2D73A 5TIMA 5A6MA 4KERA 3M43A 1V02A 1W1TA 4LS0A 2WNWA 2NQLA 5I24A 2X2GA 4ICCX 3EOUA 2D3NA 5D30A 5DO8A 2ANUA 3A4XA 1QNPA 3W1TA 4Q8PA 1CW2A 5LNVA 4RW3A 1G0CA 2NXIA 3P81A 4PC8A 4O15A 6REQB 1IXNA 2ZRZA 1VIWA 2WSRA 4AUBA 1XF0A 3BOXA 4MADA 4C6PA 2CHOA 1SW0A 4IPNB 3ICJA 2V3FA 1XQLA 4PMOA 3G0UA 2DZTA 2QZRA 2VWTA 3OQEA 4UTIA 2AGTA 3VDCA 1OX6A 3LMZA 4Z2LA 3FEMA 5F4SA 3GDBA 3EDEA 1WCGA 4UQBA 2HRWA 3KBJA 2Y88A 1EZWA 2WMIA 1JG9A 2JBMA 1WYIA 1HTIA 1HKWA 2BS9A 3CAKA 2YW4A 4AWSA 4ZSTA 2I9UA 4UNIA 1XLBA 5AVNA 3A6OA 1GVOA 2PZ0A 2YB4A 3WMBA 4Z17A 1UWSA 1BRLB 5BYWA 2PDLA 3PBGA 3V5OA 5JU6A 1M7JA 4GJIA 3D0CA 3SN1A 2Y0FA 2XN2A 3KE0A 3ABSA 1EZ2A 3N2CA 4LS1A 3LRLA 3HFTA 1TA3B 4AD3A 2VUYA 1UWAA 3MS8A 4AEOA 5CPMA 2BFGA 3IAPA 3CL8A 3ARPA 1BLIA 3PZOA 1UR1A 1Y5WA 2XWEA 3NGJA 5I2UA 2IKGA 3BE7A 1DXIA 1VR6A 4EK7A 3SI9A 2ZICA 3QZAA 1ZY9A 3VNKA 2PU0A 3TIMA 3CV2A 5EMMA 1ONRA 3S5NA 1JPHA 2V5DA 3N2BA 1UW9A 4JIRA 4C6MA 4GI6A 4ZB5A 3MANA 2W27A 3U6WA 1H7XA 4ALDA 3G3DA 1QI3A 1E5JA 4DUXA 5ABTA 3TCSA 2FJKA 3PZMA 1DIOA 2W5FA 1LYXA 2J8FA 3BJTA 4R7OA 2NVCA 3TQ0A 4LAKA 4NNBA 4UWMA 3IUHA 3VD3A 3VX1A 3CTTA 2TPSA 1HJWA 3TNOA 3KUMA 2AAAA 3PAJA 3MJMA 2CPUA 1QPNA 1GQJA 5EPDA 1GVIA 5CKSA 3H7UA 4H2CA 1V0MA 2E8YA 3D3FA 2VURA 1OGBA 1BGGA 1H7PA 5A8OA 3MMDA 4QE5A 2EPLX 4YVXA 2XH4A 3VNZA 2DZUA 2PGRA 3QV8A 4MHBA 3A13A 4IGNA 3GHSA 3VZXA 2JF7A 3NG3A 4GZEA 1BKSA 5HXMA 4XO6A 4S2BA 4ACZB 3EB4A 1F3XA 1JL8A 2RHGA 2E5DA 2Z6IA 1UR0A 5CC5A 1W1VA 4HZMA 1JEZA 1W8GA 3LG3A 2Z1VA 3RRAA 4HMDA 1L0PA 3IUDA 2FTPA 4B5VA 2BHYA 5AYXA 5D8WA 2R91A 1FDZA 2GK1A 4BA0A 1SZGA 4GUFA 4L6OA 2IS7A 3VIHA 2XIMA 3CLMA 3TROA 1NP2A 1AUSL 2J8TA 2NX3A 1DWIM 2E5CA 5K9XA 8A3HA 3VU2A 2C1HA 3G1XA 2VZUA 4OTKA 5JBDA 1UR3M 3SRDA 3LDVA 4KW2A 4PGLA 1MEWA 2CBVA 4PSRA 4B5NA 4HMEA 3WO8A 4EIVA 3C5QA 3G1VA 3SN0A 3NWRA 3VE9A 7REQB 3MDWA 3IGUA 4K8GA 1GVEA 3W02A 1WO2A 3BICA 1XLKA 2HXUA 2DZAA 1KM0A 2PDBA 4GVFA 5HUPA 1M1BA 3DXIA 3N29A 1DWAM 4Q8NA 2YL5A 2RDTA 3CV6A 1KR0A 2OR2A 3MW7A 1SPQA 2PURA 1UB3A 1X1NA 1SW7A 2PBOA 4ZQMA 3VD9A 4NAFB 3BZGA 1B54A 4LX4A 3BOLA 3NPWA 4F9JA 2Y2WA 1ZQ5A 3GKAA 4HNUA 3NXFA 4PMQA 3WMCA 5ABFA 3OLDA 1OG0A 5F1VA 3VDGA 2QV5A 3G1SA 1MYRA 2ZFAA 2BVYA 4YTSA 3FXGA 2GOUA 4Q4KA 4FAMA 1MMFA 2QUMA 3APGA 3SEPA 4HU8A 4DZIA 4XZWA 3UCCA 5CPQA 1KQZA 1Z44A 2OPJA 3WH7A 3P0XA 3ABXA 3GNDA 1FY6A 3MUCA 3RO8A 1JULA 1KXVA 1R3RA 4RZ4A 3R79A 1G1YA 2J7GA 4IWWA 5G1TA 4YYFA 5FCZA 2HTMA 2FGLA 6TAAA 1RQBA 4DXXA 2Y4SA 3WK2A 1XRSA 2HBXA 1DWHM 2QJHA 1JFXA 1PZ3A 4C7FA 2QS8A 3FVDA 3QV9A 1T99A 3VIPA 1RP8A 1GT8A 2P0OA 4LT9A 3O6CA 1HJVA 4YHEA 3CV7A 2HNEA 4H9VA 3A5VA 4CNNA 4DUWA 2VI0A 3QOKA 4YMZA 2W0UA 2BY3A 4LV9A 3TMLA 3CYVA 4GHRA 2CLLA 1ZENA 4R9XA 1E4IA 5E1QA 3UETA 9XIAA 4ZB2A 4F0RA 3W7HA 4ZQPA 4KH2A 3T0DA 5JXQA 3N6HA 4UMCA 1LRQA 2ZBTA 1HGYA 3S2NA 4Z2KA 3DUGA 3IK2A 2VGIA 4W9TA 5CPSA 3AROA 4WLCA 1GOMA 4TOQA 1QAPA 2YFNA 4RKAA 3U3HA 3AJ7A 1Q65A 1NWRA 2WJDA 3NQGA 5I7GA 3B0XA 4WJXA 2VKZG 1J2WA 1I9CB 3EKLA 1XV8A 2BOFX 2ZUNA 3RLVA 2CWXA 5HUOA 3SQLA 1SO4A 2KZHA 1EPXA 2H9AB 3EX1A 4ZOBA 3PTDA 1POJA 4LUYA 2VCAA 4WOZA 3HQPA 1W37A 3G77A 5HMEA 4EKJA 1ZBVA 3KVJA 3BAJA 3QPYA 3AIEA 2DT0A 3UPBA 2E5BA 4JAWA 4L61A 3W85A 3T0AA 2QVNA 4QNEA 2R1KA 4GXMA 3OGVA 3T6CA 2DEPA 3RITA 3S1UA 3CK5A 3FKRA 3C3UA 3I65A 4ATWA 4LXFA 2QKFA 4YYCA 4E4PA 2Z27A 1H61A 3LGDA 3E9AA 2ISSA 5C9UA 3B8SA 2J7BA 3F5LA 2XZ9A 4EP8C 4WCJA 3CEPA 4D8LA