2OU4A

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 115
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2ou4A00
3BANA 4HHMA 4A8IA 1DIEA 2HK1A 1TZ9A 1XIBA 4HGXA 4QDWA 3NGFA 4DVOA 1XLCA 3UU0A 1XIIA 5EMLA 3XINA 3KBWA 3WQOA 4X61A 1XYBA 1CLKA 1A0CA 1XINA 2HK0A 3CWHA 2G0WA 3KBNA 4GQBA 4US6A 4E3VA 3KCJA 5EMMA 3QYSA 3BZJA 4GLEA 3JU2A 1XYLA 3TC3A 3M0YA 4LNCA 1XISA 3ITXA 4ZB5A 3ITVA 1XLEA 2GYIA 1O1HA 3QZAA 2OU4A 3IUIA 1DXIA 9XIMA 2I56A 4A8RA 1XIDA 3ITYA 1I60A 2QULA 2XISA 4HHLA 4QE4A 2QW5A 3M0VA 1XIMA 3KBSA 3LMZA 3AALA 3N4AA 4ZB2A 4Q7IA 3BZGA 3M0LA 3M0MA 1XLLA 3BDKA 3QXBA 4OVXA 4QDPA 1QTWA 2QUNA 4XIAA 3VNLA 2HCVA 4PGLA 4ZB0A 4A8LA 1XYAA 3KTCA 3CQJA 4J4KA 1YX1A 3OBEA 4QE1A 1XICA 3C0SA 2GLKA 1OADA 2G4JA 3QC0A 4DUOA 1DE5A 1MUWA 1XIFA 2NQ9A 3XISA 5XIMA 4G56A 1XLBA 5B7YA 6XIMA 1XLKA 2ZVRA 3KWSA 4YTRA 3CQKA 3P14A 3L23A 2GVEA 5EMJA 5AVNA 8XIMA 4QEHA 4QE5A 4A8NA 1QT1A 1XP3A 3P6LA 4W4QA 4PFHA 4XSLA 4XSMA 4YTSA 3KCOA 1XLFA 3UA3A 3VNKA 3KBMA 3UXIA 5XIAA 2NQHA 4YTTA 3ITTA 4XKMA 2ZDSA 5H1WA 4KW2A 3AYTA 4GJIA 3XIMA 1XLIA 3U0HA 3M0XA 5I7GA 3VNMA 4XIMA 3C0LA 1XIEA 2X7VA 3ITLA 1GW9A 3FVMA 4YTUA 3ITOA 2X7WA 3C0QA 3IUDA 4ZBCA 5C9ZA 4K1GA 5XINA 1S5NA 1XYMA 3BWWA 9XIAA 1BXCA 3KCLA 3VNJA 2QUMA 1A0EA 5J8LA 1DIDA 1QUMA 3UVAA 1XIGA 1XYCA 6XIAA 1D8WA 3CQHA 1DE6A 1XLAA 5H6HA 1XLHA 5B7ZA 4HNOA 3AYVA 1XLGA 3VYLA 2XIMA 3KBVA 4K3ZA 3U3HA 4EAYA 5FA5A 1MNZA 1XLDA 2I57A 3IUHA 4X60A 1I6NA 8XIAA 1XLJA 3GNXA 4QEEA 3AAMA 3CNYA 3UA4A 4GJJA 1XIJA 3KBJA 3DBNA 3DX5A 2NQJA 1A0DA 2GUBA 4X63A 2Q02A 4YTQA 3M0HA 3CQIA 2J6VA 4XISA 1BXBA 4EACA 7XIMA 5EMKA 3VNIA 3TVAA 5TNVA 1S5MA 2XINA 1XIHA 5B80A 1K77A 5AVHA 1XLMA
chains in the Genus database with same CATH superfamily
2VUNA 4O0QA 3F1QA 3NGFA 2PGFA 3ES8A 3IJ8A 1VBJA 1IEIA 2FH8A 4ML4A 2C16A 4S3EA 3GYCA 4I5UA 5JH2A 2E77A 3MP3A 3FGCA 2JGQA 4PMQA 4UFMA 1J8VA 2XG9A 1E3XA 3P61A 4HNUA 1M6JA 3E49A 1C91A 2ZADA 3AZSA 3WQVA 2VNCA 1R9YA 1GZJA 4KPLA 1P0DA 3LPOA 4I5RA 3BJSA 1XS2A 3UXIA 3TCSA 1UH4A 1VHNA 3PSVA 4AVNA 4JTSA 3T40A 3GQYA 4R27A 3LDVA 4U4MA 3FNDA 1KLZA 3DKLA 1KFLA 3Q37A 2WW5A 3RMJA 2R6OA 4XG1A 3GTNA 1G7UA 3VU2A 5FD0A 4EK7A 3QJAA 1OHLA 1F3XA 2OO6A 2MNRA 1J2WA 3W88A 4UOQA 4LS1A 1QDSA 3LN3A 2ACSA 5FOOA 5AYBA 2VX6A 4QLKA 1XRSA 2NLIA 2OZ8A 3UZXA 1GVFA 3DFNA 1J0HA 5CPMA 1TWWA 2YW4A 4Y7EA 2WSPA 4LQ1A 1OGBA 5EB8A 2X1SA 2WC7A 3EMQA 1GG1A 3QLLA 3BAWA 1S5VA 1UIPA 4DUWA 2DT1A 3ZXWA 4O16A 6REQB 3GX9A 1OT1A 3K4AA 4MAZA 3C8NA 1H5VA 4DJFC 3IVTA 3WK2A 4X0VA 2Z6IA 5D09A 1GQLA 3W1UA 1WDPA 2J6XA 3SUVA 4AAJA 2YDQA 4H9ZA 4NYYA 3BW3A 3FIGA 3ZR4A 2B7OA 4E6MA 2A3EA 2PRMA 3VILA 1W17A 3PNZA 5AC8A 1UWIA 1F07A 1GJWA 4HPNA 2CZVA 1RD5A 2QCDB 3REQA 3NSMA 3BMWA 5HK4A 4PRRA 1ZENA 4E8DA 3W26A 5ABEA 4J2MA 3BAXA 3PJTA 3RM8A 1JGIA 3W1QA 4AVFA 1HJQA 2P8BA 2VQTA 5FA5A 3GTIA 2EG7A 2A7NA 2Q8XA 2Q6ZA 2C91A 1A5LC 5HR6A 5C0QA 4POCA 2J7CA 1JRCA 4FF7A 4XISA 4NJJA 4HMEA 3HF3A 3BW4A 1UROA 4HHMA 1W1TA 4OT7A 2W3ZA 3INPA 4O0ZA 2NVDA 4IPNB 3B9EA 1HKJA 3CT7A 2TYSA 3C52A 4WKHA 4XD6A 5CJMA 2HJPA 3C6CA 5DANA 2OOFA 1OX5A 5HATA 4QNWA 1XPYA 3WCZA 5M03A 2PTXA 3GXMA 4DJDD 2QKFA 1XL9A 4ZOBA 2NT1A 4QS5A 1KCXA 3FN9A 1KCLA 4MY9A 3VIKA 8CGTA 3LM7A 3VDHA 4LVBA 4RZBA 2ZVRA 3DC0A 1X1ZA 3RPMA 2EGZA 1F73A 1KQYA 5CSYA 1W3LA 2EQDA 3MKCA 1O66A 4ZE5A 5MF5A 1MRQA 1TKKA 4KWUA 1K9FA 3GC2A 1GW1A 1Q6OA 4AFYA 1RK5A 1PWMA 3IUDA 5A8NA 1UYQA 1PHWA 1F3WA 3RJYA 1LYXA 2OEJA 4GIYA 2QDHA 1K02A 6TAAA 3N2TA 4HA0A 3GC5A 5AHEA 1TVPA 3QPZA 1EC9A 5AYZA 1R2RA 2DT0A 1Y5VA 1RY8A 2I5IA 4S3FA 4UIOA 1H61A 1UD6A 3VD7A 1FX6A 2V2CA 3N11A 2F9RA 1OB0A 3RIKA 3WQ8A 1WX0A 3EOEA 3B03A 1XIIA 4J3WA 2GOKA 1XBZA 1SW0A 2OLHA 5K9CA 5CPNA 4YYFA 3VMOA 1EIXA 2V81A 2OT0A 4GX8A 5CPQA 3UPBA 1OT2A 5D03A 1QOPA 2ISVA 1AJ0A 2PFHA 4FF5A 2OB3A 4D8LA 1RQEA 3THUA 2QGYA 1E0XA 2J7GA 5D30A 3SJ3A 3M0VA 4L1WA 3LS9A 3QR1A 4RE0A 3RK8A 3QSTA 5HUOA 1XGDA 4TOQA 5CGTA 3BG5A 1MQPA 3JR2A 3FA4A 2EG8A 1F4HA 2QJMA 4X2PA 1E6RA 2D23A 3K8KA 1R9ZA 2VUYA 3K8LA 3GKFA 1QK2A 4IFKA 3SRDA 4DJDA 4RE2A 2FGBA 1EBGA 4WJ8A 5I3HA 1YE6A 3D5HA 4U33A 1XQLA 1Q4NX 1J4EA 4DAIA 2O7SA 2V3GA 5J8LA 2FVMA 3GXTA 1VCVA 1GVIA 2A3LA 1UUQA 1VAHA 1BYDA 4CCZA 3VOGA 1CPUA 2XDFA 4CD5A 1QVBA 3WG6A 5DQPA 1KRBC 2OZ3A 3USBA 3P60A 1LWIA 1EPVA 3NXFA 4K38A 3HQPA 3N2CA 1QI2A 4YWIA 1WZKA 3FV9A 1RPXA 1UOZA 2JIEA 1CLKA 1GYMA 5EMMA 3LCIA 3QTPA 3KRZA 1DXIA 3MVIA 4UR9A 3STPA 3TA9A 3GAYA 3K5XA 4KEVA 2EF9A 5G2IA 3GTXA 3WJWA 1EJSC 2BX7A 4CD8A 4BI7A 3PSWA 5CSRA 3WEZA 3KOFA 1VFHA 2NV2A 2PPGA 1LWHA 4JL2A 1HIZA 4MUZA 3OLEA 3MSGA 4UTWC 4AF0B 4IQEA 1OVDA 3LHYA 4N9EA 1O68A 1T6MA 4KCTA 2AMXA 4GVIA 5LNVA 3T07A 3TFXA 4QSFA 1F3TA 2W9MA 2XM1A 3SN0A 1Z41A 1WBJA 2TAAA 1BVNP 5AN7A 1EHAA 3M5YA 4Q8MA 3KDOA 3UPMA 4LAMA 2WZTA 4XX6A 2CLOA 3LHVA 1VS1A 2YDAA 1FWAC 3AO0A 3MA8A 5BMWA 1W5OA 3W1LA 4Y90A 7REQB 4UTIA 5A6MA 4KGJA 1MUMA 4GRSA 4DUXA 4C6LA 4DZ5A 2J8GA 4FNPA 1JZ4A 3DX5A 2HZGA 3CUGA 4X63A 4BK9A 3WK3A 3VPLA 2BLEA 3UNTA 5I3JA 4AYSA 4RV8A 4HGXA 5TF0A 4HOZA 3U48A 4GACA 4H19A 3WF2A 4XD3A 4AIEA 1WV2A 3AS1A 1WOAA 3DHPA 1HF6A 1ODUA 3QY8A 3VABA 1PTAA 3NL6A 4CN4A 4UTMA 3CPRA 2Y5JA 3IUIA 3DFTA 3A9IA 1DL3A 1DJGA 1BRLA 3I3EA 5LA2A 3OGSA 1XX1A 4O1CA 1DKWA 1UUMA 1IWPA 4F2BA 5AYIA 1Q6EA 1SZFA 2QV4A 3A3XA 4MJ2A 4AWEA 4YU1A 3KE0A 3BGJA 4K8EA 3BTNA 4RUBA 3NYZA 3DBPA 4HA4A 5AYYA 3QY6A 3N3TA 1NH6A 3CLWA 1UC5A 4QE5A 2ZXDA 2VRQA 4NG3A 1EBHA 5I3DA 1S2AA 5CC5A 4JNMA 4A3UA 1JL8A 1PDYA 4Q4PA 1UBPC 1TJRA 1R3VA 1WOBA 4NT0A 4KCVA 3G1VA 1HW6A 1ZJIA 4NVTA 1AK5A 1YTKA 2NUWA 4UTJA 3PUEA 4H1ZA 4ZO9A 1OQFA 4ONVA 4R33A 4BF7A 2HPMA 2EPKX 3M44A 1I6NA 3LBCA 3VGDA 4ZOAA 1E4LA 1VYRA 3UA4A 1JCTA 3AIRA 4JQ3A 1VYPX 4W8LA 5EA9A 3BV4A 5KZEA 5TNVA 1EL3A 7PTDA 1V6UA 1WXYA 2F38A 5CH9A 1W5NA 4JFUA 2W91A 1QNVA 2BHZA 2W79A 5IDIA 4OU1A 1Z42A 2VMFA 3B3DA 5IBXC 5HJLA 1WA3A 4B4FA 5HDRA 3BZJA 1KLYA 3ZIZA 3RCMA 3ZJ6A 5U4NA 3VOJA 3VE7A 3G1FA 5CPOA 3F5KA 3UVIA 3IIXA 1JZ2A 4D71A 2OX1A 4Y9MA 3AZTA 4F0SA 1GVYA 4PTMA 4G1KA 1B3ZA 3FYYA 3HPFA 3VOCA 5GVJA 1O1ZA 2PWDA 4DF2A 3PBYA 4RNJA 1US2A 3N9RA 3VNKA 5HOSA 5A6AA 2Z1VA 2BOFX 4KW2A 1IGSA 2NW0A 3OB8A 4Q8WA 4XUYA 4AQLA 2YFOA 4BJHA 2ZUTA 4DWSC 3OQEA 4UCGA 3LTSA 3CAQA 1EPXA 1X38A 3NCOA 1NF0A 2HMCA 4GZIA 1J11A 4ZO8A 3SRFA 1RSCA 1JXKA 4TO8A 1QJWA 3ZJ8A 2WVVA 3NZRA 3L4VA 3APTA 3AQUA 1EDTA 3H12A 2VRJA 4W85A 2XH4A 3LD5A 1P6WA 2PRHA 4R7WA 4LALA 3BSMA 4WXYA 5JH1A 4NHVA 1VBGA 4KRTA 1H4PA 4QJ5B 4QLJA 2RJHA 3S0CA 2E9BA 2G50A 1EXBA 2XM2A 3H55A 1CB7B 3VCNA 1Q65A 4AZ6A 1QPRA 4DI9A 3FVDA 1EEPA 1QTWA 3AS3A 1S46A 2BODX 4YCOA 1DWFM 1J79A 1YNPA 2O9RA 4MWAB 1G94A 3UR7A 4CCEA 3LPFA 3SCPA 4KRUA 1QI3A 4NI3A 2R82A 2GVEA 2DZUA 5F1VA 1MQQA 3IK4A 1HG3A 4HTBA 3HFYA 4JAWA 3B4YA 3KXQA 1N82A 4HMDA 2D2OA 5K9XA 2Q71A 2W67A 4LC8A 3FCPA 3DECA 3PC0A 4FLRA 1EQCA 2X05A 2GVLA 3RLHA 2EKCA 3ZWTA 3NG3A 3U9IA 3VX0A 4MNMA 3O15A 5CZ0A 1FQ0A 3DYOA 1GOWA 1VPYA 4ZXLA 2GJNA 3OZOA 4CNUA 4N02A 2EHHA 2OKTA 1H5YA 2G97A 3VA8A 5LIUX 3H4GA 4HNVA 3EB3A 4TTGA 1IZCA 4WF7A 2DSKA 1GWJA 5CBIA 4ZL1A 4J35A 5DX7A 3VI2A 3VOFA 1W3TA 1FWCC 4PRTA 3GVWA 2XGIA 1AA1B 1XINA 5REQA 2Z0IA 3SN1A 4E0CA 2R1LA 2GDQA 4B2DD 3TAKA 3PTKA 5BCAA 1GHRA 3SJNA 3SO7A 1FHLA 1HZYA 1T99A 2I56A 4O1BA 2P76A 1YBQA 4AMAA 1UP2A 3KFTA 1R85A 3B8IA 1FP9A 2RJGA 1G69A 2PD9A 4B5NA 3E0LA 4K6AA 4G56A 5EMUA 1X39A 1P6CA 4C1NB 1TCMA 2YYUA 1W9DM 2GVYA 3IARA 4I5XA 4QBXA 3CAVA 5T26A 2R1PA 1XLFA 4LVAA 3UCQA 4GFIA 4XVEA 1ZBWA 3QGAC 3S1WA 1OABA 2NX9A 4QG8A 3IJ9A 3FY1A 3N2BA 4YS1A 5DT7A 1EJWC 4HN8A 2UV8G 2FPYA 1A80A 3GH4A 1UD3A 3WJXA 1LL4A 1VLIA 4HPJA 3NYDA 5DY2A 2HNEA 1J5TA 1ZCOA 1UC4A 2E9LA 1ELSA 1M1BA 1T41A 3FAWA 4UBPC 2BBFA 4O4WA 4I3GA 1BHGA 1I2PA 4UQBA 1IYXA 2XU2A 4WK9A 3H4XA 3HJEA 4HA3A 4M3PA 3HV9A 3ECQA 4RL3A 3A4XA 4LAKA 3IIOA 4S3JA 2OSXA 1IT7A 4HK6A 2L5HA 4BS0A 1Q3NA 4YIWA 1EXPA 4JIIX 1E40A 3C0JA 2F6UA 2EAWA 2DZPA 2X41A 2ZZ7A 3S1VA 2OWWA 3VNDA 2ACUA 3TN6A 1CYGA 4H6EA 3ARRA 3B8VA 1LUCB 5A95A 3FKKA 1PYFA 1A53A 2VVNA 3E74A 3HM7A 2FDSA 2IQ0A 4IMCA 6CGTA 4MDPA 4MM1A 1CIUA 2PDMA 5HINA 4WQ6A 4HQVA 3VMPA 3F5LA 1XRTA 3RR1A 9CGTA 2E5BA 3CH9A 4UFLA 5IM51 4RNFA 5E09A 4MNLA 1UZ1A 4CNSA 7TIMA 5HUPA 3E1F1 1UUOA 3CHFA 1HJSA 2YCLB 2F7FA 3G1XA 3EPMA 1QAPA 3FVMA 3MC5A 3IGXA 3WDQA 3W29A 2ZXQA 2XIJA 1LROA 4QCEA 1MXDA 3CQHA 5T8GA 1EO5A 1TJ0A 2O56A 1PSCA 5DBUA 3CHDA 4JN8A 1K03A 3CH0A 3EXTA 4AW7A 1UR3M 5KITA 3QQWA 2YOCA 1R86A 4ZQPA 3NQVA 2B7PA 3G5EA 2H8XA 4B90A 3KHJA 1X1OA 2EPNA 1UKTA 4JGDA 4NZ5A 1PX4A 1ZZMA 3DFHA 4MJZA 3ZSTA 5BOFA 3ONBA 4O11A 2PZNA 1YKWA 6PTDA 2E25A 3A5FA 3DGBA 2BMBA 1F76A 3FYOA 1MWOA 4CQ8A 3LQGA 1RZMA 2V0TA 4AY1A 4WX2A 2JBMA 4NY2A 3H22A 2OLSA 2VEFA 2DW7A 3NFUA 4O14A 2ZZ4A 3C2OA 2QQ6A 1DWAM 1O12A 5CEWA 4H4IA 4C7GA 2NV9A 3W70A 3PBMA 2RFGA 4FMVA 1MRAA 1TQXA 4XZBA 3RLVA 3DGRA 4PZVA 9RUBA 5HNTA 5F7UA 5CZKA 3NJ3A 2DDXA 4IIEA 1E5JA 1VBRA 2OQHA 4Y6GA 1M9HA 3B05A 4ATLA 3A3WA 3W83A 2PF8A 4HZMA 1SFLA 4JFWA 1GEHA 2XZ7A 2QCFA 5FAJA 1C8VA 1EC7A 3TC6A 1CW2A 3MT1A 3TYCA 1RBOB 2CLLA 1CENA 4EXBA 1IXNA 3GBEA 2QJIA 2XPKA 1S3TC 1UD5A 4TTUA 5AKQA 1LG2A 4UFKA 4FP1A 4WSKA 3PPCA 3VDAA 4U3CA 5C5YA 1T0OA 4B9ZA 2E0PA 1O95A 3RNDA 1MFVA 4AZHA 1EGZA 2VZOA 2YIHA 5DELA 4DJDC 1W1YA 2VP8A 1A5CA 5TD4A 3V1PA 1R3YA 4ZQOA 1NF7A 4D8AA 2DZXA 4J3VA 1M03A 3UXDA 4N6EA 1IWBA 1TX0A 5CPLA 2D69A 4ZB5A 2XFWA 3EDEA 4XVDA 1P0EA 3RLGA 3S8HA 2BTMA 4C6DA 3VUSA 4QDMA 1Q5MA 2CZFA 1W3HA 3L65A 3EYPA 3W75A 3IJDA 1MFUA 3KTXA 3LX9A 1Q2RA 1DIKA 4XTDA 2V9DA 4C91A 3TOYA 2V38A 3MUY1 5E70A 3BSHA 2UY5A 1D8CA 1HJXA 2Z2UA 1XGZA 3T7VA 2OXNA 1M04A 5HMFA 3STGA 1BVWA 4Y96A 3LA4A 1V7YA 4QTGA 3LSCA 4PTNA 3N14A 3APYA 4W84A 1OBAA 4Q4KA 3A24A 1OGSA 5I7GA 1NDZA 3C3NA 3GIYA 3OGRA 2WPGA 2UY3A 4Q8VA 3C2VA 4J1OA 5LZLA 1B3XA 1QNPA 1XKJA 1XLHA 3MUXA 4U5KA 3VYLA 1VEMA 2ABAA 3NXLA 3R6IA 3CV6A 2INZA 3ARPA 1OZMA 3TK7A 3MP4A 4YYCA 1E4NA 1FCBA 4GK8A 4PTWA 5G1TA 3BOFA 5BROA 1NAL1 3BO9A 3QMSA 4CCCA 1Z32X 3BSGA 4PUEA 5DRIA 1J96A 3VK5A 1DPMA 2WPBA 4RZ5A 1UH3A 1W37A 1K7XA 3TC3A 1M7JA 1S2WA 1EA9C 3FDKA 3ARZA 3GH7A 3NM3A 3F2CA 4MB3A 3E12A 9XIMA 1HO4A 3HGOA 4HHLA 4CGTA 3DERA 4H7ZA 1I2OA 3M6YA 3QFEA 4R7JA 4OVXA 3FAXA 3BDKA 1ODZA 3DENA 1OC5A 4MSSA 3PBWA 4GUHA 1H41A 3B97A 3G22A 4AD1A 1PS9A 4ZFMA 3HA1A 3FA5A 1FRBA 4KS0A 4FX6M 4RNHA 5CXPA 4US5D 2AAMA 3G0SA 4NAEA 3LXCA 4Z08A 1OCQA 1W54A 3KRUA 5FEXA 4DWSB 1S2UA 4KBXA 1S5NA 2C14A 3LRMA 1M65A 3M0IA 1DE6A 3CYVA 2NV1A 1VIZA 3NUKA 1B9ZA 1A5MC 1R87A 3V7PA 3LM3A 4NZCA 4LF1A 4PCTA 4UQ9A 3WD1A 2BVWA 3B0PA 5J5DA 4Z1YA 3FX4A 3FW6A 3SUSA 3POCA 4D6FA 3LCGA 2V63A 4ICNA 4F2TA 4H41A 1SJCA 3W73A 4BKNA 1E1CB 3VZZA 3S1XA 3MQTA 1W1PA 4AB4A 4F0LA 4K39A 4A8IA 4KIRA 5KETA 1V3HA 4L6HA 4QXIA 4CNNA 1NWTA 3NQEA 4I90A 1ZUAX 1DJWA 4EXQA 1VP5A 1KGXA 2PDBA 3DC8A 3CUJA 3O0KA 3WMCA 1JDFA 4GVFA 3E5PA 1EIBA 2PI6A 3QN3A 1JFXA 4OBSA 4GWEA 1HO1A 3LXAA 4WJEA 4WJXA 3SCNA 4HCHA 1J93A 2ZX5A 4M6VA 4X9SA 4WEVX 3UESA 1UR1A 4LC6A 3VIJA 2CBJA 3MU7A 2YL8A 1VC4A 5EKYA 4O19A 3C86A 2BY3A 2JFEX 1SZEA 5I02A 2PDCA 3EWZA 3ZT6A 3ZOAA 3IAQA 1EOKA 1TPVA 1BYAA 1TV8A 3IAPA 2FB3A 3TW9A 1I8JA 3UJEA 1AQFA 3P84A 4L4OA 3QQ0A 1J18A 3O0FA 1X8CA 4A3HA 2Y85A 4LY8A 4WKAA 2JKEA 3RRXA 3MSDA 5C55A 3MJMA 4PTXA 5FF2A 1A0EA 1TYGA 2Y7GA 1ENUA 2VM8A 3MUZ1 3RX3A 1EGVA 4HYRA 2I57A 4Y8EA 1J5SA 1XSJA 4NRSA 3R89A 2H6RA 1XBYA 3CWOX 4US5A 1TR9A 4GJJA 1XIJA 4G6CA 2GUBA 3EOSA 4X22A 1CZ1A 2P0IA 2V5DA 4UTTA 4TV5A 3PFMA 4UQDA 3B8DA 4GGHA 1SR0A 3KBWA 1RD6A 5AC7A 3VIHA 1OF8A 3IGHX 4B5WA 3FEMA 4BY3A 1RCOB 2WNNA 4GY7A 4HNTA 1UHVA 1OCNA 1JDAA 4LWWA 3TYBA 1OF6A 3PAJA 1WZAA 2WKGA 2ZWYA 2QULA 4HYVA 1UR8A 3W74A 1GJPA 2IKIA 5D04C 1CTNA 4E4UA 2X40A 5FJUA 4PMJA 5BU6A 3R5EA 3P67A 2D24A 4HVXA 2O4QA 1M41A 3EWUA 1GZ1A 3ZVHA 3Q94A 5JBEA 3CHVA 3LGDA 4IOTA 4PFHA 1VF8A 2GJXB 1W91A 1Q6FA 4YVVA 4IX0A 1A47A 1YNQA 2J7HA 3R79A 4GJIA 5F2LA 4UWMA 1KWGA 1YMYA 4KF1A 3GIQA 3MCNA 2PDXA 2FZBA 2J25A 3GVQA 4RR4A 3NEVA 2BZNA 5ABTA 6REQA 5DCEA 2WMHA 5G1MA 4MNKA 3SRHA 4LOCA 4LAUA 1DJNA 3AYVA 2WMGA 1MO0A 4NAFB 1ADSA 1X6UA 4DPQA 2WKJA 5HBFA 3ZJ7A 3CO4A 4WCJA 1SR9A 1SW3A 4C5YA 1S5TA 8TIMA 2BGQA 4EX4A 3FJ6A 3B8UA 1REQA 3GC4A 3VDBA 2QCDA 2VHLA 2YXXA 3A21A 3LZ5A 3AU6A 1AL7A 1ZFJA 2R94A 1TPEA 1X98A 3WFAA 4RW3A 1GOKA 3EKZA 4REQB 2IPFA 1KXHA 2XWEA 3KL3A 5A8GA 1GNXA 2VCCA 4HMNA 1PZ1A 1MI3A 3KRBA 2EO7A 4XO7A 3OBKA 3UZYA 1EYWA 4J3SA 2CBVA 3PANA 5D9MA 5CPSA 2GK1A 2ZBTA 4M19A 3W7JA 5HA7A 5KZDA 2MUCA 1RH9A 4DM1A 1DJQA 3RF9A 1KFKA 1GQNA 2XN0A 3W7HA 5EBAA 3FYPA 1GZGA 2DIJA 1QOXA 1OYAA 4ADUA 1BGGA 5ECUA 1JF6A 3WN6A 5C2GA 3K4WA 1HL2A 1D3GA 4OUIA 3EWDA 3SIMA 2EPHA 4U31A 4J40A 2VFFA 4CUCA 2WB5A 4P7OA 3CUZA 1LZOA 3P2VA 4M56A 1XLDA 3CUXA 4X60A 2ISDA 4KMQA 4DIAA 3R1ZA 3Q4DA 2CEQA 4NSBA 4K8GA 4AWTA 4P2VA 1NWRA 1UBSA 1T8QA 2G3FA 1EJVC 3AHTA 4DF1A 3OG2A 2DZAA 3G3MA 4H2CA 1LORA 3KBNA 1W1VA 2J4GA 5C70A 2OQLA 1BYCA 2YX0A 1Y5WA 3WD0A 3VDGA 1E1EA 4Q8TA 4GABA 2ISWA 2XTKA 2CLHA 3KBSA 1JZ8A 3BZGA 1EF3A 1C9WA 3VGBA 2A0NA 1OADA 2G4JA 1O60A 3LOTA 4WLCA 3UJRA 3VVGA 1H7OA 2ON3A 2H9AB 2DPEA 1XUUA 5DEZA 4MAVA 1TSIA 3ZT5A 6ENLA 3WYZA 2CLMA 3VD4A 2QEZA 1G01A 1QBAA 1PDZA 5CC6A 3UXAA 3CUHA 1CGUA 3OZPA 2FHBA 3M0XA 3B06A 1TPC1 3GO2A 2GOUA 5F4XA 2WCAA 2I5GA 1LP6A 1JCLA 2HTMA 4K68A 3M16A 1VPQA 3I7QA 4LFYA 4HOWA 1IF2A 1A5BA 1A4MA 1DXEA 2V5BA 2ZFAA 3UWYA 5EFDA 3W01A 1FWBC 2A3CA 3SQLA 3TQPA 1M68A 2YDRA 3NA8A 2AMGA 3CIVA 3HG4A 4AD5A 4BHYA 3N9KA 2I14A 5LXEA 1G9HA 4NKCA 2XFYA 3ARSA 5ABGA 1Q6LA 1TTPA 3ITXA 4MIMA 4NNAA 2CCRA 3ITVA 4LAZA 2IQTA 1DQXA 1XH1A 3L67A 5HWJA 1XIMA 4ZB2A 3VC6A 2WWDA 3W7NA 2E7FA 4OOZA 2PLMA 3N12A 4DO6A 2QS8A 5K3VA 3XISA 5H2ZA 3C2FA 3ELFA 1PKMA 3NVTA 5I77A 1XF0A 2Y8KA 3RR4A 1ISXA 2OKOA 3AS2A 1GVRA 4QEHA 3EA3A 1NOUA 2YBVA 4JIHA 2JALA 4JKMA 3BLEA 1CCWB 4CN6A 1YTEA 2XN2A 4LUIA 2YXGA 5TBOA 1S5WA 4IQJA 4GFSA 4NJHA 4JX4A 5DCBA 1TMHA 1UWUA 4GYFA 5IOBA 4OJYA 4YWSA 2E4TA 4FB7A 2QF8A 1HJWA 1UIOA 4XUGA 3WH8A 1HXJA 3GG0A 1KTCA 2CLPA 2PCQA 4E2DA 4AF0A 5F4WA 2NVCA 2G3NA 3B0YA 3GDTA 1E6ZA 2JK2A 4JFVA 4NZ4A 1KCKA 4F79A 4AZIA 4IQLA 4UOJA 3MHFA 3RGTA 3FJ4A 4O17A 5AVHA 3PWGA 3BANA 1VBUA 1E9LA 1LLWA 1HT6A 3K13A 1ZY9A 2NWSA 2IQDA 4LH8A 4N9BA 3B0VC 3WL1A 3OBAA 2Q8LA 2FPVA 2CXEA 2QCLA 4FHAA 2CFFA 2E8ZA 5A6SA 1GOXA 1ISVA 4D1JA 3BAIA 4GNVA 3WKZA 7REQA 4OBTA 2E6YA 4PUUA 1YHTA 4Y9NA 1NM9A 4O1DA 3U2ZA 3SCTA 2REQB 2X1UA 2ZE3A 4ADSA 1LL6A 3QC0A 4XQ6A 1R9XA 2GQ3A 3WK1A 1UWRA 2DVXA 4E4PA 3NURA 4CN1A 5HWMA 2C8NA 1DWGM 1EA0A 2PBGA 2Q8ZA 3FA3A 2WJEA 4Q4QA 4PBGA 3RRAA 3PS7A 3E2RA 1K6WA 4S1FA 2J74A 4IMGA 4LY4A 3LNMA 2VENA 4F0HA 3ITLA 4MKNA 1HL8A 3ZS4A 1L9WA 2QUMA 4XBSA 3R0KA 3GVRA 2YLAA 2NX3A 1TPUA 3KS6A 2PDHA 4K3ZA 4FXFA 3I3BA 4K7VA 1BLIA 3VDCA 4DEFA 1G4PA 1HKMA 3IEBA 2WVTA 1UWTA 4H9UA 1JZ5A 4XSLA 3FSUA 1BG9A 3AMLA 1G6CA 4BQ4A 3CZKA 3GIPA 4ROPA 4PA8A 5FF7A 1CXKA 3ZO9A 1SYTA 3ATYA 5ABHA 1EYEA 4DYKA 1QWKA 2VFDA 4LSBA 4RJEA 2Z28A 3T4CA 4IX2A 3PP7A 2QUTA 4N2YA 3GHTA 4QE4A 3PY2A 3HZ3A 4TR9A 4M51A 2BWGA 2RDUA 3WUBA 2WJZA 4GQGA 3TTSA 1ZP4A 3MKKA 4JFTA 4NQ1A 3WNMA 3R2GA 1WKEA 2XVLA 4HSHA 2O9PA 4U3AA 3CB3A 4W8AA 4TVDA 4D6EA 1QCWA 5HAOA 5L6UA 1JYXA 3NTYA 5BNKA 1QBBA 4JTIA 3BLKA 3E2SA 1VFOA 4RXFA 1JUEA 4B91A 2ZCGA 3KOYA 3WY1A 9XIAA 3CGTA 2IW0A 3FHAA 3R0UA 1V51A 1OYCA 2WNWA 1OD0A 4WD0A 1F3EA 2ZYFA 2WZMA 4HU4A 4V2XA 3IV3A 4DZHA 4KT2A 1BD0A 2DP3A 1BKSA 2VYOA 3P0WA 2V2DA 2J8TA 4OQVA 5D37A 1BWVA 4UB9A 2Q3RA 1OIFA 2GVJA 3HMJG 2V8ZA 3ZLGA 3KAOA 1LQ0A 2W92A 1EZ2A 2P3ZA 1KGWA 2R1NA 2QUUA 4Q22A 2INFA 1AUSL 1FWNA 3O8AA 2FIQA 3L4XA 2XSXA 4C6EA 3KOZA 4RCXA 3TOPA 2C7FA 4O53A 4DBUA 3AXKA 2PDUA 4GI4A 2ZICA 4QDPA 2WSRA 5IDZA 1G4EA 1H0GA 1OWQA 4FOKA 4ZODA 1NELA 4K8HA 3SFWA 1K70A 3PTMA 1J01A 3W37A 2OPJA 3TP4A 5LNRA 2V69A 2ZQ0A 1R3QA 3ANUA 3MI6A 3NQAA 4L4MA 2W61A 4AX7A 3VNMA 1MW1A 1LBLA 1WKFA 2J24A 2WK2A 4KWOA 2QNEA 4PUMA 2P5NA 3V5FA 3ZFHA 4YNGA 4BA0A 3GXPA 5AHLA 2FYMA 3CU2A 5LNWA 4MWAA 2PDQA 2D1ZA 3CBWA 1LOQA 1V0NA 4B15A 4RNIA 1VEOA 2FTPA 4OOUA 4L64A 1ONRA 5EMKA 4I9JA 3W2NA 3IGUA 4ZGYA 1HUVA 4CLMA 2HXUA 3S1UA 4IT1A 2CWXA 1F6KA 1JULA 1E6XM 4MB4A 4GLEA 4IFRA 3NO3A 1K9TA 1FHUA 2VR2A 3BLPX 2WZHA 3DEQA 4AEFA 1J6PA 4MNJA 5D33A 3TQVA 1H2JA 1A3HA 1C92A 2UWFA 4NZ3A 3PZMA 4UTTC 3WJZA 1XICA 1ZJBA 3PG8A 1TPWA 2YCEA 1VB9A 2Z1BA 4EXAA 4QQUA 3SN4A 3SB0A 4JQAA 1Q45A 2ZC1A 1FWWA 4LBSA 1PTGA 3LUTA 4LUTB 2H8ZA 3CL7A 2BVTA 3URAA 1WAUA 1FOBA 1XI3A 1TIMA 4LANA 3EWXA 1OFAA 4IG2B 3N6QA 4H9YA 3WBEA 1PX3A 2X7WA 1Y5XA 4DYEA 2VURA 3KBVA 4JN6A 3TR2A 3CUFA 2X2GA 3WQPA 3I6TA 4JTJA 4ORMA 4C1NA 5T91A 4LUYA 1CGYA 3PM6A 1Y8BA 2Z1WA 3TNOA 4QITA 4KEZA 2EEXA 4D6HA 7ENLA 2I17A 3WJYA 3HPXA 4CVWA 3MI2A 2PE4A 3EGJA 3I6RA 3W1RA 2X8RA 3V16A 2ABBA 2ZXAA 5BWAA 4GIAA 3GU9A 2DORA 3VKCA 3SCUA 1B54A 2DH2A 4O15A 1KFBA 3LZ3A 3PBGA 4I7WA 1AJZA 5H91A 3W7CA 3MUIA 3KX6A 3PTDA 2VXNA 3GZ3A 1BAGA 3W7QA 2DV0A 1YTDA 4DUOA 3H2EA 4V33A 1EJ7L 3UP8A 3BAJA 1GGOA 1AD4A 2GWNA 4LCQA 5LIWX 1CECA 1QT1A 3KCOA 3OA5A 3EXSA 2G3MA 3M5XA 2QJJA 4JTAA 3O06A 1ESWA 1LUCA 1I2QA 2NXHA 3QVQA 4XIMA 3O6DA 5I09A 1LF1A 6ALDA 4Q8UA 4FNUA 3S5NA 2C19A 3L21A 3AXIA 4J5NA 2PGRA 1V8EA 1E71M 3DFSA 2DT3A 1EJTC 5H8MA 4HMCA 3M07A 2GGJA 4P8VA 1C90A 2ZA2A 4Q3MA 4K2SA 4WSHA 3ABRA 1KV5A 3CNYA 5G4EA 4BQ3A 1CLVA 4S38A 3LPPA 2PDKA 3JVAA 1AG1O 3W7PA 3W72A 2FKPA 3HGRA 4KETA 2DSVA 2AL2B 1UWSA 2YCLA 2HE5A 4NIRA 3R8RA 5DMMA 2ZRUA 3G18A 1W3KA 4I7VA 4B5VA 4W5ZA 4TU1A 2PMQA 1LRQA 3I6EA 4I9TA 2HK0A 4MZYA 1AW2A 4GQBA 3WQGA 4A05A 2V82A 5FI8A 3VIGA 4LNYA 1FHDA 3HB9A 1DTNA 3L2LA 4M7TA 3KVLA 2FZMA 4LTSA 5E0CA 3FSTA 3BG3A 3RXZA 3H2MA 4UMCA 3OVPA 1B4EA 1UG6A 2BXYA 4RPQA 1GVOA 4IIGA 4GHRA 3LBOA 1V3MA 1ZAJA 4DAFA 2HVMA 4NX0A 1XR2A 4C6IA 4RDYA 5GJMA 1X97A 1ZQ5A 3APGA 4WDWA 1LRNA 5E9XA 2C0AA 3N17A 3FFSA 2ZUWA 1GPFA 4DXKA 3SQMA 5LGXA 1DBTA 1E4IA 3TE9A 3QV7A 3MYOA 5FJPA 4ZSTA 3C2YA 5D9PA 3WQ6A 4LUSB 3PZQA 4LX4A 3NO1A 4GC4A 1M3UA 3BUVA 1B90A 4LRSA 3ENLA 4EVZA 3W22A 3FS2A 5T9CE 3LLXA 3MDWA 1XLAA 5H6HA 1TZZA 3P5YA 3PJWA 2WM1A 3PG9A 4AD0A 3ABSA 4H3DA 3RU6A 1V3KA 4ROQA 5CPTA 4GVHA 2FZNA 1ISYA 1KXVA 1D7KA 3CAKA 4D1IA 1V79A 3ARXA 5BRQA 4JCMA 3B9OA 1QU4A 3N73A 3AU2A 1U30A 3N15A 1EF2A 1XLCA 3DCPA 3P93A 4DVOA 3QW3A 4MJ4A 1NP0A 5I00A 2G37A 4S3BA 1DVJA 4I9AA 4TMCA 1JCNA 5CLTA 4MHBA 5EYWA 4GQQA 1AFSA 3QSRA 3S2JA 3WMLA 3DZ1A 4MDOA 3TLLA 2WHJA 4PMOA 2RAGA 2DUXA 1LCOA 3E5BA 1YXDA 3STCA 3SCSA 3GR7A 3M41A 4NXSA 1PKYA 2GWGA 3QZEA 2RDXA 4OTKA 2AAAA 4PB4A 2RDTA 1YPIA 3BCDA 3BLDA 4CQCA 1J2BA 2A2IA 4Z17A 1RA0A 4GO9A 3LY0A 1VFTA 3LV5A 3ABZA 1J12A 2WMFA 5AC6A 2Z29A 1K8XA 5A3HA 3ALGA 4IQDA 5IRPA 4NNBA 5D8ZA 5EL1A 3L66A 1H1ZA 2YFNA 4IMEA 3ZM8A 2CIPA 3AXMA 1F7BA 1HP5A 2GZXA 4BEUA 1EJRC 1LRTA 4BFAA 1UD2A 1LT8A 4DBSA 2OEKA 3QFWA 4MFDA 3GD6A 3FXYA 3KBJA 3PBVA 1JF5A 3DBNA 2C13A 3MP5A 3P62A 3T2OA 3LMYA 3ABOA 1XIHA 1YADA 1EEXA 1I4NA 2PCEA 2VD8A 1WUFA 4PMDA 4ERGA 2GVGA 2ZWZA 1VFUA 3NZQA 1A0CA 2BHYA 3GU1A 3OPSA 3QPYA 2QF7A 2CHNA 4CNTA 1W3IA 1OK4A 1V02E 5HMDA 4U10A 3IK2A 1FUYA 1G67A 1B2YA 3WD3A 3KLKA 4GE8A 3IJ6A 1ZCCA 3W84A 2JKPA 4A3RA 5I6SA 1UH2A 3QXBA 2CITA 3BLLA 4HJWA 3SCRA 4I8DA 4AY7A 1O4UA 4NJGA 5G5IA 5I79A 3CB8A 1JDCA 1C29A 1PZ3A 3KDNA 1NEYA 3IIZA 2KX9A 1UZHA 4MLJA 2UBPC 3PULA 4GBDA 1P0BA 5I0DA 2F8QA 4JTRA 3GBDA 3UY7A 4F4RA 3ABXA 1S2VA 4HZ7A 1AJ2A 5HMSA 3CEUA 3W2LA 1TO3A 1OK6A 5F2MA 1QNSA 2B81A 1F61A 3P5ZA 1B3VA 2F61A 1OG6A 3BWWA 2ZDRA 1KFEA 5HWNA 5ABFB 4JTCA 3O1NA 4P7RA 4NU7A 2OWXA 1V3LA 3U5UA 3MYPA 4N9DA 5CSUA 2J47A 2GPTA 1VGAA 4LBUA 2ODOA 4UZUA 4FR6A 5JVLA 2FGLA 5C7HA 3FJLA 1PZ0A 3AJXA 1Q7MA 4P5UA 1RBAA 1ITCA 4JBRA 1R0MA 1PB0A 2F84A 3NZGA 1WE5A 1PYMA 2JE8A 3F4VA 3BL3A 4DPPA 3JU2A 4P8WA 2BVDA 1H09A 1V6TA 4GY0A 3M7SA 3I7SA 1PV8A 4LT9A 2PA6A 4NI8A 2ZRWA 4IGHA 2QPSA 2CZ5A 3SY8A 4DO4A 3BK0A 3M0MA 2QIIA 1JI1A 1NSJA 3T42A 1MNSA 1E1CA 5I07A 2PDPA 3GFZA 4HZ8A 4F3HA 3H7UA 5FCZA 3E0WA 4O10A 5D38A 4DHGA 2DQWA 4GISA 2W0UA 3DESA 3ORWA 3S6DA 2PAJA 5H8UA 2TSYA 3NEHA 1JI2A 2J66A 2WOQA 3VGGA 2PDYA 3IVUA 2UY4A 4NILA 1K9EA 4P8XA 3U7BA 3S47A 3DG6A 3LXBA 3MO7A 4XD4A 6A3HA 4ZBCA 1J0ZA 1PIFA 3MKVA 2Z2AA 3H53A 4HNOA 3LPGA 2A7RA 4IF2A 3W2KA 2QCNA 7ODCA 1EO7A 1K7EA 1R8LA 2E3ZA 4XB3A 1JVNA 2XVGA 3UFYA 4FNTA 2PTYA 3A64A 2RH9A 3CJPA 3T9PA 3S2LA 1DJYA 1DIEA 1P7TA 1XFCA 1XIBA 1JGMA 2AKMA 3COTA 3GH5A 2J8FA 4D6DA 1XG4A 4CD4A 2WLYA 3LCFA 4M82A 1FCQA 2AOSA 2QPUA 4FK9A 3ATZA 1ICQA 3NQDA 3B9DA 3I4KA 1U2YA 4PCPA 1ML1A 1TG7A 2CZDA 3EOUA 4GYJA 1OX4B 3TROA 5LYRA 1XLKA 3S2MA 1EP2A 1MQRA 3SCOA 3WENA 4YLWA 2WHMA 3PZVA 3IIVA 1PUDA 4O8AA 4ZTYA 4PYSA 2WYSA 3A12A 4BWLA 4GOAA 1PBGA 3FDGA 2D3LA 1AD1A 1E4MM 1KM2A 4UQEA 1ALDA 2OJPA 1S1RA 3ARTA 3R7MA 4OECA 1QUMA 3W2JA 1KKRA 3EMCA 1PPIA 5BRBA 2XVNA 1B5TA 1KTBA 1OX6A 3EBVA 3ZVHB 2E6FA 3CZJA 3SECA 1MXGA 1C3FA 2GJXA 4MUPA 4K7YA 3SQSA 4UOZA 1XXXA 4PL1A 1NFPA 4OUEA 3G1RA 1AL8A 1Q6GA 3S1GA 4NF7A 5EGRA 4XAFA 1XDMA 1MEIA 3QHMA 3PN8A 1U5JA 2XUCA 1XRFA 3M1ZA 1VCFA 4NAFA 2YDSA 2DFAA 2QJGA 2QMKA 3D47A 4MWAC 3UCCA 3O05A 3BURA 4YL2A 2P1FA 4U2ZA 2CERA 1L6FA 1AZ1A 5AC4A 1H7WA 1E6SM 1REQB 1AW5A 4PMVA 1FWSA 4JFSA 4UXDA 3VD5A 2B31A 1DE5A 4QHRA 2FFIA 2FLIA 3WNLA 4ZQNA 2VWTA 4CU6A 4HCDA 4AYGA 4Q32A 4AMCA 4UTLA 3GDMA 3CASA 1W2PA 4REQA 3NDOA 1P1MA 5XIAA 1NVMA 5FJIA 1W31A 1ZAHA 4PTVA 3RO6A 1GK8A 4AZ5A 4ZCWA 1VEPA 2J9XA 3CZLA 3MBDA 5TQLA 4HU0A 3URBA 4GINA 2GK1B 3AZRA 2BY0A 3Q2DA 3GDRA 3HPAA 3GG7A 3P81A 1TCDA 2VELA 3C0QA 2QLYA 3FOKA 1UPMB 2QDGA 4FEZA 5E1QA 4PL2A 4WXZA 3TYUA 1F8IA 1H49A 3WH9A 3WD2A 2FZ9A 4QJ4B 1KM4A 1QWGA 1NOFA 2C3ZA 4TMBA 2X0HA 1SMAA 4Y9OA 5M2FX 3UWUA 1VFFA 1W5MA 3NNTA 3O2LA 3SR7A 4ES4A 2YA0A 1SJAA 2E28A 1NWSA 4AUBA 1E0WA 3AHYA 3GFYA 3VKKA 2P50A 4Z2KA 2QAPA 1RP9A 3IVSA 1K9DA 1FHVA 2CLKA 2WVSA 4FSAA 2P10A 3THDA 4V27A 4W7UA 4WRHA 1SO4A 1V08A 4MB5A 1PWLA 1POKA 5KSWA 2Y0FA 4ALDA 3AC0A 5AHMA 2LLEA 1UASA 3HV8A 3SZ8A 4C1LA 1CBGA 4L7ZA 4EWJA 1I75A 4UC5A 1W3JA 2NXGA 1Q66A 1XM3A 3PZIA 3NQBA 4QQ3A 5GJNA 1E6NA 2CBUA 3EDDA 5L9FA 3WEMA 3WQDA 3WMBA 2WM0A 1H50A 3AFBA 4NYUA 2ACRA 3OVQA 3TU9A 4ZTXA 2CBIA 1BXCA 2CKSA 1DIDA 1XYCA 2Z7GA 3W1PA 1A5KC 4CVUA 3RITA 1N8WA 1VRXA 3VOHA 1XWYA 2C79A 2BXZA 4PUDA 2QUVA 2H9AA 2Z1SA 1W56A 4GNKB 4WDXA 5DMLA 1IEWA 4S3KA 2ZTKA 2Y1HA 2PGEA 3OHIA 3CQIA 1FWIC 3IGSA 2I1OA 3RUBL 5JIWA 3OIHA 1D3CA 1XLMA 5KINA 1IIHA 4ZEPA 4DLFA 3HGJA 3THAA 3WQFA 1GVSA 3W53A 2X2YA 2FHCA 3F03K 3GWQA 2QGHA 3RHGA 1N7KA 4Q33A 3VKAA 3T0TA 4LNCA 3A6OA 3CZGA 1N8FA 3L5AA 3SBFA 3N2MA 4HU8A 4RV3A 3KL5A 2OMAA 1KR1A 4W88A 1I1XA 4Q7IA 2OZ0A 1Q85A 1AQ0A 2D2GA 4ZSUA 3QTGA 3IACA 4JQ4A 4O18A 2XFFA 3Q45A 1ITXA 2DU2A 4XV0A 2PC8A 4JOMA 3CQKA 4N6FA 5GJPA 1KM3A 3T44A 3ZWSA 4G2DA 2OWCA 3W7GA 2CLFA 4L80A 4G9PA 5GNXA 1JZ6A 2Z7KA 3E0FA 3MI3A 3BJFA 3M0ZA 5FEWA 5I3GA 3LLDA 3GW3A 2C1GA 4AD3A 4RZ6A 2VL4A 5F2GA 4ZR8A 2WC4A 2Z26A 2PWEA 2YYTA 2VFIA 2DSUA 4IGNA 4PUWA 1G0CA 3TV8A 2E9MA 2QJNA 1OFBA 4RDVA 1WO2A 1B3WA 3W7RA 2D22A 2OSYA 2E67A 1V7AA 3LBMA 3V5OA 5A6KA 1TR1A 2DSZA 4IGSA 1H1YA 3W3OA 4FPSA 5A8PA 4J3UA 3F7JA 1FA2A 4M29A 1FFRA 3JZUA 3WLRA 5FACA 1XLEA 1QASA 2QT3A 4RXGA 2QV5A 1JD7A 1EFZA 3D3FA 1YE4A 3CLMA 3QKEA 2I9EA 4UTUA 2PTDA 2SFPA 2VEGA 1HL9A 3T0AA 1NTHA 2QCGA 1TA3A 1NDVA 3V5CA 4ERIA 1JPDX 3BE7A 2XSAA 5PTDA 3EWYA 3MDUA 5D9NA 1GJUA 3VTRA 1MEHA 1Q63A 3G1HA 3K2GA 1CNVA 3SURA 1EX5A 4AISA 4AHOA 4TXEA 1QK0A 4DXVA 2CETA 2OYLA 4PCNA 4AG0A 2IKGA 4EPBC 5C9ZA 4K1GA 1FWHC 1RVKA 1R6WA 1S38A 3PNUA 2REQA 4CCDA 1HP4A 1JCXA 1WPCA 4KEMA 1RAKA 4L9YA 4QCFA 2D3NA 4UFHA 1ZP3A 1CX9A 1I2NA 4E38A 2WJDA 1XDJA 4WVXA 3W1MA 1AZ2A 4KGLA 4B3ZA 1Z48A 1JCMP 2PWUA 1J0JA 5DMYA 3NDZA 2B7QA 3DYMA 4EIVA 1E9ZB 5BXRA 3LHWA 3LCXA 3V36A 3W76A 2A5HA 4NJKA 3ZZ1A 1KRAC 1R38A 1KO0A 1T5AA 3QYSA 1GYNA 4N42A 2D2JA 2GYIA 3MO4A 2NZLA 4HBKA 1TV4A 3VC5A 3CQ0A 3DUGA 1YEYA 3E3HA 3BQ6A 3HG2A 3MZ2A 5IHSA 3MJYA 1ECEA 4ZENA 2P88A 1TWSA 1Z69A 1VHCA 3CV2A 4GI6A 2E68A 3L2IA 3F4DA 5CC7A 2QIWA 4HOXA 2QXWA 5HR7A 1UR0A 4BF5A 2OOGA 3UWWA 2EJ1A 2J9ZA 3EX1A 4Y8FA 3P82A 3GXIA 1BQGA 3OODA 4UNLA 1TRDA 3HGSA 1Q7QA 4FNSA 3QY7A 1US3A 4FIRA 1CEOA 3AYSA 4J28A 1PX8A 4YN5A 1QPKA 3GHUA 2J7EA 3QV9A 3AUOA 4E4FA 2PU1A 3LK6A 1TVLA 4GYKA 3RX2A 2E6DA 5K7JA 1H7NA 4N0RA 5KTLA 1FH8A 3HN3A 5JBFA 3GNPA 4IHCA 4OHQA 7XIMA 4XZHA 4R9OA 2ONEA 3QEZA 1E1FA 4IP4A 2QMJA 4OFCA 3CK5A 2A21A 2FPTA 4JEJA 5JIPA 1KTNA 2A1YA 1OCJA 1TUXA 3BCFA 4BCEA 2JIWA 1CLXA 1P0NA 3MTWA 3WDRA 1GPWA 1XRVA 2ZVIA 4X2RA 1ME7A 2ZUSA 1ZJAA 3NIYA 3WL0A 2QW5A 4H9XA 3G8RA 1FCUA 3GVVA 4DM2A 1QNRA 1FCVA 1UD8A 2V3FA 5BZAA 4XWUA 4P7NA 3W7IA 1N55A 3KZPA 2C1IA 2UZ9A 2PGWA 1ZSXA 1XLBA 1W8SA 3W7LA 1JCJA 2XIBA 3SAZA 4I6VA 3UG4A 3L23A 4MFEA 8XIMA 1ONEA 3BXWA 3A23A 1OG0A 3N04A 3G6LA 3VUPA 1KM5A 3I4EA 3O16A 1G1YA 1TE6A 4ML9A 4PB5A 4F0RA 4CQBA 1SFJA 1H3GA 2YSWA 1W1ZA 3R8GA 1A50A 4LS0A 4AC7C 1A5SA 3MANA 4I7UA 4JIPA 4L1GA 3S2NA 3MWAA 4DO5A 1V6VA 2NLYA 3OLGA 2EPLX 4WHBA 4UFIA 2XZ9A 5FEPA 3DHUA 3TEVA 1HNYA 1WZLA 4Z0JA 2Y2WA 4AZCB 1S5MA 2Y6ZA 3S5ZA 4XSMA 4EKJA 3IJ7A 2HK1A 4DZAA 2XH0A 1PJ9A 4YJ5A 4Z1AA 4HNLA 2VTFA 1E5NA 1JEZA 2ZRZA 3S5OA 4RW5A 2CU0A 1JCYA 1P0KA 2Y7DA 3K1DA 1RLDA 1JIBA 1XSKA 2WSQA 2HE8A 4JD4A 2VGBA 3W71A 3D46A 2YL5A 3WUEA 3AOFA 2PWHA 3S9YA 3BGGA 3S5SA 4LPCA 3NO5A 3WZ0E 1X96A 1BG4A 1SUXA 1TPB1 1W9XA 3AI0A 1F6PA 3R25A 2Z24A 1EWDA 1FDJA 1KBBA 3W7MA 3OW1A 1FTXA 2OT1A 3QHOA 1KRMA 4KFNA 2RKXA 4GYPA 5A6JA 3L9CA 1C9DA 1OFRA 5H1WA 4ERAA 2B4GA 4ZOEA 4AIOA 1LJYA 1B30A 3AIEA 3NPXA 3WH7A 1L8NA 4UR8A 1UA3A 4RDWA 3RO8A 2WHLA 5BW6A 3UGRA 2J7BA 2Z00A 2DIKA 3NSXA 3VD3A 1UP0A 1FKXA 1I2RA 4JIEA 3M47A 2BV9A 1WP6A 3NL3A 1RK6A 2POZA 3TKFA 3U4AA 1IEXA 2VQUA 4ACZB 2XVKA 3EDJA 1P5BA 3QGKC 4ZO6A 3EX2A 4LUTA 3S42A 3R43A 3USZA 1XH0A 4H9MA 4R3UA 3AMCA 1V3JA 4BWLC 1LQ2A 1Q8AA 4CQAA 3LGGA 4IG2A 3POHA 4HN4A 1KKOA 2IS7A 1YIXA 3UETA 1CXIA 3TC7A 4M6UA 4FX7A 4GJ1A 2QCMA 4CEUC 3MPGA 3G77A 2C1HA 1OFDA 2OYKA 4IUGA 4DNMA 3PB2A 1QHPA 3BW2A 2EPOA 3S2CA 1V0LA 1E55A 5I03A 3UBPC 1UJQA 4K37A 1QR7A 4GIEA 2X1TA 2V3EA 4LGXA 5JQ9A 3T0BA 1QMLA 5D9OA 4Q7NA 4M5PA 5CZJA 1XCWA 4PRWA 1W9PA 4IPJA 4JYFA 3WSUA 2GSHA 2DY3A 4X9YA 4B5SA 4LEQA 3UA3A 4PCFA 2WNZA 2PDWA 4F8XA 3HURA 3CEPA 4L9XA 5E6ZA 3H8AA 1CXEA 1XLIA 3OYZA 2QHAA 2DVTA 4CU7A 3T0DA 3OLIA 3W2UA 1LM1A 2OCZA 1YDYA 4MPKA 3RCYA 4J3ZA 4ILSA 1T40A 5D02A 3B04A 1EDGA 3MWCA 1Z3NA 1GOMA 1HJVA 3C2RA 2OG9A 4F48A 3EX6A 2I9UA 4N4QA 4DWDA 2PDJA 3UNDA 1D8WA 2P3EA 1MZHA 1VD6A 3DIPA 2VGGA 3PZUA 1MNZA 3GSMA 5BMXA 3WDIA 3WEOA 3WDHA 4XZLX 1H62A 1M01A 4Z2HA 4D2JA 2GDUA 3EOOA 3BICA 5IBXA 4GXPA 1L6GA 1ZRQA 2GSEA 4LYQA 2PEVA 4GZ7A 2XJ7A 4HCLA 4JHOA 2WV8A 1JD9A 4S3CA 2AL1A 3A47A 2Z1XA 4KERA 4XZIA 3NQMA 4JDBA 3SSJA 1BSIA 4HPXA 3UPWA 1E73M 4E2OA 3NOYA 4QG6A 4B2DA 3C61A 1W1IE 1P48A 2AGKA 3M6DA 4HA1A 4A8LA 2QCEA 5JU6A 1TWZA 1CXFA 3V1HA 2FZDA 3OZMA 2PP1A 2AL2A 3OOQA 1R46A 4RKAA 4FI4A 1Y0EA 5M1TA 1NDWA 4HU3A 5CJNA 3KWSA 4GH1A 3DKJA 3S6OA 1MZRA 4PCSA 1FWFC 3HPSA 4XAPA 4WIWA 2XFRA 5FJJA 2QR6A 2VJXA 5AHIA 3UERA 3GUWA 1QO2A 4O8RA 3ARYA 2X30A 4R34A 1HKWA 3WBWA 4AWUA 2H3DA 2D0GA 4O4VA 3RMEA 4LB3A 3HG3A 1WDQA 2ADAA 2CYGA 3NWRA 1R5YA 5FSDC 2X16A 1SVDA 3DFYA 2R9RA 2VZTA 3AAMA 3BMVA 4JIRA 7TAAA 1A0DA 2VGFA 4G7FA 1FH7A 1GQIA 1ONWA 2V3DA 1HJUA 1K4HA 1L6YA 1WNOA 1ZAIA 4N9CA 1B0IA 3DHDA 4ACYA 3QF0A 4LUSA 5RUBA 3MSYA 1ZALA 4MWAE 3JZEA 2GGGA 3EWWA 1A5NC 1ITQA 5H8PA 4EANA 3OHMB 4LEFA 3WNKA 1KW1A 3W6YA 2AQWA 3NQGA 5C54A 4ZO7A 1L0PA 3L4TA 3A4AA 3H23A 4MVAA 5D32A 3I68A 1C93A 2ZKMX 1VFLA 3VM7A 1CI1A 2PDLA 2CLIA 4JNYA 4QROA 2CWNA 4IIDA 3VKBA 1GTEA 3BMXA 4GQRA 4GG9A 4LJ3A 1GOIA 3WLNA 3CTLA 4Q6JA 3NOEA 4A8NA 3P6LA 4DF0A 3HG5A 2PRLA 1U1UA 3SM0A 3UY8A 5J04A 2PZ0A 3RG6A 5AC5A 3SGUA 3AHVA 1AMKA 4ZZ9A 5ECVA 1HFBA 5D2VA 1AH3A 3ME3A 1XC4A 3CTTA 3U4FA 3TQ0A 1RLCL 4P7LA 2J27A 4CQ9A 4E2BA 1YYAA 2ATSA 5DXXA 4ENLA 4KWVA 3EOLA 1OCBA 4F0KA 1Q6CA 3KP1A 5G4HC 2NQJA 3WX7A 3UR5A 5HULA 4L1XA 3ZQ9A 3R13A 4MPQA 4JN7A 3L4ZA 3UWQA 1LG1A 3ANYA 4W87A 3FK4A 3H4WA 2CPUA 3G6MA 3W2MA 1UPPA 1G7VA 4US6A 3M0YA 2A79A 4YVPA 3H2OA 1E0UA 3ARVA 1ZJHA 2XH2A 2ALDA 3AMDA 4XAZA 1VPXA 1BEUA 5FJTA 1B3YA 3GG1A 1H60A 4W7WA 5D2YA 3UR8A 2J62A 3NR0A 4YTUA 4M80A 5DRCA 5K4ZA 5C2CA 4AC1X 5AY7A 5JMUA 5I5RA 3NQ8A 4I6KA 1CGWA 1K8CA 2DZVA 1J0KA 5A1AA 3DI0A 1VENA 3OO2A 3HO8A 5GNZA 5BRPA 1RV8A 3ZLFA 4TUFA 2W5FA 2E40A 2FTWA 4LBRA 3E02A 3VMNA 1XPGA 1UR4A 4NJIA 4S2BA 3HPZA 5D4YA 4XAGA 3OP2A 2WQPA 3PZOA 4IISA 3L4WA 6XIAA 5LSMA 1EB3A 4B5XA 3VKJA 2J75A 4UNKA 2PLCA 3CYJA 5MKGB 4U28A 3CHEA 3C5QA 3QBUA 3TYZA 1OSEA 4O50A 3M7WA 3GHSA 4O52A 3S6TA 3TVAA 1LQAA 4IL2A 5CAHA 2XINA 2DEPA 3E96A 1MXSA 4QISA 2E1WA 1NQ6A 4AXNA 4KKXA 4PEEA 5ABFA 2ISSA 3T78A 2EXOA 3WUGA 1DJIA 2WBKA 1KBJA 3E2VA 4KEUA 3GRIA 1T8XA 4XO6A 1I1WA 4P8UA 2ZX8A 3ICJA 2QDEA 4C1KA 2YCKX 4XBKA 3N1AA 3JUGA 3GR8A 3TJIA 3P80A 1R2TA 2WXDM 3ZVIA 1XP3A 4WOZA 1B9BA 4LYPA 1ISWA 1KC7A 3RLUA 3U7VA 4Y2WA 1XGEA 1DQUA 3GY1A 3P8JA 2VD9A 2FZ8A 3A9BA 3JS3A 2WNQA 1QI5A 3KWXA 3F5JA 1VR6A 3LCHA 3PJUA 4A2RA 4E5TA 1AH4A 4IUOA 3UVAA 1XIGA 2ZA3A 4IMDA 1NWUA 2BY2A 3BLIA 3UYCA 4DI8A 3PTQA 4HIBA 3OVGA 3ZMRA 1CXLA 2YW3A 2ZUNA 4HTYA 1E70M 1E15A 3GHRA 1XFBA 4MG4A 3HOJA 2ATMA 3O07A 4LVDA 1X7IA 2VFEA 2DQXA 4JXCA 2XSBA 3QHNA 5AZ0A 4O54A 3LGEA 1VIWA 3ID7A 3RJXA 3N6HA 4NNCA 3FLUA 4FZIA 1JNEA 2ALRA 1XG3A 1Z9AA 1ZBVA 1SSGA 3RU8X 5G1YA 4PMXA 5J5RA 4PE8A 3AIQA 2HVOA 1GCYA 4HK5A 1SO6A 1B4KA 3N4AA 2QAFA 3VZYA 1XLLA 4XIAA 3WLJA 4CQDA 4QAIA 3IJLA 1BF6A 1P7TB 4RE4A 4R85A 2HQAA 1XIFA 3PVFA 1FP8A 2C18A 1KA9F 4DY1A 4F66A 3WH5A 1LBFA 3BAYA 3RAOA 3LRLA 3QYQA 3KUMA 4IL0A 2NXIA 3VCCA 3THQA 2R14A 2NQHA 2INEA 4S3AA 4WY0F 4XKMA 4M8UA 2DZTA 3WF1A 3AYTA 3TXVA 4C6FA 3QV6A 4O28A 3QC3A 4W5UA 2JF7A 3V0SA 3E9AA 1KM6A 2FMOA 3E2QA 3VGHA 2F2HA 4A29A 1HGYA 1IWAA 1OX4A 1XLGA 3L0GA 1VJIA 2R91A 4FOUA 1KCZA 4P61A 2RGMA 4FXSA 1JPIA 3OVRA 3THCA 4ICCX 1X6LA 2W6RA 1UB3A 8A3HA 2OVLA 3G8EA 2J9YA 2EPMX 2FMNA 2GQAA 4GZJA 3IWPA 4PMZA 4H8HA 3BOXA 3UZWA 4LS2A 1DWIM 4JX6A 2VT0A 5G2WA 1HGWA 1YDOA 3OA3A 1S2CA 3AROA 4OKDA 1RPKA 2IXVA 1IXOA 1X1NA 3RPDA 1ZBKA 3BCJA 5I3KA 3O3RA 3WF3A 1WDSA 2XIQA 4JTGA 1YPXA 1XUZA 2A3AA 4JZ5A 5AHFA 1UQZA 1V0KA 4YTSA 4CD7A 3D3AA 4J7RA 3SUWA 4HKPA 4BI5A 2C6QA 1F9CA 3QMTA 2V6AA 3QOKA 4S39A 3VIOA 2ZX9A 3GKAA 2G41A 2PWVA 4WOQA 5HNUA 2CZEA 2ZRYA 3M9YA 3TN5A 2I7GA 1XHGA 4W86A 2NT0A 3R11A 1JAEA 3IANA 1UJPA 3ARWA 1JYNA 4GYPC 2J6VA 3QMRA 3CAWA 1JYWA 5A94A 1FXQA 1HKKA 2C15A 1FKWA 4H9TA 4MLRA 3A13A 3B8WA 5CJ5A 4AY8A 2WO5A 4UQCA 4OIFA 1NJJA 3QW4B 4MYXA 4IPLA 5I23A 3T1GA 5BWFA 3TR9A 2A4AA 4DRSA 4V1YA 4FX8A 3AUJA 5E93A 2R1KA 3LMZA 6TIMA 2QVHA 1DJHA 4TIMA 3VGEA 4FA3A 1LOLA 2DJLA 2ZZ1A 3OZYA 2NQ9A 1GKPA 4PMYA 5FESA 1QPOA 1R3RA 3CL6A 4MY1A 5EMJA 3VO0A 1T7LA 3CIXA 1L8PA 3M5VA 2D2HA 4H8NA 1K6AA 2ZX6A 3H6OA 4PFMA 1WAWA 4O57A 4WGHA 1UR9A 3DU0A 3ZLHA 1OINA 4INFA 4PULA 5CQ1A 3DG7A 4JCLA 3W1TA 4GKTA 3W87A 1PVNA 1NARA 4NL1A 5DFAA 5C6MA 4FAMA 4PC8A 3PZTA 1MDRA 3ANVA 3EEGA 3W86A 1RP8A 2OQYA 4B16A 1XDLA 3N18A 2X09A 1BYBA 3WFLA 2V5JA 2G3JA 4B5TA 4GPNA 4CKQA 1TPDA 1C7SA 5BXTA 5TAOA 3CT2A 1M7PA 1VBHA 4M6QA 4EE9A 1S2TA 1TVNA 4D6CA 4Q8NA 4XK2A 5CG7A 1TJ2A 3FHQA 4QAWA 4GXMA 4TV6A 5DMNA 3GVGA 3DXIA 3EMZA 4QFUA 4DBWA 4B9YA 4IP7A 4HSNA 4NZFA 1A5AA 4D6GA 1V4YA 1YLVA 3NQ2A 3VX1A 3N13A 1B31A 1U1HA 4WKFA 2FFCA 3W1NA 3W24A 4JNZA 1IE7C 1SZRA 4PH6A 1RVGA 3ITCA 3ARQA 4L9ZA 4EF8A 2WWCA 2ZA1A 2OX4A 5AVNA 3R8HA 1LWJA 2YBTA 1KR0A 5D8WA 1XYZA 2WCSA 3WQ4A 2VX7A 3VKDA 1QRQA 4AZ7A 5AECA 5BXPA 2Z1KA 2WC3A 3CUIA 3W1AA 2VC7A 1SPQA 5FSEC 2YCJA 1SZGA 3W02A 3TN3A 1K4GA 1NQKA 2PLKA 3SW6A 4QGCA 3KCLA 1DV7A 4JTHA 1UWAA 3A5VA 4PR4A 4I9MA 5CBJA 1HX0A 4IIHA 1H51A 3H2CA 1ME8A 1PO9A 2OSWA 1WDDA 3W00A 3T09A 2POTA 2XN1A 1BXBA 2YXOA 3AXHA 3GW0A 1WXZA 2E6AA 1S39A 3TSBA 3R58A 2P53A 3UU0A 5FF3A 4UMBA 2FTYA 5HJYA 4PMNA 4R5EA 2G0WA 4UNIA 4Q4OA 5FF4A 3U2OA 2AKZA 2O7QA 1BKHA 3VZXA 1BSLA 3N29A 4KWSA 3CS2A 1W9VA 4E8CA 4LF2A 2W66A 4NASA 1U5HA 4TX6A 4LXFA 1G5AA 4U2YA 2HCVA 2VEKA 2OFJA 4V28A 4UFJA 4FNQA 2VWSA 4OV9A 3CV7A 3MMWA 4QP0A 2VZSA 2BDQA 1R30A 1VRDA 3IJQA 4FXJA 4MGGA 1DHKA 4PMUA 1JZ7A 1UKPA 4YTTA 1N8IA 5HPOA 3N34A 1BWKA 4LV9A 2G95A 1OEPA 2J7FA 3EWCA 2B0MA 1TA3B 4KCWA 1XYMA 5D05A 1UZ4A 3WH6A 4BZYA 4IZGA 5B7ZA 2PLJA 2NQ5A 3ZJKA 4OV4A 5D2XA 4H9VA 4H2HA 1ZU8A 1OFPA 4S3DA 3AICA 3PF3A 3PPFA 4E2VA 1WDWA 1YPFA 4D6IA 1MMFA 3P74A 3MB9A 3QH2A 4C7FA 5I78A 3UJSA 4WGXA 1DJZA 3B0XA 3W6LA 3LTPA 2VC5A 2QJHA 4E3VA 3DYPA 1SQ7A 1GQKA 5F2IA 3WMSA 1XCFA 3C3UA 1JZ3A 2VDGA 1DP0A 3MHGA 2OR2A 2D73A 4FLOA 1UMYA 1QHZA 4KCUA 3GNRA 4Q8QA 4GMEA 4XKYB 1MW3A 3NDYA 4BQ5A 2TMDA 3SDOA 3H54A 5A6BD 3P14A 4H8VA 4GIRA 3EDFA 2HNHA 1TTJA 3M5ZA 1SO5A 1CGXA 1GTHA 5M5DA 3V0UA 3HQ1A 4IWWA 2YB1A 3WLPA 1TJPA 1CWYA 1TPFA 5BXSA 3N4EA 2PB1A 2VFHA 4EPDC 5HXMA 4GCAA 3ITOA 2Y24A 3PK7A 5K2ZA 3GNOA 5IFTA 2Y88A 1SSDA 3M46A 1W32A 2A7PA 4HJFA 3TZNA 4V15A 4F9DA 3BG9A 2V68A 1TV7A 3OIXA 3GYEA 1GHSA 3TNBA 1KXTA 4PUNA 3VNIA 4C60A 1TUFA 2PTWA 3M64A 4C6CA 4AWSA 3LNPA 3H21A 1P43A 1BPLB 3WK0A 2RGLA 4HHHA 1TTQA 2YA2A 3TXZA 4CNOA 4KRZA 1V02A 3P3BA 4DXXA 3U57A 4UQAA 3T8LA 4WR3A 4JPGA 5I2UA 1XJBA 2IXUA 4OBRA 2VGIA 5K4XA 1THFD 1M5WA 1UQYA 2TODA 3VNLA 2E5DA 2OODA 2GJLA 4CNPA 1YDVA 3M0JA 3UJ2A 2AGTA 1EX1A 3TIMA 4BF9A 1BGAA 2FGZA 3PPHA 3W23A 1JFHA 1IHIA 2FDMA 3M43A 2BG5A 1SGJA 3HFTA 1IV8A 1Q13A 2E1DA 3WBXA 4XZNX 2GQ9A 4Q8OA 2W4XA 3FJNA 1N2VA 3GK0A 3KP0A 2YCIX 3SEPA 2ZOXA 1TB3A 2GUYA 3HIJA 5A2AA 3WLQA 7CGTA 5A6BA 2WHKA 4AH7A 1AW1A 3CV1A 3SUUA 1KGUA 4GBUA 3DFQA 5CZSA 1KD0A 2IPGA 3I65A 1C8XA 5FEZA 4Q4MA 2OYMA 5HPCA 2ACQA 1J10A 4ADTA 4IJCA 2WMIB 3LEPA 4QDWA 5I06A 4R9XA 5CAKA 4M81A 2PTZA 2D0FA 2J88A 2ZC8A 1EHNA 3CWHA 1JYVA 4QSHA 5D2WA 4PSPA 2Y70A 3UR2A 2PSNA 1R3TA 4U5IA 3AHZA 2UY2A 3VXGA 2ICSA 1QW8A 4A8RA 4AEEA 2A85A 3M0LA 4O1FA 2X1IA 1WZMA 3KTCA 3C0SA 1W9BM 4H7CA 4AZCA 3JRKA 2CNCA 4A2SA 2J77A 3O6YX 1VFSA 1WCGA 1DYSA 3GLCA 2PP3A 2PDNA 3R12A 2HEJA 4ZOCA 3KLLA 1IT8A 5FJOA 1XCXA 1HQTA 1FWJC 1TREA 1W6TA 2HBXA 3MCOA 4IXXA 2VOTA 5AOUA 1GONA 1L2UA 1EUAA 3GTHA 3UF9A 3DAQA 2OO0A 3Q65A 3VNZA 2E5CA 1Q7ZA 2WANA 3WNPA 1E56A 3O63A 3C2EA 4M24A 4GUGA 3CZEA 2HV5A 3MMDA 4OZOA 4NP7A 3R4IA 2BASA 3EDKA 1UD4A 2BVYA 3LLFA 4LRTA 1ZNNA 3W27A 1K77A 3M4HA 4GA8A 3EEZA 4Z1CA 4AZBA 2PURA 3NVDA 3W1XA 4ZVJA 1UR2A 1W2VA 1ZB5A 3KCJA 4RZ4A 1GUVA 4JX5A 3DFPA 5G2HA 3BARA 1PAMA 4GNJA 1UKOA 1NP2A 1XIDA 3RILA 3QRHA 3KHDA 1X8FA 1NDYA 2PWGA 3W7DA 4DO7A 4ACZA 4NZ1A 4HB7A 1RJQA 2VCBA 2ZZ2A 2V5KA 3S9IA 5CG0A 4GD0A 2Y61A 3NSNA 4MZ8A 1JPKA 4G7EB 4Y9AA 1F4AA 1O5RA 1NFBA 2ZTJA 4FOJA 2PU0A 1Q2SA 3B8TA 3UW6A 3LTYA 1CB2A 2R1MA 2XVPA 1KFWA 4OE7A 1D7FA 4RPPA 4L4PA 3TN4A 1O7AA 2X7VA 4PSRA 4FALA 1NOWA 2DUZA 1GOQA 3WBYA 1FWDC 3CM4A 1QOQA 4D72A 4A35A 3II1A 3NL5A 4LVFA 2YLLA 2C0HA 5E6YA 4X0NA 1AMYA 1TV3A 2YGYA 2G3IA 2PP0A 2A3HA 2HS8A 1BXNA 4J9JA 3B0UX 2HXTA 4GH3A 3H2AA 2Z27A 5A8OA 3A3HA 3NQ6A 3YPIA 3O7UA 2XGZA 3U8GA 3VM5A 4EPEC 3XINA 3BPWA 1PIIA 1TFVA 4L4LA 1BFNA 3A4WA 2HROA 3L7RA 2HSAA 2W62A 5DCDA 2PODA 2EBNA 4MKSA 4HK7A 4LCSA 1TMQA 2VEIA 4HHPA 3TH6A 1QATA 2MANA 2VVSA 5F1UA 3T08A 5LIKX 1DEDA 2V30A 2QYGA 1AVAA 4XBJA 1UP3A 5CGMA 1EGMA 4L61A 1TV5A 2FB2A 3UCDA 3S4TA 3G0XA 3KVJA 1W5PA 1TQJA 2GJRA 1X6NA 1FFQA 1Z89A 4QIUA 1LOSA 1H1NA 5F4SA 3VAVA 2BGNE 1RQBA 5HANA 3KBMA 4PN2A 2ZIDA 1ADOA 4JY9A 4JEQA 1RJRA 5FJRA 3NL2A 4CU8A 2BS9A 2FJKA 1QHOA 3P0XA 4GCXA 2GSJA 3VNYA 4QR6A 3VNJA 2GQ8A 3N3MA 1O94A 1HKVA 1FXPA 4NUWA 2BHUA 3KZSA 2E8YA 3NPWA 3NZPA 3WF0A 2IKJA 3SFKA 3ZSSA 2J13A 4GVGA 1TIWA 2Y8UA 3SY1A 1A3WA 4TX8A 4J2PA 3TWBA 3WFZA 3SIZA 2TRSA 4WY0A 4C65A 3EPOA 4JHZA 4E8GA 3WQCA 4L6DA 3E6EA 1TELA 4NXKA 1PCWA 4WSJA 3LI1A 4ASTA 5MHBA 1I60A 4RX0A 1RALA 1T96A 4B92A 1OJXA 4IXHA 1C7TA 3SRKA 3MSRA 4UTKA 4GKLA 2PWFA 4PB3A 1W3NA 4KQNA 4AIBA 5C9WA 1UCWA 4W4QA 4AU0A 2JQXA 3HBLA 2WSYA 1D2KA 3OTRA 4NRRA 1CGVA 1QPNA 3SI9A 2Y4SA 3QLDA 1DJXA 3E0IA 1E3ZA 4N4PA 1P6BA 3F2BA 1V3IA 3UT0A 3OG3A 3KEHA 3TMLA 4JQ1A 5C9XA 1OGGA 2XIMA 4IICA 2Z2BA 3MV11 2YPIA 2BOGX 3CMGA 4LYRA 3EWBX 8XIAA 4OWGA 4J3XA 2CW6A 3PR2A 3FGCB 3OQ8A 1F74A 4EACA 3LB0A 4BQ2A 1YNYA 4QG9A 3N19B 1IQ8A 4YHGA 3R94A 1NY1A 5EMLA 4GX9A 4P7QA 2CC0A 4YVXA 1ITUA 3ZR6A 4DQWA 4QJ3B 4HYWA 4UMAA 1IEQA 4C7DA 1E43A 4EPKA 3W7KA 5C8BB 1OYBA 2XISA 2F2KA 4W8BA 5HQMA 1DHPA 4GO8A 5LA0A 3N4FA 4C6QA 1CGTA 4MZ1A 5DO8A 3H7RA 5E9AA 3CL8A 2XIOA 3AIBA 1YRRA 2YR1A 2OTDA 5TIMA 3BC9A 2O9OA 1XC6A 4QX4A 5A69A 2GL5A 3H26A 4C6JA 3UJFA 3TSDA 3T6CA 3M0KA 3MV01 5JXQA 2W27A 2ZUUA 3AMGA 1XH2A 3CMFA 3AWOA 2PUZA 3VINA 3W07A 1EOMA 2NWRA 3QR0A 1W8GA 3AXXA 4WDUA 5GQBA 4A21A 1OIMA 4JIQA 3WLHA 4YHEA 1F8MA 3LI0A 4EAYA 1TWIA 1RUSA 1W5QA 3GU2A 2VOMA 3WJSA 3WQWA 4LCRA 1Q8JA 2G5WA 2VDHA 3AWNA 3NPUA 4EF9A 4MTVA 1PE1A 3ITGA 1EJUC 3GTFA 3TWAA 4DJED 4Z1DA 3GDKA 4YMZA 4AHQA 4O0KA 3MCMA 1GVQA 4DBDA 2YBUA 4M6PA 1LL7A 1OFEA 4B5UA 4Y9PA 3V4BA 4PBFA 1JPMA 5C71A 1KWKA 5HJXA 3BGAA 4G5DA 3WQOA 1XYBA 3TW7A 2J7DA 2RHGA 3W28A 4TX9A 5CBBA 2DVUA 1XW8A 2V5LA 3EA1A 2VX4A 4D8ZA 3L0KA 2G4FA 4H6QA 1V6WA 3WD4A 2ZUMA 3AISA 1GQJA 3REQB 2XGBA 5AZ1A 3G24A 5MKGA 3ABQA 3CC1A 1O6IA 1D9EA 1CXHA 3QGVA 3CXOA 4PGLA 3MS8A 1YX1A 2IPWA 3EB2A 3TONA 3DH7A 3K8MA 3W38A 1I45A 1A4LA 2V67A 2FH6A 1WYIA 4V1XA 2JEPA 1Z7AA 2VR5A 2IKHA 1M7XA 2G8ZA 3VOIA 5BU9A 4QS6A 1H7PA 4S3GA 1QNOA 1I9CB 3U0HA 4NX5A 2BNJA 2NSXA 3VIMA 1P1XA 3DDMA 2BOEX 2Q3OA 1W1A1 1M7OA 4JYDA 3STFA 5HQEA 1NFGA 1B57A 5CGQA 4UTFA 4ECLA 1GKRA 3BJTA 5K9DA 1UW9A 1MEWA 1H0IA 4JICA 5A8MA 2Y8VA 4C6KA 3TTEA 1XSIA 3TYDA 1CT5A 4C6MA 1ZBCA 3KRSA 3U2CA 3PUOA 1UZDA 3OJGA 2FVKA 1FWRA 3BV7A 3FXGA 2ZDSA 5B80A 3MUCA 5LXXA 2HISA 1F05A 4HSOA 3EX4A 2YZ5A 2OGJA 3QV8A 1UKQA 2EJAA 4GZEA 4PUKA 3PJXA 1QI0A 2VO5A 4L5ZA 3GR4A 2AQOA 1I0BA 3G1SA 5LA1A 2XYLA 1JRBA 1JQXA 4JKKA 4PEKA 4DJEA 3H2NA 1ZLPA 5HMEA 2QUNA 3D6NA 4L65A 5M17A 3CQJA 5M3WA 1BWLA 1GVEA 1V03A 5A2CA 3PB0A 4KFOA 1JXJA 4H04A 5DBTA 1W1B1 1LDCA 3QOMA 5A6TC 3SSZA 4S23A 2DGAA 4F2UA 4IMAA 2VKZG 4IJRA 2ZZ3A 4H00A 3HTWA 2VX5A 1HVQA 3BLOA 2VZUA 3UG8A 4IGMA 3ES7A 4HZ6A 2CESA 2VFGA 1UMLA 1U22A 4GUFA 2O92A 3DN5A 1LT7A 3TTYA 1UKSA 4JS3A 2ASHA 2PBOA 2CKRA 1LLOA 5C9UA 3GDBA 2Y89A 4URIA 2O4MA 3LSBA 3G1DA 4YCPA 4M7SA 4HT3A 3KTSA 1OY0A 3KVKA 3LRKA 2WZIA 1FWEC 2GGEA 1S1PA 5EPDA 1OD8A 3UD6A 3T2PA 1B3OA 1ZHAA 3CHCA 3N2OA 5CCZA 5EMYA 4DB7A 3FEQA 3W82A 3LYEA 5LNSA 4A3QA 2E09A 3RCNA 1XISA 4TVCA 4IFKB 4IP5A 2VCAA 1O1HA 4DLMA 3HU7A 5LIXX 4O1AA 4GGBA 5HNRA 1V6YA 4W89A 5FL1A 4ZB0A 1ADDA 5KZ6A 5DT5A 4W9TA 3MMTA 2DT2A 1TX2A 3UQNA 1PKLA 3WUFA 3EB4A 2C71A 5GPRA 1EKOA 4LU0A 5IFPA 4QM1A 1XD1A 4FXRA 1EWEA 3PWAA 1ZS2A 4JY8A 3G0UA 2PS2A 4LAOA 3OLDA 3TJ4A 4QNEA 1JUKA 3AJ7A 3TTOA 4A3YA 2GDVA 1PXGA 4IJBA 1PIGA 4AHPA 4K36A 3TX9A 1EP1A 3SCVA 1AH0A 2QZRA 1G4TA 2ZX7A 3EA2A 4IPIA 4KH2A 1UWQA 2DZSA 1PL9A 3WF4A 1YXYA 1TJ1A 1K7FA 3IUHA 5CSSA 2YJQA 1R3WA 1BF2A 5CLWA 1WKYA 4B4HA 3TTQA 4JQ2A 2HRWA 2ZXBA 2XHYA 1A5OC 5DLCA 5T9BG 2YB4A 3NM1A 3P8IA 3VFCA 4DZIA 1TTIA 1HTIA 1XBXA 4WUIA 2IUZA 4GC3A 1X7FA 4AIUA 3RM4A 2Z4GA 4MADA 2VZVA 4UR7A 1FDZA 3EXRA 5EFFA 3FKRA 1MDLA 5JBDA 3OYXA 3AALA 1KBKA 4JTUA 1PEZA 3IRSA 1SFSA 5B7YA 2GFTA 1KFJA 3QR3A 1FVPA 1U5VA 1BVZA 4LV4A 2ZUVA 3VIPA 3AIVA 3ISIX 4ZE4A 5AYXA 3ITTA 3F4CA 1E6QM 3Q58A 2HPIA 4Z1BA 3SCWA 3WLSA 3AMKA 3LG3A 5FKYA 2P0OA 3UGVA 4G8TA 1DQWA 1HKIA 1XIEA 4LW7A 3CPGA 2QCCA 3STEA 5XINA 4JL1A 2I16A 4FLQA 4A22A 5LKYA 1UOKA 4HNCA 4ZFCA 2YA1A 5CKSA 4LVGA 1BRLB 1XLJA 2ZE0A 1FDYA 4MMWA 4GUIA 3EZ4A 1RR2A 5ENLA 5GNYA 1KNWA 2WCGA 2JGYA 4GI8A 4EAMA 2X1RA 1C8YA 3A4JA 2J79A 3L5LA 3MBFA 3RDKA 3GXFA 1K8ZA 2XIIA 1RCQA 1ECQA 1V6XA 2TPSA 2WKLA 3CMJA 4FS9A 1ZPTA 3IS4A 3S9ZA 2FJUB 3VGFA 4PBEA 4Z2GA 3QZAA 2QPXA 3B9AA 3KW3A 4KIEA 3ITYA 2VR4A 4AEOA 3MUAA 1WB0A 4JTKA 2VI0A 3CWNA 3AYRA 4HPHA 2ISFA 4Z2LA 2EKGA 3GAKA 5I3IA 4J4KA 1OC6A 4F0MA 3UXKA 3T2QA 3T05A 4YPJA 1H11A 1QPQA 3TJLA 3ERPA 1H7XA 3V75A 3K30A 1A3XA 3SGZA 2FVLA 1SMDA 2ZRXA 3PWIA 5DN1A 3MY9A 3VE9A 3U5YA 1GEQA 1US0A 3OU8A 1JUBA 2Y7EA 4LB4A 1KQZA 3EPNA 1Q6QA 4FIQA 2B7NA 4DJFD 1W9UA 1WBHA 3N2XA 3HQOA 3URNA 2WJFA 1F2JA 3KL0A 3NPVA 4J27A 1GYLA 3WLOA 4MWAD 5JUVA 4KFPA 4AXKA 5C9RA 1IR2A 5C7VA 1PKNA 2CHRA 3QZ6A 1JNDA 2A6NA 1O5QA 2HS6A 1JQVA 3NQ7A 1VZWA 3KS5A 2BFGA 1RBLA 1RA5A 4XAYA 3S3GA 3WQ5A 4A6GA 3K4DA 1MW0A 1RJPA 3C4UA 1IT0A 3PPGA 2NX1A 1V5XA 5FL0A 2WQDA 4CD6A 2WLZA 1E0VA 1SU5A 1FH9A 3PZGA 1TE1A 3R10A 2YL9A 1HN1A 1JR1A 2PF0A 2OU4A 3ALFA 1LBMA 1KBIA 4UTHA 3J7HA 4QLLA 2GGHA 3TFCA 3JW7A 2FHFA 4H83A 3ZYZA 4C6PA 1XD0A 2PDIA 4DUVA 2DSWA 3TJXA 1R7AA 1IR1A 4IIBA 3UWZA 3G2GA 1XV8A 4O12A 4S2CA 2ZRVA 3LERA 3RN6A 3UWEA