2OU4A

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 115
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2ou4A00
3BANA 1XLMA 2X7WA 5I7GA 4QDPA 5EMJA 5AVNA 4YTSA 6XIAA 1XIGA 4ZB0A 3AAMA 3XISA 1A0CA 4ZB5A 3CQJA 1DIEA 3ITTA 3NGFA 3P6LA 3IUIA 3KBMA 3OBEA 1I6NA 1XIFA 1XIIA 2GUBA 4XSLA 1XIEA 5XIAA 2HK1A 8XIAA 1DXIA 2G0WA 1XLIA 1OADA 1XLBA 3AYVA 3KBVA 2OU4A 1XLJA 5XINA 1I60A 5H1WA 3VNIA 1XIBA 5B7ZA 1YX1A 1XYBA 2I56A 1BXCA 3CNYA 4HHLA 1XLDA 1XYLA 3C0LA 4PGLA 3CQKA 3M0XA 4K1GA 4HGXA 1S5MA 1XIMA 3VNLA 3CQHA 4YTRA 3LMZA 5J8LA 2NQ9A 1QTWA 3IUHA 4QE5A 1XINA 4XKMA 5EMMA 1XLFA 1QT1A 4PFHA 3M0YA 3UA3A 5B7YA 4DVOA 1DIDA 2NQHA 4J4KA 3BZGA 5AVHA 3U0HA 3M0LA 4QE4A 4XIMA 3QXBA 4ZBCA 3XIMA 4K3ZA 4A8IA 4YTQA 1XP3A 2QW5A 2ZVRA 5EMLA 4GLEA 3N4AA 2XIMA 3QC0A 3CQIA 3VNKA 4A8NA 2XINA 1XIDA 5C9ZA 9XIAA 4XISA 3ITOA 2J6VA 1XISA 1XLGA 3UXIA 2QUNA 3C0QA 1MUWA 2QULA 3VYLA 4YTTA 2HCVA 5B80A 3BWWA 3L23A 8XIMA 3C0SA 4GJIA 4E3VA 3QZAA 1O1HA 3UVAA 4XIAA 5EMKA 9XIMA 1XLAA 4OVXA 4EACA 2HK0A 3AYTA 3FVMA 4YTUA 4EAYA 3GNXA 4GQBA 4HHMA 4DUOA 1TZ9A 3KBJA 3U3HA 1DE5A 4QE1A 5FA5A 4X60A 2QUMA 3KTCA 6XIMA 7XIMA 1DE6A 1D8WA 3ITLA 3VNJA 1CLKA 4A8RA 3KCLA 3M0MA 4HNOA 3ITXA 2ZDSA 3CWHA 4QEHA 2XISA 1XIJA 2I57A 3JU2A 1XYMA 3UA4A 3UU0A 3BDKA 3KCJA 1S5NA 3M0VA 1A0EA 4QEEA 4US6A 1QUMA 4X63A 1XICA 1XLCA 4W4QA 4X61A 3KBNA 4G56A 2GYIA 4ZB2A 5H6HA 4QDWA 3VNMA 4KW2A 3ITYA 1XLKA 1A0DA 5XIMA 5TNVA 1MNZA 3DBNA 4GJJA 2GVEA 3AALA 4Q7IA 1GW9A 1XYCA 3XINA 3WQOA 3P14A 2Q02A 3IUDA 1XLEA 4LNCA 1K77A 3KCOA 3ITVA 1XIHA 1XLHA 3TVAA 1XYAA 3TC3A 3BZJA 3KBSA 3DX5A 2G4JA 3KWSA 4XSMA 3KBWA 2GLKA 4A8LA 3QYSA 2NQJA 2X7VA 1BXBA 1XLLA 3M0HA
chains in the Genus database with same CATH superfamily
1DWJM 1VBRA 4DWSB 3B03A 3QFWA 3E5BA 5D8WA 5FJIA 1JZ4A 3QRHA 1QOQA 2HK1A 2FPTA 1JFHA 4O4WA 2XGBA 1K7FA 3IJ9A 2PU0A 4HZ8A 4KETA 2DZBA 1XXXA 1EJSC 1PL9A 2E1DA 2V5CA 4UNKA 4UTMA 1E6PA 4KFNA 3SCNA 4F0RA 3THAA 5DFAA 4PTNA 2XVGA 1UUQA 1HGWA 3C52A 4B9YA 3QBUA 1V6YA 5I3GA 4UOQA 1M1BA 4CNSA 1UWSA 3WK3A 3GU2A 4G9PA 2OZ3A 2D1ZA 4RKAA 1JCYA 2VCAA 3SUVA 4H6QA 4CQ8A 2DSWA 1OT2A 2YW3A 4EPBC 5DLCA 3W2NA 2CC0A 3PR2A 3UJEA 1D9EA 5F2LA 3L68A 1OQFA 3R10A 3GDMA 5CC6A 3RGTA 1XFBA 2E8ZA 5LIKX 5DMLA 1W3IA 2XIOA 2Y0FA 5HUPA 1AD4A 1RBOB 2D2GA 4ZGYA 2OCZA 3P14A 2NXIA 3DG6A 1F3WA 2ZC1A 3DUGA 2X40A 3H55A 1D7KA 4LNCA 3LX9A 3DKLA 1QI4A 1QI3A 4MWAC 3TW7A 4XTDA 3W2KA 3USZA 1K4GA 4ZQPA 3EWXA 5BMXA 4C6KA 2DSKA 2ACSA 3CHCA 2BVYA 1UKQA 2FHFA 4RW3A 3W01A 2PPGA 4DUVA 3M0KA 2E09A 3MWAA 3JW7A 3QZEA 4JTKA 4P7RA 4NZCA 1MEWA 2XGIA 3F03K 3ITGA 4TMCA 5D9PA 5FF0A 3M0JA 4UNLA 1NF0A 4M6QA 1Q6OA 1ZENA 3N4AA 3H7RA 1JGIA 1G67A 1K1DA 3KZSA 4JTQA 2E68A 5A3HA 2FYMA 4KFPA 3NURA 4F2BA 4GJIA 1A3HA 1H61A 2E7FA 4HMEA 5EU9A 3SIZA 2FDMA 1LJYA 1C8XA 3LNMA 4IX0A 2CEQA 1KV8A 5E0CA 3AICA 3R13A 4DWDA 5CC7A 4ZXOA 4JTIA 1Q65A 1IWPA 3VNYA 3MTWA 4KGLA 3MCNA 4GWEA 2WW5A 4KWOA 4JN7A 5G2WA 3DZ1A 3WY1A 2H3DA 5FIPA 4MPQA 5AFDA 2CLMA 2OEMA 3C61A 1XG3A 4NXSA 4P8UA 2J7DA 1YEYA 1N8IA 1MI3A 2Q01A 3UPBA 1PV8A 4KEUA 1ICQA 3KDNA 3PM6A 4YHGA 3N3MA 2VFIA 5G1TA 3R58A 4NNCA 3SFKA 2A6NA 3GKFA 1ZQ5A 1EYEA 5CSUA 4PUNA 2WNQA 4QM1A 1AH3A 2GZXA 3ARPA 4LB4A 4MTVA 5E70A 1MQQA 1GQJA 1X38A 4WLCA 4GNVA 3GU9A 2ASHA 1RXOB 3N3TA 1UP0A 4J27A 4DZAA 4JFSA 3GC2A 2Y5SA 3BGJA 4U3CA 3LCIA 1US2A 3TQPA 3IARA 1I45A 4D71A 3O1NA 2Y5EA 1CDGA 5D8ZA 1CECA 2X8RA 4D6CA 4N2YA 3FV9A 3GAKA 1XGEA 3CWNA 3GTXA 4JD4A 1OVDA 1OABA 2CWNA 3HG4A 4YCOA 2QUMA 2AL2B 1KA9F 3WSUA 4CVWA 4JTLA 1B3WA 1DHKA 4AVNA 1UZHA 2DH2A 2CBIA 3MUXA 3VAVA 1DJGA 1EB3A 2FH6A 2IKHA 1SQ7A 1V3IA 3ZZ1A 3GTNA 4J9JA 1EF3A 3VOJA 4DWSA 1SW7A 2XTKA 4UTKA 1PDZA 5KITA 5TNVA 2FTYA 5AYBA 1DQUA 2ZRUA 5JMUA 1KXVA 3TZNA 3E9AA 1EZWA 3C3NA 5T26A 1A5UA 3BUVA 3OO2A 3TN6A 4HU8A 5U4NA 2ZTKA 2BY0A 4PTXA 4DO4A 4N9EA 3W1MA 3WLTA 4GUIA 3K46A 3WL1A 4ZB5A 2DZVA 3G0XA 1P48A 1VC4A 3ABQA 1TJ1A 1HNYA 1GJUA 1H7RA 3IJQA 2FIQA 4C6LA 1XSIA 2YXGA 1XH2A 1J0HA 1WV2A 2PURA 3LDVA 1TVLA 2BMBA 4PMDA 1W5NA 2XPKA 4L6HA 1DJZA 4HOWA 1CT5A 1O66A 3E2RA 1Z3NA 4D8AA 4IQJA 3RHGA 1KM3A 5LXEA 4UTWA 2RJHA 3K8LA 5A6AA 1O12A 3STCA 4PH6A 3WH8A 2ZUMA 2JEPA 1XYFA 3W07A 2AMGA 1O1HA 1KTBA 4FNSA 1B3ZA 1W1VA 4E0CA 4ATWA 1RJQA 1FQ0A 2DUAA 5HATA 4F2TA 5F7UA 3G1VA 3EKGA 3F5LA 5AYXA 3EOOA 2BSLA 3VKKA 2AKMA 5D9OA 3OEXA 5CPNA 3BL3A 4JX4A 3V3WA 1ZU8A 1ZBKA 1EH9A 2DZUA 2EG7A 3A24A 2O0TA 1UROA 1WDDA 2QIIA 4Z0SA 1SMDA 1XLHA 1YNPA 1E9YB 2G4JA 3SGUA 3FAWA 3CUIA 3W7HA 5FEXA 4NJJA 1KM5A 4A3YA 4DBUA 1TJ0A 2OR2A 1P0BA 3VIOA 4ERAA 4HB7A 4EX4A 4FZIA 3FNDA 4Q4OA 3BLPX 1ONEA 2OPJA 3AWNA 4IFKB 2QJMA 5IFPA 3QV7A 4C60A 1ADOA 1HTIA 2DH3A 1A3WA 3NPWA 1GVSA 1O68A 2ZXBA 1QWKA 4IXXA 3EWCA 1UR9A 3UJFA 2YCKX 4YVPA 3E02A 1ICPA 1TYGA 4GC3A 2W3ZA 4MOZA 3LV5A 2YFOA 4JTCA 3OIXA 1B5TA 2VEGA 3NZRA 4E3VA 1TR9A 5I06A 4HPGA 1RVKA 2XWEA 3CWOX 1LLZA 5ABGA 3O9NA 3FVMA 4JDYA 2YKKA 1ITQA 3FDGA 3R8GA 2YFNA 4LV9A 5HWMA 1D8WA 2W62A 4RCXA 1EJ7L 1CBGA 1TUXA 3S6OA 2W63A 2ZDRA 3T08A 3QOMA 3KFTA 5LIUX 5FJRA 4GZ7A 3QHOA 4PR4A 3VILA 1B3VA 4IP5A 3CMGA 1NF7A 5E6ZA 5K7JA 1WKDA 5HINA 2GLKA 3W2JA 1L8PA 1DXIA 2PRHA 1VGAA 3AHXA 5DRIA 4F9JA 3U7BA 3KRBA 4O8AA 2QXWA 4MGGA 3TTOA 4I5RA 2ZXDA 5I09A 1VAHA 1XLIA 1W3JA 2YA0A 3FOKA 3H2OA 4PGLA 3WH9A 1E6QM 3CQKA 1XJBA 3RN6A 4WRHA 3SUWA 1DWAM 1W1YA 4MZYA 3FKRA 2V3EA 4AZIA 1B4EA 3TYUA 1TPH1 3AS3A 5AHNA 5HMEA 2AL2A 4ZOCA 5CBJA 2FFIA 4N6EA 1OM0A 3C3UA 3BLOA 4C5YA 4PUDA 3M47A 1JEZA 2GJRA 4NZ5A 4F79A 1A5CA 1OFEA 3C2VA 3T0CA 1HN1A 1LOQA 4CUCA 1AH0A 1U5VA 4MLRA 4Z1DA 1HL2A 3E96A 4MSSA 3RILA 3WJWA 1VFOA 1VB9A 3ITXA 2IKIA 2DW6A 4QRNA 4YPJA 1ZUAX 1RD6A 1SYTA 4FR6A 1GG1A 5HQEA 1K8YA 4CCDA 3GDBA 3W6MA 1GVYA 1SUXA 3CUGA 1Z69A 5I5RA 3NPXA 4MY1A 1VBUA 1KLYA 3RDKA 5PTDA 3M0HA 3D47A 4X9SA 3BTNA 1PCWA 2O7QA 5CLTA 1XIGA 4PFMA 3UGRA 5A6MA 1FHVA 4CNOA 1T5AA 3M0ZA 3TMLA 3DI1A 3AUJA 5FEPA 3BVJA 2Z0IA 1WZLA 3BXWA 5IDZA 5HUOA 3BE7A 2XH0A 3EX2A 3Q65A 5G2IA 3MP5A 2Z7KA 1R3SA 3LZ3A 4J3VA 3IVSA 3OIHA 5F1UA 1Z48A 3GDRA 4LY4A 4DJFA 1DJWA 5FAJA 4C7DA 1TVNA 3V4BA 1HKMA 5I03A 4W8LA 4YU1A 2WHKA 2YOCA 1LLOA 4QSHA 2OELA 3AMKA 3LBOA 2WM0A 3W70A 1IYXA 3G1RA 3L66A 1J0ZA 2CERA 1K9FA 3S8HA 4IT1A 3KBJA 3CAKA 1DOSA 3PFMA 3TV8A 1M7JA 2XIJA 4UWMA 3ARWA 4E4UA 2VMFA 2RDXA 4XD4A 3FGCB 3HO8A 4XZIA 1MRQA 3H53A 3A5FA 3JR2A 1TQJA 1K70A 4KF1A 4LY8A 4AMAA 4BEQA 1K4HA 2EPLX 2ZCGA 1WDRA 4IFKA 1GVOA 3DYPA 3PPGA 4LYRA 4MFEA 1V0KA 1FWRA 2O4QA 4LEFA 3KBSA 3KVJA 3MYOA 2V3GA 1NP0A 1EDGA 3NXLA 4IPPA 3NQ6A 2YX0A 3DU0A 3MI6A 4IGSA 2P8BA 2GUBA 3W1PA 5CJMA 1MW2A 5I3IA 1LORA 3NYDA 3QKZA 1EX1A 4H8VA 5EMMA 1WDQA 3RG6A 1EA9C 3G3MA 3E49A 4KWVA 1RVGA 3WNMA 1BQCA 3VUSA 3LPFA 5LA0A 1S2WA 5CGQA 5G5IA 3KZPA 4D8LA 3G1XA 1QDSA 2XINA 3UR2A 4WIWA 4O1EA 1TPEA 3VE9A 1SPQA 1LRTA 5E6YA 2DUZA 1BPLB 4G1NA 4Z1CA 1L6WA 2QMKA 3TSDA 2FFCA 2REQB 4AWTA 1NWUA 2WJZA 2FPYA 5GJPA 3LERA 3U5UA 1W1IE 3A4AA 4C6OA 1VFUA 2I5IA 3SCUA 1AD1A 3L5MA 1LBFA 2A85A 1H11A 3UU0A 2DDXA 4A29A 4H9XA 5SWUA 2Y70A 1E9IA 1RQEA 4EANA 1GOMA 1C9DA 4XBSA 4MY9A 5EFDA 3RCNA 2ZBTA 4OHQA 2QCGA 4AZ6A 3T4CA 1V6UA 3EA2A 4V1YA 4FIQA 1XBXA 4REQB 2AAAA 3UBPC 4DXKA 2RKXA 2Y7EA 4MJ2A 2PLMA 2VVNA 2CLLA 5I23A 2OMAA 5D37A 3AO0A 4I90A 3VNIA 1KV5A 4DLMA 1W91A 1ZAIA 1BSIA 3WQEA 5C9WA 1XGDA 3WH6A 4M6VA 1JCJA 2FJKA 3K30A 1CX9A 1ME9A 2BB0A 3F4VA 3BG3A 4ORIA 1CCWB 1AZ1A 4PTMA 5HJYA 4MADA 4MYXA 4FOJA 2OWCA 4WSJA 2ACUA 3QHMA 2QQ6A 1VEOA 3WH7A 1V77A 5K3VA 2J66A 4HJWA 3POHA 3DFQA 1T8QA 2PAJA 3TSBA 4GQBA 1E40A 1ZAHA 3S9IA 5FA5A 4L4MA 2P50A 1O94A 3GDLA 1UUMA 3CUJA 1LUCA 3S42A 2QCMA 3QTGA 4GBDA 1KBKA 2UY4A 2NWSA 3N6QA 3FEMA 3GYEA 3OGSA 4DRSA 3GC4A 1R7AA 1R2SA 5FF7A 1ZSXA 4HA1A 5AC6A 3B9OA 3OJGA 4Q22A 1U2YA 2J9ZA 4ZXLA 6REQB 1GNXA 5I02A 4H8UA 4P7OA 4TX6A 1EO5A 3B8VA 3EWZA 3AXIA 2ACQA 3KS6A 4HZMA 3RPTA 4AIOA 1IT8A 1YPFA 3BW4A 1J11A 5BXTA 2Z2AA 4X22A 1BVNP 5C8BB 2QDGA 4D6GA 5DO8A 4A22A 1WDWA 1BTMA 1EC9A 4H04A 4NZ4A 4BA0A 3A12A 1TV7A 3T07A 5AY7A 1TPDA 3H8AA 4DJDC 1OZMA 3VE7A 2D2OA 3NCOA 4UFHA 2ZE0A 3FA3A 3HPFA 2O9OA 3HJEA 3WLNA 3FGCA 3CASA 2FZBA 5BXPA 1IWBA 3WLIA 2V30A 4IL2A 5DXYA 2ZZ1A 4LJ3A 1A5AA 2A3HA 1FOBA 1IHIA 3GVVA 1QHZA 3W84A 1UASA 1CNVA 3IK4A 2PDHA 3CWHA 1KKRA 1XGZA 4N9DA 1TTPA 4JX6A 4HNUA 3AXKA 2H6RA 5LIYX 3SUSA 5JVLA 2WPGA 4HTBA 4O54A 3H2AA 4ZQOA 1VRXA 4LQ1A 1F3EA 4AD5A 9RUBA 2Y2WA 1EL3A 3AS0A 1M04A 3HPAA 1PUDA 4IGMA 3C8FA 4KRUA 1HKJA 1X1NA 3TNBA 3KL3A 1R2RA 4HHLA 3NG3A 1Q85A 3UWUA 3NSNA 1E4MM 3KUMA 1QTWA 2OTDA 1FH8A 1RBLA 3L9CA 5AB3A 3WUFA 3SY1A 3LY0A 3UVIA 2REQA 3V75A 2Z26A 1CPUA 3UWEA 1LWJA 1QPRA 3WN6A 4A8NA 2YDSA 1L6FA 1J12A 1CXIA 2HE8A 4IUGA 1WKFA 4FI4A 1EDTA 1XRFA 2IPWA 3N13A 3STFA 2V5BA 2E6FA 4RV3A 2YGYA 1R46A 2HV5A 3TYDA 5C55A 1TJRA 4HA3A 3OP2A 5F4WA 4MJZA 1LOLA 3WBYA 4R7JA 2C19A 3WEMA 3GNXA 1I0DA 3MYPA 4QE1A 5DBUA 3HURA 4QCFA 1F6KA 1SZNA 4UC5A 4FIRA 3WL0A 4REQA 5D09A 4NZ1A 4EWND 3BW3A 2GK1B 2ISFA 3N19B 3OGRA 2QCLA 4MNLA 3GQYA 1QPNA 5LKYA 2X2YA 1QHPA 3REQB 3PZTA 3RX4A 3VD9A 3IEBA 3CUHA 1C92A 1FWFC 1T7LA 3HF3A 1RA5A 3ABRA 3G77A 4IJCA 2EPOA 3TTYA 1HJSA 3SFWA 4E4FA 3WLHA 1ODZA 6TIMA 4JQ2A 4DUWA 3NL3A 3QMSA 4LAUA 2PWDA 3OZMA 1XV8A 4PBEA 1YMYA 3TW9A 2NUXA 1GQNA 1VIZA 2QCHA 2ABAA 3H23A 1R6WA 1EXPA 2PS2A 2ATMA 4W86A 5LNUA 1P0NA 4Y9AA 3MBDA 2OWXA 2CHOA 2X09A 5CZSA 3WEOA 2QJHA 4L1XA 2A7NA 3VKAA 4PRTA 3HQ1A 4Q4PA 1ISYA 4JIRA 3W6LA 3CPUA 2VZVA 3CLMA 3RNDA 2P76A 1B3YA 4NUWA 3LRMA 4V2XA 2GSEA 6REQA 1ISWA 3DYMA 3SM0A 2G97A 2HXUA 3QGVA 7TAAA 3W1RA 3MHUA 1W56A 1KFJA 1IEQA 2QV5A 4UFJA 3CMJA 3QV9A 1YKWA 2C14A 3R8HA 3IJ8A 3VKDA 3H24A 1RY8A 5EFFA 2VUNA 4GY1A 2ZQ0A 5KZDA 1WKYA 2ZZ2A 5GQBA 4F2UA 1K3UA 3CIVA 3PUOA 4LVGA 3S47A 1OBAA 1QAPA 2ZZ6A 4HHPA 4GXPA 2ALRA 1VFFA 2NV2A 4QXIA 1C29A 1K8ZA 5GPRA 1TR1A 2VGBA 4IG2B 3B8SA 2HWGA 4IJRA 5CG0A 3S2MA 3H2MA 1KRCC 2P8CA 3DIPA 4GUHA 4ZQMA 1UC5A 2XM1A 5BRBA 3M0IA 4Q32A 1EEPA 2X30A 1XBVA 5TBOA 4XAFA 1W5OA 4ALDA 3GR8A 2HNEA 4XTIA 1B1YA 4FEZA 4DI9A 3NQVA 1ECQA 3ARYA 2C3ZA 1HKKA 1VFTA 3V7PA 3AYSA 3GHSA 1ZP4A 4JR5A 3OPSA 3LHWA 3VOGA 1SO6A 3SCQA 4DJDA 4M81A 1C8YA 1D8CA 3NQGA 3LI0A 3P81A 4WVXA 4R34A 5M5DA 5CKSA 1NQ6A 1GEHA 4AB4A 2I16A 1MMFA 3LSBA 2RAGA 1HJQA 4AY8A 1RPXA 4QS5A 3MV01 3NO5A 1KXTA 2ISVA 2WCGA 3LGEA 3UYIA 2X7VA 1R38A 4Y9NA 4EVZA 4C90A 1IXQA 2ZX8A 2DJLA 1YDVA 4MWAE 4K36A 1C90A 3M4HA 3LXCA 3D3AA 3S0CA 4FLRA 3S9YA 5K9CA 5A6SA 2E4TA 3DENA 3WQGA 4XAYA 1S5WA 4GZJA 2ZZ5A 4IPIA 1VP5A 3EOEA 2YL6A 3MO4A 2FMNA 4EP8C 4DB7A 5CSYA 4TVDA 2YZ5A 1H5VA 2VFHA 4JFVA 4O4VA 2QPSA 4H9VA 1F2JA 3FYOA 3APGA 4ZODA 1V02E 1VBJA 4HSOA 4DJEC 5KEZA 3VVGA 1PSCA 3L65A 4HA0A 1VKFA 4DYKA 4YTTA 3MSGA 3CV6A 4HD5A 2Q8XA 2GK1A 3D0CA 1QPKA 4GD0A 3VGDA 2FLIA 1Q6DA 2ESCA 1JF5A 2PDNA 4KWSA 5DN1A 3EB2A 4CCZA 1GONA 2YDRA 4IFRA 4MAZA 3UY7A 2EBNA 2R14A 1OFAA 5D30A 4M51A 3HPXA 3UXAA 4O57A 3NSXA 3DEQA 4ZQRA 3VNMA 3RPMA 1W9UA 5FEWA 5GJNA 3WDRA 2GVJA 4UMBA 3DG3A 3NR0A 3W29A 1CXHA 2PWVA 4GYJA 2H9AB 2QZRA 4R27A 3UXDA 3W83A 3LD5A 1XWYA 2RGLA 1FP9A 1TJPA 1L0PA 1DJHA 1ESWA 2V8ZA 4FALA 3U7VA 1M5WA 1XF0A 1BYDA 1YDYA 1G6CA 1LRQA 4G8TA 2WM1A 3V36A 2A6LA 4Q4MA 3L2IA 1H62A 1Q7MA 2CLPA 2B0MA 3PJWA 3ZLFA 4UTIA 4F9DA 3WD4A 4Z17A 3T2QA 4GVHA 4UQBA 4EOUA 1IXPA 1FUYA 2PODA 3NFUA 4EPDC 5C5YA 3NAVA 5EL1A 2XHYA 4D6JA 3KM8A 2WCAA 2QHAA 5I07A 1JI1A 2FZ8A 3PSVA 4V27A 3TQ0A 5BYWA 2CW6A 2IS7A 3EAUA 2ZA3A 5JXQA 3M9YA 1KR0A 3MHFA 4LS0A 5LYRA 1SM9A 3CBWA 4M6UA 3WENA 2XISA 1E72M 2G50A 4ZO8A 3TCSA 4HIBA 1S5NA 2Z28A 1Y5VA 2ZADA 2ZZ7A 1V03A 4ORMA 1VR6A 2OOFA 3W28A 5IOBA 2VZTA 2V5DA 4IG2A 5I78A 3VD7A 1KM4A 4TTGA 4QX4A 4QAWA 4Q7NA 2V38A 2ZRYA 4UTLA 4O12A 3BANA 2X7WA 4ZB0A 1TIMA 2E8YA 2HVMA 4RNHA 4HNCA 2D20A 2P53A 3UW6A 1K9TA 4XZLX 3DC8A 1KTCA 4N0RA 4H6KA 4XQ6A 1JDEA 3BW2A 3M1ZA 4HK7A 1F3XA 1QXLA 2HE5A 2V5JA 3NA8A 2J25A 3PNUA 1S5TA 1R0MA 3GU1A 3TJ4A 4LFYA 3L12A 4UOJA 4QG6A 3OA5A 4NASA 5A1AA 2DSVA 3UF9A 4DX3A 1OYCA 3TQVA 3EOLA 3M41A 3O16A 1AODA 4D72A 3NQFA 5EKYA 5C6MA 4AEEA 4JIIX 1WO2A 2OZ0A 2IQDA 2NSXA 2HCVA 1R87A 5G1MA 3S2LA 4YL2A 1Z89A 6CGTA 1DJNA 4EF9A 3ME3A 2BXVA 3PK7A 4PMUA 2BOEX 6TAAA 1F4AA 2JGQA 1PKNA 4IMFA 5CSRA 1QI2A 2V2DA 2UY3A 3IJIA 3UJSA 4RXFA 2Q3RA 1YBQA 2B81A 1LT7A 2ZX5A 4ZE4A 2CLOA 2J13A 4P7QA 3QR0A 3T2PA 4ZEPA 1RJPA 3UJ2A 1U1UA 4PULA 5FL1A 1V4YA 2OEJA 4E2VA 3VNZA 3A6OA 3AMLA 4FA3A 2WO5A 2DIJA 4GUGA 4YYFA 3DG7A 3W7JA 4B92A 1TSIA 1Q63A 1IR2A 2DT2A 2VC5A 1UD4A 2VGGA 3Q94A 3I10A 1VD6A 1E1CB 4PL1A 1M7XA 1F61A 4TV6A 1W9BM 3L2MA 4MUPA 2B7OA 3VGHA 1TPUA 1ZJIA 3FDKA 1F76A 4GO9A 1FFRA 4W89A 5LNRA 4JPGA 1BG9A 3CMFA 3DC0A 4JTDA 3LQGA 3G1SA 3HIJA 4GO8A 3GIYA 1V51A 5G4HC 1RJRA 3HTWA 3JS3A 3VZZA 1N8WA 3OOQA 5BWAA 4Q4KA 5DCDA 2DT1A 3AZTA 4UXDA 2GQAA 1HQTA 4O14A 2H9AA 3QLDA 2GVLA 1PWLA 1TE6A 3AMDA 3A47A 4DJEA 5E93A 3ALGA 3WF4A 5HBFA 4X61A 2VZSA 1VENA 2J75A 3ITYA 3AJXA 1DTUA 1TPWA 2GUYA 1HGYA 2HS8A 3WQPA 4PMXA 1ADSA 1MDLA 1NDZA 1W5MA 4US5A 3G8EA 4MZ1A 4F0KA 3B0XA 4I9MA 2A79A 3EWBX 4NJIA 1ZPTA 4MB1A 3TDFA 2R94A 2JIWA 5HMFA 5TD4A 1VJZA 1LDCA 3AJ7A 4HK5A 4PTVA 1DQXA 2Y1HA 4HP5A 1E56A 1DIKA 1H60A 3WMBA 3W1UA 1OHLA 1H49A 2Z1KA 2VWSA 4Y9OA 1EWDA 3NNTA 5I3HA 4CQCA 3SDOA 1W1B1 1JNDA 3ZT6A 4K39A 3PS7A 3XIMA 3S5OA 3W1NA 2J8FA 3IIXA 4L7ZA 2CCRA 2X2GA 4QSFA 2OVLA 1DXEA 1CIUA 2WSKA 3MDWA 4W9TA 1EGVA 3PTDA 5B80A 1T8XA 4WJ8A 3W7OA 1F5ZA 4E4PA 3QY8A 1PZ0A 5KSWA 3GXIA 3RRAA 4GRSA 4Y96A 3FK4A 2POZA 2VR5A 5CSSA 4C6CA 1TPC1 1JPHA 3R43A 2IUZA 3CL7A 1DWGM 2WMKA 1FBAA 2FKPA 3TYZA 1QNVA 1SJAA 3KCJA 1A0EA 4CNPA 1OX6A 1UWRA 2JIEA 4NAEB 2J7GA 4D1JA 3S5SA 1I9CB 1A0DA 1YRRA 3WD2A 3AU6A 2CZEA 4JTUA 1Q6EA 2WNWA 4KWWA 3OVRA 3ITVA 3ZO9A 2F61A 5TAOA 1AG1O 1W31A 3PUGA 2EPHA 1CGYA 3WD1A 1OCNA 1TCMA 2VFFA 3NOYA 4IPLA 5I3FA 3O2LA 4U10A 3BO9A 2VEFA 3E5PA 1SVDA 2EAWA 1M7PA 1DL3A 4O0KA 4QLKA 2Y24A 4M5PA 4W8AA 5BW6A 5J8LA 1Z6KA 3A9BA 3QPZA 1MW0A 3F2BA 3CT7A 3KL0A 1B3XA 2MNRA 2X16A 5CPMA 1Q6FA 2F9RA 2PC8A 2AAMA 2Z25A 3MC5A 1HL8A 4JYEA 3VDBA 2TODA 3W38A 2VL4A 2V3FA 4JKMA 3B9EA 1EGZA 3GXMA 3K1GA 4TX9A 1QBBA 2NV1A 4E5TA 1E1EA 3R89A 5D2WA 3WF2A 1W5PA 1V6XA 3NEVA 4H19A 2EPKX 3NVTA 3V1HA 1UH2A 3GZAA 2J4GA 5JBDA 2VEIA 3OBKA 3KBNA 5H6HA 4B4HA 4DNMA 5HNNA 2VGFA 3R7MA 1N8FA 1Z32X 2YB4A 2BWGA 3VIJA 4OECA 1UQYA 1US0A 1RP9A 2J24A 3PWGA 3AIVA 2Z7GA 4BQ5A 3WFAA 4DXVA 5J5DA 3UWYA 1MEHA 2DSUA 1DPMA 3BLLA 3ITTA 4FNRA 3WF3A 2NQZA 5HNUA 2BHUA 2UBPC 5XIAA 1M6JA 1RQBA 2WMHA 1A47A 3SBFA 3U6WA 2NQLA 2HQAA 3NO1A 2HZGA 1UR1A 4BEUA 4GYPA 1KBJA 3RLUA 4IJBA 1DWHM 2JKAA 1W3KA 3B0YA 5ABFB 1M03A 2QDDA 4JIPA 3DFTA 1JZ8A 1P7TB 4OTKA 1FY6A 3DI0A 3CQ0A 3W2MA 2GWGA 3V18A 4O1BA 1W1TA 2XIQA 3I6RA 1ZGDA 3C56A 4JICA 3EBVA 1CB2A 4UMCA 2VM8A 5EMKA 1GOWA 3THDA 1V7AA 3HGOA 1E71M 4NNBA 2FGBA 1QW7A 2QCNA 3IJ7A 2WOQA 3F1QA 3VZYA 3MSRA 3KTCA 4ROQA 3WQDA 1V3MA 1WBJA 4XD5A 2YDQA 3IIVA 5JBFA 2HPIA 3GC5A 4WQ6A 3HG2A 3O8AA 3UPMA 5JH1A 1GVQA 3PNZA 3SY8A 1A49A 2C79A 1AMKA 4J7RA 4CCEA 3AXHA 1ITUA 2W6RA 3BAXA 1JRCA 1KR1A 3WDQA 2P5NA 3NQ7A 3SUTA 1BHGA 5HPOA 3GE7A 4Y90A 4KMQA 4ML9A 2BP1A 1D3CA 2O56A 1B9ZA 4K37A 2YCLB 2WZEA 3LHVA 4C91A 1ENUA 4Q8MA 4L9YA 4DUXA 3M6YA 3VGEA 1BXNA 4Z2IA 4ML4A 1SO3A 2NLIA 1VEMA 3NQEA 1M9HA 3QQWA 2ZZ4A 1XR2A 1XLJA 4FNQA 5FESA 1BXCA 4KCUA 2FJUB 2JQXA 2QJJA 1V3HA 2OT0A 4BCEA 3T0TA 1V93A 5LIXX 1UP2A 4AX7A 1TMLA 4XIMA 1MEIA 1OFRA 2VC9A 4DF1A 4HSHA 1XP3A 4I3GA 1WZKA 2J47A 4I5XA 4DI8A 2XIMA 3QHNA 1BGAA 4UTTC 3WCZA 3ZSSA 4XZHA 5I24A 3BJSA 1X97A 4QDMA 3B8IA 3GIQA 1X8FA 1JPDX 2V67A 4GQRA 1H0IA 4NAEA 1HKWA 2PB1A 3WQWA 1UZDA 4Z2JA 1GYLA 1XLAA 1PAMA 3IACA 4FK9A 3GVRA 1EIXA 4AHPA 5JIPA 5I3JA 4I9AA 1JXJA 1NAL1 3CLWA 1HKIA 2A0NA 3PSWA 1BWKA 3LM7A 3GH7A 4WDWA 3HPSA 2OLSA 1H1YA 1XLKA 1G7VA 1RP8A 4FX8A 4ZZ9A 2BGSA 1P1XA 3B04A 4QG9A 1YPXA 1SU5A 3F2DA 3AS2A 3BV4A 4M56A 1SGJA 3TONA 2XN2A 4B5XA 1YIXA 1LQ2A 1W2PA 4PCPA 4G1KA 3RR1A 1A0CA 2JFEX 1SR0A 1E3ZA 4C6PA 1VLIA 3GNPA 1IIHA 1XIBA 1UD2A 3WQ4A 5JBEA 1WYIA 3WBWA 3KDOA 4B5NA 5CZJA 3MQTA 1OWQA 3TW6A 2YJQA 2ZOXA 3PJXA 5KZMA 1X7IA 2D2JA 4UFIA 2FZNA 1L6YA 3S1GA 3MBFA 4ZFMA 2QPUA 1GT8A 2WB5A 4QJ3B 4O16A 3UZZA 3MI2A 2ZXQA 1PTDA 4LXFA 3QGKC 1TA3A 1MVYA 3AIUA 3QZAA 3NSMA 3R79A 3DGBA 4HYVA 1WA3A 2V3DA 4QGCA 1JDCA 3RR4A 4E2OA 1S3HA 3FHAA 1CGUA 5KZEA 3H54A 5M3WA 2PD9A 1Y65A 1C91A 2PDGA 5C2GA 3S2NA 4U5IA 2H3BA 2YL5A 2VHLA 2VEKA 4H4IA 3NZPA 4L65A 1FCQA 1A5NC 1SZGA 4K38A 3LGDA 2O55A 2G8ZA 2C1HA 4FXRA 5HK4A 5DBTA 3OQ8A 3QYSA 1KTNA 4QJ5B 2NWRA 5ABFA 1BQGA 3RM9A 1L2UA 2OGYA 1M41A 5AC7A 1W17A 1P7TA 1DP0A 3OVGA 3CL8A 3CHVA 2CESA 1U33A 1XIMA 5EGRA 1DVJA 3DFSA 2GJPA 3LCGA 4WZHA 2YIHA 2DIEA 4K6AA 4J3ZA 4AD1A 1S46A 2YCIX 4C5ZA 1H50A 1R9ZA 5GNZA 4NYUA 2Z1VA 3A64A 4Z0JA 1OINA 4DF0A 3MKKA 3QMRA 2G3JA 3MUIA 9XIAA 3UXIA 3NEHA 4QROA 4BQ3A 3GRIA 5D9MA 1H63A 2XSBA 4C6BA 4U4MA 2TPSA 3PZGA 4Q8VA 2ACRA 9XIMA 3LU2A 5KINA 2XFRA 3SRDA 2CLHA 1GOIA 3VD4A 4NYYA 1XW8A 4GH1A 1R9YA 3VOFA 1JZ7A 3K8MA 3BAWA 4OQVA 4TO8A 3DFHA 1EJRC 3NPVA 2I9UA 4MJMA 3FFSA 2W79A 2YCLA 3MKVA 3FVDA 1JCXA 1QOXA 1QNQA 3G1AA 4JTHA 4KWUA 1DXFA 3STGA 3N1AA 3CGTA 2W5FA 3WLSA 1RA0A 1CENA 2UWFA 4WXZA 3KWSA 3C2EA 2X42A 1MW1A 3PFRA 1E6NA 3UXLA 2VELA 4PMQA 3O63A 1F05A 5ABEA 1PPIA 4TIMA 6A3HA 1CYGA 4WK9A 1EKOA 1NJJA 3AYVA 3AFBA 3CUXA 2DJXA 3IJ6A 1GQLA 2XFWA 3I3EA 1HJXA 3QW4B 1BAGA 5H8MA 2RUSA 2WAGA 3R4IA 3M7WA 1E9ZB 3HM7A 4AWUA 3TXZA 4NJKA 1H5YA 2P3ZA 2WBKA 3VYLA 3ARZA 4IIEA 4YVXA 2DU2A 4LT9A 2GDVA 1NTHA 4FNUA 4D8ZA 2OZ8A 1N55A 3RRXA 5C0QA 1AH4A 4JQAA 1X1OA 3IWPA 2WVSA 2BXYA 2DUXA 3VMPA 3BJFA 2KX9A 2YBVA 3ZT7A 2BNJA 3M5ZA 2QEZA 2H8ZA 1UKTA 4AYSA 4Y9PA 2QCCA 1H7XA 1KO0A 4A35A 3ZFHA 4AEOA 4Q8PA 4Y7EA 3IGHX 1KBBA 1E6XM 3TROA 5LA1A 1E43A 1EF2A 3TA9A 1DIEA 3I3DA 4NNAA 2CHRA 1W6TA 1Q7QA 3SADA 4XSLA 2NLYA 1A4LA 1W5QA 2PGEA 3APTA 1FH7A 4XZ9A 3V0UA 3HA1A 1JGMA 3CQHA 3SZ8A 5C70A 1YQ2A 4GJ1A 3OG3A 1E0XA 4WSKA 4GX9A 1ELSA 4POCA 3PZQA 3BJTA 3M07A 3LUTA 1XRSA 3WLOA 3GKAA 3IGUA 3M43A 4NI3A 1QPQA 1HJWA 4F40A 5ECUA 1REQA 4MZ8A 2PCQA 2FHBA 2P0OA 2B7PA 4TV5A 4NSBA 1GYMA 2R1PA 3GSMA 4DAIA 2C6QA 1KRAC 2W27A 3PZVA 3QC3A 4DEFA 2ALDA 2PF0A 1UJQA 1AMYA 1OZQA 1GHSA 1JPKA 2VX6A 1UHVA 3WLRA 4PSRA 2QJGA 4AXKA 2BZNA 2Y5JA 1IIGA 1QO5A 2FH8A 1BYCA 5A95A 2A2IA 4MVAA 5CZ0A 3WLPA 1FWWA 2CKSA 4QDWA 5BWFA 4P8WA 3OZPA 1POJA 5KMYA 2I17A 1G7UA 4UR7A 3CU2A 3TC7A 3ISIX 2WZIA 1BKSA 2HSAA 4LALA 4CNTA 3LTYA 4LEQA 4MJ4A 1UB3A 3POCA 3GVGA 2WJEA 1CWYA 3VGGA 3HQNA 3AUOA 4A3UA 4BWLA 3UEQA 3TTSA 3T42A 1P6BA 3NTYA 1EHAA 1OX5A 1GQKA 4EAMA 3K13A 3ORWA 3ZVIA 4YVVA 3VU2A 2QGYA 4RZBA 4EWJA 1NFBA 3H21A 3A3XA 3LCHA 2Y8UA 1QT1A 3ONBA 4HT3A 3BOXA 3GS6A 2NQ5A 3H2CA 4WOQA 4LBRA 1HW6A 3TN5A 1KQYA 2G4FA 1QPOA 1JJKA 3HG3A 1ZLPA 2E25A 4B5TA 4FF7A 3VX1A 2PLCA 3ZIZA 5HR7A 1K7EA 1F07A 3K2GA 1VFLA 1MXDA 3BSMA 4UOZA 3KTSA 3HB9A 4O1AA 1DE5A 3E0VA 3G22A 1YNQA 3RO6A 1XFCA 5FJUA 1GW1A 4ICCX 3Q37A 2YB1A 3G2GA 3F4NA 2F2HA 2J62A 3APYA 4ZTYA 3TWBA 5DMYA 2ZE3A 3CUZA 2HRWA 4B2DD 2IPFA 4X63A 1H0GA 4X3ZA 1FWNA 1T40A 3LI1A 4FOUA 3VKCA 3PBYA 2QIWA 4JKKA 4W88A 1EP1A 4IIFA 3I68A 4IMGA 1XUUA 3GX9A 4P8VA 4I9TA 1Q5MA 4YXGA 3P8JA 4FHAA 3QSRA 2Y7DA 3SGGA 4LTSA 4YTSA 2YYTA 4Z2KA 1V3LA 1WQ5A 2ZXAA 2DQXA 1XIFA 3AIRA 1XQLA 5DMMA 2QUUA 4AEFA 4CD8A 1XPGA 2NXGA 4D6FA 3VKJA 5HMSA 1XYBA 4KGJA 4DWSC 2OYKA 4PTWA 4F4RA 1OC5A 1B30A 2GGIA 3PPFA 3B9NA 2DFAA 2ISWA 1MO0A 3PBUA 5HQLA 5FF3A 1PXGA 3K4WA 3O0FA 4IIBA 3SRHA 1KXQA 1EQCA 2OLAA 1G69A 4MFDA 1XSJA 4Q8QA 1OIMA 3BG9A 2OODA 1B57A 5FL0A 4UBPC 4XWUA 2HK0A 4S38A 5DCBA 3DFNA 3LLXA 1FVPA 2PUZA 1WXYA 5BCAA 1O5XA 2V69A 3U48A 3BAKA 2CITA 1UD3A 3MANA 1BWLA 4TUFA 2PCEA 4W85A 1BGGA 3F5JA 4JDBA 3RCMA 4H1ZA 5CJ5A 1FKWA 3UWWA 4A2RA 2OOGA 4XUYA 2A3CA 3WBAA 1W0MA 4ZSUA 1JAKA 4UTWC 4P61A 4HYRA 6ENLA 4ZO7A 3TVAA 4XSMA 2NSOA 4IH3A 3VC6A 1OYBA 1YE4A 1DQWA 1OF6A 5D03A 6XIAA 3W75A 5D04C 3PTMA 4RZ6A 4FPSA 5LHFA 4PEEA 4ZVJA 1W3HA 2WQDA 3QN3A 1U1JA 1S2AA 5C2CA 1RD5A 5A8PA 4C65A 3WF0A 2YSWA 4WXYA 3A4WA 2PDYA 4QLJA 3TMQA 1TMQA 3FEQA 1H7WA 4GK8A 1J8VA 3FIGA 1M7OA 3LEPA 4IICA 1EUNA 4ZOBA 2J6VA 2WHJA 2PZNA 3KRUA 3BCJA 3R12A 3WUEA 1O60A 1PKLA 3I7RA 3IRDA 2DZTA 4PB4A 1GOQA 1MW3A 4AY1A 3B9AA 4OVXA 1DJYA 3H2EA 3PC0A 2JK2A 4DF2A 1B4KA 1RK6A 4DUOA 1KFCA 4Q8WA 1CGVA 1UR3M 3TSMA 3ES7A 5F4XA 4W8BA 3CO8A 2HPMA 4L5ZA 4D2JA 1XYMA 4S23A 3O6CA 3NQCA 2C15A 1OX4A 3BARA 3K4DA 1R3RA 3CAWA 4XAZA 1P0DA 1TUFA 2E67A 3AIEA 1UCWA 2VOMA 3OU8A 4UQCA 1GKQA 3O6DA 4B16A 4GMEA 4K68A 3SUUA 3G1FA 2WVUA 4UZSA 4JL2A 1XIHA 3A3WA 3UZ5A 3UR5A 4M1RA 2BGNE 3HMCA 1YTEA 3WELA 2XH2A 4NG3A 1PIGA 3R0KA 4IM4A 1U22A 1UIOA 2PGWA 3N18A 3G1HA 3P3BA 2UV8G 1OFBA 2ZX9A 4I7UA 1FFQA 3OHIA 1XC6A 3QV8A 4GNJA 3T9PA 4Q4SA 3KTXA 4GIYA 3L7RA 4ILSA 1DIDA 1A5KC 1PIIA 1GG0A 2ISDA 4MNKA 1I2RA 1KFLA 4LUIA 1LF1A 4GLEA 3EMZA 2PDCA 4DBSA 3DFPA 1SJCA 4LB3A 1GKPA 4O18A 2R1MA 3GNOA 4J3UA 4KT2A 2CLIA 4RLIA 1QW8A 4PODA 3S1WA 4KIRA 3C2RA 3THQA 3VK5A 3GB6A 2WC4A 2PGRA 3E6EA 3GR7A 5IRPA 4JTRA 4IHCA 1U1HA 4DPPA 3NXFA 5ECVA 1X6LA 3TXVA 1RCQA 5L9FA 3MP4A 1UPMB 1UWIA 3RXZA 5M03A 4N42A 2INEA 5D9NA 4WDUA 1EUAA 3AALA 3UCCA 2NXHA 3ARVA 3ZSTA 3NO3A 5MHBA 1ADDA 2SFPA 4M1BA 3HJZA 4HQVA 5EMUA 3BSGA 4ZQNA 4JNZA 3HU7A 4GVFA 5AVNA 3URAA 1ZP3A 3G0SA 3CHEA 3NGFA 5FCZA 1I6NA 3E2QA 3IGSA 2CLFA 2BLEA 3U4AA 3UY8A 4MMWA 3UR8A 2XDFA 1Q4NX 1Y5WA 3W82A 1BF6A 1UR0A 3CC1A 4HU3A 1O6IA 5HJLA 5GNXA 4HNLA 3T40A 4BKNA 4HCHA 2A7PA 1KWGA 4OJYA 4J5NA 1VS1A 3PULA 4L6DA 3B3DA 3GW3A 4JQ3A 1WAWA 1EJWC 3WX7A 2VKZG 4KCWA 4LC8A 4EPKA 2QLYA 1C7SA 3C0SA 4KERA 2OO0A 3MSDA 4WDTA 4AUBA 1CZ1A 4IMEA 4HNNA 5HA7A 1Q3NA 2BG5A 4C6EA 4PB3A 2GVGA 4C1LA 2RDTA 3F4CA 4HK6A 1J2WA 3N17A 2XZ9A 4H9MA 4HNOA 4LCQA 3QPEA 3C86A 2QT3A 4LYPA 1S39A 3CT2A 3PWAA 4FS9A 3P5YA 3NQ2A 2GGGA 3N2OA 4DJFC 1MXGA 1XLCA 3GG0A 1ZBCA 1RCXB 3U4FA 1HF6A 2I5GA 3BAJA 3NDOA 4QJ1A 5FSEC 1E9LA 2IQTA 5C71A 1ZAJA 2BXZA 3D3FA 3C8NA 4LYQA 2QKFA 4TMBA 5LNWA 3DAQA 1KW1A 1Y8BA 1PKMA 7ENLA 3IK2A 2R82A 3AXXA 3WKZA 1HVXA 3A23A 4B3KA 4XD3A 1F6YA 1SW3A 2QF8A 1J5TA 4DZIA 3AS1A 2BHYA 3FN9A 1L9WA 3L4XA 3Q2DA 4UMAA 1TV8A 3UWQA 3GXPA 4JNMA 5HNRA 1J9YA 2VX5A 1HP4A 4G7FA 5AZ1A 3FY1A 4M8UA 1FKXA 3W53A 3TLQA 2PTYA 5LXXA 1LBMA 2WYSA 1SSDA 3O6AA 4MHBA 4Q6XA 4DJDD 3DESA 3MZNA 3MJMA 4Q3MA 3MDUA 2CHNA 2YLAA 3SY5A 4HJFA 3UETA 1SFJA 4CQAA 1K7XA 3IRSA 1BEUA 2OEKA 1DORA 3G5EA 3RX3A 4WD0A 2E28A 3KOYA 3LHZA 3R11A 3QW3A 2IXVA 4PRWA 1DV7A 2RJGA 1H7PA 1J0JA 4UQAA 4LS1A 4K2SA 3TC6A 4QHRA 3PZNA 1JYWA 4R9OA 1L6GA 1TTIA 1AQFA 4HU0A 3U5YA 2VDHA 4ZE5A 3G1DA 3GXDA 3N12A 3H6OA 1ZJBA 4UQ9A 3AAMA 1CTNA 4DYEA 2W91A 4OU1A 4FNTA 3P8IA 1EWEA 2D0FA 3TA6A 8XIAA 1VZWA 4JL1A 1K02A 3EA3A 2BBFA 3CB8A 3EEZA 4RE2A 2E5CA 3UNDA 2WV8A 2F38A 1UIPA 1RV8A 5TF0A 3PBMA 3TZFA 3H2NA 4LU0A 3WDPP 4FLSA 1TV2A 1NWTA 4L9ZA 4OGZA 1E70M 4BZYA 1VBHA 3TQKA 2O4MA 3ARUA 3L23A 1ZFJA 1OG6A 1GPWA 4MB4A 1Q4WA 1EJUC 3URQA 1A5MC 3AHTA 3MI3A 2Z6JA 1TX2A 2BDQA 2JE8A 3NPUA 2YBTA 1HX0A 4PMNA 2VEPA 3OB8A 4I6KA 4MKVA 4PUUA 4EXQA 5BOOA 3AHVA 1R85A 4NT0A 3LCWA 5C9RA 3N14A 4X9YA 3MMTA 1WNOA 3ITCA 4E6MA 1EOMA 1E4IA 2GJXB 1QBAA 1VHCA 3THUA 4AZCB 4OBRA 1KLZA 4P5UA 1NY1A 2CXEA 3THCA 1S2UA 3O15A 3LCFA 2VURA 2VYOA 2VFGA 4YLWA 3ZJ8A 3ZT5A 4TVUA 3LGGA 1XD0A 3GO2A 1ZCOA 3N2MA 4ACYA 3KBVA 1DHPA 3T1GA 2A7RA 1FXQA 3WNLA 4MKSA 4JXCA 1VRDA 3RLVA 3BG5A 4N9BA 2HDJA 1U5HA 1PYMA 3RJYA 2WJFA 3P74A 1WPCA 1JIBA 4Q8NA 3NJ3A 1Y7VA 3N2BA 1JI2A 4J3XA 4AVOA 4L1WA 4R3UA 4AFYA 1AQMA 5CPQA 1QCWA 1BWVA 4S3CA 4NHVA 4AD3A 1VPXA 1EXBA 1SJBA 4B4FA 1X1ZA 1EX5A 4R85A 2ODOA 1JXKA 4TR9A 3CZLA 4M82A 4YYCA 1R8LA 4DZHA 3WQ8A 1OGBA 5CPLA 5HWNA 1K8CA 1IZCA 1LUCB 1UOKA 3BC9A 1JVNA 1FHUA 2EG8A 2IMRA 4JTTA 1F73A 1AK5A 1A5OC 4GHRA 2CZDA 3LK6A 4AZGA 3P0WA 3VIFA 3GHTA 4FLQA 4LAKA 2IKGA 2ZRWA 3TCEA 1H1ZA 4AC7C 3WQOA 1J0YA 3ECQA 2D73A 4DELA 3NQDA 4Y8EA 3PZOA 1Q2RA 4WX2A 3SW6A 3EPMA 8CGTA 1MFUA 3GXFA 4H2HA 1NELA 3UR7A 3WFLA 4GVGA 3H22A 1ZTVA 3TFCA 3RPDA 2R91A 1X96A 3T8QA 1FHDA 2X1IA 2X1RA 4H9TA 5BXSA 2EQDA 2DZPA 1J6PA 1IZKA 4JFWA 2PLKA 3JZEA 3TUUA 1R7OA 3D5HA 5HR6A 5DEZA 3SSZA 4YWIA 4RZ5A 3HMJG 2CKRA 1MWOA 5CBIA 3F5KA 4S3GA 1PX3A 5A8OA 5ABHA 2PWEA 4FXFA 3GG1A 5CPOA 3ITOA 5DX7A 2WCSA 2WC7A 2J27A 3RF9A 3UZYA 3MP3A 3RO8A 1CGWA 4U2YA 1NDVA 4WSHA 3EB3A 1JCTA 2ZICA 3QFEA 1IQ8A 2DV0A 2C1GA 1ALDA 3S46A 3I6EA 3M64A 3DERA 1ZL1A 2Y6ZA 4YN5A 4JNYA 3WMSA 1S2CA 4ZENA 4LVBA 4HPNA 4GINA 3T0BA 4TX8A 3USBA 5LNSA 4CN4A 4XBKA 2CIPA 1XKJA 1H7OA 3LSCA 3GUWA 3BMWA 3A3HA 5XIMA 3BSHA 1JD7A 2NX9A 1XYZA 4GYKA 3K4AA 1C7TA 3CL6A 3GH4A 2FTPA 1KB3A 3W7RA 2EG6A 1G4TA 1OG0A 1V3KA 2O9RA 2H90A 1NOWA 4GIAA 2VOTA 4PCTA 2E6DA 3W7PA 3ZYZA 1YTDA 4YIWA 3GXNA 1KBIA 4XO7A 2CBUA 2GGEA 4CD7A 2OU4A 1H3GA 2DT3A 2NQ9A 1QW9A 3L4UA 3PBVA 2WJDA 4MLJA 3UA3A 3S1VA 4L56A 3I7QA 3ATZA 4KQNA 4JQ1A 3QPYA 3WD3A 5HANA 4OBTA 1B54A 3IV3A 1XBYA 1AVAA 1XPYA 2F7FA 5DCEA 3RJXA 3BLEA 2VX4A 3L4VA 2Z27A 2R1KA 3SQLA 4R33A 4DJED 2PSNA 1QNOA 1MFVA 4EKJA 3BQ6A 4CVUA 2GJXA 4JOMA 4AZCA 1DE6A 1PVNA 4AZBA 3UQNA 1QI0A 3PB0A 5EPDA 4XX6A 4US5D 2YR1A 4YMZA 4C6JA 5FACA 3SCWA 3L4ZA 3ANVA 3PAJA 4GH3A 2VZOA 4IUOA 3NYZA 1K8XA 1XYAA 4O13A 1GZ1A 3B0UX 1YE6A 1GZGA 4NVTA 4JTGA 4RV8A 3VIKA 1XLLA 2CWXA 2VRKA 3ICJA 3EEGA 5AHMA 2OFJA 2DVTA 3LPPA 3BLKA 2WVTA 4AD0A 1G01A 2TYSA 4NKCA 2LLEA 3QM3A 5HJXA 1XCFA 5HXMA 5FD0A 3ARQA 1ML1A 2YW4A 2W61A 1FDZA 5AHIA 3YPIA 3R25A 4JIHA 4YNGA 1Q6GA 1IGWA 3BGAA 4BQ4A 4CEUC 4ATLA 5DY2A 1KM1A 2NX1A 3WLQA 1IF2A 2PI6A 4KS0A 4FMVA 3VNDA 3CZKA 3KWXA 3UZWA 2QMJA 1TV3A 7ODCA 3BWWA 3W3OA 1UPPA 3LNPA 3WQ5A 3UYCA 4Y2WA 1UWAA 2E9LA 2V5KA 4BF5A 4YCPA 4PC8A 2D22A 4WJEA 1JDAA 1NIUA 4J28A 3INPA 3BLDA 4HPXA 1RR2A 1ZBWA 1BYBA 5D2VA 3BQ5A 4FLOA 4JGDA 2PDUA 4IWWA 2TMDA 5BRPA 1S3TC 3LXAA 1XICA 2IPGA 4E2BA 3O06A 5A6BA 4X2RA 2DY3A 3H7VA 3CZGA 2YA1A 3T2OA 4GJJA 4BJHA 2HNHA 1RSCA 5M1TA 1GVIA 1W8GA 2HISA 3QR1A 2QGHA 2WKLA 3F4WA 3W7NA 2QAPA 2G5WA 1DWFM 4OUIA 3VKBA 4ONVA 3QLLA 1TWIA 3A5VA 5HOSA 2RH9A 2PTXA 4GKLA 2V9DA 4AZ7A 1FDJA 4J35A 1GK8A 3E0LA 4RPPA 3GDKA 3AMCA 3W7IA 3N9RA 2NT0A 3SN4A 3KXQA 4A4AA 1DBTA 4LAOA 1KM2A 3B0VC 3EGJA 1LCOA 4PFHA 5BZAA 1HO4A 3PVFA 3M0LA 1AW5A 2VQUA 4K7VA 1ZBVA 3LHYA 5E0FA 5TIMA 1QMLA 3OLEA 1TX0A 4DYJA 3CK5A 4NY2A 4HPHA 1E5JA 1AFSA 5IDIA 3P80A 3CB3A 3HQPA 3LMYA 1DIOA 1JAEA 1SMAA 3SJ3A 4ZSTA 4Q8TA 4W84A 2DGAA 2CETA 2J9YA 4ECLA 1H4PA 3TH6A 2WZHA 1JQXA 1S38A 3MUAA 1WX0A 3CJPA 3WNOA 2J88A 4YWSA 1LWIA 2X1SA 2JF7A 4X0NA 3WYZA 3QMTA 4HPJA 4J3SA 5BU9A 5FAGA 5A8NA 1I2OA 1RPKA 1IGSA 3FX4A 3SRFA 4W7UA 5DMNA 4IIHA 3WQVA 4GC4A 2WANA 3IGXA 2YXOA 1Z7AA 3TAKA 2OQYA 1K77A 1UW9A 1WDPA 4GQQA 5GVJA 1MZHA 3N25A 1KD0A 3IVUA 3L5LA 1DJQA 3MWCA 1XRVA 4H9ZA 3LRKA 1KRMA 3KOFA 1XG4A 4H7VA 2XN1A 4ICMA 4WY0B 4LF2A 2RGMA 4IP4A 4XV0A 4AYGA 4GX8A 1TRDA 1JUBA 5H1WA 3KVMA 4LW7A 3U57A 1O1ZA 3EMQA 3QTPA 1KM6A 4GY0A 3IIZA 3IUHA 2CBJA 2EKGA 3W9ZA 3W00A 3KAOA 4PN2A 4GY7A 5J04A 1MSSA 1V8EA 3VD5A 1YXYA 2OYLA 1Q8AA 4JIQA 4EXBA 1WOBA 3R94A 4U5KA 2J7FA 3NOEA 3QY7A 1XHGA 3M46A 3EXRA 2VTFA 2PMQA 4PMOA 2D0HA 3W1TA 2XVNA 3W2UA 4K7YA 1E0VA 3TJLA 3C2YA 4QEHA 1B0IA 2I57A 3UZJA 2RHGA 1FWHC 3H12A 3BMXA 4HOXA 1VJIA 3W85A 4MNMA 4UCFA 2OLHA 1EYWA 1AJZA 3CS2A 1M3UA 4QR6A 3T05A 2DQWA 4CU6A 3VCRA 2D0GA 3BCDA 1CLXA 1GOXA 4CLMA 1TMHA 3CYJA 1O5QA 1SR9A 1FA2A 2GFTA 4EIVA 2OZTA 5HAOA 4PTDA 4PE8A 2Q3OA 2VCBA 1UBPC 2R24A 2F6KA 2QPXA 1VPQA 4NZ3A 2VZUA 1J4EA 4BF7A 2QUVA 1NFGA 5H8UA 3NUKA 3UT0A 2XN0A 1CB7B 3M0YA 1SZEA 4C6DA 3ABSA 3H7UA 2WWDA 5EYWA 1JCMP 1TV5A 3S83A 4WUIA 2GJLA 3MV11 3PZ9A 5I3DA 1KCLA 1QRQA 2VFDA 1VF8A 1XISA 1ITCA 4O8RA 2BX7A 4HZ6A 3LLDA 3SB0A 3D46A 4PMYA 3UJRA 1R3VA 4XZMX 3W4RA 3F7JA 3BOLA 3PZIA 3OBAA 3A22A 3OZOA 1LQ0A 5D2XA 2BOGX 3LBMA 3EX3A 1BF2A 3H2FA 2VNCA 3UWZA 4QQ3A 3GWQA 3EWUA 3O7UA 3VZXA 3MS8A 4AWSA 3EWWA 2VI0A 5MKGB 3FJ4A 1P6CA 1YW1A 4QEEA 3AIWA 4MWAB 2PDMA 3W6YA 3DDMA 1EQPA 4LAMA 2VGIA 5EY5A 4C1NB 3RITA 3AHYA 1TO3A 4LANA 4PA8A 2VRQA 1PE1A 4UFLA 1QASA 3CZEA 4JY8A 2ZUUA 1HL9A 5FSDC 1JZ2A 4C1KA 3PZMA 1PJ9A 4L80A 2VXNA 5BOEA 3PPHA 2VO5A 4DIAA 5KETA 1X8CA 3KRSA 4NILA 4J2PA 2VJXA 3GIPA 4M6PA 1YX1A 2J7HA 3O05A 1MUCA 3LTPA 4ENLA 4D6DA 2QJIA 4K3ZA 2QW5A 4N6FA 5AKQA 2G3MA 3NQMA 4RXGA 3VOHA 2ATSA 2Q71A 3QC0A 1UH3A 5BRQA 1SFTA 4E2DA 4XISA 3T09A 4KEMA 2FDSA 2GSJA 2V0TA 2V2CA 1V79A 1SO4A 4NZFA 5CAHA 1W1PA 3NQ8A 2WLZA 4XIAA 1NFPA 1VYRA 4NAFA 2XWDA 2F8QA 3CAQA 3VIGA 1P4CA 4TOQA 5A5WA 5U7SA 7XIMA 2AQOA 1UJPA 3V5CA 3WK0A 1FWIC 2C71A 3L4TA 3VIMA 1P5BA 2J7CA 2ZDSA 4NJHA 3IAPA 2F84A 4C6MA 5C54A 4R5EA 4PBFA 3NQBA 4HHHA 3TOPA 3W1AA 1YBQB 4C6QA 3FAXA 4KW2A 4WY0A 1FWDC 4Z2GA 4K8GA 1EA0A 4E8DA 1VFSA 3GNDA 1KBLA 5CQ1A 4NRRA 3PJTA 1TZZA 2OKOA 3TC3A 2XJ7A 3HPZA 4AY7A 4UFKA 4E3TA 3O0KA 1E1FA 2JKEA 3RMJA 1JZ3A 5G2HA 3C6CA 4WR3A 1OEPA 4GI4A 2BODX 4C6FA 2JALA 1I1XA 4WDXA 3W23A 1POKA 5L6UA 2G41A 3ABXA 3OODA 2XU2A 3EOUA 3C5QA 1UR8A 4GFSA 3T8LA 3BAYA 4QE5A 4GUFA 4S2CA 2GJNA 3WK1A 2V5LA 4CU7A 1CEOA 3TNOA 2PDWA 1TQXA 2ABBA 2QJNA 1KNWA 3UGVA 1GTHA 5A69A 2DP3A 1QJWA 5D2YA 4EF8A 3EA1A 4D9PA 2BVTA 4RE0A 1IT7A 1D3GA 3W7KA 3C4UA 4GE8A 3R5EA 3WEZA 3BMVA 4I8YA 2QVNA 5AC4A 2OYMA 2I5QA 3TWAA 4OIFA 4EE9A 4I9JA 1US3A 2YL8A 3RM8A 4GIRA 1NVMA 1KGUA 2OSXA 4XO6A 3UG4A 2PDPA 3T81A 5T9CE 5AZ0A 4GI9A 3W7GA 2TAAA 3SQMA 3GK0A 1WAUA 1XDLA 1PHQA 3CH0A 1S1PA 3VGBA 1G4EA 1V0LA 3IUDA 1OF8A 4Z2LA 1AL7A 4WHBA 4NU7A 4PUKA 2AL1A 1ME7A 4QAIA 3V0SA 1UC4A 2PBGA 2ZX7A 4Q33A 4CQDA 4IXHA 3SI9A 4UTHA 1ISVA 2WKGA 3TEVA 3Q67A 3M16A 3CZJA 1OGGA 3U8GA 1ZY9A 2BV9A 3PP7A 4JTEA 4HOZA 3KP0A 3DHPA 1ISZA 3EPOA 4YTQA 3ZQ9A 2MUCA 4MNJA 3LOTA 3PY2A 2GWNA 4H41A 1FWTA 4Q6JA 1JG9A 2IQ0A 4KCVA 3GHUA 5MKGA 1YTKA 3MSYA 1BG4A 4V15A 1R86A 1Q6RA 3B9DA 2HS6A 1J79A 3HG5A 4MWAA 5FJTA 3N4EA 5CJNA 3AHZA 1AW2A 2P3EA 1JUKA 3WNKA 1DEDA 4C1NA 2DORA 2Z1BA 4FAMA 4LUTB 2YZRA 2CZFA 4W5UA 1HJUA 3GAYA 3JRKA 5D33A 1ONXA 1S2TA 1O95A 3UA4A 4FXSA 4XK2A 3L5AA 4O11A 4Z1YA 3W7LA 3EX4A 5DXXA 1FWBC 1K9DA 4M19A 2WSYA 3JZUA 1KWKA 3SN1A 5FI8A 3FA4A 1V02A 1FXPA 4RX0A 2PRMA 1F9CA 2PDQA 1R2TA 5LHEA 2FZDA 5CC5A 3UP8A 4KCTA 4XAGA 2VR2A 1MRAA 3T0DA 4WGHA 4IMDA 3CO4A 2HVOA 3W22A 1OK6A 4GZIA 2D3NA 3SGZA 1UZ4A 4AHQA 2PTWA 1UA7A 5AC5A 4MM1A 4GG9A 2DZAA 4H7ZA 1X39A 3UZXA 1PDYA 3QF0A 1KKOA 1NWRA 4DNHA 3P93A 4W93A 1J5SA 2ZUTA 1N2VA 3I65A 1EO7A 4NL1A 4DO5A 1JRBA 3L0GA 3TAOA 3BPWA 1O7AA 3CEUA 4GFIA 1XLGA 3VMOA 2B7QA 2EJAA 2HJPA 4RDYA 1Q13A 3NDYA 7REQB 2WXDM 3IS4A 7TIMA 1IWAA 2CNCA 2WNZA 4MY8A 2ZX6A 3V5OA 3MB9A 4GYPC 1GJPA 3KVLA 1JF6A 1R30A 3G0UA 3II1A 2O9PA 3N11A 3M0VA 1EC7A 4ZA0A 4H6RA 3L0KA 4KPLA 4B3ZA 3WMLA 4PL2A 2J8TA 4BR1A 4Q8OA 1P0EA 3EKLA 1RALA 4LBSA 2PDBA 2TRSA 3MZ2A 1PZ2A 1D7FA 3SN0A 2VT0A 5REQB 3ZR6A 3W1QA 1HZYA 4A3RA 1ISXA 1RLCL 4ASTA 5JIWA 3E3HA 3P6LA 1VFHA 4S3AA 5BXRA 1PHWA 4PMZA 4H8HA 5DQPA 2WLYA 1KGXA 2P10A 2Q09A 2VD8A 1FWEC 1IE7C 5CAKA 3E0WA 3NVDA 1XUZA 3LM3A 5C7VA 5EMYA 2Z24A 1GORA 1P1MA 4AHOA 1JZ6A 3EDEA 1XSKA 3B8DA 3G8RA 2ADAA 1L8NA 3GFZA 4ZBCA 2VC7A 3N04A 2OSYA 1N7KA 2ZKMX 1PX4A 2JKPA 5I2UA 2QUNA 4BHYA 5C9XA 1TWWA 1LP6A 2A3LA 2GVYA 5A6KA 2BY2A 4A3HA 1J96A 3QJAA 1EHNA 2G3IA 2OQHA 4YS1A 1BTCA 2PWGA 4PB5A 5IM51 1O4UA 1J0KA 4JS3A 3HBLA 3OTRA 3VM5A 5F1VA 4V28A 2QR6A 2J7BA 4Z1AA 4UUIA 3MUCA 1EP2A 2FZ9A 4W5ZA 3E2VA 1OIFA 4WY0F 1E5NA 3RK8A 3DXIA 3EKZA 4S3DA 1HJVA 3UESA 4DBWA 2RDUA 1B3OA 3A4XA 4UB9A 4TU1A 4DM2A 3TYEA 4EPEC 4CNNA 2ZTJA 1GVEA 2INZA 2WZTA 3VXGA 4OWGA 2I7GA 3W25A 1MYRA 1J2BA 3WBEA 3EZ4A 4MB5A 1GEQA 5EMJA 1LTDA 1OGSA 1WXJA 1K6AA 5CLWA 1P43A 2PA6A 1WB0A 1UR2A 2PTDA 3AQUA 5XINA 3NIYA 5I79A 3EWYA 3T6CA 3PWIA 2YXXA 1NQKA 4QISA 3TTQA 4O1DA 3HZ3A 2Z29A 2ZRXA 3WZ0E 4QE4A 3E2SA 3RMEA 2ZUVA 1EP3A 1UOZA 4LUTA 3W26A 8TIMA 2XIIA 3WNPA 3ERPA 4G6CA 3LPGA 3SSJA 4GVIA 3AWOA 2WNNA 1WBHA 3D6NA 5CCZA 3K5XA 4EAYA 3W74A 4JEQA 5AHEA 2VUYA 5E9AA 1IR1A 1IV8A 1D3HA 3QSTA 1W9DM 3T7VA 1ZZMA 4A8RA 1D2KA 4OFCA 4I7VA 3PG9A 5FOOA 3S1UA 2AGTA 3Q45A 2YLLA 1CXLA 3EXTA 2DPEA 2BASA 3B97A 4B3LA 2OGJA 1X98A 3B0PA 3AI0A 2WSRA 2FTWA 2WMJA 3PBWA 4C6IA 3MT1A 3IIOA 1DTNA 4D6HA 2CBVA 3HQOA 3LS9A 2IKJA 3BK0A 3TYCA 3CQJA 1NSJA 2GSHA 5AOUA 2A3BA 2VWTA 3FSUA 2FVLA 2XM2A 3VCCA 3W2LA 4HKPA 5A6TC 1RCOB 2NX3A 1F8IA 4GA8A 2W92A 1AW1A 1GJWA 3ZJKA 2VRJA 2R8WA 1PBGA 2PWUA 4P7LA 4B2DA 4DZ5A 7REQA 3LMZA 5JH2A 4LRTA 4QNEA 3I4KA 2Z4GA 3VIHA 2J78A 1PB0A 2DZSA 5CXPA 2OKTA 3NL5A 1OFDA 2PEVA 1MNSA 4FX7A 3S3GA 3WLMA 1DJXA 3FCPA 5BOFA 1DJIA 3GZ3A 3N6JA 2ZUSA 2FGZA 1UP3A 2QULA 7PTDA 3QY6A 1TA3B 2WK2A 5F2MA 5C9UA 2QYGA 1R47A 4YTUA 3EX1A 3S2CA 1O5KA 1C9WA 2VQTA 3HV9A 4IIGA 1PO9A 4HNTA 1GZJA 4O1FA 4A21A 1J18A 5REQA 4LSBA 4H8NA 1JUEA 1CW2A 4L6OA 2OG9A 4ADUA 3MCOA 4NRSA 1YNYA 4US6A 3SQSA 1JNEA 1RLDA 3UPWA 3EDDA 2XFYA 4DPQA 2VX7A 1V3JA 4HCDA 2Z2BA 1UKOA 1MQRA 3R0DA 5DY3A 4Z08A 3KRZA 4XVEA 2X0SA 1NU5A 1WZMA 1IEIA 4CKQA 3W73A 4LVAA 1WUFA 5DF0A 1V08A 2E9MA 5DT7A 4OUEA 1EEXA 7CGTA 1S5VA 4NJGA 3TTEA 1SFLA 3ABZA 3NZ1A 2CU0A 1ZJAA 3KOZA 1AUSL 3HV8A 5I00A 4LAZA 1TV4A 4IOTA 3RCYA 1XLBA 1EPVA 2PDJA 1XD1A 2QDEA 1LLWA 5G4EA 4FXJA 1XLDA 3M0XA 1EPXA 2WBGA 4IGNA 3CV1A 4B5WA 3WH5A 2GQ3A 2XSXA 3AMGA 4CN6A 2Y8VA 3N9SA 5AVHA 2EXOA 2E5BA 4S3KA 1TZ7A 3DCPA 2E1WA 3QGAC 4PUJA 2A3AA 4KRZA 4NZJA 1OSEA 1MUWA 4JKLA 4MG4A 2OB3A 3PBGA 1QNRA 3VGFA 3T55A 3LG3A 1K9EA 2QCEA 2J8GA 1WP6A 2HBVA 3CIWA 4DO6A 2F2KA 5I3KA 1HFBA 4LYKA 3PTKA 4OKDA 2EJ1A 3S9ZA 2RFGA 5GNYA 1Z44A 4GACA 2W0UA 4FNPA 4RDZA 1OC7A 5HMDA 3OVQA 4Y9MA 1I1WA 3OQEA 5E9XA 3G1YA 3OYXA 3BZJA 4DN1A 4MDPA 1HT6A 4QDPA 3S5NA 1Z41A 2OQLA 5IHSA 4JHZA 1F7BA 5A8GA 1ODUA 1V6WA 3EDKA 5TQLA 2HXTA 2AQVA 2EEXA 3PPCA 2WSQA 3LCXA 3LLFA 5LA2A 2YA2A 5LIWX 3T0AA 1QR7A 1I60A 1R3WA 1IEVA 1ZHAA 4LUSB 1PKYA 2P1FA 3UG8A 4NX5A 1YYAA 1YHTA 1WUEA 4RNFA 4JY9A 3VD3A 4JFTA 4DWSD 4IZGA 4GQGA 4KEVA 3SCVA 1X6UA 3P2VA 4H6EA 3MCMA 2R9RA 4JZ5A 1GGOA 2D69A 3EWDA 1AJ0A 3PHAA 1FCBA 4AISA 4PZVA 5IBXC 4O0QA 1UWQA 1E55A 1E73M 1OC6A 2Z6IA 1NDYA 1BKHA 4RPQA 1FRBA 5FJOA 2C1IA 2DW7A 4CD4A 2CLEA 4B9ZA 4B91A 3DH7A 4DLFA 5AECA 1UQZA 4O28A 3ZLGA 4QLLA 2E77A 2OX1A 3DBNA 3GYCA 3VDAA 2HBXA 2PP0A 1FCUA 3F4DA 3VM7A 2D3LA 3SR7A 4ZL1A 2A21A 3B05A 3Q4DA 1W8SA 2X0YA 3MPGA 3FXYA 2WSPA 4NI8A 1RY0A 2G96A 3KBMA 1SFSA 3BH4A 1HUVA 1XIIA 1Q6CA 4C6NA 2ZUWA 4OBSA 1W37A 4UR8A 4AC1X 1R9XA 4XVDA 2FB2A 1RAKA 3V16A 3WO8A 3FJNA 3Q58A 3W7EA 4K8HA 3VDCA 4BF9A 2PP3A 4MYAA 1REQB 4BS0A 3B40A 3T78A 1E3XA 3TP4A 1VCVA 2E9BA 3OZYA 3TYBA 1LRNA 2XYLA 2C91A 5K2ZA 4BWLC 2IPJA 3ES8A 1RK5A 3WUGA 5A2AA 2UY5A 3P61A 3VFLA 4HHMA 3VCNA 1LBLA 4ZOAA 4M24A 3SCRA 2C0AA 2Z1XA 4HTYA 2CLKA 3ELFA 3LB0A 3R2GA 3UERA 4Q8UA 3LN3A 3LHTA 1GVFA 1F3TA 1TRIA 1IXNA 4IMAA 5AYZA 4LWWA 5HDRA 3FSTA 4MKNA 3N2TA 4M0XA 3CAVA 3H4XA 4AIEA 3UCQA 1NM9A 1XRTA 3VOIA 3PN8A 4KBXA 2EHHA 3OLIA 2V63A 3E38A 1FWAC 3CTLA 3HGRA 4GQ0A 3O07A 1X6NA 2NVCA 4PBGA 2YL9A 1I2NA 2CZ5A 4ADSA 1KFEA 2CXGA 3AIQA 2C18A 2QF7A 4K1WA 4GXWA 4LF1A 2C8NA 4DY1A 1XYLA 4B5SA 3MUY1 5D05A 1TB3A 4AVFA 1XINA 3FLUA 5EBUA 3SCOA 3S6DA 3ONCA 2BOFX 1NP2A 2MANA 4DVOA 2NQHA 4JFUA 2WKJA 1W9VA 1BVWA 2R6OA 3O3RA 3GBEA 5I6SA 3KX6A 3B4UA 3N34A 2Y8KA 4NX0A 2HEJA 3VI2A 4XUGA 2ON3A 1OK4A 4KFOA 4G7EB 4RNIA 1UUOA 3TOYA 3MHGA 4URIA 3VOCA 4HBKA 1VPYA 3HFYA 4O17A 3FXGA 5AN7A 1S1RA 2PE4A 1UR4A 2X41A 4ICNA 4A2SA 4QIUA 4H2CA 3TR9A 4JEJA 3TJIA 1FX6A 1NH6A 5AC8A 3RX2A 3EX6A 4GIEA 2E40A 5T8GA 3B06A 3RIKA 1I2PA 4IGHA 2O92A 4P2VA 3PB2A 4N4QA 4H9YA 1YXCA 3TN4A 4GKTA 4G56A 1YPIA 3PUEA 3IPWA 3GW0A 1LZOA 1EIBA 4UQDA 2GGHA 3WQ6A 1OCQA 3OGVA 4F3HA 4ADTA 2J9XA 3CXOA 1UKSA 3MMWA 4LUSA 3RLHA 2QUTA 4PCSA 2QDHA 2ZZ3A 1JDDA 4GISA 5LGZA 4L64A 3XISA 3CV7A 2OXNA 1TPFA 1T41A 1KCKA 3AZSA 2HMCA 3DBPA 2IW0A 2YBUA 1FP8A 2Z2UA 1A80A 3ANUA 1UMYA 4BI6A 1J6OA 4X2PA 5AHLA 1V0NA 3W81A 2W9MA 1W54A 3J7HA 1ONRA 1UD6A 4E8GA 2B4GA 3V35A 4HSNA 3AROA 3FJ6A 2DVXA 1FWJC 4ROPA 5FEZA 1KGWA 1F4HA 2B31A 4B90A 1W9PA 3V0TA 5G1YA 1LG1A 1R3TA 5H91A 5K4ZA 1AQHA 4YJ5A 3FYPA 4J2MA 3GLCA 1JDFA 3EOSA 1TIWA 1EDQA 1A3XA 1YADA 3LPOA 4ZQCA 4V1XA 3G18A 4HZ7A 1BYAA 3O6YX 1E6RA 1U83A 3EMCA 5A94A 3LENA 5LSMA 1B90A 5IBXA 5DELA 1I4NA 1XQKA 4PRRA 3KE0A 1OCBA 1GW9A 4S3FA 5K9XA 1SZFA 1OFPA 4DJFD 1TJ2A 2D23A 1XLEA 1UWTA 2Z1WA 3REQA 3I4EA 4F0LA 3LZ5A 2Y89A 2B7NA 4XG1A 1XL9A 5K9DA 1P6WA 1W3TA 1ZALA 4K8EA 3UXKA 3NL2A 3ZWSA 1MXSA 5CC3A 4D6EA 2W66A 2I56A 4QP0A 1M65A 1MQPA 3T4WA 4K1GA 2OO6A 4YTRA 4OV4A 1F6PA 1U30A 1PZ1A 2IXUA 4B15A 5EBAA 4O15A 5B7YA 3N2CA 3GVWA 1CXEA 3ARTA 3ZWTA 1EC8A 4LV4A 1XCWA 3SEPA 4PMJA 3VNKA 3SO7A 1AJ2A 2WHLA 1C93A 3IVTA 4EXAA 2EGZA 1E0TA 3I7SA 8XIMA 2XUCA 4MDOA 3UVAA 1DKWA 2NVAA 4AD2A 1VYSX 2BVWA 4F8XA 1N82A 1W1A1 1BVZA 1TCDA 1HVQA 4QBXA 4IQEA 4N02A 2C0HA 4GGBA 3KCLA 3NWRA 3UCDA 4UTJA 1PEZA 3G6LA 2PLJA 2GOKA 3BDKA 4AZ5A 3R8RA 1Y0EA 1QUMA 1OX4B 1XCXA 1VHNA 5M2FX 4Z2HA 2WVVB 2JBMA 3G24A 1TTJA 2GGJA 2JEQA 2ZC8A 1JPMA 3DX5A 5C2XA 1QO2A 1VIWA 3S1XA 3NM3A 1V6VA 3C2OA 1EOKA 4XBJA 4CCCA 3W88A 2G95A 3LRLA 3VTRA 4RNJA 4AX6A 4G7EA 3CUFA 5J5RA 3WLKX 4LUYA 2ZRVA 1GCYA 1SJDA 1TWSA 4O52A 1FCVA 3HGSA 4HVXA 4BFAA 4WCJA 5BROA 3GVQA 1QOPA 3GM8A 1WXZA 3P5ZA 1TELA 2ZRZA 1Q66A 4J4KA 3QYQA 3PTQA 1PZ3A 3E74A 4F48A 2P0IA 2C13A 4KESA 1IZJA 1T99A 3L21A 3MUZ1 2KAUC 3MO7A 3ENLA 5LZLA 4E8CA 1AA1B 2VC6A 4AW7A 1CXKA 1WOAA 4I7WA 4ZO9A 3E0IA 1GPFA 1MDRA 2HROA 2Y85A 3RAOA 5AHFA 4GABA 4AZHA 1BSLA 4CQBA 3AIBA 2PDXA 4QCEA 4FF5A 1QK2A 4IX2A 4PCNA 3P0XA 1Z42A 4R7OA 3ZR4A 1E0UA 2C16A 3TFXA 3P82A 1PX8A 5LNVA 3H26A 1VJSA 3KCOA 4FO4A 5D2TA 2E0PA 2WMFA 4DXXA 1OT1A 3W86A 4HMCA 1TE1A 3JVAA 2UZ9A 2PGFA 3ARRA 3CEPA 2OJPA 4IQLA 3OVPA 3GTIA 2X1UA 1C8QA 5CZKA 1OY0A 2VDGA 4XAPA 3ZS4A 4PUWA 3W37A 1I0BA 1Q7ZA 1A53A 4XZNX 3CNYA 1JULA 2VENA 2PZ0A 1SO5A 1V7YA 1IEXA 3GBDA 4LBUA 4DO7A 3P62A 4A8IA 3VA8A 3JUGA 3VDHA 5D38A 3A9IA 4IIDA 3LTSA 1XDMA 1HG3A 4P8XA 2BHZA 1W32A 1W1ZA 2RDWA 5IHRA 2ZUNA 3E12A 3PG8A 3B4YA 4S3BA 1G4PA 2DZWA 5HWJA 1TFVA 5E5CA 4XKYB 3S5YA 4Q4QA 1GUVA 1M53A 1Q2SA 3NDZA 4MAVA 5A6BD 2BGQA 4M3PA 4HCLA 1ECEA 3WLJA 1VH7A 1H1NA 5KTLA 5CH9A 4KEZA 1S2VA 1UZ1A 3H4GA 2A1YA 4PCFA 4F0SA 3ARXA 4DBEA 1LL6A 3VO0A 3BLIA 4WEVX 1OD0A 3GD6A 4LC6A 3N9KA 4JCMA 1BRLB 1W3LA 1B9BA 4KKXA 1XYCA 3W7CA 3QQ0A 1TPVA 3VX0A 4L4LA 1PTGA 4L9XA 3RLGA 1GWJA 4HA4A 5CGTA 3VDGA 1VCGA 1AQ0A 3ITLA 3AISA 3AOFA 4O53A 2PDIA 3WFZA 4B5VA 1G9HA 3SCSA 1ZB5A 4UNIA 3W76A 3STEA 4NP7A 1IEWA 4U2ZA 4CGTA 3P67A 4WJXA 1JL8A 3WJYA 7A3HA 1H41A 3P7YA 2XG9A 2E6YA 4LPCA 3C2FA 3S2JA 1R3YA 3W0KA 1J93A 3TK7A 1IXOA 4CQ9A 3KW3A 5F4SA 5ABTA 3C0QA 3EXSA 3ZOAA 3ZVHB 3E1F1 3VPLA 1QU4A 1UG6A 4H7CA 5T9BG 2E6AA 4TVCA 1FWSA 5CPSA 3LA4A 4BQ2A 1XM3A 2WVVA 3TR2A 3E0FA 5M17A 2YCJA 2PWFA 4TXEA 4H3DA 3OYZA 3P60A 4OE7A 1VFMA 4UQEA 4RDWA 2CFFA 2J74A 5DRCA 3V5FA 1JYXA 4TQTA 3AU2A 4RK8A 2FVMA 4LS2A 3W87A 1F8MA 2G3NA 3MMDA 1J0IA 3VABA 3ALFA 4J3WA 4M7SA 4D6IA 5JQ9A 3WJSA 4KRTA 4XD6A 5BU6A 4U31A 4Q4RA 4RJEA 2NUWA 3LYEA 5IXEA 2WHMA 2I14A 6ALDA 3R1ZA 1PWMA 4PMVA 3COTA 4DBDA 1RQHA 1KQZA 3WJZA 3M5XA 1HKVA 1NARA 3LXBA 4ATDA 4KH2A 1LROA 1RHCA 5I77A 4MPKA 3CHDA 5HULA 3WNNA 3R0UA 3T44A 4ERGA 5D32A 4J1OA 2D24A 4JN6A 1F74A 2V2HA 4UR9A 4AXNA 4RZ4A 2PC4A 3TKFA 1CI1A 1ICSA 1YDNA 3RU8X 3NZQA 3BGGA 3KOXA 4OOUA 5CZTA 1LL7A 2AGKA 4QNWA 4LVFA 3IAQA 2V6AA 1EGMA 2ZVIA 1G94A 2EKCA 3GHRA 4QFUA 3H70A 1KFBA 3OLDA 5CEWA 5HQMA 3PAOA 3DYOA 4GCAA 3WMCA 6XIMA 3DHFA 2AQWA 4IISA 3L4YA 3W7DA 2GDUA 1E4LA 2WZMA 4M80A 5E1QA 3BOFA 4AD4A 1AL8A 5MF5A 4LX4A 3IANA 3QOKA 3DN5A 1WKEA 4ZO6A 1T6MA 4IL0A 2V68A 5F2IA 2PF8A 1IT0A 3TJXA 1JPIA 1H2JA 1KCXA 2WMIB 3ARSA 4HYWA 4RE3A 2NUYA 1CGTA 3PUDA 4MB3A 4QTGA 3DFOA 2BY3A 1RBAA 3VFCA 2VP8A 3A4JA 1XH1A 1O5RA 4A05A 4FR1A 1LWHA 2R1NA 1E1CA 1YXDA 2XVLA 1KC7A 3U3HA 4AH7A 4F0HA 3AZRA 1S5MA 2PTZA 1W3NA 1UD5A 4Y6GA 3L67A 3AXMA 4UIOA 4XKYA 4AWEA 1U5JA 1ZS2A 3UNTA 2QAFA 1A50A 3LQLA 4YHEA 1K6WA 1FTXA 4S2BA 1T0OA 2PWHA 2FHCA 2OSWA 3GNNA 4W7WA 2PP1A 1RZMA 2PDFA 3URBA 3FA5A 3BLFA 4X0VA 4GCXA 1R5YA 4GPNA 3W02A 5G4WA 4JHMA 3A21A 3MVTA 1BRLA 3AYTA 2FB3A 3UG3A 4O10A 3KS5A 4JYDA 4BI7A 3DGRA 1JYVA 1AZ2A 1CLKA 4IMCA 2OX4A 1WZAA 1VBGA 3I3BA 3PJUA 3CPRA 3L0NA 1OCJA 3EDJA 5A6LA 3FKKA 3ZR5A 5I0DA 4DHGA 4ACZB 1KFWA 3UG5A 3BICA 1MNZA 4OZOA 1A4MA 1B31A 4JTSA 1CLVA 4NXKA 4OOZA 2PBOA 3KBWA 1UWUA 8RUCA 3F2CA 1XI3A 2F6UA 3M6DA 4WF7A 3L4WA 1H09A 3STPA 2HVNA 5HNTA 4RR4A 1A5BA 1I8JA 3KLLA 1LT8A 1JQVA 2XGZA 1UKPA 2BFGA 4UTFA 3S6TA 1PTAA 3CV2A 1VQTA 3ZM8A 4A3QA 2PD5A 5FJJA 1QATA 4MIMA 3ZVHA 3GTFA 3HOJA 4JAWA 2BVDA 5E0KA 3CIXA 1Q45A 1MUMA 2GL5A 2ZYFA 2VFEA 4RUBA 3N73A 4UCGA 3BURA 4GZEA 1NDWA 1XDJA 3MY9A 2A3EA 3BCFA 2DT0A 3DHDA 1TG7A 4A6GA 3OG2A 5F2GA 4I6VA