2OU4A

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
290
structure length
290
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 115
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2ou4A00
1XP3A 3U3HA 2ZDSA 3ITYA 1XLEA 3ITXA 3QZAA 3BWWA 2NQHA 2XISA 3CQKA 3LMZA 1BXBA 7XIMA 1XYBA 1DE5A 4W4QA 3AYVA 3CQJA 3KCLA 4K3ZA 3GNXA 5TNVA 3UVAA 2GUBA 3KBVA 3KCOA 2G4JA 1GW9A 4QDWA 5XINA 5EMLA 3KWSA 1XLAA 1O1HA 4X60A 3ITTA 4XSLA 1K77A 4DVOA 3AYTA 3KTCA 4XSMA 3UA3A 5B7YA 1XLGA 3IUHA 4OVXA 4K1GA 4HHMA 3TC3A 4QEEA 4QE1A 3C0LA 1XYAA 3ITVA 1DIDA 1OADA 1CLKA 3UU0A 4YTRA 5C9ZA 4EAYA 1D8WA 3QYSA 4YTUA 2HK1A 4PFHA 5FA5A 6XIMA 4YTSA 3L23A 4GLEA 1S5NA 1QTWA 2X7WA 2NQ9A 4XISA 3TVAA 4HHLA 1BXCA 1XYCA 4A8RA 5XIAA 3UA4A 2J6VA 1XLKA 1QT1A 3P14A 1XLMA 4QE4A 4G56A 4ZBCA 3KCJA 3ITLA 4LNCA 4EACA 4J4KA 1TZ9A 3IUIA 4US6A 3VYLA 1XIGA 4GJIA 4YTTA 3ITOA 6XIAA 5AVHA 1MNZA 3WQOA 5B7ZA 3CNYA 3QXBA 3M0MA 4E3VA 2QULA 3JU2A 3AAMA 4YTQA 5B80A 1DIEA 5I7GA 8XIMA 4X61A 9XIMA 2X7VA 5J8LA 3BZJA 1S5MA 3BANA 3FVMA 3M0HA 4A8LA 5H1WA 1XIFA 3CQHA 9XIAA 3CWHA 3UXIA 1XIBA 1XLDA 1DXIA 4XKMA 4ZB2A 2I57A 4HNOA 3XISA 4GQBA 1I60A 1XIJA 3M0LA 4ZB5A 4PGLA 4Q7IA 2XIMA 5EMMA 3IUDA 3M0VA 1XLLA 3QC0A 1A0DA 1XLBA 2HK0A 5H6HA 1XIMA 1MUWA 2GLKA 1A0EA 1XISA 5XIMA 4DUOA 3CQIA 1XLCA 2GYIA 3KBNA 3VNIA 1XLHA 4XIMA 3BDKA 1XIEA 1XIDA 3BZGA 3OBEA 3M0YA 4HGXA 2XINA 1XLFA 3N4AA 3KBMA 4KW2A 3M0XA 3VNJA 5AVNA 2NQJA 1XIHA 8XIAA 4X63A 1XIIA 3KBSA 3KBWA 2I56A 3VNLA 3DBNA 4QEHA 3VNMA 4ZB0A 1XYMA 1XICA 3KBJA 5EMKA 2QUMA 3XINA 1DE6A 4A8IA 2GVEA 2Q02A 3U0HA 1YX1A 4QDPA 3XIMA 3C0SA 1QUMA 3VNKA 2OU4A 1XLJA 4GJJA 1I6NA 3NGFA 5EMJA 4A8NA 1XLIA 2QUNA 3AALA 2HCVA 3C0QA 1XINA 4QE5A 2G0WA 2QW5A 1XYLA 3DX5A 3P6LA 2ZVRA 1A0CA 4XIAA
chains in the Genus database with same CATH superfamily
4CVUA 2Y8VA 4TTGA 4RDYA 3AIVA 4ZGYA 1MNSA 3UXLA 1ZJIA 4ZENA 2FTWA 3MHGA 5TF0A 5FF4A 3FJ4A 1XUUA 3CUZA 3P61A 1W5OA 3MUAA 5DXYA 3DKLA 3WLKX 1J0KA 3KRBA 2PGFA 4MPKA 4PRTA 1ZQ5A 3MSGA 4TVCA 3HF3A 1WDQA 1LBMA 4C91A 1ISVA 1D2KA 3MWAA 2ZWYA 2VZSA 5FAJA 4J3VA 3CS2A 3QEZA 1VP5A 4RNIA 4OUIA 4W5UA 2ZZ2A 3P5ZA 4F8XA 1NWUA 1W8GA 1WZAA 3SEPA 1K70A 3L65A 4DJDD 3HV9A 1ONWA 4S3DA 2R1KA 1R38A 2Y5SA 5HUPA 4J1OA 3BJFA 5F1VA 4AYSA 2PWUA 1TWSA 2WMIA 3AYSA 3WNKA 3OW1A 1WX0A 3CO4A 2CZEA 1TJ0A 2D0GA 2HQAA 4EANA 3VNMA 4CCEA 4YJ5A 4QP0A 2C14A 1BWLA 3HO8A 1KXHA 3WJWA 5BZAA 3TJLA 1UD5A 4C6OA 1UQZA 3QR3A 3N6JA 2SFPA 3UG8A 1US3A 2ZDSA 3QFEA 5DCEA 3SCRA 1XRVA 4HMCA 1E15A 5C0QA 1XPGA 1TE1A 1WYIA 3NL2A 1W3JA 2TMDA 3GZ3A 4S3AA 2TPSA 1XCWA 3D47A 1RXOB 1NWTA 4JYDA 1PTDA 2XZ7A 1RV8A 2YL5A 2DUAA 3SFWA 3VIMA 3A6OA 2DT0A 3VIIA 2HXUA 1NY1A 1B9BA 4NG3A 4O1AA 4DO4A 2V3DA 4QE4A 2ATMA 3LHYA 4YIWA 3NZ1A 4JTSA 3VGBA 4U3AA 4LVGA 3TTQA 4J3XA 4JTUA 3PY2A 3ABRA 1P1XA 4EXAA 1Y65A 5AYIA 3BANA 3MP3A 3KAOA 4M7TA 3EWBX 4DBWA 4ZB2A 3RAOA 4D71A 3LXCA 3M46A 2YYTA 4X0VA 2OPJA 5HNTA 3N2MA 3SUVA 1U5JA 4LAMA 1ONRA 5CLWA 4HGXA 1Q6EA 2BWGA 1L6GA 3W81A 3S5ZA 4Z0JA 2MUCA 4MOZA 2FZDA 3BW4A 4BA0A 2FGZA 4PE8A 1DBTA 5EKYA 1N8IA 1P0BA 3IV8A 2DSKA 1CLVA 2PLMA 3TOPA 2XPKA 3W87A 1G4SA 2HPIA 1W5PA 4MGGA 1KFWA 2WQPA 1PCKA 3SCQA 3EPMA 4JTJA 2WW5A 2WLZA 4H9TA 3W7LA 3FGCB 2XVKA 4RZ4A 2WJDA 3C6CA 1WKEA 2POZA 1WKFA 2AKMA 1S39A 2UBPC 2C16A 3THAA 4PTXA 5FL1A 3ZJ7A 4W7VA 4UTWC 3OQ8A 3E49A 1L2QA 3SCVA 3SB0A 4JFTA 2DV0A 4GUIA 1WZMA 1OFPA 5B7ZA 2OZ8A 3SRKA 3QKZA 2Z1VA 3PG8A 3MI3A 4YL2A 4WJEA 3R0KA 1UD6A 3EDDA 1UR4A 4UOJA 4OECA 3A9IA 3M0LA 3EMZA 3A5VA 3GY1A 3T2PA 2HK0A 1H7NA 1UJQA 1K7XA 2NXIA 1R30A 3UWUA 4XIMA 4DZAA 1VZWA 3PN8A 1LP6A 3U48A 1GVYA 1LM1A 3VNJA 3M5VA 4EWJA 1BVWA 2E6FA 1E6XM 3UGRA 3H4XA 1NEYA 3M4HA 2R1NA 1IR2A 1ZPTA 1JFXA 3N15A 1RZMA 2IPGA 3E2QA 1EWEA 3WQ4A 2GL5A 1H41A 1WE5A 2WSRA 4GZ7A 4UTHA 1QO5A 3GVQA 4AEOA 1J96A 3BH4A 4IPJA 3SUSA 3UYIA 4DJEC 4PN2A 4Y9PA 2CXEA 4GD0A 2BP1A 2IQTA 4ZE5A 5C54A 4YVPA 1KRMA 4GH1A 1Q4WA 1JR1A 1XYAA 4MWAC 1C91A 3KZSA 4GZIA 3HGJA 2IS7A 4XD4A 4CNPA 1W5QA 3Q58A 2UWFA 4PMQA 4FSAA 4QJ4B 3CMGA 2FMOA 1EO5A 5LIYX 1QFEA 3GK0A 3GHSA 2VTFA 5EY5A 2ZRUA 3AAMA 2A5HA 2E7FA 3E0IA 3M0HA 4D6FA 1LQ2A 2E1DA 4JNZA 4KWUA 1NWRA 1ZP4A 3TYAA 3P8IA 1B57A 4MIMA 3H53A 3C3NA 2DUZA 1K9DA 3LRMA 3R43A 1S2TA 1IF2A 4ERGA 2LLEA 3W82A 4MJMA 4W87A 4V33A 3MZNA 3V36A 1NJJA 1O94A 4KRTA 5A69A 1XCXA 3GVRA 1MRQA 4JIEA 5CAHA 1KV5A 2ZZ4A 3WBAA 2OELA 4KFNA 3QRHA 4W4QA 2QJMA 4M81A 4QLKA 3EKLA 3AZTA 1X97A 4A21A 4H41A 3VD4A 2H3DA 4G7EA 3QPYA 1CLKA 1RY8A 4H00A 3QYSA 3W1QA 2D2GA 3MV11 4AYGA 2VD8A 1FH8A 4G2DA 3LA4A 2VT0A 3P14A 4NAEB 3ABZA 5I0DA 4P8VA 4DI9A 1IGSA 2YBTA 3EDJA 3W9ZA 4N02A 5C2XA 4LC6A 3F4VA 2R14A 2E8YA 1B5TA 2OZ3A 3JVAA 4ZO9A 1V0LA 3NL6A 4YCOA 3IRSA 3ARWA 4OQVA 1ZBWA 1QPKA 3U7VA 3TSDA 3GFYA 4R9OA 2RDTA 1S1RA 3WKZA 3A24A 3PVFA 4JKLA 4M29A 1BTMA 3KEHA 1SZNA 4KCVA 3R8GA 2DP3A 2XIJA 3RF9A 5CJMA 4E3TA 3FXYA 3GTNA 2MNRA 3BGGA 3VU2A 2IKHA 3OA3A 2ZBTA 4BQ4A 4U31A 5IHRA 3AXIA 4C6BA 1I6NA 2NX1A 3LPGA 3VM7A 2B31A 5F2MA 1VQTA 3CZGA 1FP8A 3AU2A 3QTGA 1OT1A 1UIOA 1R9ZA 1YPXA 4ZO7A 5DF0A 2WLYA 2VXNA 4GQQA 3FYPA 4QDMA 5HOSA 1QXLA 1QI3A 4ML4A 1Z32X 4NNAA 3FN9A 2XH7A 2VVSA 1JYVA 2V3EA 1YNQA 4PMUA 3W7CA 4GINA 4O1BA 3KTCA 2Q09A 4TMCA 3TEVA 4L9XA 1DPMA 3Q4DA 5A8OA 3OZOA 1V3HA 1I2PA 2C79A 1AZ1A 3TVAA 2ZOXA 5DT5A 3W2LA 3EB3A 3ITCA 1V0KA 1EIXA 3W22A 1MXDA 4O14A 2I5GA 2HSAA 4AHQA 4E8CA 1XSKA 3TCSA 4ZR8A 4QHRA 4AISA 3CU2A 4HU4A 4DN1A 3M0MA 2PA6A 1W31A 1E40A 2A2IA 1KR0A 4LEFA 4TX6A 3VILA 4IGMA 4PBEA 4CQBA 4E2OA 4UQCA 1F6PA 3NO3A 3OB8A 1UR2A 4US5D 1ICQA 2VDGA 4I5RA 1E6RA 1QMLA 2WVVB 2YCIX 1M1BA 3NZGA 3T0DA 3MUXA 5AHIA 5HDRA 4CU7A 1US0A 3LM3A 2PLKA 1GPWA 3MCNA 2BY0A 5C9XA 1AW1A 1BQCA 1K9FA 1DTUA 3HB9A 4BQ3A 3VOJA 2GQ3A 1OGGA 3TV8A 3ARUA 2PGWA 2Y61A 3GDTA 5CH9A 3ZT5A 1WOBA 4AZ5A 3K5XA 2EPNA 4EPKA 4TQTA 3H2MA 3UZZA 1EGZA 3KL0A 2WHJA 2ISVA 5KZMA 4FR6A 1ZJAA 2BGNE 3OVQA 1VBHA 1JG9A 1TTPA 4Q8PA 2B81A 5K9XA 3H12A 4L6DA 3IARA 4JIPA 4CLMA 1S5VA 4QJ3B 3DCPA 3W1RA 1A5SA 5LKYA 4OBRA 4US6A 2NLIA 4NT0A 2Y7FA 3W25A 1KD0A 4WOQA 1ZJHA 3AMCA 3KX6A 4ACZA 5FJTA 3CHDA 1XC4A 1XIFA 1QNSA 2FJUB 1RA5A 2XIQA 4HYWA 3RK8A 1KCXA 2A3CA 1B30A 3WQ5A 3TN4A 4YNGA 5A8QA 2Y62A 3B4YA 1ZUAX 2NX9A 4PMOA 3YPIA 2DORA 3LHTA 1P48A 1LBLA 3VGHA 2I56A 1W17A 4X2PA 1EBGA 1V6VA 3HIJA 3PTMA 3W38A 3TCEA 3UQNA 4EXBA 4EVZA 1CW2A 2WO5A 3UJ2A 3PNZA 4ORIA 3HG3A 3AOFA 4DO5A 2PD9A 2IMRA 4UC5A 2OKTA 2EG6A 3IIOA 1ITQA 1TJRA 4R33A 1E1CA 4FF5A 1OB0A 4OV9A 3H2AA 1L6FA 3ICJA 3MY9A 2QJGA 1X1NA 3S2JA 2HE5A 3PTDA 2O4QA 4YTRA 5ABHA 1E51A 3ID7A 2J9YA 1A5BA 5JIWA 4O52A 1XGEA 1HL8A 3B8WA 4LBSA 3HPSA 3CTTA 3NQFA 3TC6A 3PUOA 1HF6A 2PDUA 5LIWX 1QPNA 3VTRA 3WD1A 5DMYA 2E5CA 3VKJA 3GDLA 3GBDA 5C55A 2QV4A 4WDUA 4WDWA 1LWHA 2QGHA 4KESA 1VR6A 1C8VA 4L80A 1FUYA 3GB6A 5K9DA 1GQKA 3LUTA 3RCMA 4CQCA 2VKZG 3V18A 4DO6A 1UROA 4LVFA 1TRIA 1H60A 3S2MA 1Z8AA 4MWAE 3OVPA 5AVNA 2NQJA 3WX7A 4AIEA 3BUVA 2FZ9A 3A22A 1H7WA 3T55A 3MSRA 2W4XA 3T2OA 4RJEA 1YXCA 2QCHA 2ZVIA 3NQ7A 3U5YA 2B7NA 3E6EA 3S6OA 1Q65A 4GIEA 5GJNA 5HK4A 1B3WA 3VIOA 3WF0A 1J4EA 3B0VC 2W27A 4JEJA 4AW7A 4IL2A 4GIYA 4L4OA 3VE9A 1R6WA 4PSPA 4GRSA 3ZLFA 1SJCA 1DWJM 1OCNA 3POCA 4KF1A 3FAXA 1DJYA 2GGGA 4UTIA 3WDRA 2YW3A 3C0LA 4UUIA 4PL2A 3VNYA 1PBGA 4FNUA 3MMDA 5I24A 1Z3NA 1EX1A 1HP4A 1YTKA 8A3HA 3A5FA 3LU2A 4LOCA 1KLZA 3BAYA 4RNHA 1SU5A 1HL9A 1FCVA 4R7JA 2J62A 4ERIA 4C6KA 4ZA0A 2I1OA 1R2TA 4MDPA 2O9TA 2REQB 3UERA 3VDCA 2W6RA 3FVMA 3N2TA 1EPXA 3LCFA 2Q8ZA 4UQAA 1F73A 3I7SA 2OSWA 1XLBA 3W1LA 2ZZ6A 1XS2A 1SR9A 1Z69A 3PJXA 1H1ZA 1LG2A 3R11A 3EYPA 1W3TA 1ZZMA 3S5YA 4K38A 3BQ6A 1UKSA 3LHZA 3PZGA 1XRFA 3I3BA 1SO6A 2FB3A 1FWRA 2GSEA 4R53A 2E9BA 4WQ6A 3K13A 4QDPA 1OD0A 1Z44A 3TJ4A 1GJWA 4LEQA 4NI3A 4MZ1A 2XISA 3KTSA 1AL7A 4RDZA 5DEZA 1HJVA 3O6CA 3ITGA 1QI0A 1E9IA 1JZ6A 1O1HA 3WQFA 2G97A 2WHLA 3LDVA 1TR1A 1S2AA 2HPMA 2ZFAA 3P60A 4IGSA 1D8CA 2X42A 1Z42A 4I90A 1OF8A 1YQ2A 3TOYA 2PDHA 3KRZA 1ICPA 5D05A 4WGHA 1DJQA 3QOKA 3CHEA 4XVDA 4X0NA 1BXCA 1PYFA 4V27A 4NNBA 3TR9A 3WY1A 3W37A 2NW0A 1FFQA 3GSMA 4WIWA 4C1NB 1K6WA 1GQIA 3E02A 1DTNA 2EBNA 2GWGA 2V68A 3STCA 1H4PA 2PBGA 2NUYA 1CXFA 2H8ZA 2WMKA 4F0HA 3QLLA 2WOQA 1O68A 2CZVA 1JUKA 2ZUUA 5DT7A 5K9CA 4DUVA 3I6EA 4PMJA 3G0SA 4XAYA 4ICNA 1JI2A 4AU0A 5G1TA 4BQ2A 3UJSA 3MUCA 4WLCA 2VFIA 4ZZ9A 5EA9A 4EE9A 2V81A 3OGVA 4D9PA 3S2NA 3EPNA 1D9EA 2CFFA 3PBGA 1P4CA 3NQDA 3NSMA 5CG7A 2PRMA 3CB3A 5JIPA 3HGSA 3ALFA 3LTYA 4JIHA 3MYOA 4Q6JA 1EPVA 4DJED 3M7WA 2V5KA 1TWZA 4LY4A 1FHUA 2TAAA 4KWOA 3TC3A 4IFKA 1Q3NA 4JICA 3ZSTA 3UR2A 4MWAD 2HK1A 1R7OA 1TV3A 1OFQA 2XH4A 2G96A 3UJEA 3L4YA 3ZR4A 4CKQA 4UMAA 1YIXA 3EEGA 4XKYA 4Z1CA 4J4KA 3VYLA 4RLIA 4JCLA 1LOLA 1WPCA 1ZBVA 4RE3A 4G8TA 4RK8A 5E70A 4JEQA 1YMYA 2GPTA 2GWNA 4QXIA 1UB3A 1M9HA 2G37A 1WCGA 4UTTC 2V8ZA 1C3FA 2WCSA 2DSWA 9XIAA 2BGSA 1QBAA 1QU4A 4IMAA 1K6AA 3EWXA 3N04A 4DUOA 5CXPA 1B3YA 3WF1A 1ZBKA 2F7FA 3WLIA 3DAQA 1EXPA 3PANA 4HZ8A 3AWOA 4MMWA 1TB3A 3WQEA 2E68A 4FLRA 1V6WA 4X9SA 3MP5A 3MSDA 4RXFA 3S47A 1U1JA 1IIHA 3KS6A 3C2FA 2NQZA 4OJYA 4PTMA 3THUA 4QRNA 4AEEA 1LOQA 2UY2A 3P74A 1P7TA 1YYAA 2FFIA 4R9XA 3TTYA 4AMCA 1KTBA 1O60A 4RZ5A 2X2YA 4EWND 1EX5A 2VUYA 2Y5JA 3U57A 4JXCA 2XSXA 4LBUA 4K6AA 5E0CA 4DWSA 2C6QA 4H7ZA 4LF2A 1LYXA 4GYJA 4XSLA 3APYA 4JQ4A 4YYCA 1JZ8A 1FXPA 4QBXA 4O19A 2E9MA 1ME8A 3SGUA 1Z48A 1OYCA 1UA7A 4NYYA 4AWSA 1EGMA 2QJIA 3S9IA 3UWZA 1V7YA 1SPQA 1XBVA 3O0FA 3SSJA 3VC6A 4ZEPA 4A35A 3TROA 1VPQA 3IJ7A 1REQA 1E6NA 2VJXA 4P7LA 3TU9A 2X1SA 4Q8WA 1GPFA 3IUDA 3CQ0A 2QIWA 4AX7A 4M6QA 2Z6JA 1ML1A 3KP1A 1S2CA 2QV5A 4P2VA 1RA0A 3AHZA 3W7RA 3WH6A 8RUCA 1T8QA 5D04C 5FOOA 2BZNA 3CV2A 4E4UA 1SUXA 2V5LA 1TWDA 1VFUA 4OOUA 1MDLA 4Y9NA 1QPQA 1U33A 2E6AA 1V3IA 2RHGA 1PEZA 2B7OA 2HE8A 3B4UA 2NV9A 2D0HA 3OYZA 1KB3A 4WX2A 2PD5A 4BEUA 1RQBA 2PAJA 2OXNA 3HQPA 1E5JA 1W54A 1E55A 3NQCA 1OYBA 4ICMA 5DBUA 2X41A 3F4DA 3A4JA 4MB4A 3TKFA 1IEIA 4GUGA 4X60A 4LC8A 1OC6A 4NVTA 4ZCWA 4B4FA 3OLGA 1R3TA 3I3DA 1ZP3A 4PCFA 3T0CA 4CCZA 3LHUA 5TBOA 9CGTA 1RK6A 1H1YA 2NV2A 3SUUA 2CITA 1XWYA 5DMNA 1KFEA 3RRXA 5A8PA 3FK4A 2Y7GA 4JTEA 2CCRA 3BMWA 1GOIA 2PTXA 4MAZA 2R1LA 5GNXA 2E40A 3G1SA 5F7UA 3THCA 4I5XA 5GNZA 3DFPA 4H19A 3TDFA 3N34A 3B9AA 4UQ9A 1G4EA 3G1DA 3GIPA 2D2JA 2H8XA 1D3GA 1LWIA 3W1AA 2J13A 3M43A 4WZHA 1GGOA 3W7QA 1TA3B 1RJRA 2D23A 3W6YA 1VEMA 2DSUA 4DZ5A 3T07A 1YX1A 1HP5A 1XXXA 5C70A 2VC9A 3M0KA 4RZBA 1FDYA 4XZMX 2PDFA 2A7RA 2ZC1A 1XQLA 1ZLPA 3M9YA 4W86A 3MHUA 4WXZA 3GNPA 2ZA3A 4H9ZA 2BGQA 3SCTA 4QDWA 3U7BA 2X1RA 5ABEA 1KGWA 3KXQA 1EGVA 4M8UA 4ROQA 3L66A 5K2ZA 2C19A 2J7EA 4PMVA 2Y5EA 4UBPC 1OCQA 1K02A 1FFRA 1JDAA 1H51A 3MV01 3SAZA 5U4NA 3L23A 3LHVA 3WMLA 3WCZA 1I2QA 2AL1A 3UR8A 2F84A 3GG7A 4V2XA 1W1TA 4I9JA 5D09A 3IACA 3W23A 2WCGA 1X96A 4GFSA 4H8UA 4HTBA 4DF0A 4EACA 3ARYA 1I2OA 1Y8BA 1KM2A 1DOSA 1UP3A 1TMQA 2AAAA 4HOWA 3NDYA 1KV8A 4O0ZA 4DZIA 3N2BA 1GOKA 3UG4A 4UTMA 3C4UA 4LPCA 1XH0A 1YW1A 2FYMA 3IIXA 3GNOA 3ZVHB 2YA0A 1D3HA 4O54A 3BZGA 1TRDA 3P62A 2XZ9A 3DU0A 3M0YA 4H9MA 4LFYA 2DUXA 1UKPA 3QC3A 2F9RA 4HK5A 1BYCA 4J7RA 1FP9A 3CL6A 3G0UA 2J66A 3Q67A 4JTRA 2OLAA 2QF7A 1VEOA 4KWWA 1IEXA 1H5YA 3B9EA 1UZDA 4Y8FA 4YN5A 1UH3A 4KCWA 1F8MA 3L4VA 1W9XA 5FCZA 3STPA 2OWXA 2E8ZA 3OTRA 4JKMA 3ZT6A 3CXOA 1AMYA 5BMWA 4IOTA 3GNXA 3GC5A 3W7DA 3WEMA 5CGMA 4ZE4A 4J40A 4Q8OA 2QUUA 3KWSA 1V7AA 5HMDA 1MFVA 3EA1A 1D7FA 5HJXA 3DYPA 1CXKA 3GG1A 1GK8A 1HXJA 2IKJA 4QTGA 4W93A 1GYNA 1XDMA 2ACUA 3AHVA 4XV0A 3CPUA 1AH3A 1X8CA 3EMCA 3GXIA 2V3GA 2W67A 4D8ZA 3F2CA 4MZ8A 2J7HA 3QXBA 3T0TA 3WUFA 2Y85A 3R89A 1WDDA 3AQUA 2J7CA 2DQWA 4GO8A 4J2PA 4IP7A 1R9XA 1R86A 2ZXAA 4IMDA 4MWAB 1W9UA 3CH0A 1Q2SA 1SFTA 4ZTXA 3WQCA 3UY7A 3GHUA 4UWMA 2QT3A 4ZQCA 5I3HA 4ML9A 2CLKA 3UETA 4F3HA 4HD5A 2PDXA 2YDRA 4KQNA 4S3KA 4FO4A 5DCDA 3QMTA 5FIPA 2IQ0A 2KX9A 4OOZA 3F2BA 4FIQA 3MB9A 2IXUA 1K7FA 4G6CA 4DAIA 2VEFA 3VIJA 3UP8A 5D32A 4JR5A 3AJ7A 3D3AA 3MHFA 3TNOA 1DHPA 3KRUA 1ZRQA 2WJFA 4HNUA 2D69A 2J9ZA 3BCDA 5FJIA 1UCWA 1PKMA 1QPRA 3EB4A 2QUVA 1E1FA 2IXVA 1E72M 2FHFA 2EG8A 4IFOA 3LPOA 2FVLA 1OHLA 2ZUVA 3V75A 3WJSA 1MWOA 3PR2A 4OIFA 2WXDM 4QR6A 3KOZA 1QW8A 2GK1A 3D0CA 3GVWA 1TCMA 3DYMA 4CNUA 2H90A 2XJ7A 5BWAA 3QQWA 4MB1A 1I2NA 1TVPA 1MO0A 2GOUA 1OYAA 2OO0A 1WXJA 2P53A 3DFSA 1A0DA 4Z2IA 1R5YA 4RW3A 1EL3A 5JH1A 3BLOA 4HCHA 4S3GA 5FEPA 4GISA 4GY1A 3QY8A 3PJTA 1IEVA 5L9FA 4GPNA 3HMCA 2Z28A 3HN3A 3FGCA 1WOAA 1OF6A 1K8XA 1JXKA 1UD3A 2YL8A 5D2WA 1S2UA 1O12A 4BK9A 5I02A 2KAUC 4W9TA 5LNVA 3O06A 5D30A 5E0KA 1OX6A 4GABA 5LSMA 2AGTA 2ZX5A 6ENLA 3QGAC 3NQ6A 4W89A 1F3EA 1RLCL 1A5NC 4QEEA 3A64A 4BY3A 1MUCA 2XFYA 3OOQA 4FMVA 1FWFC 1LLWA 4GCAA 3VGGA 4EAYA 1QNPA 2JIEA 2VMFA 2RDWA 3VCRA 1FWAC 2CU0A 2VEPA 4IQEA 4MHBA 2PZ0A 2GJXB 4LNCA 2OX4A 1UUQA 3BAWA 3UZYA 2AL2A 4UFMA 1F74A 1WDRA 1EH9A 3GG8A 1RUSA 5AC5A 5JBDA 3L4ZA 5FI8A 2FPTA 3DZ1A 1SFJA 3DFNA 4DJFD 1CT5A 1YE6A 1EIBA 2GUYA 1JDFA 5HQEA 4IG2A 4CCCA 3LGEA 5K3VA 3TA9A 3M5ZA 4JN8A 3DH7A 3TYBA 1VHCA 2Y63A 3KBNA 1US2A 1WP6A 4DB7A 1H7PA 4JFVA 3LX9A 2JF7A 2ZRZA 2R24A 2YLLA 1HKJA 3VCNA 5HA7A 1RVKA 3MVIA 4UFLA 2V63A 2HBVA 2PDNA 4JGDA 3CIXA 3URQA 4BR1A 3HBLA 2X05A 1XINA 3VKKA 1ITCA 2ZZ1A 1KM6A 3R6IA 3W7PA 1KC7A 1WAWA 3R8HA 2VOTA 2ACRA 4J9JA 1XL9A 4LAUA 4GG9A 4UZUA 1BSIA 3A4XA 5XINA 2ZDRA 1TPWA 1V77A 3HPZA 3HMJG 5HJYA 2PRHA 4JIIX 1R3QA 5FF7A 1OCBA 3FLUA 2J27A 3L2MA 4HP5A 2ADAA 4ZQMA 1MEIA 3ARZA 1P6BA 4BI6A 4HTYA 2R82A 3FJ6A 4XUYA 1ZL1A 2BY1A 3LCLA 4A3YA 4UTKA 4PMXA 5KMYA 3MKKA 1G4PA 1B3ZA 4BHYA 3UR7A 2HEJA 2CKRA 3CLMA 4BI7A 3PZ9A 4L9ZA 1UWIA 4CQDA 1H11A 1IEQA 1QNQA 2QAFA 3LSCA 3AS1A 5BOFA 1FX6A 3EAUA 1YDOA 3TFCA 2QYGA 2QAPA 3K8LA 4H3DA 1MW1A 3HPFA 3F5JA 3TQKA 2Z1WA 1S38A 3QPEA 4ZXLA 4ACYA 2XSBA 3N19B 4M56A 4ATWA 4KFPA 4C65A 4A2RA 1GOQA 1WDSA 1F3TA 4O11A 2D0FA 1TV8A 2WZHA 5AZ1A 2QZRA 2RGMA 4M6VA 3RMEA 2QPUA 2AMXA 1JCYA 1SW0A 3ITYA 1QASA 2C1IA 5K4XA 4XO7A 3KZPA 3GXNA 3KW3A 2VFDA 2FDSA 4KGLA 4Z0SA 4UIOA 1J2WA 2A3HA 3LBMA 5A2BA 1BQGA 5BOEA 3PZNA 5HBFA 2OKOA 2J24A 1Q6CA 1FKXA 5A2AA 4MNLA 4GBDA 1IHIA 5J5RA 1F3WA 2BHZA 1F05A 5D2XA 3BLKA 4H9UA 1T99A 3NGJA 1KBJA 1AVAA 3CV6A 3PBVA 4IWWA 3CHFA 3CGTA 2WKJA 5G2WA 3BZJA 1YTEA 2PWHA 2VCCA 4UOZA 4O18A 1H7RA 4KGJA 3N9RA 5A8MA 3TTSA 3UJFA 3MUZ1 1EEXA 4B5TA 2EG7A 3LBCA 2V0TA 1O5QA 1WZLA 5DRCA 1NTHA 4NYUA 5H8PA 3BOFA 2VELA 2DEPA 4JX6A 3CZEA 5LHEA 4TOQA 3WNPA 4DJDA 2P10A 2YL9A 1RY0A 1YBQB 1Q7MA 4GBUA 3VUSA 2DZVA 1FKWA 3FAWA 1YXYA 4PUKA 2DDXA 1XYMA 2A1YA 2OG9A 2PFHA 2P0IA 2W66A 2ZUSA 1YDVA 1MEWA 1KCLA 3GW0A 4G5DA 4H8VA 4RXGA 1MXSA 3QZAA 3DN5A 2F2HA 3WLPA 2EJ1A 1SJDA 1QOXA 2ANUA 1IWAA 5FEWA 4M5PA 3WD2A 2IPFA 1LTDA 4L1XA 4NNCA 2KZHA 1ONEA 4WSHA 5M17A 2ZRVA 1V51A 1LRQA 5AN7A 2EKCA 3HZ3A 4AEFA 3SQSA 1PHWA 3KLKA 1HVQA 2VX7A 3SURA 4FXJA 1A5UA 5GQBA 4Q6XA 2G8ZA 2XVPA 3EX2A 4KMQA 1CXIA 1Z6KA 1UPMB 4O4WA 3W75A 4PULA 4CD6A 3MANA 2OSYA 4JY9A 4OKDA 3TJXA 3T05A 3CHVA 5FJOA 4XD3A 1B0IA 1F7BA 3NFUA 5D33A 4LSBA 4QROA 1HO4A 3PPHA 1ZALA 2XUCA 1VJIA 5ECUA 5F4WA 3N25A 2BSLA 4HNNA 1OC7A 3N9KA 2WV8A 4GUFA 1I9CB 3L9CA 4LV4A 5CPSA 3NM1A 3NIYA 3BXWA 1RCXB 1KBKA 3GAYA 4GKLA 4R34A 4F0KA 3M16A 3N4AA 1ESWA 1M5WA 6CGTA 4CD4A 3LXBA 1OX4A 3DG6A 2YA1A 4NJHA 1XICA 3GTFA 1QI2A 2QKFA 3WLNA 1GTHA 4JYFA 4PA8A 3VOCA 3B40A 3EOUA 4B5UA 3T44A 2XWEA 4L4PA 4XZIA 4DXXA 1OD8A 1XKYA 1J0ZA 1EC7A 3OPSA 3W1NA 3ZLGA 3KBVA 1XG3A 2QHAA 4QIUA 2X09A 4LF1A 2Z2UA 1VEPA 1A3XA 3DHPA 1FWIC 3NL3A 3GNRA 1UZ4A 2WHKA 2XIBA 3W7IA 3VM5A 3NAVA 4D6CA 1QI5A 5A5WA 2C91A 2FIQA 4GJ1A 4M82A 5LGXA 4IIGA 1PZ1A 2VOMA 4JZ5A 3U2CA 1RD5A 3L4WA 1BPLB 3GU9A 4CQAA 4RZ6A 7ODCA 3P3BA 3PBMA 6XIAA 4MZYA 1TPH1 3CNYA 3S46A 4EXQA 4OBSA 1I75A 2YDAA 3K2GA 1CLXA 4ZQPA 3TSMA 1X39A 4A8LA 3NOEA 4Z42C 4HNCA 1K8CA 1LT7A 1R2RA 1OFAA 4M6PA 3HPAA 1U1UA 1W9VA 1VH7A 3TYUA 5H6HA 2FMNA 1ZS2A 4XZBA 4XWUA 1C29A 4BF5A 1ADOA 2CLPA 3DHFA 3N4FA 3UWVA 1UP0A 4QLLA 1W3HA 4TX8A 1GVOA 4KERA 3J7HA 4V1YA 1MI3A 1JNDA 3GUGA 1TE6A 3UWEA 4QAIA 4E2BA 2Z6IA 3T81A 1DE6A 1VFLA 1C9DA 1QUMA 3IRDA 4J35A 4HU0A 4PB3A 5LNUA 5HXMA 4WGXA 2P5NA 3WIJA 4FHAA 3EGJA 3PB0A 2V2HA 1E6PA 1O5XA 1YDYA 4JNYA 1NIUA 4MJZA 1C93A 1HKVA 2J7GA 4QNWA 2YFOA 3L2IA 2Y4SA 2RGLA 3BO9A 1LQ0A 1UR9A 1M68A 4XSMA 5DFAA 3LD5A 4BEQA 2OYMA 1ADDA 3VNZA 3L67A 5PTDA 3WQVA 4LVDA 3B05A 1LROA 1LRTA 2ZUWA 5KETA 1H7XA 3ZJ8A 4WY0B 2JALA 4O15A 2H3BA 2PBOA 3VUPA 2J8GA 2XH0A 3MC5A 1SQ7A 2ZX8A 5AC8A 2BNJA 3NR0A 3TYEA 2GVGA 4C6NA 1GVFA 5DY3A 3RLUA 3M5XA 5A6BD 1VBRA 4LX4A 1F2JA 2HDJA 2O7SA 4LY8A 2NUXA 4XG1A 3F03K 1EP1A 4EOUA 1EJVC 4FR1A 1G69A 4HOXA 4C90A 3AS3A 1TCDA 1TQJA 2PCEA 1CENA 4HA0A 4UR8A 1E0TA 1P43A 3T4WA 1JCTA 2PF0A 3UNDA 3ATZA 1OSEA 4A22A 2ZUTA 3H2OA 4S23A 2JFEX 3E5PA 1IWBA 3CEUA 1DHKA 2X16A 2Z7KA 5HQMA 1DORA 3WMSA 2VDHA 1XLIA 4H04A 4X9YA 4L1WA 2CHOA 2OODA 1CGUA 1KRBC 3GDBA 3NL5A 4NF7A 3UPWA 2J75A 5LIUX 3K46A 3S5OA 2OLHA 3NQVA 1CPUA 3CBWA 4ADUA 2Z26A 4LBRA 2ISWA 3UF9A 2YA2A 4J3ZA 4LH8A 2YCLB 1W1VA 4XZLX 1DJNA 4AIUA 1TX2A 4IMFA 1WB0A 1E9YB 4QM1A 2VWSA 3RDKA 3E3HA 4FX7A 4LS0A 4X3ZA 3NO1A 1XG4A 4FZIA 3OLDA 4A8RA 2DSVA 4O16A 5ECVA 3PZIA 1Q4NX 4PUDA 2IKIA 4LTSA 3WJYA 3EA2A 1RH9A 1OJXA 1JZ7A 8XIMA 5T9CE 4Q4OA 3M5YA 1V6YA 2GVJA 5A8NA 1CECA 5CBBA 2QIIA 1O6IA 4CD8A 2YFNA 1LBFA 2CESA 5CGTA 4JIQA 1H1NA 1UJPA 3FX4A 1QAPA 1J0YA 3EEZA 4C6EA 1JVNA 4M24A 4FEZA 4O0KA 2X30A 2PMQA 3KOYA 5AFDA 1FCUA 4DBDA 1A3HA 2PDPA 1OBAA 3GKFA 1VYPX 5JBEA 4JDBA 4DLFA 1QK0A 1U1HA 4MSSA 1GZJA 3VDAA 6REQB 3L68A 1A0CA 1VBGA 5KITA 3NYDA 3WFZA 1HQTA 4UTLA 2EO7A 5JMUA 4HIBA 3IJ6A 3S1XA 2Z2AA 4O1CA 4C6IA 3LS9A 4JDYA 1E6ZA 4GOAA 2PWVA 2V38A 4M6UA 2D20A 4ZSUA 4K1GA 4DWSC 5CBIA 1I1WA 1V8EA 3KUMA 1LOSA 4B91A 4Z08A 1J79A 3GUWA 1A5CA 1OGSA 3QJAA 1ME7A 2VENA 4F0LA 3MJMA 4YWIA 3SDOA 2DZSA 4QG9A 3KCJA 2DT3A 4XBSA 3TN5A 4K8GA 1M03A 5BRBA 4WOZA 2NT0A 3VAVA 4GA8A 1DWGM 1XI3A 2QVNA 3AMLA 1W1IE 2PTYA 2PTWA 1XQKA 2A3BA 3HQNA 2Y8UA 4XAPA 1OC5A 3G1YA 3N29A 2E25A 5CSSA 3P93A 1MZRA 1NP2A 4LUSA 4KW2A 1OFRA 2ZQ0A 4Q4SA 3DXIA 3FYOA 2QCDA 4C60A 2CWXA 4BWLC 4ENLA 1E4IA 4DM2A 1V02A 5D38A 4QNEA 4HNTA 5FF2A 3EMQA 3TJIA 3WK2A 2PDQA 3GTIA 2W9MA 1V08A 1DE5A 3OBAA 2E5BA 5LGZA 1QDSA 2NVAA 1EOMA 1JZ5A 1UC5A 4I9MA 2WWDA 5CQ1A 2X1TA 1E4LA 2CERA 1RPKA 3IJ8A 2WMIB 3ITVA 4GFIA 4PEEA 2QCFA 3UESA 4PH6A 3T1GA 3B8TA 4EF8A 4K7YA 1VLIA 4E8DA 4IPNB 2BTMA 3QSTA 1ODZA 1VB9A 2VC7A 2WZIA 4OT7A 1W32A 2WPGA 1R9YA 4PCPA 3VABA 5E6YA 4N9DA 4WEVX 2FH6A 4WSJA 3TQVA 1SO4A 1W0MA 1VAHA 1JCMP 1RHCA 3IK2A 1Q5MA 4J2MA 4L56A 4ADSA 3GH4A 1POJA 3ARQA 1SFSA 3M0VA 2C8NA 1M7PA 3QF0A 4F2TA 1AFSA 1XIMA 1ZENA 2PCQA 3NO5A 1PKYA 5FJJA 3PSWA 3MPGA 3BDKA 1SR0A 1DJIA 5DN1A 3RGTA 1KBBA 5ABTA 2CKSA 1U2YA 4HNLA 2CLOA 5D8ZA 5LA2A 3BW2A 1UHVA 1VPXA 1ONXA 3MT1A 2WANA 3U5UA 3TA6A 3OGSA 3GDKA 1OINA 3P0XA 1EDGA 1UBPC 3EXTA 3CEPA 1DJWA 2QDGA 4WR3A 1ODUA 3TWAA 3AXMA 3S9YA 3PHAA 3VFCA 1JPKA 2OR2A 1XLAA 2CNCA 3JS3A 1RQEA 5CZKA 1NQKA 1K77A 4P8XA 4QITA 3G1AA 1UUMA 2R91A 4FOJA 2EGZA 5LZLA 4O10A 2QR6A 1IR1A 3SY8A 4KEUA 4A29A 1FWDC 3ARVA 3H8AA 1EUAA 3W1MA 4M1RA 2R8WA 2Y1HA 4H6KA 4NHVA 4GVHA 1SYTA 2ZYFA 1NOUA 3IUIA 2XM2A 1XIGA 3BV4A 3VO0A 1CX9A 5AVHA 3L12A 3WL1A 4CNOA 1GQNA 4IGHA 5HINA 5C9WA 5D9NA 3PNUA 5J8LA 1OFDA 2PTZA 2X40A 4JN6A 1EP3A 3APGA 2I7GA 1XBXA 3U4FA 2EEXA 3HG4A 1GJUA 3MMWA 4Z1DA 4GI6A 2E28A 2GYIA 4XO6A 4GHRA 1KM4A 2CIPA 3IIPA 3PC0A 4AIBA 1XKJA 2ZZ5A 5CLTA 3EOSA 2HWGA 3DG3A 4KS0A 3N13A 3T40A 2BODX 3HURA 3GRIA 1W9BM 1W1PA 4P61A 3PBWA 3E0FA 1N82A 3URAA 3XIMA 5DRIA 3VNKA 3MS8A 4XVEA 1BEUA 4GYKA 1T96A 3R8RA 1ZTVA 1ENUA 1T5AA 5IBXA 3DX5A 3DFQA 1O66A 3IAQA 3S0CA 2BXYA 1FY6A 2CLIA 2W3ZA 4GVGA 3TYDA 4ZOBA 4D2JA 3OA5A 3LGDA 4BF9A 1E43A 4P7NA 2BY2A 1TWWA 3AYTA 3UYCA 3LV5A 4WKFA 1F8IA 1FWEC 1XGDA 3OVRA 1ZGDA 2PB1A 4INFA 4O28A 1NFGA 3VNDA 2WZMA 3FS2A 5AHLA 3RJXA 2FLIA 3GXPA 2FVKA 3VOIA 1UP2A 4OWGA 1XPYA 4QX4A 5MF5A 1E0UA 3NVTA 4LS2A 3SIMA 4Z2KA 1IEWA 1OWQA 1W3LA 3V7PA 5SWUA 4GVFA 3TX9A 3ZO9A 3DYOA 2ZRYA 4N9BA 1KGXA 4HK6A 3K4AA 5JVLA 2D2HA 1H0IA 5BRQA 3SCNA 2VX5A 4GUJA 1AH4A 1JYWA 3QFWA 1EC8A 5HWNA 1WDWA 2EPOA 1QOPA 6TAAA 2CLLA 1HKKA 1TSIA 3DESA 3NUKA 3OVGA 3SCUA 4HCDA 1JCJA 1CGTA 5BMXA 3AZRA 4PL1A 4IPPA 1RBLA 2TRSA 3K8MA 3EWCA 1CGVA 4YU1A 3EDKA 4FX6M 2DT2A 3GM8A 1XP3A 1NM9A 3WBXA 4EAMA 2WKLA 3AYVA 3O2LA 4N6FA 4NAFA 3M1ZA 1XF0A 4IUGA 3RO6A 5BXTA 2A3EA 3NSNA 1JF5A 2W61A 1KR1A 4YWSA 4LYQA 4UCFA 3BG9A 4HB7A 3UD6A 3CAVA 5I2UA 1Z89A 4FNRA 5E09A 5CEWA 2FZBA 1RJPA 1I2RA 2E5DA 2IPJA 5XIAA 2ZRWA 1IIGA 3B8VA 2VEMA 4PBGA 3FOKA 1WQ5A 2ACSA 1O7AA 4WDTA 4JFUA 4NZJA 5RUBA 1GOWA 3QZ6A 3CUGA 3ANUA 4MJ4A 4E4PA 4J5NA 4JTQA 4A4AA 9XIMA 2VR5A 1L6YA 1UMYA 1VJSA 2DT1A 4AFYA 4MG4A 4OHQA 4LCSA 2GJRA 4C6MA 3RM9A 3CAKA 2E6DA 3NOYA 3W02A 2I9UA 3UG5A 3VIPA 4A05A 4PB5A 3UEQA 4G7EB 3TQPA 2CZ5A 2I16A 1ZFJA 3KVLA 1JPDX 1IZCA 2OGJA 1KXTA 3BICA 2BHYA 5C6MA 3SRHA 2P8CA 1W91A 4PMNA 1LCOA 4QS5A 5D02A 5J5DA 4IUOA 4PTWA 2DIKA 1TZZA 5KZDA 3CHCA 4OU1A 2VZVA 2GJNA 1PS9A 4ZODA 4UR9A 2RJHA 4URIA 2I17A 4DLMA 5M5DA 2HJPA 3W7NA 4IT1A 5CZSA 5AB3A 3UBPC 2J88A 1EYWA 3TH6A 1F5ZA 3TXZA 4QE1A 1V0MA 4B5VA 3EWWA 3GIYA 4D6DA 3EWYA 4DJEA 2INFA 5E5CA 5D9PA 2Q8XA 2G3MA 3HGRA 4UXDA 1D7KA 2J74A 3PM6A 3U4AA 2JEPA 4AHPA 3K1DA 2V67A 3QV9A 1TZ9A 3OBKA 3LV6A 2C15A 4YTTA 1TTJA 3WLQA 2WNZA 3I6RA 4REQA 1JAKA 7REQA 1Y5XA 4GX8A 5I7GA 5HWMA 1TTQA 3AXXA 2D73A 4GZEA 1TV5A 3S5NA 5H8MA 1TJ1A 3H7UA 2IUZA 2V3FA 2H9AB 3KHDA 1XIDA 1A47A 1VCGA 1NWSA 5E9AA 4HYVA 3SZ8A 1X1ZA 1I0DA 3ARSA 3C8NA 4HCLA 1E9LA 4DYKA 4HN4A 2AQVA 1DIOA 3NXLA 3C0SA 1CTNA 1YEYA 3HU7A 5BNKA 4XZWA 1ISYA 5KZ6A 1GORA 3DERA 3S3GA 2EQDA 2G3JA 1JDDA 1CIUA 5I3KA 4TO8A 2VGGA 5D8WA 3R7MA 1NARA 2GUBA 4AY8A 5A6JA 3GHTA 3GNDA 1BWKA 4PCNA 3STEA 3A4AA 4MB5A 2DPEA 3FW6A 5M2FX 1EKOA 4FALA 3NDZA 5MHBA 3N3TA 3QLDA 1MQRA 3G3DA 4XISA 2WYSA 1T8XA 4J27A 3ZIZA 4PRWA 3DI1A 1PUDA 3CT7A 5CCZA 4PTVA 2C7FA 4ADTA 2NWRA 3W1PA 2FDMA 1C7TA 4FNTA 4KETA 4W7UA 3M07A 5FD0A 3LMYA 1PKNA 3UJRA 4Q4RA 1QHZA 4GQBA 3N2OA 4HHPA 5AHFA 3FV9A 2XIMA 4UOQA 4F9DA 1MYRA 4LUTA 5DO8A 1EC9A 3RLHA 4AWUA 1J0HA 5CJNA 1RCOB 1F4AA 3T78A 3FHAA 1KFJA 3VMOA 2QJNA 4UQEA 1XM3A 3KVJA 2Z7GA 3LG3A 3CWOX 1ZHAA 2J6XA 1GG0A 1OIFA 1W9DM 4LALA 3OJGA 1BYBA 1F6YA 4J3TA 4U4MA 2OCZA 1CYGA 5IXEA 3TLLA 5CKSA 2WM1A 3BSHA 4ICCX 2VDIA 4GYFA 4DY1A 4H8NA 3F2DA 4KCTA 4OZOA 3IWPA 4J3UA 3HQOA 3KCOA 3I68A 3K30A 2XFWA 5EMLA 2GJXA 1NQ6A 3REQB 2VZTA 4K36A 4CEUC 5AC4A 3N4EA 4DWSD 3DI0A 2XG9A 1FDJA 1SO3A 3AXHA 1MW0A 2OFJA 4H6QA 1ZCCA 1O5RA 3C2EA 4AXKA 1PDZA 3VPLA 3C86A 2VFEA 2D2OA 4D6EA 3WD3A 3LI0A 4LNYA 3OG3A 1S2WA 1NDZA 4IQLA 1IXNA 2W62A 3WELA 2BVWA 3CUXA 3OHIA 3XISA 2ZZ3A 5ENLA 4E5TA 1E1CB 3NNTA 2OQYA 1P0KA 4UZSA 4DNMA 4LYRA 2YOCA 4NZ5A 1RALA 5CSRA 2NXHA 1YKWA 3MA8A 1UD8A 2XGZA 2A7PA 4RE4A 1NF0A 3UPMA 1ISZA 3PFMA 5D2VA 2YR1A 4PUJA 4DJDC 4MVAA 3XINA 4MUPA 1RD6A 3URBA 1ELSA 4IM4A 2G0WA 3ERPA 4DYEA 3BWWA 1Q6OA 3D6NA 4XD5A 4IIEA 5TNVA 1IT0A 5A6AA 3N6HA 1R3VA 5E93A 1EQPA 2BXZA 2NVDA 1TREA 2VRQA 1I0BA 3QQ0A 3W2UA 2PWFA 1XFBA 4EKJA 1MUMA 1D8WA 2PP3A 2FGBA 1N55A 3T7VA 2WSYA 4LAKA 4JOMA 3TN3A 5EBAA 4GQGA 3TW9A 1VIZA 3P67A 3NQAA 4G56A 3N3MA 4ILSA 3O9NA 1TV2A 2BX7A 2NVCA 1WA3A 4TUFA 1GYLA 4ZO8A 3G3MA 4M3PA 1OFOA 4KT2A 3H2FA 3T4CA 4R3UA 4GNVA 2VX4A 3Q37A 5MKGA 4JNMA 2WSQA 1HZYA 2VGFA 3MSYA 5BWFA 3IIVA 3GAKA 5CGQA 1EB3A 3O16A 5EMYA 4GGBA 2UV8G 3OBEA 2EPKX 2XINA 4MM1A 4DHGA 5U7SA 1TYGA 3OQEA 3IVSA 2INEA 5AHEA 2D1ZA 4ASTA 4HVXA 2WCAA 2FPYA 4CU8A 4DF1A 2GFTA 3GFXA 4N7QA 4A8NA 4I8DA 1W3NA 1E56A 3O05A 2GJPA 1P1MA 1W1B1 1SZRA 4JTCA 2CHRA 1BRLA 5A6SA 3UA3A 4Z1YA 4OVXA 3RX2A 3RM8A 1XW8A 2PEVA 2R94A 3FVDA 2VYOA 1PKLA 4B15A 4YTSA 4C1KA 3Q94A 2J6VA 3SO7A 1AK5A 1U30A 3I10A 4JTTA 1TELA 3QGKC 4E2DA 4NSBA 2HBXA 1XCFA 1YBQA 5I3DA 4HA4A 5AY7A 2GDQA 4A6GA 5H1WA 1EFZA 5G2IA 4JTGA 1Q8JA 2HVMA 2IPWA 3WLOA 2WHMA 5REQA 1PPIA 1QRQA 3AHTA 2WKGA 3BE7A 2OYLA 1K8ZA 3HJZA 1JDCA 5AZ0A 4AZCA 2JE8A 1UBSA 1VJZA 1EF2A 3BGJA 3KOFA 4FLSA 1IXOA 3M0IA 4LYPA 3W53A 1XH2A 2WSPA 4WHBA 2Y2WA 1BF6A 2DQXA 1JCNA 4MNKA 2DSZA 4ZVJA 3FKRA 3V1HA 4GC4A 1GKPA 4XIAA 4MF4A 2UZ9A 4U5KA 4DAFA 2E3ZA 2NQHA 3LMZA 3GYEA 2BOEX 1S3TC 1KA9F 1ZAJA 2PDGA 4NY2A 4LUJA 3HG2A 1BLIA 4Z17A 1NFBA 1HT6A 5G1YA 5A94A 3BJSA 3V5FA 2GDUA 1KLYA 1TPVA 4JTIA 3OIHA 3RLVA 1TMHA 5CZTA 1XD1A 3ZR5A 1LUCA 1HKWA 3CUIA 2HZGA 3UA4A 3EXRA 3GFZA 1E3XA 4MY9A 2F6UA 3VDHA 2OT0A 1PSCA 3NDOA 3QHNA 4FNSA 2X8RA 3FSTA 1J5TA 3G6MA 4ZQRA 3IS4A 3NQ2A 1AUSL 4HMEA 4PC8A 4DBUA 3B9DA 1JGMA 3TAOA 4XD6A 3DFYA 3LTPA 1VRDA 1DKWA 4F66A 4JX5A 1RK5A 1LG1A 1MQPA 2XIOA 4BF7A 4LS1A 4CGTA 3RPTA 2PDJA 4UTJA 3C2RA 4ROPA 2WZEA 9RUBA 4NZCA 2XWDA 2RUSA 1H62A 1XH1A 3R58A 3LBOA 1EF3A 1G6CA 2AQOA 3O07A 3QHMA 4HPNA 1VFMA 3H2EA 2CHNA 1Q45A 2BB0A 3KWXA 4DWDA 1GJPA 3EDEA 2YYUA 4L6HA 3LN3A 3M44A 3MP4A 4XKYB 2HCVA 2P1FA 1R3SA 1L9WA 1XDLA 3VXGA 4A2SA 2OQLA 3B8SA 4S39A 2GSHA 1XLEA 3NXFA 1HJWA 1KM1A 5IDZA 1GHSA 2YPIA 2X0SA 1F3XA 5D03A 2PU1A 4F0SA 3GDMA 4Q4QA 4Q8VA 3OHMB 2ZZ7A 4WY0F 3WQWA 1ZB5A 1QTWA 1V3MA 3PZOA 1GVQA 3EKZA 1JAEA 2P3ZA 3RO8A 1YDNA 3LQLA 1DQUA 2ICSA 5AECA 4ZBCA 4ZOAA 1SZEA 3R5EA 1QHPA 2XDFA 3W4RA 4W8LA 1P7TB 4RE0A 2F8QA 1V0NA 2OLSA 1EXBA 2C3ZA 5HR6A 4KEVA 1F76A 4XAFA 1W1A1 2GGIA 3G0XA 5AOUA 3SM0A 1CBGA 2VGIA 2Y7EA 2YXXA 4FF7A 4DWSB 1E0XA 4RPQA 2BBFA 4DJFA 3VOFA 1FH7A 2C13A 2PGRA 3UY8A 1HUVA 3WLSA 5HNRA 5CPNA 2E0PA 3EX3A 5E0FA 4ZFCA 2QUMA 3EX6A 4UNKA 3VINA 3U0HA 1MDRA 3WK3A 1DWHM 4B3ZA 1QW7A 3OG2A 4HK7A 3VK5A 3WLJA 2A21A 5BW6A 2ABAA 5I03A 3R12A 3S1VA 3EBVA 4GXWA 1REQB 1KRCC 1E70M 2QJHA 4K7VA 2XTKA 1Q8AA 2QEZA 4WY0A 3W29A 2O0TA 3IAPA 4FNQA 1NP0A 1V5XA 2O9PA 3FDGA 4RNFA 2VGBA 4UTFA 3WDHA 4V1XA 5KEZA 3AJXA 1R7AA 4GQ0A 3TSBA 4LQ1A 3CLWA 4CEXC 4MTVA 4O53A 1J10A 5AKQA 3V0UA 2JEQA 3N1AA 3ARPA 3KVKA 3D5HA 4G1KA 5I06A 3HPXA 4AHOA 4C6CA 4WSKA 1OK4A 2A0NA 3BMVA 5LIXX 3SECA 3EZ4A 2Y89A 3IANA 3C52A 3CQIA 3RITA 2PS2A 1EWDA 3W26A 3QW4B 1W9PA 5C71A 4B2DA 3FIGA 3TYZA 4WF7A 3BAIA 1YNPA 2BMBA 3VKDA 3EPOA 1UH4A 2YCLA 1HNYA 3KE0A 3TMLA 5G2HA 3ECQA 4C6PA 4C1LA 1L6SA 1UWTA 4CNSA 3MDUA 2DH3A 2A7NA 1R47A 3WSUA 1M53A 5A8GA 4ES4A 2X1IA 3SSZA 4RV3A 2OGYA 3DECA 4PUEA 2GVYA 1IT8A 3ARTA 5EL1A 1EJ7L 3AWNA 1LDCA 4GXMA 2Q6ZA 4Q8QA 3WEOA 4OTKA 3WBYA 4PFHA 3SADA 2FFCA 2J7BA 4GI8A 4RW5A 1EO7A 4HHLA 4O1FA 4B9ZA 2V6AA 3BMXA 1HKIA 3GU1A 3LNMA 5LHFA 1H2JA 1X6UA 5A6MA 2FTYA 3MKVA 1E1EA 1LORA 4JTHA 1VFFA 3Q45A 4Q3MA 3OP2A 3W73A 1N8FA 1I60A 2PDCA 3VX1A 4PGLA 1EDTA 2V82A 4DZHA 1N2VA 1MQQA 2JF6A 1UKQA 3E0WA 1TX0A 5ABFA 2GLKA 1QPOA 6REQA 1P5BA 4JX4A 3I6TA 2EF9A 2CETA 1ECEA 3A3HA 3LCXA 3PJWA 4GH3A 1C90A 5A1AA 4A8IA 1NELA 1B3VA 5FF3A 3AIBA 3FA3A 4TR9A 2BDQA 3GYCA 4NKCA 1YE4A 2J8FA 2ZVRA 4W5ZA 2E6YA 3LB0A 1WAUA 1NOWA 3W2KA 1A80A 1PCWA 2QPSA 4MKVA 5GJPA 2V9DA 3WLTA 2E9LA 3TQ0A 1WKDA 3C2VA 4I7VA 3NQGA 4PMYA 3USBA 3S6DA 3VKCA 4FIRA 2GGJA 4OFCA 4MKSA 1XFCA 2Z4GA 1EYEA 3M64A 4O13A 4IXXA 4HOZA 1V6TA 1FHDA 4KIEA 2DJLA 3FSUA 2RH9A 4Q4MA 2FJKA 1DXEA 4C6JA 3MMTA 2PURA 4Y2WA 1A53A 1YADA 3ZWTA 4Z1AA 4YLWA 3W6MA 3MKCA 5CC3A 1FDZA 3S1GA 3LOTA 1NF7A 1OY0A 1GNXA 3JR2A 3PS7A 4H7VA 3PAOA 3EKGA 3QZEA 3FEQA 3T2QA 1A3WA 2QUTA 1UR3M 5DY2A 3NSXA 1GKRA 3DGBA 3TXVA 5KTLA 2VQUA 3TWBA 1H49A 3DEQA 3IIZA 1B3OA 4NJGA 1LL6A 4PRRA 2O9OA 3G8EA 2QF8A 2O9RA 1UMLA 5DXXA 4GE8A 1VYRA 3ZSSA 4RCXA 3WL0A 3IPWA 1V6UA 5LNSA 1A50A 1XYLA 3JUGA 1GOMA 4H9VA 1S2VA 3EDFA 2DU2A 5IBXC 4KWVA 3TK7A 4ORMA 5A95A 3ME3A 4Q22A 1H5VA 3WH8A 4QJ1A 1JD7A 2VM8A 3ABSA 2W5FA 3HM7A 4RNJA 4TVDA 2E67A 4B5SA 3OLIA 1S3HA 3HFYA 5FJRA 1SGJA 2ON3A 4GC3A 3ES7A 3MBFA 1B90A 1A5KC 4PZVA 1V79A 1EJWC 7PTDA 1Q66A 5I09A 1K4HA 3A47A 3EX4A 4RL3A 1OG0A 1EA9C 4YTQA 5DCBA 4ONVA 1PXGA 2PC8A 4H8HA 3R10A 4JFWA 2YZRA 1GYMA 3ONCA 4PTNA 4POCA 3ZJKA 5I3FA 4U10A 1EZ2A 5EMMA 1XLLA 1CB7B 2QS8A 3R0DA 3W1TA 2QLYA 1HN1A 3H6OA 3QM3A 5LNWA 1JZ4A 2G5WA 4HPHA 5C9UA 1BWVA 2TYSA 1KO0A 1DJXA 3LLDA 5FL0A 1TMLA 1FH9A 3WF4A 1CI1A 5CZ0A 4HA3A 4IIDA 2QW5A 3W01A 4BQ5A 1OG6A 1UZ1A 3OLEA 4CD5A 3G1RA 4AVNA 2GK1B 1K7EA 2FZMA 1UWAA 3R1ZA 2VCBA 2DZPA 4B3KA 4FLQA 1H09A 4NIRA 1BFNA 1TPDA 3RILA 3W74A 3N12A 1FWCC 4L6OA 2YB1A 3WK1A 4HYRA 1FWHC 3NCOA 1E6SM 4DX3A 4ZMGA 3WK0A 1BGGA 4N4QA 1QT1A 1FWBC 1TJ2A 2PWGA 2J7DA 4NRRA 2PUZA 1MMFA 1VFHA 2O56A 2JGQA 3WQGA 3E1F1 3H23A 3UR5A 3ATYA 1B1YA 4MB3A 1EJSC 4YXGA 2BV9A 5BXPA 3ABXA 1VFTA 2DGAA 2PWEA 1KCKA 2WC3A 3BGAA 3GXMA 5A6BA 1A0EA 2VEIA 1YLVA 3I4KA 3P5YA 4U2ZA 4AZHA 2GGEA 4LWWA 5I5RA 1RP8A 1UD4A 2B4GA 3KBJA 1GKQA 1GOXA 1JL8A 2OEMA 5C2CA 3PAJA 2FGLA 3AMGA 5C2GA 4JL1A 4L7ZA 3PWAA 2VFHA 2AL2B 3MUIA 5CJ5A 1PIGA 2ZXBA 1SSDA 3NPUA 2XGIA 4JN7A 3W2JA 4KCUA 4UFJA 1H0GA 4HNVA 3QY6A 4B4HA 2C18A 4DM1A 4IG2B 3HOJA 1AQ0A 1JYNA 1PTAA 4N42A 1TO3A 1P6WA 2ZXQA 4H1ZA 3S8HA 1LLOA 1WUFA 3CWNA 2XU2A 1GW1A 2CLMA 1FA2A 2GSJA 4YVVA 3U2OA 4LV9A 3WF2A 2RFGA 3OZPA 1NDVA 1FWWA 5BXRA 4DUXA 5BU9A 3WN6A 1MNZA 5AHNA 4AD5A 4PSRA 4ATDA 1K9TA 5F2LA 1CXEA 3BJTA 1WKYA 4HZMA 3CQHA 1V02E 4MYXA 2Z1XA 4KBXA 3BAXA 1JDEA 1PAMA 2ESCA 1EHNA 2ZA1A 3CPRA 4DF2A 4D6GA 1K3UA 1AW2A 2WJEA 1JD9A 4EP8C 4I9AA 3WH7A 1I45A 2JKEA 2GOKA 5E6ZA 4O12A 3ZMRA 2Y88A 3W88A 4S38A 2HNEA 2BG5A 3L0KA 5IOBA 2BVTA 2YB4A 5C7VA 2WMJA 4RE2A 3BV7A 1XYZA 4M80A 3WDJA 3PUDA 5CZJA 5BCAA 2QUNA 1BD0A 1HJUA 1V03A 4C7FA 3RCYA 3ZXWA 4DPQA 4A3UA 5A3HA 4E38A 2HVOA 4JTLA 3CJPA 4JS3A 1CDGA 3L4XA 3K4DA 4S3BA 3B3DA 1XYFA 4YPJA 3H4WA 3N11A 1JPMA 4NXKA 4PYSA 3OIXA 1UA3A 4NQ1A 1Q85A 4NX5A 4BKNA 3SQMA 3PBYA 2JKPA 2Y0FA 3G1HA 1RBAA 3GXFA 4W88A 1HGYA 3A23A 1C9WA 4PB4A 3COTA 2A3AA 1K03A 1ZU8A 4V28A 4O50A 1JRBA 2PDWA 5B80A 2ZCGA 2PRLA 4A3HA 1DP0A 1POKA 3M6DA 3BVJA 3WLMA 4WCJA 1VLWA 2Z1KA 2ZTJA 3MCMA 4AD4A 3D46A 1MUWA 1OZMA 1M41A 1PDYA 1TKKA 4AZ6A 3V35A 1PE1A 1Q6RA 1T41A 3W76A 2EKGA 2DJXA 4X63A 3AIWA 3DBNA 1UD2A 2X0YA 3VIKA 2PWDA 2FHBA 3W7KA 3PWIA 3NURA 2W63A 3E12A 4JQ1A 5H91A 1E73M 2ZWZA 4GXPA 1PWLA 2HVNA 3RN6A 3K8KA 3BSMA 1RBOB 3WH5A 1OEPA 1LWJA 4GQRA 3VD7A 1U5VA 3G24A 2F6KA 3B8IA 3KL3A 4DVOA 2O7QA 2OX1A 1PVNA 4GX9A 3AFBA 3CV7A 4FX8A 3MYPA 3ZQ9A 4NASA 3WUBA 2G3IA 2NQ9A 3LEPA 4S3FA 1HVXA 2CZFA 2VEGA 5FSDC 3G22A 2J9XA 3GQYA 1Q7QA 2YZ5A 4MKNA 1CEOA 2ALDA 1ZCOA 2H9AA 1Z41A 3O7UA 4AG0A 4CD7A 3ARXA 3OEXA 1OFEA 3TW7A 4AD1A 2FZNA 3SJ3A 1HL2A 3TIMA 1R46A 2V2DA 4ZQNA 3OU8A 3C3UA 1BYAA 3WDIA 3DOPA 3TNBA 3E96A 3EXSA 1P6CA 3DKJA 3TZFA 2RKXA 3VFLA 7TIMA 2NV1A 3SFKA 4DPPA 2CC0A 3SUWA 1NDYA 1N7KA 3AROA 3KBWA 4TVUA 4HA1A 2Z24A 4GACA 5EMKA 5FESA 5CPTA 1JIBA 1R3RA 4L4LA 3V16A 3O63A 1G9HA 2NX3A 3WH9A 3LY0A 4NJIA 1TQXA 2BASA 1W2VA 1P0NA 3DFOA 4NZ1A 3KOXA 1CNVA 4I5UA 3N18A 3STGA 1QNOA 3CQKA 4Z1BA 2B7QA 2WNWA 4GGHA 3VZZA 3CB8A 3NG3A 2PI6A 3R25A 2ZE0A 5DLCA 2XFFA 4LB4A 3N2CA 3FCPA 5FEXA 3GXTA 4MY1A 1IQ8A 2POTA 3OZYA 4IP5A 4P7QA 1CB2A 5CSUA 4MNMA 4DI8A 2BOGX 1Y5WA 3O3RA 4WKAA 3S83A 4MLJA 3U6WA 1OX4B 8TIMA 3KTXA 3T0BA 3CASA 3MBDA 5D2YA 1V3JA 1TZ7A 4CN4A 3A4WA 5E1QA 1KM5A 4Q8MA 4I9TA 1PWMA 3W83A 1XX1A 2VWTA 4ZL1A 4F2UA 1RSCA 2WM0A 1WBJA 1X38A 3ZYZA 4BFAA 3S42A 1DXFA 3ISIX 4U3CA 3UXDA 1AJ0A 3IK4A 4AF0B 4H6RA 2WVUA 3SUTA 4E6MA 3G77A 3VGDA 2QPXA 3P7YA 4F0MA 3PZQA 3MZ2A 3M41A 2C1GA 2FPVA 4TV5A 4Y9OA 1IZKA 1DWAM 3LHWA 1PX4A 4IZGA 3REQA 8CGTA 1VS1A 3UZJA 4LAZA 5H2ZA 4GNKB 4RPPA 3WENA 2W0UA 5EYWA 7XIMA 3CQJA 4IHCA 4K8EA 4QQUA 3LZ3A 3WFLA 2NT1A 1HG3A 4KKXA 3R13A 3ITTA 3G5EA 1RLDA 1FWGC 1XLGA 5LIKX 2V5CA 3MUY1 3WMBA 2W91A 4GNJA 4XBJA 3APTA 1XSJA 3MI2A 1X7FA 6A3HA 4R7OA 2X1UA 3LPPA 1FHVA 1SVDA 3OODA 3T0AA 3A9BA 3O6YX 3ITLA 4B9YA 4WK9A 4MYAA 3VD9A 1W3KA 1PO9A 5JXQA 2I5QA 2P50A 4BI5A 4F2BA 1PB0A 4ALDA 3S2LA 3DBPA 3GLCA 3W27A 1H63A 3PTQA 1F9CA 5C7HA 3QC0A 3VZXA 1N8WA 4EK7A 1KW1A 1XISA 1JEZA 1XLHA 4WVXA 3FHQA 1TPUA 4MFEA 1RR2A 4IFRA 1WBHA 3UNTA 4K68A 5A2CA 1SO5A 4GO9A 2OYKA 3MO7A 2J7FA 3N73A 1KM3A 4NAEA 3GU2A 3WBWA 1QATA 4UQBA 3B9OA 2A85A 2Q02A 1U83A 2PF8A 3IJ9A 3UWQA 5IRPA 2GQAA 1A5AA 4GZJA 2VEKA 4I6KA 4W8BA 1WXYA 3LI1A 3BAJA 1VGAA 1UWRA 3L5AA 3NTYA 3W7EA 1QWGA 4D72A 3CV1A 3H2CA 3T42A 1L0PA 1TR9A 5BOOA 1FCQA 1VD6A 3QR0A 1L6WA 5JBFA 4UB9A 4DIAA 4AVFA 1X98A 4WDXA 1E4NA 2CYGA 1G01A 2CPUA 4WJXA 4UR7A 3MDWA 2FHCA 2Z1BA 4MJ2A 3G6LA 3B0YA 1S5MA 2CEQA 4IICA 1CXHA 1UH2A 4GUHA 3BLIA 4P8UA 1VPYA 2FB2A 1GHRA 3UXKA 3DUGA 2P88A 4R27A 2YXGA 1QK2A 3O6AA 3VKBA 1E6QM 3WDQA 5D9OA 1VKFA 3NPVA 4G7FA 4BCEA 1W6TA 1QW9A 2FTPA 1OZQA 1KTNA 4H01A 3W00A 1UW9A 2CLHA 2A3LA 4S1FA 3CL7A 3SY1A 1W2PA 4LGXA 1GEHA 4JQ3A 2AOSA 5HQLA 3GBEA 3A12A 2BS9A 4EPDC 5JH2A 1OX5A 2X0HA 3KDNA 3WNOA 1AZ2A 2FKPA 5HMEA 3LPFA 1UR8A 1QOQA 1MW3A 2JBMA 4Q32A 1BG4A 3II1A 5T8GA 4ZO6A 3W2MA 1AD1A 1UASA 3RU6A 3BAKA 3AIUA 1B54A 2WVVA 1PZ0A 3BARA 3FA5A 1JPIA 4LRTA 2PZNA 5GPRA 1FVPA 1ITXA 2PDBA 3H22A 3C56A 2NQLA 3GX9A 5AYYA 7TAAA 1IV8A 2YSWA 4L65A 4QGCA 3B0UX 1LL7A 2XVLA 1JUEA 2OEKA 4IIFA 5DELA 1UWUA 1BHGA 3F1QA 1KWKA 5CG0A 4HKPA 1EA0A 4JFSA 4EPBC 2RJGA 2GJLA 2OOFA 2PGEA 1EHAA 3DHDA 4ZOCA 1XC6A 2DIJA 1FHLA 5CC5A 1ITUA 3SCOA 3V3WA 2QCGA 1HJSA 6ALDA 3M0XA 4FOKA 4H2CA 3VI2A 4DJFC 2AMGA 1MXGA 1EDQA 2VUNA 7ENLA 1JXJA 3ABOA 2QMKA 3TN6A 1T7LA 5M1TA 1ISXA 1S5WA 4WXYA 1VHNA 3E2VA 2OU4A 1BTCA 3H55A 1QO2A 2X2GA 2WC4A 2ISFA 4UNLA 3BC9A 3DIPA 2A4AA 4XB3A 5I3JA 4D6IA 2R9RA 3TLQA 3CM4A 3ITXA 4FPSA 2VFGA 4GYPA 4NZ3A 4Y96A 2UY3A 5G5IA 5E9XA 3OZMA 3CH9A 2HISA 4PODA 4HZ6A 1J5SA 2Y7DA 1LF1A 2PTDA 1KQZA 3WUEA 1GWJA 4MPQA 1R8LA 4RV8A 3HQ1A 4N4PA 2J25A 3WQ6A 4LUSB 4D8LA 3H21A 3WD4A 3SCSA 5M03A 5G4HC 3AUJA 4IJRA 2QCDB 1BVZA 4G1NA 1S1PA 3DENA 4S2BA 4MUZA 3ITOA 4D8AA 3CYJA 4FNPA 3VVGA 2CZDA 3GO2A 4AWTA 2XGBA 3NQMA 1KXQA 2ZUMA 3QTPA 4MFDA 5LA0A 4U33A 4P7RA 1ZNNA 4RX0A 1GZ1A 3GVGA 3LCIA 3PPGA 2OZ0A 3VMPA 1J0IA 2CXGA 3WMCA 1VCVA 1DWFM 4OUEA 3V1PA 3TMQA 2ZADA 2Z25A 1NU5A 3W7MA 1NVMA 2PLCA 4U28A 2VC5A 4N2YA 1SW7A 2L5HA 1L8PA 3NEHA 1VBJA 5I78A 2PDMA 4FLOA 3LLFA 4M51A 4B90A 3CZ8A 1PJ9A 3P8JA 5EBUA 3SJNA 3LYEA 1TUFA 2YGYA 3AS0A 5AC6A 1PIIA 5I3GA 3TTEA 4E8GA 3IGSA 1TPFA 2AQWA 3MWCA 4DQWA 2BY3A 4JTDA 1GEQA 1MVYA 4R7WA 3QYQA 3THDA 5HR7A 3BTNA 5TQLA 4O0QA 4X22A 2J78A 3SN1A 2Z1SA 3BG3A 1KRAC 3CZJA 5F4XA 3AU6A 3PBUA 3AMKA 3GTHA 4BZYA 3WFAA 5DQPA 1HIZA 4UMCA 4NILA 3C0JA 4FA3A 3E2SA 3W7GA 3NZRA 2IW0A 2PU0A 3RMJA 3WQOA 4W84A 4RDVA 2NUWA 3I4EA 3BG5A 3RPMA 2DVTA 3WZ0E 3UVIA 3RU8X 2HRWA 1J12A 1ZY9A 4LT9A 1W5MA 4HNOA 4S3CA 4JHMA 2OSXA 5JU6A 2DW6A 3E38A 1P0DA 2NWSA 4H4IA 4IJCA 4LANA 3RRAA 4W8AA 5DMMA 1XIHA 2VHLA 2QCCA 3GKAA 1VFSA 3B04A 4QEHA 4XTIA 4XBKA 3DHUA 4CN6A 3SRFA 3BL3A 1I4NA 2Z00A 4Q8TA 4B3LA 2ZE3A 3VOGA 2VRJA 1LT8A 1HJQA 3C0QA 2REQA 1X1OA 4GIAA 1KBLA 3W70A 3ALGA 2E09A 5G4EA 4U5IA 4RDWA 2J4GA 4BWLA 1BXNA 4FS9A 3RM4A 3W1UA 4NL1A 1RP9A 1XD0A 2J77A 2HROA 1R0MA 4LXFA 2YIHA 3FDKA 5DBTA 4B92A 3U9IA 1BAGA 3N17A 3WQPA 2G4FA 3M0ZA 2DZBA 4N9EA 3ZOAA 4JCMA 3LCHA 1J6PA 2DIEA 4MAVA 5F2IA 4AVOA 3H7RA 1G67A 1X6LA 1KFKA 4HU3A 3IJQA 2ZXDA 4F48A 1GT8A 3VIFA 3NQEA 3KVMA 1L8NA 4HBKA 4WD0A 1QNRA 5F2GA 4AQLA 1XIBA 3BOXA 4AAJA 3NJ3A 2TODA 4XZ9A 3LENA 1DEDA 5LYRA 3GWQA 2J47A 4PUNA 5FF0A 3T09A 4XTDA 3SW6A 3VKAA 3GHRA 3GR7A 3LM7A 4ZTYA 3N6QA 1EP2A 1XIIA 1CGYA 4HPXA 4ZFMA 1E3ZA 2DFAA 2YCEA 4Z2JA 1PTGA 2HV5A 4C1NA 1MW2A 4LUIA 2I5IA 2CBUA 3N14A 1G7UA 4HU8A 2PP1A 2JQXA 4ERAA 1VENA 1AJ2A 2VURA 5HAOA 3W7OA 1HO1A 4XZNX 1WUEA 4IQDA 2O4MA 3OYXA 4NRSA 3VGEA 3G1XA 1A5LC 4Q7NA 3GD6A 2XN1A 1OCJA 2G95A 3E0VA 4ECLA 3H24A 3ZR6A 1GVEA 3IEBA 4S2CA 1B4KA 2VQTA 3DC8A 4I7WA 3RX4A 5B7YA 3IUHA 2WVTA 1KBIA 4L5ZA 1FCBA 3VGFA 1GQLA 2DW7A 3RCNA 1ALDA 1JGIA 5HWJA 5ABGA 3RX3A 4HMNA 3H4GA 2YDQA 4JYEA 5EFDA 2PLJA 3THQA 3AHXA 1TPC1 3IVTA 3S1UA 2RDUA 3BW3A 4NU7A 2VI0A 3QQ1A 3NM3A 4WRHA 1UWQA 3PUEA 5A6LA 1Y0EA 3D3FA 3S2CA 4HSHA 4Z2GA 4FOUA 3QY7A 2PP0A 3CWHA 3QSRA 5I23A 4US5A 4NAFB 4MNJA 1OVDA 1R87A 3A3WA 4HHHA 1AW5A 3UZWA 3ES8A 2OT1A 5I79A 5I00A 1JUBA 4Q33A 4Y7EA 3H7VA 4L64A 2WPBA 4C6DA 2DZUA 4YCPA 3R94A 3FFSA 1M04A 3UG3A 2WMFA 2XH2A 2B7PA 3RFAA 3U2EA 4WUIA 1VCFA 1SJAA 4QAWA 4QE5A 5M3WA 1YTDA 3P6LA 3P84A 1OK6A 2NSOA 3ZWSA 4AZGA 5H8UA 1ZSXA 3S1WA 4DO7A 1B2YA 4XQ6A 3AIRA 2ISDA 4JTKA 1QCWA 2VZOA 3S6TA 1GW9A 3AO0A 4H7CA 4UQDA 4PMRA 1K1DA 3W24A 1J8VA 2D3LA 2A79A 7CGTA 4HHMA 1P0EA 3CYVA 1QI4A 3UU0A 3IV3A 2GQ9A 2WMHA 1JF6A 2X7WA 2PDYA 2P8BA 3HJEA 2JIWA 5D37A 3H54A 1FRBA 1ECQA 3HA1A 1J01A 1BVNP 3L4TA 5IFPA 3PZMA 1HKMA 1FWSA 1DIKA 3W84A 4HPGA 4O1EA 2VCAA 1HGWA 1DXIA 2Z2BA 1A49A 3WLLA 4AY1A 1PX3A 1V4YA 4P7OA 2A6LA 2HXTA 4S3JA 4LVBA 3WLHA 1TV4A 2ZC8A 2DH2A 1Q63A 2DVUA 3CZKA 4NXSA 3C2OA 4GWEA 2QCLA 3CL8A 1KFCA 1CXLA 4JY8A 4L1GA 4QCFA 1C8XA 3W07A 3CUHA 3CAWA 3KBSA 4IGNA 3L4UA 4PR4A 4O1DA 3W7JA 3WG6A 1IZJA 3VX0A 4C6LA 1KCZA 2QDEA 1F07A 3SCWA 4JL2A 3KL5A 5I07A 5T91A 1YPFA 3W28A 3CT2A 3FJNA 2EJAA 2VZUA 4REQB 7REQB 1KFBA 1JQVA 4DNHA 3WO8A 3BLEA 2G41A 3H2NA 5FJUA 2W92A 3MJYA 3GNNA 2ACQA 2QQ6A 1IYXA 3P81A 3GS6A 3MQTA 5HUOA 1GVIA 4CCDA 1OFBA 3NYZA 1T40A 3PZUA 2BFGA 1GUVA 1ME9A 3FKKA 3JZUA 4FXFA 3S4TA 4KIRA 3VD3A 4GK8A 2OWWA 1F6KA 1PHQA 1TIMA 2AKZA 2HMCA 3QV8A 4QS6A 1J9YA 3T8QA 1W56A 4DUWA 1VF8A 2OB3A 4LU0A 3AIQA 3LGGA 2HS8A 3VC5A 3BK0A 2Q3RA 4R85A 4AUBA 1JYXA 2DZTA 4RUBA 3CIWA 4TMBA 1UPPA 3VD5A 1AG1O 2XN2A 3NWRA 4HT3A 1GZGA 2F61A 3EOOA 1PX8A 2DY3A 4C7DA 4AH7A 3I3EA 1VFOA 3W3OA 1XLCA 4CUCA 2VR2A 1UKTA 4U2YA 3MW7A 4Q8NA 4FP1A 2JKAA 5G1MA 3N9SA 2EXOA 2AGKA 3NZQA 5CC6A 3GC2A 4C6QA 4Y9AA 2YXOA 3S9ZA 3ZJ6A 1EOKA 4W85A 3C61A 3HV8A 4F79A 1T6MA 5CPLA 2QCMA 5DANA 3INPA 3CO8A 3AMDA 3B9NA 4K3ZA 2WNQA 1YNYA 1KKRA 2BVDA 3B0XA 3P82A 1RAKA 3A13A 1SZFA 3BCJA 3TFXA 4M0XA 4MY8A 4LUTB 4JPGA 5JUVA 5AYBA 4XAZA 2PDIA 3M0JA 1TA3A 2IKGA 3FNDA 4I7UA 4FI4A 3PF3A 3PSVA 4GLEA 1ISWA 1S5NA 4LJ3A 4QQ3A 1RQHA 1JQXA 3GVVA 3G1FA 3L0GA 1H50A 1AJZA 4C6FA 5T9BG 1WO2A 1FXQA 4JIRA 1J2BA 4LCQA 4CN1A 5CPQA 1I8JA 4X61A 4ZSTA 3MMUA 3AZSA 4NUWA 2ZUNA 1BSLA 3NPXA 4IISA 2BXVA 4KPLA 3O8AA 3RR1A 2D22A 4AC7C 5EFFA 1AMKA 3AIEA 4LAOA 3BPWA 3L5LA 5A6TC 1W3IA 3PUGA 3VNIA 4QLJA 3V0SA 3U8GA 1JZ3A 2EPMX 5C9RA 1AQHA 2R6OA 2GQ8A 4NJJA 1KGUA 3QN3A 5BYWA 2HTMA 1J6OA 2WK2A 4RR4A 1E4MM 1Q6DA 3VA8A 2YBVA 4LB3A 4IMEA 1JRCA 1IE7C 1U22A 2OO6A 1PZ2A 3VZYA 1C8YA 2ODOA 3ZFHA 5D2TA 5FKYA 2F38A 3KOWA 2G4JA 2V69A 3BLPX 2J8TA 2YBUA 1FWJC 1QWKA 1WNOA 3LCWA 3ZVHA 1UC4A 4D1JA 1WXZA 2P76A 3IJLA 4UTWA 5EGRA 1S5TA 1UUOA 4JQ2A 1UQYA 4YTUA 4BS0A 3AS2A 3KHJA 2CBIA 1W1YA 3RUBL 1KQYA 2WZTA 3RHGA 1Q6FA 4TX9A 2WMGA 3IGUA 1JULA 5HNUA 1DIEA 3E5BA 4AB4A 3IJIA 1XLDA 4L61A 2VR4A 4GI9A 3BSGA 4XX6A 1HX0A 2A6NA 4M1BA 4UNIA 3LRLA 2CWNA 4FB7A 1BG9A 4XAGA 2ATSA 4Y9MA 2QXWA 3KBMA 4JHZA 4DBSA 4O17A 5CBJA 1O5KA 3ZVIA 2H6RA 1ZBCA 3DC0A 1KXVA 2XM1A 2XIIA 4B2DD 3W0KA 3O6DA 4B16A 3AALA 5T26A 1PV8A 3QMSA 3CTLA 3V0TA 3NEVA 1FQ0A 2ZX6A 3WYZA 3UXAA 3QOMA 1XV8A 3ZT7A 4GMEA 2OVLA 4OV4A 2E4TA 4H6EA 4MWAA 3ZS4A 1M65A 5MKGB 2OOGA 3VCCA 2CBVA 2WJZA 2FQIA 2ZA2A 3RXZA 1R85A 5EPDA 1DWIM 4JD4A 4DYJA 1A5MC 3KFTA 2VX6A 4PTDA 4YVXA 2YLAA 3KP0A 1I1XA 1HTIA 3DG7A 2I9EA 2XYLA 1Q2RA 3BURA 5L6UA 4AWEA 3HGOA 1AL8A 2EPHA 4EPEC 1WDPA 2V5JA 3F4NA 3L5MA 5EU9A 5EB8A 1SSGA 4LUYA 5KINA 1B3XA 4KWSA 5C5YA 4AZIA 4D6HA 3O1NA 1XSIA 3POHA 2VD9A 2V5BA 2I57A 4K39A 1W37A 5I3IA 1UR0A 4J28A 3VE7A 5HJLA 3RIKA 3AXKA 1BRLB 3SY5A 2OEJA 1H3GA 3AHYA 1MFUA 1F4HA 5CC7A 5GVJA 3QHOA 3NPWA 3WNNA 4NJKA 4Q4KA 1UWSA 3E9AA 1GQJA 4AIOA 1DVJA 2BVYA 2VL4A 1A4LA 1EJTC 5JQ9A 1XLJA 2XN0A 1Q6GA 4OGZA 2YX0A 3B8DA 1XUZA 1TPB1 4WJ8A 4CU6A 2E1WA 2J79A 1DJGA 4IXHA 3U3HA 1UG6A 1XJBA 3NQBA 3RLGA 3PTKA 3QVQA 1K9EA 3SRDA 3EWZA 3G8RA 4GY7A 2OMAA 3VMNA 2XVGA 4K37A 4DELA 2NZLA 3ZLHA 1HFBA 4O57A 1YHTA 1RVGA 3WF3A 1ZAIA 5REQB 3BOLA 1OADA 5FAGA 2Z27A 1RPXA 4B5NA 2Q8LA 3GR8A 2O55A 4AZCB 4MLRA 1W5NA 3C5QA 3WD0A 2Q3OA 4M19A 3V4BA 4F0RA 2YCKX 1KKOA 3SGGA 4Z2LA 3PPFA 4QSFA 3LTSA 2NSXA 3JU2A 1XRTA 3F4WA 5HMSA 3PULA 2X7VA 1TG7A 5AYXA 3GZAA 3FY1A 3F5LA 5J04A 3W7HA 5BROA 3LNPA 3GW3A 3TYCA 2V30A 3ORWA 2YW4A 4KFOA 2D24A 3P80A 4FXSA 2QCNA 1EJRC 5XIMA 1AQFA 5K4ZA 3E0LA 4Y90A 3TR2A 1KNWA 3FA4A 1UZHA 4H9YA 4ACZB 3WJZA 4E0CA 1GCYA 2NQ5A 5IDIA 1V6XA 4CNTA 1G1YA 2I14A 2XVNA 4ZB0A 4PMDA 3L21A 3AISA 1LUCB 3QR1A 3BLLA 2WSKA 3WDPP 4D6JA 3NGFA 4DRSA 3I7QA 1AA1B 1LQAA 2F6XA 1M3UA 5CSYA 3AICA 3EOEA 4Y6GA 3QPZA 3PFRA 1EJXC 4IX2A 1XYBA 4YHGA 3WEZA 1QHOA 3CMFA 4KEZA 3ANYA 1J0JA 1CGWA 3QGVA 1PZ3A 2R1MA 1UOKA 1EZWA 3IGXA 3BCFA 3W85A 4YMZA 5IM51 1T0OA 2CLEA 4Q8UA 4J3WA 1JCXA 3PZTA 3WQDA 2WBGA 5HULA 1LJYA 4QCEA 2ZICA 3AYRA 2Y8KA 1KM0A 4O4VA 4P5UA 3SGZA 3G18A 1DV7A 3Q65A 3JZEA 4CQ9A 5FEZA 4AF0A 1M7XA 2VVNA 4IF2A 3B8UA 1IWPA 3LERA 4K1WA 3U2ZA 2YJQA 4HQVA 5IHSA 3GXDA 4K8HA 3W86A 4Q7IA 3P0WA 2HS6A 3KLLA 3UGVA 3WNMA 4C5YA 1EEPA 3PP7A 1SMAA 3HTWA 1DYSA