1ZSXA

Crystal structure of human potassium channel kv beta-subunit (kcnab2)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Human Potassium Channel Kv Beta-subunit (KCNAB2)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Voltage-gated potassium channel beta-2 subunit
total genus 120
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zsxA00
3LD5A 2PDWA 4DBSA 3R94A 1IEIA 2IQ0A 2PDJA 2IS7A 2I16A 2PDCA 2IKIA 4GCAA 5HNTA 3LZ5A 2IPFA 4GABA 4YVVA 4LAZA 2VDGA 4XZIA 4WDWA 2PDNA 4PRRA 2HE8A 1YE4A 2PDXA 4WDTA 2PDIA 5LIXX 4HBKA 2WZTA 2ACQA 4GACA 2INEA 1X96A 2IKHA 4WEVX 3BURA 5C7HA 4JIHA 2PDHA 2ALRA 3COTA 1XGDA 1UR3M 4IJRA 3UYIA 4GIEA 3O0KA 4EXAA 2F38A 3VXGA 1PZ0A 3EB4A 1YE6A 1MI3A 3B3DA 2PDGA 2IKGA 1IHIA 4XO6A 1YNPA 2INZA 1EF3A 4JTQA 3P2VA 3GHUA 3CAVA 3R8HA 2PEVA 1MZRA 1Z8AA 3CV6A 3BUVA 2BGQA 4MHBA 3LNMA 4YVPA 4AUBA 1MRQA 1QRQA 2HVNA 1S1PA 4I5XA 3M4HA 4JIIX 4FA3A 4HMNA 3RX4A 4LAUA 5JH1A 2IPJA 1X97A 2ACUA 1LQAA 3D3FA 3LZ3A 2PDUA 1XF0A 3V0UA 5AZ0A 3M64A 1ZGDA 1EL3A 1Z3NA 2FZDA 2NVCA 1VBJA 3WBXA 5JH2A 3KRBA 2J8TA 2QXWA 4PMJA 1M9HA 4R9OA 1OG6A 3N2TA 2WZMA 4GQ0A 1XJBA 3H7RA 2AGTA 4GQGA 3FJNA 1QWKA 4XO7A 3V36A 2HV5A 3WCZA 4H7CA 3O3RA 2PDLA 1K8CA 3DN5A 2P5NA 3LUTA 3CAQA 3UG8A 1AH3A 3N6QA 3M0IA 3T42A 2CLPA 1AH0A 3WBYA 3UZYA 1HQTA 4PR4A 3V35A 3ERPA 3QKZA 3GHTA 4JIRA 4Q3MA 3Q67A 1T41A 4IJCA 1SM9A 3CMFA 4DZ5A 1HW6A 2PF8A 5LIUX 2PFHA 2IKJA 1Z9AA 2FZBA 4YVXA 1PWMA 1C9WA 3LBOA 3BCJA 5HNUA 1US0A 4OTKA 1GVEA 1RALA 4XZHA 1RY8A 2HE5A 3LEPA 4EXBA 2HDJA 2DUZA 1X98A 2BP1A 3NTYA 3LQGA 1AH4A 4JQ2A 3R8GA 4DBUA 2ISFA 2FGBA 4LBSA 1VP5A 3EAUA 2NVDA 4XK2A 3LENA 4JQ1A 4GA8A 2PDBA 3UFYA 3GHSA 1PWLA 3GUGA 1YNQA 3LN3A 4QR6A 3UGRA 4G5DA 1ZSXA 4JQ4A 3RX2A 4ASTA 1T40A 3RX3A 3H4GA 2R24A 2IPGA 1RY0A 4FAMA 4QBXA 4LB3A 1ZUAX 3LQLA 5DANA 4IGSA 4NKCA 1J96A 4XZLX 4LB4A 1Q5MA 4PRTA 3Q65A 4H8NA 2HVOA 5LIKX 1FRBA 3CV7A 1Q13A 2DUXA 3R6IA 3WBWA 2C91A 4L1WA 1S2CA 4FALA 4XVEA 2BGSA 4Q7BA 4L1XA 3MB9A 2R9RA 3G5EA 4JTCA 2IPWA 1ADSA 2FVLA 4JQ3A 1EXBA 2ACSA 2PDQA 4JQAA 3F7JA 2PDKA 5M2FX 2DV0A 3FX4A 3EB3A 2F2KA 1JEZA 4FZIA 1PYFA 3R43A 2PDMA 1AZ1A 5LIYX 4F40A 3V0SA 2PD5A 2FZ8A 2HEJA 3WG6A 2IQDA 2PDYA 1PZ1A 1A80A 1R38A 4DBWA 4JTAA 4YS1A 3ONCA 3GHRA 3BV7A 3UP8A 3MC5A 1AFSA 4WDXA 1S2AA 4QX4A 4ICCX 4WRHA 5LIWX 4XZNX 3CASA 3DOPA 5KETA 1ZQ5A 3UZXA 2PZNA 4LBRA 4WDUA 1AZ2A 3UWEA 3U2CA 2FZ9A 3R7MA 4JTRA 4PUWA 3G1RA 4JTDA 2ACRA 3V0TA 5HA7A 4WGHA 3C3UA 3ONBA 2PDFA 4PUUA 3UZZA 4YU1A 1Z89A 3H7UA 5AZ1A 2PDPA 3UZWA 4XVDA 4ZFCA 1LWIA 4RPQA 3S3GA 3R58A 2I17A 4XZMX 4XAPA 1S1RA 4QXIA 1EKOA 2A79A 2PD9A
chains in the Genus database with same CATH superfamily
3IGSA 1OT2A 4F2UA 4WXZA 1CWYA 2AKZA 3QW4B 3GFZA 1XX1A 4L6DA 1KGXA 3CWHA 3NXLA 2BY1A 2DZSA 2A3EA 4YVVA 1GQNA 1FCBA 2VZTA 2BXZA 3T0AA 1PS9A 2VCBA 3WDPP 3PSWA 1LQ2A 2PWVA 4EOUA 4HNCA 3W23A 5FCZA 4GI4A 3NOYA 3LNPA 3DZ1A 2J75A 4K39A 1YTEA 1H2JA 4GH3A 1WKDA 4IL2A 3GXTA 1R7AA 3NDZA 3CNYA 1Q8AA 3Q37A 3EOLA 1GTHA 3GXNA 3AALA 4ZOCA 1WZMA 3DFQA 5DEZA 4MLRA 3WF1A 1DQUA 3O0KA 3G1DA 3M6DA 1A5OC 4IZGA 3NA8A 4XUYA 2VZVA 3M5ZA 4TX6A 4HU8A 4GIYA 5CC7A 2O56A 4JKKA 5E9XA 1O95A 3AXMA 1A3XA 3TV8A 3LNMA 3CZGA 3WDRA 4MOZA 4N9BA 3HV9A 2FFCA 1J6OA 2GVJA 5U7SA 4JIQA 3WLLA 1I0DA 2ZC1A 1BRLA 1UW9A 4GYPC 3D3FA 3LZ3A 1OQFA 1MMFA 3BAKA 2IMRA 1WDDA 4RL3A 3QTGA 1I45A 4ONVA 4JN7A 5I06A 1M3UA 2ZUUA 4QAWA 3CMGA 4H00A 1BYDA 1G4TA 4LEFA 4NIRA 3AHVA 4FI4A 3ITCA 5I6SA 2PB1A 5C54A 4RDYA 3HA1A 3PK7A 3N3TA 4TTGA 1H62A 4AZ6A 1EJTC 3RF9A 2O55A 2QJGA 4H9TA 4MJMA 3W76A 2J24A 1UQYA 1REQA 5JBFA 1WA3A 2B7PA 4PTMA 5EMMA 4ICMA 1Z41A 1PXGA 1ZBKA 1PSCA 3QFEA 3AAMA 2PA6A 3U5YA 4Q3MA 5FIPA 1TV8A 4KWUA 2ZRXA 2VGGA 3L2IA 1FHUA 1PEZA 1BTMA 4AG0A 3TWAA 3FDKA 4RCXA 3RK8A 5E5CA 3UY8A 3NQ6A 4GVIA 1UWTA 2NXGA 3QV7A 2Y88A 1QBAA 4B15A 4JYEA 3S6DA 1UKPA 1L6FA 2FYMA 3FAXA 1AK5A 2PWUA 3LV5A 3GTIA 1HG3A 2BB0A 1W5PA 4OTKA 4ZOAA 5M03A 1UIOA 3CGTA 1NQKA 4PMUA 2O7SA 1A5NC 5B80A 7REQA 1IIGA 3FLUA 3KCOA 2OODA 3KXQA 3KUMA 3CQIA 1SR9A 4AY1A 4JDYA 2FGBA 2XZ7A 4LBUA 4GVGA 3EAUA 1V79A 3MUY1 4P7LA 4XZBA 2ZBTA 3C2EA 1J0JA 3JVAA 1GWJA 3IAQA 1WAWA 4G56A 1VJSA 5J8LA 2A4AA 1G9HA 1E6ZA 3OLDA 3HM7A 3PFRA 4DWSD 2DW7A 1FWRA 3B04A 1CGWA 3PBGA 4AD5A 1RSCA 1BF2A 1OG0A 3UT0A 1ZS2A 4P8XA 2P50A 5HXMA 2VCAA 4R85A 1A5UA 2FVKA 1LTDA 4HHHA 4LF2A 2BY3A 1K7EA 4JL2A 4S3AA 2OO0A 1R85A 1M03A 1IT8A 1R2SA 4L61A 4RPPA 4AMAA 4K8GA 3AUJA 1B30A 3T55A 1A5SA 1ME7A 4L1XA 3HFYA 4GISA 5FL0A 1C8YA 1V3KA 2V9DA 2W6RA 1KKOA 1XQKA 2V0TA 1VENA 3NVDA 4JQ3A 2ACSA 4M6QA 3I4KA 3TW6A 4MLJA 3VD7A 3WEZA 3W3OA 1B1YA 2PDQA 2ZZ3A 2VYOA 1MW1A 4J3WA 1F74A 3TKFA 3D46A 4QROA 1XLBA 4R88A 3VINA 3PBWA 2OR2A 1GPFA 3VE7A 2J7BA 3NYZA 2VEGA 4RW3A 2REQB 3HB9A 4PC8A 2Y7GA 4PUNA 4HCDA 1DIDA 4OUIA 4A6GA 1OX4A 1A80A 1H0IA 3BLFA 1UJQA 3DI1A 3BV7A 3MY9A 3M07A 1ZNNA 3SZ8A 5I77A 3S42A 3W7EA 4I3GA 3VNZA 4GZEA 4ICCX 4LCSA 1KM0A 3W1XA 2YLAA 3CHFA 4DXVA 1RA0A 3K2GA 2DFAA 3JU2A 4QCFA 5I0DA 3REQB 3I68A 2OQLA 5A2CA 1VJZA 3HPXA 4F48A 2TYSA 5AVNA 1FWTA 2P0OA 5AYXA 4Q22A 1E40A 4PB5A 5HA7A 4QISA 5I7GA 2B0MA 4AD3A 2J77A 1UBPC 6TIMA 2HS6A 5C2CA 3W1PA 5XINA 5KZEA 3Q2DA 1VHCA 1VB9A 3KAOA 4DJED 2BSLA 3MV11 3THCA 4V28A 4QXIA 4BF7A 3P8JA 3DFSA 3O8AA 2CLHA 3G1SA 1KFKA 1XBXA 1KXTA 2PDWA 3VE9A 1B3ZA 1NWSA 3W70A 5I78A 2MUCA 2GUBA 4RDWA 1DTUA 1JGIA 2OPJA 2A3HA 5A69A 2EPOA 3W71A 2E68A 2DZPA 2E9MA 3BAWA 4E3VA 1GOMA 1QI3A 1NDWA 1YPFA 3T0TA 5F4XA 2VTFA 1YRRA 1YDVA 4KWVA 4B9YA 3GH5A 8CGTA 5FI8A 4H8UA 4C90A 3G18A 1NWRA 4KH2A 4P7OA 3NOEA 3TQKA 3NL2A 3IRSA 3M46A 3GTHA 1UYQA 4FF7A 4I6VA 1LQ0A 4A2SA 4Z0JA 3AQUA 1UUMA 4EAYA 8A3HA 4A3HA 3TLLA 1ICPA 1BQCA 1V6XA 4GKTA 2OGYA 3L4WA 5K2ZA 3U4FA 3BPWA 2OX1A 4YYCA 1Y8BA 4IM4A 2QW5A 4HPJA 3S1UA 3KL3A 1KXQA 2CXEA 1Z8AA 3PFMA 3NO5A 3ZO9A 1AA1B 1JYWA 4YVPA 4AUBA 3S2CA 3C86A 1G01A 1DWGM 3VIPA 1YMYA 5AB3A 2WC3A 4ERIA 3THQA 3VCRA 1YYAA 3OB8A 2A0NA 5AC7A 4LTSA 4N4QA 1WUFA 1CPUA 2VC6A 1OIFA 4WCJA 4EF9A 3H2FA 2ZE3A 1EO5A 3GH7A 3VOHA 2YA0A 1S46A 1VS1A 4GFSA 1DIOA 1GK8A 1W9UA 4CQDA 4GQ0A 1XJBA 4GQGA 1W3HA 1LYXA 4E4PA 4IP4A 4FLQA 3EOEA 4YLWA 5CLTA 3W7RA 3LS9A 5BRQA 4E5TA 4PZVA 2F6XA 3PBMA 2Y7DA 5E0FA 1PTGA 1NARA 5CLWA 1AH0A 3P82A 4X9YA 1GNXA 1V93A 4MFDA 5BW6A 1HVQA 2D2HA 3OZPA 5HJXA 3LRLA 4U3AA 4FIRA 3F4WA 3QKZA 1FDYA 4NNAA 1R3QA 2ZOXA 1J93A 3PNUA 1VHNA 5HMEA 3VIOA 1TPEA 1VGAA 1TSIA 3OYZA 2WJEA 3B0PA 3NQ8A 2X30A 4QGCA 4A8IA 2EGZA 3SCTA 4KPLA 2YFNA 1Q63A 5HQMA 4GIAA 2XVKA 3QN3A 5BZAA 1L0PA 1H1NA 1ZENA 3ARPA 4LRTA 2V63A 4MGGA 4NX5A 3M0XA 1LP6A 3WQ5A 5D9PA 3MI3A 1UIPA 4HMDA 4TUFA 3IIXA 4ZO6A 4BY3A 2AGKA 4PODA 4EX4A 4BWLA 4JZ5A 1ZCCA 4RR4A 1V3IA 3VKAA 3S9ZA 1IZJA 3LXBA 3U0HA 1K8ZA 2XN2A 4UR9A 4C5YA 4C6JA 3MUXA 3VNKA 3TYEA 3D6NA 5I3JA 2HDJA 3E2RA 2BP1A 1GOQA 2W0UA 3IARA 2CIPA 5FJPA 4JTLA 4YL2A 4MJZA 3M47A 2DT1A 3B9OA 4XK2A 3T4WA 4Q4PA 2QAFA 3WK1A 4PMXA 2D0FA 3EYPA 3QSTA 3RITA 1POKA 1ZSXA 1TIWA 4Y8FA 1DQXA 1UWUA 1FTXA 5IHSA 3EMCA 1TELA 2E6YA 2QUMA 4H41A 2Z7KA 4MG4A 4QS6A 5DO8A 4JEJA 3EEGA 4F8XA 3BGGA 4IIFA 1J96A 3TWBA 3KEHA 4H7VA 4HNTA 3W2JA 1NQ6A 4H8NA 1H7WA 2QV4A 3R25A 3W29A 3P5YA 3W07A 1I2OA 1M04A 3WKZA 4KRUA 1JL8A 3R6IA 3OGRA 3QLDA 5AHFA 4DPPA 5T9CE 3V4BA 2FPYA 4KFPA 1HP5A 3PNZA 1FKXA 4DNHA 2D24A 1XYFA 4FO4A 2ON3A 1UH4A 3W82A 3APGA 2XH2A 4TU1A 3MSDA 3VDAA 3FFSA 3DG7A 3B0UX 1CXFA 1PIIA 5EMYA 1SO5A 5JU6A 5CAHA 4HNLA 3UXIA 1N7KA 4B4FA 1OK6A 4PEEA 1VPXA 3DBNA 1MFUA 3GH4A 1XBVA 4LUJA 1GZGA 1LROA 3U4AA 3AFBA 4M6UA 2Z1XA 3LCHA 1KC7A 5I3DA 3R2GA 1XICA 3UWYA 3TNBA 1EHNA 3QKEA 4MB5A 4O57A 4EWND 1M7OA 3DFPA 2GJXB 3W00A 2HISA 4C5ZA 4YCPA 1YPIA 4X61A 1HVXA 3GHRA 4WHBA 1A3HA 4C1NB 3M5VA 4HU0A 2XN1A 1IWPA 4WUIA 2I5IA 2DDXA 1FWGC 2Q3RA 2XH7A 1E4IA 2AQVA 1C7TA 4G8TA 3UZXA 4QTGA 5CGMA 3NZRA 4D2JA 1E0XA 1ZAHA 5TAOA 2BVYA 3M16A 2J7GA 4C6QA 8XIMA 1JRBA 3BLEA 4FLSA 3S9IA 4HQVA 2V6AA 4L9XA 4MAVA 4HKPA 4IX2A 2JE8A 2PI6A 4UCGA 4C6NA 2J6XA 1GG1A 4XAYA 2UBPC 4R34A 1LWIA 3VOFA 2J7EA 4KIRA 4ECLA 4L80A 3N25A 3MSRA 2E7FA 1JZ3A 4NI3A 2P8CA 5H8PA 1D8WA 3ISIX 1OM0A 3VKDA 3W75A 4KESA 1JNEA 4O28A 4J28A 2QJNA 2AAAA 1N8FA 3DKJA 4A05A 2NLYA 4LNCA 3MO4A 1QNOA 3C3NA 1ZCOA 3B8UA 3EWUA 5LGZA 3PG8A 3UYCA 3AC0A 4CD6A 1QOQA 4M81A 3GIYA 1JI2A 2Z25A 4F3HA 1FWHC 1SSGA 3KW3A 3NNTA 4I5UA 4ZQNA 1W2PA 2ACQA 1NM9A 2HROA 3H4XA 3UWVA 4RDVA 2D23A 4B2DD 3CAKA 4HPGA 2AL2B 3AIEA 3KVJA 5E1QA 4E8DA 2VGIA 1HGYA 3SUUA 1BSLA 3TA6A 1TPVA 4Z1AA 4QITA 2XU2A 4U2YA 1XS2A 2XN0A 3VXGA 3PVFA 5EYWA 2EF9A 1L9WA 3L12A 3EB4A 5JVLA 2VHLA 3NQDA 3GWQA 3O2LA 3KRZA 4NJKA 2OZ0A 3M41A 3M7SA 2INZA 4HCLA 1ZFJA 4JX5A 2VL4A 4RLIA 4ACZB 2WLYA 1UZHA 2HTMA 3IIPA 4UUIA 3AS3A 3VD9A 3BLIA 2ZZ4A 5ABFA 1KBIA 3OBEA 1KFLA 1I60A 1NDZA 1Z32X 1IEXA 5E93A 1LCOA 5DELA 4WJ8A 4H9UA 4BQ3A 3L2LA 3RX4A 2FLIA 1LUCA 3SGGA 1GHSA 3QJAA 4WD0A 1EPXA 3LHVA 3EWWA 4GI9A 4RZ6A 1TJ0A 2JKPA 4AVNA 5JH2A 1XD1A 4P8VA 3ZFHA 1MUMA 4IMFA 4D6JA 1XRTA 3WL0A 3VDBA 2ISVA 1W8GA 4QS5A 3GDMA 1E1CA 4UNLA 3PTMA 1UPPA 1OZMA 7REQB 4FF5A 4BI5A 1DXIA 4X2PA 4UC5A 1P7TA 2OKOA 3PR2A 2AKMA 3P67A 2RFGA 3NFUA 2VDHA 1W56A 3G1FA 5BOFA 3GXFA 4AB4A 1QPRA 1FY6A 2VWSA 2MANA 5CPQA 1ELSA 1BHGA 3IIOA 1PUDA 3KE0A 5F2GA 2NV1A 1GG0A 3LHWA 1EX1A 4R7JA 1E43A 3SR7A 3RMJA 1U5HA 2QUUA 3LMYA 1CXEA 2VQTA 3CL7A 1S5TA 2XG9A 3L9CA 1SSDA 1IIHA 5FSEC 4XQ6A 4X3ZA 2WMFA 4QG6A 4PMNA 2XVPA 3IVUA 4Z0SA 3XIMA 1RQBA 3M0LA 5HNNA 1VLWA 2B7NA 3MT1A 5A6MA 2WB5A 4FEZA 4NAFA 2OEJA 1QHOA 1K77A 1ICSA 4UMBA 3CV2A 4UQ9A 4EIVA 2X0YA 1BG4A 1AQFA 3KRSA 4PCTA 2A5HA 1XSKA 2NV9A 4GYJA 4LALA 5D2TA 4X9SA 3C61A 3H2CA 3D0CA 1SO6A 4XAFA 1JCXA 2HK0A 2ODOA 5IFTA 1JZ4A 3URNA 2PCEA 4HPNA 2OWXA 2XH4A 2OCZA 3T2QA 4ORIA 4L9ZA 1FA2A 2CETA 3MYOA 2FKPA 3TMQA 5AECA 1HKJA 2CFFA 2VDIA 1HJQA 1RY0A 4ZO8A 3N6JA 3ZT7A 3K8MA 2VJXA 1EIBA 1CB7B 3PTKA 4XZLX 3U7VA 1F5ZA 1M65A 4E2DA 3N2OA 1CEOA 5HQEA 1VR6A 3S83A 2VOMA 2BVTA 2WPBA 1GVOA 3O7UA 2YB1A 5XIMA 1FWAC 2OMAA 3W88A 3O9NA 5SWUA 4W84A 4M82A 4GC3A 1KFWA 3PWIA 4WX2A 1H7RA 1Q85A 2WCAA 4MWAE 4JTCA 1RK5A 4O1BA 1Y5XA 4LT9A 4CN1A 2MNRA 3G8EA 1JD7A 1EJSC 1U1JA 3E96A 5M2FX 1TVPA 1CTNA 2CZEA 3RLHA 3BJTA 1AUSL 2F2KA 3G1YA 2NX1A 3F4NA 1OFDA 1PTAA 3LCLA 1H1YA 3GAYA 3BANA 3GIPA 1DJZA 2D2GA 3WF4A 4NAEA 1WQ5A 2OYLA 1J5SA 1ML1A 1ZZMA 4YHEA 4S23A 2FZ8A 1TV2A 3WD0A 4I9MA 2RDTA 3WD3A 3RIKA 4PMRA 1V51A 1R38A 2GDQA 1G69A 2XVGA 4DBWA 3QQWA 3BMVA 3FNDA 1PBGA 3NCOA 1R3TA 3YPIA 2JIEA 3FIGA 4AWEA 5T91A 3HGRA 3CMJA 5LIWX 2X40A 1UMLA 4Z1CA 3PBYA 4IGNA 4KWSA 4H9ZA 2VZSA 5KETA 4CVUA 4ZXLA 5CC5A 3TSMA 1GZ1A 4GLEA 1MZHA 4WDUA 4WZHA 1OCJA 3WMCA 4M5PA 4C6OA 1PO9A 5A8QA 2WNWA 3VC5A 1S2WA 1WOAA 4HA4A 2CLEA 2FHBA 3W83A 4P7NA 1RAKA 1EO7A 1XIHA 3UZZA 4E2BA 5EU9A 3TIMA 5AZ1A 4MTVA 3G8RA 4C91A 2FMNA 3N2MA 3MWCA 1S2TA 1JCLA 4MZYA 5CSRA 2F9RA 2AMGA 1J12A 2F84A 2BY2A 3N15A 2YL8A 1HKKA 2PTXA 1FWFC 5EKYA 4NXSA 3TROA 3QV6A 1Q6EA 1IEIA 2WV8A 3R13A 2IQ0A 1KB3A 3HJZA 2PDCA 3ZT5A 1ENUA 1G6CA 2PBGA 1GORA 3TC3A 3A12A 4KS0A 3MO7A 3C2YA 2G37A 4XZIA 2GFTA 2VEKA 1X6UA 5C9RA 3B03A 2OEKA 2VRKA 4J4KA 3EEZA 4ZO9A 2R94A 1ZRQA 1CXIA 2E5BA 3VABA 3AXIA 1C90A 1O1HA 1X96A 2IKHA 3P61A 4XD6A 1TPFA 3G3MA 1ICQA 3AS2A 3CHEA 3TXVA 3ITXA 4DXKA 2DSUA 3JS3A 4MYAA 4UQAA 3B8WA 2NW0A 3L65A 2GDUA 4DWSC 1XXXA 1CGUA 2O9PA 1HJUA 3QSRA 4GZJA 5G4EA 1LBMA 5IBXC 2ASHA 2F38A 4LCRA 3L21A 3OOQA 1JF6A 4O54A 4Q7NA 5HJYA 2EJ1A 4XKYA 3NO3A 1MI3A 4CNPA 5DXXA 4GNJA 3TTYA 3THDA 1SFSA 1QK2A 4Y7EA 1I0BA 1DWJM 1OGGA 2DSZA 2RJHA 3LYEA 4HHMA 3BG9A 4PMYA 1BAGA 5GJPA 1QRQA 3WJYA 4P7RA 3GSMA 1DXEA 5B7ZA 3UCDA 4H9XA 3NQAA 2FPTA 4JIIX 2XGZA 4KT2A 4FNUA 5L9FA 3S46A 3W7MA 4OKDA 1LRQA 1M41A 3IGUA 1XF0A 5CSYA 4J3XA 3ZMRA 2PWEA 4MKNA 2XFWA 5EGRA 2FZDA 1E3XA 1H5VA 3VD3A 5C70A 5A8NA 3EDFA 4RE3A 4J3VA 1QPOA 3KVKA 4I9AA 2G3JA 5BXRA 2QUTA 3KBWA 4PMJA 1UKSA 3STPA 1R7OA 4IIEA 4WKAA 4DIAA 1TZZA 3VZZA 4XO7A 4RZBA 1W3TA 1UZ4A 4S3DA 2ISDA 1JNDA 1ZJBA 3TC7A 3LRMA 4PL2A 5BOEA 2ZXAA 2PU1A 5LNRA 3N6QA 3GDKA 2V5CA 4JX6A 2ZUWA 2CU0A 4MIMA 5HMDA 2GK1B 2QGHA 3H8AA 1G4SA 2G41A 1V6YA 1MRAA 3GZ3A 5DLCA 3NZGA 3ATZA 3KOWA 3GVWA 1TFVA 4FMVA 1T41A 4MJ2A 3QVQA 4IQDA 1XG3A 1D3GA 4JIPA 1OWQA 2Y61A 1BFNA 3TE9A 1AMYA 5BOOA 1D3CA 3CMFA 4OE7A 5A8GA 2J4GA 3M44A 4H6RA 3GQYA 3T0CA 1JPHA 3VTRA 1MWOA 4LU0A 4PCFA 4HNVA 4RKAA 4H6QA 9CGTA 4RXFA 3E2VA 4F0MA 1RALA 1NP0A 1ZHAA 2GWNA 3BZGA 1DBTA 1FUYA 3G0SA 4ZA0A 1C8XA 5J5DA 3TYUA 1VP5A 3AIUA 4QJ4B 5AC4A 4CNTA 1TPH1 4WVXA 4JCMA 1HO4A 4LUYA 2PU0A 3APYA 1SFTA 4ZFMA 2FDSA 1RBLA 1O60A 4JFSA 1XYLA 4PYSA 1BD0A 1RCOB 1P1XA 3LBMA 2C0HA 2RGMA 3JR2A 2XFRA 3NSNA 3W2NA 3P93A 1PIGA 1H61A 4I8DA 4DO4A 3WQCA 1E4LA 5FJTA 3JRKA 3WUFA 2QDHA 3WZ0E 3M0JA 1JQXA 4IMCA 2ZADA 3NL3A 1E0TA 2Z1VA 3OVPA 4FPSA 4Q6JA 3LM7A 1IXPA 1QU4A 1UD8A 3S6TA 2DVXA 2FGLA 2C91A 3KX6A 4K8EA 4YWSA 3RU8X 3FEMA 1VCVA 4UTTC 2BGSA 2GL5A 4JHMA 3S47A 3IVTA 4W87A 3UXKA 3HMJG 3CUZA 4ML9A 3FHAA 5C5YA 4L4LA 2R1NA 1LL6A 3QPYA 3OG2A 1WDRA 3EWCA 4Q8PA 2GSEA 1GYLA 3F1QA 3M0YA 1NFPA 1FWDC 4FXSA 4GX8A 5M3WA 1MDRA 5I79A 2X8RA 3SAZA 2E1DA 1W3JA 4M7SA 4AIEA 1EBGA 2FFIA 2XFFA 2ZDRA 3FJ4A 1K9EA 1E9LA 4NUWA 2PWFA 3W9ZA 2A2IA 2QDDA 4FNSA 5G1MA 1VCGA 3FEQA 2P0IA 3KOFA 4ZQOA 3IV8A 2V2CA 1XIGA 4HNOA 4C60A 4Q4MA 3SN1A 3PP7A 3CASA 1XDJA 4HCHA 3EMZA 1UA3A 3EGJA 4MWAA 5D02A 2F7FA 4ROQA 5M17A 3USBA 3CJPA 4Y96A 3VKKA 2WKGA 2UWFA 3QMSA 3ITVA 4PN2A 1XH2A 3P8IA 4YU1A 4YTUA 2XH0A 3GAKA 3UVAA 2PDPA 4E6MA 4ZFCA 4CVWA 5FF7A 1A0CA 2ABAA 3DGRA 3DG6A 1C9DA 3O15A 1F9CA 2I17A 1WUEA 5DN1A 3SM0A 3EWYA 2YBTA 4MY9A 1KWKA 4Z2HA 4GUIA 4DAFA 4WY0B 2R82A 2ZA2A 3S8HA 2E1WA 3QGKC 3NUKA 1IR1A 1UA7A 3LXCA 3SN0A 4PTWA 1WB0A 2ZRYA 2Y5JA 4NI8A 1TKKA 5TIMA 2QNEA 2IKIA 4K38A 3KWSA 4RV8A 3B05A 2VDGA 7CGTA 3RCNA 4J3ZA 1XLEA 3OHMB 1BRLB 2I9UA 4AEFA 2BLEA 3FKRA 4ZO7A 4HBKA 2DZAA 5D38A 4Q8VA 2ZUNA 1NDVA 2ZXDA 1EOKA 4DPQA 1AJ0A 3NDYA 4Y9OA 3WQ8A 1EJUC 4V33A 5IDZA 3COTA 2VX4A 2X41A 5CJMA 4AX7A 4C1LA 3DI0A 2VRQA 5HWNA 1N55A 1XISA 2QF8A 4Z2JA 2YPIA 1C8VA 2AOSA 1BVZA 2NVAA 1ONXA 2EHHA 2YCJA 1U2YA 3HPAA 2ABBA 2YKKA 1OIMA 1PKYA 4N42A 5C9WA 3VFCA 5M1TA 1TPC1 1IF2A 1F07A 1NELA 3T2OA 1FBAA 2RGLA 2WNNA 4L7ZA 3FSTA 2PP3A 4A35A 3E1F1 4QG8A 1IWBA 4GK8A 3W7NA 5AHEA 1QI0A 4LYQA 3F4DA 3I3BA 4O1CA 2E9BA 1WXJA 3ORWA 3W6MA 1EEPA 4HMNA 2YBUA 1E9YB 1Y5WA 5EL1A 1K1DA 2O4MA 2O7QA 4XZ9A 1DOSA 4HA1A 1T8XA 2VFGA 4IP5A 3OQ8A 1O5RA 5BMXA 2PS2A 5FJRA 1LOQA 1ITXA 2QXWA 4R9OA 4EF8A 4ROPA 1P48A 1GOKA 4OJYA 3CQ0A 2NQJA 4XD5A 4MSSA 4DUVA 3FYOA 4DXXA 2IXUA 2SFPA 3SQSA 1JVNA 1W17A 3UF9A 1Q2RA 4H1ZA 3L4ZA 4S3JA 1J6PA 3UG8A 3UETA 3WQGA 2VUYA 2FH8A 2UV8G 3TJLA 3WBYA 4R27A 4XISA 4UFHA 1H7OA 4PR4A 4YWIA 3EPNA 2DIEA 3WK3A 3V35A 4S3KA 4ENLA 1I75A 1GHRA 4AVOA 4AYSA 3Q67A 3C0LA 3OBKA 1K9TA 3S2LA 2E5CA 1OINA 3GVVA 4P2VA 1Q6OA 3PC0A 2OLHA 4I5RA 3C5QA 1W3KA 2PF8A 2CHOA 5EFDA 3BDKA 1KXVA 5AN7A 3DBPA 5FEXA 4HZ7A 5KMYA 2CKSA 4LV9A 1JGMA 3ZM8A 1FDJA 1LLOA 2CHRA 2P76A 2XWEA 5BXPA 4G1KA 2OKTA 4AZGA 4PMOA 3W2KA 1XHGA 2Q71A 3KRUA 2PRLA 3W86A 3PPCA 2INFA 3PULA 3R8GA 2XGIA 4K68A 4DBUA 4MDOA 4O15A 6ENLA 1K70A 2W67A 1IT0A 1SUXA 3BSMA 2YW3A 4KGJA 1F73A 3NZPA 3LLDA 3WMSA 1XLHA 3LN3A 4CQ8A 3BAXA 4ZSTA 1TZ9A 5D05A 3PZVA 4Q4QA 1KRBC 4S3BA 4Y2WA 1UD2A 3MHGA 2VP8A 4MNJA 1J18A 3ANYA 1QNSA 3DHPA 3VC6A 2YL9A 1WP6A 1HL2A 3WFAA 2VQUA 1K3UA 4CCDA 5KEZA 5LA2A 4K7YA 3E6EA 1ZU8A 1WBHA 1FRBA 3NEVA 3L4UA 5AY7A 3WBWA 6REQA 2WHKA 1IR2A 1P6CA 1NSJA 1X38A 1BSIA 3QQ1A 2X16A 4JFUA 2Z24A 5CJ5A 3OA3A 3L4XA 2DZXA 1GGOA 4AIUA 1AW1A 3W1LA 3T44A 4IT1A 2HNEA 1XKYA 4F9JA 1X39A 3KFTA 4PMVA 5GNXA 1LRNA 3V0SA 4MDPA 3M0MA 1B90A 2VZUA 1LWHA 2VXNA 5JBDA 2RKXA 3N29A 4QJ3B 4DI8A 2WMIB 3SCSA 2J78A 2O0TA 2ZRWA 3VNIA 1HUVA 1AQMA 2E0PA 3MI2A 2AQWA 4CD5A 4AF0B 3G0XA 4Z17A 3LHYA 4QLKA 4O19A 1OFAA 3O6AA 9XIMA 1EYWA 1VFOA 3FGCA 4FOUA 2HK1A 3ZWTA 1ZQ5A 3DH7A 3MMWA 3P60A 2PZNA 1E6SM 3ZLGA 4CD7A 4LBRA 4ADUA 3LB0A 1NFGA 4QJ1A 1IGSA 3WJZA 4O14A 5D2XA 4FXJA 2P53A 4NP7A 3B8VA 2NQ5A 1LL4A 5CPSA 3SADA 1JYNA 3M1ZA 3IJDA 4LS1A 1YKWA 1PCWA 3KTXA 2C14A 1VEOA 4DWSB 1VAHA 3JW7A 4GXPA 3W0KA 1TV5A 1Z42A 3N17A 4HHPA 3REQA 4H2HA 5HUOA 3I7RA 2LLEA 4OU1A 1X1OA 1GUVA 4AQLA 4IIBA 1R8LA 3CQKA 1OC7A 4FX6M 2VFIA 2VUNA 4Q4KA 1BKHA 2V3EA 4MAZA 4RJEA 4AD0A 2PDNA 4B4HA 2OFJA 4ZQCA 1GW9A 4R5EA 3DKLA 1BGAA 1TIMA 2HJPA 4CNOA 3T81A 3BURA 2W92A 1WAUA 4GYFA 2QS8A 2D2OA 3FVDA 2DQWA 5J04A 4HYWA 3PANA 1E5NA 4GKLA 3ZSSA 3LTPA 2ANUA 1ONEA 4PFMA 3SDOA 1W6TA 3AMGA 4KEVA 3ES7A 1CLXA 4CNSA 4M8UA 3WBAA 4GY1A 3E0WA 3F2DA 1ONRA 4GQRA 3VIFA 4O1DA 1TWZA 3TN4A 4LH8A 2ZTJA 2QHAA 1A0EA 4AZ5A 3C2FA 4F0HA 5DCBA 1HKMA 3QM3A 1J0IA 4HK7A 4W5ZA 1EPVA 3P2VA 3UGVA 4GINA 1ZBVA 3OLEA 1TMHA 4JHOA 3UZ5A 2Y8VA 1WKEA 2BGQA 3GNOA 2W66A 3VGHA 1V7YA 2WZIA 4GY0A 1W1TA 2DT3A 1ODUA 4I5XA 5E09A 3BMXA 5DCDA 4A29A 5A3HA 4MYXA 3WLRA 2BVWA 3VD5A 4EKJA 1RHCA 1XLIA 2V5LA 1XLDA 4DJDA 1TRDA 1Q2SA 3M64A 1B9ZA 1Z3NA 1D9EA 3VOJA 4IQJA 3WBXA 3QHMA 3MTWA 3CTLA 4D8LA 1JQVA 3VYLA 4BEUA 3NQBA 1FDZA 2H8XA 5DX7A 4IGHA 4A3RA 4B3ZA 3R79A 1O5QA 1D3HA 2CKRA 2Z1BA 2Y62A 1DJQA 3AS1A 4R3UA 3FJNA 3HGJA 5HOSA 3ARQA 4AZBA 3T9PA 2YZ5A 1EC9A 3PB2A 5BRBA 3S5ZA 3VCCA 4A2RA 1ZTVA 2OWWA 2TPSA 1ZJIA 1W91A 2G3FA 2XGBA 3EMQA 3T42A 2TODA 5EY5A 1TE6A 1Q45A 4Y9NA 4ZENA 2PURA 1HQTA 4BQ4A 1SJDA 2HWGA 4HNUA 1PX8A 3MUIA 1R3WA 1B4EA 1UUQA 3GC4A 3W1RA 2NQLA 4IJCA 1EQCA 2FPVA 3KLKA 1YBQB 4NRSA 4HT3A 1WYIA 2FHCA 2ZZ2A 3HMCA 3INPA 2KX9A 4CQCA 2ISWA 3TNOA 5MKGA 2G0WA 3VILA 3WD1A 1HKWA 4YNGA 2CC0A 4HZ6A 4DLFA 3AJ7A 3O63A 3KDOA 4JTKA 4V2XA 3MV01 4Z2KA 3ARZA 3I3DA 4S3EA 3G1VA 4BCEA 3CUIA 3TTSA 1A0DA 2NXIA 2OG9A 5D4YA 2R1PA 3P6LA 4HA3A 1R3YA 4BJHA 4GVHA 4QLJA 3KBNA 1HJVA 2HNHA 3WLNA 1R2RA 4GO8A 1MYRA 3PZIA 4FNTA 4PBEA 5HMFA 1NY1A 4KF1A 2PZ0A 3QY7A 1OSEA 3I6RA 1HTIA 1OCQA 1H7PA 2A85A 3D5HA 1RUSA 1KQYA 1GQJA 5C9ZA 2OQYA 3LCGA 4NJGA 3GNDA 1N8IA 3VU2A 1SO3A 3TW9A 4LAKA 4J2MA 3LPPA 4JFWA 1TG7A 5DMYA 2C71A 3KVLA 5D2VA 4L1WA 3T4CA 4IFOA 2DIKA 2EAWA 2QCFA 1UR2A 2Q02A 2FH6A 4XB3A 3G5EA 1ITCA 1DXFA 2H3BA 3II1A 1ADSA 1E5JA 1EXBA 5D9NA 4FXRA 1UC5A 3TYBA 1CDGA 1A5CA 3UPMA 3VOIA 4HN4A 4JNZA 1EH9A 3DYOA 2YCEA 4PMDA 4UQBA 3OZMA 1XFBA 5A6BD 1XUUA 3AXKA 4D71A 1UR1A 3RRAA 2CBVA 4PB3A 2V67A 3ZJ8A 2C7FA 1W3LA 1FHLA 5EMJA 2XINA 4XBSA 2GDVA 1RJRA 3LGEA 3F4VA 3GD6A 4MADA 4GO9A 3VD4A 4LGXA 5MKGB 4W86A 2XIIA 4S2BA 3MC5A 1YDOA 4WDXA 4TVDA 1YXYA 3LTYA 1DJXA 2WKLA 5H8MA 4ZEPA 1K7FA 1MW3A 4M80A 1WDSA 3AYSA 5E70A 1GZJA 4AVFA 1QHZA 3MUZ1 1AZ2A 1ZAIA 3NJ3A 1DP0A 2FZ9A 3TTOA 3MDWA 3PJXA 1EDTA 3B40A 3MKVA 1AODA 3ZXWA 1XLJA 2HRWA 2VD9A 1H7XA 3VVGA 5GPRA 4JAWA 4J5NA 3WH5A 5C2GA 4C1KA 3OO2A 4U2ZA 1E4NA 3OP2A 3GY1A 3BG3A 7TIMA 4XZMX 4BI7A 1OJXA 3AUOA 2GWGA 5H2ZA 1MQRA 1EP3A 2J62A 3MS8A 3A13A 3VNLA 1IQ8A 2V81A 1IYXA 1KA9F 3CQHA 3UERA 1DJGA 4AC7C 1V8EA 2WVVB 2IPFA 2PWHA 5IFPA 1MQQA 4WDWA 2X09A 1Q6QA 4REQB 4PRRA 3QLLA 3WY1A 4DO6A 2BOGX 5HNRA 1GVRA 4GXWA 1W9DM 4Q4SA 5LIXX 2QQ6A 1W1PA 3RN6A 2P8BA 1SZGA 1K9DA 1JDCA 3RLUA 3SY5A 1KKRA 4DQWA 3MYPA 4O53A 1TTPA 1UR3M 3CO8A 3UYIA 4ZGYA 3MDUA 4IISA 2PWGA 4WJEA 4DNMA 1HKVA 1B4KA 4IG2B 4ALDA 5CAKA 5CG7A 1GJUA 1PZ0A 1EBHA 4NYYA 3ZR6A 4RNIA 1ME8A 3BARA 1OX5A 1GJWA 4KFOA 2C1IA 3TAOA 5A2BA 2VI0A 5CPOA 3AI0A 5A8MA 3T0BA 2WMIA 1XGEA 3WO8A 4RE0A 1WDQA 2JF6A 3NPVA 2V8ZA 2XSAA 1PB0A 3CEPA 5T26A 3B4YA 3TVAA 3DC8A 1S5NA 2ZX8A 3FW6A 1PAMA 4ML4A 3E5BA 3ITTA 2ZWZA 3NL6A 4L5ZA 2ACUA 4GPNA 5HULA 3QR1A 3AU6A 3CUHA 2CHNA 4RZ4A 4L64A 4F9DA 3E2SA 3NQVA 1QNVA 4FNQA 1I4NA 4UOQA 2D73A 4E2VA 3GTFA 2AMXA 3VI2A 5LSMA 4FK9A 2BXVA 1V7AA 3EBVA 1PYMA 3N2TA 3UG3A 4BKNA 1IEQA 2G3IA 4X22A 4E4FA 3UJ2A 4MKVA 4H9YA 1TQXA 2P3EA 5IHRA 4UR8A 3V36A 1TTIA 2UY2A 1TMQA 3RO6A 5C7VA 1FH8A 4CEUC 1OABA 4BQ5A 1K8CA 1W5NA 1EOMA 1XRFA 1E51A 1XPGA 4NL1A 4OHQA 1RJPA 3NPWA 1OFQA 1REQB 3KP0A 2OLSA 1CGTA 1KR0A 4PA8A 1ISWA 1O4UA 5D9OA 4BZYA 1VC4A 1VF8A 3OEXA 3RM4A 7PTDA 4W7WA 3UWQA 3WUEA 1IWAA 4JIRA 2G50A 4QE5A 1KFBA 1R86A 5IBXA 1KRCC 3GR4A 4LUTB 4LV4A 4HIBA 3CBWA 3UNTA 3VIMA 4WY0A 2BGNE 3IEBA 2NUYA 2O9TA 4TX9A 3VM5A 2PC8A 5K9CA 2G8ZA 4B16A 1JUEA 3WNMA 4O4VA 3ARUA 1LLWA 4WY0F 2H8ZA 1GVEA 4GI8A 2NLIA 5BMWA 4FSAA 4HYVA 2O4QA 3TSBA 3O07A 4JTEA 2DUZA 3OZYA 1K4GA 5I07A 6ALDA 4JQ2A 3CTTA 5LNUA 2P88A 1XLLA 3W7DA 4H7ZA 4LQ1A 4BK9A 4GYPA 1YPXA 3QXBA 4WLCA 5FL1A 4EACA 4JX4A 8TIMA 4MB3A 4DRSA 1S5VA 7ODCA 5I23A 3E74A 4F2BA 2F2HA 1WZKA 6A3HA 3WQPA 1QI2A 3B9DA 1MNSA 3RX3A 1FWBC 4M56A 5ECVA 3WLIA 1RV8A 5G1TA 2WK2A 4NZCA 3PHAA 3CHVA 3OG3A 4NT0A 1FCQA 4Y8EA 1RP9A 4MMWA 1TWWA 3CHCA 4N02A 3BWWA 1XRVA 3W1UA 2YR1A 4ACZA 4Z2LA 3CQJA 3BV4A 3HV8A 5CXPA 2EG7A 2GOKA 5BWFA 4HD5A 3W1QA 3U8GA 2WSKA 4HSNA 4Q4RA 1KM2A 1DTNA 1VEPA 3NR0A 4PSPA 1C7SA 3MB9A 1V03A 3OLIA 3VIIA 2QCEA 1Z7AA 4UR7A 2NZLA 3QY6A 4AF0A 3G1AA 4JL1A 4EPBC 5ABGA 2V38A 2OEMA 3M5XA 5GQBA 3P62A 1M5WA 3WIJA 3Q4DA 1I2PA 4QDWA 4FB7A 5AHLA 1UD3A 1QBBA 1EA9C 4CCZA 3GC2A 2OOGA 4LUTA 4F79A 1H0GA 2QZRA 4LYKA 3T05A 3WD2A 3H53A 4OOUA 3C4UA 4AD2A 4HB7A 1S3TC 3VMNA 1M7XA 1LWJA 1XYBA 2V82A 3W25A 2D20A 3EXRA 3W26A 1Z69A 5A94A 2BNJA 3TEVA 5CSSA 4RE2A 1W5OA 1NU5A 1UKOA 4J3SA 3H12A 3VKBA 1EDQA 4OVXA 4PBFA 2RDUA 5AYZA 3WLMA 4GRSA 3NQMA 1XCWA 3WNNA 4JTTA 4TIMA 4PMZA 4CNUA 1GT8A 3L4TA 4A4AA 2J9YA 4LC8A 2R1MA 2JALA 2ACRA 2VRJA 1TRIA 4FX7A 2XIMA 2Z1KA 4L6HA 4U5KA 3WQOA 1RBOB 2VURA 1LZOA 3S3GA 1X8FA 1F8IA 2QVHA 2OSYA 3WLTA 2E67A 1T6MA 1OCNA 1UHVA 4CGTA 5FJOA 5JUVA 3BQ5A 1PDYA 1GVQA 3PZ9A 4HTBA 2F6UA 3HURA 3TU9A 2I16A 3M9YA 5D03A 1Q6FA 4HZMA 2Y5EA 1KV5A 1M68A 4GABA 3WK2A 3DHDA 1XINA 2VD8A 3CEUA 1NAL1 3AICA 4DJFA 5CBJA 2PDXA 2QPSA 1CCWB 1PX4A 3GU1A 4WDTA 5C2XA 1DJWA 4JYDA 4O1AA 5C7HA 2PCQA 4AIOA 2V5JA 2XIBA 3S5OA 3CT7A 4ILSA 4QIUA 1TMLA 2Y85A 2CLKA 3PUEA 5BU6A 1XGDA 4WSJA 3PZGA 3AZTA 1WPCA 2QPUA 1P0NA 4GIEA 4KRZA 4PBGA 2A3CA 4ZBCA 1G1YA 1RQHA 2CBJA 3IUDA 1I6NA 3UG5A 4NSBA 3UZJA 2NX9A 5DMMA 4D6IA 2CWNA 1H7NA 3VKJA 1ZP3A 1MZRA 2V5BA 4R9XA 2CBUA 2YW4A 2FZMA 4Q8UA 3FY1A 4L4PA 3TTEA 1QPNA 2NUWA 3HGSA 3NL5A 1HKIA 2YDAA 1K7XA 3NWRA 3CIWA 3TOYA 3OVQA 3CH0A 4NF7A 4B92A 1ISXA 1F4AA 2C0AA 1KM5A 4TX8A 2IW0A 1VBJA 4KWOA 1EP1A 3U7BA 5FF4A 3VM7A 1XG4A 4U3CA 4UZUA 5DRCA 3T0DA 3ELFA 5DMLA 4E38A 1PIFA 1ITQA 2E8ZA 3PPHA 3TYAA 2BHUA 1HFBA 3PZQA 3AJXA 2OLAA 2NSOA 1OEPA 1FH7A 2IUZA 2PDLA 3W01A 3EDKA 3EA1A 4ZB0A 4ATDA 6TAAA 3QH2A 3FHQA 2YB4A 1AH3A 1LM1A 1JCJA 2CEQA 3GM8A 1O68A 3WNPA 3W4RA 3ZIZA 1L6YA 2X42A 1KBBA 4KBXA 1X7IA 5I03A 4O0KA 4W9TA 2E6DA 4G9PA 4DUXA 4LAOA 1QXLA 2PC4A 3W1AA 2JIWA 3EA2A 4H3DA 1SM9A 2HXTA 2ZA3A 2E09A 1QPQA 4LNYA 3DFYA 3WH6A 1TWSA 3SQLA 4MNMA 1PKNA 5HQLA 1H11A 1K02A 4NJIA 3SQMA 3UNDA 1TB3A 4GMEA 2GOUA 4PUKA 3WQEA 1XBYA 3TN6A 2DY3A 3SIMA 1QWGA 2VT0A 1ZPTA 2FHFA 3MVIA 3A9IA 1W8SA 4AYGA 1TR1A 4Q8OA 3LA4A 2WHJA 2HE5A 5C8BB 1G4PA 4F0SA 4F0RA 4KW2A 5ENLA 5LA0A 2XTKA 3QZEA 1JDDA 2ZZ7A 4DHGA 3BE7A 1T0OA 3C56A 4GXMA 1CB2A 4B3LA 1IGWA 4NASA 3G1HA 4Z1BA 1KW1A 3NGJA 3AXXA 1GW1A 1I8JA 4MWAB 2PLCA 1E6XM 2GSJA 1YNQA 3V1PA 4OWGA 1GJPA 1QW8A 4U4MA 1PHQA 4JQ4A 1XP3A 1H5YA 4UFIA 1LT8A 4IG2A 1RBAA 3H2EA 1JPKA 4QBXA 3HF3A 1WNOA 1HL8A 2J27A 3URBA 3ATYA 3P5ZA 2XFYA 1SZFA 3BQ6A 1XIDA 3TJXA 1PVNA 2HVOA 3AIWA 2GJLA 1JRCA 3I7SA 1IXOA 3CV7A 4S3FA 2CPUA 2WMKA 3PZNA 4GC4A 4Y90A 3AOFA 4B5UA 4US5A 1Q4NX 4IUOA 2WHLA 5JXQA 2PGFA 1U83A 3VA8A 4K6AA 2DORA 2IPWA 4Q7IA 1FCVA 1VCFA 1SMAA 4JKLA 2GVGA 3MI6A 1JAEA 9XIAA 1GKPA 1P7TB 4BHYA 5G4HC 3FJ6A 1JFXA 1P5BA 1AZ1A 4F40A 3TXZA 3LCIA 1ZY9A 5E0KA 3LHUA 1G94A 4NJJA 5K9DA 2RH9A 3KL0A 4BEQA 3MKCA 3LK6A 1EJXC 3E02A 3IJIA 1AVAA 4JTAA 4M24A 3UR7A 3VUSA 2A3AA 2BHZA 4LVDA 2PTYA 2WQPA 4P8WA 1GOOA 2DSKA 4DO7A 1LDCA 4HU4A 1E4MM 3WENA 2ZVRA 1VPQA 3TYCA 1V3JA 1LORA 3WLQA 2GJNA 1JZ8A 2QPXA 5A6SA 1E3ZA 4ZMGA 5F7UA 3RRXA 1QJWA 4JTGA 1QNPA 1X1NA 2X7WA 3W1MA 3FYPA 1I2RA 1EHAA 2CERA 4B90A 4W93A 3E0LA 3DFHA 3WLKX 1JFHA 5FKYA 1JULA 2A21A 3F2CA 1EX5A 2ISSA 1U1UA 3CIVA 8RUCA 5AHIA 3RPMA 3QHNA 3IUIA 4WGHA 2CLIA 3EPOA 1JZ6A 4K2SA 1G67A 3LHTA 3AHYA 1V4YA 4JXCA 4RPQA 4LSBA 3LI1A 5K9XA 4JIEA 5A1AA 1XFCA 4PEKA 4UQCA 3RM9A 2I1OA 1BYAA 4UFLA 2J74A 2JEPA 3KLLA 1VFSA 1Q65A 4NY2A 4NHVA 3GTXA 1LBFA 3V75A 1FWJC 1W54A 1XPYA 2Y8UA 4MVAA 1W2VA 6XIMA 9RUBA 1K6AA 1CGYA 3LX9A 3TZNA 4I90A 4BR1A 4EAMA 3LGDA 3IACA 5E6YA 2HE8A 1P4CA 3G1XA 3T1GA 4EE9A 5I00A 1UPMB 1G7VA 4GACA 1O12A 3LMZA 4UCFA 2R1KA 3IJLA 3U3HA 2YGYA 4TMCA 1YNYA 1XH1A 2NQ9A 3MBDA 4E3TA 1VFFA 3W02A 3OIHA 1RA5A 1FWCC 3MQTA 4WKFA 5E9AA 4C6FA 4ADTA 3N4FA 3N04A 3QEZA 1FWWA 1XIBA 5FJJA 3U2EA 1LG1A 3BGJA 1UR8A 4I7UA 2ONEA 4URIA 5AOUA 3ZSTA 1AW2A 2PDGA 3SO7A 1EUAA 4I9TA 3TFXA 5CPNA 1JDAA 4JTQA 1TV7A 1XIFA 2VR4A 2PEVA 1PHWA 4P7QA 5XIAA 2IQTA 1PL9A 4B5NA 1S1PA 4WIWA 1FWSA 4DM1A 2V5DA 4GJ1A 2YSWA 2HS8A 2PLKA 2VGFA 5GNYA 2C16A 2FDMA 4Q4OA 3EX1A 1BWVA 2JKEA 1UOZA 1ZGDA 5CZJA 1Y65A 5HWMA 2OTDA 2ZZ5A 1IEVA 1A4LA 4UNIA 4GFIA 2YYTA 3W22A 5LKYA 1JCMP 2GJXA 3VIKA 4JY9A 5IM51 1Q8JA 4C6BA 2EXOA 1A5LC 3KDNA 1YBQA 4I6KA 4L4OA 2BXYA 3H7RA 3VGEA 3UWUA 1XQLA 4HVXA 5CH9A 3GFYA 1EQPA 2DH3A 1R46A 4XIAA 4GIRA 2QULA 2Z4GA 2EEXA 3FK4A 4JKMA 1MFVA 1GYMA 3OIXA 3GTNA 2OZTA 1MUWA 3LLXA 2J47A 4ZODA 3FKKA 2DZTA 4TXEA 3OVGA 1O66A 3WDHA 2QKFA 5KZ6A 4YN5A 1DWIM 2ADAA 4LAMA 2WNQA 3UU0A 2FTWA 4MM1A 2I5GA 5ABEA 1E55A 1FFQA 3MMUA 2PFHA 1TWIA 4IMGA 3CL6A 3HZ3A 1Z9AA 4PRWA 3GG8A 4YHGA 2Z7GA 1SMDA 2J13A 1KQZA 3UR8A 3ENLA 3SI9A 2XIOA 3BJSA 4N2YA 4NYUA 1XLAA 4ES4A 3WJXA 1XL9A 4ORMA 3CC1A 4PH6A 3W7QA 3RU6A 2G97A 3E0VA 1Z48A 4GUJA 1XLKA 1EJ7L 5CQ1A 1FXPA 3NQFA 1XSJA 4UXDA 3LI0A 2VCCA 1KV8A 2WSYA 1ZL1A 4HJFA 2Z2UA 3GU2A 3H2OA 3UA4A 3C2OA 1KTBA 2A3BA 1BGGA 3ARRA 3VNDA 2QCNA 2J9ZA 4PTXA 4ICNA 1EXPA 1UBSA 4GA8A 3CYJA 1UR4A 3N2XA 1KLYA 2PMQA 3WMBA 4RV3A 4KKXA 1J2BA 2DVTA 3FJLA 4A8RA 1MXDA 3IANA 1BXNA 3UGRA 4G7FA 1VJIA 3ECQA 3BSGA 1GPWA 5LNSA 1OYCA 3H70A 2WSQA 5RUBA 2X1RA 3RLVA 4FX8A 4BI6A 1UWSA 3V7PA 1GOIA 1FOBA 2QAPA 5A2AA 3L23A 1WX0A 4GOAA 1V3LA 4LYPA 1KD0A 1MEWA 3ARWA 1I2QA 4FOJA 3L2MA 3HIJA 2EKCA 3L67A 2W62A 3PS7A 1NJJA 3IV3A 4C65A 1PZ2A 3O6DA 4IH3A 2EJAA 3WFZA 3A22A 3BG5A 3TONA 4M6PA 3STFA 4Q7BA 3LPOA 4A8NA 4J1OA 6XIAA 4S39A 3W2MA 3ZJ7A 1YX1A 1DE5A 3NURA 4JQAA 1Q66A 1SJCA 4G7EB 4QHRA 3CZKA 2DV0A 1EYEA 4H6KA 1R9YA 4DAIA 5F4WA 1E6PA 1NP2A 1OT1A 4IQEA 3R43A 2FTPA 1YLVA 3TQVA 4EP8C 2EPMX 3TN5A 1BYCA 1TO3A 3NXFA 1HIZA 4UOJA 1NWUA 4DJDC 1CXLA 3ZT6A 4DWDA 4IOTA 1PE1A 1KBJA 1ECEA 1T5AA 3EKGA 2WVUA 3SBFA 1VIZA 3GK0A 4P61A 4JYFA 4HU3A 4F2TA 3KBMA 4RZ5A 5I5RA 1OD8A 4BFAA 4IIHA 3OVRA 1AFSA 5DT7A 4G2DA 2YL6A 1FHDA 5AC8A 4XTIA 3KTSA 1MEHA 1QCWA 2VM8A 1LT7A 2QV5A 2E6FA 1F3TA 3CPRA 2WNZA 1O5XA 1R6WA 3MHFA 3CL8A 3BC9A 5D33A 3IPWA 3U5UA 1MO0A 3AS0A 4UFKA 5FESA 1Y7VA 3HG5A 2PDFA 2Y6ZA 1J4EA 2QEZA 4XVDA 3GBDA 2OGJA 3BK0A 5I3HA 4AHPA 1YQ2A 2WXDM 1ZLPA 3BW2A 5I2UA 3UJRA 3HQOA 1G7UA 3CM4A 4AMCA 1DE6A 4Q33A 3DGBA 3NDOA 3A6OA 1EKOA 4MJ4A 3V3WA 2X1TA 3ZYZA 5I02A 1A5BA 4HMCA 5DXYA 2ESCA 2QCHA 1G4EA 2ZZ6A 5FD0A 1CLVA 2Q09A 3ZS4A 1Q6CA 3S0CA 2WMGA 3EXTA 2V3FA 4AHOA 4D9PA 1V0KA 2BY0A 4YMZA 4P5UA 5MHBA 3QF0A 1JI1A 2ATSA 1KBKA 2DSVA 2WBKA 2NQHA 4E4UA 1P0EA 3QW3A 4BS0A 2VFDA 5DY3A 4KEUA 1TUFA 3B8DA 5BWAA 1G5AA 1SZRA 1MXGA 4B5XA 4B5VA 4WEVX 1IXNA 2VKZG 5TF0A 4DZHA 3VOCA 3W27A 4DYJA 4V27A 1QASA 1MEIA 3BL3A 2ZRUA 1HP4A 3R8RA 1GVSA 4Z1DA 1EWDA 3V5FA 1JCYA 5CCZA 3R89A 1TCMA 4A21A 2ZX7A 2Y7FA 1EJWC 1Y0EA 5K7JA 5FOOA 5C71A 1RPXA 3POCA 2WC7A 2BASA 4D1JA 4L65A 1QDSA 3BGAA 2C6QA 4LY8A 2QMKA 1YNPA 5FF0A 1EF3A 3IK4A 3H2NA 2QR6A 3TX9A 5CZ0A 5EB8A 3POHA 3GHUA 1A53A 3U48A 1QOXA 4UTKA 1CW2A 1V0NA 5JIWA 5HINA 2YCKX 2ZICA 1A5KC 3BOXA 4MY1A 1P0DA 1U5JA 4M3PA 1K9FA 3ALFA 4FS9A 4FOKA 5A6AA 3QRHA 1W9XA 3E49A 2P3ZA 4WOQA 3V0UA 3EDDA 3EOSA 1OFRA 1FWEC 1P0KA 1ZB5A 3LTSA 3CZLA 3WH7A 4IGMA 1UROA 1A49A 2QJIA 4XBJA 3M43A 4O11A 5D32A 2H9AA 3RCYA 3NQCA 2E5DA 4IMDA 2FQIA 1TV3A 4UTHA 5LA1A 2CYGA 3HN3A 1E6NA 2DT0A 4H7CA 1AL8A 2C79A 3AU2A 4QFUA 4A22A 4ZR8A 1JAKA 3T8LA 3M0IA 4UIOA 3WLHA 3RJXA 1JPMA 3MVTA 4OQVA 3W7JA 5HR6A 1BVWA 3CUGA 4C6CA 4GBUA 4ZQMA 3UCCA 3CHDA 4GH1A 3SCRA 4MNLA 3M0HA 2REQA 2Y2WA 3CPGA 3SCQA 3MPGA 1XC4A 3WQ6A 1TWDA 2RDWA 5FF3A 5F1VA 4NZFA 3ZQ9A 3QZ6A 4XAZA 3ZVHB 2B7QA 1E0VA 2YIHA 3M0KA 3OGVA 2QVNA 3LLFA 1BKSA 4PTDA 4C6DA 2HPMA 1VQTA 1UMYA 3MJMA 3S2JA 4JD4A 1BWKA 1UQZA 1QT1A 1RR2A 1F4HA 2FZNA 1X98A 3CUXA 5ABHA 1KTCA 2B7OA 3MMTA 1AH4A 2I5QA 1YDNA 3KBVA 4OBSA 2C8NA 1BTCA 3QGVA 2ZX6A 2ISFA 4DZIA 3AZRA 4PTVA 1B54A 1E71M 2NVDA 4I7VA 5EA9A 2DP3A 3LENA 1PTDA 1IZKA 3AMLA 3AO0A 3MCNA 3N3MA 1YIXA 1HZYA 4MUZA 3GUGA 1VRXA 1PKMA 2X0HA 1DYSA 3A3WA 3A4XA 4ZTYA 4RW5A 4TOQA 2GUUA 4ZQPA 1KCZA 2W4XA 4TQTA 4C6KA 4NKCA 4CEXC 2Y63A 3XISA 3W7IA 3N18A 2NQZA 2OO6A 4H4IA 3VPLA 1WZAA 1W31A 3R0KA 4K3ZA 3WDIA 1W3IA 1E73M 1H09A 2Z27A 3QYSA 2OVLA 1OFOA 3EXSA 2ZDSA 1F3XA 5AHNA 2HQAA 2VC5A 3EOOA 4XZWA 3EZ4A 3RGTA 1GKRA 3L7RA 2EG6A 3QC0A 3U57A 2WOQA 4US5D 2X0SA 1FHVA 3ABRA 1RH9A 3IJ6A 4HHLA 4L56A 3GO2A 3T2PA 1N2VA 3U2ZA 1Q7MA 2PD5A 1WZLA 3SJ3A 5ABFB 5I3KA 1R9ZA 4OBRA 4DJFC 3UQNA 3K4AA 4YS1A 3S5SA 3HG3A 3N14A 4G7EA 4UNKA 2PSNA 3UP8A 1OCBA 3AMKA 3LBCA 2GVLA 5I09A 8XIAA 1UP0A 1V3HA 2NXHA 4PL1A 1IZCA 2VELA 5AYIA 1A3WA 2GLKA 1ISZA 4LS2A 3PWGA 1EWEA 4ZQRA 1F3WA 2WSRA 1E9IA 3NPUA 3P80A 1VBUA 1B57A 4FR1A 1TPDA 5A6TC 3HPFA 2E8YA 2O9OA 2WHMA 3PF3A 5EFFA 4LWWA 2D69A 2O9RA 1Z6KA 5DBUA 3DFNA 4BQ2A 3DFTA 5G5IA 1SFJA 5D9MA 3W81A 4GJIA 3R58A 3VFLA 3NYDA 3OBAA 3ABQA 4WKHA 4TV5A 4XAPA 4AWTA 3GB6A 3DFOA 3N6HA 3W6YA 1A4MA 2J79A 4N9CA 2PD9A 2X2YA 3B8TA 2DZUA 4LX4A 1PPIA 1JUKA 3TJ4A 2KZHA 2PDJA 2BTMA 3E5PA 3IJQA 4OECA 1MUCA 2E3ZA 2QDGA 1H49A 2D2JA 2BZNA 1SJAA 1XM3A 3SB0A 2UY5A 3FN9A 1PDZA 3VO0A 4WXYA 3O06A 1AJ2A 1H1ZA 2CLFA 5FA5A 4Q8NA 2VMFA 2PDHA 4GGBA 4OZOA 5EMUA 3FAWA 3MU7A 2R91A 3BAJA 3I7QA 3N9KA 4XSMA 4A8LA 4NRRA 5REQB 1UWIA 4N6EA 2FGZA 5A8PA 3VGDA 2D22A 3N9RA 5K4XA 3GVGA 3NQGA 3UJFA 4E2OA 2DVUA 4JDBA 4GCXA 2PTWA 1YE6A 3QR0A 3B3DA 1E0UA 1W1B1 2I56A 3MP5A 1J10A 5KITA 4GX9A 3R8HA 1UH2A 3BJFA 3BUVA 1L6GA 3ARSA 1N82A 1KR1A 7XIMA 2HVNA 1EJRC 4WOZA 4AXKA 4HA0A 3M4HA 1E6QM 3SRHA 4M0XA 2A7PA 3A4WA 1GVFA 1X1ZA 4DELA 3SUSA 1QNRA 3V16A 3SSJA 3RR1A 2KAUC 3CH9A 1RLDA 2RJGA 3OYXA 4KIEA 2NVCA 4DJEA 4U28A 4LW7A 4D8ZA 4OV9A 1K8XA 2OT1A 2YBVA 3WJSA 1EZ2A 1C93A 4HOWA 1M9HA 3W73A 3CAWA 5H1WA 2DEPA 3GXPA 3N9SA 4DM2A 1QWKA 4J2PA 3DXIA 2PTDA 5FACA 1BG9A 5BROA 4JR5A 4H8VA 1J8VA 3ARXA 1ME9A 4O18A 3TCEA 4B5WA 3DN5A 2HCVA 4C7DA 2QUVA 3A21A 3EWXA 5U4NA 3P0WA 1W1YA 1I1WA 3L0KA 4DJFD 2OT0A 4PSRA 3TTQA 4GD0A 3B4UA 3G6MA 1JYXA 3S9YA 1K03A 1DKWA 2NT1A 3SJNA 3GZAA 4BA0A 3TAKA 1V0LA 4DF0A 2GVEA 5LXXA 1OY0A 2YCIX 3TK7A 4MF4A 3FA4A 3R0DA 3WNKA 3W7PA 2V3GA 2Z00A 3OA5A 1HW6A 5LIUX 2WPGA 2IKJA 2FMOA 3P81A 4GWEA 1FH9A 2CLLA 3PN8A 2GQ9A 1ISVA 1ISYA 1XIMA 3LBOA 5AVHA 2V30A 3OODA 3QQ0A 1US0A 1TE1A 1SR0A 2WMJA 5HMSA 1AW5A 4A3QA 1TYGA 3F5JA 3KOZA 3W2LA 1RY8A 2YLLA 4LF1A 3P74A 3J7HA 1XDMA 3WH9A 2YYUA 3EDEA 4TV6A 3TDFA 1QMLA 3W38A 3WH8A 3AWOA 1SJBA 4MWAD 3EWDA 3W85A 3B0XA 1L6SA 3SGUA 1EJVC 3AIBA 1B3OA 3WEOA 1FX6A 3KVMA 4LUSA 1EUNA 4G5DA 2OB3A 1LUCB 3W7CA 4U33A 4V15A 3PG9A 4CU8A 3R0UA 3NPXA 3NEHA 2ZFAA 3LQLA 1QVBA 1M7JA 1QPKA 4EXQA 4AZCA 2PUZA 3WF3A 3Q65A 1FXQA 3ITYA 5LIKX 4O8RA 2CWXA 2YDSA 2CZDA 5D2YA 1S5WA 1VBGA 2DUXA 3GNPA 4S3CA 2WMHA 3FS2A 4FALA 1B5TA 3GDLA 4UFJA 4D6HA 2UY4A 4AAJA 1HGWA 2DZWA 2R9RA 1Q6DA 1O1ZA 4HP5A 2F61A 5FJIA 4RDZA 4UTLA 3AHXA 4O0ZA 4W8LA 3PZTA 4AU0A 1JEZA 2D0HA 3H4WA 2Q8XA 3RNDA 2PDMA 2CCRA 2Y7EA 3VZYA 5CC3A 2JGQA 1ODZA 1NDYA 3N2BA 1SW7A 3STEA 3VOGA 1G0CA 1AG1O 2NWRA 1VYSX 4QQUA 3SCNA 3WG6A 1D7FA 4LVFA 3PUGA 1M6JA 4M7TA 1M7PA 3UESA 3WYZA 5CSUA 1WDPA 2EQDA 3EWBX 2ALDA 2NX3A 1JUBA 3I6TA 3N73A 4BF9A 4JNMA 5JMUA 3EX3A 4JS3A 3ABOA 1DL3A 1S39A 3QOMA 2QMJA 5DCEA 5G2IA 1S3HA 4IFKA 5LHEA 3NZ1A 5FSDC 3KWXA 1VZWA 1OC6A 3HQ1A 1FP9A 4KMQA 1MQPA 1OF8A 3PY2A 3E2QA 2XM2A 1V5XA 3E3HA 3IS4A 2QCLA 1PX3A 3SGZA 3UPWA 3B8SA 4TMBA 4IICA 4LCQA 2VFFA 3BOFA 2ZYFA 3Q94A 3DHUA 3BCDA 1IT7A 3GIQA 1BXCA 1CENA 4PCNA 4V1YA 1W1IE 1H3GA 3H24A 4G1NA 2Z2BA 3W1TA 4WR3A 3VMOA 1CX9A 1E6RA 1TV4A 4QE4A 3KOYA 4JTHA 1NH6A 3R94A 3DESA 3RM8A 2UY3A 3WL1A 3W53A 4DLMA 2IS7A 1OX6A 2I14A 4PUDA 5GNZA 1IXQA 2V68A 3SEPA 4HPXA 1F3EA 5DFAA 2BVDA 3QMTA 2H90A 3PWAA 1GOWA 4XD4A 2CZFA 3IJ9A 3G0UA 3HO8A 3CZJA 4D1IA 4MB4A 3FV9A 3P0XA 1JYVA 3UXAA 2ZE0A 4QG9A 3VNMA 3WD4A 5C6MA 1YXCA 3CXOA 2D3LA 4JGDA 1M01A 4HOZA 1J11A 1QW7A 3WELA 1UD5A 1DV7A 4YYFA 2FVMA 1UOKA 3NM1A 1UH3A 2GYIA 3PUDA 5KSWA 1RLCL 3N19B 3E0IA 3URAA 2BFGA 1GVIA 2Y5SA 2XZ9A 3ITGA 3GDBA 2YX0A 3ZOAA 1XI3A 3SCOA 2YXOA 3H2AA 1E0WA 3BW3A 3FA3A 4EPDC 3BMWA 1MRQA 5BU9A 4D6EA 4K1GA 3OQEA 1F2JA 3U6WA 1QUMA 4POCA 4DVOA 1ZJAA 3KHDA 3VGFA 3TMLA 4C6IA 1CIUA 5JH1A 1X97A 2BOEX 4AD1A 4JTFA 3STGA 2D1ZA 1QTWA 4A3UA 2QJHA 1J0HA 2G3MA 4EVZA 1JZ2A 3TYDA 1YEYA 3GDRA 1DIKA 1LOLA 3W84A 3DEQA 4W4QA 1GQIA 2OJPA 2J8TA 3TP4A 4RE4A 1OG6A 2QIIA 2V5KA 4HK6A 3I6EA 2BG5A 2CW6A 4AXNA 3GFXA 4AC1X 5AHMA 4DF2A 3UWWA 4O10A 3QPEA 2W9MA 3T09A 2XSXA 1EDGA 4KCUA 3WF0A 2HV5A 2DQXA 3S1GA 4EANA 5BRPA 3VDCA 1DJIA 2Z28A 3TC6A 3VGBA 3CAQA 3NIYA 1KFEA 3MZ2A 3FOKA 2C13A 3IRDA 4LVBA 4AY7A 2CLPA 4S3GA 3W74A 3ARYA 1SYTA 4JFTA 3UZYA 2RUSA 3APTA 4AWUA 1EB3A 2P1FA 4K7VA 3SFKA 3GC5A 4Y9PA 3T40A 5H8UA 1R3RA 4QQ3A 3DHFA 4FIQA 2EPHA 3OJGA 3EX2A 3W6LA 3OPSA 3CO4A 1GQLA 2PP0A 2G4FA 4MZ1A 3UVIA 1I2NA 4O8AA 3VNYA 2VFHA 5K3VA 4MFEA 2WYSA 3OU8A 2Y4SA 1K4HA 2DZBA 2YFOA 5LHFA 2ZUMA 3H7VA 1QO2A 4XZHA 2CBIA 3LEPA 1EGMA 3PBVA 3IGXA 3WQVA 3VCNA 6REQB 1QI5A 3RHGA 1C29A 2TAAA 3HTWA 1RD6A 2HBVA 3CU2A 3TN3A 3HG4A 1TR9A 2W27A 7A3HA 2JEQA 3GHSA 1LRTA 3OZOA 1M1BA 1F6YA 2Z0IA 3NO1A 3LOTA 1KCXA 1X7FA 1AD1A 1YW1A 3ZLFA 4QEHA 4ZZ9A 2R24A 2IPGA 4CQBA 2ZRZA 5F2IA 3HGOA 3WLOA 3A24A 1XBZA 1L8PA 5TBOA 4C7GA 3C8NA 4J40A 1V02E 4B3KA 4J3UA 2GQ8A 2J9XA 4LYRA 4MZ8A 2VEPA 3L66A 3DENA 1DWHM 3MJYA 5LZLA 2ZWYA 3GVQA 4XVEA 4Q8MA 1FWNA 2FIQA 5FEWA 3MSYA 1BLIA 4BF5A 3VMPA 4H9VA 2ZXQA 2CNCA 1C8QA 3S1VA 3K30A 2VWTA 4AIBA 4AW7A 2ATMA 1W37A 3AYTA 3N2CA 1SPQA 3FX4A 3BLOA 2DJLA 5EBUA 1PYFA 4Z1YA 1B3VA 4HSOA 4JN6A 2Q6ZA 4GE8A 3KL5A 3R12A 2QCGA 3KZPA 3TCSA 3CWOX 1EIXA 4K37A 1OBAA 4E8GA 2IQDA 2W61A 2QCDA 1PZ1A 1W5QA 4TR9A 3BTNA 1XC6A 2NT0A 3ONCA 2QCCA 1BYBA 4IJBA 3WSUA 4Y9AA 3NGFA 3D3AA 3WF2A 4N6FA 3VDHA 3I10A 1Q4WA 1NF0A 3ES8A 1VBHA 2GGHA 1UZDA 4IUGA 1QW9A 1MSSA 3AYRA 1XLMA 2TRSA 5IXEA 4CLMA 4MPKA 5BNKA 3PJUA 5F4SA 1XLGA 1V77A 1C92A 3U2CA 5HWJA 2J7HA 1VKFA 3BVJA 2WWDA 5AC5A 1GEQA 3G1RA 4QNWA 3L5LA 3HU7A 4IWWA 2O92A 5AYBA 2GJRA 1N8WA 2CITA 3CS2A 1XGZA 4HYRA 1J0KA 4DB7A 1Z89A 4ZE5A 1VFLA 4UTFA 5D2WA 4PTNA 2C1HA 2ZUSA 1QI4A 3BLKA 3MUCA 5HPCA 1VYPX 4CU7A 3U2OA 4JTUA 4X60A 5DRIA 1O6IA 2VC9A 3A3HA 1NVMA 5IDIA 2PRMA 3UR5A 3CIXA 3MHUA 4JTSA 5IOBA 3DIPA 3P7YA 4RNJA 2FTYA 4FNPA 2P10A 2VGBA 3UG4A 3BAIA 2Q8ZA 2OYKA 4DBSA 3CB8A 1CZ1A 4N7QA 5HR7A 4DF1A 3ZZ1A 2YA2A 1JZ5A 4KCTA 2J7FA 4PB4A 2DUAA 1LF1A 2CXGA 4HMEA 1VFUA 3WEMA 1PV8A 4LC6A 4L6OA 4LAZA 4UQDA 1ONWA 1HJWA 3L0NA 2C1GA 2GGIA 1UZ1A 2WBGA 3RLGA 3GNNA 3K1DA 3Q45A 3QV8A 1OYAA 4RNFA 3F5LA 2R8WA 2INEA 4RNHA 5D8WA 3SSZA 1HJXA 2ALRA 4M19A 3MW7A 4N0RA 4TVUA 3WMLA 3AHZA 2XIJA 3HJEA 5PTDA 4HOXA 5CPTA 3MA8A 3EWZA 1LL7A 1OGSA 2VFEA 1B3WA 1JPDX 3PTDA 3W28A 2GPTA 4KCVA 3NQ7A 2PTZA 1E15A 2IKGA 2XVLA 4ADSA 3SRFA 2VOTA 1KFCA 4YPJA 2JFEX 3VK5A 3R11A 5BXSA 1XCFA 3ZVIA 1GQKA 3HG2A 4YXGA 3AXHA 4WJXA 5HUPA 3CB3A 5D04C 1OADA 3WNOA 3THUA 1QO5A 5CGTA 4JBRA 4FA3A 5F2MA 1JXKA 1U33A 4KEMA 3N4AA 4L4MA 3V1HA 1KGWA 3SRKA 4KRTA 1E70M 2XIQA 2PDUA 1UP2A 5BXTA 3UY7A 1OD0A 1DQWA 5I3IA 5AZ0A 1DVJA 2POTA 4ZOBA 4PULA 1EL3A 4UMCA 3RPTA 5D30A 3ITOA 2QGYA 4S2CA 4WGXA 2BX7A 4RK8A 4UBPC 5A6BA 3KRBA 2B4GA 4ZOEA 1SGJA 5A6LA 2BV9A 5CG0A 1DIEA 3FCPA 4JY8A 2CESA 1RQEA 4NU7A 3FYYA 3O05A 3A5FA 4DUWA 4I9JA 5C0QA 2JBMA 5EBAA 4B2DA 3AZSA 3MUAA 1DJYA 1IE7C 3C2VA 1E56A 1ZAJA 2DZVA 1W5MA 3UR2A 3F5KA 2NUXA 2ZA1A 4UTTA 5C9UA 2ICSA 3VNJA 2GUYA 2VZOA 4OGZA 1YXDA 3AHTA 3SCUA 3KBSA 1Q3NA 4UWMA 4DBEA 3A47A 3KCLA 3B8IA 3LY0A 4R7WA 2XWDA 3EX6A 3GXDA 4TO8A 3TW7A 1KM1A 3K4DA 4H6EA 2CLOA 2I7GA 3EDJA 1KLZA 4YVXA 2WVTA 1RP8A 1Q6GA 1CNVA 4C7FA 2HXUA 4XSLA 3MWAA 3SCWA 3M0VA 2X05A 1P6BA 2BWGA 3LU2A 4JOMA 4NZ1A 4ATWA 2VX7A 1XIEA 3RYSA 2G5WA 4KWWA 3QTPA 2GSHA 2WLZA 3FSUA 3SUVA 5K4ZA 1H63A 1XYCA 4MNKA 1US3A 2C15A 4FP1A 3W7HA 2PE4A 4IXHA 4ZCWA 4JTIA 4CCEA 2J7CA 1V0MA 1W32A 1BVNP 2DPEA 1FP8A 4W8BA 1NTHA 2PDBA 3MP4A 4AY8A 1PWLA 6CGTA 5HPOA 1TQJA 4CUCA 4UTUA 1T8QA 2YL5A 2PPGA 4IFKB 1OHLA 3RX2A 3Q58A 2XUCA 3H4GA 2OYMA 1MXSA 1OK4A 2C18A 2GZXA 2RAGA 4OUEA 3UBPC 1C91A 2J6VA 3QV9A 2WZEA 3VIGA 1XV8A 1SU5A 3RMEA 2YDQA 2HBXA 3SURA 4RXGA 1KM4A 4OFCA 2YJQA 3RILA 1BEUA 3UA3A 2WKJA 2QCMA 3FXGA 3W1NA 5ABTA 3QC3A 3RO8A 1F8MA 2V69A 4CN6A 1R47A 2GQ3A 1TVNA 3JZEA 1A5AA 5HATA 3W24A 4QE1A 2F6KA 3B06A 4JPGA 3FDGA 1V08A 1UD6A 3EB2A 2CZ5A 3GG0A 2WJZA 4GQQA 4PMQA 4CCCA 1LBLA 1UKTA 3GRIA 3PAJA 2JK2A 4QRNA 3SUTA 1W3NA 2PDKA 1CECA 5CZSA 5CKSA 4V1XA 2YZRA 2TMDA 2VENA 5FAGA 3S5NA 2E25A 5D8ZA 4NZ4A 3AIQA 3T8QA 3SECA 4ERAA 1NOFA 4Z2GA 5G2HA 3ME3A 3NG3A 3WQFA 5JBEA 2YA1A 4GHRA 4IIDA 2PDYA 2DH2A 1O7AA 1XW8A 1OF6A 3B9AA 2W79A 1T7LA 4GG9A 1L2UA 3DX5A 3UCQA 1UWAA 1FCUA 1V02A 3D47A 3AIRA 3H23A 1S2AA 3HQPA 5LXEA 4ZE4A 3DECA 3O0FA 4S38A 1R9XA 3PZOA 1BXBA 4XZNX 5LGXA 1XIJA 3O16A 1WO2A 3UXLA 3FVMA 5IRPA 4I8YA 4XKMA 5CBBA 3R7MA 3S1WA 2Z1SA 3W7GA 1VYRA 4PUJA 4JTDA 3L4VA 3VX1A 1HNYA 1CLKA 4J7RA 3C3UA 3QOKA 1KGUA 3VUPA 2FB3A 3H7UA 1XYAA 2DJXA 3WJWA 4JFVA 3K1GA 2Y24A 4W88A 3ZWSA 2ZVIA 3VDGA 2OSWA 1UKQA 4MWAC 5KTLA 2V3DA 4DI9A 4HJWA 2V2HA 3DYMA 1OVDA 1P43A 4B9ZA 4EK7A 5REQA 4AX6A 3WDQA 5CZTA 2WCSA 3O1NA 3LPFA 2A79A 3MMDA 4DJEC 5A6KA 1JXJA 2Q3OA 1ALDA 4LFYA 4GYKA 5C9XA 5FJUA 5BCAA 1TPWA 3AIVA 3NZQA 3B9NA 4NNCA 1LLZA 5J5RA 4NZJA 5DF0A 4W89A 2A7NA 4KQNA 2Z2AA 1WXYA 2YXXA 5LYRA 4HGXA 1SFLA 5HNTA 4Q8QA 3LZ5A 4NAFB 4F4RA 5LNVA 1YE4A 2OQHA 1VFMA 1ZJHA 4CQAA 3CPUA 2PDIA 2EKGA 3LSBA 4NAEB 4AZ7A 1UWRA 4OIFA 3AMCA 3DG3A 4AHQA 4DY1A 4JIHA 2QJMA 4GNKB 3OHIA 5DBTA 2NWSA 5D37A 1W9PA 2EPKX 4AH7A 4IJRA 1W1A1 3WFLA 2DW6A 1RK6A 2WWCA 5I3FA 2R6OA 4UB9A 4OBTA 5M5DA 4HN8A 2I57A 2RDXA 1RD5A 1YADA 2J8FA 2QT3A 4JICA 2E4TA 4W85A 2QYGA 3OW1A 4L9YA 3CLWA 4A3YA 1JDFA 1AMKA 2ZQ0A 2VEIA 1HO1A 2ZCGA 3S6OA 4XTDA 3ZJ6A 1F05A 4HK5A 4IHCA 3CV6A 5TNVA 4CKQA 3TOPA 2GGJA 2OSXA 4IL0A 3MSGA 3QBUA 2PBOA 2VO5A 3NAVA 2VNCA 3WDJA 1CI1A 2DU2A 1H50A 2Z6IA 3ARTA 3E9AA 3A9BA 2BODX 4JNYA 4TVCA 3G22A 4X0VA 4NQ1A 4ERGA 1TA3B 2VR5A 1GEHA 4LRSA 4JN8A 3PJTA 3T78A 4XAGA 4QNEA 5CEWA 1TJ2A 3UJEA 3WQ4A 4LVGA 2AGTA 1EP2A 4JTJA 3HPZA 3F2BA 4RX0A 4LPCA 3T07A 2A1YA 3RPDA 2BBFA 1E9ZB 3WCZA 1VBRA 2H6RA 1RVKA 1TUXA 2P5NA 1V6UA 3LUTA 1OB0A 2VX5A 2ZX9A 1JDEA 1JJKA 1HL9A 1B2YA 1FFRA 5FF2A 3NQEA 3M6YA 3MANA 4CD8A 1S2UA 1UC4A 1WBJA 3WUGA 4H83A 4C6EA 1KTNA 3TH6A 3GHTA 3TR9A 1CGVA 4M6VA 1SW0A 4INFA 3KS5A 3LPGA 3DYPA 4M51A 1J2WA 1OFBA 1ZALA 1RPKA 2BDQA 3H55A 2H9AB 3I3EA 1XCXA 1IV8A 1D7KA 3K8LA 1VLIA 3A23A 1J9YA 4DZ5A 1AQ0A 1EF2A 4WK9A 5F1UA 1Y5VA 4QDMA 3UPBA 4Q8TA 3GG1A 4J35A 3PUOA 1L8NA 2W3ZA 3A4JA 3BCJA 5HNUA 4ZTXA 5FAJA 1ADDA 2X1SA 4XWUA 4ZL1A 2BOFX 1OZQA 1P1MA 3SCVA 3UWZA 3GNXA 2ZIDA 5F2LA 3K5XA 3NTYA 4J9JA 3SY1A 4GZ7A 1TJPA 2VEFA 3ZLHA 1E1CB 3QFWA 4GQBA 4LBSA 1CXHA 1XRSA 3A64A 3BXWA 2EBNA 1B0IA 3JUGA 3KM8A 4WQ6A 3S2NA 1OFEA 2WJDA 2ZKMX 3USZA 2UZ9A 4O0QA 3W7KA 1NF7A 1VIWA 3OGSA 1CT5A 1HN1A 4XX6A 1QK0A 3DCPA 1HXJA 2Q8LA 3KCJA 4US6A 1YTDA 2Z1WA 4Z42C 3ICJA 1KXHA 3THAA 3I65A 4IGSA 2QF7A 4GUFA 1XYMA 3TYZA 4PRTA 4D6DA 4IP7A 1EZWA 1T99A 4LJ3A 2X7VA 5A8OA 1E72M 1GCYA 3K13A 4LEQA 4IX0A 1KNWA 3I4EA 1JZ7A 3G24A 4WF7A 1DEDA 4IMEA 2E9LA 3T08A 1A50A 3K4WA 3PPFA 4O1EA 3SIZA 3LG3A 5G1YA 2J88A 3KHJA 4PUEA 3N34A 3SFWA 1QR7A 2A6LA 2WVVA 3T6CA 1V6WA 1LOSA 4D8AA 3GE7A 4IPPA 4O1FA 1SW3A 3ARVA 3F7JA 4N4PA 3LDVA 5AC6A 4HSHA 3PZUA 5AYYA 4IMAA 3TSDA 1L6WA 3GXIA 5LIYX 2PAJA 3O6CA 4XV0A 3WK0A 3M5YA 1QOPA 4N9DA 2DGAA 3G2GA 2HEJA 5FEZA 4WSKA 5TD4A 3DU0A 4AZIA 3GW0A 3AWNA 3GBEA 1UG6A 3PPGA 5A5WA 3W87A 3VAVA 2YOCA 3N4EA 1X6NA 3QGAC 1VFHA 3N1AA 4KGLA 3B9EA 4Q32A 5GVJA 3PTQA 1US2A 4QX4A 3GKAA 1KCKA 4CQ9A 2AL1A 3DOPA 4B91A 2W5FA 2YCLB 4H04A 4B5TA 5GJMA 4QAIA 2JKAA 1U30A 4IXXA 3ANUA 3E12A 4HNNA 1XLFA 4JTRA 3DAQA 3QR3A 4I7WA 2ZZ1A 2OZ8A 3KZSA 3IGHX 3S4TA 4WSHA 1AJZA 5A95A 3BW4A 1TTQA 2VVNA 2EPLX 3RJYA 3UZWA 1DWFM 2G96A 4MY8A 3QZAA 1C3FA 1CXKA 3B0VC 4YTTA 4UZSA 1QNQA 1F7BA 5CZKA 3WLJA 4O17A 2X1UA 2F8QA 4FLOA 3NM3A 4W8AA 2OELA 1F6KA 2PGRA 3RDKA 3SUWA 5HBFA 2XYLA 3LD5A 1ZBCA 3BLDA 5HAOA 3ZVHA 1W1VA 4GUGA 5AFDA 4M1BA 2X2GA 1TA3A 5T8GA 4L1GA 3C6CA 4OV4A 4GCAA 1UWQA 5DT5A 3GUWA 4XUGA 5KINA 1Z44A 3TUUA 4U10A 3ABZA 4AD4A 4REQA 4K1WA 1PCKA 2HMCA 1I1XA 3C8FA 3LSCA 3BICA 3G3DA 2WZTA 1UB3A 4GY7A 3W2UA 4J3TA 4H2CA 4C6LA 2OXNA