1ZSXA

Crystal structure of human potassium channel kv beta-subunit (kcnab2)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel beta-2 subunit
publication title Crystal Structure Of Human Potassium Channel Kv Beta-subunit (KCNAB2)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 120
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zsxA00
4QR6A 2F2KA 3N2TA 4JQ4A 4ZFCA 1M9HA 2PDXA 1X98A 2PD5A 1J96A 4GACA 5LIYX 3M4HA 3V0SA 2ACUA 3LN3A 1YNQA 4LAUA 3LQGA 3CAQA 3LNMA 2DUZA 2VDGA 4LB3A 2P5NA 1XGDA 1IEIA 2PDWA 1PWMA 5LIWX 4L1WA 4JIRA 2C91A 1YNPA 2PDUA 2INEA 4FZIA 4QBXA 1T40A 2IKGA 1ZQ5A 4HBKA 2FZ8A 4GCAA 2R24A 2R9RA 4GQGA 2PZNA 1AH0A 4DBWA 5LIXX 3MB9A 3LZ3A 3LEPA 3T42A 3U2CA 1QWKA 4PUUA 3H7RA 1AH3A 2IKHA 3GHRA 2NVCA 4LBSA 1UR3M 4JTCA 1RALA 3R8HA 2NVDA 2PDKA 2IPJA 3DN5A 3RX4A 3CV7A 2PDBA 3D3FA 3UZZA 3LENA 4WGHA 3M0IA 3ONCA 3V35A 2PD9A 4WDTA 2PDGA 4JQ2A 3M64A 4IJRA 4YVXA 4JIHA 1HQTA 3CMFA 4LB4A 3EB3A 1ZSXA 3N6QA 5LIKX 1T41A 4XZIA 3BV7A 1MZRA 1MI3A 2ALRA 4IGSA 2I17A 1PZ0A 3H7UA 4XZLX 4JQAA 3S3GA 4DBUA 4XZNX 1ZGDA 1MRQA 1JEZA 2HE8A 1LQAA 2BGSA 4FALA 1EKOA 1Z3NA 4L1XA 4WEVX 4I5XA 5HNUA 1GVEA 3F7JA 4XK2A 2ACRA 2IPWA 1R38A 4QXIA 3R8GA 4GIEA 4XO6A 3WBWA 1VBJA 1PWLA 1US0A 1Q5MA 4MHBA 1X96A 4EXAA 2HE5A 1K8CA 1FRBA 2IKIA 3Q67A 5LIUX 3CAVA 2PDJA 5AZ0A 2AGTA 2ISFA 3G1RA 2QXWA 3LBOA 3NTYA 4FA3A 2FZBA 5C7HA 1VP5A 4GABA 1XF0A 4XZHA 3BURA 3V0TA 2DV0A 2BGQA 3UWEA 5KETA 3R6IA 3V36A 3EAUA 1AH4A 3UGRA 4XVEA 3WBXA 4XAPA 1OG6A 4ASTA 1ZUAX 3R58A 4LBRA 3RX3A 3G5EA 2PDYA 4R9OA 3UYIA 2PDMA 4JTAA 4PR4A 2WZTA 4JTRA 2F38A 2HEJA 3LD5A 4GA8A 4JQ1A 1Z89A 3UP8A 5AZ1A 1QRQA 3LZ5A 1S2CA 2HVOA 3R43A 4DBSA 1AZ2A 3DOPA 3O0KA 4Q3MA 3C3UA 3GHSA 2FVLA 3RX2A 4OTKA 3GUGA 1AZ1A 4YVPA 4Q7BA 2ACSA 4PMJA 4H8NA 5HA7A 1HW6A 4JTDA 5DANA 3BUVA 2I16A 2PDPA 3FX4A 3LUTA 1YE6A 1IHIA 3CV6A 4RPQA 4HMNA 3V0UA 2PDFA 1ADSA 1PZ1A 4PRTA 4H7CA 2FGBA 3WCZA 1AFSA 3Q65A 4WDWA 2HDJA 1EXBA 3GHUA 2PDHA 3P2VA 4YU1A 4WRHA 3O3RA 3VXGA 5JH1A 1EF3A 3UFYA 4G5DA 4JIIX 3UZXA 2IQDA 5JH2A 4FAMA 3ONBA 3UZYA 2PDQA 4QX4A 2PDIA 2WZMA 4NKCA 2IS7A 2FZ9A 2J8TA 1EL3A 2ACQA 3UZWA 3QKZA 5HNTA 1S2AA 1Q13A 4JTQA 3CASA 1A80A 3MC5A 3UG8A 4XZMX 4GQ0A 1Z8AA 3LQLA 3ERPA 3H4GA 4IJCA 3EB4A 2PDLA 4YVVA 3KRBA 3B3DA 2IPGA 1YE4A 2IQ0A 4ICCX 2FZDA 1SM9A 1S1RA 2IPFA 1RY8A 2BP1A 4LAZA 3WBYA 4JQ3A 3R94A 2INZA 1LWIA 2PF8A 4DZ5A 4WDXA 2PEVA 1S1PA 3WG6A 5M2FX 4XVDA 2A79A 4AUBA 4YS1A 1Z9AA 4EXBA 3GHTA 3R7MA 2DUXA 4PUWA 3FJNA 2PDCA 1XJBA 3BCJA 4PRRA 1RY0A 2HVNA 3COTA 2IKJA 2HV5A 2PDNA 4XO7A 1C9WA 2PFHA 1X97A 2CLPA 4WDUA 4F40A 1PYFA
chains in the Genus database with same CATH superfamily
1B4EA 3HN3A 3SCNA 1WXYA 3M5ZA 9XIAA 4EVZA 2JFEX 5FJPA 2VGIA 4IUGA 3W1RA 3G2GA 3XINA 3RHGA 1KCLA 5JIPA 3MTWA 4GI4A 3GBDA 5IHSA 3W25A 3N6JA 2NX9A 3DYMA 4H9UA 4C90A 5BWFA 4L1WA 4K6AA 3OYXA 1H7RA 4JEJA 1N7KA 1XRSA 2DQWA 4C6PA 1CGWA 5MHBA 3TA9A 3ABOA 3UNDA 3TH6A 1LWJA 1XLFA 3WQFA 1AH0A 4GX8A 1R6WA 3PWIA 4Z0SA 3L4WA 2OU4A 1JZ8A 1Q6DA 3LZ3A 1H50A 4TUFA 3QY8A 1LBLA 3IIVA 1QVBA 1AODA 1K03A 3OLEA 3W70A 4BF5A 1X7IA 4K8HA 4PMXA 1UR3M 3DH7A 6A3HA 2Q09A 1FX6A 1LCOA 2XH0A 4NZJA 3UJ2A 1EJTC 4IICA 4NJIA 3R0KA 3EDKA 2VM8A 1EWEA 4PUKA 1OCNA 2GK1A 4FHAA 3WLOA 3BXWA 4LUTB 2HNHA 2Q8XA 4S2BA 3SFKA 3WNPA 1MUMA 3WSUA 4HSOA 4GVFA 5GJMA 5HR7A 1UBSA 1T7LA 1J5TA 1R0MA 3EB3A 3LLFA 3S1XA 4GY0A 4RDVA 5LIKX 3MA8A 3CUXA 2OKOA 5LXEA 1LRNA 2I7GA 2QIIA 3NQGA 4NZ1A 2G37A 1GHSA 1OB0A 4IWWA 2XDFA 4FNRA 4AD1A 4XZLX 4JQAA 4BR1A 1V08A 3APTA 1K8YA 2J9ZA 4XZNX 1PX3A 2A3LA 1ZGDA 1BYDA 1AW5A 1YPFA 5IDIA 3GW0A 3AZRA 3QPYA 1WDSA 4L1XA 5AVNA 3UR2A 4MVAA 3TC6A 4OV4A 1IF2A 1QO5A 1XH0A 1ZU8A 4Q7NA 3ES7A 3TXZA 3LMYA 4LAOA 4HTBA 2Y5SA 1UZDA 1WX0A 2W62A 4LVBA 2G95A 3R12A 4S1FA 1T96A 4ZOBA 2DSZA 2V8ZA 1HKWA 1DKWA 2G3NA 4Z0JA 4Z1BA 3VNYA 3W82A 1ONRA 3T09A 1JPIA 3RO8A 1XLEA 1UOZA 2XFRA 1J0ZA 4A3UA 3SUTA 3DESA 2G3JA 2GVEA 4CN4A 1IE7C 3S2JA 4GOAA 2QIWA 3EB2A 5HJYA 1Q2RA 4O1CA 1F05A 4JIEA 3WDQA 2VO5A 4FO4A 2YCIX 3T4CA 1FHLA 1E9YB 4HA1A 3VC6A 1HL8A 2RJHA 1OCQA 1OD8A 2DVXA 1A0EA 1TZ9A 3EAUA 3LTYA 5CPOA 4F0KA 4H2HA 3ANUA 2EHHA 4D6CA 4FNUA 4XVEA 4HU3A 3CEPA 4Z1YA 5E0FA 3B04A 2UY3A 3S5YA 2ZRVA 3RLGA 4L9YA 3FS2A 1ZBCA 2A6NA 4V1YA 3UYIA 1LRTA 1ZAJA 4RNIA 2PP0A 1W5OA 3EDFA 3FY1A 2FPYA 2QJIA 2HEJA 3FKRA 5EA9A 1W5NA 1DQWA 2OQLA 2VOMA 3LHTA 3K1GA 4LF1A 1AZ2A 3LI0A 1NOUA 4C6IA 1JIBA 3OEXA 4Y9OA 3WH5A 2Q8LA 3AYSA 2C3ZA 4F0HA 4K39A 3L67A 2VL4A 3NJ3A 4MYAA 1Q8AA 1OGSA 2ISVA 4ROPA 2DEPA 1W32A 4LEFA 7XIMA 1ONEA 1Q85A 5F2GA 3KCLA 3A3HA 4D8LA 4KCUA 4PB5A 1JUBA 3BARA 3B8DA 3LCWA 1HKJA 2DVUA 4AVNA 1S2VA 4B15A 1RBOB 2JKEA 1FVPA 1S5NA 3DI0A 3U6WA 1ITQA 2BODX 3BSHA 1A4LA 1PBGA 1N2VA 3QW4B 3MVTA 3GHUA 5TQLA 3H26A 3GU2A 4CD8A 1GVRA 3TUUA 5J5RA 3A4AA 1AL8A 3U57A 4BFAA 1RLCL 5I3JA 1GORA 5I6SA 2NXGA 1A3XA 4R7WA 3EWCA 4AZ6A 2NV9A 3VDAA 3MCNA 3GU9A 4ZZ9A 4BEQA 2NQJA 3K13A 2V5DA 4ZO9A 1XYAA 1S2AA 4AISA 4LYRA 3RLVA 3R89A 3C0LA 4QTGA 4F2BA 5A8MA 4QNEA 4ICNA 1EA9C 3TKFA 1EYEA 4C6OA 3TW6A 4Q8WA 5KSWA 3SCWA 2XIJA 3ZSTA 3CIVA 3KBJA 3M0ZA 1WCGA 1JCNA 3FDGA 5AOUA 5A5WA 3VKBA 2VX6A 3G1XA 1OFQA 2VQUA 1NQ6A 2BZNA 2NW0A 2IPGA 3BANA 2CFFA 2BXVA 2V5KA 1SPQA 2CLMA 2CKRA 5IXEA 2OEKA 4TTGA 2WNZA 4ZQNA 4NASA 1W9UA 4IIHA 2INZA 3VKJA 4GG9A 1RAKA 3OZMA 4J2PA 5BRQA 3T78A 3FGCB 5C0QA 1SJCA 4H04A 2PS2A 1GOQA 1LP6A 3AYVA 4UTIA 4GUHA 1FUYA 6XIMA 1HP4A 2ZZ3A 5EPDA 2HVNA 1XFCA 5AHMA 4DJFD 1KTNA 1EJRC 3PWGA 1CEOA 3CO8A 4O17A 3K4WA 5KEZA 3PTQA 4P8WA 2BTMA 2DFAA 1UASA 3OOQA 3CAKA 1E0TA 1GGOA 4ADTA 2F2KA 4B3LA 3I7SA 4ZFCA 1PKMA 1J96A 3P8IA 1EZWA 2D0HA 4GZEA 1DIOA 4MWAA 2CETA 5C9XA 4A3RA 1SFSA 1ISXA 4UMAA 2DUZA 1FXPA 3M47A 1B3YA 1F2JA 3ZM8A 1PWMA 1B5TA 1V3JA 2OR2A 3GR8A 2CESA 1SW3A 4WKAA 5GPRA 4E6MA 3GIYA 4AEOA 2OQHA 2FVKA 1PB0A 4FMVA 3QMTA 4HNCA 4M7SA 3GE7A 5LIXX 3RR4A 3DEQA 5BCAA 5A3HA 3A9BA 1BWVA 2WV8A 3KDOA 2IKHA 3GVWA 2DJLA 2E1WA 1JXKA 2XSBA 2KZHA 2X7WA 4B9ZA 4M29A 1B57A 4B92A 4IIDA 2YLAA 4QSHA 1U5JA 3F2DA 4Y7EA 1V8EA 3HQNA 3PZOA 3WMBA 1YQ2A 3EOUA 3AMCA 4QG6A 2CYGA 1UR0A 1FQ0A 1XYFA 4MPKA 3WDHA 3GUWA 2UY4A 4DJED 1UC4A 1OEPA 2X0YA 3BW2A 3N6QA 3URQA 4MZYA 1JZ3A 3W73A 3N9SA 3P14A 4ZSUA 3QEZA 4K1WA 4CVUA 5D9OA 2I17A 3ZT7A 1AK5A 2WNWA 1ECQA 2CBVA 3GC4A 3QOKA 3TAOA 5A6LA 3HPAA 3RUBL 1CGTA 2I14A 3B8WA 1EKOA 1GEHA 3MSRA 3D47A 4F4RA 4ORIA 1GZ1A 3T4WA 3UWUA 3HMCA 4BQ4A 2DW7A 5IFPA 4QGCA 4X61A 3KCOA 4E4FA 3BSGA 1BG4A 2GWGA 4GZJA 5CZSA 1E1FA 2B0MA 3OBEA 2XSAA 5C9RA 2XGZA 4JTHA 3UWWA 4REQA 4EANA 2GQ8A 1VBUA 4D72A 3UQNA 3HTWA 4Y2WA 4MHBA 3RG6A 1EUAA 4IX0A 1Q7ZA 1JZ7A 4G9PA 1QXLA 3N25A 1EEPA 2QQ6A 2Z2BA 3SDOA 3CAVA 2XFFA 3V7PA 3S5ZA 4UQAA 3LBOA 1QU4A 3WH6A 1DWIM 3GR4A 4H6EA 4QQ3A 1EA0A 2I5QA 4WX2A 7CGTA 1JUEA 2DV0A 1P7TB 2ZXBA 5C55A 4JOMA 2YL8A 1BLIA 3WLKX 4AZIA 3QMSA 3VO0A 3UGRA 2A2IA 3WFZA 1NEYA 4B9YA 2QDGA 3DI1A 3M44A 1D3CA 1HJUA 3H70A 2HK0A 3RX3A 2ZWYA 5G5IA 4HOWA 3K1DA 3QZAA 2PWDA 3D5HA 1JZ5A 3STFA 1D7FA 3W7QA 2J9XA 1B3ZA 1H49A 3D3AA 4ALDA 3WF2A 3OZPA 3ARRA 4IM4A 1FWNA 1H4PA 4JY9A 1AL7A 3I6TA 2HVOA 3ZFHA 3L5LA 2WMIB 2OCZA 1E6RA 4GVHA 2ZZ7A 3NOEA 4DPPA 3NNTA 1RHCA 2PAJA 4GY1A 4O0KA 4KWUA 4IMCA 3WJSA 1XLAA 4XIMA 4LH8A 4OQVA 4MYXA 2XPKA 3UWZA 4KRUA 4W89A 3NQVA 1PZ3A 3AXKA 1PCWA 1Y0EA 1XGEA 4ZQRA 1QPKA 1H09A 3VCNA 3P67A 2C16A 1TWIA 1UD5A 5D9NA 2JGQA 1SUXA 2FQIA 1AFSA 4ZOEA 1W3HA 3SSJA 3ORWA 3LYEA 4AWSA 3P2VA 5CBIA 3N9KA 3T0CA 3A4JA 3O3RA 1AD4A 4JIIX 3W24A 1K7EA 3B0VC 2ZIDA 2PTDA 1YDOA 2WCSA 3V1PA 3WX7A 2PDQA 2E9LA 1S5VA 2GPTA 1KBBA 1GZGA 2NVAA 4J35A 5IOBA 2XJ7A 3GY1A 5XINA 2P53A 4JX5A 3VX1A 1ZNNA 4J3TA 1BSLA 2BVTA 5EY5A 3AZTA 3W84A 4QLJA 2WMJA 1KNWA 4KETA 2RGLA 2EJAA 3LERA 2H90A 3HPZA 4I9MA 4HZ6A 4UFMA 1OC5A 2CHRA 1XHGA 4PFMA 3U2EA 3B3DA 4GD0A 1JDDA 1C92A 2RUSA 4JX4A 2J8FA 1P6WA 1ICPA 3R5EA 2Q3RA 4D6EA 2GZXA 3UPWA 2I57A 4TVUA 3VIHA 3CK5A 5CLTA 1XGZA 5TD4A 3AHTA 1QOXA 4NUWA 1BQGA 1PVNA 1YIXA 3L4ZA 3O0FA 1KXVA 1H0GA 5HPOA 5DMYA 3GTIA 1R7AA 5FIPA 1DBTA 3RGTA 5DLCA 4AHPA 3T08A 3N13A 1BTMA 1NTHA 4UMCA 3HQPA 4XO7A 3SY5A 3VFLA 3TTSA 4I3GA 1S2UA 3TA6A 1A3WA 3TAKA 3VA8A 1OBAA 3QZEA 1QHOA 1K9FA 3CMGA 2E6DA 4HCDA 1XW8A 1RCQA 1K6AA 4NVTA 4J1OA 4LAUA 1PTDA 3LBMA 1RBAA 1W8SA 2GVLA 3FHQA 3QHOA 5H1WA 5A6KA 3IVUA 4PTNA 2X1UA 2J9YA 3QFWA 3RN6A 1T8QA 1GCYA 4WK9A 2DT2A 3QKEA 4TX8A 1V93A 4L9ZA 1PKNA 3RO6A 3GQYA 3ITLA 4DQWA 4AMAA 3E2RA 4GCAA 1GVOA 1G69A 2O9PA 4XKYA 3IUIA 5H8PA 3CB3A 3ARWA 4H41A 3L66A 1WOAA 3P93A 4XD4A 1DYSA 3O6AA 1OINA 2Z26A 5AC5A 4R88A 2F9RA 3NPVA 1VS1A 4E4PA 5A1AA 3GS6A 1E0WA 4BS0A 3R10A 2B7OA 5A8OA 1AQFA 3S5NA 1RALA 1UOKA 4DUVA 4K7YA 4GH3A 4HZ7A 1SO5A 4K8EA 1FY6A 4WY0B 4GI6A 1DTUA 3CZGA 1G67A 1DJHA 4AZ5A 2BHZA 4U5KA 3LG3A 1XCFA 4UOJA 2PD9A 4UIOA 4J3VA 2R1PA 1M41A 4MKVA 4EPBC 4IJRA 3B0YA 4HOZA 5AKQA 1IZJA 1OX4A 2NLIA 2OTDA 3RIKA 2BHYA 2VFDA 4FLOA 2Y88A 2X0HA 1MZRA 3SCTA 1CGVA 3JUGA 1X38A 1OFAA 4BQ3A 4ZO7A 3BAWA 5CSSA 3KL3A 3M0JA 3VYLA 4YIWA 4DBEA 3GG8A 1Z3NA 4Q4QA 3SCRA 3CH9A 3M0VA 4EIVA 1W1PA 4ERAA 2NT0A 5CPTA 2QUVA 1GVEA 2ZTKA 1VAHA 3CO4A 4EPKA 2A85A 5D2YA 3SBFA 2IPWA 4PA8A 4FNTA 3W7GA 5AVHA 1DE6A 4WHBA 2WKLA 2C8NA 3RPTA 7TAAA 4FR1A 2X16A 1LUCB 3TSDA 2A4AA 1D8WA 3SN1A 4L56A 2O55A 2EXOA 3UU0A 1LOLA 4IHCA 3REQB 1TUXA 3QQWA 3HG3A 4MF4A 1KBJA 4JN8A 4JTUA 3GLCA 3IJQA 3S5SA 4ES4A 3M7WA 1KD0A 4Z2LA 1B9BA 1HZYA 1VP5A 2VFEA 3E0LA 3TN4A 2J77A 3EOSA 1XD1A 3R6IA 3CGTA 4HA4A 4X9SA 1H2JA 3LGEA 4UTWC 1I1XA 1C7SA 4AWEA 4EXQA 3T0DA 3THQA 3RF9A 1FDYA 2WBGA 2HROA 4LYPA 3CPRA 1JYVA 1VEMA 1DXEA 3NVDA 3O05A 2F84A 4ZR8A 3IPWA 1S2WA 2XTKA 3R11A 3C2FA 3LD5A 3U5UA 3DGRA 4OZOA 4CNUA 2YFNA 1S2CA 5GNZA 4E2VA 1KW1A 3U0HA 4FSAA 4C5YA 4GQBA 3NQ6A 2PC8A 7ENLA 1TQJA 4IMAA 2VFIA 2DORA 3NGFA 2VXNA 1JFHA 1VPQA 2WWDA 5K4ZA 3UETA 1TE6A 3L4XA 3WQ4A 4YVPA 3D6NA 1TREA 3NQMA 4PMJA 4C6EA 1Q6LA 2RH9A 3FIGA 4U10A 1Q63A 1W9BM 3GK0A 1WDRA 4X60A 3W7NA 1YPXA 2Y61A 1GQLA 5TIMA 1NP2A 3W2UA 1MFUA 2YR1A 2OO6A 5CC7A 4IMGA 1AW1A 3P3BA 4TO8A 2WHLA 4BI6A 1E0UA 1GVFA 2XH7A 1HJXA 3DFTA 4LCSA 5AC4A 4PBGA 3CL8A 3W00A 4HYWA 3QPZA 2IQDA 4A8NA 1XR2A 3UZYA 1GEQA 2WQPA 3CPUA 3ABSA 3CZLA 3PPCA 3SADA 5CJMA 3BJTA 3M7SA 4GYFA 4GYPC 1QI3A 4GJIA 1IZCA 1NARA 3LNPA 1EZ2A 5I5RA 2LLEA 3WQGA 3BCFA 1KBKA 2OXNA 1XYLA 1RVKA 4Y9MA 3MHFA 3CAWA 4ENLA 2AQOA 2GGIA 2OZTA 3AZSA 3WNMA 4UQ9A 3BZJA 3N2BA 3I4KA 4O0QA 1WZMA 2C15A 2Y0FA 3ZR6A 3DC8A 2Q01A 4HZ8A 4FLQA 1E70M 1QO2A 3QM3A 3T1GA 2OGYA 1F3WA 3G0XA 1O94A 1M7XA 2ZUWA 4LC8A 3ITYA 7ODCA 2ZFAA 3PS7A 1UKSA 3UZJA 1WZAA 4C1LA 1TPFA 2ODOA 3B9EA 4FLSA 4ZEPA 3VKAA 4V2XA 3WBYA 3CWNA 4J3UA 2Z1KA 5H8UA 3VK5A 1H7XA 4PBFA 4NZ3A 4LVDA 1E9LA 1T8XA 4CU7A 4MM1A 4C6NA 4D2JA 1BSIA 4D6JA 2V3DA 3EX2A 1JDAA 1CLVA 2EPHA 4I6VA 2ATMA 3I7QA 4ZQMA 1K6WA 5DMMA 4XX6A 3TMLA 4EWJA 3SUWA 1ZBKA 3IRSA 5T8GA 1O5XA 3URBA 4L1GA 4UQBA 5BMWA 3TOPA 1HIZA 1XC6A 2WNQA 4J28A 1TA3A 3W27A 1UROA 4P5UA 3WLJA 2B4GA 1ZS2A 3N04A 5CZJA 3TSBA 4MWAD 4WQ6A 1P0KA 5F2MA 4D71A 3ME3A 2EO7A 1IEIA 3K5XA 3A21A 2D3LA 3WKZA 5FF0A 3W87A 2V38A 2EPKX 1Z6KA 1MW2A 3GX9A 4OECA 2F7FA 1YDVA 3EX1A 1W6TA 4E0CA 3QTPA 4NX0A 1BXNA 2PA6A 2NUXA 4W88A 3NQDA 3WEOA 4XWUA 3EYPA 2EEXA 3N12A 3UNTA 5ENLA 4KRZA 3ZT5A 5B7YA 1E1CA 2NVCA 4JHMA 2PGFA 2TYSA 1LBFA 2DGAA 3GVGA 3WD0A 4AYGA 2PLJA 5HWNA 2QUNA 4RL3A 1UG6A 1J8VA 1EJSC 1NH6A 3QF0A 2VHLA 4B4HA 2WKJA 1OM0A 1VFUA 2NX3A 2C71A 3WQEA 4Q6JA 3HG2A 1B9ZA 2P3ZA 3C86A 3NR0A 1P7TA 3WLIA 1SYTA 2WOQA 3BOLA 4HHPA 3OYZA 4DO4A 2DZXA 5EMLA 2YBVA 1UUOA 2W91A 1K4HA 1M7PA 3IIZA 4RJEA 1MDRA 4ZCWA 4E2DA 4RNFA 3THCA 3T7VA 4J3XA 2ALRA 2QR6A 4IGSA 2YW4A 4M1RA 4R5EA 4RUBA 3SCPA 3A12A 4WVXA 2WCAA 3M07A 1VPXA 3DUGA 1XIBA 1MRQA 3SW6A 3VD7A 4LRTA 4FALA 4R7OA 4XB3A 1XV8A 4WEVX 4DUXA 2JF7A 1Q6CA 1GPFA 3ITOA 3LK6A 1ISZA 4GRSA 4AG0A 2D3NA 2WMIA 4IIBA 3THAA 3B03A 2QV4A 5FCZA 1UMYA 5I78A 4Q8UA 1VJZA 4JN7A 2ZRWA 3QV7A 3QY6A 2IUZA 4DVOA 4LBUA 1JDEA 2J7HA 5CGMA 1OF6A 3UWVA 3FK4A 1WB0A 4U5IA 3ITTA 5E1QA 4D6DA 3OHMB 5HXMA 1H61A 5E5CA 3U48A 3W02A 2IXVA 1BKHA 4HMCA 1QBBA 2ZDSA 4WJXA 5AZ0A 6TIMA 2REQA 5I00A 1D3GA 3R25A 4JL1A 2GDVA 3N14A 3AIUA 2QAPA 4HPGA 2ZUMA 1R7OA 4F0RA 2O4MA 2Z7GA 1S3TC 3T44A 5AC8A 3LBCA 2YDAA 4H9XA 3UXAA 3KZSA 1KFEA 2BVYA 3SGZA 1U1HA 1ZUAX 3G5EA 2FPTA 5FAGA 2YBUA 1VBGA 3NEHA 5CXPA 4JTAA 3T55A 3CBWA 4ATWA 3GWQA 2EJ1A 5T9CE 5M03A 1BYAA 3UP8A 3WQ8A 2FFCA 3KM8A 5F2LA 3P74A 1IV8A 4RCXA 4RW5A 2TAAA 3FV9A 3CZJA 2Q6ZA 2J7BA 3RITA 2FH8A 3JS3A 4I90A 1O1HA 3TZNA 5H8MA 2JGYA 2FVLA 1ZLPA 1GKQA 4PUJA 4OTKA 4C7GA 4IFKA 3NFUA 5C9UA 1QK0A 2WVVA 3ICJA 5BRBA 2ZXQA 4Q8OA 3W26A 1LL4A 1AZ1A 4IZGA 2QJHA 4CNTA 1Q4NX 5U7SA 2Z00A 3YPIA 3WNKA 4C6CA 1AJZA 1WPCA 3W7MA 5L9FA 4A2SA 4AZ7A 2NXHA 3G24A 4JY8A 4IP4A 1IHIA 2GOUA 3QR0A 2ZZ2A 2PDFA 4Q33A 1F6KA 4FXFA 4NYYA 1PPIA 3KTCA 4H7CA 4ACZB 3OA3A 2WWCA 3PPFA 3H23A 1AD1A 6REQB 1G01A 2Z27A 2JE8A 4H8UA 1SR0A 1K8ZA 2O9TA 4NIRA 5I0DA 3KRZA 2YGYA 2YX0A 1E6ZA 4LS2A 2XGIA 1X6LA 4DB7A 3SAZA 1LQ2A 2GSHA 4S3GA 1PTGA 3WQCA 3H2EA 4PUDA 3U7VA 1Q13A 1WKYA 2QCMA 2R1NA 2PCQA 3L0GA 4G2DA 2ZKMX 3A6OA 1SJAA 4GGBA 2OYLA 3S0CA 1JYWA 1OFDA 2G96A 2ZX9A 3SY8A 4JYEA 1YX1A 3EB4A 3B0PA 1IT8A 3DFPA 2PLKA 4CKQA 2BMBA 1YE4A 3KZPA 2ZRZA 3DFOA 1LWHA 2X05A 1SM9A 1WBHA 4RE4A 3QHNA 1RY8A 4LOCA 4D6HA 1JDFA 4PL2A 3B8SA 3I3BA 3ZLHA 1RQBA 1IT7A 1IXQA 1ZBWA 3ZLFA 2DUXA 5I23A 4PUWA 2QCNA 3AWOA 1XDJA 1XJBA 2VZSA 3WQDA 2D20A 3IGHX 4Z1CA 5XIMA 2V67A 1E72M 3LRMA 3BPWA 1QNSA 1LDCA 3L23A 4H7ZA 1A5CA 1RQEA 2OZ3A 2NQLA 5DMNA 4BF9A 4NP7A 2V9DA 5D9PA 2XUCA 1DWGM 1V0KA 4US6A 1YXYA 3HQOA 3TN3A 1D8CA 5LIYX 8A3HA 1F8IA 3OVQA 3V0SA 1EPVA 1NU5A 2ACUA 4DUWA 2WC4A 2EKGA 3V16A 3ZVIA 2R82A 3QJAA 3BL3A 4DUOA 1SW7A 4QE4A 4N0RA 1BAGA 1RSCA 3RYSA 3CUIA 5H91A 4DXKA 3H2MA 3KTXA 2DZUA 4MB1A 4QE1A 2CCRA 4RK8A 1Q65A 3OVRA 2GGGA 3HV9A 1QDSA 1OIMA 3GXTA 4I5UA 2QDEA 3OBKA 2DSVA 4UC5A 5CQ1A 4AD3A 5HQMA 2YDRA 4D9PA 2ZE0A 4AB4A 5CBBA 4K38A 4M56A 3ARTA 1C29A 1JAEA 4FEZA 1CBGA 4H8VA 5AYZA 1NFGA 3AS3A 4PGLA 2BY1A 3W7KA 5D2VA 2VCAA 2ZOXA 3RXZA 1KLZA 4JTSA 1EPXA 2VX5A 4C1NA 5T26A 3L12A 2DSWA 4L61A 1M5WA 1J2BA 4LQ1A 4B16A 3V35A 2BY0A 4RZ4A 1U33A 3G22A 4TMBA 2BS9A 5E6ZA 3C61A 4U2YA 3IIPA 3BGAA 2V3FA 2AKMA 1IR2A 3TTQA 2Z1VA 3AMDA 3IEBA 1XLCA 4O53A 3KBVA 4XZIA 1XRTA 1EP3A 3LGDA 1W3TA 2A1YA 4PMZA 4C60A 1V51A 3VIPA 4H9TA 3ZMRA 3W1TA 1SFLA 3G8RA 3RDKA 2DW6A 2GJLA 1CNVA 4I6KA 4Q8NA 5KMYA 1TVPA 1UKOA 3M5VA 4UMBA 1M3UA 1IT0A 2QHAA 4OU1A 3SUUA 2A3HA 1NVMA 4BZYA 3B9NA 4Q8TA 1HJWA 5EB8A 3UXIA 4I5XA 1DV7A 1FHDA 1V77A 1GG1A 2FLIA 1PAMA 2DVTA 2J79A 4RDZA 4XK2A 4AC1X 2XZ7A 2XN1A 4EWND 2WC3A 2X8RA 3FAWA 2OZ0A 4CEUC 3O16A 4GZ7A 3TR2A 2R1MA 3CIXA 4Q8QA 3ARPA 4TV5A 3WQPA 1VZWA 4ML9A 2VCBA 1Q5MA 4LUSA 1H0IA 4P8VA 1J12A 3CTTA 4JZ5A 3DX5A 1W3LA 3AS0A 3NXLA 2AMGA 3VGBA 1EUNA 3PSVA 5LIUX 3CNYA 3GNPA 1U5HA 1MDLA 3VGEA 1Q66A 1V02E 4CLMA 3GXFA 3SUSA 4AX7A 1BF6A 1MEHA 1OX5A 1E3XA 4L80A 3VIOA 1CI1A 2Z4GA 2OSWA 4DAFA 4D8ZA 2J74A 1R2SA 3G6LA 4AZGA 2BGQA 1KFCA 1A0CA 3H2AA 3W1LA 3UWEA 3E0VA 4QJ3B 3CQHA 1UWTA 1L8NA 3MWCA 2H9AB 4S38A 1XLMA 4MJMA 2B7NA 5D8ZA 4TIMA 1E9ZB 4JCLA 2J7FA 3P61A 2E8ZA 3BTNA 3NQ7A 2ALDA 4DEFA 2Z1BA 3H7VA 4JKMA 1TMLA 1HGWA 2OFJA 1BHGA 4F2UA 3A3XA 1R86A 3L7RA 4FK9A 4GYPA 1V6XA 1EBHA 1F3XA 3CHVA 4AZHA 4UTKA 1PO9A 4JFUA 3GC2A 6ALDA 2IW0A 1TPDA 4HU8A 3C2OA 4N02A 5FJTA 3O63A 3W0KA 3D46A 4DO6A 2Y7GA 4X3ZA 1ZL1A 3KLLA 2POTA 1C8XA 4ZTYA 4B5VA 3PZGA 1J0IA 1E55A 2F6UA 1QJWA 2JKPA 3T8QA 2JK2A 3IIOA 3MO4A 1YADA 4M7TA 1R30A 4HIBA 3HURA 4CVWA 1DL3A 4F8XA 5C70A 4ZTXA 4AY1A 1KM1A 2C1GA 5I06A 1OGBA 3V0UA 3NZRA 3V3WA 2VEKA 1P48A 1JPMA 3BLDA 4HMDA 2VFHA 3ITCA 1DQUA 1YBQA 7REQB 3OHIA 5JH1A 3LSBA 1W1YA 3KEHA 1VF8A 1TUFA 2UZ9A 1FFRA 2Y1HA 3U9IA 2Z1WA 4Q8MA 4H6KA 3IAQA 2P3EA 4P7NA 4AF0A 1OFOA 3C0SA 3ZOAA 3S2CA 2WNNA 4XIAA 3PUEA 1GOMA 4DWSC 1HX0A 3AU2A 4ZBCA 3VM7A 1A80A 5F4SA 2VFFA 3B05A 3GDBA 1R3RA 3ZSSA 4NU7A 3ERPA 1SO3A 4J3ZA 4M51A 4IJCA 4XISA 3WK0A 2ISDA 1ZCCA 3U3HA 3W7LA 1CWYA 2NUWA 1FWCC 3NSMA 3BGGA 3CM4A 5K7JA 1J0YA 4KKXA 2JEPA 2A6LA 5D2WA 3T6CA 4AAJA 3GR7A 4MUZA 3SIMA 3LPOA 1OADA 4GK8A 2AL1A 3FSTA 3QVQA 4KWOA 4MNLA 1DJIA 3KHDA 3LU2A 5CZKA 4GXWA 3BW3A 4MMWA 3RCMA 2F61A 4HSNA 1Y7VA 3GXMA 1PL9A 4QS6A 2A3EA 4EXBA 3NAVA 3R7MA 3GFXA 4OOZA 4S23A 3SIZA 1VRDA 3FJNA 4UR7A 4F0LA 3CJPA 1E4LA 3E5PA 3BCJA 1V79A 2GL5A 1UD3A 2IKJA 3DYPA 4P8UA 1RV8A 2DH3A 4A2RA 3L2LA 1C9WA 3MO7A 3DYOA 5FEPA 2CLLA 2YL6A 3ITXA 3TN6A 1JFXA 1V0MA 4K7VA 2D23A 2EKCA 2XIIA 3CL7A 1IGSA 1GW1A 3W7OA 3C0JA 1W5PA 4ZO8A 3BH4A 1JDCA 2W66A 1W3IA 2P0IA 4PEEA 3UJFA 4H4IA 3HG5A 4CNSA 2HPIA 5AYYA 4AVOA 3VDBA 4XSMA 1RD5A 2HRWA 1OFBA 5DY2A 4W7UA 1U5VA 4JHZA 3GC5A 4F9DA 4EKJA 2HWGA 2HZGA 2W5FA 2BSLA 2CW6A 3IIXA 3LM7A 4YTUA 4DJDD 1TV3A 3TYCA 4E8CA 4TV6A 5EMUA 3Q45A 1OY0A 3MUCA 5FD0A 1KA9F 4PTXA 2GK1B 5LKYA 3K46A 3U2OA 4DZAA 1BG9A 1G9HA 2YLLA 3RFAA 3CWOX 4E2BA 4K3ZA 4FNSA 4H00A 4IPJA 1G4TA 4MOZA 2YCKX 4UTMA 1QUMA 1SSDA 1WA3A 1MXGA 4YYCA 1I6NA 4C91A 5REQA 5MKGB 1GPWA 3LDVA 3ONCA 4QDPA 3ZR4A 1SFTA 4UTJA 1E6XM 4GIRA 3W1PA 1WE5A 5A2AA 4V27A 3CZKA 3QYQA 1PUDA 4WLCA 1I8JA 1KXHA 5AY7A 1GUVA 1U2YA 1MI3A 4ECLA 2CZFA 1IEQA 1XLHA 1YDNA 4CN1A 2QT3A 3MUIA 1A5AA 3UA4A 3WF1A 2YBTA 2KAUC 1A5BA 3L4TA 4B5TA 3UY7A 5K4XA 4IG2A 1BVZA 4RE3A 2VZUA 3VCRA 1OX6A 3RRXA 4O0ZA 5L6UA 3W1XA 3GNDA 3G1FA 1JCTA 4E5TA 2ZZ1A 3EX3A 2D0GA 4IL2A 1MFVA 4YCOA 3BAYA 4WR3A 5FA5A 5FSDC 3HU7A 4YHEA 1GOOA 8RUCA 3IJ9A 3R8GA 3TFCA 4HD5A 4Q7IA 3UWYA 2O92A 4X0NA 3C3NA 5EU9A 3MDWA 1IEVA 2WPBA 1I2RA 2O56A 2P8CA 2CLOA 5J04A 4EOUA 4UFJA 3P8JA 4EXAA 2BFGA 2HE5A 4MDOA 1FCBA 3MW7A 3VDCA 5C9WA 3EMZA 3PAOA 2PDJA 1V7YA 3PFRA 2OG9A 3AO0A 3GTNA 3G1RA 3MDUA 3VD5A 4ACZA 3QW3A 4ZGYA 1GTHA 4ZE5A 1MWOA 4GABA 1BXBA 4PBEA 1GVIA 4Y8FA 2ZUUA 1Z69A 1FHVA 1GOIA 3VNJA 4LNCA 3AHYA 3MMDA 3STEA 3WJZA 2PWVA 5EMJA 1QT1A 4JN6A 2X09A 1T99A 1DJWA 4GUJA 4C6FA 4JNMA 4ASTA 1O95A 3NQFA 1OC6A 4PUNA 3FYOA 4JTFA 4YTTA 3F5LA 4X9YA 1FWRA 2DJXA 4RPPA 2GJXA 2X1SA 4BJHA 5EMMA 4TQTA 1JGIA 4Z2HA 2UY2A 1L9WA 1FWGC 2QEZA 2FTPA 3DFHA 1BGGA 3VINA 1ADOA 3SRKA 2ESCA 3MI2A 2VELA 1IYXA 3GG7A 4QJ4B 2PI6A 3WK2A 4IMEA 2PTWA 1QOQA 1TIMA 5AC7A 1CXFA 5CJNA 4RNJA 3APGA 3L4UA 1Q6QA 2QUMA 5I24A 1XSKA 3CHCA 4Q7BA 3ARYA 3W6LA 4I5RA 3KRSA 3IK4A 5LGZA 1X8FA 1MQRA 1KXTA 5FF4A 4UNLA 3TDFA 2WMKA 3WLRA 1XUZA 1FKWA 2FJUB 5IHRA 5AHEA 2FH6A 2BWGA 2GQ3A 1W3NA 1Y5XA 3R0UA 1DWHM 1YXCA 2PWUA 4UOQA 1XYCA 4ACYA 3TP4A 4YTRA 4CCDA 2HDJA 3C8NA 2PDHA 1FHUA 2QZRA 4MY9A 4AXKA 5FF7A 1DJQA 8XIAA 1NOFA 3GIPA 5I77A 3N4FA 3VGGA 4NKCA 3IGUA 4KW2A 2VVNA 4LYQA 1WZKA 5IBXC 2E7FA 2ATSA 4J27A 2NLYA 4N6EA 3T2OA 3W9ZA 2GSJA 5E9XA 3FXGA 2XVGA 3TR9A 1XDLA 1V3MA 3M0XA 4LS1A 2ZZ4A 4JTQA 2W9MA 1TWSA 3A5VA 5IFTA 3SURA 1CXIA 2QGYA 4XZ9A 3TW9A 3STPA 5BNKA 3ABZA 3AMKA 2J6XA 4QJ5B 1XIEA 3RMJA 2X1IA 4PCSA 3ES8A 3IJ8A 2WMFA 4KFNA 1B1YA 3GDKA 4HYRA 3ITVA 2IQTA 4FXRA 3W53A 3BLIA 2FKPA 1HJSA 4GFIA 3PTMA 4G6CA 5SWUA 1E4MM 3MANA 3UY8A 2IPFA 3N3TA 3NWRA 3SQLA 2DZPA 3AALA 1YHTA 2Z0IA 2E0PA 3AROA 2DP3A 4IF2A 3UERA 1EH9A 1TVLA 5HMFA 2QDDA 2PBOA 2W4XA 1Z32X 2J25A 1GJWA 1KBLA 4R85A 2BDQA 1UR4A 1I2NA 2DY3A 3FCPA 1GONA 4JL2A 2PDNA 4FR6A 1UBPC 5HWMA 3BLLA 2XM2A 2YZ5A 1IWAA 2CLPA 2HISA 4PH6A 5DY3A 4B4FA 3W1NA 5BXPA 2WVTA 3N2TA 3VOFA 2P50A 2WB5A 4U3AA 4KGJA 3G1VA 4PMVA 3OIHA 2WPGA 4C7FA 1YNQA 2GLKA 1ZP4A 2WK2A 4HOXA 1V5XA 2Y7FA 1KQZA 4CD7A 1KC7A 5TF0A 1SZRA 4YLWA 5A8GA 2C91A 1A3HA 2H8XA 2NWSA 1F74A 3ABQA 4FZIA 3N9RA 4KCWA 2ZZ6A 4IQDA 1ZQ5A 3TWAA 3S6OA 1TG7A 2QLYA 1XLGA 1OVDA 2Y4SA 3NGJA 4QDMA 1POKA 2PZNA 2WJEA 2E5CA 2WBKA 3VX0A 5DBUA 1V6VA 4NNBA 4FIRA 1NELA 4YWSA 3T42A 3E2VA 5K9XA 2WSPA 1G94A 3POHA 2HTMA 3WLPA 1B3XA 5G2IA 3R8HA 3NYZA 2H8ZA 3ARXA 4UTFA 4I9AA 1CXEA 3T9PA 1Q3NA 2GDQA 4WGHA 4AH7A 1YDYA 3CT7A 2R6OA 4MNMA 3WBEA 1UHVA 5FACA 3M0HA 5AB3A 3A3WA 5GJPA 1SZGA 1QHZA 5A94A 4M6VA 1A0DA 4GIAA 4JQ2A 3S46A 1KGUA 5HNNA 5I3DA 4LB4A 4JNZA 2J62A 1UWIA 5E9AA 1SJBA 3UXDA 2Q3OA 3AHXA 2PWGA 4OUEA 2WVUA 3LCHA 2WXDM 4KPLA 3ZWTA 3BMXA 1MMFA 3VVGA 4YHGA 3W1MA 4OFCA 1RP8A 1DE5A 3ID7A 1JEZA 3E0WA 3B8VA 4MNJA 5LNSA 4GIYA 4FB7A 1VEOA 1LQAA 5A95A 4L65A 4KWWA 4BI5A 3WUGA 3GVRA 1CCWB 4KEMA 2EBNA 2OX4A 5EKYA 4INFA 3KOZA 3W01A 3NO3A 3TCSA 3KOWA 1LG1A 4A29A 2EPOA 5K3VA 3UG5A 1BTCA 4J7RA 2C19A 3T0AA 3TN5A 3VIFA 4J9JA 1UH2A 3QZ6A 5CZTA 3SN4A 1I2OA 2PE4A 4D1IA 3STCA 2EAWA 1F9CA 1MNZA 3W7HA 2QS8A 2MNRA 4G7EA 1B3WA 5DXYA 1M04A 1TMHA 1RZMA 4LV4A 1DIEA 3CIWA 3QQ0A 4DM1A 1BKSA 1LRQA 2BASA 1J0HA 3L4VA 1VCGA 1UH3A 4D6IA 5C7HA 3L2MA 1FWIC 2GFTA 7REQA 4BCEA 4RDWA 5J5DA 1HF6A 5M5DA 3CQ0A 2Y70A 4L9XA 4DJFC 1YW1A 4YNGA 2RDXA 4P61A 4CD4A 1BEUA 4PMYA 1XQLA 3EBVA 3GYEA 4IQEA 4DPQA 1YTDA 4R9OA 2XN2A 1J11A 4S3FA 3G1SA 3WUFA 3KLKA 1JI2A 2WANA 1EOMA 4M24A 3TMQA 4JTRA 3FN9A 5A6TC 1BGAA 4NY2A 3GKFA 1S5WA 1Z44A 1G6CA 1GOXA 3FLUA 5G4EA 3SJNA 1OSEA 1BVNP 4ZSTA 5C2XA 3PM6A 3KE0A 1O5RA 2VDHA 3WDIA 3C6CA 4MAVA 5FJUA 2Z2AA 2JF6A 1W37A 3KHJA 4RKAA 3GUGA 1KCKA 3VI2A 1HKVA 1P6CA 4H2CA 4LYKA 1VENA 2QCEA 3PJTA 3GDTA 3FA4A 4NAEA 4HNOA 1UP2A 5ECUA 4PUEA 3LPFA 3TCEA 4G1KA 3SN0A 1X39A 2P76A 2HQAA 4PRTA 2FGBA 4WSJA 3EPOA 4CNNA 1OF8A 3CLMA 3ELFA 3B8TA 3AOFA 3H54A 4NI3A 2GGHA 3ZIZA 1TQXA 1FWWA 2OODA 1TELA 2CZDA 5F7UA 5BWAA 1S2TA 4XZWA 3H55A 1L6YA 5AHFA 1GYLA 2XN0A 5KZEA 1JRCA 3KP1A 3GAYA 4DX3A 5HANA 1H51A 2FDMA 4GXPA 2CERA 4X2PA 3G18A 2YCLA 1EJUC 1A5LC 5CC5A 1DVJA 3VKKA 2HSAA 3EWZA 1WBJA 3BG5A 3LX9A 4RZ6A 3PPGA 1A49A 4V1XA 2ZE3A 1BWKA 4N9DA 3GXDA 1UYQA 1YPIA 1UPMB 3MSDA 5LHEA 1EP2A 1KFKA 1S1RA 5EMYA 3KUMA 2NV1A 3H4XA 1GJPA 5EGRA 1VHCA 3R94A 4WOQA 3UCQA 1LTDA 4HN8A 3BC9A 2HS8A 1S1PA 5AC6A 5E09A 4BWLC 3M9YA 3KRUA 1QI0A 2V2DA 5MKGA 1VFMA 2QCHA 3SRHA 2Z29A 4UQEA 1HL2A 4Z08A 3MWAA 3NL3A 4CQCA 3NO1A 1G4PA 2Y5JA 3HFYA 2GVYA 1PJ9A 1V0LA 1W1B1 4DNHA 4IQJA 3RCNA 4GJ1A 1U30A 3CV2A 4JQ4A 1WDWA 4XAGA 3W2KA 1X98A 1M01A 4KFOA 3KL5A 1ADDA 3S2LA 3ALFA 1XS2A 2OEJA 1BRLA 4XKYB 4HHLA 1EOKA 1HG3A 4LB3A 3OO2A 4XG1A 4IIFA 2PTZA 5AYIA 2OJPA 1RA5A 2E1DA 1VFFA 4L6OA 5IM51 2PDUA 1F6PA 2INEA 4ZQCA 1JPHA 2RDUA 3P5ZA 4B2DA 1HJQA 1MUCA 3NG3A 5AHIA 3HO8A 4L4LA 4K68A 4Z17A 2PU1A 4A8RA 1WKDA 1VB9A 2INFA 3LEPA 2Z6IA 1H11A 1XG4A 4GFSA 3VNZA 3APYA 5CAHA 2CHOA 3B9DA 3PZIA 3JU2A 4IT1A 1HO4A 4QG8A 3GH7A 1OX4B 4BKNA 2IPJA 1IQ8A 3AHZA 4LX4A 3N29A 3IUDA 3UVIA 4HGXA 4HSHA 1NJJA 4YJ5A 4S3BA 2I5IA 4GWEA 2OVLA 3IAPA 4TX6A 4IQLA 5KZDA 5C2CA 1I2PA 3W83A 3BJSA 4YVXA 3CMFA 4AMCA 3NO5A 1DWAM 2QGHA 3HMJG 1CTNA 4M0XA 2YKKA 2V2HA 1RCXB 1Q4WA 4URIA 1C91A 1B31A 3SZ8A 1TVNA 4H6RA 3QHMA 4DRSA 3G0UA 4HP5A 1HNYA 2XZ9A 2HE8A 2G5WA 3IRDA 3ZJKA 3MV11 1SO4A 4Z1AA 3B9OA 5I7GA 3W1QA 1W1VA 1TB3A 1VC4A 2E28A 3SQSA 4MZ1A 2WHKA 1MRAA 3EX6A 1QNOA 2ACRA 2QJMA 3Q2DA 4ZXOA 3H24A 2XU2A 4GISA 3EPMA 1A47A 3WBWA 3EGJA 1RR2A 1QW8A 1PWLA 2GUBA 1M65A 4W4QA 1C9DA 2J27A 3GFYA 5LA0A 4IX2A 3V75A 2XIQA 1W17A 2Y89A 2OYMA 2DIEA 2NQ9A 4O8AA 3MYPA 3AYTA 3F2BA 1VIZA 3MT1A 2E4TA 1CB2A 4CNOA 2FZBA 4Q4KA 4ADSA 3VOGA 2ZUNA 3AUJA 1NF7A 4BEUA 1CGUA 3MUAA 1EHAA 1Y65A 4IXXA 1HGYA 1F4AA 4P7LA 3S8HA 1KCZA 3UCCA 1BD0A 4LCQA 3K30A 2Y24A 3USZA 4HQVA 4OBSA 4P8XA 3AS1A 3CQIA 4IIGA 2PDYA 1J9YA 1Q45A 1UKTA 4GUGA 5IBXA 2PWHA 4GO9A 5C8BB 2PTYA 2PB1A 2VCCA 4GUFA 1CXLA 1FWDC 2V3GA 4A35A 1KGXA 1O12A 1POJA 3R43A 4AHOA 2FFIA 3BLFA 2BXZA 4UQCA 4PMNA 4B91A 5I3FA 2FYMA 2W61A 3H6OA 3E38A 1X1ZA 1E73M 3I10A 4TVDA 2V5BA 3NQ2A 3BOXA 2YOCA 4CD5A 2ZA3A 1JPKA 1TWDA 1HP5A 2IXUA 2I16A 3KOXA 3E0IA 4XD6A 1JL8A 5I79A 4DWDA 1B3OA 1VD6A 4LY4A 3GZ3A 1DIKA 4HK5A 3E5BA 1ZENA 2OX1A 2WC7A 3SO7A 1D9EA 3NSNA 4WIWA 3EWBX 3R8RA 4BA0A 1UA7A 4TR9A 1EC8A 2X1TA 5JXQA 2Q8ZA 4MUPA 2IS7A 2A21A 1ZHAA 3O6CA 3R1ZA 2P88A 2J8TA 1TX2A 4C6KA 1VBHA 2W79A 3OODA 3NZGA 5F4WA 1BWLA 2V0TA 4DXVA 1E6QM 1UZ4A 5HNTA 1WOBA 4QCFA 4PC8A 3FSUA 3CASA 4PSRA 3K8LA 3SCQA 3TYUA 2ZA2A 4C7DA 1G5AA 2WMHA 2PLCA 3KOYA 3QXBA 3DG7A 4LFYA 3VABA 3NA8A 2VX7A 2FTYA 1O60A 2Z24A 1QFEA 2H6RA 2D24A 4ICCX 2FZDA 4YTSA 1PKLA 1P4CA 4O4WA 3K8MA 1FP9A 3O9NA 2F8QA 4W84A 1UP3A 2V6AA 1CLXA 1XYBA 4DM2A 4E4UA 3WG6A 4DXXA 1Q6GA 4L6DA 1W0MA 4QAWA 4O15A 1TJ1A 3DHPA 1E1EA 1TA3B 5FJRA 4CEXC 2J7DA 2WJDA 3EOLA 1QNQA 2W3ZA 3VUPA 5FJOA 1L0PA 3UCDA 2J78A 4E3VA 5A6BD 4US5D 1Z48A 1V3IA 4HNNA 4MTVA 4A05A 4EPEC 1ODUA 1BF2A 1U1JA 2D73A 5LYRA 3W75A 2PWFA 5G4WA 4DO7A 2CWNA 1OFPA 1MXSA 4ERIA 4LANA 1E6SM 1R2TA 3OG2A 4W8AA 5BMXA 2VNCA 1JGMA 1ALDA 2JBMA 4HU0A 1UWQA 2PDWA 5DN1A 4JIRA 8CGTA 4JFVA 3ARQA 3CTLA 5IDZA 3VZZA 2DT1A 3WQ5A 3W22A 1E1CB 3GH5A 3PBVA 5G1MA 1J79A 3VOCA 1B54A 4J2MA 2YIHA 3TLQA 2C0HA 1NWRA 2BVDA 4CUCA 1B30A 1QWKA 1XD0A 1V4YA 4FX6M 3WLTA 4CU8A 4XAYA 4D8AA 5A6MA 2G3FA 1XPGA 2ZX6A 1WV2A 1XH1A 1TYGA 1A5MC 1SR9A 1H62A 4Q32A 4PL1A 4W85A 5G2WA 4FNQA 2YYTA 3PWAA 4DI8A 3K8KA 4JFTA 4RW3A 3F5KA 1YNYA 1DWJM 2YXXA 4LV9A 3UZ5A 3C5QA 2QYGA 1QNPA 4YPJA 1E56A 4H7VA 4W5UA 5KTLA 3TQ0A 3KVLA 1AUSL 1ICSA 3SR7A 2VWSA 2W0UA 1HQTA 1NWSA 2ZUTA 5ECVA 3M6DA 3QV9A 3VPLA 1SVDA 2E40A 4JICA 4XTDA 3U2ZA 4YCPA 4XBKA 1JXJA 3O2LA 4GKTA 4DJFA 1G0CA 2V5JA 1XISA 4UTUA 3PZQA 3VMOA 2Y63A 3WIJA 4PMQA 2BOFX 2DSKA 3IANA 3E1F1 4OHQA 2ZUVA 2V82A 5HMDA 3UBPC 2PRHA 5HNUA 4FIQA 3RM8A 1VRXA 4S3CA 3M0KA 3U4AA 1QATA 3S2MA 2DQXA 3LCGA 3OBAA 1SW0A 4OUIA 3THUA 1U83A 1KR1A 1EGMA 2REQB 4B5UA 2VC7A 1XBVA 1R9ZA 4CCEA 1VPYA 1KGWA 2OQYA 1US0A 1UD4A 2G4JA 3O15A 2RDWA 2ZQ0A 2PGRA 1GKPA 4DYJA 2J7CA 3AYRA 4B3KA 1EGVA 1N8IA 1W9DM 3NTYA 4AHQA 3CHDA 3IJ6A 2JIWA 1WUFA 1RCOB 4TXEA 3V0TA 3SCUA 1H1NA 1KR0A 2D1ZA 3OLDA 1A4MA 2E3ZA 1RJPA 2F6KA 2PMQA 2X7VA 1NM9A 2FTWA 3WNOA 4O52A 1IR1A 4X63A 3WH8A 1K9DA 3W76A 4KCVA 3AUOA 3OU8A 2QPXA 1GJUA 4XAPA 1P1XA 3WQVA 3PBUA 4ICMA 1WZLA 1OYAA 3TW7A 4F9JA 2E9MA 2QF7A 4KCTA 4PFHA 5GJNA 1XI3A 2Z1XA 4IFKB 2WVVB 3LLDA 4JS3A 3RNDA 1W5MA 3BMVA 5DELA 4L4OA 4MWAC 5A6SA 2I9EA 3ZLGA 1B3VA 4EAYA 2QULA 3CUFA 5DQPA 1F07A 2XGBA 2AKZA 1FA2A 1EQPA 1PX8A 4Y6GA 4DN1A 3GAKA 4J40A 1LOSA 8TIMA 3SQMA 1F73A 1PCKA 3KBNA 5D9MA 2WLYA 3VIIA 4DAIA 2R8WA 3F1QA 3KBMA 3IVTA 2PDPA 2DZVA 3M0LA 1WAWA 3LUTA 3NQAA 3ECQA 1GK8A 3DCPA 1SZNA 3LHUA 5JBDA 1GVSA 4E8GA 1UPPA 1JF5A 4NG3A 3WCZA 3G1DA 3E74A 1KKOA 5HUOA 1KWKA 1W5QA 1QPQA 3HPXA 1ICQA 4NQ1A 3AIEA 4YTQA 3TSMA 4BWLA 3ONBA 2ZWZA 1ITCA 3L5AA 2DZSA 1BFNA 1D2KA 3FA3A 3KVKA 5HINA 3QH2A 3WJWA 1VYSX 1X1NA 1O5QA 5F4XA 2HXTA 3WH9A 4PODA 3PZUA 1GWJA 5A2BA 2AQVA 3DBPA 3VNKA 1QK2A 4LW7A 1QI4A 2CWXA 3TJLA 3MY9A 1R87A 1RPKA 4IOTA 2VR2A 5E6YA 4C6MA 4XBSA 4U2ZA 2BLEA 2VDIA 4BY3A 3RLHA 4HPNA 4O16A 3MVIA 4YN5A 5AHLA 1X7FA 2EPMX 6CGTA 3VE7A 4K36A 4M19A 1KWGA 4UZSA 1CYGA 3LCIA 1EYWA 3P6LA 2DIKA 4AIUA 1AA1B 1NAL1 1DWFM 1ZAHA 4FS9A 3CU2A 1NWTA 2HPMA 1E6PA 1UR2A 2H3DA 2NT1A 2PODA 1Z9AA 4Z2JA 2C0AA 4LRSA 4U31A 3MSGA 4WY0F 3LM3A 3N6HA 3Q37A 3GXPA 4Z2IA 3ZR5A 3VGDA 5FL0A 1P6BA 4GMEA 2PTXA 1LG2A 1VFSA 5BOFA 3WD4A 4WDUA 1K9EA 2EG8A 4H19A 5HWJA 3UD6A 3TWBA 4O13A 1TR9A 1MW0A 2PDXA 4WD0A 3GYCA 2CXGA 3PNUA 4BHYA 3WUEA 3TX9A 3E2SA 1TTQA 3P84A 1BXCA 1K02A 3ARUA 4W7WA 2XINA 2EPLX 1YNPA 4DLMA 1H60A 1T40A 3GW3A 1PHQA 3WL1A 1UW9A 5HNRA 5MF5A 4B2DD 3FDKA 4UFLA 4GQGA 2QV5A 4S3DA 1KFLA 1W1TA 4DBWA 3GNRA 4PTMA 2E77A 1PXGA 1WYIA 4HK7A 2FGZA 1E15A 4C1NB 2PUZA 5KITA 1WKEA 2E09A 2WVSA 1E43A 3GHRA 5DCDA 4LBSA 3OVPA 3FEQA 1R3VA 5DCBA 4TX9A 1K3UA 5LXXA 3GRIA 2J8GA 4MB3A 3DN5A 3S1VA 3LENA 3M0IA 3U7BA 3BLPX 1JCXA 1PTAA 1WKFA 2G3MA 1OWQA 3L5MA 2VQTA 2J6VA 5BOEA 2OYKA 2V63A 4MNKA 1US3A 5A2CA 4KWSA 4AD4A 5I09A 5G4HC 4WUIA 4PTVA 4AY7A 5GNYA 3H21A 3QLDA 1H63A 3MKCA 3H2CA 3RPMA 3BAIA 3WJYA 2AMXA 3CT2A 1L2QA 2J66A 1L6SA 3PHAA 5G1YA 4PCNA 1HUVA 2ZX8A 1DTNA 2BGNE 3A64A 1VIWA 1ME8A 1CENA 3WNLA 3N17A 4QQUA 3WD3A 4LVGA 4R9XA 3CZEA 3WLMA 4UTTC 4LUSB 2J75A 3DIPA 2B7PA 3GTFA 1O6IA 2BX7A 1EJWC 3CYJA 3LCFA 3EMCA 1RJRA 1E6NA 4P7QA 3C2EA 4WSKA 4GNJA 3I3EA 2VRKA 1R38A 1EDTA 1R3SA 3WLLA 1P0BA 4JYDA 2UV8G 4QRNA 1NDVA 3FNDA 1TO3A 5TNVA 5BYWA 3QTGA 1XIJA 3FAXA 1ZCOA 4H9YA 3N4AA 4I9JA 2A3CA 1GT8A 2C14A 4NRSA 2YA2A 4U33A 5CGQA 5HK4A 1BYBA 4MSSA 1UZ1A 4K2SA 4ZVJA 4PTWA 4NI8A 4OV9A 2TODA 4P2VA 1S3HA 3OVGA 1PE1A 4NJHA 3PB2A 1S38A 4NX5A 4EE9A 1TV8A 4GUIA 1I2QA 3RJXA 3V36A 3N3MA 3DHUA 1TZZA 4NL1A 4UCFA 3RAOA 4EF9A 3L0KA 3FA5A 1EB3A 3WJXA 1TTJA 3VGHA 3BAKA 4OE7A 2QCDA 3R58A 4JTIA 1A5NC 3PPHA 1IXOA 1XIIA 1G4EA 1F5ZA 1KFBA 2OT0A 4PB4A 4AIOA 2FHBA 2OELA 2YJQA 4A21A 1UQZA 4JPGA 3I6EA 4N4QA 3MPGA 4LUYA 1OQFA 4XKMA 4LC6A 3AXIA 1XBXA 1J01A 2OKTA 3NZPA 3S1GA 3JZUA 1TSIA 1QCWA 4O11A 2Z1SA 3WMCA 1CW2A 2VT0A 3RR1A 5C7VA 2YYUA 1XSJA 3H12A 1S5MA 3KTSA 1VFHA 3AIRA 3UG4A 1QOPA 1WNOA 3TQKA 1UWSA 2C6QA 3W2MA 1YBQB 3W37A 1GVQA 3PF3A 5HAOA 1EDGA 1NP0A 1MSSA 4Q4SA 3CYVA 1EC9A 2VEFA 1M1BA 3EZ4A 4RE0A 2F2HA 1PEZA 5BOOA 3Q58A 4IPLA 4W8BA 3PUOA 1IZKA 5BW6A 3ZJ8A 3BQ6A 3NDYA 3S2NA 4AF0B 4IISA 5D09A 1SJDA 3M0MA 2SFPA 4IL0A 2YFOA 4O1FA 2FJKA 4M5PA 1CXKA 3EX4A 4HB7A 4UR9A 4QX4A 2WHJA 4QITA 4JIPA 3B0XA 2D2JA 2VJXA 3CMJA 1EL3A 3GNNA 1EC7A 1A5KC 3LXBA 3NL5A 2ACQA 3WEZA 1C3FA 2ZCGA 1YTEA 4FOKA 4G1NA 4N4PA 4QDWA 3PBMA 3B8UA 3UT0A 3MU7A 1PIFA 4YYFA 3OJGA 3TNOA 4HU4A 3W7JA 4ZMGA 4JIQA 4KWVA 3TJXA 4LEQA 2PDLA 1RLDA 2CNCA 3ARVA 2X2YA 3HBLA 4QS5A 3WY1A 3QFEA 1QPOA 5E0KA 1V3LA 3VZXA 1SZFA 1RA0A 1M53A 2BP1A 3C52A 3CUJA 4NHVA 3GU1A 5EBAA 3LCLA 1LJYA 4JQ3A 4O14A 1EIXA 4HMEA 3W29A 4WDXA 2OPJA 4WOZA 1D7KA 2WJZA 3EEGA 2A79A 1E0XA 1JNDA 4GO8A 3U8GA 4MJZA 1A53A 3UGVA 4H9MA 3W71A 1ITUA 3F4VA 4K8GA 3ZVHA 1GNXA 4XD3A 3WDRA 4AZCA 3RLUA 1R2RA 4Q4OA 2Z25A 3NXFA 4YMZA 5CC6A 3UF9A 1FDZA 1DJXA 1HJVA 2YDQA 1PIIA 4OWGA 4WGXA 2A3AA 2YCJA 3P81A 4MIMA 3F4CA 3MUZ1 1HKKA 1M9HA 2Z7KA 1I4NA 3GG1A 3W28A 4AEFA 5D2TA 4KERA 2WSYA 1JR1A 3C2RA 4IGHA 3TXVA 4Y9PA 5G2HA 3LN3A 3LOTA 2UY5A 4WCJA 1XSIA 2XVPA 3VILA 2CPUA 3S9IA 3IJ7A 5FSEC 1CXHA 4G56A 3VIGA 2ADAA 4F2TA 2D2GA 4H9VA 3CZ8A 3IGXA 4ZQOA 3EOOA 1OJXA 2OOGA 2GQ9A 2ZX5A 4GNVA 3VCCA 5D38A 2VC9A 2PRLA 2R24A 3IS4A 2R9RA 4B90A 3D0CA 3PY2A 2VENA 1WAUA 1XIHA 2VMFA 4IMFA 3VOHA 4IPIA 1FCVA 3GXNA 5REQB 1GYMA 1LROA 5M3WA 1ISYA 1ZJAA 3U2CA 2WSKA 3W07A 1HL9A 3VFCA 3ZS4A 5EMKA 2PC4A 4QFUA 4JTCA 1KRBC 2E9BA 3WYZA 3CXOA 1Q6FA 2W63A 2NVDA 3URAA 3I3DA 3LHVA 5FL1A 4KEUA 4LF2A 4ROQA 2OLAA 2PDGA 3VIMA 2RGMA 4IG2B 4AX6A 1TPB1 3OZOA 4CNPA 4D1JA 3NDZA 1LBMA 3N18A 2HBXA 3KXQA 3RMEA 3PBWA 3SM0A 3DENA 3GH4A 5HDRA 1ONXA 1MYRA 3LB0A 1MXDA 4LSBA 1XFBA 1XINA 3UPBA 5CCZA 1X1OA 2GSEA 3V4BA 2X42A 4JGDA 4HNVA 3NQ8A 4BI7A 1JD7A 4GJJA 2VGFA 1VFLA 1QWGA 4AEEA 1C7TA 2G97A 2DUAA 3Q4DA 1P43A 1SU5A 1W1A1 4GIEA 3K4DA 2VFGA 2V30A 4AYSA 3W2JA 1WUEA 3C56A 3VE9A 1XCXA 2PPGA 2R91A 4RNHA 1YRRA 3W86A 2VZOA 3FXYA 3HOJA 2A0NA 1QMLA 3QN3A 5CSYA 1KRMA 2BVWA 3BAXA 3TYEA 1EJVC 3TC3A 3MZNA 2FGLA 2V3EA 4AIBA 1DPMA 3PSWA 2B81A 4NRRA 1XLKA 3BURA 3W7EA 1UB3A 3GFZA 3VNDA 2YZRA 3JW7A 3UR5A 2GJXB 1V6UA 2CLHA 4MB5A 2UWFA 3IK2A 1XPYA 1DP0A 3M46A 5XIAA 1FP8A 2QUTA 3EEZA 4PMRA 5IRPA 1OG6A 3MBFA 3EWDA 1OD0A 3OZYA 3V5CA 3P0WA 4QSFA 4F48A 3DXIA 1IXNA 3W23A 2F38A 3ABRA 5I02A 2AQWA 1RD6A 4GA8A 2DT0A 1NDZA 3R0DA 2ABBA 5AZ1A 1H7WA 4GPNA 3T2QA 2WSRA 3BOFA 1K4GA 4WXYA 2YL5A 4M3PA 4NZ4A 3LRKA 4JYFA 1L6FA 3PK7A 2WZHA 3TLLA 2RFGA 1LT7A 3ISIX 4DJDC 3LI1A 3WDPP 1XLBA 2CXEA 1XQKA 2WAGA 1ZJHA 1J0KA 3LGGA 5KZMA 1QR7A 2JIEA 2OZ8A 5LNUA 3P0XA 4KF1A 1XBYA 2C1HA 2Q71A 1ESWA 3IV3A 2VYOA 1XYZA 4C65A 3CV6A 4HMNA 3VZYA 2GOKA 1PZ1A 1V6WA 4XZBA 1EFZA 1XIDA 4WDWA 4KEVA 1EXBA 4GCXA 2XG9A 3LTSA 2J13A 4HPXA 1QAPA 1XYMA 2JQXA 2YB1A 3VXGA 3BW4A 4PCFA 4JD4A 1XIFA 4Q8VA 1VYRA 2Y7EA 2GWNA 1YLVA 4R3UA 3HPSA 4CQ8A 2FB3A 4M82A 2FZ9A 3B97A 4UXDA 4RV8A 3B0UX 2CU0A 3LCXA 3MKVA 2OGJA 1LLWA 4OBRA 1NF0A 4E2OA 2OOFA 2WMGA 3WENA 1W91A 3P62A 1Q6RA 4W7VA 3UZWA 3FEMA 5DXXA 4UWMA 3TK7A 3HGOA 3S47A 3MC5A 4ZFMA 4AXNA 4XAFA 4LS0A 5DT7A 5CPMA 5CEWA 5I3KA 1DJZA 2VUNA 4JTKA 4A3QA 1REQA 3BG9A 3NM3A 2KX9A 3WD2A 4R27A 4ZODA 3B06A 4JTGA 4X2RA 1AQ0A 1EJ7L 1H1ZA 4N2YA 1IXPA 1B4KA 2IMRA 3DFYA 4NT0A 4GBDA 4Y9AA 1B90A 1SQ7A 1A5UA 1L6GA 4UUIA 1LL6A 1C8VA 2V5CA 2ZADA 3QGAC 5HOSA 1Q6EA 1XLLA 2O9OA 1P5BA 3LY0A 4JBRA 3V5OA 3VNMA 3K2GA 4UTWA 2PU0A 3M6YA 4GC3A 5ABFA 2E6AA 2TRSA 2O7QA 3DC0A 3QGVA 1FWEC 3VM5A 1DJYA 1DHKA 2HVMA 2V81A 4N6FA 4H6QA 4JEQA 4GYJA 4F40A 1FWBC 2CLKA 3EPNA 1H1YA 3ZZ1A 4KQNA 1IIHA 2PD5A 2XFYA 4LGXA 2AAMA 1E9IA 3GSMA 5CG7A 5J8LA 2NQZA 3LQGA 2VGBA 3CAQA 3LNMA 4WF7A 4LU0A 2AGKA 4NAFA 3BLOA 1IWPA 1E0VA 1EO5A 1XRFA 3L0NA 2ON3A 4C5ZA 1K9TA 2CZVA 2RDTA 5C9ZA 1U1UA 3TC7A 5D03A 3EA2A 4DYKA 5HMSA 2FDSA 4QJ1A 3L9CA 5FJJA 4E38A 1ECEA 1LM1A 2O4QA 2CHNA 4LALA 3BQ5A 1V3KA 4AIEA 3CB8A 3EWUA 1UH4A 3L68A 1TIWA 1KM0A 1JCJA 4UTTA 2X0SA 2OSXA 4HTYA 1M7JA 4MLJA 2PGWA 1RUSA 3QSTA 3JVAA 3NL2A 5FF3A 4DYEA 2VZVA 1BYCA 3H7RA 3AI0A 1AH3A 2I1OA 1PHWA 2ZC1A 3PTDA 3BE7A 4OT7A 3OA5A 3ZYZA 4IJBA 3KVJA 4YL2A 1K7FA 3V5FA 2VVSA 4A8LA 4C6BA 3VD9A 3PC0A 4GLEA 3GNOA 3CS2A 5EFDA 3B4YA 1PDZA 3DZ1A 3UZZA 1CPUA 4N9EA 3E2QA 2TMDA 3SY1A 1VHNA 3MMTA 4QCEA 3HJZA 4I9TA 4HPJA 3W7PA 5F2IA 3N73A 5C6MA 1FWJC 2J88A 2L5HA 3BV7A 4I8YA 3R79A 8XIMA 3B8IA 1TV2A 1QBAA 1AQHA 5A8NA 3R13A 4LUTA 4LPCA 3E0FA 1E51A 1PX4A 4H01A 4ADUA 4M81A 3SECA 3VMPA 3S3GA 1N8FA 1V0NA 2JKAA 1C8YA 3VNIA 5A8QA 2R94A 2BGSA 4AD5A 3RILA 4AD2A 1ZJBA 2Y7DA 2WYSA 3S83A 3KDNA 4UCGA 5C54A 1R46A 4G7EB 4UFHA 4N7QA 3RPDA 4O50A 3VIKA 1RJQA 2CLIA 4YXGA 5LNRA 3RRAA 2XHYA 1LF1A 2QVNA 5D8WA 3FW6A 4XO6A 3VIJA 1EP1A 5DFAA 1KRCC 3POCA 3QR3A 3WBAA 4DELA 3NSXA 4E8DA 5D2XA 1VJIA 2QF8A 3BSMA 3EXTA 3HB9A 3G3DA 4CN6A 1R3YA 3PBGA 1PDYA 2IKIA 5JBFA 1JJKA 4EF8A 3IWPA 2NZLA 1UKPA 3FVMA 3HFTA 1JUKA 3LPGA 4DO5A 3DBNA 4O1EA 4D6GA 4FA3A 3OG3A 4GY7A 1I0DA 2QVHA 2ICSA 1MW1A 1CGYA 5I3IA 2FZNA 4UFIA 4A22A 4DF2A 1UWUA 1R3TA 2ZVIA 1TPVA 2C1IA 3PFMA 1XWYA 1OFEA 4QG9A 5CBJA 4GQQA 1AH4A 3WN6A 3VD3A 3WBXA 3DFSA 5HPCA 4DWSB 4LBRA 5LA1A 2C18A 5K9CA 3B40A 2NV2A 1FKXA 1K7XA 1W9PA 2X1RA 3GXIA 4MAZA 2ASHA 1KBIA 3LTPA 2BOEX 4PR4A 5EBUA 4WKFA 1SO6A 2BV9A 3BICA 3AICA 1QRQA 3LZ5A 3H22A 1S39A 4ZB2A 3O0KA 3C3UA 3DDMA 4NAEB 2DT3A 4J5NA 4GVIA 1W56A 3I68A 3IJIA 4GYKA 3L4YA 4M1BA 5DBTA 1TPWA 1RK6A 4EP8C 4IMDA 3TZFA 1V6TA 4ZOAA 2EGZA 5K9DA 1DIDA 4XD5A 3BUVA 1MUWA 3HGSA 1GKRA 3MJYA 2ZXDA 1PZ2A 2WZIA 1YE6A 1XG3A 4NJJA 5FEXA 3AMLA 1XLDA 2J7GA 2PLMA 5D32A 3LLXA 5LSMA 1RQHA 3GZAA 2AL2B 5DX7A 3QQ1A 3Q65A 1OGGA 1JYNA 3N11A 1I45A 4XQ6A 5I3HA 5RUBA 4O10A 1DHPA 3F4DA 4MDPA 3DERA 2CBIA 3H53A 1EF3A 3NDOA 4HA3A 3GVQA 4B5WA 3A13A 3IVSA 4CCZA 3LPPA 3SFWA 4MADA 2YCLB 4JKKA 2OT1A 2P10A 4JTLA 3SEPA 4HPHA 3RU8X 3H2NA 4CQBA 1EHNA 1QNRA 1I75A 2XIBA 5AYBA 3CUGA 3P7YA 2TSYA 5CAKA 1JZ6A 4GBUA 1WXJA 3UG8A 4MJ2A 3PUGA 4PMUA 5HJLA 3LQLA 1GVYA 3N19B 6ENLA 4FXSA 1O7AA 2VEIA 4S3JA 3HJEA 4NXKA 2Y8KA 1J10A 1TFVA 5TBOA 1H7NA 1THFD 1JYXA 3Q94A 3ARSA 3LHYA 1YMYA 1F3TA 2GJPA 4CQAA 2PCEA 3IUHA 4K1GA 4DZ5A 3TIMA 4MZ8A 4YS1A 4O54A 2QJJA 1JZ4A 4W5ZA 4UZUA 4BF7A 3OW1A 4PCTA 4KH2A 3DG3A 3MBDA 5D4YA 1UUMA 2HV5A 4MG4A 1BRLB 1ME7A 2PFHA 1CGXA 1X97A 3AAMA 4B5XA 1AQMA 2GJNA 1DXFA 3INPA 1PYFA 3FGCA 3H4WA 4YWIA 4GXMA 1CZ1A 3IACA 5D02A 4GACA 1DJNA 1C93A 1JVNA 2G3IA 1R85A 1QPNA 3M4HA 1JQXA 4N42A 5HR6A 3F4WA 2XWEA 1JULA 4HNUA 3OB8A 1R9XA 4L5ZA 1KO0A 4F0SA 5HJXA 4JR5A 2R14A 2QCGA 3VUSA 4Q6XA 1KTBA 3DFNA 3W6YA 2CZ5A 3UESA 2R1KA 2VR5A 1ZBVA 3ANVA 1JCYA 4QNWA 1GW9A 2I5GA 1TZ7A 3FJLA 1LT8A 1QTWA 1X6NA 3SUVA 4ZQPA 1MQPA 5EFFA 2D0FA 4RX0A 3KFTA 3WNNA 4H1ZA 3DKJA 2W67A 1ZTVA 4KBXA 3CC1A 3T05A 2QJNA 4TOQA 2WKGA 4MLRA 3RX4A 3WQ6A 2GDUA 3D3FA 4L4PA 1JI1A 1KFJA 2QDHA 5AECA 5C5YA 2XIMA 4TMCA 1CIUA 3PAJA 4JTJA 3M64A 1GQKA 1LYXA 3TTEA 5FOOA 2VRJA 3UJRA 4S3AA 3ZT6A 3MMWA 5HATA 1TCMA 3PB0A 5ABTA 5CGTA 3KP0A 2G0WA 4FF5A 2A5HA 4POCA 3W7DA 2VEMA 1PZ0A 3H7UA 4I7UA 4AD0A 9CGTA 1O68A 5K2ZA 4WJ8A 5I2UA 3KS6A 1TV5A 2VC6A 4HCHA 4DNMA 1N82A 4QISA 2O9RA 3A22A 1P1MA 3CQJA 3UA3A 1WXZA 1UWRA 5FF2A 3TOYA 3JZEA 4AVFA 1XLIA 3KCJA 5FAJA 3AHVA 1P0DA 5DF0A 4X0VA 3F7JA 1JF6A 1FCQA 4JHOA 5F1UA 1M6JA 1J5SA 2WM0A 5D04C 4CD6A 3ZQ9A 5BRPA 1CT5A 3T40A 2PURA 4JTEA 1AG1O 1RVGA 2QMKA 4KT2A 2EQDA 1X96A 3S6TA 3O6DA 4DJDA 2NQ5A 3TV8A 5D33A 2FMOA 3GG0A 5AYXA 1K8CA 3A24A 4FLRA 3EA1A 3Q67A 1KV8A 1HN1A 1XKJA 2QUUA 3TTYA 3WDJA 4M8UA 1UUQA 2C13A 3P82A 1XF0A 1UZHA 1YEYA 1W31A 2YCEA 3QSRA 5ABHA 1MEWA 5C71A 5DRIA 4CGTA 4PN2A 3W7CA 3EDDA 4GQRA 5F1VA 1FDJA 3W38A 3PP7A 3MCOA 1XKYA 1ISVA 1JAKA 1UIOA 2XFWA 4D6FA 4DZIA 4OOUA 1TTIA 2XSXA 1SMAA 2E68A 4A3HA 2PDMA 4GC4A 1MW3A 4O18A 4UFKA 3IJLA 3VDGA 1XH2A 4QEHA 3KVMA 1GYNA 3CUZA 4MKSA 3DHFA 2PP3A 1WP6A 5BROA 3BLKA 4S3EA 2ZICA 3ATYA 2VX4A 4NYUA 3GDLA 3RJYA 2CBUA 1QW7A 4B3ZA 1S46A 3NQEA 3UG3A 3MCMA 4N9BA 3GB6A 4MY8A 4B5SA 3DAQA 5HMEA 2ACSA 1ITXA 3F4NA 3WELA 5BU9A 4H8NA 5HA7A 3UXLA 1HW6A 2AAAA 3W4RA 1J6OA 1KM5A 3FX4A 4A8IA 4I7VA 2C7FA 3NEVA 3OQEA 2DSUA 3GO2A 2ZDRA 1K8XA 4C6DA 3QPEA 5H2ZA 1W1ZA 2VWTA 2A7PA 1ADSA 1O66A 1KV5A 2X30A 1MZHA 3NYDA 1JQVA 3N34A 4L6HA 3VTRA 1ELSA 1UKQA 4WRHA 1T6MA 1L8PA 2B31A 1PYMA 3MKKA 1ZALA 2QMJA 3SI9A 5LNVA 5FEZA 3ITGA 5JQ9A 5CSUA 3OQ8A 3UVAA 3E6EA 4DF1A 2GQAA 1TCDA 3KBWA 3M0YA 3L65A 1IIGA 1I9CB 4WSHA 1FCUA 1UWAA 1PV8A 3MUY1 4UNKA 1EXPA 3UR7A 1M03A 1J0JA 1ZJIA 4Q4PA 1OZQA 3CQKA 3OPSA 1V3HA 4O28A 4LTSA 3WZ0E 5CKSA 3SB0A 4AQLA 3AIQA 3PVFA 4WJEA 3HV8A 4KESA 1Z8AA 2X2GA 1Q7MA 3UEQA 3OGVA 1EBGA 2DZWA 3NQCA 2A3BA 4KFPA 4M6PA 1UR1A 3W88A 1FH8A 2RKXA 1CX9A 4JNYA 5DMLA 1TJPA 2QW5A 2Z2UA 4S39A 1EIBA 1YKWA 1X6UA 4DF0A 3HF3A 3E12A 4BQ2A 5E70A 4LAZA 1TV7A 4XV0A 6TAAA 1KFWA 1VBRA 2ZRUA 3W3OA 3OGSA 2NUYA 1JNEA 1NDYA 1PSCA 1DXIA 4KIEA 5DRCA 5JBEA 2BXYA 2PEVA 3EWXA 1W9VA 3EA3A 1IEXA 3GHTA 3AJXA 3IV8A 3RM4A 1TPEA 3S9ZA 4IXHA 2YXGA 3COTA 4ORMA 3WLHA 1H5YA 3U5YA 3FHAA 2CKSA 1H7OA 3SCSA 2HBVA 6PTDA 2OEMA 1OT2A 1U22A 4E3TA 3AIWA 5CG0A 1NQKA 1IWBA 4FF7A 4JDYA 3G77A 2XVNA 4OVXA 3FOKA 1A5OC 3AJ7A 1TE1A 4RDYA 2VEGA 4GZIA 5U4NA 1H7PA 4QLKA 1BPLB 2FHFA 4L7ZA 5G1TA 2DPEA 1I1WA 1XGDA 3SCVA 4OKDA 1A5SA 2QPUA 2GUYA 5I3GA 1FWAC 3BMWA 1Q7QA 4A4AA 3GDMA 4GI8A 4PULA 3T0TA 2NX1A 1MVYA 3GBEA 3EDJA 3PZTA 4J4KA 1SZEA 1KCXA 4NXSA 1QI2A 4ZXLA 2FZ8A 4GGHA 1YTKA 1Y5WA 4EPDC 2OMAA 1ONWA 3MYOA 3VKCA 2ZX7A 3LHZA 1VYPX 3WK1A 4XUGA 2E67A 3PR2A 1J4EA 3WMLA 2VKZG 1ZFJA 3IARA 4PUUA 2B7QA 2QCFA 3FVDA 3BZGA 4ZOCA 3U4FA 4A6GA 3EOEA 2OLSA 1XUUA 3EKGA 3HIJA 4F66A 4NJKA 1EEXA 4HA0A 3C8FA 3CV7A 3T07A 3MHUA 1K70A 1GOWA 4WDTA 3E9AA 3AXHA 4N9CA 1NSJA 2J7EA 1GTEA 2WM1A 3KX6A 5BZAA 3P60A 1T41A 1I60A 3UXKA 4GKLA 4PZVA 4WY0A 3TU9A 2Y6ZA 4O19A 2XVLA 3NVTA 4AU0A 4DWSA 4JAWA 4MFEA 4EK7A 4G7FA 4DBUA 1EJXC 4Y9NA 3ZJ6A 1VFTA 3ARZA 4L4MA 4XSLA 3DG6A 5CLWA 2TPSA 3QV8A 1PIGA 1UCWA 2ABAA 3W1AA 2DH2A 2GUUA 4C6LA 1SSGA 3MI3A 4U3CA 1VR6A 3II1A 1TJ0A 2PGEA 4I8DA 2GYIA 4HNTA 4OBTA 3M5XA 2Y8VA 2Q02A 2BG5A 1Q8JA 1XLJA 3W74A 4QIUA 3QR1A 1IGWA 2HJPA 1UJPA 2DDXA 4K37A 5DEZA 3VAVA 2A7NA 4CCCA 3CV1A 3FFSA 4IPPA 1FWSA 3GD6A 4MJ4A 3WL0A 4ZB5A 5E0CA 3W2LA 2OWWA 3AIVA 2AL2A 4DJEC 3W85A 3WF4A 2EF9A 1XICA 2QXWA 1UP0A 2FHCA 1LL7A 3I6RA 3ZXWA 4HVXA 3V18A 3VOJA 3TFXA 1TMQA 4GE8A 2YL9A 5CSRA 1LUCA 1BQCA 1R5YA 2D2HA 4LAMA 1OK4A 3AMGA 3CL6A 3E3HA 5ABEA 1ODZA 3AFBA 4KEZA 3GKAA 4GH1A 3REQA 4AY8A 3M16A 4QLLA 4JKLA 4O8RA 3MMUA 4HJFA 3HPFA 4X22A 3N4EA 3THDA 3PN8A 3ALGA 2PRMA 2W6RA 3WF3A 3LV6A 3V1HA 2CZEA 4O12A 3PTKA 1XBZA 3KS5A 1XIMA 1QASA 4XBJA 2VR4A 3CLWA 2GVGA 1AJ0A 1NWUA 5A6AA 3BDKA 1O1ZA 1OC7A 2CLFA 2YDSA 1UA3A 2Z6JA 5JIWA 3JRKA 4JFWA 4JX6A 2PZ0A 4DBSA 1OCJA 1A50A 1Y8BA 3SGUA 3DOPA 3GHSA 2XH4A 5KZ6A 3RX2A 5A6JA 3PJWA 2H3BA 3BCDA 4Y8EA 3I4EA 4PSPA 3ZWSA 1KM4A 1KKRA 1TR1A 9RUBA 2ZTJA 4FX7A 1T0OA 3DGBA 3N2MA 3TQPA 4KGLA 2ISSA 4Q4RA 1N8WA 1W2PA 4FP1A 3KOFA 1XCWA 4Q8PA 3WEMA 3FYYA 4JTDA 2RAGA 3BAJA 3GTXA 3PANA 1GQIA 1CLKA 1LZOA 3G1AA 4PMOA 4RPQA 4HZMA 1XP3A 3RM9A 3GM8A 3TNBA 1OYBA 3BG3A 3IJDA 2QCLA 4CU6A 1VCVA 4Y96A 4GI9A 2XWDA 2QPSA 3FJ6A 4A3YA 3H2OA 5H6HA 4WZHA 1YXDA 3UZXA 1JPDX 3UWQA 4AWTA 1B0IA 4W9TA 2HCVA 1HKMA 1MEIA 4IGNA 1X8CA 2JALA 3QLLA 1SFJA 1WDDA 1F76A 1F7BA 1SGJA 1ZP3A 5TAOA 5FJIA 1W2VA 4LNYA 2VZTA 3ATZA 3QKZA 3NUKA 2DZTA 4TTUA 2BHUA 2E25A 2G8ZA 1ZY9A 1E5NA 3WQWA 2QAFA 3TJ4A 3A5FA 2OB3A 4XZMX 5GNXA 3HG4A 4O1BA 3I7RA 1HT6A 4PEKA 2PBGA 3T0BA 1M7OA 4FXJA 1L2UA 3VU2A 2HMCA 3M43A 3L21A 4RE2A 2VUYA 4ZA0A 3M1ZA 3NURA 3TE9A 3NM1A 2WQDA 3TYZA 1FTXA 4XUYA 5CJ5A 2O0TA 3CPGA 3VMNA 5HULA 3T81A 4LUJA 4UBPC 3K4AA 1R8LA 1LWIA 2PF8A 1YYAA 5M2FX 4G8TA 1TPC1 2YXOA 2WW5A 3BV4A 5FESA 1Z42A 4M6QA 4BK9A 1TPH1 4QM1A 1Z41A 2Y85A 4C1KA 3MP5A 1FWHC 3PUDA 3EWYA 1MO0A 1VCFA 2G41A 3DECA 2FZMA 1KM2A 4PE8A 1KRAC 1FFQA 3BLEA 1GZJA 4PRWA 3S1WA 5CPNA 4LUIA 2E5BA 7PTDA 1AMKA 3WLNA 3XISA 3MHGA 3NL6A 4M6UA 4IIEA 4LXFA 5CZ0A 4H83A 3PZVA 3VDHA 1GQJA 3UYCA 3PZ9A 5LIWX 4IGMA 3LA4A 4IP7A 2QJGA 2G4FA 1ZZMA 3GIQA 4QBXA 5BXTA 2Y8UA 2IKGA 4HBKA 2FIQA 2XIOA 2F6XA 3VOIA 4JDBA 3SGGA 3MB9A 1UR8A 2E8YA 5M17A 5CPLA 1R47A 4J3WA 1K1DA 1GHRA