1ZSXA

Crystal structure of human potassium channel kv beta-subunit (kcnab2)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Voltage-gated potassium channel beta-2 subunit
publication title Crystal Structure Of Human Potassium Channel Kv Beta-subunit (KCNAB2)
rcsb
source organism Homo sapiens
total genus 120
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zsxA00
1S1PA 3N6QA 1T41A 2HDJA 1FRBA 2INZA 2PDIA 1PWMA 3RX2A 1PYFA 4XK2A 3EAUA 3CV6A 4QXIA 3V0SA 2IKIA 5M2FX 2WZTA 4LB4A 3QKZA 4FALA 3GHUA 4PRRA 4EXBA 4GIEA 3ONBA 1IHIA 1T40A 2IPFA 1VP5A 2FZDA 3BUVA 3O3RA 2ACRA 4HBKA 1AZ1A 3WBWA 1YNQA 4XZNX 4F40A 4JQ2A 1J96A 2PDYA 3UG8A 4PUWA 1IEIA 1XJBA 3MB9A 3F7JA 4XZMX 4NKCA 2BP1A 3R8GA 4LB3A 1RY0A 4I5XA 1SM9A 3GHTA 3UZXA 2VDGA 2ACQA 1ZQ5A 4L1WA 3D3FA 2ACSA 1HW6A 3V35A 2PDXA 1MRQA 1Z8AA 3M4HA 2FZ9A 5LIUX 5KETA 4PR4A 1S1RA 2IPJA 2FZ8A 2HV5A 4DBSA 3UZWA 4WDXA 2ACUA 4XO7A 2PD9A 3LQLA 3LUTA 2PDQA 1QWKA 3UGRA 3R94A 1C9WA 2F2KA 4WGHA 5HNTA 2HVOA 3C3UA 1PWLA 4RPQA 3CAVA 2J8TA 3LEPA 5LIKX 3DOPA 1X96A 3UYIA 4LAUA 3EB4A 4IJRA 3LN3A 3LZ5A 4YU1A 4H8NA 3LNMA 1Z3NA 3Q67A 5LIXX 3RX3A 3EB3A 2PDHA 3VXGA 1MZRA 2IQDA 4PMJA 4IJCA 2FGBA 3WG6A 3BURA 2HE8A 1AZ2A 1X97A 3UZZA 3UP8A 3H7UA 1Q13A 1GVEA 2F38A 1EF3A 2QXWA 5LIYX 4FAMA 4WDWA 4FZIA 3LD5A 3LZ3A 4Q3MA 5AZ1A 2R9RA 4IGSA 4XAPA 4YS1A 1AFSA 3NTYA 1S2CA 2DV0A 3UFYA 2PDLA 3KRBA 2PDNA 2IPGA 2IQ0A 3V36A 1M9HA 1ZUAX 2IKGA 3T42A 2HEJA 1AH4A 4LBSA 2PDFA 4JIHA 3G5EA 1K8CA 1Q5MA 5HA7A 4GCAA 2PZNA 5C7HA 5AZ0A 1PZ0A 3U2CA 4XVEA 1JEZA 4JTCA 3S3GA 2WZMA 4LAZA 3FX4A 4DBUA 3G1RA 2I16A 5JH2A 3B3DA 3BCJA 3GHSA 4WDUA 4JIRA 4XVDA 1AH0A 1ZSXA 1ADSA 4XZLX 2PF8A 2HE5A 2FZBA 3CAQA 2IKHA 4G5DA 2R24A 4JIIX 3R6IA 1VBJA 2PDWA 4JTAA 2IKJA 3R58A 1MI3A 4JTRA 3N2TA 3H4GA 2BGSA 2HVNA 4EXAA 1US0A 3Q65A 4DZ5A 3M0IA 4YVXA 4JQAA 4WRHA 4XZHA 3LQGA 3R43A 4JQ3A 1OG6A 3M64A 2PDPA 3GHRA 1UR3M 4HMNA 4GA8A 4YVVA 4XZIA 4WDTA 2I17A 2ISFA 1LQAA 4GACA 1A80A 4LBRA 5LIWX 1HQTA 2DUZA 2PDUA 3RX4A 4GABA 4PUUA 3R8HA 2NVCA 4YVPA 3FJNA 3V0TA 2CLPA 4Q7BA 4WEVX 1ZGDA 1QRQA 1Z89A 4QX4A 3H7RA 1XGDA 2PEVA 1EL3A 2PD5A 4ASTA 4XO6A 2ALRA 3WBYA 4FA3A 1YNPA 4L1XA 2DUXA 5DANA 3WBXA 3UWEA 3UZYA 3WCZA 3COTA 1XF0A 4GQ0A 4ICCX 3LBOA 3V0UA 1AH3A 4MHBA 4JTDA 2PDMA 5JH1A 1X98A 2P5NA 4JTQA 1YE6A 2FVLA 2C91A 1R38A 4H7CA 2INEA 3BV7A 2PDGA 2IS7A 3CMFA 2PFHA 2PDKA 3O0KA 4QR6A 2PDBA 2NVDA 1RY8A 3ERPA 2PDJA 3P2VA 2IPWA 3MC5A 4OTKA 3CASA 2BGQA 5HNUA 2PDCA 1EXBA 4QBXA 3LENA 1LWIA 4ZFCA 1YE4A 4JQ1A 1Z9AA 4R9OA 4GQGA 4PRTA 4AUBA 2A79A 3CV7A 3ONCA 4DBWA 3DN5A 1EKOA 1S2AA 1RALA 3GUGA 1PZ1A 2AGTA 3R7MA 4JQ4A
chains in the Genus database with same CATH superfamily
1EBHA 2HDJA 4P7NA 4BQ2A 1H1NA 3TW9A 1WX0A 1Q45A 5D2WA 4BF5A 1YBQB 3UESA 2GZXA 3BSHA 4PUDA 1UIOA 4M6UA 8RUCA 5TAOA 1TJ0A 1Y5WA 2GWNA 5G4EA 1AZ1A 2ZXBA 4N4QA 5I3HA 3B9DA 3GFYA 2GGEA 1BYDA 4LX4A 4PUEA 1GYLA 1E72M 1YRRA 2QJGA 1O12A 2XVKA 2VVSA 4QQUA 1VBHA 3E12A 3VD7A 1WNOA 1EFZA 2DW7A 3DI0A 5BYWA 3NDZA 1XYFA 3IJLA 3AS2A 3IPWA 3HFTA 3TC3A 4MPQA 1NSJA 1EDGA 2V3FA 5HK4A 2OYMA 4ONVA 4I90A 2NXGA 1EO7A 3I6RA 2EG8A 2HMCA 2P3EA 3RMJA 4FMVA 4LYKA 2XU2A 4IISA 3CQIA 3B8SA 3U7BA 4CNUA 2OWXA 5FAJA 2IPJA 3T07A 3B0PA 1REQA 3TQKA 4I7VA 4JXCA 3AU2A 2DZPA 3EDEA 2W3ZA 3ABXA 5IM51 3GNPA 1T8QA 4LUYA 1O6IA 2E9MA 2IXVA 3N2BA 3SUWA 1US3A 3SQLA 4MWAD 3H23A 2FB3A 3SCSA 1XKJA 3GNDA 2R91A 1XISA 7ODCA 2Q3RA 4UR9A 1NELA 4LH8A 2TYSA 3K4DA 3I10A 1XXXA 1S2WA 3GW0A 5LHFA 1J6PA 1E9ZB 4MF4A 4H9VA 4H4IA 3ABRA 3T8QA 4FF5A 3EX3A 5JBFA 1MQRA 3CTLA 5T26A 1O5KA 5FD0A 5EU9A 3ARTA 1OSEA 4PFMA 1UA3A 4E2VA 1CGUA 3BWWA 4OE7A 4YN5A 3LRLA 4AHQA 1PEZA 3UYCA 4P2VA 1KTCA 1S2VA 4XZBA 1VEOA 3WFZA 2VOTA 3TX9A 1MDRA 3GTIA 4GI6A 3NYDA 3UP8A 1W37A 1Q13A 1XFBA 1E6XM 1KM6A 4KCVA 2IQTA 4MB3A 1UBSA 2ZE0A 3UWUA 3NURA 2QJIA 2G4FA 5LNRA 4JFWA 4QLLA 4TMBA 3MV11 2OZ0A 4ZOEA 3UG5A 1QPQA 3PPGA 1HVQA 4CEXC 1FWHC 2C13A 1PKYA 3BL3A 5A8QA 4JFSA 1E4MM 2R1KA 2RDTA 3NG3A 3GVRA 5CJMA 1O1ZA 3WQWA 3PR2A 1FWJC 1A5OC 4HSHA 1NAL1 4MIMA 4F0RA 3U48A 3T2PA 1T6MA 5CC5A 4W8LA 5D02A 1HKJA 1IR1A 4F3HA 1TV5A 4PMVA 5KZDA 3RUBL 3DG6A 5LXXA 3N9KA 3VGHA 1BG9A 1S3TC 1G0CA 3A5FA 5BWFA 1EXPA 1US2A 3H53A 3MVTA 4V1YA 1U83A 3FFSA 3WQGA 3P3BA 1J0KA 2V8ZA 4AWTA 3QLDA 3TMQA 4UOZA 1TX2A 2EPMX 2X2GA 4OIFA 3DFTA 3BPWA 3LK6A 1UUMA 2F6KA 4G5DA 1CT5A 3RM9A 4GIAA 4DN1A 4K7YA 4JFTA 3W85A 3N6HA 4ZQCA 2XH7A 1FXPA 2DU2A 1XLDA 2F9RA 4ES4A 3GK0A 3W2NA 2CBIA 2P8CA 3MJMA 2AOSA 1V6VA 1WDPA 3STEA 1VBRA 1IEQA 3RHGA 3U5YA 2UWFA 4D6DA 2P8BA 4JHMA 3NQ7A 1W0MA 1R3TA 1DJGA 4JTJA 1TJ2A 1VFLA 4JY9A 1LLOA 2J88A 1A80A 1RBAA 1V4YA 2HXTA 1E71M 3M0LA 2PDUA 1A3HA 1IXOA 3ZS4A 1YXYA 4KWWA 3N18A 1OFRA 4OJYA 3T4WA 1CB7B 4DELA 3HM7A 2RDXA 4MNLA 4DXXA 2FGZA 2GGJA 2PD5A 4WJEA 4TXEA 1YNPA 1PBGA 4EK7A 3B97A 2A21A 2QAPA 4IWWA 4YNGA 4Q6XA 4D6IA 3JRKA 1TTIA 1A3WA 3COTA 1XF0A 3G1HA 4TVDA 1ZS2A 5C70A 4ADUA 2FQIA 2WV8A 2GQ8A 1JVNA 1IWAA 2ZWZA 3UERA 2Q3OA 3K13A 1UROA 3E0IA 3GRIA 1JCLA 3CXOA 1WXYA 3L0KA 1TRIA 4L4MA 2ALDA 4ZXOA 5BMWA 3GXFA 7REQB 5I24A 3BLPX 1B1YA 1YTKA 2QUMA 2NV1A 2PC8A 3TVAA 5LA0A 3O0KA 2FZMA 2FPVA 3IJ8A 4LEQA 3OHIA 4M19A 1W5MA 1FFRA 1L6WA 3GH5A 1UZ4A 4LUTA 4ALDA 2FJUB 3RILA 4X63A 2G96A 1J93A 2A3AA 5DXXA 2WC3A 4DLFA 1RP9A 1TREA 5D04C 4W7UA 3Q45A 2Y89A 2ZXAA 2Z4GA 3K30A 3PJTA 4IIDA 4E0CA 2C1GA 4XX6A 3RG6A 3ARQA 4PULA 4MJ4A 4RLIA 3MHFA 1RALA 3NPUA 3W7PA 2A0NA 3M43A 2CHOA 4H2CA 1FWAC 1E9IA 4OQVA 4IMAA 1MDLA 4WJXA 2MANA 3E2RA 1QPRA 3BJSA 3FOKA 2TRSA 4WCJA 2I1OA 1YIXA 4US5D 3O3RA 1X1ZA 4CQAA 1IWBA 5LXEA 3F5LA 5D4YA 4MZ8A 1W1IE 1JULA 1IE7C 1E1CB 2PDYA 3UG8A 2OU4A 4ZO7A 4CU8A 3FIGA 4H6EA 3MB9A 1BYAA 1FWCC 3KBWA 4NKCA 2HRWA 1G4SA 4Y8EA 2QUVA 5HR6A 4ZSUA 1Z48A 4GC4A 2CYGA 3RM4A 1RA0A 1RHCA 3BG3A 1B4EA 3BH4A 2E28A 5F1VA 3MTWA 3SUTA 4MFEA 4GY1A 3UZXA 1AG1O 2D0FA 2YJQA 2JALA 5E0KA 2NSXA 3UPBA 4L1WA 2NQZA 3TTYA 3ZWTA 1WDRA 3WD0A 3TK7A 2G3MA 4AC1X 3VU2A 1ZJIA 1Q6OA 3BQ6A 5KETA 4JTUA 2CLKA 2OQLA 4W84A 1OCQA 2CLIA 2ZXQA 3SY8A 1JRCA 3FAWA 4H83A 3VOFA 4WDXA 2FYMA 2XDFA 3A3HA 2D23A 4GK8A 3HOJA 1EA9C 3GIYA 3PZ9A 1O7AA 4GZEA 5CPNA 4C6NA 1PTDA 3CZEA 2YCLB 3NO5A 2ZOXA 1XICA 4U28A 3QZEA 5KZMA 1BYCA 1DWAM 1EWEA 1YADA 2DVTA 1L2UA 3UJSA 1HT6A 5D9MA 3WZ0E 1TMQA 1UKQA 3L4TA 3CHVA 5FSDC 4B15A 2EHHA 1DEDA 4I9TA 1JAKA 2QDGA 4B3KA 1KM1A 4IHCA 2B7NA 1OZMA 3AQUA 3BZJA 3RPMA 3NJ3A 4NL1A 2Q8LA 1R85A 5G2IA 4JEQA 2OEKA 3IIZA 4Z1BA 3TOPA 4QRNA 5E6ZA 1W3TA 1X97A 5DMLA 3EYPA 1J10A 3O6YX 4LYPA 3FJLA 2F38A 3SCQA 4KF1A 3W7OA 2GUYA 4MKSA 2WMFA 2B31A 4ACZA 3M46A 1FHVA 2G8ZA 3SJ3A 2UV8G 2RH9A 4FNRA 1CLXA 4NF7A 5XINA 3ARYA 3GFZA 4HNLA 4NVTA 2C14A 2ATSA 4J3UA 3JVAA 4JYEA 3AI0A 1UWIA 2VRJA 5CZ0A 5J8LA 5HMDA 4O1CA 1XLBA 3L67A 1TO3A 1EH9A 5KZ6A 5HJLA 4D6FA 4A3QA 1U5HA 4J28A 3UY8A 5A8NA 3T42A 1W9PA 3OLEA 2BBFA 1CPUA 3MUY1 5DELA 2QCGA 3LCFA 4G9PA 4R7OA 4H9ZA 3UXAA 4QEEA 5TBOA 1DQUA 1H5VA 1OG0A 1E1EA 2R1MA 1I75A 2X42A 4ZB0A 1N7KA 4V28A 1VHNA 3BCJA 1DPMA 1OVDA 2GL5A 4BHYA 4OU1A 3ZO9A 4PH6A 3DZ1A 5G1YA 3BLIA 3P84A 4ZE5A 1JQXA 1NFPA 4V33A 2XZ9A 1EUAA 1ISXA 1POKA 1JZ8A 4Z0SA 4F66A 5CQ1A 3N3MA 3GFXA 4JIIX 4AIUA 5AC7A 2PTWA 4K38A 5CJ5A 4FNTA 3USBA 3N2TA 2WW5A 2BGSA 5I5RA 4S3FA 5HWNA 1E0VA 2FIQA 3LOTA 2BSLA 3OVRA 5CPTA 3VOJA 2MUCA 1V03A 3GDRA 4B5XA 4K39A 3PAOA 3H70A 4O14A 1QI4A 3MCNA 1CXHA 3IJIA 1HJVA 1H11A 4KT2A 4MB4A 5D8WA 5ENLA 1VJZA 2MNRA 3S5YA 4PUUA 4H41A 3QTGA 3R8HA 2C6QA 1QTWA 1JZ3A 6XIMA 3FJNA 2X30A 5KZEA 1GTEA 2ANUA 1ISVA 4HCDA 4W4QA 4PC8A 4RNFA 4NJIA 4J3TA 5LSMA 1P1MA 3K4WA 1YTEA 3TJIA 5HULA 5GJPA 2BXVA 1H7OA 5KMYA 4YLWA 4LF2A 2ALRA 4JS3A 4HNTA 3WUBA 4K8EA 1DOSA 4S2CA 3WD3A 4C1NA 2WJDA 2CLOA 3LPOA 4B92A 1PL9A 3HGOA 4IP7A 1ITQA 3NL3A 2X1RA 1NJJA 3Q4DA 1NF0A 1KM4A 1Q6DA 4PEKA 5I79A 2PDMA 1BF6A 3URNA 1ALDA 2P88A 1QNRA 2HXUA 1TRDA 4GGBA 4E38A 1SZFA 3C2RA 1UA7A 3L4YA 3GVGA 3LLDA 1XRTA 4GLEA 4YWIA 1RD6A 4Q6JA 1XCWA 3M47A 3ERPA 2VT0A 3OLIA 4PMRA 4K37A 2TPSA 4AD2A 2XIBA 4O4WA 1S5WA 1EP2A 1M1BA 3RU8X 1LWIA 4J2PA 1TJPA 1T5AA 2VNCA 1TPC1 3KXQA 2GVYA 4M80A 1M7OA 3EX6A 5AB3A 1TUXA 1JNDA 4ICNA 1I2RA 5HMEA 4R7JA 4O54A 4ML9A 3AHTA 5I7GA 1H7PA 8XIAA 2NUWA 4IIBA 1KGXA 2JGYA 3HQ1A 2A3BA 1UWAA 5EMUA 3QPEA 2WMIA 1BEUA 3CPGA 5D09A 3KRUA 4AZ5A 2BY2A 3LG3A 5AHEA 3ZVHA 1R47A 3OU8A 2IPFA 1V08A 3KFTA 1WPCA 2ZUWA 4QE4A 2XISA 4ZOAA 4DAIA 1JZ4A 3GNRA 4UTJA 3RLHA 4C6PA 3YPIA 1PXGA 5HQLA 2I9EA 5CAKA 2J8GA 4LRSA 1J96A 1KFBA 2DT3A 1EGVA 1AUSL 2NZLA 1DTUA 2JKEA 2DDXA 3CB3A 3LY0A 1AMYA 1SMAA 3WEMA 4C90A 5A6LA 3E2QA 4LB3A 4E6MA 4JR5A 3C0SA 5D38A 1IXPA 2QVHA 3N9RA 4B2DD 4O1FA 3PC0A 5HDRA 3H12A 1GPFA 3GR8A 4HNNA 4W86A 5KEZA 3N25A 4A3RA 4REQA 3I6EA 1H7XA 2ZUVA 2WZHA 3FA5A 4XB3A 3PSVA 2D20A 5C8BB 4DYKA 3UZWA 2NQJA 3GG0A 1FWBC 3W9ZA 1VFFA 4UIOA 2G97A 2PD9A 1YNYA 4F2TA 4RZ4A 4CGTA 4D9PA 5H6HA 1TPFA 4NZ3A 3N2CA 1ZCCA 2E77A 2I56A 1PWLA 4RPQA 4LRTA 3CUJA 4W93A 4IL2A 2Y62A 2ABAA 2J8TA 1MVYA 4Q33A 4U5IA 3QMTA 3OZPA 1T7LA 2YOCA 1ZENA 3S9IA 2B4GA 3IGHX 3TTSA 2ISWA 4X0VA 3RR4A 4ZTXA 5C54A 3LERA 3OZYA 3WJSA 3THQA 4L4LA 5K7JA 1Q4NX 4MFDA 3NGJA 1QK2A 1S5NA 4C6FA 2E5DA 1W91A 1DWJM 1ICPA 4BCEA 5CBJA 4PB3A 4L5ZA 3N04A 1XC4A 2DH3A 2YB1A 5ECUA 1S5VA 3BVJA 1GJWA 2G37A 1QPNA 3F4VA 4Q3MA 5AZ1A 1L8PA 3R4IA 1AL7A 3B8WA 3TUUA 1DP0A 4GKLA 2WPGA 1JZ2A 3N2OA 3EOOA 3L2MA 3TSDA 5LGZA 3WKZA 1SZGA 3GXIA 4A05A 3M0VA 4HU8A 1UH2A 1PHWA 4MAVA 2YL5A 2IQ0A 4D6EA 1KR1A 3GXTA 2EEXA 4NAFA 3TJLA 3HG5A 1NOFA 1XQKA 4UQEA 1V6TA 1NWTA 3WF3A 3M0KA 5AZ0A 3KBSA 4AWSA 4RUBA 2FFIA 5FOOA 1EJRC 3NQFA 2VQUA 4MZYA 4WJ8A 1UMYA 3QSRA 3QVQA 2O7QA 2W66A 3AHVA 3EBVA 5FEXA 4Y6GA 4Z1AA 3V5OA 3MA8A 3VGDA 4AB4A 2QCFA 3APGA 1X39A 1TVPA 3JZEA 3L21A 3MP4A 1QCWA 1JL8A 2WCGA 1NFGA 2OO6A 5A8MA 2Z0IA 1ECQA 1OX4A 5BXRA 2PDWA 1QHOA 5I3GA 1PDYA 3DAQA 3N2XA 1EIXA 1K70A 3HQOA 3PVFA 2P76A 4E3VA 2AMGA 3VNIA 3U2OA 2XUCA 3OGRA 4CN4A 3AYTA 4LT9A 4LGXA 4C6DA 3R89A 4DZ5A 1UD6A 2UY5A 1KXVA 4ADTA 1UP2A 2BHYA 3B40A 3CNYA 3DIPA 4AHOA 2VEIA 4DJDC 1CENA 3L4WA 1I45A 3AXXA 4KRTA 4LUSB 2VEKA 4AYSA 1DJYA 2X16A 4DJDA 1R46A 3WDHA 1UD5A 3BQ5A 3NDYA 2V0TA 3QR3A 3UXKA 4IGHA 1UKSA 4Y9MA 1TV7A 2JKPA 1RCXB 4FIRA 1AVAA 4A3HA 5CPOA 3I4EA 1K7FA 1E70M 2V30A 1JDCA 3PUDA 4XO6A 3KDNA 3RXZA 4M82A 2GGIA 1XINA 1KRCC 4LVFA 5LNWA 1V7AA 3UJEA 5CLTA 5E5CA 4X3ZA 3PZTA 3W2KA 4DWSB 2RUSA 1FCUA 4PCTA 2E5BA 3BLEA 3TQ0A 1I2PA 3K8MA 3UJ2A 3R5EA 3TIMA 4D2JA 3WNLA 1EPXA 1HGYA 3L2IA 2C91A 2ESCA 3AYRA 1E5JA 3A21A 4KCTA 4O50A 3NL6A 3EDDA 4LJ3A 4O12A 4TUFA 1GKRA 5D32A 2OVLA 1KQZA 3WMCA 4LV9A 3PAJA 2CLHA 3V5FA 2PDCA 2QAFA 1XFCA 3H2EA 3RM8A 1JNEA 4H8UA 1HJXA 2Y7GA 3KUMA 2QUUA 2VZVA 4GQGA 1PZ2A 2X40A 1BSIA 4AUBA 2CBUA 3VM7A 2A79A 4HSOA 4IPJA 5LHEA 3N2MA 4LALA 2Z7KA 1DJZA 1IT8A 3LCXA 4C5YA 2VEMA 1I2QA 5FF2A 3R25A 1PYFA 1KBLA 3EAUA 3KOFA 1UOZA 1O1HA 3HGRA 3GQYA 2VOMA 2YXOA 3ZSTA 4IPNB 1XD0A 3ARVA 3FA4A 1ZY9A 5GJMA 4GFSA 3M0HA 5FJTA 3UG3A 3O63A 3KBMA 1T40A 4QSHA 4BK9A 3VOGA 3CQKA 3CL6A 3DYPA 3KP1A 5CPMA 2VUNA 4MJZA 1ONXA 1W3JA 1LRTA 2QPXA 3BMWA 1EJXC 2XYLA 4XD6A 1QHPA 1KCXA 5AVHA 4QITA 5MKGB 5A8PA 1FWTA 2CWXA 1MNSA 5CC7A 3CIXA 3GVVA 1NDYA 1F4HA 3TWAA 1LTDA 2C0AA 4ZBCA 3F2DA 5ABGA 2YIHA 3NDOA 1YPFA 3KDOA 4ZO8A 4Q8MA 1MUWA 4DF0A 4H6QA 1Z8AA 2A5HA 5AC8A 4LWWA 1DV7A 2D69A 4UNLA 3URBA 2W79A 3NOEA 1K9TA 1SFJA 2HV5A 3RIKA 3WK2A 3KZSA 2I5GA 1HP4A 1A4MA 4TOQA 4KEMA 3EDJA 3G8RA 1DWFM 4K6AA 4PTWA 3LQLA 1M7JA 3LUTA 5DCBA 1B9ZA 1CI1A 3AICA 2GSEA 3PS7A 3WF4A 3FJ6A 5K2ZA 3CAVA 4KFOA 1YW1A 4DJEC 3OO2A 1Q2SA 4LPCA 1BVWA 1W5PA 1EHAA 3LN3A 3W28A 1XD1A 2V6AA 3I3BA 4H6RA 1W3IA 3LM7A 2H3DA 4MADA 2QKFA 3INPA 4CCCA 3EWCA 1P5BA 5E6YA 4N42A 1VC4A 2Z2AA 3Q67A 3LCLA 3GB6A 2FDSA 3FVDA 2W62A 1R87A 4I6VA 3KOWA 3QH2A 2OB3A 4A3UA 1DXIA 4WY0F 4RXFA 3WJYA 4DBDA 2VGGA 3CUZA 4AZHA 3GNNA 1ONRA 2E6AA 5EMJA 1A5KC 1XW8A 2CKRA 4FP1A 1P0NA 4AF0B 7PTDA 1U22A 4L9ZA 4KEUA 3EDFA 4B90A 5LIYX 4PODA 4DZHA 2WWCA 1XG4A 4FZIA 3P67A 1MW0A 4I9AA 5EFFA 2BASA 1HGWA 1XLCA 4XAPA 1B3VA 2VZTA 3WFAA 2EKGA 2W91A 4Q8VA 2JIEA 3G3MA 3LU2A 2WJEA 1ADOA 1VYRA 3BW4A 4IL0A 1FWFC 1X8FA 3EKGA 4GG9A 4EF9A 2PDNA 1F05A 4UNKA 4MKNA 3WLPA 1F6KA 1TPVA 3QOMA 4KWOA 4BQ3A 2CZEA 2R1PA 3WQ5A 4PTMA 4HP5A 3R13A 3W7GA 4JIHA 4F2BA 1A0CA 1CLVA 4XZWA 3C2YA 3TLLA 3NZ1A 3CUIA 3H22A 3V16A 5C7HA 3U2CA 4RDYA 3PNZA 4IFKB 4DUWA 3WJZA 1M65A 4HJFA 3A13A 3PTMA 3RPDA 2D3NA 1EC7A 2CW6A 4HU3A 4LAOA 3M9YA 3CS2A 3IGUA 1S5TA 3C52A 5HUOA 2Z1XA 1ADSA 4IPPA 4GXPA 1R7OA 3W23A 3PG9A 3W1MA 4XZLX 3N73A 4M7TA 3NO1A 1ME8A 3TYDA 3AISA 3UZ5A 1Q6FA 4ZODA 4RE3A 2R24A 4EE9A 4IQLA 3R6IA 3VNZA 2OT0A 2BVTA 3KOXA 2V9DA 2QJJA 4PEEA 3S1UA 1UHVA 2CLMA 4L7ZA 1NQKA 3NZQA 3TNBA 3FHAA 3VOCA 3G1XA 4LTSA 2I9UA 1ZBVA 2OKTA 2QQ6A 2XH2A 4IMFA 3AMDA 1H41A 2ZCGA 3RK8A 1VJSA 3O6AA 1QNSA 4UOQA 1Y0EA 2V63A 1LF1A 4LCQA 1M41A 5DN1A 1UUQA 3O8AA 2VFDA 2KZHA 1JYXA 4PBGA 4GI4A 3VTRA 2FHBA 2ZZ5A 3C61A 4HYRA 2CLPA 3FW6A 1QRQA 1W8SA 3G1VA 2E6YA 4QX4A 3NZPA 1E6RA 2F6UA 3ARZA 1H5YA 3OYZA 3LHVA 3CUHA 3W1XA 1YDYA 4L1XA 2Z1WA 3GXNA 1VIZA 4J4KA 2BODX 2GDVA 2DW6A 2O9PA 2X1TA 3TNOA 1TWZA 1NF7A 2PWDA 4QLJA 1XUUA 3WLOA 1UWQA 3W37A 5M03A 2WVVB 3TEVA 3RLGA 3GM8A 4F0HA 3AYSA 1OWQA 3W07A 4H1ZA 3N9SA 1F5ZA 1UPPA 3PF3A 4HIBA 4WUIA 4NZ4A 1FHDA 3BAKA 2ZVIA 1CGXA 2QPUA 4PE8A 3RDKA 1M68A 4ADSA 3F4NA 1B5TA 3U8GA 2IS7A 3EGJA 5JQ9A 3WF1A 5BW6A 1KLZA 2DP3A 5EL1A 1UIPA 2G0WA 3M6DA 4QIUA 2HWGA 4F0SA 1THFD 1ZCOA 3RYSA 3T78A 1BGGA 1OYCA 2Z7GA 4BKNA 3BAWA 1IV8A 5CBIA 3LI0A 4H9XA 1D3CA 4JAWA 2WHKA 2PWFA 4K1GA 3IVUA 1YXCA 3E9AA 1GW1A 3WH5A 2AGTA 4B5UA 3GH4A 5AHNA 2BXZA 1QFEA 3IJ9A 3USZA 1KO0A 4ZZ9A 3V0SA 1BRLA 1TZZA 1OX5A 5I07A 1WKEA 3SN4A 1GVYA 3QFEA 3GHUA 4UFJA 2EBNA 5BRQA 4FF7A 1UR9A 3ONBA 2PWVA 3HG3A 4ROQA 3BUVA 2CLFA 3WUGA 5A6SA 3BV4A 4YTUA 4GVGA 2QF7A 3B8IA 3PBGA 2D22A 2O4MA 3OB8A 4JICA 2ZDRA 3DC0A 1IGWA 2ZRUA 5B7ZA 1OYBA 1ZU8A 2E68A 3WN6A 3L66A 2H9AB 4XBSA 1GQJA 3QW4B 3HV8A 1MFUA 1W3KA 2ZXDA 2OR2A 1B31A 1TCMA 1V79A 4C6QA 3GTFA 4ZR8A 4BEQA 3UWYA 3NGFA 4AD0A 2TAAA 1GVIA 3LNPA 2DZVA 1ITUA 4FNQA 4JTTA 1BFNA 1ITCA 3WLMA 4MWAC 4FXFA 3JZUA 4WSJA 4MWAA 2RFGA 2FZ8A 3QY8A 1NVMA 3FYYA 4AWEA 3W2MA 4DBSA 3TJ4A 2WHMA 3SEPA 4UFHA 5AYBA 4AXNA 4ZMGA 4GXWA 1FKWA 5H8PA 4QS5A 1X8CA 3W7CA 1KBIA 2DSZA 5EYWA 1JDDA 2NT0A 3GU9A 3SI9A 3UGRA 1SO3A 4JKMA 4R53A 4XAYA 2VX7A 2YA1A 2CHNA 1RP8A 1SJAA 1V51A 2DORA 4AY1A 3M41A 1XSIA 3BAXA 4RNIA 3W1NA 1X38A 4H00A 4QG8A 2YBUA 5DO8A 3TV8A 3N34A 3EB4A 1GZGA 3TYZA 1R8LA 4H7ZA 3T1GA 4O18A 1SPQA 5D2XA 1MUMA 4P8XA 1JZ6A 3EB3A 4UMCA 1W17A 1MZRA 3MKKA 3SM0A 2WAGA 4W7WA 3BSMA 1P0DA 4BI5A 1GONA 3F4CA 3W71A 3CQ0A 5JIPA 3UPWA 1ML1A 1AZ2A 4DM2A 3PZMA 2PLKA 3SQSA 1RVKA 2CZFA 1OB0A 4I9MA 1AW2A 3H7UA 3MDUA 3MYPA 1VR6A 5CJNA 5LKYA 1EF2A 1YDNA 4CQ8A 1VFUA 4GX8A 3W7RA 3S1VA 2EPNA 3IK2A 3DFHA 4NJGA 1PYMA 3LD5A 3PUEA 3NCOA 3B04A 2PLJA 2AL2A 4KPLA 4YS1A 3P60A 4J3ZA 2XIMA 2G5WA 4E4UA 4C91A 2OOFA 3TLQA 3RFAA 3OODA 3AAMA 1W1YA 2YA0A 3MSYA 3G0UA 2YPIA 3CYVA 3EDKA 3CMJA 1LOLA 1RZMA 1U2YA 3S8HA 4DWSC 5HXMA 1G69A 3BSGA 1KBBA 2QDDA 2D1ZA 2O9RA 4Y8FA 7XIMA 2YFNA 5MF5A 4GQRA 1I4NA 2NVAA 3GE7A 3B8VA 3QTPA 2G4JA 4RDVA 5C9ZA 1B0IA 4FX6M 2DZXA 1ENUA 3SFKA 2RJHA 3M6YA 5CSSA 3GC4A 2ZTKA 1VF8A 4E8GA 3PJXA 2VHLA 5BOFA 1Y5XA 1OFBA 2CNCA 4R7WA 3W1QA 1VFMA 4A8RA 3GR7A 4JFVA 2GQ3A 3CAQA 3LHZA 3PBVA 5EPDA 1YPXA 9RUBA 3NQ6A 1EIBA 2AL1A 1OQFA 5LYRA 3P5ZA 3BLKA 1NP2A 1MEIA 3DFQA 3P5YA 4XD3A 4JTAA 3NA8A 3TTEA 5D8ZA 4GNJA 2BHZA 1I8JA 3QGVA 4M3PA 5FCZA 4FIQA 3CAWA 1XV8A 4XZHA 1YKWA 4XWUA 3E49A 3R43A 2JF6A 4DZAA 1ODZA 2ZFAA 1V7YA 4OOZA 4KMQA 3VCRA 1AJZA 2X1SA 1XLHA 4YVVA 5ABTA 5F2MA 2DPEA 4HHPA 4KGLA 2J66A 1HXJA 2ZZ2A 1GVFA 1HQTA 4M6PA 4O16A 1VRDA 3OVPA 2GUBA 3TXVA 2NLIA 2W27A 4N7QA 4CQDA 1KBJA 1E9YB 4MGGA 3O1NA 4O15A 3AS3A 3SW6A 3W2LA 3T08A 1W3NA 3PM6A 5D37A 5A8GA 4QG6A 5DX7A 1B3YA 8CGTA 1UJPA 4ASTA 2JEQA 3SGGA 2RJGA 2Z1BA 1KXTA 3CEUA 2X05A 4NAEB 4TR9A 4X2RA 1QI3A 1V6UA 3V3WA 4ZENA 3VPLA 1DWHM 1MW3A 3K1DA 1JZ7A 4MZ1A 4IMDA 1AH3A 1KGWA 6TAAA 5A69A 1W31A 5JIWA 2ZVRA 2Y8UA 4LUIA 3H2MA 1R38A 4GC3A 4V2XA 2YBVA 3U5UA 1U1UA 4UZUA 3AIWA 3NQBA 1R5YA 1KGUA 2PDKA 3ZT6A 1WDDA 4I5UA 2Y85A 4PCNA 3SCVA 3LGGA 2QCHA 1NFBA 3OG3A 2FLIA 1FHLA 3QOKA 1H0IA 2XVLA 2DZAA 1VRXA 3B0XA 4MLRA 4ZFCA 1BSLA 3T0AA 3WO8A 3PP7A 3ARWA 3CUXA 1TV2A 1MWOA 5M5DA 3ZLHA 1P7TB 1KM2A 4J2MA 2FH6A 2P0IA 4GZIA 3AIRA 5DRCA 2JKAA 4J5NA 1UOKA 3PZIA 1WP6A 4XUGA 1T41A 2PDIA 2DUAA 2FH8A 1VIWA 4J1OA 4US5A 4ZA0A 3FSUA 4FHAA 1R9ZA 1XG3A 1ISYA 1PCWA 3IUDA 4HMEA 1QT1A 3FDKA 4IP4A 4TX8A 4HA1A 3HV9A 4TVCA 3WNKA 2QLYA 2OYLA 2YA2A 3KHDA 1YNQA 5CZKA 1XI3A 1SW0A 3HU7A 1UZDA 2G3IA 1ONEA 3GXPA 2CETA 5T8GA 1DJXA 4LU0A 1KWKA 1QPOA 4BZYA 3SUVA 3GD6A 3WUEA 5HANA 4WF7A 3R8GA 7TAAA 1E5NA 2OSYA 3QPYA 1H49A 2BNJA 1FXQA 3GHTA 3HQPA 1BWVA 1PPIA 1QO5A 3W00A 2ZRVA 1I60A 2PPGA 3Q94A 3TN5A 1R86A 1VENA 3ABOA 2A2IA 4ZXLA 3GVQA 2FZ9A 5LIUX 2HNEA 1SMDA 4C60A 5A1AA 5FJOA 3U4AA 1Z69A 2JIWA 2Y8KA 4AU0A 3ZZ1A 3VUSA 1REQB 2Z24A 3FVMA 4LCSA 1H1YA 5H8UA 2F6XA 5DLCA 1XDMA 2PB1A 2ACUA 2EPKX 2V2CA 2BLEA 4JHOA 5DBUA 3GU2A 1LWJA 4GUHA 5CGTA 2QYGA 3L68A 3W3OA 3IIVA 2HVOA 1E43A 3SECA 1ME9A 3P8JA 1XIEA 4V1XA 1HJSA 3VD4A 1EA0A 2GJXA 5C2CA 2FMNA 1QVBA 4W85A 2BV9A 3ZT5A 1XH2A 1KV8A 3TYUA 3KWSA 2OZTA 1IT0A 4PTVA 3W1LA 5AC5A 4P8VA 2V69A 3WNNA 2GDUA 3CZLA 3C3NA 3VI2A 2ZX5A 3BURA 2HE8A 4PCPA 3W83A 3OGVA 3QY6A 1K8ZA 3UXDA 3DERA 2DZTA 5BCAA 2J62A 3R1ZA 3WBAA 4HPHA 4MJ2A 1IEXA 1TIWA 3W7LA 1QAPA 2EXOA 1K7EA 4RKAA 1IT7A 1ESWA 3W26A 4JIPA 4C6JA 3IVTA 4HPJA 1EQPA 3SO7A 1FCVA 1K9FA 1J2BA 1QO2A 4YMZA 5A6JA 4M6QA 4J3WA 4TO8A 3VABA 2ADAA 3LV6A 4IZGA 3O9NA 1OC5A 1J0YA 3RCNA 3EWZA 2GSJA 4N9CA 1M9HA 3B9AA 2FDMA 3M0YA 4GVHA 2IKGA 5HWJA 5CKSA 5ABEA 3GKAA 4LBSA 1JCYA 3AXHA 1I9CB 1QNPA 1R30A 2DVUA 4XVEA 1M04A 1B57A 4WK9A 4RK8A 3KLLA 4OUIA 3B0YA 4LAZA 2H90A 3FX4A 2L5HA 2D0GA 3GXDA 3DHPA 2YYUA 3B03A 4OWGA 1WUFA 3VKAA 4PMZA 1J79A 3MI2A 4WIWA 1ZZMA 3R12A 3UNDA 1IIGA 2Z1VA 5J04A 3EX2A 1WAWA 3WF2A 1TG7A 4JDBA 3M5XA 4NJHA 5AHLA 3LPGA 2F84A 1GVSA 1LDCA 4G56A 1E6PA 1OGBA 1XHGA 1VBJA 3UJFA 3UA4A 1UJQA 5E0FA 2GJPA 1XH0A 1TV3A 4HOXA 4H9UA 2PI6A 3QQ1A 3GDMA 6PTDA 1BXBA 5C0QA 4BY3A 2EO7A 3V75A 1RXOB 2QIWA 5AYXA 4GKTA 1EBGA 1UR3M 4EIVA 4GA8A 5CC6A 4HK7A 3NAVA 3HJEA 4IP5A 1K77A 3UCDA 4F8XA 4JTFA 5IDZA 4PTXA 4ROPA 3REQA 1W1TA 1UD4A 3GYEA 1O5XA 4QE5A 1DHKA 4Q7BA 1M53A 4LAKA 3GG8A 1OIMA 2PE4A 1KM5A 1H50A 4QFUA 3G77A 1TJ1A 3WBXA 3DGBA 3UXIA 3CLWA 1ITXA 1UWRA 2H8ZA 3WH6A 3SAZA 2PP3A 3N13A 3C0LA 3LXAA 1BTMA 1V3KA 3T4CA 5LA2A 3OOQA 5FJIA 1X7FA 4ZB2A 4UTWC 1KB3A 4BEUA 4N0RA 3FCPA 1CEOA 4UTWA 3ITTA 3OVGA 3FXGA 1GQKA 3PWGA 1LWHA 1FTXA 3K8KA 2W9MA 3CHCA 1YX1A 2PFHA 3N14A 4C6IA 3SFWA 2QV4A 3BMVA 2IPWA 1P0BA 3UETA 5A2AA 2BGQA 1N2VA 3VMPA 2BVDA 3FY1A 3OP2A 4UUIA 1PIGA 4LUTB 5CPLA 4CCDA 4RZ6A 2VI0A 5EFDA 5LNSA 2QCDA 1GOWA 1H4PA 4QM1A 4UQCA 3CV7A 4GIRA 4UTLA 3ZMRA 5K4XA 3IVSA 3A4XA 3NFUA 1NIUA 4F48A 5J5DA 4AEOA 2ZE3A 3RX2A 3DFYA 1CDGA 3N19B 1DJQA 1LL4A 1QXLA 3EKZA 5DEZA 1XC6A 4UFMA 2CBVA 2CLLA 4XSMA 3IJ6A 4FALA 3UY7A 3IK4A 5FEZA 3U7VA 3JW7A 5IXEA 1R6WA 3H26A 2D0HA 2CLEA 1VP5A 3MCMA 1KNWA 2DZUA 4UC5A 4NZ5A 1UB3A 5EB8A 4GH3A 4XIAA 4MB1A 2CZVA 3S0CA 2G41A 3QC3A 4XTDA 1P6CA 1SJBA 3UEQA 4XZ9A 3T8LA 4GMEA 3IARA 1EC9A 1H3GA 1YTDA 3BLFA 4TV6A 2CCRA 3OA5A 1E0XA 4B2DA 1SQ7A 1W54A 3NR0A 1G4TA 3EMCA 2VL4A 3HPAA 4AX7A 3ZJ6A 3FLUA 1DYSA 3W1AA 1S39A 1EDQA 2PLCA 2JGQA 3MUZ1 1MRQA 4WKFA 2R6OA 1JUBA 4TMCA 3BC9A 1JIBA 2ZC1A 2Z28A 2E6FA 1AMKA 2PP1A 3H8AA 2WHLA 4YJ5A 5LNVA 3QJAA 4C6EA 4Q7IA 5CPQA 4IFOA 2C3ZA 1KFWA 2V81A 3G6LA 3BLDA 3GU1A 3TW6A 5I3IA 1F74A 4WGHA 1JPMA 1E6ZA 5C9RA 1LL6A 2R94A 2PGRA 5G4WA 3HPXA 1G6CA 1LUCA 1P48A 5D2YA 3A4AA 1VBUA 1KW1A 3DOPA 3VDCA 3UYIA 1AW5A 1W9VA 4RJEA 1EQCA 1RLCL 1VFTA 2WVSA 2GJLA 1GNXA 2XIOA 3VIOA 2RDWA 5JU6A 4N9DA 1HJUA 1VPXA 4UNIA 2W67A 1FY6A 1JPHA 1AD4A 4ENLA 1W1A1 4JDYA 5CZTA 1Q7ZA 4UFIA 5AN7A 1LG2A 3KM8A 3UU0A 4FR1A 1B2YA 5E0CA 2PGWA 4DEFA 1VCVA 1MW1A 1W32A 4HVXA 2J78A 1MZHA 3W88A 5CSUA 3SCWA 1XBXA 1XGZA 2VCBA 1JDEA 3CK5A 1PE1A 5F2IA 1W9XA 3NSXA 5H2ZA 3I68A 4QE1A 3LZ3A 1CX9A 3T2OA 3MO7A 4ACZB 1XLIA 3A4WA 3DESA 3EMQA 3VIJA 2R9RA 1UG6A 4NZJA 1S2CA 2WC7A 1PZ3A 5BROA 4FR6A 4S39A 1PTGA 4NX0A 3WY1A 4JTLA 3V18A 3ZR4A 2QT3A 1SO4A 1SZNA 3MBFA 4NAEA 4O0KA 4QDMA 1GKPA 5EKYA 1GG0A 1QK0A 3ZIZA 2WSQA 2QUNA 4OT7A 3ES8A 3W74A 2E9LA 1VEPA 4S3JA 2VGIA 1K8XA 1UBPC 3W02A 1UC4A 1EWDA 1VJIA 5HUPA 1JEZA 1OBAA 2C79A 1GPWA 3TP4A 3TYCA 4JTCA 1VYPX 2VDIA 4HNVA 3SUSA 1Q6RA 2WKLA 2XZ7A 1EOKA 3AIQA 4WDUA 5K9XA 3WBEA 1FDJA 2WC4A 1F2JA 4YYFA 3W53A 1VPYA 1Z44A 2R1LA 4RW5A 1JZ5A 3OHMB 4XD5A 1EJVC 3RRAA 4DQWA 4FOJA 1AODA 2DJXA 4S3BA 3HB9A 2OWCA 4UQDA 4AD3A 4OFCA 2I57A 3IS4A 4DUVA 5HPOA 1YPIA 3WQFA 4OV9A 1SR0A 2VUYA 3VE9A 1PKNA 2NXIA 3H24A 4C7DA 4YPJA 1Q66A 4H8VA 1XIHA 4QCEA 4JX6A 4NSBA 3GIQA 4WVXA 1RBLA 4RW3A 3PZUA 3WLIA 4EXAA 1QU4A 3QZ6A 3TE9A 4OGZA 3RF9A 1SO5A 3FEQA 4FEZA 2ONEA 4WOZA 4R27A 3R2GA 3BOFA 4FXSA 3EWXA 4UCFA 3TTOA 3S6DA 3W2UA 5IFPA 4WDTA 4NILA 4IIGA 4J7RA 1MUCA 4GACA 4J3XA 1FWEC 2EF9A 1J5SA 1F3WA 3KVKA 3W70A 2O9TA 2OOGA 5BU9A 1XCFA 1O66A 4YVPA 4K68A 1LROA 1XIGA 2ISVA 4EVZA 1EZ2A 2OQHA 3BLOA 2BVYA 3PSWA 4FOKA 1GEHA 1O5RA 3VX1A 5F2GA 3A4JA 3SRKA 4IG2A 1XGDA 1GT8A 3DFSA 4YTQA 3VNJA 2Y24A 2ZUUA 3TN6A 3HN3A 3QN3A 5I3KA 4Y9AA 4GH1A 3HTWA 3EMZA 3CPUA 2PRLA 3UWEA 4U10A 4EPDC 2WM1A 4Q4QA 3AMLA 3CPRA 3PBYA 5TIMA 2BFGA 3DGRA 4C1NB 1R7AA 3V0UA 1BF2A 2YKKA 1KRBC 2WKGA 1IZCA 1GVQA 3NM1A 3CO8A 2Q09A 2OJPA 4B91A 2IW0A 1Q6QA 4YHEA 2WYSA 3QV8A 1GJUA 5FA5A 2AAAA 4OTKA 3W6MA 4E3TA 2XGBA 4LY8A 1E4IA 1TR1A 2ON3A 5EY5A 3SGZA 3RCYA 2NWSA 1CIUA 1UZHA 3S2JA 1TIMA 3AUJA 4IXHA 2WJZA 1W9BM 1Z9AA 3FK4A 3QMRA 2WZEA 3GAKA 2HVMA 4GUJA 1GCYA 5HQEA 3MSGA 4MNKA 1PAMA 3H4WA 3RCMA 4MVAA 4IIFA 5HJXA 1BKHA 1S2AA 1VAHA 1HKVA 1FKXA 4K1WA 3SBFA 4O4VA 3W82A 3BANA 3THCA 3IRSA 1HJWA 1DIKA 2XFWA 3OYXA 1DIDA 1UP3A 4QXIA 3TSMA 3ID7A 1UMLA 1POJA 4RR4A 1FWIC 2E7FA 2WMIB 3EX4A 1MSSA 3LRKA 4QG9A 3VDBA 3WJXA 3AROA 4AIBA 4CU6A 1K1DA 3ZVHB 4W9TA 1ME7A 2CHRA 2ACRA 4XG1A 3II1A 3D3AA 4HGXA 2CERA 4W5UA 2XN1A 3FXYA 5DMNA 4N9EA 1IGSA 3S2LA 1ZLPA 2ZX9A 3NVDA 4HK6A 3DYOA 2G3NA 1LT8A 2Y7DA 3KVJA 5EMMA 3D46A 4LF1A 2EG6A 1M7PA 3CHFA 4HPNA 2WCAA 3EOEA 4NNCA 3W29A 4QDWA 4K36A 3WK3A 1XCXA 1U1JA 1EJ7L 2VZUA 5IDIA 3AMGA 1R3VA 3EWWA 3VFLA 1QW8A 3PBMA 4PRWA 4H19A 1DJNA 3O15A 1RQBA 1UD3A 1A5MC 1KKRA 3CZ8A 4FXJA 1S38A 4REQB 3WQ4A 1K9EA 4ML4A 4XV0A 2H8XA 4LS0A 5U4NA 2FPTA 2J7GA 1XRVA 5DMYA 3D5HA 5G1TA 5DY3A 2PDQA 3NZGA 2AQVA 4A2SA 1KV5A 4IGNA 4QDPA 1SJCA 1JF6A 2W4XA 5FKYA 4MPKA 1TMHA 4DJFD 2GJRA 3DEQA 5DT5A 3A9IA 2HROA 3O7UA 4FSAA 6REQA 3VGEA 3HPFA 3ITYA 1HP5A 2Z6JA 1XYLA 2GSHA 4GY7A 3OG2A 3QMSA 4DF2A 1TYGA 2J79A 1RD5A 1XLAA 3QGKC 3GYCA 2PF0A 1BVZA 1F9CA 3MVIA 1T8XA 3N15A 1QNOA 3OEXA 3OVQA 3RX3A 5H8MA 1LJYA 4DUOA 4HNCA 3SN1A 2X2YA 2HK1A 4IGMA 4TU1A 2IQDA 1E0UA 1YYAA 2YCEA 1HF6A 3O2LA 3VA8A 3ALGA 5K9DA 2W92A 5IBXC 4Z2IA 1IWPA 4V27A 5IBXA 1TWIA 1ZL1A 5DY2A 3VK5A 4RXGA 3AZSA 3MUCA 2ZRWA 1MO0A 4DAFA 4FAMA 2OSWA 4Y9PA 3G1DA 3KX6A 3CWNA 3H2NA 2JK2A 3RJYA 4UB9A 4X61A 4MB5A 2YW4A 1GORA 1V3IA 3UFYA 1V6XA 2WPBA 4EP8C 5FF4A 2ZRZA 4I9JA 4AQLA 1OGGA 2J75A 4NRRA 1ZBCA 1J01A 1H60A 4NZ1A 5A2BA 2WMJA 3V36A 4RE4A 4UOJA 4IIHA 1JR1A 1U33A 4NAFB 2NQ9A 2CU0A 4POCA 3M5VA 4DM1A 3SR7A 2NWRA 3AU6A 2VR5A 4A29A 1WOAA 2POZA 3C5QA 5T9BG 4DBUA 2I16A 3B3DA 3SADA 4LBUA 1AH0A 1KRMA 9XIMA 4UWMA 4HJWA 3CAKA 4B5TA 8TIMA 1QI2A 1TPH1 4IMEA 1G1YA 2VX4A 3T44A 3VMNA 1AQ0A 1TELA 4PB5A 3R79A 2EJAA 2HE5A 1D3GA 3EOLA 4UR8A 4DO4A 3KRSA 1HZYA 3XINA 5DRIA 1K8YA 1Q6CA 1BD0A 4JN6A 1KFKA 4P8UA 1F07A 1NOWA 3SZ8A 4UTKA 3G1AA 5AHMA 1OX4B 1JDFA 4GUGA 2VD9A 1FH8A 4PUNA 2AKZA 3S2MA 5A6MA 4EWJA 3C8FA 4GYFA 1M3UA 3P81A 2Z29A 3ARUA 2PTDA 2Y63A 1OEPA 3K8LA 3N6JA 3KLKA 1LQAA 5A95A 1LQ0A 1YEYA 4O0ZA 1TX0A 3B9NA 1UH3A 3W7NA 3NUKA 5DMMA 2VC7A 5F1UA 3C2FA 3CZKA 3P82A 1K9DA 3OZOA 1XM3A 4KBXA 3LGDA 3TYBA 3WNMA 2C71A 4WOQA 1EL3A 1V3JA 4HU4A 3BDKA 3VKDA 4JD4A 1VHCA 4XIMA 2AKMA 5D2TA 2WB5A 3WDJA 2RAGA 2DUXA 3MP5A 3L12A 3BGGA 4NI3A 1OFPA 2WQPA 3L5MA 1GQNA 3KEHA 2EPOA 4L56A 3U57A 3SCOA 4FI4A 2C19A 2PC4A 4I7WA 3GW3A 4PZVA 1A5UA 2Y4SA 3ORWA 4ATWA 4BWLC 2OQYA 2DIKA 4BWLA 2VURA 3HIJA 3MMWA 1XBVA 5HMFA 2FTPA 4W5ZA 3ABZA 3CIWA 1W1PA 1QNQA 2I5QA 1G4EA 2CZ5A 3LXCA 4UTIA 3W4RA 4QNEA 4YL2A 2WJFA 3L4UA 3MO4A 2PDJA 1F3EA 2VRKA 3NQVA 4HA4A 1QBBA 1NEYA 3LLXA 5CGMA 1G7UA 4AFYA 3TU9A 1EJWC 2PUZA 1HUVA 3H4XA 3NEVA 2A1YA 4P7QA 1XX1A 2KX9A 3G6MA 4LCRA 4O19A 1R3SA 3TWBA 4QJ5B 3STCA 4P61A 1BWLA 4Z17A 4M0XA 3H21A 4JNYA 1RCOB 4UMBA 3BGJA 3M44A 1BHGA 4AEFA 3GWQA 1DJHA 2ZZ3A 1VCFA 2JF7A 4FNSA 5L6UA 2E4TA 2WVUA 4GBUA 2DQWA 3CBWA 2Y0FA 3GH7A 2C16A 1VQTA 4XAZA 4Q8NA 1EO5A 3WELA 3A24A 4LVBA 4P7OA 1QW7A 3QW3A 3TR9A 1B3WA 1M6JA 5IFTA 1XIMA 3GDLA 3RO8A 3S1GA 1OT2A 3QV6A 4CNPA 4IXXA 4FX8A 3T0TA 4G6CA 1CZ1A 1V0MA 3I3EA 3K46A 3UXLA 2QNEA 4XZMX 2QGYA 3KCJA 2WCSA 2VR4A 1LRQA 3ZR5A 4O1EA 3VVGA 4Q4SA 3TQVA 4EOUA 5AOUA 5KTLA 4JYDA 4QJ3B 4US6A 3ZM8A 1CGTA 4HMCA 4JTSA 3L4VA 2JQXA 2OELA 2ISSA 5AY7A 5XIMA 3PG8A 1QI0A 3V35A 3EEZA 1QASA 2PTZA 2E0PA 3GC2A 4U2ZA 4F0KA 3NZRA 1J12A 3EPMA 1TV8A 3S5NA 4UTHA 4JTKA 1OFAA 3VNYA 5BNKA 1RH9A 4LS1A 2E1WA 4JYFA 4KQNA 1XYAA 1OF8A 2FTYA 4TTGA 3WDPP 4AEEA 3DBPA 4JCMA 3GDTA 3WD2A 1BQCA 1M7XA 1C9WA 1QUMA 2A3EA 1JCMP 2GOKA 1S46A 3THUA 3BOLA 4GX9A 2CBJA 2BHUA 2CXEA 1QNVA 1CGYA 4AY8A 1X96A 3QY7A 3L23A 3VYLA 2BOFX 1OD8A 4D8LA 4H8NA 3CT7A 3MS8A 4H9YA 4FX7A 1UD8A 1QPKA 3W7HA 4HU0A 2FKPA 3ZQ9A 4ZCWA 1D8CA 2CWNA 4PMXA 2R14A 3PFRA 3CGTA 1K4HA 4AZIA 2C1HA 4XKYA 1K02A 3U6WA 1EJTC 1WZMA 4EANA 2Z2BA 5CZJA 3UZZA 4PMYA 2PP0A 1CXKA 1OC7A 4N6FA 1XIIA 4CCZA 4ZSTA 3BAJA 5JVLA 1H63A 4Y96A 3KP0A 1DQXA 4NZCA 2O55A 3S1WA 1TZ7A 4MJMA 5A6KA 4GRSA 2E8YA 1U30A 3Q58A 3BG9A 3IWPA 1HKIA 3TYAA 1E73M 4EACA 1K6AA 4KW2A 4U2YA 4AIOA 2X7WA 4NY2A 4I5RA 4C6OA 2CFFA 3WLNA 2YDQA 2FZNA 4R85A 2ZZ7A 2AQWA 4QGCA 1CXEA 1K8CA 2OEMA 4LY4A 1Q5MA 5HA7A 4WD0A 3QHOA 2PZNA 2VEGA 1HKMA 3MMDA 1NDZA 2EG7A 3ZJKA 2D24A 1SFSA 4ZQRA 4J3VA 5FIPA 3T05A 1AL8A 1ZNNA 4UTUA 3A6OA 3GHSA 1BQGA 4PL1A 2VWSA 3WNOA 1ISWA 1JD9A 1LLWA 4H01A 1LBLA 3S1XA 1OINA 3RAOA 3QV9A 2X41A 2IKHA 4HYVA 4R9XA 4YTSA 2PBOA 1JD7A 2GGHA 5XIAA 3G1FA 4XAFA 3F2BA 4KIEA 1SYTA 2P3ZA 1UUOA 5HNRA 3CV1A 3E3HA 1MI3A 4DJED 3W84A 2VX6A 1XLLA 2QJMA 7CGTA 3LXBA 4AC7C 1US0A 4Y9NA 1O68A 3GUWA 1XP3A 1G01A 1VZWA 4S2BA 3ARXA 3C2VA 1IQ8A 3VNKA 3ICJA 1KXHA 1QWGA 3ZOAA 5F4WA 5K9CA 4RNHA 1SJDA 4F0MA 2BXYA 1FWGC 1TPB1 1B3ZA 4IPIA 4KEVA 3E38A 2DUZA 3LHYA 3AIVA 3BZGA 4JN7A 3F4WA 1Z6KA 3AXKA 4DO5A 3K4AA 3P0XA 4C1LA 1EJSC 3K2GA 2X0SA 3BJTA 3FS2A 4Q4MA 3SCNA 3NVTA 3F4DA 2PWGA 2YBTA 1C7SA 4KRUA 4LAMA 1QJWA 1SW7A 1Z89A 3FYPA 3VD5A 2XINA 1W8GA 4ATLA 3W24A 2YZRA 3KL5A 1V3HA 4O1DA 5E9XA 5GQBA 3UCQA 1DIOA 1JCXA 5I00A 1EP3A 1W2VA 1ICQA 4M51A 4X22A 3UZYA 1UD2A 3FKRA 4OBTA 4GYPC 3S46A 3QXBA 1D7FA 1UC5A 4GYPA 4QEHA 3WX7A 4AZCB 2HZGA 1AJ0A 1F61A 2XGZA 4L65A 3LTSA 2O9OA 2J7FA 2P5NA 4GUFA 2P10A 1DL3A 1C92A 2VFHA 2HPMA 1HTIA 3ABSA 4J35A 1G94A 4GFIA 2J27A 3RNDA 5AHFA 4NJKA 2YLLA 3AO0A 4BFAA 2NW0A 1NWRA 1IXNA 1C8VA 2OT1A 4AHPA 3DHUA 3TDFA 1N8FA 4MUZA 3PHAA 5L9FA 1CNVA 4JTHA 1F76A 3PK7A 5CAHA 5FF7A 1OK4A 2HQAA 2E5CA 3W7IA 4HZ6A 4W7VA 4TTUA 4EAYA 4R9OA 2ZICA 4PRTA 2OZ3A 2ODOA 1H0GA 3VD9A 2PMQA 4X9YA 3ONCA 4DBWA 2QUTA 1FVPA 3TA6A 1L2QA 3F2CA 4HB7A 1XL9A 4ERIA 1NWSA 2ZX6A 1OT1A 4U3AA 4Z0JA 3AZRA 4CQBA 4KERA 3GIPA 3ISIX 3BCFA 1TE1A 3HMJG 1I0BA 2WMKA 1ZBKA 3QKZA 1BRLB 1OJXA 1XIDA 3EX1A 2QPSA 3W7JA 1IHIA 1HIZA 1TUFA 4TX9A 3CUFA 3WBWA 4URIA 5HBFA 1J11A 4NYUA 1N55A 2VX5A 3F5JA 3LHUA 3BCDA 4DZIA 2J24A 3VILA 5IHRA 1Q65A 2A6LA 4O52A 4GGHA 1MW2A 4OECA 3SY1A 4NIRA 2OX1A 3LDVA 2D2HA 5FL1A 1UASA 3OBAA 3MI3A 4S3AA 4UZSA 1SM9A 3ZFHA 3OA3A 2DZWA 1IZKA 1I6NA 2VDGA 1R9XA 4FK9A 5F2LA 4S3DA 3GG7A 1EGZA 1K6WA 8A3HA 1E3XA 1ZQ5A 5H1WA 5C5YA 4PSRA 5ABHA 2PDXA 1XBYA 5RUBA 3KE0A 3QZAA 3W7KA 2DY3A 4LXFA 4O11A 4L80A 3TN3A 1F3XA 4Z1DA 2P0OA 3AIBA 1RBOB 2XWDA 4G2DA 1EUNA 4MWAB 4GQBA 5LGXA 4CNTA 2XIQA 3AFBA 3M5ZA 2CC0A 4M8UA 1QBAA 3VE7A 3C86A 1WE5A 4JL2A 3GVWA 3TJXA 2F2KA 2YZ5A 1MEWA 1W2PA 2HK0A 2OLHA 3PB2A 3S9YA 4AZ7A 3MDWA 3TTQA 1A50A 4PMOA 2OKOA 2ZA1A 1HO1A 1A5BA 4H8HA 1Y8BA 2DZSA 3W7MA 3S6TA 4LAUA 4IJRA 3OIXA 3DC8A 3T55A 1TKKA 4XQ6A 4X60A 1J2WA 2V3EA 1G5AA 1KWGA 3LA4A 5LIXX 4C65A 4S38A 4CNNA 4IPLA 1YDOA 1FH7A 1DJIA 3E74A 4WY0A 4QLKA 3VO0A 3W22A 3IJQA 3KTCA 4RDZA 2CEQA 2PURA 3LTYA 3PBWA 3HURA 1S5MA 3KVLA 3TZNA 4FNPA 3MPGA 4GCXA 3RU6A 2Q8XA 3CZJA 2V67A 3GY1A 4YCOA 2WSPA 4WKAA 2QHAA 3S5ZA 4F4RA 1AQMA 1XLGA 3EPNA 4Q8TA 1CXFA 5TD4A 1Q4WA 3NTYA 4O17A 5H91A 1R2RA 2UY2A 2AL2B 4Z2LA 4G7EA 1XIFA 2VKZG 3WIJA 2DIJA 4EPKA 4QJ1A 1OABA 3KBJA 4N9BA 1A47A 2WNZA 1FFQA 1ZHAA 4I7UA 2HEJA 2NXHA 2J6XA 1KXQA 1RCQA 4Q4KA 4O10A 1BVNP 1W5NA 4OZOA 4HCHA 2NV9A 2ZUTA 1Q63A 4M29A 3SRFA 5A6BD 4DY1A 1FX6A 2A4AA 2YCKX 3NXLA 3SCPA 5I78A 3H2FA 2VELA 3L7RA 1B30A 5JH2A 3M0XA 4JIRA 4P7RA 4XVDA 2CESA 1KM3A 1JXJA 4J40A 1XLFA 1TA3A 3BK0A 2NX9A 2FVMA 4JX5A 2BB0A 4E4FA 1EP1A 2D3LA 2BOEX 5CEWA 2J74A 1H2JA 2DH2A 2PF8A 1PTAA 2FZBA 3E0LA 3LS9A 2QMKA 1OCJA 3GBEA 3WQ6A 4CD4A 1KA9F 4AX6A 3S2NA 4LEFA 1GOOA 4AY7A 2DZBA 4A22A 2YSWA 2OYKA 4XUYA 3CT2A 4AVOA 1YHTA 3O06A 4P7LA 3W7EA 3GDKA 3GXMA 4ERAA 3NL5A 2OSXA 1JYWA 2YX0A 4JQ3A 1A5AA 4PCFA 1MXGA 2PU1A 1A0EA 3OLGA 2I17A 1XLKA 4MYXA 4RNJA 1WA3A 5BU6A 3LRMA 1CCWB 3WL0A 3VCCA 4DYEA 2ICSA 4GABA 2OG9A 3VC6A 3WLRA 4L6HA 3LBCA 3LYEA 5FI8A 1ZAHA 4W8AA 2J4GA 2YFOA 4M5PA 4KWUA 2PEVA 4IM4A 1V3MA 1MEHA 4HNOA 3T7VA 5JBDA 3WQDA 1DXEA 4LW7A 1EJUC 1E15A 2QJNA 3VKCA 3UW6A 4ICCX 3A3XA 2PWHA 4MY8A 3KS6A 2OCZA 6CGTA 3KL3A 2O92A 1T96A 1O94A 3KWXA 4GE8A 4DWSD 2DFAA 3CZGA 5HJYA 2ZADA 2BG5A 3NQMA 2DSWA 4ZO9A 3FGCA 1QDSA 1JPIA 5EBUA 3MC5A 3DFPA 5CG0A 3B0VC 2A3LA 2Y5JA 2HPIA 4KFNA 4HT3A 2ABBA 4J3SA 4XAGA 3A12A 3C6CA 4JQ1A 3CC1A 3U2EA 1YMYA 2GYIA 4HZ8A 3UF9A 4A4AA 3HBLA 1E6NA 1L8NA 3W81A 3M07A 2XFRA 4KWVA 3G8EA 4JTEA 2O56A 3H55A 1LL7A 4L9YA 3UWQA 5A5WA 8XIMA 1A0DA 3WYZA 2GQ9A 1S1PA 4A2RA 3MYOA 1JI2A 2XSBA 2IKIA 3O0FA 5IHSA 1AJ2A 2NLYA 4RX0A 4WXYA 1XYCA 3KVMA 2QULA 3FHQA 4D71A 3BARA 4W8BA 2DSKA 2YLAA 3MSDA 4MNMA 2IMRA 1E40A 4L6DA 1PHQA 3PN8A 3GKFA 1GJPA 2RGLA 3C4UA 4JQ2A 3LB0A 4ORMA 4EF8A 4EPEC 1L9WA 1MNZA 4BQ5A 3B8TA 2W5FA 1J6OA 4A8NA 3AHXA 3W27A 1DBTA 2J7DA 1WKYA 1PKLA 4BI6A 1A3XA 3L4ZA 3NQGA 3VD3A 1OY0A 1RA5A 1SVDA 2NV2A 2X0HA 4EX4A 3A23A 3HJZA 3TCEA 4JPGA 3PUOA 4BJHA 1VFHA 4K2SA 1BAGA 4B9ZA 5DCEA 3SGUA 3P74A 3FEMA 3SDOA 5K4ZA 3DFNA 3SY5A 3IANA 1VCGA 2J9ZA 2NQ5A 1Y5VA 4GYKA 4PBFA 1XSJA 4L1GA 4PUKA 3U2ZA 4DRSA 2XH4A 4PMQA 1VLWA 4IQDA 2OX4A 3R11A 4I8YA 1L6SA 1EGMA 3OIHA 2NSOA 3TYEA 5ABFA 3M0ZA 2YB4A 3C2OA 3GNXA 3C3UA 4UQBA 3ZJ8A 3N11A 1LRNA 2PAJA 4NJJA 4C6KA 1UZ1A 3CHDA 4ORIA 5D05A 2GJXB 4IX0A 1JAEA 5D9PA 3QHMA 2YR1A 1FQ0A 1RAKA 1JG9A 3V1PA 3TN4A 2PRMA 4L6OA 5EMYA 1HX0A 1OCBA 3BG5A 3HFYA 2BTMA 2J7EA 2XHYA 5F4XA 1WZAA 3B9OA 4NU7A 1TPUA 5D30A 2RKXA 3S2CA 1UCWA 4QQ3A 3CYJA 3W86A 1R2TA 4BF7A 5TNVA 1TTPA 3WF0A 4GHRA 1J18A 7ENLA 3AS0A 1D7KA 3QQWA 4NQ1A 2VGFA 2VZSA 1DQWA 3AOFA 4PYSA 3C2EA 4Q4RA 1BYBA 2QF8A 3KOYA 1WBHA 2QV5A 3HGJA 1AQHA 2DV0A 4FS9A 2I14A 4RDWA 3R0DA 1GW9A 3KBNA 1DWGM 2CITA 5BZAA 3LTPA 4RE0A 3LSBA 3VZYA 4NASA 1PDZA 2PDFA 4AZCA 1Z41A 1RJQA 1N82A 5REQA 4GO9A 3SIZA 3ZLGA 4Z2HA 4K8GA 4Q4PA 5KSWA 4O28A 3P61A 3SJNA 4Z1YA 1HN1A 1OM0A 3AXMA 3IUIA 4JNMA 3E5BA 3S83A 2WQDA 2ZTJA 1A5CA 4NXSA 4DPQA 3VGBA 3A22A 1B54A 1RJPA 3OQEA 1ZSXA 4NG3A 4BR1A 3VNLA 3ABQA 3GC5A 3KTXA 2Q6ZA 1A5NC 3B06A 4TX6A 4INFA 2E9BA 3GTXA 5FJPA 1E6QM 3HMCA 4MKVA 3N4FA 1AA1B 1Q6LA 4ZQMA 4H04A 1GGOA 1XYBA 3T2QA 3DYMA 4PMUA 4ZEPA 6TIMA 3MW7A 2HNHA 1GKQA 4ZE4A 1ZB5A 4E2OA 3VGGA 2BS9A 1W6TA 4KRZA 4KIRA 4JQAA 4OOUA 4WRHA 3E0FA 3UJRA 3RMEA 4DF1A 5BOEA 2Z2UA 1J0ZA 3IGSA 4A3YA 5I3FA 4CD5A 5FL0A 1K03A 3GX9A 1KFEA 4HMNA 4U3CA 5D33A 4IFRA 3ITLA 1WAUA 4HHLA 3AALA 1LT7A 3BE7A 3JR2A 4AAJA 4AWUA 4ICMA 2ASHA 3EZ4A 2WBGA 1YLVA 3B4YA 4CEUC 4UQAA 1TWSA 4UR7A 2NVCA 3P0WA 3REQB 2I7GA 3KS5A 3VNMA 3S42A 1X7IA 3M0JA 3T0CA 1MRAA 3VM5A 4WSHA 1C29A 4QISA 2IXUA 3TH6A 1PS9A 2VFGA 1K7XA 5BRPA 4HD5A 1D9EA 2WLYA 1VBGA 3C0QA 4QROA 1WXJA 1WXZA 1IYXA 4FA3A 3EWBX 1OF6A 1ZRQA 3P62A 5E9AA 3RN6A 3QC0A 4IUGA 4M1RA 5I3JA 3PZQA 1J0JA 3MUAA 5I3DA 3I4KA 1IXQA 1UQYA 3QQ0A 1QOXA 1XRSA 3RRXA 5HNNA 3NIYA 2E6DA 1YE6A 3KCLA 3WLTA 4FLRA 3FN9A 1VGAA 4NNAA 2D2GA 3VFCA 2PDGA 6ALDA 4QJ4B 4QAIA 3T40A 3P2VA 3KZPA 1W5QA 4MLJA 3W76A 1DIEA 2OWWA 5C9WA 4N02A 5E93A 1QI5A 1WKDA 1EXBA 1Q6EA 4QBXA 3LENA 1FWNA 2DQXA 1SUXA 3EWDA 2XG9A 1RSCA 3SCUA 1X6NA 3KL0A 4DNHA 3RO6A 4M6VA 2QCDB 4B5NA 3TKFA 3H2OA 2VWTA 3AWNA 1QMLA 2GDQA 1I2NA 3RPTA 4QSFA 1D2KA 1OHLA 5CZSA 1T0OA 1FRBA 1A49A 4YYCA 2EGZA 1YBQA 2Q01A 3P14A 3CV6A 3W25A 2C0HA 2XPKA 1MQPA 3ENLA 2ZX7A 3IJDA 2V5JA 3DENA 3QRHA 4GIEA 4DNMA 1P43A 5D9OA 1TFVA 5DBTA 1TPWA 4DXKA 4HBKA 1J0IA 4Z1CA 3G1YA 1WYIA 1Y7VA 2NUYA 4H3DA 3TW7A 1XLEA 2RGMA 3D6NA 3F7JA 1XSKA 1P4CA 5FEWA 2PZ0A 2XN2A 1JGIA 1P6WA 3W38A 4C6MA 3DHDA 2E3ZA 3PWAA 2Z26A 5G1MA 4LOCA 2J9YA 4YCPA 4NXKA 1UR0A 3WK1A 2BMBA 4NHVA 3VDHA 4PCSA 1IZJA 1C93A 1V02A 1R3YA 2POTA 2FTWA 3M4HA 5F7UA 2AMXA 4Y90A 5AYYA 5HATA 3HO8A 4GOAA 4DJFC 3W6LA 3WLHA 4DJFA 5BXSA 2UY4A 2HS8A 4XO7A 3CIVA 1KFCA 3EKLA 1EPVA 4E8DA 3R94A 5C71A 3MUXA 4TV5A 3CM4A 4YXGA 5HNTA 3NQEA 2C8NA 4DO6A 1FOBA 1GVRA 1ZFJA 4XSLA 3I6TA 2EPHA 4JIEA 1LUCB 1NU5A 4MM1A 3BGAA 4PFHA 5DXYA 5E70A 1SU5A 3URQA 5KINA 1OK6A 3PY2A 4LUJA 4Z42C 1P0EA 4Q8WA 3UR7A 3PZOA 1SFTA 2HCVA 3NYZA 4RL3A 3DI1A 1BLIA 4HK5A 2B7PA 4IJCA 1K3UA 3GG1A 4NRSA 3WG6A 3AS1A 3GO2A 4YTTA 2OEJA 1SZRA 1QHZA 1V8EA 4CVWA 3TFCA 3NSMA 4AVFA 3OBKA 3T0BA 1X6LA 1XQLA 3AJ7A 1EF3A 2WLZA 4AIEA 1GOKA 3ARSA 2YXGA 3POHA 1TWWA 1J5TA 2JBMA 1QOQA 4AMCA 5GPRA 3H54A 4M24A 3TAKA 1BWKA 1H7NA 4IGSA 1AFSA 4GJIA 1KD0A 1PUDA 3GZAA 3W87A 2PDLA 1W1ZA 3EOUA 2DT0A 3W73A 2XN0A 2VRQA 4MYAA 1QR7A 4NUWA 4LS2A 4IT1A 4JIQA 4PB4A 5CSYA 5G4HC 4C7GA 1DORA 1AH4A 2O0TA 1JCNA 4PUMA 4RPPA 2B0MA 1XGEA 3MI6A 1JCJA 1J0HA 4B9YA 4GCAA 3NQCA 1PCKA 3RLUA 3S5SA 5B7YA 2CXGA 4W88A 2J13A 4RE2A 2Q8ZA 2WZMA 3G18A 4U33A 2HISA 1L0PA 4PTDA 2ZIDA 1XWYA 3OJGA 2BOGX 1IIHA 1Z42A 4H6KA 1UWTA 4UTMA 2VEPA 1OADA 4WHBA 4H9TA 3C56A 4KKXA 2ATMA 3TQPA 1C8QA 3E5PA 3MSRA 2FJKA 5CG7A 1MXSA 4B5VA 5DQPA 3ANVA 1C8XA 2HVNA 1EHNA 1OD0A 4JZ5A 3W2JA 2PCQA 4AYGA 1OCNA 4FOUA 2DGAA 3DBNA 5FJUA 2ZUMA 2YL8A 2VJXA 1DKWA 5AYIA 3NNTA 2DVXA 3MT1A 4D8AA 3CV2A 2ISFA 3LMYA 4AD1A 1JYNA 1ZJAA 1W9DM 1UKTA 3G0XA 3ITCA 2ZA2A 2CIPA 2BY3A 1W3HA 2PLMA 4X0NA 4QCFA 4HKPA 5CH9A 3SQMA 3L0GA 5I6SA 1PX3A 4MUPA 4IG2B 5GNXA 3WBYA 5FESA 3MZ2A 3L65A 3U0HA 3MQTA 2WSKA 3VZZA 2VDHA 4UXDA 2V68A 3CHEA 1P1XA 2ZA3A 3LPFA 4O8RA 3UGVA 1FWDC 5BXTA 3E2SA 4TQTA 4JTQA 4S3CA 1VYSX 4O53A 2FVLA 7REQA 4L61A 4GXMA 1GYNA 4H7CA 3BV7A 2Z1KA 5BRBA 2QVNA 1UQZA 4DYJA 3CMFA 1B3OA 4AVNA 2NVDA 2F7FA 4U4MA 1NARA 2YW3A 3HZ3A 4ZL1A 2ZYFA 1LQ2A 1PSCA 3VGFA 2QS8A 4OBRA 2V5KA 5BOOA 3N4EA 5CSRA 4LYRA 3KW3A 4LC8A 1B3XA 1V0NA 1TPDA 4S23A 2WMHA 3LCHA 1R9YA 4FLQA 1V02E 4Q22A 4AH7A 3UWWA 4GWEA 5E09A 5EBAA 2OPJA 4PMDA 3DN5A 4EAMA 3M7SA 3LCGA 3RLVA 2V82A 4B4HA 1LOSA 5CXPA 2QCNA 4UQ9A 1PZ1A 4DBEA 4JQ4A 4O13A 3QGAC 2INZA 2PRHA 2JEPA 3SCRA 3WMLA 3PULA 4LVDA 2VD8A 4CU7A 1MMFA 4GO8A 4RZ5A 3E96A 4KGJA 3VKKA 4ERGA 4D6GA 4E8CA 5IOBA 2QDHA 5JBEA 2GFTA 1A5SA 3V7PA 4CNSA 2C7FA 2DT1A 3EB2A 4N4PA 3W1RA 4BA0A 3PBUA 1NTHA 1LBMA 3WLQA 4HPXA 3TXZA 1KC7A 1PIIA 1E1CA 4JL1A 5A2CA 4PBEA 4UFLA 1GQLA 2X09A 2PTXA 4PUWA 2UY3A 1BXNA 3UR2A 4JTIA 3G24A 4I8DA 6XIAA 3CU2A 1AW1A 4L9XA 1LZOA 4HZMA 5EA9A 5C2GA 1FWSA 2ISDA 1TQXA 3DU0A 4R3UA 3AYVA 1XDJA 3EWYA 5AKQA 4XBJA 4IH3A 2D73A 5A6AA 1WZKA 1HW6A 2VTFA 2XH0A 1ZAIA 1Q85A 2E1DA 1UKPA 1TSIA 5AVNA 1NQ6A 1H51A 3O16A 3E6EA 2F8QA 2H6RA 1BKSA 2EKCA 3O6DA 3GZ3A 4YIWA 4A8IA 1PO9A 4KH2A 3LPPA 1HJQA 3TFXA 3VMOA 1L6GA 3T0DA 4WGXA 2BVWA 4Y7EA 5U7SA 2YCLA 5GJNA 1F6YA 2VR2A 3IRDA 4P5UA 3EXRA 3F5KA 3A47A 2GVJA 3B4UA 2HSAA 5LIKX 2X1UA 6REQB 4WSKA 4A6GA 1DJWA 1V5XA 5M1TA 4UTFA 3NQ2A 4EWND 1R0MA 1WO2A 4QHRA 3VDAA 3LNMA 1RPKA 2NUXA 4IIEA 2ZUNA 5EMKA 2JE8A 4RV8A 2WK2A 1U1HA 3SRDA 2REQB 5TF0A 3QLLA 2VC5A 3W01A 2B7OA 2E40A 3B8DA 3DHFA 3I3DA 4JN8A 1FH9A 3KCOA 3GS6A 3UVAA 2QGHA 5ECVA 3P6LA 3PJUA 1GVEA 4XKMA 4IICA 2BDQA 3P7YA 4PSPA 3SSJA 2R1NA 3JS3A 1RVGA 2WNQA 4DHGA 1HO4A 4J9JA 1XR2A 3POCA 3T6CA 1OGSA 3N1AA 5IRPA 5BMXA 3WLSA 1V0KA 3ZSSA 4E2DA 3WUFA 1TE6A 3ARPA 1VH7A 3BO9A 3VIHA 1LM1A 3QFWA 1ODUA 3UBPC 5HMSA 2VXNA 4OUEA 5AC4A 4K8HA 1O5QA 4OBSA 1Z7AA 1EEPA 3E2VA 3G5EA 3XISA 3D47A 3CUGA 3S9ZA 1DE6A 4A35A 2YCIX 4JBRA 3PUGA 1AQFA 2ZRYA 3CJPA 4D6JA 4N6EA 3S3GA 1H7RA 1P0KA 2PGEA 4NT0A 3WD1A 4IJBA 2XGIA 2PS2A 3MKCA 3G0SA 3MWCA 2LLEA 1HKWA 2C18A 3QBUA 2AAMA 2XFFA 3GNOA 1NDWA 1Q8AA 1J9YA 1TQJA 2W0UA 4B3LA 4Q32A 4Q8QA 4AZ6A 1JQVA 1RUSA 1TVLA 2BZNA 5FAGA 2G3FA 3WLLA 4DJEA 4JEJA 4M7SA 1KQYA 4MDOA 1VPQA 2GGGA 3WLJA 4E2BA 4CLMA 1Q7MA 3WQEA 2XVPA 1I1WA 3B05A 1SSDA 2ZWYA 3N17A 3BW3A 3HQNA 1UR2A 3CO4A 4QTGA 3UNTA 2PDPA 1UWSA 4LC6A 3H2CA 1KBKA 3SB0A 3J7HA 3PTDA 3UG4A 5LIWX 2AQOA 3SN0A 3OTRA 3TONA 2HS6A 2QCEA 3PB0A 1GOMA 2VFIA 3A9BA 1AK5A 1NDVA 1NP0A 3L5LA 1QOPA 2V38A 4AXKA 4JY8A 2EJ1A 4UBPC 5HQMA 1C90A 1XLJA 2VC9A 4GQQA 2V5LA 4LFYA 1W3LA 4HSNA 3WCZA 3IUHA 3DCPA 3NM3A 7A3HA 1E55A 4MTVA 1KCKA 4DI9A 3W1PA 4OHQA 2X1IA 2YDRA 3GR4A 2FFCA 3DXIA 4MHBA 1MQQA 3KAOA 1X98A 3O07A 1HL9A 3L0NA 4EXQA 3KOZA 2VENA 4JFUA 3FJ4A 1L6YA 4ZB5A 4ZOBA 3K1GA 3LHTA 3BLLA 3R0KA 1UW9A 3LM3A 4S3GA 4JOMA 2P50A 2O7SA 2PGFA 1FBAA 2GVGA 1TWDA 2WSRA 3AUOA 1J4EA 3NWRA 4FPSA 2R8WA 3QV7A 1X6UA 4JKKA 3LSCA 2PA6A 1RQHA 1Q3NA 1ISZA 1FCBA 1H62A 2KAUC 1E51A 2C15A 2XIIA 2XSAA 3W7QA 3MU7A 4K7VA 3ZLFA 4HPGA 4NX5A 3PZVA 3OZMA 2J9XA 4LVGA 4MY1A 4DB7A 3GLCA 4YHGA 2V2DA 4J27A 1TR9A 3DUGA 4GVFA 4H7VA 5AFDA 3DX5A 3THAA 1EKOA 3C8NA 1TMLA 3HPSA 2AGKA 1R3RA 2E25A 2ZDSA 1S3HA 2V2HA 3UVIA 4HOZA 3FAXA 1PWMA 1TJRA 9CGTA 3QEZA 2YYTA 1X1NA 1UWUA 5M2FX 2X0YA 3JUGA 1CTNA 3P8IA 1WB0A 4PRRA 5C9XA 4EXBA 4BF9A 1A5LC 1HL8A 2GOUA 3DFOA 4HTBA 1XIBA 2FZDA 3IV3A 2PCEA 4NP7A 4CQ9A 1C7TA 1XBZA 1KFLA 1F4AA 4XZNX 3BJFA 4KWSA 2GK1B 2QDEA 2Y5EA 4L4PA 1NWUA 3VIFA 4H9MA 2VO5A 4KESA 3EPOA 1GK8A 3VIPA 2YCJA 1RY0A 3TC6A 3SIMA 2Y7EA 3WJWA 2EAWA 1HFBA 1PIFA 4ACYA 4C7FA 3OW1A 1DVJA 4H2HA 4DUXA 1SZEA 4CVUA 3APYA 2QCCA 2ACQA 1ZJBA 5MHBA 3WSUA 3W7DA 4CCEA 3MUIA 1Q2RA 3T9PA 5HPCA 2Y88A 3GBDA 4OKDA 3LGEA 3M0MA 4PR4A 1GVOA 3A64A 4EPBC 1R3WA 3E1F1 3KTSA 4LYQA 2INFA 3DG3A 1OFOA 1DHPA 1JFHA 1TVNA 4AW7A 3CH0A 3PPFA 1OIFA 4RV3A 3MHGA 2BX7A 1ZAJA 1WOBA 5JMUA 4ZGYA 3HGSA 1C9DA 1TTQA 3MBDA 3STFA 3EA1A 4D1JA 2WHJA 1GQIA 2OXNA 2QZRA 1Y65A 3LV5A 2PSNA 3NOYA 5T9CE 3W1UA 5C9UA 2D2OA 3BICA 3MP3A 3ZYZA 4XISA 2NX3A 3P93A 2WO5A 4GZJA 1VD6A 2CKSA 1RV8A 2WSYA 1ZBWA 1XUZA 3VXGA 1U5JA 2FGBA 3IV8A 2FHFA 2VMFA 4CUCA 1ADDA 3OBEA 3GTHA 3L2LA 4W87A 4XKYB 1VKFA 4PGLA 4YWSA 4D8ZA 4RCXA 1KFJA 5G2WA 6A3HA 1E0WA 2ZRXA 3WMBA 3EEGA 5I02A 2OTDA 4KETA 1H7WA 1KKOA 3DECA 1ZALA 4Z2GA 3CB8A 4D72A 3ME3A 5M17A 4YTRA 4K3ZA 4GY0A 2GUUA 2WXDM 1EB3A 3WEZA 3WQVA 1WQ5A 4IQJA 3GDBA 3ZVIA 1KCZA 1GOXA 3KRBA 1JYVA 3GSMA 3E0VA 2IPGA 1SSGA 4HN4A 3HPZA 4U31A 5CC3A 5A6BA 2A7NA 2TODA 3ATYA 3G1SA 5A3HA 7TIMA 4ZTYA 2OMAA 2X8RA 2TSYA 4ZQPA 1XPYA 2XSXA 2VZOA 4Z2JA 1ELSA 5FF0A 2ZZ4A 5GVJA 3QM3A 4CNOA 4ILSA 3OGSA 2HTMA 5KITA 2BWGA 2VC6A 2ZBTA 3KHJA 1F6PA 3RITA 2B7QA 4XTIA 5HR7A 1UR1A 3UZJA 1F3TA 4V15A 3L5AA 3HG2A 1UPMB 5CCZA 4LV4A 1GOQA 4M81A 1RR2A 1G67A 5JXQA 3VUPA 4DPPA 4A21A 4B4FA 1SO6A 4GIYA 3MKVA 3ELFA 2A3CA 3PTQA 4X9SA 2A6NA 1N8IA 3PTKA 4HHMA 3V4BA 4KCUA 4MG4A 1CXLA 3UA3A 4JTRA 3U3HA 1C3FA 3H4GA 2DEPA 3MMTA 1ECEA 3L4XA 3RR1A 1O4UA 3Q65A 3PZNA 3M0IA 2DIEA 3M7WA 1JXKA 4DWDA 3MJYA 3FNDA 1G9HA 3CL8A 1RK6A 1ZP3A 4LUSA 2QCMA 1CLKA 2ZQ0A 1GZJA 1JI1A 3WQCA 2VP8A 3VIIA 4XZIA 3G22A 5HAOA 4B5WA 3QR0A 2XFYA 1Q7QA 4S3KA 4KCWA 3DKJA 3ITGA 5LZLA 5A6TC 2J8FA 1RLDA 4NI8A 3N12A 2OLSA 5I03A 3RX4A 1N8WA 1PX4A 2EQDA 4MOZA 4LNCA 1C91A 3U4FA 3MCOA 4C6CA 5LA1A 3VDGA 3H7RA 1DTNA 4DO7A 4MNJA 3IJ7A 4B3ZA 2VYOA 1E3ZA 4TIMA 2E09A 5DANA 3WLKX 4F2UA 2XM2A 2ZKMX 4DWSA 4S1FA 3LBOA 4NZFA 3PPCA 4GINA 1JFXA 1FUYA 1WV2A 1Q6GA 1V3LA 4G7FA 4JTDA 5JH1A 3AZTA 3SURA 3QHNA 1S2UA 2FVKA 4GISA 4AISA 1D8WA 3NPWA 1WCGA 3IEBA 2INEA 2WWDA 3FDGA 5PTDA 4QR6A 1VB9A 3QR1A 3BW2A 3I65A 2ZZ1A 3EA2A 2BY1A 4I6KA 4MMWA 2ZX8A 5A94A 5B80A 2VGBA 5HNUA 2P53A 4FXRA 1XLMA 1MFVA 1V93A 4XBKA 2VCCA 1FDZA 4WXZA 1WDSA 3PJWA 4ECLA 2QCLA 5FJRA 1PB0A 3CMGA 3AHYA 1MYRA 2Q02A 5K3VA 1GTHA 1H1ZA 4HA3A 1OX6A 1EX5A 3GUGA 5FF3A 2GVLA 5FSEC 1CXIA 4QS6A 3VOHA 1O60A 3N6QA 3SSZA 4XK2A 2REQA 4O0QA 1TZ9A 4Z08A 5G2HA 4O8AA 4Q4OA 3H7VA