1ZSXA

Crystal structure of human potassium channel kv beta-subunit (kcnab2)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
b'QFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel beta-2 subunit
publication title Crystal Structure Of Human Potassium Channel Kv Beta-subunit (KCNAB2)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 120
structure length 323
sequence length 323
ec nomenclature
pdb deposition date 2005-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1zsxA00
3P2VA 3RX4A 2PDCA 3ERPA 2HVOA 2FZBA 1Q5MA 5HNTA 2AGTA 3O0KA 1EKOA 4PR4A 2J8TA 2WZTA 4JQ1A 4OTKA 2PDBA 3U2CA 2IPJA 2HV5A 3R8HA 2I17A 3RX3A 2WZMA 4ZFCA 1AFSA 2PDIA 1M9HA 3WG6A 3N2TA 4H7CA 3EB4A 3T42A 4YVPA 2ACSA 3G5EA 2FVLA 1GVEA 1LWIA 3Q67A 1QRQA 3G1RA 2DUXA 5LIXX 4JTRA 4GQ0A 2HVNA 4WDXA 3EB3A 3LNMA 3ONBA 1UR3M 2HEJA 2P5NA 4JIIX 2IPFA 4Q7BA 4H8NA 4QX4A 4R9OA 5JH1A 2HE5A 1XF0A 1VBJA 3VXGA 3V35A 2ACRA 2PF8A 5KETA 4LAZA 3WBXA 3BCJA 4XK2A 4XZLX 2PDGA 3QKZA 4GQGA 1X96A 4G5DA 4FZIA 3UWEA 4LBRA 3LN3A 5M2FX 4JQ3A 3UGRA 4DBWA 2FZDA 3LD5A 3MC5A 3FX4A 2PDNA 1S1PA 3EAUA 4QR6A 1IHIA 1AH4A 1RALA 2DV0A 2A79A 3CAQA 3S3GA 3R58A 2VDGA 5HNUA 1PZ1A 1Z8AA 2PDWA 5DANA 3GHSA 3R43A 3KRBA 4XZMX 3R94A 1XGDA 2PDFA 3V0SA 5C7HA 3H7RA 1YNQA 1OG6A 1S2CA 4WGHA 3UG8A 1XJBA 3GHTA 4XZIA 3R8GA 1YE6A 2PDQA 2I16A 1VP5A 2HE8A 3ONCA 3WCZA 4EXAA 1MI3A 4QXIA 2NVDA 1RY8A 4XZNX 2IPGA 3RX2A 1YNPA 4GACA 4JQ2A 1SM9A 3DN5A 5LIUX 2PDMA 1MZRA 3LZ5A 2PD9A 2ACUA 1AH3A 2PDJA 4JQAA 4FALA 4JTQA 2IKJA 2PZNA 2R9RA 4DBUA 1T41A 1EXBA 4ASTA 2PD5A 1T40A 2DUZA 3COTA 3H4GA 4I5XA 1Z89A 1A80A 4XAPA 1S2AA 4QBXA 3LQLA 4WDWA 1HW6A 2HDJA 3M64A 3BV7A 4IJCA 3H7UA 4DBSA 5JH2A 2PDHA 2QXWA 5AZ1A 3WBWA 3CV7A 3CMFA 4LB4A 4DZ5A 1US0A 3V36A 4GIEA 1LQAA 2R24A 1ZGDA 2PDXA 2BGQA 1Q13A 4JIHA 3N6QA 2PFHA 1EF3A 4PMJA 3UZYA 2F2KA 3D3FA 2ISFA 4IJRA 1AZ1A 2IQ0A 4GCAA 2ACQA 4PRTA 2PDKA 1IEIA 4HBKA 4LB3A 5LIKX 1EL3A 4XO6A 3LQGA 2NVCA 1S1RA 4MHBA 3BURA 4XZHA 2BP1A 4EXBA 2IS7A 2FZ9A 3V0UA 1K8CA 1ZSXA 4GABA 1HQTA 3UYIA 4Q3MA 4RPQA 1YE4A 1JEZA 3C3UA 1MRQA 3Q65A 3LENA 2INZA 1R38A 2PDUA 2INEA 3GUGA 5LIYX 4YU1A 4LAUA 1C9WA 1Z9AA 4PUWA 4L1XA 1AZ2A 2PDLA 3UZXA 4JTCA 4AUBA 3MB9A 2IKHA 4FA3A 4JTAA 3LBOA 3F7JA 4L1WA 3R6IA 1RY0A 4YS1A 3FJNA 4PUUA 2IPWA 1PYFA 1Z3NA 5LIWX 4PRRA 4YVVA 4XVDA 1ZUAX 1ZQ5A 3NTYA 2IQDA 3LUTA 5HA7A 1X98A 2FGBA 2CLPA 4F40A 3BUVA 4WDTA 4IGSA 3UFYA 3CV6A 3GHUA 3M4HA 4JTDA 4LBSA 4GA8A 3B3DA 4FAMA 2IKIA 1J96A 1FRBA 1AH0A 4NKCA 4HMNA 4WEVX 2C91A 4XO7A 4JIRA 2FZ8A 4XVEA 1PWLA 2F38A 4JQ4A 5AZ0A 3UP8A 3R7MA 1ADSA 3LZ3A 2IKGA 2PDPA 3DOPA 4ICCX 3M0IA 2BGSA 3V0TA 3GHRA 3UZZA 4WDUA 4WRHA 2PEVA 3O3RA 2ALRA 3CASA 1PZ0A 3UZWA 3CAVA 2PDYA 1PWMA 3WBYA 4YVXA 1X97A 1QWKA 3LEPA
chains in the Genus database with same CATH superfamily
3RX4A 4MWAA 4KWVA 5G5IA 4QSHA 3EWUA 2OCZA 1V08A 4ZSTA 3PZTA 4QJ1A 4UTJA 2YCEA 3PY2A 1RA5A 3UWUA 3PM6A 4MZ1A 3APGA 3BLOA 1FCVA 4WGXA 4KRTA 1QW7A 1LL7A 5I5RA 5I3HA 1A49A 4B5WA 1DJHA 4FS9A 1ONWA 3BICA 3U6WA 2CZ5A 2X40A 1UA7A 1E0TA 4U2ZA 4DO4A 4B2DA 2A7RA 1I8JA 2VDIA 3TK7A 3TYEA 4F0RA 3D46A 3QC3A 4JGDA 3CWHA 4O12A 4JKMA 4AHPA 3II1A 1G7VA 3IJ9A 5HR7A 2VFFA 3MY9A 1KKRA 1OFQA 1WPCA 3S5SA 1UASA 4ZQPA 1EYEA 3R0DA 1W8GA 2JBMA 1RZMA 3Q37A 2QUUA 1UQYA 4NJJA 3EWCA 4TUFA 4GJIA 3CQJA 1Q7ZA 1K03A 4AD0A 3TJIA 4W5UA 3KXQA 4HN4A 3L2IA 3R0UA 4OOUA 2NQ5A 3EWBX 1HXJA 1QO5A 4H7ZA 3A3WA 1KQYA 4GQGA 4QQ3A 4KETA 3ZFHA 1UUMA 2A3AA 3EOLA 1V0NA 1Q6QA 5LGZA 4JN6A 3GVQA 1TYGA 3KDNA 4CCCA 5K7JA 4ROPA 4LS1A 1AH4A 3VOIA 4RDVA 3S3GA 3EPNA 1KFKA 3SEPA 4NU7A 4QCFA 1YX1A 3PBMA 3QY7A 2EHHA 4PCPA 4DI9A 4REQB 3WD3A 6REQB 4YPJA 4ZL1A 4M6VA 3H2MA 3ME3A 1D9EA 4LPCA 3RU8X 3MW7A 3N34A 1XJBA 1TJ2A 2XIMA 2ATSA 4H1ZA 4US6A 5EBUA 3N04A 4C7GA 2W3ZA 2VX4A 4QEHA 3H54A 5BYWA 3JZEA 1LZOA 3UESA 3A21A 5D2VA 1IT7A 3NWRA 1SGJA 1KO0A 4IIBA 1BG9A 2VX6A 3AISA 4PCNA 1QW8A 4U10A 4U31A 2W63A 1DXIA 4GACA 5LIUX 1MZRA 2B4GA 3QJAA 5EMMA 1BXBA 4ERAA 1PO9A 2ZUVA 3WF1A 3L2MA 4B4FA 3WQEA 1CGUA 1QATA 2VFHA 1O5RA 2FH6A 3E2QA 4IISA 3M0YA 3WLRA 5H8PA 1F4AA 4FK9A 2R14A 1T40A 3NJ3A 3IVTA 3B0UX 4UBPC 3BOFA 3H4GA 4B3LA 2AMXA 2ATMA 2NZLA 4NX0A 1C8VA 3M5ZA 1OZMA 2G37A 4JD4A 3E3HA 3GTHA 1H0GA 4NJGA 1Q66A 2YYUA 1QU4A 2QCDB 4WJEA 3BV7A 4IJCA 3NL5A 1IE7C 3TJ4A 2QF7A 4LNCA 4QITA 2Q09A 4IFKB 1C91A 4NZ4A 3N15A 1F7BA 1SMAA 2E1DA 3I6EA 1P1XA 2HTMA 2PDHA 2VP8A 5J8LA 5A6BD 2NUYA 1K8ZA 4H8HA 3IJIA 1U5VA 5CBBA 2BHYA 3S6DA 3ITYA 1HKWA 1UWAA 5I3IA 1G01A 3AYVA 3WJWA 3EWDA 2ABBA 1EF3A 2GK1B 3E12A 4I3GA 3DG7A 1JDAA 3D3FA 2ZYFA 3GK0A 4IJRA 2QCCA 4GCAA 3ABSA 3W7JA 2J62A 1KCKA 5A8NA 2EG8A 4K3ZA 1C8QA 4POCA 2BVYA 3GG7A 3NPUA 5LIKX 3EDKA 4BHYA 4ZO8A 4JKKA 3WD0A 3LQGA 3B9EA 4S3GA 4KIRA 4CD4A 4WXZA 4S3KA 3SGUA 4XZHA 4XIMA 2IMRA 2GOKA 4QAWA 4AQLA 4KT2A 3MSRA 2ISWA 5KINA 1K4GA 1P6WA 3KWXA 2C15A 4EANA 4MFEA 1LOQA 3PG9A 5KZEA 1G69A 1V6UA 3EDEA 2O9OA 5EYWA 5CJNA 1OEPA 1J0IA 1ISVA 3ID7A 3MMTA 4LV9A 4GO9A 1EBGA 1PHWA 3UZXA 3AXMA 5K9XA 1WZLA 3W74A 2PTYA 3F7JA 5A3HA 5CEWA 1B0IA 2E5DA 3GH5A 3KCJA 4UWMA 4RDWA 3MUAA 3NZRA 3G0SA 3S4TA 4LRTA 4DZIA 3PBGA 1ZQ5A 3FDKA 1FWCC 3PP7A 2YXOA 2HRWA 2XVPA 4JX6A 3AU2A 3PPFA 4DXKA 4O4WA 4A8NA 3CAKA 2VFIA 3CT2A 1W9XA 4ZXOA 1J11A 3LY0A 1MXSA 1IXQA 1DPMA 1Z41A 4JICA 4AEOA 3FS2A 4O28A 1AH0A 3E49A 3BG5A 2AGKA 4WEVX 4HA0A 1S5NA 1PKLA 3M41A 3BPWA 4HSOA 2F38A 2BVWA 3LU2A 1Q6RA 3NL3A 3D3AA 2EGZA 2VZTA 2Q8ZA 1F3EA 2ZUWA 3S5YA 1Z7AA 3INPA 4KS0A 2BMBA 4J3SA 3TYDA 3CASA 3MQTA 4L9YA 1WBHA 2QS8A 1UR8A 7XIMA 2G4JA 4F9DA 4HB7A 5D32A 3WDJA 2GJRA 3W02A 4MAVA 1S2WA 4GVFA 4PMNA 4NF7A 2A3HA 4HD5A 3M44A 3RILA 3RU6A 1F76A 4YLWA 5HMSA 4J5NA 5H8UA 2WYSA 3VGEA 2I56A 2C3ZA 3GTFA 4F8XA 3MZ2A 3H55A 2PRHA 1KLZA 4E6MA 2PDBA 1FP9A 3LLDA 3WD2A 4DWSD 3LCHA 1AJ0A 5CJMA 3M07A 3WBAA 3D6NA 4WKAA 1XLKA 4H04A 3S42A 3WH8A 1FKWA 5D37A 3BMXA 1JYNA 3IAQA 3WMCA 2GQ3A 5MHBA 4HPHA 3L0KA 4KERA 4I6VA 1O95A 1YXYA 4MKNA 4DO6A 1ONXA 3CEPA 4GKLA 4X2PA 3WIJA 4QNWA 2E25A 1WP6A 2DH3A 1BRLB 4GQ0A 4C1KA 1GTEA 2EAWA 3FAWA 4AEFA 3G0UA 3ONBA 3AWNA 2GVLA 4F0LA 4BQ2A 4M6QA 4QROA 3BGJA 1W3HA 3L21A 3LMYA 3C5QA 4EAYA 1U33A 2A1YA 3H2CA 4A6GA 5A1AA 5LA0A 4WXYA 3L5LA 2PAJA 3HQOA 3WL0A 1H41A 3N9KA 4KCWA 1RQEA 1LWHA 1EGMA 1FWEC 1VBJA 3E6EA 1XI3A 2PF8A 4I9MA 5HANA 1CYGA 3R25A 3KP1A 4A3RA 3ANYA 3CH9A 3ZR4A 4FZIA 1XLBA 3VDBA 1B2YA 1DWJM 3EGJA 4NAEA 5M2FX 3T0TA 4N7QA 5AYIA 1EFZA 1XQLA 5DY3A 3T7VA 2ZZ7A 1S3HA 4MWAD 1E1CA 1FTXA 3OVQA 5A6TC 2HS8A 2A79A 1MW0A 3C0JA 4M7SA 3QM3A 5HNUA 3NQVA 3W75A 1W9BM 4K7YA 1QK2A 1OINA 3ZVHA 1TO3A 4B5TA 1B54A 2ZUMA 3GU2A 4I7VA 2HPIA 1N2VA 1I2QA 4ES4A 1EX5A 3CV2A 5KZ6A 5A6SA 4ONVA 3BLDA 1ZAIA 3W87A 3NXLA 2GGHA 4R7JA 2X09A 3L68A 2D2HA 2CITA 1VRXA 3MSGA 1X1NA 3G1YA 3MBDA 2O92A 1CGVA 1RCQA 4B9YA 1PYMA 3TNOA 3QV8A 2Y1HA 2IPGA 3O2LA 1YXCA 3W1AA 2PDMA 3E2SA 1MVYA 3BGAA 1FWHC 1SO4A 1GWJA 4D8AA 2PBGA 3GNDA 1X7IA 2PSNA 1W1A1 1S39A 3I3EA 1JNDA 3TOYA 1Q6OA 1SZRA 3LXBA 2XN1A 3COTA 4K36A 1EP1A 3CHFA 3BSHA 3W7CA 1UPMB 1WO2A 3LS9A 4XZWA 4G56A 4MTVA 1CTNA 5CG0A 4OFCA 4UZUA 3KL5A 3UPWA 4KWWA 3R2GA 3SUVA 2WZIA 1Z48A 4FOJA 1Q2RA 4Z1BA 1G9HA 3ZOAA 1UJQA 4XAYA 5HDRA 4AZGA 4N9CA 3BG9A 5LKYA 1UQZA 1JFHA 5AZ1A 2ZE0A 1QW9A 4HMCA 3IV8A 4FLOA 1GJPA 3QR3A 4PYSA 5JIWA 2H9AA 1OF8A 3VNIA 3UF9A 4UFHA 3NSXA 1EGZA 3DFOA 2CFFA 5C9UA 1REQA 4ERGA 3BARA 3HPZA 3IWPA 2OQYA 3EOEA 1E56A 2XH0A 2OLHA 1PXGA 1R87A 3CC1A 3EA1A 1MNSA 3FFSA 4MY8A 3AO0A 2ZA2A 3H23A 1P6CA 3EWXA 4Y2WA 1UWIA 2R1MA 3RR1A 3GS6A 4GRSA 1GYLA 1FH7A 1JEZA 5DF0A 3VGDA 1X6UA 2NW0A 2I5IA 4IX2A 1W31A 4XSLA 1JAKA 3MYOA 4BKNA 4KF1A 3VE9A 3T9PA 4I8DA 2WSQA 3WX7A 3NZQA 3TYAA 3KOZA 1FCBA 2CWXA 4LBUA 3MB9A 2IKHA 4Z0JA 4NNBA 1IEQA 4BFAA 4DF2A 3PZUA 3WJZA 4J1OA 3W53A 4MNJA 2XG9A 2VMFA 2W9MA 1UKPA 4RXGA 4IF2A 4UZSA 3HO8A 3TNBA 1B3WA 1OG0A 3ARUA 2OPJA 2CHRA 3APYA 5DBTA 1EB3A 3IIZA 4XUGA 1LP6A 4PUJA 4BWLC 1BD0A 2REQA 4EP8C 1UR2A 3WK1A 1JCNA 1P1MA 2BG5A 4GVHA 4NXSA 4TO8A 5D8ZA 3SSZA 3BJSA 1X8FA 4D6JA 2GQ9A 3BAKA 2EBNA 4BWLA 3AICA 2FVMA 3M0MA 3GDLA 1FWAC 1AL7A 4J3UA 2D23A 1E9IA 2G3JA 5CZKA 4AMCA 4E5TA 3U2EA 3KOWA 2Q3OA 2ZZ5A 3IJ7A 1HJQA 1E0XA 5F2LA 1ESWA 1ITUA 4KCVA 3L7RA 4N6FA 4HT3A 5DMLA 1TCDA 4IFRA 3ZJ6A 1QHPA 2DPEA 3WF2A 2DQWA 2PMQA 3LLXA 1DE6A 1OVDA 1XLJA 4JAWA 3RK8A 4H6EA 3V18A 4LALA 4WSKA 1OWQA 1OC6A 2OZTA 2WSKA 3BQ5A 2JALA 3O0KA 5FL1A 3OBAA 1NARA 3F4CA 4C6EA 2UBPC 3FGCA 3ABZA 4OTKA 1XYFA 3HIJA 3LG3A 3U2CA 2ZRVA 5AKQA 4IPPA 1E51A 3B8UA 1VF8A 2P1FA 4MJMA 3TONA 1KFWA 1EDGA 5BXTA 2NX9A 4CQDA 4XWUA 3D47A 4YVPA 3KVKA 3IJ8A 3NO5A 3P82A 3W37A 4M1RA 1WBJA 4IZGA 3ZO9A 1O60A 5CLTA 3CYJA 3NYZA 2FHBA 4LSBA 3NR0A 4X61A 1JZ7A 3VD3A 4Q8MA 2QCGA 4QM1A 4Q7BA 1PS9A 1UCWA 2ZOXA 3KBMA 4GPNA 1OQFA 1NOFA 4CQBA 1TPH1 4L65A 1TA3B 1UUQA 5G4WA 2GVEA 2WMHA 1V3HA 3HF3A 3ICJA 3WUFA 4XAFA 2OO6A 2UV8G 1ME7A 4C5ZA 3GBDA 3IJLA 5M5DA 3JZUA 4X9YA 2V67A 3L4WA 1GW1A 3KM8A 4DXVA 4NG3A 1H50A 1B31A 3LGGA 3AZRA 3KDOA 2BOEX 4FR1A 1X39A 3DYPA 4JX4A 3K1DA 2HPMA 4GVIA 3CAQA 3PNUA 1KTCA 2DORA 4YYFA 2OZ3A 4HK7A 3KVLA 5ABFB 3TP4A 2GOUA 4UOZA 4Y90A 1FX6A 3MPGA 5F2MA 1R9XA 1YNQA 2QMJA 3S1UA 5ENLA 4PMXA 3IEBA 3UZ5A 1O4UA 4EAMA 4YMZA 4NZCA 4AC7C 3GHTA 3VABA 4KFPA 4Q8UA 4XZIA 2RDTA 3GG8A 5GNZA 1Q2SA 3W26A 3WCZA 3OW1A 1UR4A 3AIVA 4NIRA 3SY8A 2VEKA 1ZHAA 1BFNA 1GT8A 1UR0A 1KGXA 1XL9A 2OKOA 3NQ2A 1OGBA 1DYSA 1JPMA 1SQ7A 4AXKA 1TWIA 1JYWA 3RGTA 1DV7A 1HF6A 2YGYA 1GOQA 4C1NA 1XDMA 3PBUA 2BOFX 3ZVHB 5MF5A 3VGBA 1M01A 3CZEA 4YWIA 3NAVA 4XAPA 4YTSA 3SQSA 3SI9A 1W5MA 1TJ0A 4TTUA 4F0SA 4MM1A 1KB3A 3IRDA 2CBVA 1L6GA 3UJSA 3LRMA 4QE4A 2XIIA 3PBYA 1QOXA 4BY3A 3C2EA 2NLIA 1G4EA 1IZKA 1NTHA 4JYEA 3WBWA 1K1DA 4LB4A 3CB8A 4CQ8A 3L4VA 1FWGC 4Y96A 4GC4A 5LNRA 3W7MA 3EOUA 3D0CA 3VTRA 1Q13A 5I09A 4MJ4A 5AC5A 4JNZA 5TF0A 3QGVA 3WLOA 4L5ZA 4CVUA 2XU2A 4PN2A 4HOZA 4O53A 2OYMA 5JUVA 2G3MA 4IGNA 3S1VA 1NF0A 2O9PA 4HYVA 4W9TA 1B3OA 4LB3A 3VZXA 2VZVA 3QZAA 2DVUA 2FPVA 1VH7A 3F4WA 5JBFA 4MHBA 1EYWA 2A3BA 3W1MA 3NSNA 3V3WA 5FF3A 3DYOA 4OKDA 4N4PA 1X6NA 2H6RA 1Z44A 1EOKA 2W27A 2YJQA 2J7DA 3E5BA 4CNOA 3P0WA 5CBJA 3CL8A 3B40A 3U4FA 4OU1A 3LENA 1I2NA 2G3NA 3CUZA 4LX4A 1F5ZA 3EXTA 1J5SA 3CT7A 3OZOA 4GK8A 3UY7A 3ZSTA 5LZLA 3OG2A 4Z1AA 3NEVA 4Q8WA 2XH7A 1SVDA 3ARPA 4UFJA 2NV9A 4D6EA 2ANUA 2J9YA 5FJJA 8TIMA 1M3UA 1W32A 3TEVA 4A3QA 3CUIA 4TXEA 3W9ZA 1UBSA 5AYYA 5I07A 3TXVA 1O6IA 2JF7A 1Q6CA 4I7UA 2Z2AA 5HA7A 1SSDA 5FKYA 4UB9A 3IUIA 2NQJA 3CV6A 4DUXA 1JF6A 1LG1A 4HKPA 3DFNA 1Z6KA 3BO9A 2WVSA 4NKCA 1LLZA 2BV9A 5DX7A 1X6LA 2CXGA 3KEHA 4JIRA 4RZ6A 2RDXA 5FIPA 3BGGA 1PEZA 4L4LA 1NU5A 2QNEA 1V02E 4HPNA 3A64A 2PDPA 4UQ9A 1AW5A 3DKLA 5G4EA 3VIIA 3FA5A 1TV3A 2CZEA 3E74A 1SO3A 2V3EA 2Z1BA 1UA3A 3RM4A 4DBEA 1SYTA 3DFHA 1BF2A 1HJSA 4IQEA 3GC5A 3SN4A 1H7RA 1J79A 3NPWA 1O66A 4ZB5A 1PE1A 1W3IA 4YVXA 4HOWA 5HJYA 2ADAA 2FTYA 3BAWA 4HZMA 1KA9F 2XGZA 3F4DA 3B03A 2NX1A 1W6TA 1FFRA 2WZTA 2PLCA 4O0QA 4Z08A 1DHPA 3LI1A 3QFWA 3VIGA 2P8CA 4BK9A 1QI5A 3AOFA 3NGJA 4LQ1A 5KMYA 1P0NA 4J7RA 3S6OA 4J40A 4IOTA 3F03K 4C6IA 1AFSA 1CXEA 2Z00A 4C6KA 2VWSA 3WSUA 2Z1KA 5A6JA 3HMJG 3SBFA 4O14A 2E40A 1C8XA 3MUY1 2E9BA 5C55A 3F5JA 5FA5A 1RD5A 4WDXA 1XIGA 3SR7A 4BF5A 2KX9A 2PURA 4ADUA 4AYSA 3LLFA 3HPSA 4G7FA 1L8NA 1LF1A 3M0VA 3TA6A 3M0HA 5FJPA 1JDEA 2HROA 3JVAA 4R9OA 1H49A 1F2JA 1XF0A 1UD6A 3O15A 3QHMA 4H9ZA 1A5KC 1ZENA 3WF0A 3FGCB 2WHLA 1DWAM 4L4MA 3AI0A 2E5CA 1AG1O 3CTLA 4NT0A 1P0EA 3GUWA 4G5DA 5AC6A 3L4XA 3RITA 4GMEA 4LBRA 5E9AA 2C13A 3CO4A 2E1WA 3GU9A 2Z2UA 3MKCA 4M1BA 3SCNA 5U4NA 4MB4A 3S5ZA 2YXGA 3MC5A 2VRKA 1KFEA 2XIBA 3VD7A 1UG6A 4IMAA 4C60A 1HO1A 1LDCA 2EG7A 4NYYA 1CT5A 1JZ4A 2YKKA 1QTWA 4CU8A 1XGDA 3TMQA 1H4PA 3O1NA 2E9MA 4JCMA 3ORWA 2QT3A 3SUUA 5EU9A 2QDEA 1WCGA 4IHCA 5A69A 3EKLA 4NNAA 2ZUSA 3BLFA 2ONEA 4EXAA 1WDPA 1MI3A 4RXFA 5IDZA 4HHLA 1VD6A 3ABQA 3PUEA 2NVDA 4CEUC 3W71A 4XZNX 2RGMA 3CMJA 3W88A 1TV8A 3V7PA 3QQWA 4CQ9A 4JQAA 4JTQA 1EO7A 2Z28A 5CC3A 4JHMA 2QUTA 3CLMA 3BCFA 4BR1A 1VFLA 4LYQA 3L0NA 4FPSA 3GIYA 3VCRA 2PP3A 3ZLGA 4RW5A 2CC0A 5AHEA 3W1PA 1HX0A 1UC5A 4JTHA 1I2OA 3FHAA 4PL2A 1GOKA 2YFNA 2POTA 2P0OA 1R47A 3W25A 5TAOA 1W54A 3K46A 1ZJAA 4FIQA 3C2FA 4BQ3A 1VYSX 4GX8A 4Z2IA 3EYPA 1GW9A 2QIIA 1EQPA 1G4PA 1WE5A 1UWTA 5K3VA 1G4TA 1OCQA 2QJNA 3FDGA 2NVAA 1K02A 3P81A 4EIVA 3NZ1A 5F1VA 4H2HA 4BS0A 5REQA 4RK8A 2W5FA 4GIEA 3KRUA 3R4IA 3W2UA 4WKHA 3W6MA 5CC7A 4Z42C 4F0HA 3MHGA 2ZC8A 1VIZA 1PBGA 2BB0A 1NQ6A 1VFUA 4H83A 3B0XA 4C1NB 3SO7A 2ISFA 3L5MA 2UY4A 2X2YA 3R1ZA 4HZ6A 1YLVA 5HUOA 1SW0A 2XIQA 4DM1A 2XVKA 3LSBA 3RJYA 3TQKA 3W83A 1W1B1 3TX9A 1RSCA 2XDFA 3I10A 2ON3A 3UJEA 1XH2A 5D8WA 2OQLA 4ZA0A 2ZA3A 2BP1A 2IUZA 3XIMA 4EXBA 3O05A 1RHCA 1EA0A 1IXNA 3N11A 1DBTA 1QI2A 3P8IA 3QF0A 4HN8A 4LS2A 1V7YA 3N2MA 3SUTA 2GSJA 3DERA 1E4LA 3FEMA 3C3UA 1QI4A 2NWSA 4AZHA 2OO0A 2INZA 4O1EA 3REQB 1DIDA 3SCSA 5DT7A 3W1RA 1E4MM 1FKXA 3BH4A 1GG0A 1IWPA 4YU1A 4LAUA 2A6NA 2CHNA 2DVXA 4PA8A 1YQ2A 4Q7NA 3G1AA 4WF7A 1FWNA 5GJPA 2DEPA 3M0ZA 4MJZA 4D6FA 3GFYA 4H3DA 3C8FA 3Q58A 3WH6A 4CN4A 2C1IA 4CUCA 3AIRA 2ZQ0A 3F5KA 2WMGA 3TDFA 5EBAA 3O6YX 2ODOA 2ZX5A 1VEOA 4PSRA 1L6WA 3D5HA 3SCVA 2UY3A 2DZPA 3LTSA 3ELFA 4ZSUA 4JN8A 3TJXA 3T1GA 5BXRA 4O1CA 4M56A 3M9YA 3I6TA 1ZBKA 1VFFA 4MNLA 2J74A 3MMDA 4GI4A 1TTQA 1GCYA 3GHUA 5GJMA 3T0DA 3AC0A 4DJFC 3WEOA 5I6SA 2CESA 4MSSA 3OQEA 1FXPA 2HZGA 2J7FA 4X0NA 4GH1A 3VPLA 3F2BA 2Z6IA 1MEHA 5AZ0A 2UWFA 3MVTA 1C90A 4DJFA 2PWFA 1EXPA 1V0MA 1I0BA 1XX1A 4XZBA 3TW6A 1FWSA 5E6ZA 4CD8A 1W17A 1WUEA 3RHGA 1QK0A 2YR1A 4UFLA 3O3RA 2I1OA 2Y88A 1S2UA 3WZ0E 4QQUA 1OFPA 2VUNA 5HPOA 1F6KA 1VBGA 1XHGA 4RJEA 1JR1A 2D2GA 3PZ9A 1KFLA 1MRAA 3SCPA 5HQEA 1IXOA 3VMPA 2YCLB 4F2TA 5FF0A 4I6KA 1KCLA 2OKTA 4JKLA 1CLVA 1GEQA 4MVAA 3FEQA 1E9YB 4DB7A 1I75A 1KR1A 3IIOA 3KFTA 1JZ2A 4LUYA 1E6RA 2Y2WA 4FR6A 3WQGA 5I03A 4DJEC 5KSWA 3L23A 1B3VA 2X42A 4H9TA 2VD9A 2WQDA 3EZ4A 4CD6A 2KAUC 5JIPA 1ZP4A 2Y8UA 5KZMA 2WNZA 3UJFA 4DJEA 4HP5A 4AD5A 2V81A 4L80A 1R2TA 3A5FA 1DWGM 2J7BA 5LIXX 1LRTA 5M03A 5GPRA 1TRDA 4PTVA 1IT0A 1FDYA 4MKVA 1LBMA 2J88A 1OSEA 4H8NA 3GAYA 1UYQA 1QR7A 3T8LA 3W1XA 2DIEA 2E77A 3AHZA 4IG2B 1U2YA 3OYXA 3ALGA 2CLIA 1TCMA 4DYKA 1SO5A 3CO8A 1S5VA 5HNRA 4WJ8A 3AIWA 3GDTA 3UWVA 2V0TA 3B4UA 2ZZ2A 3TTOA 3WKZA 2P88A 3SW6A 5HR6A 1M6JA 4R53A 4N4QA 5T26A 2V6AA 2ZKMX 1M68A 5AYBA 2D20A 4JFUA 4H6QA 3HPXA 4KEUA 1V02A 2GQAA 3VNLA 1P48A 3SQMA 2HNEA 1HGWA 3R12A 4ZFMA 3ATZA 4B90A 4GY0A 2D2JA 1KXVA 5DANA 3CQIA 2CLFA 1XC4A 4PUDA 5C7HA 3KCLA 4Y7EA 2DSVA 1S2CA 1ZS2A 4TX6A 2QDDA 3HQPA 4FIRA 5K9CA 3OGVA 3RCNA 3PTKA 2Y5SA 4QEEA 1YPIA 1FWTA 3NM3A 1XIEA 4TU1A 3K8LA 3SJ3A 1KBJA 3CM4A 2BDQA 3N4EA 2PGFA 1T7LA 1UD5A 1GVRA 3DU0A 4GYFA 1VP5A 1UMYA 1S5TA 2WVUA 3MJYA 4M82A 5IBXC 4S3BA 3BLIA 3T55A 1OD0A 3PWAA 3TU9A 1G67A 4KCTA 1R3SA 3ZT6A 1TMQA 1E3XA 2YL6A 1JAEA 1XBXA 3TTQA 4J2PA 5TQLA 4FX7A 2VCAA 1B9ZA 3WK3A 5IBXA 1F3XA 4BI7A 1V03A 5E70A 4DEFA 4EK7A 1X1ZA 2OOFA 3GE7A 3E38A 4L6HA 2WK2A 2V5BA 3SZ8A 4MGGA 1GEHA 4ZQMA 4UCGA 1J12A 3FXGA 1TZ7A 2C14A 2VR4A 4S3EA 3TTSA 1EDQA 1R3TA 1G0CA 4RE2A 3U3HA 2YDQA 1FWJC 3L4ZA 2X8RA 2X7WA 3FSTA 1MUWA 3H7UA 4AW7A 1TTJA 4NVTA 3WNNA 1PIFA 4HYRA 1WOBA 3TWBA 5L9FA 3EEGA 3AJ7A 3QYQA 3VZYA 3GZAA 2V2CA 4D6IA 1J8VA 4LYRA 1H61A 3WQCA 1XLMA 3U2OA 3OIXA 1OX4B 1JZ8A 4DVOA 3C0QA 2V5JA 3L65A 3PWGA 3W7KA 3VIHA 3W1TA 3TC6A 1V6WA 2DVTA 3LYEA 5I2UA 1H7NA 4UXDA 4JL1A 1UIOA 4IP4A 2D24A 2CETA 4OBSA 1M65A 3MCNA 1RP9A 3QHNA 4LAKA 2WLZA 5DXXA 1H7PA 1VLIA 1S1RA 1YEYA 3BURA 4FLRA 2YIHA 2ZDRA 4C90A 4JHZA 2QZRA 3P7YA 3P0XA 3T44A 3BAIA 3LPGA 5CBIA 5DCDA 3WUEA 5C2GA 4D1JA 5A6LA 2A2IA 5BRBA 4RPQA 1UWSA 1BWKA 3WUGA 1UOKA 2Z1XA 4PUMA 1B30A 1EIXA 2HSAA 2WBGA 3NXFA 4Q8QA 4XG1A 4ZVJA 4YN5A 1AZ2A 1I9CB 3HZ3A 1XLEA 1UP3A 1T99A 3W24A 2ZUUA 1N82A 3EDDA 4M51A 4S38A 3IK2A 4KRZA 2IPWA 1KM2A 2ZZ1A 1T6MA 1IZJA 4GX9A 4ACYA 3PVFA 4E3TA 4PMZA 2AQWA 2X0HA 3A24A 2NQZA 4GYJA 1ZJIA 1HKIA 3C61A 2XSXA 2CLPA 3DFPA 4LVGA 4IGSA 3LOTA 4O10A 2OXNA 4Y8FA 3RMEA 4F48A 4Z2KA 3CIWA 3IACA 3B3DA 3GIPA 6ALDA 2PLMA 5E1QA 1XH0A 3SRHA 3H21A 3Q2DA 1EJRC 4K1WA 1YYAA 3RMJA 3WF4A 4C6DA 3BLEA 2BGSA 1JGMA 2LLEA 3HB9A 1E6SM 4WRHA 1P5BA 2X2GA 3UVIA 1QPQA 2OYKA 3G1VA 1BGGA 4JBRA 4P7RA 4MYAA 4EE9A 1BYAA 3L66A 4X0VA 2B7QA 1QJWA 2WW5A 3T0BA 3W7IA 4NNCA 3ERPA 1RBLA 4B5NA 2FZBA 4NZ5A 2WWDA 4G1NA 4LCQA 1UWRA 1VIWA 3OZMA 4WZHA 1JG9A 1KLYA 4A05A 3S2CA 3EA2A 1E6QM 2ABAA 1TVLA 2I57A 4DQWA 5AHFA 3R8HA 3EX4A 4G6CA 1CDGA 1IGWA 4L4OA 2XGBA 5H6HA 2J66A 4NHVA 1ZP3A 3RPMA 2ZFAA 1LOLA 4MB5A 3O7UA 3QZEA 4LY8A 1JI2A 4UTTC 4E0CA 3T8QA 1HKKA 3U7VA 1NQKA 4L9XA 3WQDA 4E8CA 1VS1A 1IV8A 1RJPA 4S2BA 2VVSA 5AY7A 4ZOEA 1NFPA 3IAPA 4KGJA 5A8OA 1UR3M 1W1ZA 1ADOA 3SAZA 4H41A 5HNNA 4UTTA 1FHVA 1QAPA 3P84A 4DF0A 5FEXA 3TUUA 3EX2A 3HG2A 3N2OA 3G22A 1C3FA 4C6NA 3E0VA 2OWCA 1GYMA 3BCJA 3UEQA 1WXJA 1BVWA 1D3HA 4FI4A 1H5YA 2HMCA 3LM7A 2HQAA 1MW2A 2QKFA 4RR4A 4YHEA 3CBWA 3T0AA 5CC6A 3DI0A 3UGRA 4LCRA 1BKSA 1GOWA 1J0ZA 4QAIA 2ZXQA 4QE1A 3OA3A 2PDNA 1QVBA 1IHIA 3TIMA 4W89A 3VUSA 4RNJA 3WDIA 1XUUA 5I06A 2WMKA 3KRBA 4AY7A 1SZNA 2GUBA 4KFNA 1IR2A 1ENUA 4BF7A 5HBFA 1XKYA 4RZ5A 4WGHA 3GXDA 3ARQA 4X2RA 2XFYA 3CUGA 3CPGA 2QUMA 4GE8A 4ZGYA 2V2HA 4PTXA 1ISZA 3R8GA 3I6RA 4UC5A 5D38A 2D22A 2ISVA 1JUEA 3T2QA 3OODA 4NL1A 2WCSA 4Q8OA 1AQ0A 1LL4A 3HN3A 1JI1A 1OCBA 2O4MA 1I2RA 2H3BA 1QOPA 1YNPA 3MP3A 4OVXA 4MFDA 4FNQA 2J6VA 4QG6A 1NDYA 3I4KA 4XAZA 3TW7A 3FJLA 2VGGA 1T0OA 3WJSA 1TZZA 1YBQA 1WAWA 4XBJA 2XGIA 2FMNA 4PMUA 1ME8A 4UFKA 4FNTA 3WDRA 4GG9A 5J04A 4UMAA 4O0ZA 3QR1A 1LLOA 3BSMA 4I5XA 1UKQA 3U48A 1PCKA 1CXHA 2E6AA 4R27A 3TCEA 1V8EA 3RXZA 1KXTA 4KEMA 1L0PA 2VFEA 2A0NA 4AU0A 2HDJA 3ZZ1A 2BXZA 4HYWA 2AL2A 1JVNA 4HA3A 5HOSA 3FY1A 2WC7A 1OT1A 3LV5A 4WUIA 4JZ5A 1RXOB 2IXVA 4GUJA 1D7KA 4J4KA 1WQ5A 2ZRYA 3T2OA 2CLEA 3GDKA 2QCMA 3ZLHA 1I45A 1ZGDA 3CQ0A 1MUCA 3LTPA 3K4WA 2CBJA 3G6MA 3UYCA 5T91A 3ALFA 4ZB2A 3UVAA 4AD1A 2E67A 1L6SA 1OF6A 2F2KA 5K4XA 2BY3A 1RR2A 3KAOA 1XLLA 3KW3A 2VI0A 3I68A 3ITTA 1LLWA 5IFPA 2DT3A 3EDFA 3VD5A 1KQZA 3UWQA 5CPTA 4GI9A 3VCNA 1XYMA 3URAA 1H2JA 1JDFA 1M1BA 4FB7A 1J9YA 4XZ9A 1EC9A 2VX7A 1OM0A 5H2ZA 4K1GA 3GXTA 2ZZ4A 3WFZA 3RLUA 1GUVA 1JZ5A 1XCFA 4Q3MA 2V3FA 3TH6A 3IARA 5CXPA 1GQNA 3SUWA 2WZHA 1KFJA 4ORIA 1WDWA 5ABTA 1Y65A 4B3ZA 4OBRA 2QAFA 1TTIA 3QY6A 1Q6FA 5G4HC 4EX4A 3TFXA 1Z9AA 3NNTA 4HA4A 4L1XA 3UW6A 3S0CA 4JTCA 4H2CA 1CX9A 3MMWA 4O13A 2QJMA 2CCRA 1FXQA 5BU6A 4ALDA 3QTGA 7TIMA 2E28A 5T8GA 1EO5A 3ARXA 5CH9A 3CXOA 4REQA 4PRRA 6REQA 1XIMA 4MJ2A 4YVVA 3E0IA 5XINA 1K9TA 4LC8A 2WANA 2NWRA 3ARYA 4WSJA 1QUMA 4ICMA 4F3HA 2GVJA 3M0LA 4WDTA 2YCIX 3A5VA 1EA9C 3W81A 2YX0A 3CPUA 4TIMA 3MWAA 1S5WA 4UFMA 3E5PA 1NOUA 1P0KA 2HJPA 5E0CA 3WLNA 5ABGA 3N2BA 4DLFA 4IFOA 4NAFB 4HNCA 3AXIA 3E0LA 3DHUA 3MI2A 2IKGA 4C6QA 2EQDA 5ABEA 2V63A 3WQ5A 5HWNA 3SGZA 4RNIA 2PRLA 1MQQA 4G7EB 1SSGA 3DFTA 3NIYA 2X30A 5FD0A 4M0XA 3WENA 3PZIA 1UROA 2XN2A 4JYDA 2ZX9A 1DQWA 1B3XA 1JJKA 3UZWA 2B0MA 1B3ZA 3CAVA 4MADA 6XIAA 4MPKA 4H8UA 4JTJA 2PDCA 3PTQA 5BOFA 4OJYA 1BG4A 1R3WA 1JYVA 3DG3A 1PZ3A 3G1DA 2VGIA 2XH4A 1W1YA 2QCDA 1KV5A 3NQAA 3VOFA 4IFKA 2CZDA 3EOSA 3AXHA 1HP5A 1E4IA 1CNVA 4RNHA 2CBUA 3BV4A 2VT0A 3HGOA 5G1TA 4XISA 3CQKA 3EB4A 3T42A 4KW2A 1L8PA 1LWIA 4MDPA 4C6CA 1V3IA 1J0YA 2WNQA 3GXPA 1UD3A 3SFWA 3GXIA 5F4XA 2GK1A 1OFDA 4DJDD 3U57A 4JIIX 2PB1A 3MTWA 5CSSA 3CZKA 4GH3A 2ZICA 4LUIA 2J8FA 2DZXA 3GNXA 5DQPA 5E0KA 1K7FA 4HGXA 4BEUA 4TV6A 1R3VA 3WLIA 1OX6A 1Q63A 4I8YA 5JH1A 1ZBWA 2XTKA 1HJXA 4QLLA 1P0DA 3OB8A 3QBUA 3NCOA 4LAZA 4GINA 3K8KA 4XK2A 4DNHA 4OE7A 4YHGA 1RP8A 3HV8A 3URQA 3S9ZA 2C6QA 4MF4A 1WOAA 4ZMGA 3IJ6A 1WNOA 2E09A 3ABOA 4B92A 1FBAA 4NJKA 4UIOA 1UR1A 1IEXA 2WBKA 2OU4A 4XIAA 4Q4PA 3V75A 4R85A 4US5A 2WOQA 3P74A 3RM9A 1RALA 1VAHA 2DV0A 1JXJA 3UA4A 3F2CA 1H51A 2HK1A 1HT6A 4WX2A 4AZ7A 5FF2A 2OOGA 2VQTA 2PWEA 1J6OA 2XYLA 4XTDA 2VCBA 3NVDA 1CPUA 4DUWA 4NZ3A 5FACA 4S23A 4QGCA 3UG8A 3TLQA 3AUOA 4KEZA 5FJRA 1ZU8A 3ZT7A 2Y89A 1XYZA 2CXEA 4AIBA 1Q7MA 5FESA 1GOIA 4OQVA 3AXKA 1YPFA 4ICNA 3WQ4A 3M7SA 3G3MA 5CSYA 4QLKA 1OD8A 4GUIA 4O16A 3MA8A 2F84A 1S46A 1RAKA 2G41A 3DN5A 2ISSA 5CG7A 3T6CA 4N9BA 2WNNA 3RO6A 4HU8A 2RKXA 1TQXA 3BW4A 1IR1A 1V6YA 5C9WA 1KNWA 2WSYA 3LCLA 2QV5A 3UXAA 4KEVA 4DBUA 1DJNA 5K9DA 4NYUA 4ZTXA 4U33A 3FYPA 1CGTA 3GDMA 2QJGA 4PULA 3C86A 5FF4A 1XYCA 3HU7A 3EB2A 2GWNA 4HJFA 2JGQA 4YTRA 3ITLA 1AW2A 4EVZA 3LCXA 1S5MA 2JKPA 2P10A 4IQDA 1WYIA 4R3UA 3POCA 2JIEA 1HW6A 1XPYA 5EFFA 2Y24A 3LBMA 4K68A 4B91A 3K13A 1CXLA 1JDDA 4UQAA 4P7QA 3ZJKA 4IPIA 1OFAA 4QLJA 3WLHA 3P6LA 1ICPA 3TQ0A 2V3DA 3CUJA 2OZ0A 2R6OA 1H7OA 2PWDA 2QXWA 1N8IA 2XZ9A 4CNSA 1GKQA 3MV11 3TAKA 3OOQA 4AHQA 1B5TA 2DSWA 3UA3A 3GR8A 1AQHA 4M6PA 4HPXA 1EC7A 4IP7A 5DRCA 2PGWA 4A8RA 3VIFA 3N6QA 4NASA 4P8XA 4QDWA 1PPIA 1XYBA 5FEWA 4YTTA 3QMRA 2X7VA 4AMAA 2OWXA 2UY2A 1JXKA 3FK4A 1GVQA 1KM3A 3NO3A 5GNXA 4HCDA 1A5LC 3UXIA 2OGYA 1XIJA 4INFA 2NT1A 3DX5A 4H9VA 4ATLA 1VPYA 2AL2B 1D8CA 1XIFA 2PU1A 6A3HA 4CNTA 4WOZA 1MWOA 4D72A 4GY1A 3SFKA 1ZZMA 4UCFA 4O1FA 2A5HA 2DGAA 1KCZA 3VM7A 1YE4A 3QGKC 4DF1A 4LJ3A 5CQ1A 2WVTA 5ECVA 2VRQA 1IEVA 4V27A 4HPJA 4MG4A 3W27A 3W01A 4F4RA 5LIYX 1TE1A 4D6GA 1ITXA 1G1YA 1KM5A 4AUBA 3FAXA 4B5SA 3EPOA 2Z1VA 1OADA 3W1UA 1C29A 3AAMA 1FHUA 4GFSA 1GZGA 3Q45A 2J9ZA 3KCOA 4IGMA 5LIWX 4KQNA 4MKSA 4UTKA 1GVSA 3U9IA 3FYYA 1POJA 2W61A 1Q6DA 2GQ8A 3ARRA 1UIPA 1KXQA 4W86A 2DQXA 5B7YA 2DZBA 4N6EA 1UD8A 1XW8A 3AU6A 3SRKA 3LHTA 4B16A 1HKVA 4GA8A 4RZBA 3LHVA 3UXKA 1ZAHA 4W7UA 2ASHA 3CHDA 3WJYA 2C1HA 1TPVA 3OZYA 3W7HA 1KD0A 3DCPA 1PWLA 3UP8A 2AKZA 3N9SA 1TV7A 1JD7A 1XIDA 1XRSA 3M0IA 4YTUA 2VNCA 1O68A 3THDA 3B05A 2XM2A 2W79A 4GI6A 1MUMA 1XGEA 1Q6GA 3H2FA 3STGA 2J78A 3SY1A 2WPBA 1XM3A 5HULA 4LUTB 1KBBA 2VC9A 3E96A 2EXOA 2PWUA 3P2VA 1W56A 1ZLPA 3VINA 3AYRA 2J7EA 3R8RA 1HTIA 4HHPA 5EMJA 1WDDA 3VAVA 3VO0A 3TXZA 3GVWA 1V93A 3IGUA 4XV0A 3K5XA 1V5XA 2QCFA 3G1XA 3NQFA 1A4LA 3RX3A 1HG3A 1SZFA 2PU0A 3FOKA 1LT7A 3HGJA 1NH6A 4F79A 3TAOA 1XFBA 4QS6A 2J79A 3WMLA 4DUVA 2JKAA 2J6XA 4JTLA 1EDTA 3O6AA 2BOGX 2DIJA 1R86A 1XINA 3EB3A 1UP0A 4QCEA 1NJJA 5CKSA 2F7FA 4NXKA 4IMCA 4H6RA 2XISA 1FDZA 1BXCA 3THAA 2ZTJA 4TR9A 2Q8XA 4MUZA 1DJIA 1QXLA 3S2MA 2PDGA 3HM7A 3VVGA 4GZ7A 4WJXA 4HNLA 3LN3A 4UNLA 4PTMA 2GGEA 1DP0A 1MFUA 3MHUA 1NP2A 5FJIA 3EPMA 3NYDA 1CENA 4UQEA 3R58A 4KRUA 2HWGA 3SN0A 4BJHA 1FWIC 3BZGA 2D3NA 3K30A 2NSOA 1A3WA 3V0SA 2HXUA 4H00A 1F8MA 1QDSA 2EEXA 1CXKA 1PX4A 2TAAA 1JZ3A 3SCWA 1KRBC 5DMMA 4UQCA 1QPNA 3A9BA 2QR6A 2V69A 2WSPA 3UG3A 1TPFA 4Z0SA 3WLLA 3OIHA 2FIQA 3MI6A 1SMDA 3U8GA 3PBWA 1OFRA 4F9JA 2DH2A 1JNEA 2VWTA 3UNDA 4M7TA 1FDJA 1HL8A 2ACUA 4AVOA 4L56A 1NWUA 3TYUA 5E09A 4IM4A 1AMYA 4PH6A 5CZ0A 5BMWA 3M5VA 5C6MA 1LM1A 3R79A 1B4EA 1R9ZA 4H7VA 4GKTA 3PZGA 4LVAA 3W84A 5HWJA 3F2DA 2WM1A 4QG9A 4PMRA 3VDGA 2TMDA 3WDQA 4GUFA 1SJCA 3DHDA 2YCKX 2WMIB 2CBIA 2X1RA 3I3DA 4BCEA 4US5D 1Y5XA 2G50A 4MIMA 5HATA 3C3NA 4W8LA 3MO7A 3PSVA 2PC8A 3EX1A 1BEUA 3FJ4A 3BL3A 5D2XA 4HHHA 4QFUA 4LWWA 4QIUA 3KE0A 1Q8JA 3CJPA 4CD7A 5GNYA 1NAL1 4AIUA 3NO1A 4RV3A 3CAWA 1MMFA 3M43A 1US0A 3B9AA 1XLHA 3W7PA 4AY8A 1FH8A 1UKOA 2PDXA 4HU0A 3PF3A 2Z25A 4RE3A 3IIPA 2E68A 2Z26A 1GVIA 4IL2A 2FB3A 1EBHA 4QJ3B 3UR2A 1EJTC 1ICSA 5G1YA 3WF3A 4HOXA 3DAQA 3OQ8A 4PRTA 4LAMA 2V38A 4RX0A 3WQFA 4Q4MA 1ZTVA 4HBKA 2C79A 3SURA 4GBDA 3WQ6A 4N42A 1RUSA 1EL3A 3GDRA 3ZIZA 4IWWA 4AG0A 2XPKA 2C1GA 3NQDA 2V82A 3VD9A 3AS1A 2PGEA 3VOJA 3GW3A 4PODA 4LW7A 1TMHA 2DIKA 4AVFA 2IS7A 2OX4A 4C6LA 1XSJA 2YL5A 4LEFA 3H70A 2W67A 1TA3A 4FNSA 3VIMA 4ZO9A 2I5GA 3TCSA 3N14A 2F8QA 3OZPA 4LCSA 1P43A 3SSJA 2PI6A 3GTNA 2WV8A 1LJYA 2XWEA 1TKKA 2WB5A 4AIEA 2C8NA 3C56A 4Z2JA 1GVYA 8CGTA 3W7EA 2VZSA 3CIXA 4QTGA 4KESA 2WLYA 3GY1A 2PRMA 5D2YA 3DESA 3SDOA 3CGTA 4TQTA 4DY1A 4O18A 1UH4A 5D9MA 3EXRA 5ABFA 1W1TA 3PZOA 3NTYA 1BWVA 2G0WA 3HFTA 4J3XA 1I1WA 5BRPA 3VOGA 3KHJA 4LF2A 4M8UA 1ITCA 1HNYA 2FJKA 4GGHA 1JIBA 1P4CA 1SZGA 3N13A 1A5BA 1CEOA 4JHOA 4Y9OA 5K2ZA 4MAZA 1UWUA 3BLKA 1VJIA 4JQ4A 2WMJA 2OSYA 1RQBA 1OZQA 5HJLA 3ZM8A 1VYPX 4BZYA 4TTGA 3ATYA 3JRKA 2JK2A 1A5SA 1JGIA 2GYIA 2JGYA 3U2ZA 1TPC1 2GWGA 3TYBA 1SFLA 2JQXA 1JCTA 2PP0A 2AMGA 3IVUA 1BQCA 1UBPC 4DYJA 1HKJA 1VJSA 2RHGA 1N8WA 1QI3A 5HXMA 4I7WA 1TVPA 2QPUA 2C16A 4M24A 2BXVA 4EPBC 4B2DD 2VC7A 3PANA 2A3CA 4O57A 5DEZA 4JDBA 4GXMA 2WO5A 3NEHA 3TZFA 3QOKA 1VRDA 5CPOA 2PUZA 1EC8A 3IRSA 2FDSA 3L12A 2QV4A 3M16A 5LYRA 1B57A 3G1FA 3PJUA 1C7SA 2FKPA 2A7NA 3LXAA 3PPCA 1YXDA 1QBAA 3LHZA 3S2LA 4Q8NA 4A2SA 2VQUA 1UMLA 4CNNA 3NA8A 3LB0A 4LFYA 3TC3A 4Q4KA 4K8EA 3VOHA 2HEJA 2P5NA 4WY0A 3K1GA 4HK5A 3QMTA 4MZYA 4W87A 4QJ4B 7CGTA 3B8IA 5FJTA 1EQCA 3HPFA 3FVMA 5AHMA 1L2UA 3P80A 3S83A 5DT5A 2WCGA 4NI8A 3VK5A 1XP3A 2EJ1A 5KETA 2GFTA 2P3EA 1PV8A 1YKWA 1KFCA 1K77A 2NQ9A 5I7GA 1US2A 3WY1A 3WLQA 4OBTA 4D1IA 2CW6A 1LRNA 1ISXA 1U5JA 1P6BA 3QRHA 3P3BA 1TIWA 3L0GA 3WNMA 3N2XA 4UTHA 2QDGA 2YBTA 4ZXLA 1OB0A 3IGSA 2WC3A 3BAYA 4PFHA 2EPOA 4O15A 1J5TA 3BLPX 3CHCA 1V6VA 1SFSA 2D0HA 1TRIA 4IMGA 4F2BA 1EUNA 1UPPA 4XZMX 4BQ5A 3V1PA 2JE8A 4LNYA 2V30A 4MB3A 1V6TA 4A4AA 5B7ZA 5FF7A 4PTWA 1EPXA 4ATWA 1W1VA 2WXDM 3W1LA 3H53A 1W2VA 1G5AA 4K8GA 3SB0A 5XIAA 2ZRXA 1VENA 2QPXA 3L9CA 3VKDA 3VNYA 3AJXA 1V77A 3FHQA 4Y9AA 5C9RA 4XKYB 4IT1A 1RY8A 4CN6A 2W4XA 4LEQA 2GPTA 5C8BB 3EDJA 1TR9A 4JQ2A 1YHTA 3EEZA 2Y85A 3VC6A 3OG3A 3KBNA 5AC7A 4EPKA 3S5OA 2RGLA 1J0KA 2F61A 4OV9A 1V3MA 3OYZA 4Y8EA 1SZEA 3LCWA 2I9UA 2VFGA 3N73A 4PUEA 1L6FA 4NI3A 1G4SA 2X1TA 1GQLA 1WKDA 5TD4A 3KLKA 3AIQA 1A80A 4Y9NA 1MXDA 4P2VA 2Y63A 1P7TA 4DELA 2XIOA 4WDWA 1W1IE 1HP4A 1DEDA 3HV9A 5HQMA 1JDCA 3G1SA 2FGZA 3GZ3A 5EGRA 3SRDA 4DBSA 3A47A 1FH9A 4D6HA 3HG5A 2YOCA 2VR5A 3VGHA 3BAXA 3RO8A 1PVNA 4M19A 5BXPA 3DFQA 4XD5A 4JX5A 3HGSA 1J93A 4R5EA 3T78A 1XG4A 1YDVA 3ZWSA 2YA0A 1R30A 4XSMA 3W6LA 2VXNA 1IF2A 1FA2A 1W1PA 3GQYA 3ZWTA 4HNUA 1JPDX 5A6BA 1CXFA 3TR9A 4CLMA 1B3YA 3GNNA 5MKGB 2C71A 2PDKA 1A5NC 2VTFA 1M7XA 1IEIA 5AC8A 4K7VA 3UXLA 1Q8AA 2RJHA 3ES8A 1GVFA 1R3RA 3TKFA 2XSAA 2NVCA 4UOJA 1E9LA 4EACA 3EKGA 3WEMA 5I77A 4XKMA 3QQ1A 4C6OA 4FOUA 1OC5A 2YL8A 1EEPA 2O7QA 4EF9A 4EWND 1ZSXA 1GQKA 5I23A 1HQTA 1SJAA 4RL3A 4ZZ9A 1FWRA 4FSAA 2SFPA 2WVVB 2FPYA 1KXHA 3BW2A 5A8MA 1DKWA 4IPLA 4RZ4A 1L9WA 3NOEA 3QYSA 2PDLA 1R46A 3PAOA 2GJXB 2WKLA 4QSFA 3MUZ1 1UZDA 2MNRA 1XQKA 1ZCOA 4NILA 4WKFA 5EPDA 2X1UA 4GGBA 1IIGA 1M03A 1F6PA 1PYFA 2VD8A 4C6PA 1E71M 4JEQA 3W4RA 4CCDA 1CZ1A 4DAIA 4P8VA 3WLSA 1SFJA 2ALDA 4UTMA 1NOWA 2PPGA 1AJZA 1XPGA 1E1EA 3GVGA 2ZX8A 4JIEA 1E73M 1LWJA 3UXDA 5A2CA 3QW4B 1XLIA 1CGWA 1GPFA 1BLIA 5DCEA 3LHWA 4JTDA 1VFHA 1OYCA 1J2BA 1FRBA 3WEZA 1GKPA 4HMNA 2ZZ3A 2FTPA 4IIDA 3BANA 4XO7A 1BQGA 3KWSA 1B1YA 1QHOA 1TV5A 3P61A 1M04A 3MDWA 1OCNA 2YLAA 1GG1A 3AIUA 5A95A 1O1HA 3LNPA 4YYCA 3CWOX 3I3BA 1XD1A 1UHVA 2W66A 3RRXA 4BQ4A 3BVJA 4ENLA 5AFDA 5FI8A 2OZ8A 3UWWA 4B5UA 4PFMA 2HBVA 2F6XA 5FAJA 4LUSB 2CPUA 1K3UA 1SR9A 1M7OA 3WN6A 3Q94A 1HGYA 1XWYA 5DO8A 3VFLA 3G8EA 1EZWA 4ZB0A 3VKJA 3B9NA 4PTNA 1WDSA 4ECLA 5FSDC 8A3HA 3B8WA 3GD6A 1F74A 3EBVA 1RLDA 1VCFA 1DIOA 2WZMA 2JIWA 1DJWA 2PDIA 4GIYA 2VRJA 3BC9A 1NFBA 3TROA 4GBUA 3OEXA 5TIMA 3G5EA 3PJXA 4W88A 8RUCA 3RJXA 4XD6A 2X16A 1QRQA 1YDOA 3NQGA 1H7WA 1ELSA 5EMYA 2YCJA 3U5YA 3WFAA 3CK5A 2AOSA 1E0WA 4W7VA 2Y61A 1VKFA 5DRIA 3V16A 2CYGA 2TODA 2Z4GA 4C65A 4NSBA 1JCLA 2Y7FA 5EFDA 2Z6JA 4AZBA 3BK0A 4JYFA 2GSEA 2YLLA 4Q7IA 1A3HA 1IT8A 1R3QA 2P76A 4IQJA 3SY5A 1PDZA 2ACRA 3CZJA 4Q32A 1GZ1A 2Y7DA 3SRFA 3C4UA 5GVJA 4A22A 4MMWA 2BHUA 5TNVA 3QTPA 4PB4A 3B0VC 2YYTA 4MZ8A 6XIMA 1ZRQA 3TV8A 2FZDA 4RNFA 4Q8VA 4WD0A 4PCFA 1TPWA 5IFTA 2Y6ZA 3KX6A 4GQRA 4DHGA 2EG6A 3REQA 4AD4A 9CGTA 5I24A 2WMFA 1CW2A 1BYCA 4UR9A 3FNDA 3NG3A 2GGIA 4DNMA 3GHSA 1LT8A 4WY0B 4R34A 3FLUA 4E8DA 3OHMB 3H2EA 1Z69A 3LM3A 1EEXA 1EF2A 1OFOA 2YDSA 2OGJA 4O1AA 4ROQA 2OODA 2X41A 2PDQA 4HTBA 4UFIA 1JULA 4L64A 1J0HA 1J4EA 2HE8A 1JPIA 3KZPA 1OCJA 3P14A 3VI2A 2PWHA 2QYGA 4CCEA 1EJ7L 4K37A 1CGXA 3AIEA 3MU7A 5D09A 4JNMA 3G3DA 2W0UA 3KBVA 3HJZA 4OT7A 4S39A 4Z2HA 4ML9A 3CL6A 4B9ZA 5D9PA 4FALA 4L4PA 1IIHA 3URBA 2DT0A 2R9RA 1GJWA 1ECEA 4LU0A 4Q8TA 1VGAA 4NJIA 5LHFA 2ZZ6A 3SCOA 3GLCA 4RUBA 4HMEA 1YTEA 4NZ1A 1M53A 1BYDA 4S1FA 2ZA1A 4PUKA 1C8YA 1OFBA 1S2AA 3L5AA 1BSLA 1C9DA 4GHRA 5CZTA 5D03A 1KR0A 1BSIA 2YBVA 4JFWA 5I00A 5I3GA 4L6DA 1B90A 3VOCA 2A3LA 3B9OA 2QVNA 1RH9A 3W23A 3AQUA 2PF0A 2YCLA 3LGEA 1VB9A 1VFMA 3GVVA 1PIIA 1HFBA 1ZNNA 1DWFM 4UOQA 3S1WA 4I5RA 1MO0A 3WBEA 4E4FA 1LQAA 2G3FA 4GZIA 4CVWA 1JRCA 1EHAA 2YW3A 2QCEA 1CBGA 4WY0F 4TVUA 3TC7A 3PBVA 4JIHA 2XFFA 1ZALA 1OGSA 4AZCA 4PMJA 1D2KA 1DWIM 4DN1A 3WD4A 4UR7A 1W9VA 2X1IA 4U2YA 1U1HA 2ESCA 3KS5A 1P7TB 3L67A 1AODA 4ZBCA 3E2RA 2MUCA 3KL0A 3PJWA 4LXFA 3GB6A 7TAAA 3ZYZA 4AF0B 2CNCA 3RDKA 1A0DA 3PULA 3STPA 5AOUA 2I5QA 3JS3A 4ORMA 4IIHA 2ZBTA 3A13A 1K8CA 3B8VA 3EOOA 5CZJA 2BY0A 1E6ZA 3R11A 1VEMA 4H8VA 2E9LA 3MCOA 3BE7A 4IG2A 3W3OA 3S1GA 4D9PA 5BXSA 1A0EA 1H1NA 1XLCA 1XXXA 1E70M 2PTZA 4C6MA 1RJRA 5C70A 1XRFA 1QNRA 5L6UA 4L1WA 3DZ1A 1J10A 2QAPA 3LRLA 2PWVA 3OP2A 2JEQA 1NELA 1SUXA 4OZOA 4CKQA 1MQPA 2W62A 5GJNA 5HPCA 4FLQA 1OGGA 4AEEA 1WKFA 2Y5JA 3FW6A 4CEXC 1QPKA 3RCYA 5A8GA 4GJ1A 2Y7GA 2OJPA 4QJ5B 2FGBA 2DP3A 3L4YA 2Z27A 3UY8A 5F1UA 3OVGA 3GKAA 4L9ZA 1RBOB 4KIEA 1GQIA 3PZNA 2C19A 3M4HA 4LBSA 4J9JA 1JCJA 4K38A 5JBDA 3A6OA 3PR2A 1LUCA 3KRSA 1EPVA 3WLJA 3DECA 5FL0A 2F6KA 5IRPA 1TG7A 4DZHA 3KS6A 1S38A 5F2GA 3IIVA 4GD0A 1VZWA 2PA6A 4ICCX 3RNDA 4G8TA 2NQHA 5LNUA 4B5VA 4WDUA 5AB3A 5I79A 4BI5A 2YL9A 1GOXA 4J35A 1AA1B 4GCXA 1K7EA 3MSYA 1PZ0A 3C8NA 1A5AA 3WBYA 4CD5A 4PMDA 3CNYA 3CB3A 6PTDA 4BF9A 4AISA 3FA4A 2VCCA 3O07A 2DW7A 5BRQA 2VHLA 2ZRZA 4HPGA 1NIUA 3W76A 3A4JA 3A9IA 4PC8A 1XV8A 4C7FA 2FJUB 2HVMA 2L5HA 3AMLA 4OECA 3ARWA 2NT0A 2VGFA 1GK8A 1JQVA 5HK4A 4GXPA 3ITXA 2ICSA 4EWJA 3OHIA 3QHOA 1MDLA 3W73A 4DPPA 4H7CA 3KVMA 1MNZA 1W5OA 3WLTA 7REQB 1B4KA 4N2YA 3M0XA 2BODX 4O0KA 1GVEA 1K9EA 2E6FA 3UQNA 3KRZA 3B8SA 3KTCA 1OX4A 2NUWA 2DUXA 2D0FA 3IGHX 2HVNA 1U30A 3BMWA 2GZXA 3C2VA 3SIZA 3KOXA 4PCTA 1A5CA 1XBZA 3DXIA 4CU7A 2AQOA 3AMKA 3W86A 2RAGA 3VNZA 2IQTA 1K8XA 3N6JA 4YIWA 1FWDC 3S8HA 2VUYA 3I4EA 4Q22A 5HINA 1SJDA 2PP1A 4XZLX 2OQHA 1NDZA 1KTBA 2OG9A 1H11A 3W7QA 3T4CA 1KRCC 2B81A 3NL6A 4JTKA 2R1NA 4IMDA 4DBDA 2DZSA 2Z1WA 3UJRA 2NV2A 1D8WA 3NM1A 1VC4A 5G2HA 4ZENA 3DC0A 4DWSB 2O7SA 4HZ7A 1W5PA 2A21A 3QH2A 3UR5A 1DTUA 1A0CA 2R94A 3W1NA 1RVKA 1XC6A 3R43A 5M17A 3KL3A 1X1OA 3GNPA 4HHMA 2E8YA 1TWDA 3R89A 2BNJA 2G96A 2AQVA 2VKZG 4XD4A 4ZEPA 1CGYA 2J7HA 3IUDA 5CCZA 3E02A 1DJQA 1QO2A 3VKCA 5DXYA 4LF1A 1ALDA 3BWWA 3RLVA 5C5YA 3W29A 3M47A 3OBEA 3ONCA 3VIJA 2WM0A 3TFCA 4JTUA 4NP7A 1K9FA 3MWCA 3GG0A 3OBKA 1EP3A 1GYNA 3PSWA 3QPZA 3E1F1 1AH3A 3IVSA 3H8AA 3PWIA 1B9BA 4PCSA 2QQ6A 4J3WA 1ZBCA 4FF7A 2EPHA 2PWGA 2GJLA 2QUNA 1XLAA 3OTRA 4ASTA 3GXNA 3RLGA 3PN8A 1RV8A 2WJZA 2GJPA 4MWAB 3BMVA 2VEIA 1KW1A 1YW1A 3UNTA 1VCGA 3ZT5A 1JUKA 4FXFA 5G2WA 1RK5A 2FYMA 3CIVA 2ZUNA 4PMYA 4IGHA 2B7NA 3LRKA 3VCCA 3ARSA 3MO4A 2G5WA 4ZQNA 3LERA 2V68A 4U28A 2B7OA 2WC4A 1IWBA 1NY1A 1CIUA 2BHZA 2TYSA 5BMXA 3MUCA 1RA0A 3CWNA 4JY9A 5D02A 3S9YA 2FVKA 3CPRA 5HAOA 3QGAC 3GU1A 3GW0A 1UOZA 2DU2A 3CH0A 3MS8A 5FEPA 4BI6A 3EMQA 3QW3A 3WFLA 4K2SA 4AD3A 2GSHA 3C2YA 4NUWA 3T08A 4QDMA 4KFOA 3DG6A 4ADSA 3GFXA 4KPLA 3OLDA 4FNUA 4DIAA 4AZ5A 4JTTA 2VL4A 2ZVIA 3I7QA 1GGOA 3NQMA 1HVQA 1XYAA 1PKYA 3VILA 4Z1CA 1U5HA 1JYXA 3OLGA 3Q65A 3UZJA 4TX9A 2VEPA 3K4AA 2ZWZA 4C6BA 3J7HA 1W2PA 5FOOA 3GUGA 3OVRA 4HTYA 1ZJBA 3W2MA 2TPSA 3F4NA 4AZCB 3IIXA 1W91A 4HU3A 3ARTA 1QT1A 4XQ6A 2WKJA 1VJZA 1DWHM 5AHLA 4JTAA 2D73A 4P61A 1PX3A 2GDQA 1KV8A 3URNA 2ZDSA 3ISIX 5KTLA 1XISA 2DZUA 2P3ZA 3N2CA 1QWGA 2PE4A 5CPNA 4YS1A 4GIRA 1Q65A 4FMVA 5I3FA 3VDAA 4A29A 4PGLA 1EUAA 1I60A 1KTNA 3TYZA 2ZADA 5EA9A 5G2IA 2UZ9A 3W07A 4U3CA 3KVJA 4NZJA 3K8MA 3LUTA 2O0TA 5RUBA 4PSPA 3EMCA 1DORA 4DO5A 4V15A 3LCGA 3GVRA 4HNVA 5H1WA 2QPSA 3AMGA 1F73A 3WH9A 4Z2LA 3AWOA 1HO4A 2WHMA 4UTIA 1PTDA 4ATDA 2QF8A 1VHNA 1BTMA 3NGFA 3AS0A 1MDRA 1E9ZB 2VENA 1G7UA 2OELA 1OC7A 3R0KA 2O55A 4RE0A 1YPXA 3V0TA 3VDCA 5E0FA 1XCXA 4O50A 4WVXA 3T2PA 1W37A 1IXPA 3VNMA 1NWSA 4U4MA 4QG8A 2EF9A 4JEJA 1U83A 2YZ5A 1R2SA 2INFA 1S3TC 3PAJA 1AVAA 1X97A 5DELA 3A3XA 4ML4A 2CZVA 1GQJA 3SECA 4UMCA 2HVOA 3BQ6A 1LYXA 1OX5A 1E15A 1EP2A 3HA1A 1AQMA 4IX0A 5IDIA 1NVMA 4Q6XA 3CHVA 3VD4A 4PR4A 3AROA 2XSBA 3OJGA 2J8TA 3BXWA 1TMLA 3PHAA 1EJWC 4GY7A 5K4ZA 2NUXA 1LUCB 2I17A 4JCLA 1NF7A 3QVQA 2GVGA 1M9HA 3WG6A 5A6AA 1WZMA 1FWWA 1FFQA 2R1LA 3GR7A 1PKNA 2ACSA 3TMLA 2EJAA 1TJ1A 1V0LA 1SPQA 2TRSA 1T96A 4JTRA 5C9XA 3GYCA 3TQPA 2BX7A 1ZCCA 5M3WA 2I14A 3LNMA 1J01A 1UW9A 5BU9A 1QOQA 4UNKA 3S1XA 2FZMA 1WV2A 4D8ZA 1LRQA 4FOKA 3PJTA 4E8GA 5HQLA 3KHDA 4C6FA 1A5UA 3MP4A 3WD1A 2F2HA 3MDUA 3DHFA 4D71A 2Z7KA 1OHLA 3FCPA 1RQHA 3QV9A 5I3KA 1UKSA 2Y0FA 1TELA 2PS2A 1Y5VA 5DFAA 5JQ9A 2BXYA 2OT1A 4P8WA 1I4NA 3PUDA 3W28A 3VYLA 1W0MA 5H8MA 4KWOA 1UZHA 3OLIA 4JN7A 2FLIA 1A50A 3XISA 3A4WA 2QUVA 4JR5A 4URIA 1VR6A 1LOSA 1A5OC 4AX7A 3BLLA 4LVFA 5ABHA 4QR6A 3ZR6A 1XS2A 1CLXA 4XB3A 3JR2A 3H4XA 3L2LA 3A22A 1XBYA 3M0KA 3WJXA 3CEUA 3R94A 4Y6GA 4O17A 1KCXA 1KC7A 1OG6A 3E0WA 1TREA 1DTNA 2ZWYA 1HN1A 3LV6A 4HJWA 3VNKA 5BW6A 5E9XA 4FX6M 3GX9A 3UETA 1H63A 1BYBA 1F05A 4IIFA 3TOPA 1GOMA 1YE6A 1E1FA 1SR0A 1PZ2A 2E3ZA 4QE5A 1YNYA 3GRIA 4NRRA 1RJQA 4H9YA 2J13A 3W00A 3CHEA 1RPXA 4UTFA 4Q4RA 3G18A 2E6DA 3RM8A 3SADA 3N29A 1SM9A 3QY8A 2F6UA 4GYKA 1HUVA 3BG3A 3WDPP 3GC2A 1XDJA 2Q71A 4IXXA 2B31A 2PZNA 4KH2A 4K6AA 3GH4A 1LG2A 1OABA 4YWSA 2V8ZA 4NAFA 1T41A 5AYZA 2XH2A 4AIOA 4HSNA 3QC0A 2FMOA 3RYSA 2BVTA 6TAAA 1WA3A 2OVLA 1U1UA 4G7EA 4IQLA 2R82A 1E55A 4IMFA 3DFSA 1GHSA 3W82A 2DSUA 4S3FA 4FNPA 4QISA 1DE5A 2CHOA 4J28A 2D2OA 1YIXA 4AZ6A 4OHQA 1C7TA 2QW5A 4GZJA 3TW9A 7PTDA 1RVGA 3LPOA 3BDKA 2O56A 4E2OA 4Y9PA 4IMEA 2PGRA 2VDHA 2EPKX 1UH3A 3N4FA 1T8QA 2YBUA 3NQ6A 3UG4A 1EJSC 4E4PA 3EA3A 3HGRA 1E5NA 4QDPA 3H6OA 2RDUA 1XICA 1NP0A 1QFEA 1NSJA 4IP5A 2OLAA 5CGQA 3KP0A 3N17A 1ZPTA 1XGZA 1K6AA 1J0JA 3ITVA 4GOAA 1JFXA 4DM2A 5HMEA 5BROA 4NJHA 5B80A 1HJUA 4F0KA 1HJVA 4FP1A 5CPLA 4R88A 4G2DA 3G1HA 1ADDA 3WLKX 1TUXA 1RPKA 3V0UA 2EKGA 3MI3A 4NAEB 1ISWA 4PL1A 4JY8A 5XIMA 3LGDA 1MRQA 1E1CB 5G1MA 1W5QA 4GI8A 1MSSA 2INEA 3M5YA 1CWYA 2J75A 1XD0A 3GC4A 1VHCA 5EKYA 1LROA 1K9DA 2VC6A 1BXNA 1LL6A 1OYAA 2BY1A 2ZRUA 3JU2A 1XSKA 4FXSA 1TJRA 2P50A 3UJ2A 3HBLA 1KGUA 5ECUA 3MUIA 5AVNA 3A12A 5BZAA 4FX8A 4FO4A 4DI8A 4MY1A 3AS3A 3WQWA 1R0MA 1Z3NA 4LTSA 3CMGA 3S46A 4S3JA 2Q6ZA 1O12A 4GZEA 2RH9A 1HJWA 2FH8A 4I9TA 1R5YA 3C0LA 4IUGA 3T09A 4DRSA 1KRAC 3C2OA 4D8LA 1R6WA 1TPUA 4DJFD 2QVHA 4OUEA 2CLOA 3G0XA 2WJDA 3WQVA 1UC4A 3CQHA 1V3JA 5M1TA 4J2MA 1E40A 2C91A 2FZ8A 4A3YA 1BVNP 3P8JA 3OA5A 4R7OA 5DCBA 2Q8LA 4B5XA 2X1SA 4GIAA 1QMLA 2FHCA 3N19B 3GHRA 3AHTA 4F66A 4J3ZA 1FVPA 1NDVA 2QEZA 3MP5A 3DH7A 3T0CA 1PWMA 3KZSA 4FF5A 1TPDA 1MXGA 2CKRA 1Q85A 2ZTKA 5CSRA 4DJED 3PTDA 3UCQA 2AGTA 3ZSSA 1R7AA 1V79A 2QDHA 2HNHA 4HMDA 2J7GA 2Y62A 5HJXA 1AD4A 1Q3NA 2H9AB 2GDVA 3GO2A 3DBPA 2J7CA 4P7LA 1V7AA 4S3CA 2YA2A 2C18A 3O9NA 2J24A 4QS5A 4W85A 4EOUA 3T4WA 3WK2A 4EPDC 1K7XA 1BVZA 1NWRA 3V5FA 1REQB 3Q67A 2D3LA 4KGLA 2PODA 3BZJA 3P67A 3ZXWA 3N1AA 3OGRA 3QQ0A 4CGTA 1AD1A 1A53A 2W92A 3O8AA 2VELA 2WZEA 5EMLA 1ITQA 4YJ5A 2OYLA 2JEPA 1R85A 4RDYA 3GAKA 2HE5A 3C6CA 1ODUA 4N02A 3W7LA 5AECA 4GWEA 2YB4A 1E5JA 1DHKA 3WBXA 4UTLA 1A5MC 1QPRA 3PNZA 6ENLA 3UWEA 2G95A 2BZNA 3KTSA 1W3KA 1GVOA 4Q33A 3ENLA 4DBWA 4NX5A 5BOOA 3AALA 1JCYA 2FPTA 3NQCA 3AIBA 4XD3A 4AWTA 3FX4A 1Z32X 2HXTA 1UB3A 1LCOA 2Y8VA 5E5CA 1ONEA 3BW3A 5IM51 5LGXA 1UKTA 1BKHA 1PZ1A 4CQCA 1E43A 5CC5A 4AFYA 4H4IA 3GTXA 3UD6A 3AMDA 1GKRA 3H7RA 3N12A 3GR4A 2ZCGA 3HMCA 2QJJA 4HIBA 4KBXA 5U7SA 2GUUA 1W3NA 2Z24A 4ZTYA 2REQB 3QPYA 1I1XA 1TQJA 4YCOA 4E2DA 3CUXA 2NV1A 1OT2A 3AZSA 2Z0IA 1TV2A 3AYSA 1PB0A 3T81A 5A2BA 3IV3A 3OGSA 4QXIA 2PCQA 2H90A 2EO7A 3UU0A 2FGLA 2PD9A 5CPMA 3QOMA 1TWWA 2NLYA 3FIGA 3NUKA 1XLGA 2Y8KA 4Q6JA 2NSXA 3KOYA 4V1XA 1EX1A 2VFDA 3QSRA 5CLWA 4JOMA 3W2LA 2CLLA 1XRVA 5DMNA 2P53A 2Y4SA 5C7VA 4DO7A 4LS0A 5FCZA 3MANA 1CI1A 4QBXA 3LQLA 1KKOA 2EKCA 4DX3A 4GFIA 4MPQA 4MNMA 1TE6A 1R8LA 1EH9A 4LUTA 3VMNA 4GQBA 4IH3A 3ARVA 2DSZA 2DJXA 4M29A 1V4YA 4L61A 3LXCA 4HSHA 3ITCA 2XFRA 5JU6A 3CMFA 2WQPA 1FHDA 4GNKB 3VU2A 3V36A 3QLLA 4O54A 1I6NA 4MLJA 3NQ8A 1TIMA 2J77A 3ZVIA 4GNVA 4C5YA 1QBBA 1HL9A 3TLLA 2PFHA 4O1DA 3ANVA 1W5NA 1W9DM 3G24A 1EGVA 2F9RA 1OJXA 3OO2A 3PS7A 1IEWA 2OR2A 1HKMA 1EHNA 3O0FA 2QHAA 3MZNA 4A2RA 2OTDA 3OPSA 3NZPA 4C1LA 2H3DA 1YDYA 2J4GA 4B3KA 2VX5A 3SQLA 1UD2A 5EMUA 4DUOA 2P8BA 2AKMA 4N0RA 3MYPA 3XINA 4W5ZA 3UYIA 3HG3A 1BAGA 1QNQA 3CS2A 4GLEA 5EY5A 3N4AA 4AXNA 5CJ5A 1DIEA 2PDUA 3V5OA 2XINA 7ODCA 3UBPC 1OFEA 4Q4SA 1KGWA 3GBEA 3PZVA 1L2QA 4OUIA 5BOEA 1TPEA 3KBWA 3GKFA 2HCVA 4B15A 2BY2A 3UWYA 3LBOA 2A4AA 3DENA 4F0MA 2BWGA 3R6IA 1F3WA 1KM1A 2D1ZA 1RY0A 4CNPA 3N3TA 1Z42A 4NQ1A 1XH1A 3VKAA 4LGXA 1RCOB 2DUAA 3PUOA 1LBFA 4CQAA 2ISDA 3MV01 3YPIA 1FCUA 1FQ0A 2QLYA 3LA4A 3DFYA 3TTYA 1X98A 3TN4A 1UH2A 4L1GA 2WPGA 4PB3A 1GTHA 3FSUA 3M7WA 5C2XA 2R1KA 2A6LA 1PAMA 4JIPA 4Z2GA 1MYRA 2IKIA 5D9NA 2FB2A 1XR2A 3I65A 2V9DA 3WK0A 3PFMA 1O94A 4HA1A 5CPSA 3CL7A 1XSIA 1DL3A 3GXFA 4NRSA 3TZNA 3TTEA 3UZZA 4C6JA 1F3TA 4XUYA 3NPVA 2WAGA 1JQXA 3USZA 1XBVA 2ALRA 3GDBA 3TSMA 2POZA 3KLLA 4S2CA 4PBFA 3WNLA 3NDOA 2PZ0A 1C93A 1KRMA 2VVNA 1V51A 3G8RA 3LEPA 3UGVA 4ZE4A 5DY2A 2J9XA 4UTWC 2YW4A 2WCAA 2PLJA 4RW3A 4A8LA 1CXIA 3MMUA 1GZJA 2WJFA 4X3ZA 2DT1A 2R1PA 3LCIA 5CAKA 3BTNA 1EKOA 4M81A 5HMFA 3KOFA 5I3DA 4G1KA 3QN3A 2PBOA 2WMIA 3APTA 1GHRA 4UTWA 4C7DA 1PSCA 4WHBA 4Q4OA 4S3DA 4O11A 2CZFA 3B0YA 4PB5A 2FZNA 4RDZA 3L4UA 4BA0A 3P5ZA 4ZFCA 1O5QA 2WSRA 5D05A 3AYTA 3EMZA 4JXCA 3BJFA 3WO8A 1MW1A 2FVLA 5AHIA 4J27A 5E6YA 2BS9A 3IJDA 2ZX7A 2VOTA 1AJ2A 1ME9A 1WB0A 4L6OA 3LHUA 4IL0A 4PMVA 4UQBA 2WWCA 4AWSA 2V3GA 4RPPA 1KBLA 3HQNA 4IIGA 1XIIA 5F2IA 4ZCWA 4ERIA 1YTDA 2X0YA 2EPMX 4QX4A 4RV8A 4TX8A 5F7UA 2QIWA 4OIFA 3DBNA 3GTIA 3VXGA 3SIMA 3K4DA 4X9SA 3LPPA 1UZ1A 4O52A 2V2DA 4D6CA 4PEKA 3C2RA 4TVDA 1ISYA 3RAOA 4W4QA 3AHYA 3DIPA 4IJBA 3MCMA 9RUBA 3RIKA 3UG5A 3LD5A 2HISA 3QR0A 3KBJA 3H22A 1TJPA 3O06A 3MKVA 3MBFA 2NQLA 2VEGA 4AHOA 4R9XA 5AC4A 2WHKA 4U3AA 1CCWB 2C0HA 1FP8A 1PJ9A 2Z2BA 2O4QA 5E93A 4JFSA 4IICA 2OFJA 1F8IA 4F2UA 4YL2A 1VFOA 1A3XA 3GWQA 3B8TA 1EWEA 3EWZA 3W7DA 1W3LA 2QMKA 1RCXB 2XVGA 1LTDA 1E0VA 2G97A 3RG6A 2VEMA 2FTWA 3NPXA 2R8WA 2I16A 4E4UA 1M7PA 3OLEA 3WDHA 4LRSA 3T40A 2Z29A 1VBUA 3POHA 3B0PA 5IOBA 4I90A 1IYXA 3AMCA 4PZVA 4O1BA 3LHYA 1AQFA 4WCJA 3VNDA 3NDZA 5DBUA 1VBHA 3F4VA 4H01A 1LBLA 4PMOA 1QNPA 2HS6A 2ZXAA 4HZ8A 1MEIA 4IPNB 4H19A 4LANA 3QZ6A 5I3JA 2G4FA 1YADA 1VEPA 3W38A 1R9YA 1EXBA 5FJUA 1QNSA 1O5KA 1ZJHA 2GVYA 2CLKA 2CLHA 1T8XA 2WNWA 3RPDA 1UP2A 2PC4A 1HVXA 3SCUA 1H5VA 1PKMA 1XLDA 3S9IA 2WHJA 1RBAA 3K2GA 4HCHA 3ZJ7A 3UPMA 3PB0A 3SCQA 4PBGA 3IK4A 5JH2A 3DC8A 3WMSA 5KZDA 1D3CA 5FAGA 3U7BA 2YFOA 1D7FA 4XAGA 3VDHA 5IXEA 3AUJA 4DZ5A 3LBCA 4X63A 1UZ4A 2R24A 4GQQA 4MY9A 3TN5A 4P5UA 4DLMA 1AL8A 4YNGA 4LY4A 1JCMP 4GVGA 2XUCA 3WLMA 5T9CE 3UZYA 1LQ2A 1AZ1A 2VM8A 3ECQA 3DDMA 2W6RA 2ACQA 1G6CA 3M5XA 4KWSA 3S47A 3TSBA 1J2WA 4N9DA 1SW3A 3PZQA 4Z1YA 1PHQA 1I0DA 3FA3A 1K8YA 4A3HA 1KFBA 5EB8A 2C7FA 4GO8A 3U0HA 4ACZA 3P60A 1PDYA 4ZQRA 3EWYA 3S2JA 1FOBA 4IPJA 4AD2A 4C91A 4DWDA 4V2XA 3V4BA 3B04A 3CZ8A 3VFCA 3B9DA 2CU0A 1DJXA 5FJOA 2EPNA 3H12A 4A21A 3CLWA 4DYEA 3GH7A 4MB1A 1A47A 1XLFA 1V3LA 3ZS4A 4PE8A 1E4NA 5LXXA 1W8SA 2VZUA 4NZFA 1U22A 3STEA 1DXEA 1SO6A 4NY2A 4TMBA 5T9BG 1ZUAX 1H1ZA 2Y7EA 3BSGA 2Y70A 3WLPA 3TJLA 3GIQA 3MJMA 2V5CA 1M41A 3WUBA 3FJ6A 3UFYA 3W85A 4TMCA 3ITGA 4ADTA 1N8FA 3IJQA 3QPEA 3MT1A 3O16A 3LMZA 4P8UA 1J96A 3ITOA 2RUSA 2QCLA 2DZTA 4S3AA 3VIPA 2VGBA 3WH5A 1C92A 3PPGA 3WL1A 3CYVA 3MHFA 4XKYA 1GPWA 3ANUA 3NSMA 4IUOA 5SWUA 3ABRA 5I02A 4J3TA 3R7MA 4ZQOA 3WMBA 4PTDA 1DOSA 1ADSA 3QFEA 3V5CA 4AH7A 1WAUA 2OEMA 1XFCA 2QULA 1TFVA 3WELA 2GL5A 4GJJA 1QWKA 3ES7A 5FEZA 1WDQA 3S6TA 4JL2A 5LHEA 2Z7GA 3VX0A 1ZB5A 3TQVA 2OLSA 3CUHA 2OT0A 5CSUA 1FHLA 2DW6A 3AXXA 3W72A 5H91A 5REQB 5LSMA 2WJEA 3HPAA 1JUBA 2O9RA 2W91A 2GLKA 3HJEA 1Q6EA 3NDYA 4GUGA 1US3A 1H62A 2IPJA 2HV5A 2H8ZA 4Y9MA 3M46A 4W93A 2ZE3A 2R91A 5JMUA 5HWMA 3EKZA 3LX9A 3OU8A 3VUPA 1N55A 4XBSA 2J25A 3IS4A 3GSMA 4UNIA 4DAFA 1POKA 4HVXA 3ZJ8A 1SFTA 3R13A 1OYBA 3E0FA 4HCLA 3TR2A 1SU5A 4MDOA 2QCHA 3R10A 1DVJA 2JFEX 4W8BA 5MKGA 1M5WA 4DJDC 1KM0A 1Q45A 1MFVA 1GNXA 5F4SA 3WYZA 1CLKA 1GOOA 4JTGA 1RD6A 2DZVA 4TV5A 3VKBA 1OIFA 1O7AA 3V35A 4OV4A 4A35A 1NFGA 3FV9A 2ZRWA 4DJDA 1IZCA 5A8PA 1V3KA 3RR4A 4EPEC 2AAAA 3QKZA 1P0BA 5AHNA 3FKKA 4JQ3A 4X60A 5KITA 5LA2A 1QNVA 1CECA 2HBXA 2J47A 1ML1A 5BCAA 3VZZA 5C54A 1IGSA 3EAUA 3W2NA 4CNUA 2WVVA 3BOLA 2G8ZA 3TVAA 4PMQA 5A2AA 1ZL1A 3FYOA 3BCDA 4M80A 2VDGA 1R3YA 2PDWA 3P93A 3VM5A 1KM6A 3SGGA 4QHRA 2PDFA 4UQDA 1DQUA 2Q3RA 2GJXA 1G94A 1E0UA 1TPB1 1O1ZA 3FN9A 1D3GA 1BHGA