4GC4A

Crystal structure of the mutant r160a.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
b'DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gc4A00
2CFFA 3HJZA 3OVPA 3IIZA 2Y88A 3TX9A 4RK8A 2R14A 2C18A 4FXSA 3M43A 5HWJA 4QITA 1TB3A 5HWNA 3L67A 4JTUA 1AW2A 1C29A 1FWRA 1WDWA 3W1NA 1KV8A 4K6AA 4LVFA 5F2GA 3CIWA 3G1XA 4A21A 2GVLA 3O63A 2O7QA 4JYFA 3CEUA 5HR6A 4M6PA 1PE1A 3C52A 4GUJA 3O6CA 3W22A 2NXGA 1OYCA 3G0SA 4PEKA 1QPOA 4HNVA 3BK0A 1QPRA 3WJSA 3KVKA 3GR8A 1A5AA 3NQ8A 3TFCA 3QH2A 1NF0A 4LRTA 4A3UA 4HN4A 4K8HA 3W7GA 1FY6A 4ZZ9A 3L68A 2DZTA 4H4IA 2GPTA 1H61A 1UUOA 4RZ5A 2W79A 4K39A 1SO4A 3W7CA 3FJ6A 3TCEA 1YTDA 2H90A 1F05A 3AO0A 4EIVA 1EP1A 3NZ1A 2VOMA 3O6YX 5G4WA 3W75A 1ML1A 1V5XA 3G18A 4TMBA 4JTHA 2DZPA 1F6PA 3L5AA 3O6DA 4Z1AA 4JX6A 1NAL1 3IIPA 3S5ZA 3S5OA 3QMSA 3UPWA 3C3NA 3G8EA 3HB9A 3L0GA 3HOJA 4ALDA 3S0CA 1XXXA 5KINA 3VE7A 1MSSA 5EL1A 3Q58A 1JRCA 4RV8A 1TV7A 1H7WA 1KM2A 3HBLA 5KSWA 4DO4A 5AN7A 3RLUA 1FWNA 1SW3A 4IWWA 2Y7DA 5FF3A 5DN1A 3NL6A 3S5YA 3E96A 1VS1A 1RQBA 4XUGA 1LOSA 4JTLA 5E1QA 3ZWSA 2ISVA 3SECA 1TRIA 1H50A 1KFBA 4LUJA 2Y85A 1TRDA 4RZ6A 4GC4A 4JN6A 1Q6RA 1TPFA 8TIMA 1UUMA 3BLIA 1FCVA 2QJHA 3MI3A 3A22A 4CCEA 3STFA 1OHLA 3GYEA 1TTJA 4LUIA 3BW2A 2FFCA 3QMRA 3K30A 1XI3A 4XKYA 5AHEA 1W37A 1EWEA 3WJWA 2OX1A 1MEHA 4UC5A 3UWYA 4O13A 1VH7A 3BG3A 1GWJA 1A5SA 3L2IA 2QCGA 1I2RA 4JTIA 4UFMA 5H2ZA 4HNUA 3C61A 3IVTA 1EWDA 3NPWA 3BARA 4YMZA 2XN2A 3TJXA 3IIVA 1PV8A 3LRMA 4DPQA 1L6WA 5F2MA 2F7FA 3NZRA 3W1XA 1DL3A 1HFBA 1PCWA 4FX7A 4MKNA 5G2IA 3L5MA 3L65A 3Q2DA 4BI6A 1Z41A 2V2CA 2TMDA 2RDUA 4OWGA 4D2JA 4I7UA 4LS0A 4JYEA 3JS3A 3DAQA 4X22A 1NSJA 1LLZA 3OG3A 1RQHA 1SUXA 2VFFA 3LTYA 3QZEA 2C16A 4OQVA 2D73A 5IBXA 4NT0A 1B57A 3ZR4A 4KFOA 1OYBA 2A7PA 3NPXA 4UFKA 5G2WA 2VFDA 4RCXA 1ZCOA 3NQEA 5EYWA 1IF2A 3NNTA 1KFJA 1VHCA 3LHTA 4UFJA 2C3ZA 1BTMA 3DFPA 4WOQA 2B4GA 4YCOA 2EAWA 3C4UA 2DZVA 3EWWA 4A2SA 4AB4A 3QF0A 5KMYA 4JTGA 4MIMA 1L6YA 1T99A 3W1RA 1HO1A 3LCXA 3A5VA 3WJYA 2J9YA 4IX2A 1DOSA 2YSWA 3EEGA 1H60A 3TQKA 3TE9A 4L4MA 2I1OA 2X1TA 1H5YA 4MLJA 1N7KA 2PURA 2EKCA 3NL2A 5BMWA 2YW4A 1W3TA 3I65A 3W1PA 3S42A 5J5RA 2A0NA 3E02A 3TU9A 1IIHA 2YYTA 4MZ1A 5CZ0A 3M6YA 2JGQA 3B4UA 1CW2A 4MFEA 2ZDRA 4JR5A 3GK0A 2BZNA 2YW3A 4ML9A 4XBKA 4QNWA 4FNTA 3UWZA 4K38A 2XN1A 2OCZA 1SFJA 3EXTA 3KRUA 3MUXA 4A22A 4R33A 1H63A 2CZFA 3N3MA 1WX0A 4A29A 5HWMA 4TIMA 3ELFA 1LBMA 4O52A 3M5VA 2E1DA 3NL3A 1D3HA 2WO5A 4TR9A 2X1RA 1W5PA 4N4PA 3T40A 4DO5A 2E5BA 4Z08A 2ZA2A 3ZFHA 3GDLA 3E9AA 3RMJA 3LCIA 2ZRUA 3OBKA 2EPHA 4JY8A 4O10A 5DELA 1S5VA 4AHOA 3IEBA 3S1WA 4AHPA 2C1HA 2VELA 4LT9A 2YR1A 3PSVA 2OJPA 4HKPA 3G0UA 3SR7A 3QYQA 1JRBA 4MVAA 1F76A 5I3IA 4ADTA 3LCLA 1H7RA 1LRNA 5EBUA 5KITA 4K7VA 1K3UA 3UXDA 5LKYA 4LVBA 3ABOA 2GVJA 3LTPA 4JGDA 4AVFA 3ABQA 1O5XA 3KXQA 3E0IA 3W7JA 1M6JA 4E2DA 4QNEA 3GAKA 2WJZA 2ZZ5A 1VJIA 3DZ1A 5CG7A 3DFOA 3G1YA 5C54A 5CSSA 4BI5A 4MPQA 2G96A 4XTIA 6ALDA 4AWTA 1QOQA 3IV3A 4QIUA 4O17A 4DELA 1IGSA 4KFNA 1XFBA 1LOQA 3STCA 6TIMA 1TV8A 4Y9AA 1FCQA 1DJNA 1XBYA 2DJLA 4CQ8A 3N14A 5MHBA 4RR4A 5F4WA 1L2UA 4JIQA 3BVJA 3HPZA 3TNOA 3LHUA 3TV8A 3W87A 2R8WA 3HG4A 3O05A 2B0MA 4QQ3A 3OIXA 5L6UA 1K7XA 3OVQA 3LM7A 4UMCA 5D33A 5CSRA 5FEPA 4BR1A 1EX5A 4QISA 3PR2A 2PE4A 1NFBA 1QCWA 4GUGA 4EF8A 5HULA 4MFDA 5HQEA 5DXXA 3L66A 1PHWA 4M6VA 1A50A 1KM3A 3TSDA 1WYIA 4MJZA 3FA5A 3F1QA 1AW5A 3EX2A 3MYPA 3DH7A 1QOPA 4JTJA 3PG8A 1YXCA 3A23A 2BX7A 4UFHA 3G22A 1NF7A 7TIMA 3DU0A 3SW6A 1BWLA 3LI0A 3M16A 3S1XA 4PL2A 3TQ0A 2E6YA 3P80A 3KRSA 5LGXA 4LS1A 2FLIA 4AAJA 3BO9A 2YGYA 3BLEA 4O4VA 2J27A 1K8XA 1Q6QA 2TYSA 2V81A 2Z1BA 3MJYA 4JICA 5C5YA 1J5TA 2ZCGA 3A5FA 3W23A 4AHQA 2WSQA 1I2PA 3IIOA 3M44A 4KFPA 1JCXA 5I3KA 1VRDA 1OX6A 1GG0A 1EA0A 5HUOA 3UPBA 4JTTA 5K4XA 1I8JA 4UNKA 5J5DA 2CLKA 3FJLA 3RNDA 4UTLA 2A1YA 2OT1A 4CCCA 1VCVA 1JR1A 4O19A 3FOKA 4ZQMA 3MO7A 2BSLA 4JTKA 3BGGA 4LS2A 1RD5A 4WY0B 1T0OA 4QSHA 4CNOA 3GZ3A 3GX9A 1RQEA 3EXRA 4U4MA 3W73A 1O4UA 3O15A 2H6RA 3MYOA 1VLIA 4ZQOA 1I4NA 3R2GA 1F7BA 1QDSA 4LTSA 2JKPA 3EX3A 3GXPA 1PS9A 3MBDA 3G8RA 4FNUA 4IMCA 5KTLA 5FESA 1F74A 3R12A 1PCKA 3W9ZA 2GVGA 2ZRWA 1WAUA 4ZQRA 1O95A 2Q8ZA 3TJLA 4TX9A 5G1YA 4N9CA 1ZY9A 1LRTA 4O0ZA 1ICSA 2RDTA 3N34A 3TXVA 1QO2A 4FB7A 4IMFA 4UTTC 2QUUA 1IXNA 3PSWA 4CCDA 4RXFA 2HTMA 1EP2A 1AK5A 1ZAJA 1FCBA 5AC7A 2Q3RA 2NLIA 3P61A 5DY3A 1ALDA 3L0NA 4RX0A 3W1UA 4DF0A 3R8RA 2CZEA 2QDGA 1KLZA 3DHFA 4JXCA 2QJGA 3FYOA 1BKSA 3QRHA 2X1SA 4QAIA 4WD0A 4JDYA 3Q37A 1MXSA 5IM51 1S3HA 3A24A 3NXFA 4L4LA 2ZFAA 4W9TA 1HL2A 3EKZA 4AEOA 2X2GA 3CWOX 2EF9A 2NWRA 1G4TA 3MMTA 1JUEA 3MHGA 1U5JA 2X1UA 3I68A 1GTEA 3W83A 4JEQA 3HQ1A 1SO3A 5KZEA 5LNUA 2WSRA 1OFPA 3BLFA 2P1FA 4GJ1A 4MOZA 3M7WA 3UD6A 2I14A 1SU5A 3HGSA 4PL1A 1XUUA 3FYPA 2Y7FA 4AH7A 4IMEA 2QCDB 3P84A 3PBYA 5D32A 2A2IA 4UTJA 3G1DA 1L6SA 1TQJA 2ZA1A 1TO3A 3C2RA 1YLVA 2JGYA 3HG3A 2ZZ1A 3GNDA 3LHVA 2VXNA 2X30A 3BW3A 1SSGA 2QDHA 2TPSA 3MI2A 1ZHAA 2YFNA 3LHYA 5FEZA 4AWSA 1EIXA 1SQ7A 4BK9A 3LCWA 3G1VA 4FO4A 1IXQA 4U28A 2A6LA 2YX0A 3GLCA 4NNBA 3B0PA 3HPSA 2Y62A 1VHNA 2Y70A 3IGUA 1TJPA 4LW7A 1X7FA 3M5YA 3M41A 4LNYA 1GVFA 1TTQA 5DBUA 5LNVA 4Z1BA 2CLOA 2DU2A 2VC6A 2R94A 1GPWA 2R91A 4PODA 1SO6A 1L9WA 1RVGA 3KVMA 5CZSA 3T78A 3F4WA 2DZSA 1JVNA 2YDAA 1DBTA 4TU1A 1KFEA 1OVDA 1KTBA 4O54A 2AGKA 3W1TA 5LNSA 2H8XA 1EPXA 3C56A 4N6EA 3IRDA 5FF4A 2YYUA 4LRSA 1SFLA 4ZL1A 3PC0A 1DQWA 4UMBA 5EMUA 3QFEA 5F2IA 5AHMA 3OVRA 3EX4A 5L9FA 1TREA 3HGOA 2A21A 3MP3A 4UTHA 1GVOA 5AHFA 2DJXA 3NR0A 1QPQA 1YTEA 2G5WA 3W1AA 1Q45A 1B4EA 1KA9F 3N2MA 3B8DA 3H54A 3W3OA 1WOAA 2WV8A 3KFTA 3VKJA 3MW7A 1AW1A 2Q3OA 3DGRA 4HNNA 5K3VA 1LDCA 3QM3A 4AF0B 1S5TA 5H91A 4LV4A 3C2OA 1WBJA 2FTPA 1TPH1 4IXXA 1TPC1 4HPXA 3P5ZA 5I3GA 1LP6A 2BXVA 3QPZA 2H8ZA 1PHQA 4DBEA 1GTHA 3DHDA 1QAPA 2G97A 2B7QA 1J2WA 1HTIA 3U2OA 3DFQA 4UUIA 2E5DA 5D03A 1S5WA 1RZMA 3ABSA 4GBUA 2QAPA 4QJ1A 1LRQA 4DBDA 3W71A 1G7UA 1FDZA 1OX4B 2Z0IA 4JX5A 1JQXA 3VE9A 4ZQCA 5LNRA 1P0KA 3N73A 3PUDA 5K7JA 3SFKA 3B03A 4EF9A 2YZRA 3TIMA 5U7SA 1V7YA 3FKRA 1GJPA 4E38A 5AHIA 2W6RA 3LBCA 2V5LA 2ZQ0A 1G4EA 3W76A 4UTIA 2CZDA 2WKJA 1TIMA 4UMAA 3V75A 4CLMA 3HGRA 4MUZA 3VNDA 4CQAA 1Q6LA 2PRMA 4N9BA 1VQTA 2P0OA 1EUNA 3LCFA 3JR2A 3LLDA 3RU6A 3PY2A 5D38A 3NO5A 3UZ5A 4GUHA 1OX5A 1W5OA 1VZWA 3W7PA 3QSTA 4UNLA 3EWZA 1BEUA 2E68A 3TK7A 3B0VC 3S8HA 5AC8A 4WUIA 1H7PA 1NVMA 4JTFA 3NGJA 5CPOA 4O18A 3W88A 3LHZA 5D02A 2FPTA 3UZJA 3W07A 2H3DA 1KM0A 3I7QA 2JKEA 5CZJA 3QW3A 1FBAA 3G0XA 3W1LA 1VCGA 1OFBA 1IXOA 3KOFA 5TQLA 3NEVA 3SGUA 3QEZA 1QO5A 2C14A 3SY5A 3WJXA 5TIMA 3PBWA 5U4NA 5K9DA 1MEWA 1WOBA 1O94A 5G2HA 1LBLA 5HNRA 1R30A 2A7NA 4LC8A 2ZZ4A 2YXGA 3PBUA 3PF3A 4JY9A 2GJLA 5LZLA 4WX2A 4GUFA 3P67A 1ME7A 5E0KA 2V9DA 3DENA 1T8XA 3EX1A 2VFHA 1OYAA 3NAVA 3QQ1A 5FF0A 3KX6A 3LTSA 2V5BA 3PBVA 4LY8A 2RH9A 3O06A 2IQTA 3TH6A 1KM4A 2A7RA 4H6KA 1IIGA 2FDSA 1GYLA 3QC3A 4IPJA 3SJ3A 4YWIA 1W5MA 3W2UA 1KFCA 4YL2A 2BLEA 4LOCA 1W1ZA 3HGJA 1VYPX 2VEPA 2ZYFA 4FEZA 2QCMA 3N9SA 4KWWA 4DF1A 2HSAA 2QUTA 3L0KA 1FUYA 2ZRXA 2GUUA 1B3OA 1GG1A 2W0UA 2ZTKA 1SO5A 2TSYA 1ICPA 5K2ZA 2VFGA 3A21A 3TMQA 3C2VA 3KVJA 4C1KA 1OFOA 4TMCA 4PFMA 4MZYA 3W72A 2RKXA 1G4PA 4XWUA 1OF8A 3MHUA 4IMGA 1RPXA 3BGJA 1TTIA 4FXRA 3BG9A 1OX4A 3FS2A 1H1YA 3W7KA 3LXCA 1GEQA 2CZ5A 5AB3A 5I3JA 1W54A 1LCOA 4FX6M 5FEXA 3SZ8A 1Q3NA 5D2VA 3U6WA 2UV8G 3MP5A 2ALDA 3TAKA 1XBVA 2ZRVA 1G6CA 1Y0EA 1K03A 1J4EA 4WJEA 1DHPA 3W2LA 2B7PA 4FF7A 1JCJA 1G69A 3W1MA 3AJXA 2C0AA 2CLIA 4WZHA 3NQCA 2LLEA 4JNMA 4M6QA 3S1VA 3CM4A 1E51A 4NU7A 3C0JA 3NQ6A 3CHVA 4RZ4A 2V8ZA 4K36A 3ZWTA 3NG3A 2ABBA 3C2FA 1OFEA 4ORIA 2FIQA 5IBXC 2G95A 1LROA 1UCWA 4AMAA 5AHLA 2A6NA 4LV9A 2OMAA 3PULA 3CQ0A 4PCFA 4O53A 2WSYA 3C8FA 3P5YA 4JYDA 1VC4A 5FEWA 1P1XA 2E6FA 5LHFA 4S2BA 4JIPA 5AYZA 4Y90A 3TR2A 3NOEA 3KAOA 1YXDA 4O57A 2VKZG 3G1FA 3P82A 1K7EA 4UXDA 4OHQA 4P61A 1TCDA 2A85A 4HIBA 1OG0A 3LRLA 2ZZ6A 4GE8A 4IJBA 3DFNA 3LLFA 3NPVA 4FIQA 3TXZA 2ISWA 4OE7A 5CKSA 4NJHA 2DZWA 5LGZA 3N2XA 5D2WA 1AMKA 1KM1A 4XZ9A 2JK2A 1XCFA 3CWNA 3TFXA 1EUAA 4NVTA 1VGAA 2CLMA 3TW7A 2WNNA 4E2BA 1IXPA 3UXAA 2XFWA 4PTNA 4UFLA 1YADA 1I2NA 1RR2A 4R34A 3WK1A 1DV7A 1JCMP 2V0TA 5D04C 1WXJA 4H3DA 3B04A 2J9ZA 4LVAA 2QUVA 1HG3A 3SIZA 3TC6A 5D2XA 3HPXA 3RLVA 5HINA 4R7JA 4N9EA 1KTNA 5AYYA 1VYSX 2P10A 3LDVA 1W0MA 3UYCA 1R46A 1VYRA 3E49A 4EWND 3LI1A 4O50A 4S1FA 2DP3A 2QCNA 4WOZA 3E12A 1KFKA 1X8FA 3CLMA 2B7NA 3TSBA 2RFGA 2HS6A 4O16A 4OV9A 4IUOA 1XBZA 3VI2A 1AL7A 5F1VA 2NXIA 4HT3A 2FQIA 2Z2UA 4Q32A 5CPLA 3UY8A 1TPWA 1FXPA 2NWSA 2YCEA 2CWNA 4B5NA 4HSOA 5AFDA 4UR7A 5AYXA 1ONRA 1XUZA 3IVSA 3MI6A 3RF9A 3NQGA 1OJXA 1ZJIA 4IXHA 1H51A 3M5XA 1PVNA 4NZFA 1Z44A 4OT7A 3W7EA 3F4NA 1GQNA 3LERA 3UWVA 2J9XA 5BMXA 1FWTA 4I7WA 3QSRA 4UR8A 4IOTA 5I3HA 5LNWA 3MWAA 4ONVA 3LXBA 1A5CA 3N19B 5I3FA 3U8GA 4K8EA 4KWVA 1QNVA 3TDFA 2NX9A 4BF9A 3DKJA 3INPA 3KRZA 5DCEA 5K4ZA 5FF7A 2FB3A 3EWUA 3DXIA 4XBSA 1ZENA 3C2EA 1M7OA 4ADSA 2NV2A 4N4QA 3P7YA 4OBTA 1TPDA 3IGSA 3NYZA 3TA6A 5G4EA 2AQWA 4DQWA 2VENA 4DF2A 4R53A 3PB2A 3UWQA 4NZJA 3PS7A 1XDLA 3KVLA 3QJAA 4C1LA 1QR7A 3M0ZA 5CZTA 2B7OA 4Z1DA 3R13A 1TQXA 4PH6A 3KHJA 3W74A 3W7QA 2VFIA 3UQNA 4Q4KA 3W1QA 3P60A 4NJIA 1SW7A 3TC7A 4K7YA 2E77A 4X9SA 4NXSA 1GZGA 1FXQA 5AOUA 3LGEA 2ATMA 3GDMA 4HPJA 4NJJA 3W2KA 3CPRA 1W31A 3W2JA 3T44A 1TMHA 4O15A 3CC1A 4MZ8A 3WJZA 3P62A 1YDNA 1W3IA 1LTDA 1SSDA 3EWXA 4BI7A 1A5BA 1YDOA 3LBMA 5DXYA 3TUUA 4O1BA 4WY0A 1G4SA 5ABTA 2CLEA 2V2DA 1QPNA 1N8FA 3GXTA 3IIXA 3OHIA 3O8AA 3A9IA 1YPIA 1TPUA 2FPYA 4IGHA 3L5LA 4FNPA 3B0UX 4MY1A 4ZMGA 2QCHA 2RHGA 1I2OA 3EKLA 4O11A 1XKYA 3WK2A 1W5QA 1OK6A 3V1PA 3W7IA 1ME8A 1H7NA 1W5NA 3M9YA 3W6YA 3FLUA 4ZQNA 3NQ7A 2WPBA 3G24A 2X16A 3S9YA 5LHEA 2CU0A 3W7LA 3H55A 4K37A 3S5NA 4NNCA 5AC6A 4XTDA 4JTSA 5KZMA 1MZHA 5D2TA 3HO8A 3HG2A 1UASA 2AAMA 4Z0SA 1VPXA 3YPIA 4M7SA 3DI1A 4O12A 3H53A 1JULA 1JCLA 1LYXA 1X1ZA 2J88A 1JQVA 3P8JA 5A8GA 3ZS4A 2NZLA 1UJPA 4ADUA 5F4SA 3NDOA 3PVFA 1ZFJA 2C15A 3ANYA 3S1UA 3NQFA 3M5ZA 1OFDA 3M1ZA 2QAFA 1X6UA 1FCUA 1QWGA 1KM5A 4O28A 4AWUA 1YDVA 2ATSA 3G1HA 4IQLA 3CIXA 3LCGA 4MJMA 2YFOA 1R47A 5GVJA 3NM1A 1EEPA 2ZZ2A 4P2VA 5DLCA 4GNJA 2PRLA 2C19A 5DY2A 4UTMA 2FJKA 3NVTA 5K9XA 1GOXA 3GR7A 1SR9A 3I7SA 1K02A 1KLYA 4UCGA 3W7DA 5DCBA 4RLIA 1TYGA 3CEPA 4JDBA 1F73A 4MYAA 1U83A 1X1OA 1FQ0A 3GKFA 4DXVA 3HF3A 1D9EA 5HMSA 2QCDA 1KBJA 1ZNNA 3QW4B 1FWSA 1W3NA 5F4XA 4Y8FA 3BV4A 3BW4A 4N9DA 4YLWA 5F2LA 3PG9A 3CT7A 1YTKA 5TBOA 3W7RA 1AG1O 4O1AA 4N6FA 4MY8A 2ZRZA 1ZAHA 4ICNA 3GNNA 3STGA 4WXZA 1F6KA 3P81A 1GVRA 4LU0A 1PL9A 1K7FA 3IGXA 2EGZA 3EX6A 3DFSA 1SZGA 3TQVA 3DI0A 1YYAA 4RXGA 4NNAA 1O60A 2RDWA 4UTUA 5LSMA 4BFAA 4A2RA 4RKAA 3NQAA 4O0KA 2Z6IA 1RV8A 3HG5A 3OEXA 1YXYA 1JCYA 4NUWA 4O4WA 5K9CA 2QKFA 4AXKA 4YCPA 2OZ0A 2GQAA 3UWWA 1CX9A 4PA8A 4DEFA 1OFQA 2Y63A 3NL5A 5T26A 3WK0A 2DZUA 3VCRA 4HHPA 1OFAA 3LX9A 3IVUA 2Y61A 1JUKA 3FKKA 4M19A 3FIGA 1XDMA 3BPWA 4IPIA 4O1CA 4LVDA 2VEMA 3GB6A 4POCA 1TPVA 3L9CA 2V2HA 4BWLA 2QCEA 1KTCA 1KW1A 1Z42A 4ZVJA 2NXHA 3TROA 5CPNA 3GIYA 1OF6A 4JTEA 3RFAA 4NX0A 1CI1A 4FNSA 5E93A 1SZNA 1WA3A 2CW6A 2NUYA 4XQ6A 2GOUA 2QEZA 1N55A 1ZALA 2BWGA 1R2TA 1MEIA 1XL9A 5HUPA 1MO0A 2QCCA 1WQ5A 5CGQA 4OV4A 3LHWA 4FNRA 3STEA 3SI9A 1P0NA 4CNPA 4CNNA 4WQ6A 1VCFA 1SPQA 2A5HA 4AF0A 1W56A 5BRBA 4RJEA 4I9AA 3ABRA 1JCNA 2VEKA 2JBMA 1LORA 4LC6A 4UTKA 1UB3A 1G7VA 1ICQA 2HMCA 4UTWA 2ZZ3A 5HR7A 3TAOA 2Y6ZA 1GT8A 3CB8A 2QJIA 3W2MA 4X2RA 4LVGA 1LOLA 4Y6GA 5EKYA 4EVZA 3PB0A 3MHFA 4O8RA 3PUEA 3HMJG 1XM3A 1TPEA 3THAA 5SWUA 1SW0A 3GXNA 1QMLA 1TJRA 4UTTA 4Y96A 5D2YA 2A4AA 3GKAA 5C6MA 4IMDA 2VFEA 4WY0F 2QR6A 4EOUA 3W70A 1DQXA 5EPDA 1F2JA 4HSNA 4MYXA 5D30A 1D3GA 4E0CA 3ATYA 1C9DA 3O1NA 1SZEA 2E09A 3NQDA 5A5WA 2DORA 3LXAA 2PCQA 3FFSA 1K8ZA 3OA3A 3D0CA 2J24A 3WK3A 2GQ8A 4N02A 4TO8A 4S2CA 2ABAA 4DPPA 3P74A 4NQ1A 4G1KA 4UIOA 1UBSA 1FDYA 3S6DA 3PUOA 3MBFA 4CQ9A 2ZZ7A 2XN0A 4ZQPA 3GAYA 2WNZA 2Q8LA 1LLWA 2NUXA 4GFSA 2CLFA 3W7NA 5EY5A 1GVQA 1I45A 3EWBX 3TMLA 3CU2A 2PRHA 4YXGA 1H7OA 1VR6A 4NJKA 1PIIA 1TSIA 2E6AA 5F1UA 1H7XA 1G67A 3G3MA 1T96A 2TRSA 3G1AA 1BWKA 4GRSA 2QCLA 3HIJA 2Y7GA 2PC4A 2WNQA 3GDKA 5D37A 1B4KA 3T55A 5D09A 5KZDA 4M5PA 3EWYA 3EXSA 3W7HA 1H1ZA 2CLLA 4N2YA 3N9RA 4NX5A 1SZFA 3CTLA 1XC4A 2F84A 3THQA 2YPIA 3UWUA 4DO6A 3LOTA 3GVGA 4FNQA 1F5ZA 2ZTJA 4HNTA 2J6XA 5C55A 4MLRA 4MY9A 1P5BA 4JX4A 4M7TA 2V82A 2WQPA 2OT0A 2V30A 4LWWA 1ADOA 2ZRYA 4QM1A 1Z48A 3BG5A 3O16A 1Q6OA 3NQVA 3GDRA 3SSJA 1HO4A 2ZBTA 3B06A 2Y89A 2Z6JA 1R2RA 3LB0A 2ISSA 3L21A 2Y7EA 2FB2A 5FF2A 3Q94A 3QMTA 1QFEA 3NQMA 2ZA3A 1M5WA 1NEYA 2QCFA 2E6DA 1DORA 5FI8A 5HJLA 1THFD 1JUBA 1KM6A 2C6QA 4FHAA 3W7MA 3C6CA 4JD4A 1FWWA 3W84A 4JS3A 1M7PA 3UNDA 3PM6A 4X3ZA 5C2XA 5EA9A 1LM1A 1AL8A 5BNKA 3PAJA 1JJKA 3B05A 3QQ0A 4OGZA 4BWLC 4FIRA 5AHNA 3VFLA 3I7RA 1C8VA 1EP3A 4J9JA 1ME9A 1ZAIA 5DCDA 4NXKA 4Q33A 1FDJA 2WOQA 1KV5A 3P8IA 3TKFA 4I7VA 2H3BA 3DFTA 3LV5A 1B9BA 2QF7A 2VEIA 4GWEA 3QPYA 1R2SA 2EHHA 2HS8A 4IX0A 2CLHA 2FPVA 2NX1A 1DVJA 3W2NA 1LZOA 1TPB1 3W85A 4ORMA 3ATZA 3NQ2A 1EB3A 3USBA 1OFRA 3LCHA 3NPUA 5DBTA 1DJQA 3T4CA 3O07A 1FX6A 3TW6A 4O1DA 1VLWA 5G5IA 1W8SA 2NX3A 4KKXA 1I2QA 3SGZA 2JKAA 5BW6A 1GVSA 2DZXA 4UTWC 4Z0JA 4O14A 3M47A 3MP4A 3GDTA 1K8YA 1OABA 3F03K 1OK4A 3G3DA 1WBHA 3I6RA 2KZHA 1TTPA 2NV1A 5G1TA 2GQ9A 4WXYA 3RK8A 1H62A 2O7SA 3WFAA 4OU1A 2C13A 2E5CA 3DKLA 3JRKA 3LV6A 3W7OA 5D05A 3W86A 3TSMA 2BTMA 4XKYB 1DKWA 4UFIA 3R89A 1KFLA 2I9EA 3UY7A 4PC8A 3LRKA 4GXMA 2GJNA 4FX8A 1A53A 1O5KA 2NUWA 1LBFA 3G1SA 3T7VA 1P4CA 3DBPA 3NM3A 1TV5A 1YPFA 1KBIA 3FEMA 1WV2A 4GUIA 1GYNA 1XBXA 3NA8A 3EB2A 3PWAA 5CPMA 4Z1CA 5BOOA 3R5EA 4NJGA 1HUVA
chains in the Genus database with same CATH superfamily
3QY7A 1H0IA 5A8OA 4EK7A 2XM2A 4B2DD 3XISA 5HWNA 4HNLA 3QV7A 1QHPA 5AZ1A 3WQPA 2PF8A 4KEVA 1G1YA 3KE0A 3OO2A 4PUKA 4TXEA 4LVFA 5F2GA 4JQ3A 1CBGA 2BGSA 4A21A 4JYFA 1OGGA 3CEUA 3EZ4A 3C52A 1HVQA 1OYCA 4JN7A 1AQMA 4PEKA 1RA5A 1QPOA 2CHRA 2FFIA 4A6GA 1Q66A 2G4FA 1R9YA 4MF4A 3QH2A 1PTDA 2VZTA 1HNYA 4A3UA 3CV2A 1FFRA 4HA4A 4F2UA 4GGBA 4HN4A 3W7GA 2D69A 5C9XA 3LMYA 2DZTA 3WBAA 4R27A 1J0JA 3UZXA 3FA4A 1SFTA 4L6DA 3AO0A 3FW6A 4GY1A 3WBXA 5A2AA 1ML1A 3PFRA 4TMBA 1QW9A 4H7CA 1EXPA 3EB4A 4Z1AA 3QPEA 3IIPA 3NDYA 4IFKB 3UPWA 1Q6GA 1P7TA 3BAJA 3AXKA 4J3TA 4J2MA 5EL1A 3Q58A 3M46A 4JIRA 5GJNA 4GI6A 1L8PA 4DO4A 3GUGA 4WKFA 5BU9A 1SW3A 3MT1A 1OCQA 2XGIA 3VX1A 5DN1A 3E96A 2XH7A 1HN1A 2XSBA 3RO8A 5E1QA 3E6EA 1XLMA 1JZ3A 3SECA 1XPGA 3UF9A 3NSXA 2CPUA 1TRDA 4GYJA 4D6JA 2PP1A 4RNIA 3ARZA 3BOXA 3G1RA 4GJIA 2QMKA 2J78A 3A22A 3STFA 1KBLA 1DWFM 5EFFA 3QGAC 1TTJA 3BW2A 1KXVA 3QMRA 1G5AA 5AHEA 1W37A 3GTHA 3MMUA 3AHVA 3UWYA 4AC1X 3W38A 1A5SA 4XAGA 1F61A 2X41A 1PXGA 3TA9A 2G0WA 1EWDA 1BGAA 4BY3A 4YMZA 1A5MC 2DY3A 3B9NA 4HN8A 1PV8A 5A6TC 1KRBC 4FR1A 3SY1A 3NZRA 3FCPA 2YXOA 2RDUA 5MKGB 5LA1A 4TUFA 4JYEA 4DJDD 4IIHA 1M7JA 1RQHA 3OG3A 3MMDA 3TN4A 4NT0A 3ZR4A 4KFOA 3UP8A 3FY1A 3ARSA 4NAFA 4XUYA 3SCSA 4UFKA 1TVLA 3VO0A 3D3FA 3MWCA 1LL4A 2VFDA 2XFFA 1EL3A 1B3WA 3ECQA 2O4QA 1CCWB 1PKMA 1NDZA 4UFJA 3IJ7A 4WOQA 4YCOA 2BMBA 5BROA 4XZWA 1YKWA 1SR0A 1JI2A 4MIMA 3S1GA 2J79A 3A5VA 3BICA 2WZHA 4P7QA 3B9AA 1DP0A 3CMGA 4L4MA 4MLJA 5FJRA 4EE9A 4GLEA 2PURA 3CZEA 2PDQA 1UKOA 3F2CA 1DIOA 3S42A 5J5RA 1X6LA 3NUKA 3TEVA 4F9JA 3CAKA 2W66A 2JGQA 1CW2A 1H4PA 4JFWA 3UEQA 3WMCA 4ML9A 1S1PA 4XBKA 3N29A 3I4KA 2HCVA 1CLVA 4YTQA 3ZSSA 1XC6A 1VB9A 3H23A 1SFJA 2V5CA 4R33A 3V5FA 3N3MA 2E25A 1WX0A 4A29A 3LGDA 2WC3A 3H2CA 3N4AA 2WO5A 1J10A 3SEPA 4TR9A 3T2PA 2X1RA 2WCGA 4GZEA 4DO5A 3E9AA 2VVSA 3DBNA 2R1MA 3RMJA 4JNYA 2IXVA 2ZRUA 3OBKA 4JY8A 1D8WA 4DLMA 4O10A 5I00A 1S5VA 4AHOA 1RBAA 3VZYA 5A69A 4I5RA 3AYTA 3ARTA 4LT9A 2YR1A 5DX7A 3PSVA 4NRRA 3GTNA 2FJUB 1ZP4A 3EKGA 3LG3A 4PCNA 1K3UA 1HXJA 3RDKA 3T09A 2VGIA 2J74A 3ABQA 3GWQA 3VIJA 3CHCA 3KXQA 4AY7A 2P88A 2GL5A 4X0VA 1EJTC 3GAKA 2ZZ5A 4REQA 1OIFA 4UQ9A 3DFOA 1XLJA 4H6RA 4MPQA 2G96A 2ADAA 1KWKA 3LPFA 1MI3A 4CNSA 3WD3A 5I0DA 1XR2A 4KFNA 1XFBA 3UR7A 4KIEA 3STCA 4Y9AA 1DJNA 2DJLA 4CQ8A 3N14A 4F2TA 4ZOBA 1CLXA 2OR2A 3TV8A 2R8WA 3HG4A 1DIDA 3CYJA 2C8NA 4GKTA 5L6UA 3AROA 3LM7A 4B4FA 3BOLA 5D33A 2DT0A 1R87A 3E38A 4MHBA 5AZ0A 1V6WA 2NQ5A 2VZSA 4CQDA 4GFIA 2FGZA 1NARA 1V8EA 4ENLA 1NWSA 4MFDA 1EO7A 2PCEA 2PC8A 2ISDA 1PZ1A 2XSAA 3MYPA 2G41A 1A4MA 3PG8A 1BGGA 4CU7A 2BX7A 1GORA 4RE0A 3MCNA 3LNMA 2OX4A 2E6YA 3P80A 1K9TA 3PP7A 1MQQA 4AIOA 1IWPA 4AAJA 3BO9A 4XO6A 4O4VA 3CUHA 5EMMA 1WE5A 3URQA 2HBVA 3PK7A 1IEVA 2EBNA 4IL2A 1J5TA 1FTXA 2VQTA 4F66A 1CGVA 3W23A 4AHQA 3IUDA 2E3ZA 1L6GA 3UCQA 2WVUA 4KFPA 3H70A 4H8UA 2IMRA 1BTCA 1EA0A 4C6FA 3V36A 1AODA 3EOEA 9CGTA 4GIRA 4NIRA 1RJRA 4UNKA 1ECQA 2AAAA 2CLKA 3GXMA 1W3KA 2X0YA 3RO6A 4H2HA 3R25A 2XUCA 4B90A 4CCCA 1JZ6A 3FOKA 4JTKA 5GJPA 1QI0A 4D6IA 3M0JA 1VFMA 1IEXA 1PIFA 4U4MA 3T8QA 1L6FA 4N7QA 3MYOA 1VLIA 4JHZA 3FVMA 2EEXA 5DFAA 1F7BA 2W67A 4KCUA 5FESA 3R12A 3W9ZA 2GVGA 4Q8PA 4ZQRA 1O95A 4Q4QA 2X1IA 3GH4A 4B4HA 5G1YA 4YWSA 1P6WA 4IH3A 1LRTA 2YDQA 2RDTA 3HV9A 2QUUA 3WL1A 5EMJA 1AK5A 1E1CB 1ZAJA 4HSHA 1FCBA 4KF1A 1HJUA 1K9DA 4RX0A 2PDCA 4RL3A 2FMOA 3W1UA 4DF0A 3CHFA 2GK1B 1XYMA 3FYOA 4WD0A 3ZO9A 1XD0A 3BZJA 1ZJHA 4FP1A 1PTAA 4GH1A 4L4LA 3EKZA 4B5SA 1CPUA 3QN3A 3ZQ9A 1W1IE 3MMTA 1U5JA 1TR1A 4I6KA 3U4FA 5KZEA 4QS6A 3M7WA 3AHXA 3DG3A 3UD6A 1UOKA 3G2GA 5CLTA 3HURA 4AH7A 3FAWA 3P84A 3PBYA 4I5XA 1NTHA 2A2IA 5H1WA 4WSKA 2ZA1A 1JXKA 4AD3A 2JGYA 4GNVA 2AMXA 3BXWA 1V6XA 4GX9A 1UZDA 3LHVA 1MUCA 2VM8A 4HHMA 2BB0A 5TNVA 5FEZA 3SGGA 3G1VA 3BCFA 2PWVA 5D8WA 3T9PA 4U28A 2OO6A 4NNBA 4LANA 2Y62A 3TYDA 3L2LA 1TJPA 4JTAA 2OQHA 2QUMA 3M41A 1PX3A 3GG7A 5DBUA 4PTVA 4R7OA 2BVTA 3VIKA 4ERGA 1UKTA 1ESWA 1SO6A 2BOFX 1L9WA 2D23A 5CZSA 3ITXA 3T78A 1DBTA 2PDMA 1S2VA 4B92A 3E2SA 4O54A 1KTBA 1U22A 1UR4A 5A6AA 5LNSA 2H8XA 3B0XA 1EPXA 3WL0A 2VHLA 3C3UA 4LRSA 3QFEA 4QJ5B 1WKYA 1YBQA 3EX4A 2D0GA 4JPGA 2WCAA 1GOKA 5C7VA 2I56A 3MW7A 1ECEA 2Q3OA 2D2OA 5JQ9A 3GE7A 1XLBA 4GJJA 1TX2A 1XCWA 3U5UA 1WBJA 2QXWA 1TPH1 3AXIA 4HPXA 3LMZA 1B3YA 5I3GA 3QPZA 2H8ZA 1FKXA 2WMIA 3GRIA 3QTGA 3NCOA 5A94A 3LQGA 1QAPA 2B7QA 2EJ1A 2OSYA 1T40A 4LFYA 4Q8OA 1RZMA 4QJ1A 4DBDA 4E4FA 4UQCA 1BF6A 4QX4A 1GK8A 1P0KA 3PUDA 3OZOA 5K7JA 4EF9A 2R9RA 2YZRA 2GYIA 4PZVA 5BRPA 5A6JA 1BYDA 1GJPA 4DY1A 1HJWA 2V5LA 4UTIA 4UMAA 3H26A 3V75A 2VR5A 4CLMA 3HGRA 3W53A 1TMLA 4GC3A 2ODOA 1XINA 4RV3A 4MWAD 4KQNA 3OW1A 3PY2A 2D3LA 3NO5A 3ZLFA 4GMEA 3WLNA 3QSTA 2E68A 3B0VC 4WUIA 3VOCA 5IFPA 4JTFA 4HMCA 1TELA 5D02A 2FPTA 3WO8A 2ACSA 1KM0A 3I7QA 5TQLA 1IXOA 4MG4A 1Z9AA 3SGUA 3QEZA 5GJMA 5TIMA 6XIAA 3WQOA 1WOBA 1R30A 2A7NA 3K8LA 3KL5A 4J4KA 1B3VA 5D9MA 1E6QM 4GUFA 2VZOA 3P67A 2DUXA 5EU9A 1JDDA 3NAVA 4EPKA 2V5BA 3O06A 1Q8JA 2IQTA 4OBSA 3WNNA 3CL6A 2A7RA 3F4CA 3NZQA 4H6KA 4D6HA 7TAAA 1D8CA 2WJDA 1UR9A 1UR1A 1W5MA 3W2UA 4DJEA 3CAWA 3HGJA 3VX0A 1NM9A 1VYPX 3CT2A 4FEZA 1NP0A 4Q8QA 4DF1A 2YA1A 5EMLA 3T0AA 3L0KA 2O9PA 1E0TA 3VGEA 4JFSA 1BF2A 3FAXA 4MAZA 1PDZA 3GC4A 2UY5A 5K2ZA 2VFGA 3TMQA 4AVOA 5JH2A 3GNXA 3PPHA 4PFMA 1UPPA 4MZYA 2PDNA 3PWIA 3L4YA 3WLRA 5LIXX 1J0ZA 2HNHA 2F6XA 1TTIA 3FS2A 1XCXA 3FX4A 1O5QA 4AIUA 3AALA 5FEXA 1VFFA 3BAIA 1UR2A 2Y8KA 3KOXA 3U6WA 1MNSA 2O55A 4YHGA 1G6CA 3EMQA 2PGRA 1T5AA 4NZ1A 5CSYA 1VENA 3AJXA 5HDRA 1XYAA 2CLIA 2QIIA 1CGXA 3S1VA 1W1YA 3CB3A 3OZYA 2PLCA 4J7RA 4TTUA 5D4YA 1C92A 3NQ6A 4RZ4A 4XK2A 2REQA 1AH0A 3ONBA 2DGAA 3ZWTA 6XIMA 3VZZA 3KTCA 4KCWA 3BAXA 4NZ5A 5IBXC 5IFTA 2G95A 4F40A 3W37A 5AHLA 2YCKX 4U5IA 1KXHA 4YJ5A 2A6NA 3TNBA 2OMAA 4PCFA 1GOOA 2ZUVA 2GJXA 1R86A 4JYDA 2E6FA 4S2BA 5DMMA 4JIPA 5AYZA 3TYAA 1X7IA 3C8NA 2R1KA 1K7EA 4LX4A 4V1YA 3GU9A 3B0YA 4HIBA 2J4GA 4OE7A 2DZWA 2I5IA 3N2XA 1C8QA 2JK2A 1XCFA 2OSWA 4EWJA 3TFXA 1EUAA 4X60A 5HOSA 1OIMA 2CLMA 3F7JA 1QT1A 1UD3A 4Q8NA 1IXPA 3K4AA 7CGTA 4S3CA 4LEQA 2BHYA 2XFWA 2X05A 1PZ2A 4OVXA 1RR2A 1AH4A 1S5NA 1XSKA 3WK1A 1DV7A 2QPXA 4FA3A 3NO1A 2BP1A 1AUSL 4ZCWA 1CT5A 1GUVA 1XPYA 2FZDA 1P1MA 3B04A 2W5FA 3CNYA 1OB0A 2QUVA 4HK6A 1HG3A 4G8TA 3TC6A 4EPBC 1QHOA 1WPCA 5HINA 4IIEA 3P93A 3CLWA 1W91A 3A13A 1UBPC 2P10A 4H01A 2NV9A 4PBFA 3QLLA 4LPCA 3AIQA 3C86A 3W0KA 3I6TA 1MXGA 2DP3A 4GX8A 4W88A 1X8FA 4YPJA 3VD3A 2B7NA 2RFGA 4Y9MA 4Y2WA 4LCRA 1PYFA 2V68A 2D1ZA 4YVVA 1M9HA 3VI2A 4GQGA 8RUCA 4PBEA 2DSUA 3UY8A 1TPWA 1FXPA 1T8QA 4HSOA 3HPAA 4CD6A 1ONRA 1XUZA 3IVSA 3MI6A 1OJXA 1ZJIA 4IXHA 4QE4A 1Y7VA 1ZJAA 3RM8A 4NZFA 1Z44A 2F9RA 2RAGA 1GJUA 2J9XA 5BMXA 1JAKA 4I7WA 4PRWA 3ZLGA 1DJWA 3FEQA 3OLDA 4UR8A 2VQUA 3AAMA 3MWAA 3ZT6A 2PLKA 5I3FA 4KWVA 2NX9A 4US5D 3SURA 2Q02A 2RJHA 2FB3A 3VIMA 5CAKA 1ZENA 3C2EA 2NV2A 1W8GA 4N4QA 2QJJA 3EPNA 1KFWA 3IGSA 5G4EA 3MJMA 4DQWA 1TE1A 2WVTA 3DYOA 5HJXA 3SCVA 3KVLA 4C1LA 1QR7A 1ZB5A 4Q4PA 1UPMB 4Z2KA 4AZGA 3R13A 2D22A 4E5TA 3A3HA 4GI8A 3CUIA 1R85A 2J13A 1UWRA 3IK4A 4Q4KA 3W1QA 2OB3A 5EBAA 3I4EA 3P60A 3KLLA 2E77A 1TX0A 2GVYA 4X9SA 3GU1A 2ZX8A 1GZGA 4NP7A 1X6NA 5AOUA 3AWNA 2G3MA 3GH5A 4W85A 3B3DA 3W2KA 1DJGA 4JKLA 1TMHA 3WJZA 1W3IA 1SSDA 1CGWA 4BI7A 1GOIA 1YDOA 3LBMA 3TUUA 4CD8A 2QHAA 4WY0A 5ABTA 4Y9NA 1QPNA 3GXTA 3IIXA 3O8AA 4IGHA 1S5MA 2PUZA 1VFLA 5FSDC 2RHGA 3EKLA 3WK2A 1W5QA 1XLFA 1FWCC 5C71A 4CCZA 1ME8A 1NY1A 3GNOA 2XVNA 1W5NA 3M9YA 3W6YA 3FLUA 3ID7A 1XYFA 2X0SA 1E6NA 4C6LA 3S9YA 1CWYA 1OD0A 3H21A 3W7LA 1TA3B 1ZBWA 4K37A 5AC6A 1AH3A 4BEUA 4JTSA 3Q67A 1JEZA 3WQFA 1PX4A 4NI3A 3H53A 1JULA 4GY0A 3E3HA 2J88A 3PZMA 4D6DA 3EWCA 1UJPA 2V5KA 4H9YA 1SM9A 3ANYA 3MPGA 1RA0A 3B97A 3WDQA 4M51A 2W63A 1X6UA 1L0PA 2VOTA 1FCUA 4H19A 3OB8A 4FOKA 1QWGA 1N8IA 3WH7A 4AWUA 4X2PA 3CIXA 4PTWA 3IANA 1CXLA 4H83A 4PUMA 1JZ8A 5DLCA 4GNJA 6REQA 4UTMA 2QIWA 3VIFA 1DXFA 5EMYA 4YS1A 3W7DA 1K6WA 3A9BA 1ENUA 3HF3A 2QCDA 2HE8A 4DZ5A 3N12A 3QW4B 4FXJA 3T08A 1EF3A 4N9DA 4WK9A 2PWUA 4GQ0A 3WY1A 1YTKA 1NFPA 2PDLA 2DH3A 2ZRZA 1ZAHA 4ICNA 3STGA 4C6NA 4U3CA 3P81A 1E9YB 4DI9A 1R3QA 4HPGA 1GVRA 2WSPA 4OOZA 4QFUA 4MWAE 5A8NA 3DFSA 1SZGA 3DI0A 4NNAA 4PBGA 3E0VA 3EDKA 2OYMA 2G3JA 1ZBKA 4BFAA 1JCYA 2XU2A 4O4WA 3MDUA 3PNUA 5K9CA 2QKFA 2GQAA 4WCJA 1CX9A 3L4UA 4P7OA 5LXEA 4U2ZA 2DZUA 3NSNA 4HHPA 2QGHA 2JFEX 3TTOA 2Y61A 4M24A 2DEPA 1UUQA 1W3JA 3OYZA 1WKFA 1S2UA 2C91A 1E3ZA 5DMLA 1OCJA 4IP7A 3WLQA 4BWLA 2PPGA 4M6UA 1XLGA 1JD9A 4B2DA 1Z42A 3WG6A 2HBXA 2HRWA 3TROA 5CPNA 3GIYA 1OF6A 1CI1A 4JL1A 1FP9A 1SZNA 1WA3A 2CW6A 3IAQA 3R8HA 4RDYA 3BANA 3KZPA 1TZZA 3L12A 2BWGA 1MEIA 1QNSA 4OV4A 3STEA 4FNRA 1P0NA 4WQ6A 3R0DA 4AF0A 2OEJA 4DUVA 5BRBA 4Q22A 1JCNA 2WKLA 1LORA 4LC6A 4QP0A 1UB3A 1ICQA 2ZXBA 3V0UA 4ZOEA 3TJ4A 4P5UA 2DT3A 4KRUA 3PZVA 4DLFA 4O8RA 2VWTA 3HMJG 2NVDA 1SW0A 1QMLA 1TJRA 4UTTA 3CL7A 2OOGA 3PBMA 1GEHA 1R6WA 2QR6A 4EOUA 3W70A 2QF8A 4F48A 5EPDA 1F2JA 4HSNA 1D3GA 1SJAA 2NSXA 3NQDA 5DT7A 2G4JA 2DORA 4GQBA 3LXAA 4QDWA 2PCQA 3UGVA 1K8ZA 3D0CA 1YEYA 5DO8A 1FP8A 2ABAA 4DPPA 4G1KA 1FDYA 1FH9A 3UPMA 3TYZA 1JGIA 1RY8A 4ZQPA 1OG6A 2FZ8A 3FJ4A 4S3KA 5BZAA 3FJNA 5BYWA 3ABZA 3W7NA 3EWBX 1FWIC 2E8YA 1VR6A 4NJKA 4C6JA 5I23A 2E6AA 3ITOA 1NWRA 3RCNA 4JTCA 5J04A 4GRSA 3HIJA 3U57A 2Y7GA 5CGMA 1BG9A 4AZ7A 2WNQA 1X1NA 1R9XA 1B4KA 5HA7A 3RRAA 3LSBA 4M5PA 1D7FA 3EWYA 3IAPA 3GIPA 4HZMA 1MNZA 1LG1A 3UWUA 3DC8A 2Z1KA 5CBBA 4PYSA 1KC7A 3BWWA 1M01A 3QTPA 4KRTA 5IRPA 4JX4A 3KRBA 3T6CA 1JNEA 3LN3A 2ANUA 5BWFA 3E5BA 1UG6A 1UD2A 2ZRYA 4MGGA 3LS9A 4LQ1A 4GCXA 2AOSA 4IG2B 2DSVA 3BLOA 3B06A 1R2RA 3LB0A 5J8LA 1LT8A 1W1A1 3L21A 2Y7EA 3Q94A 3NQMA 2PD5A 3AXHA 1NEYA 2QCFA 2E6DA 5HJLA 4FHAA 3W7MA 4V28A 2VRQA 2IPWA 2XIQA 4O8AA 2VCAA 1YNYA 1AL8A 4OGZA 2G3FA 2JIEA 3B05A 4FIRA 5AHNA 4IJRA 1RAKA 3LY0A 1C8VA 4HA1A 3D47A 1ME9A 4NXKA 4Q33A 1FDJA 2XINA 4I7VA 1NDVA 1FHDA 2JIWA 4P8VA 4IX0A 2CLHA 2FPVA 2NX1A 3W2NA 3KS5A 1LZOA 2YCLA 2EKGA 2AQVA 3NQ2A 3USBA 3LCHA 2ZUMA 4FLOA 3GBEA 5HJYA 1E9ZB 3TW6A 1HL9A 3GFZA 4MNMA 4OJYA 4JCLA 3ZSTA 2NLYA 3LQLA 1HKKA 2PP3A 1GVSA 1UR8A 2XVPA 4WR3A 3W00A 1NWUA 3WQ6A 1BWVA 1UD4A 4TVCA 3M47A 9XIAA 1OABA 1MRQA 3G3DA 1WBHA 3I6RA 5AKQA 1KBBA 3RK8A 5IOBA 2AL2B 4LH8A 4D6GA 3R89A 5GQBA 1UWQA 3UG5A 2W3ZA 3JZEA 3LRKA 2V3GA 2W61A 2DPEA 1A53A 3T7VA 1XW8A 2ACRA 2CWXA 1B9ZA 3DBPA 1TV5A 1YPFA 1KBIA 4AB4A 3LUTA 3NA8A 1QI3A 4PMZA 3PWAA 4C60A 1OZMA 1DEDA 2CFFA 3OVPA 3CH9A 2XHYA 3RCYA 2WLZA 2C18A 3GDBA 3EEZA 4ICMA 3E0WA 4QITA 1TB3A 2VVNA 4AEFA 2YCJA 4P7RA 2P50A 1C29A 1KCZA 1FWRA 5HATA 3VIPA 4XISA 4K6AA 1B30A 2GVLA 1SJCA 2O7QA 3O63A 1ISWA 4KGJA 4GUJA 2OKTA 3W22A 4PMVA 1KGWA 4NAFB 4HNVA 3SQLA 1E6XM 1QPRA 2OKOA 1REQA 5G1MA 3TFCA 2WJEA 1LL6A 1TVNA 4HTYA 3WEZA 4K8HA 2GPTA 3B4YA 1YHTA 1UUOA 4FOUA 1FWJC 1R7OA 1WKDA 3KBJA 4E8GA 1U33A 4EIVA 1EP1A 3NZ1A 2VOMA 3AMKA 2VI0A 4KRZA 3ICJA 1XDJA 1PIGA 3CV6A 3JW7A 3VU2A 1RCOB 4J3UA 1DXIA 4W8LA 3G6MA 3VKCA 3KP1A 5BRQA 1TE6A 3EOLA 3S5OA 3TTQA 3C3NA 3G8EA 3HB9A 4PUUA 3CJPA 3VM7A 1SJDA 3VE7A 3W4RA 2WSKA 1JRCA 2PAJA 3OGSA 2F61A 3TOPA 4PSPA 4KCTA 3BC9A 1VBJA 5M17A 1VFUA 1W9BM 4XO7A 4IQEA 5AN7A 4QE1A 1FWNA 5FF3A 1HKWA 4FSAA 3PJWA 4KT2A 2E8ZA 1S2WA 1UWUA 1VRXA 3O0KA 4XUGA 3IWPA 3ZWSA 6TAAA 3L4ZA 2ZC8A 2HPIA 2Y85A 4DN1A 2CLPA 1UUMA 1LUCA 3U9IA 1W6TA 4PN2A 4CCEA 4AD4A 1OHLA 3SN1A 4B9ZA 2FFCA 1POKA 4XKYA 1GQIA 1B54A 1HF6A 2OX1A 3BURA 4J3WA 1EDTA 4O13A 1VH7A 1E73M 4JZ5A 3V0SA 4E2OA 1HX0A 3BG3A 3L2IA 1ZGDA 4UFMA 2EG6A 3W28A 2IKIA 1FWHC 2ZX6A 3C61A 1KCLA 4XKMA 3NPWA 4LEFA 2XN2A 3TJXA 5M5DA 1K1DA 2OWWA 4I90A 4DZHA 2W9MA 3CWHA 3W1XA 4FX7A 4MKNA 3L5MA 3L65A 4Q8WA 3Q2DA 1CIUA 1Z41A 3WLHA 1J11A 3T0DA 1RK6A 1XRTA 5H8PA 4LS0A 3TLLA 3KBSA 3CUJA 1Y5WA 2EG8A 4X22A 1LLZA 2UY3A 4IICA 1SUXA 5FAJA 1OADA 2VFFA 3LTYA 2FHBA 3OQ8A 2OTDA 1ELSA 2WC4A 3NPXA 3ISIX 5E0FA 3E2RA 4JHOA 4RCXA 2DVXA 1P6CA 4IGSA 4IGMA 4W84A 3NQEA 2YL8A 4EXAA 1IF2A 3WDIA 3UT0A 4TQTA 1TV3A 3VOGA 4D1JA 3SUUA 2IKGA 3C4UA 2DZVA 3EWWA 4IZGA 1EDGA 3IARA 3J7HA 4W4QA 3H2EA 2OLSA 2B31A 4R88A 3QF0A 3W1RA 3LCXA 4PB3A 3WJYA 3CHEA 5TF0A 3NXLA 1H60A 3TQKA 7ODCA 1H5YA 1Q7MA 1Q8AA 1VP5A 1N7KA 4C7DA 3NL2A 4A3HA 3I65A 5JIWA 4IQDA 1NU5A 3W1PA 1Z32X 2A0NA 2YYTA 4BJHA 3SCTA 4LBUA 2JEPA 4YTRA 4MFEA 7XIMA 2ZDRA 4ZFCA 3GK0A 3SO7A 2YW3A 2HDJA 4QNWA 2F38A 2OCZA 1MW1A 2HVMA 3MUXA 3KRUA 4FLRA 4MNKA 1E15A 3UXKA 2PWHA 3T4WA 3OVGA 3T2OA 3ELFA 1LBMA 2WHKA 4O52A 2G3NA 5AC4A 3T40A 2ZUTA 4OTKA 4AZBA 1RH9A 3WKZA 1V3KA 3H2NA 2A3CA 3AS2A 4V33A 3GG1A 2W4XA 1EZWA 1F76A 4BCEA 3LCLA 1H7RA 1LRNA 1ZLPA 3LGGA 5LKYA 4LVBA 2GVJA 3LTPA 4LUSA 1NQ6A 1O5XA 3S9IA 2Q71A 3H4XA 2PWFA 4IISA 2WMFA 1AFSA 4N42A 4XD4A 3DZ1A 1MYRA 3OLGA 2JF6A 1JNDA 4DAFA 6ALDA 4LB4A 4NAEB 1JYVA 4L4OA 4CVWA 4FAMA 3POHA 4C1NA 4JIQA 5C70A 3SCWA 3KS6A 4AZIA 1KO0A 4JN8A 2A3HA 3WD1A 2ZUUA 3WENA 2B0MA 4QQ3A 3WDJA 4IF2A 1CB2A 4BQ5A 3EAUA 1EJSC 3OVQA 4UMCA 4BR1A 3CYVA 2PS2A 2PE4A 1WP6A 3I3DA 3L4WA 1NFBA 1QCWA 3SRHA 1V02A 5HULA 1XIMA 5DXXA 3VDAA 2VZUA 2GGJA 1FWDC 1AJZA 1O1HA 5G4HC 1GZ1A 5EMKA 4U10A 8A3HA 4GHRA 1YXCA 3A23A 1UWIA 1E9IA 3G22A 4UFHA 5CSUA 1S2CA 3SW6A 4ES4A 3LI0A 3M16A 1GYMA 3ZT7A 1BQCA 5LGXA 4LS1A 4F0HA 3NSMA 3UZYA 5BXSA 2WYSA 4H8HA 4WDWA 2TYSA 3S2LA 4W7UA 3MJYA 2Z2AA 3S2NA 2J7EA 4JICA 5C5YA 1QU4A 1V7AA 2ZCGA 3NJ3A 2QV4A 2HEJA 3A5FA 1FRBA 1B3ZA 2GDVA 1VEMA 1I2PA 3EYPA 1JCXA 2GDQA 3CQHA 5I3KA 1VRDA 2J8GA 3PTDA 1D2KA 5HUOA 3UPBA 1S1RA 5K4XA 1I8JA 3FJLA 4UQDA 4UTLA 2A1YA 3RNDA 3QBUA 1XIDA 2HK1A 3WF1A 2E9BA 1JR1A 4H9TA 2G37A 1BAGA 2H9AA 3FHQA 3BGGA 1Q2RA 1VFSA 9RUBA 3EWDA 3QV6A 4CNOA 5C2CA 1E0UA 3GZ3A 3GX9A 1CXIA 1RQEA 7A3HA 3H2FA 3PN8A 3MA8A 1O4UA 2H6RA 1N2VA 2EJAA 1KCKA 3R2GA 4LTSA 2JKPA 3UW6A 4IMCA 3G8RA 4IPNB 3N9KA 5KTLA 1PCKA 3T1GA 3GXIA 3HJEA 1S39A 1VJZA 4Y9OA 4N9CA 1ZY9A 2Z28A 3E74A 4O0ZA 1ICSA 3N34A 1QO2A 4WDUA 4M8UA 4IMAA 3PSWA 3VOFA 4RXFA 3MANA 2KAUC 5FJJA 3VA8A 4Q6XA 3L23A 4QG8A 3P61A 5DY3A 3L0NA 1FKWA 5CXPA 1E5NA 3APGA 5FAGA 3TR9A 4GGHA 3ITGA 3GS6A 3CBWA 2X8RA 3B9DA 3FN9A 1W3LA 3N11A 3GFXA 4WGHA 3V0TA 3Q37A 2C7FA 1QRQA 4NF7A 1S3HA 3GG8A 3NXFA 4JIEA 3WF2A 4W9TA 1HL2A 5D9NA 2NWRA 1JUEA 3CTTA 2X1UA 4JEQA 2QT3A 1V3LA 2YDSA 3BLFA 2P1FA 4GJ1A 3S47A 1BHGA 1XIFA 4EXQA 2I14A 4PL1A 4F2BA 2X0HA 5FJTA 2V5JA 1J0KA 3G1DA 1L6SA 4DI8A 4BZYA 3K4DA 1K77A 1TO3A 2DV0A 3C2RA 1YLVA 1UWTA 3UG4A 4B5WA 2V6AA 4Q8TA 2PTDA 3HG3A 3WLMA 3BW3A 2QDHA 2TPSA 4H8NA 4DJED 4B15A 4FALA 1PZ3A 1IXQA 5H6HA 2FTWA 2DSZA 3R79A 1VHNA 3ZVIA 1R3RA 4LW7A 2BY0A 5A2CA 5REQB 1HT6A 2CLOA 2BV9A 2R91A 3MKVA 3KOYA 1AZ1A 2OXNA 1OVDA 3WUFA 3TWBA 3VGGA 3MKCA 3SN0A 3GXFA 3APTA 4N6EA 3IRDA 1W2PA 3A6OA 2YYUA 4CKQA 4ZL1A 2HJPA 2XH2A 2YB4A 1DQWA 1GJWA 4UMBA 5EMUA 3TYEA 5AHMA 2J6VA 1TMQA 3VAVA 1TREA 2A21A 3MP3A 4UTHA 5LA0A 2CEQA 5M1TA 1UA3A 2CIPA 1WOAA 4CNUA 3KFTA 3U2ZA 3DGRA 4J40A 1F9CA 1S5TA 5H91A 4LV4A 2FTPA 1PX8A 4IXXA 5FL0A 3KDNA 1X96A 1GKPA 2BXVA 2ZXQA 1J0HA 1QNPA 3H7UA 2YL9A 4CU6A 1ISXA 2E5DA 4NRSA 5D03A 1S5WA 2CKRA 3ABSA 2QAPA 4Q8MA 1LRQA 4P7LA 3GTFA 5CC3A 3WSUA 1G7UA 4MJ2A 4ECLA 1QNQA 1XP3A 1EEXA 1JQXA 4XD6A 3AI0A 3N73A 2VRJA 3FDGA 4PCSA 4JQ2A 2YBUA 1V7YA 3FKRA 4GBDA 3DFHA 2A3BA 1R9ZA 4CN1A 5AHIA 3TYCA 3LBCA 2ZQ0A 2CCRA 2CZDA 2WKJA 1OT2A 7REQB 4KCVA 1ITUA 1CYGA 1EHAA 5TD4A 3F2DA 4MUZA 4EKJA 3M0KA 2VD8A 4CQAA 1JF5A 2EO7A 4Q7NA 2PRMA 3LLDA 1EO5A 1XIIA 2O56A 3UZ5A 5IDIA 1W5OA 3NVDA 3I6EA 3TK7A 1Y65A 5BOFA 2Z4GA 4IFKA 3HZ3A 1NVMA 3VFCA 2GJXB 3UZJA 2H3DA 1HP5A 3NEHA 3QW3A 5C7HA 1OFBA 3KOFA 3NEVA 1VBGA 4HP5A 4ROPA 1F4HA 1QJWA 3D5HA 3PPFA 1LJYA 5U4NA 1JCTA 1Z3NA 5T9CE 5HNRA 2YXGA 3PF3A 1A5UA 1AJ2A 1MQPA 5LZLA 2UY2A 4WX2A 4GD0A 4J28A 4M80A 2QJNA 5E0KA 2V9DA 2FGBA 3WNOA 2VUNA 2CBJA 3SAZA 2VFHA 3UR8A 5FF0A 3LTSA 1BYCA 1YX1A 1YNQA 4LY8A 1Q6EA 3TH6A 1KM4A 2V63A 1ZU8A 2OG9A 4DWSB 4WVXA 1GYLA 4IPJA 3KCJA 3RN6A 1PZ0A 2DIJA 1RCXB 2R1PA 1TG7A 4PUJA 1PDYA 1EBGA 1PAMA 5C2GA 2VEPA 3BMWA 2HE5A 2QCMA 4XV0A 4Q4SA 3GW3A 3OYXA 1FUYA 4JQ1A 1A0CA 4GYFA 1UW9A 1GG1A 2ZADA 1SO5A 1ICPA 1E0WA 4GK8A 3A21A 3W82A 3C2VA 4C1KA 1V3JA 5ENLA 3IV8A 3PZUA 3F4DA 1KNWA 5T91A 1OF8A 5C0QA 1HQTA 1EYWA 2J66A 3H7RA 3LXCA 2CZ5A 1U5VA 1JPDX 4FX6M 3H4WA 3QC0A 3GVRA 5D2VA 3OLIA 3TAKA 2E7FA 1CTNA 3QHMA 1ONEA 5MF5A 3IJ8A 1K03A 3N17A 1JCJA 3AZTA 3W1MA 4NZ3A 3NQCA 2J7HA 1E51A 4NU7A 3PZ9A 1DE5A 1OSEA 1KXTA 1OFEA 4LAKA 4BQ2A 2DH2A 3MSYA 3FK4A 5I3DA 2CERA 3APYA 4K68A 3S6TA 4AMAA 1FH7A 1TV2A 3V18A 4JL2A 5CQ1A 3CQ0A 4HYRA 4JFTA 5JBEA 3KCLA 5LHFA 4KGLA 4O57A 2YBVA 4UQBA 2W27A 3P82A 3ZR6A 4UXDA 4OHQA 4DBUA 3F5KA 5D8ZA 4HZ7A 3VABA 5HPOA 3RGTA 2Y5EA 4GE8A 4MB5A 1TZ9A 3DFNA 3LLFA 3NPVA 1YPXA 4PMDA 3TXZA 1ZUAX 5CKSA 2O9OA 4HCHA 2PDHA 1J9YA 5LGZA 3U3HA 3L4VA 2OELA 4E2VA 2F6KA 2DIKA 1C9WA 1UWSA 1VIZA 2EPKX 4G6CA 2EPOA 4DXKA 5CPQA 3RU8X 4E2BA 3NDZA 3OTRA 2OEKA 1XSJA 3BCJA 5A2BA 1JCMP 2ZUWA 3PBGA 4O1EA 5D04C 1WXJA 1HKMA 3VIOA 3MSDA 1UKPA 5CC5A 3RX4A 1ZBCA 2XM1A 4MADA 3FA3A 5HNTA 1ZJBA 2XIMA 5FIPA 1RXOB 4N9EA 1FHUA 1KTNA 1EF2A 2VT0A 3E49A 4EWND 1JAEA 4D9PA 2WHMA 8CGTA 4LYKA 3WF0A 2QCNA 2UBPC 2XIBA 2I17A 1TZ7A 4OV9A 3V1HA 2F6UA 3UFYA 4IUOA 3COTA 2P5NA 2NXIA 4M81A 2FQIA 2NWSA 4FOJA 5AFDA 4UR7A 5AYXA 4NKCA 3ITLA 4DJFC 1H51A 3CO8A 3AMGA 4OT7A 3LERA 3UWVA 2FVMA 3ORWA 2BGNE 3SCQA 4QJ4B 3LPGA 3CUXA 4ONVA 3LXBA 3VIHA 4C7FA 2ZUNA 3CK5A 2WM1A 4K8EA 1QNVA 3TDFA 3T42A 4I3GA 4BF9A 4UWMA 5DCEA 1IR1A 2P0IA 2P3ZA 8XIAA 4C6CA 5XIMA 3P7YA 3QY8A 1QTWA 1V3MA 3NO3A 3REQA 3MV01 2PODA 2NVAA 1XRSA 3UWQA 4NZJA 1XDLA 2GJPA 5CZTA 4W86A 5E0CA 3QHNA 4HK7A 3SRFA 1CGYA 2VFIA 3PPCA 4NJIA 3DYMA 1A3WA 1BRLA 1SW7A 4K7YA 3THUA 4IT1A 1TUXA 3W27A 3PZOA 2FH6A 3CZKA 4L7ZA 4RE3A 3CPRA 1W31A 2GVEA 3T44A 4O15A 3CC1A 4L80A 3P62A 1ONWA 4H8VA 3EWXA 3GG0A 1CZ1A 5DXYA 4YVPA 4PGLA 1KGUA 4FI4A 1SMAA 3OHIA 1B90A 3KBWA 3A9IA 4Q8UA 2FPYA 3SQMA 4FNPA 2PBOA 1G9HA 4ZMGA 1JGMA 4BKNA 2PF0A 2ZDSA 3IJ9A 4FZIA 1PEZA 3W7IA 1H7NA 3TTYA 1P6BA 4ZQNA 2X16A 4GKLA 2CU0A 4Q7BA 4AY1A 2NQJA 5LIYX 3H55A 1JYNA 4XTDA 1OINA 2OGJA 3U5YA 3QOKA 4JCMA 5KZMA 4OZOA 3VILA 1O68A 1E1CA 3YPIA 4M7SA 2XGBA 1I9CB 1Z89A 2A3EA 3GZAA 4W5UA 2C79A 1JQVA 1AZ2A 3EB3A 4ADUA 5F4SA 3B8TA 2YL6A 4JBRA 3DESA 3PVFA 2YLAA 1ZFJA 2GK1A 3G6LA 3NQFA 1WXYA 3KBMA 5BWAA 2SFPA 4D6EA 4XD5A 2ATSA 3G1HA 3S4TA 3LCGA 2YFOA 3NM1A 3FNDA 3QR3A 3OODA 1CXKA 2D0FA 4GI9A 4QCEA 4E6MA 4D72A 5K9XA 4MB4A 1SR9A 4KWUA 3V3WA 4ZO6A 1O12A 4RLIA 1EJUC 1F73A 4MYAA 4QE5A 1U83A 4Q8VA 2NVCA 1X1OA 3MSRA 3GKFA 1RP8A 2CBIA 5HMSA 1ZNNA 1YE6A 4Y8FA 3BV4A 2ZXAA 3LZ5A 5F2LA 5HK4A 3LBOA 3M0LA 3CT7A 1WB0A 1AG1O 2ZC1A 4DNHA 3GNNA 3WH8A 3WQVA 4WXZA 1J8VA 3ARQA 1AQFA 1UKQA 4US6A 4LU0A 4HU0A 3BSMA 3GUWA 4A3RA 3UJRA 1K6AA 2BVWA 3TQVA 5ECUA 4RXGA 3LLXA 2FH8A 1CDGA 4AX6A 1O60A 2RDWA 5HBFA 4UTUA 4RKAA 1NELA 3NQAA 4ZB5A 1J79A 4FK9A 4EAYA 2OZ0A 1A5KC 3ITCA 3NL5A 2VCCA 1F8IA 1WDSA 3VCRA 3C0QA 5I5RA 1OFAA 3LX9A 2OO0A 3O0FA 3FIGA 1XDMA 3QV8A 4O1CA 2JE8A 3GB6A 2CZVA 4POCA 3W81A 4E8DA 2BOGX 1TPVA 3K46A 2V2HA 4L9XA 1BYBA 5KETA 4I8DA 3MUZ1 3DG6A 4DYJA 3WQEA 4JTEA 4ZOCA 5E93A 4L6OA 2D20A 4YHEA 2WXDM 1R3WA 3MTWA 1EFZA 4XQ6A 4UB9A 1SVDA 2QGYA 3IGHX 4DBSA 3P14A 4Q3MA 1W56A 2J47A 2PBGA 4PFHA 4PMNA 3ZJ6A 2JBMA 1XSIA 2HMCA 3M07A 4JTRA 1IHIA 2ZZ3A 2V38A 2QJIA 3W2MA 4X2RA 4Y6GA 1IEQA 4EVZA 3PB0A 3MHFA 2Z7KA 1EGVA 1XM3A 4NZCA 5SWUA 3GXNA 1IWBA 2J25A 4IMDA 3TTEA 4MYXA 5D30A 4UR9A 2E09A 4WGXA 2OLAA 2GQ8A 3R1ZA 4TO8A 4IFRA 3VM5A 2A79A 4XSLA 3S6DA 3WUBA 4KERA 2GGIA 3MBFA 3TTSA 2RUSA 1KD0A 2J8TA 2WNZA 1LLWA 1XJBA 4GFSA 2VX6A 4C6QA 5EY5A 4B91A 3CU2A 1A47A 4UOJA 2J7FA 1MZRA 1K9FA 3RAOA 1TSIA 4NY2A 5F1UA 1R0MA 1G67A 3G3MA 2J75A 1BWKA 3WYZA 3VD9A 2PWGA 2PC4A 4HA0A 5D37A 5KZDA 2OZ8A 3N9RA 4FPSA 1SZFA 1ZBVA 1F6YA 4AYGA 1EIBA 3VMPA 1MDRA 2YOCA 1F5ZA 4PE8A 2ZTJA 4HNTA 2BBFA 3QR1A 5A6BA 5H8MA 3RM4A 1RBLA 1OBAA 2NW0A 4LWWA 3O16A 3II1A 1HO4A 2ZBTA 1MQRA 5AYIA 1M65A 2ISSA 1REQB 3MUCA 3QMTA 2AQOA 3BTNA 4UQAA 1JUBA 2VP8A 2C6QA 3BJFA 3BDKA 4JD4A 4R5EA 1QW7A 3QLDA 4B5TA 3UNDA 4JKKA 3PM6A 1N82A 4RNJA 2Q01A 1M41A 1C91A 3PAJA 2FVLA 3K2GA 3I7RA 5FOOA 4ERAA 2QMJA 2CXGA 4J9JA 4GNKB 1ZAIA 1JZ5A 5DCDA 3P8IA 2WOQA 3VD4A 2WMGA 3TN3A 3IRSA 3DFTA 3U0HA 3LV5A 3VIGA 2Y5SA 2XISA 3F5LA 3QPYA 4K2SA 2DQWA 1XG4A 1GQKA 2HS8A 1DVJA 2YDRA 3HN3A 4XAFA 1VBUA 4GPNA 3R8GA 1MRAA 4ORMA 3W85A 3ATZA 4S3AA 1EB3A 1OFRA 3WLPA 3N2OA 1FX6A 3ZJ8A 4LYRA 1Q4WA 1VLWA 3C5QA 5G5IA 1W8SA 4KKXA 3SGZA 1CXHA 1E4MM 2V69A 3VYLA 1NP2A 2YBTA 4LF2A 4UZUA 3GDTA 1JG9A 4HA3A 1OK4A 3QV9A 3URAA 2WZTA 2NV1A 1JFXA 1UROA 4XIMA 5G1TA 2GLKA 3AHYA 4WXYA 3OLEA 1H62A 7PTDA 2O7SA 2QV5A 3HMCA 2E5CA 3LV6A 3W7OA 1J96A 3HQOA 4XKYB 4UFIA 3UVIA 1KFLA 3UY7A 2XVKA 3ABXA 2GJNA 4PCPA 2BY2A 1LBFA 3G1SA 2Z1VA 3SQSA 3IACA 3CPGA 1P4CA 3WUEA 3FEMA 1WV2A 1IZJA 1GYNA 4I6VA 1BSIA 3EB2A 4Z1CA 4NJGA 4KH2A 4HU3A 2Y88A 2W91A 2R14A 5HAOA 2RGLA 5HWJA 3UETA 4W8BA 1UOZA 2HV5A 1LT7A 1WDWA 3W1NA 4H7VA 1KV8A 2WPGA 1UQYA 1UD6A 3CIWA 5XIAA 1MW0A 2PZNA 3MCOA 1PE1A 2XZ7A 3AYRA 5IXEA 3G0SA 4W87A 2Z26A 3KVKA 1J6OA 1A5AA 3SY8A 4WHBA 2WQDA 3K5XA 4C6MA 4X9YA 3L68A 1EQCA 4H4IA 4I9JA 1XH2A 1SO4A 2X7WA 3W7CA 5CAHA 3TCEA 1F05A 3VNZA 3O6YX 5G4WA 3W75A 3A64A 1UD5A 3G18A 3W26A 4AD5A 4JTHA 1R8LA 1Z6KA 3QOMA 2DZPA 1F6PA 3L5AA 3O6DA 3K13A 2R24A 2GDUA 4JX6A 1TFVA 2IS7A 2INEA 4GISA 4WJ8A 4DWSC 4MKVA 3L0GA 3HOJA 1PTGA 3S0CA 5KINA 1BQGA 4AD1A 1TR9A 2GOKA 1MSSA 3ALFA 2DZBA 3ALGA 1TV7A 1KM2A 3CHDA 2XVGA 1XLHA 4IWWA 2Y7DA 3VUPA 3S5YA 2F2KA 4Z2IA 3RPDA 3OHMB 3UJSA 1MDLA 1TRIA 1H50A 4LUJA 4Z2LA 2FGLA 4M1RA 4RZ6A 4GC4A 1I1XA 3FXGA 3BLIA 3M64A 4GACA 2ICSA 3VGFA 3MI3A 4XZNX 1H5VA 1GHSA 4KMQA 4GQRA 3K30A 1XI3A 2ASHA 4AFYA 1EWEA 1J0IA 3DG7A 3RG6A 3WX7A 1GWJA 4Q4OA 3NTYA 2L5HA 1RLCL 1I2RA 4JTIA 5DANA 3PJUA 5H2ZA 1QI2A 2POTA 4HNUA 3N6JA 2PI6A 3IVTA 4LUSB 1UH3A 2FHFA 2YB1A 1C7TA 3LRMA 4BA0A 4DPQA 3GO2A 1X39A 1XQLA 2AKMA 4YTTA 2F7FA 5A8QA 4GZJA 1DL3A 1PCWA 4ZTXA 4BI6A 4CEXC 3EOSA 2V2CA 4ZSTA 2TMDA 4R7WA 2HXUA 1IZKA 4OWGA 4PTMA 4Q7IA 2VTFA 3JS3A 1NSJA 3QZEA 4OQVA 1R3TA 2OYLA 5HQMA 2J8FA 1OYBA 2A7PA 4ZE5A 3NFUA 4RNHA 4TV6A 1KBKA 4W5ZA 4URIA 1OGSA 1JYWA 4ACZB 1ZCOA 1G01A 1WDDA 3OQEA 1KFJA 2A3LA 3HPFA 2C3ZA 3DFPA 2ACUA 1R5YA 3LPPA 5GNXA 3BSGA 2CC0A 5DT5A 1T99A 3FXYA 3XINA 1HO1A 4ATWA 1EC9A 2PWEA 2J9YA 4IX2A 2YSWA 3THCA 3TE9A 1EGZA 2I1OA 1ODUA 2X1TA 3V5CA 4U33A 1EJRC 2EKCA 3B9EA 1W3TA 2OSXA 2BY3A 1IGWA 1WUEA 3E02A 3SN4A 4OECA 4LUTA 3M6YA 2X09A 4IP5A 4JR5A 2BZNA 4TVUA 1FHLA 4HVXA 1TA3A 3LYEA 3UWZA 4K38A 2XVLA 2PTZA 1EA9C 4LY4A 4HK5A 4TIMA 1A3HA 5XINA 2Y2WA 2E1DA 4ZENA 5I78A 4IUGA 1W5PA 2E5BA 4Z08A 2WVVA 1MVYA 1TWDA 2ZA2A 3ARPA 4MWAB 3LCIA 3IJQA 1EHNA 5D9PA 1ZP3A 5DELA 3IEBA 1H09A 3S1WA 2C1HA 2GWNA 2VELA 1MUWA 4IL0A 3G0UA 3SR7A 3QYQA 2GJRA 3WQWA 2XH4A 4ADTA 1PO9A 4TX8A 5EBUA 5KITA 9XIMA 4JGDA 4AVFA 3AWOA 4LBRA 2FHCA 4AG0A 1M6JA 4E2DA 4QNEA 5CLWA 1WZAA 4GZIA 1RPKA 3QKEA 3CASA 3ZIZA 5BU6A 3G1YA 4PUDA 2VGFA 1G94A 4XTIA 4UTFA 4M56A 2HXTA 4O17A 3AIUA 1M68A 1AQHA 1GVYA 3MKKA 3H2MA 1IGSA 4D8LA 6CGTA 6TIMA 2FZMA 1FCQA 4A05A 5MHBA 1L2UA 4JEJA 2BNJA 3HPZA 3TNOA 3LHUA 1LWIA 4CEUC 3G5EA 3O05A 1UKSA 3OIXA 3ANUA 3CZLA 3ONCA 2Y1HA 5CJ5A 1K7XA 4ACYA 4DAIA 5CSRA 5FEPA 2NT1A 1XLLA 4H6QA 4IP4A 3BLPX 3MQTA 2ONEA 4D1IA 1DWHM 2X40A 3L66A 4FS9A 4M6VA 1A50A 1KM3A 3SUWA 1EC8A 3FA5A 3F1QA 3EX2A 3DH7A 3UYIA 5AC5A 3I10A 3RCMA 2NSOA 1NF7A 2BOEX 2ZX7A 7TIMA 5JXQA 4HTBA 4K1WA 1ISZA 1BWLA 1HJSA 2WZIA 4GVFA 1SZRA 3S1XA 2PP0A 1PWMA 3KRSA 2WBKA 4RPQA 4MNLA 3EDJA 3GVWA 4DVOA 1E55A 1LLOA 4WF7A 3BLEA 1TIWA 2J27A 1K8XA 3GTXA 3OZMA 4TOQA 2Z1BA 1I0BA 1CGUA 4PMQA 2OU4A 3FSTA 5FJIA 3O7UA 3WD4A 1O5RA 1WZKA 3IIOA 1E0VA 2ZWYA 2CITA 1OX6A 4JTTA 3EOOA 3RITA 3RM9A 3IK2A 3KCOA 2Y8UA 3HFTA 5J5DA 3W29A 3AHTA 3MO7A 5LYRA 4LAUA 2J7CA 4BF7A 1LWJA 2OOFA 1RD5A 1ZQ5A 1PWLA 3EXRA 3ENLA 4PUEA 3O15A 1JZ7A 4ZQOA 3QZ6A 3UERA 2QVNA 1C8XA 1KRAC 3EX3A 3KM8A 3GXPA 1PS9A 4C6KA 2BDQA 1E6PA 4FNUA 3VGHA 1FA2A 4PSRA 1EH9A 3AOFA 1F3WA 2ZRWA 5I77A 1WAUA 3SBFA 3SADA 4BEQA 3FSUA 3KDOA 3KZSA 3TJLA 4TX9A 2R1LA 1I0DA 3CZGA 4C65A 4FB7A 4UTTC 4L1WA 4JIIX 1IXNA 4CCDA 2P8BA 1EP2A 4EPEC 1OM0A 4S3GA 2NLIA 1ALDA 4BF5A 1W9DM 2CZEA 4ZODA 2GUYA 2QDGA 2VUYA 4KIRA 1DJZA 2BGQA 2QQ6A 4NHVA 1BKSA 3QR0A 3QRHA 3TN6A 4GIAA 3K1GA 3F2BA 4MAVA 4JDYA 1MXSA 1BVNP 3STPA 2ZICA 2AMGA 3MV11 4ICCX 2ZFAA 3DECA 3F4VA 1B0IA 1DIEA 3W24A 2X2GA 1G4TA 3MHGA 1A5LC 1GTEA 3W83A 3HQ1A 1WZMA 3CV7A 4AX7A 3KWXA 5LNUA 2WSRA 4MOZA 4HGXA 4LJ3A 4G9PA 1SU5A 2OWXA 3FGCB 1XUUA 4CU8A 3QGVA 2Y7FA 3BJTA 4IMEA 4QBXA 4UTJA 3ZJ7A 4IG2A 1AD1A 4U5KA 5ABFB 2IPJA 3CAQA 3WQDA 4QRNA 1XHGA 1MMFA 3MZ2A 1H49A 3E0FA 1WXZA 4XSMA 4DX3A 3S3GA 4PTDA 1E1FA 1GQJA 1X38A 3N1AA 1XV8A 1SSGA 1UIOA 4PEEA 3RLGA 1ZHAA 2YFNA 1JDEA 3LHYA 3QXBA 2HROA 4DM2A 2XPKA 3BQ6A 2V5DA 4LGXA 4AWSA 1EIXA 2ZVRA 4BK9A 1JD7A 3LCWA 4FO4A 1I75A 3TOYA 2GSHA 4KETA 2A6LA 3RX2A 1LWHA 1AJ0A 3MMWA 3GHUA 3IGUA 2GGHA 2E4TA 1E72M 1X7FA 3M5YA 4DJDC 2WKGA 1AA1B 1GVFA 2WZMA 1TTQA 1XIJA 4Z1BA 2E9MA 2DU2A 3WH9A 1RVGA 2DZSA 1JVNA 3GIQA 1JPIA 4P8UA 3D6NA 3UWEA 5AVHA 1NQKA 3W1TA 3GM8A 4XB3A 1US0A 3SUSA 1UD8A 3VNYA 4YN5A 1E4IA 3GC5A 1A5NC 4ATDA 2INZA 4J3XA 3KWSA 1VIWA 4ILSA 3ME3A 5L9FA 1W1VA 4CD4A 2DJXA 3UCDA 3NR0A 1QPQA 3KEHA 1YTEA 2G5WA 2UZ9A 3W1AA 1RHCA 3WELA 1S38A 2VO5A 3N2MA 1I60A 5EB8A 3H54A 3W3OA 4F3HA 2WV8A 3VKJA 2AL2A 4HMDA 4H9UA 1LQAA 3DHUA 1AW1A 5I2UA 1FWAC 4HNNA 2XJ7A 5K3VA 3QFWA 3AYVA 4V15A 2YLLA 4QSFA 3P5ZA 1PKLA 1V02E 1LP6A 2GSJA 2RGMA 1IT0A 2V3EA 1PHQA 4DBEA 1GTHA 1J2WA 3AJ7A 1UA7A 3WMLA 5ABEA 1E71M 4RW3A 1FDZA 3VE9A 5LNRA 5FSEC 1WAWA 5CG0A 3SSZA 1UMYA 2V67A 3TIMA 1W9PA 2XWEA 5U7SA 5B80A 2QJMA 3N25A 3WH5A 3WQCA 1E0XA 4F0MA 4E38A 3T07A 2W6RA 1CXFA 3RYSA 1G4EA 5CZKA 1TIMA 1F3TA 1PBGA 1NIUA 4IHCA 4CQBA 3NOYA 4NL1A 4DZIA 4WDXA 4DRSA 2PTYA 1Q6LA 4X61A 8XIMA 2G3IA 2C71A 4C6OA 1XWYA 4N9BA 2OQLA 3VKBA 3VINA 1EUNA 3LCFA 3JR2A 3IS4A 3A47A 5D38A 3K1DA 3DFYA 1VZWA 3TVAA 3W7PA 1G0CA 4UNLA 3EWZA 2DT2A 1IZCA 3CGTA 2FYMA 1H7PA 5CPOA 4O18A 3LHZA 2JKEA 5CZJA 3ITTA 1FBAA 3ZVHA 3G0XA 1VCGA 4A35A 4GXPA 1XRFA 1B31A 3A4XA 1QO5A 1TUFA 5FA5A 4AZCA 3WJXA 3PBWA 5K9DA 5G2HA 4A8NA 1LBLA 4JTQA 2ZZ4A 3PBUA 4JY9A 2IPFA 4OUEA 3CUGA 3VDHA 3DENA 1T8XA 4PUNA 2FZBA 3TJIA 1OYAA 5GNYA 3QQ1A 4HZ8A 3DCPA 3VGDA 3BLKA 3PBVA 2RH9A 3W6MA 4HU8A 1TV4A 3ITVA 1IIGA 1HZYA 1HIZA 2FDSA 1RY0A 4HZ6A 2IW0A 3FDKA 3SM0A 3VOHA 2WCSA 1ISVA 1W1TA 3SJ3A 4YWIA 1GVEA 4P7NA 4AD2A 2YL5A 1C3FA 1E43A 2W92A 1KFCA 4YL2A 2BLEA 2HWGA 4LOCA 1W1ZA 2ZYFA 4L9YA 2Y24A 2QUTA 5CPTA 1EZ2A 2F2HA 4MDOA 4XZBA 3AYSA 1PJ9A 2GUUA 3K4WA 3MDWA 2ESCA 1B3OA 3UJFA 2W0UA 2ZTKA 4ZO7A 1V77A 4Y8EA 3H6OA 5JH1A 2MUCA 2CXEA 1OFOA 3ZR5A 4TMCA 2BXZA 2BHUA 2YJQA 4DJFA 4IFOA 3MS8A 3W72A 2RKXA 3AZRA 1XF0A 1XLDA 3NGFA 4F9DA 3MHUA 3BGJA 4TTGA 3BG9A 1OX4A 4H9VA 1H1NA