4GC4A

Crystal structure of the mutant r160a.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTAPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: a structure-based explanation for how the 5'-phosphate group activates the enzyme.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2012-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4gc4A00
1YTDA 3N9SA 1XM3A 4OQVA 5D2VA 1DVJA 3R13A 3PB2A 1L9WA 2QDHA 3GB6A 5SWUA 4IGHA 2X1UA 3HGRA 3HG3A 3QF0A 4KWVA 4IWWA 4XTDA 3CT7A 1TO3A 4N9DA 1FUYA 3H55A 3NL3A 3LHWA 3NQVA 3MBDA 1TV8A 2NX1A 2CLEA 2QCDA 1LOSA 3DFSA 3MP4A 3GVGA 1R47A 2X30A 1RZMA 2QUVA 5KSWA 4M7TA 1IXPA 1DOSA 1FQ0A 3YPIA 3GYEA 4LNYA 3MI3A 3TXVA 3LXCA 1WX0A 2FB2A 3FJLA 1I4NA 2ZYFA 3S9YA 3IV3A 1ZAJA 4E2DA 3MHUA 3NYZA 1ICPA 4NNBA 1HO4A 3NPUA 4TIMA 3NPXA 1MEIA 2YCEA 4O54A 4UIOA 3QRHA 1FCQA 1OK6A 2X2GA 5DCEA 5U7SA 2H8ZA 4GUJA 3KVLA 3QC3A 3W7CA 1M6JA 2YX0A 3O07A 4MZYA 4YMZA 2GVJA 2Z6JA 5KZEA 5TIMA 2Z2UA 3VE7A 1FCBA 3JS3A 4QQ3A 2NXIA 1VLWA 2NUWA 2VEMA 4RCXA 4JDBA 3HG5A 3S42A 3QJAA 4IPIA 3FJ6A 1JCXA 1H7NA 5TBOA 1I2OA 3N9RA 2OT1A 5AFDA 4QJ1A 1LLZA 1L6SA 5GVJA 4DF2A 2P1FA 3EWUA 3MUXA 1BKSA 1DORA 2R94A 3S1UA 4ZL1A 4KWWA 1ICSA 1TJPA 4PODA 1W5OA 1IXQA 1NFBA 3OIXA 5LZLA 3VE9A 3MI2A 1EPXA 1YYAA 3NZ1A 5I3IA 1LLWA 1ZAIA 3LLFA 3Q94A 4ORIA 3R2GA 3P80A 4ALDA 3W22A 1WA3A 4A29A 1QNVA 2YFOA 4JXCA 3W1XA 3GXNA 1SZFA 3MW7A 3ATZA 3W2MA 3UNDA 1FWNA 1TV7A 4NZJA 1TPH1 2Q8LA 4AB4A 1YPIA 1W5PA 3C61A 1ZCOA 3G22A 4O13A 3P74A 3F4NA 4NZFA 1RQBA 3KRUA 1SFLA 2Y7FA 3MYPA 1XI3A 4MLJA 4LRSA 3UZ5A 2QKFA 4TO8A 4FNTA 3RNDA 4GE8A 3U6WA 3TIMA 3UWUA 2DZSA 1M5WA 5KZMA 5K7JA 2ALDA 3QEZA 3NL5A 2NXGA 3W7NA 3W7EA 1NSJA 2ATMA 4N6FA 3RLVA 4JTSA 3TC6A 3GNNA 2QCFA 2WOQA 3PAJA 5U4NA 4O1DA 1XL9A 4LV9A 1A5BA 4O0KA 4FX6M 4CCEA 1XFBA 3O16A 3SIZA 3W1AA 2YYTA 2EAWA 2GQ9A 2VKZG 2WNNA 1OFRA 2Y7GA 5CPNA 1BWKA 1QPQA 4FXSA 3ABSA 3S5NA 5HJLA 2TPSA 4LTSA 1AW2A 2WNZA 2FLIA 1TRIA 3NR0A 3MYOA 4BFAA 2LLEA 1B4KA 2Q3OA 4E0CA 5AHFA 2H3BA 1LBMA 1TPDA 4EF8A 2VFGA 3JRKA 1ADOA 1ZY9A 1JQXA 4HKPA 3TH6A 4JTLA 1UBSA 3QMTA 4JX6A 5CZTA 2J9ZA 2GVLA 3INPA 2E09A 3QPZA 3VKJA 4U28A 1XBXA 1OK4A 1Q6OA 2QCGA 3IIZA 4FIQA 1FWRA 4FNSA 4NT0A 5LKYA 2VOMA 1L6WA 3HIJA 4QSHA 3O8AA 1TJRA 3DENA 5IM51 4LC6A 5D32A 4NJKA 1IXOA 1G4PA 3TK7A 4PL1A 3BG5A 1KFLA 3E49A 4OHQA 3TDFA 4IUOA 1F6PA 4DO4A 4M19A 3STCA 3CM4A 4YCPA 1H63A 4GNJA 3DZ1A 5F4XA 1VPXA 3W2UA 1ZHAA 3BV4A 5I3FA 2CLKA 1TTQA 1W3NA 3KHJA 1SSDA 2ZZ6A 1DJQA 4X3ZA 2GPTA 4O19A 3L68A 3CEPA 4ONVA 4N4PA 3EWWA 3S5ZA 4Z08A 4CCDA 1QOQA 2NUXA 3KX6A 3HGJA 3L0GA 3B06A 5AC8A 5K9XA 1Q3NA 3GNDA 3BPWA 4I9AA 3L0NA 4ORMA 1TPVA 1PVNA 3LRMA 1A5CA 2FB3A 5E1QA 3HGSA 3IIPA 1W8SA 3SFKA 2YW4A 7TIMA 2TRSA 1QCWA 3UY8A 4O50A 2VFFA 1KFCA 2DJXA 1WQ5A 3MP3A 2B7OA 1SU5A 1U5JA 3EX6A 3TW7A 1IGSA 2P10A 3CC1A 3B04A 4O57A 1BTMA 1O5XA 1AK5A 2VFDA 4QITA 2I14A 4PC8A 3W1QA 2YYUA 1VGAA 1P0NA 4GUIA 2ZBTA 4GWEA 1X6UA 3W70A 3CTLA 2CLHA 2OMAA 3G1AA 3LCFA 4UCGA 1D3HA 3NM3A 3W7KA 5K9DA 1T8XA 2GQ8A 1DHPA 3BK0A 4M7SA 3T78A 4BR1A 3B0UX 2JKAA 2V2CA 3KVMA 1KFBA 5EY5A 3OA3A 4JYDA 4Y6GA 2DU2A 3PG8A 3OVPA 3S0CA 3N73A 3CWOX 3RF9A 4FX7A 3GAYA 4KKXA 1LZOA 2PCQA 3DFPA 5EA9A 3W7GA 1VCVA 4RZ5A 3GR7A 4LRTA 1TIMA 3L21A 3ATYA 1H7OA 1TCDA 2AQWA 1TPWA 4UTHA 4RV8A 2QCEA 3LHZA 4HHPA 3SI9A 4AVFA 4OU1A 3C3NA 4OV4A 2RH9A 3NO5A 2NZLA 4IX2A 2Y62A 1LROA 2QR6A 2E77A 1KTNA 5D02A 3EKZA 4MLRA 2QJHA 1UB3A 3P7YA 5F2MA 2GJLA 5G4WA 5D2YA 1P0KA 2YSWA 3N14A 4ICNA 4MUZA 3MI6A 1GTHA 1AL7A 1MXSA 3PUOA 3UXDA 1CW2A 3G3DA 1QPNA 1FDYA 3GDKA 1X1ZA 3F03K 3GZ3A 3LBCA 4O15A 3NL2A 3UQNA 4MY8A 3RMJA 4DEFA 3WJXA 1YXDA 3SZ8A 1FXPA 3WK2A 5DXYA 1FDZA 4GBUA 1C29A 3A9IA 4WQ6A 2J9YA 4AAJA 3TW6A 1HFBA 3LB0A 2V9DA 4DPQA 5HR6A 1K02A 2NWRA 4IXHA 1TREA 5AC6A 5G2IA 2XN2A 3IGXA 4ADSA 1VC4A 2QCNA 3I7QA 3QSTA 4Y9AA 1G7VA 2BLEA 1OVDA 1OX4A 1F5ZA 1GVQA 2I9EA 4IOTA 4ZZ9A 3EX3A 4ML9A 4YLWA 3TSDA 2O7QA 1CX9A 2VEKA 4UTWC 4ZQCA 1T0OA 1HUVA 2OCZA 1F76A 5LSMA 2ZZ7A 3S1XA 4HSOA 2R91A 3W3OA 4CNPA 3G18A 3KVKA 1GQNA 3M16A 4O18A 4UR8A 1ZAHA 3CHVA 2ZRZA 3STFA 1UUOA 3NQDA 3EWXA 3NQMA 4AHOA 4EIVA 5HWJA 4ZMGA 3QQ0A 1KM1A 2VENA 1QAPA 3W76A 4JX5A 3W85A 2YZRA 4HNVA 4O12A 1ICQA 1FX6A 3ZS4A 3O6CA 4TR9A 2YXGA 1XUUA 1YTEA 5EL1A 3W7PA 2G5WA 2D73A 3C2FA 4FF7A 4MFEA 3O1NA 1JCMP 3P8IA 5EMUA 4PA8A 1Q6LA 1J5TA 4RX0A 1TV5A 4PTNA 4R53A 3UY7A 2QEZA 4UTKA 1LOQA 1TSIA 2GQAA 5LHEA 1TPC1 3P8JA 4LY8A 3LCLA 3EXTA 3IGUA 1Z44A 3M5VA 1O60A 4P2VA 1ALDA 2ISSA 1X1OA 4JTKA 1XBZA 3M7WA 4H6KA 4WX2A 2B0MA 2A7PA 5D2TA 2B7QA 3EB2A 2WNQA 2CLLA 1F74A 1U83A 3B0PA 4JTFA 2C0AA 3E12A 1HTIA 1I8JA 2J6XA 4ZQRA 5HNRA 2DZXA 2Z6IA 3P67A 3N34A 4AHPA 3TJXA 4OT7A 1RPXA 5DLCA 1NAL1 3F1QA 4XBKA 2I1OA 3BG9A 3P81A 4FNRA 4OWGA 4LC8A 4JTJA 2CLOA 3W7DA 1NF0A 4TX9A 1VHNA 2FPVA 2WKJA 3TMQA 1LCOA 2V82A 4FNUA 3UWYA 4O8RA 3C2OA 1TPEA 1W1ZA 3P60A 2ISVA 2ZDRA 4FNPA 4RZ6A 3ZWTA 2YPIA 3HF3A 1SW7A 2QAFA 3IVUA 5CPMA 5FF0A 5LNRA 4K38A 3N19B 5EBUA 4JYFA 3W87A 3GKFA 1TTIA 3H53A 1JJKA 2NUYA 4JIQA 2QAPA 1OX5A 1W54A 2NV1A 2TSYA 3DFOA 4WXYA 5G1TA 4K6AA 3ABOA 5DY2A 1KM0A 3S1WA 2CFFA 1K03A 1EWEA 1SW0A 5C54A 1FCUA 3KXQA 3S8HA 1TPB1 2BTMA 1SQ7A 4TU1A 1KBIA 2FIQA 3WJWA 4AF0B 2G95A 1VYSX 1UUMA 1DQWA 4BI7A 1JRCA 2ISWA 1JR1A 3G0SA 3PUDA 1KTCA 1Z42A 3AJXA 2A5HA 3BW4A 4WXZA 3L0KA 3TFCA 1JUEA 2JGYA 1Z41A 2OT0A 2J9XA 3W73A 4WOQA 2C1HA 1TQXA 5HUOA 1RV8A 5DN1A 1S3HA 4NJHA 5F2LA 1GT8A 4LUJA 1QO2A 1VCGA 2ZTKA 4X9SA 4Z1DA 1OYAA 3R89A 1EB3A 4FX8A 2FQIA 5HMSA 1IXNA 5IBXA 1TQJA 3C4UA 2ZA3A 4DF0A 1DBTA 3W9ZA 2H8XA 5T26A 1GEQA 3KOFA 5HWNA 2RFGA 1VHCA 2C18A 4O11A 3L2IA 3TSBA 4MYXA 4I7UA 3QSRA 2GUUA 3CPRA 2V2HA 4GUGA 4H3DA 2DP3A 4LVDA 3B8DA 3ABQA 5CSSA 4WY0B 3HB9A 3L5AA 3O06A 2QUTA 1JCLA 1GG1A 1D9EA 4ZQOA 3I65A 4LVGA 2WPBA 1HL2A 3M47A 4ZQPA 3VCRA 4JTEA 5H91A 4M6PA 3LOTA 2QJIA 3S6DA 3CLMA 3L66A 2A0NA 3TQKA 5AYXA 5IBXC 1M7PA 3WJYA 4AWSA 1K7XA 1JVNA 3E9AA 3PB0A 4A22A 4GXMA 3UYCA 3NZRA 3SGUA 1SO4A 4O10A 2X1SA 3HO8A 1OHLA 4NNCA 3T40A 1OF6A 2CZFA 1TTPA 3UXAA 5BNKA 4N9EA 2BWGA 1YDVA 2Y7DA 4K37A 4Y8FA 1ZENA 3NPVA 3SJ3A 4DF1A 4S2CA 5C5YA 2Y7EA 3DBPA 3DXIA 2HMCA 4OGZA 1NVMA 3DAQA 5HWMA 1VR6A 3LHYA 1ONRA 3OBKA 3B03A 3IIOA 1WOBA 1LP6A 1EP3A 3TAOA 4QIUA 1GVSA 4JTUA 5LNSA 3FYPA 1EP2A 1RQEA 1JCNA 4WUIA 1EP1A 4PFMA 1LOLA 5FF2A 1H1ZA 2EKCA 4XZ9A 4EF9A 3D0CA 1H51A 3P5YA 3G1SA 2E6DA 6ALDA 4DO6A 2ZRVA 1KM2A 5BMXA 1JCJA 3OVRA 3MBFA 3N2MA 4E38A 3SECA 1S5TA 5L9FA 3G24A 3NQFA 2GJNA 5J5RA 3DFQA 3W1RA 2EF9A 2X1TA 1Y0EA 3MHGA 4JYEA 1I2NA 3HPXA 4XUGA 3LERA 4N9BA 1C9DA 3M5ZA 3LGEA 3V75A 3A22A 3CIXA 1ME8A 3T55A 3GDLA 3PC0A 5D2WA 1L2UA 1VCFA 1O4UA 4M5PA 1FY6A 3PR2A 2X1RA 2FJKA 1XKYA 1GJPA 3EXSA 2RDUA 2Q3RA 1R2SA 5I3JA 4PH6A 3W2JA 1N7KA 2ZZ4A 3Q58A 2QJGA 5HUPA 4DQWA 3A23A 2WJZA 1EUAA 3GX9A 1VLIA 3WK0A 5BMWA 1UCWA 4CCCA 3PSVA 1BEUA 4NX5A 1SO6A 4Q32A 4S2BA 2ZQ0A 3GXPA 1XDMA 1B57A 2DZWA 1KM5A 1FBAA 1W37A 4WD0A 1G4EA 1LBFA 2VEIA 1KLZA 1N55A 3L5MA 3H54A 2ZFAA 2QCHA 1JULA 3W1NA 3SGZA 1Z48A 5LNUA 4IMDA 4ZQMA 4K8EA 1XUZA 5AHNA 1R2TA 4UNKA 1DQXA 3QM3A 2NLIA 4C1KA 1GOXA 2EPHA 3F4WA 3NPWA 1G67A 3W88A 3DH7A 1CI1A 4FXRA 1V5XA 1QWGA 3C2VA 1IF2A 1A53A 1BWLA 1T99A 3Q2DA 4MZ1A 1FCVA 2R8WA 3T44A 4CNOA 4DBDA 1OG0A 1KW1A 4BI5A 2WSRA 3TQ0A 5FESA 1VYPX 1E51A 1JQVA 3LCHA 3LTYA 3TC7A 5K4XA 4MY9A 3STEA 4MVAA 4UFHA 4Z1BA 2CZEA 3NQGA 5D2XA 3TX9A 3LCGA 3CB8A 4DELA 3A5FA 5K4ZA 1LBLA 3DI0A 3EX2A 3DKJA 1H60A 3EKLA 5CSRA 1P4CA 1TYGA 4Q33A 4Y96A 4JIPA 2RDTA 1XBYA 4LS1A 1LTDA 4YXGA 3DFTA 3NM1A 1ME7A 1MZHA 1WV2A 3LTSA 3C6CA 3FFSA 1QOPA 2FFCA 3PY2A 4JTTA 3SSJA 2CZ5A 2CLFA 3HOJA 3DGRA 5D38A 2A21A 4POCA 4BWLA 1FXQA 2NX9A 3SR7A 3SY5A 5D37A 3TXZA 2W79A 3PVFA 4HN4A 4IQLA 2EGZA 4LU0A 3PSWA 3FEMA 3GDMA 1W5NA 1NF7A 1G6CA 1KA9F 3M9YA 3LRKA 4AMAA 1XBVA 2H90A 4O1BA 4WY0F 3PBYA 1TPFA 1Q6QA 1GVRA 4LVAA 5DXXA 3QFEA 2E1DA 4UMCA 4EOUA 3OG3A 4AXKA 2A7NA 3T7VA 4AF0A 3BG3A 1K3UA 2J24A 2FTPA 1PCKA 4GFSA 5KZDA 5C2XA 4RZ4A 5AYYA 2AAMA 3W1PA 1WAUA 2XN0A 3NL6A 4K7YA 3LCIA 3MWAA 3GR8A 5BW6A 3NOEA 3PULA 2HS8A 4MFDA 4A3UA 4GRSA 3FYOA 1GVFA 4Z1CA 1PE1A 4BWLC 2HTMA 3FS2A 3O15A 5KTLA 3KAOA 3LM7A 4HPJA 5TQLA 3W1UA 3BARA 2BSLA 1W3TA 4UXDA 2GOUA 5G5IA 5D09A 5FF7A 3W71A 3THQA 4I7WA 3UWZA 1O5KA 3ELFA 2C19A 3G1FA 2V81A 1B9BA 4JTIA 2F7FA 5KMYA 3EWZA 1RQHA 1OFPA 3MP5A 4NVTA 1G4TA 3PWAA 1G69A 2CLMA 3RK8A 5AHIA 3JR2A 1OYBA 2Y61A 2UV8G 1NEYA 3IEBA 3QW4B 4MY1A 1XDLA 2DZPA 4JR5A 2YDAA 4O0ZA 1VRDA 4JDYA 4LW7A 3W2KA 2W6RA 1J4EA 3C52A 5EPDA 1ZFJA 1YLVA 1GYNA 4HPXA 1K8ZA 2C15A 1PL9A 3R5EA 1OYCA 3NAVA 1SPQA 1KFEA 3R12A 4WY0A 2ABBA 1WYIA 5CZ0A 2RDWA 3GDTA 3MMTA 2QDGA 2EHHA 2C16A 1MEHA 3LV5A 1XXXA 4LS2A 5HINA 3T4CA 3TU9A 5A5WA 2YW3A 3BW2A 4JTGA 1KLYA 4UFMA 2CWNA 1K8XA 1VZWA 4NXSA 3KRSA 3LI1A 3ZR4A 1H50A 1WOAA 2JKPA 5DCDA 3TMLA 4UTJA 3W23A 4UTUA 4JEQA 1SO5A 1THFD 3TUUA 5CKSA 1OFDA 1OABA 1W5QA 3MJYA 5D30A 5I3GA 1LRQA 2YGYA 1F6KA 3S5OA 3UD6A 3W7IA 1ML1A 1N8FA 3C2RA 3W75A 3HBLA 4MJMA 4Z1AA 4GUHA 3UZJA 3GLCA 1OF8A 1H5YA 3HQ1A 5AHEA 1O95A 4FO4A 3VI2A 3NQ7A 1H62A 4NJIA 2VC6A 3LBMA 2ZZ2A 1EWDA 2C14A 1EX5A 4IJBA 3W7QA 4HSNA 1RD5A 4CLMA 5FI8A 3WJZA 5CZSA 1OFQA 3E02A 2V2DA 3CIWA 8TIMA 3IGSA 4RK8A 4UMBA 1SFJA 3M5XA 5G1YA 4RXFA 1QPRA 4PCFA 2R14A 4ZVJA 3TAKA 4TMBA 1B4EA 4K36A 4O28A 1R30A 2Y89A 2DZUA 3NNTA 3PG9A 5DBTA 1WBHA 2ZZ1A 5FEXA 3FKKA 2PURA 4O4WA 3GK0A 4O52A 3BGJA 1DJNA 1GYLA 2ZA1A 4KFNA 4R7JA 5CPOA 3W7JA 2ZA2A 3FLUA 3G1YA 5KITA 5EKYA 1SZNA 5LGXA 6TIMA 5FEPA 2HSAA 3DU0A 1GWJA 4UUIA 3A24A 3WJSA 1I45A 4UR7A 4JN6A 1R46A 2B7NA 1VS1A 3HPSA 4MZ8A 1QFEA 5KINA 2DZVA 1P1XA 4HNNA 1T96A 4S1FA 2ZZ3A 4LS0A 3PBUA 1XC4A 3LRLA 3EXRA 3U2OA 5F1VA 1EA0A 3UWWA 3TFXA 4Z0SA 2QCLA 4JX4A 4DXVA 3B4UA 4NUWA 3G0UA 4IPJA 3LX9A 3LCXA 1SUXA 2NWSA 1H7PA 1GG0A 3O63A 2ABAA 4UNLA 1JUKA 1GTEA 2QF7A 2P0OA 5I3HA 1MEWA 2XFWA 4HIBA 5FF3A 5D04C 1SW3A 3MHFA 1IIHA 4M6QA 4TMCA 1H7RA 1OJXA 1KM3A 4RR4A 3KVJA 4I7VA 1J2WA 3LHVA 4LOCA 3PF3A 3UWVA 3DFNA 1LM1A 2O7SA 1PCWA 2J27A 2V8ZA 1X7FA 3LHTA 1LORA 3LLDA 3QPYA 3BO9A 3NQ8A 1ZALA 2PRLA 1LRNA 2QCMA 2ZRWA 1A5AA 3NQAA 1G4SA 5AN7A 1M7OA 3RLUA 4D2JA 1KFKA 2DORA 2DZTA 4GJ1A 4QAIA 3IVSA 3LV6A 3C8FA 3M41A 4XKYB 4DPPA 3CEUA 1OX4B 1X8FA 3I6RA 4UFLA 4NXKA 4YL2A 4CQ8A 1JRBA 1K7FA 4JICA 3TE9A 3OEXA 1MSSA 4MJZA 3B05A 2ZRXA 3FIGA 1TTJA 1LDCA 3TROA 4LVFA 4O17A 3IRDA 5K2ZA 3TCEA 5DCBA 2Y88A 1A5SA 2WV8A 2AGKA 2V5LA 3PS7A 3UPBA 4LWWA 3L5LA 3W1MA 3W74A 1PS9A 3HGOA 3G0XA 5CG7A 2BXVA 5F4SA 3NQ2A 4JNMA 3C56A 5AC7A 1EEPA 1KV5A 1TRDA 4FEZA 3UWQA 1WBJA 5I3KA 3BGGA 3VNDA 4MKNA 3W2LA 3V1PA 3FOKA 2WQPA 5A8GA 1L6YA 5FF4A 2VXNA 2A6NA 1D3GA 1F73A 4IX0A 2A85A 3DI1A 4RKAA 2RHGA 2Y70A 3HG4A 4U4MA 2CW6A 2H3DA 4RJEA 4N2YA 4NX0A 4N9CA 4MYAA 2A4AA 4X2RA 3I7SA 4UFKA 2Z0IA 3TNOA 4UTMA 2WO5A 5AOUA 5LNVA 5FEZA 1KM6A 5EYWA 4MIMA 4RLIA 3CWNA 2BZNA 4UTTA 1YDOA 1LYXA 2A1YA 4FB7A 5BRBA 5C6MA 4KFOA 3W6YA 1B3OA 2C13A 1P5BA 4JGDA 2ZRYA 2B4GA 4E2BA 1H61A 3EEGA 2ATSA 1DV7A 4A2RA 2OJPA 3W07A 1PIIA 5F4WA 3UPWA 1H7XA 4R34A 4OBTA 3QH2A 3M43A 5E93A 3IVTA 2Y6ZA 4IXXA 4Z0JA 4OE7A 4K7VA 3LHUA 3E96A 3NXFA 3P5ZA 3NEVA 3N3MA 1TPUA 2FPYA 1S5WA 4WJEA 1FWTA 3NQEA 1XCFA 2JK2A 4H4IA 3C0JA 2A2IA 4LVBA 3TSMA 4UTTC 3U8GA 3MO7A 3NA8A 4K39A 2GVGA 1WDWA 3QW3A 1AL8A 3W7OA 4EWND 1SZGA 3QYQA 1VQTA 4IMEA 3LDVA 2E6FA 3I7RA 5LGZA 1H1YA 2PE4A 3A5VA 1FWWA 2E6YA 2CZDA 3W1TA 4HNTA 2BX7A 4LT9A 4QNWA 5HR7A 2V0TA 1PV8A 1UASA 2C3ZA 5ABTA 3O05A 3WK1A 1MO0A 4JY9A 4X22A 4O53A 2CU0A 1I2RA 3ZWSA 1ME9A 4N6EA 3NGJA 2F84A 4WZHA 2J88A 1TB3A 4CNNA 5LNWA 1QO5A 3BVJA 1AW1A 3FA5A 2QCDB 1GZGA 3A21A 4DBEA 1OFEA 2VFEA 3W7RA 2VFHA 2E68A 3HJZA 3I68A 2V5BA 1QPOA 4IMCA 3W1LA 4MOZA 4AEOA 2FDSA 2Y85A 3L65A 3W2NA 4HNUA 4QM1A 1H7WA 1JUBA 1R2RA 5AHLA 1I2QA 3PM6A 2XN1A 1SZEA 4O14A 5CPLA 3ZFHA 1DKWA 2NV2A 2Q8ZA 3TV8A 2QUUA 2HS6A 4R33A 3DHFA 2RKXA 3G1VA 1YPFA 2JGQA 3GIYA 4UMAA 2JBMA 4MPQA 3BLEA 3BW3A 1YADA 3G1XA 1VH7A 1ZNNA 4FNQA 3P61A 3OVQA 1ZJIA 4JD4A 3HPZA 4HT3A 3W7MA 3PUEA 3NQCA 4BK9A 4B5NA 5HULA 1W5MA 1YDNA 5K9CA 3QMRA 4FHAA 2VEPA 3AO0A 2C6QA 1K8YA 5DBUA 4QNEA 4WOZA 4YWIA 4XWUA 2OX1A 4NNAA 5HQEA 2PRMA 4KFPA 4A21A 2W0UA 5C55A 4O16A 3EWYA 1SR9A 3BLFA 4C1LA 4NJGA 5AB3A 3NVTA 3O6YX 3W7LA 3L9CA 5BOOA 2PRHA 3LCWA 4QISA 4AWTA 4O1AA 2WSQA 3SW6A 3LXBA 3KRZA 3EX4A 4LV4A 1WXJA 2JKEA 4XTIA 1PHQA 3NDOA 1DL3A 4UFIA 5LHFA 2B7PA 2NX3A 5CZJA 2TYSA 1I2PA 3TR2A 5J5DA 2PC4A 2E5CA 3RU6A 3W84A 4L4MA 1K7EA 1QMLA 4AWUA 1QR7A 3W72A 4O4VA 3TKFA 3TQVA 4CQ9A 1OX6A 3STGA 1YXCA 3Q37A 4YCOA 3KFTA 2G96A 4XBSA 4DO5A 4Y90A 3RFAA 2WSYA 4NU7A 4UTIA 4A2SA 3B0VC 2VELA 3NQ6A 4G1KA 5H2ZA 3LXAA 5F2IA 1PHWA 1AW5A 3G8EA 5AYZA 1HG3A 5CGQA 3M0ZA 4NQ1A 4UTWA 5D03A 1C8VA 3IIVA 4PL2A 3QQ1A 2TMDA 3NG3A 5DY3A 2V30A 1KV8A 3GDRA 3C2EA 2H6RA 4P61A 4W9TA 3IIXA 2YFNA 4ADUA 3G8RA 4IMGA 1YTKA 2CLIA 4UFJA 1AMKA 4XKYA 3QMSA 1F05A 3DKLA 4JTHA 5K3VA 5L6UA 3W83A 3GXTA 2Y63A 1S5VA 4J9JA 1GPWA 1LRTA 2QCCA 3G1HA 5F1UA 5G4EA 5D33A 2ZZ5A 4IMFA 1V7YA 1O94A 5AHMA 4UTLA 3S1VA 1KFJA 4CQAA 4PEKA 3GAKA 2E6AA 3CU2A 1A50A 2OZ0A 3M6YA 3TA6A 1F2JA 1AG1O 1W56A 4OV9A 2E5DA 2NXHA 4M6VA 4NJJA 1FWSA 4L4LA 4K8HA 5G2HA 3ANYA 1OFAA 1YXYA 3PBWA 4UC5A 4FIRA 1HO1A 1Q6RA 4GUFA 3TJLA 1W3IA 2KZHA 3BLIA 3FKRA 1QDSA 3P84A 1VJIA 4RXGA 5FEWA 1W31A 3M1ZA 3M5YA 2E5BA 4ZQNA 3M44A 4ADTA 1W0MA 3WFAA 5G2WA 1TMHA 3R8RA 1KM4A 5MHBA 1RVGA 1SO3A 3LTPA 1OFOA 3OHIA 1G7UA 3EX1A 3CQ0A 4BF9A 3G3MA 2IQTA 1RR2A 1GVOA 5F2GA 4GC4A 5DELA 3W7HA 1KBJA 4EVZA 3HMJG 3USBA 3WK3A 2A7RA 1UJPA 2DJLA 3K30A 4AHQA 2VFIA 3N2XA 1VYRA 2ZCGA 1JCYA 1OFBA 3PBVA 2Z1BA 4O1CA 2ZTJA 2G97A 3QZEA 5D05A 3O6DA 3VFLA 4LUIA 3GKAA 3HG2A 4BI6A 2X16A 1F7BA 4AH7A 1Q45A 4XQ6A 3G1DA 5E0KA 3EWBX 4N02A 1EUNA 3E0IA 3LI0A 4Q4KA 3L67A 3THAA 1FDJA 3W86A 4JS3A 2FPTA 3P62A 3S5YA 2A6LA 4N4QA 1EIXA 1KTBA 1IIGA 1SSGA 2ZRUA 3DHDA 3P82A 4JY8A 3ABRA 2YR1A
chains in the Genus database with same CATH superfamily
1RJRA 2DGAA 3HV9A 4QG6A 5D2VA 3K8KA 2W66A 3WMBA 3DCPA 1DVJA 3OBEA 1YDYA 3CJPA 1SYTA 3VIJA 4WKHA 5GPRA 1UWQA 3U57A 4B5SA 3GB6A 4IZGA 1YEYA 4ASTA 3W25A 2CC0A 3HGRA 1Y65A 2XVLA 3HG3A 2J7CA 1J18A 2WYSA 1ZRQA 1TO3A 4RNIA 2ICSA 1XFCA 2WVTA 2QCDA 2X30A 3VINA 1KRBC 4QAWA 3YPIA 4BKNA 3WQCA 3GYEA 1FP9A 4RW3A 1EYWA 4XG1A 4UQDA 3SN1A 4IPLA 4OJYA 2OKOA 1I4NA 1PTGA 3ARPA 1XPYA 1F8MA 3MKCA 3DC8A 1ZAJA 3NQBA 2YLLA 3MTWA 1QW7A 2XGBA 1ICPA 4RPQA 3M0VA 3NPUA 3NPXA 2YCEA 1XG3A 2UZ9A 2PDUA 4H01A 3QXBA 3W24A 3UR5A 2H8ZA 3E38A 4ZO9A 3QC3A 5CBIA 3XISA 2Z2UA 3ABZA 4Q22A 3R8GA 3BAWA 1W1YA 2AOSA 5MKGB 3REQA 1NOWA 4AIUA 1LQ0A 5A6BD 3WDHA 4A35A 2OT1A 3PP7A 1FWHC 5GVJA 2PA6A 2P1FA 4L64A 3W37A 1DORA 2CHRA 2BVYA 4PODA 1IXQA 1MQPA 1NFBA 4PEEA 9CGTA 4LYKA 3OIXA 5FJOA 5LZLA 5BRQA 4UCFA 5I3IA 1AFSA 5CSUA 3LLFA 3ZVIA 1JZ4A 1NM9A 1HGYA 2ACRA 4XD4A 4A29A 1QNVA 2JEQA 2DT0A 4JXCA 4C60A 2Z26A 3MW7A 5H8UA 1B3VA 3LGDA 3PHAA 1WDDA 1TPH1 4F4RA 5I3DA 2GDVA 1UWAA 1P0BA 3ARWA 3WENA 3PJWA 4J3ZA 3G22A 1MRAA 1Y5XA 1RSCA 3NSXA 3UZ5A 1RY0A 1Z89A 5JIWA 3VTRA 4GIEA 3U6WA 3TIMA 1V8EA 3UWUA 5KZMA 5K7JA 3AOFA 3W7EA 3KWSA 3ARTA 5FACA 2X7VA 3WYZA 4C6KA 2ATMA 3RLVA 4M29A 3TC6A 4E8CA 2QCFA 3HV8A 5U4NA 1X1NA 4E4UA 1XL9A 4LV9A 3T9PA 1XFBA 4GI9A 3PANA 3VNLA 3W1AA 2YYTA 3LQGA 3KTCA 1NQ6A 1AA1B 1UROA 3MDWA 3MSDA 1QPQA 5LIXX 3VNIA 1HQTA 3WNOA 4AY1A 3S5NA 5HJLA 3UERA 2EJAA 3QTPA 4QTGA 3B8IA 1KCLA 2FFIA 1KR0A 4NZCA 4W4QA 2OLSA 3WMSA 3ISIX 4JTDA 1FWEC 2H3BA 3KP1A 3VGDA 4EF8A 1ADOA 1ZY9A 3UXLA 4HKPA 4C6EA 3TH6A 2PSNA 4L56A 1O1HA 2YXOA 4JX6A 4DJED 3INPA 3TN3A 2BV9A 1OK4A 1Q6OA 1RK5A 5LA1A 3DENA 5IM51 4MHBA 3QQWA 1PIGA 5I6SA 4NJKA 5FJRA 4PL1A 1EO7A 3BG5A 3E49A 3DDMA 4DO4A 2ANUA 4M19A 3STCA 1SZRA 1Q66A 1XHGA 4UQ9A 2OODA 3DZ1A 3GHUA 1B30A 4L4PA 4RPPA 4GISA 2VR4A 2YB4A 2CLKA 4JNZA 4O19A 3L68A 4J5NA 3PN8A 3S5ZA 2NUXA 4Q8PA 3WDJA 2OEMA 4EPDC 1P7TB 1Q3NA 4S3KA 1RP9A 4I9AA 4S3DA 1J6PA 3L0NA 5LA2A 4FZIA 3H2CA 1PVNA 5E1QA 1G01A 4GQQA 3WELA 2YW4A 2TRSA 4RZBA 2VFFA 1KFCA 4PUMA 4NILA 1EBGA 2B7OA 2PPGA 3AMCA 2P10A 5GNYA 3AHZA 1AK5A 2XVKA 4QITA 2I14A 4GUIA 4W5UA 3TZNA 3NM3A 3VOIA 2GQ8A 1DHPA 4M7SA 3T78A 4L1GA 2IS7A 3KDOA 2OEJA 3WX7A 1PPIA 4PRTA 3U5YA 3UJEA 5B7YA 4Y6GA 3S0CA 3N73A 1WDRA 3BTNA 3DHPA 1H49A 3DFPA 3KZSA 3CASA 4YWSA 4G7EA 1TIMA 1TCDA 1CGXA 1O6IA 2QCEA 3NSNA 3LHZA 4HHPA 4XKMA 1O68A 2I56A 3UZYA 2VC7A 2YDSA 3B9OA 3R58A 3RCMA 1F4HA 4MMWA 4IX2A 2Y62A 2XVGA 2XIQA 1YNYA 1E4NA 1JPDX 5G4WA 2INEA 5BXRA 1TA3B 2J8TA 3C86A 4AMCA 4KMQA 3NGFA 5ABGA 1QPNA 3GDKA 1OB0A 1X1ZA 4C7DA 4L1XA 3GNOA 3N2CA 4NZ4A 3L4WA 3DG6A 5DXYA 2Z2AA 1A0CA 2J9YA 4YTRA 3GG0A 3JVAA 3O7UA 2V9DA 2IQ0A 3AYVA 1W1PA 4LANA 2G8ZA 5FIPA 4GY1A 5AC6A 1QHOA 1J93A 3WIJA 1VC4A 3N9KA 3I7QA 1RA0A 2BOFX 2D2JA 2EG7A 1OX4A 1M1BA 2VDIA 4G7FA 2Q09A 1GVQA 4ML4A 3AS2A 3FCPA 4ML9A 1DJHA 4KRTA 4UTWC 1FH7A 1V0KA 4ZQCA 5M17A 3VNYA 2ZZ7A 4HSOA 3E2RA 1AUSL 3OJGA 3M16A 3CHVA 2OTDA 2W91A 3STFA 1OWQA 1KKRA 1UUOA 3NQDA 3EWXA 2Y2WA 2OZ3A 3NQMA 4AHOA 4HTBA 3EEZA 1ODZA 1X38A 3W85A 4R9OA 3WUGA 4E5TA 1ICQA 2BG5A 1J11A 3CTTA 1LWJA 1EXPA 1EHNA 3UR2A 3WH7A 4WR3A 2VX4A 2J7DA 2W92A 3TLQA 1CECA 4PTNA 4R53A 2ZXQA 2GGGA 3P8JA 2ODOA 2AGTA 5CGTA 4DJFD 1H4PA 4P2VA 2ZC8A 1W2VA 3DFYA 3ES8A 1GQLA 4YYFA 3M7WA 5I7GA 2A7PA 3SCTA 3EB2A 5BRPA 3MV11 2X42A 2DZXA 2V5KA 2PLCA 3TJXA 3E74A 4OT7A 5FAGA 5DLCA 2JIWA 1NAL1 2X0YA 1QRQA 2Y5JA 2I1OA 2R1MA 5FJPA 1FTXA 2DPEA 4FNRA 1PKLA 3VIKA 2CLOA 1KB3A 4IIGA 3TMQA 1LCOA 4FLSA 1TPEA 3ITXA 3QV7A 3BH4A 2ISVA 1YE4A 2GJRA 3KBJA 1O1ZA 1M3UA 4FNPA 3VKDA 1WPCA 3HF3A 2J8FA 4IP5A 5CPMA 3N19B 5EBUA 1TTIA 1KD0A 4W5ZA 2PP3A 2PBGA 2JF6A 5REQB 3AU6A 1BLIA 4KEUA 1W54A 5G1TA 3IJ9A 4CQCA 3AS1A 5JH2A 4J1OA 3O3RA 2OPJA 4MSSA 2OLAA 5T91A 5E9XA 4PMOA 2FIQA 1HVQA 1W3HA 1UUMA 1DQWA 4JTQA 4BI7A 1RPKA 4PTWA 2XVPA 3G0SA 2QHAA 3AJXA 4HZ8A 2JGYA 3SUUA 4B5VA 1UZ1A 1NFGA 3W73A 4ZTXA 2C1HA 4U33A 3VYLA 5F2LA 3SJNA 2XDFA 1VCGA 5JUVA 1HJSA 2ZTKA 1OYAA 4FX8A 5HMSA 3NTYA 1WZAA 5AYIA 2VZSA 4H41A 4HK7A 1GEQA 2Z29A 5C9UA 3L2IA 6XIMA 3AUOA 2GUUA 3ARZA 2ACQA 3H7UA 4DYKA 1WDPA 3IAQA 4ZBCA 3L5AA 3CIVA 3O06A 2QUTA 4H6RA 2OR2A 3K8LA 1GG1A 3CUGA 5M1TA 4Q4RA 3M47A 2XTKA 1AODA 2QGYA 4M6PA 3LOTA 1DXIA 2A0NA 3IJLA 4W87A 5EMLA 4DI8A 1JVNA 3PB0A 4WJXA 2R82A 1EQPA 4KETA 1OHLA 4R27A 1HKWA 2CZFA 4C6CA 4DYJA 1DIOA 1TTPA 2CLPA 4NYYA 5BNKA 1YDVA 2PDMA 2X1IA 1ZENA 2XGIA 3NPVA 3SJ3A 3WLSA 4S2CA 4IJRA 1H0IA 2C8NA 1RLDA 2QVNA 2QZRA 3OBKA 3CQIA 3B03A 3G77A 1CXKA 1ZCCA 4GIYA 3BMVA 3ZJ7A 1G5AA 1EP3A 3ITCA 4P8WA 3TAOA 4QIUA 4JTUA 3MB9A 5C70A 3FYPA 1UPPA 5TD4A 3ENLA 1LOLA 3OO2A 4DLMA 2NW0A 3JZUA 2EKCA 4GNKB 4EF9A 7CGTA 1DWFM 6ALDA 5CQ1A 1OIFA 3WLKX 1JCJA 3VABA 3AXKA 4H7CA 3GR4A 5LIWX 1PX4A 5L9FA 3HN3A 1ITUA 4DNMA 3AXMA 4GINA 1Q7ZA 1JXKA 3GVRA 3VIPA 1MDRA 1Y0EA 3MHGA 2QYGA 3LSBA 5JQ9A 3VD7A 3DN5A 2QF8A 1C9DA 3V75A 3CIXA 5D2WA 4N0RA 2O9PA 5FJUA 1FY6A 1MZRA 1FFRA 2PDXA 2WM1A 4HU4A 5A6BA 2WZIA 5I3JA 3L4VA 4GVGA 1FWFC 2ZUVA 3F4CA 2IKJA 2QPXA 2QJNA 2ZZ4A 2V3EA 4S3AA 1OT2A 5HUPA 1C7TA 2GDQA 3BZGA 2WJZA 4ZB5A 2WXDM 1PKYA 4EAMA 1UCWA 3PSVA 5DF0A 4NX5A 1E6ZA 3GWQA 2ZQ0A 1R3QA 4HGXA 1KM5A 4XISA 1PTAA 1W37A 1XIJA 4WD0A 1LBFA 4P7NA 4B9ZA 3H54A 3L5MA 1JULA 3SGZA 4WDWA 4IMDA 4K8EA 4HNLA 1KQYA 2HV5A 1LJYA 1ISXA 1GOXA 2EPHA 2XWEA 3NPWA 4WRHA 3W88A 2G37A 2WVSA 1IF2A 2FHFA 3FW6A 6XIAA 5BU9A 1BWLA 2X7WA 2L5HA 2R8WA 3SEPA 3T44A 1OG0A 1R5YA 1UIPA 1UH4A 4BI5A 1I1XA 2WSRA 3OYXA 4U3AA 5FESA 4A8LA 1VYPX 2J8GA 3GY1A 1E51A 5K4XA 3KOYA 4UFHA 4Z1BA 1FRBA 3ARYA 2PB1A 3T2QA 3AWNA 1AZ2A 4LCSA 1H60A 2AMXA 4E8GA 3EKLA 1P4CA 1TYGA 4Y96A 4C1NB 4H9XA 3WUBA 3TONA 1ZZMA 1RD6A 3LGGA 3PPGA 3MCOA 1QOPA 3WEMA 3CUHA 4H6EA 4JTTA 1XSIA 5D38A 4POCA 2TODA 4W7UA 2W79A 4A8NA 3GDMA 5FOOA 5AC4A 4AMAA 1XBVA 4QDPA 2VEGA 4DJEA 1NY1A 1Z9AA 1TPFA 5I09A 4G5DA 3L7RA 2WLYA 4Y2WA 2XZ7A 3OG3A 4AXKA 2A7NA 4AF0A 1K3UA 2J24A 2FTPA 3RITA 4GFSA 4MB4A 3DC0A 4RZ4A 5C2XA 2AAMA 1VFHA 1LL6A 2VDHA 3LCIA 2Y5EA 3GR8A 5BW6A 3PULA 3UVIA 4GRSA 3FYOA 3KS6A 1PE1A 1A3WA 3FS2A 1XYCA 3KAOA 4KWUA 4Q8QA 1TWIA 1W3TA 4UXDA 1NIUA 2CXEA 2UWFA 5FF7A 3W71A 3APYA 4I7WA 4HPHA 2BP1A 3WLHA 4JTIA 4DJEC 3GBEA 3RMEA 1OFPA 3A6OA 3TYUA 1G4TA 4QE1A 5FKYA 1B2YA 1EF2A 4QROA 1JIBA 2UV8G 1NEYA 2VC9A 4JR5A 1J5SA 2YDAA 4O0ZA 1KR1A 1J0KA 4L4OA 3FYYA 1GYNA 2VX5A 1K8ZA 3WLJA 3TLLA 1XLJA 2C15A 4GQGA 2YA2A 1CB7B 4ES4A 5HMFA 1OYCA 1KFEA 3TYCA 3R12A 3AIUA 2W4XA 2UY3A 2EHHA 4U5KA 3XIMA 1MEHA 3D5HA 4IP7A 3TU9A 2GZXA 4X9YA 4JTGA 4DLFA 3H4GA 1UWRA 4NXSA 3KRSA 3LI1A 5DMYA 4C6FA 2JKPA 3USZA 3TMLA 3MMWA 3W23A 5DRIA 5CKSA 3WH8A 1F6KA 3CK5A 2J74A 4JKKA 3GUWA 5A6TC 1GONA 2G3JA 4MJMA 5CH9A 4Z1AA 4A3YA 1OF8A 1O95A 3NQ7A 1H62A 2VC6A 4D6GA 5DQPA 1EWDA 4CLMA 3E02A 2V2DA 1CDGA 4RK8A 5G1YA 4UMBA 3OU8A 1DTUA 2R14A 4LXFA 3QY8A 3MVTA 4K36A 1NDVA 4O28A 3NNTA 2XISA 2ZVIA 5DBTA 1QXLA 1WBHA 1BQGA 3WMLA 2NQLA 2GGIA 2J66A 4O52A 3GXMA 1E1CA 4R7JA 5D8ZA 5KITA 1IWPA 3OGRA 2VO5A 3V0UA 3ARVA 4OIFA 1GWJA 4HK5A 1XSJA 4HMEA 5MF5A 1BD0A 4LBRA 4JN6A 3T1GA 3PFRA 4DWSA 2ACUA 1CGUA 2P76A 3MMDA 1UOZA 1V02E 2IPFA 3VZYA 3L2LA 2HE8A 3IUDA 1C93A 3AROA 2ZZ3A 2V6AA 5A2BA 3WLLA 1XC4A 3LRLA 3QLLA 2XZ9A 1LWIA 4OZOA 3TFXA 4Z0SA 2QCLA 4JX4A 3RILA 3BSGA 1CEOA 4RDWA 1RJQA 3APGA 2DUAA 1FWBC 1IEIA 4Y9NA 1JUKA 3RDKA 2QF7A 4LAOA 3EMQA 2XFWA 3BJSA 5FF3A 1CXEA 2BS9A 2VD9A 2V5CA 3MHFA 2DT2A 4S3EA 4ICMA 1IIHA 4WJ8A 4PMXA 2WSPA 2XJ7A 2FGBA 2Z00A 1R3SA 3SUTA 1KM3A 3KVJA 3FAXA 1BFNA 1HN1A 3M64A 1JDFA 2QGHA 3LHVA 3F4VA 3DFNA 1PCWA 1W9VA 1K9FA 2WVVA 1LORA 3NQ8A 3LNPA 3V5OA 3W00A 4MPKA 3NQAA 4ZFCA 2PGEA 3RPMA 1TMLA 2J77A 4D2JA 2DORA 1XPGA 4GJ1A 4H6QA 1D2KA 4XKYB 1VFSA 1KWGA 1OX4B 1E0VA 3VO0A 2P8BA 3ZSTA 4UFLA 4NXKA 4YL2A 4CQ8A 4RE0A 3DG3A 2RJHA 3B05A 1ZQ5A 1GK8A 3IRDA 5K2ZA 3VDAA 3R43A 3RLGA 2AGKA 1NTHA 3UPBA 3UR7A 4JCMA 2FH6A 2ZDSA 3BLDA 2GK1B 5CG7A 2PTDA 5AC7A 1R3TA 4AYGA 2AKZA 2Q71A 3UWQA 3UCDA 1ADDA 4DJFC 3NOYA 3GC4A 3SUWA 2B31A 4FP1A 3HJEA 1L6YA 1ZPTA 5FF4A 3BUVA 2VXNA 5KZ6A 5I23A 1ZL1A 4IX0A 4Z2JA 3UEQA 4CQDA 2H3DA 3BOLA 3EOEA 4PGLA 1D8CA 1RCOB 3AYRA 5FD0A 1KC7A 4GXWA 1E56A 1XLHA 2NQ5A 4UTMA 2WO5A 5AOUA 3RPDA 4MIMA 3FNDA 4NG3A 5HOSA 3R0UA 4W8BA 3SCUA 1UD8A 1LYXA 3WLOA 5BRBA 5IOBA 3W6YA 2ZRYA 2B4GA 1H61A 3PK7A 4TV5A 3W07A 1BRLB 3ZIZA 4JAWA 1GVYA 5F4WA 3KEHA 4R34A 1JYNA 3EMCA 2WBGA 1C8XA 4Z0JA 1HJQA 5M5DA 3NXFA 3DYPA 1V6VA 1E5JA 2WHKA 2FPYA 4H00A 2J78A 4WJEA 1FWTA 5C0QA 3WQ8A 1XCFA 4H4IA 2VQUA 1ECQA 2OU4A 3WKZA 3PZQA 2QDEA 1BKHA 3NA8A 4K39A 5FJTA 4U2YA 4D6EA 3TYAA 2JALA 1V6XA 4KWSA 2E6FA 3K2GA 3I7RA 1GVEA 4MNJA 2PE4A 2CZDA 2CYGA 2GVEA 3AHTA 1O5RA 3UA3A 1QBAA 4GQ0A 5ECUA 1UASA 3F7JA 3K4AA 3WK1A 3L12A 1VKFA 3N25A 4B3ZA 1I2RA 1ME9A 2OG9A 3NGJA 2F84A 1IYXA 2J88A 4DZHA 5LNWA 2E25A 3BVJA 1AW1A 3FA5A 4FALA 1PX8A 3A21A 1PKNA 4DBEA 2GGHA 1U1UA 3BLKA 1CZ1A 2VFEA 4P8UA 1XIFA 4TUFA 4AX7A 3LNMA 3HJZA 4XZIA 1QPOA 2WM0A 2Z1SA 1CB2A 3FJ4A 4QM1A 1B1YA 1H7WA 2P0IA 3C0QA 3A3HA 2O55A 4LUSB 2GOKA 4HNCA 4MUPA 4O14A 4AIBA 2IW0A 2Q8ZA 1O66A 2HS6A 4B5UA 1YPFA 3GIYA 4KH2A 3T0TA 3UR8A 3B8TA 2WANA 2BGSA 3UGRA 4FNQA 3HPZA 4HT3A 3W7MA 2QNEA 3M0MA 4MGGA 4AVOA 1W5MA 1YDNA 2R1LA 5K9CA 1EHAA 4DJDD 2VEPA 4YWIA 4XWUA 2GFTA 1XYAA 1S38A 3CQKA 4ILSA 4KFPA 1EGVA 1JZ6A 1GKQA 4KF1A 4C1LA 1ZBKA 5AB3A 3NVTA 3VIHA 3L9CA 3LCWA 4QISA 1XICA 4I8YA 4AWTA 2VX7A 4Q8NA 4KS0A 4H8VA 3SW6A 1WXJA 1G1YA 3ZVHB 4PCTA 4NYUA 2NX3A 4F2UA 1EZWA 4DUVA 1R3WA 3AQUA 2E5CA 4W7WA 4R7WA 4F2BA 4RW5A 3S2MA 1K7EA 1QMLA 2VEFA 4TVUA 1C92A 3TKFA 4L7ZA 4P7LA 1OX6A 3STGA 1YXCA 3QLDA 1N82A 3ZO9A 4NAEA 5CG0A 3LA4A 2F9RA 4L6OA 3B0VC 3PZVA 3P14A 1AW5A 3G8EA 4B4FA 2NT0A 1IEWA 2XIBA 5JH1A 1XKJA 3IIVA 2PTYA 5DY3A 1KV8A 3GDRA 2POTA 2HISA 4P61A 1WUFA 4CD6A 1CENA 1IV8A 4ADUA 4F66A 2CWXA 2D0GA 4UFJA 3QMSA 3VD3A 4CU7A 1F05A 2WMIA 4JHZA 2KAUC 1P1MA 3W83A 1S5VA 4J9JA 3TWBA 4WIWA 4ERIA 1HKVA 4C5ZA 1UKSA 1O94A 2IUZA 5AHMA 3KZPA 1PJ9A 2J79A 4PEKA 1RCXB 2E7FA 4GA8A 4X61A 3MSGA 5A95A 4E2OA 3WD1A 2PP0A 4CN4A 1F2JA 3DYMA 4LF1A 5C7VA 3W27A 4Q3MA 3QTGA 2E5DA 4QE5A 3K8MA 4L4LA 1IZCA 2XIMA 4JKLA 3ALGA 3ANYA 3KWXA 4FIRA 4HOZA 2Z1XA 1J96A 4K2SA 2G41A 4GUFA 3TJLA 2I5QA 3BLIA 1KO0A 4RXGA 1VJIA 3M1ZA 1QI5A 4Y9OA 1TMHA 5IDIA 3ITYA 1SO3A 3E6EA 3TN6A 1KGUA 1G7UA 3R0KA 2Z7GA 3S2CA 2X8RA 2RAGA 5F2GA 2Z27A 4GC4A 5DELA 4KCWA 3USBA 1PDZA 1T8QA 2A7RA 3K30A 3MT1A 3UCQA 3JUGA 3HQPA 1FWAC 2I57A 4BCEA 4INFA 2J7HA 3ITVA 3E1F1 4EPKA 3UNTA 1QATA 3W38A 3RXZA 4KCVA 1TWWA 1CXIA 2VC5A 2I5IA 2X16A 4B3LA 1A0DA 3S83A 1F7BA 1EOMA 2WMKA 5CJ5A 5E0KA 1AMYA 3UJSA 4V15A 2ALRA 3N2TA 3W86A 3LMZA 3P62A 3S5YA 2PDHA 3ZJ8A 4JFVA 4F79A 3VILA 3H70A 3RX2A 3WUEA 1YTDA 1Q4WA 4LAZA 3N9SA 3M0XA 2W61A 3R7MA 2E67A 2YKKA 1RBOB 3PB2A 3GXDA 1E6SM 2HRWA 2YCLB 5SWUA 2AL1A 1F3WA 3EB3A 1XH1A 2O9RA 2E8ZA 3QF0A 2OO6A 1KWKA 2PP1A 3GBDA 1ONWA 5A2CA 3H55A 1XV8A 1AJZA 3NL3A 3NQVA 3MBDA 4CVWA 3MP4A 3MUCA 3EWCA 2QUVA 2DEPA 3MUY1 1WO2A 1IR2A 2DSUA 1DOSA 4LNYA 1CBGA 2G3NA 2D0FA 1REQB 2EG6A 3FJLA 1WB0A 2V63A 3D47A 2PFHA 1JZ2A 3W0KA 3KBNA 4PRRA 4XZLX 1XYLA 4E2DA 4WCJA 1CPUA 4CD7A 1W1IE 3Q4DA 1DXEA 1JXJA 1R0MA 2PDFA 3QRHA 1N8IA 3H2NA 3M0HA 1LL4A 3W7CA 1MMFA 3T2OA 4YMZA 5EMYA 1FCBA 4QQ3A 3WDQA 2NXIA 1HGWA 2VEMA 4LJ3A 3AXHA 4RCXA 4JDBA 1CLVA 4DUWA 2D2HA 3QJAA 1JCXA 3SQSA 2ZX9A 3RO6A 3N9RA 5BWAA 2EJ1A 4QJ1A 2W5FA 3CUXA 4GGHA 3MUXA 2ZE3A 2HXTA 2R24A 3GQYA 1SVDA 2YL6A 3WFZA 5ABFB 2WKGA 4XBJA 1TJPA 4U10A 1W5OA 1CXLA 4H8UA 4ROQA 4H2HA 4J3UA 4IGSA 2BHZA 4IH3A 3MI2A 3VE9A 2REQA 3NZ1A 1LLWA 4H7VA 1DIEA 1DWGM 4P8VA 5IFTA 3R2GA 4G2DA 3P80A 5BOEA 2E9LA 3HU7A 3T08A 3WQWA 1KQZA 3GXNA 2G3MA 1SZFA 3HTWA 3UNDA 1GOIA 3OOQA 1TV7A 4NZJA 2QS8A 3WQFA 2Q8LA 1W5PA 4NKCA 5I24A 1BYAA 1W1A1 2EG8A 1RQBA 5D9NA 2J47A 2Y7FA 3MYPA 4LRSA 4CQBA 4TO8A 4WKFA 4GE8A 1YKWA 2FTYA 2ALDA 3THUA 1GEHA 3GFXA 2PMQA 3GYCA 1EKOA 3E5PA 4JTSA 3GNNA 3R0DA 4PBGA 1Q6GA 3GTIA 3ITTA 1F07A 3O16A 2YOCA 3K1DA 2EAWA 5A8QA 1WDSA 4J7RA 3CO4A 3O0KA 1OGSA 3MSYA 2Y7GA 4C6OA 5CPNA 4FXSA 1JPMA 1J79A 3LD5A 3HFYA 1XD1A 3BAKA 3I4KA 4PN2A 1XLGA 4L9XA 4E4PA 1B4KA 1M68A 4IISA 1HVXA 2Q3OA 3WNKA 1DJXA 1PBGA 3IRSA 5FJIA 3G6LA 1VFTA 3BV7A 1UBSA 2J9ZA 2GVLA 1RBLA 3OLDA 2WMFA 2E09A 3VKJA 1OC6A 4F8XA 4U28A 1XBXA 4GYKA 3OW1A 1MW0A 2VJXA 1FWRA 4FNSA 2OVLA 5LKYA 4E3VA 2VOMA 3HIJA 4QSHA 1TJRA 1YBQA 2W9MA 3TTQA 5D32A 4KIRA 3LY0A 4OHQA 3TDFA 5GNXA 5JBDA 4KIEA 4YCPA 4MB5A 1H63A 1ZB5A 3IK2A 1Q6DA 2XVNA 3KOWA 4LYQA 3UZWA 3OGVA 1TR9A 1VPXA 4YIWA 1VFOA 1ZHAA 3BV4A 1MW3A 1MI3A 2GPTA 5GQBA 3U0HA 4ONVA 3TYEA 3EWWA 4Z08A 6A3HA 1U33A 3KX6A 4QP0A 3B06A 4M80A 5AC8A 2WVVB 3QYSA 1K9DA 3S5SA 2C0HA 2PZNA 1TPVA 3PZUA 4N7QA 3MDUA 4PMJA 1FWIC 2Q02A 3AYTA 1DHKA 3IIPA 4Q8TA 1W8SA 1NOUA 3WQPA 7TIMA 3UY8A 1QCWA 3AZRA 3HMCA 2DJXA 1U5JA 3E2SA 3TW7A 5AVNA 5FL0A 3CPUA 4LALA 2VFDA 5CBJA 3W1QA 4GJIA 1VGAA 1P0NA 4GWEA 1CWYA 3MA8A 3G1AA 3LCFA 3MY9A 4IIFA 4UCGA 1R86A 4V28A 3W7KA 4HPNA 3BK0A 4PTXA 1XIBA 2P50A 1DQUA 4BR1A 3B0UX 2D2GA 3AIRA 3AMLA 5EY5A 4JN7A 2V3FA 4JYDA 4TVDA 3CWOX 4FX7A 1X7IA 9XIMA 1W9DM 3W7GA 2EPKX 4RZ5A 4KEMA 3GUGA 2ZE0A 1UJQA 4M0XA 4AU0A 1K4GA 4RV8A 3UG8A 1ZBWA 4AVFA 1J0JA 1XYBA 3GVQA 4OU1A 2RH9A 3V5FA 2E77A 2IKHA 4PCSA 5D02A 2QJHA 4PULA 2RGLA 3IJQA 3N14A 4MUZA 1GTHA 4AYSA 1AL7A 3PUOA 4AISA 2DSKA 2V67A 1PDYA 4O15A 3F03K 3LBCA 3RMJA 2INFA 1YXDA 3SZ8A 3EB4A 3CZ8A 3D6NA 1M04A 3CNYA 4GBUA 1C29A 3A9IA 1K02A 4HZ6A 1TREA 3QC0A 3IGXA 2DZAA 5E6YA 1E3ZA 2QCNA 3C2YA 3QSTA 1VBGA 1XQLA 1GQIA 2PU0A 1G7VA 2BLEA 4ZO6A 4ERGA 1XCXA 4AD1A 2J7GA 1OG6A 4AG0A 3ARRA 4OUIA 3KRBA 4A3RA 4JFSA 2J7FA 3EA1A 4IOTA 4ZZ9A 3WQDA 3EX3A 3TSDA 3R25A 2PBOA 2DW6A 5MKGA 1NJJA 3BE7A 4GXPA 1HNYA 1T0OA 1HUVA 1F76A 2Y0FA 2ZXDA 3ERPA 2FVMA 2DIKA 2WHLA 1PWMA 4W88A 3B8SA 4O18A 4UR8A 4ZOEA 3E0LA 1ELSA 4DJDA 4EIVA 4XAFA 5HWJA 2WSKA 4IQDA 5B80A 3QQ0A 3W76A 2WZEA 2QLYA 2P8CA 4GI4A 4GPNA 3MWCA 3O6CA 1LUCB 1MUCA 3ONBA 4ZENA 4XK2A 2G5WA 1OCBA 3C2FA 3APTA 4MFEA 2OLHA 4LB3A 5EMUA 4RX0A 1OM0A 1LOQA 1TSIA 1TX0A 2GQAA 5LHEA 5BXTA 4LY8A 3LCLA 1XRTA 3R11A 4DJDC 3M5VA 5FAJA 1ALDA 3R1ZA 2GQ3A 4JTKA 1XBZA 5DMNA 4H6KA 4XZBA 4WX2A 2B0MA 5D2TA 2WNQA 4GIAA 3B9AA 2CLLA 3WLMA 1FHVA 2D22A 3VD4A 3THCA 2R1KA 1YQ2A 4BQ2A 4K8GA 1I8JA 4GI6A 1EGZA 4ZQRA 3P67A 4AHPA 3N34A 2WHMA 3S9ZA 4NRSA 1PWLA 4IJCA 3BG9A 3VIFA 4AD4A 4IGMA 3VCNA 7REQB 1X6LA 2WKJA 1ZBCA 3PBMA 2V82A 3UWYA 3QZ6A 1BF2A 1W1ZA 3P60A 2I16A 2AKMA 2ZDRA 1IEQA 5D9OA 5A8NA 4MG4A 4KEVA 3ZWTA 3WCZA 1HW6A 2QAFA 3IVUA 5FF0A 3RJYA 5A94A 1EYEA 4MB1A 1M41A 1P0DA 1JJKA 3KDNA 1M7XA 3GZAA 1DYSA 1KXVA 2NV1A 2PDPA 2YBTA 5DY2A 1K03A 1EWEA 2VT0A 3Q45A 4B15A 3UFYA 5C54A 3S8HA 3GNRA 2BTMA 1SQ7A 3WJWA 3GXIA 2G95A 1D7FA 4OUEA 4QEEA 3VIOA 1JRCA 4D8ZA 3UP8A 5CGMA 3PUDA 2CZVA 4NSBA 2A5HA 4HA3A 1R85A 1P7TA 4DXXA 1ISWA 3CS2A 4JEJA 4WOQA 1K9EA 5I06A 1TQXA 5HUOA 5DN1A 1S3HA 3V3WA 3WD3A 4Q8VA 4LUJA 3KW3A 3BANA 2B81A 1WZMA 4L6HA 1NOFA 3BLLA 3B8UA 2FQIA 4J40A 2HK1A 2QJMA 3AZTA 5IBXA 1VJZA 1TQJA 2ZA3A 3V35A 3EZ4A 4DF0A 1L8PA 5JVLA 1GKRA 2RFGA 3TQPA 2C18A 2CBJA 2E9MA 2Z4GA 3QSRA 1RHCA 7XIMA 1WCGA 1L8NA 4UR9A 4ZQOA 6ENLA 3I65A 5CJNA 4LVGA 1HL2A 3TYDA 4JTEA 3AYSA 2ZWYA 1GOQA 4Q6JA 4WSHA 5IBXC 3NVDA 4AWSA 4FSAA 5M03A 3VC6A 4A22A 3VMPA 1EBHA 2ZUNA 4LYPA 1SO4A 1EFZA 2WJEA 3T40A 2V3DA 4UNIA 4YTSA 3QV9A 2BWGA 2Y7DA 4TTGA 4K37A 4C6LA 2UY4A 1O5QA 1UR9A 1TA3A 1M7JA 1UZ4A 1JG9A 3BQ6A 3DXIA 1E0TA 4OKDA 1C9WA 4G1NA 2VVSA 1VR6A 4L80A 1OD0A 1XLDA 3I10A 1WZLA 1VPYA 1POJA 1WOBA 3B9NA 1LP6A 1SJDA 4AXNA 1S46A 1GW9A 5LNSA 2VP8A 3CBWA 1KCZA 1H1ZA 2A3AA 3D0CA 3G1SA 2E6DA 2P5NA 4PSPA 1W1TA 4OOZA 1KM2A 2DDXA 2ACSA 4GMEA 4JFWA 4E38A 3G24A 4GGBA 2GJNA 3PTQA 2EF9A 4IFKB 1E0UA 4JYEA 5A6LA 2XH0A 3LERA 3M5ZA 2YL8A 1ME8A 1TZ9A 3GDLA 4HU8A 2W67A 2FJKA 3EXSA 4EP8C 2RDUA 1XW8A 3N12A 4PH6A 2R1NA 4IL0A 3CL8A 1N7KA 3Q58A 4F9JA 2HPIA 1WKFA 2QJGA 4DQWA 3A23A 1EUAA 3VDGA 4CD8A 1VLIA 5AZ0A 1A5OC 4MF4A 5BMWA 1SO6A 3WY1A 1POKA 4DBWA 2OYLA 1XCWA 1KLZA 3KTSA 3T4WA 1WE5A 4L9YA 1JDDA 3ABXA 2NT1A 1DQXA 4S3JA 2D23A 1G67A 4GY7A 4FXRA 2MUCA 1VFMA 1ZLPA 3NJ3A 3W02A 1FCVA 3VUPA 2DT3A 1V08A 1KW1A 3V5CA 7TAAA 1FVPA 3TQ0A 2XSXA 4YN5A 2ZWZA 3VNJA 4D6FA 3GRIA 1Q6EA 3LCHA 3TC7A 4MY9A 4MVAA 2CZEA 3TX9A 5CXPA 4Q8WA 4GX9A 4QJ3B 4M56A 2YXXA 5K4ZA 4Y8EA 3EX2A 3DKJA 2OWCA 3WBEA 4IQJA 4XVEA 1EGMA 4JIPA 2RDTA 3CYJA 4RNJA 4I9JA 2DQWA 3OZYA 4JNYA 3AHXA 4D6CA 4LS1A 4GABA 1MQRA 1JZ3A 4C6NA 1BVNP 1EA9C 1I6NA 1WV2A 3LTSA 3C6CA 3RM9A 2FFCA 3VFCA 3WQGA 2C1GA 2REQB 2WCGA 3HOJA 5A8PA 3GU9A 1FXQA 4WGHA 3SY5A 3TXZA 3K4WA 5REQA 4LU0A 4Q7BA 2VCBA 1QTWA 1NF7A 4CGTA 1QU4A 3MKKA 4LGXA 4DAIA 4B16A 4WY0F 4LVAA 4DBUA 3QFEA 2E1DA 4NF7A 4EOUA 3CUJA 3T7VA 1UWTA 1ZU8A 3URAA 4JN8A 1HL8A 3W1PA 1WAUA 1GZ1A 2XN0A 3T0BA 1XLEA 3WSUA 4MFDA 2HS8A 2VYOA 5I07A 4J27A 1VFUA 1V02A 1GVFA 2IXUA 3O15A 5KTLA 1WXZA 2GDUA 2GJXB 2BSLA 2GOUA 5G5IA 2FZDA 3CPGA 3OA5A 3FXGA 1UH2A 3IK4A 1FWDC 4PMZA 2CPUA 3G1FA 2F7FA 1UZHA 1ZJHA 4NVTA 3B97A 5CLTA 4F2TA 3RK8A 1OYBA 2DSVA 4MY1A 3IEBA 3M6DA 3VKAA 2DZPA 4MJ2A 4PR4A 3ZXWA 4LCQA 4ZB2A 4LW7A 3W2KA 3C52A 4YTUA 3LQLA 4YTTA 2PF8A 3U4AA 1JD7A 4ZO7A 2PDQA 4WEVX 1B31A 3R5EA 1Q7QA 3MKVA 2ABBA 1WZKA 1S1PA 5CZ0A 4FR1A 3VGHA 4Z42C 4S3GA 2QDGA 3C5QA 5HXMA 1E43A 4PUUA 4LS2A 5HINA 5A5WA 1XIEA 1OIMA 2NQZA 1UQYA 4WDTA 3KHDA 1K9TA 3H23A 1K8XA 3S4TA 1ONEA 1K6AA 3PZ9A 4W89A 1YBQB 4KERA 4JFTA 1SO5A 1DXFA 1A5KC 3RX4A 1TE1A 1OABA 5D30A 5I3GA 1B3XA 3CYVA 3S5OA 1VEPA 5DANA 3GXFA 2V3GA 1XIHA 3W7IA 1ML1A 3GVVA 3C2RA 3HBLA 2PDBA 4B3KA 1X8CA 1HKIA 3UZJA 3GLCA 3ZLGA 3HQ1A 2HK0A 4BS0A 4FO4A 3VI2A 2R1PA 3OZPA 4IJBA 2NSOA 3WJZA 1OFQA 1V51A 5M3WA 3CIWA 2ASHA 2PDNA 2BB0A 3WQ4A 3M5XA 2VDGA 4RXFA 4XV0A 4PCFA 4ZVJA 3TAKA 1AQMA 4TVCA 2Z24A 4F0KA 1OZMA 3F5LA 3PG9A 2Y89A 1KGWA 1OINA 3PAOA 3N1AA 2ZZ1A 2PD9A 4LY4A 4O4WA 2FH8A 3GK0A 3BGJA 3BSHA 1DJNA 3U7BA 5CPOA 4QDWA 5FSEC 1B3YA 3S6OA 1SZNA 2GWGA 3WNMA 4GQBA 3W28A 6TIMA 3ID7A 5FEPA 1A0EA 2HSAA 1VAHA 1QNOA 3A4WA 3A24A 4EXQA 4JTCA 4WSKA 3CZJA 4UR7A 1AZ1A 1R46A 2B7NA 1VS1A 3HPSA 4DUOA 6CGTA 1QFEA 2DZVA 1T96A 4S1FA 4LS0A 3PBUA 1GJWA 3U2OA 4I9MA 3ORWA 2PLMA 4CEXC 3TOYA 3F4DA 4UZSA 3GSMA 1Q65A 3G0UA 3L4TA 3LCXA 3O63A 2ABAA 3VAVA 2P0OA 2VR2A 3SUVA 3FVDA 1SW3A 3R94A 5GJMA 1H41A 4PMRA 1T41A 2C1IA 4M6QA 1GUVA 4TMCA 1H7RA 3MANA 5D9MA 2J62A 2OO0A 4V27A 4LOCA 1LM1A 3CZEA 2O7SA 4CUCA 1OCQA 2ONEA 3PBGA 3LHTA 4PTDA 2QULA 4PMVA 1TWSA 3BQ5A 2G3IA 1U5VA 2QCMA 2VZVA 1A5AA 2ZC1A 2G3FA 1M9HA 3QN3A 1GYMA 2FVKA 3L2MA 3TN4A 4K1WA 4KQNA 1IT0A 4XD6A 3IVSA 2F61A 3C8FA 3AMGA 1I0DA 3PZMA 4MDOA 4DPPA 4HJFA 3LLXA 3SQMA 3ITOA 4LSBA 4H83A 3W6LA 4KBXA 1F3TA 1PXGA 1LDCA 1H11A 4LVFA 2WHJA 1B5TA 1V03A 4QHRA 5DCBA 4AFYA 2Y88A 1A5SA 1MXGA 3J7HA 2WCAA 3E5BA 2XSAA 4RE3A 4HPGA 3U4FA 2QW5A 4C1NA 5E0FA 1Q4NX 3HGOA 3G0XA 2BXVA 4PUJA 5F4SA 3LG3A 3NQ2A 2ON3A 3C56A 2VCAA 1EEPA 3ECQA 1TRDA 1WBJA 5I3KA 4GNVA 4H9YA 3V36A 4AD0A 1JYWA 4MKNA 3P2VA 1LQ2A 1DEDA 1IR1A 4C6IA 4QEHA 3E2QA 3TNBA 3PJUA 3P0WA 3WO8A 1WKDA 3MJMA 4U4MA 1XR2A 3RR4A 2F6XA 1GGOA 3O2LA 4BQ5A 4X0NA 4MYAA 3F2BA 3CZKA 1E6NA 2BGNE 1XP3A 2ZOXA 3TNOA 1Y5VA 4H1ZA 1NELA 2PD5A 1VENA 1D3CA 1AH0A 5KETA 2VQTA 3KCJA 2BZNA 3MPGA 1YDOA 3CQJA 4AZ6A 1VFLA 5C6MA 1WUEA 3EEGA 2GVYA 2OJPA 3M46A 3RYSA 4KEZA 3UPWA 1B3ZA 4YVPA 4H9MA 4JTAA 5E93A 4IXXA 5H8MA 3E96A 1EC7A 3P5ZA 3NEVA 3S47A 1WP6A 3DECA 4GCAA 2A2IA 3TSMA 1AQ0A 2GVGA 3WFLA 1WDWA 2JFEX 1Q8JA 3W7OA 3WF1A 1V0NA 3A3WA 1SZGA 3QYQA 3H2AA 5I0DA 1E1EA 4IMEA 4FLQA 1NWTA 4CNUA 1H1YA 2E6YA 3W1TA 4P7OA 3UW6A 1HX0A 4PUDA 2V0TA 1XRSA 1PV8A 4JQ2A 2C3ZA 5ABTA 1E0WA 4O53A 3H7RA 1XIMA 3ZWSA 4N6EA 4ACZB 4WZHA 2XH4A 1XF0A 1TE6A 3AISA 4CNNA 1QO5A 1Y5WA 4S3CA 1MYRA 1GZGA 1X97A 3AIVA 8RUCA 1OFEA 3H2EA 4G6CA 3V16A 4KT2A 3W6MA 2QPSA 2VFHA 4H19A 2DT1A 2V5BA 4MOZA 2HVOA 4F0LA 4DUXA 2FDSA 2Y85A 4GX8A 3GFYA 1JUBA 3PFMA 1R2RA 4H9UA 3AU2A 1I2QA 5CPLA 3ZFHA 2DSZA 3OGSA 4PMNA 4R33A 3TA9A 4JPGA 3N6HA 4W8AA 3HA1A 4UMAA 1EF3A 4AWEA 4MPQA 3BLEA 3BW3A 1HT6A 1YADA 3RX3A 1IGWA 5E5CA 3EA3A 1JZ7A 3E3HA 2BVWA 4GQRA 1EH9A 2C7FA 3PUEA 4B5NA 1AJ0A 1RH9A 1MNZA 3PPCA 1P6BA 4DI9A 3MMUA 2DV0A 3ZOAA 2OYKA 1TWDA 3OTRA 5DBUA 2Z1WA 4QNEA 4WOZA 4NNAA 5HQEA 2P88A 2GUYA 1BPLB 4O16A 3EWYA 2HWGA 1G9HA 4HA1A 2GUBA 2AMGA 3N17A 3URNA 5BOOA 1SJBA 2HVNA 2PRHA 1V6YA 2XGZA 2QIIA 3KRZA 1K6WA 3LXBA 4LV4A 1UP3A 2JKEA 1IEXA 4XTIA 1V4YA 3A4JA 4M51A 3U7VA 3DUGA 4HCLA 4HZ7A 3AIBA 3KLKA 3VGBA 2TYSA 1I2PA 3SCOA 5JIPA 3W84A 1Y7VA 2Z1KA 1IT8A 3N4FA 1QR7A 2XHYA 4CQ9A 3OP2A 3VMNA 2WMGA 4YCOA 3I6TA 4PB5A 4Y90A 1AD1A 3RFAA 4A05A 4F48A 2WSYA 2PDGA 4J4KA 4UTIA 3LPGA 3NQ6A 1E4IA 2HE5A 1WAWA 1R9XA 2DQXA 2BNJA 5CGQA 4UTWA 5D03A 2NLYA 1C8VA 1NWUA 1JAEA 4K3ZA 1TCMA 1IZKA 5C9ZA 4W9TA 4GVFA 4AZ7A 4J3TA 4JQ1A 2PTXA 3FDKA 2YFNA 3CHCA 4R7OA 3SY1A 3RJXA 5EMKA 3G8RA 2W27A 4IMGA 2ZUSA 3HURA 1YTKA 1V79A 4XKYA 3RUBL 3DKLA 5L6UA 2Z28A 1IQ8A 2Y63A 1LRTA 3QR1A 3VNKA 2CESA 4MNMA 2KX9A 1PIFA 3S1VA 4EACA 3GAKA 3NXLA 4RDVA 4A8IA 2E6AA 2HCVA 1RJPA 1A3XA 3MS8A 1BQCA 3CU2A 4X60A 3OYZA 3AXXA 3TA6A 2GK1A 4XD3A 4OV9A 4EXAA 4M6VA 2QMJA 2G50A 4QR6A 4LEQA 3UA4A 1CGWA 1OFAA 1E72M 4QJ4B 1S2AA 5M2FX 1CT5A 3WN6A 4DIAA 2PWDA 5AY7A 4DBSA 1W0MA 1Q7MA 3URQA 1E3XA 3R8RA 1YE6A 1RVGA 4PBEA 5MHBA 3LTPA 3OHIA 2XSBA 1TKKA 5ABHA 3FA3A 3Q65A 5DO8A 3WNPA 4KPLA 4NHVA 3W7HA 1EJVC 1R9YA 1OFBA 1UZDA 1L0PA 4WHBA 4QS5A 5CC3A 1CTNA 2E40A 4ATLA 1BG9A 4XO6A 5D05A 4GH3A 3GU2A 1BRLA 3GKAA 4DHGA 4BI6A 4OBRA 1Q45A 3BZJA 3RGTA 1US0A 4N02A 3TP4A 4ZOCA 2EEXA 5LXXA 4JS3A 2FPTA 1KRMA 1XLFA 4TX6A 3DIPA 1WXYA 1XLIA 1SSGA 3DHDA 3WD4A 3ABRA 2PWHA 1BG4A 4OQVA 1E15A 3DBNA 3AZSA 3R13A 7PTDA 1JCTA 1PSCA 2QDHA 3ARSA 4BZYA 4YVXA 2VWTA 4HJWA 3LM3A 3GVWA 2X1UA 1DTNA 1QJWA 1CGYA 4ZE5A 4IWWA 3PZNA 4XTDA 1UA3A 1NQKA 2NX1A 2GL5A 2FZBA 4C91A 2CLEA 5C2CA 2OGJA 3NUKA 4ZXLA 5KSWA 2IXVA 4B2DD 3VNMA 4KESA 3SN0A 1FQ0A 3MI3A 3TXVA 3U2ZA 3LXCA 3HQNA 2OQYA 3KLLA 2FB2A 3GC2A 1UUQA 4LUSA 3IV3A 4Z2HA 2BY0A 3KE0A 4S3BA 3MHUA 2EBNA 1B3WA 3T2PA 1LL7A 4TIMA 2JIEA 1MEIA 4UIOA 4OBSA 5AZ1A 4D1IA 1OK6A 5DCEA 2VZTA 5U7SA 1UKPA 4GACA 3G1RA 2HBXA 1M6JA 3O07A 4MZYA 2GVJA 2Z6JA 5TIMA 3JS3A 2EPLX 1PZ2A 2E8YA 5HNUA 3S42A 3FJ6A 4AZHA 1H7NA 5TBOA 5TF0A 1I2OA 1ZP4A 1L6SA 1XSKA 3QPEA 4DF2A 1BKSA 1D8WA 4Q7NA 4ZL1A 4KWWA 4MWAB 1RVKA 3N18A 1JDCA 5BZAA 1Z8AA 3FGCB 1JPKA 5A6JA 2AL2B 4RUBA 3FA4A 2A79A 4CU6A 1YYAA 3TJIA 3Q94A 1JFHA 4ALDA 3W22A 1KBBA 3ZVHA 4C5YA 1SJCA 2DSWA 2YCJA 5BXSA 1FHLA 1RUSA 4AB4A 2E9BA 1ECEA 3C61A 3UGVA 1ZCOA 2FDMA 3F4NA 3N4EA 2Y24A 4EANA 1SFLA 5CPSA 4Q8UA 4MLJA 1XGEA 2QKFA 2V38A 2PF0A 4UB9A 1ZJAA 4ICCX 4IUGA 3DG7A 2X0SA 3H4XA 2O4MA 1LF1A 3NL5A 7ENLA 2NXGA 4HHMA 3WDPP 1NSJA 2QV4A 3NDZA 1V6WA 5DT7A 3PAJA 1V3MA 1A5BA 4WVXA 3SIZA 3CXOA 2CHOA 1NP0A 4JFUA 4QCFA 4US5D 2GQ9A 2VKZG 1HXJA 2D2OA 1OFRA 3N4AA 2FZ8A 4LTSA 1AW2A 3OZMA 1TRIA 1VEOA 4EK7A 2D0HA 4JQ4A 3NR0A 3MYOA 2UY2A 1JDAA 2LLEA 6REQB 1U1JA 2OXNA 1TPDA 1JGIA 4AY8A 3JRKA 1PKMA 1JQXA 1VBUA 3RCNA 3QMTA 4GFIA 4S3FA 3M0YA 4DN1A 2GGEA 5CZTA 3QPZA 3MV01 4TTUA 4BQ3A 1AH4A 3IIZA 3TYBA 4FIQA 4ZOAA 2OX4A 4NT0A 3W4RA 1WNOA 4Q4SA 1L6WA 3II1A 4ZODA 3ZT7A 4IPPA 1XISA 1Z6KA 1IXOA 1G4PA 1AH3A 2FKPA 4H7ZA 4HVXA 1MFUA 2C71A 3CM4A 4D8AA 3UYIA 3SUSA 3A3XA 4J3XA 3N04A 4GNJA 5F4XA 3T05A 4P7QA 1CGTA 1BSIA 3V7PA 5I3FA 1TTQA 6PTDA 3KHJA 1DJQA 3KM8A 1JZ8A 3CEPA 1UG6A 3B40A 3VNZA 5K9XA 5HJYA 1DJIA 3BPWA 3GNDA 1VBRA 4ORMA 1TVPA 4J3VA 3LRMA 3HGSA 3SFKA 2ZX8A 3T42A 5LIKX 1WQ5A 1QI3A 1SU5A 5HJXA 3ICJA 3SRKA 1IGSA 4H04A 1JPIA 5I03A 4O57A 2DH3A 2WZMA 2JF7A 4LF2A 2VHLA 3VZZA 2BVTA 2YYUA 1PYMA 3W70A 3CTLA 2CLHA 2OMAA 2F6KA 1D3HA 2NQ9A 1YRRA 4XZMX 5C9RA 1UH3A 2XFFA 5F7UA 1KFBA 3OA3A 3FHQA 2DU2A 3PG8A 1XYZA 3RF9A 3GAYA 1HL9A 3GR7A 4CD4A 2GLKA 4LRTA 1P43A 5I78A 2AQWA 4ZR8A 1TPWA 4QCEA 4UTHA 4HBKA 4LH8A 2YCLA 3SI9A 1KKOA 3VOFA 2D3NA 3H8AA 4D8LA 3W01A 1YNQA 3QBUA 4I6KA 4GOAA 1HP4A 4DWDA 4MJ4A 1LROA 5JBEA 1KTNA 3FX4A 3EKZA 2GJLA 1P0KA 4MAVA 2YSWA 4ICNA 2GSEA 3MI6A 4GC3A 1MXSA 3UXDA 4Q8MA 5HA7A 1CW2A 1OBAA 3H2OA 3G3DA 1FDYA 3GZ3A 3VGFA 3QFWA 1FXPA 1REQA 4LAMA 1FDZA 4WQ6A 4TXEA 2YDQA 1HFBA 3LB0A 5HR6A 2NWRA 5IXEA 5G2IA 2XN2A 1MXDA 2WNWA 4Y9AA 2XWDA 4HSHA 1W2PA 1JPHA 3OLEA 3MZ2A 1C91A 1S2TA 2OEKA 4NY2A 4FLOA 2VEKA 4B4HA 2JE8A 1U30A 3N3TA 2OCZA 3AC0A 3ES7A 3S1XA 1XX1A 1FFQA 4IIHA 1GPFA 1UR1A 2WB5A 2V68A 1ZAHA 5ABFA 1LT8A 2ZRZA 3M4HA 4M8UA 2O56A 5TNVA 1KBLA 4AY7A 3RM8A 3SCWA 2YB1A 1YPXA 4ZMGA 1KM1A 5AYBA 3H2FA 4HNVA 4CNSA 4O12A 2PDLA 1GORA 3UU0A 1XUUA 1HKMA 1YTEA 5EL1A 4ZCWA 2D73A 3GIPA 3BSMA 1JCMP 5XINA 4EPBC 3UG3A 1VJSA 2GWNA 2EPOA 4NZ1A 3CV7A 5HANA 4UTKA 1TPC1 2OWWA 3EXTA 3IGUA 3SCQA 3N11A 1O60A 4AZIA 1YX1A 3H7VA 3C0SA 2B7QA 4OTKA 3GG8A 3O9NA 1F74A 1ZGDA 4JTFA 2DVUA 2C0AA 3AWOA 1Q6CA 3E12A 3G2GA 2J6XA 3UETA 5HNRA 2Z6IA 1DE6A 4AD2A 5EFDA 3WLRA 3DHUA 5CLWA 2I9UA 1U5HA 3GHSA 4YJ5A 3F1QA 1H09A 3GIQA 3IUHA 3QV6A 3JW7A 4LC8A 1J0ZA 3COTA 1YMYA 4JTJA 4XZWA 3W7DA 1S5NA 2FPVA 1ODUA 3CUFA 1IWAA 1X96A 4FNUA 3C2OA 1NH6A 3KL3A 2PWFA 4XZHA 1DIKA 1XLBA 2Q01A 4RZ6A 3BAIA 2YPIA 4LPCA 4XUYA 1L6GA 4AC1X 3GTFA 4K38A 2WC4A 3GKFA 4FOUA 5JXQA 2BODX 3H53A 2WKLA 4JIQA 5EB8A 1J6OA 1GOOA 1OX5A 4HHHA 5LIUX 3DFOA 3Q67A 4K6AA 2IPJA 4BJHA 4UBPC 4TX8A 2VRQA 3BWWA 2CFFA 1SW0A 1TPB1 2FGZA 3NDYA 1KBIA 4ENLA 1W1VA 2Z7KA 1VYSX 3A4AA 2HEJA 1UP2A 4ECLA 4CN6A 5IHSA 4MWAE 2ISWA 3S2JA 1KTCA 1Z42A 4WXZA 1XYFA 4NRRA 3WL0A 1JUEA 2O0TA 2YLAA 3EOLA 2J9XA 1U1HA 2D24A 3K1GA 3EDDA 4HTYA 2PLKA 2SFPA 5E0CA 1GT8A 3RPTA 5A6SA 4P5UA 4WDXA 4OVXA 1QK0A 5HQMA 4IL2A 1YIXA 1R3VA 4LBSA 4NAFB 2YIHA 3C4UA 4UQBA 3CZGA 1DBTA 4C90A 3O0FA 2H8XA 2YZ5A 4DJFA 1QUMA 5T26A 2WJFA 3KOFA 4UOQA 1VHCA 3BLPX 1TV2A 3TSBA 4I7UA 1PZ3A 2V2HA 1EC9A 2AAAA 4LVDA 1A5UA 3B8DA 3ABQA 4LUTB 4WY0B 2WC3A 1JCLA 1D9EA 4A4AA 4FXJA 5H91A 1UD3A 2J13A 3S6DA 3L66A 1UR0A 5C9XA 5AYXA 1XIGA 3WJYA 2HROA 3E9AA 4GXMA 3VCCA 3UYCA 4O10A 3HO8A 4GKTA 1UR8A 3AHYA 3PZGA 3WLPA 4WDUA 3BURA 3DOPA 1EJWC 3PZOA 1KCKA 1EZ2A 3NZGA 1OEPA 5C5YA 2Y7EA 1KRAC 4PUEA 4XAYA 3DBPA 4OGZA 3F5KA 3RG6A 3N2OA 5HWMA 3AXIA 3IIOA 4CNTA 1UHVA 3DEQA 1GVSA 2WMHA 2XH7A 3WF0A 2ZXBA 4Z2LA 2BMBA 5C71A 4QLKA 4B2DA 4GVHA 1EP1A 5FF2A 4XZ9A 3P5YA 4DO6A 5BMXA 1A5NC 1NWRA 3LYEA 4PB4A 3AIEA 3MBFA 1LG1A 3KBWA 3N2MA 3SECA 1UWUA 3NQFA 1MRQA 4C6MA 1XH0A 3QHOA 4A3HA 5ENLA 3WBWA 2X1TA 4J2PA 3DFHA 5HQLA 1XDJA 2EXOA 2QDDA 3HPXA 1QNQA 3MSRA 4N9BA 3A22A 1UD6A 1L2UA 2VZUA 1O4UA 4M5PA 4BEQA 1A3HA 1B54A 1XKYA 2Q3RA 3M7SA 1ISVA 4K68A 1J12A 3W2JA 3OB8A 1MNSA 1HJVA 1BF6A 3BOXA 3LMYA 3AIQA 2PWEA 4MNKA 1PTDA 1LUCA 3QGAC 3QR3A 1W9UA 1HIZA 1BEUA 4S2BA 1XDMA 3KOZA 1B57A 2DZWA 4NI8A 3UJFA 1FBAA 4C6PA 1O12A 1G4EA 1N55A 2ZFAA 4GO9A 1Q2SA 3ZZ1A 2QCHA 3W1NA 3FSUA 1Z48A 5LNUA 4UTFA 4ZQMA 1XUZA 4BEUA 2D20A 4Q4MA 2NLIA 4C1KA 3LZ3A 3F4WA 1DWJM 2Y8KA 2DIJA 1CI1A 3CQHA 5DFAA 1V5XA 1QWGA 3TW9A