1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords ALPHA-AMYLASE
publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
1WZKA 1E5NA 4OIFA 2JIWA 3BAKA 1LL6A 1QVBA 1WZAA 4A4AA 4B9YA 1DWGM 3F5KA 5A6BA 3T09A 3ZJ7A 4NF7A 5A6AA 3QOMA 1LJYA 1E6SM 2EEXA 1VFFA 5I0DA 4QLJA 4KMQA 3LPPA 2XWEA 2DEPA 2CHOA 3CO4A 5CG0A 1K6AA 3U7VA 1Q6FA 2J7GA 4TTGA 1U30A 3ECQA 4MB3A 4PMZA 3WUFA 4DUXA 2CBVA 3VM5A 4AEEA 1GOWA 3UERA 2J25A 1NM9A 4FF5A 2BXZA 4JFSA 1GQIA 3VIKA 1MW2A 1Q6EA 1HJVA 3RM9A 3S5ZA 3ARPA 3KLKA 4W93A 4Z2IA 2B31A 3K4AA 3RIKA 4CVWA 1IZKA 2XIBA 1LG2A 1PBGA 4OBSA 4MB1A 3L4ZA 1W1VA 2GJRA 2XN1A 3D52A 3UETA 1XHGA 1DTUA 1BPLB 1BF2A 3K46A 1CENA 2GK1B 1EGZA 2GJXB 1SMAA 1UQYA 1JYNA 2F7OA 1OM0A 1CGVA 4CD8A 4DWSB 3O6AA 2A3CA 5DF0A 3KEHA 1UD4A 4UQAA 2OWWA 1JZ5A 4Z2KA 1HJQA 3SUUA 2D0HA 4URIA 4NRSA 3OLDA 3MUIA 3AYSA 2WVSA 4UQBA 3AIBA 4UOQA 1DHKA 4AXNA 2XVLA 3WF0A 4PCTA 1TE1A 1H4PA 2PWHA 5A2AA 1KCKA 2YOCA 3AI0A 3WENA 3NSNA 4W86A 1OD8A 1WDPA 2V3GA 1C7TA 2VX7A 3T0BA 3LRMA 2GK1A 3VIHA 2GJXA 2OYLA 1MVYA 1W9DM 3GTNA 3CZKA 4PBGA 3I3DA 1QHPA 5CJ5A 1E40A 3RCNA 1J0YA 2V5DA 1QPKA 3A22A 3KWXA 1BG4A 1OIFA 1R87A 1XGZA 3BAYA 4Y7EA 1VEPA 1VAHA 1O7AA 2WMJA 1EDQA 4PMQA 4XV0A 2Y4SA 4CU7A 4D72A 5A6JA 5I6SA 3W37A 1V0KA 4AZIA 2OW6A 3CZLA 3LX9A 3KL3A 5A94A 1SYTA 4H7VA 4C7FA 3W26A 1H1NA 5GPRA 4PMRA 2JF6A 4GINA 1C90A 3B8SA 4PTVA 2XTKA 1ESWA 3MMWA 4OOUA 1G5AA 2DH3A 2QMKA 2AAAA 5A6MA 5FIPA 2IXVA 2VT0A 4BQ4A 4AMWA 1E6NA 1TQUA 5C71A 3VD3A 3ZM8A 3UCQA 3SCPA 1WP6A 4MJ2A 2F61A 3GXDA 4RE2A 3W6LA 2WHLA 4JL2A 1PZ3A 3WH8A 4PYSA 1K9TA 2X2YA 3CTTA 2ZWZA 2X8RA 4UFIA 3UG3A 2VVSA 1V08A 3VILA 1ZBKA 3QGVA 4AIOA 2X0HA 3PZNA 1H09A 4RE4A 4ZXOA 2EPKX 1HXJA 1KWGA 4B3KA 2X09A 1TMQA 1KXHA 1HTYA 1M01A 5EFFA 2CXGA 4GI8A 3H53A 4AD0A 5I24A 2PWFA 2DIEA 2WMKA 1KXVA 3CMGA 1JIBA 2X1IA 3CHEA 1R7OA 4Q22A 3GXMA 3AIRA 3VDCA 1JDCA 1EO5A 3TONA 4D1IA 1MFUA 1E3XA 4WIWA 3M46A 1UD2A 4OUEA 1Q6GA 1W32A 1W2PA 3AS0A 3WUGA 5JBDA 4PEEA 1V02E 4GKLA 5AYBA 1JD7A 2UY3A 3AXXA 4F66A 1PX8A 1AQ0A 4TXEA 3W28A 3ZT7A 4D6DA 2Y2WA 4GO9A 3L4TA 1VF8A 4N42A 1E71M 1V6UA 2QF8A 4B9ZA 2Y8VA 1WDQA 3HG2A 2GUYA 1UWSA 4GXPA 3WDPP 1XYFA 3AIUA 3NCOA 2DSUA 4Z2HA 1O7DC 2VX6A 5CPTA 3WF3A 5HDRA 1GOQA 2CIPA 1MQPA 1GJUA 4TVUA 3UEQA 1R8LA 2WZHA 1Q6CA 5A8NA 2WZEA 1PJ9A 2YLAA 3WD1A 2XIIA 3MMUA 2ZX7A 4HA4A 3E1F1 1ZS2A 3ARUA 3SCUA 3A4AA 4P7LA 5JUVA 4WK9A 2W92A 5CGTA 3VUPA 2G3JA 3IJ8A 4DUVA 1M03A 2PC8A 2FHBA 3VIIA 4GQRA 3GNOA 3CZSA 5E09A 4P8UA 2CERA 3OIHA 1UH3A 1E6PA 3AHYA 2CHNA 4W7VA 3W25A 4Z2JA 1UR4A 1W2VA 1UR8A 4FK9A 1E1EA 1EHAA 3SURA 2QV4A 3AIWA 2CNCA 1UQZA 1QNRA 3T2OA 4AZ7A 1WE5A 2EBNA 3W24A 1B31A 2PF0A 3VIMA 1HN1A 2DSWA 1CBGA 1FA2A 1OT1A 1JG9A 1SMDA 3CMJA 2D24A 3LXAA 2AMGA 1UWRA 2J8GA 3G6LA 4LPCA 3L4VA 3WDHA 4J28A 2G41A 1L8NA 2Y8KA 4PTXA 3EDKA 1B3WA 3ZR6A 3WY4A 4YHGA 1KGWA 4AD4A 4D6CA 3ARQA 4WKFA 1PPIA 4H8VA 3NDYA 1C91A 1W1TA 2X2IA 1TUXA 1TVPA 3OB8A 2OWCA 2O92A 4TX6A 4EKJA 1KGXA 3CUHA 4M56A 1GONA 2XG9A 3POHA 2D22A 3BMWA 3BUQA 3TOPA 3RJYA 3II1A 1Y7VA 1MXGA 2VC9A 1C92A 2HVMA 4ZE5A 3VDAA 3ARYA 1QNSA 3MMDA 4JCMA 4KRUA 2ZUWA 4PMYA 3UG5A 1WO2A 1H2JA 3ZQ9A 5BXSA 1Q4NX 4HMDA 3AQUA 4OJYA 2V38A 2VVNA 4M82A 1BGGA 3BXWA 2EPNA 3WY2A 3CUIA 3T2PA 1JNDA 2VCCA 2XGBA 2ZWYA 3U57A 1PEZA 2W67A 4W8BA 1X1NA 4KRTA 1XH2A 3WD4A 4W5UA 6TAAA 1E56A 1W3JA 5LA0A 1HNYA 4JFWA 4CCCA 4V28A 3N15A 4FNRA 2WKLA 2HISA 4NX0A 3AZSA 1NH6A 4CCEA 1GZJA 4HPGA 3BAXA 3DYPA 4W7UA 2F18A 4CN4A 9CGTA 5HNNA 4MB4A 3FXYA 3WH5A 4V2XA 1GOMA 5A8MA 4CKQA 2WC7A 1XV8A 3VGBA 3U5YA 3AHTA 3GH5A 5JBFA 1J12A 3CIVA 4W85A 1UH2A 1GUVA 1OCQA 3TTOA 2ZUVA 1BAGA 4AISA 4CD4A 1GHRA 1BQCA 2WWDA 1GHSA 4D1JA 3BVUA 1QI5A 1DP0A 3GM8A 1WB0A 4U3CA 3AFBA 4TUFA 1JYXA 2CKSA 2YDRA 3FHQA 2YL6A 3A24A 3PZOA 3TP4A 3CZNA 4UTFA 1VEMA 4MTVA 2NT0A 4HTYA 3WNNA 1EDTA 4L4OA 3GBEA 4GQQA 4EAMA 1FH9A 3HN3A 4LX4A 5DT7A 1LG1A 1W91A 4AEFA 2VNCA 2FYVA 2E9MA 5BCAA 2YJQA 1B1YA 3VDBA 4EANA 4WLCA 5IDIA 1DWJM 1SFSA 2C8NA 1ITXA 5A8OA 1UG6A 2G3NA 3VGGA 1O6IA 2G3IA 4ZE4A 5E70A 1E5JA 5ECUA 2F7RA 1GOKA 3CZ8A 5GNZA 1RH9A 2J62A 1MQRA 1NWSA 1D7FA 3GDBA 4GZJA 2VZTA 3N12A 1JFHA 4CGTA 1HKJA 3THDA 1D3CA 2XN2A 4J27A 4D6HA 3I3BA 1QI2A 7CGTA 3WF2A 1GPFA 1EO7A 4Z2GA 4NI3A 3AMCA 5IFTA 3GBDA 1FP8A 4GZIA 1KWKA 1B3ZA 1E0WA 4UFHA 4UOJA 2WMHA 4AYGA 4M29A 4M24A 5GQBA 1B3VA 2E40A 4HPHA 3PZVA 3S6TA 5AC5A 3MV11 2VL4A 2GVYA 3EMQA 4CVUA 3IANA 1ISYA 1VJSA 1VIWA 3LXCA 4JFTA 4DM2A 3VIFA 3L2MA 4BS0A 1BVNP 4AW7A 4JKKA 3VOCA 1QWUA 5ABGA 4TTUA 1J10A 3RM4A 2Z1SA 3BC9A 4JZ5A 3D4YA 4U2YA 1G01A 3AROA 2VUYA 4U5IA 5ABFA 1N82A 4FNQA 3SUSA 2AOSA 4CU8A 3ZOAA 1MWOA 1GCYA 1UD3A 2WPGA 1CGTA 4X0VA 3BLBA 1VB9A 3WQ6A 4K68A 1E3ZA 3B9AA 1W3LA 4MNKA 3WNPA 1R75A 1HT6A 2JEQA 1H5VA 5D4YA 1JAEA 1XSKA 1M53A 5A6LA 4J3UA 3WY3A 1J0JA 2E4TA 4PCSA 1G1YA 2ALWA 1E55A 3AHXA 4TVDA 5ABEA 2VRKA 3WQ4A 1JI2A 4UZSA 3BSHA 4DO6A 4QP0A 1ECEA 1CGXA 1HKMA 3W82A 1C8XA 1LWJA 1E15A 4ACZB 3LRLA 4OOZA 4CD5A 3K4DA 2DT3A 2BVYA 3KL5A 1XYZA 5DMYA 2DSVA 1V3LA 3TTYA 2F7PA 2V3DA 2XSBA 5D9OA 4ZEPA 4FNTA 4MB5A 2C7FA 1GVIA 4MJ4A 3T2QA 2WXDM 3WNKA 4NXSA 3FY1A 5BXPA 2V3FA 4D6JA 2UWFA 4GPNA 1DWAM 5JIWA 2WVTA 3BAJA 1HL9A 2W91A 1GQKA 2J7EA 2WVVB 3J7HA 1V0LA 2PB1A 1HF6A 2J75A 1SR0A 2WYSA 2QHAA 4D6EA 1JNEA 1XCXA 1ODZA 2XVKA 3GXFA 1AVAA 2O9TA 3NUKA 3AZTA 5IXEA 4NRRA 4PSPA 3ARVA 3EJRA 2XN0A 4HA1A 2FDMA 5DT5A 1J0KA 4M8UA 3OGVA 1ZJAA 5FL0A 3DX2A 1NOWA 3FAXA 4F79A 3IJ7A 3WMSA 1UKTA 3S5YA 2WC3A 2WKGA 2FH6A 3VMOA 3VGEA 3HJEA 1LLOA 5CQ1A 4QFUA 1MW1A 1R33A 2IGTA 4DWSA 2WC4A 4AWEA 1KQZA 1XH0A 2WBKA 2E0PA 5CSYA 1PX3A 2DPEA 2WW5A 2F2HA 3MANA 2QPSA 3POCA 1UZ1A 2E9LA 1LL4A 5IHRA 1W9XA 4MDPA 4WJXA 4JFUA 4OZOA 3DX4A 1WZLA 4P8WA 4BZYA 1ISZA 3OBAA 3LMYA 3VIGA 3GXNA 4UQEA 3SIMA 5A6BD 1CDGA 2RGMA 3WD2A 4FLSA 4M1RA 4BF7A 1BGAA 1V3MA 3TTQA 1KR0A 2UY2A 3EDFA 4LYPA 2ZX5A 3BGAA 3WBAA 3HG4A 1NWTA 1US3A 4J3WA 1QI0A 1AQMA 4FMVA 4UCFA 1OBAA 2FHFA 2WK2A 3D5HA 1HJXA 4TX8A 3OLIA 4UFKA 1DEDA 2OW7A 3PTMA 1E4IA 4D71A 1KFWA 1M04A 1UYQA 1W9VA 3WNMA 4AIEA 5FL1A 4PMXA 1NOFA 4H8UA 1V3KA 1W9UA 3LRKA 3CHCA 2EJ1A 3A4WA 3N18A 3SCSA 4ATDA 2FE0A 2XYLA 2PWDA 1E70M 1FFRA 1SZNA 3L4WA 3WNOA 5BXRA 3CUFA 2YDSA 3W0KA 3CC1A 1V3IA 4V27A 2C0HA 1UOKA 3OLGA 5EFDA 4FNUA 1GORA 2J7HA 3F4VA 4HOZA 4AZHA 2VX4A 5FOOA 1BHGA 1GVYA 1KCLA 1NP2A 2J8FA 2ZXQA 3U7BA 2YFNA 2EPOA 3WKZA 4H2CA 3N1AA 2WCSA 3CUGA 2BY0A 3A5VA 4AZGA 3WDRA 5DEZA 3WD3A 4EE9A 1XRVA 4HZ6A 5I2UA 4UOZA 3K8MA 8A3HA 2ZE0A 5I5RA 3GH7A 4AYSA 4MPKA 5A69A 3ZMRA 3DX3A 1PX4A 1B3YA 4NZFA 5EB8A 2BVDA 2YLLA 2A3BA 4U2ZA 1CGYA 2X0YA 1EQPA 2XPKA 2XVPA 3WMCA 5M17A 1CIUA 2IUZA 4RE3A 3AS1A 1JZ3A 2E8ZA 2XM2A 1C8YA 2XFFA 1L0PA 1ZU8A 2XGIA 2ZIDA 1UR2A 3S2CA 1G9HA 1BYDA 2ZXBA 4W87A 3GNPA 3VNYA 1BVZA 1CLVA 4FLRA 1UR1A 5LA1A 3WDIA 4UFMA 2DIJA 5CLWA 1IV8A 3AOFA 4YHEA 4AD5A 1BYAA 3NYDA 3VIPA 1EIBA 1NP0A 2QMJA 1WCGA 1RPKA 1Z32X 5A6KA 1C93A 1WAWA 2OLHA 5D8WA 1VBUA 2WLYA 2ZX9A 7A3HA 1UA3A 4B3LA 3WEZA 2GJPA 3BUBA 1UKSA 3TV8A 5CZKA 1KXQA 4ACYA 4XB3A 4GO8A 1JZ4A 1V6XA 4MNMA 4X0NA 1MXDA 3WELA 4UR9A 3AXHA 2EQDA 1B30A 1YQ2A 4PMOA 2OWXA 3FAWA 1S46A 3I3EA 5FD0A 3GXTA 1LF1A 1V6YA 2W5FA 4PUDA 4JIEA 1CXIA 2WHJA 4U5KA 3AYRA 3NJ3A 2D2OA 3QR3A 4J7RA 3O9NA 3M6DA 3W53A 3DC0A 4UFJA 4CCDA 1CGWA 2Y5EA 1VJZA 5D8ZA 1QX1A 4M80A 1I1WA 4QAWA 3MUY1 3ARXA 4P8VA 1V6VA 1KBKA 2VZVA 2XHYA 4ATWA 1GOIA 6A3HA 1EOMA 4MAVA 4W7WA 1UH4A 3FNDA 3AIQA 4HZ8A 1V3JA 5E6YA 4HA3A 3DECA 3VD9A 2WSKA 1VFUA 4JFVA 1TVNA 3DDFA 3WDJA 3UG4A 3ZJ8A 1XC6A 3KL0A 3PZIA 1KQYA 1BLIA 2BFGA 3A23A 4JHOA 4AZCB 1UHVA 3BLKA 1V02A 2ZICA 5A1AA 1ISXA 1E6QM 3WFLA 1TQVA 1FOBA 2MANA 4WSJA 2DT0A 3BVTA 3VDHA 3VTRA 3EJUA 4ZENA 1JDAA 2UY4A 2J77A 1W9BM 5AYIA 1HWWA 3ZR5A 2J79A 1CNVA 3WQWA 1R86A 5BXTA 3LXBA 3BUDA 4X9YA 2JF7A 4AIUA 2FGLA 3EJTA 1OD0A 3SCVA 4ML4A 2CBJA 4AZ6A 1K9FA 5E0FA 3ZT6A 4IPLA 2WCGA 2PBGA 1DWFM 2QPUA 3AMDA 8CGTA 1HVQA 2DH2A 4GZEA 5HPOA 3RO8A 1T0OA 1ZB5A 3GH4A 1V0NA 3N11A 3K8LA 3WH6A 4U33A 3VVGA 4QCEA 5E6ZA 4YN5A 1CYGA 2WAGA 3ARZA 4DUWA 3IAQA 1R85A 2QLYA 3ARSA 3D51A 1LWHA 2ESCA 4U31A 4FLOA 4F8XA 2VZUA 3LPGA 3W38A 3EJPA 5I23A 3AJ7A 5LA2A 4E2OA 5HXMA 4LYRA 3OGRA 4KGJA 3N9KA 1E72M 1UD5A 1CECA 2Q8XA 1JD9A 4D6FA 2J7CA 1JL8A 1BYCA 4UQDA 3MUZ1 1UD6A 2XFYA 1TG7A 3L4XA 1VBRA 3F5JA 3SUWA 3L2LA 1UWUA 2VR5A 1XSJA 3F5LA 1HJSA 1Q6DA 1RD6A 5BRPA 2VQTA 3N13A 4IISA 1NWUA 3DHPA 3D4ZA 1PIGA 4QLLA 2VCAA 2F1BA 3BVXA 1WDSA 1LL7A 1OGGA 1CXLA 2VR4A 4PMUA 2YIHA 5AY7A 2XWDA 2A3AA 2V5CA 1GQLA 3EMCA 2UY5A 2BY2A 4B16A 3IAPA 1IZJA 4HMCA 1EHNA 3VX1A 2WVUA 4F9JA 3EJQA 2RGLA 2W4XA 1V0MA 3VX0A 1QW8A 3W6MA 4PSRA 2PWGA 1HVXA 2J4GA 2ZUSA 2O9RA 2GDUA 3H54A 3OGSA 3MUAA 2YA2A 4H41A 2NW0A 1US2A 2CEQA 4NSBA 4QCFA 4RL3A 2V3EA 4WSKA 3CBWA 3WDQA 4OKDA 1B9ZA 3BCFA 3MU7A 2ZOXA 1QI4A 2WNWA 3B9EA 1VFOA 3MSGA 4HZ7A 2J7DA 4TVCA 2WM0A 3RM8A 3H55A 3T0AA 5IFPA 2PWEA 4XZWA 2XFRA 1OSEA 3ALGA 1KR1A 1ZJBA 1JZ6A 3HZ3A 1E9LA 3T0DA 1JAKA 3ARWA 2X2JA 2BHZA 1UR0A 3WNLA 3HG5A 1ITCA 1HL8A 4LXFA 1BG9A 4AMXA 2WMFA 3PZ9A 3D50A 1HJUA 4M81A 4AY1A 1GJWA 1K9EA 3SEPA 1AMYA 2D3NA 4ATLA 4PMVA 3SCTA 3AICA 2WLZA 3APGA 1ODUA 4C7GA 2XVGA 3BVWA 3VM7A 2CESA 3SCRA 2ZUTA 5I3DA 1QI3A 2F7QA 3T08A 4FNSA 3A21A 1XCWA 1UKPA 3VINA 2EPLX 4IPNB 2CKRA 3WL0A 4S3KA 3MS8A 3EDJA 4J3TA 2OYKA 4A3HA 1B0IA 3NSXA 5HBFA 2ZX8A 5DO8A 3WMBA 2ZUMA 4L4PA 3L4UA 3SUVA 5A8QA 2BY3A 1JXKA 1EQCA 4CU6A 4AD3A 5ABHA 4PN2A 2J74A 2DGAA 2ZXAA 1I75A 2XJ7A 1FH8A 1GQJA 1TCMA 1LQ0A 3AMLA 3BAWA 4AD1A 5M03A 4UQCA 3VIJA 2JE8A 3D3AA 3WN6A 1TR1A 4IM4A 2WCAA 2OYMA 3GXIA 1ZBCA 2WB5A 5M5DA 2VX5A 1CLXA 1KBBA 2E9BA 1VEOA 1OGBA 3CPUA 4XUYA 4P7NA 2VTFA 3VO0A 5TD4A 3UR7A 1FP9A 4EK7A 1DWIM 2VZSA 4DO5A 1CGUA 1CEOA 4J3VA 3CHFA 3U5UA 5I78A 1EXPA 3ARRA 4F9DA 4TOQA 3PZGA 4P7RA 1HP4A 3BVVA 3CZJA 2DSZA 3AISA 2EO7A 2F8QA 3IJ9A 1NOUA 3WQ5A 5A6SA 2CYGA 1VRXA 4P7OA 2EABA 1QNQA 4WF7A 1J0ZA 1JGIA 2OSXA 4PTWA 3N04A 5CSUA 3WFZA 3EDDA 4LYQA 5JBEA 1MFVA 3UR8A 3WH9A 1PZ2A 1MW0A 1J18A 3EBVA 2Z1KA 1EH9A 4ACZA 6CGTA 4D6GA 4CD7A 4W84A 1JYVA 4JKMA 2GFTA 4PUEA 2YBUA 4W8AA 1B90A 1NWRA 1OIMA 4MAZA 2XSAA 5A95A 3BAIA 5GNYA 1E1FA 2VOTA 5BYWA 2JEPA 1FH7A 2D1ZA 4XZBA 3VKKA 3EJSA 1HKIA 1P6WA 2A3EA 2D23A 4R27A 3FHAA 3AIEA 2D73A 2EAEA 3K8KA 2WVVA 4JL1A 3MV01 3PZQA 4UQ9A 3ZO9A 3WY1A 2O9OA 4NXKA 3SCWA 4ZFMA 5KZ6A 1AQHA 1CWYA 3PBGA 4P8XA 4KGLA 5D9NA 4OBRA 2WHMA 1KXTA 1U33A 3BSGA 3ZJ6A 1C8QA 3THCA 1UD8A 3QOKA 1DWHM 1PS3A 2VMFA 3OG2A 5CXPA 2D3LA 3EMZA 2VO5A 3BCDA 3W27A 3TA9A 1X6NA 1MW3A 2J7BA 4MADA 5CPSA 4N0RA 3NIYA 4PRWA 4NZJA 1JZ2A 1X6LA 3A4XA 2ZXDA 1H0GA 2W63A 4BCEA 5F7UA 3A6OA 3PHAA 3PTKA 4BA0A 1A47A 1PIFA 3N17A 3VGDA 2FHCA 1JZ7A 3CHDA 1QHOA 2BHUA 5JIPA 2OSWA 4GI9A 3VSTA 3AIVA 1E6RA 1KTBA 2D0GA 3IK2A 1E73M 2YFOA 4J3XA 3PZUA 3PN8A 4CD6A 4AZBA 3KE0A 2O9PA 3KLLA 2BV9A 4DO4A 3AZRA 3PTQA 2YA0A 4JAWA 2NT1A 3WD0A 4CN1A 3GZAA 1TA3B 2EADA 4FNPA 1NARA 3WEMA 1V03A 1HJWA 4GIAA 3AS3A 2DT1A 2VI0A 1CXFA 1OINA 5E1QA 2WSPA 1OT2A 2EXOA 1WDRA 1JF6A 3DYOA 1J0IA 2DSKA 1C7SA 1R7AA 3GXPA 5CLTA 4C7DA 1ZBWA 3KZSA 2A3HA 4JHZA 5EMYA 1G0CA 5I77A 1TQTA 1XD1A 1BSIA 2ZUUA 4DWSD 2E8YA 2BS9A 3ZT5A 1J11A 1B3XA 4AC1X 2YA1A 1BFNA 1W1PA 3AHZA 4CUCA 4CN6A 1TA3A 1GNXA 2EPMX 2ZUNA 3BH4A 3AMKA 3RDKA 3ZSSA 1KGUA 3K1DA 3RPMA 1B2YA 1QNPA 4J3SA 1ZL1A 5KEZA 1HP5A 2YKKA 3VMNA 3AS2A 1H11A 5LYRA 2BNJA 3WSUA 2YL5A 4MNLA 5FCZA 3HMCA 3VGFA 2CCRA 3AXIA 3VD4A 2XVNA 1GW1A 3CH9A 3SCQA 5IHSA 4UFLA 2TAAA 3PZMA 2DQXA 3W81A 2VRJA 4ZXLA 3ZJKA 2X2HA 1UA7A 1UKOA 1UZ4A 1IT0A 1FHDA 3DHUA 1J0HA 3TTSA 2CITA 1E0XA 2IXUA 3OLEA 2X05A 3L4YA 4OGZA 1ISWA 2G4FA 1FFQA 3AHVA 2VQUA 3MI6A 2W62A 1QNOA 3BUIA 1TFVA 2YL8A 4E4PA 1V6WA 2PBOA 3VNZA 3CGTA 1MQQA 2Y24A 3VD5A 2EACA 1R46A 3WH7A 3ARTA 3WL1A 3ALFA 1UKQA 1NQ6A 2G8ZA 2VZOA 1HX0A 4WKHA 4U3AA 3EYPA 2CPUA 2G3MA 3VSVA 2WZIA 4PMDA 1V3HA 1QWNA 4DWSC 3VIOA 3W4RA 2W66A 4MDOA 5FKYA 4GI6A 2ZX6A 3OZPA 3DX0A 1CXHA 3RILA 1BTCA 3CZGA 4IUGA 1J9YA 3WF1A 2BY1A 1I1XA 4BQ5A 2BHYA 1JYWA 3VU2A 2OSYA 1CXKA 1QW9A 3CV5A 3WBEA 3A3HA 4BQ2A 1UASA 1H49A 3BLPX 5CPQA 4YPJA 1GOOA 4HP5A 3QHOA 4NZCA 3SCNA 5I79A 2NSXA 1TZ7A 4R5EA 1XSIA 3GNRA 1H0IA 3GYCA 1YHTA 1JF5A 4LQ1A 3G6MA 5D9MA 2WANA 1J01A 3M7SA 3B9DA 4Q7NA 4AZCA 1CPUA 5A8PA 1JI1A 1RP8A 2DDXA 2JIEA 3O2LA 1JDDA 2D0FA 4QDMA 1WPCA 3W29A 3MKKA 3BUPA 1E4NA 2F1AA 5A3HA 4JCLA 1JFXA 2VURA 5C8BB 2J7FA 1CXEA 1W9PA 3JUGA 3NSMA 3LPOA 2YL9A 5HPCA 3CUJA 4B15A 1EOKA 1M7XA 5BRQA 5HOSA 1EA9C 3FN9A 3VPLA 1ZBVA 1XD0A 3PZTA 3ZIZA 2DT2A 1E4MM 5DFAA 1F4HA 1E43A 1WKYA 1FHLA 2CBUA 5EBAA 5BROA 3UESA 4XX6A 1OWQA 1K9DA 1VENA 1UUQA 3OA5A 1CZ1A 4KH2A 4HU8A 4A3YA 4FLQA 3WIJA 1QOXA 3A47A 4H8HA 4AZ5A 3SUTA 3EDEA 5E0CA 4BQ3A 1F4AA 4LGXA 2XM1A 4UZUA 4W88A 1PAMA 1JXJA 1UWTA 2WHKA 4HMEA 2W61A 1HIZA 2FGZA 3WF4A 1MYRA 1UWQA 3WUBA 2BXYA 2WWCA 4PTMA 3HG3A 4W8LA 2CBIA 4HOWA 2WMIB 3WQ8A 3LPFA 3ZSTA 1JZ8A 2YDQA 3IGUA 4W89A 4D6IA 4JKLA 3FW6A 4W5ZA 3QHNA 1OB0A 1E6XM 2WBGA 1W3KA 2J78A 2FH8A 1KB3A 1CTNA 3DYMA 1WZMA 4E8CA 5E9AA 3NDZA 1OGSA 4H04A 3MSDA 1KTCA 5A2CA 1UWIA 3HU7A 1U2YA 4P7QA 1W1YA 4MNJA 3RMEA 5C70A 1XH1A 4UNIA 1QBBA 1H41A 2J47A 2PI6A 5M3WA 4QLKA 1QHZA 2WMIA 1E6ZA 4S3JA 3BMVA 2D20A 4HOXA 2WMGA 1VFMA 3DX1A 4AD2A 3WQVA 5A2BA 3VD7A 2VJXA 1HKKA 4HU0A 3M07A 4DM1A 2VCBA 3DDGA 2JFEX 3AMGA 1BYBA 2GSJA 2VRQA 2GDVA 2XUCA 3WUEA 5AC4A 3CZEA 1A3HA 5ABFB 3MO4A 4WKAA 4AMCA 1D2KA 2JALA 2E3ZA 1HXKA 4KWUA 1QBAA 3WEOA 2YBTA 1UR9A 1RP9A 3QHMA 1E0VA 4E8DA 2CETA 1R34A 3VMPA 1H3GA 1TQSA 2BVTA 1R47A 1TQWA 4PMNA 3SCOA 1C3FA 1W3HA 1E4LA 1G94A 5D9PA 4Z2LA 5GNXA 3RJXA 7TAAA 3CLWA 1EDGA 5BWFA 5CGMA 1ISVA 3VGHA 1WNOA 3VSUA 3OZOA
chains in the Genus database with same CATH superfamily
3LN5A 1LL6A 5JPNA 3CDZA 1LE9A 3DTXA 2EO1A 4A55A 1A50A 2YARA 4XTRD 2XYCA 3N42F 1JP5A 5BVPH 1U30A 2BNRE 2F15A 3B40A 4O9HL 3DA0A 4DGIH 3FU6A 3REWB 3S2LA 3NK4A 5J5RA 2NY0D 5DD3H 1OEPA 3WLIA 4OBSA 1BLNB 4PJEB 3QPZA 2XN1A 1M05A 3D08A 5CLZA 3K46A 4LDOB 1GZPB 5G2WA 2PDBA 3N2JA 3LRSA 1JJUA 1IB5A 5E2UL 2ISSA 1TJMA 3SZ8A 3OG4B 3BKYH 3DRQA 2WQPA 1F45A 3G6DH 1KFLA 2YOCA 4GRWB 1TTGA 3VW3H 3QCTL 2A9AA 4JN1L 2GBVA 3G1HA 1IGFL 3AADB 2FIRT 5JPMA 2X1TA 5FHAL 4WHTB 1XGZA 3WD5H 5C1MB 3NFSL 2JQXA 1UJQA 4AM0Q 3N91A 2ED7A 2WNKA 3FEQA 5C9WA 3LEXA 1C90A 2CLFA 4Q8UA 3OMIB 4BSWB 1A3LH 4H8PA 1QCWA 2QIIA 5EO0A 4RGNC 3QG6A 4RMQA 2R27A 3KWWA 4MJ2A 3ASOB 3WJXA 3W6LA 3MUXA 4L1WA 4JL2A 2VL5B 5DEJA 1K9TA 1WGOA 5J0BA 5LKNA 3QSRA 5E4OA 2IBGA 2CO3A 1I9RL 4PCPA 4FIRA 1LGVA 4RESB 1TEFA 5F7HA 5FGBA 3IJSB 5GRUH 4NHCH 1HTYA 1P0KA 4GI8A 2H41A 3T0EA 3SKMB 1SJEA 3LCHA 2R83A 3EF7A 1L8PA 3TDFA 2EE2A 4ZT1A 3GIVA 3CBKB 5BWAA 4GKLA 2XJLA 4N2EA 3BSZL 8FABB 4TXEA 5LZLA 4D6DA 4FF9A 4JO4H 3SYCA 2RAGA 2W9DH 3SQBB 5D5ME 5EO1B 2OVLA 1UENA 3QJRB 2GUYA 1WA1X 4Y9OA 3W72A 1OLZA 2EDQA 2FIKA 5GISH 2QEJA 4K7PY 1Z7AA 4GOAA 4F5CE 2ATSA 1KLFB 1W5PA 2F9RA 2HS8A 3VQMA 1S7SA 3ARBC 4ZQRA 3V0IA 3KPLA 1REQB 4PB9H 1GEHA 3H7BB 3FYOA 3EKCA 2AI0H 3QUXD 3VOFA 5E09A 5BZDA 2QADD 5GRVK 3TO4A 1UR8A 1SBSH 3S37L 1Y8BA 3W24A 1B31A 2A79A 2YZ5A 4GUPA 3O3RA 1I7ZB 1SMDA 3DSFL 4H01A 1A4JB 4RQQA 3U0TA 1BKSA 1RJLB 3AGWA 3RX5A 4CBZA 3TA3B 4KPHH 1A7PL 1X5HA 2X6UA 1ADQL 1AD9B 3LCXA 1S7RA 2Z27A 3NEOA 3SE3C 4BUHA 3GMNA 1M7DA 2V7HB 1TVPA 2HV5A 1R5WB 3R4IA 5TK4A 1TMLA 4NZTL 4YXKH 5FV2A 3MMDA 5CD5D 1MY5A 4W9LC 2RAMA 4RX0A 4DZIA 3HPJB 1JUEA 5T3XL 2VVNA 3KPMB 5KG9B 3MP3A 1Q9KB 5HHMD 3BH8B 1X1NA 3V0VA 4K3ZA 2AVFA 3WD4A 3QKEA 5AWNL 2GZXA 3L3OA 4FE9A 4J1UA 5TFSH 3MC0A 5SX4H 5EU7E 3T05A 5T5FA 4WV1A 1EB3A 1TJHL 4OV9A 1HL4A 1I8LC 3EUDA 4GSDH 5C8JA 1BIHA 2GPTA 4EN2A 2CLKA 4F3HA 3V52H 4UT9L 4C6DA 2WXGA 1Q94A 3LDVA 4P3DA 4MHHG 1XXDC 4GCXA 1FH9A 2GT9B 5HPMB 5DD6A 5EN2A 2F84A 1KPRA 1TXKA 5KS9A 3O2DL 4MNQB 4MXWH 4UV7H 2ICEC 4BA8A 3CC5A 3WQFA 3CT7A 5B7ZA 3KPQB 3DO3A 2J5LB 4PV8A 4X4XB 5I5IA 5ECUA 1RUMH 4GK8A 2J62A 4JW3A 5AHEA 2KKQA 3NSDA 1SFJA 3EFDL 5M2FX 3THDA 3WMLA 4LHUA 2BMKA 5AN7A 4L8BA 5PCYA 4NI3A 1ZD6A 3VOGA 1IGYA 2HFGL 3PZVA 5AC5A 4NKMA 3P77B 5CP3H 3G3DA 5AECA 2PDYA 8XIAA 1BVNP 2WUBL 4OCNC 2KQMA 3O4OB 1SO3A 3L3HA 1PL9A 3TJIA 2VLKE 4LAQH 4UDUA 3IDYC 1KTDB 3V6BR 2PDJA 5C08B 1SEBA 3QDJB 1DQQA 1ADSA 1E3ZA 5C0AB 1EL3A 3K3QA 1A5UA 4JIRA 5D4YA 4L37A 1Q0XH 3NPUA 1YEIH 3W1PA 4ACZB 3U1QA 3QI9A 5HHOA 1XYZA 4MYWB 3LHPL 1ZHAA 2FZ9A 2Y7OA 2FJFA 2JELL 1NJ9A 4Q3MA 1A6WH 4IP4A 1YEEH 4IKLA 1MEXH 1HL9A 1QACA 2MOGA 4FL4B 1BQLL 3O11A 3GMPB 3OMAB 1IIIA 1W8NA 2XN0A 2FDMA 4PP1D 5IBTH 2IGFH 4C54A 1G6RL 2JCCB 4QTIH 3HJEA 5BMFH 1DE5A 2AQ1A 3A5FA 1IRAY 3Q01A 4EXAA 1BQRA 5IHRA 1W9XA 3CIXA 4JG0L 4NKCA 2EEFA 2JKPA 3UBXG 1VS1A 2VAJA 3TZVD 1ZALA 5EU6B 3MBEA 2WLKA 3QDMA 1GR7A 4GVIA 5CIPB 4IGBB 3H2CA 4HNNA 2XWJA 3ROLB 3EJZD 1XGQA 1QMUA 1P7TA 4MCZB 4N6RB 3V16A 4N24A 1RJZA 2FO8A 1WA3A 2YGPA 5JW4R 1EGVA 4JAMB 1SBBA 3OB0H 5GZND 1LXMA 3K6FA 2G3XA 2EPOA 3VFSB 1FVDB 4EBQH 1PD0A 2XV2A 4N8UA 3U6WA 1EEQA 4PWJA 3K8MA 4KS0A 2ZE0A 3EYUL 1F2QA 1MIEL 4JYEA 2YLLA 4F57L 2O1AA 2X4SA 3TV3L 5A2FA 2N7AA 3TZFA 3QJHB 3GNPA 4FLRA 3OZMA 4EN3A 1PDZA 2HK0A 2F2KA 4JHWH 3RPKA 3VIPA 3ZUCA 5CGBA 4DO7A 1UGNA 5B22A 4OFYA 3AGVA 2WQRA 2IPTL 3S8WA 1CG9B 4NO2B 2PP1A 1A4AA 1ZZMA 5F89B 3AXHA 3GJFB 4HLZG 1A9BA 1TOXA 5A3ID 4DERA 5FD0A 1G7HB 1QLEL 2X7LA 3DC0A 4ZFZB 1XVSA 2MPVA 4ZQKA 4JEJA 4LAZA 3OKMB 3J2PA 2QGEA 4EZLA 2O61B 4YHLH 4JFEA 2JJSA 1CF8L 4HZ8A 4YC2B 2PXYD 1LNUB 1E6JL 4U7MA 2GSGA 4Z7UB 1NGZA 4N8CL 4L5FH 1ADWA 2J1YA 3BFWA 2VDKH 4FCAA 3RZCD 1ISXA 4N0YL 4NN5C 5F7YC 9RUBA 1R24A 3U9PL 3BVTA 3KD4A 4LE8A 1AH1A 1OTTC 2IDCA 4RGMB 4CKVX 4EIZC 3FF7A 2J77A 3EFOA 1HWWA 2H1PH 1C5CL 4GXMA 5ITBL 3BUDA 3T9WA 4EE2A 3EJTA 3Q8CA 3SCVA 3T4YA 4DJDA 4J3OF 4R8WH 1E28A 2OEJA 2PBGA 4GZEA 5EFIA 3GHBH 1NFDF 4LDLB 3UWQA 2DJSA 1UBPC 1YVLA 2YPKA 1HZHL 3JWOL 4QAMB 1T5WB 4EPDC 3QAQA 5MEND 1ACZA 3ZDZE 3IAQA 3V5DA 3IJQA 4S1DD 3LPGA 5B1AB 4DK5A 1AHKA 5AVWB 3TEXA 3DX7B 1WIOA 4W9ZA 4JZNA 4AFYA 5DQDL 3C60C 2KS0A 5CJOH 1GPOL 3PXHA 4QHLA 4JTHA 2WXOA 4GUIA 3VI3F 1ED3B 4YDKL 2VCAA 5T9BG 3SIKA 5I74C 3CASA 3QUYB 5CD3B 3BUTA 2XG5B 4INFA 3RJOA 3ME3A 2BY2A 3PK7A 1KNWA 5IIEB 3VX0A 5IBLD 3W6MA 3R06B 1IGJA 1O7DE 5AD0B 2DQEL 3KBJA 2B1HH 2OZ3A 3H54A 5D7JA 4H41A 4HHGA 3EHBD 5E8EA 2C4FU 4XN8A 3BD4A 1RIVH 1C9SA 4DQOH 3LLXA 4P5TC 1F90L 2FEEL 5AZEL 1M7IA 3DGRA 5GGUA 1G9NL 4DYKA 1JZHA 3FEMA 4XXCA 2EUXA 1G7LB 2KLRA 4JANA 1ZCOA 2F53A 3HG1B 3ZMEA 3UJFA 1AO7E 3VXRD 1XLCA 3HNVL 1RURH 3BANA 1K9EA 4PMVA 1ZLPA 1MIMH 5DURB 2QSCH 5KZEA 1H9DA 1BREA 4Q6IA 2AL2A 4UINL 2WLIA 2AK4A 3EYVA 4GKSA 2EPLX 1ZV5A 2CRMA 3JWDH 1GQNA 5ABHA 2NYZA 3KYNA 2XU9A 4UIMB 2ZXAA 2OJ1A 4ADTA 3CIAA 1Y6NR 1FG2B 5BPPA 1CCZA 1GTHA 3OAZH 4MKTA 1BBJA 1OG0A 1CLXA 3FMGH 4O50A 4QISA 5KMYA 4N9DA 3L5WA 5C54A 4NZDA 4FFZL 4PRHD 1Q90A 1PZSA 3B06A 3UXAA 2F8QA 3WQ5A 1IGCL 2CYGA 1VRXA 2R23A 3COTA 2CBMA 2V0TA 2CPCA 2QQKL 2R1XA 2VW6A 3K30A 1TWDA 3WIHL 4HUUA 2Z29A 1MFBH 3MX0A 3LNGA 1II4E 4G82A 5JDSA 1B90A 1CW2A 1KXTB 4MSSA 5GNYA 1UATA 1I1CA 2QVTA 2VKWA 5BS0E 1VADA 1YTDA 2WVVA 1KGCD 2JQAA 2NY3D 4GJIA 1TELA 2NYKA 2OTPA 3PPHA 5CPMA 4M4PA 5C0BD 4JFYB 4S0SD 4S3BA 3QIWC 4XOCA 4PJIA 5AVZB 1RHFA 5KBDA 2VEMA 1U8CB 2NY7H 1NFAA 2J1KA 5C7XH 1PS3A 2J8OA 4M7LH 2WXLA 3N6HA 1AH0A 1WGVA 25C8H 2CR0A 5JW4N 1T99A 2OZ4A 3V79C 2I56A 2O5YH 4PJHB 1TKKA 4LNYA 4CNNA 4S2SA 3TJEH 4BCEA 4WSHA 3F5WA 2NUWA 3KDMA 4BA0A 2UY7A 5JOFA 1YTKA 2DDQH 3FB5B 2OSWA 1JVNA 3CQPA 2IH8A 3BG3A 1QBMH 3S35L 1WFOA 4S0HA 2CJSA 1QOKA 1UB6A 5IVNA 2Z4GA 4JQIA 2FTWA 4GIAA 1OINA 1PBYA 1FI8C 3SN6N 1A2YA 4PUUA 1WDRA 4YQXH 4KRZA 3GXPA 4JQVA 5I6OA 2DW5A 3HBZA 1QWHA 2ZUUA 3PY2A 1YBQB 3F7JA 1BFNA 2PYEA 2Z34A 4DN3H 4IF2A 5DJCA 4UILH 4ALDA 1FWTA 4NZ4A 3UTOA 4FYSA 4MJIA 4Z3JA 1VBHA 1LDPL 3N41F 1BFTA 1A7NH 3VJ6B 2A6DA 1PCXA 1LP9E 4R4NC 2NXZC 1HYRC 2HX7A 4YSTA 4K38A 3VFMA 4A66A 2VLLA 4N5UA 3QUZD 2ALAA 2E5DA 4HKJA 2QUVA 3UBXI 2ZCLH 2DMBA 1VFBA 5C92A 2J4WH 4AQLA 1MJUH 4OGZA 2VQUA 1A7QL 1MNUH 2HFFB 4E4PA 5JU6A 3CGTA 4DB7A 1D6VL 4N2BA 1DQLH 3AW5A 1WV7T 2EKGA 2B2XH 4L6HA 2Q5BA 3BLOA 1R5VA 3OD3A 4IJCA 3EKGA 2ARJA 4J8RA 4D8LA 2G3MA 4FQCL 4ZW8A 2WYTA 5IB2B 5E00A 4JY4A 3KPRB 2F54A 4HT1L 4MAUH 2JJWA 4LCYA 1FSKC 5ALBL 3NCJH 3QORC 2X7WA 4Y9PA 1ASPA 3WG6A 3NMEA 3EOOA 4LS0A 4DN4H 3KBFA 4HWZB 4LSTH 3O2WL 3RP1A 2FT7A 4EAEA 3NAAL 1GGIH 1OSYA 3EOLA 5T3ZL 3WJMB 2C4FT 5IF0A 5D2LE 2Z31D 4AQ8C 4ZMYA 4M6MH 1S78C 3PREA 3IMVA 1CT5A 3M41A 4LDEB 2NUPA 3D48R 1XBYA 3VI4E 4P49A 1IL1B 4LSRH 1GJPA 3UC0H 1CL7L 2V7NB 2FJUB 4XKYA 5DFAA 5BROA 3W1QA 1CDCA 2GITA 4ANXA 1R9XA 1QOXA 2WTPA 2X4UA 4KROD 3LSBA 2G3FA 4WK4B 2VISA 1IT9H 4PWEA 4HMEA 3WLTA 4PUMA 3TO2B 1B3IA 1IIGA 5TQ2H 2OO6A 3QSTA 4FYQA 2JKIS 3IKCB 3TYGH 2CHZA 3KVKA 3MRQB 1TZIA 3DYMA 3HMWH 3BE7A 1H7NA 3N6YA 3BWWA 4MFEA 1UWIA 4WO0A 3RMEA 3HHRB 2J47A 3U30C 3ZKND 2OPJA 1S9YB 5CS7A 1E6ZA 4S3JA 4NBYB 3TCEA 4MWAA 1X5LA 5EIQA 1Q38A 1MLBB 2JFEX 1MCOH 3QLDA 1I31A 4Z5RA 4WUKH 4ZQCA 2BSTB 2NNFA 1E3FA 1BQSA 2IH9A 4G8IA 3QC5X 5DJXB 1A0QH 3AITA 3UTTB 2BVOA 3RX3A 5EMUA 3VRLF 4HKBB 3KMDA 3X13B 3RFRA 3VMPA 2GB2A 1I3RB 3WS6A 4L2LA 1W3HA 1FFNA 3CVIH 5L2KE 2WN3A 4XH2B 4G7FA 1A80A 3VGHA 1WNOA 2AABL 2X89A 5K9KA 5DCCA 4IJBA 1JPTL 3FB6A 1DVFD 2OFJA 1VFFA 3HV9A 3AU0A 3TFBA 2CGRH 2GQHA 2PGFA 2R4SL 3HE6C 1ZGLA 4PUJA 5IHWA 4FFYA 4JFXB 5IKCA 4TTGA 2J7GA 3MSYA 3OB0K 5LIUX 3LNHA 4KCVA 3U36B 2HQAA 1HJVA 3BZFA 3GB6A 3JWNG 3DOSB 3CH8A 1OTUD 1QBLL 4IK7A 2GUBA 5FHBH 3DBNA 3FVDA 1YEHH 2ZZ5A 4PVMA 3GG8A 1MHHA 1FO0A 4QGTA 2EIZB 1IC4H 2GK1B 3GSOB 1FNFA 2XN9A 3FONA 3QHTC 3MBXH 2ZJSH 4JTLA 3W75A 3T6XA 4OCRH 5BOPA 4XG1A 5D4HA 2C18A 4LF1A 4UQBA 3DDMA 3V4UH 4CRPA 4KKNA 4ZDHB 1IFRA 1UZDA 4XISA 4P59L 4JZJB 4NJ9L 5J12C 1I53A 1H4PA 1UQSA 4MKSA 4UC5A 3JWNE 3PJSB 4QXUL 5AW8B 1TZOA 1W9DM 2I7SA 1AOHA 3KWXA 2I1OA 4PJ8D 4GIYA 1L5GB 3FF8A 3VFUB 4JTDA 4XV0A 4UB0H 1CFSA 1V0KA 2Z35A 2OMZA 4MZYA 3LX9A 4DVRL 1H1NA 3ZHKA 2P50A 4PMRA 3LSOB 5BOEA 1OFAA 5TF1L 2ZP8A 2CXKA 5LBVA 1XCTA 3UJTH 1YUHA 2M26A 1BD2D 3S2AA 2DTMH 4Y5XA 3MOBH 1FUYA 4UDTB 4PD4K 5EZOL 2B20A 12E8L 3QFEA 2YGOA 3ESNA 1DN2A 3KXFE 4MYAA 2L3BA 3VWKB 3CVBA 2A73A 4G7SB 2X8RA 4R9OA 3UG3A 4DF2A 4PJGB 1ZBKA 4AIOA 4Z77B 4QM1A 1KB9J 3WE6A 4F33A 2WSQA 1NDTA 1AO7D 1S7UA 3MNVB 3FB7A 4HWBH 4NUWA 4JBRA 4W6WB 1XGTB 4TVSa 1HEJC 3FTGB 5ICUA 5HGHA 4PEEA 4K3HA 5HNTA 4Y2NA 3K1GA 3NJKA 4YTUA 3OVPA 1BVLA 4R53A 4HXBL 5GJPA 3P0XA 1AZVA 3JWOC 1PKOA 1O6TA 3L13A 4WR3A 3O7UA 2BNQA 3GG7A 4R2GD 4GT0A 4WY7H 2XNAB 2H26B 1ZLSL 2V2HA 1ZFJA 3C6CA 4NO5B 1YEYA 2PO6D 2G97A 1ECZA 1U58A 5DK2A 5GRJH 1X98A 2NTSP 4WJKB 3IN0A 5JXEA 4WGHA 3A4AA 5HULA 4QXGL 1GXEA 2FZ8A 5JUVA 1U3HB 3ARGB 3DV4B 2R14A 1GGBL 4ZMWA 1BQHA 3IJ8A 2WXMA 4HIBA 4ETYA 3HAEH 5KVFH 2AKRB 3QCUH 5JHDA 4WGXA 3IJEA 4NC2B 3SDAB 4HEPA 1AD4A 3QY6A 2XIQA 3ZZ1A 2QV4A 5F72S 3GVWA 1JDFA 2DSWA 2ICCA 1QKZH 3W74A 3FT9A 3UVIA 3DVIA 3BZJA 5DQ9A 5CEZL 1L9TA 3BDYH 4YIQA 4ZFFB 1IGMH 1S3KH 3GU1A 5BS0D 4XC1H 2PTVA 9PCYA 1G9NC 2A0NA 1I1AB 3KFTA 4XP4L 1C91A 2OR9H 3PL6B 4Y7MA 1Z8AA 1Q45A 4KTGA 1GONA 2OAAA 4WZHA 2Y06L 1XIWB 3IPFA 3NWRA 1XGRA 1VGKA 2GK0B 5E9XA 1QRNE 3HC4L 1FYTA 4OJYA 4CVXA 4C91A 3CLFH 3T6CA 2XTJB 3KRSA 1U6AH 3OTTA 1HHIB 2W67A 1AXIB 2X16A 3STGA 3EJYD 1XIGA 3N15A 1SF3A 1D7CA 4KY1H 4NNBA 3G8RA 4CCEA 3P2TA 3NZGA 3K4WA 2XDHA 4W7UA 4PRAA 2OXHB 4JRYB 4W4NA 4G7VH 3UOAB 1EXBA 3BVUA 1TPFA 3OKNB 2QJNA 4V1DD 1EERB 2VSMB 3HZMB 2YL6A 4L2YA 1NCTA 1K6WA 4R4BA 3GBEA 4HETA 1XGEA 3ZDXF 2VR9A 4AEFA 3FH7A 1P1XA 4KJYA 2D7OA 2OJEA 2PF6A 4L18A 1AG1O 1E0UA 2IPUK 1ORSB 3X3FH 5H8UA 1XFCA 5ESAB 1U91A 3CZ8A 1MI5B 4A22A 2NXHA 4GZJA 3UZWA 1DLFH 3ZDYE 1MAML 2ARWA 3H70A 3W9EB 4M5ZH 5CP7A 1WVZA 3QWNA 4HPHA 3MRCB 3WX7A 2WGXA 4OV4A 1QWUA 1CC3A 4IDLA 3KPSB 2YEZA 4DQAA 4OLYH 1CDJA 5LKYA 1MNNA 3KHJA 1AYOA 1EZVX 1N82A 3BZ4A 1Q85A 2YBRA 4LVNC 3EYSL 4HXAL 3GI8L 2AMXA 1XSKA 1ZHNB 4OVXA 5AG8A 3EXTA 4Y5YB 2E4TA 3RN6A 4BD4A 4HSQA 3SE6A 1XLEA 4UZSA 2IPKB 2IG2H 1EEXA 3TIDB 3GUGA 1G9MH 3DJRA 4P46B 5TE7H 2R24A 5F1KC 4YCPA 1GMEA 2QULA 3Q45A 4ZEPA 2H9GA 1XF4A 2E7LA 4MJ4A 4IOSD 1MHEA 4FALA 4FF7A 1QP1A 2NDFA 2XWTA 3TC6A 1C5DB 2BIPA 2R29A 4K7FB 2DPKA 3J7HA 3B5TA 1CLYL 6FABL 2J75A 3FCUB 5IBUG 3NFPB 3S36H 3BQVA 3PTDA 2DRUA 2XQ0A 1SDAB 3L7EA 5FA3B 4HA1A 3U4AA 4ZD3H 4GABA 1ZJAA 4R83A 3IXTA 1S9VA 1KELH 3O9WD 3L7FA 2WKGA 3ML9A 1HHJA 2F8VA 1YTEA 1W17A 3SOBL 2J13A 1XH0A 1KBPA 4IKJA 1IGTA 3Q94A 1KGJA 5EU5B 3B8WA 3MLSH 1RUAH 3WD2A 4XZNX 5E4EC 2YD0A 3QNXB 1A5NC 1J05B 2F68X 5AUMB 5HGAB 3ZN6A 2UY2A 4QQ3A 2CH8A 1CK0L 3QRBA 2ISVA 1T0MA 2AHIA 1US3A 3ZXWA 3C87A 1D5MB 4PJCE 1VBGA 1JZIA 5F0MB 1BZ9A 5HHME 3K6OA 5CILH 4BHUA 1W8SA 4Z7NE 4XX5A 2E7CA 4C6JA 2N1TE 1HUVA 2VXVL 1NIDA 4ESKA 2LAAA 2PGWA 1PMYA 3HUJA 5I1IH 1XQLA 2AGJL 1TKWB 1DCEA 3U82B 1OY3B 4HOZA 1NP2A 8XIMA 2D7MA 2GVJA 3W39A 4GRMA 3KVDD 2YAPA 3HFML 4WO4C 2OMVA 2GFBA 3GH7A 1TWIA 1MI3A 2IPFA 1BBDL 2Z8VC 5JPNC 3SDDD 3NJXA 3VFGL 1RZJL 4E9YA 1ZXQA 1JCLA 5M17A 3UROR 3CWHA 3NN8A 2A7BA 3RJDA 5DHVB 3MA9L 3ORJA 4IIFA 1RZ8B 1A1NA 3B0PA 2AKZA 3TPKA 2XT1B 5A7BA 2HT4C 4G8AC 3FJLA 2ADAA 3I50L 1V5JA 4Q9QH 3WS3B 1VKFA 4IUOA 1S38A 1G7JA 1PDYA 3GMRB 3QAZC 1Y65A 5CZKA 3QS2A 1IZCA 5LHFA 5L0QB 5IJDC 3WBDA 4Y1SA 1HQRB 3IJYA 4IMLA 4LSDA 1YQ2A 2YLKA 2FR4B 3HPSA 3SGDH 2NY6B 1BFVL 1UCBH 5EBLB 4Z7IA 4U5KA 3AYRA 3LCWA 2E09A 3O9NA 1YMHB 4ZUTB 3W2JA 3P7YA 3NOEA 4E0RA 1P7QA 1QX1A 4W9EC 4CNPA 2ZF9A 2ZSWB 1GOIA 5AB0A 3Q5OA 2UZIL 2HJPA 3WHXA 4NRYA 2HKHH 2WSKA 4MMZB 2J8HA 4KZDL 5JPMC 2NYYC 3IGLA 5FOBB 2GY7B 5F88B 2VHLA 5DJ0B 4BEUA 2MANA 2V5RA 4Q32A 4FYRA 4RWYL 4N4PA 1UEYA 3B56A 1HHGB 4UTJA 2EYSA 2ZWNA 4RBPH 4X6BB 4TO8A 1F3WA 4X8XA 3S2MA 1NF0A 4NNAA 2FDBP 3BWSA 2VWEE 4Z7OF 1CYGA 3BUYB 1G4EA 4EJ1C 3OYZA 3EGDB 1MNZA 2G4GA 3H2QA 2VN4A 3VABA 5D4JA 4CADA 2VDNB 5U7SA 2ZOUA 1JD9A 3T0EC 3D0CA 4AL8L 4R0LB 2K3HA 1W72B 1B0RA 4UQ2B 4LBRA 5BO1H 3T0XA 1PIGA 3S42A 3AU6A 1HINL 4X99B 1MUMA 3NSYA 4L1LA 4KFMA 2VR4A 4HZLB 4B9CA 3DURA 3ECBB 3IAPA 3KR3H 2B14A 5I8EA 4KDTA 2QHRH 4TLTA 5J04A 4Y1AA 2J4GA 4J2MA 5FOJA 3SKOA 2CEQA 3L5XH 5AYUL 3N3TA 2V2TB 1PSCA 1L6WA 4XRCA 4KJWC 1S5WA 3MSGA 3T07A 3L48A 4TR9A 4GKOA 5DXXA 3S4SA 5J06A 4Y9BA 1BMGA 1NGYA 3IFNL 1KO0A 4MY1A 1XTMA 3FCTA 1TYJA 2OZ4L 1BG9A 3RLUA 1A5SA 3W76A 4NQ1A 1BWVA 4AMKL 4JY6A 4K73A 4XZUA 3TO4C 5IQOA 1TJIL 2GHZA 4PRPA 1VIZA 2CESA 3MB9A 5DEGA 5FW8A 3VINA 2BPBA 1R3IH 3BIKB 4XO5A 3F4CA 1A1MA 4A3HA 2GIXA 5FLUA 3NJFA 3WMBA 3S1VA 3WU1A 3TWYA 3QYQA 2F74A 2B4GA 4FQ2L 3OAUH 2Q7YB 5F4XA 3QQDA 3TNOA 4PLKC 4IHOA 3CXDL 3H26A 1I9IH 1OY0A 4FEIA 4R4FL 4WI2A 1LQ0A 4RDYA 4F91B 4JQIL 1PSKH 5AHLA 4R7XA 4A37A 1FVCB 1Z3NA 2OYMA 3QXVA 1ONRA 1VEOA 1Q6RA 3FU7B 3CE1A 3EO9H 5HMSA 4P7NA 3V6ZA 4EK7A 2OT0A 3T78A 3P0GB 4DO5A 5ICYA 2DIKA 3LGGA 1NSJA 4AI7A 1GYLA 1DSFH 2E9GA 3ARRA 4YHIA 5KZDA 4X8JA 4P7RA 3O06A 1MDLA 3AISA 4LASH 4JNMA 3S88H 1LBFA 4F80A 2B59A 1VKXA 4IP7A 3AABA 4MGGA 2E6PA 5HY9B 1CICD 4OD1L 4PVLA 2XXMB 4NC1E 5CP3A 3VXMB 3L3OC 2ZXWB 4O4YH 2ZWKA 1QRND 2HEJA 4LSVL 2VH5L 4PC8A 4HSCX 3MUGA 3E2QA 1E1FA 4WV1C 3UXDA 4ES8A 4NNPH 3OPZH 5I07A 1BIIA 1TQCC 2X1XR 3SSZA 4ANKA 4R27A 1J7VR 3VVWA 3TM6A 3MV01 1KLUA 3D87B 3ZO9A 3D0LB 3DN5A 4KZ0A 2IAAC 3SCWA 5C2XA 4DXXA 3Q9QA 4S0TD 5KBMA 4PMEA 2UZYA 1XYLA 4OBRA 1IBFA 3CFJB 4C47A 2HMIC 2WJDA 3MA7B 1PE1A 3OHXA 1JV2B 4Y9FA 1E50A 5CXPA 5DC2A 2VDML 2P8PA 5MENE 3BFOA 3TA9A 3H56A 3E0VA 4XNXL 1MW3A 3ISWA 3VE7A 3DIVA 5HVFB 3SR7A 3R4DA 5K1NA 3A4XA 1IEHA 1B0GA 2FVMA 3CL6A 3N17A 1FWCC 4X7SL 1MAKA 4NQDA 3AIVA 3W1RA 4YWIA 1KTBA 3WLWC 2P8MA 2IJ0C 3F83A 4KKBD 1OAXH 3PGFH 4U0RB 1DBAH 2WSYA 3HNSL 1OC5A 3WEMA 4QSHA 4BK4A 2WSPA 1X7QA 5ANHA 3D05A 1JPFB 4G9FE 4NZRH 2DSKA 3ZLGA 2DVTA 3F7PC 1MCCA 3QH2A 5D7IE 1IGSA 2LOEA 3UR2A 5JQ6H 1WBXB 2BS9A 4QG8A 3KH3A 1MCIA 1FPTH 5DMGC 3AMKA 1IHIA 2Y85A 1QSEE 1I0DA 3CHXA 5C0ND 3QPXH 1WKFA 1UWFA 1T21B 4KZCA 3V6FB 3QI9C 4XPTL 2HKAA 5LGKA 3QZNA 3VXRE 4BH7B 2QPFA 2HT3D 3DO4A 3RNKB 4PVNA 3K72B 2CKBH 3H2MA 5FA5A 4Q9BA 5FYLL 3R12A 3MOAL 1JR1A 4WY0F 1DLHA 2Y1HA 3TR9A 2YXGA 3DTUB 4APQA 1G7IA 3PJWA 3AQXA 4PR5B 3Q8EA 1XH3B 4TMBA 4WVXA 2BH0A 3GPSA 2WZIA 3A4FA 5AB2A 1CD0A 2NY5H 5IMMB 3NA4A 1CXHA 1WDDA 3QG7L 4LESA 1G4TA 4G59C 2DUXA 1JYWA 2CO7B 4O16A 3DX9A 1G7MB 4A05A 1GOOA 3MBEC 4HFWB 3RIFK 3GWQA 4PRHE 2NW3B 1TETL 2LABA 2VDQL 3ZMNA 3FGCA 4PRIA 2ZCZA 1XSIA 4N86A 2IH1A 1EBHA 2R15A 4O52A 2BC4B 1NQBA 5TQ0H 1PLBA 5DVOA 5TDOB 1WPCA 3V9FA 3E7JA 4FFYL 2FX7H 5F2MA 1W54A 3RWDB 4Q58C 3LQLA 3FDKA 3PFRA 2YUZA 2OX4A 1U8IB 5GRWA 3L5MA 2DT2A 5C6PB 1UUQA 4N6EA 4PUNA 4PRNA 3OA5A 1U92B 4DFHA 4DI9A 1AR1B 3PAOA 2DJUA 1YDNA 1KGCE 1JFQH 2IBBA 5SWZD 1VYRA 1FO0L 3VCLA 2QJDA 3UZJA 4KRPD 1N3NA 5C0BE 4W88A 4NZUL 1Y6MR 1HIZA 4D3CL 4LRNL 1AKJD 3MKGA 2CBIA 3O16A 3WQ8A 5CJ8A 5HDBB 2WQXA 4ECNA 3FQWA 5F1NB 3SDXE 4Z3IA 4EN3C 3C5SA 3FPYA 2FVLA 3SB0A 1MEIA 3ATDA 3D85D 4P23D 4PUBH 4E4FA 1EAJA 1G7QA 2VXSH 5A2CA 2J21A 3RPTA 3EOYG 1KZYA 2GGIA 3NIDF 1NGWA 3QDAA 2A38A 4A39A 2P48B 3ET9F 1HSAB 2R8SH 2PP7A 3FTWA 4ELMB 5HDOA 4K6AA 4AUBA 4F7PB 2AXJA 2H32A 3FFCA 3IJHA 3UJIL 5E03A 1KC7A 1OM9A 1LQSR 4AM0B 3WCZA 4LANA 2EILB 1IMHC 4QDGA 4EI5A 4QRSB 2JJSC 3GG0A 2Z7ZA 4LNRA 1YNKL 1EDGA 3LCIA 2DYSB 4UTCA 3MLZL 1SZGA 1E5NA 1AY1L 2JIWA 2AEQL 3ZJ7A 1YYLL 4HB7A 5I1GL 1D6EB 5CEXA 1KBVA 4IMAA 3V5FA 3P67A 4BUQA 5BXFB 2VDLB 4HHAA 3DX5A 2O6DA 2CALA 4HJ0C 1H0DB 4BWTA 2L5HA 1HKWA 2QCNA 1HNGA 2OMBA 2ZUQC 4N2YA 3GSWA 1RZKL 4DJDC 4N3UA 1Q13A 2BX5A 4POZC 1UZ8B 3CWGA 4Z2IA 1TMHA 4NN6B 4BFEA 3L4ZA 1DTUA 3NVDA 2VDRB 4LCRA 5T1KA 1GEQA 1RZJC 2VUKA 2OWWA 3F05A 4R3SB 4Z2KA 2PTWA 2AGTA 5C5YA 2D0HA 1FDZA 2A4EA 3QVQA 2BCKB 4XN9A 3QJXA 4PJAB 3GD1C 5GS2D 3U46B 1U1JA 3CFIC 2DMHA 3UO8B 3C2FA 3GTNA 1BQKA 5IVXB 1TX2A 4JX5A 4M48H 1BGXL 3D2UB 1LBMA 2YSSB 1R87A 4I18A 4GUOA 3N29A 5I6SA 2XPZA 3QZBA 1OCRB 2LV4A 5LWYL 1D9KD 4DEPC 3DIDA 1LEKB 5D7JC 1NCHA 4XXWC 1OX5A 1PYWB 5K9JH 5I8CA 2JH2A 5GRXG 1M41A 5E8DL 2DH3A 2DYPA 4JFFA 2YSWA 3FOLB 2PR9A 3BWZA 1LVEA 4DVBB 3O45A 3VWJA 3IETA 5DLML 4XXCC 1CB4A 3L9YA 3BYYA 3VD3A 3E8UL 2BVUA 1RPXA 3BPNB 3IKKA 3OJVC 3PHOA 2X2YA 2XPGB 4N2HA 3EOAB 2PCXA 4MLIA 2CFFA 3SQSA 4QJ1A 1KXHA 3GO1H 2CXGA 4YSAA 5FK9B 2DIEA 2X1IA 4GFSA 4NQUA 3P4NB 3WNIA 1KJVB 2XPYA 3GXMA 3T44A 4RBPK 3QR1A 3PBYA 1MFUA 1UD2A 5D71H 3WQOA 4A67A 1V02E 3RWJB 5IV2A 5F9OH 2FBJH 1RI8A 3DROA 5F1IA 4GVHA 3AREB 5DJYA 1PKQE 3CSYA 4WK2B 5IB4B 4GXPA 4LWWA 2X4PB 4FQJL 5IT2L 2YD6A 4UOW0 5DI8B 1DR9A 2NQ3A 3I7RA 1Q6CA 4M19A 2O7SA 1T3FA 2CRZA 1NCCH 2FUQA 4AL8C 2A1WL 4WK9A 3PB2A 4LAKA 1S8DA 2DWEA 3IMBA 5DSCB 2I26N 4QWWD 1X9QA 4GT7A 4XBEH 4W7VA 3EGSB 5E4AA 4OF0A 3TJHC 2PLKA 1E1EA 3TCXA 4FI6A 3VXTA 1RK1A 1TF4A 5EC2B 1FTXA 4TNVK 2R0ZL 1N7MH 2ADYA 5IFAH 4N8VG 2Z8SA 4GJJA 2Y8KA 4E41E 4F3FB 1EPVA 1WBYB 3REQA 3L1GA 2K6YA 2BJML 4WW2B 3C09C 4HUWB 3MGAA 1PPIA 3BP6B 4P3CH 1IEVA 5FJPA 1WAAE 2L04A 1MMFA 3HPXA 2ZZ2A 4FG6C 5C97A 3BMWA 3TOPA 3HB3C 4LLUA 3RJYA 4Q9RH 3EXLA 3FJTA 4FQHB 4KRUA 4LH8A 3R0NA 3V0WH 4B97A 2V38A 1O4UA 4HAGA 3GT6A 3PXLA 2CDGB 3U57A 5CBAB 1NBCA 2C1PA 4C55A 4CCCA 1F97A 1IXOA 2LHAA 3K2GA 1A6TA 5LQBH 3RLGA 4OLVH 2H1XA 3KPOB 1HC1A 3WH5A 4XCEA 3LM3A 2R29L 4ENLA 4BE6A 4YFLI 1UOZA 4JQVC 1A0DA 3MMTA 3OYXA 4XVUC 1EUTA 2IXQB 4F48A 3FZUD 5DMIH 1OM3H 4XCFH 3GUWA 1TZAA 2BOLA 2K45A 4Z7VB 1OARH 4G9FD 2DLHA 2F8OA 2NZLA 3RIFF 3F2CA 1BD2E 2OPCA 5DT7A 1W91A 3D25B 4U6TA 3S5SA 2H8PB 2YPIA 5DUPH 2CGZA 4KHTL 1OGTB 1DWJM 1P84J 3UMTA 2VITA 4ZE4A 5EZJB 4PJEF 2OT1A 1QSED 3MLVH 4RNIA 4XODA 1XKJA 3HPLB 4LVHB 2WOBA 3N12A 1HKJA 1IKFH 1X4YA 4Z2GA 2WCPA 4PJDB 4K7PL 1KWKA 4JFDA 5FW7A 3ZHFA 4WKZB 4ZUSA 4L8DA 1ISYA 5EF3A 4S3DA 4HPXA 3V0TA 3L2MA 2JKLA 4GRWF 4YJ5A 4RSYA 2AF2A 1BRLB 3KZ8A 3P74A 3BKYL 4POUB 5JW5A 4U2YA 2RCSL 1XLAA 2P5ED 4QJ4B 3G6DL 2MCPH 1UD3A 2PA6A 4QRTA 5IGXH 3QHFL 4HPOH 4ZQMA 1JAEA 1Q8MA 3V0EA 5LAXA 5JUEH 1J0JA 1KM6A 3WD5L 1I9JH 1TJGH 1EGMA 5J8OA 4TVDA 2CA3A 1TJPA 4LSSH 1ECEA 3W82A 3CL7A 4OOZA 2BVYA 4FXKB 5C0DA 4F2MB 5DMYA 5DZNA 1G0DA 3I6GA 4BK8A 4I5BA 5FUZH 3WNKA 4GPNA 4JLRB 1DWAM 1Q6OA 1KN2H 3K91A 2XH0A 1OGAE 1TEGA 4KZEH 4MHHI 2Q8BH 5I73B 1JNEA 2EDEA 3D39A 3NUKA 1GVOA 3AZTA 2ZF8A 5F6IB 1WAPA 2BOCA 3IDGB 4MVBD 4ETQB 3OGVA 4HJSA 3UAJD 4POCA 4GP4B 1FBAA 3I4EA 3MLWH 4KOBA 4KNUA 3CK0L 2VM4A 1R6VA 1PX3A 1VPQA 5FM5O 1E5YA 3POCA 4Z1YA 3QXUA 4GAGH 3V5KB 1XR8A 4KDVA 2BW4A 4G8GB 2NY1B 1S5NA 2FQFA 1RZ7H 4HIXL 3B3IB 3IIVA 3G6JF 4D94A 3MV7D 1IAKB 4KERA 1K3IA 3L5JA 1JCNA 3GZPA 1LMKA 5AL8A 1MH5A 3H42L 1A6VH 2JKWA 5E2VL 5GISL 4D71A 1KFWA 4EEEA 4KK6C 1W9UA 3A4WA 4J8QA 5A2KH 1RCXB 4HD9A 3Q5TA 1FWWA 3GEWB 1NBQA 1KV3A 1A6AB 5D03A 1H19A 4HD5A 1GORA 1K8DA 4FXSA 3MLRH 2IPWA 4ZMXA 4US5D 3ZTEA 5ID1B 2AI0L 2FLRT 2GW5A 4FKHA 1LILA 1ZSXA 3WS6C 3APFA 4F24A 5H8PA 2YAMA 1JPGB 4L65A 4TSAH 4V1DE 4B9IA 4CGUB 4KK8C 1SBSL 2NQJA 1BG1A 1YMMB 4KHXL 5TDNB 1A64A 3MGOA 4X6EA 5B7MA 4MQSB 3W7JA 2X4RB 4ZR8A 4LSUH 3B2DC 3PJTA 1KB5A 4IDJH 3VTMA 2E7MA 4KPHL 2AQVA 4RPQA 3OKOA 3CB8A 7ENLA 5C0CB 4RFOH 4BXSV 1L9QA 1UT1A 4JO8A 4XC3H 2E28A 3VNKA 4J3BA 1ZIBA 4GO8A 4QRAA 2GPZA 3OJ2C 1M9SA 4UTLA 2A0LC 4ES9A 3BEWB 2OWXA 3EJCA 1AJ0A 5AAPA 1V6YA 1JPSH 1JZJA 2YB4A 4NG3A 1QPOA 1OHZA 3CHVA 1EMTH 4HWBA 1F86A 1K7XA 1VGAA 1XRSA 3BVNB 5K39B 4DN1A 1AMKA 4YDLB 5D8ZA 4YR6A 4MYPA 3ES6A 4H5SB 2XOTA 1RPQA 4RIRA 1N9PA 1XISA 1J8KA 2EXWC 5HQLA 4UTWA 5TFSL 2N7BA 3U9UB 3RY4A 3VXSB 5HA7A 4N2FA 2Y23A 1DFBH 5BUGA 4K8GA 3L3KB 4AZCB 3BLKA 3W5NA 4QHPA 4G56A 4NWTH 4IRSA 5TE6L 4OGQC 1BWWA 1EFXD 2LVCA 4EVNB 1HGWA 5FEBA 5KSVB 4ERAA 3WQWA 1DBJL 1A5CA 2JF7A 4G2DA 4Y5XC 1PW3A 3ZT6A 1DWFM 2V9DA 4AH7A 4MXWL 2BP0A 4UV7L 2VFDA 2JSFA 1CDBA 2FATH 4DP4X 2JGQA 2PDHA 3EWCA 2NV9A 1QFEA 1VFLA 1WH0A 4JN6A 1RUML 2VZUA 4ZAKB 4RCAA 2APTA 5I23A 1AS6A 2RIKA 4KGJA 4BFRA 1NCDH 3GQYA 4PPTA 3EOEA 2Z1PA 4TNVF 1VBRA 5IMLB 1HJSA 5TIMA 3C5ZA 3P3YA 3CPLB 3ZY7A 3SDCA 2R0KL 2V17L 1RZKC 4JIPA 2HN7A 2NX5E 4WHYH 3VYNA 3H9HB 4LAQL 3OKLB 3P60A 3NJLA 5HMDA 2VFIA 3UG8A 3WYRA 2VM9A 1XLMA 3VD1A 2Z7UA 1KC5H 1PB0A 3OGSA 3O6ML 2YA2A 1US2A 2WMPA 2PURA 1W5NA 4LUJA 2W9MA 3H4FA 1RQEA 4GW4B 3CVHH 1YEIL 1VFOA 1NEUA 2AV7B 5JXEC 1QR1A 1RSFA 4ENZA 1J5OH 5DZAA 2XFRA 5FUOH 2IPJA 5KSWA 1AZ2A 2BHZA 1MZYA 3ULVD 2D03H 4IRJD 3PWNB 3IV3A 1R3QA 2DW7A 1THFD 2FSEB 4HLJA 2DQHL 3NGBB 2W0FB 5CCKH 5AAWA 1NFDA 1T04B 2FX9H 2JCCF 3CU2A 1UKPA 4G1KA 5GSVB 5I75C 3S6DA 1IO4C 5HYJA 4X5PA 4C4UA 3NABH 3W7IA 3HIJA 1F56A 1NWOA 4LCSA 2IGFL 4D7PA 1JXKA 1PIIA 4U1KA 5EA0H 2ZVIA 5ACLA 2LU4A 5FM5M 4QTIL 4PJFE 3VQLA 4OUOA 4TQIA 1U36A 3PWJB 2P24B 3AU1B 3CDGA 3D3AA 3ZRFC 1XF0A 1N67A 3AWFA 3NACL 3M17B 1LEIB 2YXWA 4K9JA 1TCRA 1CWVA 5LUMA 1H62A 4E41D 3VI3A 3UP8A 3WFCH 4PGEA 1CVSC 2R9HC 3A12A 3BVVA 1ESOA 1KY7A 3KJ6H 4NHVA 5A6SA 1KFAH 2CNZA 4IHCA 2EABA 1GYUA 2YCKX 5F2GA 1E1CA 3QIBD 4JKMA 1PFOA 4MXVE 4W8AA 1YSOA 1MVFA 3DUSB 4YGVA 3SGGA 1R3KA 1A9EA 4YLQT 4S2BA 2J44A 4ZS6C 1HKIA 2IQTA 1S7WA 1QEWB 1WFUA 4EBQL 5EZPA 3FYPA 1FGNL 3PZQA 3OC5A 4XAFA 4RMSA 5C9JB 2JKAA 3QDHA 4YO0B 4JJ5B 3OQEA 4GXVH 3WK0A 2DQMA 3H7UA 3ULUF 3PV7A 4G42A 5L6YH 2RQEA 2P3YA 2WP3O 4S11A 4MS8C 3SSJA 3PB0A 4A2GA 3MCMA 3GBNH 5JA9A 5BRZD 3ZKMD 4UBDD 4TULL 5TE4H 4PB4A 3GLCA 4FOUA 5ADPH 3HI1B 1A3QA 4V1YA 3GDMA 2VLJB 4P99A 4TPRL 4NT6B 2DN7A 3D1MC 3VXUB 4AB4A 4KC3B 4UQIM 2Y6ZA 1DQXA 1SGKA 3SCMB 3C0JA 3X11B 1U8NB 3DFOA 3L5HA 2OX1A 4WTZA 1V03A 4RJEA 2DT1A 4YFDB 5DRXA 4LSBA 4M1CC 4IOFD 1BA9A 3Q4DA 4PS7A 1ZBWA 2A3HA 3BI9X 2YC1A 1H5BA 3KUMA 1UM5H 3ZWSA 1S7XB 4WWKD 3MZNA 4TIMA 1IKNA 4O18A 4E3TA 1TA3A 2OJPA 3RDKA 1QSFA 3GQFA 5T5FL 2QV2A 4Y2LA 5DLLA 3D0VA 4JK0D 2FD6L 5LYRA 1G7PB 3SDYH 2BFVL 3KYOB 1GW1A 4H9TA 4IP5A 4XMPL 5AKRA 5GGRY 4GI4A 1OP9A 3RWGA 2YMTA 2E7LC 1UA7A 4KI5F 4R8WL 5HI5D 3DHUA 3GHBL 3L4YA 2AJVH 1HW6A 1FFQA 1PTAA 2CO6B 1HZYA 3LKNB 5KVDE 4QIRA 5J9PB 3MLXH 1I8MA 2EACA 4CW1A 1RAMA 2PYFB 3ZTJG 2DWXA 4GAYB 4IIQB 3U4EA 1FNEA 3MP5A 2OL3A 4IPIA 1N7KA 4PMFA 1OGAD 2LLGA 2JTDA 2C3XA 2CCLA 3HRPA 3RTQB 4L3EA 5CJOL 5F8QC 4GXWA 4NQQA 3L9EA 1F6AA 3CZGA 3I75B 4B50A 4EOUA 2BY1A 3W22A 3LKOB 3ZE2E 4K3JL 3A3HA 1AS8A 1OE3A 5GS1A 3ARDB 5K2ZA 4CQCA 4U3SA 2V2XB 1HWHB 1M7OA 1XF5B 2LLLA 3S35X 4R5EA 2ENJA 4DW2H 3GNRA 1JGEB 4LQ1A 1BWLA 1G43A 4O2FB 2B1HL 1RP8A 2JIEA 5AAMC 3MKKA 4JPVH 1JFXA 2QCEA 1EXUA 4DQOL 5HPCA 3CUJA 1FNLA 1EOKA 3OTRA 2FECI 1BSLA 1RCYA 3RG1C 4PWKA 5ADOH 4S1QH 2VN3A 3SGEI 4HIPA 4QRRD 2XC8A 4FZ8H 3VC6A 2H0PA 3DFHA 1RURL 4JREB 2PDQA 4AVNA 3KOYA 5KJ7E 4C6EA 1T4KA 2DB8A 5AVXB 2QSCL 4LGXA 3INUH 1CLZH 3WV0A 5KBLA 2OMXA 3WUBA 1INQB 1FXPA 5HWJA 2WWCA 3E6HB 2E1DA 2ZZ6A 2KZ1B 4YDIH 3MCLH 3JWDL 1F8MA 1NAMB 4JN8A 4MCMA 1W8EA 5FB8A 4Q0XL 2GDQA 2ED6A 4JZOA 4M5SA 4HKZB 1S1PA 3RL2A 5D9SA 1SO4A 4P2QA 5KVMC 1AD0B 3A6BH 2UZXB 2E9JA 1QBBA 4LKXB 3BMXA 3VRIB 1E9PA 3ZE0B 4HWNA 4N1EA 5DEFB 1ZVSB 2IMNA 4ZXBD 3MV8D 3W3OA 4HGWB 2VCBA 2UY6A 4MA3A 4EIBA 5HYSA 2X53A 5IQLA 5HJLA 1DEEA 1D2KA 2E3ZA 3EXRA 1BZDA 1EAPA 2CHDA 4JDTH 1U3ZA 2Z1WA 4QGYA 2CETA 3QCVH 5KSAD 1XT5A 5I06A 5D9PA 4D9LH 3IFPB 2WM1A 5C2UB 4G83A 1XG3A 1RMFH 1DWGM 4S39A 3FNKA 3FYEB 3TK7A 5D2NA 1KM2A 2P47B 3LPPA 3MOQA 3FLUA 1KJ2A 2CBVA 4JTGA 2HTKD 5HI4D 2VM8A 2FZ3A 4C56B 1XKYA 4YAQB 3VIKA 1Q6EA 2NY7L 4PJHF 5DJZB 3V1HA 4GRWH 4M7LL 3DHMA 4AJWA 4GP5B 3N4AA 1N70A 3ELAT 1A7RL 4DZBB 2O5YL 4FZEH 3TJEL 5MI0B 5EOQH 4HKPA 1NUFA 2OXGB 4Y0GA 3WG7B 5B3JE 1F11A 3BP5A 4KBXA 5JQIB 4YBQC 3OOQA 3GNMH 3MUIA 3GKWL 3FFOA 4FQXD 5EMMA 1DHKA 4NM4H 3PS6A 5EC1B 3BWAB 3NQVA 3WFHA 2PTTB 1EJTC 4L4TB 2KLSA 3QC0A 4QEGA 1C7TA 4DGUA 1ONQA 2RFXA 3NQEA 3AALA 4JFPB 3T1FB 4R88A 4POYA 3RCNA 3ISIX 4M51A 1GTFA 3T40A 1OIFA 4HV8A 5LGYA 1N8ZA 3M0IA 4KDTC 4K7YA 1LRQA 1P4IL 4G1EB 5LIXX 2GAZA 5DHYA 2NX5D 1HL2A 4JNXA 3GTVA 3RU8H 3B8SA 1RHHB 4UILL 2ISDA 3SDOA 1DOSA 3ABKB 2GLKA 5FS5A 1TIUA 3UCQA 5DZVA 2NZ9D 3N14A 3MRRB 4F7MA 4HIIB 5SWZE 1MFDH 1V08A 1XUUA 5HHNB 2J4WL 4ZXOA 4BH8B 1MJUL 3LKQB 4F15C 1MNUL 2XWRA 1FNGA 1AZCA 4FXRA 4E2BA 1AS7A 2ITCA 2B2XL 4M0XA 1RZIB 3U0PA 4DZ8A 2Q01A 4QAIA 1YY9D 2OKOA 3SGUA 4P4KA 4M61B 5JBDA 2ZOWA 2RUSA 5ISZE 4GH1A 1HQ4B 1Q7QA 1J2BA 2N59A 3LD8C 5E08L 2WXFA 4MAUL 5FF6B 4MS6A 3NCJL 2R39A 3PWPA 1BAFH 4DN4L 2A6KA 1BD0A 1TTIA 4Z2HA 3I6EA 2VX6A 3WF3A 5HDRA 2NQHA 1SRDA 4AE1A 4K2UH 4WJ5A 3CHSA 4EI6A 5JH2A 2C91A 4I0PA 3GMMB 4P7LA 1AQFA 1DVZA 4F7EA 1BTMA 4ODVH 3N2TA 6ENLA 3DXAD 3BPLB 4X9FA 3NNTA 5I1LB 4ODUB 4GYKA 3W25A 1XLDA 3HO8A 2VC2B 3R7RA 2R0LH 1P5UB 1LE5A 1CF1A 4MRBA 5DFVD 1ZAJA 1C08A 3TYDA 2QJJA 3KYKH 4TNWK 2FMNA 1T96A 4OZIF 2AMGA 3PGDB 4FTVB 4J28A 4TL4A 4G9PA 3NIFB 3C52A 3W1LA 2Y36L 4YHGA 4BFJA 1X9UA 3C75A 1SJAA 3ARQA 5TQ2L 4WKFA 4H8VA 3ZW3A 3OHXC 1U8OB 4RW3A 2Y5TB 1NFIA 3TYGL 1OFPA 4CMMA 1TPUA 1T1YB 4TQ8A 3JV0A 3IU4L 3GHPA 4UMSA 3HMWL 3IAGC 3VFWA 2XQYK 4F7TB 2CKBA 1KIUB 1WO2A 2YAEA 5I7GA 2ZDRA 3W7QA 3DVGA 2HE8A 3AQUA 4WUUA 3BXWA 3TNMB 2XH7A 2Y9RT 4S3CA 2ZWYA 1JCJA 1TPXC 4GCAA 4MNGA 4KCWA 4E9TA 4O28A 1FUNA 3CHQA 1NC2B 1HNYA 1PVNA 2A5HA 4NAFB 4X61A 3FTZA 3GLAA 2GY5A 1HI6A 1OOWA 3WFEH 5INCA 1EBPA 1UXSB 4HPGA 1MCOL 1TPC1 4WFFD 1CQKA 5FGBC 4GRLA 2NWSA 1CJYA 2Q6WA 3W23A 2FWSA 1A0QL 4DAIA 3KHOA 4W85A 3TTOA 4YHOL 3QXDB 2WOYA 4GC4A 4KUCF 1PGRB 2WWOA 5EIIG 3CVIL 1NC4B 1UCTA 3QW9A 4DF1A 4B5VA 2QAFA 4IU3B 4M7ZC 3PZOA 3DRTA 3UIZA 3CG8A 1BXXA 5J6GB 4PB0H 4GQQA 1S9KC 5EU4A 2NXYD 4ZX6A 1XGYH 2I9LB 4LBEA 3CQIA 4N85A 4O2CA 2BIMA 4O1AA 2XKNB 3TYEA 3HGSA 2V5JA 2G3IA 5I1EH 4MHBA 3L5IA 2AW2A 1WCBB 5DVNA 5A6IA 1VCAA 3OVUB 1E4WH 5FHBL 4JQ4A 2WINB 1YEHL 2Y0SA 3GDCA 1CLCA 2ED8A 4OCSH 1WJ3A 3Q58A 2V82A 1H6EA 2DD8L 3MBXL 4LYKA 4AW7A 4LB4A 3LTYA 4L5ZA 2Z8RA 3WQDA 5K4ZA 3R89A 4U5IA 5ESVA 4CQAA 4FNQA 4L3FA 4TL5A 3G18A 3T8XB 3BV4A 3CQHA 1KLGA 4K68A 5IOBA 3SJVA 3L9RA 3B0XA 1MCEA 2CLRB 2CC0A 4MQ7B 1IGWA 1NGPH 5AYQA 2ALWA 2BOBA 4ORGA 4JYFA 4UB0L 3BSHA 3D9AH 4CSSA 1I8KA 4OTKA 5LXXA 4LF3A 4RA0C 2P4AB 3IARA 4Z9KB 1N68A 1KB5L 2OR7A 3UJTL 3MYJB 2RA1A 3MOBL 4I90A 3WEXB 3BAJA 5ACZB 3O0FA 2J7EA 1GYWA 3FRUA 3B83A 4PJGF 1FV1A 5BMWA 2WXPA 1IFHH 3STEA 4U1MB 4TUKH 3MLYH 5CIPH 3L3IA 4JFQB 5I2IA 4NRZA 1NOWA 3LHAA 2XA8L 3C8KB 1BJ8A 4KTDH 4RNRB 4DWSA 4RGOH 1AL7A 3WTWA 4HWBL 1Y0LB 2F2HA 1AGBA 5BZWB 5C9KA 2E9LA 4HK5A 3L12A 2P53A 3KLAB 4DKFH 3GIYA 4OZOA 3MMEA 3OM3B 1NFKA 1QR7A 4FS9A 4FABH 2DBLH 1IEAA 2XZAL 3ECVA 2YGQA 1ETZA 2YCIX 4EMZA 4M3HA 3REVA 1QI0A 1FWRA 4X6DE 1HSBB 1OBAA 1LDSA 2HBVA 1U5JA 4TX8A 1A49A 4WY7L 1QUPA 3MJWA 3WAJA 2WWKT 4H00A 3KJ4B 2XYLA 2DJXA 5GRJL 2CZNA 3ULUH 4Y4HA 1VLXA 4FJZA 2OGJA 1US0A 5KJ4A 4EI5C 2ZE3A 3T0VA 1RZPA 5KVFL 4GG6E 2XIJA 3RX8A 4OBTA 5EUOE 3QCUL 3ECUA 5F7DA 3C08L 5F7BA 5DRZA 3T5WA 2QSTA 3FK4A 3GJFH 1H3PL 2BVDA 1CR9H 3WO3B 1ASQA 2XM2A 4ZTOH 1LQAA 2PCFB 2ZXBA 4W87A 4ZW5A 3T4AA 4KV5E 4NHUA 4HPYH 3M1ZA 3RR4A 1S3KL 4ADGA 4YDV