1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords ALPHA-AMYLASE
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
3B9EA 2WMKA 3WENA 5IDIA 1E73M 3BC9A 1PX8A 1KXHA 4UQBA 1Q6FA 3W27A 5E0CA 3NSMA 3KWXA 2E0PA 1E4IA 1HXJA 2VCCA 4PUEA 2JIWA 3LXAA 3OIHA 4URIA 1PAMA 2WNWA 2JEPA 4W7UA 2X05A 1DWIM 4MAZA 1GOQA 3GBEA 3BUQA 5BXPA 1O6IA 3WMCA 4AEEA 3A4XA 1CGVA 1G0CA 1E72M 4FLQA 4AYGA 1EIBA 2CBVA 5DMYA 1W3HA 2BHUA 4TXEA 6CGTA 2FDMA 4PMVA 1WDPA 1JFXA 4W93A 1W9BM 2W63A 5A6BA 2UY5A 4IM4A 2O9RA 3QOMA 1NWRA 1RPKA 3K4DA 4OUEA 4U31A 1UUQA 3WBAA 2WZEA 2QMJA 2VRQA 7TAAA 1ITXA 2CCRA 4C7GA 2YFOA 4FNRA 2XPKA 1UA7A 1CPUA 1J0JA 3EJPA 1EDGA 1GQKA 3AIWA 4CCDA 4D6FA 5DT5A 1XYFA 1E4NA 2D73A 5CG0A 3TP4A 2DSZA 2D22A 2BHYA 3AS2A 2BNJA 2WMJA 1BQCA 2UY4A 4GZEA 2GVYA 3U7VA 1CLVA 2G3NA 3WNKA 2WLYA 4C7FA 3EDJA 5A94A 2D3NA 1IZJA 3SCNA 3WD3A 4BS0A 3EJSA 5JIPA 3AXXA 3AZRA 4W8AA 3A5VA 2V3GA 3WDQA 5M03A 3SUUA 2ZE0A 4JAWA 4OJYA 2BXZA 5A3HA 3BUBA 3CUGA 1C7SA 2JFEX 1BG9A 1C91A 1WDRA 5CXPA 2JALA 1MQRA 3AYSA 3ARXA 4W85A 1QPKA 3WDPP 5A95A 2VQTA 3MV01 3VVGA 1UR1A 5E0FA 4UOZA 1CWYA 3ZSTA 2W62A 5JBEA 1TFVA 3O2LA 4X0NA 1QI4A 1MQPA 1UR9A 3AHTA 3PZOA 5GQBA 3AIVA 3HJEA 4J27A 2WMFA 1HX0A 1NWTA 4WK9A 3WQWA 3QGVA 2W61A 4W8LA 1XV8A 5E6YA 2OWWA 2B31A 2DH2A 1H09A 1RP8A 2DGAA 2WSPA 1C93A 1C92A 3VIPA 2WVVA 1JDDA 1GW1A 2XSBA 1E0VA 4QLJA 3EBVA 1M53A 2XIBA 1WZKA 1B90A 4JKLA 3BGAA 3QHMA 3CZSA 3CZKA 3HG4A 5D9PA 4CD5A 4YN5A 3ZSSA 3UG4A 3AOFA 3BXWA 1XHGA 2YA2A 4FNPA 1CGUA 1OSEA 1WO2A 4KH2A 1B2YA 4AD5A 2JF7A 1TR1A 1ISYA 3WQ8A 1VF8A 1V3MA 4ATLA 5A6KA 3WDHA 1UR8A 1W1VA 4IISA 3WUFA 4YHGA 1NQ6A 1V6XA 2V5DA 4PMYA 2VVNA 1JF6A 4EE9A 1GOOA 3SURA 4AIOA 1US3A 3WH8A 1W1YA 1UKPA 3DDFA 1JXJA 2VZVA 4A3HA 5FL1A 5DF0A 3CBWA 5I5RA 1Q6EA 5EFDA 4OZOA 1JF5A 2ZUWA 1EH9A 2NSXA 1I1WA 3JUGA 2XTKA 4LPCA 3BLBA 1CGWA 1WP6A 5KEZA 5BCAA 5M3WA 4PTVA 2PWHA 5LA1A 4JL2A 5GPRA 5GNYA 1KBBA 2EXOA 4W8BA 1HVQA 3UERA 4QLLA 2ZX7A 3ZIZA 5D9MA 1GORA 1GVIA 3MMWA 1UKOA 1WE5A 3OGRA 2XUCA 4AZCA 3AHXA 5CJ5A 2Y8VA 1OWQA 4M81A 1WDQA 2OYLA 3AIBA 2O9OA 2QV4A 2CESA 1B0IA 2E9LA 1BYDA 3N12A 5LA2A 2J7GA 1KQYA 3PHAA 4JZ5A 5FKYA 3MUZ1 5CSYA 2DDXA 4NZCA 3EDKA 1JZ4A 3UG3A 1W32A 3AI0A 1JAEA 1FP9A 2W92A 2V3FA 1W1PA 4UNIA 4CGTA 4AISA 3NCOA 4B16A 1V0MA 3IJ8A 4P8WA 5ABGA 4D1JA 4ACYA 4ZEPA 4KRUA 1E6XM 3GXNA 1BTCA 1QW9A 4JHOA 3OG2A 3F4VA 2GDVA 4M56A 2PWGA 5AYBA 4MNKA 3AHZA 3BAKA 3PZGA 2XVPA 4DM2A 2F7OA 1TMQA 2EADA 1YHTA 3IGUA 2VMFA 3PZIA 4E2OA 2ZIDA 3WUEA 3EDDA 4H8UA 2WYSA 5A8PA 2VRKA 3I3EA 5CQ1A 1S46A 4WSKA 2Q8XA 1EQCA 3LMYA 1KGWA 2ZWZA 2V3DA 1FH7A 4B3KA 5BXSA 5M5DA 2UWFA 4ACZB 4GZJA 1UG6A 3CHDA 3MU7A 1H2JA 1VBRA 1BPLB 3S6TA 5A6JA 3N1AA 1TUXA 5I24A 3VTRA 3DYPA 1UKTA 4H41A 3W29A 4MDOA 4JFVA 5LYRA 3AMGA 1HF6A 3T0AA 6A3HA 3CIVA 3DX0A 1W9XA 2EABA 3VIGA 2ALWA 3DX4A 3W0KA 3CPUA 1OINA 3THCA 1O7AA 1UD3A 3U7BA 3VKKA 1TA3A 3WH7A 3MUY1 1AQMA 1WB0A 3I3DA 4W7WA 4PMUA 3GXFA 4U5IA 4KRTA 1QWUA 1GHRA 3GBDA 5HDRA 1OBAA 2YDRA 3TA9A 3W26A 1VENA 2YOCA 1ZL1A 2WWDA 4NSBA 1TQWA 1EDTA 3L4UA 2A3EA 1HKJA 3SUTA 2QLYA 4AZBA 3AXIA 3UR7A 3GXDA 1CYGA 1V0LA 1ZU8A 4ACZA 3VIFA 3OLDA 2X2IA 1QI5A 2VVSA 2D3LA 1VEOA 3WNPA 1NOWA 5A2CA 2YLAA 1JD9A 2WHKA 5BWFA 5EBAA 3VIMA 3WUBA 3M46A 4CCCA 1ECEA 1HJQA 1X6LA 5A6LA 4M1RA 1SR0A 2DH3A 4AW7A 1OB0A 4KMQA 2EBNA 4F9DA 5I3DA 5JBDA 3WEOA 3EJQA 2CBUA 4UFMA 1E4MM 4GO9A 2CBJA 3VILA 4BCEA 1J01A 2BS9A 3VIKA 4U33A 3CZJA 2BY3A 2CXGA 3VX0A 4DWSC 1W9VA 4P7OA 4AD3A 4GZIA 4IPNB 2QPSA 2VURA 2VL4A 2VCBA 4GI6A 2FGLA 4IPLA 3II1A 4Q22A 4BQ5A 3HG2A 3SEPA 3WD4A 4OGZA 1HIZA 1XYZA 3PZ9A 4D6JA 3WY1A 3U57A 1K9DA 3WELA 5DFAA 1Q4NX 2NT1A 3IAQA 4DWSB 4FF5A 3VDCA 2VRJA 1JIBA 4D6GA 3GXMA 3FY1A 1JI2A 1JNDA 4PCSA 1E15A 3O9NA 2BY0A 1TA3B 5M17A 3PZNA 5A6BD 2J7BA 2J62A 1UYQA 4HP5A 3ZMRA 3VGHA 5A8OA 4NRSA 5A6MA 4H8HA 1PBGA 3W6LA 1LWHA 1MVYA 3FAWA 1CGXA 5D4YA 1GONA 4AMXA 1ZB5A 1UR4A 1BYBA 1HJXA 2XN2A 1W91A 8CGTA 4R27A 5BXRA 2VO5A 3EDFA 1JZ5A 4N0RA 2VJXA 1OCQA 1PIFA 1V6VA 4DO6A 3VNZA 1HXKA 4JIEA 3D52A 1VFOA 1Q6DA 2VZSA 1V0KA 4MB5A 3HG3A 4BF7A 2D0FA 3H55A 1WNOA 1PX3A 2JIEA 2WHJA 2WCAA 4S3JA 1JFHA 4BA0A 4M29A 4UQCA 2WB5A 3ARWA 1JZ3A 3VMPA 3VD5A 3G6MA 3VM5A 2AAAA 4PMXA 2Y8KA 2XHYA 1HL8A 3EJUA 5CPQA 2X1IA 3KLKA 2IGTA 2WVSA 3BLKA 3PN8A 4HOZA 3T08A 1KXTA 3LPOA 4F8XA 3EMZA 3U5YA 3WBEA 2ZXQA 1H0GA 2IUZA 2YL9A 3J7HA 2D24A 1SZNA 3F5LA 2XN0A 1J9YA 1U33A 2XVGA 4J3WA 1NARA 1UZ1A 1E6PA 2UY3A 1L8NA 1AVAA 1UHVA 3A6OA 3A23A 4JFSA 1UD6A 1G9HA 4CU8A 4N42A 1JNEA 1D3CA 1FH8A 3T2PA 3PZVA 4P7LA 3ZT5A 5EMYA 3BAIA 4M82A 3CV5A 2WBKA 3AS1A 4AIEA 4AZ6A 3H54A 3ARVA 3AYRA 1BSIA 2XVKA 3VPLA 4B15A 2BVYA 3OGSA 3MUIA 3A24A 1VRXA 3WY2A 1ITCA 3GH7A 2J77A 1UKQA 3SCVA 1JI1A 1KFWA 1MFVA 3RDKA 3L4WA 1DWHM 5AY7A 3N18A 5CZKA 4GIAA 5BROA 1H5VA 1BAGA 3EYPA 1E43A 1EA9C 2WCSA 5FIPA 1X1NA 4FLOA 1I1XA 1UWUA 1JZ6A 3VSVA 1NOFA 1JAKA 5CSUA 4UFHA 3WIJA 1OD0A 1NP0A 3AIEA 3L4ZA 1PPIA 2PC8A 5E70A 3MV11 5E09A 4FLRA 4H04A 1M03A 1EOMA 3WMBA 4Z2HA 4ATWA 1JG9A 1J18A 1QHZA 5JIWA 4HMDA 2XFFA 1R33A 4LQ1A 2FHFA 1H49A 2AMGA 1OGSA 4D6CA 3WQ6A 1TQUA 1K9EA 3AZSA 3K1DA 1J12A 3OLIA 4AD1A 2A3BA 1UA3A 1CXIA 5I0DA 1ISZA 1BLIA 2E8YA 1V0NA 2VX5A 2A3CA 3GXTA 1E5JA 5A8NA 5C71A 3MS8A 4QFUA 1PX4A 1OM0A 4AIUA 2RGMA 2WC7A 3N17A 1CNVA 2WVVB 1V3KA 3K8LA 2Y5EA 4Z2IA 4J3TA 5I77A 3A3HA 2C8NA 4TUFA 4PMNA 3SCPA 4GINA 1WZAA 4AMWA 1DP0A 2C7FA 5E9AA 1EHAA 1LL7A 2DEPA 1JYNA 2WVTA 1NWSA 2HVMA 1UH2A 1DWAM 3BSHA 5DT7A 3RM4A 2J74A 4CD7A 1E9LA 3FNDA 2EPNA 4AMCA 4UOQA 2J8FA 1PJ9A 1B3WA 1VB9A 1BYCA 3WQVA 4H8VA 4DWSA 2C0HA 3DX3A 3MMUA 1GQIA 3BAWA 1WPCA 2CETA 1AMYA 3VSTA 3AIUA 2WWCA 3SUSA 3RCNA 1R85A 4MNMA 4DUWA 1MXDA 2GJRA 1CEOA 1V08A 3OZPA 1CIUA 3WD1A 5CGMA 4P7NA 2WM0A 3BVWA 2CKRA 9CGTA 4J3UA 5A2BA 3D3AA 2J25A 2VT0A 5CLTA 3MI6A 2VX6A 3WQ4A 1GVYA 3BLPX 4X9YA 4MB3A 1QNSA 3WDRA 2A3AA 2ZUUA 2MANA 3WNMA 1UWRA 2GJXA 3L4TA 3ALGA 1W9PA 4D1IA 3ZM8A 1E40A 1HP5A 4U2YA 3A22A 4V2XA 4F66A 3WL1A 1XSIA 1XC6A 1A3HA 1LJYA 4GXPA 1QBAA 5AC4A 1E1FA 8A3HA 3ZOAA 1FHLA 2XWDA 3DYMA 2CHOA 4MAVA 1UR2A 3A21A 4HPGA 4KWUA 1R46A 2DT0A 1CXFA 1L0PA 4XZBA 3WNOA 4XB3A 3CHCA 4CN6A 4PEEA 3A47A 3VGFA 4BQ4A 2Y24A 2EPLX 5DO8A 2ZUSA 3WFZA 1ZS2A 1CGTA 1KCLA 1K9FA 3EJRA 3AS3A 1PEZA 4FLSA 1QBBA 4LYPA 2DQXA 2NW0A 1P6WA 3ARZA 1GJWA 4PMZA 3L4YA 1LL6A 4F9JA 3WF4A 1B1YA 5IFPA 2YFNA 1M01A 1E6RA 2GDUA 2OSWA 2G3JA 1ODUA 1OIFA 5A6AA 1V3HA 4LYRA 2QF8A 3BCFA 1RP9A 2E4TA 2ZOXA 2DT2A 1H4PA 4W5ZA 2WANA 2VZTA 1VJZA 1QNOA 4J7RA 3VGGA 3S5YA 2YLLA 1FOBA 3RIKA 1DWGM 4KGLA 2EQDA 1GPFA 2Z1SA 4F79A 1PS3A 4WIWA 1TVNA 2VQUA 4L4OA 4JCLA 4UFKA 2HISA 3OLEA 1V02E 3F5KA 5EB8A 1LWJA 1XD1A 2DIJA 1RH9A 1R8LA 4E8DA 3UG5A 5FOOA 3VUPA 2VC9A 4AD4A 1G94A 2O9TA 1MQQA 4HU0A 1EO7A 1XD0A 2WMHA 1TE1A 2EEXA 2FHCA 1JDCA 2DSUA 3SCWA 4FNUA 3VGDA 3NDYA 3PZMA 2YBTA 1J10A 3FXYA 1FA2A 5D9OA 2O9PA 2OWXA 3VD7A 3CHEA 2V5CA 2G3MA 3TTYA 1YQ2A 3LPGA 2CNCA 1QNRA 2OW7A 1XH2A 1D2KA 2BFGA 2FHBA 3DHPA 3EMQA 3VGBA 4NI3A 2EAEA 3EMCA 3B9AA 4D6IA 2EO7A 3CLWA 5KZ6A 1BGAA 4E4PA 1C3FA 1LLOA 1UWQA 2YKKA 2J7EA 1KWGA 1XH1A 1EQPA 1ODZA 2WXDM 1G01A 1V03A 3W82A 4ATDA 2JF6A 3QOKA 4CN4A 3BUIA 4CCEA 3BVTA 1J11A 4AD0A 2X2JA 1LF1A 3PZTA 4PCTA 4HOWA 3FN9A 1ISWA 2YL8A 4K68A 5GNXA 4B9ZA 1QHOA 4OOUA 4OBSA 1CGYA 3KZSA 5AYIA 2F1BA 3ZJKA 1ZBKA 4PUDA 1H1NA 4JFUA 1EHNA 1XH0A 1R47A 1TQSA 1CXHA 1G1YA 5TD4A 1E6NA 1NOUA 4GI8A 1VFUA 2X0YA 1Z32X 2ZUNA 2EPOA 3MSGA 4QDMA 4UQDA 4Q7NA 3BVVA 1VEMA 1W2PA 3DC0A 4QP0A 2GK1A 2EPKX 2J78A 2DSWA 4RL3A 5IHRA 3CTTA 1F4HA 1FH9A 1UH3A 4EAMA 2GJXB 3VDHA 2WPGA 4UOJA 2CPUA 3RJYA 3SCRA 2CYGA 4Z2LA 1J0KA 4GQRA 1O7DC 3KEHA 3ZT6A 4LYQA 3UEQA 1TG7A 2W66A 1SMDA 1CBGA 2XFYA 4JHZA 2D0HA 4A3YA 5FCZA 1JD7A 1PIGA 1EXPA 2XM2A 2EJ1A 3N15A 3VIJA 1E5NA 1J0ZA 4U3AA 4BZYA 4HZ6A 1FFQA 4AEFA 3ZR6A 4CVUA 3UR8A 2BV9A 1UOKA 3APGA 1QVBA 4MB4A 1UZ4A 1W9DM 1GZJA 1BF2A 5CGTA 4JFWA 4FK9A 4WLCA 3K8MA 5A1AA 1LG2A 3ARRA 1WKYA 1OT1A 2YIHA 1JZ2A 4Y7EA 1WDSA 2NT0A 1VBUA 1GOWA 3SCQA 3WY3A 2E9BA 3L2LA 2D23A 3I3BA 4V27A 4FNQA 3M07A 1MW3A 1XRVA 2WAGA 4WKAA 1HL9A 3NUKA 1MYRA 3VDBA 3AMDA 3WY4A 3WN6A 2G8ZA 4WF7A 1JXKA 3W6MA 4AZ7A 1HP4A 4PSPA 4WKFA 1K6AA 1KR0A 5A69A 5E1QA 3AHYA 4YHEA 3BAXA 1DTUA 3BUPA 1UD2A 3E1F1 5CLWA 4GKLA 1G5AA 3BVUA 4A4AA 1E0WA 3WD0A 2WK2A 4TOQA 1XCWA 2D0GA 5I79A 1GNXA 4UZUA 4CN1A 2J7CA 1R75A 1B3XA 3N04A 1GQLA 5JUVA 3IANA 2WSKA 4Z2JA 4HA1A 1JYWA 4PTWA 1KGUA 3WH6A 4HU8A 1DWJM 4CD8A 1FP8A 4JKKA 4TVCA 1ZJBA 1R7OA 3RM9A 4YPJA 3IJ9A 2CERA 5I2UA 1V6YA 3WUGA 3FAXA 3POHA 4TVDA 4B3LA 4NRRA 4ZFMA 3PZQA 3ZR5A 4CU7A 4LGXA 3QHNA 1M04A 4UFJA 2DIEA 1LG1A 4M24A 2WCGA 1QNPA 4U5KA 4X0VA 4P8XA 2WW5A 2GFTA 1FFRA 1E70M 1OD8A 2FGZA 1IZKA 2QPUA 3WL0A 3HU7A 2OYKA 4OOZA 5IFTA 2XN1A 1ZBWA 4PSRA 2AOSA 3CZEA 2WBGA 4GPNA 3W53A 3AROA 1KR1A 3CMJA 4MB1A 2VI0A 1BVZA 4UQEA 3CH9A 1UWSA 1BFNA 3WF0A 5EFFA 2ZUMA 4AD2A 4U3CA 1W1TA 3LXCA 2XIIA 3RJXA 2J7HA 4J3SA 1NWUA 3LX9A 3AIRA 4AC1X 4JFTA 2E3ZA 5HPCA 4UZSA 3WKZA 1J0YA 5A8QA 3LRMA 2XGBA 2DPEA 2WMIB 4CVWA 4UR9A 1MW2A 3KL5A 1VFFA 1CLXA 4TTUA 4DO5A 4AYSA 1JYXA 2CKSA 4DO4A 4P7RA 2CHNA 1AQHA 1PZ3A 2GK1B 2PWDA 3CZGA 3L2MA 3ARSA 2BHZA 1OGGA 4XUYA 4OBRA 4CD4A 1CDGA 1UKSA 1C90A 4H7VA 2BY1A 1HWWA 2F61A 2XWEA 2X2HA 3BVXA 5A8MA 3WNNA 2X8RA 3MKKA 1BGGA 3OGVA 1J0IA 4ZXLA 1KTBA 1GOIA 3AMLA 1UQZA 3KE0A 5BYWA 1M7XA 1Y7VA 1E0XA 3DDGA 1OGBA 3VU2A 3TOPA 4HZ7A 4J28A 5HNNA 3THDA 3RMEA 1EGZA 1EOKA 4PYSA 4W7VA 2YBUA 1NM9A 4HZ8A 4NXKA 2J4GA 2XJ7A 2PWFA 4EKJA 3D4ZA 4UCFA 1HJSA 1ISVA 4AZHA 5A2AA 1CENA 2D20A 3AISA 4JL1A 3O6AA 3VDAA 3IK2A 3ARQA 2WC3A 3ARUA 5ABHA 2DSKA 2ZXDA 2V38A 3N11A 4ZE5A 4ML4A 1LL4A 2WHMA 3SCTA 4W89A 4PMOA 4CU6A 1VJSA 2WMGA 4LX4A 4ZENA 3HG5A 2VTFA 3M7SA 5BRQA 2WKLA 2FYVA 1QI0A 3N13A 3MUAA 1MW1A 3WNLA 1XSKA 3W4RA 1K9TA 4UFLA 3RPMA 3LXBA 4EK7A 1GJUA 3UETA 4S3KA 2VUYA 2BXYA 4UFIA 5ABEA 2DSVA 3VX1A 4KGJA 1ZJAA 1UWTA 3NSNA 2CBIA 2W91A 1V3IA 3GH5A 3DX2A 1ZBVA 4RE2A 1US2A 3WF3A 1WCGA 1R34A 1C8YA 1UQYA 4HA3A 2BVTA 1EO5A 1EDQA 4P7QA 4CD6A 2IXUA 1LQ0A 4UQAA 3VM7A 3OBAA 2YA1A 1KXVA 3AZTA 3AFBA 4CKQA 1QNQA 4TX6A 2PI6A 2FH8A 4PMRA 1GHSA 3POCA 3AMKA 1DWFM 1TCMA 4UTFA 1UH4A 3LRLA 3L4XA 4QCFA 4BQ3A 1GCYA 5FL0A 1TZ7A 3MANA 2XG9A 3MO4A 3VIHA 1XGZA 3DHUA 1IV8A 4W86A 2F1AA 3ZJ6A 1R7AA 2VNCA 1HKKA 3WDIA 3W28A 2OYMA 1V6UA 2ZX6A 2J7DA 3D50A 3GNRA 1QW8A 2VZOA 5GNZA 2ZXAA 1H11A 3TV8A 3BUDA 3ZJ8A 1HJWA 2EACA 1BYAA 2XSAA 3DECA 1VFMA 3T0DA 4Z2KA 4AZCB 4OIFA 1R86A 1VEPA 4BQ2A 1A47A 2A3HA 1NP2A 2PWEA 1E6SM 2OLHA 2F7PA 1FHDA 1T0OA 3ALFA 4W87A 1AQ0A 3BAYA 1CXLA 2WVUA 2VCAA 2WZHA 4AXNA 4W84A 2WLZA 2VX4A 3S2CA 1JL8A 3VD9A 3IJ7A 4MNJA 4TTGA 4B9YA 2ESCA 5D9NA 1QX1A 3OLGA 1W3KA 3CMGA 5E6ZA 3A4AA 2EPMX 1C7TA 2OW6A 5ABFB 4RE4A 1GUVA 4PMDA 1BG4A 2O92A 1QWNA 1OT2A 1N82A 2ZX5A 2XVLA 1KB3A 7A3HA 3VSUA 5C70A 5FD0A 3PTMA 3RO8A 4GO8A 3ARPA 3QR3A 3OB8A 3VNYA 3CGTA 2J75A 2QMKA 5D8ZA 4PTMA 2G3IA 4FNSA 4R5EA 2XYLA 1IT0A 2F18A 4MTVA 1GOKA 1VIWA 2YL5A 3SCOA 3D51A 1VAHA 1E55A 3AMCA 1HJVA 3AXHA 5DEZA 3TONA 4D6DA 1HVXA 5HXMA 2CIPA 3AHVA 4WSJA 1SFSA 3WF2A 1E3XA 3FHQA 2XGIA 1UWIA 3ARTA 1JYVA 3BH4A 1V3LA 3A4WA 4QCEA 2X2YA 3M6DA 1UD4A 3N9KA 4FMVA 3TTSA 5AC5A 3D4YA 1KQZA 1QI3A 2J8GA 3NDZA 2F7RA 1E3ZA 1E6ZA 5I23A 2WC4A 3HN3A 1B3VA 1JZ7A 2YJQA 2CITA 4NZFA 3VIIA 4XV0A 1X6NA 2VOTA 1W2VA 2DT1A 1R87A 3DYOA 3BMVA 3EJTA 3LRKA 2ZUTA 3LPFA 3BCDA 3WEMA 1B3ZA 2RGLA 3WD2A 1WAWA 1E4LA 4LXFA 1B3YA 3RILA 2E9MA 3CUIA 3CC1A 1HNYA 3WEZA 3L4VA 3OA5A 1V02A 4MNLA 1E6QM 1KCKA 3WMSA 3CO4A 3BMWA 4MJ4A 5IHSA 1H3GA 5I6SA 2YDSA 4GQQA 2VR4A 4ZE4A 2ZUVA 2Y4SA 4MPKA 3SCSA 1SMAA 4U2ZA 4PBGA 2DT3A 1RD6A 3T2QA 3CUJA 3VD4A 3UCQA 1HJUA 2Z1KA 1UR0A 1W3LA 4MADA 5D8WA 4WJXA 1HKIA 4JKMA 1W9UA 2X09A 3AJ7A 2FE0A 3SCUA 1CXKA 1H41A 3WSUA 4D6HA 4HMCA 4TX8A 1KXQA 3BSGA 2YDQA 1XSJA 3GXIA 4QAWA 2WMIA 3OZOA 1HT6A 1OIMA 2YA0A 4Z2GA 3MMDA 3GH4A 2VR5A 2VZUA 4NZJA 3GNOA 3VIOA 1DEDA 1TQTA 3KL3A 4HOXA 3NIYA 5LA0A 3RM8A 2UY2A 3W38A 2V3EA 4H2CA 3PBGA 4P8UA 1QOXA 3WFLA 3D5HA 1CZ1A 3K4AA 4JCMA 3ARYA 1B31A 3GXPA 1KBKA 3KLLA 2WZIA 3CZLA 2GUYA 3S5ZA 3GTNA 3W25A 1JGIA 1I75A 1UD8A 2BVDA 1HKMA 1BVNP 1UASA 1Q6GA 3F5JA 3B9DA 2OSXA 4DUVA 2IXVA 3U5UA 2XVNA 3W37A 2QHAA 3CUFA 2ZWYA 1C8XA 3UESA 4W5UA 1KWKA 4MJ2A 2TAAA 5F7UA 4QLKA 4D72A 4DWSD 2ZX8A 1U2YA 5I78A 2F8QA 4J3VA 1H0IA 3KL0A 3HMCA 3SUVA 2J47A 6TAAA 4GI9A 3VMNA 1J0HA 3VINA 1C8QA 4L4PA 2W67A 1ISXA 3H53A 1TVPA 1U30A 3NSXA 5JBFA 2W4XA 2D1ZA 3VOCA 4E8CA 2GJPA 2G4FA 3WQ5A 3EDEA 3B8SA 5A6SA 3FHAA 4AWEA 1XCXA 5HOSA 1D7FA 1ZBCA 5HPOA 4C7DA 1KTCA 1QHPA 4AZIA 4XZWA 1MW0A 2Y2WA 3PZUA 3SUWA 1PZ2A 1CTNA 5ECUA 1JZ8A 2GSJA 3T09A 4OKDA 2XM1A 1E56A 2J7FA 4PMQA 1HN1A 3MSDA 2XFRA 2ZX9A 4D6EA 1E1EA 3AICA 1V6WA 3VGEA 2W5FA 2OWCA 2OSYA 3K8KA 3GZAA 3W81A 3ECQA 4XX6A 4IUGA 1QI2A 1WZMA 3W24A 2E8ZA 3BAJA 2JE8A 1GQJA 4DM1A 3K46A 1DHKA 5CPTA 3LPPA 4NX0A 2PBGA 4HTYA 3DX1A 4M8UA 2J79A 4MDPA 3G6LA 3VMOA 2ZICA 2VX7A 3PTQA 3ZT7A 4ZXOA 5BXTA 1UD5A 3GDBA 4M80A 1B30A 5C8BB 4UQ9A 1MWOA 2WKGA 1CXEA 2F2HA 1MFUA 1B9ZA 4EANA 3CZ8A 3WH5A 4D71A 3VD3A 1CECA 2G41A 1WZLA 3WDJA 4AZ5A 4PN2A 1Q6CA 3CHFA 7CGTA 3NJ3A 3TTQA 2BY2A 3QHOA 3CZNA 3WH9A 1V3JA 1SYTA 1ESWA 2JEQA 4AY1A 4AZGA 2PF0A 3ZO9A 2D2OA 2X0HA 5CPSA 3HZ3A 3AQUA 1E71M 3SIMA 2E40A 4HMEA 2CEQA 2PB1A 1HTYA 3AIQA 2YL6A 3FW6A 4NF7A 5BRPA 4PTXA 2WHLA 3PTKA 2F7QA 3GYCA 3GNPA 3ZQ9A 2PBOA 4DUXA 1GOMA 3WF1A 5HBFA 4V28A 4WKHA 2FH6A 3T0BA 4FNTA 3IAPA 3AS0A 1BHGA 3TTOA 4CUCA 1NH6A 3NYDA 4HPHA 3VO0A 3CUHA 3GM8A 4RE3A 4PRWA 1W3JA 4NXSA 1TQVA 5ABFA 5IXEA 1JDAA 3T2OA 1MXGA 4J3XA 4W88A 3ZJ7A 1F4AA 4TVUA 1KGXA 4HA4A 2ZXBA 4P8VA
chains in the Genus database with same CATH superfamily
3B9EA 1P4LA 4JRFA 3ZJAA 3G5EA 1TVHA 3MLWL 4XBSA 1E73M 1EZ2A 1NVMA 5C07E 2ZAIA 5I66A 4FXRA 3SDOA 4PJFB 4UQBA 3L9RA 3VKBA 5E0CA 4XE0A 5KZEA 3NSMA 1KGYE 1UM6H 2JFCA 2E0PA 5AW0B 1ZLWH 3S96B 1NBZB 5K9OB 3M0MA 1PYWB 1AZ1A 1SDDA 2VCCA 3CFQA 3LS4L 1BZ7B 3F84A 4OLEA 2W95A 3ESVF 4P2QB 3HFTA 4HK3N 1ZIBA 1NANH 1YEHL 1XYBA 3FIGA 2PPAA 4XMLL 4ODXA 4P2RE 4JFED 1Q7MA 4WDUA 2CUHA 4MNHA 2RCSL 1MAML 1CLCA 4NPJA 4X4ME 2YSSB 2EXYD 5C0AE 3GBEA 3BUQA 5BXPA 1XEUA 3QZAA 4F57H 3ZHLA 3A4XA 4GMSH 1QO5A 5BVJB 1G0CA 4MVBD 5DHYB 4KQ4H 3URQA 2E7LA 3WEXB 2BP0A 3G1RA 3CLFH 4ZRGA 4AYGA 1MFBL 3H2PA 3OQ8A 2B4CH 1P4IH 4MQSB 4EXBA 1W3HA 1R3HB 2BHUA 1QZ1A 4B0MM 4Y16A 3P60A 3ELAT 3O2WH 3ITOA 4RDBA 5FDWA 2OR9H 3HRZA 3R8GA 2MNWA 1YBQB 2W63A 4YSSA 2H2SC 2K78A 2UY5A 3ZMNA 3FA5A 4HEPG 3S0PA 2XG4A 5AOJA 4KHTH 1AD9B 1H15B 1RPKA 6FABH 1QR1B 4R7VA 2W0FB 5B3JF 3AY4A 1WA3A 1T1YA 3SN1A 1P2CA 4A21A 4U31A 3DHJA 3RZWA 1M05A 2WZEA 1JNHB 3PWJB 7TAAA 1ITXA 2CCRA 1QTPA 3QZWG 1T03H 2X89A 5IOKA 3RWJB 2Y7FA 4O8RA 5CBEB 4HCFA 4G9FD 4BXSV 1MEIA 4R88A 1P84K 3ZGIA 3AIWA 1ZOXA 1PKNA 3ATFA 4JM2D 4KXBA 1G7MA 2L0DA 5DVMA 1XIJA 2Z0IA 4XTDA 4D6FA 3MLRH 5SWUA 1E1CB 5EBMB 2VN6A 1XYFA 1E4NA 3P3BA 1MMFA 3QWNA 5GS0H 7REQB 4WHTB 4G7FA 3VRJB 4CVZA 2PABA 2ZFAA 4LBUA 1BBJB 4HUXA 1ZY9A 1KTLB 3DUHA 4J12A 3F4WA 2CHXA 4MNQB 4GZEA 3KYNB 1MHCA 3MTWA 1Q6LA 3IDNB 3BKCL 3STCA 4GZ7A 4N6FA 5LWYL 2WSYA 1HG3A 2FEEI 2D3NA 1IZJA 5I1KL 2X6CA 1AH3A 2EF9A 4UU9A 1Y8BA 4FTVA 4BS0A 5LIYX 2X28A 3EJSA 5JIPA 3DV6B 4AVNA 1RCXB 4EP8C 4R7NB 1H3XA 4HUWB 1BF6A 3M88A 4I8DA 5E4IA 3STLB 1EGVA 2EYTA 3AZRA 4R4FH 1GW9A 3A5VA 1KLYA 3D05A 3IKKA 3E12A 1FWFC 4WJKB 1SJCA 4XVDA 3S2MA 3WDQA 5JXQA 4L29A 4LCIH 4N90D 4C4KT 2NXGA 2ZE0A 3SUUA 3T9PA 4UQ3B 2BSDA 1XB8A 3H7RA 3AALA 3MOAH 2BXZA 4XVSL 4KI1A 1RSYA 2HT3D 2AF2A 1WWCA 3BUBA 3H85A 1K5NA 3G5YA 1TLMA 3HR5A 3CUGA 2POTA 5DMIH 5F3HA 2B08A 2BRRH 2OMUA 5FO2A 1RPXA 3IS1X 2NSQA 3ARXA 3I68A 5H37H 1RJYA 3TO4A 4O50A 2PCFA 1QPKA 3MLVL 3WDPP 4WCYL 5A95A 1JRBA 1E6JH 2DBLH 3D85D 2E86A 5FW7A 2VWTA 3MB9A 1JCVA 1RZ7H 1WDPA 4P4KB 1CFNA 4YHLH 3V75A 1XQLA 3N2OA 1WKFA 3T2LA 1QI4A 1UR9A 1UPPA 3O2LA 4NN7C 3NG5A 4J27A 1ASPA 3EGJA 3CXOA 4RLIA 4F20A 2N7AA 1SJEB 2AVFA 3CHXA 4I5UA 3DO4A 3QQ9D 3FU7B 3TZVC 1AQFA 2GJ6E 3B8VA 3IRPX 2IPJA 4K3JH 3Q2DA 3S6OA 1AD0A 1DVSA 4QLWA 1BMWA 3E02A 4OCSH 5CPLA 5AALA 1GKOA 3U2SA 2QCMA 4MDJA 2BNQE 2DGAA 3FQNA 3SZ6A 3ZRCC 2EDYA 1BOYA 3OR7B 3RL1B 1RULL 3VIPA 1XR2A 2D3VA 3II2A 3EBVA 2XIBA 4W4OC 5DHVH 3VFGH 4BZ2A 3L68A 4FXFA 2FZ3A 1B90A 5GSRA 4MD5B 2AJZA 1YQVL 3AQDA 3BGAA 3OKOB 2GVLA 3EX3A 3QHMA 3CZSA 1TPVA 4HFUH 3HG4A 2P5WE 2OVLA 3LV3A 2XFXB 2P80A 4FI4A 1KN2L 4IL2A 2FKPA 1ZPUA 3D3VD 2OMWB 5PCYA 3SSGA 4FADA 1SLXA 3F03K 1KM2A 1XGDA 4N6EA 1F74A 1FWDC 2QGDA 3F6LA 5TDNA 3BXWA 3AOFA 4NUJB 1H50A 3TF4A 1B3OA 3N0AA 1JHLL 3QF0A 4L6OA 4HIQA 2NV9A 4P2OB 3IMRA 5CJMA 4YIQA 1L7TL 2QVTA 2ZOTA 3RDTA 1OQFA 3EJYC 1CGUA 1MG2C 3VFPA 4HHLA 3E9TA 2CJTA 1WFJA 4AQ8A 3VH8A 4PJHA 3F12A 2XFWA 1B2YA 2E27L 4DP6X 5CF3A 4G9FA 5HYQB 2JF7A 2HE8A 4G6JL 4L4TA 4BQCA 3I02A 1SNRA 4ANKA 1ZALA 3WDHA 4MTMA 2VDLL 3TO4B 1UR8A 1A2YA 3Q13A 3RZCB 5KYXA 4IISA 3CPGA 1PY0A 3GPEA 5IHBA 1IHIA 4QDGA 3UNDA 3NQCA 5HYSA 2DWSA 2VCOA 4HF5L 2ACSA 2V5DA 2NW3B 3LKQB 4XCCL 3SKJH 4EE9A 2ROYA 5U4NA 1E4KA 4G6KH 2C9RA 1BREA 2P8PB 4JZOA 3ZVIA 1INEH 5I75C 3VRIA 3UJTH 3T4AB 1GOOA 2PDWA 4LVNC 3WCYA 3FT4B 3PWNB 3WLWC 1W0WA 4N8UA 3REQA 2KAUC 3T3ME 1UKPA 4QHMA 2C3VA 2MSPA 3CQKA 2ZP9A 1JV2A 1SDDB 5HD8C 4JRYE 5A6IA 1KFBA 2X53A 1PCKA 5DEGA 4KUCF 1TQJA 4L9DA 3S37X 4LEOB 1AS6A 3GMOA 2B14A 3L5MA 1DUYA 1JF5A 2QSCL 1EH9A 2ZUWA 1TJGH 5FHAL 2NSXA 1XLBA 2XTKA 5DQJB 4M02A 3N50A 1A4BA 3K4WA 4LPCA 4F8LA 4ISVA 4XP5H 1AKJB 4G8EA 2R0LL 2YUVA 3U4FA 2PXYB 3QIWD 5BCAA 5AAWA 1DIKA 3W7OA 2WOYA 3JYBA 3UTTA 4DP5X 3MRNB 4J23A 3VVWA 5H2ZA 3WS6A 1TQXA 4JL2A 2VGLM 2XI9A 4TUJA 5GPRA 1KB5H 5I1JL 3K71A 4R97B 4QX4A 2C5DC 3EYFB 4KT2A 3E2HC 5IVXE 2RKXA 4K7PY 1I1FB 3UERA 4QLLA 1PKOA 2EDLA 2UV3A 1I1AB 4G6AC 3IKCA 3IDXH 1S3HA 5D9MA 4G42B 2NX3A 4RV8A 1J4EA 2NMSA 2WNNA 2RD0A 1B0GB 4PRIB 5J3HD 2JGYA 3S9ZA 3SQSA 1EEYB 4L6DA 5HHVL 2IAND 3OHXB 3HMXA 3VI3B 1G7JB 4DZAA 2ZCZA 4EVNB 2POZA 2R14A 1A02N 4X98B 3FVDA 3Q06A 2HLAA 3CSYA 1B0IA 4N85A 2A7NA 3PUUA 2W07A 2E9LA 3APTA 3GRBA 3ZY7A 2J7GA 2KL6A 1ZLPA 3DDMA 4KO6A 5D33A 1U8OA 4B5WA 3OKOA 1BKSA 2R4SL 2A6DB 1ZHBB 4ZUWB 5DHVB 4D2NA 3DOSB 2IGLA 4S39A 4IOIA 5EBGA 4WJG3 4K5OA 4NZCA 1JZ4A 1JPIA 1W32A 1NFDF 4RNHA 5SV3A 4LF3A 1Z9SB 1KJMA 5FJJA 3EKZA 4ALAC 4YDJB 2VDKH 4AYMC 1P4CA 1WQ5A 5ACMA 4MRCA 2HQAA 4UNLA 2X1WL 1Z9AA 2QVKA 1KJ3L 1KLGB 2Z31A 2FYYA 3IWUA 4IRSD 4X0KA 1AIZA 3DX8A 5KANI 4HC1L 3NCOA 5JQ9A 4ENEC 4P8WA 1SZGA 4DZIA 4OH2A 1OY0A 3P8IA 1DQDH 4L9LA 1HE8A 4KRUA 5E2VL 2WZPD 1TMHA 4PJAF 3GXNA 1A2YB 4OFKA 5DWUH 4C60A 1H6TA 1FC2D 4K5NA 1PSKL 2ZC8A 1BBDL 1MCCA 2G37A 3C2YA 4O58H 5EPMB 4XNQA 3OG2A 4JREC 3Q05A 4XD5A 4WI0B 4L1WA 5TE4H 2GDVA 4WY7L 4CAGA 4M56A 4AGQA 4Y2DA 1Q1JH 4KQ3H 3W9EA 2RALA 4OV5B 2B4GA 4PGEB 2EYSA 2IXQA 5EU5B 4XP4H 5JW3H 1VCVA 3OU8A 5DMGC 3HI5L 3R8QA 4FFTA 1OTSD 5KSVB 5F6IB 2OSLA 3MBDA 1XBZA 5D7KD 3CSPA 4OIIH 1EXHA 3ZTDC 3SCMB 4Z3TA 1B9BA 3NZPA 3N3EA 5DUBB 1MIML 3PBUA 4KTDL 1TEGA 3QZ6A 5FF2A 3L6FA 2VRKA 1QSFA 3ZKXC 2XRAH 2VEPA 5CQ1A 4X6DB 4MSWB 3L3JA 2Q8XA 3E8VA 3MYJA 1OCCB 1A1NB 2NY6D 2P46B 3RBSA 5C2UB 4KZDL 2HT3C 1HO4A 3LMYA 2PDCA 3HC2A 1TFHA 4JDBA 4B0MB 1G87A 3M7OA 3NJLA 1EPVA 2PP3A 2K8QA 3UMTA 1W56A 2UWFA 1OALA 2Y72A 5HHQB 3R7RA 3SQBB 4F7TA 3CHDA 3V5HA 4OJEH 3MU7A 5XIAA 5MP6L 1V7MH 5T3XH 1A66A 3CWHA 4G8GB 1GHFL 3O6DA 2RFXB 4BRVA 4XH2B 1PKQE 5I18L 5I24A 3KTXA 3QXDB 5LCVH 4RGMC 3VTRA 4DOHE 1IFRA 3ULVH 1A7RH 4LUTA 4GHRA 4I0PA 3LS5H 4JTDA 2C1GA 2FYMA 2F58H 2GWGA 4MDOA 4JFVA 5C0JA 4XMVA 3HLAB 1AL7A 3GK0A 2XZZA 1HF6A 3WAKA 2DZWA 5J11C 4E2VA 1A6AB 4P5TB 4X83A 1VKXA 4GIRA 5CBBA 1DKWA 3S47A 1IC1A 2Y06H 5J1AB 4LKXB 1TVBB 1BZ9B 3CT7A 5T8GA 5KANG 5D96B 1W9XA 3VIGA 1A0QL 1UC4A 2XWZA 1VKFA 4BWWA 1DJQA 1H8LA 2F0CA 3QH3B 2XXMB 1UD3A 1U8OB 1AO7E 3OXRB 3ZKND 4B9PA 4QRUB 5LXGL 3I6RA 4FFZA 5D38A 3EG9A 2FWSA 3QN3A 3VKKA 3WH7A 5C0BA 2OAAA 2V33A 4AQEB 1WWAX 3W57A 1JE6A 3FUKA 2V67A 4W7WA 3V7PA 3X13A 2PLMA 5A3ID 1SQ2N 2N01B 3Q9PA 5SV4A 5LNGA 3FULA 3RNDA 1MI5A 1AO7A 2J44A 4HUNB 3S96A 1H61A 3MJYA 4P2RD 2QTVA 1N7MH 4OSUH 2OKTA 2PO6D 2O1AA 5HDRA 2GTQA 1PDZA 3W9DB 1MCDA 5ECVA 4H2AA 1UA6H 1VENA 3GI8L 2J9YA 4YQXH 1H7XA 4O14A 3ZN6A 3E2HB 4PIRF 4PUUA 4XAFA 1QLRB 3HPJA 1KXTB 4KK8D 5D1XD 4NQXA 5DMLA 4XNDA 1CDBA 1FVDB 1QA9B 3PWVB 1TYJA 1TFPA 2GCYA 3USBA 1MCWM 4FDWA 1FF5A 1HKJA 1AHMA 1XPGA 4Z08A 4OFYA 1H3TA 3NA9L 4AZBA 3OZKA 5EUOA 3AXIA 3H1ZA 1GXEA 5FHBH 3F04A 1CYGA 4LCWB 4ANUA 1V0LA 4LRIA 2L3BA 3I6GB 4KK6C 1PZ0A 3VIFA 1MWAL 2X2IA 3G3LA 5HY9B 3PAUA 3C2SA 1DFBH 5MHSE 1YNLH 1TYEB 2HTLD 2WNZA 4WU7A 1T7WA 2I07B 4EDWL 1DQQA 1VEOA 3WNPA 4X4YA 5EOCH 1VZWA 4PWEA 1NOWA 1ORSB 1AG1O 3N9GH 2XZ9A 2HDJA 5E93A 3M5YA 4A2HA 3NCJL 3HAEB 3H42H 5A2CA 2FIQA 4M19A 4W6WB 1WTLA 3MVSA 4LLDB 4LPVA 5BWFA 3TCSA 5I30H 1ZA6A 4FC3E 4WFHE 4F57L 2VWEC 4WJ8A 1HJQA 3UA4A 3QDMA 3V4PH 4DPRA 1OT4A 1W0VA 4ZG1A 3JU2A 3LZ5A 5D6DA 5DHMC 4UCGA 4C1NA 1VSCA 2DH3A 4AW7A 2L4OA 4KMTL 3Q2NA 3VI2A 3SY5A 4F9DA 4JKNA 3X2QB 2B5IC 3ABLB 3WEOA 5JBDA 2VEKA 3GK8H 3D2TA 3Q43A 4UFMA 1YNKH 2VGBA 3RFZB 3VILA 3URNA 1J01A 2BS9A 3MA9L 1TTBA 2ZNXA 3KOWA 2GDQA 1ZENA 2BY3A 1OTTC 1U0QA 4QY8A 5CBAB 4LSBA 2VLKB 1WIOA 1Z7AA 4P7OA 3QV9A 5TQLA 3W84A 4YO0A 2R2BA 2OMVB 2P8MA 3HS8A 2I9EA 2ZRZA 3QEHA 5HWNA 1HS6A 2Q7NA 1H62A 1Y0LA 3Q01A 1RCQA 3EWUA 4L5FH 2EO1A 4IUOA 2VDIA 2GIXA 2X1RA 2H9AA 4Z7NB 4CC4C 4H1LA 4GI6A 5JXEA 1XLDA 1ZHBA 2WYHA 3T6XA 4NLAA 1AC0A 5D2LB 3ZZQA 2FGLA 2KPNA 1QA9A 3PWVA 5SWQB 4H9YA 5MERA 2WNGA 3HG2A 4HCDA 2ZJSH 3V4UL 4M62H 4OGZA 3R8BB 3WD4A 3H3PH 5HHMB 1KJVA 4D6JA 3QWRD 4ODBD 3BP7A 1FNHA 5GRXG 3GB7A 3JRKA 3ZE2B 35C8L 1I2PA 1ACCA 1NGYB 1FIGH 1Q4NX 3NEEA 2F19H 3SB0A 2O5ZL 1NSNH 3K6SA 5CMAA 4WKZB 1LEKA 2GJNA 4DWSB 4X8GA 2P3ZA 2VRJA 3TYZA 3GXMA 5J11B 1Q6OA 3FY1A 1JI2A 5B39G 1VZIA 4Y9OA 2QDVA 4BIKA 1QRNB 4DP7X 2BY0A 1BD2E 4XRCA 4N6QA 5D6CB 3RY6A 1FKWA 5TK4A 5CIPH 1EP3A 2XHNA 3OPUA 4HH8A 1ZANL 2PCFB 4CNOA 2JF1A 4YE4L 4PWHA 2ICCA 3BOLA 2OZ4H 3HUJA 4KFOA 3GNNA 3PZNA 4LAUA 2JI1A 5J4MA 4N0UA 4F40A 3QISA 2QJHA 1BD2A 1GG1A 1XS2A 3QFDA 1SZEA 2NNAB 3FB5A 1DE6A 4JO5A 4XXWA 2FJSA 3ZMRA 1UYQA 2J62A 4KDWA 2RQ8A 5HI3D 4U3XA 1A3RH 3IN2A 1TTJA 2RJHA 4WX2A 2B2XL 5A8OA 5C0AD 2H0JA 5AENA 2F8XC 1PBGA 3P3RA 1O68A 1MVYA 3FAWA 3H3PL 4C6NA 2E7HA 3U4BL 1SXBA 2ID5A 1FWHC 1UROA 4Y5XA 4JHOA 3OSVA 3QCVL 4K4KA 1GONA 3FB7B 5D4YA 2Z92B 1CF8L 1LDPH 4HJIA 1BV8A 4EPEC 3N85L 2YWZA 3M47A 2YZ1A 4IG2A 1IFHL 5DCCA 3L3JB 5DI8B 3BGFB 1K4GA 2DWDB 5BXRA 4FF7A 1NAKH 2J8UF 4Z7UE 1FXQA 2EPHA 2XWXA 3QEQB 1V51A 2VJXA 4Z7IA 4E3VA 4U1KA 1ADQH 3G1DA 5TDPA 3TWCL 1S5IL 5IBLC 3ULVE 2XQYG 3TE9A 3O15A 3MROB 5HMEA 1WXYA 2JGQA 3CDZA 4J1OA 3BP7B 3K81A 1WQVT 4PYHA 5GGVL 3SODB 2AZUA 3VXRE 3EXRA 2PRMA 1IT9L 1E5YA 4S2SB 1VFOA 5J13C 3CHVA 1Q6DA 5B7YA 3EOSA 3H2FA 3CMOL 4PJHB 1SVCP 4JNMA 4XAZA 1S7RA 1XB6A 5EA0H 1MAMH 3UP8A 4E6MA 4F15C 3D48R 3MUGB 3VJ6B 4OI8A 1WNOA 3PFQA 2VZ3A 4DKDC 4WHBA 4LKXA 4GSDL 4DN1A 2JIEA 3BN9D 4F27A 2Z7KA 4WFHD 4N1HB 1DLHB 4BA0A 4HJJL 1YUHB 3KHOA 4LSUL 3IB4A 4HK3J 3GEWB 4M29A 4F1SA 3DA0A 5DFTA 2WB5A 3OW1A 3RAOA 3E6HA 3FPXA 4D8AA 1A5CA 2W65B 2AMUA 3CFJA 1ZJHA 1MLCA 4L1TA 3OMNB 3VMPA 2ALAA 4KMTH 3ZZSA 3VD5A 1OWWA 3G6MA 3GUGA 5L6UA 1TYGA 4R0LA 3CIQA 4EXKA 5IMOB 2AEPL 1MREL 4MZ2A 3IGSA 4FX7A 1DBAH 1N64L 3SI9A 3PGDB 1CI1A 2YZRA 1Q9LA 4F7KA 1ZUAX 2AQ2A 3MP4A 1Q0EA 4HKXA 1EJXC 4JTCA 4LT9A 5DMGD 5CPQA 4Y7MA 2IGTA 3D0VB 3BLKA 3LSOB 3PABA 4PJXF 4LMQE 3DKLA 3DUSA 4L7ZA 4ML9A 2WNQA 4G8GE 1PZ5A 1KXTA 4U7KA 4HOZA 1S5NA 4ROQA 3WO4C 3EMZA 3ITVA 4OD3H 4U6HB 4U1SB 3IIPA 3U5YA 3WX7A 1TEFA 1NCIA 1UUSA 2JIXD 4B9KC 3NL5A 2AP2A 2D24A 3SDXA 1CL7I 4LAMA 2CDFA 5CPNA 3F5LA 3I7QA 5CP7B 3PJNA 4PJ8A 4F37F 3QFJA 5DC9B 1UZ1A 2GJZB 2UY3A 3QNXA 2VR3A 4HQQL 3E9UA 4N2LA 1NSNL 1L8NA 5IRPA 3CDYA 2B16A 1IE5A 1G67A 4AHOA 2UX7A 4NO0A 1R6WA 3FFCD 2GJ6A 2H26B 2XZAL 3HFYA 3R1GL 4Q56A 4IL0A 3OJVC 4CU8A 1BECA 4J1UB 1X3DA 3SY1A 4QR6A 1ZTVA 5D1QE 1FH8A 1NFIB 3T2PA 2Z8SA 4C6MA 3FRPA 3QQ1A 4HU2A 1A4KB 5F0LB 15C8L 5KETA 2CK0L 3BAIA 3KWTA 4WK4B 4GQ9H 4M82A 5F71A 3QUML 2YHGA 3IFOB 3VTAA 12E8H 1QW7A 3CX5K 1VR6A 4HX1A 4GC4A 3AS1A 2BP1A 2GBAA 4Y4KA 1FZJA 2JK5A 2DZUA 5T26A 1OYBA 4AZ6A 2FEDD 3NRPA 3WYZA 4AQ1B 4BK9A 4AG0A 2DTSA 1K8ZA 1FYTE 1DQLL 1DVYA 5HMSA 4YXLL 1W5QA 4A63A 3UXLA 3AVEA 1BSIA 2XVKA 2FEJA 1ZT4A 3ZPDA 3W1AA 1U91A 2ARJB 3I9GL 3IGFA 2BVYA 3NSCA 3PWLA 4FFYA 4MA3A 4N2BA 4HU8A 1S9KC 1WKEA 4HQVA 4TRPL 1IM9B 2I9TB 1K02A 3KS5A 3BYTA 4UILH 3N17A 1PAZA 1I1FA 1H63A 2R69A 3QULB 5IHWA 2UYLB 4C59B 3KPSA 1XIHA 2NTSP 1K4CB 3QRHA 4M6ML 1XGRB 3QUXA 2GVEA 4R5XA 5EZOH 4U6HA 2IAAC 2D7NA 2WUBL 3EOTL 4YEFA 6PCYA 1DWHM 3FDGA 4L4VE 4WI7A 3VI3A 3D18B 4M5YH 4BINA 1YEFL 1MZRA 1XR9B 1FCCA 2AJSH 2OPCA 1P7TB 1SR9A 1X6UA 4ZMQA 2WN3A 5IHZB 2PDMA 3EYPA 1FSKC 1BFOA 3O9WB 5F89B 5BOEA 4WTZA 4I3SL 5F9WB 2G2RB 3BG9A 1XCQB 2QVNA 3LGEA 3EFOA 1E28A 3B2VH 1EA9C 1IC5L 2CO7A 3L3IB 4JZJA 3RWEB 4PGEA 1W15A 4CMHC 5AVRB 4Z1PA 2Z24A 1GZHA 4R0LB 4PBXA 3RYMA 3ULVC 1W37A 1X1ZA 4FLOA 2OFJA 2QKIA 4NSKB 3HZMA 4JFDB 4JANA 3S34H 3I6KB 4KPHL 3IIXA 5CSUA 4UFHA 1J9QA 3QQ3A 4PRHD 3N43F 3EPOA 3AW5A 3MXVL 2AL2B 4KO9A 1Y1DA 4LSUH 2PGFA 4MNQE 5E70A 3RVWC 2PC8A 2Y8UA 5E09A 4FLRA 4QRQB 1M03A 3FU8A 4YFEA 2GEQA 4AHPA 1XCTA 3L5HA 3U46B 4ATWA 4WR3A 5JIWA 5JOPD 3CPLA 3R1ZA 3V4PA 5BXFA 2NW2B 2ZPKL 5EDXA 3IWVA 1CQYA 1N6UA 4UTAL 3AO0A 2X42A 4JN8A 4HJWA 1BAFH 2DYRB 4RGMB 1X8CA 3H4GA 3RCYA 5G55A 1LHZA 1CCZA 2CJSA 4X6BB 4X6CF 3TBBA 3WQ6A 1M2VB 4HVBA 1TQUA 4PJEB 3D85B 4NQTA 1RBAA 3AXKA 3QE5A 3BGGA 4GUFA 3RGVB 3K1DA 3W1TA 5CZVH 5ID0B 3U4AA 5FA4B 2VXVH 4OVVA 3TNMB 2WJ5A 2ADFH 2QZ5A 4TNGA 3RAJH 3SDAD 4O2CB 5IJVB 3NJMA 1E4HA 3C8KB 3UH8A 4N24A 3S36X 2UZIL 3QI9B 1XGPB 1CXIA 4GQ0A 2Z4GA 1ISZA 3TIMA 1QR1A 1A7PL 3CFEB 1F1DA 1OB1B 3RGHA 3D06A 3T4AC 1ASOA 4XHJD 2VX5A 2BSBA 3H12A 4EI5D 3EIFA 1E5BA 2AAMA 4KJQD 1GW0A 4NQEB 5B38B 3TEWA 3QIBC 4JRXE 1G4SA 3NZ8A 4Z3JA 1NIFA 3U7YL 1OCNA 2RGMA 5SX4H 1OGAE 3PM6A 1NGPH 1G6RH 1WZ1L 4KNQA 1AG0A 1R3KB 2WVVB 4GRWF 1H7NA 1X7QA 2DQMA 3L16A 3LIZL 1TPXC 1TZGL 2R4RH 3EJZC 4HXAH 2ZCHL 3KS0J 1S7RB 3A3HA 1CMOA 4MCZB 3CFUA 5AKVA 1JPFB 2EIMB 1Z6KA 4HBCL 1S9WA 2IOOA 3NIGF 3TA3C 1WZAA 3ZLQC 1WAPA 2A9MH 1EHAA 2IQAB 2IQ9L 4ZSOB 1MCOL 1WIPA 3DETC 3NIDB 3BPCA 3TQKA 3L9EA 2Y85A 1TQBC 1GYNA 2HVMA 5G2NA 3CFDB 4OZ4A 5IBUG 4KK5D 4KWVA 4M5PA 3G1FA 5HYJE 2YXMA 1ITUA 2EDHA 2H32B 3VACA 2J74A 4DK5A 5D05A 2FPVA 1E9LA 1SDAB 1XLCA 5L4IA 2R0ZL 2BVUA 5AL8A 2HVJA 1S1RA 3FNDA 4X9SA 3QG6B 4JKPH 2UZIH 5LXGH 3MJ9H 4XQ6A 2MH4A 3VQMA 2PTVA 5JMUA 2P5WB 1PEWA 3SJNA 1U36A 4UOQA 5KSAC 1B3WA 3IJIA 4AMCA 3GSUA 4DNMA 2DY3A 1N8IA 4Y2LA 1BZQK 1QSED 1HKVA 4IQHA 3M86A 4S1QH 2B0SH 3LNMA 4B5SA 3W73A 2CETA 2OMXB 3RG6A 5BS0E 4DLMA 1AMYA 3VSTA 4X7TB 1VYPX 1QNIA 5CN2A 3SUSA 3UPWA 2A6JA 3RCNA 1QLEH 4XZNX 3ZWSA 1K5NB 3HR5B 2GJRA 4QGTA 1I8MB 1EX5A 4PUJA 1XR8A 4X5LA 4BEQA 25C8L 2WXRA 4Z0XA 3UGUA 2DZBA 2WM0A 3CVHH 1B57A 4IU2A 3WD1A 1LP9E 2WQUA 3BVDB 2CKRA 2UVEA 3GHPA 4NQDD 1IM3D 1M2OA 5A2BA 4Q6JA 1W72H 2VT0A 2ICEA 5CLTA 3VOGA 3SGEI 1BJ1H 3FTWA 3MI6A 4GP5B 4N3UA 1UWAA 2XNAB 3IRDA 3WQ4A 2KPWA 3DRTB 4Q8MA 1I9RL 1ZLVH 1ZHNB 3ARGB 3H22A 3BKMH 3WTWA 1QNSA 4NO0B 2IH1A 3WDRA 1XEDA 3BPNB 4R2GD 3V4PB 2GWNA 2GAZA 1CB2A 2MANA 4JO1H 3MVTA 1VGKA 2BERA 2DQGL 4YL2A 4V33A 2E47A 1W9PA 1E4JA 3MRGA 1E40A 3OM3B 4TQEL 1WXZA 3CMFA 2YXFA 4W6XB 4MY1A 2EVHA 4ZAKC 3T77A 1XSIA 1C9WA 3RGVA 4G9PA 4RDWA 1XC6A 2M1KA 2H3NB 4FI6A 5AZ2L 3TSBA 3IACA 3D3VE 4JFDD 1ONQA 2ZCGA 3CV2A 2JV6A 5TE6L 2R2HB 3C12A 3DYMA 1JPMA 2CHOA 1MAKA 1O6SA 2ADIB 2BIMA 3OQRA 1BM3L 1NAMH 1U58A 3A21A 4C6PA 3NCYS 4KWUA 1JRCA 3HZVA 1CXFA 1L0PA 1T1YB 3BGFC 3KYKL 4ZMOA 1OB1A 1JEZA 4QSHA 2UXTA 1NFAA 5SWSB 1NFKA 4XB3A 4KH9A 5EO0B 3NPXA 4Q8WA 3E6FB 4NUJA 5B39A 3HZYA 3JWDC 3EB3A 4D8ZA 4F3FA 4JO3H 1EEQA 1T7YA 5CBEA 4GKNA 2EPLX 4KZCA 1ZS2A 3X3GH 4X9HA 1CG9A 1SO4A 1F90H 2N0KA 3G0SA 2J1YA 1J87A 3JVFC 4ZFZA 4H19A 1EA0A 1JPFA 1QBBA 1R30A 5HQEA 4KO5A 3JV4A 4WWOA 2AQ3A 3GS6A 5KYXB 4PWGA 2NYKA 1N70A 2DQEL 2H8ZA 3HN8A 3RWHB 1UC5A 3IDGB 5EIIG 2ENQA 4PMZA 3LY0A 1BFOB 4JFFE 2YFNA 4ICWA 3MRLA 1R9ZA 3LLDA 4FL4C 4YJZL 3QCTH 2DM2A 2GDUA 4F0MA 2E7BA 4Q74A 4G8FB 2P8PA 4PLNC 4GKSA 4WXZA 5DRNA 1A5NC 5ESVA 3LXUX 4M7LL 2EDDA 4AKQA 2X12A 3GTFA 2G3FA 3EWWA 1AGCA 2GIMA 4GQPH 4YUEH 2EUZA 1TPC1 2VFGA 1QO3B 3HC3H 3EYSH 5GGVY 5AQ0A 4N90E 5FA3A 4ZB5A 4KV5F 1UXSA 1FO0L 2GTWB 2VZTA 1TB3A 4Z1BA 3TYDA 5EUOF 3IJHA 2R0WL 1VJZA 1RJYB 2WTRB 1I9CB 2CPCA 1M71A 2E9IA 4J7RA 2QFPA 3TBSA 1HWGB 3MOAL 5CC7A 4DGYL 1FUNA 1TU2A 2VLKD 4X5RA 3S5YA 2AQTA 5MI0B 4DKTA 1KPRB 2TSBA 4LYKA 5J0BA 2HFEB 3P74A 5JPNB 5F2LA 5KINA 3M1ZA 5IY5B 4F79A 1PS3A 5IZ7A 4L1SA 1LP9B 5I1GH 2R9HC 4NYLB 1NJ9B 2P9RA 3SPIA 1S7UB 3S88L 1O7SA 2RA1A 3T3PF 5GRZA 4AIZB 2XXFA 4Z95H 4DYEA 4AT6A 3RU8X 4UFKA 1VFBA 1EQWA 5EEYA 2DMKA 5LXVA 4O11A 3U7WL 4GAYB 4A2RA 1FH5H 1K8CA 3LPWA 1EWEA 1V02E 1LWJA 3KBHE 1CG9B 1EPFA 1XD1A 4HNOA 5ERWB 2XZQL 3NQ8A 1QLEB 4P99A 3ATBA 4E8DA 2ED7A 1B2WH 3EHBB 3EYSL 3P81A 5AD0B 2BSTA 5FOOA 5DJ2B 3TU6A 2X9YA 2JJVA 1WWWX 4LCCB 2ZD0A 1G94A 2QAFA 4AD4A 1Q0YH 2XN9B 4M4RA 2JCCE 4KO7A 4E0CA 3PRZA 1DE4A 1TO4A 1WTGT 5KJRH 3AJXA 2WMHA 1KB9K 1TE1A 4X5WB 1A5UA 5KOVC 3FFDA 4TULH 4UDUA 5DK0B 4U1HA 5K9QI 1IKNC 1RJZB 3NT0A 2Q01A 3WIFA 2R24A 3BCJA 4IPJA 1RVKA 1U58B 2C34A 3WUWB 3SCWA 1U3NA 3JUZA 2PMZA 3O7UA 3ZLHA 1NWOA 4Y89A 1QFPA 4ZMZA 3VFSB 1SO6A 1Y07A 3BT2H 1OPOA 2I56A 5HNUA 3NCJH 1F4YL 3FXYA 2VE6B 1F2JA 4N9GB 3SGZA 5EA0L 5D9OA 2G0KA 3CVBA 3WXWH 4JTFA 3OJMB 2AGTA 3HI1B 3VD7A 1KUMA 2V5CA 3O81A 4O5LH 2G3MA 5E6SB 5F7AA 4F3FB 5I19H 2HKHL 3NDYE 4DW2H 1YQ2A 4YL4A 3RRAA 4WTWA 2INZA 5IEKB 1QNRA 5FYJL 3U6WA 1S9VA 2CU0A 3IJEB 3N44B 1MJJB 2BFGA 1U8KA 1AY1H 2FHBA 2QCFA 2PS2A 4NU7A 1N55A 4BKNA 3MZGB 1CK0L 4PLJD 4K8EA 4K9JA 1BA9A 2ADAA 1KELL 2OL3A 2EH7L 3GSUB 4PJ7E 3WN5B 3VGBA 2UX6A 3BKCH 2DI7A 4Q52A 1FFNB 5CINL 1S2CA 5T1LD 1RQBA 4UT6L 3ZVHA 4D6IA 4MXVE 3TNBA 4Z7QE 2YCLA 1C3FA 1OSYA 3ZL4H 1SOQA 1NGQH 3NJGA 1LLOA 1V5XA 4QXGH 3MLSH 2VFFA 1J93A 1BXAA 4I6VA 4PJBB 43C9A 5HDWA 1G01A 1GQNA 1S7UA 3IDYC 4ZFOL 3NM3A 5IBLD 5BW6A 3QOKA 4CN4A 1SFHA 3HUJF 4KU1A 5IMLB 2X2JA 1O12A 2VH5H 3ABRA 1VQTA 5HI5C 4PCTA 1P4UA 3LBMA 2CAKA 3NESA 3BJFA 3OAYH 3I6LD 2NOYA 2YAMA 3ZE1E 1QAWA 3KPRD 4WFFE 4Z7UA 4ZSOE 4K68A 1P43A 4WWNA 3PK7A 2JK5B 3C2AL 5I15L 1AW1A 4L8BB 4Z7WF 3ATYA 3BOVA 3IRZA 4WWPA 4B9ZA 3ARFD 3LEYH 3T0WA 2IALB 5FKAB 5BUGA 2KZBA 5CBJA 3WUWA 3BIAX 1AUSL 3QV7A 2V82A 3UWVA 5ICZA 4L1LA 3K2GA 1A21A 4KDTC 4REQA 2Y22A 4Y9FA 3LUTA 1X5ZA 3HMJG 1EHNA 3T0XA 1AP2A 1XH0A 3B7UX 2PF6A 4L37B 4X6CB 1GOGA 5KJ4A 1MWAA 1I2QA 1TREA 5D04C 1NCDH 3F5WB 4TKWA 1V6TA 4HD5A 1KBGL 3UTOA 1A7OL 1O7DE 1SXCA 2AJVH 3B7TA 4GI8A 2OOGA 4H7CA 1VFUA 5FDWB 5T1KA 4AV0A 4Z6AT 2R2HA 1PZCA 1Z32X 2OX4A 4DPBX 5ERWA 3C60B 3SPCA 4N9EA 3MV8A 2GUBA 4DKFH 3NN8B 4Q7NA 4QDMA 5DCEA 3AU6A 3KLAA 1SW0A 2AK4B 3DSFH 4OCYH 4JR9H 1N67A 4JDZB 4MX7A 4HG4J 5KYYB 1F8TL 1OFRA 4O54A 3DTXB 4GUPB 2GK1A 3MJ9A 2J78A 2W07B 2DSWA 2ZDRA 5B3SB 1SRDA 3CTTA 1F4HA 4HNTA 1UH3A 2FBOJ 3MV8E 1GGCL 2PPCA 2AXGB 2K7QA 4G6MH 5F1OB 3HMWL 1BQLL 4DEFA 1OK0A 3QPKA 1JHKL 3V0WL 5FR3A 3RN6A 4JZJB 1CDIA 2CPUA 3IJYA 4S2BA 4ZX6A 4HSCX 3I6LE 3QR0A 2ITFA 2ODIA 4LYQA 1SJAA 4PZVA 4U3SA 1FVCB 4OKVB 1FV1A 4RZBA 4PJ6A 3LQZB 1IGFL 1OAQH 3OA3A 2IPKB 5CZXD 3QJFB 4ZUUA 4Q4OA 2XFYA 4JHZA 4UDTA 5GGVH 1JD7A 3UIYA 4I4WB 4GD0A 4ATTA 1PY9A 1TX0A 3SDXE 3V7MA 4DPAX 3BE7A 4AE0A 4NWTL 2HTKC 2RAMA 3MI2A 5DBUA 1J0ZA 5ID1A 2VO8A 5J3HC 3CWOX 3OBEA 2YW3A 1UZGA 3S9IA 3K2IA 1DXEA 4H4NA 5HPMA 1FFQA 5DS8A 1KIRA 1FX6A 3C6LC 3AXMA 1S7SA 2M2DA 1H60A 3L67A 3UR8A 4QHUB 3LTYA 4HN4A 2WMGA 4X63A 3LGDA 2C9PA 5KSBB 1ELSA 1AE6L 1QVBA 2V63A 4Y5VA 4XNAA 2YKLL 1N0XH 1G9ML 1ORSA 4LL9A 5T1DH 3WS3A 1NCCL 1R1CA 1J8HE 1BF2A 3EFFA 3UAEA 5CGTA 3STZB 3NTCL 4PB5A 3RBGA 1ZXQA 4Q6IB 2EG8A 3OOQA 4XWGH 3UPBA 3HPLB 3DFHA 2IG2L 4O2EB 2WLMA 3O4LA 3S35L 1EHKB 4GAAA 3HGJA 1PGRB 4NZ4A 5D30A 5J6HA 3QRFM 4LCWD 1QFWM 2C9XA 2F54E 2EKSA 2H0PA 3QDMB 5LBSA 3TM6A 1ZQ5A 4NQEA 5B38A 2HVNA 4EXPX 1KCZA 4PGDA 1WKYA 3IS4A 4ENED 5E2WL 1JZ2A 3H8NA 3D8MA 4Y7EA 1PY4A 2NT0A 3H9SB 1WDSA 3PVFA 1GOWA 4AMAA 3FT0A 3TJEL 4RUBA 4PFEA 2F54A 2E9BA 4M1CC 3SBPA 1MUCA 4V27A 4REQB 1QFUH 1IIIA 1SJHB 2Z1PA 3M07A 3UTPE 4LEQA 5H8DA 1RY7B 2WAGA 4WKAA 2DIKA 3NUKA 4Q58C 2VFHA 1QVOB 4XB7A 2F1EA 3LQZA 3RJOA 3WIHA 4XGZB 3ZDZB 2I5GA 3WN6A 4FQCH 2H32A 2QTEA 1HKLL 4WF7A 1RJZA 3C8KA 4HTBA 4DO7A 4WW2F 1EFXB 4ABQA 2AKRB 2C26A 2YS4A 3SD2A 3SBWC 2VXSL 4P2CG 2GPTA 3PF2A 3MV7A 3WQCA 1K7EA 5MERB 1LE9B 1HHJB 2MCPH 1VHPA 1CCWB 3WK0A 1ACYL 1JWUA 2TRSA 3VKDA 5C6MA 4XWUA 2ZCHH 1DTUA 2GJ6D 3BD4A 2YQ3A 1A3QA 1T8XA 2X9WA 4FJ6A 4GKLA 2M8XA 4PJXB 1A4AA 4GQ9L 5A8GA 5AVYB 4QOKE 2BNQD 1XF2A 2H9GA 1E0WA 4QIUA 3HNTL 4QHUA 3WD0A 3RZCC 2QADC 1E27A 1FDZA 4N8PA 4J2MA 1NCAH 4PJ8D 1L6WA 3GSNA 1ZLSH 1XYAA 2D0GA 1JGVH 1P5BA 4ZXBC 2V5LA 2KDGA 4NFBA 4JBRA 1KTRL 4DRSA 4LLVA 1XLMA 5DJCB 3MI3A 4HSAC 1QRQA 4MNQA 4NRZB 3W11D 2DJMA 5ACLA 2NQCA 4JAMB 4IRJB 4OM1H 3SD5A 4FIRA 3CBKB 4CEUC 1TG8A 2BO0A 5AW5B 5MEPB 3RFRA 1XFCA 5D2LF 3VG0H 4PBDA 5I0ZA 2XQBL 4L0PB 3VFVA 2X7LA 1NC4B 4NM4L 4DZ5A 1E2VA 4KC3B 1XZWA 1R7OA 3RM9A 2FCBA 2BVPB 2IWEA 1EHXA 1OM3L 5JR1L 4M9PA 2V2TA 1SFTA 4DEWA 1L9RA 4P2OC 3QC6X 1V6YA 3IBOA 5F4SA 3IMVA 2O6PA 1MZYA 2A6IB 4NPKA 4EPDC 3POHA 4DVRL 1RVFL 4TVDA 4WI2A 3MCLH 2EDFA 3NZSA 4JPIB 4P9MH 4PRAA 3HCVB 4CNUA 6XIMA 4C56B 2X4NB 4PRNB 4LGXA 1W0YT 3GMLB 1WOAA 3OZOA 5CC5A 2N4IA 1M04A 3C2OA 1DFBL 3GMMA 1KCWA 2FLMA 4H9TA 3KBFA 4PRBB 1H3PH 3O16A 4QTGA 1X5AA 3OKNA 1GC1L 2WCGA 4P4KA 1W5PA 3EGSA 3GTTA 4JNYA 4MY9A 4U5KA 2WW5A 4X0VA 3NK4A 4N0YL 4QHLA 1E70M 4JRXA 4Z7QF 2FGZA 1OD8A 3UXKA 1RLBA 2EDRA 3MWAA 2QPUA 3WL0A 3MRIA 2EH8H 4MG4A 4IRJC 2OYKA 4P9HH 2XN1A 2CO1A 2ZOUA 1AKPA 1PD0A 3CS2A 2HG5A 3LZPA 4XE5B 4AV5A 1T5XB 3D46A 1DJGA 1OWRM 2VDQH 3CZEA 3ILQC 4M1GH 4JG1L 5EF2A 3MO1B 1HH6A 4LBEB 4TNVK 4LCYA 3GHBH 5FV1L 3VYPA 5BZDA 5C7ZA 1OM3H 1RZKC 1BXBA 1EMTH 4OT1H 5BJTB 1BRLA 3ENEA 1A7RL 1Q6QA 1AR2A 1KV3A 4RDZA 1XRTA 1DBKL 4AKOA 2J8UB 1DBAL 1BVZA 3N1QC 3MCKA 3G77A 1PG7L 2IS7A 3FJ6A 4V2CB 1BFNA 1UWSA 1W1ZA 5EFFA 1MIMH 3DGGA 4FYTA 4LPWA 3IJYB 2ZUMA 2BW5A 1BFVL 5EMJA 4AD2A 4U3CA 4YH6A 3IFNH 1US0A 5C0GB 4AGLA 1GWJA 4Z7WE 3DFYA 4LARL 1USQA 5C0AA 5HVFB 1E30A 1IKNA 4M3PA 3CN4A 4B5XA 1BYOA 2XWCA 4R4BA 4ZTOH 4HLJA 4GKNB 3RJXA 2WZAA 4PRID 4UV4H 5K9KB 5MEQB 3H9ZA 4J3SA 4PV1C 4JFTA 2E3ZA 1ZT7B 1WYIA 1Z41A 2NSOA 3N06B 4B2DD 3WKZA 5HI5D 3U7YH 4WNJA 4DJEC 3HG1A 1V7ML 2W9EH 3TBSB 3RZCA 3LRMA 4BFIA 3FL7A 3AGWA 1J5SA 3HURA 1BVLA 4MQ7B 4PJCE 2XGBA 3UF9A 3G24A 2G4GA 4JG5A 2FTPA 1UFUA 2MCPL 4NNBA 3D5OF 2CDGB 4WI0A 1BD2B 2BGQA 4ONGH 2Y5TA 2V5MA 5D5MB 1YPFA 1CLXA 4TTUA 4MM1A 4DO5A 4ALAH 1IM3B 2EDTA 3OIXA 1LO2L 4A7GA 1CD1B 3OR6B 3CUZA 5C08D 4AVJA 4DO4A 4MLJA 3O4OB 3BURA 2VN3A 2B20A 2H1LM 4Z7OF 3OMZA 3BZ5A 4D9PA 1MWAH 2HG5B 4NY2A 3N41F 1EWDA 5IHUL 4JKPL 3KJ4B 4TPRH 3WEXA 3L2MA 4LEOA 3EBGA 2H1PL 4NKDA 4OJAA 5AD0A 2O6EA 3MKVA 3PAVA 3ULUL 3BVXA 1UJQA 3IVSA 1VGEH 3JTBA 3WNNA 2X8RA 5EHFA 4YHKL 3MLTB 4ZL1A 4WDIB 4UNKA 1RKRA 3MKKA 2V8LA 3MCKB 5F96L 2WZMA 1J0IA 1B4JL 4ETYA 4GW1A 2PXYA 3TN0A 4IU3A 4WUIA 4ZXLA 1D8WA 2J8OA 1N7ML 3EFDH 2OI9C 3KE0A 4OSUL 2BOGX 3QQ0A 2X6BA 1LLAA 3MRBA 3DDGA 2Q8LA 2VERN 3WG7B 3TOPA 2VDPL 2NY5L 3PY2A 4IRZA 4KVPA 4EPKA 2JJUA 4ABVA 4LCSA 3UGRA 4O02A 5E2JA 4D9RE 2J24A 1S5IH 2XIQA 4N9OB 4I85A 3C6LB 2E75C 4LL1A 1XIWA 2NUYA 2W27A 1EOKA 3C2EA 5BU6A 1NM9A 1EFQA 4UT9A 5CD5C 1PZDA 4PH8A 4P2QD 5FHBL 3VZYA 1OFBA 3IRSA 3D4ZA 4BYHA 1VRDA 1K2DB 4KVCL 4IMAA 1YYLL 5CH9A 1G4RA 4HALA 3PXJA 4NAEB 3R8RA 3P84A 4CVZB 2R2EB 3VFCA 4PUDA 2P8LA 2XBDA 3O6AA 3P5ZA 5FM5M 2O26U 3ARUA 1UBPC 2WC3A 3F7KA 3LHPL 2QFRA 3GZOA 5EG6C 2PODA 3QLLA 1V93A 4S1RH 2UXGA 5KVFH 3AU2A 4X42A 5EV7A 4ZE5A 3P3UA 3QO1A 4X50A 3OHMB 1WISA 4N2KA 4Q9RH 1CB4A 2C7UA 43C9B 1ADOA 3SCTA 2XV0A 1E7UA 2XPZA 3UGEA 4W89A 4HVXA 3LIZA 4MNQD 1XW8A 4XTRD 1LE5B 1Z9SA 3V0VB 3TKFA 2B9AA 2IQ0A 5E9DD 5F7WC 2Y25A 2X2UA 2PKDA 4DCQB 1A22B 2W80C 3KYKH 1S78D 3G6AA 2E28A 4IBWA 3QW4B 1QEWA 4NKDB 5EO1A 3X1EA 4ZNEA 1FVPA 4M6NL 2CLMA 1QI0A 4LCWE 2E76C 2XU2A 2Z2BA 1CFTA 3QQ9C 4BHYA 1KM5A 1MW1A 1K9TA 2X3AA 2YMOA 5DD1H 3VQLA 4UFLA 5HBBA 3RPMA 2G3XA 4ZTEA 1MI5D 2X4TB 3WFBL 2XINA 4EACA 5C1MB 1SQMA 2A85A 3R2GA 5FYJD 3N40F 1OCRB 4PVNA 4MD5A 3QDJE 5I1JH 1PVNA 2FTWA 4C4BA 2NNFA 4XXCA 1J1OH 5FX3A 1KD0A 2EYSB 5EU5A 3B1TA 3AM8C 1A3RL 3LB0A 4ZMTA 1GGIH 5DRZA 5ETUB 5GGQL 3VX1A 3CAWA 3TIEA 4KGJA 5I8KH 3MA8A 1E90A 2FWOA 5CJBA 5HDBB 4HIJB 3NSNA 3SDYL 4OIAA 3GX9A 4PEKA 2W91A 4L3EA 5FAAA 2XTLA 1AE6H 2YRPA 3JWOH 4YIQB 4GYJA 1DUZB 1WAEA 2FSEB 1OFPA 3VFPB 3B2UC 4R4ND 4ROPA 2PPEA 2FB4H 3EGXA 1R34A 2CWRA 4E9WA 2EHHA 1UQYA 3TJIA 4HV8B 1DQTA 1U8NB 3OX8B 2KERA 4APQD 4GFXA 3QIWC 5F7EH 4YUEL 5IK3A 4UANA 3T65A 1P7KB 2JKSA 2P8LB 1A1NA 5CO1A 2IXUA 1MSSA 4OF3A 4P7QA 3NR0A 5EULV 3MYZA 4CNIA 3E96A 4XXCC 1WBXA 1S3KL 1G9NL 2A9ML 1UQSB 2HNEA 4MSSA 4C6EA 3FTUA 4US6A 1I7RB 2K6WA 1KXVA 5C3IA 3UYRL 5DZNA 4M0XA 2P4AB 4NN5C 5IREA 1LVEA 4U6YA 4E0RA 5AKRA 3AFBA 4XOBA 2ZUXA 2VENA 1UZ8A 2YEZA 4HUUA 5DJZB 1RA5A 2NX5A 4LBSA 1DWFM 3QY6A 4XVSH 1KGIA 1LO0H 1TCMA 2AJXH 3FUHA 4ZW7A 1UH4A 2VUNA 2EEAA 5F4XA 4MJHA 1ZD6A 5EU7E 3W7RA 5IB2B 3PS7A 3B2MA 5DA0B 1RH8A 2WLJA 2I1OA 4GT0A 4J3OH 5E94B 2AK1H 2DQIH 4ADGA 3L65A 1XINA 2WINB 3U7AA 3FUMA 4BRJA 4R7NA 1TJ0A 1S5MA 3CB8A 3MO4A 2PLCA 5D2NC 2WGNB 4Y2NA 3DHUA 1IV8A 1D5IH 4OLWL 3A4JA 5D37A 2WXLA 2F1AA 4M1CD 3FUIA 4IMGA 3W7DA 2VNCA 4MAYD 5EOCJ 3L1EA 4Y19D 1XG3A 2NUTB 2WQSA 3PDGA 3EFOB 1YE6A 3IMWA 1UZ6F 2PDKA 4JE4B 3RWEA 3V4VL 1PFOA 2IDSA 2ZX6A 1U4FA 3REVA 5IQ7H 2XC8A 4ZJ9A 4JE0A 3D7PA 5HVWA 2CFFA 3B0VC 4XNYL 4IIZA 1E1CA 2NY0D 2OM5A 2VN4A 4WUUE 1AODA 1DPMA 1FNSL 1WC7A 2VZOA 4NKIL 5BO1L 1F58H 3TJ4A 1H7PA 3C9NA 3SE3A 2DKSA 3BUDA 4N2NA 2XH4A 2H3KA 5C9WA 2EACA 1BYAA 1AAJA 3QJHB 4KZ0A 4C5ZA 4XCYA 3DECA 2CLHA 1I3RA 1KFLA 2IQTA 4ZQNA 3FYOA 3GMOB 3O2DL 4ERIA 4Z2KA 4QXTB 2VXTH 4IRSA 4WFFD 3HBZA 1RAKA 4GBXC 3W01A 1GK8A 3S3BB 4I4WA 2PDIA 5C0DB 3ARGA 1O6VA 1VEPA 3NPSC 4LESA 3MCMA 1G7PA 3NIFB 4AW4A 1N5YL 1IBGL 2A3HA 2TODA 2BNRA 1L9SA 2VSCA 2IADA 4FHKA 4ORZC 3GE7A 3U83A 2GL5A 2NDGA 4E9TA 4M6OH 4CQBA 4ONHA 5F93C 3DJZA 1JXFA 1HHHA 1DJWA 1OP5H 4D0BA 1UZ8B 5DJZA 3G5YB 2OMZA 3IFLL 1Q7QA 4RXGA 5MKGA 3UZQA 5C9UA 3L7FB 3NEOA 5HYJA 3U0WH 3HTWA 5TIMA 3P9LA 3FO1B 3HE7A 4XZ4A 4ADUA 5LG1A 3QQ4A 1YPZF 3EJCA 5EOQH 1FNAA 4D9LH 2WLZA 2Y89A 1MUJB 3IDUA 3GFXA 4AGPA 4EZJA 3VD9A 3VD0A 5J6GB 3CQ0A 3D34A 5HUPA 1LO5A 4MWFA 2ESCA 4DJMA 3EBAA 4YTQA 5D1ZA 1N0LA 1A0CA 3CMGA 4QO1B 4NQSA 2ATAA 5AVVB 2JH2A 2F53A 3M5ZA 4MAVA 4P2OA 4PUNA 3KVMA 1JDFA 4RFNB 2I5YH 4YPGA 1FHNA 2H3DA 4M8VA 4JFQA 4K38A 1JRHL 4LUSA 3FCSB 1Y65A 4RMUA 3DURB 2O92A 4MGGA 4GS7C 3SCMC 4F5CE 4HUKB 1QWNA 4POYA 3UTQB 4M43H 3C2AH 3N19B 2VDNB 2ZAGA 4BEUA 2F19L 1VADB 2CKBL 3F6JA 1EIXA 5DEJA 1TZAA 3MRPA 1N59B 3GHBL 3HFFA 1R0AH 1UIPA 1RPQA 7A3HA 1DQJB 2GBVA 1X7SA 3IDMA 5JPMC 3PTMA 4R90L 2QJGA 5CJOH 5C6TL 5CFHA 2ZQ0A 1LK3H 2R1YA 3D3VA 1WDDA 1DBKH 2P80D 5DJDA 4TVPD 2VXUH 2NLYA 4AISA 4KPLA 4DNHA 3II3A 1LO3L 1UACH 3VNYA 2BODX 5ECJE 5DZAA 1P0BA 5D8ZA 1A0DA 2E77A 1UWFA 1JWMB 5GZOC 2R91A 2CK0H 2UXFA 3MLYL 3PGDA 1OCOB 4MTVA 1XT5A 3B9KD 5IR1A 2MNUA 4GY7A 1BQSA 2YL5A 3D51A 2A83B 3L5WA 1J1PL 3O6LH 3BZJA 1MVFA 5F0MB 1E55A 2IGFH 4Z77B 3AXHA 1BVKB 3RVXD 3CPRA 2IVFC 3BLDA 3GHTA 4GVFA 1UOLA 4TSAH 3TONA 2WIIA 1AGFA 4YHPB 4BFBD 4LY8A 4IU2B 4D6DA 2NUXA 4F15B 3DXAD 5ENWA 3AHVA 1X7IA 4HFUL 3HMWH 3UL4A 4AOFA 2G97A 5KVGH 1JJKA 3F4CA 1MFNA 5CKSA 1A6WH 2FDSA 5DUBA 1KCXA 2R1PA 2HT2D 2DQJL 5I6MA 4IRJA 3CVHL 2X2YA 4G11A 4NAFB 1UD4A 1X96A 3OKYA 2Z7ZA 2ZZ5A 4FMVA 5DSCB 2EDMA 1P6AB 3D4YA 3OHXC 4JB9H 4UYQA 3G08A 4DH2A 2IH1B 1WOBA 3W7KA 1ETZB 4PGBB 2A9BA 2V2CA 1OL0A 3ZX1A 3DIVA 1A14L 1MZHA 2PDJA 1Q72L 5K9DA 1IMHC 5DUPH 1QKZH 5SWZD 1AXSA 3M1OA 5I23A 5TAOA 3ILDA 3EH2A 1JZ7A 4GK8A 1FRGL 1QACA 2KX9A 1DVXA 1MRFH 2YJQA 2AZAA 3ARDD 3EZJB 4BXVA 4C83A 3O2DA 2OZNA 4NZFA 4W6YB 4XI5C 5FYLH 4MAUL 3LU2A 4Y8AA 3VIIA 1VPQA 1M7DB 4YXHH 2FATL 4Z7VF 4J3ZA 2XN9D 3MRHB 2O55A 4WAFA 1TWSA 1JMXA 4MJID 1W2VA 4P5KB 4MWAA 3B06A 3QO0B 1WUFA 4HC1A 2E5EA 2GGHA 1WT5C 4A3RA 1W6LA 3LPFA 3UBGA 3UTTB 1J9SA 2WXIA 5D2YA 1NIBA 4PRDA 3OC8A 1XXXA 3IAGC 3S3PA 2B59B 3HBLA 3V0UA 4GIYA 2IBZX 3BPOC 2YXVA 1XC4A 1CFQB 4JDYA 3SR7A 3A6CH 1SOXA 1KYAA 2LU3A 3NXLA 3W7HA 4Z7VE 5E6IB 2WYZA 3BVNB 3EH4B 4CL7A 2F6UA 1LNUB 3CC1A 2HPMA 4PJDB 4QYOA 4HUMB 5JZ7D 3EA2A 4DNLA 3K5SA 3FK3A 3KPRB 3IRCA 4JM2A 4NHVA 1JPGA 5AAPA 4S1DC 3EYQC 2CIKA 5K9KA 5MEQA 4DY1A 1QRNE