1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
2VZSA 4E8DA 4AMWA 5IXEA 2W66A 4DUVA 4UQBA 5AYIA 4GI6A 4D6FA 1VFOA 1I1XA 1CXKA 4GINA 4BZYA 2WW5A 4R5EA 1X1NA 1V0NA 4CN6A 4M82A 2BY1A 2QPUA 5HPCA 1NWRA 5E6YA 1V03A 3WH8A 5DT5A 3A47A 1FP8A 4DWSC 1M7XA 4PSPA 3AIBA 1H1NA 2ZE0A 4XUYA 2J7DA 1B3YA 5BRQA 2VX4A 4AYGA 3W0KA 3VM7A 1E4NA 2V5DA 2WBKA 2PWGA 4JFSA 1G01A 3BAJA 3T0DA 5CG0A 4LQ1A 1XRVA 4AYSA 2XVPA 1JI2A 1XGZA 5M03A 4OOZA 5E0CA 1ZBCA 4C7GA 2EJ1A 3TP4A 2J7FA 4FLSA 1WDQA 2WZHA 3PZQA 4ZXLA 4AISA 3DHUA 2ZX9A 1UWUA 3W38A 2NW0A 2YA2A 2XUCA 2WMGA 4E2OA 1A3HA 3HN3A 3CUHA 3BLPX 1C7SA 4MB3A 5E09A 4KGJA 1VFUA 1OGBA 3DX4A 1B3ZA 1GVYA 1HKKA 3HZ3A 1D2KA 3HG3A 4YHGA 3CBWA 5EB8A 2XVKA 4B9YA 4F9JA 5I78A 1EH9A 2YL9A 3EJRA 2BNJA 1EA9C 3AQUA 3RDKA 2WVUA 2CBUA 4JFWA 2X0YA 2OYLA 2VT0A 1E6PA 1E5JA 1QW8A 3VIOA 5IFPA 1MW1A 2FH6A 5KZ6A 2J75A 1KGWA 1WNOA 4PTVA 4WK9A 2WHLA 1AQMA 2W61A 1MFUA 2BVYA 1UYQA 1UA3A 1V3KA 3ARXA 1NWUA 3U5UA 2CEQA 4PCTA 2WLYA 1TQWA 5CJ5A 2J25A 2RGMA 1KXHA 4H8HA 4V27A 1W9UA 5A8PA 1CDGA 2F7OA 4UOJA 1MW3A 3WQWA 5JIPA 2E9BA 4U5KA 3UERA 4NX0A 2VZOA 2ZOXA 1E3XA 1XH1A 1IZJA 2JIWA 3U5YA 3FXYA 3AHTA 2ZUNA 4PMNA 3VMPA 3BVWA 1TQVA 1W9VA 2FGZA 3B9AA 4C7FA 3OLGA 2QMJA 2WVVA 1ITCA 3BAWA 2CPUA 2WANA 2WC3A 4KRTA 3CGTA 4J3WA 3DX2A 3WKZA 5A6JA 3W6MA 1R47A 3VD9A 3E1F1 4HU0A 4W7WA 3WF4A 3SUVA 1BYAA 3D5HA 1UD3A 3OLEA 3ARWA 2EEXA 2FE0A 1JZ4A 3F5KA 4LXFA 1CTNA 2VMFA 3WH5A 3AFBA 1UKPA 2XJ7A 1EDQA 2VZTA 2BHYA 2ZUSA 3M46A 1CECA 5TD4A 1XH2A 3ZSTA 1UH3A 3KEHA 3VIFA 1CYGA 4W7UA 3GZAA 2WKLA 3ZJ6A 4LYPA 4TVUA 2XFYA 4F66A 2UY2A 2Z1SA 3BSHA 2A3HA 2CERA 3WNPA 1XCWA 2EBNA 4WJXA 1JYXA 3VUPA 3VX1A 1CGWA 3OLIA 3PZ9A 3VD7A 2D24A 5HOSA 4BQ2A 5E9AA 5I79A 3CUFA 3NDYA 2JFEX 3F5JA 3AHXA 4MNMA 3BUBA 1NM9A 3M07A 1DP0A 1JZ2A 1VJZA 2BHUA 2CBVA 2Y24A 4AEEA 2OSWA 1EOKA 3GM8A 2ZIDA 3NCOA 4NRSA 3AIUA 4FNQA 3GH5A 2D2OA 1KXQA 1OIMA 2PF0A 3ARUA 3L4TA 3VDHA 3I3DA 4AD1A 1LL7A 4WLCA 2G3JA 4UFKA 3T2PA 3GXNA 3K8KA 1NWTA 3VU2A 4WKHA 1BFNA 1BPLB 4MADA 1H0GA 4YPJA 5A2AA 2F61A 5HNNA 3VX0A 5C71A 1TQSA 5EFFA 1W1YA 1QHPA 1DWAM 4W7VA 2VOTA 4PMQA 8A3HA 4W5UA 4Z2GA 2O9PA 1QNRA 2XGBA 1OSEA 1UD8A 1UR1A 4LGXA 4U2ZA 3MMDA 2WAGA 1V08A 1JZ3A 2X2IA 4AEFA 1UA7A 2YL8A 3VIKA 4X0VA 3K1DA 1QNSA 3U57A 1QI2A 2DT1A 3QHNA 2DPEA 3MSGA 3EDFA 3WQ8A 3WBAA 3VMOA 1EQCA 3VSTA 1M53A 3FAXA 1WB0A 2ZXBA 4JL1A 4S3KA 1JL8A 1HXKA 2O9OA 1J18A 1HWWA 4HOZA 4CCCA 1UR9A 1W9PA 3WUBA 1WO2A 4ML4A 4ACZA 1WZMA 1HN1A 3GBDA 1DWGM 4J3TA 1UHVA 1JD7A 4H8UA 2DT0A 4GQRA 4M56A 5ABFB 4ZE5A 1E6XM 1JNDA 3CZ8A 3N1AA 3ARYA 3VKKA 3AIWA 2CBIA 1EHAA 1RP8A 2VRQA 2JF6A 4PRWA 3AS2A 1C92A 1CXIA 2GVYA 3DYPA 4V2XA 3NUKA 3VIMA 2VC9A 2CHOA 3N9KA 4QLLA 3WIJA 4ATLA 4AZ5A 3CHFA 3CHEA 1QNPA 2PWFA 4W8BA 2XN2A 2WC7A 4GZEA 4XX6A 3WDRA 4EANA 1C93A 2XVLA 1ZBWA 4FF5A 5A6KA 3RMEA 3ARPA 2F1BA 3FN9A 3W26A 2X8RA 3MUIA 3BH4A 1UUQA 3CUGA 3PTQA 4PMZA 2WVVB 5JBFA 1QI0A 3NSNA 4TXEA 1NP0A 4CCDA 2FGLA 1O7DC 2CCRA 4AD3A 3DX3A 3OLDA 4UTFA 3WD3A 1AQ0A 5IFTA 2W91A 5I3DA 1LWHA 4D6JA 4AC1X 1SMDA 1H2JA 3WF2A 1V3MA 4NRRA 3VPLA 4D6EA 5CGMA 4NI3A 3ZSSA 3WF0A 3DDFA 4N0RA 1WZAA 3ZT6A 4Z2IA 4C7DA 3CHCA 2FHBA 3OGSA 2O92A 1VFFA 3ARRA 4XB3A 1HKJA 4U2YA 1E6SM 5CSUA 4Z2JA 2VRJA 5HXMA 1J0YA 2WXDM 2DEPA 3VIHA 3WFLA 1XYZA 3AMDA 4BCEA 1US2A 4RE2A 4RL3A 1QBAA 1V6YA 2VQTA 5BCAA 3BUQA 8CGTA 1E15A 1ZB5A 1Q4NX 1NP2A 1F4AA 1MWOA 1X6LA 5D9NA 3VNYA 3BUPA 1KCKA 3H53A 1E0WA 4W89A 1R7OA 2BS9A 1GQIA 3KZSA 4QFUA 1XSJA 4CGTA 3BVVA 1H09A 2X2HA 1DWJM 1CPUA 2E0PA 4D1IA 3AXXA 1FA2A 4CN4A 2GK1A 5I24A 1VEMA 1W1PA 5E0FA 1KBKA 3PZTA 3AXHA 4TX6A 4MAVA 4TTGA 5CLWA 2ZICA 2OYMA 4WF7A 4P8XA 1V6XA 1TFVA 4AZGA 4X9YA 1TUXA 1WPCA 3UG3A 3W82A 3VOCA 1R7AA 3SUTA 1WZLA 1UKSA 3KL3A 4Y7EA 1GJUA 2ZUMA 2XN0A 1UWQA 4YN5A 3K46A 3KLLA 3WQ5A 5CPQA 1SZNA 1BHGA 3WY2A 2YLAA 4HZ7A 2G3NA 4AW7A 1GOWA 3WMCA 4LPCA 1WDPA 6A3HA 2YBUA 2QMKA 1W9XA 2CNCA 5EBAA 5I77A 2F7QA 3SUSA 3LPGA 5A6LA 4HZ8A 3MU7A 4HP5A 4DWSA 2NT0A 1UH2A 3T0AA 4HOXA 4W84A 3WNKA 5CQ1A 1OCQA 1BTCA 3ECQA 2PWHA 5IHRA 2BY2A 2OLHA 4F79A 2F7PA 3HJEA 1H49A 1PZ2A 3UCQA 2VCAA 4MDPA 1WDSA 2Y8VA 4UZUA 2EACA 1XCXA 1EQPA 2F8QA 1VBRA 4QAWA 3WUFA 4AZIA 4HU8A 2A3EA 1BGAA 1KWKA 1LL4A 3K8MA 3IAQA 4U31A 4ZXOA 3ARTA 2E40A 3WDPP 1TCMA 3HG4A 1E55A 4AD2A 1E4IA 5ECUA 2ZX5A 3CZKA 2XYLA 4U33A 4OUEA 1GOKA 3GXIA 1E72M 3WQ4A 1HL8A 4UFMA 1Q6FA 3DYOA 3BCDA 3CUJA 4B15A 3EMCA 3RM9A 4ACYA 3BAYA 1BQCA 2EPMX 2JEPA 3VM5A 4JIEA 4HOWA 4W85A 3SUUA 2G41A 3DYMA 2XVNA 1ZL1A 2WCSA 4GPNA 1JXJA 1NQ6A 3MUY1 4K68A 3N15A 1M03A 5JIWA 3WDQA 4NXSA 3PZUA 3THDA 3GH4A 2F18A 1Q6GA 1OD0A 1H11A 1UZ4A 3D51A 2CKRA 4AZCA 4AZ7A 3CMJA 1CGTA 2ZX8A 1ZJBA 2OSYA 2XG9A 1BF2A 1CBGA 3ZR6A 2QV4A 2DH3A 1BGGA 2C8NA 3UG4A 1K9TA 4HZ6A 3DHPA 2WSKA 3L4XA 1W9BM 4D6CA 3BAXA 1B3WA 1HVQA 4IISA 5M17A 1BLIA 4AMCA 1VEOA 4M80A 3OIHA 2UWFA 4CCEA 4H41A 4Z2HA 2IGTA 3ZOAA 1HVXA 3KL0A 3VGFA 4MB1A 3BMVA 4FNSA 3ZJ7A 1X6NA 1HJSA 3SUWA 5A6BA 4W5ZA 5E70A 2WWDA 1R33A 1QHZA 2CXGA 2W62A 3POHA 3S5YA 3AS1A 4DM1A 2DSZA 1CGUA 4CU7A 3LXBA 2J62A 1C8QA 3WNMA 3ZIZA 3EDKA 3A21A 2WMIA 3GNPA 5CPSA 3WF1A 1PAMA 2GFTA 3IJ7A 5A69A 1KB3A 4M81A 4HMEA 3WNNA 2D0FA 5JUVA 1MW2A 3AMKA 4M8UA 1RH9A 4W8AA 1GW1A 3BC9A 3OBAA 3MUZ1 2EPOA 3GXTA 5A6SA 3H55A 2JIEA 1JAKA 1PX8A 2EABA 4BQ4A 4HA3A 4PMUA 4DO4A 3WD2A 5FKYA 2PB1A 1CNVA 4MB4A 1JF6A 4F8XA 3WH7A 4GZJA 4TOQA 3AHVA 3WQVA 5LA1A 4B9ZA 3EJSA 3PZGA 1DWIM 1VBUA 3SEPA 2ZUTA 3LMYA 4Z2KA 2Y5EA 2DSUA 1MQRA 1TQTA 2UY5A 2GJXB 2XSBA 2GUYA 5ABEA 1UOKA 1K9EA 1HF6A 4D72A 3WSUA 3M6DA 3ARSA 1CWYA 3CZEA 4RE3A 1E4MM 4KMQA 2OWWA 4X0NA 5JBDA 3ZQ9A 4UNIA 1V02A 2V5CA 1HP5A 3W6LA 3SCWA 1YQ2A 4D6DA 2YFOA 4TX8A 5DFAA 3ZO9A 3AROA 2WZEA 3THCA 1LF1A 4Q7NA 2EPNA 3PHAA 1UD2A 2J8GA 2XFFA 2GDUA 4BQ3A 3OA5A 2ZWZA 4DWSB 1GHRA 3L4UA 1R46A 3BGAA 1VJSA 2WC4A 1HIZA 4J7RA 3L4ZA 4W86A 1Z32X 4PN2A 3T0BA 2DSKA 3VDCA 3HG5A 1XD0A 3TTYA 1G5AA 2BY3A 5AC5A 3OB8A 3LXCA 1PX4A 3MMUA 3NSMA 2DDXA 3O2LA 1HX0A 2J78A 1UASA 3VNZA 5DMYA 3N13A 3RIKA 1U30A 3I3BA 4V28A 4DUWA 1PPIA 3AYRA 2WMJA 3AIVA 3AMGA 3QHOA 4QCFA 4UFIA 2YLLA 1BVNP 1MVYA 3W24A 3A4AA 1V3JA 3VGGA 3F4VA 2BVTA 3MSDA 5C8BB 1KR0A 3VTRA 3J7HA 2O9RA 1V0LA 1KR1A 2VCBA 1CXEA 4WSKA 2V3EA 1HT6A 3VGDA 1J0IA 4IPLA 4DUXA 3D4YA 3TONA 5BXTA 3CLWA 2PWDA 1EDTA 3DDGA 4YHEA 1V6WA 1WDRA 1Q6CA 5BRPA 1K9FA 3VIIA 2YA0A 1CLXA 4GI8A 3OG2A 1WAWA 1H5VA 4PCSA 4OKDA 1ODZA 3HU7A 4AZCB 2D0HA 3F5LA 4R27A 5GNXA 1MFVA 1JYVA 4MNLA 4PMVA 5GQBA 4HPHA 1BYBA 2J7CA 4CU8A 4MPKA 2BXZA 1UWTA 2ZUVA 1E1FA 3CZLA 3RILA 1TA3A 4OBRA 1KWGA 4JHOA 2PC8A 4DWSD 3GXFA 4AZBA 1OGGA 1EHNA 3RPMA 1JDDA 1CZ1A 4AD5A 1LQ0A 4ATWA 3WH6A 4JFVA 4MDOA 3G6MA 2ZUUA 4MB5A 3CZGA 2XN1A 2G3IA 1TQUA 5GNZA 1ESWA 4P7OA 1JYNA 1JZ7A 1OBAA 4J27A 4D6HA 5A6AA 4J3XA 1E6RA 4B3KA 1KQYA 4JKLA 3WMBA 1QWNA 2AMGA 2G8ZA 4CD7A 5A2BA 1GVIA 5C70A 3ALFA 3BUIA 2VX7A 4JCMA 3WELA 1UD4A 2YOCA 2JALA 1WP6A 4CKQA 3NYDA 4CUCA 3RM4A 1KGXA 1HL9A 1VENA 3GNOA 2VZVA 1V3HA 3RJXA 4J28A 2QHAA 2V3DA 3I3EA 3L2LA 3BXWA 4UOQA 2WMKA 4DO5A 1V0KA 2DSWA 1JG9A 2C0HA 1DWHM 3LXAA 2J8FA 1KXTA 1FH7A 3EDJA 3T2OA 2AAAA 2YJQA 3ZT7A 1GZJA 2NT1A 3HMCA 1QVBA 1I1WA 5F7UA 2G4FA 2YL5A 4ZEPA 1C90A 1LLOA 4L4PA 3B9EA 3WL1A 3FNDA 5GPRA 3CH9A 1B31A 2GJRA 4HPGA 3CIVA 4E8CA 3PTKA 5M5DA 3UR8A 2W4XA 4P7RA 3TV8A 2DT2A 5E1QA 2HISA 3CMGA 3BCFA 1B3XA 5D8WA 2CBJA 2XSAA 2BHZA 2D3NA 5A95A 1WCGA 4W88A 1E70M 4F9DA 1HNYA 5CPTA 5CXPA 3RCNA 3W25A 3PZMA 1RPKA 2WMHA 2ZXDA 5I5RA 3AIEA 1OGSA 1J0JA 4MTVA 2WB5A 3KE0A 3SCVA 4OBSA 1ZBVA 4NSBA 1OD8A 3A24A 3A22A 3BLBA 4GZIA 3CV5A 4JAWA 1JI1A 2XHYA 3OZPA 4HMCA 1O7AA 1KCLA 1R87A 1UQZA 4PTMA 4KH2A 3VD3A 5D4YA 2IXVA 4D6GA 2DSVA 5I2UA 2EPLX 1H41A 4M24A 3WEZA 1B30A 1XD1A 2W5FA 1NOFA 1MYRA 4JHZA 3VSVA 3QOKA 4MJ4A 2YDSA 7A3HA 2DT3A 1J01A 4CD8A 3FHQA 1PX3A 4A3HA 4GKLA 3DX1A 3VD4A 2EPKX 4AD4A 3EJUA 1R75A 4AWEA 2G3MA 2XIBA 1UR4A 1PIGA 2WVSA 1NOWA 2IXUA 4B16A 1JFHA 2Y4SA 1OT2A 3EJQA 2DIEA 2WSPA 5AC4A 3AS0A 3VDBA 1UKOA 3SCNA 4QLJA 1G94A 1O6IA 1FH9A 5CLTA 6TAAA 3SURA 1UQYA 2D1ZA 4Z2LA 3UETA 2VQUA 3PBGA 5D9PA 1SYTA 4JFUA 4CN1A 1J10A 4NZCA 3GDBA 3RM8A 3QOMA 2A3CA 1RD6A 3IGUA 2X09A 3ZT5A 5E6ZA 1HJQA 3FAWA 2WZIA 2YBTA 1VIWA 1XSKA 2BXYA 3VIJA 3MO4A 5FCZA 4HA4A 3LPOA 1ITXA 1CIUA 2J77A 2VURA 2ZUWA 2IUZA 2WBGA 3WL0A 3WY3A 2DIJA 2VX5A 3BAIA 3GYCA 1DWFM 3W37A 4H7VA 3AHYA 3AZRA 2VO5A 2WHJA 3ARZA 2UY3A 4L4OA 2ZXAA 1OM0A 3L4YA 2QPSA 5A3HA 7CGTA 2EADA 2Z1KA 3WDJA 1SFSA 4MNJA 1QPKA 1EO5A 2CITA 2J79A 1QW9A 1W3LA 3WFZA 3CZNA 1E4LA 3WD4A 3MKKA 4WKAA 4W8LA 2CESA 1E56A 5D9OA 2NSXA 1IZKA 2E8ZA 3S6TA 5EMYA 2YDQA 1C3FA 3A4WA 1R8LA 2WLZA 1GJWA 1H0IA 3A5VA 1JD9A 3MANA 4U3AA 3BSGA 1KFWA 3BUDA 2CETA 2J4GA 2CHNA 1ISVA 2PBGA 3W29A 5IHSA 3AHZA 3N17A 3NIYA 3WNOA 4ACZB 1E43A 2DGAA 1W3JA 4UQCA 1LG1A 3D50A 2YA1A 3QGVA 4JL2A 3VVGA 1HJWA 3FY1A 1KQZA 1ODUA 1E6NA 4JFTA 1NH6A 2PBOA 2WCAA 1GPFA 3VILA 4OZOA 1QI3A 4ZENA 2J7BA 4FLQA 1H4PA 2WHMA 2OWXA 1MW0A 3VIGA 1JDAA 5IDIA 3VGBA 1OINA 3UR7A 2XTKA 3WBEA 3ARQA 4D71A 2GSJA 4ATDA 3VD5A 2GDVA 4FK9A 1W2PA 2CIPA 1UG6A 2WWCA 5AY7A 1OB0A 3M7SA 4UR9A 3MUAA 3GXMA 2VR5A 3QR3A 1HKIA 4B3LA 4WIWA 4IM4A 1D3CA 2WYSA 1R86A 1QWUA 2WKGA 2XPKA 2XIIA 3EMQA 1ZU8A 1EDGA 4TVCA 3SCUA 3SCOA 4NZJA 1A47A 1E40A 1PBGA 1HXJA 4XZWA 1TMQA 4HMDA 1C91A 3CHDA 1FFQA 2J7EA 1XH0A 3DX0A 1UZ1A 4AXNA 3WNLA 2FYVA 4FNPA 4AIEA 2VNCA 3LRLA 4J3SA 3AIQA 3U7VA 1UWRA 2BY0A 2JE8A 1HJXA 4W93A 3N18A 3ARVA 3SCTA 4QDMA 3LPFA 4EAMA 1TVNA 3CO4A 3AOFA 1HTYA 3L4VA 1FH8A 3D3AA 7TAAA 6CGTA 2V3GA 3TA9A 2DQXA 2DH2A 1KGUA 2Y2WA 4QP0A 1HJVA 2D0GA 3VINA 3NJ3A 4QCEA 1GQJA 4EKJA 2WNWA 2HVMA 1XSIA 3MV11 3H54A 1W1VA 1YHTA 1MQPA 4A4AA 1CENA 3VO0A 3N12A 1V0MA 3GXDA 1GQKA 5BXPA 2XFRA 1L8NA 1ISYA 2D22A 2VI0A 2GK1B 2BFGA 1BSIA 3FW6A 1E9LA 4TTUA 2VTFA 1E0VA 3WD1A 3BLKA 4GO9A 4ZE4A 3IJ8A 3WH9A 5CGTA 4H2CA 5I6SA 4GI9A 3TOPA 2FDMA 4JKMA 1KXVA 3T09A 3CUIA 4UQ9A 3BVUA 1EIBA 2VUYA 2XWEA 5KEZA 4GXPA 1JYWA 1CEOA 4P7NA 3W81A 1J9YA 1LG2A 1QX1A 1CXFA 3BMWA 3II1A 3K8LA 2F1AA 3WEMA 1F4HA 1UD6A 3AZSA 4P8VA 2O9TA 5ABFA 4AIOA 5HBFA 2FHCA 1BAGA 4OJYA 4KRUA 2D73A 1UR0A 3SIMA 1PJ9A 2J7GA 1I75A 5DT7A 1W3HA 2CYGA 1K6AA 4CD4A 3MV01 1JGIA 3TTOA 3VDAA 1G1YA 2EAEA 3AMLA 4FNTA 1Q6EA 2JEQA 2YL6A 3EMZA 1LL6A 4U5IA 5BXRA 1QI5A 1W32A 2BVDA 4JKKA 4PYSA 3CTTA 3VMNA 4IUGA 1DTUA 1E73M 2WK2A 1JAEA 2MANA 5I23A 1EGZA 4M1RA 1QI4A 1GONA 1TZ7A 2YDRA 2WMFA 1JIBA 1LJYA 5A8QA 2PI6A 1J12A 1J11A 2VVSA 1CLVA 1TE1A 4AMXA 3K4DA 4N42A 4E4PA 1KTBA 2X2JA 2VX6A 3PZVA 4IPNB 3EDEA 5BYWA 5FL1A 1CGXA 2Q8XA 2X2YA 5AYBA 1PS3A 1JXKA 1B0IA 3TTSA 3AYSA 1UKQA 2QF8A 3BVXA 2A3BA 2AOSA 3ZR5A 4P7QA 1E3ZA 4P8WA 1AMYA 1V3IA 2E3ZA 4H8VA 1TG7A 3AZTA 1UR2A 5HPOA 3AISA 5BXSA 3GH7A 4DM2A 2OSXA 2ZWYA 3ZJ8A 3SCRA 1QHOA 4FMVA 5D9MA 1QNQA 2V3FA 2XWDA 1UR8A 4PUEA 5CZKA 3W53A 2WCGA 4J3VA 4UFHA 2BV9A 5FD0A 4UFJA 1UH4A 3MS8A 5I0DA 3GNRA 1CXLA 2ALWA 3WUGA 2E8YA 3PZOA 3AIRA 3GXPA 1XYFA 4BA0A 1J0HA 1CGYA 3OGRA 4HA1A 3BVTA 4W87A 1RP9A 2OW7A 4PMOA 3SCPA 1PEZA 3O9NA 3S5ZA 4UZSA 3SCQA 3KWXA 1KBBA 1TVPA 1VRXA 1Y7VA 1V6UA 1UKTA 1BYDA 3K4AA 3PZIA 1W9DM 4AY1A 3TTQA 2V38A 1W2VA 3AJ7A 1B9ZA 1BYCA 3UEQA 3KLKA 3W4RA 3WDHA 3EDDA 3ALGA 3ZM8A 2WMIB 3A23A 4FNRA 2ZXQA 2JF7A 2XGIA 1GCYA 3OZOA 5HDRA 3EJTA 5A8OA 1MXDA 1US3A 4PMXA 4JCLA 4P8UA 2UY4A 1P6WA 1WKYA 1M01A 3WQ6A 2F7RA 5FL0A 1DEDA 1U33A 4KWUA 4EK7A 2W63A 2XVGA 5A2CA 4KGLA 1D7FA 2VCCA 3O6AA 4RE4A 1J0ZA 4JZ5A 4LYQA 5LYRA 4LX4A 5A8MA 3AXIA 1MQQA 1VF8A 4J3UA 2OWCA 3WEOA 3MI6A 1QNOA 2E9MA 5CSYA 3WMSA 5EFDA 1E71M 2D20A 3JUGA 2OYKA 1V3LA 2X1IA 1HP4A 1GUVA 2C7FA 3WD0A 3POCA 1QOXA 2VZUA 2WPGA 3T08A 5FIPA 4HTYA 1FHLA 1GOOA 4AD0A 2YKKA 5GNYA 1G9HA 1G0CA 3PZNA 1EO7A 3A4XA 1B1YA 1N82A 1OIFA 1NARA 3D4ZA 1C8YA 1KTCA 3LPPA 1ISWA 1GOQA 5LA2A 3VGEA 4UQAA 1GNXA 3IK2A 4WKFA 3IJ9A 5D8ZA 5A6BD 1FOBA 3SCSA 1FHDA 1H3GA 1S46A 3NSXA 4NZFA 3L4WA 4DO6A 4PMYA 4A3YA 2W67A 3MMWA 2VVNA 1GQLA 5A94A 4PMRA 3RJYA 4EE9A 2QLYA 4AIUA 1W1TA 5DEZA 4OGZA 1BG9A 1U2YA 1J0KA 1UWSA 4CVUA 1OWQA 3RO8A 4WSJA 2FH8A 3LRMA 1SR0A 4PBGA 3WF3A 1UD5A 3ZJKA 1M04A 1NOUA 1JZ5A 1L0PA 3B9DA 1E1EA 3EJPA 1V02E 1XC6A 2X05A 1JZ6A 1UWIA 3IANA 3FHAA 3GBEA 3D52A 3IAPA 3LX9A 3LRKA 4MJ2A 1W3KA 4AZHA 2PWEA 4FLOA 3WY4A 4D1JA 1PIFA 5A1AA 4FNUA 3U7BA 1B3VA 1JDCA 1ISZA 1AQHA 5BWFA 5ABHA 2YFNA 1OT1A 1ISXA 1T0OA 1XHGA 4UOZA 3WN6A 3WENA 4CVWA 3N11A 1AVAA 2ESCA 2EQDA 3T2QA 3CZSA 2EXOA 4TUFA 3S2CA 3AI0A 1XV8A 2E9LA 1R85A 2RGLA 1R34A 5BROA 5M3WA 4NXKA 4LYRA 3L2MA 3EYPA 1BVZA 1VFMA 3W28A 4PTXA 2TAAA 1JFXA 3A6OA 1DHKA 2WHKA 3WUEA 1CXHA 4GO8A 4ZFMA 4UFLA 2D23A 1JF5A 3CC1A 1QBBA 1V6VA 1Q6DA 4GIAA 4PMDA 4Q22A 4BQ5A 1ZJAA 5LA0A 1TA3B 3GTNA 3KL5A 5A6MA 1B90A 3NDZA 3G6LA 5DF0A 1HKMA 3AICA 2VR4A 3QHMA 2CKSA 2D3LA 1IT0A 3N04A 4P7LA 9CGTA 3HG2A 3UESA 3A3HA 2J47A 4M29A 2ZX6A 3PTMA 3VGHA 2VL4A 2GJXA 1FFRA 3W27A 5JBEA 2VJXA 4CU6A 4AZ6A 1B2YA 1FP9A 2B31A 1IV8A 4URIA 3BAKA 4UQDA 1MXGA 1E0XA 1GOIA 3DECA 2XM2A 2WVTA 1TR1A 4PUDA 4PEEA 4TVDA 3UG5A 5DO8A 3WDIA 3DC0A 2Y8KA 4CD5A 1SMAA 5A8NA 2F2HA 1JZ8A 4CD6A 5ABGA 4PSRA 1VEPA 1VB9A 3APGA 3VSUA 4PTWA 1ZS2A 2E4TA 1ZBKA 4OIFA 3CZJA 1GHSA 1E6QM 2YIHA 4FLRA 1W91A 3VIPA 1E6ZA 2XM1A 4XZBA 2X0HA 4GQQA 2A3AA 3WY1A 1K9DA 1PZ3A 1GOMA 1E5NA 2WM0A 4QLKA 1GORA 4BF7A 1C7TA 4UQEA 4D6IA 2VRKA 3AMCA 4BS0A 1WE5A 4OOUA 1HJUA 3ZMRA 3EBVA 4U3CA 2GJPA 1VAHA 2J74A 4UCFA 3PN8A 2ZX7A 2EO7A 1LWJA 3B8SA 4H04A 2J7HA 2FHFA 2W92A 1NWSA 3AS3A 4MNKA 3CPUA 4XV0A 4S3JA 4MAZA 4NF7A 2OW6A 1ECEA 1WZKA 5FOOA 1EOMA 3OGVA 1CGVA 1C8XA 1EXPA 1JNEA 1BG4A
chains in the Genus database with same CATH superfamily
3TWYA 3WD5L 2VW4A 2WQVA 4F7EA 1TX2A 3VXUA 2Z65C 2J1XA 5JXEC 3CXDH 1EWDA 4XPBH 3ULVD 3T3MB 4LIQH 1L6WA 4C58B 4P3WA 4N2KA 2PP8A 3QFWA 3SBFA 5MP6H 5B4MC 4Y88A 4YHIA 3ZKND 3R11A 3VM7A 4TV6A 4N20A 1JPSL 2VLMD 5FYJD 3WI9A 1EJVC 1Y0EA 2VDQB 2GVLA 3I6RA 3RCYA 4Q4RA 1YDPA 4KQ3L 5AOIA 4WEUD 5I00A 1BQGA 1HKKA 1PG7L 2R0LH 2EC9T 1EUNA 1SW0A 1A0QL 4Y4KB 3N41B 1SOQA 2HRWA 2Q01A 1DKWA 5DT1H 2CO6B 1YYML 1YPZB 4HWUA 1L3WA 2GB2A 3BGFB 1CLOL 5EEYA 1XGPA 2IO5A 2EEAA 1K72A 1N5YL 4XO3A 3V6ZB 4CBPA 4AVNA 1S2EA 5KZ6A 2J75A 4YXKH 4FYQA 2Z0BA 3ZE2F 3ME0A 3DBSA 4WFGD 3U5UA 2CEQA 1ZLUH 4N2BA 5ESAB 1TQWA 2V33A 3R0NA 4G6KH 3UTSE 2MKWA 5EF0A 1DVJA 3BESR 2WYZA 3MR9B 4QTGA 1MW3A 2UXGA 3N55A 3LV3A 1UT9A 3EXJA 3BH8B 3TO4A 5I3GA 3IRPX 2H6OA 4GH1A 3NGBC 3V4VB 3OAYK 3LEVH 1OT4A 3F4NA 4A7TA 4HIXL 5IQ7H 4PRNA 1ITCA 2CPUA 1OFDA 3LH2L 5HYEA 1KB9J 1DE4B 3WK1A 4BHUA 1E9PA 3KGUA 4GRSA 2WNNA 2UY6B 3IMTA 4NQDD 1BIIA 4G83A 1YC8A 4UB0H 4R96A 1JEZA 4BEQA 2XJ7A 4Y5VB 1M3UA 2CLFA 2WJDA 3W22A 4ATTA 2WO4A 4I0KA 4QY8A 4N0UA 1F3JA 3TJ4A 1VZGA 3F7RA 1GYCA 5E23A 2RJGA 4HZ1A 2CD0A 3VXMA 3WE6A 3WNPA 1XCWA 1FNHA 1X5JA 3TO4C 3PZ9A 2ZAGA 2D24A 3WJJA 2BIPA 3NPSC 1NGQH 1QSFE 1BW8A 3AREA 1DVUA 4MNMA 4QOKB 1GS8A 2FX9H 5BMWA 1AFSA 1LLWA 2CBVA 1IGSA 2QCCA 3MOAH 4MJZA 1J87A 3I3DA 1AGDA 3K8KA 2D2JA 4A04A 4AQ1B 4EVNA 4G1EB 3VA2C 2AI0L 4S1SH 2ZTBA 4Z7NE 4L5FH 5TFSH 3FUHA 3TS8A 3U7WH 1UR1A 4U2ZA 2WAGA 5LAPA 4X0VA 2XXFA 1KNOB 3QFJD 1P4LA 1Z6KA 5AYTA 3MV8D 1MJ7H 5J5RA 1SJMA 1HJBC 2EVFA 4L1HA 5IQMA 4QROA 1OGTB 1Q0XH 4JL1A 1HXKA 2V68A 1YEGH 3NCXA 2VOMA 2E7BA 1AH3A 1IGYB 2C15A 4H8UA 3G6JF 1UOLA 4E3VA 1RK5A 1HQ4B 1B54A 4FULA 4HC1H 4GRLA 3DIFB 2C1OB 4CMMB 4W4QA 1VDGA 1IYXA 1EP1A 2JKJA 2PWFA 4JVWA 4KJQC 3WDRA 4HH9A 4WGVB 2VLJD 4FF5A 1GKOA 1MQKL 3ARPA 4E0RA 1B0WA 4L3FA 1UUQA 3CUGA 1TZOA 3H9HA 3FOKA 1FF5A 3IU3A 1D6VH 3GJFA 1XB3A 3JS3A 5E2UH 3NVQA 1A1MB 2PGEA 3A6BH 3KHOA 3MRNA 2FL5B 1A50A 3NJFA 1AJ0A 1WAPA 3KPMB 1HKJA 4U2YA 1TWDA 5GZOD 2HVKB 1GVSA 5KWYC 2YQ2A 4I13B 4GRLC 1EUAA 1E65A 1T04B 3INUH 4QHMB 4HKXB 5FO7A 4YL4A 4CGTA 3R12A 5FB8B 4MLRA 3FFCB 1SHMA 3VXGA 5LXXA 3EOOA 4R9HA 3II2A 3D47A 1C1EH 3CAQA 1IWAA 3GE7A 1D8CA 1LO4H 2B7NA 5AVHA 2PPAA 4ZD3H 3G0UA 1WZLA 4DEUA 1YPIA 3WQ5A 3P9LB 4RIRB 5KVEL 3FUMA 1N5AA 4R0LB 2G3NA 2H32B 3FJ6A 3ERXA 2CNCA 5E2WL 4MJIE 4IRJB 5IBTL 2DEXX 1LBMA 1BTCA 1EJWC 4RFOH 1RR2A 4NM8L 3DX8A 3FDWA 2VFEA 5HWNA 1K8IB 1EX5A 4GK8A 3K8MA 4LAKA 1CVRA 1HFBA 3STBA 4TPRL 4P2RA 3IUIA 4C4UA 4YYFA 3HE6B 2ZX5A 4GUQA 1HL8A 2QR0B 1HILA 2ZZ3A 4ACYA 2MNRA 5AD0A 1ZP3A 1T6WA 4IKNA 3E0IA 2DLFH 1NMAL 3E74A 5D1QD 5C9KA 3THDA 5T1KA 3HRZB 2F18A 2CKRA 3BARA 1MCBA 2V4LA 2BJMH 3T71A 2GZXA 4ZFGL 5FYKE 1FYTE 2XRAL 2GTZB 4NKOB 4YX2H 1Q9OA 1QHZA 4PGDB 3L2IA 3BG5A 1CGUA 3NTCL 3PNUA 1IM9D 4D3CH 3JWNE 1VADB 4PL2A 4HMEA 3WNNA 2D0FA 5AB0A 1TZHB 3W3BA 2NCEA 2HK1A 4PGZA 1R3HA 2CWNA 4JPIA 1CL7I 4Z0XB 4FZEL 1X4ZA 2XG4A 1COBA 2NWRA 4P46A 2LR4A 3CS2A 1T7VA 2LU5A 5L9FA 5HBBA 4P2OC 5IQ9B 2FT6A 4YTTA 5JBDA 4AIBA 2YCKX 1W56A 2EVGA 1V02A 2WUCL 1TYGA 4J12A 5EU9A 2XGZA 1Z9PA 1YO4A 1EXUB 2X7VA 3T4YA 4AOFA 2OB3A 4G82A 2X9XA 2YK1L 2R29L 2WXHA 5I02A 2A77L 4S1DC 5IFAL 2GDUA 2BHFA 1EJ6A 2CO7A 5BMFH 3MACL 5DJXA 4OE7A 4X5WB 4GAGH 1G5AA 1AGCB 1O60A 4PGBB 3SDDD 3S35X 3COTA 5DMYA 4P46C 2EECA 3I3BA 1AA1B 4RAHA 5CJOL 2YLLA 1ZTMA 3UCDA 3I6GA 2VQ1A 4NY2A 2BVTA 1SYSB 1MJJA 3EBIA 4XNXH 4IBYA 1I45A 4TVPH 1I7RB 3ABGA 5HGHB 2YB1A 4YHEA 2FMOA 3H2OA 4LSDA 3PDOA 3ETBF 4AXKA 3TIMA 4YWIA 1TETH 4JTKA 1ONEA 5GSRB 4AKQA 4AZCB 3TMLA 1BCIA 1JNLL 2ATPA 3HFTA 3CZLA 3B37A 2PXYA 1QOPA 1B2WH 2BWGA 4B9CA 3Q2DA 4MDOA 1R19A 3G6MA 3I7RA 3L81A 1B4JH 4EF9A 1B0GB 3C56A 9XIMA 4DZBB 3CC5A 4BFOA 5LXVA 2XDFA 1FRGH 3L21A 2I5QA 1LEGA 5I1GL 3B2UD 5KSVB 3H6JA 3F7YA 3LIZH 4BFNA 3UZJA 3S47A 3UR2A 2CDEA 2DQDH 3V5HB 1OCNA 1KGXA 1GKPA 4A7GF 4JO4L 3TJEH 4IIQB 2CUHA 2IKHA 4PAZA 4KK5C 1E30A 4X7EC 3L2LA 3UACA 4LY4A 4KKLD 1SM9A 2PXYC 3SOBL 3QORC 1N2RB 1J05A 1GZJA 2PDGA 2EDXA 2DVUA 1J6PA 2PLMA 2DYSB 4JX6A 1XCQB 4HCGA 5CZXD 3VACA 3VXPA 2W4XA 2BC4B 3Q45A 4QRPE 2VEPA 5AVNA 1EEQA 3WO8A 4Z1PA 2O4EA 2WJ7A 4G42B 2VGFA 5EBWA 3NJVA 4A66A 2A6LA 4K3ZA 3D0LB 4IYKA 3VYNA 1TQBC 3DX9A 1Q1PA 1SFHA 2OXGA 1UJTA 2QXWA 2RDUA 1EZSA 3HS8A 1NFDB 1Q94A 2R29A 5C3TA 1KCLA 4I5UA 4LLWB 3DX7A 4CNPA 1OCBA 1A5BA 2CIKB 4OT1L 4OJAA 1FFOA 4GAYB 5AYZA 4HGXA 4P23A 4N2YA 2QVHA 3GMPB 1WD9A 2DYPD 1LO0H 4JZNA 5F9AC 3W57A 1AXTH 5DELA 1PX3A 1F4XH 2EPKX 3EYUL 3EJUA 4IMLB 4NNYA 4RSVA 2QGYA 4NI6A 3WMPA 3N1MC 1D7BA 3UTSA 1K4GA 4KPHH 4N68A 5HD8C 4UMCA 4O1CA 5D04C 3V0IA 4Z6AT 2CJSA 4BSVB 2Y63A 3UO8B 5G2NA 4N2HA 4WOZA 3HS0A 1HJQA 3QG6B 1GHFH 2DQJL 1P5VB 4IU2A 4HIEA 2K78A 4MQ7A 2IUZA 4P23C 4CMHB 4WFFD 5SWZD 4G2DA 1DWFM 2FZ3A 2OCZA 2HE8A 5GRVL 4OZGF 2VO5A 5L4FA 1FDJA 2IDQA 1RFDL 3BPLC 2Q8BH 1EJOH 2LV4A 3GZQA 4ECNA 3VXRE 3S8FB 2EC9U 3CBKB 1IZKA 5CUSH 5T1MA 3BSGA 1B5TA 1KFWA 1L5GA 3L7EB 1OC7A 2CETA 1XRFA 3OZMA 3NIGE 4PQXA 1ZRUA 1L9QA 4R2GD 1LEKB 4LK4A 5ICYB 3MLTB 1IIHA 3UYIA 5FSDC 4H1LG 3HS0C 1RVGA 3NQIA 3T42A 3PNRB 1ODUA 5DLCA 4MNHB 4AVFA 4NJ9L 1AR2A 1MW0A 1OINA 3W56A 4JKPH 1KD0A 3W0WD 3P4NA 1LROA 2Z31D 2OZ3A 3QEGH 1J1PL 4GKSB 1U1UA 8XIMA 1TTIA 4GNJA 3BKJL 4I1PA 5IROD 4WDWA 2W8CA 5IK3A 1C91A 1JV2B 3OAYH 2Q5BA 3HPXA 3BOXA 4A39A 3WNLA 2FYVA 1FX6A 1K6WA 1OY3B 1G6CA 4IWWA 2HROA 3H2MA 4BSWA 1V8HA 1AXSA 4U1NB 3L4VA 4Y19D 1XIEA 3NZGA 2DQXA 2CA3A 1HJVA 3IWUA 3DJ9A 4Q8BA 5DX7A 3FT3A 4B27A 1D2OA 3UTQA 5CGBA 2C1IA 4WY0F 2KAUC 3L3DA 2OQLA 5LNUA 2ZYSA 4ZCWA 5L2JA 5CGTA 1D5XA 5FYKL 1GGCH 2HWGA 4ZDHB 35C8L 3IF1B 1EWEA 2KZ1B 3WFCH 4YHNB 3EJCA 4HUVA 5E08L 1F4HA 3GK8H 3ITGA 3IDNA 4NN6C 4BINA 5ABFA 1BAGA 4KRUA 4L1LA 3DPDA 4BZ1A 2LFGA 5I15L 2WLLA 1Q9KB 4YSDA 4TQEH 2C3ZA 2O1AA 3MRJB 2YAFA 4FA8A 1M41A 3WKPA 4IUGA 3SKOA 2LVEA 4M1RA 2MWCA 3C86A 4TSCH 1I2PA 1XCTB 4LPWA 4YNYB 5DJ0A 3H2PA 4C56D 3MNZA 4GUHA 3SRFA 1CJYA 5IP4A 3GSNA 4WU7A 4MNQA 4KX8A 1OADA 1B0IA 1EEYB 4AL8H 1UM6L 5KYXA 3UY7A 4KHTL 1TG7A 4US6A 5DSCA 2W80C 5T33L 1UR8A 3HW7A 3SECA 3S96B 3UY8A 5F8RC 4NUJB 5H4YA 3W2JA 3N44B 5C9ZA 5ADPH 4FABL 2A7PA 5IJVA 1CGYA 3SCPA 3QIBA 3RHWK 1ZLPA 4RA0C 1AANA 1AMKA 1VRXA 4L9DA 5C7ZA 4MJIA 2HNEA 3TR9A 5EBMB 5LN4A 4M9PA 4LEOB 1WA1X 1GYAA 3I02A 3GTHA 4NQSA 4ZPTB 3WDHA 1ETB1 3N4FA 2XV0A 4RCXA 3Q58A 2F54B 3S5OA 4XCFH 4GVGA 4HUCA 2GGEA 1Q8AA 1FIEA 3LDBC 3PS6A 2EZ0C 2XOTA 3GRIA 2VLKE 4BY3A 4G7YH 5KS9B 3KXFB 3GHPA 1F5WA 3QDHA 5D96B 1Q6LA 3G0XA 3OV6A 4QHUA 4U1MA 4JZ5A 5FDYA 4U3SA 3AXIA 1WAAF 5I7GA 3QIBC 2QUNA 3NCFB 4WSHA 3JUGA 2Z4GA 1GUVA 3V6OA 2KZKA 1CD1B 5DVMA 2R8WA 2W60A 3GAKA 4AD0A 4NPYB 1R5IA 3CHPA 1MCSA 3CSBA 2DUXA 5AYYA 1W6LA 1FYTA 3RA7L 4HWNA 4DO6A 4DW2L 1B9KA 2CZFA 1WUEA 1KIPB 2QLYA 4MD4A 1U58A 5B39B 4Y9MA 2KHAA 4JJHA 4C65A 3WF3A 1M04A 3U6XA 3W87A 2XPZA 5AYUH 3REQA 3QXDB 1W72H 2OXHA 3GIZH 1AC0A 3R8GA 4UBDC 3V6OC 3U7BA 4N9BA 4K2UH 5BUGA 3LN5B 1ISZA 1Y6KR 2YFNA 4DETA 4KV5E 4C6PA 2YPIA 2KL6A 4RSYA 5E00A 5TQ0L 4JIIX 5JHLL 4MDIA 3FO1A 3AJXA 1KMGA 1R34A 1RZQA 4NXKA 4NWTH 3MGTA 3FCSA 4QS6A 1P7QD 1FAIH 1T22A 1H3VA 1DHKA 1CXHA 4P5RA 4GYFA 3F7VB 1JF1A 2F74B 4OQ1A 1CWVA 3AICA 3JWNC 3BZGA 4OFVA 4LV9A 4TYUA 5ANME 3BZFB 4JFOA 1EFXD 1MFBL 2ZG1A 5EOQL 1A14L 3GZ3A 2YGVA 1T6VN 3LKPA 3NA8A 4A8RA 5C0BA 2X2UA 3VRJA 2FYMA 1HIMH 2Y7OA 3T65B 3F7KA 5EN2A 4GQGA 4HW6A 5I09A 3DJSA 3HV9A 2O93L 5IJDC 4JTAA 4PUDA 3QHFL 2WLNA 1RCOB 4HU3A 1U3NA 5J57B 4FZ8H 4Z7VA 3H42L 3H9YA 1T0NB 2NV1A 2G5BA 5HHQA 4Q8TA 2N0MA 4PTUB 4KJYB 3BSZH 4XPAL 3UDWA 3VD1A 3E8VA 2P8LA 3Q8CA 4A35A 1TO4A 4HK0A 1FVCB 4YWGL 3F6IA 3DDMA 3Q44A 4H01A 1LWJA 2HE5A 5FOJA 1NF7A 1MFDL 2FO4A 1ADSA 5DA4A 2CU9A 4NF7A 2QELA 3WQCA 3QUYD 4YLCA 2OOGA 3V7AE 4KI5D 4HWBL 1P0EA 2QGDA 1Q66A 1D9KD 3NABH 1T4KA 4XVDA 4R5EA 2OQYA 4X99A 2FUQA 3UXKA 2OR2A 4HHGA 4NO0A 1G1OA 4OR1A 3NOEA 3WKYA 4NBXB 3MLPA 4LVHB 2ZCHL 5CSZB 3E9TA 4UM9A 1D5ZB 1LO5B 5EB9A 1G01A 1ZHLB 3BWAB 5D93C 3FYIB 1NCBL 1XRVA 4B5SA 1BJ1H 4OOZA 5E94A 5E0CA 5ESQA 3K2UH 3LKOA 4LSRH 2YA2A 4AQZA 3ZXWA 1NL0L 2AXFA 2LAGB 3OXSA 2O5YL 4NQQA 3S2LA 4OFYD 5CBEA 1WQ5A 1HC1A 5I78A 1EH9A 3ABOA 4N9EA 4CCZA 2CBUA 3VI4B 4QRPA 3KJ6H 4KVCL 1QW8A 2ALRA 2FH6A 4YDLB 1BLNA 1D5BA 1H15B 4WEBH 4NN7B 1F8IA 1I6NA 4LC8A 3I50H 2E9WA 1I1FB 5K93A 1E0UA 4Z3FA 2WLYA 4PJBF 5CJ5A 2ATMA 4YVXA 3TSBA 4AMAA 4H8HA 5HI4C 3E02A 2GSIB 3IE4A 2E9BA 5IBUG 3PJSB 3L1EA 2I9LA 1TE6A 1R3IH 3ARFA 4XBPB 3VNJA 4ERSL 4J2MA 4GA8A 5ISZD 4AUJA 2MPAL 1A3RL 2FGZA 3TFKC 2OQHA 3OLGA 4M00A 1HNFA 1J9CT 1KEGH 5D37A 4UXDA 4PN6A 5EFIA 1H6FA 1T1YB 2JV6A 3THUA 1MPAL 2GUUA 3EH4B 1UKPA 2E67A 2P5EB 3OR6A 1VLIA 4B41A 3WKQA 1IC0A 3FN0L 1RIHH 4O2FA 2DV0A 4LARH 2SEBA 1R3YA 3MBED 1E4KC 1E42A 1FWJC 2ZP8A 4MMYA 4XVSL 2XT1B 2YMXH 1FC1A 2NLJB 4WI7A 4LT7A 4AUUA 4UMSA 5T3ZH 4HWBA 3LM7A 1R17A 1I9JL 5AL0A 2WKOF 4N6QA 1PDZA 3MLVH 1OIMA 4F7CB 1JDFA 4H9ZA 4AQAA 3MJ9L 5IZ7A 4MADA 4YPJA 1H51A 1NEUA 8A3HA 5IUSA 3QUMH 2R8SL 2H47C 4GMEA 4IOIA 3MMDA 4W6XB 5AW4B 4RE0A 2G2RA 2WXGA 1QU4A 3Q1SL 4O1DA 5F2IA 1KJVA 5A3IC 3ELQA 4FN0A 3QZMA 1EQCA 4RRPA 1VHPA 1SO5A 2IPWA 5HHMB 5CGQA 4PB0L 2P3YA 4RWYL 2WQAA 5E8PB 4GUFA 2QSQA 4ML4A 3T8XB 3MRBB 4WXZA 3ZU8A 1FWFC 4J3TA 1OP3K 3HMWL 1ICQA 4IMGA 3QPEA 4YHLL 3GEFA 2OELA 3GDMA 5EKYA 3SN4A 4OGQC 1SM3L 3PPGA 4ZQPA 2CHOA 5F3HA 1U93A 5D1XB 3TJHD 4KMTL 2NY5H 1ZVHA 3P1VA 5E1GA 2NVAA 3PAOA 1G7LB 1WA3A 2F1BA 5EEWA 4L48A 1CFVL 3PTQA 2L5HA 3G8RA 4XNAA 3ATDA 4FOJA 4FP8H 4M7LH 2VXSL 2YS4A 3MHGA 5D9SA 4LLDB 3E12A 2FAUA 3MLWH 3MRLA 4M7KL 1TIWA 3K2IA 3D7PA 4PRHE 2W3ZA 4PWIA 3CL6A 3IV3A 1AACA 3TEWA 3T7VA 1S5HA 2XZQL 1POKA 2YEQA 4YQXH 5E4AA 4DJFA 1UWGH 2J6XA 3STCA 3ARBD 4N2CA 5TH2A 4H6KA 3OKYA 3AMDA 3S5LA 2DWEA 2J73A 4D8OA 5BCAA 2XH7A 1MWOA 3SM0A 3VNYA 1J1OL 3PPHA 1XB6A 5K9OA 1S3KH 3B6SA 4WWOA 1AW5A 3EBHA 4FC3E 4NUGH 2Y06H 2ZICA 4HETA 4N0UE 3REWB 4WF7A 3G9AB 3MBDA 1BDYA 4FF9A 2RAMA 1LE5A 3S46A 1W8OA 3KPSD 3GIYA 3VXME 3KL3A 1T5AA 4Y2DA 1TFHA 3Q13A 1BM7A 3QJSB 3Q9PA 4DJFC 1OO2A 5FM4A 5LJYH 2IWFA 3S88H 3FO0H 1UUOA 4OLYL 3MJ9A 2DMHA 4QXTA 4RRPG 4DY1A 4NQVA 5GIRA 1UH2A 4C6EA 3PHOB 5ENWB 1OCQA 1YYCA 1T6BX 1AS8A 3L68A 1CDHA 3GSWB 5HVHB 3VH8B 3KLSA 1H49A 1BOGA 1DBBH 4N2NA 3ZDZB 2Z2UA 2V2HA 5F6HJ 3SFKA 3BRFA 3SE3A 2FATH 4CQ9A 2VELA 5AVVB 1DN0B 2B2XH 5TDNB 2Y3AA 5HHPB 1ZGLA 4LU5H 5AAMA 3P77A 4Y2DC 2Y7MA 3DYMA 5FEXA 3MT1A 4BFIA 2DQCH 4Y96A 3MUY1 4R3SB 1NQ6A 3URBA 3N15A 3FH8A 1N0LA 3MLXL 5K9KA 2OSYA 1XKJA 1DQJB 4TMCA 1K9TA 3DHPA 3JSSA 2VLKA 1RURH 1ILUA 5F7EH 1U5HA 3T77B 2VLRE 1TCRB 1UP0A 3EG9B 2IGTA 1BZEA 3LOWA 3BMVA 3FKUS 1RJZB 4QYOB 1IKNA 2Z28A 4C83B 4O5LL 4CVZB 3X1EA 1S7TA 2LQRA 4IRSD 4G70B 2H7WA 3EFFA 4LYKA 5AAMC 2WMIA 2V0AA 1VS1A 3GNPA 3NGFA 2HFEA 2GFTA 5A69A 1CFSA 5LWYH 2XN9E 1MRCH 3LKQB 5TE4L 3GTXA 3EFOB 4POZC 5D2VA 1M71A 3S4SG 2D03L 4HS3A 1PL3A 3DI2B 5AW5B 2WTOA 3HMXH 2WHVA 3HBQA 5C0CA 3PWNA 2PO6B 3W1LA 3B5GA 2VH5L 1DBJL 2G3FA 5LA1A 2YW4A 3PZGA 3QSRA 3VQ2C 3B83A 2Y5EA 3L3KB 1VFAA 3LU2A 3VFUB 2GJXB 4LB8A 5DC2A 2Z7GA 2P8PA 5ACZB 4POYA 3WSUA 3MLYL 4XOCA 3GZPA 1IKNC 5CJNA 5IR1A 4M7LT 4ELKB 3TAOA 1ADQL 3MRIA 2EH7H 1TVBA 5E4OA 3AROA 4WW1A 3U46A 4BFJA 4FCHA 2AJZB 3OA5A 4DWSB 1XGTB 3QJHB 4J7RA 2ARJQ 2CZVA 3ETTA 5DD6A 4FAAB 5J6GA 4LH8A 1MHPH 2F5BL 2OZ4H 4O2EA 2CUIA 1UM4L 4QAIA 1B4KA 2MCPL 4CJ1A 3G1SA 4W9KC 2GK0B 2OMVB 4K8RL 5ANMA 1XRSA 3W71A 1N12A 1CXEA 1CVSC 4WSKA 1ME7A 4Y2OB 1R3LB 4YVNA 1EA0A 4H7CA 4WO4A 2Y62A 5BXTA 3N2JA 4MA3B 4HKBA 3QNYA 1V6WA 2X1OA 5BRPA 1K9FA 1E0OB 2A9NH 3IJEB 3U2IA 3N2BA 3BE7A 4Z1AA 4GW5A 2XINA 4X5XB 5GGVH 4R27A 3X3FL 3AU1B 4P2RE 4HPJA 3RWHA 5HDOA 2BDNH 3EFDH 4I9WE 2PC8A 3NJIA 4G9FD 4ZFFA 1CZ1A 2XPGB 4F58H 3FONA 5KSAD 43C9B 3WH6A 3TH4T 4JTDA 5C6WH 1HWGB 4M1CD 5I2IB 2G3IA 3NIDE 3UWWA 3VW3L 4LEFA 2NQ9A 4D6HA 2F1EA 1O75A 3TNBA 1A4JA 5FUCE 1YMHB 4ZFQA 2E1WA 4WO4C 4QRTB 5J56B 1Q6RA 2VC2L 3PY9A 3SPHA 1VZWA 1RZMA 4TS6A 3VG9C 4CUCA 1PVHA 1W72B 5E5MA 5I1JL 4QS5A 2IPTH 4PI2A 1Z9SB 5ADOH 2ATAA 3T04D 5DJ6B 4EI5A 1OC6A 1V0KA 5I1EL 4F15C 3OBEA 3I75B 3BGMA 5AW1B 4NZUH 4W68A 3DMMC 1PD0A 5EMLA 5DYOB 1G7IA 3CH9A 4H26B 3MFFA 3WLPA 3CCHB 3UR8A 2OR8A 3PIQA 5D02A 2YQBA 3CMGA 4UV7H 4HIJA 2BHZA 4EXKA 1JXFA 1S7RB 1QFWL 4ZAKA 3T0TA 1S4IA 3BAEH 5CFHA 4HFWA 4OCSL 2RJHA 3WIAA 3LM3A 3WUWB 2XZAL 2JWYA 4DERA 1DDHB 3V1HA 3FSAA 1Y0LA 3ILQD 4Q9QL 4EI5C 4WEVX 3EHBB 3DHMA 4CEUC 1YMMD 4HUWB 5I2UA 3PTDA 5CCGE 3ZWSA 3WEZA 1ET8A 4QWWC 1JCNA 3O9WB 3ZPDA 1WEJL 3R94A 1TJHH 4DBSA 4ZO9A 1JR1A 3PQYD 1AZVA 2V2WB 3WTXA 4PGLA 4P5KB 4UQ2A 3B56A 3MLSH 2ZCGA 4NQXB 1ED3B 1P5UA 1PZ5B 1P0NA 1PIGA 5JIQA 4KH9A 4AEHH 3LEYH 1UKOA 1O6IA 1U9KA 5AB2A 1DVFB 2NXGA 4YDVB 2IANA 3FFDB 3HGJA 1OIOA 2Z7YA 5J11B 1PXGA 2QPXA 1TJ2A 2X4PA 3VE9A 4WTWA 1IL1A 1CIUA 3BT2L 5AKTA 4DGVH 1PJWA 2C3WA 2OT1A 2DIJA 4FEIA 3TN0B 1L6SA 5BOPA 3NRQA 1SFSA 4OV5B 4DEFA 2PD5A 5D1ZB 1P5UC 5F0JB 2KX9A 2Q20A 2AGKA 1YYAA 5EZOH 1IF2A 2NSXA 3KWTA 2X42A 4K8RC 3A4WA 2WLZA 1GJWA 1I60A 1BVLA 4PS4H 4Y8AA 1QR4A 4ZO7A 3BUDA 2J4GA 4RV3A 3MGOA 2ZKHH 4L0PB 4M6VA 3N17A 2QQKH 1HE7A 4NFBA 1CLKA 1HJWA 2IFFH 1C12B 2Y88A 2R6OA 3KNBA 4M7SA 4S38A 4Y1SA 2DF3A 2YN5A 4GSQA 2J66A 5DJ8B 1GY1A 4XD4A 1V5XA 4DPCX 3HPLB 4B3LA 4E42B 3UXLA 3EKCA 1LLZA 1Z69A 1ORQA 3EMQA 3SCUA 4IX2A 4GIYA 1FL3A 1ZLEA 5LLIC 3IDMA 1SUXA 3RDTD 5E93A 4UV4L 1CLYL 2KDYA 5GGSB 4QDMA 1F02I 5CCHE 3CO4A 2YD0A 4QP0A 1P69B 4JANA 3QJQB 1H7PA 2PGRA 4QGYA 5D7JB 1EPVA 2X4QA 1PCXA 3VKJA 1ORSB 3N12A 4PJDE 3EA2A 1ECQA 4Y9FA 4EACA 2LGNA 4KZDH 2VI0A 3RTQB 2BSTB 1E9LA 4OF5A 4TTUA 3V3WA 3N6JA 2Y7NA 4N0FB 3GFYA 1TPUA 4YN3A 3KBWA 2A2QT 2RD0A 2WPBA 1I9RL 3GINA 4AJYV 1CEOA 2BSEA 1T40A 4LCIL 4XSMA 1NBVL 3SYCA 2IKJA 3AZSA 1C08A 1BAFL 3TN6A 5GJPA 2IPUG 2MQ0A 4LHUG 2RCSL 1VPXA 4PJEF 1H7RA 4Y9OA 4PRHA 5KBMA 5I1IL 4F2MB 1P1MA 1WUZA 5D72H 3O4LB 5E8EB 3D0VA 4O16A 4DEPC 3WEBA 1P4UA 1J11A 4AMXA 1WX0A 3CVBA 1FJ1A 2HFGL 4P4KA 2X2YA 4XZNX 3WQOA 2EP6A 4QLWA 1UKQA 3QUMB 4WHYG 1AMYA 2QUUA 5HVGB 4TX9A 3BHBA 4P59L 1OP3H 3PWVB 3KLHD 5C0DB 1KCZA 3ZJ8A 4JLRB 4CVXA 3NM3A 1S78D 1MCRA 2WLJA 1Z42A 2XPYA 4P48A 3DV6B 4B0MB 1KBGH 4Q8OA 2GVJA 3FS9A 3E80A 1GEHA 3LZRA 4DF0A 2XZZA 4PYGA 3UBXB 5M1TA 3OGRA 4F9PA 3PP4H 3TBSB 5LUMA 2DQ6A 3KWXA 3BGGA 4JHAH 4OV9A 1XLKA 3FO9B 1BYDA 1MEWA 1VFHA 1HGWA 1V79A 1B9ZA 4P4KC 4H19A 4V11A 4X5PA 3KLKA 3LZOA 2BODX 3EDDA 3C5SA 4W4OA 1NY1A 4KNQA 2FZBA 1NKRA 3TNNB 2H8ZA 1HHHA 5HJ3A 1N4XH 4HXBH 2AQVA 5EO9A 1L9SA 3PDDA 2BP0B 5CN1A 4PMXA 5AVZB 3QA3B 3D05A 4S0SD 4J3OD 3NIFE 3U0TA 1LK3H 1YZZA 2QGBA 1ZEAH 1F4YH 4Y5YB 4U1LB 3BO8A 3I9IA 3F62A 4KWUA 3VFVA 4LOEA 3IS0X 4NM4L 4HIBA 3WJJC 2ZG2A 4F9PC 3W2DL 5I6XB 4HF5H 3AREC 1ACXA 3EGSB 4Z8FH 3FQXB 1TSRA 1HP4A 2BINA 4I7ZC 4Y7MA 1XH3A 3NGJA 4OLZH 3DIDA 3T3PF 5BVPL 1JCLA 3D4ZA 2V7NA 2VLRA 4MX7B 4EXQA 5LA2A 3VGEA 1PYFA 4UIKL 2P43B 3IK2A 3QI9D 4FYRA 5I75C 1DLFL 2BLEA 5C55A 3ARDB 4OLUH 4YTRA 4IP7A 4YR6A 4PMRA 3PFUA 1VPOL 2IH8A 3RJYA 4NSKA 2IOMA 5HYQB 3BN3B 3W88A 3CPGA 4RX0A 2XN9A 4BXVA 2NSOA 3RLVA 4ODXA 4AVKA 2EDTA 3LRKA 1MQ8A 3AQXA 5E6IA 2YPVL 1TFPA 2DYRB 5FF6A 3LV5A 5D8JH 3QW3A 2YRZA 3TYBA 4KWOA 2PP7A 1SO4A 3CD4A 4LP8A 4M4RB 2R2EB 2UVFA 3GUWA 2X7WA 1IXPA 1G4SA 1JFXA 3WUEA 4ZFMA 5CPOA 1V6VA 3B9KB 4NJAL 4MNQE 5A6MA 5FGCB 3RWJA 4JK0D 3I68A 3OR7A 3CFKA 3CB8A 2FB3A 4I77L 2W59A 2ZX6A 4LLYB 2O5XL 3VGHA 4D0BB 4PJGF 4D2NA 2VL4A 1T21A 5D7IF 2RDTA 3WLJA 2VJXA 3RRQA 3KS6A 5E6IC 1RD5A 2ABAA 5A8GA 1I1AD 2VERA 4TUKL 4LRNH 1KC5L 2HH0L 2Q76B 3GMRA 4N9GA 1X5KA 1TENA 1NCUA 1SW3A 4ZS7H 3T05A 3W7IA 1QLEH 2GQAA 3UG5A 4MA1C 2Y8KA 3V2AR 1OAYL 4F3FB 1RJYB 4QCIB 2JKWA 1S5VA 4X2RA 5I8CB 3W11D 1UXSA 2PN5A 3GQYA 4R8WL 3HFYA 4XZBA 4F37K 5LAXB 1ZANH 2A3AA 1UURA 4UQEA 1E8YA 4OZIF 1MY5A 4JFZH 3MSYA 5PTDA 4J3BA 4JGNA 3N91A 4S3JA 3U0WH 3UZQA 5IGXH 2ZA2A 4HIPA 4HKZB 1H50A 3MSPA 1I1XA 4GINA 3QIWB 5F3FA 1RHCA 2BNUB 4H0HB 3DSFL 4Q8NA 2QCHA 4R33A 3TNMA 4HDIB 3TF4A 3V6OE 1R3SA 1XBZA 2VDGA 4FKKA 1NEZG 5J89A 4KERA 3UZXA 5G2HA 1C8PA 4TMPA 4A2EA 3RJQB 1FVEA 1S7WA 2ERJB 2F19L 4TNWF 1ZSDA 3JQOB 4ODUA 1X8CA 5EA9A 5TDOA 2BCKA 1JCJA 1BV8A 1EZWA 1F4WL 3K72B 1KIQB 2FJHB 2CKBL 2VMEA 4WWID 1HOEA 3H4WA 3H3BC 4Z7OB 4NKIH 3HZ3A 4IU3A 3KVMA 5EB8A 5HGAA 4B9YA 1ZLWK 1TR9A 2YPVA 4X5QA 4E6MA 1MY7A 3SDXB 2J6EH 1OCZB 2P42B 3R0MA 5F4WA 2AQTA 5L2KA 4QXGL 3G04B 4ZS6C 4M61B 5FPIA 3IDUA 5FUCC 1MZZA 3LKSA 2D3JA 5BOEA 3C2OA 5FV2A 4X5LA 1JWUA 1VYPX 3PWGA 2WXQA 2ZJSL 3QZWA 5BZDA 5DJDB 1A49A 3AG4B 2AJYL 3LUTA 4IJCA 4N8UA 3GS0A 2IEPA 5JNYB 3ZTNL 5B7ZA 2EYTA 4XCYB 5JIPA 5EWIL 2QULA 3UERA 1TNMA 4CADA 4O1EA 3QMTA 4ORIA 3MJ8A 4XD6A 1ID2A 2A0NA 1TQVA 2ZOWA 5HHNA 3R06B 2ZTJA 4NZTL 4BFFA 4JPWH 4NUMA 4D0DB 5F7DA 5C0BE 1ITQA 2EXWC 1B4LA 3LEXA 4KKZA 3O3BA 1HZYA 4I8DA 5LGHH 3UBFA 2XFXB 4HS8L 3NVDA 2VAAA 3QY8A 4FTVE 2D8KA 2R4SH 1MNSA 1E5CA 1EDQA 4DBDA 2ZUSA 2DVXA 2PCYA 1PVNA 3C0QA 1N3NB 4M3JA 1IXOA 2DBLH 4Y1AD 4IICA 1PTDA 4O1AA 4Z7VE 1OABA 4JRFA 1HCFX 1TU2A 3NCEB 4H9VA 3TQKA 2VXVL 2UY2A 3BPOB 3TT1H 4RESB 3VD7A 1GGUA 1WIPA 1XXDC 1ZSHA 2NY0C 5HHOD 2DI7A 4GCXA 1AG0A 3BVDB 1JZ2A 1EZUA 2BHUA 3QEQD 3RX9A 4QR7A 3C2RA 3SCMD 3GXNA 1BFNA 1ZVYA 3EYSH 4FEMA 4LBUA 4A3QA 1U8LB 5T5NG 3VX0A 2AEQL 4GX8A 3RYSA 3GLZA 2QCGA 4X6CA 3E0VA 3TLRA 1RK1B 3F12B 4FHKA 1C9DA 3V4PH 3G1XA 2X1TA 5AENA 4NRYB 1QNSA 3U57A 4TLUA 4AKPA 3MSGA 2CKBA 4ZG1A 1RLBA 1TPXC 3WQFA 5LXGH 3Q5TA 4S3KA 3QZWG 3VZZA 4NWUL 4UM8B 1PV8A 5AOLA 5LKNA 3W39A 1TYJA 4TSBL 4M56A 1F3RB 5KZDA 1MSSA 4H1LA 1CW2A 1NCDL 3NUKA 1OAZH 4KEVA 4MNGE 2RA1A 4GQPH 2BVPB 2ENJA 3DFNA 2IGFL 3PP7A 3SDAA 1JPFB 2WJFA 4X8GA 4G71B 3IIXA 3I7SA 4FA3A 1F0LA 2VWSA 2DRUA 1N67A 3B8WA 4P5TA 4AC1X 3X1GA 4PJDA 3FMGL 2Q0ZX 2R1XB 5I74C 1E6SM 4LOUD 4HG4K 1BGXH 3AUVA 3PF3A 1PKMA 2X7LA 4D94A 2YXGA 4Q7BA 3H53A 3DXAD 5EF3A 3ML9A 4HCIA 3S36L 3OQ3B 4JFYB 3SDAC 1QNZH 3MRKB 5JA9A 3CNYA 2CXEA 2VD8A 2RH9A 1KBKA 2ZQKA 1L2UA 3PZTA 5FXCH 4TTGA 2EYSB 4P5TC 1LP9F 1V6XA 3JTTB 3K6DA 4BZ1L 4OF0A 2IQ9H 1SOSA 1WPCA 5D2LF 1ZVNA 5I1AA 5EBLA 4GBXD 2I1OA 2DJXA 5BVJA 3SE8H 1NFPA 1KLZA 2LLLA 2YAEA 4AW7A 1KENL 1A6UH 4JGMA 3U7YL 1XIGA 4IMEA 4HP5A 1G6RA 5GGRY 4M51A 5FLUA 1IGMH 4ALDA 4PGCA 1SSGA 3GSNL 3V0TA 2F7PA 4RZCB 3HJEA 1F90L 4LVEA 4LPUA 3VE0A 2ZWSA 4UZUA 4XTRC 1IVTA 5FK9B 2HEJA 3MRQA 1BP3B 1FBIL 4TL5A 4XODA 4WFED 4JKNA 1JPMA 2XIDA 3T6QC 3CFBA 3WLTA 4Q8QA 4E9TA 1DQMH 4KRMB 3VXSD 3ATEA 3CUJA 2GSEA 4Q9RH 2XIOA 2OA9A 4K3EH 3G6DL 4B5UA 2OMYA 4K68A 3JZ7A 3HI1B 1FYHB 3ATFA 2IMMA 4AH2B 1Y18A 2X16A 5JU6A 4UT6H 3HC3H 3U9PL 3U36B 3QF0A 3BLDA 5KOMC 1CIDA 2Z26A 1X5YA 2PDFA 1W9BM 5EU3B 4GXUM 1M7OA 4A63A 1F13A 1U6AH 3NFSH 1M57B 3VGFA 3ZJ7A 4O2CB 1M65A 3DOSB 1NIEA 1CK0H 1C16B 4XPGL 1IGIH 3ZZSA 4MXVE 1NWOA 1I7UB 2DSZA 4O00A 2HX7A 3G08B 4YHML 5CPSA 3WF1A 5D7LA 1QMLA 4G6FD 2I9TB 4RZ6A 3RB5A 2GIXA 3HFMH 5DY2A 1XMEB 1GW1A 3CH1A 3WLRA 2YAHA 1KFAH 1KACB 4FCAA 1W0WA 1T8QA 2CZ5A 4DO4A 4LBEB 5FKYA 1CNVA 4F8XA 4FQQB 4P2QD 2YGNA 4YUEH 4AV4A 1DWIM 1DCLA 4FX5A 4AG4H 1UT1A 3QCUL 3P67A 1IILE 4D8PA 1S7UA 4Z3IA 3U6XS 3UCRA 4Q6IA 1YEYA 4JZJA 4UNIA 4JFDA 1BJ1J 1NGXA 4D6DA 1JUFB 2YFOA 4TX8A 1UENA 1FUNA 2VSCA 5CPLA 1GHRA 2WC4A 4PBWD 4J5VA 1G7PA 5TK2A 2FCBA 1EJRC 4XPTH 3U6RA 3KPRB 3H8AA 4AVOA 1T7WA 3D3VA 2F38A 1JCXA 4FXFA 2G2PA 1S5MA 1JSYA 5F89B 1UASA 5JHAA 4X2PA 2Y8UA 4HIQA 3VXOB 2ZFAA 3FO2A 1J8SA 4FNLL 3M1ZA 3PUUA 1NMBH 3RQ3A 4MJ5B 4YU1A 4AU0A 2C13A 4Q6IC 1XL9A 1GGBH 5TJWK 4JZJC 3WK0A 5FF3A 3Q94A 3P3RA 4LSSH 2CR3A 4JDZB 4M62L 4Y4HB 1OAJA 2YA0A 1CLXA 4FR1A 4UDUA 4WW2A 4L7ZA 3QUXA 2P7TA 4MNLA 3KOFA 1BYBA 2GLKA 1I3RB 1RZIB 1VLWA 4JHOA 3GI9L 2X9YA 3V5DA 1FCBA 3QV9A 4LLVB 1CU4L 2L7QA 3WE1A 5F1IB 4O02H 2G30A 4U6YA 5EIIB 4MSWB 4N0YL 1ZHAA 1NEPA 4KKAD 1BWMA 1QEWB 1JZ7A 5TE7H 1KKOA 3BKML 3E38A 4KRPD 4LAZA 3MPGA 4XG1A 2NTFA 4RAUA 1TTCA 5ICXB 3G2GA 3AT9A 2EDYA 3FB7B 2JB6A 4WI6A 1QO5A 2Y36H 5DU7A 1CLZL 3FUIA 5FHBL 3K71A 5JZ7C 1Q72H 1WZ1H 3GNOA 4BUQA 4WW2C 2UZYA 5ETUB 3QUXC 4RAVB 5EEUA 4XMLL 3HPFA 3VFGL 3BXWA 3D2TA 2NQ3A 1AJ7H 3Q4DA 1FH7A 1RVFH 2YJQA 3PV6B 2BOEX 2QADD 4WWPA 3V5CA 2P24B 1I1WA 1F18A 1ZOXA 1LLOA 2EDRA 2CQVA 2ZYIA 4L8CB 2GJRA 3PAUA 5LHEA 3K4WA 1LORA 5M5DA 3ECBA 5K3VA 4JG1H 3H3PL 4GFXA 4XP1H 4ONVA 4MZ8A 5C0CE 1JPIA 2CBJA 2XSAA 1BAWA 3QXAB 5F44A 3DETC 3VWKA 1NGPH 5F9DC 3BN9C 3W25A 3TBVA 4MCYB 1HZLA 3GI8H 3SGZA 4YLBA 4LF1A 4NJHA 1D6EA 1OGAA 4JAWA 1R3WA 5KYYB 5K9JH 5AW3B 5E1HB 3O41B 4ZOCA 1PZSA 3IJHB 1QLEB 2DT3A 3MRDB 1NLDH 4R5TA 4KJPC 3VD4A 2FVLA 3SIKA 3HC0B 3CVIL 1OSZA 1JWSB 3PABB 4NRZA 4B16A 5M2FX 2VAJA 1JFHA 1RUAL 3QC0A 2WBJA 4BQ9A 3SO5A 5CZTA 1BMGA 3VWKC 1KZYA 4ONGL 3O11A 1DANT 2F58H 3SQOL 5DC0A 2QT3A 4LPVA 2K70A 3KBEA 2IADB 2YUXA 5C08A 4JO2L 4HVXA 1FNGA 1SJVA 4IHBA 3SGDI 2J6VA 4KETA 3JYBA 4GMSH 3N9GH 1DL7H 3MXVL 4AIZA 3ARZA 3VI2A 1Z5YD 1MI3A 2H2PC 1J5TA 4N1HB 4OM1H 3HQPA 3SE9L 4EOWH 2X4TA 3PGDA 4FTVA 4O0KA 5C0AE 1PZ1A 4HWZA 3WFZA 3BG9A 3L48A 2BASA 1M05A 4ENED 2WBJC 2XXMB 4JW3A 5K2ZA 1ZLWH 2E8ZA 2VN3A 3NL3A 4AQOA 4ADGA 1XR9A 1N70A 4UT7L 5HJGA 4FEZA 3W29A 1SJEB 4L4TB 4ACZB 3DIVA 3D85B 3AWNA 3QULA 2V9UA 4ODHH 5EMJA 2BMBA 4C6NA 1O7DE 5EYWA 1RHHB 1Q0YH 4FK9A 2W65A 3AXKA 1QO3A 4ILSA 4RFNB 1XLCA 4MASA 3VG0L 1D3CA 1H62A 1E4XH 5LG6A 1YN6A 5SWSD 1AKJA 4PCYA 1ONXA 4G7RB 1TMQA 1TJGL 4NZDA 5IDZA 1PWLA 3DX0A 4RVBA 2A4EA 3SDYL 1OFOA 2YGYA 1KLFB 3TBYB 1SO6A 3LTPA 3FRPB 4N6EA 4TUJA 1E9QA 5FJRA 2OJZH 4WHCA 3UDWC 5CG7A 3LKNA 2QTVA 4BF9A 3ZBMA 3UZVA 2Z93B 3AOFA 1NC2D 2E59A 1KPVA 2XA8H 3H2CA 2V3GA 1HAWA 5DRXB 2OL3H 2FECL 3N9RA 1B4EA 4F0MA 1HEZA 4QAMB 4AYMC 4WVRA 2A9CA 1HESA 1NUNB 5I71C 3CQQA 4MNGA 2QDGA 4GLRI 3ZDXB 5CEYA 4H2CA 5H4ZA 1RU9L 3QDGB 3B0VC 1J5HA 3NSYA 3OPSA 3OQRA 1WRFA 3RPIB 4X7CC 5GS0D 1J9YA 3BMWA 3U4AA 3WEMA 2OTWB 1M9SA 3OJDB 3HKZA 4GJ1A 5DC4B 3T6CA 2E6PA 3SYOA 3PWPB 2YJLA 2VD9A 3NIGF 1IRAY 3UFYA 5BXRA 2IANE 3N19B 1BECA 4LRSA 4HU4A 5CP7A 4S2CA 2WK2A 4LOFA 4FR6A 4E9WA 1IR2A 1MEXL 3UAFA 2FQDA 3ZRCC 1AI1L 3DIPA 2E7DA 4KDTA 4GXVL 2R23B 5HHVH 3E2QA 4HWEH 3U9IA 1PS3A 3GG7A 1YEHH 4G1NA 2ADGB 1HKVA 3ZR5A 2GGJA 4HUKB 3V4PB 1UQSB 3KVDD 3KHDA 3OVGA 3QG7L 4FMVA 3H2FA 2OTUB 5T3XE 1VF5C 2AV7B 4M8VA 2A6JB 5AHLA 4UFJA 3C6LD 1OANA 2E77A 3F00A 3FH7A 4FG0A 4Q0XL 5CP3H 3GRWA 2Y5JA 1XX9C 1TJ1A 4AFYA 3ARFC 1J0HA 3W2UA 2V7HB 1U8KB 3FJNA 3HZKB 3OMNB 2PC4A 2FLBT 1QR7A 3IGHX 4GIOA 4OCRL 4IDJH 4KDTC 1KFJA 1N8OE 4ZFZA 3JV5A 4Q8PA 3TTQA 2R0ZH 15C8L 1WBZB 1M2VB 1ZY9A 5L9DL 3CFCH 3ZM8A 1AO7D 3CBJB 4PD4J 2NY1C 2XGIA 1NCAH 5AZEL 1A1OB 1P1ZB 3UA4A 4G2AA 2AJUH 3DOPA 4LT9A 3HI6H 5AVQB 1MNUL 2XYCA 1DEDA 2CM5A 4X50A 5KSUB 1RZJC 4HNLA 1Z9MA 1FWCC 5LYRA 1MWAA 2EAWA 2QGHA 4C59B 1BZ8A 4A2RA 1FFPB 1WCBB 3CPLA 4PV9A 4NYLA 4LUTB 3V52H 4Y7OC 2UZXA 1V05A 4PPTA 1DVQA 2WSDA 3BKCL 3B2VL 3X3GL 2YBRB 1TITA 3DPBA 4IQDA 1HZHL 4OIAA 4KTDH 1IGJB 1F3WA 3C6EA 3LBCA 1UWFA 5I17A 5A6BD 1EWHA 3U79A 3QQ9C 2H9AA 3IMWA 5DK0A 1O9VA 5ECVA 2AGTA 3FU5A 2FX8L 1DIKA 4DTGL 1HU8A 3ZHKA 4AYID 5K39B 4OGZA 1TQCC 5IMOA 2VDPH 3LV6A 1OWQA 4FQJH 4Q97A 1XGRB 2XX1A 2X70A 3QAQA 2YYUA 5IG7A 1X5AA 1E28B 3UX9B 4X4YA 1EJTC 5PCYA 3HB3D 1MFCL 3ZLHA 2FD6L 5LGYA 3SD5A 4JGJA 1T0OA 4APQA 5FWQA 5C0ND 3CFEB 4RZBA 5ESVB 4YXHH 1RERA 5M7QA 2RGLA 3PWJA 1QWHA 2JKNA 5EGRA 4KO9A 4HHLA 2R1WB 2HRPH 4ZW5A 1SY6L 1HCYA 3D0AA 3BV4A 3CC1A 4L3EE 2EDEA 2EEFA 1XP3A 3P4MA 4J2QA 4V1DE 25C8L 3NN8A 4FOMA 4L2YA 3ORWA 3ZKMD 3LMJL 3S4SA 2NQLA 3UP6A 3WHXA 1VGAA 4OGXL 3NQDA 2I24N 2P28B 2CIIA 3SRKA 3TEYA 5MHBA 4ZTEA 3P0XA 4B5XA 1A02N 2VCOA 2QEZA 5HYJE 5TQLA 4M7ZB 4O11A 5DRNB 3UWVA 4APQC 3PGCA 1XLBA 1OF2A 1VGKA 4LASH 4TVDA 1UB6A 4ISVA 3DC0A 4LVNB 1T1XA 4CD6A 4MIMA 2A6IA 3O8XD 4JM2B 4OIFA 3GUGA 3M0ZA 1XGDA 4XWOC 2XTJE 1H61A 4E9RA 3JZEA 3ES8A 1PZ3A 2UY7B 1FL6A 5HPMA 2H8XA 1Q9WA 4OTXL 5BQDA 2IPGA 1NDMB 4C6DA 1EAJA 1CLCA 1KBJA 4I48B 1ZAIA 2J7HA 4D9LL 3LAFA 2X41A 3WBXA 4UNVA 5LG1A 1XFCA 1MNNA 4L9XA 2OULB 3DURA 4LCWB 5AYIA 3EYQC 3RJOA 2Z35A 4CN6A 5AZ0A 1S2CA 1TR7A 5KVDE 5JW4N 3LHZA 1FUYA 3GUTA 2WBKA 2PWGA 2Q86B 3T0DA 3BAJA 4JO3L 2JCCB 4TOYH 4R7LA 4G6CA 3BLIA 5D4HA 1KSRA 4ZQCA 3VFOA 3PZQA 1EJ7L 3SE3C 3W38A 4H5SB 2OKTA 4XPHH 2A6KB 4ZYKA 3BKYL 4W9DC 1LWRA 4HT1H 1DSYA 2W27A 3DX4A 5JA8B 3MKGA 2GHWB 1D2KA 2YXWA 1A5UA 5T5FH 1FGNL 4IGMA 4OZ4B 3DGRA 1A0DA 2V6HA 3AQUA 3KYOA 3R8BB 5KZEA 1OTUC 2HB0A 1BVKA 4NQCB 2B1AL 3O07A 2QHLA 3IGAA 5IFPA 1KGWA 1SY6A 1E6OL 3GNXA 3RZCA 5H94B 5JPMB 2V6AA 5T1JA 1QASA 9PCYA 3QIUB 4QYAA 4OGAC 2Y1YA 5HTSA 2EE9A 1XXFC 2F7OA 5CJQH 4UOJA 4CAGA 4EDXA 3NQVA 3QPQC 5DUBB 5LIKX 1CQYA 4XTIA 4FJZA 2VDLH 5D5MB 4MDRA 2BS71 2INEA 4PMNA 4C6KA 2HPTA 2WNXA 1U3HA 2OMTA 2ITCA 3MP3A 4O02B 2WANA 2WC3A 4Y4KD 5FEWA 3B7YA 5E2VH 1XYLA 4NP4H 1YEIH 3WF4A 2FJSA 1RA5A 5B22A 1FCUA 5FESA 2P26A 4NZRH 3RZCC 4AY7A 3WH5A 5F97E 5CU9A 1IUZA 1I8JA 3M86A 1KYDA 4F66A 3QUZA 3CFNA 4WJXA 3M88A 1WUFA 4MHHG 5E6RB 4B96A 1F58L 3BMXA 5I1HH 4YAQA 4WHTA 4PVLA 3OC8A 4FFYL 4D9QD 2XA3A 4HLEA 1U3HC 1XC4A 4HCHA 1BJMA 2ZIDA 4YZWA 5C0AA 4A7UA 4RV8A 3P3TA 4JO1H 3RUGA 4DBEA 1KCUH 3G24A 3FT4B 4KROB 5I6MA 1QUNB 3LK6A 3CEPA 1OYBA 4U10A 3P8JA 1DJWA 5J12B 1OQFA 4JHBA 2F61A 4HNTA 1D5IL 1MCFA 2VISA 4PMQA 3MRGA 5T3XL 1J5OL 4AV5A 3M0IA 2KMWA 5IVOA 2X4RA 3QUZC 2YAOA 2QVFB 3VIKA 3M1BB 4LBRA 1MH5A 2X6BA 1VBHA 1YVLA 1FG2B 2Z6FA 3FAXA 1SHSA 3SYQA 4GLEA 1DANU 4YIQB 1ZE3H 2FO1A 3OIXA 1KCSH 4OCYH 3STZA 2CE6A 5C09E 4HJGA 4GQRA 4QOKD 5HAOA 5SWQA 3L7FB 1UROA 5HGDB 3OPUA 2CA4A 4K39A 3OPZH 3NXFA 3RPBA 4TNFA 3P54A 1J5IA 5L2KE 1DBMH 3W86A 2XN2A 2WC7A 1F3XA 5HMDA 1T0MB 4BM7A 2H1LM 3ULUD 4PVBA 1E51A 2FTYA 3WLHA 1KV7A 3TCLA 3I4KA 2FGWH 5JOPD 5HI3D 1O7DC 2XWJB 4HUUB 4JHMA 2HVJB 5CBBA 5L8LB 3WF2A 1X4XA 3JXAA 3U9UA 2QIWA 3GDCA 4BCZA 4Z76B 4M6PA 2QJDA 2J72A 4DZ8B 1VFFA 4DELA 2CM6A 1P53A 1GW0A 1DSWA 2ICEA 3G1FA 1GAFL 3QO0B 3SGGA 1TJIH 4PY7A 5DHXB 2I69A 3BUQA 3VAVA 4F1SA 2GHZA 3HE7A 1HXMB 4I6VA 3ZTDC 3BVVA 4O4WA 4ZAKC 2IAAC 5BMXA 4CSPA 4CN4A 1BG1A 3WJXA 1WHPA 2ZP0T 4MVBC 3QAZB 3MWAA 1OSPL 4OD1L 4TLSA 4FFYA 3VWJA 5C0RL 4Q32A 5ABAA 2VR2A 3IB4A 1SXCA 1CL7H 4KZEL 4JR9L 2ICEC 2AJXH 3LH9A 1NGYB 2N7BA 4R4BB 2QMKA 4TXVB 3L7RA 1L7IL 3K7UA 3O6KH 1IJ9A 5CQ1A 3WNKA 4LHUA 2X1RA 2BNRB 3VA8A 2TRYA 3HE7C 2ZSWB 5GISL 2NXHA 4LALA 4MDPA 2DQUL 1WDSA 1VBRA 3BFOA 1DJSA 3MO1A 3DZ1A 5E1IA 4DYKA 4X6CE 2E40A 1TTFA 1AH0A 1TCMA 1F6YA 4ODWA 2OL3B 1E4IA 2ZCKL 3FFCD 1VHNA 3GXIA 4WY7H 3VWJC 3WQ4A 3TAKA 5IT2L 5IHZA 3RU6A 4IMKA 4F2BA 1SXSA 2EPMX 3SUUA 4XAKD 4S3CA 5KSWA 2ZOLA 3N85H 2NNCA 2D7OA 4XXDB 4AC4A 3H9SB 4OF7A 4NXSA 1FWAC 3N0PB 5CWSB 1NJ9A 4POUB 5BZZA 1VFBA 1FXPA 3SD2A 4NENB 1BLIA 4JPKL 4IRJD 4P9MH 4Z7UA 2QAFA 4NAQA 5E9DB 2IBBA 2R7EB 4L8SB 4EN3B 3QR1A 5REQB 2H6UA 4ZUTB 2Y7QA 4W5ZA 1MEIA 2WWDA 4I85A 5DR5L 2WQUA 3PAVA 2ZOKA 4LB3A 1TUFA 2QFPA 5I1CL 4IMKC 1OM3L 3KXQA 2P53A 1I82A 1U4FA 3HE6D 2HQAA 4RQQB 3SB0A 4DEWA 3CFDA 1G9NH 3KR3L 3U4KA 3C4UA 5CPMA 3FBKA 5KVDL 2OK0L 3R5EA 3WQVA 1XIBA 4XBGA 2FTPA 3HIJA 1VBUA 1HQTA 4KY2A 3C8NA 1EO8L 4QJ5B 3WFEH 3W7LA 1GH7A 1CWYA 4LQFH 4ZNCD 3ZRSA 1X39A 1U8JB