1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
4P7NA 1YHTA 1V03A 4N0RA 2XVGA 5FD0A 2ZX6A 3AHXA 1J0YA 4NZCA 2YOCA 3A3HA 4D6JA 2CEQA 3T2QA 4PSPA 4W87A 4Z2KA 1BLIA 4IPNB 1XD1A 3B9DA 1BYCA 4Z2JA 1M7XA 1UD8A 2PWHA 4ZEPA 2ZUWA 3OLEA 1VIWA 1BHGA 1FP8A 3QR3A 3DX2A 1M53A 1JZ3A 2CCRA 3GBDA 4FNTA 3GNOA 4NI3A 2XVPA 1B9ZA 1I75A 2DT3A 3NUKA 5A8QA 3SCTA 2NW0A 1V6VA 5JIWA 3IANA 4ML4A 2WMIB 3ZT5A 4TUFA 1GJUA 4UFJA 4W86A 2W67A 2O9OA 1KCKA 3KL5A 4JFSA 2J75A 5D4YA 2D24A 3CUIA 4WKHA 1E9LA 3OZPA 1L0PA 1JL8A 3WY4A 5HPOA 4MJ2A 3MS8A 4OBSA 4R5EA 3WF1A 4QCFA 1ECEA 3AHVA 3L4WA 2GJRA 1W3JA 1RH9A 1MQQA 2TAAA 5IXEA 2DIEA 4E8CA 1JZ2A 4ACYA 1NOUA 3WL1A 4UQ9A 2WSKA 3WQ4A 1BYDA 1R46A 4LQ1A 4E2OA 2B31A 1XSIA 2ZUMA 3SCSA 1K9FA 3MKKA 3D50A 4AZHA 3AMLA 1QI5A 3CGTA 4AIOA 3TTOA 3DX0A 4H8VA 1NP0A 1IV8A 4AEFA 1S46A 3LRMA 1VAHA 1UWQA 2WMGA 1VEPA 1XYZA 1JI1A 3ARQA 3K8LA 5CLTA 2A3HA 4DO5A 3FHQA 2WVTA 2ESCA 4U5KA 2YL8A 3MU7A 3AMKA 5AY7A 2WHMA 2J77A 1ZS2A 1B31A 1NH6A 4JAWA 1KWKA 3EDEA 4B9ZA 1E73M 2GK1A 4UQDA 3KE0A 3AYSA 1UKPA 1OCQA 2YFOA 3WQ5A 4OBRA 5A8OA 4CCEA 3HN3A 3N04A 3UR8A 3AROA 2GDUA 1R47A 1DWFM 2XFYA 1PZ3A 3IJ8A 1OBAA 1GQIA 4KRTA 1UKTA 3WDQA 1V3LA 1BSIA 5E1QA 1JIBA 1GOKA 3UERA 3WNNA 4U3AA 3TTYA 5A3HA 2WWCA 2G8ZA 2WHKA 1NM9A 4TX8A 3RM8A 4UOQA 3ZJ7A 1A47A 3I3DA 1W1TA 2XG9A 3S2CA 2V38A 2Y5EA 4D1JA 3VSTA 1CYGA 3IGUA 3DDFA 4F9DA 2YA0A 4MB3A 2Y24A 2MANA 1MYRA 3A23A 4U33A 4DO6A 5CXPA 1W3HA 2GFTA 1JFXA 1H4PA 4NXKA 2ZE0A 1VF8A 1F4AA 3CV5A 2WPGA 5GQBA 1DWJM 1J01A 1WAWA 2OYKA 3NCOA 1R85A 2BVTA 3WNKA 3M6DA 2UY4A 2XUCA 3WH9A 1LL7A 4W7UA 3AIUA 1H3GA 1BPLB 1OGBA 3GDBA 1VFFA 2VNCA 1XGZA 3L4TA 5A6BA 3MUY1 1MWOA 3WY3A 3K4AA 5I0DA 3AMDA 4DUXA 3D5HA 1I1WA 3WH7A 3HG3A 2YDQA 4AZCB 2VZVA 4EAMA 3GH5A 3AIWA 1CIUA 1XYFA 1BYAA 3VMOA 3W25A 3CO4A 4OJYA 4NRSA 1V0LA 5BRQA 3WY1A 1B3ZA 2XTKA 2FDMA 1MQRA 2W4XA 1LL4A 3FNDA 2CYGA 1WP6A 3KLLA 2FYVA 1X6NA 1HXKA 3POCA 4W8BA 2F1AA 2DEPA 4HOZA 2WMIA 5CPTA 4J3SA 1MXDA 3VSVA 3ZR6A 2VX4A 1E3XA 3PZQA 3WSUA 1HJXA 3CTTA 4AIEA 3SCWA 1NWUA 3FHAA 2V3GA 1R8LA 3W28A 3CZNA 2A3EA 4DM1A 1BG9A 6TAAA 1ZB5A 3CUJA 4HP5A 5F7UA 2CPUA 2Y4SA 1JZ7A 2F7QA 2VOTA 3PTQA 5I5RA 1BVZA 3TOPA 1HP4A 3LXAA 4GINA 4CD7A 2WSPA 1MVYA 5EFFA 5A94A 5JBFA 1VFMA 4WJXA 1KQZA 1R86A 2GJXB 1CPUA 3WNPA 2VI0A 4H41A 3SEPA 4D6HA 3GM8A 1JF5A 1WO2A 4OOZA 2QV4A 1JYWA 2WMFA 4JL2A 5CSYA 1KR1A 2J7HA 4MJ4A 2XYLA 3S5ZA 2QMJA 3AZRA 3VILA 1BF2A 5DT5A 1J0HA 1E3ZA 3ALFA 3CZKA 3PZGA 3VGFA 4HA3A 2Q8XA 1MW0A 1UH3A 3SCPA 3QGVA 3ZT7A 1FH8A 1KXQA 2VL4A 1JFHA 1HIZA 2XFRA 2YL5A 1CGWA 1NWTA 3WNMA 2YDRA 4ZXLA 4QDMA 2XN2A 4MTVA 2G3NA 3AXHA 3BLPX 3AIVA 4J3XA 3ZSSA 4QLJA 1V6XA 3VDHA 3T2PA 2CITA 5BROA 3GNRA 2X2JA 1AQMA 4RE4A 1YQ2A 3PTKA 1OD8A 3KZSA 4AXNA 3PZ9A 4ZE5A 3GH4A 1RD6A 2EABA 1VB9A 4R27A 3FAWA 4X0VA 1C8XA 1E5NA 1Q6DA 5GNZA 2F2HA 2JEPA 1QBBA 3PZTA 2WHJA 2XVKA 1KCLA 2D0FA 3WD0A 4C7GA 4PTWA 1CLXA 1UA3A 4E4PA 3I3EA 5C70A 3PBGA 1GONA 1FFRA 1HKJA 4AD2A 5FL0A 3D51A 4NRRA 2BXYA 2F1BA 2F61A 3SUWA 4WSKA 2RGMA 3WQ8A 3OG2A 1J9YA 2XHYA 2EQDA 4JL1A 1JNDA 5JUVA 2OW6A 2G3JA 4AEEA 3A4AA 1XSJA 1JG9A 2GJPA 1BYBA 3TP4A 1H0IA 3W82A 2A3CA 3WH6A 3AICA 1Q6GA 1B2YA 3HZ3A 1FHDA 5BRPA 3PTMA 4QP0A 4UZUA 4FLOA 4EANA 1M01A 3THCA 2UWFA 4AZCA 5HNNA 3N17A 3WH8A 1LQ0A 1CGXA 1JD9A 4CUCA 4CVWA 1E55A 4M56A 4P8UA 4WLCA 4EE9A 2JIEA 2VC9A 4KRUA 1US3A 1GOIA 1P6WA 1V0NA 4P7QA 7CGTA 4QCEA 4M8UA 3VGEA 1QNRA 1HJSA 1JDCA 3NSNA 4P8WA 2XGBA 2EO7A 3N9KA 1G94A 3OB8A 3WD1A 1W9DM 3WBEA 3ZR5A 1C8YA 3ZJ8A 2VQTA 1UWIA 1EQCA 4MADA 4U2YA 4BQ2A 3DDGA 4HA4A 1E0WA 2WWDA 4F79A 1D3CA 4AMWA 1UR2A 5D8ZA 1AMYA 1W1YA 4KGJA 3VIOA 3BUQA 4UQBA 2WC3A 3BVTA 1EO5A 1X1NA 1VFOA 1KXHA 4PMQA 4KH2A 1E0VA 5A6BD 2IUZA 5D9PA 4PMYA 3EBVA 1R7OA 4Q7NA 5FOOA 2X05A 3EJUA 5E6YA 3VPLA 1MW3A 2GJXA 1O7DC 2VZSA 4BS0A 2JFEX 1C7SA 3VOCA 2WMHA 5CPQA 2WKLA 5E09A 5E70A 1E56A 1MXGA 1NWSA 4BF7A 3L4UA 3AS2A 3HG5A 2BS9A 1HKMA 2VO5A 3VVGA 3HJEA 1KGWA 3FW6A 1VBRA 5CSUA 3WD3A 3PZOA 1OT1A 3IJ7A 4AZBA 1IZKA 2WMJA 4GI6A 4MNJA 3VD4A 1LF1A 4OIFA 2XIBA 1W9PA 4UOZA 3QHOA 3VKKA 4BCEA 4PN2A 2DDXA 2YA2A 3L4ZA 1B30A 1ZBWA 1CGYA 3WF3A 1OB0A 1WZMA 3KEHA 1UD3A 1JZ5A 1W3KA 2V3DA 5I78A 3UG5A 2J8GA 1ESWA 2A3BA 3K4DA 5I2UA 1T0OA 1K9TA 2EEXA 3WDIA 1LWJA 1ISVA 1UD6A 1XCWA 1E6QM 2GUYA 4GI9A 3SCNA 4C7FA 3NSXA 2J8FA 1CTNA 3QOMA 4UR9A 3BCFA 2W62A 3ARTA 1E1FA 4CD5A 3EJTA 3WL0A 1W9UA 3WF2A 4UQEA 4AY1A 5I24A 5A6JA 3RJXA 4AZ6A 1XRVA 1HVXA 2VCAA 3RMEA 3POHA 1W9VA 4LYPA 3AISA 1V3MA 3CZGA 3WELA 4MDPA 2XFFA 3W29A 1QW8A 4P7LA 3U7VA 3T09A 4JIEA 2J7BA 4ZENA 1IZJA 1JXJA 3SUUA 3UR7A 5CLWA 3UETA 1FHLA 2W63A 3WMCA 1W1VA 1E40A 3OLGA 1TCMA 4PEEA 5A6LA 3BLBA 3KL3A 3BH4A 2VRKA 5A95A 4U5IA 2CNCA 4HOXA 1EHAA 1ISXA 5BXPA 4WIWA 1NOWA 4PTMA 3B9EA 1PX3A 4D6EA 4B9YA 2JF6A 3AZTA 3MUZ1 4WSJA 1Y7VA 4J28A 2X0YA 3EMQA 1XV8A 3GYCA 3ZIZA 4QFUA 2E9BA 2G41A 1UR9A 4JKMA 1H11A 3ZQ9A 3LRLA 3AZSA 4GKLA 2O9PA 4FK9A 3VIFA 2VRJA 1MFVA 1MW2A 2FHFA 4AWEA 1TG7A 2F7RA 1PEZA 1O6IA 1SR0A 4W7WA 2WVUA 1EDTA 1MW1A 1EDGA 2IGTA 1U30A 5BXSA 5I6SA 1ISYA 3PHAA 3LPGA 1V6UA 2G3MA 1LL6A 2D3NA 1TR1A 4AZGA 2ZXQA 1HF6A 3GXFA 4PCTA 3CC1A 1EA9C 2XVLA 3T2OA 3VD9A 2WKGA 1FFQA 4CD8A 3BVWA 1R87A 2W5FA 4GO8A 3GNPA 2EBNA 1PAMA 3EDFA 3G6MA 5I3DA 3EJQA 2OWCA 4LXFA 1QPKA 1TUXA 4PUDA 2DSKA 1FP9A 3EJPA 5GNXA 3RCNA 1HL8A 2ZIDA 2E4TA 1PBGA 3VIGA 2QLYA 1FH9A 2XN0A 2E8ZA 4WKFA 3W6MA 3CMJA 4JZ5A 1UG6A 1WPCA 1GVIA 4H2CA 3ZOAA 3CLWA 2BNJA 2VX7A 1US2A 2CBUA 3HG4A 2CKSA 5E9AA 2NSXA 3TONA 1UHVA 1ZL1A 2FGZA 2YFNA 1DWAM 3EMZA 3WNLA 3WDRA 3H55A 4W88A 8A3HA 4F8XA 1E4IA 1TFVA 1XH2A 5CQ1A 5IHSA 5DO8A 1QX1A 2XSBA 1UUQA 1PX8A 2O9TA 2OWWA 2V3FA 1E43A 1ISZA 1SMAA 3VX0A 2CBVA 3WNOA 3ARRA 1UQYA 2ZXBA 1C92A 1UWSA 1KTCA 2WBKA 3ARUA 3D3AA 4X0NA 1GCYA 2YL6A 1NP2A 3WDPP 1UD5A 2BHZA 5C8BB 3CHDA 1I1XA 2EJ1A 4HOWA 1R33A 1U2YA 3N11A 1W9XA 4JCMA 3OLIA 3OA5A 3D4ZA 4PSRA 1GVYA 3MSGA 3U7BA 3F5KA 5I23A 2JALA 4XZBA 1QNQA 2X1IA 3FAXA 2EAEA 2FH8A 1J0IA 1CXKA 1UR8A 1CZ1A 3N15A 1OIMA 1LJYA 3AMCA 3K8KA 3LPPA 1HKIA 3BUDA 1KTBA 1U33A 1E72M 2VZTA 1GOQA 3AYRA 1JZ6A 2C8NA 4KMQA 3DX4A 4GQRA 4U31A 3F5JA 4S3JA 2J7EA 3CZEA 1WDRA 4PYSA 2DSWA 1M03A 3PZIA 5HOSA 2D2OA 3GBEA 4XZWA 1QI3A 1M04A 2VTFA 2J78A 2EPNA 3ZT6A 3DYMA 3BMWA 4MAZA 1UWUA 1UKSA 1ZBVA 3KLKA 6A3HA 1JDAA 2ZX8A 2BY2A 1JYNA 2E40A 4MAVA 3NDYA 2VT0A 1Q6EA 3ZSTA 2J25A 2FE0A 3FY1A 5IFTA 5A69A 3VMPA 3SUSA 2XPKA 1CENA 2W61A 3WUBA 3AI0A 5ECUA 5A2AA 3AIRA 1D7FA 2PB1A 4K68A 4IISA 5FL1A 4P7RA 4M29A 1SZNA 2DH3A 3S6TA 3OLDA 2QPSA 4FNPA 3LX9A 3RDKA 2VVNA 1W32A 3N13A 1A3HA 3WMSA 1E6ZA 3GXDA 1B3YA 4FNQA 2XN1A 2WAGA 1AQ0A 3LXBA 2XSAA 5A8PA 1UYQA 1CEOA 1KFWA 3CMGA 3H54A 1V02E 4W89A 2DH2A 4NF7A 2FH6A 2OSXA 1GHRA 3AHTA 1K9EA 1V3IA 1TQUA 4W84A 1UH4A 2GSJA 4HMDA 1NOFA 1CGUA 2CIPA 1PJ9A 4YHGA 4TVUA 4FNRA 4J7RA 3BAXA 4W5UA 1GQKA 3TV8A 3BUIA 3O6AA 1HTYA 1ZJAA 2QPUA 3L4YA 5AYBA 3L2MA 4D71A 4GXPA 4FMVA 1BTCA 3A47A 5IHRA 4AD4A 1KXTA 2V3EA 5E0CA 1H2JA 2WW5A 3ARPA 3AS1A 5AYIA 3W26A 1JYXA 1B1YA 3W81A 2X2YA 1RPKA 1E4LA 2VR5A 1OM0A 5LYRA 3D4YA 2ZXDA 3OGSA 3VINA 1J11A 2VCBA 1CXHA 1PZ2A 1WNOA 1V08A 4GZEA 5D8WA 4GPNA 1HN1A 6CGTA 3CIVA 4J27A 4ATDA 2CERA 1V6WA 4HMEA 4DWSB 1C91A 4GO9A 3K1DA 1PPIA 3BCDA 5D9OA 2XWDA 5EFDA 3I3BA 4CU8A 1QWUA 2WC7A 4X9YA 1E5JA 5ABFB 3WD2A 1UZ4A 1WE5A 1KBKA 2XJ7A 2BV9A 4PTVA 2OLHA 1XD0A 3M07A 3LXCA 4OOUA 3IJ9A 4MDOA 4AZ7A 1SFSA 1GW1A 2BHUA 3F5LA 1UKQA 1VENA 3OGRA 5A8NA 1H49A 4KGLA 3VTRA 1VJZA 4HPGA 1PIFA 1OSEA 3NSMA 3BAWA 3ZJKA 4AZIA 2QF8A 2WM0A 1TVNA 1QW9A 4P8VA 2EACA 1E70M 3AFBA 4HA1A 1HL9A 1QBAA 4BQ3A 5A6KA 3BAKA 1V6YA 2YKKA 4ZXOA 2D73A 5I77A 2WVVB 3VGGA 3BVXA 4AD0A 5A6AA 3IK2A 1LG2A 1E6NA 3VIHA 2YLLA 4AD1A 1H1NA 5EBAA 3EDKA 2VX5A 2ZUSA 2Z1KA 4H8UA 5A2BA 1J18A 1ZBCA 2PWDA 8CGTA 2D23A 5JBDA 3RILA 4CGTA 3DHPA 2PF0A 1UR4A 4JFUA 2WCAA 4AD5A 5FCZA 3HMCA 5BWFA 2OYLA 3WMBA 4CN4A 4GQQA 5KZ6A 5CGMA 1BFNA 4UFLA 2VVSA 4AMXA 1G1YA 3BSGA 2VJXA 5TD4A 4J3VA 3ZO9A 3U5YA 3WFLA 2DT2A 1JI2A 1B0IA 1WB0A 3PZNA 1KWGA 2BHYA 2VURA 2WXDM 3AIQA 4HZ8A 3CHCA 2PBGA 2CHOA 2E8YA 4RL3A 3VGBA 2J62A 1CGTA 2F8QA 1BGGA 3BAJA 2Y2WA 3GZAA 4Q22A 3W37A 3AS0A 3SCOA 2UY5A 3N12A 3GXNA 2WYSA 2F18A 3O9NA 3VDBA 4U2ZA 2X8RA 1ODZA 5DFAA 4QLLA 5BCAA 4MNLA 3M46A 4PMZA 2RGLA 5CPSA 3SCQA 1UA7A 2W91A 1G0CA 4A3YA 4GI8A 4MB1A 3FXYA 1VJSA 3VM5A 1VBUA 4PUEA 2BFGA 4J3TA 2XVNA 5HXMA 2GDVA 4JHZA 5C71A 3BSHA 4PCSA 1DWIM 5DMYA 4BZYA 2WK2A 4FF5A 2NT1A 3GXTA 3UG4A 3VMNA 4PMUA 4UFKA 1HJQA 4CN1A 3ARYA 2WZHA 1XH1A 4QAWA 1QHZA 4CU6A 1TQTA 3WUGA 3VD7A 1QNSA 1AQHA 3CH9A 4D6FA 3CZLA 3THDA 4TXEA 5GPRA 1AVAA 3WY2A 2J7FA 3WFZA 2J7CA 3LPOA 4ATWA 3WUEA 4JKKA 2YLAA 1CXEA 4W85A 2ZXAA 2J4GA 4LPCA 2F7PA 2PWFA 4PMOA 1PX4A 1QNPA 3A24A 4DWSA 4CD6A 5BYWA 4HMCA 3BVVA 1UASA 4WKAA 4HZ6A 2CESA 3WQ6A 1E4MM 1W2PA 4HU0A 3MSDA 3WENA 5DF0A 2CETA 4CN6A 5ABFA 3ZM8A 5FKYA 4URIA 2W66A 2PI6A 2G3IA 3PZMA 4AIUA 1UH2A 4AYGA 1GZJA 5I79A 3RM9A 5HPCA 1JNEA 2V5DA 5D9MA 5EB8A 1JGIA 5DEZA 3SURA 4N42A 2XGIA 4D6IA 4JHOA 3HG2A 3VIMA 4AW7A 3BC9A 4WK9A 1DEDA 1RP8A 3EDJA 2BY3A 4PMNA 1TQVA 4JFTA 3VSUA 4XB3A 3O2LA 3SIMA 3CZSA 4F66A 2WMKA 3UEQA 2WVVA 3W38A 1BGAA 4H7VA 1HJVA 2ZX7A 4UOJA 3WBAA 3BUBA 5LA2A 1EXPA 3N18A 2CKRA 1W3LA 4Z2IA 1J10A 1E15A 5IFPA 1E6RA 1KGXA 9CGTA 3OBAA 1DWHM 1EQPA 3CPUA 3VNZA 1NQ6A 3ZMRA 2YBUA 2J47A 1GHSA 3PZVA 4AYSA 5M5DA 1E4NA 5GNYA 4OZOA 1QI0A 1TMQA 1XSKA 1OT2A 1KBBA 1JYVA 2IXUA 4CU7A 3NIYA 3DECA 5A6SA 1JAEA 3WF4A 4P7OA 2O92A 1GOOA 4RE2A 5IDIA 3GXMA 4H04A 2J79A 5CJ5A 3AHYA 3N1AA 4TVDA 4UNIA 2DSZA 4NSBA 1ZJBA 4PMXA 1TA3B 3MI6A 3CUGA 1C3FA 1UWTA 1SYTA 3A21A 4PTXA 4MNKA 3BUPA 2WCGA 3OIHA 2VMFA 1B90A 3BAYA 5HDRA 1W9BM 1ITCA 4ZFMA 3MUIA 3L2LA 1MFUA 1C93A 4L4OA 1DWGM 4UFIA 1QWNA 3D52A 2JEQA 4L4PA 2WVSA 3T0AA 2D22A 4Z2HA 4MB5A 5FIPA 4J3UA 1KR0A 2JIWA 4M1RA 5CG0A 3S5YA 4B15A 1H41A 4AC1X 2EPOA 1GUVA 1VFUA 1GNXA 3LMYA 1GQLA 2DSVA 1V3HA 4U3CA 1PS3A 2WANA 1BQCA 4OKDA 4Y7EA 3VIJA 1TE1A 3AXIA 4FLQA 3UESA 3NJ3A 2DIJA 2WC4A 2QHAA 1CXFA 1HKKA 1UWRA 3II1A 1CBGA 2V5CA 4W7VA 1E1EA 3ARSA 2EPMX 3ARVA 4DUWA 2D0GA 3DC0A 1W1PA 4D72A 1KXVA 3E1F1 5JBEA 5M3WA 3GXIA 1OD0A 3ECQA 2VZOA 1CXLA 1TZ7A 3RJYA 4AZ5A 4UFMA 1CLVA 1OGSA 2ZUUA 2OYMA 4EK7A 4V28A 4UQAA 2BY0A 2XWEA 2C0HA 3WUFA 3WDJA 1HP5A 2BY1A 2YL9A 3K8MA 4M81A 5BXRA 2EPLX 4PMDA 1PIGA 2PWEA 5ABGA 4XUYA 4AMCA 1R34A 1W2VA 2BXZA 4BQ4A 4PMRA 1ITXA 2OWXA 3AS3A 1UD4A 3WEMA 2XM2A 3WH5A 5A6MA 1UD2A 3A22A 2X09A 4NXSA 1G5AA 3L4XA 1WCGA 3CZ8A 5M03A 3U57A 4M24A 4XX6A 3AIEA 3EDDA 4S3KA 4WF7A 3JUGA 1UQZA 3T08A 2ZX9A 3H53A 4TTGA 3SCRA 7A3HA 3BVUA 1J0ZA 4W93A 2WLZA 3GH7A 2G4FA 2X2IA 2QMKA 3RPMA 2AAAA 3BXWA 4B3KA 4DWSD 3WD4A 1Z32X 3WEZA 1WDQA 2VUYA 1V02A 3T0DA 3LRKA 5EMYA 1EOKA 5AC5A 1VEOA 4YN5A 3VD5A 4UTFA 1E6SM 2YDSA 2YJQA 3RM4A 4QLKA 1EH9A 2XM1A 1QHPA 3OZOA 2DSUA 2IXVA 2OSWA 1H09A 4H8HA 1F4HA 4W5ZA 4TVCA 2VCCA 1JZ4A 1FOBA 2ZWZA 2X2HA 3SUVA 3TTQA 3VM7A 3IAPA 1B3WA 2E9LA 1BG4A 4E8DA 2ZWYA 2J7GA 3VIKA 3CBWA 2F7OA 1QI2A 2E9MA 3BLKA 2EPKX 3W24A 2WLYA 1XHGA 1BVNP 4PMVA 4MPKA 4BA0A 4JFVA 4J3WA 2DGAA 1HWWA 1NARA 2BVYA 4DM2A 2O9RA 2J74A 4Z2GA 1TA3A 2PC8A 3WQVA 3WEOA 2Z1SA 1N82A 1DTUA 4FLSA 1D2KA 4DWSC 4IPLA 2X0HA 1EO7A 1R75A 3WDHA 1V3JA 4B3LA 4V27A 5CGTA 3AJ7A 4CCDA 3PN8A 7TAAA 1J12A 2CBJA 3L4VA 4GZIA 3SCUA 1H0GA 5AC4A 2VRQA 1QHOA 1HNYA 2ZUNA 2HISA 1CDGA 1GOMA 3A4WA 3AOFA 1RP9A 4JFWA 2EADA 1EOMA 1QOXA 3CHFA 3MMWA 4LX4A 4BQ5A 1NWRA 4D6CA 2OSYA 3MMUA 4UQCA 1B3VA 3BGAA 2VR4A 1UZ1A 4TOQA 1KB3A 1DHKA 1E6PA 3SUTA 1V0KA 5HBFA 2ZX5A 4HU8A 1WZAA 1HVQA 2HVMA 3B8SA 1E71M 4D6GA 1KGUA 3ZJ6A 3ARZA 2VQUA 1V3KA 3DX3A 1W91A 2VZUA 4ATLA 1CWYA 1OGGA 1FH7A 4P8XA 4GIAA 4MNMA 3CUFA 3VDAA 4OUEA 3EJRA 3BMVA 1C90A 1HJWA 3FN9A 1GPFA 1XH0A 1G01A 3J7HA 1Q6FA 1G9HA 5E6ZA 1UR0A 4C7DA 1C8QA 4ACZB 3KWXA 1LG1A 3U5UA 3BAIA 3UG3A 1R7AA 2WB5A 2A3AA 4LYQA 4D6DA 1UKOA 1HX0A 3RIKA 2UY2A 3DX1A 3MV11 1J0KA 3WF0A 2W92A 3VIPA 1WKYA 4JCLA 1IT0A 1ODUA 4CCCA 2BVDA 4F9JA 1GJWA 5LA1A 2NT0A 2E0PA 1EGZA 1VRXA 2Y8VA 2Y8KA 1GORA 1V0MA 2EXOA 3OGVA 2PWGA 2FHCA 4EKJA 3EYPA 3W27A 1CXIA 3W0KA 3A4XA 1MQPA 3A5VA 1JDDA 3WN6A 1EHNA 4PBGA 4UFHA 3EJSA 3NYDA 2XIIA 1EDQA 1WDPA 2YBTA 4W8AA 3MUAA 1C7TA 3W53A 1XCXA 4ZE4A 4YPJA 4HPHA 1JD7A 4Z2LA 5A1AA 2CXGA 2ALWA 3TTSA 3WIJA 2GVYA 4AD3A 3TA9A 4CD4A 3VGHA 4M82A 4V2XA 4NZJA 2C7FA 3DYOA 1Q4NX 1UOKA 3VDCA 3VUPA 1OINA 3F4VA 3WKZA 4B16A 2E3ZA 4UCFA 1JAKA 4CKQA 2FHBA 1FA2A 1H5VA 4CVUA 1HXJA 4RE3A 1OWQA 3UCQA 1LLOA 1SMDA 5ABEA 3CHEA 1QVBA 3M7SA 4D1IA 2WNWA 2YIHA 3VGDA 4NZFA 3MO4A 4DUVA 1ZU8A 2AOSA 1ZBKA 4A4AA 1J0JA 2D1ZA 3QHMA 2CHNA 1K9DA 1HJUA 5DT7A 5BXTA 1HT6A 3KL0A 2UY3A 3G6LA 1QI4A 1QNOA 4A3HA 3EMCA 1O7AA 5D9NA 3T0BA 3WQWA 1BAGA 3ARXA 3B9AA 3ALGA 3HU7A 4XV0A 3MV01 1XC6A 2ZUTA 3CUHA 1JXKA 3IAQA 4LYRA 3VNYA 2D3LA 3LPFA 4HTYA 4M80A 4MB4A 2VX6A 2D0HA 4AISA 3AHZA 3QOKA 2DT1A 4YHEA 1WZKA 2WCSA 4GZJA 4UZSA 1LWHA 3VO0A 3CZJA 2FGLA 1CNVA 2D20A 3GTNA 2CBIA 5M17A 2ZUVA 4NX0A 2WHLA 3K46A 1EIBA 1CECA 1UR1A 1KQYA 4OGZA 2JF7A 1L8NA 3PZUA 3MANA 2OW7A 3GXPA 2GK1B 3W6LA 3AQUA 1JZ8A 1CGVA 1GOWA 4DO4A 4IM4A 3VX1A 1E0XA 3VD3A 3VU2A 2WZEA 4FNSA 2DPEA 2WZIA 1GQJA 2YA1A 5KEZA 1TQWA 4HZ7A 3ARWA 3W4RA 1E6XM 4KWUA 2J7DA 2ZICA 1OIFA 4JKLA 2JE8A 1DP0A 1TQSA 5A8MA 1Q6CA 4LGXA 4PRWA 3A6OA 5CZKA 4TX6A 1K6AA 5A2CA 1TVPA 3APGA 4TTUA 2DQXA 3AXXA 2AMGA 1X6LA 4FLRA 3QHNA 1B3XA 3DYPA 3AMGA 5ABHA 3AIBA 2ZOXA 3SCVA 2WBGA 2DT0A 4ACZA 1WZLA 3DHUA 1WDSA 5JIPA 2PBOA 1VEMA 1ISWA 1JF6A 3MMDA 3VIIA 3NDZA 5LA0A 4IUGA 5E0FA 4W8LA 3RO8A 4FNUA
chains in the Genus database with same CATH superfamily
3EOAB 3QNYB 3O2DL 4HGXA 2CEQA 2MQGA 2IKIA 1UACH 4EBQL 3ULUD 4MQXD 4G7VH 4PE8A 1Q45A 4Y9OA 5DXXA 2DT3A 2OXGB 3WTSA 4AVHA 2NW0A 3CTLA 3ALWA 2WMIB 3KYMB 3WQFA 4DN3H 4XCCH 1AFSA 1AOHA 3WG7B 1V6TA 1YEFL 1NM4A 3B3BA 4NIYE 1IWPA 4A04A 1R2RA 3WF1A 3WQGA 2D03L 3K5XA 1U6AH 2QUTA 4G2DA 3SGGA 4CC4A 2NNCA 4DYEA 4X6CF 3E2SA 4FQQA 1UJ3A 2YSSB 3HLAA 7REQB 1WV7T 5EN3A 2E6QA 5FEPA 1EO8H 4UUJA 5JXAH 3LKQB 3M86A 5K1NA 1YECH 4P48A 4JANB 3PPEA 1VPQA 1DVZA 1AXTL 3SPIA 3OAZH 3RTQD 1N12A 1S8DB 1DWFM 2ZSWB 3TJHD 1J9TA 3EWYA 2APBA 4BQ8A 2Y7GA 3GDTA 3IS1X 2PS2A 3RM8A 3I3DA 3TFKD 1OFRA 2QJHA 4Q56A 4L3AA 1FLRL 2PP9A 3GK8L 4U33A 5D71L 5CXPA 3NR0A 1XIJA 3BKJH 3CEPA 5GQBA 1YEKH 1N64H 1J5OL 5CN2A 4GRLB 3WNKA 3M6DA 4P5SA 4OI7A 5EMMA 1D6EA 4RDZA 3E74A 4J3BA 4E41A 1XGZA 3K4AA 2JKNA 4N8VA 25C8H 2Q7YA 5DGRA 4CMMB 4TSBL 4UBDC 2NUTB 3H8AA 3AIWA 4K38A 5T1KA 4UTAH 3TGXA 1B3ZA 4WO4D 3N2BA 4AMAA 4JRXE 4HOZA 3UABA 1HJCA 3PZQA 1ME9A 3LUTA 4K94H 1KCXA 3S8GB 2BZDA 5L2KE 1OTSD 2EDMA 3QDMA 2ZRUA 3MRQA 3FQWA 2CPUA 2Y4SA 2F7QA 5A94A 5H4YA 3VI2A 3RVUC 4XP9L 4IXXA 4M6NL 1CPUA 1T1ZB 3FFCE 3KCWA 4NQCB 4ALDA 4F0KA 2BX5A 1A4MA 2PCEA 2WMFA 3SKMA 4KV5E 5IZ7A 4W4QA 2I32A 5DHVB 4YX2H 1XCTA 1QSFE 4ZMGA 4AM0B 5E4IA 3O11B 4PP1D 3EPNA 4US6A 4MTVA 2G3NA 1T5WB 4FG6C 3C87A 2CITA 3UZZA 4UXDA 4F2BA 3FMGH 3KZSA 4ZXBB 4ZE5A 1BA9A 4DPPA 2WB7A 1VB9A 4R90H 3KXFE 2BS71 4L3EE 1QFWH 2V81A 2OMTA 4XMKH 3PZTA 1NTDA 5IHZA 4LWWA 1JFQH 3U7YH 4AD2A 2B39A 2F38A 4LSSL 4HKJA 3WQ8A 3OKOA 4ML9A 1JOIA 3MJ9A 1B2YA 4L05A 1EPVA 2H2SC 4GQBA 4XH2B 4BCZA 2UWFA 5HNNA 2Y7MA 4NJGA 4N8VG 1P6WA 1KIQA 4QCEA 1YHPA 5EU7C 1OE3A 3UJ2A 3FCGA 4YS4A 5AKVA 2HLFC 2I7SA 5DJ0A 2DW7A 4KMTL 2HVOA 3UTTA 2FIKB 3S2AA 1JHKH 2Q02A 5IWLA 4FMFA 1QFPA 1R3SA 2V8MA 4F79A 3WJJA 2X4SA 4DGIL 4UQBA 2WC3A 1XF5A 2VL5A 5AB1A 4L8SA 3NIGE 4PS4L 1ETZA 5FYLD 4JFED 1XF2B 1SO5A 4WU7B 1O7DC 5G1YA 2H0PA 3ARBB 2GSGB 3VWKA 1KM2A 1TZZA 2R2EB 2WKLA 4WNJA 4L4JA 2NZ9D 4FA7B 3U30C 2QQLH 3HG5A 1UCBL 4LQFH 3SJVB 1GZ1A 4GUJA 1RJZA 4JM0A 2GTWA 4AGOA 1OT1A 3IDGB 2WQSA 3K6DA 1NEPA 4S10A 5JOPE 3UW6A 3I7RA 1G4SA 4WI3A 4XPHH 5I74B 4A38A 1YNKH 3H6OA 1E50A 1B30A 1FKXA 4YNYA 3UG5A 3QI9D 3DAQA 1ISVA 4XO9A 2WYHA 4P3DA 3PANA 2DWSA 4GI9A 1CTNA 3B4NA 1G6CA 3ARTA 2W62A 2APTA 4LSBA 1AGBA 4O54A 2VEIA 4AH2B 1N0LA 3AUOA 1EEYB 3WAJA 4RISH 3RQ3A 2IDFA 1JUEA 2HWGA 5IOKA 1XH3A 2KT6A 3POHA 3HC3L 4LYPA 3FYEB 4F2ME 2H8PB 2VE6B 3SKOB 4JIEA 3MMEA 2I5QA 1M7JA 3WBYA 4M1DH 4GJJA 3VFUA 2GGJA 3ZZSA 2Z7WA 1KB5L 4PUBL 5D1QC 4LLAA 2WJ5A 2R4SL 2B1HL 3VXUB 4XD3A 3LK6A 1SVZA 3ZUNC 4A7TA 4M51A 2J13A 5D7SH 5LKYA 1XGQA 3H6AA 3O7UA 3RP1A 2EE0A 3RU6A 2VRJA 5F7YC 1WWAX 4FOKA 3O4LB 4RZKA 4E5TA 1PU0A 1Q0YH 1XFCA 3HI6L 5FO2A 2NV1A 5DSCB 4QRUB 1LJMA 2WQPA 1BKHA 2ZXQA 2ARJQ 4K2UL 4BA8A 1E51A 3QDJB 4PCTA 1F3DH 4XAZA 2QFRA 5DMIL 4NZDA 3MNVB 1N6QH 3BV4A 4PJAA 1R87A 3D87B 5AZUA 1KFBA 1XLAA 4DOHE 5DR5L 4NZ5A 2FWSA 1RK6A 1RZKC 5B7YA 2PABA 1HL8A 2E4TA 2X88A 4LRTA 1QPNA 4HFUH 4JG1H 3CMOL 4X50A 4AYFA 3ZOAA 3Q45A 5G2HA 4HD9A 5LGHH 1DWAM 4LFHD 3GRGA 2OMZB 1KTRL 2OJZL 4W9GC 5I8CA 1Z42A 3CVHL 2DKMA 4X60A 4HNCA 1QX1A 4WUUE 4H0HB 1G1CA 5L8JB 1E0TA 3ARRA 1E4XL 1A7PL 1G4RA 1R3IL 3ARUA 4KRMB 3UTSB 2JCCA 2C16A 3PJSA 3V9EA 3WDPP 4DN4H 2GQ8A 1H62A 3VFMA 3CHDA 1X96A 3FSUA 1FSKC 3R0KA 4QNPF 4NZ1A 4IMEA 5MI0C 2O4QA 4OZGA 3PVFA 1I3UA 2YPIA 4H2HA 3FT2A 5EIIA 3DA0A 3I6LD 1IFGA 5BRZA 5GZOA 2YPVH 2FR4B 4OFQA 3X17A 3RWGA 3NPSC 3VXQB 2X4RB 1KPUA 1QEWA 5EBMB 1R5YA 1IWAA 2ERJC 1AP2A 2DSWA 1NAMA 1WISA 1EJFA 3GRWA 3WAKA 2QSQA 3UP8A 2Y69B 2Y06L 3D18A 1KC7A 2YCJA 4LSDA 5EEUA 3O81A 3LN4A 4Y5VB 3BQ5A 3W7LA 5FECB 1A21A 4EDWL 1CF8L 4IQJA 2P5EA 1SZNA 4KOBA 4UTWC 3LLXA 3RYMA 3O0RH 4Y0GA 5ID0A 3T0CA 2P8BA 1P1MA 4TQPA 1B3YA 1HI6A 5D02A 2XSAA 1CEOA 1Q6OA 2XJLA 4PJXB 4Q9BA 1AZCA 1FJ1B 2GSJA 1FVPA 1Z89A 1X5YA 4G8IA 5SWSB 3X13B 5EG6C 3TV8A 2IOOA 2NLJA 4X6CB 4LHQB 4XPFL 4QI3A 2CLEA 3DSNB 5FYLH 1BWMA 3ARPA 3W26A 3CVIH 3L9CA 3PJLA 4R5VA 1B4KA 1YNPA 1Z48A 1RLCL 4MCYB 2YQGA 3NZQA 3ISRA 4QKXB 3CV7A 4Q4MA 4GMSH 1XCQB 2WLNA 2R82A 1WE5A 3V95A 2Y7QB 1FFPA 1IJNA 1SFSA 3F5LA 1UKQA 4F2UA 2Y22A 3DFNA 4MNQA 2XI9A 4IPPA 3VDGA 3RWFB 2EACA 3SKUD 3KDMA 1CFQB 1R38A 1W72L 5I77A 4QHKI 4PFMA 4TOYL 2JLPA 1TJ1A 4JX4A 4L8BA 2PWDA 3CFCH 4I9MA 1WFNA 2DY3A 3HE6D 1MHHA 4HCLA 2QCFA 3KVDD 2Y1AA 2R1XA 4AD5A 1NDTA 1OFOA 5LBSL 3FTZA 1EXBA 3RVTC 4L9DA 4FS0A 4EI6A 1MJUL 1NC4A 3RDJA 4M7LL 3SD5A 5EIQA 2J5WA 1H15A 3PZNA 5K9KA 2PZNA 4HZ8A 5B1KA 2OR8A 1PLGH 3TYGH 1HAUA 5FF2A 3P73B 3AG1B 3BAJA 3SD2A 3GZAA 5KYXB 4YBQD 3ZE0F 4PJHA 1OP4A 3GPSA 5TF1H 3MROB 1X5GA 5DFAA 4RBPH 3UGRA 4BH8B 2YD8A 1P43A 5EOCH 5D2WA 2D31A 4JHZA 4QRPB 3V0EA 2Z31D 2FLIA 2JFCA 2IDSA 4JNXA 3ATBA 1XGPA 4S3EA 3G7TA 2WXGA 4QAWA 2NTFA 3MV9A 2F84A 4BKSC 1NCBL 3AG3B 1X9RA 3HB3D 5JHBA 5EU6D 4Q58C 3LPOA 2ZG2A 1J4EA 4I48B 3QQ9D 4MHHI 1OF0A 3D09A 4PJ5B 4HMCA 5CPOA 3U30B 5FYKE 1IKFL 5F7FA 4DJFC 4JFZL 1D2PA 3UYPB 3ZM8A 1RIVH 4UCGA 5IJKC 1X7FA 2V9RA 3FCTA 5AW7B 5CFAA 3SQMA 1BIHA 4EE2A 5BMFH 4NU7A 5LXEA 4WW2F 5F7DA 1JNEA 3NEHA 2JQAA 3AG4B 4YXLH 1IE4A 4NEHB 1Z5HA 2BNRB 3FOLA 1Q38A 1RP8A 2INEA 1KPVB 2BY3A 4PMNA 2PGWA 4Y7OC 1HSAA 3VK5A 2DQFB 3UD6A 2J1YA 4HWEH 4R4FH 3EB3A 1W3LA 3CQFA 3NTCL 1XLKA 1JPGB 4QDWA 4LV4A 9CGTA 2Y88A 3ZMRA 2AEQL 3NOIA 4MD0B 1DBKL 3L9RA 1J8SA 1F74A 2GJZB 1WK0A 4GC4A 3LS9A 2DMBA 2PDBA 2Q71A 3IMBA 2NXHA 3LSOB 1FWHC 5KSBF 2R51A 5D1QB 5FJRA 3MLSH 2C9VA 4G72B 4IICA 4PRDB 5BOPA 4U1SB 4OGYH 4HJTA 3P30H 1ME7A 4A3RA 5HYQB 3CFIC 3STBA 2G0WA 3JVGA 1OGAB 1KZYA 4I0PD 3LQLA 4BCXA 1HHIB 1TJHH 3WO8A 3SGKC 3BAYA 2ZTKA 3E49A 4BWUA 3VCRA 1S78D 4GCXA 1RUML 4PPTA 3ERXA 4OCWL 1D3HA 4TV6A 2V5LA 1T0PB 5C0GA 1TPVA 5CG0A 4AGPA 3TO2B 3NWRA 4EQ3A 1NCOA 3MKVA 3QT2A 3MU3A 4N2IA 3UESA 1MEWA 1E4KC 2HTMA 3NJ3A 2BOBB 3SJVE 2AJXL 5C2GA 5FUOL 4TX9A 3K72A 2RD0A 1YBQA 4PGDA 3P80A 3QY6A 4UUIA 5CP7B 2OI9B 4D72A 4E2BA 4KQ3H 2XY2A 2YWYA 4N9BA 5CAKA 3RVWD 5I3GA 4YMPA 3QO0A 4B0MM 4X6DE 2XX0A 3H8NA 4YEEA 4I1PA 3L3IB 3WUFA 4JY6A 3K8MA 2POZA 5LWYH 5K39B 2NNXA 2JJSC 1RBOB 4QTIL 3HHSA 4QRBA 3O6CA 2ARWA 3MCLL 3D0AA 3F00A 5CN1A 4Y4FC 1MQKL 1FFOB 1UXWB 3LEYL 5GS1C 5EUOF 3HPXA 7A3HA 1YSOA 1C9SA 1GCFA 2A77H 3NJJA 1RCQA 1BX2A 4KROC 1S7TA 2VSCA 3UC2A 1XAUA 3S36X 3PL6A 2ZT9C 1REQB 1EEUA 1XR8A 4RJEA 1NFIB 3T0EA 2PPEA 4AEHL 1GIGH 2BCKB 1JZ4A 4BFRA 3T78A 3NOEA 3VIKA 1HK6A 5ITFB 5CEWA 3FHEA 3BLKA 4APQA 2ERJB 2F74A 1KKOA 2WLJA 1O5KA 1NGQH 4NHVA 3WEOA 1D2KA 5D2TA 2LU7A 2X0HA 3MLYH 1P9MC 3U4BL 4O0QA 5IW1A 4PG2C 1IR2A 3GBML 3BGJA 3QDJE 3E0IA 2IH8A 5L0QB 4KJQD 4NP9A 3SCUA 2H1PH 2CDFA 1FH2A 4TYUA 4LX4A 5DJAB 1NWRA 4D6CA 1B3VA 4YLCA 5C55A 4EIZC 3TIEA 5E0QA 1I2RA 5F7WC 2BLFA 1LLAA 4IBLT 1FUNA 3JRKA 4MNMA 3CUZA 4JHUA 2J2ZA 2OL3B 2MJWA 4IHCA 5KTEL 1XZ0B 2JKSA 2ICEB 4NYLB 2IG2H 5DJZA 5E6IB 3C2RA 3B2DC 2ICWI 3H9SB 3B0PA 2ICWB 1CO1A 4UB9A 1UC5A 4KNTA 1RURH 1T89C 3GIYA 2VUOA 4XAPA 3X1BA 3KCJA 4JY4B 1QPOA 3SDOA 1H7RA 4J2PA 1MAML 4YSQA 1LMIA 2JB6B 1IQWH 1FH5L 4X4XB 2I1OA 4K3EH 2Z8WC 4B16A 2FL5A 1PKQB 4ZSOB 3EA3A 3C56A 4R3SB 2X9WA 3CSYB 2HN7B 1OB1A 1OKEA 3CHEA 2OQLA 2X4TB 3TQVA 2ACQA 3AALA 5I30L 3MO4A 4WY0F 3RMJA 4UTTC 2WINA 2FECL 1XBRA 5JW4R 3H4FA 1T7XA 2CNYA 3KLQA 1Q7ZA 3KW7A 4U6XB 1K2DB 3GC2A 4WI4A 3WJWA 2NWSA 3NQ6A 4U05A 1A9BB 5DMGC 1F90H 2D3LA 4Q4SA 5DJXB 3L3DB 2QDVA 2WIMA 4CJ0A 2RACA 5IM7A 4KFPA 2OCJA 4NKDA 1CECA 4RPPA 5FCSH 2UXFA 1BF5A 4JFDB 4GRWF 2OQJA 1NIEA 4WJ5A 3DLQR 4HUKB 2PETA 3EYUH 3H0TA 2WQUA 2FD6H 3FB8A 4HZ7A 2VLLB 5CIPA 4WR3A 3FDKA 1GMIA 3TJEH 1M56B 3L7FB 5ESQA 4EI5A 4XWOC 4PRWA 1AIFB 3APGA 2XN9B 5SWSE 4Z7OB 4JHWH 5TDNA 1A65A 2J9XA 4GMTL 4X6CE 4P9MH 1HXYB 4NI8A 3SSZA 1HUVA 4G5ZL 1ETJA 4PG9B 4NQTA 1QAWA 1YN7A 1XF4B 2X1WL 3JR2A 4C6JA 1NCNA 1MFCL 5GRJH 4MAUL 2EKSB 3B9DA 1X9UA 1MHPL 1G7QB 2ENQA 1JPKA 5CJ8A 2BODX 3CLEL 2QHRL 4PS8A 4H0GA 3GNOA 1W5PA 3L9EA 3QJHB 2E09A 3BQ6A 5HHMB 2YBRB 5IBUB 1GOHA 1M2VA 4MF4A 2DZBA 3HHMA 2P3YA 4LP4A 1M9WA 4RW3A 4AH7A 3TDFA 3BJSA 4ZMVA 4YSSA 4MWAB 2Q2LA 1XIFA 1HZYA 1ZLDA 2MQ3A 3MA9L 1W16A 4B5WA 3ILQD 3DV4A 5EDSA 1FI8C 2XKNB 1JUKA 4KK9D 5JPMC 5DGQA 4OZHA 4B0MB 5HHOA 3AMLA 3DN5A 4ESKA 1T66C 1NP0A 3H9HB 4AEFA 3I9GH 2VGBA 1VCGA 8TIMA 1F5ZA 5KBMA 5DFTA 4KF1A 1L7IH 3ARQA 4ZQMA 2FO1A 3R13A 3DUSA 5AY7A 5DDHA 1BF6A 3W0WE 1OCQA 1NBVH 4HX1A 3WGVB 1PZ3A 3M0JA 1UKTA 5CWSA 5JDJA 1DBTA 4N2NA 3ZE0B 3SDXA 2KX9A 5E1QA 1T3FA 4ZUVB 2YD7A 3M4HA 4GB9A 3PQYE 4C65A 1VQTA 5I07A 2X7WA 3DIDA 2J73A 3CHSA 2E6JA 2YA0A 1RZ8A 3MLUL 4Z7AA 4DO6A 3BQUC 4G3YL 5DYOA 2DUZA 1ACYH 4X0KA 3QZPA 5C6TH 4QRPE 2HNHA 4Y4HA 1WAWA 2GVGA 2BTMA 2XUCA 2Z25A 2OZ0A 2CO7A 1A14L 1YDPA 2K45A 1YYMH 1ZOXA 4W4OC 4EKXA 5IVZA 3WY3A 2CGRH 4E9WA 3T4YA 1YA5A 1EZWA 4XP1L 1GHFL 2YGNA 1H5YA 3M0KA 4QITA 2WN3A 1XFBA 3UWQA 3GMLB 4N2GA 3C2OA 2GEQA 4OVUA 3FRPB 3PHQB 1ZHBA 5D93B 1HGYA 1O4UA 4MGGA 4WW2B 1H63A 5IB3A 2DEPA 4QX4A 4M7SA 3EYQD 3FTUA 4EXPX 3BP4B 2OZ8A 3BAEH 1NWUA 1XVSA 4XNYL 3B40A 3RK8A 3QUHA 4L4VD 2IPUK 4IRJB 1FFNA 3B2VH 3LHPL 4AVJA 2AQPA 2E75C 2WV3A 3APMA 3HOJA 3CT7A 1KIPB 1JSYA 4WJXA 5AW6B 2R9HD 5DZ9A 1UZDA 4GY0A 2Z35A 3BWAA 4O28A 3DI3B 3V0JA 2X1RA 4JGJA 4ZSTA 3SDCA 3AZRA 1BF2A 5GS1B 3PHOA 3QGVA 4KROB 2DEXX 5JHAA 4MASA 5KSBB 1GY1A 5CEZD 2XFRA 2VD8A 3RTLA 3C2YA 1THAA 3FULA 1NCTA 2JGQA 2FJUB 1DDHA 4Y8DC 4RE4A 4BSWB 4E0RB 3IK4A 1OGAE 2VCOA 3WJYA 3SYAA 4H25B 3W1QA 2AQQA 3FUKA 1KCLA 1XAKA 2D0FA 1K4CA 4PTWA 4Y1AA 4XNQA 4OKVB 3TEXA 1FCUA 4JIHA 2GITA 4MS6A 1J9YA 1YEEH 2QQQA 4G6FB 4E9XA 1B0RA 2EE9A 4BI5A 2OW6A 2PYEB 3T8QA 1Q8JA 1DQMH 1USQA 3QC6X 2A3CA 1EXUA 1ODAA 4ODHL 2ZP8A 1XIHA 2K0RA 4QP0A 4UZUA 4EANA 4J6RL 4HTBA 4LVAA 1OAKH 4C6IA 1NFDF 3ECBB 1CFNB 4WFEE 4AZ8B 3REVB 1HJSA 1JDCA 4P8WA 2ID5A 4Y2OB 3S2NA 3K30A 3E02A 1QR1A 1UWIA 2YUXA 4FL4C 4PHXA 3G5XB 1LO3H 4JN1L 1P5UA 3W11D 1QFOA 3CVCA 1PFOA 3QWRA 2QELA 3BUQA 3BVTA 1UB3A 4KY2A 3W1NA 1CLOH 4TQIA 4FGMA 5EUOB 5H1WA 3IGAB 2NNFA 2WUCH 4CADA 4GJIA 4XKMA 4IBUA 2GBAA 4WW1B 1GVSA 4HT1L 3R7MA 1E4WH 1N5AA 2A6NA 3V0WH 1HKMA 3QJFA 1OAXH 2ZJSH 1DL7L 1MFBH 2CLRB 4BINA 3IXTB 3U1QA 4UYPA 3Q5YA 3H22A 2R27A 4OIFA 3OSVA 3QUYC 4LOEA 3D9AL 2YPKB 4S3DA 1JZHA 2YKLL 3WF3A 2WKJA 5LIUX 2AXWA 3OBKA 4A7GA 4NUJB 3US1A 1J8HD 1JPFA 4BUQA 2UZXA 2E7CA 3C6SA 3FB6A 1PIIA 3NSXA 3I10A 2MOGA 3HB9A 5T9CE 1VFBA 4P57B 2EO1A 4FXGC 2ZBTA 4DBDA 1G7IB 1S5TA 1R19A 4LRIC 4JRFA 3TL5A 2N56A 1LXMA 4GG8B 2FQIA 5HK4A 4JRXB 4L6HA 2QCEA 5D04C 4YSCA 5F7NC 4I9WD 2WNQA 3B9EA 1FL5B 2OMYB 3AZTA 3CHXA 3QUZD 5FCUL 4IQEA 2FSEA 2YYUA 1D9KC 3PU7A 2XU9A 4WVRA 3ZQ9A 3B8UA 4AQAB 1GW9A 4X7SH 2JKXA 1PVHA 2ITEA 3FFCB 3W7GA 4ZODA 2Y8UA 2ON3A 3BKYL 1WVZA 3BN3B 3RXZA 3FSAA 4QNPE 2FJSA 3CQJA 3AGWA 2EKCA 1ZCRA 4ZT1A 1QSFB 2XWTA 3G6MA 1JK8B 4PC8A 2ITCB 5JDSB 1OF6A 1EJXC 2OWCA 3GGWA 1ERNA 4PB4A 3X3GH 2FB4H 3RCNA 4M61A 3GKWH 4ZSOE 3SGEH 1PZSA 3PDGA 1FH9A 3VUSA 1DDTA 4WKFA 3CFJA 1K8IB 1U8QB 5HYSA 4JTLA 3KXFB 2Q5BA 2B8OT 4L3EB 3MB9A 4AGMA 3S96A 1F86A 3D6NA 3H21A 2EJAA 1EUNA 1I7UB 1ZV2A 3FONA 2I9LB 3LS4L 3P8JA 1E4IA 5ACLA 1KTLA 2CR6A 1MQ8A 1AG1O 1LEGA 2YK1L 4YQXL 3LQZA 1AZRA 4F8LA 2VN4A 1N67A 2C34A 2O4MA 2AK4D 3IJEA 4AYBA 1QA9A 3UTQB 3CN0A 3GU9A 4A7VA 4L5FL 4XNMB 4JFDE 3AAMA 4XVUD 5CEZH 4OI9A 2AKMA 2UY6B 1NEYA 4A63A 5B38A 4L3FA 4U1LB 1UZ8B 4IFRA 4PODA 4JHVA 4BUHA 1LP9F 3H9YA 4RCXA 1DANU 1LJYA 5ALCL 2VZTA 4TTDC 3S36L 3KVMA 2X3AA 4Z7UF 1TWSA 3EZ4A 4LCIH 3PZIA 5HOSA 2ZOLA 2D7OA 3L1OL 2WCPA 3BQUB 6A3HA 3QUGA 3K1GA 2ZX8A 4JM2F 4MAVA 3Q5TA 3IIOA 1NVMA 5I6NA 4RZ6A 4HJGA 2WTRB 3UJIL 1CENA 4FQ2L 5KINA 4BH7B 5ECUA 1D7FA 2GUOB 3UZJA 2FX8H 4GXVH 2BPBA 4LRNL 4OV9A 1YRKA 3VCLB 1RUPH 4QXTB 2AKZA 3LX9A 2F19L 4GKSB 2WAGA 1ZSXA 4ZXBC 3NSYA 3D2UB 1MZHA 2NDFA 1V7AA 3GB7A 2DV0A 2A99A 4MWAE 3MNWB 4AIZA 3NQEA 4J7RA 3KTXA 3INUL 1TKKA 3LMZA 3QNXB 4FFYL 2BJML 3TN0C 2OSLA 4YJ5A 3B8WA 3BESR 1Q9WA 5HYSG 1FL6B 5T1DL 1KIRA 3WLBA 3OZKA 4PRBB 1GZPB 3EXSA 5AYIA 1H5BA 4HLZH 2W3ZA 3UAJA 1X39A 2PLTA 1GYAA 5IROC 3OZ9H 5IJVB 3QHFL 2ZXDA 4L9YA 4XCYA 1GYLA 4U6YB 4AENB 1TO3A 4WHBA 1RPUA 2VH5H 1HN1A 3BJFA 4J27A 2CERA 3BCDA 2V4LA 3CWHA 3PK7A 5MEND 1XRTA 5F9WB 2ZPKL 3LNEA 1B88A 3ZE0E 1H61A 2KZ1B 3B3IB 2IPTH 2KYIA 5B38G 4JKPH 4HA1A 1BZ7B 1T83A 4HHAA 3WFBH 5F8QC 3D30A 4QAMB 3ARBC 4LALA 4PB0L 2OTPA 4AEIL 1ONWA 4QJ1A 4AYDC 3RILA 3O6FB 3L3HA 2BX7A 5BMWA 4PGEB 4XZIA 5ANMB 4PWIA 1CFMA 1Q9KB 2NYZA 5CGMA 4W6YB 4D9QE 5I26A 3SFKA 3CFDB 4IKKA 1WA0X 4MVBC 3C8HA 2IBBA 1MCEA 4QRRD 5I74C 4G1KA 4LLYA 3EGXA 3U4KA 3AIQA 4CGUB 3I50L 2HFEB 4IDLA 4PUUA 2J62A 2AXGA 1PKMA 2WLLB 3KPRA 3VTTA 5FA3A 5BUGA 1QKZH 1BEUA 4U2ZA 3TIDA 4MSWA 3STZA 3ETTA 2HTKD 3SCQA 1DSFL 2W91A 3IXAB 4GI8A 3O3BA 1VJSA 4D0BB 4QR6A 1AHKA 1A6PA 2BFGA 4LVOC 1ADSA 2GK0B 1URIA 2BK8A 1OF2A 4PB9H 3ARYA 2VFDA 3HGSA 3R12A 1T1XB 2BC4B 2BP8B 1UXMA 2DQIL 4LIQL 4BZ2H 5JHLA 1CL7L 1HYSD 2XG5B 3H26A 6REQB 4EDXA 5IBXC 1OP9A 2ILLA 4NZRH 3H9ZA 2ZXAA 5HYJD 1XYCA 5KSBE 1MCCA 2EIZA 4DGYL 4GW1B 2JB5H 1UOLA 3K5SA 1W5NA 1U8JB 3QXDA 1DJSA 3L5LA 4JNMA 4Q9RL 4MLRA 3WLHA 1ZLSL 2L4OA 5CCZA 2H2PD 2ZDRA 3TWCL 5JQ6L 5KAQG 2ZCZA 3FCBA 5MERB 4AW7A 3EOBA 1HDMA 1WICA 1D9EA 3F7VA 4ZW8A 1S7QB 3DFSA 4ODTL 3O2LA 3GSXA 4FX8A 4ADSA 2ZX7A 4OD2A 2NXIA 4FA3A 3QIBD 4RGMC 5IQ7L 1IWBA 3UCDA 4QS6A 3EIFA 2PYEE 1BZ9A 1ROWA 1ICSA 1TYEB 4HQQH 1GHSA 4JLRB 5BW7A 4HVBA 4FXGB 1NFDB 1S7UA 1QI0A 4QTHB 3DIPA 3CUXA 1OT2A 2F8OA 4I5BA 4LVGA 1EF3A 4WK2B 4CU7A 3MQIA 4WV1A 1CURA 2EGZA 5CJ5A 1QPXA 4FYTA 3SY1A 3PGCA 1O5PA 1RERA 4DF9A 1TA3B 3MYOA 1D9KB 4J35A 2IKJA 1HS6A 3DRTB 4HLJA 3EKZA 3USBA 3NACH 1CCZA 5F9JB 5C0JB 1B90A 3L3GA 2WQAA 4FIRA 1U1UA 2Z4GA 1ALDA 5EUOE 2VO8A 3L48A 3SPVB 1JXFA 2GSIA 1QDSA 2VLRA 2VAAB 1IF2A 2B3IA 1RBLA 2DSVA 3SCMA 2F1EA 3EEZA 1HCVA 4HBCL 4XOAA 4WHTA 1JRBA 2VC5A 3LHZA 1CXFA 1KCVL 4YSAA 2ADGA 2O5XH 4QYOA 5DMJB 3Q8BA 3SBWA 5J8LA 2FYYA 1BVWA 2BSTB 1OD0A 4MFEA 3ECQA 4PBXA 3ZDZF 3QZWA 4Y5VC 1S5VA 1VSCA 4M43L 5FEZA 1DXEA 5JIHA 1LROA 1TVHB 2VXSH 1MVUB 3MJ8B 4KNQA 1LNUA 1ITXA 2OWXA 2HWZH 2JIXD 3QF0A 3CDYA 3EYSL 3BRDA 3X14A 4ZPTB 1TU2A 5ENWB 3D8MA 3MODH 5K9OA 3DMMD 3UDWA 1J0ZA 3FSWA 4HDIA 1XGTA 2QMKA 2OM5A 4LUIA 3UYOD 2QGCA 1QACA 1GC1H 3WD4A 1KBGL 3BICA 4AOFA 5HI5D 3L9YA 1DN2A 2PGFA 3IJQA 1EK3A 1IM3D 3UVAA 2ZWYA 2IMRA 3V6ZB 5BXFA 4AMKH 4ADIA 5C0AB 4BA0A 5LXVA 2PW1A 5EOQH 5BUPA 1N82A 1HH9B 4B9FA 1PWLA 3SN1A 3S37H 3UNTA 4V27A 2D7QA 3WIIH 3V75A 3U36A 3QZLA 3WXVH 3N91A 5CUSL 3GQYA 3U0WH 4UB0L 4ECNA 3FTGB 1RP9A 1QOXA 1MEHA 1HL2A 1UWFA 3IFNH 3UNDA 3LEXB 2JWYA 5CNHA 3W74A 4D6GA 3NZHH 3K2IA 3ZJ6A 1V3KA 1OCWL 3EUDA 4A2EA 4CQ8A 1W91A 3HKZA 2AMXA 4C91A 4U0QB 3IJDA 2ANUA 3QPZA 1HJWA 3SRFA 4JFXA 3D39D 3KOXA 5TQ2L 4LS2A 1Q6FA 4YUEH 2R8SH 3P2DA 2QT3A 3W75A 3UJSA 1G7JB 2ZAIA 5KZCB 4LL1A 4IJTA 2R23B 1I1YA 2CR3A 3TN0B 3MACL 1EGZA 5T3ZD 3PG8A 4XE0A 2FX7H 4HIXH 5C6PB 4J39A 4PJ9B 3KYNB 1U3ZA 4HMNA 3QZWG 1TWIA 1C7TA 2NSOA 1JD7A 3EFOB 5ICXB 4LEEA 3L5IA 2GJLA 4YDZA 5DJCA 2FKPA 4GRWE 1I7RB 4O5LL 4V2XA 1Q8AA 3PP3H 4BFNA 4U7SA 5D32A 1UOKA 3CFUA 3DFQA 3QH2A 3VUAA 1HO4A 3Q2DA 2TRHA 2ZA1A 1HSBA 3LAFA 3HAEH 4OF5A 4LYKA 2PYFA 4D1IA 1W8EA 1HESA 2K6YA 4QT5B 4PL1A 2F5BL 1UGNA 4LL4A 3E1ZA 3GM0A 1HJUA 2R69L 2XXFA 1NANH 2VHLA 5LGYA 4I9XA 2UBPC 1BVKB 1HKLH 2CWXA 4MX7A 3MLZL 3ULUH 1MCRA 1FCQA 2E27H 2HRPL 5CMAB 4Z0BH 1T03L 4JM2B 4M7JH 2IXQA 2IQ9H 2JTYA 1JCXA 5FKAA 4NENB 2I27N 1TEFA 3TXVA 4YFLI 2VERA 1YMME 4LAOA 3MUHL 5SX5K 4E8GA 4AT6A 3ABLB 4N2HA 1OX5A 1JZ8A 1CGVA 5DC2A 4QJ4B 3URBA 3VX1A 3QULA 4DXKA 5MF5A 4O12A 2WZEA 4AHOA 3QUML 4MS8D 4GMEA 1QWKA 2IADB 5T91A 2Z8VC 1OG0A 4PTUB 4X6DB 3BO8A 3SE4A 3WIHA 1I1CA 3IYLW 4PLJC 2DQXA 3KMDA 1FWGC 4KCTA 4XNZB 3BSZH 2ZZ2A 3ZTEA 3PJNA 5HGAA 2HJKB 2X9ZA 1M7PA 3PAJA 3MMDA 3NDZA 3ORWA 4RIRB 4LVOB 3ZUCA 3RO8A 2EDDA 4P7NA 2ACRA 3G6DH 2AQ3A 1EFXA 4UMGA 1UG9A 1P7QB 4DIAA 2OTUA 3P74A 2ED8A 6FABL 4L2YA 1BQUA 3HI5H 3L17A 1R3LA 3GBDA 4QAIA 1U41A 3BGFC 2AL2A 1NBYA 1BXAA 2OT0A 2HT4D 4C47A 3IDJB 3S3BB 1AANA 5C9UA 1CFSB 4KH9A 1UZHA 3SZ6A 2CUAA 4F7PA 3C6LD 1OAUH 3V4PL 3TBSB 4FQXD 1PKYA 4KTDL 1AK5A 2Q8AH 3F12A 2OMVB 4UQ9A 3GD6A 1OM3H 2FT8A 1XG3A 3SCSA 4P4KC 3D50A 1RIUH 5ANME 3DARA 3NZ8A 3GO1H 2PZ0A 3LKRB 5GGTH 2DZSA 2NQLA 1NC2B 4RGMB 3BUYB 3TVMD 5CC7A 3A6BL 4UINH 2OI9C 1OHQA 1I1RA 3P82A 5FWQA 3JTTB 1Q8MA 4G83A 1U8OA 3CBKB 1VERA 4BFFA 4TSAL 4DPBX 1BMGA 3FCUB 1DIDA 3QEZA 3UERA 4QTFA 4GAJH 3WNNA 3V0AC 1JJUA 4X4MA 3ZJ7A 4MJIE 2RHEA 5BV7H 3MR9B 1FDJA 4LHUA 3JWDL 4GNJA 4PLKD 3UBFA 3TC6A 5DK2A 3FO9A 1PQZB 3A23A 4BK8A 1IEBB 1SM3L 3ULSB 3ULVD 4K3DL 1F4AA 1A3ZA 2PTZA 2YPLB 2GIYA 2BVTA 3RVXC 1CD8A 4W7UA 5DXYA 1ZSHA 3EAKA 3AIUA 1BPLB 1D5ZA 4QXGL 4L37A 5GGQH 1NCGA 1I8UA 2R29H 4UMCA 4F9PC 1OCBA 2FWOB 4FEIA 4GT0A 1A3LH 3UZQB 5I0WA 1ET8A 1HH6A 5KVFL 3UZWA 5FA4A 1BYAA 3U2EA 4AKOA 3N6YA 3GLDA 4M8QB 2H4EA 1L9MA 4OFYD 2PD5A 4Q97A 5DEJA 1HE8A 3SHSA 5AYQA 2AV1A 2MCMA 4JD4A 1HJXA 3B8YA 5L0QC 3OHMB 4KAQH 3ZLHA 4NJHA 4DK5A 1OAZH 2IH3A 3GQFA 3PAVA 1O5XA 4P2AA 1BG9A 4DM1A 1FDZA 3GI9H 4ORGA 4Y5XB 1WDWA 2P80D 3FYIB 1A2YB 3S35H 4N0CD 1S6NA 4K1WA 4UI2A 2X70B 4LZKA 4MNGA 5E6UB 4JG0L 5AUMA 1JF5A 4N2OA 1BWKA 3IGHX 3CMFA 1U3HB 2ICEC 3F65A 5I1EL 2GY5A 1WFIA 1NFDE 5BO1H 4HA3A 5E6IC 2Q8XA 3VFRB 4UT9H 4NS0A 3N55A 3Q8EA 3HR5A 4WI2A 1WHOA 2KLSA 3GIZH 1JFHA 3F64A 2G5UA 3N0PB 5I1CL 1E65A 4YOKA 3N50A 4NQDD 4QDMA 3BTNA 3AXHA 3ABXA 4ELKB 4DCQA 5KJ4A 3P7YA 5IFHH 4BWLC 1ROCA 1P4IH 1RFDH 4NQEE 4ZQNA 3QAZC 1XIIA 2RKXA 4F80A 2MQCA 4GYJA 2ZKYA 4I87A 3A9BA 2INZA 2BHFA 4LHUG 1OC5A 3LV5A 2BXYA 4WSKA 4K9EH 4ZTEA 4WGVB 4IHOB 4HS3B 4A3UA 3G8RA 2IJ0C 4BD4A 3ZZ1A 3UYRL 2C0AA 4X22A 2HT3D 3T42A 2A3TA 1FHDA 1RZFL 3BD5A 5AZEH 2KZBA 5CSBA 1WBYB 4BHUA 2CBOA 2GYIA 1KM6A 3O6LH 1I8IA 3VFSB 5DCBA 4P7QA 2ZRXA 4HJEA 3ZDZB 2JKWA 3EJYC 3FQXA 5G4NA 4QGYA 3KVPA 5F44A 1WCBA 1KCUL 1IIIA 4W1TA 4U1JA 4DZ8B 3GMOA 4BQ2A 1EZVX 3DDGA 5ANHA 4KGJA 1OEPA 4NDMA 5I1KH 1G4EA 4X9HA 2CALA 2OMNA 1MRFH 1E0VA 3W0WB 5DBTA 4Z1DA 3OGCB 4NFDA 3M0YA 3K2KA 4TO8A 3GG0A 3B5TA 3WUWA 2WMHA 2VDRH 5E09A 4RZ4A 2E9WA 2I24N 4Q9CA 2FMOA 5BVJB 3PQYB 1TLMA 2PRLA 4RNFA 4ZTOL 3HTLX 4A8IA 4PJBF 3HE7A 2WWMD 4WHYH 3ZL1A 1JCJA 3EJZD 4UTWA 3N9GH 4N2YA 3I9AA 5C0AE 2XZ7A 1KY7A 1SJAA 3V35A 5AVSB 3QFEA 1C1EH 4FJYA 1VGKA 3X11B 1UD6A 4A37A 3SCNA 2OLDA 4ICWA 3NM3A 4AI7A 3DVNB 3GWJA 5GISL 1QNZH 2WXLA 4NGHH 1QZ1A 5I24A 3B7TA 4NNXB 1D2OA 3HZYB 2AJUH 4MWAC 3MRRB 3ZL4L 4O0ZA 1DQVA 2PCPB 4PEEA 1EHAA 5IB4A 1PX3A 3SN6N 3MUZ1 1HHJA 2V30A 4XXWC 4KXZI 4OQTH 4WIQA 2ENJA 2KDYA 4RFEB 3ULVH 1M3UA 3OKEB 2A1WL 2G9HB 1S2WA 3QUXD 1IL1A 1MFVA 1BWLA 3UYCA 3UJFA 1XI3A 2VDPL 4J4PC 1L6ZA 2EC9T 4G6CA 2F9BT 2XVBA 3FDGA 4JDYA 3VRIB 3QZ6A 1QTWA 3VWJC 3N2XA 4PWHA 4IZGA 5MP6H 5CC6A 4OGAD 4JIIX 3BVWA 2MSPA 2IDCA 4N9GA 3PAUA 3SY5A 1KNWA 2G5BA 1U8HA 1TUXA 4PUDA 4N25A 3HGJA 4JUTA 3CXDH 4PRNB 5HUPA 5E2UH 3BGFB 5LDUA 5ICUA 1F3RB 3FJLA 4NM8H 4XZUA 4Z7UE 1TETL 3WUWG 2QGBA 3UTPD 5E9AA 1MI5E 1C8PA 2BIOA 2BIIA 3U7WH 3SKJH 1FCGA 2L7QA 4UR7A 3URAA 3RWDA 5I6OA 4LSUL 4GI4A 4JDEB 1FZMA 1BIIA 3UJTL 1D6VL 5J5DA 2YEQA 4M62H 3T8MA 2O9TA 4FADA 2VYOA 4JRYA 4AJVA 4P4KB 2MPVA 5EZLB 1NSJA 1NP2A 3TZNA 5BVPL 5KVGH 5DZOA 4DZBB 1MWAL 1R33A 1J1XL 5D93C 3QXAB 3PY2A 4WW2C 4XP4L 5D7LD 3FJTA 2A6KB 4K5NA 4XZBA 3W7OA 2Q76A 3L4CA 1QNQA 1NMCC 2EAEA 1UR8A 1DUYB 1CZ1A 2YBGA 1OK4A 3MBDA 3MOBH 4OGXL 3WS3A 3OZMA 4P46A 4IRJC 3F7PC 1F4YH 3IJSA 5DRNA 3V4VH 3ITCA 4S3JA 4NT6B 1EDHA 1SY6A 1B4LA 2NQCA 3HG1A 2CKBB 2YBVA 3GFXA 1SXAA 4TVPL 1GPOH 2NV2A 3NVTA 1B9BA 4ZJ9A 2RIKA 5MHSE 4XOCA 1RHCA 4LCVA 5JW5B 1OT4A 1JDAA 4DJFA 3SDYL 1OZQA 3RYSA 1M71B 1EXHA 4I3SH 5IJKA 1INQA 4OJCA 3SUSA 1A7QH 1SJEA 4M5TA 1MFEL 4PRID 1LGVA 4K68A 4YHNB 4BI7A 1HEHC 1AY1L 1COBA 2Z4QA 2DH3A 3S6TA 4JQIA 3O4OC 3NPZB 3LLFA 4DNMA 2XN1A 5J57B 1AQ0A 1EEPA 2GIMA 2VDKB 2QSVA 1TYRA 3QQ4B 3L2IA 4PTDA 4WEBL 1UMLA 3KYKL 5AVVB 1BYPA 3PWPD 4AV5A 4A2LA 5JNYA 4YHGA 1G43A 2OEKA 1EP2A 5AYXA 2WZTA 1TJGH 2XWBA 2XFWA 3RAJH 3BVJA 3K2UH 4UWMA 3ILPA 3OF6D 4P5TD 2Y7OA 3MO1A 4OJFH 5JYLA 4L1SA 1LWIA 5I8OL 4PJ8A 4XMPH 3D3VB 5HHQA 2X2YA 1B3JA 4NZTL 3MBXL 5K9DA 1BZ8A 3QEGH 1ITUA 2Z93B 3ANYA 3RRQA 1Q9OB 1PEWA 4M3PA 1TWDA 1HHHA 3IIPA 5K9JH 4ZYKB 1UXSB 1G9NL 1H9DA 1PPIA 1NGXA 3IV8A 3PUGA 3I3BA 1MCOL 3LCXA 1ZK5A 4L23A 3MW7A 4XODA 1YNLL 1D7KA 2OLHA 1CX9A 2FLBT 5ES4B 3DOSA 4FA8A 1WT5A 4AZ7A 4O00A 3VJ6B 1PIFA 4BK9A 2XIJA 3NP3A 1N2RA 4NJAL 2VXTH 4YFDB 3MJMA 1GVEA 2Y3NA 3QAZB 4Q52A 3P3UA 1YLVA 2YPLE 3RWHA 4UOW0 2JVUA 3LKPA 4H00A 1NTHA 4ZZFA 3F83A 5ACZA 1NCJA 1VPOL 1H7OA 2FTAA 3VD2A 1TPEA 2NUPA 1AL8A 4OCMC 3TBYB 3AWFA 2VXQA 1G6RA 3E96A 2RALA 5JA9A 1JI2A 3MRHB 5HUOA 2DAVA 1U8PA 3I65A 4FTVB 4XD5A 1BBJA 4ELMA 4P4RA 4Y4FA 4N0YH 4WWOA 4L8CA 2HNEA 2V7HB 4GSXA 2WYTA 3VM5A 1YTEA 3L3KB 4L29B 3TU6A 2AP2A 3BSHA 1SZRA 3AT9A 3Q2WA 5I1GL 4G9DA 2NT1A 3GMPA 5FGCB 1OFDA 4UFKA 4QXVA 2LFGA 2JGYA 3QJVB 3IDUA 4D6FA 1E28A 2AW2A 2PDIA 2VQ1B 3WUEA 5KUKA 2YARA 3W84A 1FWBC 3VE0A 1XLMA 3OJMB 2J4GA 3ARDD 1N6UA 3ITXA 5TK2A 2UZ9A 2GI0A 3PV7A 1QNPA 1H8OA 5DVMA 4OB5L 3OPZL 3UWYA 4TM9A 2NY0D 1KPRB 3KWWA 1IGTB 4ANUA 3B37A 1OTUC 4XCEA 2WJFA 2G9KA 3UA3A 3F04A 4ONGL 4AQ8A 3OXRA 4IPJA 2X7LB 2M2DA 4ZUUB 1QRND 5EB8A 5I75B 3WO3B 1OSPH 2F53B 4JN7A 2ZKWA 3EOUA 1ZDQA 3EDJA 2BIPA 1JRCA 1AQKH 2VZ3A 3W38A 2B4CC 4H7VA 1UB5A 3VI3F 1R3HA 4C90A 3BHBB 4NNPL 1MCKA 4HK3J 1E15A 3UJJL 3FBKA 2QVIA 4HSOA 1DEEA 4GAYA 4O02B 3NQAA 1DJHA 2Y5SA 2WOBA 4F91B 2HLAA 1I3VA 5C2XA 4JKWA 1J5SA 2OKMA 5D1ZB 5DS8A 4LUTB 3IDIB 3NL2A 4MA1C 3ZDZE 5HHPB 3ZO0A 3HRZB 5AW9B 1HINH 4FQIH 3A4JA 1QPQA 4PMXA 2F6AA 1CFVH 4UQ3A 1AO7D 3AJXA 2I9UA 4MNKA 2WCGA 4BZ1L 3CFKB 5JA8B 4HIJA 3IS4A 2COQA 2VMFA 3QCVL 4BDVA 3B3DA 3UWWA 3HQOA 2P47B 3N42F 4PH8A 5IMLA 4K5LA 5EC1A 2GVEA 4S2SA 5GRWA 3GHPA 3VWJB 4GQGA 4ADUA 4LY4A 4AIXA 1NGZA 4J3UA 2P8PB 2BSBA 4HCRA 1YXYA 1DCEA 3N85H 1GMEA 3V5DB 1ICPA 3MLWL 2DQWA 2WANA 1THFD 5J12C 3CO8A 4YHOH 1X5XA 3CZFA 1NDMA 4FERA 4FABH 1A7NH 1JGUH 1CDUA 2AQNA 4PJBB 5JBEA 5C7XH 2O6FA 3CE1A 1NQBA 2Z91A 5DUPH 4GW5A 1WFOA 4NKMA 1BVNT 2PPFA 4ORZC 4V28A 4MZ2A 3BZ5A 3DIVA 3O41A 4JPVH 5DVLA 4H8QA 2EPLX 2LLGA 1OP3H 3DRQA 4AMCA 1BQ5A 1WRFA 5L2KA 3D48R 4PA8A 4MD4A 3WEMA 1UD2A 5M03A 2A5HA 3R18A 5TDPB 4ANWA 3XINA 5FYLE 4WKZB 2QGHA 4B3KA 4MOZA 4IQDA 3RZCB 3T0DA 4YN5A 1NMCB 4Z7VF 4S2BA 4Z1PA 4S1RH 5I8EA 3RLHA 1X4ZA 1P7KB 1CICC 4FQJH 2IXVA 5AQ0A 4W5ZA 2D7TL 1AMKA 3IAPA 4C4UA 3VXRB 5EC2A 2C1IA 1VCBC 4W6XB 1PCXA 2WNKA 3QCUL 1XYLA 1IT9H 4OLVL 1VPXA 1JHLL 3TM6A 1E5UI 1R75A 2OG9A 2E3VA 5L4FA 3GBNH 1ZNNA 1JVOA 2EYSA 4H9UA 4KEMA 5F9WC 2HISA 4N5UA 4GUPA 5J4MA 3SE3C 2VR4A 3V18A 4R7NB 2ADYA 1C9WA 1E4HA 4ODXB 5DJDB 4XB8A 3QISA 3O4OB 2FFIA 5JPMA 5FHBH 3SGDI 3NSCA 5LNUA 4KHXH 2J72A 4NBXB 2FPTA 3W1MA 4UIOA 4C7DA 3U5UA 5EMLA 5BW6A 1UJTA 2AXFA 4OVXA 3O6FC 4H4IA 4XTRC 3TEWA 5DMKB 3ES8A 3HNSL 3GSNL 2F8VA 2NYYC 2X4PB 4GUGA 1CXIA 3E6FA 4GIRA 5EU3B 3RZWA 1ZDSA 3QXWA 4Z78B 2OTWA 2YBTA 4ZE4A 5AZ1A 5I17B 4LTSA 1XBYA 4MJ5A 2WY3B 2BSSA 2C7FA 4F37F 3VDCA 3F4VA 3SO3C 1QABA 3VQMA 1FA2A 1TB3A 1OWQA 4ODWB 4BFEA 4DPAX 1QLEH 5EO1A 4BWWA 4MA8H 1ZAGA 5FM4A 1NL0L 5F3FA 3S34H 1AKJD 2W9LA 2BVWA 3MGTB 3H85A 5EORH 3UAAA 3QORD 3HMXA 5I6XC 3P4NB 3QHMA 4XVJL 1LYXA 1PF3A 4KNUA 1JCNA 5JQIB 2Y07H 4M02A 3QQNA 1V7YA 4NRXA 2ZUTA 1I7ZB 1JXKA 2J12B 4WWID 4IIDA 3B7UX 5CAYB 2WZ5A 3JWOL 2YEZA 4P23B 4YHEA 3LN9A 2NR6D 2ZUVA 4BF5A 3LS5L 3B0VC 5ENLA 4YAQB 2WHLA 2NCMA 3QIUB 3PZUA 1XEUA 1ED3A 4ZCWA 3GXPA 3FX4A 5D7JB 1FBAA 4JN2A 5CD5D 1S38A 3PJXA 3VD3A 4RZCA 5FO7B 3TS8A 5H37A 1GQJA 4F2MA 1NBZB 4DQOH 1IC4L 2X38A 4GH3A 3P6LA 1U2CA 3RGTA 2DZEA 1ENUA 1BQHB 2VUKA 4LGXA 1QAPA 3KDNA 3I6LE 1RZJL 2VC2L 3OP2A 4TTUA 1S9XB 4FLRA 3QBTB 3QHNA 3P11L 2CIIB 2F6UA 2B0SL 1F1AA 1R3JA 4B53A 3X12A 4ACZA 3GS7A 4RDYA 4LSTH 2KPNA 1CS6A 3RWJA 4NAMA 1OGTA 4P2RA 3H4XA 4LLMB 5GRXG 2R1YB 5LA0A 3D3VE 4NFBA 5DK0A 4F57H 7FABL 4U3SB 1J0YA 3IGSA 3M44A 2DYPD 3A67H 1DFXA 1M7XA 4P9HL 3HZKB 3CFEA 3JZ7A 2I85A 2B7NA 2Z2AA 3TYUA 2G97A 3O6DA 1JN6B 3M0HA 1MREH 3W9DB 4H9XA 2X40A 3GNXA 3L9BA 4GKNA 5LBGA 1E9LA 3F7YA 2H26A 2EH7L 3WY4A 4OBSA 4GUOA 1F1DA 3AHVA 3EYOA 3UCCA 2GJRA 3NQMA 2NY5H 3HUJA 5ID1B 2DEYX 4FZEH 1A6UL 3GJFA 1I0BA 5MKGB 1KGCE 2W0KA 4NZUH 4MAYD 1EZVY 3GIVB 1K9FA 4LKCB 3HS9A 4AIOA 1VHCA 3GFYA 3P9LB 4O8RA 5F6HJ 1EEQA 1GW6A 1JWMB 5EWIH 4LAZA 4WUUA 3CCHB 3ZDXF 3RNKB 3T3MF 1SJHB 1G0DA 3DX8B 4WY0B 5CLTA 4ECLA 2CLVA 4BELD 4Q0XH 2WVTA 3WUZA 2FBRA 3MOAL 3IIXA 4Z7WA 1M7IB 3GTVA 4FTVE 4IMAA 4XP6L 2L0DA 4LAKA 4NJKA 4TUKL 2LV4A 1TQXA 3VXOB 1RAKA 2AKRB 2GYSA 3FU3A 2PMQA 4YZFF 3DVGA 4HUMB 2QUMA 4MA1B 2WHKA 4UOQA 4V2CB 1W1TA 4EZJA 3M43A 2VIRB 5H37G 4MB3A 1UJPA 3Q2LA 2C13A 1IGMH 1IFHH 5EN2A 2PSNA 3MRCA 4NXKA 5JORB 4J2XA 4Y4KA 2DZWA 1A4AA 4GRWB 2Z0IA 5AAMA 1V05A 1J01A 3IVKA 4GEJA 1O6SA 5FGCE 3ZMNA 1LL7A 3C5ZC 3P0YH 1CT5A 1OX4A 5LSMA 2VNCA 3QUYA 5CPNA 1MWOA 3EOAA 3QNYA 5I71B 4K8RL 4Y19D 1LQ2A 3KXQA 4HSQA 4BGLA 1XYFA 5J12B 4R5TA 3II3A 1VP5A 5D70H 3D25B 5J6SA 1FNEB 1PNCA 3LSBA 3WLIA 4POYA 1TE6A 2G75B 2OXGA 2LE9A 1FPTL 1ZFJA 1A6VH 2WMIA 3KYMA 3MSPA 4E3VA 4HUXB 5F21B 2F53E 4AG4L 2AANA 4F24A 1KYFA 2XINA 4QXUH 1YMMB 4NWTL 1ZB5A 4IQLA 4POZC 2MCPL 4TN9A 4AQOA 1L0YA 1I8LC 2EDTA 3A6CH 1M4KA 1ZUAX 1P5VB 7REQA 2O5ZH 4O11A 4F2TA 5JXED 3MO7A 3K71B 2QKFA 4R88A 1EJ7L 4XO7A 1F58H 1UH3A 2Z26A 3ZT7A 5JR1H 4JANA 4E9QA 3FQ2A 3MBED 4IOIB 2Z9TA 3OJDB 5LIKX 1S8DA 1CICB 1BOYA 4NBYB 3AIVA 2ZSWA 2K6ZA 4QLJA 1I8MB 3UAEA 2WUBL 4PJ9C 3RN6A 2COVD 1AQMA 4YHPB 3PZ9A 3X1NA 2QVFB 1FWRA 4LSVH 5C9ZA 4XBEL 3LI1A 3G6JF 4OV6F 4CAGA 4FFWD 1SDAB 5FK9B 1ND0B 3I3EA 3WFCL 3LNPA 5EEYA 1KC5L 5HYFA 4UZGA 4GRLA 2H0FA 2PDNA 1H6UA 3U2SB 1JG9A 1OQXA 4D3CL 1N6VA 4QTGA 4P3WA 5HA7A 1JCKA 2EHHA 2ODIA 3PTMA 2NUTA 2Q20A 4B2DD 4PJBE 5J1SC 1UWGL 3MGOB 3M1OA 1OAQH 1JDFA 4JM2C 2QLVB 4ZBJA 2QQKL 5IHBA 1X6UA 2EDLA 4KHTL 1C8YA 4DPQA 1A1NB 1QRKA 2Q3AA 2DLFH 3UC0H 5F9OL 3TT3L 2KDGA 4E4FA 1KD0A 5FO8B 5DMNA 2VLKD 5IB5B 5ESVB 1ZA6B 2YMOA 3EBVA 3BH9B 1MW3A 3VG0H 2DVUA 1SVDA 1T1ZA 2PWVA 4NQCA 2O4EA 3ULUF 3GNML 1O6TA 4X8CA 4XNZC 4UV4H 3DGBA 2BS9A 3SO3B 2FQDA 3S46A 4ZTPH 4MJIB 1VBRA 2Y89A 1U95B 5DHVA 4BE5A 1XWYA 2E67A 2TSYA 3M5YA 2K7QA 1FLTX 3VXRE 4AM0A 5EF0A 3O11A 5I6XB 1PFCA 2J6EL 2QXWA 1KJ2L 1T5WA 3OKYA 4DGVL 4H0IA 5IHLB 4QCIB 5I2UA 1CTOA 3ROOB 4ZXBA 4F9LA 3AXLB 2C14A 1EERB 1TDQA 3G08B 2DQGL 1HIML 4TSCH 1LMKA 4LNYA 2VCAA 2VDLL 4UTBA 1W9VA 3EH3B 1V3MA 1ZS8B 5GS0D 2PDMA 5HI4C 3SUUA 3TBCA 1GOGA 3K80A 5A6TC 1UPPA 1TCMA 5IQNA 1QR4A 2R1PA 2CCWA 4IEFB 1YQVL 1KV5A 2VD9A 2VRKA 4ZMQA 5IROA 2CZDA 2JF6A 4XH2A 1QYGH 3X3FH 5C08D 2PWUA 3CN2A 1R3VA 4XZ9A 1BM7A 3GHEH 1W1A1 1D5IH 4G7EB 1EFQA 1U93B 2DQDH 1G4MA 4C4KT 3E0WA 2D2CC 2FIKA 3GI8H 3W01A 4DXVA 1P69B 1OFQA 1HF6A 3GXFA 2ZAGA 1WEJL 4XO3A 4H6KA 2WKGA 1WBXB 4LEBA 4XMVA 1CE1L 2VN3A 3RDTA 1XF2A 1MEXL 3BEVB 4JO2L 2J71A 3TZVD 4WU7A 5GNXA 1IUZA 2ZIDA 3ARBA 2GSGA 2OT1A 2R2EA 3Q2NA 2D2GA 3QG6A 1AW5A 3D4CA 4NQEB 5I82A 1E9QB 3SJVA 5JZ7D 2MPAL 5KG9B 3HTWA