1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords ALPHA-AMYLASE
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
3RM8A 2QPUA 3LRMA 2XTKA 4CN1A 3ZSSA 1JG9A 1L0PA 4YHEA 5IXEA 3RM4A 4HPHA 2VZTA 4JHZA 1SMAA 3NIYA 1PX3A 2EXOA 3WEMA 3CUFA 1B9ZA 2VRQA 1XYZA 4K68A 1EDTA 2VZVA 2VZOA 1W91A 3BLBA 5BROA 4YN5A 1DWGM 1LQ0A 3G6MA 2YDQA 4QCEA 5DO8A 3WEZA 4P7NA 3K4DA 2J62A 4UQDA 3SUVA 4P8WA 1JYVA 2J25A 1VEMA 5D8WA 1GOMA 1I1XA 3CZ8A 2ZICA 1TR1A 4E8DA 2XWDA 3AIVA 1PBGA 2ZX5A 4W86A 1CECA 3IJ8A 4BS0A 2X0HA 4UNIA 3CZNA 1KWGA 3ECQA 2WB5A 1V02E 1ZBKA 2WANA 4MB3A 5FKYA 1UHVA 3AHZA 3U7BA 1W9UA 3VDAA 1SMDA 3EYPA 4MNLA 1EQCA 2A3HA 1AMYA 4P7QA 2VZSA 1QNSA 3MUY1 4J27A 4AW7A 4ZXLA 2HVMA 2XVNA 4IPNB 2XUCA 3PZUA 2WWDA 1A47A 3L4VA 3W82A 1R86A 3ALGA 1WDPA 5A6LA 2E0PA 1N82A 4OOUA 2XGIA 3GXDA 2XG9A 3WNPA 2D3NA 3RJYA 3WDJA 4IISA 3ZIZA 1UD4A 4H04A 4D71A 5I6SA 5A2CA 3NSMA 1CGTA 3VIOA 2VRJA 1OCQA 2Z1SA 5JUVA 3M07A 4P8UA 1Z32X 4ZEPA 3HG5A 5A8NA 4NSBA 3FAWA 4ACYA 1C92A 4W89A 4R5EA 4CU6A 5D9MA 5A6BA 1MWOA 5GQBA 3W27A 5A3HA 1R8LA 1ZS2A 2WVVB 3EMZA 1JAEA 1KBKA 4HMCA 5DFAA 3VTRA 2VO5A 3K8KA 2PBOA 2Y4SA 3G6LA 4W87A 2W63A 1E5NA 4JL2A 4S3KA 2BY3A 3ARWA 1UKSA 1FA2A 3OLDA 3BUBA 3ALFA 3RCNA 3ARTA 1HIZA 2O9OA 4AIOA 5JBDA 4C7DA 5I0DA 1HKMA 3EDKA 1RP8A 1E4LA 3W6LA 2VC9A 4D72A 1E56A 1UYQA 2JFEX 1DWHM 4AZIA 2B31A 3VINA 5GPRA 2MANA 1V02A 3CHEA 5JIWA 1QBAA 3EDDA 3HG3A 4TTUA 3UG3A 5ABHA 2OWWA 1MW3A 1QVBA 3MO4A 2VMFA 4WSJA 1NWUA 1XCXA 1UH3A 3DHUA 2VT0A 5LYRA 2XM1A 2XYLA 2DQXA 3VOCA 3CIVA 1V6WA 4V28A 2J77A 2VR4A 3VPLA 2WSPA 3ARPA 4D1JA 4LQ1A 1OBAA 2J4GA 2D73A 2VX6A 3VUPA 1C3FA 4XB3A 1MQRA 3CHCA 1EGZA 3MANA 1JZ5A 2BY2A 1TQWA 5F7UA 3QGVA 5CXPA 1GQJA 1VENA 2OYKA 1CBGA 1KFWA 2XHYA 4HA3A 4N42A 5DT5A 2Z1KA 1GHSA 3CHDA 5AC4A 3AHYA 4AIUA 4AEEA 4Z2KA 1XH1A 1UR9A 2ZXAA 2EPLX 1CXFA 2ZOXA 5CLTA 3VGHA 4UFLA 2WAGA 3THCA 5BXRA 2D23A 1D7FA 4FLQA 4QDMA 1YHTA 3BSGA 4A3YA 3AXIA 1J18A 3EJSA 1NM9A 2XPKA 1NQ6A 2DSZA 4OIFA 2A3EA 4J3WA 3VD5A 1WZAA 2BHYA 2CETA 2WWCA 5M17A 3VD4A 3RPMA 1OIFA 1GOOA 1WE5A 2V3GA 5I24A 3ZJ7A 3GBEA 1CXEA 1E73M 2UY2A 3BVVA 4BQ4A 4W88A 3RMEA 1B3XA 3B9EA 3VKKA 3GH4A 2W61A 2WHJA 1CGVA 4FLRA 1DWFM 3T08A 5A94A 4XX6A 3ARSA 5D4YA 3CBWA 5KZ6A 3KL5A 4EAMA 3EMCA 1TVNA 5BXPA 1QBBA 1VFFA 3POCA 3A6OA 2EQDA 2BY0A 1V0MA 3AXHA 3L4TA 4R27A 3PZ9A 1H2JA 4FNTA 3GDBA 2FH6A 1K9FA 2QLYA 2YDSA 4OOZA 3WMCA 4WK9A 3WUFA 4H41A 4KGLA 3AS2A 4L4OA 4UZSA 5A95A 1WAWA 3SCQA 3AIQA 1G94A 1HL9A 3RIKA 2E4TA 3BVUA 3N1AA 1B3ZA 5A6AA 2J7EA 3BAIA 1PPIA 1M01A 2W67A 2DH2A 1HJSA 2IGTA 2FGLA 3DX4A 5M5DA 5HDRA 3AROA 4AIEA 2CBIA 4WKFA 3QOMA 4DUWA 4AD3A 3WL0A 1QI2A 5D9OA 1OT2A 3AI0A 1WB0A 1PEZA 3W37A 1E6SM 2VRKA 3MMUA 2XWEA 4OBSA 2BFGA 4XV0A 5C71A 1V3IA 1XH2A 3LPOA 3HMCA 2CHNA 4WSKA 1BFNA 4FNSA 4AMWA 5FL1A 3BC9A 5TD4A 5IFTA 3N04A 1GONA 4PMDA 4DO5A 3VO0A 2J7BA 1UZ4A 3WENA 1WCGA 3K8LA 1VIWA 1HVXA 1W2VA 3WKZA 4AD5A 1JF6A 1DTUA 3UCQA 1LF1A 1W1YA 3POHA 5A8OA 4DO6A 1CDGA 1SYTA 5AYBA 2XJ7A 2OSXA 3WDHA 3U5UA 3VIIA 1XSJA 3BUPA 4H8UA 7TAAA 5A2BA 1UKPA 1JD7A 1ISWA 4J7RA 1HNYA 3LPPA 2QPSA 1EIBA 5DEZA 3AIEA 2FDMA 3SCWA 1MFUA 1UD2A 4PRWA 3TOPA 1JZ3A 3A22A 2YBUA 1H3GA 2AMGA 4PUDA 3GYCA 4IPLA 1BYBA 1IV8A 1CGUA 4L4PA 1BVNP 4PEEA 1TUXA 5ABFB 1HJVA 3OIHA 3D4ZA 3A47A 1XD1A 5FCZA 4MAZA 3VVGA 2F7PA 1J01A 3MS8A 1H0IA 2PI6A 5GNZA 3DHPA 4U2YA 3WMSA 4TOQA 3U57A 3FHAA 4URIA 2WNWA 3L4YA 3F4VA 2CYGA 1ZJBA 3K8MA 1WDRA 2G3MA 2JEQA 1MW0A 3AS0A 3VIGA 4Z2LA 4XZWA 1GOWA 4LX4A 2D3LA 3KLKA 4WKHA 1HJXA 2J8GA 3WF3A 4MDOA 3WQ6A 5LA1A 2VZUA 3RJXA 3PZQA 3M6DA 4J28A 1QI4A 1QWNA 3GH7A 1W1TA 4MB1A 3WY4A 1KBBA 1J0YA 3EDJA 2WYSA 3FNDA 3WQWA 2DT3A 2WM0A 3K46A 1LLOA 2PC8A 5I77A 4FLSA 1GUVA 2EBNA 5CGTA 1LJYA 1UASA 2FE0A 4AY1A 4MADA 1Q4NX 1GOIA 3H53A 4EE9A 1CWYA 1V0LA 3CMGA 4PMXA 2OWXA 4AZGA 1MQPA 1VFMA 3O2LA 4M80A 4UOZA 2V3EA 2WVSA 2YLLA 1LWJA 3CHFA 2OLHA 3OGVA 1QI5A 2YL5A 2VX5A 2VL4A 3H54A 2CCRA 3MMDA 1NWTA 1WO2A 2GK1B 4MJ4A 4WJXA 5A6SA 5LA2A 1WP6A 1EQPA 1HKKA 4JZ5A 4E4PA 2A3AA 2X2YA 1E55A 1M53A 1C8QA 1JD9A 1BGAA 1KCLA 3B9DA 1KGWA 1OIMA 1KWKA 3VSUA 2VCBA 4ZE5A 2JALA 3A23A 4FLOA 2JEPA 4MNJA 3A21A 3EJQA 1H1NA 3WY3A 3M46A 3AFBA 1JNDA 4NZJA 4GI8A 4PSRA 1NP0A 4PTWA 4UZUA 3L4ZA 2Y24A 4OUEA 1HL8A 2O9PA 1XV8A 3K1DA 4CD8A 2WLZA 4GO9A 5E70A 1QWUA 1VRXA 4W7VA 1GOQA 1IT0A 3EJUA 1E71M 1W3HA 3AMGA 3VIMA 1HWWA 2DIEA 3ZJ6A 4MTVA 4OZOA 4F79A 1K9EA 4PMUA 1EHNA 3RILA 4GI6A 2RGLA 4CCDA 2C8NA 3L4WA 1SFSA 3EJPA 1RD6A 2NSXA 4W85A 4AD4A 1KTBA 3HN3A 2Q8XA 1CGXA 4GQQA 2CITA 1L8NA 4FNPA 1V0NA 5HBFA 1Y7VA 3EBVA 4PMRA 1NP2A 1KXVA 5FL0A 2WMKA 1E0WA 1J12A 4UFHA 4B16A 4JKKA 2WMFA 3BVWA 1NOWA 4EK7A 5HXMA 1PIGA 2VX4A 1V08A 1RP9A 3KWXA 5DMYA 1U2YA 2G41A 4JFUA 3A24A 2D0FA 4PBGA 3AMKA 1QI0A 3LXBA 2WZEA 2WC7A 1HVQA 1TZ7A 5I79A 4PMOA 1D3CA 4FNRA 4DWSC 4KRTA 4H2CA 1FFQA 4MDPA 4TVUA 5BYWA 1J11A 3N18A 1HJQA 2HISA 1V3JA 5KEZA 1RH9A 3VIHA 4CUCA 3BUQA 2VUYA 5D9PA 3BVTA 2GFTA 4W7UA 1UA7A 3AMCA 3VD9A 2G8ZA 2F7QA 4NXSA 4N0RA 1CPUA 1K6AA 5I78A 1UR0A 1TCMA 3WFZA 3WQVA 3II1A 1W9DM 4HTYA 4GINA 4HU0A 3D50A 3IGUA 4AYSA 3T2QA 2VJXA 1E0XA 2WKGA 2WHMA 1FOBA 2FHFA 4M81A 4AMXA 1ODZA 3ARVA 1E5JA 2G3NA 2XIBA 2CKRA 1E6QM 3NDYA 5DF0A 3W28A 1BYAA 1I75A 1B0IA 1JF5A 2ZE0A 4PCSA 2W4XA 1PS3A 3D51A 1UWRA 3BUIA 3WDIA 1HF6A 4HU8A 3T0BA 2CPUA 8A3HA 3PZIA 1W3KA 3BLKA 1CGYA 2E9LA 1Q6FA 2DSVA 2YBTA 1JDAA 4D6FA 5D9NA 2J7HA 2WMJA 3AZRA 3VIFA 1CIUA 1FH9A 4JHOA 1MVYA 1R34A 5BCAA 3F5JA 5C70A 3MKKA 3WELA 3BGAA 6TAAA 3FHQA 1H0GA 4CU7A 1XYFA 4AWEA 4X0VA 4NZFA 3UERA 1CNVA 2WVVA 3EMQA 3ZM8A 3WH7A 3PZTA 4D6IA 3PZGA 1WDSA 1DEDA 4BF7A 1ISYA 2UY5A 1TVPA 5GNYA 1R7AA 3MUAA 5E0CA 1OD0A 1K9DA 3VX1A 5AC5A 2YA0A 3GXFA 2W62A 2QV4A 3I3BA 2X1IA 1ISZA 5CPQA 2E9BA 1J0ZA 2A3BA 5IHRA 4UCFA 3DX0A 5FIPA 4AZ5A 2V3FA 1UQYA 4W8BA 5CPSA 3PBGA 4CVWA 3WNMA 1R87A 3A4WA 3BH4A 4S3JA 2AOSA 3MU7A 4F9DA 1H5VA 3WFLA 2WCGA 4PCTA 3ARXA 4HPGA 1V6XA 1XSKA 2QF8A 3MI6A 1EOMA 1MW1A 4BQ3A 3D4YA 3FW6A 2VVNA 1JYNA 2G4FA 1GOKA 4M24A 2DIJA 3UG4A 1OGSA 2WC4A 2GDUA 2ZUVA 4GO8A 1JFXA 2D1ZA 3LPFA 1ITCA 2WCSA 3ZOAA 4B9ZA 3IAPA 1E6PA 1H11A 3S6TA 4MPKA 1R7OA 1ZBCA 3SCNA 3AISA 3DX3A 2J75A 4PYSA 3OLIA 1HKIA 1ZB5A 3W0KA 4LXFA 1HN1A 1V03A 3WQ4A 3BMVA 4V2XA 5A6JA 2YL6A 3TV8A 1C93A 1G01A 4GZJA 1J10A 3WNNA 2EPOA 3A5VA 1PAMA 4M56A 1GNXA 1DHKA 3GXNA 3A4AA 4U5IA 1MFVA 3OGRA 7A3HA 4PTMA 2ZXQA 3VX0A 5CSUA 4Y7EA 3T09A 4B15A 4GIAA 4F9JA 1C8YA 2XN2A 3N12A 5JBEA 1ISVA 3IANA 4D6JA 3ZR6A 4MJ2A 3MSGA 3VNZA 2WBGA 3VGBA 3F5LA 3JUGA 3W53A 4D6HA 5BWFA 1BAGA 2CXGA 2F2HA 2XFFA 2CESA 1GPFA 1UWSA 4AZCB 4TX8A 2VX7A 2DT1A 1Q6DA 1WZLA 1R85A 3OGSA 1TMQA 1UR2A 4FNQA 2J8FA 2F8QA 2CBJA 1QHZA 2VOTA 3VDBA 1WZKA 1JZ6A 1KGXA 1OGBA 5CSYA 3WBEA 1GVYA 4UFIA 4PMZA 4HOZA 3WEOA 4AZ6A 5DT7A 2YFNA 4AISA 1VEPA 2EO7A 3ZO9A 5HPCA 1XHGA 3OA5A 1HP4A 1B90A 3PZNA 3SCVA 2WPGA 3PTQA 4LYQA 2WSKA 3CZEA 4H8VA 3AICA 4AD0A 2D24A 4DWSA 4NF7A 3BUDA 1G0CA 3AOFA 5EB8A 4AZBA 2W66A 1UD6A 1EDQA 1E9LA 3VMPA 5AY7A 4CU8A 1E70M 1E1EA 4W8AA 2EADA 1HT6A 3VNYA 2C0HA 4UOJA 1EXPA 2CHOA 3ZMRA 1C8XA 5D8ZA 3CUIA 4M8UA 3KZSA 5A1AA 1JDCA 1MYRA 1BLIA 2GDVA 3TP4A 1CGWA 2WHKA 2YIHA 4HMDA 4ML4A 2BNJA 1JZ8A 2GJRA 1OWQA 1J9YA 3L4UA 4JFWA 1W1VA 2GJXB 1FH8A 3ARUA 4BQ5A 4BCEA 1LL7A 3TA9A 4QAWA 3PZVA 4W7WA 2RGMA 5BRPA 3OBAA 3DDGA 2YA2A 3BMWA 3L2MA 4MNMA 1E4MM 1JXJA 1BYCA 4UQEA 4TVCA 3WD3A 2XFRA 1B1YA 1V0KA 4QLKA 2ZX8A 1K9TA 2CBVA 1F4HA 3S5YA 2V5DA 3O9NA 2YOCA 1W3JA 3OB8A 2XIIA 1H09A 5CZKA 4NRRA 1KR1A 1ZBWA 2WMIB 2VR5A 4QLLA 2F7OA 5M3WA 1V6VA 4P7LA 1QW8A 3DDFA 4TUFA 4X9YA 5A6BD 4DM1A 3EDFA 1JZ7A 4MB4A 2WCAA 1QHPA 1X6NA 4D6EA 1V3LA 1TQTA 1OB0A 4PMNA 1BVZA 9CGTA 3AHXA 3NSNA 5EMYA 2JIWA 4B3LA 2XVLA 1P6WA 1TA3B 1EHAA 2D22A 2FHCA 4NI3A 2GVYA 3VSTA 3DYPA 3MMWA 2UY3A 1SZNA 3QHMA 4J3TA 1UUQA 1EH9A 3D52A 4Z2JA 4GXPA 5ABFA 4Z2GA 1VFOA 3CZSA 2BVYA 2E8ZA 1QI3A 1QNOA 1OINA 1DWJM 1EO5A 1KGUA 5ABGA 3AYRA 2ZXDA 3OLEA 2VQTA 2BS9A 4U3AA 1UR4A 1E6RA 2ZUMA 3AS3A 1AQHA 3TTOA 3HJEA 3VGEA 4HOWA 1UR1A 1HKJA 4B3KA 2ZUUA 5A2AA 4M1RA 2D0HA 2PBGA 3VIKA 3PHAA 3O6AA 3DYMA 4UQAA 2W92A 3WUGA 4MAVA 4P7RA 5EFDA 1WKYA 3AS1A 3AZSA 3GNPA 4CN4A 4IUGA 4WF7A 5JBFA 3H55A 3MUIA 1E3XA 2WMGA 3WH8A 3T0AA 2ALWA 3SCPA 2EPMX 2IXUA 2IUZA 2FGZA 5ECUA 3ARYA 1E6ZA 1QPKA 3TTYA 1FFRA 4QFUA 2WZHA 3N15A 1KXTA 2NT0A 1G1YA 2F18A 3D5HA 3VM7A 2QMJA 2EACA 2WZIA 1M03A 2BVTA 4LYPA 1ODUA 4OJYA 4FF5A 1W9XA 3VILA 4PMVA 3UG5A 2VCCA 5E0FA 3QOKA 4JFVA 4X0NA 3AQUA 1LL6A 1BF2A 1V3MA 3IJ7A 1C7SA 5A8PA 3OZPA 3SEPA 1J0JA 1GHRA 2PB1A 3SUTA 3NUKA 2DSWA 4JCLA 2OSYA 4DO4A 1LG2A 1YQ2A 4P8XA 2TAAA 1W9PA 4J3UA 4M29A 1DWIM 1XRVA 3W81A 2WC3A 2J79A 2WXDM 3KE0A 5A6KA 3PN8A 1BHGA 2ESCA 1UWTA 4GZEA 2DEPA 3WIJA 4DUVA 1G9HA 1J0HA 2WKLA 1IZKA 2DSUA 5ABEA 4UQBA 3BAWA 3WY1A 1XSIA 2XM2A 4J3XA 1KQYA 2Y2WA 3EJTA 1UD8A 3APGA 4UOQA 2XSBA 2Y8KA 1UH2A 3FXYA 3LXCA 4AD1A 1ECEA 2WMIA 1B3YA 3LMYA 3GXMA 3TONA 3CGTA 4U31A 5E6ZA 1KB3A 3DC0A 1TQUA 3SCRA 1HJWA 3LPGA 2UWFA 4JIEA 3BAYA 1E4IA 3WQ5A 1EA9C 3U5YA 4JCMA 1QNQA 3AIBA 2F1BA 2XSAA 4C7FA 2BXZA 4U3CA 1UZ1A 2AAAA 2F7RA 2GJXA 1AQ0A 6A3HA 1C7TA 2V3DA 2XVKA 3WNKA 5CJ5A 4H8HA 4BZYA 2QMKA 2BXYA 1B31A 4M82A 1B3VA 1CEOA 3DX2A 3IK2A 4OKDA 2XN0A 3ZJ8A 1GQKA 3ARRA 1F4AA 1JZ4A 2VCAA 3TTSA 3GXIA 3PTMA 3WUEA 3OG2A 2FH8A 1ISXA 3S5ZA 3IAQA 4HMEA 4ZXOA 1GVIA 1EO7A 2Y5EA 1KXHA 4UR9A 3AYSA 2D20A 3D3AA 3GXTA 4YHGA 1JAKA 3N11A 4AEFA 1CXIA 4D6DA 1JI2A 1TQSA 3F5KA 3VD3A 1E6XM 1U30A 1V6YA 1CLVA 2DH3A 4KRUA 3GXPA 1R46A 1BTCA 2F61A 4D1IA 2XFYA 2ZXBA 2A3CA 3WF0A 2J74A 1J0IA 1CTNA 3AJ7A 4GQRA 1XCWA 4W5UA 1BYDA 5HNNA 3AIUA 3DECA 5I2UA 5CQ1A 1PIFA 4D6CA 3WNOA 2WW5A 2V5CA 3GZAA 2WVTA 1UKTA 4RL3A 1QNPA 5I5RA 2J7DA 3MSDA 1IZJA 3WQ8A 2Y8VA 2ZWYA 4RE4A 3WH9A 2PWFA 4WLCA 3WD1A 3SUSA 2NW0A 1E43A 1CYGA 1W3LA 3BVXA 1Q6EA 1PZ2A 1AVAA 3VMOA 1H49A 2QHAA 5EFFA 2BVDA 1E3ZA 1CXLA 4QP0A 4AZ7A 4E8CA 2DT2A 3WDRA 5JIPA 3NDZA 3EJRA 3WF2A 1QNRA 3BLPX 4J3VA 2JIEA 3MV01 2JE8A 4TVDA 3VM5A 1WPCA 3HG2A 3VGFA 1NH6A 2DDXA 2J7GA 5IHSA 2FYVA 4UFMA 1MW2A 1KTCA 1B3WA 2O9RA 3PTKA 2EJ1A 3WMBA 1GORA 2PWEA 2ZUSA 4AD2A 1HJUA 2XGBA 3ZT5A 1PX4A 2GUYA 3DX1A 3WDPP 4DM2A 2X8RA 3SCSA 2W5FA 2CIPA 1MQQA 2E9MA 4NZCA 4KH2A 2O92A 1XC6A 4HZ7A 3AHTA 3EDEA 3CTTA 4FMVA 2YLAA 1GW1A 1WZMA 1CZ1A 3CH9A 2BY1A 3RO8A 3ZT6A 3I3EA 4CD7A 1BG4A 3BAKA 2JF6A 4UFJA 2W91A 1EDGA 1KR0A 1TQVA 3BAJA 1EOKA 1E15A 1JDDA 4RE2A 1KQZA 2BHZA 3VIPA 2VI0A 1OT1A 2PWDA 2F1AA 3NCOA 4DUXA 1QHOA 1FHDA 4XUYA 4H7VA 1E4NA 4EKJA 1JL8A 4PMQA 1ZL1A 4JFSA 3SUUA 4KGJA 4TXEA 1X1NA 2EEXA 4GKLA 7CGTA 1UG6A 3WH6A 1VJZA 2G3JA 4DWSD 1JFHA 2EABA 1JXKA 4J3SA 1J0KA 1E6NA 2WMHA 4AZHA 1TE1A 1DP0A 1Q6GA 2ZIDA 3SCUA 1TFVA 1V3HA 3RDKA 4TTGA 4PMYA 4U2ZA 3CZGA 5LA0A 4PTVA 3ZQ9A 1PJ9A 3AIRA 3AIWA 4JKMA 1O6IA 2CBUA 3CLWA 4OBRA 5A8MA 1BG9A 2X05A 2YFOA 1LWHA 3CC1A 1VF8A 1I1WA 4MB5A 5I3DA 1UA3A 1AQMA 3J7HA 2VVSA 2DGAA 3UR7A 4W84A 3K4AA 4W8LA 3CV5A 2PWGA 5CG0A 5E9AA 1B30A 1TG7A 1D2KA 3WNLA 3QHOA 3MV11 4CD5A 1GJUA 2PWHA 3CZKA 3L2LA 1NARA 3KL0A 2J7CA 3ARZA 1NWRA 4A3HA 4XZBA 1ESWA 3CZLA 2OWCA 3N13A 1PX8A 1MXGA 1QX1A 3KLLA 1UKOA 3B8SA 4UQCA 1HXKA 1VJSA 1R33A 1E72M 1JZ2A 4ACZA 8CGTA 2WK2A 3WSUA 2V38A 1O7DC 3WH5A 5BXTA 1HP5A 3T0DA 3ARQA 4CN6A 2CERA 3SUWA 1E0VA 1OM0A 2ZUTA 4QLJA 5E1QA 4NRSA 3VU2A 4RE3A 1UR8A 4U5KA 4AXNA 4UQ9A 4Q7NA 2C7FA 2ZX9A 3ZSTA 3FAXA 2ZUNA 3VSVA 4CD4A 2YL9A 3HZ3A 3AZTA 3CPUA 2ZX6A 1JIBA 2J7FA 3AXXA 3BCFA 4UFKA 2OSWA 4FK9A 1UD5A 3E1F1 5FOOA 1ZBVA 3N17A 3NYDA 3VGDA 1B2YA 2BV9A 4LGXA 1UOKA 1CXKA 3VD7A 2E3ZA 4NX0A 3CZJA 2CNCA 4ATDA 2D0GA 2EPKX 3WBAA 3W25A 3WY2A 1CLXA 2ZWZA 4ZFMA 4P7OA 4E2OA 4PSPA 1XD0A 2G3IA 4JKLA 5E6YA 4HZ8A 4FNUA 2ZX7A 4PTXA 4AZCA 3AHVA 3NSXA 1VBRA 1GCYA 2VQUA 3OLGA 3CUGA 3PZMA 1UKQA 1Q6CA 1US2A 1JI1A 3CO4A 2D2OA 3LXAA 1H4PA 1FP8A 1KCKA 2X0YA 1X6LA 2XN1A 5A6MA 1BGGA 2DPEA 1A3HA 5HPOA 1HXJA 2JF7A 2O9TA 3VDHA 4DWSB 3KEHA 4BQ2A 4ATLA 3SURA 2WBKA 4WIWA 3BAXA 4IM4A 4BA0A 2OW6A 2UY4A 2XVGA 4HP5A 1W2PA 3QR3A 5A69A 4AC1X 1BQCA 5AYIA 3W4RA 2CKSA 5E09A 1UH4A 3DYOA 6CGTA 1VEOA 2YL8A 1CXHA 1GZJA 3W38A 2EAEA 1XGZA 3VIJA 1DWAM 4ZENA 3BXWA 3GM8A 3WN6A 3B9AA 4F8XA 2YA1A 2NT1A 3ZJKA 3VGGA 1PZ3A 1CENA 4ATWA 5HOSA 5EBAA 2OW7A 1GQIA 3SCTA 2X2HA 4CD6A 3HG4A 2WHLA 3CUHA 1E1FA 3W6MA 1W9VA 3RM9A 4HZ6A 4CVUA 3W26A 1UD3A 2OYLA 3VMNA 3GBDA 4HA1A 4CKQA 5BRQA 5A8QA 3OZOA 4NXKA 1WNOA 4V27A 1XH0A 4AYGA 2VNCA 4P8VA 3THDA 2IXVA 3U7VA 4JL1A 1C91A 3TTQA 1KXQA 5GNXA 3SCOA 1GJWA 3GTNA 4PUEA 1W1PA 3T2PA 5CGMA 2ZUWA 3A3HA 4W93A 1OSEA 2VTFA 2WVUA 3AMDA 1LL4A 2E40A 3T2OA 1FH7A 4C7GA 1NWSA 1UWUA 1V3KA 1VBUA 3WD2A 2X2JA 3FY1A 2YDRA 3FN9A 2GK1A 1UWIA 1OD8A 3GH5A 3SIMA 1QW9A 1T0OA 5FD0A 1HX0A 4GZIA 5IFPA 1M7XA 4JFTA 4TX6A 4AMCA 1NOFA 4UTFA 1O7AA 1UQZA 3AMLA 1C90A 4CGTA 3GNRA 1HTYA 1W32A 1OGGA 2J47A 1RPKA 1V6UA 3BSHA 3UETA 3WUBA 1QOXA 1VFUA 1JYWA 3CUJA 2YKKA 1G5AA 1H41A 4CCCA 3ZT7A 1TA3A 4LYRA 2E8YA 4KMQA 4HOXA 3BCDA 3N9KA 3ZR5A 1GQLA 1BSIA 3S2CA 2WLYA 5BXSA 3GNOA 1E40A 1VB9A 5I23A 4GPNA 3UEQA 3W29A 1VAHA 4GI9A 3HU7A 4Q22A 3LRLA 5IDIA 4D6GA 1ZU8A 1FP9A 3WDQA 3L4XA 3LX9A 3MUZ1 2GSJA 4WKAA 2X2IA 2DT0A 4HA4A 4ACZB 1R75A 5CLWA 1ITXA 4PN2A 2DSKA 3KL3A 3WF1A 4W5ZA 3WF4A 1LG1A 2J78A 3NJ3A 4Z2IA 1MXDA 3LRKA 3UESA 4CCEA 4A4AA 4EANA 1JGIA 1S46A 2OYMA 3QHNA 1JNEA 1SR0A 1US3A 1BPLB 4MNKA 1M04A 1R47A 2BHUA 3CMJA 1UWQA 2CEQA 3WD0A 4ZE4A 3IJ9A 1W9BM 5C8BB 2EPNA 4U33A 2XVPA 4OGZA 1FHLA 3M7SA 1WDQA 3PZOA 4F66A 2YJQA 3WD4A 1JYXA 4JAWA 3VDCA 3I3DA 5CPTA 2VURA 4LPCA 3UR8A 1NOUA 4KWUA 5M03A 2X09A 4YPJA 2PF0A 2GJPA 3A4XA 4Z2HA 2FHBA 3WL1A 4QCFA 4B9YA 1ZJAA 3W24A 1U33A
chains in the Genus database with same CATH superfamily
4IOFD 1ZV9A 4RGMC 2FB4L 2EXSA 1SYSA 3N41B 3ARDD 1BGXL 1IKOP 2Y72A 3F12B 4CN1A 1A3QA 4JQIH 1MFNA 1WAPA 3M0VA 4WK0B 5LNRA 1JHKH 3GI8H 4OCYH 2Z2UA 3IARA 4JFYB 2BSRA 1H61A 4HK3J 4W6XB 5DEJA 4L1XA 3VVWA 3NIDB 3DETC 4Q74A 1PX3A 1R5IA 2EXOA 3FONB 4X6CF 1F9CA 1PDZA 2JKRM 1XXXA 5MHSD 2VRQA 1QPOA 3CUFA 2KC0A 1R5WA 3L17A 2VZVA 4JJOA 1GVRA 5IM7A 4NUQA 4QOKD 1W91A 3OJDA 4I0KA 1JRHI 1WWWX 1HHHB 4UT9H 4YN5A 1DWGM 1LQ0A 5K69A 4RGND 3SDCB 1ADQL 3Q2NA 4QCEA 5DO8A 3GG7A 4JZOA 2J62A 3BOFA 5HD8D 4A7TA 5F7LB 1XL6A 1AIFA 1G7LA 1KT2A 4PJ7F 4UQDA 1AQ8A 3TXZA 3PGFL 1J79A 5LAPA 3M17B 4P8WA 3B7YA 3BEVB 1BD0A 4UQ3B 1OG0A 4KK6D 1IRAY 4OM0L 4GG6A 3UWQA 2J25A 3QA3B 4OZIF 3P0VH 4YHLH 3TWCL 4A7GF 4ZOAA 1I1XA 4G56A 3W83A 2R0ZH 3HTLX 1GZHA 1TR1A 5JHDB 4LAJH 4E8DA 1DBKL 1M2VA 4GJIA 4YJ5A 3PF3A 4ECNA 1GOHA 2H1PL 3E6HB 3NJMA 5AALA 2K1MA 2H1LM 2VP8A 4KWOA 1XSOA 2QPFA 5ESAB 1PBGA 4JYEA 5K39B 1NFGA 4DAGH 3C08H 3QULB 3IFNL 1CECA 4LF2A 3GI9L 4NILA 2KDYA 4KKBD 4JO2H 1P1ZA 2KZ1B 3MOAH 3O3EB 4UNIA 3FSUA 5HAOA 1IIKA 3AO0A 1KWGA 4Z42C 3BUYA 1VADA 4BKLB 4KK9C 4HD9A 1XLFA 3ABQA 4NJGA 4NO2A 1K5WA 4MYAA 2JSFA 4AC7C 4M5YH 1UHVA 3NO1A 1XRTA 3U7BA 4HJ1A 2HWGA 4LNYA 3LERA 4KROB 5IVZB 2NNAA 2GHWB 4MNLA 1KF9B 2HT2C 2KLRA 2W65B 5I8EA 4YDJB 3VI4F 1T41A 5FGCE 2VZSA 5AYZA 4WJG3 4B27A 4F4RA 3ZDYE 2F54D 5BNXD 2ADFL 4XMXA 5DJXB 4AW7A 1NOLA 2MNRA 5EZLB 3NXFA 4ZXLA 5KSBF 4JQ4A 3HGRA 2W59A 4UV7H 4IPNB 2FJFB 1A6PA 1F2QA 2DMCA 3W57A 3LGGA 1R17A 2QEZA 2RMNA 4IGNA 4DHLA 5FF4A 2Y9RT 3USZA 2K7PA 1A47A 1DQLH 4EXAA 1JPFB 2POTA 4H4NA 2BVPA 2ADIB 1A14L 3KHDA 4HHAB 4L8SA 3W1NA 1N6QL 5GRJL 1BZEA 1MKFA 4XPTL 2XG9A 1R2RA 1N0LA 5AWNL 3IGSA 2DBLH 2XN9D 2V5SA 1IM3D 4XVSH 4XVTL 5DD6B 2OPJA 3SADA 1ZE3C 2R29L 4QKXB 4ENEC 3ZIZA 4H04A 2V7NA 2EYTA 4KJWD 3STBA 1UUNA 3L0GA 3U6XA 3RWEA 1K8YA 1CGTA 1TTGA 4NZUL 3NSMA 3IK4A 5AW1B 5C5YA 3VW3H 1FFTB 3QFJD 1CFBA 4K07A 4L29A 1OCQA 3M07A 1Q72H 3G08B 3SW6A 3LXUX 5EUKA 3VXMB 4K8HA 4B95C 3GO1H 1NSNH 2J8HA 5GGUB 4P3CH 3D47A 2OI9C 4ZEPA 3VFLA 4L3AA 4RJEA 2UY6B 1E51A 4FZEH 4W89A 3N85H 1V55B 5AOKA 4R5EA 1I8IB 3SN6N 3FU5A 4EDWL 4Q4OA 4O4WA 2FZDA 1UM6H 1MEHA 1TVBB 4LQFL 1MWOA 3W27A 3K2UL 1DIEA 2IPJA 4JFEB 2R7EA 4XZUA 3EYFB 5BRZE 1ZS2A 1WGVA 4RLDA 3KPRA 1KJ3H 5D7IA 2ASHA 2E9JA 2QJJA 3LMJH 4RNIA 3MUXA 4ZUWA 5BQ7B 1E5UI 4TL5A 3VTRA 1TJPA 2R6OA 5FF7A 4MD4B 2VO5A 1M1SA 4OD1L 1CDBA 1CI5A 3IKCA 2VFEA 4JYDA 4OD1H 2NY4C 3CVIL 4LLYB 5TE7H 1QFWL 3C5XA 3MV9E 4JL2A 1JMZA 3MJ8B 4PP2B 3V4VB 4KZEL 1FWAC 1XLDA 1YIXA 2IKIA 1WVZA 1QJWA 2R2HB 4X42A 3UFIA 4XN2A 1VGKB 1UKSA 3UA4A 1BD2D 4FQXC 4OGXL 3SGJC 2WO2B 1GGCH 2WBJB 2WPBA 1TV7A 4GKOA 4GKNB 4W81A 4YZFF 5U7SA 2HZGA 4XKMA 3FB6A 4U6YB 3VOGA 4BFEA 3WE6A 3LVEA 3NIGE 1U8QB 4F1ZA 1UWGL 3T71A 5INDB 2YXOA 3FO0H 1HINL 4MNHA 1QT1A 5TPWH 2NWRA 5F7KC 5FD0A 2OFJA 1RP8A 2MCG1 5DRXA 1LILA 2ZSWA 3G0XA 4EI0A 2BSSB 4LSSL 3VD0A 3VXRB 2JFEX 1BEXA 2OSLA 2E59A 1EXBA 3FFCE 1KEGH 1VFAA 1W72A 1W8SA 5IFAL 2MANA 3R1ZA 2FBOJ 5TDOB 2OL3A 4H88L 3BEWA 3DMMB 5TDPB 1AR1B 3STZA 4HNLA 1QBAA 1Q6LA 1MFEH 4TTUA 1AG1O 3QEUA 1AJ2A 3G6JE 1F8MA 2Y7OA 2OWWA 3V18A 1RZJC 2Z31B 3RVTC 3SDCD 3S37X 5BV7B 4PWFA 4WSJA 1ME7A 1NWUA 4GAGH 1XCXA 2C4FT 3UYRH 4U1HA 3VB8A 2JJSC 1DJWA 4K7FA 4OLZH 2VT0A 1P6CA 2ZOUA 2XM1A 2BIOA 2DQXA 3VOCA 3EPMA 5J6GB 1CDUA 2V2TA 2CZVA 4Z7WB 4I2XA 2J77A 2P7TB 1AOZA 5CSSA 3S8GB 4KVNH 1KIUA 1VDGA 5I3KA 4YO0B 5TQLA 3VPLA 1J1XH 3MACH 3RWGB 4G8IB 3DBNA 4LQ1A 1CMOA 4JRXD 3LOTA 3L7EB 4KFOA 4XAGA 3RO6A 5IFJB 2D73A 3QGKC 4OFYD 3PXJA 2W9DH 1C3FA 1BFTA 5B8CB 1I60A 1PKYA 1S2TA 3VUPA 5SV3A 2CGYA 1J1PH 3RDTA 1KLGB 1NGWB 1JXDA 2H9GB 3N50A 5EC1B 5DYFA 3CHCA 4O1CA 2E6AA 2A83A 3CFNA 3GSNB 2G2RB 3PDOB 5AW8B 4BQCA 5AFAA 4IIHA 3LU2A 4Y4FA 4R0LB 4X2RA 5BZAA 1MFMA 5FSEC 4L37B 1VENA 3N85L 4H1LG 2XHYA 1I9IH 1OK6A 4WUUB 2PDGA 2FYYB 4N42A 3L5JA 5HNTA 2H9AB 4JVUA 2HVJB 2AL2A 2Z1KA 4RMBA 4RPPA 3ES7A 3IXTA 5AC4A 1Q0XL 1KTJA 1ETB1 2DYRB 3EYSH 3MKGA 4LU5H 3WBDA 4BZ2L 1MAML 3QUZC 2PYFB 2YZ8A 2ZXAA 1JCTA 1EL3A 4P57B 4ZMTA 1CXFA 3CBJB 5CLTA 2AQTA 2R2BA 4UFLA 2MEJB 2FSDA 4IK7A 4ZUUA 2OOFA 2WAGA 3UH8A 2O6PA 4BCXA 2YUZA 5HHXH 1WT5C 3UXDA 3LKPA 4A3YA 4JHAH 4Z7VF 4HCDA 2VN7A 3QHTC 4JY6A 2EXWD 1MO0A 3SYQA 2CWRA 3F7KA 1USZA 3Q6FB 2DWSA 4N2OA 3ABOA 1UWFA 4F1SA 1CIDA 2JELL 5GJTH 1ML0A 2DSZA 3BV4A 4J3WA 1T5AA 3N6JA 3MLYH 3UTSD 1FGNH 2BHYA 5EBMB 5GGSA 1PG7H 4OTXH 3MLPA 1RAMA 1XL9A 2YEVB 3ULVF 4OZIB 4WXYA 5IQ7L 4BR1A 3CZFB 4KPLA 2V3GA 1I3RA 3UYRL 2X1SA 2OXHA 4LNCA 2BDNL 3U2ZA 4OT1L 5I24A 3GBEA 3VXSB 4OU1A 1GGYA 3BVVA 3STLB 3GDMA 1NDYA 2WINB 3MV8B 3IN2A 5E00A 4CQBA 5MKGB 1YECH 4KKZA 3G3MA 5C0IA 5IB2B 1W5QA 3KVLA 1ZHBA 5CJNA 5FJTA 3T08A 4Q4QA 4XX6A 2F5BH 1IFHH 3ARSA 3I85A 5FEZA 4Q6KA 4H1ZA 5IVZA 3V7AG 2R23A 3CYJA 1NUNB 1SBSL 2NR6D 1SFLA 1YE6A 3EMCA 1TVNA 4OFDA 1CB2A 4HDIB 5JR1H 2AK4E 5C6TL 1MEIA 1Q45A 3DUGA 1VFFA 3H26A 3OA5A 2EQDA 2IWGA 2F58H 4XTRC 5T3XD 4NT0A 2WZ0A 3L4TA 1HJCA 1TMCB 1X5IA 4G8GB 5B22A 3T4YB 1C29A 2XISA 3WXWH 3QFGA 1DPMA 2B7QA 4B6ZA 5EFIA 1H2JA 3FJ6A 1TVLA 4FXFA 3TBVA 3S6OA 3W07A 3OPSA 1WBJA 3AXKA 3IJEA 2FH6A 9RUBA 1K9FA 2CFFA 2YDSA 2XX1A 2D7PA 4OQTH 4YXLL 5JW4M 4XP1H 4LEOA 3OXRB 4CGUB 4UNLA 1QZ1A 3C3UA 3WUFA 5DT1L 1GGIH 2V2XA 3QWOB 4GXUN 3UTOA 2HTKD 4UZSA 4ODVH 5C9ZA 1S7WB 4Y2OB 4KT2A 1FZJB 4TYUA 5HPMA 3W7OA 1M7IB 4HC1H 1G94A 3AIQA 3WAJA 2GFBA 2Q2LA 2W9DL 4PA8A 2GVJA 3QYNA 4PB5A 2E4TA 4TNVK 3OL2A 4PJAA 3N1AA 5KG9A 3EWWA 1JR1A 3ETBJ 2NV2A 5IP4A 2H3NB 1YEEH 4HIEB 4C1LA 5BS0D 1RJRA 3F83A 3BAIA 3RUGA 1YNTA 5EKYA 2IMMA 5GIRA 1M01A 2UY6A 4WEBH 2Y36H 4JPIB 4XCYA 1FVPA 3SDDA 1YYAA 4EUPA 4LLMB 1OTSD 2IGTA 2MOGA 1HH6A 3KYKL 3THMH 4ELME 1SN0A 2X1PA 3DVFA 4XGZA 5JOEA 3DX4A 5LVEA 2FGLA 3HV9A 4OKVA 3S0CA 2HX8A 2CO7B 4DPAX 5CBEB 2WYIA 1IQDA 3AROA 4HISA 1A49A 3DEQA 4DUWA 4WEVX 1XR8B 3O4LB 1ED3A 1KN4H 4UQ2B 3NQBA 4AD3A 4IMKC 4YXGA 5DRWA 3B34A 1G7MA 3GSRB 4IM8A 2BC4B 1X1OA 2HJPA 1OT2A 1IAII 3O4LD 4JAMB 2CO3A 5FCSH 1WB0A 4U4MA 3FDGA 3KBJA 3W37A 2IEPA 32C2B 1KEGL 2R4SL 3ZR4A 3RVXD 1S5WA 1A5LC 3LS9A 4Y4HC 5T1KA 5FHBH 2XN9E 3N43F 3LENA 5FFOA 3LKSA 1QSEE 2PPEA 1LBFA 1BF6A 3FVDA 4GHRA 4IT1A 1VGKA 3QDME 2DOCA 4NJAL 1WUNT 2ORBH 2QCHA 3LPOA 4MQXD 2XZCL 5I06A 1TXKA 2AHIA 3GSOA 3JQOB 3UWZA 2DQUH 5TF0A 4AMWA 1LM8V 3ZLGA 1C16B 1M7DB 4OLZL 4KMTL 2FQFA 1AKJA 2YCEA 4KI1A 1GONA 3EX4A 4PMDA 2ICEC 2OCJA 2VC6A 4ORGA 1KBGH 4DO5A 5I17A 1QR1A 4O0KA 1FZMB 5DZAA 1PS9A 1UZ4A 2EH7H 3TVMA 2Y7DA 1EAQA 3P6LA 1NC4B 3FYIB 5EBWB 2TODA 4XKYB 2LTQC 1TTBA 1HVXA 4HS8H 3FEQA 1VFAB 1W72B 5I1EH 1MRAA 3QXTA 3QJHA 4CW1B 2IADB 3DXAD 4ZPTB 5I0VA 1DBBH 3VFNA 1HW6A 3SY1A 1I9RH 1LF1A 3MRJA 5A8OA 1LD9B 1H6TA 4MCYB 3QEUB 2A7RA 4CDGC 1D2OA 1NUDA 4P2YA 5L8JB 4KWSA 4Z5RA 2EIKB 3LHYA 1XAUA 1XB6A 1IXOA 5CCKH 2XJ7A 3W22A 1TQCC 2WQWA 2Z8RA 2MCAA 1OFPA 1WFMA 3VI3F 2Q09A 4XWOC 3L23A 2UZXB 4FEIA 4JPVL 3LI0A 3GSQB 5JQIB 1XSJA 3BUPA 4H8UA 4IMDA 4JFXB 3GLCA 5DJDB 4GRMB 4QG6A 1FSKB 2YGNA 4J7RA 4QNPF 5DSCA 3U9UA 2L04A 2R0ZL 4M5YL 4K5MA 1Z3GL 2K45A 1EIBA 3TA4D 4R4FH 4APXA 5LG6A 1VKFA 2V8ZA 3FLUA 5HWNA 1ZA6B 4QHRA 1DDHB 4HKJA 4FR1A 3Q01A 1IGTA 2IPUK 3TOPA 1JZ3A 1CTMA 2CZEA 3D25B 1JNLL 2EDLA 4JFFA 3IWVA 3PBWA 5G1YA 3VNKA 3SO3B 3N2OA 2ZTBA 1SDYA 2FYMA 3GI9H 3BPWA 1F7BA 2FIRT 1EPXA 5LQBL 3UMNA 3FULA 1KN2L 2B3IA 3SCMB 1M68A 3GW0A 3TVMC 2WNQA 2OZ8A 4B2DA 4PRPD 2CLHA 4L8BB 1ANUA 4DQOH 1XGRA 3D85A 4UBDC 1D6EA 1F6FB 2AL2B 2ICEA 3UCCA 4AIBA 1DZ0A 3FCTA 1XCFA 1R0MA 2YD9A 5JHDE 3BVNB 1X39A 3RA7L 2XH2A 1ZA3A 5CINH 3NG5A 3FIGA 3VFMA 5AHIA 2X7VA 3RYSA 3QHFH 4G6MH 1XD1A 2RH0A 5JMOC 2YSTA 1C5DB 1ZSDA 2Q7AA 4W9EC 1X7QA 1J1OH 2YKLH 2V4LA 2E5CA 1H0IA 3OTTA 1KBWA 2GPZA 3GKZA 4OCRH 4UDTA 1YPZA 3U57A 3V0DA 3UWUA 4GRWE 3R19A 4I9TA 4E41D 1BOGB 3NDOA 3HPLB 4N9OB 4LLWB 4XNZB 4US5A 1KGCD 4YGVA 4BV1A 6PCYA 4DEPC 3IDUA 5H37H 2YW4A 3S1WA 3IJLA 4L5FH 3PNUA 1WUZA 4NN5C 3MJMA 1DQTA 2QT3A 2G3MA 2JEQA 5DEGB 3W70A 4RZ5A 1MG2C 3G1FA 4XZWA 4E38A 5AKRA 3F05A 4ZW7A 4R97C 4XVSL 3WGVB 2B0MA 1U42A 3AXMA 3CZFA 4IMKA 1B4LA 1RQ5A 2WWOA 5LGHH 1J7VR 1DV7A 3IRDA 5CBIA 3TGXA 5CZTA 4PJCF 3TPKA 2DLGA 1YEFL 1DE5A 1JN6A 2WINA 1O5RA 1AZNA 1P0SE 1H51A 3WQ6A 4WJEA 1ZVHA 2IH8A 4HU2A 3R2GA 4L23A 2YCLB 1QI4A 1ZHBB 1OSPH 5IREA 3CO8A 1WBXA 2GAZB 2QSQA 4ODHH 3ROOB 3WY4A 3RITA 1KBBA 1MLBA 2X89D 3EDJA 4N25A 2C9VA 4N0UE 5EZJA 1U58B 3Q5OA 4XCFH 5BO0D 3FNDA 1Z9NA 1KLFB 2WBJC 2M8XA 4HQQL 4IBQA 4ZUTA 3K46A 1LLOA 3GT6A 1ICSA 4Z7OF 4HDIA 2J72A 3IFNH 3MGOA 3SYCA 3WIHH 1A0DA 2AQWA 1WBZA 1HSAB 3OAYH 5EU3A 3ZFHA 2LLLA 3HZYB 5CGTA 3BWSA 3O2VH 4J3OF 3GD1C 1LJYA 5REQA 3RVVD 4G8GA 1JV2B 4M43H 3SI9A 3FTSA 1FJ1A 4HJUA 4M43L 2OMVB 2FE0A 2XY1A 3H4FA 3HB3D 4E42A 1Q4NX 4YAQA 2ZJSL 3QMTA 3W1UA 3H53A 4AY1A 4EE9A 1KBLA 3IJEB 1L0XA 5DS2A 1V0LA 3OPUA 4PJ8B 3CSPA 5L9DL 4PMXA 2Q3ZA 3BGFB 3L81A 4MGXA 5D2NE 1L9WA 4A8NA 4C5ZA 3MLRH 1DUZB 4WI4A 1XIWC 3OHIA 4GVIA 4PJ8D 3ZJAA 3HZVB 3WEBA 2Y6SD 2XWJB 5FF3A 2A9NH 1I7RB 1PG7W 1MWAA 3DI0A 4CADB 4Y5XC 1XQKA 4GXMA 1M7JA 3KPMB 4P2AA 4UNKA 1P7KB 4FZ8H 2DQFB 5EZIH 5BUGA 1EWDA 3FTYA 1A5MC 5KVFE 3CHFA 3T81A 4YFDB 4MYXA 1VBGA 2PZNA 1BXAA 3EO0A 4MBOA 4H0GA 4PJ9C 4HCIA 2YL5A 5DY3A 2VL4A 2XI9A 1KULA 3MMDA 4DYKA 5IZ7A 1NWTA 1WO2A 1GZ1A 2G50A 1T1XB 4MJ4A 2GK1B 3FGCA 4IMCA 1YEIL 4XCNA 3OV6A 1X1ZA 4Y19E 1RZGB 1DO5A 1YA5A 2TRHA 3CFJA 4YEFA 1AHMA 1M7UA 2Z27A 2RIKA 4G1MA 2J88L 4AQ8C 5H8MA 4I7UA 2JI2A 5E5UB 4HWZB 2A3AA 5D37A 4JY5L 3IJYA 4ZFZA 4LS0A 5ENLA 1M53A 3BP5A 5DT1H 3VNMA 1YQVL 4L8DB 3CJJA 5LDSA 5DRWB 1C8QA 3SGKA 1T7ZA 3IRCA 2XKUA 4JQ2A 1BCIA 4XP4H 1OIMA 2VAAA 4L2LA 3FOKA 4MY1A 3UJJH 3L3IA 4JEQA 4JB9H 5HPCA 4JHMA 1Q9LB 4Q0XH 2VLJA 1U3JA 3F5WB 5JUEH 4AQ1A 4W4QA 1B4EA 1NGYA 1K2DA 4QT5B 4DKTA 4J6IA 1KBPA 2PWVA 2AXGB 4NZJA 4PSRA 3DETD 3DFQA 1BAFH 3J8F7 5DJAB 5BO1L 4M5TA 3L4ZA 3L13A 2KPNA 4KI5F 4G7SB 4XRCA 1BX2B 1D3HA 1XGUB 1MFCL 4EIVA 4GUPA 4DGVH 1SJAA 1XV8A 1SFHA 3S3PA 1ACCA 2AP2A 3DWTA 3MNWB 2B0SH 4GO9A 4OH2A 5F89A 3ZKNC 1LL1A 1M7DA 1U8IB 4GG8B 2DQHH 1VRXA 2V67A 3PWPB 2NXYC 2NQLA 4MD0A 4OQVA 5KSBA 4JFQB 1NGQH 1RZKH 3BKYH 3H3PL 3IETB 1QFEA 5D32A 3JV6A 4R7XA 2BGQA 2ROXA 3VIMA 5CD3A 3RWHB 1R3JB 3UBGA 1M2OA 1F1AA 4H0IA 1FV1B 3C8DA 1PD6A 1IIGA 1JXFA 4J40A 1ASQA 1S5TA 4ELMB 4MTVA 1H1YA 4F79A 5I73B 1GW0A 4MSSA 1EHNA 5F1NA 4UNVA 4P4RB 2XH7A 2Z93A 1IC5H 1SLVA 1DHPA 2RGLA 1SFSA 5DJ2A 2YW3A 4FL4C 2UYLA 1JPGB 3DGDA 5AYUL 2FBJL 3D3VD 3EG9A 3U7WH 3TSBA 2APXA 1RK5A 4RMQA 5FSDC 3S35L 4I8YA 4NKDB 5I2IB 1RJPA 4CC4C 4HT3A 1AGEA 1T96A 1V0NA 2WUBH 3H7UA 4RDVA 5HBFA 3TVMD 2IBZX 3U9WA 2E5BA 2CUMA 3DCPA 4Y2DB 4G7RB 4M3KB 4Y88A 1E5YA 5I19L 1FWRA 4LDLB 1XLCA 1Y5VA 3FO9B 3DROB 4P46A 4B16A 4FNLL 3SSZA 2YWZA 3D33A 1XIHA 4N2DA 4EK7A 1AY1H 1E9PA 1PIGA 3INOA 1CFTB 3WG6A 1JCKA 3RNQA 3IIZA 2X4NB 3KWXA 4H8WC 4HKXA 3H70A 5DMYA 1KJVB 1BZ7B 2CD0A 4UWQB 1S7TA 1T1YA 3DA0A 5F2FA 2JKAA 2NMSA 3JXAA 2D0FA 1FWTA 4G9DB 4Q0XL 2J8OA 1XCQB 2CHDA 4PJ7A 4V2XA 2AJZA 4RBPH 5ILTL 3SHSA 1JQVA 1UPMB 4PC8A 4JFED 5AAWC 3ML9A 3GDRA 1KDIA 3HHSB 4JDVA 4GRWB 5A16A 4Q8QA 4JANB 3KPPB 1I9EA 3OKLB 4ZMXA 2LTQB 3W7IA 1B2WH 1PSKL 1E0UA 4PJXA 4K1GA 1DJQA 4ZMYA 1ZJHA 1ZEAL 3SE4C 3PPCA 4PMOA 4DJFD 3WK3A 2VDMH 3MOQA 4KRTA 3DBXA 2SEBA 3PY9A 1OAXH 2ARJA 4DN3L 5ID1A 2FX7H 5J4MA 3ASOB 2J88A 1V3JA 4W6WB 1OD9A 4QRRD 1RH9A 3VIHA 3LHWA 3BVNA 3A64A 1DR9A 4UTWC 5C07B 1I1YA 3BUQA 4F27A 1LP9F 1T3FA 3TBWB 4WJ5A 4Y2NA 5C9KA 4IDJH 5BU9A 5D9PA 5JMUA 3BVTA 1RUPL 3VD9A 2G8ZA 1M56B 1XMEB 2J13A 3REQA 4YDVA 4PJ7E 5KVDE 5I78A 4M51A 1UR0A 4FQXA 3WFZA 5GZOD 4QJ1A 4DIAA 4DZ8B 4FOMA 4DY1A 2CIKB 4HD5A 3NJNA 2ZCLH 3C08L 2ESVA 1W8NA 2INEA 4N2YA 4NNAA 1IGIL 2WLIA 4PJCE 4QAIA 5K9JL 5F7FA 3LRSB 4GINA 4NAQA 3D50A 4AVJA 4AYSA 4LLQA 2VLKD 3RLGA 3K1GA 4X6CE 1A4KB 1F18A 2ZPKL 1E30A 2PPAA 2VLLB 2VJXA 4PL1A 3S2JA 2UWEF 4KX8A 5E7FA 3ZDWA 3OX8A 3FQ4A 4NC1C 4ZOEA 1C9DA 2FQGA 2G3NA 2BVOB 1E5JA 1WQVT 1ZLSL 4AYMC 3QIWC 5DXYA 2EDNA 1F11A 2YHGA 4IJ3B 3U7YL 1WWAX 3L1OL 4TNFA 5DF0A 1WV7T 4YSEA 5EEZA 1BRLA 1KFBA 4RX4D 1BYAA 3EX6A 3IGXA 4QHMA 3EH2A 3PWJB 4P9MH 4QXTB 3B8VA 3NURA 5E4EC 2DRUA 4PCSA 2W5PA 4LCVA 2CK0L 3TLRA 2JK5A 7PTDA 3D51A 1E6JH 5BW6A 4DK6A 3UPCA 2YBVA 2B3RA 4A05A 1FDLH 1DN0A 2Y5QA 5GISH 4I3SL 4Q4IA 4K5LA 1B3OA 3WDIA 1OC6A 1EAPB 2CLLA 1GA2A 1HF6A 3WTXA 4HU8A 4FKEA 3T0BA 4FA7B 4J2MA 2E5EA 2BDNH 3UAFA 2AABL 3GMRA 2E6PA 3DMMC 3PZIA 4CL7A 3QDGE 1CGYA 3CK0H 4XOBA 4NNPH 1F5ZA 1ZT7B 3APYA 3MJ9H 3OVGA 2X4RB 2HRHA 1W0WB 2FD6H 4K71B 2DQUL 4LVHB 1KBIA 3PB0A 2EYSB 1O68A 2EUVA 3A0OA 2VEPA 1I7ZA 5L0QB 4PWKA 1JDAA 4U0RB 1S9WA 3QIWB 1OTUC 4QRPD 2WMJA 3CV1A 3FQRA 1CZ8H 3HS0C 3KPQA 5IGXH 1IVLA 4JHOA 1IEVA 5BCAA 4AQAB 4TMBA 3K6SA 3QYCA 3F12A 4PG9B 3FU3A 2I5YH 2UXFA 5C70A 1H50A 5DANA 4B5UA 1F6LL 1AQDB 1KTDB 3BGAA 3DVGA 3CBRA 3QCUL 6TAAA 1E4HA 4G8GD 1H0GA 3P3YA 3PRZA 4QHLA 4CADA 3L5HA 4OF8A 4CU7A 1K4HA 1ZAJA 1NCUA 4XWOD 2WTRA 3TR2A 1TQBB 2HPIA 5BMFH 4NZFA 4B7LA 4E9YA 4OF6A 2O5NA 4Z08A 3BP7B 2XTJE 1W0YT 2PW1B 1NTDA 4FG6C 4TQEL 2F53E 2WVVA 4YHNA 3PHOA 3T6XA 2ICES 1J9CT 3EMQA 1VLWA 1ZTVA 3ZM8A 4XPFL 1A3RH 3B4YA 2DU2A 3KPLA 4G6AD 3H9YA 4FG4A 1IGSA 4C91A 2XG5B 1Y1DA 2X53A 5GNYA 5JQ6H 3CFJB 1IEWA 1SF3A 2WJ7A 3FQNA 1PL9A 2OEMA 4JZOB 2EE9A 2HMIC 2YQ3A 3WAKA 5JIDA 3GSXB 1TOXA 4KHXH 2QPDB 1QFPA 3MCOA 1GGTA 2VR7A 4GW5B 4I5BB 3QUXA 4G59C 4IIEA 3L3OC 1W72H 1A6AB 2IKHA 5LNUA 3DRTA 3VWKC 4R4BB 3WHE0 3W2NA 5DUML 2YXGA 5HINA 4FQJH 2KI6A 5AC5A 4ZQTA 1BWLA 3GXFA 3MOBH 4O02H 1WOAA 3BCJA 3KOWA 3HUJB 2QV4A 4J4KA 3U0PB 4WEBL 5F1OB 1ISZA 2CZFA 3F85A 1OYBA 1H0DA 1MFDL 3N2BA 1CR9L 1ZK9A 3DX0A 2F6UA 2AXGA 1Q8JA 3N25A 5EOCJ 2V3FA 4J35A 3QUYD 4H0HB 3RHWF 4WD0A 4XMTA 2Q6ZA 3CUXA 3H85A 4HNOA 2YBRA 3OKMA 5BVJB 4OQTA 3UAEA 3VXMD 4POZC 3TCEA 1ZPTA 2HG5B 1XZWA 3BJLA 3BPCA 5I1LB 2DN7A 4OBTA 5J5DA 2EDBA 5KW9L 4GQZA 1H3XA 3PWPA 1H5VA 4HWBH 2H3KA 2YARA 5CN1A 5JMRA 3M6YA 5BW7A 3D18A 4NC1E 4PUNA 4NAFB 3FU9A 2IQTA 3D4YA 2PURA 1WICA 1SM9A 4M24A 4MA1C 1P4UA 3MLSL 4OD2A 4U6HB 3VTMA 4HLJA 1PV8A 4NKIH 1V7AA 4P2OB 3ZKMD 3QZEA 2XA8L 4NRYB 1SQ2N 3WLBB 3BKML 3FPXA 1P5BA 4H6QA 1IBBA 2J57A 3IJSA 5AQ0A 3PUGA 3DJRA 4KKQA 1RUKL 2BSED 3AU1B 3D69A 3TJHD 1YYLL 5HGHA 4AGPA 2WCSA 1D7KA 1M7PA 3DIPA 5EMJA 3TN3A 1Z3RA 2OZ4H 4OY9A 2FPYA 4YVNA 4MXQC 4PRIA 4PAZA 1FNSH 3SCNA 1OCZB 4CVZA 1J5OL 1FWNA 4LCWD 1IGCH 1ID5I 2W1NA 3DX3A 3J2PA 3AISA 2JKLA 3VNZA 5E9DB 3C60D 4K3ZA 5FF0A 2YD7A 1A3ZA 4LF3B 5EH1A 4BUGA 1HKIA 2DWEA 3LA4A 1OP3K 1VESA 4HG4J 5EUKB 2X4NA 3UO1H 3BMVA 3REVB 2NDFA 3OKOA 2VLKB 2NY3B 3L9YA 4O2CB 5C6TH 3BK0A 2QFPA 1RSCA 4WOQA 1C93A 2VDRL 5E8PA 3WJJA 3HBLA 4G9DA 4GZJA 4OR1A 2XY2A 4GRWH 4QTHB 5DJ0B 1XMWA 2WXLA 5B7FA 3WCYA 3A5VA 3URAA 3HNVL 5LCVL 1PAMA 1GNXA 5HHPA 3B3IA 2F54E 4JANA 4D2NA 3TJLA 4K3DH 4UTBL 2NXZC 5F0LB 1TMLA 4TNVF 2NNRA 4YHKH 2AKMA 3GS0A 3EYFA 2ZVRA 5HNUA 2PPFA 3FDWA 2HXTA 1ETA1 2BINA 4FG2A 2V82A 3EIFA 5D2LF 1P7BA 3R10A 4MRBA 5D5ME 3KLAA 4WU5A 2VJ0A 3TYEA 2E6JA 4HULB 3T09A 2XTJC 5E2WH 1ECQA 1TKWA 3PABA 3N12A 1PWMA 3QPQD 3D9AH 5TE4H 5KYYA 1U8JB 3V10A 5JBEA 4PCFA 4NKMB 3LEVH 2ZT9C 3IANA 4H6RA 4D6JA 4JRXB 4XNDA 1GPWA 3ISRA 3GB7A 4LSQL 1H7RA 4O02L 4FQXB 1OVDA 1YEEL 1KPUA 1LO3L 4FHAA 4WWID 1LP9B 2E7MA 4ZO7A 3HC0A 5GRZA 5GS1C 2CIKA 1D7CA 3PWNB 3VGBA 3LNGA 1AMKA 3M0KA 4G1NA 5XIMA 4D6HA 2CGRH 2CXGA 1THAA 2F2HA 2BLFA 3E80A 3WMQA 3CL7A 1KM5A 3KNBA 1UWSA 5C0EB 2X9ZA 4AZCB 2VX7A 2DT1A 4O1BA 1Q6DA 2WXHA 2A1YA 1XDLA 2BNQB 4HJSA 4TTDD 1DBTA 3SE9L 5FYKU 1SSGA 4FNQA 4ZAKA 4K7PL 1UCBH 4IBYA 1I2RA 2ZP9A 4GCXA 3QTPA 5HANA 1TJHL 5C2BL 4U1LA 5FXCH 2CBJA 1L7IL 1E28B 2A9BA 4JHBA 1U8PA 5GS0C 1QHZA 3S47A 2AQNA 1DVZA 3MTRA 1WZKA 5C09A 1OGBA 5E6IB 4M62H 5DD3H 1XYCA 2HUEA 2GJZB 3OB0K 1WF5A 3SY0A 5MENE 3CQ0A 1R3IL 4UFIA 3HMWH 4NCC1 1EGMA 3ME3A 2GI0A 5GGTL 2AJXH 3FU0A 3W11C 2G30A 1T8QA 3V75A 4AISA 4G3YL 3OQRA 2EO7A 3QISA 2Y2YA 3QUKB 3FFOA 4KK9D 1CLOH 2J6EH 3NIDE 3CVHB 3KBEA 4R8WL 4BCYA 1XHGA 2BOEX 4Q7BA 4Z77B 5HVHB 5C07E 4HNVA 2VLRD 2DQCH 3N91A 2CBPA 4FFWD 5KYWA 7PAZA 1YW1A 3N34A 2VDKH 1FAKT 4K3DL 1RULH 4Y8EA 3PTQA 2JB5H 3TWBA 2Y5JA 4FYTA 4I9XA 2BXVA 3DK0A 1CG9B 3FBKA 4BK5A 4J23A 4ZSOA 2GQ8A 4NWUH 3DX5A 1IT7A 2CZDA 1XYBA 4H8VA 1FNSL 3UACA 3N42F 3V0VA 3DPDA 5SX5K 3AICA 4DWSA 1WD8A 1O0VA 2ATKB 3BWUF 2HXAA 3IS1X 2MOVA 4JE4B 2DZXA 2NY0B 5CU5A 3NIGB 1KV8A 2W66A 4AZBA 3K2IA 4FYRA 1QO3B 3KYMA 4Q4SA 4DSYA 2ED7A 4QS6A 2H9GA 1FDLL 4R0LC 1RK1A 5KSVB 1WAAE 4UTTA 3C2RA 4N3TA 3ZYJA 4DCQB 4QHLB 1GKOA 4L37A 4UT6L 3CV6A 5AYXA 2ZG2A 1K02A 5I1CH 3GEFA 3CU1A 1HT6A 2F6AA 2X41A 3FFCD 4KXCA 3VNYA 3TE9A 1Q9KA 2VD8A 5CHNA 5GRVL 5GS0H 3HPAA 1HI6A 4EZMA 3ZRCC 1F4WL 3EYVA 2VLKE 1EJUC 3ARDB 3BZFB 4M8UA 2XG5A 5BZXA 5HI4C 5D02A 2CGZA 1MYRA 4MQ7A 3TPUA 3TP4A 1FKWA 2A9NL 3PL6C 3GSXA 1BGXH 2RA1A 4N86A 1NAKH 2YIHA 4ML4A 3MRNA 4K8RL 4PV9A 4BUHA 2V0AA 1JZ8A 1RCXB 4S0TD 2GJRA 1LO2H 1OWQA 4Q33A 1TG8A 3T40A 1V10A 2G75B 1R30A 2BMKA 3ES8A 3R1GL 1GW6A 2VSDA 2D2CC 5EN2A 3WIAA 2V37A 1FH8A 2RD0A 3ARUA 1P6AB 4KF1A 2I32A 3VNDA 2WXJA 3O3BB 2I16A 1LL7A 4CCZA 3MV9D 3CL8A 4QAWA 4G8EA 3TNMB 4W7WA 2CH8A 1FWJC 2PGRA 4PJHB 4MKMA 1KYAA 1A25A 1S7XA 1MCWM 1TZIA 3FFDB 3LSOB 3OWEA 5GRJH 3DDGA 2YA2A 3BMWA 4PUKA 4AMKL 5AB3A 5K1NA 4MNMA 4BWLA 3LCWA 1BYCA 1QYGH 2XN9A 2EKJA 3E8VA 4U1NA 1F58L 1ZE3H 5KVGH 3SBRA 2HG5A 1DVXA 4XP4L 4MUPA 2J4WL 4HIXL 1IGYA 4DPCX 3NK3A 1B1YA 4KI5E 3L6FA 4P23C 3KUMA 4QLKA 2APVA 1L7TH 4WENB 3VFGL 4IIFA 3BZ5A 2YAMA 1HXMA 4PRRA 3BW9B 3S3CB 2OQYA 4WFGD 2V5DA 4NAFA 2EP6A 4WWOA 3SDAC 4DVBA 43C9B 1HAWA 2X87A 2LU7A 2XIIA 5LBSL 2R1LA 3BW3A 1KR1A 4S3DA 5AW6B 2ARJQ 5D1QE 2VR5A 4ZAKC 1HILB 2DYSB 2NUPA 5C08D 3UP1A 5A40E 1SO6A 4L9DA 1VIZA 1QW8A 4XPHL 3QZAA 5E5MA 1AE6L 1G9ML 1ZMYA 2DM7A 4X9YA 2XBDA 2PE4A 1J5IA 4HCHA 1VKXA 3IGAA 4DP5X 5SWSE 3TBVB 4TMPA 1A4AA 3C6LC 4KROD 3CSFA 2EH8L 3DRQA 4JIRA 5HY9B 1G1OA 1Z8AA 5C6PB 3WG7B 3BZJA 1YY8A 2WCAA 4R90L 4P5RA 3LH9A 5K9CA 2K6YA 1ZTXL 3HFML 1EGJH 1E2ZA 2LT9A 4M6OL 1JZHA 5FK9A 4MHHG 1TFPA 3BQ5A 5JA8B 2V2XB 3QWOA 1HZKA 4D6EA 2GCYA 3L3HB 4D8LA 1WIUA 4Y2OA 5IHLB 4HSQA 2AITA 4RAUA 1REIA 5EMYA 1DVUA 4GG6E 3EUDA 1IAIL 4B3LA 3NL5A 1TA3B 4JQ3A 4MLJA 5E24E 1I8KB 2FHCA 2UWEA 3VXQB 3GDCA 3GMLB 3R0DA 2GVYA 3VSTA 4OFCA 1NC4D 3DYPA 4N8CL 1SZNA 1Y18B 1IM9A 3ULSA 3P2BA 4J3TA 5I1JH 2VCOA 3BO8B 4GW1A 4I88A 1U5HA 2FEJA 2F9RA 4K1WA 1EH9A 2XDFA 1RFDH 4LHJB 3MCNA 3KCJA 3AWGA 4O54A 3QIBC 3R8RA 1HH6B 3CZSA 1UIOA 4OCWL 4OD3H 4R3SB 4UCGA 1QAPA 4P48A 2PTVA 3OJ2C 4MVBC 4UB0L 5CINL 5HMSA 4OFPA 1W5PA 3QEQE 5HK4A 3VNIA 1IAMA 1POJA 3OM3B 3C6LD 4KROC 3S2MA 2VZ1A 3NQ6A 4HUKB 1GAFH 4TSAL 4DGYL 3EWDA 1TNNA 3MUHL 2J4WH 1E6JL 4HIXH 2ZUMA 2I9LB 5FYLD 4E3TA 2P46B 4UT7H 5FAAA 3QWNA 3A6CL 3VGEA 4HOWA 2WLKA 4Z5RB 2HEJA 4IOSD 4Z0XA 3EJYD 2JCCE 3P93A 6ALDA 2DEXX 2ITDA 3UJJL 3PHAA 1RZ8A 3B9NA 1KPUB 2G0LA 2Q87A 2W92A 4MJ6B 2XWXA 3TBYB 4MAVA 3R11A 3JZEA 2GSMB 3NO5A 4X5RA 4R8WH 1JCMP 3Q58A 3GPEA 2OEJA 3GNPA 1QBLH 3UBHA 4Z7VA 4POCA 3LD8B 3TVAA 3VWJA 1ZT1A 2YPLA 4W9JC 2ZTKA 3RMJA 4F2EA 5C0EA 1MSPA 1P84J 4L5ZA 1EZUA 3MUIA 5I02A 3CE1A 3COOA 4PJIF 5HUOA 4XHJC 3F4CA 3HE7B 6FABH 3GFYA 2Z34A 1RZPA 4FFTA 5I6XB 4LHUD 3GDKA 4DJDC 5ECUA 2FGZA 2ZKHH 3ARYA 3M7FB 1KTKE 4ZAKB 4KRMB 5DJ8A 1FFRA 4GSXA 5I1DA 4O19A 2QJGA 4P5UA 4X63A 5IROA 2HUHA 3DX8B 3NCMA 4JFOB 4AC4A 3K13A 4Q4PA 4PMEA 2OGJA 3C6CA 4N2GA 5B7MA 3TT1H 3X3GL 4QR7A 1XZ0B 1HDMA 4PJGA 5FJUA 1M42A 3BVDB 4ZB2A 4ELDA 4Y1AB 2WKOA 4RFEB 4W1TA 4F2MB 2AXFA 1RJYB 3PM6A 3N1MC 3TW6A 3M0XA 1HNFA 3PNZA 1H3VA 5DJCA 1NKRA 3AU6A 1FLRH 5I09A 3U82B 1BXNA 5EYWA 4L4LA 3QH3A 3MA7B 4K5PA 1YEDB 2EH8H 3ZTEA 4ZX4A 2NQZA 1DL7H 1LL6A 1EDYA 1AI1H 3D6GA 1V3MA 3LPWA 1XIWB 1TE6A 2JKEA 2HKHH 3F7VA 4ZS6C 4OE7A 1AI1L 1FLTX 5C9RA 1KB9K 2EE2A 3DSNA 4RGNB 2A74A 1UM4H 4OJDH 4HPOH 1T21A 3U6RA 4F33A 3FZUD 2ATKA 3NUKA 5DJYB 4ZNCD 4NKOA 5EORH 3MDJA 4BQ9A 1QA9A 4IJCA 1AY1L 2HFGL 4RVBA 4ZOCA 3UG8A 3D25A 4JFFB 5ELIA 3US1A 3FYPA 3VWKA 4JTTA 4P8XA 1D9KD 2TAAA 3QUXC 5K9QI 1CUOA 4J3UA 5FJPA 3K71B 4POUB 4L4TD 5CP7B 2ZDSA 3P3BA 3SPVA 4R6UA 3UADA 2ZQKA 3JR2A 4O0ZA 4NQEE 4Q2ZB 1R3KB 3CXHK 4G43B 2E6FA 2FMNA 3SSJA 2ZWNA 4M1CD 3MYOA 3PN8A 2OAAA 2DWDB 3E2HC 1BHGA 3L45A 4HSCX 4GZEA 4TULL 4M6VA 5DWPA 3S88L 1P84K 2G5UA 2WZPA 5E1GA 2DEPA 4DP9X 1GS7A 4DUVA 4JN7A 3I6GA 2WKLA 4PGLA 5DCCA 1HI6B 4CEUC 4XAPA 5ABEA 2TSYA 1T7XA 3S2LA 5KETA 3TYCA 5KYXA 4NYLB 1XSIA 3PREA 1YC7A 3LHPH 3P3UA 4YZWA 3MFGB 3QRHA 3EJTA 1M1BA 1FZKB 5DO2D 5CG7A 1T7WA 5DHVA 2KS0A 1UH2A 3D08A 2Y8KA 4J3OG 4IKIA 4P2QD 3RPIB 1ONEA 3LXCA 4Q6XA 1NQKA 2CKBA 4Q56A 2WMIA 4YL9A 1BQHB 2Y25A 3HRPA 4J4PA 3L8QA 2EVGA 4MNQB 4GC4A 4AVHA 5CAYB 1I82A 3GXMA 2YGPA 4PCKA 1DTNA 4FXRA 2JKPA 4XR8C 4G8FA 3FRUA 1Z9SA 3KS6A 2PZ0A 1QBLL 3PLYA 1X96A 3V6FB 4R4NC 2N7AA 2OJEA 1TQUA 1JK8B 1X5ZA 4XPBL 4G5ZH 1HJWA 2FEDD 3AFLA 2UWFA 4WY7H 3FPYA 1E4IA 4GFSA 4N2LA 5D8JH 1NKGA 3VACA 4WUKH 1WXYA 1ZGLA 5DRCA 3MRBB 4WRLA 4Q7IA 1NEUA 2C9PA 4PJDA 4PGBB 1DLFL 3AGVA 4JOMA 4WDUA 5AZ1A 4C7FA 4GSUA 3CDZA 3SE8L 2JIXA 4U3CA 4APQD 2F8OA 1J9RA 2IDSA 2AAAA 4JEJA 1MLBB 2VMEA 2CBOA 3D2TA 3L6FB 1CBJA 3PGDA 2E9IA 5E8OB 3T5WA 5IQ9B 1M41A 1U3HA 1QTWA 2QFRA 3WIFA 3TV3L 4KXZI 2BGNE 1TFHA 4UM9A 5CJ5A 2PDLA 5DUBB 4WR3A 1R3LB 4H8HA 4KEZA 3VOFA 3F62A 1UB5B 5J1TC 2NUTA 4BWLC 1NCNA 3VJ6A 1S2UA 1H3TA 3D4GA 3OHXB 5BS0A 2DZAA 4KVCH 1B31A 4M82A 2NUPB 2HJFB 3K6IA 4C4UA 2FR4B 2X4TA 3UPBA 2CPCA 1D5MA 3WQCA 5IRPA 4IFOA 1UP2A 4YEEA 3HIJA 1JUEA 2TMDA 1U1UA 2VKXA 5HYJE 2WJEA 2R29A 4RDZA 1GQKA 3OQEA 3ZJ8A 5JIHA 2DP3A 1F4AA 2IQAA 1JZ4A 2VCAA 3HLAB 4YTSA 3FK3A 3MXWL 2X88A 2QULA 3DIFB 3MNDA 3G8RA 4Y6GA 1IGMH 3I6LE 1U8HA 2OMYA 4I1NB 3HZVA 4S2BA 1ISXA 3C0QA 4P2OD 3HZKB 3WFEH 4ZXOA 5ABDE 4X3ZA 1EO7A 1IKNA 1N7KA 1S9VB 3L5IA 3RI5F 1ME9A 3KBVA 1ZS8B 4M7JH 2E7LC 2LFEA 3WTUA 6REQB 4F9PA 3GMLA 1OPGH 3TASA 4PP1D 2D20A 2IH9A 1YX1A 3C2EA 2YJLA 3BZEB 3OGCB 4UTWA 4AY8A 4G11A 4EVZA 1CLOL 4D6DA 1Z2KA 1T1XA 3LZ5A 3QT2A 9XIAA 4EPBC 2HT4D 2OM5A 4QHNB 2GSEA 2IPKA 3BH9A 4KJPD 5DQDH 3SE4A 1ID2A 2IQ0A 3V6ZA 3D6NA 3J27A 4FYSA 1BZQK 3BKCL 1RZIB 3GK0A 3QR0A 3WQDA 1J6PA 5C6MA 1DVJA 4BZ1L 5AAWA 4ZFZB 4CMMA 1O6SB 4MD5B 4DUOA 1MCWW 3IDGA 2F61A 1MIEL 1R9YA 1TZAA 2ZXBA 4KX7A 5L4FA 2OMZA 3EH4B 4PWHA 5EF2A 2BZCA 1O5QA 4JZJB 1CTNA 1T0MB 3FB8B 3RHWK 3AJ7A 2J74A 1IEXA 3TC9A 4LNVA 1LDPL 2F19H 3QO1A 3HLKA 4NO0B 3T7VA 1XR2A 1HE8A 4YHOL 4TN9A 3W7QA 5IHZA 1KV5A 1A21A 1I85A 2N1TE 4Z0XB 5T1JA 1FYHB 3BOVA 4WO0A 3F04A 2R0KH 4V1YA 1FWWA 1HL5A 5T8GA 5TGBA 4A7GA 4QSHA 3UZQA 1DJYA 2A73A 3RE0A 2B1HH 5C0JB 1KM2A 1FWDC 3LKRA 1SDDA 1Z5LB 4X7TA 5FM8A 1XGUA 4CC4A 2W0PA 1U92A 4KVNL 3MYPA 1LVEA 2B8OT 4GUPB 4X4YB 1ZSHA 3TBCA 4DJED 2MIZA 2W07A 2EG6A 1JNNL 1OE2A 4JFFD 3S1VA 4Q9QL 1JGVH 4A68A 5I5RA 2J7DA 3ITOA 3MSDA 1W72L 3RGVC 3WFCH 5I74C 4D0BB 2ZWYA 4HS6A 4HKBA 1VBJA 3USBA 1KSRA 4AJVA 4JGMA 5FX3A 3UMTA 1BQHG 5H4YA 3EWXA 3CPRA 3A3WA 3ZTNH 4I3SH 3S3GA 1UGNA 3WD1A 3B7UX 1OCNA 1E43A 2D3JA 1TJGL 3DURA 4I48A 3SKOB 5I1DB 3BVXA 1CLZL 1OAQH 4HIHB 5ALCH 4LCCB 3G5YA 5AVWB 4K3HA 2KZHA 5GS0L 1JPGA 4B9PA 3Q1SL 3Q0HA 4PY7B 3O8XD 1HS6A 2WXQA 4LHUA 3NM1A 4OT1H 4E8CA 1KNOB 3WDRA 3U46B 3NFNA 3GPSA 3H7LA 3FSTA 5HJ3B 5LGJA 1QNRA 4NAEB 1PCSA 3O8XB 2ERJC 3IJHB 4DNMA 1JGDA 5I5IA 3CMOL 5A43C 3RL1B 3GC2A 4H0LC 2AK4B 2VEMA 2MQ3A 2FUQA 4RDBA 4AQ1C 5J3HD 5CD5C 3BP6A 5EEYA 5IW1A 5K59E 2QIWA 3Q6GL 4KCTA 2J20A 5SX4H 1MW2A 4NAJA 3SZ6A 4AYFA 4RDWA 3MODH 4YXKH 5H1WA 1AJ7H 1XIEA 1XFBA 5DJYA 5AOJA 2YUXA 1QLEH 1IE7C 2YZ5A 1NJ9A 3WMBA 3UP8A 1GORA 3P4NB 3LG3A 3T6QC 3GAYA 3HR5B 3MN8A 1EO8L 3E2SA 1ADWA 1I7TB 3GFUA 5CPMA 5EF0A 2GUYA 3CVHH 1O5XA 1QSFB 1LO5B 1N5AB 3W5MA 4MJZA 5HR6A 3H2FA 3SPVB 3TMQA 1G7JB 3HC3L 1JTOA 4OI9A 5F8QC 4JW3A 4AQ8A 5IBUG 4FABL 4ZNEE 4B5VA 1B0GB 4N26A 4DM2A 1QPNA 4FTVE 2IPWA 3BPLC 2W5FA 1T20B 2YGYA 4N8VG 2ATPB 1MZHA 4NZCA 2HROA 5JPNB 1LORA 2PPCA 2ARJB 1PZCA 5F1IA 2GQAA 4U4IA 2FWUA 2I27N 2CU9A 4JVWA 4APQB 1UW9A 4A7VA 1Q8AA 1T1WB 1FNAA 1ZCRA 4PJ9A 4IKLA 4HT1H 4IMLB 2IOMA 4AUJA 1E1CA 3DGGB 4LKCA 1JGVL 2WQUA 1VPQA 2H3XC 3EDEA 2AMXA 2WXMA 1O9WA 1OCWL 2YLAA 4GRWF 5E2WL 4B5ZA 5KYXB 3DU0A 4Y5XA 4GKTA 2C9XA 3EGSB 5H2BB 1BJ8A 2LVEA 4MQXC 4HKZB 4PRDB 5D7SL 2FQIA 3GHSA 4PFMA 2F19L 5DHVB 3NA9H 4J1OA 4Q8WA 4F48A 1XCTB 2W60B 3RPIA 3I3EA 4MDJB 2XWBB 4CD7A 4FGMA 1BG4A 2YB1A 5HMFA 3FFCB 4FQ2H 3D48R 1BQHA 1S3KH 3TH2T 3T77B 3EGJA 2P24B 1BZOA 2WQRA 1RVKA 1F86A 1EDGA 2OQLA 1SNRA 2LV4A 3EBIA 1KR0A 3LUTA 1EOKA 4QE4A 2BS71 1JDDA 4AV4A 1RZ7L 5EB9A 1SPDA 3S3SA 1B4RA 2R2EA 3ZIYA 4Y96A 1UB6A 5DYOA 4QLWA 2A6KB 2PWDA 3EXSA 1JV5B 1FE8L 3ZUNC 4OCNC 5TFSH 3TC6A 2J1WA 3FRPB 4AKPA 4OVUA 3MWCA 3CHXA 3RB7A 3TXVA 4LMQE 1BRLB 3MJYA 1Q2SA 2PYEB 4C6FA 2ZCKH 4NQSB 4YE4L 1TPFA 3PNRB 3NH7H 4HFWB 4M03A 1ZL1A 5CLXA 2FZMA 5FJIA 1MWAH 5D2XA 3Q5YA 4TXEA 2NY3C 3QPXH 1QEXA 3CDZB 3KCWA 5I1GL 3QWQB 5IQOA 3PYCA 5E1HB 4E5XG 3MV9B 7CGTA 5AL8A 3T0ED 2EF9A 2VLRB 4RKAA 1VJZA 4HUCA 3F1QA 5JW3L 1LRQA 2EABA 3C75A 2QZRA 1WKEA 1A5OC 1Q3NA 1XIIA 2GB2A 3H8NA 4ZFOA 5BVPL 3LZ3A 1RUKH 2WMHA 1AFSA 1UWXK 5I16B 1I8LC 1MRFL 1MZZA 4MXVF 4O5LL 1H5BC 1OM9A 2IFFH 1SUXA 1TE1A 1G5GA 4ZJ9A 3EX1A 5TPWL 3GLZA 3DX6B 1P4LB 5EIIB 3R18A 4PVMA 3C2AH 5ID0A 3SCUA 4LYKA 2P76A 3MV7A 1TZ9A 5GZNA 1KYOK 4J1UA 2EYSA 3SFKA 1JVLA 2H8ZA 2XWCA 4MDIA 3ZQ9A 2CWNA 4AEHH 3VXSD 1TO5A 5D8JL 4GG9A 2V17H 3H6AA 5IJVB 3CLWA 2CBUA 3MHZA 1BG9A 3MV8D 2X05A 2AEQL 1ITBB 3V4VH 4C56A 2YFOA 4X5WB 2P10A 1L2UA 2PDCA 1KTLB 3RIFK 2ZZ7A 3IDMA 4GBUA 1WEJL 2NZIA 3N6YA 4X4MA 4L4VB 2Z2BA 4S1FA 3CC1A 4IBVA 1JTTA 1Y1UA 1D6VL 1EEYB 3QFJB 4MB5A 4QRUA 4NZTH 3OOQA 4NZTL 5T9CE 3D4CA 4D9LH 3EYQD 4MTMA 1UA3A 3NJIA 3J7HA 1IBZA 1IC1A 2IDTA 3HGSA 3H2CA 3KW7A 4QY8A 4LCIH 4PCYA 3UR7A 4ENED 3BP7A 1XYAA 5GVJA 2YPIA 2PWGA 3FYOA 4OLXH 3FXGA 1IGFL 4RFNC 3WNLA 4F37K 2XNAB 2COQA 3ARGA 3QQ4B 2YPVA 4ZFFA 3PWUB 5EO1A 2XFXA 3VCRA 1A7QL 1UQSB 5D1XB 5H94B 3V6ZB 1IR2A 1ICQA 4HGWB 4GAYA 3Q9QA 5D7LE 2V7HB 4NFDA 3GSWB 3KL0A 2YXFA 2J7CA 2VGFA 1NWRA 3W7HA 4XZBA 3CZLA 5AAMA 1DSFH 3BZDA 3TEYA 2YUVA 1A6AA 2FJUB 2IXQB 1HH9A 4DKEH 1OOWA 5AENA 4FZIA 3ZE1F 4CNOA 5LO7A 1UKOA 3AYVA 3XINA 3X14B 4FZ8L 1T5XB 5DBTA 5HDWA 2ZKMX 4JR9H 3C60B 3VG0H 1JDEA 2ATSA 1P7TA 5F70A 3QO1B 3WSUA 1NWPA 3RZCB 5GHWL 5K4ZA 5EG6C 2WBGA 1JCXA 2V5KA 3QJTB 1TT6A 4JO2L 4KKAC 4ZSOE 3UBFA 3CDYA 3ZDYF 2NZLA 3WH5A 1DQJB 3ARQA 2YGQA 5IHWA 2N7SA 1EXHA 3KBSA 5M2FX 4F5CE 4KPHH 1YPFA 4MMXA 3BG3A 4HBQA 4WI6A 2ZUTA 2ZRWA 1P5UA 2Z9TA 1MHCB 1UM4L 3OG6B 5AZ2H 5JH2A 1JWSB 4RE3A 2JKTM 3BESR 3BG9A 3QM3A 5DWUH 3DAQA 4KMLB 4Y4KD 2YPKB 2QQ6A 4GIYA 1JHKL 2C7FA 2JKWA 4A04A 3LNMA 1HQTA 2DLHA 3VQ2C 1EAOA 4JQIL 1TLMA 4MRCA 1VCFA 4EAYA 4JY8A 1I8MA 1SJXA 5CGBA 2YL9A 3KAOA 3CMFA 3HZ3A 3TN6A 2DQTH 2IIJA 3DMMD 2OR9L 2WB7A 1AR1D 3MV8E 3OZMA 1FYTA 2ZX6A 3M8OL 1OF0A 4FLHA 4NQXA 3DC8A 5JNYA 3SGGA 1KYDA 1JIBA 1VLIA 4OUIA 5J57B 3BCFA 2VDLL 4JG1H 2X1XR 2ZF9A 2A9AA 1EJTC 1A3RL 2VDIA 2F8XC 1YUHA 3AU1A 3D69B 5IMMB 3MLVH 4WW2A 4HHHA 4TLSA 1AAJA 3ARDC 4KK6C 2EUZA 4Z7VE 2BV9A