1PIFA

Pig alpha-amylase
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENVVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAISSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCNVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAQDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE
publication title Carbohydrate and protein-based inhibitors of porcine pancreatic alpha-amylase: structure analysis and comparison of their binding characteristics.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 170
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pifA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pifA01
5CXPA 3SCTA 2D0GA 4HZ6A 1KFWA 4FLOA 1UKPA 4KGLA 1J10A 1HKKA 3ARSA 5A6MA 3BUQA 2VVSA 2XFYA 4KMQA 2OW7A 1FA2A 3BUDA 2G8ZA 3VD4A 3AZSA 2X09A 3WQ8A 3SURA 3HU7A 3K8KA 4F8XA 5HBFA 2VCAA 2YIHA 4A3HA 4ATWA 3LPFA 2QPUA 2GVYA 2FE0A 3SUVA 4W88A 1WDSA 5C71A 1UG6A 4N42A 4TVCA 5AC5A 2YLAA 3MO4A 2W66A 3WNMA 3LPPA 2EJ1A 2WHLA 4PTVA 3AS3A 2W63A 2DSUA 3VIGA 1XCWA 3PZIA 2CCRA 4OOZA 2DH3A 1JD7A 1W9PA 2ZUNA 3WD3A 3HN3A 4PSPA 3WELA 3W6LA 3WDIA 1H1NA 3L4YA 1W1PA 1B3WA 1VEOA 1BYCA 3BSGA 4RE2A 3T0DA 2CIPA 3WY3A 4UR9A 1AVAA 3RIKA 1W2VA 1DHKA 3PZMA 1Z32X 5HDRA 4AW7A 1QI3A 1E73M 1C3FA 4TX6A 1PEZA 4AZCA 3VDCA 4AISA 4JZ5A 1MW1A 1ZJBA 4WKFA 4D72A 3B9AA 3AICA 3DDGA 1SMAA 1XH0A 4PEEA 4CKQA 5DT5A 2XFFA 2J7GA 1GONA 2VNCA 1D2KA 4FLQA 3AIBA 4JL2A 4PUDA 4M82A 2CNCA 4OZOA 2Y8VA 3WUEA 3LXAA 4WSKA 1XHGA 2VCCA 3L4UA 1D7FA 4N0RA 3PZNA 5A8MA 4W86A 4NZFA 1J0ZA 3VIHA 1V3KA 3PZQA 3AHZA 5TD4A 5A1AA 2HVMA 1E6RA 5CPQA 1WDPA 2XN1A 2GFTA 2DSVA 3W6MA 3OGSA 2OSXA 1TA3B 2OWWA 2CPUA 2EPMX 2ZOXA 1KR1A 3G6MA 3W27A 2J8GA 2BVTA 4AZGA 2VR5A 1E4MM 4UQBA 3SCRA 3RO8A 2WMFA 4AD1A 3T0BA 4TTUA 1E9LA 1MYRA 4C7DA 1OD8A 8CGTA 3S2CA 2WHKA 1EO7A 1R7AA 4MAVA 4NRRA 4E2OA 2XSAA 1EHNA 1G5AA 3LRMA 3WL0A 3LXBA 4M56A 1VAHA 4CCDA 1C8XA 1J12A 1OD0A 2CXGA 2EQDA 2QPSA 1V08A 3IANA 2ZIDA 1OGSA 3MU7A 2F7QA 3II1A 4EE9A 1PZ2A 2A3HA 4LX4A 5BRPA 4AEEA 1KGXA 1LWJA 1UR8A 1Q4NX 4NXSA 1OIFA 2QLYA 3CHDA 2A3CA 3AMCA 2EPOA 1FH9A 4D6CA 2ZXQA 1OIMA 4NRSA 3CZEA 1B1YA 5E6YA 5A2AA 5I79A 4WLCA 5HPCA 1EO5A 3ZT6A 1ZB5A 3WBAA 2BHZA 1BVZA 4CN6A 1FFQA 1JYNA 1GOMA 1VBRA 2PBGA 4LGXA 3VIMA 5ABGA 2W4XA 1ZJAA 1M04A 3SUTA 1WAWA 4QCEA 3WUFA 2Q8XA 2X1IA 4Z2HA 4GO8A 4H8UA 4IISA 1J0HA 3LXCA 1KQZA 3FY1A 2WC3A 2UY2A 4PCSA 4AEFA 3AIRA 3CIVA 1ISVA 2D0HA 3K8LA 1J0JA 1QWNA 1CGUA 2G3MA 3WN6A 4NX0A 4J3WA 4D6IA 1IZKA 2QMJA 2ZUUA 1CXFA 2GUYA 3W0KA 4NXKA 3ARPA 3BAJA 3OZPA 3AYSA 5JBEA 2F18A 1J01A 5E6ZA 9CGTA 4MNLA 4OGZA 4MAZA 4B3KA 2VZOA 5LA1A 1QI4A 2ZWYA 4DO6A 1UD6A 2VO5A 2PWDA 1JAEA 1TQTA 2WANA 4GI9A 1QNOA 4UQ9A 4JKLA 4WJXA 4W84A 1C90A 3QR3A 4MTVA 4AZ7A 4TUFA 2PWEA 4OBSA 2DT0A 1DWIM 2ZXDA 4QP0A 3JUGA 1KTBA 2QHAA 4AC1X 5CQ1A 3OLGA 1JDDA 2ZUMA 4FNQA 2BY2A 3WD0A 1R85A 2VZSA 3SCOA 3W25A 1UZ4A 4UFIA 2VMFA 5I24A 2DT1A 3CZKA 1UD8A 1QI0A 3DYMA 1AMYA 3CUFA 3TP4A 4HZ7A 1CNVA 2WM0A 4UFLA 3F5LA 3T2PA 1E55A 3U5YA 4B15A 4MADA 3VIIA 1GVIA 3GYCA 2ZUWA 3ZIZA 2F1BA 4OIFA 1WCGA 2CKRA 1UD2A 4ZEPA 1E4LA 1OGBA 3PTMA 4BQ5A 3M46A 1KTCA 3MMUA 2WVSA 1W1YA 2A3EA 3RJXA 1GQLA 3BLBA 1SYTA 3B9DA 2JEQA 1DWHM 1HXKA 1MQRA 1CGYA 2J7DA 2O9RA 2CESA 1U2YA 1CECA 3UEQA 3T08A 3VU2A 2W62A 1B3ZA 2DSWA 4MPKA 4DUXA 3OIHA 1E3XA 3CUHA 3RM8A 1FP9A 3PBGA 3WNNA 1KBKA 1V3LA 3L4ZA 1CXKA 4J3UA 3WNKA 2UWFA 4FF5A 2VZVA 3VDHA 3AROA 2W61A 1MQQA 1FOBA 2W67A 5E09A 3WH6A 5FIPA 1TZ7A 3ZJ8A 3GH7A 1HL8A 3VVGA 4NSBA 1K9DA 1IT0A 4UQAA 5CSYA 3POCA 4GPNA 1TQUA 1K9FA 1W1VA 4PYSA 4DWSC 5CLWA 3SCQA 2VT0A 2WC4A 1ISZA 3VMOA 3LRLA 2ZX8A 3W37A 5CGTA 1JZ3A 4HPHA 4MB5A 2EPKX 3PZ9A 1E3ZA 1XYFA 1E0VA 2D1ZA 3AHVA 5CPSA 5JUVA 3ZT5A 1BTCA 3VX1A 2VTFA 1HIZA 3BVTA 1CIUA 4GI8A 3VGGA 1UR2A 3K4DA 1EA9C 3PZOA 4LXFA 1PIFA 2E4TA 5BRQA 4ZFMA 2WMGA 2WXDM 4LYRA 1TUXA 2PBOA 4FLRA 2WMHA 1LQ0A 3LRKA 1JXKA 3CGTA 1WKYA 1PJ9A 2VR4A 2AOSA 2J47A 3F5KA 4W7WA 1PX8A 1J0KA 3WF4A 1D3CA 5CJ5A 1OINA 1ZBVA 3W24A 1E6SM 4D1IA 3AMLA 3FXYA 2YKKA 1B9ZA 3T09A 5BCAA 4UNIA 2FHFA 2D2OA 2FH6A 4ZXLA 1MVYA 3A4XA 5F7UA 1MQPA 4S3JA 1R8LA 7CGTA 3WNPA 3PZTA 3IJ9A 3TTYA 4B9YA 2W91A 2WAGA 2OSWA 1GOOA 3WY4A 5EBAA 3SCSA 4AD0A 1E43A 1FH8A 5CGMA 1ITXA 4ZXOA 4URIA 5GQBA 3GZAA 1G1YA 3GXTA 2HISA 2VL4A 3MSDA 3WD4A 5M17A 1KCKA 2TAAA 4ZENA 3ZQ9A 3OLIA 2JF6A 1QWUA 2GJPA 4FNUA 3K4AA 4M29A 2BVDA 1BGGA 4QDMA 3GH4A 3WF1A 1Q6DA 1EOMA 4JAWA 4PUEA 3DHUA 1W9VA 3NSXA 1UD3A 2OYLA 3VGFA 1H3GA 1FHDA 1XC6A 3BVWA 3GNOA 1GZJA 5I78A 3AXIA 4RL3A 2XVKA 2BNJA 1AQHA 4JL1A 1HJVA 3WUBA 3VIOA 1LL4A 2YDQA 1M53A 1QNPA 3BAIA 4NI3A 2JALA 3OZOA 5DT7A 3W29A 3E1F1 4C7FA 1OWQA 3K46A 1QHZA 2WSKA 4FMVA 1JYWA 3IK2A 2WYSA 1HVXA 3W26A 3VO0A 2WHJA 2WMIB 3DC0A 5KZ6A 3FAXA 3ALFA 3M6DA 1EDQA 2XVGA 4WF7A 2NW0A 4B16A 5EMYA 1GOKA 3WQ4A 1VB9A 4TTGA 1OT2A 2PI6A 4H8HA 1V0MA 2YL9A 4W5ZA 2E9LA 3UG4A 1QVBA 4ACZB 4PTMA 3I3BA 5HNNA 4OOUA 4MNJA 5I6SA 4P8XA 3HMCA 2GJXA 3IJ8A 2UY5A 1J0IA 1CGVA 4KRTA 2X05A 3H53A 4PMRA 3OG2A 2E9MA 1UR9A 4WKHA 3FHAA 2O9OA 1WPCA 4X0VA 5E0CA 3AHTA 4P8VA 1UWIA 1EHAA 1BQCA 1K9TA 3GNRA 1XH2A 4CD7A 1JZ8A 1MFVA 3ARVA 3CUJA 5BXRA 3CTTA 5IHSA 1E1EA 3WMCA 2ZUTA 4D6HA 3MUY1 1H4PA 1UWRA 2AMGA 3UR7A 1BSIA 3DX1A 3OGRA 4XZBA 2VQUA 5E1QA 2J7HA 2BV9A 3AISA 3RM4A 2ESCA 3BGAA 3MKKA 4PMDA 1PX4A 2J4GA 1UD5A 4J3SA 4DO4A 2J79A 2EACA 4KRUA 5ABHA 4ML4A 4H41A 2DH2A 1CENA 1V6XA 2GSJA 4OKDA 3KL0A 3F4VA 5D9OA 4AD2A 1C8YA 4J7RA 3QGVA 3WH5A 1GQIA 2BHYA 1FFRA 2ZX9A 3WF2A 3VGBA 2CITA 4DWSB 1UOKA 4XUYA 3QOMA 3EYPA 2VRKA 3GXNA 2OYKA 1B3VA 2VCBA 3SCWA 3T2QA 2EAEA 2X0HA 4AIOA 1CGXA 1GOQA 1KGUA 4ATDA 4IPLA 4C7GA 2JIWA 1E5JA 3GNPA 3ARQA 4WIWA 3G6LA 3PTKA 4LYQA 2EBNA 4HPGA 5CG0A 4R5EA 1VRXA 3GXIA 1KXVA 3HG4A 3EBVA 4HTYA 3THDA 2DIEA 1V0KA 3NSMA 3NUKA 4QLJA 5IDIA 4DM1A 3AS2A 3AS0A 4OUEA 1YQ2A 3ZJ7A 1B31A 2D20A 2PB1A 3BMWA 2EPNA 2O9TA 3ZR5A 3VSVA 2IUZA 2FYVA 2BY1A 4D6JA 1E15A 3A4AA 3RCNA 4MB3A 1X1NA 2BXZA 4MDPA 2PF0A 3A24A 4AIUA 3D3AA 3BUBA 4JFWA 3MUAA 4PRWA 1HTYA 1JZ4A 3ALGA 5GPRA 1E6QM 3WY1A 4CU6A 1JNEA 3CLWA 3MMWA 3PZUA 3BSHA 1ODZA 5IHRA 4W8AA 1CGTA 1EQPA 3DDFA 4UFHA 3AZRA 3B9EA 3QHNA 4H2CA 1UWTA 1HT6A 3W28A 4CU8A 4UZUA 2XVPA 2XN2A 4HU0A 1BVNP 1UR0A 4D6DA 4BQ3A 4BCEA 2Y4SA 1A3HA 4GZIA 3VIKA 3TOPA 2WSPA 1C7TA 4FLSA 1VEMA 2CYGA 3AMKA 5CPTA 1JYVA 1B3XA 5LYRA 1FHLA 4H8VA 3DX0A 5I5RA 2XVNA 2YFOA 3A3HA 2G3NA 3PZGA 2ZICA 4BQ2A 3GXDA 3NCOA 2WPGA 5HOSA 1BHGA 2XVLA 3K1DA 2G4FA 2BY3A 2Z1SA 4H7VA 2EABA 2XIBA 3UG5A 1M03A 3KZSA 4QLKA 3BCDA 3WD1A 3AS1A 3WDQA 1UUQA 3VIPA 3BAYA 4U3AA 3GBEA 3MV01 3W53A 4QAWA 1DP0A 1WZKA 5CLTA 5E0FA 4QFUA 4MJ4A 4WK9A 5DFAA 3AXXA 5FKYA 1E6PA 3EJRA 2QV4A 3TONA 2WKLA 1JFXA 3VNZA 1QOXA 3VOCA 1QHPA 1T0OA 3NDYA 4CU7A 1OSEA 3CV5A 1OM0A 3FAWA 5ABFB 1E6NA 2CHOA 4FNTA 3BAXA 4ACYA 4CD4A 2WW5A 3BCFA 4UZSA 3VD7A 3UG3A 1WZMA 3OLEA 4JFSA 3SUUA 2YJQA 1UKSA 3IJ7A 1EGZA 4Z2GA 2FHBA 3MI6A 4AYGA 2VUYA 5D8WA 5ABEA 3VM7A 3HJEA 3RDKA 1KCLA 1W3KA 1MWOA 1ZL1A 3FHQA 4JCLA 1HJSA 1W3JA 1R87A 2QMKA 4DUVA 3MSGA 1CGWA 3AMDA 2XWDA 1E0XA 3KEHA 3D4YA 2F7RA 3AZTA 4DUWA 2VX5A 2BFGA 4QCFA 3WDRA 1J0YA 3EDDA 5KEZA 3N11A 1UQYA 1BYAA 3ARTA 4A4AA 1GOIA 3WQ6A 1NM9A 3WY2A 3BC9A 2J7EA 1CZ1A 5D9PA 2F1AA 2ALWA 1R86A 2G41A 2WMIA 4IUGA 4YN5A 3UETA 4CVUA 1W32A 3U7VA 1V6YA 2WMJA 4U2YA 2WWCA 4M80A 1B30A 1EDTA 1E6XM 1SFSA 1XH1A 2JE8A 3WDPP 4UFKA 1V3IA 3W81A 3VMNA 4XZWA 1GQJA 5FOOA 2ZWZA 3A4WA 1QHOA 1NOWA 1HJUA 4D6EA 3MUIA 3KE0A 4ACZA 2YBUA 4ZE4A 4KWUA 1KR0A 3AYRA 4P8UA 2XN0A 2DT3A 1UH2A 1CXHA 3EJUA 3GBDA 4PMUA 1GQKA 4V27A 3A23A 2BXYA 2WZEA 3CZLA 2XPKA 4JFUA 1RPKA 2G3JA 3ARWA 3U7BA 1E1FA 3WQVA 1JFHA 1F4AA 1WNOA 1I1XA 3WH9A 1O7DC 3RILA 4AZ6A 1R75A 3CH9A 1TR1A 2X2HA 1WDQA 1CDGA 2VQTA 5A6SA 3THCA 1UKTA 3AXHA 1I75A 2OSYA 2XJ7A 3KLKA 4P7QA 2WKGA 1UH3A 2WHMA 2D22A 2GDVA 3VGEA 3VKKA 3AHXA 5DO8A 1ISXA 1VBUA 3VM5A 4HA1A 4NZJA 2CBVA 4FNSA 1Q6CA 1UWSA 1VEPA 4J3XA 5A69A 1O7AA 2V3EA 1KXTA 2JEPA 3ARRA 4L4PA 2V38A 4PMXA 1ESWA 5BXSA 4UFMA 3VUPA 1UASA 4FNPA 3LMYA 5M03A 1LJYA 3OGVA 1BAGA 2Y24A 4FK9A 3M07A 2ZE0A 2WWDA 5BXTA 5A8PA 5D8ZA 3H55A 2FGLA 5A6KA 4JFVA 4UOQA 2PC8A 3UCQA 5HPOA 4UTFA 1V6VA 2DSKA 1CLVA 3WEOA 4PMNA 3QOKA 1Q6EA 1HKIA 1BPLB 1JI2A 4PN2A 1JL8A 1BG4A 1F4HA 4IM4A 5A8OA 4UFJA 3WENA 1H0GA 5JIPA 2YBTA 1KWKA 1HKJA 1E4IA 1KWGA 2XIIA 1B2YA 3M7SA 4W7UA 3I3DA 4YPJA 1JI1A 1GCYA 3SUWA 3WMBA 3ZJKA 1WE5A 3BAKA 2UY3A 7TAAA 1HJXA 4MDOA 3WQ5A 1CTNA 2XG9A 1PX3A 3AIQA 1I1WA 4FNRA 1UYQA 3NSNA 3N9KA 2YDSA 1V6WA 2C8NA 1LG2A 3S6TA 3LPOA 3D4ZA 4M24A 3RM9A 1E70M 1W9BM 1UA3A 3DYOA 2XWEA 3AFBA 3UERA 3FW6A 1BYBA 2VC9A 4BF7A 4Q7NA 2D0FA 1SZNA 1TA3A 4F9JA 4KH2A 1V0NA 1W91A 3MS8A 5JBFA 1VFMA 3EMZA 1CYGA 3HG3A 1NARA 3WH8A 3DECA 4OBRA 4MNMA 1E40A 4X0NA 2YL8A 3QHOA 1J9YA 3ZMRA 2VRQA 5I2UA 1JGIA 2BVYA 4AMXA 2F7PA 2VZTA 1JDAA 1YHTA 1HWWA 1ECEA 3EDEA 4HP5A 4XB3A 3VX0A 1UQZA 5BROA 4J27A 5FCZA 3EMQA 3DX2A 5AC4A 5A6BD 1CXLA 4MJ2A 4R27A 2WZHA 1KXHA 2F61A 5GNXA 3APGA 3UR8A 3POHA 3WNOA 1W9XA 3BH4A 1IV8A 5I77A 3L4VA 4W8LA 3CHEA 1MXGA 1PS3A 1HL9A 2XM2A 4JKKA 5FL0A 4AZ5A 4Z2KA 1MW0A 1HVQA 4B9ZA 2WVUA 2EPLX 1FH7A 4AIEA 2CBUA 3ZOAA 4GKLA 4JIEA 2A3BA 3ZO9A 3SCUA 3EDKA 2IXUA 1L0PA 1UR1A 4U2ZA 2F8QA 1QI2A 1CWYA 1PZ3A 1MW2A 1UD4A 4BQ4A 1C91A 1HJQA 4J3TA 5C70A 4DWSD 4CUCA 4E4PA 1GNXA 3DYPA 4D71A 3N12A 2OW6A 2E8YA 3TV8A 3L4WA 3IAPA 1K9EA 2JFEX 1W9UA 2CBIA 3CMGA 4WSJA 1V0LA 2XYLA 4P7NA 1C7SA 5ABFA 3WFLA 3WEZA 5FL1A 1NP2A 3HG5A 4GZEA 1X6NA 2DEPA 2ZX7A 4HOWA 1JDCA 4NZCA 3VNYA 1ODUA 1XD0A 2WNWA 8A3HA 3CZNA 1NWSA 2UY4A 3PTQA 4UOZA 2WVVB 1GORA 1H49A 4KGJA 3L4TA 3ZJ6A 1VFUA 2J7BA 1WZAA 3BVXA 1JG9A 4PCTA 2J75A 3FN9A 4ATLA 4TX8A 1W2PA 3ARYA 3OLDA 1U30A 3WUGA 2PWGA 4JKMA 2A3AA 2XHYA 3LX9A 4AZBA 1G94A 3WBEA 3NYDA 1DWJM 2ZUSA 5D9NA 2ZUVA 1TQWA 3AIEA 1MXDA 4U31A 5D4YA 2ZXAA 1FP8A 1UWQA 3EJPA 2Z1KA 5HXMA 2X2YA 1XV8A 4AYSA 4AXNA 4UQDA 5EFFA 3CO4A 1GOWA 5I0DA 4RE4A 1QPKA 3IGUA 4UQEA 1HX0A 2J7FA 2CKSA 4BS0A 4HOXA 5E9AA 2IGTA 3VD5A 2YA2A 3CZ8A 1DWFM 4EANA 1H11A 3T0AA 1O6IA 4TXEA 2XGBA 1S46A 5A6JA 1WB0A 3N04A 1G01A 1XSJA 1NP0A 3A5VA 1UKQA 1EH9A 3N15A 2AAAA 1JF6A 1M01A 3ARXA 7A3HA 1G9HA 2WCGA 1B3YA 2YA0A 2IXVA 1PPIA 4JHOA 2J78A 3IAQA 1N82A 3B8SA 1HKMA 5ECUA 2MANA 5A6LA 1US2A 2XGIA 3VDAA 2V3DA 1LL7A 2FH8A 2WC7A 4P7OA 3RPMA 2EXOA 1OT1A 4D6FA 1QW9A 1ISWA 3GXPA 1PAMA 2OYMA 2ZX5A 4W93A 1XRVA 4Z2IA 4JCMA 2PWHA 2RGLA 1Y7VA 3J7HA 3BVUA 2D24A 2BY0A 3BLKA 1E5NA 3W38A 4P7LA 5A94A 3VSUA 5D9MA 1RD6A 3VILA 3D5HA 4E8DA 4F66A 1CXEA 5E70A 4U5IA 5IXEA 1DWGM 3KWXA 5I3DA 1VF8A 2BS9A 2WLYA 3CUIA 3F5JA 3CZJA 4YHGA 1UH4A 1GW1A 1GJWA 1C92A 1GPFA 1JNDA 4TVUA 2O9PA 1EQCA 2VVNA 1NWUA 2CBJA 1TE1A 1W1TA 2X2JA 1CLXA 2CERA 4PTWA 2XFRA 4GXPA 4Q22A 5GNYA 1DEDA 4CGTA 1XSKA 4AD5A 4GQRA 2EEXA 2Y2WA 1BF2A 2V3GA 3UESA 5A8NA 3ZR6A 5AYIA 3ZSSA 3SUSA 5DEZA 2XSBA 1J11A 2CETA 2QF8A 5A3HA 2WCSA 4PSRA 1OCQA 3N18A 5JBDA 1HXJA 4B3LA 1RP8A 4EK7A 4LQ1A 4WKAA 5LA2A 5CSUA 3WDJA 1V03A 4BZYA 2WK2A 1V02A 1CBGA 3SCNA 1LF1A 3WL1A 1JZ5A 2WBGA 1AQMA 2WBKA 2GK1B 4TOQA 1JF5A 4P8WA 4HA4A 3WNLA 5BWFA 2PWFA 3RJYA 3GTNA 3EMCA 1B0IA 4MNKA 2DDXA 3ZT7A 4HU8A 3TA9A 3A6OA 1WZLA 4GIAA 3AOFA 4A3YA 3BUPA 5A2BA 4TVDA 4M1RA 2OWXA 5JIWA 3CHCA 1KB3A 1R46A 3DHPA 4S3KA 4EAMA 4CD5A 3WH7A 3WMSA 4AMWA 2DSZA 2E0PA 1EIBA 1NH6A 3ZM8A 1L8NA 1WP6A 1XSIA 3EJTA 2JIEA 3PN8A 1R33A 4ZE5A 4PMYA 4CN1A 3I3EA 1GHSA 2V5CA 3AIWA 3NJ3A 1CPUA 3EJQA 1Q6FA 4AMCA 4UQCA 2NT1A 4W89A 4LYPA 4AWEA 3WEMA 5BYWA 5C8BB 3QHMA 4XV0A 3CC1A 1ZBKA 2E3ZA 3MMDA 1H5VA 3CHFA 1TQVA 4GI6A 1G0CA 2GJRA 3A21A 2DGAA 3ARZA 2E8ZA 1B90A 1U33A 2WB5A 3L4XA 5I23A 1QBBA 3N17A 2X0YA 4JHZA 3TTSA 3BMVA 1BLIA 2B31A 3SCPA 1PIGA 1JZ2A 1DTUA 4PMZA 4NF7A 2V5DA 3U57A 1QW8A 3WIJA 5AY7A 3WQWA 3TTQA 1UA7A 3D51A 3WFZA 1WDRA 1H0IA 1V02E 1OBAA 1E6ZA 1QNRA 3L2LA 3OA5A 1ITCA 3KL3A 2Y8KA 4PTXA 3MANA 1E4NA 2GJXB 2WVVA 4DO5A 4GZJA 5IFTA 1EDGA 1H41A 3MUZ1 1TCMA 3GXFA 3WD2A 1H09A 3ECQA 5IFPA 4K68A 2YDRA 2OLHA 4QLLA 1NOFA 1XD1A 1VENA 1ZU8A 3WF3A 1NWRA 4MB1A 1KBBA 2XUCA 3TTOA 1DWAM 1QBAA 2WCAA 2OWCA 2VX4A 4OJYA 3AHYA 5A8QA 4XX6A 1V3MA 1W9DM 3BAWA 3VD3A 1W3HA 2V3FA 3SEPA 3VPLA 1EXPA 1TMQA 2VURA 4GINA 5BXPA 2BHUA 2FGZA 6CGTA 1W3LA 2G3IA 5EB8A 1TG7A 1XYZA 5DF0A 1OB0A 2E9BA 2F2HA 4CD6A 1V3HA 5FD0A 3U5UA 1XGZA 2C0HA 1UHVA 5M3WA 1PBGA 2ZXBA 2X8RA 1P6WA 3BUIA 5A6AA 1MFUA 2VRJA 4X9YA 5A6BA 1RP9A 1KQYA 1E56A 3KL5A 2J8FA 1TFVA 3EDJA 1C8QA 2YLLA 1BYDA 1H2JA 1VIWA 3AJ7A 2YL5A 3NDZA 1RH9A 4GO9A 3GDBA 4AZCB 5AYBA 3VMPA 1HJWA 1VFOA 3W82A 2EADA 4AD4A 3VIJA 3GH5A 3AI0A 3A22A 3WKZA 1NQ6A 3RMEA 6A3HA 4HMEA 1LLOA 3D50A 2J7CA 5EFDA 4CCCA 2J77A 1IZJA 1MW3A 2D73A 4DM2A 4HZ8A 1AQ0A 4H04A 4DWSA 1JXJA 2RGMA 4F79A 4PMOA 4J28A 1V6UA 3K8MA 1UKOA 3D52A 1GHRA 1OGGA 4Z2JA 3CUGA 4W8BA 3CZSA 1HNYA 3EDFA 4MB4A 1JAKA 1M7XA 2EO7A 3AIUA 1NOUA 2Y5EA 5LA0A 3T2OA 4HMDA 2VX6A 1KXQA 2YOCA 4Y7EA 1BG9A 4W87A 1BFNA 3O2LA 2VI0A 1HP4A 1JYXA 1UWUA 3ARUA 1LWHA 5A2CA 1JD9A 5A95A 3OB8A 2DT2A 3GXMA 4Z2LA 3CMJA 3VINA 4LPCA 2WVTA 2F7OA 3O9NA 1X6LA 2J25A 3W4RA 2JF7A 1VJSA 3VGHA 1TVPA 3SIMA 1TVNA 4CCEA 2J62A 1R34A 2W5FA 4V28A 4CVWA 2VZUA 1GUVA 5CZKA 3BVVA 4PBGA 1LL6A 3A47A 5M5DA 2D3LA 1R7OA 4AY1A 3N1AA 2CEQA 4M81A 3DX4A 4UCFA 3DX3A 3AIVA 1JIBA 1R47A 3SCVA 4JFTA 1VFFA 3H54A 2VJXA 2FDMA 4P7RA 4UOJA 3VTRA 2DQXA 2VX7A 3OBAA 2NSXA 1QI5A 4W7VA 2O92A 4BA0A 1JZ7A 1BGAA 2GK1A 4AD3A 1ISYA 2X2IA 1V3JA 4D1JA 4W5UA 1SMDA 1QNSA 1A47A 1ZBWA 4PMVA 2E40A 1HN1A 3LPGA 1E71M 3O6AA 4RE3A 4U3CA 1EOKA 2WZIA 3VGDA 4W85A 4GQQA 3GM8A 4U5KA 2YFNA 4HOZA 3EJSA 1K6AA 4AZIA 3AMGA 2FHCA 1GVYA 2WMKA 2XTKA 4HMCA 3VDBA 3BXWA 4EKJA 2YL6A 1KGWA 2XM1A 3HZ3A 1UR4A 2D3NA 2VOTA 3AQUA 3S5YA 3BLPX 2W92A 4J3VA 5DMYA 1CXIA 4CN4A 1US3A 3VSTA 4YHEA 2DIJA 2YA1A 3PHAA 1HP5A 1JZ6A 2NT0A 5GNZA 1CEOA 2D23A 4PMQA 2ZX6A 4M8UA 2C7FA 1LG1A 4CD8A 3N13A 3S5ZA 1ZS2A 1J18A 1UZ1A 3CZGA 4AZHA 1Q6GA 3L2MA 4IPNB 1GJUA 2DPEA 2J74A 3MV11 3WSUA 2CHNA 1E0WA 1E72M 2GDUA 1VJZA 3WDHA 1ZBCA 2WLZA 3CPUA 4L4OA 4F9DA 1NWTA 3VD9A 3PZVA 3VIFA 3CBWA 1QNQA 1C93A 1XCXA 1QX1A 1SR0A 3WF0A 3NIYA 3KLLA 6TAAA 4E8CA 4U33A 1HF6A 4D6GA 3FNDA 4V2XA 3ZSTA 1TQSA 3HG2A 1WO2A 4HA3A
chains in the Genus database with same CATH superfamily
5DZAA 1YMHA 5EU4A 5LNRA 4BF9A 3IFNL 3QG7L 4IMFA 4K2UL 3NAAL 2Y2TA 4Q4QA 3U2IA 5GJNA 1G9EA 3PWPE 3WJYA 1ZTMA 1M7IA 5K9KA 3MO4A 4JNMA 3T6VA 3WNMA 1ZANH 4BWTA 3DFPA 1S9KC 3O8XD 1XS2A 4LRSA 1MCWM 3LNGA 3MCOA 5TFSL 4GEJA 1A0DA 4ELME 1E4KA 1JPHA 3KFTA 2PPEA 4WCYH 4YHNA 2IBGA 4AC4A 2AK1H 2MPVA 1BECA 3LV5A 1KTKE 2EXWD 4DK5A 4KZ0A 2E7CA 1FG2B 1QI3A 1VQTA 1PEZA 4YPGA 2VDRH 3G1VA 5KOVC 5FKPB 1HXYB 2XY1A 5EWIH 1MCBA 1XH0A 3L9EA 3L65A 3EA2A 4D0CB 4Q89A 1SM3L 4YLCA 3QIWD 1IGIH 4F7MB 2EG6A 1J87A 4HD5A 3MRKA 5I1AA 2VYRE 5KZCD 4KRPD 3AHZA 2ZJSL 3WFCL 3NPWA 2DSVA 3UWQA 2B15A 3OF6A 2DQDL 4KDWA 3LG3A 2EPMX 3UWWA 1MHCB 4IIHA 4Z0XA 1TETL 3J2PA 2CLVB 3SCRA 3J27A 3RO8A 4TTUA 1GR7A 3L5JA 3ZMEA 4IXHA 2D2CC 2GJLA 1FN4B 3PWJB 1G0YR 3DX6B 1ZTVA 3TIDA 3QJAA 1H8OA 4DWDA 1R3LB 3KJ4C 4RFOH 5TH2B 4TVPH 2W59A 1FZJB 2C3VB 1I9EA 1NDMA 1LDCA 2DQJH 4LTSA 4IRZL 2BSCA 4YHIA 3TBTB 4H26A 1TRIA 4LB3A 1UURA 2L7JA 2VWEE 3B0PA 3ZGHA 4Q0XH 3WBAA 4H9XA 1VESA 2F74B 2CU9A 3ULUH 4F15C 3S8WA 3LXCA 5LIYX 1YDOA 4G80A 3GDKA 1CE6A 4XZNX 1UC4A 2NY3D 3PBYA 3H3PH 1LGVA 4ANXA 4KETA 1I82A 4MCMA 4DCQB 2BB0A 5JBEA 4DNMA 2CK0H 5LA1A 5DD0H 5AVZB 4C4BA 5IFAH 3JWDC 1GJIA 4UQ9A 1ACYH 1WH0A 1XFBA 5BQDA 4TNEA 4A38A 1VADB 3ZHNA 1Y0LB 4HETA 1TQBB 3FB5A 3UTQB 4XG1A 1I7TA 4TUUA 5I0YA 2X4RA 5FGBA 1J5CA 3QJSB 1KM4A 5F9OL 4OZ4B 3DUGA 4ERSH 1FGNL 1GVIA 2AABL 5H94B 4HJSA 3MP4A 3ATYA 3RGTA 1IE5A 5F44A 4N0CC 2FQEA 1THFD 4LEOA 3CN1A 4UQ3B 5LUMA 1GQLA 4I1RA 3D3VE 3ZE2B 4Q9CA 4BXVA 3QNZA 2JMRA 2E68A 2AAMA 2BVPA 3T05A 3FO0H 3IU3A 4P59L 1FP9A 5J6SA 4K5LA 2JELL 3US0A 4Q3MA 1RZGA 1D2PA 1XR8B 4KH9A 3BUYB 3GH7A 3R2GA 2VKZG 4NWUL 1K9DA 5IFJB 4GPNA 3HAEB 4NQSA 4JM2F 4XC3L 5HHOD 1AO7E 1OLLA 5IB1A 1EEPA 3V0WL 4MB5A 5FK9A 5B21A 3HJ0A 3R58A 4GKZB 2P5EE 4JR9L 1BTCA 3M0JA 4RGNC 3MYJB 1F2XK 4MCYB 4GJIA 4Q4EA 2VD8A 1F41A 1U8OA 5AW6B 4OGYH 4NZ1A 1NJJA 5HAOA 4NZ3A 5IRPA 4UMSA 4DK3A 3S35L 3EB2A 5JPNC 4PB9L 1MI5D 5DYOB 3FXYA 2O7QA 4L3CB 3AB0C 4UNIA 3VFNB 4S2BA 2FH6A 4S3BA 3RN6A 2ZAIA 1OYBA 1TSRA 4F40A 4NQUA 2VRAA 2W91A 1TVBB 5CBAA 2YAFA 3B7YA 1IM3B 1WYJA 2XNAB 4ZXOA 4O2FA 5I26A 3GS7A 2GC7C 4NYYA 2TAAA 1G69A 1E27A 1EF2A 4JGMA 2QZRA 1Q6DA 3ITLA 1EOMA 5TK2A 5GZOD 1BJMA 4FP8H 1BWWA 5EORH 3GKZA 4FIRA 3OZ9L 2J9XA 1ZWIA 2V67A 1P0SE 1QNPA 5BW7C 5DSCB 4HSCX 3SE3A 3GZOA 1FVDA 1PNDA 4PY7B 3RFRA 3PPFA 1S9VB 5DQ9A 2ENYA 5FYLD 5EMJA 4WF7A 5EMYA 5LBSH 2OX5A 4Q4IA 3NPXA 3FKUS 1EC8A 2BMKB 5PAZA 3VABA 4IL2A 3V4VA 1Q8MA 1P1MA 5KOMC 3H53A 3OG2A 3DJ9A 1OAQH 1RV8A 2XWXA 3UYRL 4OLYL 1AGBB 1QQDA 3FUHA 1CGSL 2PTWA 3ELFA 4D6HA 4NRXA 3UTSA 3UR7A 3R7RA 3F7PC 4OZHB 2ZOWA 4PJAA 3HE7B 3RM4A 1HCVA 1ZLSH 4IP5A 3DX7B 1UD5A 2NW3B 3PXHA 5DXWA 5GS1B 2NY0C 2Q2LA 3L3OA 2EACA 2Z6JA 3QV7A 5H1WA 3TC9A 2HJLB 4PRPE 5D9OA 3QGVA 5C6TH 2YD6A 3WIHL 3O4LA 3WF2A 5C07D 4XT1C 4BH7A 4XUYA 5G5IA 2JI3A 2WYHA 1F90L 5SWUA 5E2VL 1CGXA 1J8RA 3IM1A 4Q14A 3GNPA 3PTKA 4FYRA 4X2RA 1ID2A 3HG4A 3BVDB 3PNRB 1WFUA 4BY3A 1ONWA 4KK9C 3G18A 2ZWSA 1YQ2A 1GGCH 1MI3A 5A2KH 2PB1A 1MCPL 3SZ8A 3KBSA 1PY4A 4NYUA 3ZVIA 1L9SA 1TJHL 2YZRA 3W2LA 5KZEA 4RKAA 1P6BA 1S9XA 4DAFA 2IPJA 2VR6A 5GPRA 2CBPA 4XNQA 3W7NA 1Y65A 5KS9B 1MZRA 4U0RB 3W9EA 5E94A 4M8QB 3DSFL 2WZ5A 4N9EA 5EUKA 5HMSA 5CMAA 1KPUA 4AVHA 4D6DA 1KV3A 1AH4A 3N41B 2D7OA 1CG9B 2NXYD 4QCIA 5HNTA 4CA4A 5F8RC 2FZMA 2XIMA 1YA5A 3D2UB 1WBZA 3LDBB 1EUTA 4WO4D 3IFPA 2ZICA 4Z1YA 4QS6A 1KM1A 3K1DA 4H7VA 4OLWL 3KZSA 3O2VH 4IM8A 3BAYA 4CJ0A 4FKHA 2V5SA 3KTCA 1ASPA 2C9SA 3VCNA 3T3PF 3AXXA 1FBAA 3Q4DA 1QOXA 3FYYA 4PTTA 2D7TH 1D5XB 3O41B 5FOBB 3LQMA 5GIRA 3OMIB 4YE4H 4LGSB 5AD0A 1FQ9C 1FCQA 4KK6D 2XWTA 3QQWA 5F4SA 1OANA 4TLUA 1A0QH 1XIHA 3M47A 1L6XA 2PCPA 3LKOA 2V0AA 3CHOA 1EJ6A 4PJ7A 5KEZA 1M7DB 4QS5A 2CLEA 3BT2L 3BC9A 1WC7B 4BBWA 4Q2ZB 4IUGA 1Z5HA 3E0IA 3RG6A 3DPBA 3KVLA 1T7XA 1B30A 1KYDA 4FA6A 1V3IA 3QO0B 4DN4L 4WHTB 2ISDA 4LQFL 1CXHA 1A6VL 2CIIA 1ZHKA 2GAZB 3KD4A 4L8CA 3BL3A 1PYWB 3WEXB 3B2XA 3U7BA 4JHAH 4QUOA 1A7NL 5I6OA 1WNOA 1QK2A 2WGNB 2LQRA 4F8OA 2X2HA 4JN2B 3NQ6A 2POZA 3G8RA 2C3HA 3AQYA 5HVWA 2OJ1A 3D85D 2H6PB 4JUSA 2DW6A 1UP2A 4CNTA 1XF0A 3JVAA 3UZEC 4D7PA 5C0DA 3MY9A 1RHFA 3RL1A 1U8MA 3SPVA 4QWWC 5L8KB 5D7LE 5E5UB 3HE6A 1ESWA 1XG3A 1Q3NA 2NYYC 1TNNA 3I84A 5GZOA 4DYJA 3W0WB 5FDYA 4FI7A 4YIQA 1K4CA 4C47A 5KAQG 5D8ZA 5KVMC 3TVAA 3ABQA 2ICWI 3ARBC 1P6FA 4XO5A 4PMNA 2Y63A 1Q6EA 1BPLB 2V33A 1YCSA 1BG4A 3RZCC 4I1PA 4XO7A 4ODWA 4BYHA 2VO8A 1GCYA 3ZJKA 1MJUH 4TVPE 3BOFA 1A25A 2DJMA 3R79A 4LSSL 4PY8I 3T4AC 2EUWA 3QW4B 3O3BA 3Q2WA 3ZKXC 3O3AB 4NQCA 4D3CL 4NHVA 2XQYA 5HI5C 3MV9B 5DEFA 1RHHA 3ZQWA 4PB0H 4P5MB 4M6AA 1EJOH 4ZMYA 2QTVA 2OGYA 1CICA 3KJ4B 3ULUE 5HHVH 3CAWA 4HX1B 4GAGL 2CO6B 3DECA 5CEYA 5ACZB 1Q38A 4ODVL 8XIAA 2XIQA 4OH2A 4IU3B 2D9CA 3FKKA 3EDEA 1GYCA 4MWAC 4Q8NA 3FRPG 1S7TA 2ICCA 1BVKA 2UXVA 4LLDB 1YJDC 3VXSE 4ZI8A 2M2DA 3APGA 3UR8A 5EEWA 5GZND 2XM2A 3QVAA 3N14A 2AKRB 4BFNA 1CFBA 2VDQL 5T5FH 1UR1A 4TQIA 1OK4A 2DD8L 1TWIA 2O61A 4LHQB 3FT3A 3WE6B 2J5WA 4CUCA 4KK5D 3GO1L 2IGFH 2OW6A 2GTZA 1LRQA 3TV8A 4CBZA 3CMGA 5J6GB 2Q20A 3HG5A 1P9MC 2ZKYA 2ODIA 3N3TA 1FDLH 1AXIB 3DMMC 1SXAA 3ULUF 4ICCX 3ZJ6A 4EDWH 3HTWA 4TXVB 4YTQA 3SQBA 2B59A 5LIWX 3WBEA 3IGXA 3GUWA 2BZ7A 3TZVA 3TYEA 5JXAH 2Y7NA 4Z7AA 1T66C 1J1PH 5KBPA 1FPTH 2VW6A 4G7QB 4JG9A 3RLSA 2YMXL 5I75B 5GS3A 1F0LA 3BVJA 4JGDA 2B8OT 2E6QA 3VNMA 4F2EA 3KXFE 3ULVH 3TXAA 4HPYH 2YPKB 4FTVA 2BNUA 4HB7A 5LWYL 2AAAA 4QTHB 1DFBH 1C08B 2OEJA 2V81A 4MAYA 3VJ6B 5CU9A 4Y9MA 4JIQA 2MANA 4KCTA 3VDAA 1LL7A 4HJ0D 1XUUA 1HHJA 4EUPB 2E1DA 1FDZA 1CK0L 4QHNA 2BVEA 4ZSOA 1XRVA 3UW6A 4JCMA 4DJEC 4KU1A 5FB8A 4HOMA 5XINA 1WICA 5CP7A 4XODA 5EDSA 3D5HA 1GMIA 2WLIA 1RJCA 1UVQB 1GS6X 3GQFA 3TBSA 1KRBC 4ZO6A 3R7MA 4RGNB 5HR6A 1XCQB 5K2ZA 2A5HA 4KDTC 3ZTNH 1KW1A 1V54B 2FJHB 4KRZA 5D7SL 1JNDA 4PVLA 2Y5TB 2I16A 4YSRA 3WX7A 4PE8A 3LK6A 2ITDA 2YCEA 1UB5A 3N6HA 5D9SA 3BP7A 4OCWL 2A4AA 4LARL 2OTUB 4JQXC 3AB0B 5DD3L 5GS0D 2ICEA 5DEZA 2ZZ3A 2JK5B 1TVDA 2A83B 3TH6A 5KSVB 2X0SA 4NN6B 4IKKA 1E6JH 4XH2A 4WY7H 3F03K 2ZCLL 4U1MB 4NUJA 5E9DA 3Q2CA 4H8WC 3U2JA 5B38G 2E6PA 2J13A 4S1FA 3ILQD 5IG7B 1LVEA 5B1JA 3B3BA 4I0PC 5J1AA 4QYAA 3L6FA 2FD6L 2GK1B 3G04B 5BOZG 5T1KB 2AL1A 2ESVE 3LHZA 1M4KA 1COBA 1MCSA 2KAUC 5GVJA 4LZKA 4JDTH 3DKHA 4YDIL 1EPXA 2C34A 4DW2H 2KDYA 2X44D 2WP3T 4CD5A 3FEQA 4LSVH 3SE4C 4AMWA 2E0PA 4WEVX 4Y4FC 2AKMA 4Z76A 1W31A 3S3GA 4QNPE 3WOVA 5DC4B 4LGPB 4YFDB 4NAEA 1WAAA 3GGWA 4ONHA 1S7RB 1NIDA 3GLDA 5I23A 3APDA 3PABA 5I6PA 4PV8B 1JPSH 3WMQA 2AGJH 1FORH 1ND0A 4Y2NA 2JJSA 5HGAA 2B1HH 1A1MA 3UD6A 3VWKD 5LHDA 2BSSA 2EH7H 1I1CA 3WLWD 3SJVA 3TC7A 4HU2A 5CJ8A 4WUUE 3ECQA 4MVBC 1BQHB 2IALB 1NOFA 1NWRA 3STCA 2VMJA 3W3BA 1BZ8A 1UUNA 3M43A 2OCZA 4HNVA 2Q9OA 5AW8B 4TOYH 4N2DA 2VABA 2E7LA 1UWEL 1U42A 2BHUA 1SY6H 1IQ8A 4QNPF 2YR1A 3LEPA 3DEQA 4HIHA 5TQ0H 1Q2SA 4LCWB 4E5XB 4WNQB 2X2GA 5LXGL 2A9NH 1BKHA 3FOMA 4F7EB 3SDXE 3WFEL 4U1JA 3ZKMC 4LDCA 1AXTH 2NZLA 4AZCB 5CGYC 1NQ6A 1B2WL 3DUUB 4AU0A 4NAFB 3RVTC 4CCCA 3Q9QA 4QHUB 4DM2A 5J7CC 4FQXB 5T5NG 4JFOB 3H22A 2IGLA 3ROLB 5E8DH 4AVNA 1I2OA 1O6TA 1NCCH 3D52A 1RZ8B 4N1HB 4MB4A 1FY6A 3RVXC 4E3VA 1YUKB 5E56A 4RNJA 3OP2A 4NO3A 4ZNEA 3OB8A 2BASA 4A2HA 4CBPA 4Z8FH 3VINA 1NSNL 5JIMA 3R7QA 3R25A 1AKJD 2FPTA 4JRYD 1U22A 4TMCA 2NUPB 2F8OA 4KUCF 5DLML 5CGQA 3UYOD 4PJ8D 1Q8AA 3WHE0 2JBMA 3VWJD 3OGCB 2VSKB 2JKEA 1AW1A 3DX3A 4TUKH 5F1SA 3URNA 3SCVA 3HHRB 4AQ8C 1Z9SA 4U1NB 1Z66A 3QQ9D 3CJJA 2EICA 2BSTA 2OLAA 2GIYA 3SKNA 5L4IA 3O4OB 2FZNA 4X50A 3QCUH 1S8DA 2GITA 1UGNA 3GKWH 4X7TA 3RGVD 4P2QB 3O6AA 1EOKA 2WZIA 4ILSA 2VDOH 3QZWG 1K6AA 5D1ZA 1T1ZA 5F88A 1AFVH 4AL8C 4JLRB 4H88H 3HZ3A 5IB5B 2AJSH 2I24N 4GP4B 1A9EB 2OMVA 4Y16A 3G6AA 5AVHA 5JR1L 3VFGL 1CDHA 2KQMA 4L9LB 3KYNA 5TE7L 3RNKB 1JGUH 3SOBL 1UJQA 3HQNA 3CZGA 3LQAL 1R5YA 3L2MA 4O11A 5I15L 4F58L 3W57A 1H61A 5AG8A 3MJWA 5GGSY 5EZIH 1WDWA 5FJUA 5I76B 4P4RA 5H8PA 4AZ8B 5A2FA 3EPOA 1QNQA 1AYOA 5C0QA 3ATZA 2I17A 1QVOB 1HXMB 3FNDA 4HEPA 2J44A 2K4WA 2K45A 3SCTA 3CK0H 1UCTA 4MA3B 5A43C 2CGRH 3FO1A 3BK0A 2BBFA 2A3LA 2XFYA 3BUDA 4P46C 3AZSA 4ZB2A 4OU1A 3FB6A 4LAOA 1ZLEA 2QQLL 2B0SH 3DV4A 5CF3A 1OE3A 3B2PA 2VFIA 5CBBA 3X11B 1VFAB 2YJLA 2Q71A 2YLAA 2ACSA 3FU0A 3DIVA 4E41E 2DJ4A 1EEXA 3CZUB 5AYQA 4L4VE 3ANUA 3NQ2A 4NQXA 5HNRA 1YTEA 1BLNA 3ARBB 3EB4A 2HJKB 3W6LA 3P73B 1VEOA 3RZCB 1SN2A 3WY3A 2CIKB 5H37A 1TJMA 1Z32X 3QFJB 3SODB 3NGFA 3GMQB 4TPRL 3B03A 3ES8A 2BINA 2FZ3A 5C0CE 1LJMA 3T4AB 1T41A 4LYKA 3ZKXB 2JVUA 5H6HA 1RIVH 1NL0L 3H56A 3W88A 1YN6B 6ENLA 3LXUX 1QLFA 1WD9A 2VNCA 3BP5B 3UJEA 1NGPL 4W4QA 4AGQA 2NY4C 4JJHA 3QW3A 4YN3A 4N0RA 5A8MA 4ECLA 2AQQA 4TRPL 1S7WA 5CPQA 2ZZ5A 3VWKA 3QCTH 3NGBB 4TULL 4JPVL 2DORA 4XMPH 5L2KA 1YTDA 5EFIB 1JV2B 1SZEA 3KBPA 3DI0A 5BQ7A 3TU6A 1GC1H 1R7AA 4JNZA 3BO8A 3F6LA 1KJ2A 5EUOA 4O12A 4PL1A 4PB5A 4TUOA 3O3UN 2ZQ0A 4D6CA 4DB7A 2OMYB 4TMPA 1FWFC 4R26H 5JHDD 4UTHA 1FNGB 1GOMA 5KYYB 3DMMB 1ANUA 1Q7QA 4QCEA 1VCGA 4XO9A 1ZVNA 2YX0A 4AEFA 5KSBA 1CGUA 4DGIL 4CQ9A 5IOBA 3ULVE 4K8RH 4UNVA 4IBQA 4K3ZA 5F9AC 1QNZH 1IZKA 4D6IA 3QYCA 3CS2A 1LK3H 2Q3ZA 1CC3A 1TKWA 1FH5L 4YUEL 3LHWA 3P9MA 3QPQD 2Y7DA 2FX7H 3C2VA 3K7UA 3QJHA 4HAKA 4WQOA 1JAEA 2IWGA 3REQB 4HIJA 2VXTH 4WV1A 4KFMA 3WQPA 3QTPA 4P5TC 4GUJA 2PCFB 1M05A 2L7EA 2BY2A 3T71A 1G84A 3SE9L 4UTUA 2HNEA 3QDGB 5AHEA 1CNVA 2WM0A 1SEBA 1TLKA 3HBPA 4MOZA 3MV7D 3ZY7A 4TQPA 1OM3H 3UBXI 4IRSB 1FRBA 4XNAA 3GNNA 3MPCA 4BQ5A 1EZLA 3S88L 2OSLA 4O1AA 4Q6YA 2IAMC 3GB7B 4YJZL 2A3EA 2IPTH 2VR2A 2APXA 5T1DH 1A5CA 4LNRB 3LB6D 1TJ1A 3SDAA 1CGYA 4IIZA 5I5IA 1AR1C 3RGVA 4K7PY 3GY1A 1XIIA 3RM8A 3WTXA 5T91A 4J3UA 5AZ1A 1FWBC 1DDHA 4FFZA 5F7NC 1X4ZA 1EXBA 1I3GL 1TZ7A 4OWGA 4PJHE 4KTDH 4KO5A 5F2LA 1R9FA 1OP9A 4KIEA 1KIUB 1TQUA 1W8EA 2RDWA 3I6SA 1N0XL 5D1XA 3AREA 4XMLL 2DM2A 3VX1A 4OLVH 4BKSC 2OO6A 4LOUD 3AYTA 4RDBA 3LTYA 1EA9C 4YR6B 3RWFA 3HMWL 1TUXA 1B4LA 1O7DE 2QJMA 3RNDA 3OKOB 3GSOA 4W7WA 2A74B 1A3RH 3LKNA 1XIBA 4XN1A 4BM7A 5BMWA 2YKKA 5EIIB 3Q1SL 5BCAA 5DRWA 1TZHA 3SSGA 3K0YA 3V4VH 3QQNA 1AODA 1CDYA 3UFYA 2R2CA 3OVQA 2MCAA 2DZXA 3T0EE 4KUZL 3BZ5A 1BQRA 3KPSB 3NOIA 2GVJA 4PJHF 3GXTA 2BSLA 4ZTOL 2JF6A 1BQLL 2VN5A 5AZ2H 1MFCH 1U3HA 5JW4Q 3UPMA 3H4WA 1UZGA 1IC4H 4QY8B 4XCFL 4UINH 5BS0A 3SO5A 1YC7A 3OIXA 1D5BA 2GSEA 4RL3A 2XVKA 4Q9QH 3MRNB 1TV7A 1Q1PA 3QJTB 1OQFA 1PAZA 1GW0A 3TO4D 4HKJA 4PTDA 5IVXB 5HPMB 5KVEL 3GHEH 2GGIA 3M6DA 3TYZA 4I85A 3MBEA 3IDGB 4EZJA 1WAUA 1BBDL 4UIKH 4TO8A 4AQEB 4MNJA 4YVNA 3LKRA 4NFCA 3RX9A 2E75C 3TEYA 4PJEE 1Q9WA 3W1RA 32C2B 1NGXA 1UR9A 5F3HB 1EBPA 3VA8A 4OGAD 2OXHA 5KSUB 1JCYA 3D2TA 2BNRA 3RUGB 3SD2A 3MNWB 2ZXGA 4PJBA 1U8HA 4HAFA 3QRHA 1QUNB 4GIPD 1RUKL 5HI4C 3R1ZA 4AF0B 2QCDA 3QG6A 4AI7A 3BV7A 1TMHA 5HJYA 5TIMA 4D9RE 2ODHA 3QXAB 3VNJA 5ABHA 2C5DC 2ZZ1A 4G8GE 3HI6L 1CENA 4AX3A 4EN3D 5HDQH 2E27L 2EYRA 1D3HA 1XICA 3G6DH 4HLEA 1PL3A 4FXSA 3R1GL 1FZMA 3PQYA 5EO0B 5DMKB 1JCVA 4NC1E 3QY8A 5AOUA 4L1TA 1R19A 3QFEA 5CG0A 4HUMB 4CLMA 3D4GA 1KXVA 4PJDB 3O9WA 3U0WH 2OZNA 4B0MB 4X5WB 4PJEF 3EGXB 4G3YH 4LLWB 5D8JL 3F2DA 1VCVA 4JTHA 1XLLA 3FRUB 4J3OC 2G9HB 1Q9KB 1NAKH 4QXUL 3BZ4B 1U8LB 4F8QA 3A24A 3CXDH 1P53A 4KAQH 4S1RL 1E6QM 5BRZD 3WJJA 2RGSA 2OTWA 3MMWA 4UXDA 4BFIA 1YYML 5IHWA 5JXEA 3MLUH 4Z95H 1BBJB 1EJFA 2WSPA 3IDXH 5AVSB 2HUHA 1B3XA 2YD0A 2CHWA 4YJ5A 3NJFA 3L9RA 5CINL 2OMWA 2XVNA 3EBIA 3A3WA 2X87A 2XVLA 5D1QD 2Z1SA 3HB3B 3IJSA 3UTPE 4N9DA 2ARJA 3WUWA 2LR4A 1RUAH 3EXRA 4J3BA 3EJRA 2VDPL 4U6VL 1A3QA 1B6UA 1UBSA 3GSNA 3P3YA 2CJUL 5HATA 3HLKA 1SFHA 4NZUL 4ZRGA 2PCYA 5CC7A 3B37A 3IF1B 1G6RH 2ZSWA 3MRQB 3MI6A 5ABEA 3VM7A 3HJEA 2DVTA 1CFQA 5C0JA 2QVNA 3GQYA 3CFKB 4V11A 5CD5D 4JM4H 4C83A 4BRVA 3F7JA 3C8NA 4WFFE 1V55B 1EZ2A 3HR6A 5XIMA 3GIZL 1F8TH 2BSRB 4FMFA 4P2OC 2Y1AA 1QLEB 2JSFA 3GAKA 1NPUA 2H3KA 2QKIC 4B9PA 2I9UA 1SYVA 3D87B 4U2YA 1NMCB 4AJVA 3EA1A 3FN0H 3P0VH 3MSPA 3VMNA 3C2AH 3T44A 5GGSB 2PTDA 4ACZA 1TENA 1EMTL 3TR2A 5T3ZL 5I0WA 3PG2A 4H25B 5DD6A 1CYWA 1UH2A 4UTBL 4XCNA 3QEHB 3WV0A 1XGYL 2BXYA 2GCYA 2K70A 1J79A 2ZP9A 4QSFA 3OGOE 4L4TE 4Q9RH 3M16A 4OZIA 4PWFA 3NFNB 3Q05A 3GMMB 4TSBL 4HCFA 1YEFH 3ARFD 4PPTA 5HJBA 2BH0A 3NJVA 1I8AA 1TV4A 1ISXA 1QP1A 3TS8A 2EDNA 2OR8A 2NY4B 3ZR4A 4FNPA 2AV7A 2PP8A 2R0ZH 4GG8B 3UCQA 1XP3A 2VMCA 3LZQA 1OP3H 4LLQB 3QOKA 2DMBA 2K3TA 4EAEA 1E4IA 1YEJH 4G6JH 1KWGA 3M7SA 4DJFD 4ZX3A 4HU3A 2RDUA 1PX3A 3AXMA 3PWNA 4CVXA 1S5IH 1FFTB 4OCXH 3CX2A 4CADB 2EDHA 2J24A 3IJDA 4XI5C 1U4FA 1RVFL 5E2WH 2PW1B 5DZOA 4FFYL 3NYKA 1ID5I 2R2HA 4GG6B 1F8MA 4PBDA 4GSDH 3BHBA 3E0VA 1GGUA 3ZL4H 3QHOA 4A3QA 1BWLA 1JNHB 4MAUH 2BVYA 4AMXA 5KJRH 3NN8A 4H1LB 4X4YB 5C0NC 5CFHA 3S3PA 2Z28A 3PGFL 4UTJA 3ERXA 3EYQC 2VC2H 5GRUL 4XVEA 2IMRA 3L4VA 5AWNL 4CKVX 1HINL 2IKJA 4I77H 5CR8A 3DESA 3NT0A 3NL3A 5T8IA 5FEPA 1DQDL 4WKZB 4U7MA 4F9LA 3IAPA 3TYFB 4IX0A 1F42A 5AKVA 3WFLA 1I7ZA 3QHTC 3QSRA 5IEKA 2Y23A 4NNXB 1CT8B 3QEGL 2PODA 3NG3A 4P5TB 4Q58C 3QK0A 3UO1H 1ODUA 2X4QA 4A2EA 4Y2DA 2J7BA 2G97A 1R30A 3QWRA 1GG1A 2YUZA 4AG4H 1DWJM 1TQWA 1YDYA 4U31A 3ANVA 1WHOA 4KIRA 3TCSA 2C1GA 4HCGA 2ED7A 5C2BL 1GOWA 3TN0C 1QPKA 1F7BA 3S5LA 4HYRA 2AI0L 1XQKA 3V4UH 2IAMB 1K03A 5CSZB 4MKVA 4BS0A 4HOXA 2JKRM 5A8GA 1G7MA 1AGEB 4HALA 5AOZA 2O5XH 1ENUA 1TJ2A 1OTSC 5KYUB 3WO8A 2XBZA 4QYOB 1AR1B 3LEXB 1OWRM 5JTWA 3NZHL 3ROOB 1YDPA 2KZ1B 1TREA 5LGHL 3ARXA 4L0YA 3O3EA 5GGVH 3O3DB 3OJDA 2CWNA 3C6CA 4XCYB 1P5UA 3HC4L 4LCCC 5D1QA 4C59B 3CH1B 5D05A 2EXOA 3FBKA 1KTNA 4WY0B 1QW9A 2OMNA 3GXPA 5HHQB 1OEPA 2O26U 1WS7A 3LQZB 2D24A 3EFOB 4TIMA 4WTZG 2JB6A 5TQLA 3GLCA 3VSUA 4LPYA 2XTJE 3S3BB 3KWXA 1ZGDA 1F2JA 1GW1A 1C92A 4GY0A 1OGAA 3FQWA 1GPFA 3QO1A 2VLKE 2VXUL 4MMZB 3P3RA 2LLGA 2EXYD 2ABBA 3IETB 1W1TA 4G43B 4PTWA 1KYFA 1JZGA 1T0PB 5C0EB 2EEXA 4UDTA 1JVKA 2V3GA 5A8NA 1PQZB 3UTSE 2P3YA 2ISWA 2XSBA 1BJ8A 2KYIA 1J11A 1ZAGA 4MCZA 4LAZA 4EK7A 1N7KA 3OHXC 3WDJA 5DK0B 4G2DA 1LO5A 3VXMD 3HVDA 4Y8EA 1JZ5A 4X7EC 4XVOA 1DQWA 4UTWC 3HURA 1D5IL 1AZ1A 5CPOA 4TOQA 3QZNA 3KHOA 4ELMF 1OAJA 5J6HA 4RZ4A 4Q33A 5U4NA 3GTNA 4OZFG 2R4SL 2EUZA 4HKBB 3AOFA 3L23A 3CHCA 3E6EA 2JNZA 3OSVA 3DVGA 5CLYA 1L8NA 4O58H 3QJOA 4M8VA 2BOBA 3GTHA 3N91A 1DQLH 2MPAL 5FECA 3FNKA 2NT1A 1NLDL 5D2NC 4F2MB 2GJRA 4DT2A 2Y85A 4RX0A 5GGRY 1D5ZA 3QGKC 4PMZA 4UUIA 5EL1A 3SJ3A 2H6OA 4RDYA 2EE3A 3BAEH 2YK1L 1ICPA 3FJLA 3CB3A 4YL9A 2V5LA 2QGBA 4LANA 1R5IA 4POZC 4X5QA 3KPOB 4X6FB 4PGBA 2F5BL 4V1DA 1MJ8L 1C5DB 4PJFA 4XBGA 2NXHA 5IESL 3CASA 3SDDD 1TMQA 3WQOA 4GQBA 1W3LA 2GYSA 1RXOB 2F2HA 4KS0A 1PD0A 2QPXA 3IDMB 2FQGA 4J8RA 3EYFB 3V0TA 2OP4H 2PF8A 1C8QA 3X2QB 2FO1A 4JTIA 1SJDA 1AQDB 2YL5A 4L3EE 3Q37A 4INFA 3GDBA 3L7FB 3E9TA 2VFGA 3AI0A 3CHSA 1QR7A 3SPHA 1J1XL 3MZNA 5T3XH 4Y2WA 5D2XA 1DIEA 4PJ7E 3ELAT 1MW3A 1AQ0A 4AMKH 3O6FB 1TQXA 3WLSA 1H7PA 1EAPB 4PRHE 4R96B 4WI2A 2RFXA 1V6UA 1DUYA 3DTXB 5BVJA 4JTQA 3L3HB 4IIDA 1N12A 1OAKL 4YWGL 2A0NA 4WW2F 1NCUA 2H9GB 3ZDXE 5C09B 4QOKA 1AS6A 3OBEA 3GSWA 4KWSA 1YE4A 4Z2LA 2EZ0D 3A4JA 3U7AA 2P5WB 3QUZD 1HL4A 4HCRA 4LKXB 3VGHA 2Y7SA 1MRFL 2Q8AL 1MLCA 4ZXBD 1XVSA 3T8MA 1QR1B 3PAZA 2K8MA 3G5WA 4ONGL 2GOKA 1RBAA 3MA8A 2HKHH 3AQDA 5ITFB 4ZMPA 3PF2A 5BWAA 3NZUA 4UMCA 2VJXA 1F00I 4HT1H 1Z9MA 1DE5A 3DBNA 2AANA 4GMTL 3D39B 1SRDA 1Z7JA 2VIRA 4BA0A 4Z0BH 3Q44A 4HUCA 1M3JA 1TYJA 1XGPB 1MKFA 3EJSA 4HQQH 3W1AA 3O8XA 3NVTA 5H91A 3QWOB 1N3NB 5I2IB 4NQCE 4JKNA 2D3NA 2YXMA 4Z78A 3K1KC 1CXIA 5KSAD 4KQ0A 1TPC1 4GVIA 4P2OB 5BVPH 4PP2B 1VPXA 5D38A 1JZ6A 1UM5L 1QK0A 3L1OL 1X8CA 3FU8A 2WAQA 2F7FA 1QRNE 4FQIH 3LNMA 3HZVA 4FQJH 2NQDA 1A6WL 2J74A 3E02A 4HJFA 2AEIT 3QIWA 4L4OA 2A1WH 3MCKA 1OFDA 2Z4QA 1E3FA 5IOPB 2R4RH 3KLLA 1UZHA 2QPEB 1WO2A 2WUCL 4WI3A 2WZAA 3HUJE 3L5HA 3WKNA 4MZRA 3KBWA 2BP1A 1QPOA 3T3ME 4BKLA 5HBFA 3TV3L 4DJMA 1E5YA 5I3KA 4KNSA 1G7IA 3QRGH 4U1GB 4G11A 4FG6D 3D69B 1UG6A 3RHWK 3MGTA 2W66A 5BOPA 3RAJH 1VACB 2G30A 4IP7A 3BLOA 5B7MA 2V2CA 3HPZA 3V18A 3UPRA 1T99A 2VC6A 2HLFD 3PS6A 3WDIA 1TYGA 3T0DA 1FIGL 2FMOA 4UR9A 4ZMGA 3MRDA 4S1SH 3ZL1A 1EIXA 3I50L 3DV6B 3OAWA 3CFEA 2PPAA 4D72A 3AICA 2K6YA 4LAQL 4NKMA 1JPST 5IREA 4H5SB 2UY7A 1EGJL 3AIBA 4JL2A 3WUEA 3HUJF 1K7FA 4XNZC 3L4UA 3THMH 4M6OH 3EAUA 5CHNA 3MLSH 1BX2B 2VDML 5DD1L 3BP6B 1JTOA 4YTSA 1H60A 4FTVE 1E4JA 2GFTA 3W6MA 1TA3B 2RAGA 1E9PA 1NFDB 2QADD 1HHIB 2DAVA 2HVJB 4FNLL 1P4IL 4I18A 1VHCA 1ZHAA 4E4UA 3NQIA 5INCA 1FO0A 5B7FA 3IIZA 4AD1A 2D03L 3T0BA 3KLAA 4Q4KA 4PP1C 4PWEA 3FPXA 2X3CA 4FXKB 5B39B 2DKUA 1OSZA 1JPFA 5FM5M 1HSBA 3U30C 3NFSL 2F7QA 4HUVA 1II4E 4PJGE 4ZAKD 5LCVA 2XWRA 4ZMLA 4NM8H 1UOVA 4GAJH 2DEWX 5GRVK 5SWZD 3P8IA 3LQLA 4WLCA 2DBJA 1V27A 3B1TA 5EZOH 3VDGA 2EE2A 4M4RB 3NZRA 1KFAH 4ZFZB 5E2TL 5I1IH 3U25A 2ERJB 3QH3A 4ZTPL 3CDGA 4KNTA 2Q01A 1CXFA 1GTEA 5E9DE 4LSTH 4FFZH 2FQDA 4MLRA 2WSDA 5DUBB 3TN0B 9CGTA 1Z0NA 4MA8H 5HHOA 4JO1H 2E4FA 1BF5A 5I9QC 2D31B 2YUXA 1QNOA 4BD4A 3H2PA 3QXBA 4DPPA 3V5KA 4WCYL 3QN3A 3HNSH 3RIAF 5F7WC 2AK1L 1JFQL 2IH8A 3JUGA 5H35A 2YS4A 4PGDB 3WD0A 2A73B 2CUMA 1UZ4A 1HH9B 3DYMA 4PJGF 5EWIL 2XKNA 4AQOA 4XKMA 4NNPH 4UFLA 1MI5A 4JDZB 5CU5A 3SCMC 2CKRA 4KI5E 3G5VA 1S2CA 2FJGB 1W1YA 5HDBE 1WAAE 4HSAC 3RJXA 4L9DA 1YN7B 5EO9A 2AK4B 1MJJB 1HXKA 4WWNA 3T08A 4PLKC 1EZVX 3LN4B 1MFMA 2YQ3A 2CGYA 4XVJH 3G5XB 1XXFC 1XGUB 4OECA 3BW2A 1PZDA 4HKXA 2WSQA 5FIPA 1UEYA 5FM5O 5CN2A 1B57A 5DJ8A 4GUHA 3SJVE 3BZJA 4KKCC 3KX6A 2WC4A 2VDKB 5AKSA 5FAAA 3UBFA 3NAVA 4TVPL 1JZ3A 4OKVA 3SKJH 2DQJL 5CCGE 3PSVA 3GZ3A 1YEEH 3OHXB 4QG9A 2VTFA 1OTTD 1IC5L 4F0KA 5ISZD 4Q0XL 2WMGA 4WDIA 3V6ZA 3HI5L 3LRSB 1KIPB 1WFMA 2FX9H 4KI5F 1PX8A 3GE7A 3MHGA 4WK4B 5HDBF 1D3CA 6FABH 3VRJA 5C7XH 4ANUA 3USBA 2QR0A 3SBPA 1OHLA 3MNVB 4NQQA 4PJ5B 2D2OA 4ZXLA 2BOCB 4GUPB 1J8VA 2YKLH 1YBQB 1F6PA 4K7PX 5CLZA 2H5UA 2OBGA 5AW4B 1ALDA 3THUA 2PTXA 2CK0L 1ZMYA 1F13A 2BVWA 5DD0L 2GT9A 4LU5H 4URIA 3PV6A 5GQBA 1KCVL 3GZAA 2G50A 4F15B 3SI9A 1ACYL 4QJ5B 1FXQA 1MHHA 1K4DB 3BGGA 2XN9B 2PYED 4HIEB 4QDMA 5F0JB 3OHMB 3SYQA 3KWTA 5CC5A 1HE8A 4MNQE 3DENA 3QC6X 5TNVA 1PKQB 4ERSL 5C07A 2VITB 1XBXA 4ZO8A 2O55A 3GRWL 1ZPUA 2QCMA 3KDPB 1LXMA 2FEDC 1U95A 4WUKH 3VO0A 3K2MC 1BFOB 2FLBT 2ITEA 5G55A 3NQBA 2FLIA 5GGRB 3V3WA 4GKSB 3WK1A 4MLIA 5HNNA 4ROPA 4J40A 5T3XE 3H2AA 1CN4A 1W72A 1W0WB 1U8NA 3JSSA 4JE4B 2WXRA 3AHTA 3LGDA 4G59C 1URZA 2AQNA 1Q5MA 4CD7A 2I5YH 3S4SB 3FA5A 5IHSA 1E1EA 4TYUA 2YO3A 2CM6A 4F0HA 2XTLA 3AUVA 2V2TA 1HH6B 2OQJA 3AISA 5CM1A 1B4EA 1BXUA 3L3DB 4KKLC 3NGJA 4PMDA 4HS6B 4WO4A 5FW8A 4X8CA 2ZOUA 5ERWA 2GG1A 4FFWC 5IVOA 1RJQA 4RNFA 4OGYL 4AD2A 4ZUVB 4J7RA 1UACH 4C6KA 4HKPA 2HJPA 3D25B 1M6OA 5DJYB 4L8DB 1J9SA 1KJVB 4QE1A 2NXZC 4ZJ9A 2HN7B 4NN5C 1U6AH 1TXKA 3KJ6H 3STPA 1WV2A 3UDWA 4WIWA 3K6OA 2DMHA 1DLHA 2G3XA 3GXIA 3QFGA 5ETUA 2DIEA 1V0KA 2GJZA 3VB9A 2A0LC 3GSNH 2BK8A 3BE7A 4UT9L 4FQ1H 3VSVA 4ODXB 2IUZA 4WU5B 1CWVA 1IJNA 5JPNB 1V7NH 5F7YC 4JFWA 2DICA 3JW7A 3ALGA 3WY1A 3VD0A 3MJYA 4FP8L 4JRXB 3SN1A 1XISA 1T22A 2H32B 4PUJA 4IU2A 3LIZH 4B91A 2R1YA 2F54B 2W9EH 1CLYH 3L3KA 1SQ7A 4H01A 1ZXKA 3GHRA 6PCYA 1NUDA 1FHLA 5ADPH 2YFOA 3A3HA 3REWA 3PZGA 2C7UA 3R0MA 1BHGA 2HUEA 1IGFL 1M42A 3E12A 4L5FH 5HYJB 1XH3A 5E0FA 1VD6A 2QSTA 2QV4A 2YXOA 3TONA 3CFQA 4WI4A 3D85A 3AG4B 1OALA 1S3RA 4FNTA 3UWYA 1OAQL 4UF7C 1YPXA 2H9AB 4Z2GA 1D7BA 1UOLA 4HU4A 1XRTA 4MZ3A 3RDKA 3AABA 3NIFB 2QDEA 4OD1H 1ZL1A 4H0LC 1XL4A 3QRLA 4LRTA 3RHGA 4LSUL 3ME0B 5EPMB 5L2KE 2R8SH 1LE9B 1QUPA 5IHHA 4L05A 3NACL 1BMZA 4KZEH 4JPWH 2WWCA 4G56A 5CSGA 3ZQXA 3ID7A 1CFNB 1QHOA 4QRBA 3E6HA 3AYRA 4U49A 4F93B 4DHGA 1Z5YD 3GBDA 4QRTA 3IMBA 4X9IA 3T0CA 2JJUA 4LSPH 4ZS6D 5EO1A 3A23A 2WZEA 2NY0B 4YBHA 3PPSA 4G6FD 2KC0A 4N0FA 4L4MA 5B22A 3HPFA 4HJWA 1W3TA 3EYOB 5HANA 3EGSA 4X7SH 5JOPD 4W9GC 1E9ZB 5TE4H 1XLHA 3EGDA 1EZUA 3SN6N 4LE8A 5GZNA 5D6DA 4NZJA 2OK0L 2CBVA 2OODA 4LKCA 2Q86A 3DOIA 2Y72A 1V93A 2L5HA 2IAND 1IIHA 4XNZB 3OGVA 3EWXA 4FK9A 1OADA 2ZE0A 3VFLA 4JFVA 4UOQA 2PC8A 1YNYA 1VR6A 4I0CC 4WK0B 1FSKC 1V7YA 3L81A 3VXTA 3WENA 4KWWA 4M1CC 3UJSA 3ASOB 6XIAA 2BRRH 4RDZA 2B3RA 1SO6A 3AIQA 5IMOB 4N02A 4MGGA 3RWIA 3MRJB 1UT9A 3N9KA 3RURA 3GBMH 5EEXA 3KVMA 4WJKB 4URTB 3D4ZA 5GJTL 5F7HA 3L1EA 2KDGA 1W8OA 4N24A 4DETA 1YEIH 3FONA 1VYPX 4GY1A 4RAVB 4YE4L 2N0MA 5REQB 3U30B 1ZLWK 3UCRA 4KEUA 3DN5A 2YL8A 4OJDH 2JGYA 3QUMH 1A0QL 3F4WA 2H3NA 5D5MB 3SDXF 2OR9H 5A3ID 1ECEA 3HRZA 3QEZA 1N0LB 1SDDB 2Y07L 5F96L 4ZOBA 2BOLA 3T42A 4NZ5A 1SLWA 5DBTA 4HBCL 2WLMA 2NUWA 3TVMC 1MW0A 5M7QA 3N1QC 1HOCB 3EDKA 4LF1A 5JDSA 2R1XA 4Q7DA 15C8H 2YBVA 4E36A 1FFNB 1UOZA 3FT4A 3MBXH 4JFYA 3GSQB 5CP3A 3P11H 2H26A 1RZFH 3GSMA 4N2HA 3PUDA 2Z6FA 4ASTA 1AA1B 3R0KA 4WSJA 1F6AB 4OT7A 4Y90A 5I9QB 1U91A 4UUJB 1EHXA 4JHAL 1KLUB 4BA8A 3B2VH 1JDCA 4NZCA 5DC9B 1YEDA 1XD0A 5SWSB 3QV9A 1VFUA 2P48B 5J5RA 4BRJA 2V9DA 2CDEB 4X6BB 4M3JA 1U30A 3O05A 3VI3B 4LLUA 2FPYA 4IMAA 4JKMA 3UCDA 3LX9A 4UNTA 1TUPA 2AGTA 3NYDA 1FP8A 3K6IA 4A2GA 4QJ3B 5DJAA 2FX8H 5HXMA 1Q85A 4H4NA 3SCMB 4X4ME 3TCEA 1N2RA 2JF1A 4RSVA 1KPRB 5CN1A 3BEWA 4DESA 3GVWA 4PJIB 1NEUA 3ULAB 2AKZA 3NCEB 1QOKA 5EA9A 4F0MA 5BS0E 5ENWB 4TXEA 3VFPA 1ASOA 5DGQA 1QSEE 5T1LB 3NQFA 4KO9A 2J78A 3IAQA 1ZPTA 2DQUL 5A6LA 3MRHA 3NL2A 4PB0L 1A7PH 4BEUA 3CNYA 1X5XA 1JPTH 1EJOL 2IFFH 4Z17A 2OYMA 4Z2IA 2PWHA 3J7HA 4R5VA 1DJNA 2P5NA 2IH1A 5H8DA 5CIPA 3EO9H 5IJKA 3QEUB 1OD7A 3F2BA 2HTLC 1VF8A 4HJTA 4FXGC 1JWUA 1JV5A 1UH4A 1NGZA 3P3SA 3NZ8B 3UZZA 4XZHA 1CO1A 3VE0B 5HD8D 4MM1A 4LHUB 1DE6A 1DXEA 1QRKA 3M1OA 1SHXA 5EC1B 1NGWB 1ZV2A 2BNRE 5DY3A 3V5HA 3UESA 5T5FL 4PJBE 2GI7A 4BXSV 2GSIA 2GW5A 2FK9A 1T6WA 3ZTJH 1HIMH 3QDME 4YHPA 1CB2A 3FOLA 1E9IA 2BC4A 2IGFL 3MT1A 3GMLA 4K2SA 4MWAB 5D72L 1DO5A 2X88A 1LF1A 1J2BA 1UMLA 2YD1A 4NKQB 1KTRL 4YLBA 1H3UA 2WBKA 3DO3A 2XQBH 1Z69A 3G1DA 1ZSXA 3PWAA 3UF9A 1FDLL 3DURB 4X6CB 3GTIA 5E6ID 1AIFB 4EDWL 1RZKH 3A6OA 1GYAA 3BUPA 4TVDA 4M3HA 3SQRA 4AXWB 5JXAL 4DAGH 3U3HA 4Z1AA 1EIBA 1J1PL 5IZ7A 1FPTL 3GYEA 5IB2B 4AGPA 4DF0A 2CNYA 3CDZB 4JFFD 3NJ3A 1Y0EA 3PGCA 1JGDB 4R3SA 2HXAA 3P3UA 2DEYX 2BRQA 3BYTA 2GLKA 2J8OA 3FUFA 1U92A 5HULA 1JJKA 2RUSA 4AIZA 3ZRFC 1INQA 4N2MA 3ATEA 4NQVB 4JFXA 1DFBL 3M0VA 3T65B 2F53B 3GMNA 3PHQA 3TN4A 3AQZA 4XNUH 4NDMA 5I66A 5DK2A 4ATTA 1G7LB 2P42B 5EU6D 4WZHA 5ENLA 3KG5A 5D55A 4DQOH 3EOYG 3S8HA 2X4NB 5CH9A 1N64H 4DO5A 4GZJA 1G9MH 4HJJL 5IFPA 1FIEA 5MF5A 2OLHA 4QLLA 4LCIL 1ZU8A 5E8OB 1AKJA 4M1GH 2XUCA 4JRYA 3ZTNL 1ZEAH 5F71A 5IT2H 4YS4A 1TWZA 4NY2A 5C0BB 3FDGA 4PJ8A 4HCRH 4AVKA 3TEZA 5IROD 3VWJA 3C8DA 4YEEA 1TG7A 1FHUA 2ZXBA 5EULV 3BEVA 1SPDA 1S3KH 1SPQA 1O75A 4QE4A 3EDJA 3V2AR 3OQEA 5AHFA 3G6JA 3CWGA 4NN5B 3DO4A 2QCLA 3ULVF 5CC3A 1E6JL 4WY7L 5FLUA 2IKIA 4FZEL 3ITCA 4XVDA 4I7ZC 3UJRA 5K7JA 5I1DA 2MQ3A 2CCLA 1XPYA 1IZJA 1FVEB 1PG7W 3ZK0A 2D2GA 2RCSH 1M1XA 4WWKC 3MCLH 2G95A 3MJ9A 3DUSB 4A3UA 5I1CH 1N59A 3SSZA 4Y9PA 1IU1A 5JHBA 4PMJA 3HR5A 3AAZB 4DW2L 5DS8B 4L5FE 4LSVL 1MCWW 5TF1L 4L1HA 4I0PB 3W4RA 3QJVB 2PWUA 3PLYA 4OZIE 4K5NA 3BKML 1EHKB 2Y61A 5I0VA 3CWHA 3BVVA 4L2YA 3TT3L 2DWEA 3M64A 4S2SB 2HCZX 2GDQA 4B5ZA 4JIHA 1I4NA 2HT2D 3H54A 2VXVH 4N90D 2PP3A 4P7RA 1JPSL 1KBLA 4OIBA 1H5YA 2DQXA 2AGJL 4Y1SA 1FORL 3OBAA 1IBHA 4YH6A 2QQNH 2BP0A 4RBPH 1CURA 4Y4FB 4WZ9A 4GQ0A 3RRAA 2B1HL 3AUOA 3NA9L 1BGAA 4LS0A 1Q72H 4C57C 3EXSA 4KQ4H 4U3CA 4AH2A 5HWMA 2E9IA 5F7KC 1W17A 4JY5H 1WA0X 2XTKA 3UNTA 1XCTB 3WHXA 3VTMA 4NKDA 3T6QC 2HROA 3RVWC 3K6FA 3DGGB 4XAYA 3T1FB 2ITFA 2J6WA 1T1XB 1A6TA 1SY6L 2NT0A 2DUXA 1KFBA 1D5MA 2ZX6A 2GUOB 4O2CB 4OZIF 4E2DA 2EIZB 3PTDA 1S1PA 4QRAA 4AZHA 1KFJA 2VMDA 3CL8A 3BDYL 4N8PA 1QKZH 2A9NL 5BXFA 4K3JL 4R4NC 2CGZA 3WDHA 3CEUA 1JWSA 4DWHA 1FFOB 2G4EA 1AXTL 4UIMB 3P8JA 1RULH 4XD6A 4J1OA 2VLME 4D6GA 1HF6A 3W7MA 4R5XA 3APTA 5EU9A 1R3KB 5AALA 4U1SA 4ZMWA 1P7HL 3QIUC 1HKKA 4LIQH 1F3WA 3BUQA 1TX0A 1X9LA 4HMNA 4H6KA 5E8DL 1NCCL 3K8KA 1MPAH 2F9RA 2VCAA 1HQ4A 3EYUH 3NJJA 1A2YB 3KBVA 1KTJA 1S7UA 3KPLA 2BP3A 1IEQA 4JTSA 1TJGL 1GY2A 5F6HI 3TPKA 1KENH 4BKNA 5AC5A 1Q0YL 4OD2B 3R8HA 4IFKA 4I6VA 1IWBA 3O45B 3Q2LA 2LAGB 4Z8FL 4TL4A 2X7LB 3MLWH 4X6DA 1PY0A 4PSPA 4QO1B 1W2VA 2WIIA 3QULB 1R38A 2DQCH 2ZC8A 1FL3B 4OB5L 4QX4A 4XMVA 5JHDA 1XLFA 5BOOA 3B9AA 2PDJA 4KK8C 4PEEA 4DVOA 1F4YH 5FAJA 3JV5A 4O2EA 1LK2B 5DUJA 2YSSB 4LMQI 3RPDA 3W7CA 4KV5E 1KBIA 5LXEA 4C4KT 4OZOA 1S5HA 7PAZA 3FU6A 3GKWL 5F72S 2YZ5A 2R29A 4ODBD 1T2JA 1UUOA 2VDOL 3RL2A 4WNJA 4W6WB 3W27A 4HT3A 3SE6A 3DERA 4XP9L 3STZA 1DEEB 3YPIA 5HYEA 3IDIB 2WMFA 4ZS7L 5MEQA 5K39A 1BKSA 2X4PA 2QGHA 4MQXD 3EX1A 4ACPA 1U58A 3MREB 3PG9A 5DMIL 2MFNA 1JGUL 1L0XA 4JFEB 4DNLA 3G0XA 5D2LA 4L5ZA 3H85A 1J12A 4B9IA 3INUL 3MV7A 1OGSA 5HGHB 2LU5A 5EZIL 1S3HA 2W60A 1G7UA 5E8PB 2VEIA 3AMCA 2OL3L 2VGFA 1OGAE 3V5FA 1B1YA 1P7TB 4QXIA 4KV5F 1HYSC 4BFFA 1S9WA 3CK0L 8PAZA 4JX4A 1XB8A 4BK4A 4ECNA 3A3XA 2HKFL 3PJSB 3I02B 2B0SL 5BZDB 4QQUA 2HH0L 1I2RA 3CAQA 4G8FA 1OGTA 4GC4A 5T1JA 5F9JB 4HNTA 1OF2A 4OJFH 3BAJA 4AKQA 1K8IB 2ZKHH 1TFHA 1K3ZA 2VZOA 4XO4A 1XF5B 4IRJD 3HRPA 1VGKB 4XAKE 1ZP4A 4YLWA 4W6YB 4HIXL 2J9YA 4BELD 4P46B 5F7EL 5HI3C 3S9IA 2VEPA 3AU2A 2XXCB 3OLGA 2MOVA 1I4FA 4MSWB 4UNUA 5IIEB 4UFIA 3IUHA 1QI0A 3OAUL 1RIVL 4YSSA 3CUFA 4WQ6A 2O4QA 4JDVB 2LLNA 2UXFA 5DJDB 2CO7A 3UWVA 4ETQB 5CR1A 3IE9A 1ZQ5A 4OIFA 3BANA 3PFQA 3UMTA 4ZEPA 3PTMA 3UC0L 3E7JA 1EDHA 4JBRA 3N25A 4ZUUA 1KTCA 4EP8C 4IMKC 1B0RA 2XZZA 2B5IC 3S36H 4JTCA 2C3GA 3B9DA 3J07A 1FQ0A 1C5CH 1VYSX 2DSWA 3QCTL 4DUXA 3OIHA 1TDQA 3TNMB 4LSRH 4XMPL 2R51A 4POUB 3EH3B 3M4HA 1I8IB 5JW3H 3GD6A 5E09A 1SW3A 5MKGA 1L4IA 4L1XA 1BTMA 4BQBA 1GC1L 2VAJA 4YX2H 1SR9A 4NERA 1IAIH 5CSYA 3FA4A 4P06A 4DWSC 1VIZA 3RRQA 3FB8A 5HJDA 4NRYB 4E5XG 4KOBA 3TO4A 1TJPA 3GX9A 4NZ4A 2H7WA 4APQC 1BWVA 5CEZD 4P2RB 3J8F7 1US0A 3MVSA 4R26L 4IIBA 3V7AE 3BQUC 3EGJA 1KGCD 1PS9A 1PJ9A 3IJEB 4GFSA 3MX0A 1XGEA 1SO4A 4IK6A 1OINA 5BUGA 1NFPA 1FCCA 1KLZA 2WQPA 1JERA 4K8RL 4LPUA 3MRMB 1TIUA 1H51A 3MGAA 1QNZL 1MQPA 1I1YB 4E9VA 1LK3L 3WNPA 3B0YA 3TTYA 1FDJA 1YEHH 1W72H 2HDJA 3PU7A 4MS8D 3R8RA 1GZHA 2R1WB 1RU9H 6REQA 3WY4A 4DIAA 2OKTA 2FX7L 4WGVB 3SW6A 4U1LA 2VXTL 4X5RA 5L2JB 4O9HH 4KRNA 5EU5B 5DCBA 3HI1B 3OZYA 4KFNA 4B96A 4QOKE 4EN3A 4DEUA 4AV5A 3TYBA 43CAB 1KFKA 4FXJA 1OM3L 5IJBC 5D1ZI 4G7EB 1AGFA 4C7FA 4RFEA 4Z3HA 3K46A 1LILA 3JT0A 3PY9A 3W26A 3OQRA 4MTMA 2WMIB 1EDQA 5T1DL 4TUJB 2Y36H 3SKOA 4ZA0A 2PI6A 5SWQA 1DKWA 2P24A 2QGCA 4LWWA 3CDYA 3FV9A 3OZLA 2YPVL 2FQIA 3C60C 4MMXC 2UYLB 3KPNA 5BRZA 4I4WA 2IADB 3HNTH 2C26A 3IXTB 5FUZH 1IUZA 1Z1WA 3GU1A 2DLFH 1PKYA 3QUYC 2LE9A 1X6UA 5C9JA 1DUZA 3WMCA 4PM1A 3H24A 4F9PA 5E1QA 1VLIA 3FTSA 4GRLD 3EFFA 3BGAA 2AAVA 3R0DA 4FE9A 4IFRA 3M5VA 5DRXB 4Y19B 4IMDA 2O6PA 3ZE1E 4WWKB 2YZ8A 4IYKA 4GX9A 3RE0A 4WTQA 2NY7H 5LJYH 3CAFA 3CBRA 2GYIA 4PG2A 4Q6JA 3TURA 3IEAA 4JX0A 1HHGA 1ZXQA 3AS0A 1YVLA 4WEBH 4RCAA 4HHAA 2HFTA 3IN2A 1BYOA 4CQCA 1A6ZA 1MFCL 2VLLA 4FADA 3TJHD 1CD8A 4RW3A 4ZOCA 4YFEA 5HYSG 1GPOH 2AFNA 3COTA 3PZUA 4HGKC 4PJAE 1DE4A 4NLAA 3CFMA 1XYLA 1YC8A 3O6MH 4IMEA 5CPNA 3SPCA 5BV7L 3UGRA 1WCBB 3L3GB 2FVNA</