3AFBA

Crystal structures of catalytic site mutants of active domain 2 of chitinase from pyrococcus furiosus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
300
structure length
300
Chain Sequence
GPNANPIPEHFFAPYIDMSLSVHKPLVEYAKLTGTKYFTLAFILYSSVYNGPAWAGSIPLEKFVDEVRELREIGGEVIIAFGGAVGPYLCQQASTPEQLAEWYIKVIDTYNATYLDFAIEAGIDADKLADALLIVQRERPWVKFSFTLPSDPGIGLAGGYGIIETMAKKGVRVDRVNPMTMDYYWTPSNAENAIKVAENVFRQLKQIYPEKSDEEIWKMIGLTPMIGVNDDKSVFTLEDAQQLVDWAIQHKIGSLAFWSVDRDHPGPTGEVSPLHRGTNDPDWAFSHVFVKFMEAFGYTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative chitinase
publication title Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus- the role of conserved residues in the active site
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 113
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3afbA00
4MB3A 4CU8A 1TR1A 2CHOA 3WD4A 2XWDA 3PZNA 1XCWA 3PZMA 4F8XA 2PBGA 4ZENA 2CESA 1V0LA 3SCQA 3MMDA 1JAKA 7TAAA 1UR0A 4UCFA 3M07A 4HA1A 2O9RA 2XGBA 4WSJA 4URIA 2EEXA 2WBKA 9CGTA 1J0KA 1JZ4A 2WKGA 2HVMA 2ZX7A 3AMCA 4KRUA 5IDIA 1VBRA 1ISWA 3KE0A 1H0GA 1R85A 3AS0A 2X09A 2YDQA 2Y4SA 1PAMA 5FOOA 5A6AA 3BC9A 1JL8A 1MQRA 2J77A 1AQHA 3SUVA 4W85A 3L4XA 3TOPA 1EA9C 2D24A 2EPMX 1UH2A 1SFSA 3G6LA 5FIPA 6TAAA 5A6SA 1BVNP 3RPMA 2YDSA 2DPEA 2J7FA 1W1VA 3SCOA 2ZICA 2VL4A 1MFUA 3RCNA 2AMGA 4TTGA 3WUGA 1J0IA 2D2OA 5JBDA 3CZLA 3GBDA 3ZQ9A 4PTWA 1UR4A 3M6DA 2ZX5A 4QFUA 1H49A 1QI5A 2JIEA 1V6UA 2YL5A 3NUKA 3W26A 4DUWA 4IUGA 4UQBA 4WK9A 3BAIA 1E4IA 2VX5A 1HJUA 1JD9A 1CXIA 3FHAA 5ABHA 5I23A 3N18A 4MADA 4ZE5A 3ZSTA 1ISVA 2GDVA 4YPJA 1F4HA 3VDCA 3AZSA 4K68A 1NWTA 3FNDA 3PZIA 1UWSA 4MNKA 1WDPA 5CGMA 1HKIA 1GOIA 4AD4A 1CXFA 3SCSA 1HJSA 3THCA 3EDFA 1VFMA 4F9JA 2ZOXA 3PTKA 4Z2GA 1CGWA 1GOMA 4MB5A 1JZ3A 2J7DA 2WMIB 3W6MA 3MMWA 3IAQA 3DYPA 2XYLA 1UKTA 1EHNA 4B9ZA 1HVXA 3BGAA 1DEDA 3I3DA 1V03A 4GINA 3U7VA 2VQUA 1TVPA 1RH9A 1GQIA 1LWHA 3GH7A 2OWCA 1V02A 4UFMA 1CDGA 1VAHA 2WLYA 3VD5A 2V3EA 2WVSA 1CWYA 3AHTA 1EHAA 3WQ6A 3WENA 3U7BA 2IUZA 1HP5A 1A3HA 1OGSA 2VX6A 4YHEA 3WN6A 1DWGM 3ZJKA 2FHFA 1OIFA 1ECEA 3BXWA 2J62A 4CD6A 2J74A 5KZ6A 1E1EA 3M7SA 3TTOA 1GQKA 2ZUNA 2BVTA 4U2YA 3DYMA 4Q7NA 1H41A 1NM9A 2XM1A 3MMUA 4NI3A 3ZR5A 2EJ1A 3FW6A 1C7TA 4D71A 1OT1A 2YA2A 1ISYA 3TTYA 1LG2A 1Q6CA 3SUSA 1KXQA 3ARQA 4W8AA 3AROA 3IAPA 4XX6A 2WHKA 4AZCB 1NOUA 2F61A 4KRTA 3T08A 2ZXQA 3OBAA 5D9MA 5DT5A 3VIMA 4AD5A 3SCUA 1HKMA 3WDPP 4Z2IA 3VX0A 1E4LA 3SCTA 4DWSC 5GQBA 3WH7A 2GJPA 2DH2A 3ALGA 5E9AA 1E9LA 3OZOA 3ARSA 3AIQA 2YDRA 2CERA 1E3ZA 1OWQA 4JKKA 2G4FA 4B3KA 4U5IA 1W9XA 1E6XM 3CZJA 1GOWA 2D3NA 2WZIA 4L4PA 1W2PA 1DHKA 3N9KA 3THDA 2CBIA 2WMFA 2VX4A 2CITA 2ZUTA 1BYDA 3WH9A 2OYMA 3DHPA 4N42A 3SCRA 1WB0A 1WCGA 2WCSA 4U3CA 2J7BA 4JL1A 1K9FA 1PJ9A 4MTVA 3VIFA 1JDDA 4ZXOA 3QR3A 2AOSA 4UOQA 1E1FA 2CHNA 1TG7A 5KEZA 1JG9A 3N15A 2VX7A 3VPLA 2NSXA 4OZOA 4AD2A 5HOSA 1D7FA 2DIJA 5BXTA 1RPKA 2OSWA 1UWTA 1TA3A 2A3AA 2Y24A 4UFLA 4AZHA 1BPLB 4W88A 1E3XA 2EQDA 1JF5A 1JZ5A 2IXUA 2JEQA 3AIWA 5BYWA 1MYRA 5HXMA 1GCYA 3WL0A 1H2JA 3ZM8A 4W7VA 2BV9A 3EDEA 3WF3A 4Y7EA 1LF1A 4UQAA 5LYRA 3AIUA 3CZEA 1CXLA 2HISA 1LLOA 3FAWA 3WH8A 4MAVA 1FP8A 1JD7A 1UKSA 4FLSA 1JIBA 4M56A 3DECA 3VIJA 4ACZA 1KGWA 4UOJA 1MW0A 3A3HA 3WY1A 4JCMA 2E8YA 3CUGA 4CD7A 1L0PA 3CO4A 4UNIA 2Y2WA 3N12A 2G8ZA 2E9MA 3AMKA 4MPKA 2FGLA 5D9NA 2XVKA 2WHJA 1QPKA 1VENA 1ZS2A 2QPSA 3J7HA 5FD0A 4UQ9A 2FH8A 2GVYA 3W38A 1ISXA 1M53A 1QI3A 2B31A 3W25A 4D6DA 1KXHA 1X6LA 4Z2JA 1E15A 3CPUA 2JEPA 2E9LA 3WD3A 2ZXBA 3BAWA 1UZ1A 5CGTA 5IHSA 4P7RA 1EDGA 2X05A 2GDUA 4M81A 3CLWA 3UR8A 1ITXA 3BAYA 4AZ7A 3CHDA 4UFKA 3BCFA 1TFVA 3VILA 1DWIM 1UKPA 1LL6A 1B0IA 1W3JA 1E40A 2E4TA 4WSKA 1VEMA 3ZJ8A 1CGVA 4CCDA 1I1WA 4FLOA 5M3WA 3L2MA 2XWEA 3W81A 2ZUMA 3MUZ1 2ZWYA 1XH1A 1HT6A 1J0YA 1GOQA 3W37A 2OSXA 5AC5A 1QNOA 4GI8A 1NQ6A 5I77A 1TZ7A 1UR8A 3W0KA 2WXDM 3QOMA 4PCSA 2YL8A 3WNOA 3O2LA 3PTQA 1XRVA 5BRQA 3U5YA 1E0XA 3EYPA 3WNMA 4OUEA 3K8MA 4Q22A 2JIWA 1JDAA 2E9BA 1OB0A 1XGZA 5I79A 4LQ1A 1CXKA 1KQYA 4IPLA 4C7GA 5BXRA 2XSBA 2PWDA 2BXZA 1CENA 4U33A 1DP0A 4GZJA 3GBEA 4BQ4A 2VJXA 1KBKA 5BWFA 2WWDA 5HPCA 4FLQA 2ZXAA 3D3AA 1R86A 2OYKA 3U57A 3SUTA 4D1IA 1WDRA 3VIPA 1JDCA 3VIGA 1CGTA 5IHRA 3ZSSA 3W28A 1UA3A 2DGAA 2FHCA 1DWHM 3CUIA 4ZEPA 2PWFA 2PBOA 2QHAA 2EPKX 1PX4A 3VGDA 1YHTA 4QLKA 3WMSA 1V6XA 5E0CA 2XPKA 3KEHA 4BA0A 2GFTA 2VR5A 5A6JA 3NJ3A 5A69A 4AIUA 3S6TA 4D6CA 3G6MA 1XC6A 3K8KA 1B2YA 4FLRA 1C90A 3MSDA 1E6ZA 2WCAA 3GTNA 3POCA 2GUYA 3E1F1 1OT2A 2D22A 4PMQA 2PWGA 1WO2A 2E40A 1C8QA 2JF6A 2QPUA 3NDZA 1NWRA 1VJZA 5LA2A 3N13A 2XVLA 2E8ZA 5CPSA 4QLLA 4D6IA 1QNQA 3NDYA 1GONA 1JFHA 2VR4A 1U30A 2O92A 4HMDA 4MNMA 1QHZA 5BXSA 2WMJA 4HU0A 4ML4A 1WZMA 1WAWA 3ZR6A 2UY3A 3VDAA 3PZOA 1GOOA 1KB3A 1W32A 4OBRA 3OG2A 1W9DM 4AZ6A 3MU7A 4D6HA 1W9PA 1AVAA 1IV8A 7CGTA 4ZE4A 4TOQA 2BVDA 1FP9A 1VFOA 4CU7A 5JIWA 4CD8A 2XHYA 2J7CA 1BLIA 1C92A 2ZX8A 1V6VA 4LYQA 2C7FA 2J8GA 3GH5A 4JHOA 1CXEA 2GJRA 1G9HA 1ODUA 1XYZA 4JHZA 1NP2A 1J9YA 1XHGA 4PN2A 1FHLA 4AW7A 3FHQA 1MW2A 3POHA 4A4AA 4X9YA 4BQ5A 4HOWA 1GZJA 1KBBA 1NWUA 4LXFA 1R7AA 1V3IA 1ZU8A 4AISA 2CETA 3OB8A 3MUY1 4TXEA 2VT0A 1TUXA 1XSJA 4FK9A 2WVVA 3WEMA 4UZSA 2D0FA 1FA2A 3N1AA 3AS1A 2OWXA 2Z1KA 3A4WA 3CHEA 3SCVA 3EDKA 4W7UA 1HJVA 1KCLA 3KWXA 3AZRA 4MNJA 3OLDA 1BQCA 3AHZA 1ESWA 4GI9A 5BXPA 1BYCA 5AY7A 2YLLA 3VINA 3L4YA 1OM0A 1V0NA 3T2PA 4AZ5A 3ARVA 3VD4A 1XD1A 3PZTA 4GO8A 4PYSA 3K4AA 1TA3B 4GZIA 3IJ9A 4P7LA 2WHMA 1HNYA 4NSBA 2EPOA 1EDTA 3WEOA 1DTUA 1UHVA 4H7VA 1OSEA 1GNXA 4AD3A 4S3JA 4NZCA 5A8MA 3WNNA 2QMKA 3LPGA 3VTRA 1BVZA 5I3DA 1KGUA 3AISA 2ZWZA 1EIBA 4ZXLA 3UESA 1UKOA 1UWRA 1PEZA 4M80A 3AIRA 1UYQA 5JIPA 2XIIA 2NT1A 3AIBA 5CJ5A 4S3KA 1OD8A 4HA3A 2WMKA 3NSXA 4AD0A 4CCCA 4TVDA 5AYBA 2J7GA 2J7HA 1YQ2A 3B9DA 1XH2A 2WC3A 2BVYA 4UFIA 1UH3A 1VEPA 2RGLA 4U2ZA 5A6KA 1QI2A 3TA9A 4ACZB 3L4UA 3ZO9A 1E70M 3PTMA 3WD2A 2W4XA 3ARXA 2D20A 4CD4A 4M24A 4PCTA 5EMYA 5A2CA 3VDHA 3UERA 1E6PA 2G3MA 3L4VA 2YA1A 2NW0A 2W67A 2A3CA 5DMYA 1V6YA 4D6EA 3A6OA 2ZE0A 1QBBA 1JYNA 4AEFA 2CPUA 4OKDA 2CBUA 4HZ8A 1UZ4A 1LJYA 2DSZA 4BQ2A 3RM4A 1J18A 3CIVA 2G41A 2WAGA 4TUFA 3AOFA 2ZUVA 3VIHA 1KGXA 4C7DA 4W86A 3VIOA 5ABEA 1R87A 3GNPA 1E6RA 2PWEA 3VNYA 4PMUA 2YA0A 4AZGA 1R7OA 2PC8A 3ZT6A 1QI4A 2DSUA 2YL6A 3SUWA 4PBGA 3AHXA 4ATDA 1BYAA 2NT0A 1MXDA 2WANA 3BAJA 4AYSA 2BY3A 1UD3A 2DT3A 1HL8A 3A47A 2BXYA 2V3FA 8A3HA 3RJYA 4TVCA 1SMDA 3AXHA 2G3JA 4EK7A 2V38A 7A3HA 1C8YA 1G1YA 1VFFA 1C3FA 3CHFA 5E09A 3WDRA 5EB8A 1BGAA 1FH7A 4UR9A 2GSJA 1TE1A 5CPTA 2ESCA 1MFVA 4ATLA 1BSIA 3CHCA 1V3KA 1RP9A 5CLWA 4GZEA 3WQ8A 4B16A 1Q6EA 3W53A 1KCKA 1KQZA 1JYWA 1EQPA 1E4NA 2XFFA 3EBVA 3PZUA 1PX8A 1ZJBA 4MJ2A 2D0GA 5FKYA 1MQQA 2E0PA 1E6QM 3MKKA 4GXPA 3L2LA 2OYLA 1OCQA 4JIEA 3FY1A 1BGGA 5BCAA 4OJYA 2XVPA 4J27A 4HTYA 3WEZA 2D1ZA 2DQXA 3CUJA 4RL3A 1AQ0A 5D9PA 5FCZA 3RILA 5CSYA 1JGIA 1AMYA 1WE5A 2QV4A 4W5UA 3N17A 5A94A 3ECQA 1VEOA 4M82A 1GORA 5CZKA 4JL2A 1IZJA 4H41A 2ZUSA 2XJ7A 1X6NA 4UOZA 4XZWA 3WDJA 1QOXA 2OWWA 4FMVA 4L4OA 2BFGA 1PBGA 3MV11 5HBFA 2WMHA 1J01A 3ARUA 3U5UA 3MV01 3APGA 4LYRA 1UR9A 4HA4A 2VTFA 1E4MM 3T0DA 2JALA 3OZPA 1H09A 4WF7A 1J0JA 4BZYA 5CQ1A 3IJ8A 4QCFA 3BLPX 3WD0A 3VVGA 3AYRA 4HOZA 1JXJA 1E5JA 1N82A 5C8BB 3O6AA 2QMJA 3S2CA 1A47A 1EXPA 2BY1A 1ISZA 4CUCA 2A3BA 1GQLA 1C7SA 3WF2A 1KXVA 1BG4A 5CG0A 3L4TA 2V3DA 4W84A 1GHSA 1BAGA 3UG5A 2WKLA 3AS2A 2WNWA 1KR0A 5A95A 1GJWA 2WC7A 3UCQA 3WQ4A 4CKQA 2XG9A 1B3VA 3PZQA 4U31A 2YKKA 4JZ5A 3AIEA 1MW1A 1UR1A 1QW9A 5CSUA 4Z2LA 3UG3A 2X1IA 1OGGA 4J28A 3F4VA 1OGBA 1GW1A 3TP4A 1M03A 1DWAM 4EKJA 1PPIA 3NCOA 4M1RA 1EO7A 1SYTA 4CD5A 2XGIA 3CGTA 4J3VA 3BMVA 5HNNA 1JZ8A 4CN4A 1CLVA 2GK1A 2VOTA 5LA0A 3AMDA 4WKHA 3WKZA 4TX8A 3W24A 4W89A 4P8WA 1QNRA 3BAXA 1EDQA 1D2KA 3NSMA 1KR1A 3ZJ7A 4NRSA 3SIMA 3AHVA 1UQYA 1R8LA 3AS3A 2CXGA 2YIHA 4M8UA 4AIEA 2VZSA 5ABFA 3K46A 3GXIA 1FOBA 2UWFA 2VC9A 4U5KA 1F4AA 3B9EA 2WVVB 4D1JA 3K8LA 3N04A 3F5KA 2PB1A 4JFTA 3ZT7A 4PSPA 1JYVA 1ZBVA 1B3YA 3VMOA 1V3HA 1D3CA 1GJUA 2FHBA 4UTFA 4W5ZA 5A8OA 4ACYA 2FDMA 5AC4A 4CN6A 2W66A 2WYSA 2BHYA 4WKAA 2Q8XA 2WLZA 3SCWA 1PIGA 2W91A 4X0VA 1H0IA 4PMNA 1TMQA 1E73M 1GPFA 3LPOA 2A3HA 3WFLA 2VVNA 2GJXA 3CH9A 4B3LA 5LA1A 5I78A 1ZB5A 1WZAA 1CIUA 2PWHA 1WDQA 5GNYA 2XFYA 2BNJA 4UZUA 1FFQA 3ARZA 3RIKA 1PZ2A 4D72A 1V3MA 1W91A 1BFNA 1SR0A 4PMDA 2WPGA 4H04A 5EFFA 5C71A 4JCLA 2BY0A 3NSNA 3W6LA 2DT0A 2X0HA 3WQVA 2RGMA 3VIIA 3MS8A 3ARPA 1E5NA 3ZMRA 1NARA 1AQMA 4XZBA 4WKFA 5F7UA 2EPNA 4PMYA 4PUEA 3KZSA 2AAAA 4KGJA 1O6IA 3UETA 5A1AA 4QCEA 1U33A 3VU2A 1W9UA 3MANA 2UY2A 3GM8A 1MW3A 1WP6A 3AMGA 2W63A 1BF2A 4H8VA 2YBTA 3GXFA 3ARTA 1OBAA 3BSHA 1QHOA 3CUHA 3VNZA 4PTVA 8CGTA 4DUXA 1QNSA 1M7XA 4PMOA 1CBGA 1PX3A 3AFBA 1C8XA 1EGZA 2OLHA 4Z2KA 2D3LA 2X0YA 1PIFA 3AI0A 1J0HA 2G3NA 4F9DA 2FH6A 2VUYA 2F8QA 2F2HA 3QHNA 2BS9A 1UH4A 4JAWA 4MDOA 1IT0A 1H5VA 1JNDA 4HMCA 2C8NA 1I75A 1Q6GA 4LX4A 2D0HA 2WBGA 1VRXA 2BY2A 1RD6A 1GHRA 3EMQA 3SURA 4HPGA 3ZJ6A 4RE3A 4F66A 1WPCA 4AXNA 4TX6A 3VM5A 2J47A 3VM7A 4PUDA 3CZKA 2FGZA 4ATWA 5I0DA 1Y7VA 1E55A 3AXXA 4YHGA 3NIYA 4QP0A 1LL7A 3ARRA 3CBWA 4GQRA 1B1YA 3D5HA 4J3WA 3VKKA 1B30A 5DF0A 1W2VA 5CXPA 1VB9A 3VOCA 3RO8A 4IM4A 2WWCA 3HJEA 3GDBA 3WNPA 2WHLA 3AYSA 4D6FA 1O7AA 3OLIA 4P7QA 2CKRA 1ZL1A 1E71M 3WUBA 1E6NA 1W9VA 5CPQA 1MQPA 3NYDA 5GNXA 3VMPA 4B15A 1GVYA 3KL3A 2W92A 2QLYA 1I1XA 1BYBA 3PZ9A 1J0ZA 1UWUA 3AICA 1B31A 1UWQA 3K1DA 2WM0A 5A6MA 5D4YA 1KWKA 1W1PA 1EH9A 4UQEA 1IZKA 2WW5A 3RDKA 1GQJA 1CYGA 1GUVA 1V3LA 4EE9A 2J25A 3T2QA 4QDMA 5DEZA 1Q4NX 3ZOAA 1MXGA 4WIWA 1NWSA 4XUYA 1H1NA 3BMWA 2V3GA 5ABGA 3HU7A 5IFTA 4P7NA 4MNLA 4AWEA 1HL9A 3SUUA 2VVSA 1QVBA 4AZIA 2VMFA 4LPCA 1HVQA 5CLTA 3I3EA 3WF4A 3IJ7A 4JFVA 1W3KA 3M46A 3FXYA 2WZHA 1Z32X 3BAKA 1UD6A 2XUCA 4E8CA 3VDBA 1V0MA 1Q6FA 1UQZA 2DSKA 3IANA 4PMVA 3OGVA 4OIFA 2VNCA 5FL1A 4D6GA 4H8UA 5HPOA 3A4XA 3AIVA 1JXKA 3TTSA 1KXTA 2VCCA 4CCEA 4JFWA 4Z2HA 3WD1A 3VGBA 3QHOA 5E70A 5DT7A 3WL1A 5I24A 3MUIA 1V02E 1E6SM 3FAXA 1GOKA 3L4ZA 2VCAA 5EFDA 4GPNA 2XSAA 1CPUA 3II1A 4A3HA 3VMNA 3VD7A 1TVNA 4WLCA 1C93A 4B9YA 3UG4A 1MVYA 3B9AA 3N11A 1B9ZA 4PEEA 2YJQA 3MSGA 3BLKA 2A3EA 3PN8A 5AYIA 2YLAA 2CCRA 4P7OA 5A8PA 1V0KA 5TD4A 1WKYA 2CBJA 1JFXA 3WDQA 2CBVA 4AIOA 5I6SA 2WSKA 3EDDA 2GK1B 1CGXA 4E4PA 1C91A 4NF7A 1FFRA 1H4PA 3RMEA 1NH6A 3ALFA 3UR7A 3W29A 4AD1A 2YL9A 4H8HA 1E0VA 1CZ1A 6CGTA 1BTCA 4OOUA 3QGVA 2VRJA 2VZTA 5A2BA 5ABFB 4DM2A 1HJXA 1B3WA 2D23A 4LGXA 4JFUA 1JZ6A 2Y5EA 5D8ZA 4V28A 1QI0A 4DUVA 1G94A 3PZGA 3GXDA 3GZAA 4GKLA 4JKMA 1J10A 3PHAA 4P8XA 1ZBKA 2DSVA 2UY4A 4P8VA 2WC4A 5FL0A 4IISA 5JUVA 3IK2A 4CVUA 5JBFA 2WZEA 3T0BA 2EXOA 1HN1A 3WFZA 1CGYA 3WH6A 2CIPA 1FH9A 4KGLA 5E6ZA 1CLXA 3CTTA 6A3HA 4OBSA 1HF6A 4GIAA 1BHGA 1JF6A 3WELA 2E3ZA 5C70A 2GJXB 2W61A 1UKQA 4UQDA 4MAZA 2DH3A 4BS0A 5GNZA 1NOWA 4EAMA 4CGTA 2DT1A 2Y8VA 4BF7A 5A2AA 3AJ7A 2OSYA 2ZUUA 3TTQA 1G5AA 3MUAA 2VQTA 4HZ6A 4HPHA 3QOKA 1EO5A 1W1TA 2VRQA 2X2YA 1XYFA 3DYOA 1HX0A 1LQ0A 1E72M 5A6BD 3AHYA 4JKLA 1UD8A 4J3SA 3WUFA 4F79A 2XVNA 2C0HA 1WZLA 4IPNB 2WVTA 1LG1A 4PTMA 3GNRA 2Y8KA 3RM8A 1J11A 1VFUA 3WMCA 1W9BM 3VX1A 3ZIZA 4W7WA 4E2OA 4X0NA 4HOXA 2CKSA 1B3XA 3WF1A 5DO8A 4PMXA 1X1NA 4XV0A 3W27A 5M03A 4QAWA 4GQQA 3WUEA 3PBGA 3OIHA 2WVUA 3WDIA 2CEQA 3A4AA 3OGSA 4DM1A 3CMJA 1P6WA 1K9TA 3B8SA 1QW8A 4NRRA 3WH5A 3WQ5A 3GNOA 2VZVA 2DEPA 2O9TA 5DFAA 1FH8A 3LMYA 1UUQA 1V3JA 3RJXA 3BH4A 1OIMA 2V5CA 2DSWA 1ZBCA 1W3LA 1M04A 4AMCA 4R5EA 5GPRA 4M29A 4KMQA 1UD4A 1UG6A 1BG9A 2O9PA 1S46A 2DIEA 2WMGA 1VF8A 1XCXA 1K9DA 2DDXA 4P8UA 1RP8A 3CMGA 3T09A 2J7EA 2XTKA 4MJ4A 3K4DA 4W93A 1EOKA 4KWUA 3EMZA 3HN3A 3WNLA 3JUGA 2CYGA 4W8LA 4H2CA 2TAAA 1KWGA 3WDHA 1VJSA 4AY1A 4DWSB 3WMBA 4J3XA 4XB3A 1LWJA 3VGFA 2WMIA 1EOMA 4JFSA 5BRPA 5HDRA 2XIBA 4J3UA 3TONA 1QHPA 3F5JA 1WZKA 4E8DA 1UR2A 1SMAA 3AXIA 5I5RA 1W3HA 4OOZA 4HU8A 1QNPA 4HP5A 4AC1X 3EMCA 4PRWA 3WBAA 3SEPA 1JI2A 3EDJA 3AMLA 2W62A 4WJXA 4GI6A 1G01A 1H11A 4J7RA 5A6BA 1CXHA 4PTXA 2Z1SA 1JYXA 4A3YA 1XV8A 4EANA 1JZ7A 1UOKA 2VZUA 2VURA 4C7FA 2QF8A 1K9EA 1V08A 1E43A 5D8WA 5D9OA 1ZBWA 2XVGA 5IFPA 4AZBA 5A8NA 4BQ3A 3LPPA 4V2XA 1CGUA 1L8NA 3VGGA 2ZXDA 1CECA 1FHDA 4J3TA 2EPLX 1JAEA 1XH0A 2JFEX 2VO5A 3O9NA 3WNKA 4MB4A 2PF0A 1HJQA 3WSUA 1CNVA 3AZTA 1JNEA 1B90A 2VZOA 1CTNA 4RE2A 4YN5A 1OD0A 3OGRA 1XD0A 4FF5A 1B3ZA 2MANA 3GH4A 4PSRA 4RE4A 3MO4A 4AZCA 3KL5A 4DWSD 1ZJAA 4N0RA 2J75A 5I2UA 1DWJM 3T0AA 2V5DA 1WDSA 2EBNA 3L4WA 1K6AA 3VGEA 3GXMA 3T2OA 3CUFA 1HKKA 1H3GA 1Q6DA 2ZUWA 1E0WA 4GO9A 3F5LA 3I3BA 1HXJA 1QBAA 2PI6A 3W82A 3LPFA 4QLJA 3GYCA 3ARWA 4HZ7A 3SCNA 1EQCA 3ARYA 2JE8A 3AQUA 3HMCA 1UD2A 2DT2A 1US2A 3QHMA 3RM9A 1PZ3A 1GVIA 3BSGA 1G0CA 2ZX9A 4MB1A 3ZT5A 1UA7A 4PMZA 4V27A 3FN9A 3W4RA 2J79A 2YBUA 3CZGA 2IXVA 3VGHA 1LL4A 2BHZA 2J8FA 5EBAA 1JI1A 4UFJA 1MWOA 1US3A 4CN1A 1M01A 1DWFM 3PZVA 3VD3A 3DHUA 1V6WA 1VIWA 2J4GA 4KH2A 1XSKA 3OLGA 4CU6A 3SCPA 1ITCA 2WCGA 2UY5A 2W5FA 4MDPA 2WSPA 2G3IA 5A6LA 1U2YA 1E56A 3OA5A 1UD5A 1UWIA 2O9OA 5JBEA 3VD9A 4R27A 3OLEA 2VCBA 5E6YA 1WNOA 2X8RA 2CNCA 3CZ8A 2XM2A 4U3AA 2VRKA 4ZFMA 1OINA 4AEEA 1KFWA 2J78A 5E0FA 5BROA 3WQWA 2ZX6A 5IXEA 1VBUA 4TVUA 3DC0A 5ECUA 2JF7A 4UFHA 4W87A 2YOCA 4LYPA 3VUPA 4UQCA 3BCDA 4W8BA 1XSIA 2WK2A 3WBEA 4DWSA 3UEQA 1ODZA 1NOFA 1HKJA 3WIJA 2VI0A 3VO0A 1HIZA 3VIKA 1W1YA 1JZ2A 2WB5A 5A3HA 5M5DA 1CEOA 4CVWA 1HJWA 2XFRA 3KL0A 4HMEA 5M17A 4D6JA 1HP4A 1J12A 4TTUA 4PMRA 2ZIDA 4BCEA 2BHUA 5A8QA 2EO7A 1NP0A 1TCMA 3WF0A
chains in the Genus database with same CATH superfamily
4NHVA 4CU8A 3WD4A 4ZO8A 4LB3A 2XIQA 2X42A 4YVPA 5D03A 2FVKA 1T8XA 3WX7A 2EGZA 1ECQA 1DIKA 4BHYA 1A3XA 3TWAA 2PLCA 4HA1A 4J5NA 3L0GA 2PDQA 1K02A 4DXXA 1MEWA 1R5YA 4CQ9A 2HVMA 4F40A 2AKMA 3BLDA 3UWVA 4JQ1A 4KRUA 3KE0A 1R85A 3PJUA 4QJ5B 3S42A 2Y4SA 2CW6A 4DJDD 3W9ZA 1S5VA 1MQRA 2J77A 1AQHA 3L4XA 3TOPA 1O5XA 4KKXA 4DF2A 5A6SA 3OW1A 4QG8A 1F3TA 5AKQA 1V7AA 5HAOA 1E9ZB 2ABBA 1MXSA 1W1VA 1Z48A 2ZICA 4MWAB 1KNWA 3PBWA 2D2OA 3GBDA 3ZQ9A 4TO8A 2ZX5A 2Z00A 3S0CA 1JCJA 2VWSA 4IUGA 2P3ZA 5CPNA 4UQBA 1LORA 3BAIA 4IPPA 3UYCA 1PWLA 1XLHA 3GAKA 3SZ8A 3FJLA 2TSYA 1F3WA 5LNRA 4MADA 3C0LA 1GVEA 1SQ7A 3LLXA 4LVAA 3TYUA 3M5YA 1TRDA 2OXNA 5KITA 1TV8A 4MNKA 1HKIA 2PDWA 3THCA 5FAJA 3PTKA 1XIEA 3MPGA 1KFBA 4LH8A 2XISA 4F2TA 1GOMA 1H60A 4MB5A 3VCNA 2DP3A 3DYPA 2XYLA 1HZYA 4X2PA 2VQUA 3W2UA 1GVSA 3EKLA 3KUMA 5AHIA 1RH9A 2CZFA 4D8ZA 1VIZA 3KVMA 2OWCA 3DFTA 1Q6LA 1AJ0A 2WLYA 2YBVA 3W2NA 6XIMA 2V3EA 3VDGA 1CWYA 3TE9A 3OTRA 1K03A 3N3TA 4IP7A 3WYZA 2QCEA 1R2SA 4JX6A 3QQWA 3C3NA 1OIFA 1ECEA 2OOGA 3BXWA 4MJZA 5A6TC 4O28A 4BI5A 4Q7NA 1H41A 2XM1A 4NI3A 3A64A 2EJ1A 1C7TA 1WX0A 3DZ1A 1R3WA 3ANUA 1ISYA 3SUSA 1TV4A 1KXQA 3TZFA 4MPQA 1TWZA 4KERA 3AROA 4YCPA 1JULA 3IAPA 4XX6A 2I17A 2WHKA 1NOUA 5JQ9A 3P5YA 2ZXQA 1TRIA 2QDHA 2FJKA 1FWNA 3D47A 3VIMA 1RVKA 3W83A 3VKAA 4I9AA 4S3FA 5CC6A 4HYWA 1E4LA 3IARA 3DCPA 2GL5A 3ALGA 4POCA 2Y62A 2YDRA 2CERA 2GGEA 1OWQA 4JKKA 2G4FA 4IQDA 1UC4A 4M7SA 1E6XM 3CZJA 1GOWA 2D3NA 2WZIA 4N4QA 2VEFA 4PA8A 1W2PA 3DFSA 5CC5A 1O4UA 3THDA 8XIMA 4GNVA 2WMFA 2CITA 2PEVA 2ZUTA 3WJZA 3BOLA 2OYMA 3TW7A 3SCRA 3M0JA 4U3CA 3ZYZA 1F6KA 4R7OA 1K9FA 1EJTC 4WHBA 1TJPA 2AL2A 2A85A 2PDXA 2V5LA 4JTFA 4UOQA 3BK0A 3MJMA 3VNMA 1JG9A 2VX7A 1YNQA 2BGSA 2FZNA 5BXTA 1EX1A 3P81A 1ZAIA 1UWTA 1TA3A 2A3AA 1BPLB 4REQA 3W70A 3N73A 2TRSA 3ITCA 2EQDA 4NG3A 1QJWA 4GCXA 4J9JA 1JZ5A 5KSWA 1PSCA 3FIGA 1H2JA 1UP0A 3NZQA 3EWUA 2OZ8A 3RXZA 3WJWA 4UQAA 5LYRA 4B5WA 1CXLA 4L4MA 1DE6A 5JH2A 4PODA 2ODOA 4MFDA 3WH8A 3IUHA 4E3TA 3QY7A 1JIBA 1GQNA 4QDPA 2R1MA 1KGWA 2YB4A 4UOJA 4QITA 3W01A 1DOSA 3KRUA 4JIIX 1ADDA 5C9XA 3EXSA 3LYEA 1R46A 1VHNA 3O1NA 3WLRA 3XISA 5D9NA 2DZPA 2ZZ7A 1KRBC 4JXCA 4GNJA 3OHMB 5FD0A 3C61A 4MKVA 4DPQA 4L64A 1FQ0A 3W38A 1ISXA 2ISWA 4O15A 2BMBA 3G1HA 1N7KA 1G4SA 5FSDC 2ZZ3A 3UXAA 2ANUA 1R6WA 3MY9A 2E9LA 2ZXBA 4M6UA 1FWAC 3LI0A 3EWYA 4JDBA 5IHSA 2X05A 4DJEC 2GDUA 3B4UA 2FJUB 3E2QA 1ITXA 3CWHA 3BOFA 1B4EA 2ZADA 3BCFA 3S1VA 1UKPA 4DUOA 4WOZA 4QDWA 3RUBL 4WSKA 2PE4A 3VOGA 4XZLX 1XLBA 3GVWA 1XQKA 3SY1A 2ZUMA 4OUIA 2ZWYA 3GLCA 1HT6A 1PS9A 1FWDC 3U2EA 2OSXA 4GI8A 2FZ9A 5CBJA 2YL8A 5LIXX 3CL6A 4IL2A 3U2ZA 3K8MA 4Q22A 3B03A 1XGZA 3DIPA 4LQ1A 4YLWA 4UMBA 3FA3A 3HQPA 5BXRA 2XSBA 2G50A 4UB9A 3QQ0A 2BXZA 1DP0A 1A0EA 2IMRA 1WXYA 1R86A 4GVIA 4D1IA 5CC3A 3B8DA 4JTHA 1ZQ5A 1PYMA 3TZNA 1JDCA 3AWNA 4QX4A 3VE7A 5IHRA 1T0OA 3V16A 3PF3A 4JNYA 2I57A 3P8JA 4UC5A 3CUIA 2AQOA 4ZEPA 1Q45A 1XPYA 3LQGA 2ASHA 2PGFA 3VGDA 1YHTA 1PKYA 3WMSA 5E0CA 5A5WA 4BA0A 1UWAA 3GDKA 5A6JA 3NJ3A 4IGHA 5A69A 3S6TA 4A3QA 4GBUA 4ZCWA 4C6JA 3G0UA 2ZE3A 2PPGA 2IW0A 3HV9A 1HQTA 4HK7A 2GUYA 2VYOA 2XN0A 4C1LA 4DBSA 3BQ6A 2V82A 5HQMA 4JQAA 1C8QA 3IV8A 1VJZA 2IPFA 5HWJA 4D6IA 4QLLA 3K5XA 4YTSA 3NDYA 1GONA 2E09A 1JFHA 1U30A 1OQFA 2OU4A 4HMDA 4MNMA 5BXSA 5D2WA 4F3HA 3QEZA 5MKGB 1W32A 4OBRA 4ZVJA 3OG2A 1W9DM 3R0UA 2ZZ2A 4AZ6A 3BG3A 3B9OA 4D6HA 1IE7C 7CGTA 1XRSA 3OZMA 1FP9A 1VFOA 1GKRA 4WY0F 1C92A 1SZFA 3P82A 1V6VA 4LYQA 4NASA 4MG4A 2ZCGA 3QW4B 3CPGA 5E9XA 1XKYA 1I0BA 3BQ5A 2IKGA 1A5AA 4JHZA 4TIMA 3PANA 1FCBA 3I4KA 5JXQA 3O0KA 3LNPA 3BVJA 1FHLA 7ODCA 3POHA 4X9YA 4LXFA 4Y6GA 3MI2A 4H6RA 1P0EA 4UNLA 3NQMA 2QEZA 4EVZA 2GVEA 1XC4A 4Z08A 1KTCA 3V0UA 1KV8A 2OWXA 3A4WA 1R30A 3CHEA 4W7UA 4IXHA 3W1NA 1KCLA 5I06A 1UUOA 5AY7A 1IWAA 4A3UA 2WSYA 1EZ2A 4LNCA 1V0NA 3T2PA 4AZ5A 3ARVA 4O18A 4GO8A 3CM4A 3IJ9A 2HVOA 4OBTA 6TIMA 3ABZA 1Z6KA 3WEOA 4UUIA 1J2WA 1DTUA 1TMHA 2P0IA 1XW8A 1OSEA 1RA0A 4AD3A 3VTRA 3TN5A 5I3DA 2OZ0A 2ZWZA 3AISA 1UWRA 1SO6A 4LTSA 1PEZA 2BASA 5M1TA 1UYQA 2XIIA 1UMLA 4OQVA 4GWEA 4S3KA 1G7UA 1OD8A 4HA3A 4YJ5A 3VOIA 5AYBA 2J7HA 1F76A 1RJQA 3SRDA 3C2OA 2RGLA 4U2ZA 3ARXA 4CD4A 2YZ5A 5A2CA 2YA1A 5DMYA 2A3CA 4RK8A 4F0HA 1MNSA 1RSCA 3BW4A 3I68A 4YTUA 2HE8A 4YVXA 4GLEA 4HZ8A 2DSZA 4RZBA 4JOMA 2Z2BA 1J18A 1P0DA 3GDLA 3GSMA 3RLVA 3AOFA 4I3GA 1KGXA 3NPVA 4C7DA 4W86A 1E6RA 2PWEA 3ONCA 3ZT6A 1QI4A 1NDVA 4Z0JA 3SUWA 3PPFA 4PBGA 2OEMA 2YCKX 5I3IA 2GPTA 2JQXA 1BYAA 1MXDA 1XM3A 2KX9A 2QUVA 3BAJA 4DPPA 3A47A 5FAGA 3NM3A 3W1TA 4Q8UA 3G1RA 2R82A 4AVFA 5E09A 5EB8A 1FH7A 1AA1B 1XIFA 4C6BA 1AQFA 2NXHA 3LI1A 1DXIA 3PFRA 5CPTA 2OZTA 3EB4A 4PB4A 2XINA 2FZDA 2YXXA 4WUIA 4LT9A 3HGSA 1RP9A 3GIYA 3F1QA 3QPEA 3HG5A 4GG9A 4NJHA 3MI3A 1E4NA 1PX8A 1QR7A 5FF4A 4MJ2A 1GYLA 3L2LA 2OYLA 1YIXA 3CU2A 1W1IE 1BGGA 2YCLA 4MWAE 3RNDA 5DXYA 4OJYA 2XVPA 4J27A 4RL3A 2ISFA 3T78A 4I9TA 1LQAA 1XWYA 2HRWA 4W9TA 3DOPA 4LUSA 2QZRA 3PJTA 5CZKA 3QTGA 4JEQA 4M7TA 1K7EA 4AX7A 1A3WA 4G7FA 1IZJA 3LHWA 4GQ0A 1K77A 1X6NA 3TFCA 4PH6A 5LNUA 3WDJA 4L4OA 3UXKA 3AO0A 2NQZA 1RR2A 3MV11 1P5BA 5MHBA 1F2JA 2WMHA 5HMEA 4NX5A 4KEUA 1TQJA 1GWJA 3LHZA 4LEFA 5HULA 4LYRA 4F0MA 4HA4A 2VTFA 3T0DA 2JALA 4GVHA 3N2BA 2EG8A 1H09A 4WF7A 4LVBA 3PUOA 4IMFA 3WD0A 3AYRA 1OK6A 3SADA 1JXJA 1OCJA 1VC4A 4IG2A 3S2CA 1EXPA 4D2JA 1SJBA 4DLFA 2A3BA 5CG0A 3WLIA 3L4TA 3OEXA 1BAGA 2WKLA 2WNWA 1IIGA 3GUGA 2TMDA 1B3VA 3F2BA 1JCXA 4JZ5A 3AIEA 4Y9MA 4NYYA 4IMCA 2C6QA 1CX9A 1IEXA 5FJIA 2ZZ4A 4J28A 1GW1A 4ADSA 1DWAM 4M1RA 1LRNA 1SYTA 4CD5A 4S39A 3DBPA 5DRCA 2XGIA 3CGTA 4NAFA 3KHDA 4MOZA 3TWBA 2VOTA 3AMDA 4MY8A 3DXIA 1AFSA 4O13A 1ME7A 2GWNA 2ISVA 3SIMA 1F07A 5ECVA 2CXEA 4EACA 2A3LA 2QUUA 1OYBA 2UWFA 1ZENA 2VC9A 2QJIA 2VXNA 4EWND 4JYFA 3VCRA 2BDQA 4JFTA 3W88A 3ZT7A 3VMOA 1H61A 1V3HA 1REQA 1GJUA 4UTFA 3DFPA 1J6PA 1F74A 1EPVA 5A8OA 5FEXA 3CH0A 4CN6A 4O8AA 2WLZA 1PIGA 1DKWA 4GJIA 4X0VA 3OVRA 4UTKA 3LPOA 2VP8A 5HJXA 4DZ5A 2RDUA 3V75A 4LV9A 3H26A 5LA1A 3U9IA 1WZAA 2C3ZA 2BNJA 4UZUA 1PZ2A 4D72A 3B8IA 1BFNA 3RLHA 1SR0A 2WJZA 1N55A 2WPGA 5EFFA 5JMUA 2BY0A 3NSNA 2G95A 4JIHA 2POTA 5HWNA 3P93A 2X0HA 3WQVA 3VIIA 3LGDA 4JTLA 1YW1A 1I9CB 4AWTA 2VFDA 3KZSA 2AAAA 4KGJA 4BR1A 4QCEA 1XGEA 2ZA3A 3LXBA 4FI4A 3LHYA 3L2IA 3WO8A 4H8VA 4X61A 4DLMA 5J5RA 3H23A 3MI6A 2YW3A 4BKNA 4DUXA 3NQEA 4A05A 1RJPA 1CBGA 3IEBA 4NVTA 4YS1A 1ZPTA 4EXAA 3ZVIA 1C8XA 4L5ZA 2OKOA 4GE8A 1W1B1 4Z2KA 1XUZA 1K8YA 2X0YA 4F9DA 2Z1XA 4QBXA 4DEFA 3CC1A 1VFTA 1UH4A 4DVOA 1H5VA 5BOFA 2C8NA 4LX4A 2PDNA 4NAEA 1XIMA 4L4LA 1GHRA 1NY1A 4QIUA 4C6DA 2AMXA 1Z7AA 4NP7A 2XSXA 5D32A 4I7WA 1A49A 3VM5A 1E51A 3CZKA 1XYBA 3BPWA 3ABXA 4RDYA 2NUWA 1E55A 3LLDA 4LVDA 3NIYA 3CBWA 4E3VA 1B1YA 4AMAA 5I3JA 3OQEA 3S83A 1L9WA 3MBFA 1PB0A 2WWCA 3AU2A 3UD6A 3P74A 2QCNA 2QCCA 1GVRA 2FKPA 4UTIA 3R94A 3OLIA 3H2CA 3W6YA 4P7QA 2VGIA 4HNNA 1IYXA 1E71M 1YTKA 1E6NA 4DYEA 4LF2A 1WBJA 3E02A 1PCWA 3NYDA 3T0CA 4GBDA 1F3XA 3KL3A 2QLYA 3O05A 3KW3A 3P2VA 4JTRA 1MO0A 1NF0A 3AICA 3K1DA 5A6MA 3SR7A 3I6RA 1VS1A 1VBHA 2E5BA 1KWKA 1W1PA 4RZ6A 3RCYA 3RDKA 1CYGA 2G0WA 2J25A 4KIRA 5DEZA 1Q4NX 3EXTA 2HS8A 1LM1A 3BJSA 1W5NA 3ITYA 1H1NA 5HQEA 5CG7A 2R1LA 1QRQA 5LHEA 1XIGA 2RH9A 3KOYA 5IFTA 4WY0A 4AWEA 3P8IA 3GO2A 1TPB1 3C2YA 3EPOA 1ZUAX 1UPPA 1HVQA 2ATSA 3G8EA 5CLTA 1SR9A 1RQEA 1W3KA 2HROA 4AU0A 3URNA 1M1BA 4IX2A 3EEZA 1Z32X 3TW9A 3BAKA 3W7GA 3LBMA 1UD6A 3VDBA 2OLAA 1W37A 1K70A 3CQ0A 2HMCA 2J6XA 2VDIA 4GFSA 5CBBA 1EBHA 4DNMA 3RRAA 3W7JA 3AYVA 4JTDA 2VCCA 4WQ6A 1XLFA 3UA4A 4XAYA 1H7NA 5E70A 2PRHA 1RHCA 1UJQA 3MUIA 4GPNA 3II1A 1JPMA 3VD7A 1TVNA 1C93A 3UG4A 1KFCA 2Z0IA 3H21A 1EEPA 1NTHA 4XD5A 3SQMA 3HM7A 3A13A 4MHBA 2FTPA 2VD8A 3GG1A 2A3EA 1T41A 5FJTA 2CCRA 1V0KA 1XR2A 4RNFA 4PUNA 5GJNA 2PGRA 5I6SA 2WSKA 3EDDA 3RU8X 1S2CA 4HYRA 4NF7A 2HDJA 3UZWA 1E0VA 2CHRA 4R53A 3W7OA 3O63A 4OOUA 3QGVA 5K3VA 1KFKA 5C9ZA 3IJLA 2Q01A 3HZ3A 5A2BA 1HJXA 2B7QA 4KEMA 4TV6A 1JZ6A 4CNPA 4V28A 4DJDA 3STEA 3GZAA 4C6OA 1RLCL 5DELA 5AC6A 4P8VA 5FL0A 1XICA 5JUVA 1ZNNA 4UTUA 1U5HA 2WZEA 1WOAA 3V7PA 1HN1A 3WFZA 1ZP4A 1HKWA 3WH6A 4JYEA 3CO8A 4OBSA 3MQTA 1HF6A 2A4AA 4ICCX 3CXOA 1ADSA 2GJXB 4JTAA 1UKQA 2DH3A 2OQYA 4O57A 5GNZA 4BS0A 4LJ3A 4CGTA 4BF7A 4TU1A 3AJ7A 4I7UA 2AAMA 3GU9A 3LXAA 4C1NB 4HZ6A 3MUXA 4KFPA 4L7ZA 4CNNA 3H7RA 3B8VA 5DCEA 1W1TA 5F2GA 2R6OA 4O11A 3DYOA 1HX0A 1LQ0A 3Q65A 1QK0A 3H4GA 3G22A 1PHWA 1HO1A 4J3SA 4RV8A 2C0HA 3EA2A 1LG1A 2Y8KA 1K3UA 4FPSA 3WMCA 4RNJA 4O0QA 5K9XA 1B3XA 4MZYA 5DO8A 4PMXA 1V8EA 3GNNA 3NYZA 3W27A 3PBMA 5FJPA 3E6EA 4QE5A 1O5KA 5DMNA 1VFSA 6PTDA 4ZL1A 4HHMA 3WUEA 4YXGA 3ME3A 3W7QA 3WDIA 3A4AA 4DM1A 2NSOA 4MUZA 3GNOA 4TR9A 3LMYA 9RUBA 2YYUA 4DX3A 4B92A 4O0ZA 2V5CA 2FMOA 1KRCC 2V30A 2QXWA 5GPRA 4GK8A 3MT1A 1UG6A 4XVEA 4XG1A 3NURA 1BG9A 3NVTA 1S46A 1VF8A 1RALA 3G5EA 3KLLA 1YADA 3R8RA 3E2RA 3CMGA 1PDZA 4JGDA 2YCEA 3T09A 3REQB 2XN2A 3VFCA 2Y89A 3K4DA 3WQCA 4JD4A 3SY5A 4I8YA 1N8IA 3HN3A 3MHUA 2Y61A 3UFYA 2CYGA 3M0ZA 3O15A 1VJSA 1OYAA 1BXBA 4IP5A 3XIMA 3DFQA 3WMBA 3WBWA 2QKFA 3O16A 3NQAA 1SFJA 3TJIA 1W54A 4LAUA 5CAHA 3KBSA 5HDRA 1FVPA 4J3UA 1E0TA 5G1TA 1ZFJA 5DMLA 5D30A 3WQFA 3R12A 1BKHA 3JU2A 3LB0A 5DN1A 3GR4A 4OOZA 3ICJA 4IGMA 1QNPA 4KEZA 2FTYA 4AC1X 4FB7A 5G4HC 3EMCA 4PRWA 3WBAA 3SEPA 4GKTA 2J24A 4WJXA 3V35A 4ICMA 5REQA 4ERGA 4GI6A 3ITGA 4MZ1A 1CXHA 3SGUA 4CNSA 4EANA 3SJ3A 4C7FA 1K9EA 1V08A 4Q8QA 3ABRA 4WVXA 2XVGA 4Q4QA 2P10A 5EMUA 4X22A 4S3BA 3GFZA 1XX1A 1CGUA 3S1WA 1L8NA 4LANA 4RDWA 4K36A 3VC6A 4NNCA 3BOXA 3BJTA 4J2MA 1CECA 1XH0A 2OT1A 2AQVA 2D73A 2VO5A 3VNDA 3O9NA 1KM4A 4MB4A 1HJQA 3TMQA 4HVXA 1CNVA 3BTNA 3TSBA 2GZXA 3GH4A 2OGYA 2B4GA 4PSRA 4RE4A 4DWSD 1TTJA 2A21A 3TSMA 4N0RA 2J75A 3ITVA 5DMMA 2V5DA 1WDSA 2GVJA 3S2LA 4JIRA 3VGEA 3EX4A 3GXMA 3T4CA 7XIMA 3FYOA 4DF1A 4GZ7A 4AY7A 4AF0B 3TC3A 2PI6A 4KW2A 4UTLA 4QLJA 3MMTA 3PAJA 3AC0A 1XP3A 1UPMB 3BGGA 3QV7A 1UD2A 4KF1A 1RCOB 2QJHA 2GUUA 3TQPA 4YCOA 5AN7A 3BSGA 4K1GA 3K2GA 1JVNA 1TSIA 1FXQA 4OV9A 3CZGA 2IXVA 2QCHA 1LL4A 3L65A 2BHZA 2EG7A 5EBAA 1JI1A 4R3UA 5AVNA 3C0JA 2ACQA 3PZVA 4NX0A 1VIWA 2J4GA 4KH2A 3F4WA 1XSKA 4ZSUA 3UGRA 4BI6A 3OLGA 3BICA 4KWOA 1LLWA 5HANA 5FA5A 4L6OA 2QQ6A 1U2YA 2HXTA 2O9OA 5JBEA 2NUYA 2F84A 2VCBA 3GFYA 2YW4A 2X8RA 2CNCA 3CZ8A 4ZFMA 5E0FA 2QUNA 2Y70A 2V81A 4TVUA 4FXSA 3QQ1A 2YOCA 4O50A 5C9WA 4UQCA 3BCDA 4XBKA 4W8BA 1XSIA 4JTEA 5XIMA 4CCZA 1QUMA 3NQ6A 4KCUA 1K8ZA 2A6LA 3BG5A 3M44A 1M7OA 3VA8A 3VIKA 1G6CA 1QWGA 5CZ0A 2HTMA 3KVKA 1CEOA 4CVWA 2B7NA 3C8NA 1SVDA 3GC4A 3EX6A 4G9PA 3T44A 3QLLA 2BHUA 2EO7A 1OK4A 1D7KA 3QBUA 2CWNA 4Z0SA 2CESA 3P5ZA 1V0LA 3SCQA 5AHMA 1ZJIA 7TAAA 1UR0A 4QSHA 3UGVA 3M07A 3ZLGA 1EJ7L 2XGBA 4K38A 3P14A 4WSJA 2EEXA 2XIMA 2WBKA 1SO3A 1J4EA 1J0KA 3PWIA 4GUFA 2ZX7A 3GNDA 4YWIA 3U48A 2EAWA 1VBRA 3AS0A 3KTXA 2X09A 5CH9A 2YDQA 3ITXA 2O7SA 4RUBA 3KLKA 3PB2A 4U10A 4R88A 4IX0A 4W85A 1SFSA 3G6LA 6TAAA 2FTWA 3RPMA 4B2DD 3FKKA 2YDSA 3KAOA 2DPEA 1EPXA 3SCOA 1XG4A 3W74A 5CPMA 2AKZA 2RDWA 4L61A 3HIJA 4TTGA 4RCXA 4E38A 4PTWA 3M6DA 3N2TA 1H49A 4PTDA 4HK6A 3W00A 1V6UA 3NUKA 3W26A 1P7TB 3I10A 4V1YA 2X16A 3IRSA 4L9YA 1SFLA 1TWDA 1UOZA 2VX5A 3PG8A 1VD6A 4A8RA 3NPUA 3N18A 5BU6A 2E5DA 2HCVA 1WDWA 4ZE5A 1YYAA 3ZSTA 4F0SA 1ISVA 2GDVA 5FF0A 4YPJA 1F4HA 2OB3A 3VDCA 3DI0A 3K4WA 4K68A 3W7PA 5D2TA 3FNDA 4X9SA 1Q65A 1VBJA 2V8ZA 4ZOAA 5CGMA 4QSFA 1AW1A 3EWDA 3G0SA 4TV5A 4DBUA 1QATA 1VFMA 1QAPA 1CGWA 2PU0A 3U4FA 1OVDA 1E9YB 1BWLA 3MMWA 3LCIA 3H2EA 4DBDA 4P61A 4B9ZA 1T96A 2Z29A 3U7VA 3TYDA 5K9DA 5HWMA 1OJXA 3LHTA 5H6HA 1T7LA 1GQIA 3GH7A 2PDLA 4UFMA 1WKEA 1VAHA 4FNQA 3M9YA 3VD5A 3RN6A 3NTYA 3AHTA 3WQ6A 4GGHA 2OPJA 4XBSA 3M43A 2EKCA 4MY1A 1W5MA 4KWSA 4NZ5A 2VX6A 4YHEA 2VFIA 3GIQA 4IQEA 4TQTA 5F2LA 4NZ4A 3WBXA 4CD6A 5KZ6A 1GQKA 3C0QA 2BVTA 2C16A 3E0WA 3MMUA 1LLZA 3WBYA 1UIOA 3W7MA 3TTYA 1Q6CA 2QIWA 3N3MA 1M6JA 4TX9A 3VC5A 2QUTA 3SN0A 1RBLA 3UT0A 3KBNA 1QASA 3OBAA 2YXOA 3FGCB 3NAVA 5DT5A 4AQLA 1PCKA 1TPUA 1GJPA 3EKZA 2I5QA 4NNBA 3Q37A 2QAFA 3DESA 1Q3NA 4YNGA 3SCTA 1Q8JA 1ALDA 4M6QA 4RZ4A 1X8CA 5GQBA 1TX0A 2DH2A 3FSUA 4LBUA 2QJMA 3BG9A 1KO0A 4WRHA 1E9LA 2GQAA 3OZOA 3AIQA 4GI4A 1IIHA 1ZHAA 1E3ZA 1W9XA 3OOQA 4JTIA 4JYDA 2OODA 2VGBA 2CBIA 4ZTYA 1PKMA 3TYAA 4KETA 2VHLA 3KP0A 1TPH1 3QW3A 3W23A 1R2TA 3VIFA 1JDDA 2AOSA 3KCJA 2PCEA 4LSBA 1JPDX 3ZLHA 3BO9A 2GSHA 3N15A 3W1AA 4LAOA 2GWGA 3C2RA 1I45A 3AYTA 2NSXA 4OZOA 3GW3A 5LIKX 5HOSA 2DIJA 4GUHA 3B4YA 1XYMA 2G4JA 4UFLA 2PU1A 4XKYA 4H1ZA 3WLTA 2PDKA 1F5ZA 4GGBA 4GHRA 1ICPA 1TTQA 1YDOA 2JEQA 3THAA 2OJPA 1VLWA 1J5TA 1WV2A 5ENLA 3WL0A 3H55A 1JRBA 3WF3A 1M68A 1M7PA 3SW6A 2E25A 1YDVA 4FX7A 2ZKMX 3EAUA 3CZEA 5RUBA 1V93A 2WNZA 1FP8A 5LKYA 1GYMA 1XLGA 3DECA 1L6WA 1EWEA 3H7VA 3IWPA 3QMSA 5BOEA 1IR2A 3DKJA 1IR1A 3WY1A 4JCMA 3CUGA 4CD7A 4NJGA 1L0PA 2Y2WA 3N12A 4G1KA 2CLLA 3AMKA 4EPEC 4MPKA 4OU1A 2HS6A 2XH0A 3A23A 3FVMA 4UQ9A 4HNTA 2GVYA 4AFYA 1GG0A 4LS2A 1M53A 1QI3A 3ID7A 3APTA 1X6LA 3HGJA 1E15A 3RLUA 2VKZG 1FDJA 3IJQA 2YCIX 3SB0A 3BAWA 2PTDA 1EDGA 3MHGA 4Y9NA 2QT3A 3NQDA 4HA0A 3BAYA 1JUEA 1UR3M 4AZ7A 4HJWA 4UFKA 3LDVA 1AJZA 1FTXA 1CGVA 1I1WA 1ZLPA 2OT0A 2BB0A 4L80A 3HURA 3L2MA 1JRCA 3GXTA 4LCSA 2XWEA 3MUZ1 1AMKA 4DJDC 3K13A 3W37A 1NQ6A 3BSMA 4AHOA 5I77A 2WXDM 2PRLA 1YXYA 3O2LA 4O10A 4ES4A 4XO6A 1P1XA 3U5YA 1E0XA 2PTZA 3WNMA 3VZZA 4OUEA 4DZAA 1EC9A 2JIWA 1VJIA 1FWBC 5LXEA 2Y7FA 3P7YA 4C65A 1IZCA 1A80A 2PWDA 2Z7KA 4NJIA 1H62A 2ZQ0A 1CENA 1Z44A 4BQ4A 4XD3A 3WCZA 5HPCA 2HWGA 1A5MC 3VYLA 2ZXAA 3D3AA 3DG6A 4B5TA 2NQJA 3FV9A 1KKRA 4QRNA 2PWVA 3NPXA 3VIPA 3USBA 3W87A 3NQBA 4WJEA 1W5PA 1NFPA 1TYGA 1HUVA 2RHGA 1XLKA 3KEHA 4ALDA 3W75A 3GUWA 4EPDC 5GJPA 4HQVA 1FWEC 3UW6A 4QTGA 3GTXA 5I02A 4MGGA 4AG0A 2Y5SA 1XC6A 3K8KA 1B2YA 3ERPA 4FLRA 4HMNA 7ENLA 4US5D 1Q7MA 2XIJA 3MSDA 1FRBA 3POCA 2XDFA 4PMQA 4MYXA 1XIJA 4JR5A 5LXXA 2E40A 2JF6A 3BE7A 2NQ5A 2HV5A 2VGFA 2B7OA 4TMCA 2PAJA 2XVLA 5CPSA 3NQFA 3FJNA 4HYVA 1Q85A 5EL1A 5C7VA 5T9BG 3W2JA 3CUZA 1PXGA 3HQNA 4DAIA 2W3ZA 3IIZA 3F2DA 2X7WA 2WMJA 2FVLA 3GTFA 5E5CA 1WZMA 2UY3A 5EA9A 1TV3A 3WQPA 1X39A 4LNYA 2QVNA 3UA3A 5TAOA 4ZE4A 1W17A 5JIWA 4CD8A 3BLIA 4YIWA 1O5QA 4YYCA 2XHYA 2J7CA 1KRMA 4E0CA 4GUIA 3LRLA 1GT8A 2CZ5A 2VFHA 3STGA 2ICSA 1YX1A 2DU2A 4PULA 3TA6A 4JHOA 1CXEA 5B80A 1QT1A 2C15A 2IQ0A 3VOHA 2X1TA 3TJ4A 7REQA 1J9YA 1XHGA 1FUYA 1MW2A 1XFCA 4Q6JA 1E0UA 4BQ5A 2Y63A 2CETA 2QJJA 4GY0A 4Q4OA 5HMFA 1BTMA 2CU0A 4X60A 2VT0A 3DGBA 3GU1A 4C6PA 1XSJA 3E74A 2BOGX 5DRIA 2PZ0A 3WEMA 5AYYA 1A5KC 1FA2A 1QWKA 3CQIA 1Q8AA 1L6FA 2O56A 2AL2B 3TAOA 1VCFA 3AXMA 3NOEA 3OLDA 3RX4A 3LLFA 2G97A 3AHZA 5BXPA 4MLRA 3L4YA 1EXBA 4N2YA 7PTDA 2Q71A 1LUCA 4JQ4A 3PZTA 1XLMA 1TA3B 1OZMA 4P7LA 4REQB 2EPOA 4IMGA 4ZMGA 1EDTA 1Z8AA 2CZDA 1FCVA 1UHVA 1A4MA 2QUMA 4S3JA 3HQOA 5A8MA 3WNNA 4J2PA 3LPGA 1K8CA 3O6YX 4ORMA 5EMLA 1KGUA 3N4AA 3N19B 1VYSX 4ZXLA 1GZ1A 4NZ1A 4F2BA 3GE7A 3GY1A 3I4EA 5BNKA 2X1SA 3HPXA 4V33A 3QF0A 2WMKA 5T91A 4AD0A 4C6KA 4FOKA 2GGJA 1YQ2A 3B9DA 1XH2A 3GR8A 2RFGA 5DANA 4DO7A 2WC3A 2BVYA 1VEPA 4GY1A 4ROQA 2Z1BA 3G1XA 4K37A 5I3FA 3PTMA 4HZMA 2W4XA 3UNDA 3ISIX 4Y90A 2D20A 3P84A 4I7VA 4M24A 4PCTA 5EMYA 2HPMA 2YX0A 1IF2A 4NQ1A 4IT1A 2W67A 3TIMA 1V6YA 3DERA 1NDWA 1EB3A 5H1WA 5C55A 4AEFA 4HCHA 3UBPC 1UZ4A 3KM8A 2G41A 1TO3A 2WAGA 5G2HA 3VIHA 3VIOA 1R87A 2X41A 4AZGA 2WSRA 2YA0A 3CB8A 3P60A 2YL6A 3WQEA 3AHXA 5TQLA 3W7IA 4XTIA 1VP5A 2BY3A 1IT7A 2DT3A 4TVCA 3AXHA 4EPBC 3Q45A 4EK7A 1C8YA 1G1YA 1C3FA 3B8UA 3CHFA 3MBDA 3WDRA 1BGAA 4LV4A 1V5XA 4FNTA 3HGRA 4UR9A 2GSJA 1TE1A 4FEZA 1XUUA 3KBWA 4CEXC 4HJFA 4A8LA 4UNKA 2ESCA 1MFVA 1A50A 1ADOA 4N4PA 5CLWA 6REQB 1KQZA 2RJGA 1LTDA 3BMXA 5T26A 1EQPA 3EXRA 2XFFA 1KM2A 1ZJBA 2D0GA 3H24A 1YMYA 2C1GA 3IV3A 4O4WA 1MQQA 5FKYA 5HMDA 4GXPA 3GAYA 3SBFA 3CEUA 3FY1A 4Q33A 3DC8A 4XZHA 3K1GA 4HTYA 2D1ZA 1AQ0A 5D9PA 1XGDA 3RILA 3GHRA 1WE5A 1AMYA 4B90A 4DIAA 2QV4A 4W5UA 3N17A 3QR0A 3PY2A 3F03K 3SSZA 5DBUA 4JS3A 2OEKA 2DORA 1R2RA 3AUJA 4IF2A 4H41A 3WQDA 3A12A 3INPA 2R24A 2BFGA 3VKJA 4FX6M 5HBFA 5B7YA 2J27A 5FI8A 4GRSA 3APGA 4IJBA 2Z2UA 3KOFA 3OZPA 3PULA 4YTQA 4BZYA 5CQ1A 3S5NA 5LNSA 1TJ2A 3W7LA 4WDTA 5AHNA 2F9RA 4YL2A 2VEKA 4HOZA 1J93A 3LY0A 3TFXA 3TLQA 1ISZA 1AD4A 4JY9A 4M1BA 1C7SA 3WF2A 2BZNA 4MUPA 1BG4A 2XZ9A 2V3DA 4W84A 4IP4A 5I09A 2VM8A 2ZZ6A 3UG5A 1ZAJA 2WC7A 3UCQA 1KC7A 4CKQA 2XG9A 4O52A 2AGKA 4M51A 4U31A 2YKKA 4LAMA 1MW1A 3UG3A 3W3OA 1N2VA 3MWCA 3N6HA 3F4VA 1XYAA 1OGBA 1M03A 4A3RA 3C2FA 1PPIA 2WQDA 4ZQMA 3UPMA 1QW7A 1W8GA 3NZRA 1BXCA 3KRBA 5C2GA 3B0XA 2PDPA 4ZB0A 3TJXA 4CN4A 4FXFA 1ICSA 4WKHA 1FWJC 1IGSA 3WKZA 2QNEA 3W24A 4QEHA 3NQCA 4W89A 1TZ9A 1KCXA 1QNRA 1EDQA 4O14A 3NSMA 3I7QA 1KR1A 4HTBA 2MNRA 3CUXA 1VPXA 3AHVA 1UQYA 4NY2A 3M0IA 2CXGA 4AIEA 1MRAA 2VZSA 4Z42C 3K46A 1K6WA 3GXIA 1U1JA 1FOBA 3MVTA 4U5KA 1X7FA 3R13A 3B9EA 3COTA 4MIMA 2UZ9A 4O8RA 2PB1A 3NO5A 1IHIA 3WLJA 5I3KA 4PSPA 1ZBVA 1KM5A 4FNRA 3CB3A 1TIMA 2J9YA 2PWUA 2H8ZA 5AC4A 2W66A 2Q8XA 3SCWA 3IK4A 1MZHA 3T05A 3EWZA 1GPFA 1JCLA 3LZ5A 4GMEA 4PEKA 2O55A 3PB0A 4QJ1A 2YXGA 4MLJA 3QVQA 4B3LA 4AY8A 5I78A 1CIUA 4Y8EA 5GNYA 2NLYA 3W1PA 5D09A 1L2UA 3S47A 2R8WA 1FFQA 4GIEA 2VD9A 1PL9A 2IQTA 4JX5A 2I9UA 1L8PA 2OVLA 2DT0A 4PC8A 2RGMA 2DIKA 5F2IA 4GD0A 1OABA 5I00A 3C2VA 3O0FA 3B9NA 1AQMA 4XZBA 1XISA 4WKFA 4PMYA 4PUEA 3UETA 5A1AA 5FACA 5G5IA 1TUFA 1GPWA 1QK2A 2WJEA 4ADUA 3ZVHA 4I6VA 3GM8A 4HCLA 2Y0FA 2VELA 3L5LA 4PCNA 1MW3A 1YBQA 2PFHA 1BF2A 4DYKA 3CAVA 2YBTA 3TV8A 4WOQA 1QPRA 1OBAA 2I56A 3BSHA 1AW2A 3VNZA 4PTVA 2DUAA 8CGTA 3G24A 4JTJA 2QGYA 1QNSA 1NFBA 1OZQA 1M7XA 2V5KA 4G6CA 1EP1A 2V67A 3VI2A 3ITOA 2ZRUA 2D3LA 5TIMA 4L6HA 3TYZA 4ZTXA 1R3YA 2F8QA 2E1DA 1OFDA 3CYVA 1I75A 1Q6GA 1ZRQA 2WBGA 3JRKA 1RD6A 3ZJ6A 1B5TA 1GKQA 3V5FA 1WPCA 3PBUA 4JTUA 2NX1A 5K7JA 1ONXA 3E0FA 4YHGA 5I7GA 3RF9A 3N14A 2VGGA 4IMEA 5DF0A 1W2VA 4QR6A 4RX0A 3AU6A 3P67A 3RO8A 1A5BA 4IM4A 2OQLA 3PBYA 3GDBA 2V68A 4E2DA 1KW1A 1IEIA 1XKJA 3W1LA 3AYSA 1U5JA 1FWIC 3N2XA 3L68A 3S4TA 3PBVA 1F9CA 3F2CA 5CPQA 2QCDA 4FF7A 1MQPA 4R7WA 8XIAA 2NX3A 4B15A 5LHFA 1GVYA 1ZCOA 3W7HA 3IPWA 3KOXA 1I1XA 2ON3A 1DL3A 2YCLB 3PZ9A 4K39A 1DJZA 1HFBA 1UWUA 5D04C 3DU0A 2POZA 1B31A 1AH0A 1EC7A 4IFOA 3W2LA 4J35A 4AH7A 1AUSL 3IUDA 4UQEA 1Q7ZA 2WW5A 2W27A 4EE9A 4M6VA 4XZ9A 1JCYA 4QDMA 4KCTA 1X38A 1I4NA 2HNHA 5FSEC 3N6QA 1O1ZA 3EOSA 4IHCA 2V3GA 3MP3A 4Y9PA 2J66A 3TDFA 4S3DA 4HB7A 3RG6A 2NQ9A 3W2MA 4MNLA 1UP3A 4LPCA 4S1FA 1UZHA 1LWIA 3IJ7A 4JFVA 3R58A 4NZJA 1Q4WA 3FXYA 2WZHA 3GQYA 3T81A 2Y1HA 2OELA 1UASA 2XUCA 3TW6A 1V0MA 2O4QA 4HHLA 4N9EA 4IG2B 5XINA 1GZGA 3EWWA 1SZNA 3LHVA 4D6GA 1SJDA 3E0VA 1Q6QA 3AIVA 1JXKA 3H53A 4H9MA 3TTSA 1ELSA 4EX4A 4DNHA 4JFWA 3L5AA 3P6LA 2C18A 2E7FA 5T9CE 1ML1A 5AHLA 1E6SM 3FAXA 1GOKA 2VCAA 1QTWA 4H9YA 3DFHA 2C71A 2XSAA 4OHQA 3E3HA 3VMNA 3C5QA 5BRBA 1MVYA 2V9DA 3B9AA 3WK1A 3T42A 2FPTA 4LAZA 2BGQA 4PEEA 4S23A 2J9ZA 4M5PA 3WMLA 5J5DA 3BLKA 1L6YA 3PN8A 3N25A 2FPVA 5D37A 5AYIA 2RKXA 5A8PA 4NAFB 1R0MA 1WKYA 5TD4A 4XAGA 3UJFA 1X7IA 1JFXA 3MHFA 4AIOA 1IT8A 1CGXA 4E4PA 3GIPA 1FFRA 1OX4A 1H4PA 1NH6A 4XAFA 1K8XA 4OTKA 1ONEA 4AD1A 1FY6A 3FK4A 2PP1A 3L21A 1Y0EA 3F4DA 2PDHA 3OBKA 4PFHA 3HOJA 2VRJA 2W6RA 2V5BA 4BF5A 1DORA 4XO7A 2B7PA 4LGXA 2ONEA 4L9ZA 2Y5EA 3HG2A 1QI0A 4MSSA 4DUVA 1G94A 1CI1A 3GXDA 4FNPA 4I5UA 1AJ2A 3T9PA 3PHAA 4B2DA 2DSVA 1REQB 2UY4A 3FFSA 1JPHA 4Q6XA 1TWSA 5H91A 4CVUA 4QROA 5JBFA 2ZBTA 1HGWA 4C5YA 2EXOA 2HZGA 3A24A 1CGYA 1POKA 1R3QA 3LNMA 1QXLA 4KGLA 1IEVA 1CLXA 6A3HA 1XIIA 3TR2A 1BHGA 4ZQNA 3O3RA 4XZNX 1WAUA 1NOWA 2OSYA 2ZUUA 3TTQA 1G5AA 4L6DA 1C9DA 3PJWA 2JGYA 2VQTA 3PTDA 5C7HA 4DO5A 3NXLA 4HPHA 3LCLA 4JTGA 3XINA 5HNTA 1EO5A 2GOKA 4H6KA 2FGBA 4H4IA 2X2YA 5AHFA 4F4RA 3IUIA 2WPBA 3W02A 3HPAA 1EC8A 5IDZA 1EP3A 3RPDA 3WUFA 4H3DA 1VR6A 2XVNA 1GYNA 2WVTA 3L9CA 1MEIA 3GNRA 3PK7A 1J11A 1KTBA 1W9BM 3ZIZA 4W7WA 3B05A 3LN3A 1X1NA 3HQ1A 5M03A 4OE7A 4IMAA 4GQQA 1ZY9A 3OIHA 3PWAA 1OFEA 2EPHA 5LIYX 2WVUA 3QLDA 1P6WA 1K9TA 2X1UA 3OQ8A 4FALA 2O9TA 3GK0A 5DFAA 3SIZA 3RJXA 4HBKA 4LC6A 3ZFHA 3R6IA 5FJRA 2O7QA 5LIUX 1B57A 1W3LA 1YTEA 1PKNA 4UTJA 3W72A 4AMCA 1R38A 4HN8A 1UD4A 4I6KA 3LRMA 3LD5A 1S5NA 5CSSA 1OFPA 4NAEB 2HBVA 2WJDA 4P8UA 1RP8A 3BV7A 2XTKA 5G4EA 1EOKA 1KD0A 4LAKA 1KWGA 3EWXA 1W3IA 4RNIA 3IS4A 1EFZA 4C6MA 2NWRA 1V7YA 2WMIA 4JFSA 3HO8A 5BU9A 5BRPA 4U4MA 2XIBA 4P2VA 3TONA 1RK5A 1WZKA 4E8DA 1DQWA 3EA3A 3R43A 4CQ8A 1RD5A 1SMAA 3AXIA 3GX9A 2YDAA 4EAYA 3DKLA 3O6CA 4K3ZA 1X1ZA 3EDJA 2Y7GA 2W62A 3FA5A 3M4HA 4UMCA 5A6BA 3DH7A 3WLMA 5HINA 2REQA 1JYXA 3SECA 1HKVA 2VZUA 4NI8A 2VURA 2QF8A 3FYYA 2FZBA 2ZDRA 4GQBA 5D8WA 5D9OA 4PUKA 2XH7A 3NL3A 4WD0A 3AJXA 3LPPA 2QYGA 1TPEA 3UPWA 2QCFA 3KWSA 3QV8A 4Q4KA 4ZQOA 2NX9A 3KXQA 2EPLX 1LRTA 1PV8A 1QPOA 4WDUA 4PGLA 3QTPA 1BVWA 3AZTA 5K9CA 1CTNA 2Z26A 3D6NA 4RE2A 4WY0B 5HK4A 1OD0A 1XD0A 4FF5A 2MANA 4WR3A 3MO4A 1RVGA 4AZCA 4K1WA 3KL5A 3R0KA 4YYFA 3R4IA 3B8TA 3T0AA 1XG3A 1IGWA 5E0KA 1FBAA 1K6AA 4B91A 4QE4A 3S46A 1C29A 1H5YA 3CUFA 3C4UA 2E6DA 4L9XA 3LCXA 4GO9A 1SO5A 1HXJA 1QBAA 5D38A 2PDBA 3W82A 1FXPA 3GYCA 3NO3A 3ARWA 3SCNA 5LZLA 1EQCA 1FCUA 3ARYA 3R1ZA 1TJ1A 4OVXA 2PURA 1R3TA 1NFGA 3FEMA 4UR8A 4I90A 1XBYA 1G0CA 2ZX9A 3ZT5A 1TTPA 4ADTA 1TTIA 3G8RA 4V27A 2FVMA 3KX6A 3M1ZA 1GGOA 2YBUA 3ZR4A 5PTDA 3JR2A 3C86A 1MWOA 4CN1A 4GH1A 1N8FA 1O60A 3SQSA 4DYJA 4CQBA 1ITCA 2WCGA 3NEVA 1XLJA 2UY5A 2W5FA 2Z24A 1THFD 2Z6IA 4MDPA 4QISA 2WSPA 3T1GA 2G3IA 3GXPA 2GQ3A 2ZDSA 5CJNA 3VD9A 1CB7B 5AVHA 3SSJA 1OYCA 3OLEA 3GVQA 1NF7A 2C0AA 3NVDA 1QU4A 1T8QA 1DJIA 1JDEA 1TELA 4AEEA 1YE6A 2A0NA 2J78A 1PTAA 1SJCA 3SGGA 2ZX6A 4GCAA 3DC0A 3QH2A 2JF7A 4LYPA 4PUUA 4B3ZA 4FOJA 4IOTA 5DX7A 3WBEA 2NXGA 4QNEA 2Z1WA 3NGFA 4ERIA 3L12A 3T6CA 3C6CA 5U7SA 5HJYA 5A3HA 5M5DA 5FEZA 2TODA 3A22A 3QPZA 5EBUA 3CLMA 4LBRA 2PLMA 4OT7A 3NG3A 4WGHA 3W07A 4PMRA 1UMYA 3P0WA 4QQUA 3IJIA 1TR1A 2CHOA 3QR1A 2XWDA 3PZNA 5CKSA 3MYOA 1W1A1 4F8XA 1S2VA 1J5SA 2PBGA 4R85A 4ZENA 1TREA 3APYA 3MMDA 1JAKA 1XPGA 3RR1A 1OC6A 3LZ3A 4UCFA 2O9RA 5D2YA 1XBZA 1GEQA 3EWCA 3AMCA 3OPSA 1OFBA 1CB2A 2G3FA 3FDKA 1H0GA 5FF2A 2H3DA 1H50A 2PD5A 2ISDA 3TVAA 3FCPA 1FWCC 4XIMA 5FOOA 3BC9A 4F48A 3M64A 4RR4A 3W7NA 3IVUA 3SUVA 2D24A 1D9EA 2EPMX 2XFWA 5FIPA 4PB3A 5MF5A 3L66A 3L5MA 1LOQA 2OGJA 2J7FA 1PTDA 4KIEA 4QNWA 4Q4MA 2VL4A 4MKSA 3RCNA 2AMGA 2BWGA 1J0IA 4K2SA 5JBDA 2WNQA 2UV8G 3CZLA 4US5A 4JTKA 1UR4A 1OX5A 3B0UX 1QI5A 2JIEA 3SJNA 2YL5A 3LERA 1OC5A 1DVJA 3NQ8A 4WK9A 4XVDA 1GEHA 1E4IA 5DCBA 1JD9A 3FHAA 1EF3A 2A7NA 3ZWTA 1XXXA 4L1GA 4FIRA 1Q2SA 1Q5MA 3IGHX 2G5WA 3PWGA 3TLLA 3QV9A 1NWTA 1UWSA 4RJEA 4B5SA 4LVFA 1WDPA 2YGYA 4AD4A 3OYZA 3BJFA 4F9JA 3EDFA 2ZOXA 4AXKA 3Q4DA 2FZ8A 3EOLA 3SFKA 4DXVA 3GU2A 3CHVA 3IIXA 1O66A 2J7DA 4JDYA 3W6MA 3BLOA 2W79A 3UZZA 1EHNA 9XIAA 3S9YA 1HVXA 2QPXA 3I3DA 3UWEA 1V03A 4GINA 1LWHA 3RR4A 1V02A 4MWAD 1CDGA 4BEQA 3WG6A 1DV7A 1KA9F 4HPXA 4IH3A 2FLIA 2R1PA 3DG7A 4UTMA 3PVFA 1EHAA 2ZRXA 1ONRA 3U0HA 3BW3A 3KZPA 1AH3A 3U7BA 3UQNA 2IUZA 1HP5A 1TKKA 3NOYA 1OGSA 1ZCCA 3BW2A 1DWGM 3ZJKA 4PL1A 2WO5A 2NWSA 1E1EA 4U2YA 4XKMA 3DYMA 1NM9A 2A7PA 2I7GA 3ZR5A 4DZIA 4D71A 1OT1A 3EX3A 3NWRA 2Q6ZA 3ARQA 3MZ2A 1WDDA 4BJHA 3R8GA 4W8AA 5BOOA 5HR6A 4NZFA 2FQIA 4QS5A 5GVJA 2DQWA 3T08A 1YPIA 4Z17A 5D9MA 1BD0A 2F6XA 2BODX 3MDWA 3PJXA 4AD5A 2AL1A 3TOYA 1HKMA 3WDPP 3VX0A 3VAVA 4DWSC 2V69A 3CK5A 2DW6A 5E9AA 3E5BA 1P0BA 4Q3MA 4O4VA 1X6UA 3G1DA 5IM51 4OFCA 2CWXA 2BBFA 1H63A 3PR2A 4FR6A 5CPOA 2HK0A 4HIBA 2NZLA 1FWFC 1TV5A 3GB6A 4RW5A 4L4PA 3N9KA 4YTRA 2VX4A 3DX5A 3DHPA 1WCGA 2ZFAA 4NJJA 3S1UA 1RCQA 5CSRA 3RX2A 3WLNA 1PJ9A 3NZPA 3A9IA 4ZXOA 3IRDA 3ABQA 4M6PA 4JNMA 3WJSA 2CHNA 1TG7A 2J9XA 3LCWA 2INFA 3VPLA 2OR2A 1B54A 3V3WA 3UG8A 4ZO7A 3GRIA 3WJYA 1D7FA 2PSNA 1P7TA 5AZ1A 1XCFA 5CZJA 3W7CA 1XS2A 3UCCA 2Y24A 1WQ5A 3C3UA 4W88A 2NUXA 1TE6A 1JCMP 2KAUC 3A5VA 1E3XA 4JN7A 1X97A 4ML9A 4E4FA 1JF5A 5HUPA 2IXUA 1EGMA 4UR7A 1W8SA 3LTSA 4PBEA 1SO4A 3OG3A 3AIWA 3B97A 4PUWA 1E1CA 3ZM8A 4W7VA 2BV9A 3M0KA 4GC3A 4Y7EA 1AG1O 3RU6A 3MSYA 4QXIA 1SM9A 4ICNA 2I9EA 2HISA 2VFEA 1LLOA 3V0SA 4WEVX 1UKSA 4FLSA 4M56A 4PR4A 4ACZA 2RAGA 1MW0A 3W7KA 4BI7A 1XF0A 2E8YA 2ZA2A 4XBJA 3URQA 1I2NA 2G8ZA 5H8MA 2HSAA 3B0VC 5AOUA 1A53A 3ZZ1A 4H01A 4LU0A 2FGLA 2Y88A 2XVKA 2X1RA 3SY8A 1VENA 1ZS2A 2QPSA 2V63A 2D69A 3J7HA 5F4SA 1X98A 4ZOCA 3DEQA 2PGWA 3GHTA 3VXGA 2WSQA 3MP4A 4E2VA 1NQKA 3DHDA 2B31A 1QMLA 4D6DA 3W25A 3T4WA 9XIMA 4Z2JA 1WXZA 3SQLA 3CPUA 2JEPA 5HR7A 5SWUA 3WD3A 2VFFA 3FSTA 1UZ1A 1EF2A 4M81A 1I8JA 2J6VA 3CLWA 4LF1A 4IJRA 3MYPA 1WKFA 4G2DA 1TFVA 3C8FA 1F3EA 3VILA 3KDOA 2DVTA 1B0IA 2WNNA 2E4TA 3B0PA 5I07A 4ZQPA 4FLOA 3NFUA 3QSTA 4LALA 3W86A 1UIPA 5H8PA 3FGCA 1XJBA 1GOQA 5GJMA 5AC5A 1QNOA 4NT0A 3H2OA 4LW7A 1TZ7A 1UR8A 3IACA 3W0KA 4AB4A 1S2UA 3QOMA 4PCSA 1OCNA 3WNOA 4G7EA 5BRQA 4GH3A 2R14A 3DG3A 3U2CA 1JDAA 2E9BA 3BV4A 2HJPA 1S3TC 1WKDA 4C60A 2PGEA 2X0SA 4GZJA 2VJXA 5EMKA 5BWFA 1RJRA 4O0KA 2VFGA 4FLQA 2OYKA 3U57A 4FSAA 1GKPA 1WDRA 4I5XA 1CGTA 3RGTA 3ZSSA 5H2ZA 3FKRA 3W28A 1GK8A 1UA3A 2CZEA 2DGAA 3LBCA 3UP8A 1K7XA 2WZTA 3KRSA 1Z89A 2PWFA 2H90A 1BKSA 2EPKX 3H4XA 4XD4A 1PX4A 1D3HA 5FF7A 4QLKA 3QYSA 1V6XA 4R34A 4DF0A 2XPKA 2VR5A 1U1UA 4A21A 1FKWA 1DXEA 1W3TA 1C90A 1AD1A 3G1FA 1UCWA 2PWGA 4F0KA 3KVJA 2QPUA 3NDZA 1IQ8A 3F4NA 2E8ZA 5HMSA 4J1OA 4DN1A 4FNSA 1BQGA 3ATYA 3JS3A 1DYSA 1QHZA 2JKPA 4E2BA 3TQVA 4ML4A 4Y9OA 1L2QA 3ZR6A 3VDAA 4QJ3B 1KB3A 3R0DA 1I2RA 1G4PA 1K1DA 3E2VA 3S3GA 5BZAA 4O16A 4EOUA 1XFBA 1SSDA 3PC0A 3EEGA 4TOQA 2JK2A 2ZX8A 1KCZA 5C2CA 1JJKA 4IFRA 1RK6A 3MWAA 2J8GA 3W73A 1EGVA 3GH5A 3DFOA 3CJPA 4CQAA 3MW7A 1ODUA 1IEWA 1JGMA 1NP2A 4A2RA 5DCDA 4UIOA 4PN2A 4AW7A 4A4AA 4KWWA 4HOWA 1GZJA 3W71A 1R7AA 1ZU8A 2NVDA 3MTWA 4AISA 3FJ4A 3FA4A 3MUY1 3HF3A 2C1HA 4TXEA 3E38A 3CQJA 3QMRA 1TUXA 2EJAA 4UTHA 2WVVA 4MY9A 4NJKA 1VFHA 2D0FA 5K2ZA 2Z1KA 3SCVA 3EDKA 3NXFA 1HJVA 4XSMA 3KWXA 3AZRA 3E5PA 4MNJA 4X63A 5KZEA 1SW0A 4GI9A 2YLLA 3IIVA 3VINA 3GHSA 3MDUA 3NZGA 3EA1A 2QULA 1XD1A 2FFIA 4PYSA 2GLKA 4GZIA 5CZSA 1J6OA 2E6YA 2WHMA 1HNYA 4XKYB 3KTSA 4HHPA 4H7VA 1DJGA 1GNXA 4NZCA 1ITQA 2ZYFA 1BVZA 1OADA 3HPZA 3UESA 4N9BA 5F4WA 4M80A 4K7YA 5JIPA 2NT1A 4IMDA 2XZ7A 3CQHA 4HSOA 3TXZA 3UU0A 1DIOA 2X2GA 1S3HA 1UH3A 3HGOA 1QI2A 3TA9A 3L4UA 3HTWA 3NNTA 2Q8ZA 1W5OA 4L65A 2DVXA 3VDHA 3UERA 1E6PA 1JQVA 2G3MA 3GVVA 3L4VA 3EPMA 4O19A 2YSWA 3LOTA 1RZMA 1MEHA 1DE5A 2ZE0A 1R3VA 1JYNA 2CPUA 4D9PA 2CBUA 1UW9A 1LJYA 3OIXA 1OG0A 3VOFA 3CIVA 1G67A 2YYTA 3S2NA 3UYIA 4Y8FA 2AGTA 2F6UA 2DZXA 4IIHA 3OYXA 1TCDA 1LBLA 5TF0A 3VKCA 2QVHA 2DZWA 3T07A 2PC8A 1YXCA 5XIAA 3PAOA 2Q3OA 2HK1A 1S2TA 4HN4A 4ATDA 2H9AA 4JQ2A 2NT0A 3WLPA 2WANA 3SI9A 3QGAC 4GABA 1UD3A 2PD9A 4FIQA 3LM3A 1HL8A 2BXYA 4LUYA 3Q58A 2G3JA 2Y5JA 1VFFA 2DFAA 3G3MA 1DJQA 2J88A 5U4NA 3WLQA 5CBIA 2ACSA 4QEEA 4NILA 3DUGA 1N8WA 3S5SA 2P8BA 4ATLA 4S2CA 4E5TA 3OA3A 1BSIA 3CHCA 1V3KA 3WQ8A 4XZIA 4OV4A 1MRQA 1Q6EA 4IL0A 5EMJA 3W53A 3V0TA 1DIDA 4UTWA 1JYWA 3DDMA 3OVPA 3PZUA 1WYIA 1KM3A 4IFKA 4JTTA 4KS0A 3MKKA 1RQBA 3T7VA 2VDHA 4YU1A 1OCQA 1P0KA 3RPTA 1F05A 4XQ6A 2P3EA 3PUGA 5BCAA 1D8CA 3TQ0A 5L6UA 3JVAA 3WEZA 4C90A 2DQXA 3TSDA 3CUJA 2HPIA 4HNOA 5CSYA 1JGIA 1YPXA 3W7DA 4GNKB 2GGGA 1VCVA 3ECQA 4M82A 4DJFD 1GORA 3KBVA 2GGHA 4JL2A 1GVFA 2E67A 4XAPA 3LCFA 2ZUSA 1EKOA 4GYJA 2BTMA 1QOXA 4FMVA 4CNOA 1PBGA 4DWDA 2P76A 5F1UA 1J01A 4LBSA 3ARUA 1O5RA 4QS6A 5CCZA 1UR9A 1ICQA 3L0NA 3LV6A 3BLFA 5EMMA 2FFCA 2Z25A 3HG3A 2QCGA 2FB2A 3R8HA 5HNUA 4OGZA 5C6MA 1VRDA 4H83A 2PTYA 1E5JA 2OX1A 3MCOA 5AZ0A 2KZHA 3ZXWA 3GVGA 1ZP3A 8TIMA 1EJXC 1GQLA 1P0NA 4LUTB 1YXDA 1M7JA 1I0DA 1KXVA 1LQ2A 1GHSA 4UMAA 3AS2A 2ZRWA 5A95A 1GJWA 4K6AA 2ADAA 2A79A 3PZQA 1RA5A 1QW9A 3QZEA 5JU6A 1Z9AA 2PTWA 5CSUA 3KOZA 2LLEA 3ATZA 4FOUA 3TP4A 4KPLA 4EKJA 3ONBA 4LYKA 5G2WA 5F4XA 3RITA 3H4WA 4QG6A 3GD6A 3QZ6A 3GG0A 4H8NA 2ZC8A 3BMVA 3M5XA