3AFBA

Crystal structures of catalytic site mutants of active domain 2 of chitinase from pyrococcus furiosus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
300
structure length
300
Chain Sequence
GPNANPIPEHFFAPYIDMSLSVHKPLVEYAKLTGTKYFTLAFILYSSVYNGPAWAGSIPLEKFVDEVRELREIGGEVIIAFGGAVGPYLCQQASTPEQLAEWYIKVIDTYNATYLDFAIEAGIDADKLADALLIVQRERPWVKFSFTLPSDPGIGLAGGYGIIETMAKKGVRVDRVNPMTMDYYWTPSNAENAIKVAENVFRQLKQIYPEKSDEEIWKMIGLTPMIGVNDDKSVFTLEDAQQLVDWAIQHKIGSLAFWSVDRDHPGPTGEVSPLHRGTNDPDWAFSHVFVKFMEAFGYTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Putative chitinase
publication title Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus- the role of conserved residues in the active site
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 113
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3afbA00
4GQRA 3OA5A 1KXHA 1WNOA 2BVDA 3E1F1 2J4GA 3ZT7A 3A6OA 1CNVA 1TCMA 1V6YA 4J3WA 1JFHA 4AW7A 4JKLA 4DUWA 2JE8A 2DT0A 1HVXA 4BQ3A 4UOQA 4CCCA 3WUEA 5FD0A 1E55A 2UY5A 1K6AA 3KZSA 5ABFA 2GSJA 4KRUA 1E5NA 3L2LA 4HA1A 5D9MA 3ZJ7A 3GBEA 3ARZA 1C92A 1HJQA 2XFYA 3UESA 3AQUA 4H7VA 2FDMA 4P8WA 5EB8A 4ATWA 4BQ4A 4W89A 2WAGA 4W7WA 5ABFB 2D20A 4GO9A 5CJ5A 4S3KA 1V6VA 3AIUA 1W2PA 5CPSA 3L4YA 3B8SA 5FOOA 3FNDA 2W66A 1IZKA 3CTTA 1JDAA 3GNPA 1EDQA 3EMQA 1XYFA 1HL8A 3G6MA 4J3TA 3M7SA 3VILA 3VMOA 1Q6CA 3GNRA 3CPUA 4M80A 2XVKA 3AICA 1K9FA 3WNKA 2DH2A 1V3HA 5BROA 3THCA 1JZ4A 5EMYA 2GUYA 2WVSA 1I1WA 4GZIA 3DC0A 3ZIZA 4MTVA 3WEOA 1NOWA 4LX4A 3UEQA 2C8NA 4WF7A 4UFKA 3WF2A 4D6EA 3SUVA 1VIWA 3VKKA 2W5FA 3IANA 3N17A 3MMWA 2J7DA 3WQ8A 1OINA 3MSDA 4Z2LA 1PPIA 1NARA 3RJXA 4CCEA 1CXHA 2J75A 2VJXA 3WMCA 1R8LA 4JCLA 3ZM8A 1GOQA 3QOMA 3WF4A 5E09A 3RM8A 3ZMRA 4AISA 1QNQA 4AZHA 2WC3A 3PBGA 4W86A 2WW5A 3RIKA 1W9PA 2ZUUA 4D6FA 3NDZA 1E4NA 3SIMA 5IXEA 2XSBA 2ZWYA 1M53A 5IFTA 1E6ZA 4CGTA 1KXQA 5BRPA 3VO0A 1DWIM 1AQHA 1LWJA 1UD6A 1I75A 3AJ7A 3QGVA 3AYRA 1KCKA 1Q4NX 2DDXA 1WCGA 2J74A 1VEPA 1E6XM 3D5HA 1VJZA 5D8ZA 2WZHA 3W82A 3VGFA 3IJ7A 3WH9A 4AZ7A 3ZJ6A 4PCSA 3TTSA 2CETA 4JL2A 2X05A 2YLLA 4PEEA 5M5DA 4J7RA 1JD9A 4A3YA 1ISZA 3CMJA 2VURA 4CU6A 1OBAA 1FFQA 4M56A 1K9TA 1BGAA 3WL1A 2V5CA 2WK2A 1UD8A 2VI0A 2VX4A 4UFIA 4MADA 1H0GA 1V0KA 3N18A 4OBSA 1FHDA 1D2KA 1M01A 2J7HA 2WKGA 1E71M 4ATDA 2XG9A 1KB3A 4FLSA 1E6QM 2DT2A 3SUTA 1ESWA 1WPCA 3BC9A 4PMZA 2E4TA 5LYRA 1PJ9A 5I5RA 5ABEA 1E43A 3WD0A 3VD9A 1FHLA 1GQKA 3CUGA 5BWFA 1NOFA 1A3HA 3T0AA 1TVPA 4CD5A 3ARXA 1F4HA 2DEPA 3VGHA 4MNLA 4ZFMA 3K8MA 3TTOA 1E73M 2JIWA 2VX6A 3CUJA 1D7FA 1UKSA 1UH3A 2D3NA 4M8UA 2CYGA 2J7CA 2O92A 4LXFA 1KGUA 3AS0A 1VFMA 3L4WA 1V03A 3GZAA 4P7QA 3OLEA 1V6WA 3L4TA 5A2AA 1HJXA 1XCWA 3TOPA 2ZX7A 4UCFA 5GPRA 4UNIA 3ZR5A 2QHAA 3PZOA 1RP9A 3VNZA 1EDTA 3UG4A 2J7BA 5A69A 3WDHA 4OUEA 3WY1A 3RCNA 4AMCA 3DYMA 2VRJA 4GPNA 3WDQA 3PZMA 4CCDA 1EHAA 3WH5A 3WUFA 1CEOA 2IXUA 3JUGA 3AFBA 4W8AA 2WHKA 3ECQA 1UH4A 2PC8A 5M03A 4JFUA 2WKLA 5C8BB 1E6PA 4HZ7A 2CHNA 1E4IA 2EQDA 2WZEA 5HBFA 2DH3A 2XTKA 3A4AA 1HKKA 2VR4A 5BXTA 4HA3A 1ZJBA 3SUWA 1SR0A 1GPFA 4UOZA 1CGTA 4CN1A 4U2YA 1NWUA 4OJYA 2XFFA 2FHBA 4PMDA 4QAWA 4H04A 1UD3A 2J77A 3ARSA 1VFUA 2D23A 4YHEA 1G0CA 3UG3A 3VPLA 1R7OA 1KXTA 2ESCA 1X6NA 4GIAA 1DWJM 7CGTA 3FHQA 5AYIA 3W29A 3J7HA 2XVPA 1PIGA 4UZSA 3WEZA 1M7XA 3EDJA 3L4UA 2HVMA 2OSYA 4PTVA 5IHSA 1B3YA 4JFTA 2EPOA 2VCBA 3EMCA 3W25A 4QLLA 1JFXA 1LG1A 1LQ0A 3QHNA 1H09A 3IJ8A 4CU7A 4E8DA 1JF5A 5AC5A 5E9AA 2JF7A 1HKIA 1E56A 3FHAA 4UQCA 3VM7A 1UZ1A 2VR5A 2QPUA 1BVZA 1SMDA 4F9JA 3NYDA 3RPMA 1F4AA 4LGXA 1KWGA 1HP4A 4AY1A 2F8QA 5CGMA 3W81A 1W2VA 2G3JA 1UH2A 4W85A 3W6LA 5I2UA 4PMNA 4TXEA 1KQZA 5A8MA 1JAEA 4AEEA 3SCSA 3BAWA 5I78A 1FFRA 2ZX5A 1MW1A 4ZE5A 2DSZA 1TUXA 2YJQA 3A3HA 1DWHM 2WYSA 4W8LA 1KGXA 4WSKA 2E40A 1CWYA 3AZSA 5DT5A 2ZICA 5CLWA 3WD2A 1H0IA 3WF0A 1Q6FA 5CSYA 3WL0A 3EDDA 5E0FA 4CUCA 5FL1A 4EAMA 1TMQA 3BXWA 4KGJA 3OZPA 5EFDA 1UA7A 3SCWA 5IHRA 4WKAA 4D6JA 1S46A 3GYCA 3U57A 1JDCA 1V3IA 5A6LA 3BSHA 1ISWA 1UOKA 1H5VA 1E1FA 3MANA 3N9KA 4FMVA 3UR8A 2AMGA 1EQCA 3BLKA 2BY0A 1ISXA 4AD4A 5A8NA 4JKMA 2XUCA 9CGTA 3PZUA 5FKYA 5GNYA 2WM0A 3RILA 4PMXA 1TG7A 4PBGA 2WCSA 2Y2WA 4WIWA 2V3FA 1XSKA 4PMUA 4P7OA 1KR1A 3ARPA 2YL9A 3BAIA 4GO8A 4OZOA 1QPKA 2VCAA 3AROA 2YDSA 3PZ9A 1V08A 4DUVA 3AHXA 4J3XA 1GCYA 2EO7A 2PBGA 4KMQA 3AMDA 5D9NA 1M03A 3CMGA 1V3KA 1ZBKA 1MVYA 1EXPA 2QMKA 2JF6A 2VC9A 2NW0A 4AIOA 2YA1A 3AIRA 5AYBA 1UR2A 3TTQA 4U31A 2VT0A 2BFGA 4J3SA 4D1JA 4TTGA 4AXNA 3SCVA 1QHPA 3VMPA 1XH2A 2ZXQA 1E40A 1XSJA 3UERA 3MMDA 2CBUA 2WSPA 1WZKA 4UFJA 1JGIA 2ZIDA 4TUFA 1NP0A 3ZQ9A 1PIFA 1B3VA 2CPUA 4C7GA 2EPKX 1GHSA 1I1XA 1US2A 5A6JA 3VTRA 4HPGA 4W87A 4TX6A 1MW2A 4ATLA 2GFTA 3WDIA 3SCTA 1JZ2A 1H3GA 4L4OA 1HF6A 5FIPA 3WQ5A 4P8XA 4AIUA 3VDAA 1E70M 3AIVA 3ARUA 3OIHA 4GI6A 5HOSA 3AS1A 2EBNA 2RGLA 4ML4A 4AD0A 2DIEA 4UQBA 1CBGA 2CBVA 3WMBA 1ZS2A 1VFFA 4M81A 2XWEA 1CPUA 3MUZ1 3TONA 2BXYA 3CUHA 1ZL1A 4MPKA 1UR1A 2BS9A 5DO8A 4AZBA 1BG4A 2XWDA 1UWUA 1KFWA 1BVNP 3WDRA 3L2MA 3RM4A 2CCRA 1CGXA 3APGA 1OM0A 3CZEA 3KEHA 1FP9A 5CSUA 2WHMA 4J3UA 3CGTA 1UD4A 1BFNA 1V6UA 4BF7A 1GVIA 2EXOA 5JBDA 3PZIA 4AZ5A 2DSKA 2OWCA 5ECUA 3AS3A 1MQPA 1W32A 5M3WA 2GJRA 3WKZA 2OYKA 4YPJA 3AHZA 1L0PA 5A6SA 3ZO9A 1R7AA 2BVTA 3S6TA 1XD1A 4N0RA 3VIPA 4YHGA 3VIFA 1XSIA 1XHGA 4F8XA 3M6DA 3WNOA 2V5DA 3EMZA 4HZ6A 1BSIA 1MXGA 1JYNA 5CG0A 2CESA 2PI6A 1B0IA 1JD7A 3EDKA 1J0IA 3AISA 2ZUTA 3MUAA 1W9DM 4W7UA 2FGZA 2BVYA 1HIZA 2PWDA 5LA2A 2Y5EA 4W7VA 4AEFA 3MV01 4HU0A 1GOIA 1VEMA 4GINA 1YQ2A 2V3DA 3EDFA 4DWSD 1UKPA 1Z32X 2X8RA 2OYLA 4NRSA 5BCAA 1RD6A 3OGRA 1V6XA 2WHJA 4V2XA 1V0NA 3LPPA 1LF1A 3CHCA 2VVSA 3WBAA 2Y8VA 3CHFA 3EDEA 1UHVA 3VD7A 1BGGA 2YL8A 6A3HA 1X1NA 1ZBCA 3VVGA 3WDJA 2EJ1A 1US3A 1G1YA 5CZKA 4NI3A 3W4RA 3NUKA 2YA0A 1DTUA 1UWQA 1J0HA 1ZU8A 1J01A 2FHCA 3PN8A 2OWXA 4Q22A 2GK1A 4AZ6A 1NWTA 1JZ8A 2CNCA 2YLAA 4EK7A 1E5JA 3AXHA 4LQ1A 3KE0A 2Y24A 2WMGA 1JZ6A 5A8OA 1E9LA 3QHOA 3SUSA 4B15A 3O2LA 1XH1A 2GK1B 3SUUA 4X0VA 3FAXA 1KXVA 2VZOA 2A3AA 4AD2A 1XCXA 2X2YA 3U7VA 1ODZA 4AD3A 3OLGA 2UWFA 1P6WA 2GDVA 1BYAA 2JIEA 4PSPA 1MYRA 2ZUNA 4AZGA 2J7EA 4K68A 2DPEA 1B2YA 5EBAA 3WDPP 3WBEA 2FHFA 3ZSTA 2DQXA 3T2PA 5BXRA 1H4PA 4AZIA 3I3BA 5CPTA 1UR8A 1JDDA 2YKKA 2ZE0A 3UETA 1MQRA 1QW9A 2YDQA 1DP0A 1NP2A 1O6IA 2BHYA 3VX0A 5I3DA 1UQYA 2GDUA 3VIJA 5KZ6A 3M46A 4B3LA 3MMUA 1ISYA 3BCFA 2BXZA 4B16A 1NOUA 2ZXDA 3U5UA 1OIMA 4A3HA 4KH2A 2Z1KA 4RE3A 1X6LA 2WCAA 3WD3A 2ZUVA 4Z2IA 2TAAA 3F5KA 3GBDA 4MJ2A 3M07A 3N13A 4PMRA 2WWDA 1RH9A 3AMCA 5A6KA 1EQPA 4JHOA 1Y7VA 2C0HA 1WZMA 1GVYA 1LJYA 1W3JA 1XRVA 5EFFA 4CD8A 1HNYA 4E8CA 1Q6DA 5LA1A 1C8YA 1EGZA 1CIUA 2WVUA 2GVYA 3T0DA 4CN6A 4UQDA 1HT6A 2BY2A 2CKRA 4HPHA 1BTCA 4CN4A 3CZGA 4CU8A 3THDA 5A6AA 1NQ6A 1LL6A 4AZCA 1LWHA 4PRWA 1FOBA 1QI4A 1KR0A 1FH8A 2JEPA 2QF8A 2XFRA 3BSGA 1QNRA 1UKOA 2WMHA 1GOOA 4AWEA 1JIBA 1NH6A 1EH9A 3GH5A 3GM8A 2VL4A 2VRQA 3SCPA 1J9YA 4AZCB 5I24A 2WSKA 2PWFA 4U5IA 2EPMX 4KGLA 3AHVA 2E8YA 3WENA 4HOXA 1WDSA 3CUIA 1SFSA 2DIJA 4AD5A 1MQQA 3BCDA 1OGSA 3GXDA 3TA9A 1B9ZA 2VCCA 4WSJA 5HDRA 2IXVA 3WFLA 3PZNA 3BAXA 3BMVA 4Z2GA 4W5UA 1UKTA 2XVLA 1H41A 3VDBA 3VOCA 3ZSSA 1BHGA 1UWRA 3ALGA 3TTYA 2D0HA 2FH8A 1W9UA 1CYGA 1CLVA 4LPCA 2WWCA 3FXYA 3HU7A 1C93A 5I6SA 1J11A 1UD2A 5CLTA 1UZ4A 2J8FA 2MANA 3AIQA 4P8VA 3VDCA 1B3ZA 4PTXA 3WELA 3DYOA 1C91A 4J27A 5CGTA 2WMFA 4PUDA 4XUYA 2XVNA 1VB9A 3OBAA 1HVQA 2BHZA 2IUZA 4HMCA 2DT3A 1GQJA 2ZOXA 2QMJA 2V3GA 4QLJA 4HU8A 3VINA 1AQMA 3OB8A 2D24A 3B9DA 3CUFA 2OLHA 1HJUA 3PTMA 5E6YA 2WMIA 3FAWA 1W3HA 1QHOA 3POCA 4C7DA 4P7LA 4F9DA 2PWEA 4TOQA 3WNMA 1GONA 5DT7A 1GQIA 5A6BD 1QBBA 2J7GA 3CBWA 4JAWA 3ZT5A 3CHEA 3AIBA 4UR9A 3BGAA 4W84A 5E6ZA 2XM2A 3VDHA 1W9XA 2WCGA 2WLZA 1AVAA 2WMIB 4YN5A 4DUXA 4N42A 1YHTA 3GH7A 1LL4A 3AZTA 3WQWA 4W8BA 2GJPA 1CDGA 1WP6A 7TAAA 4R27A 1QHZA 3F4VA 4HTYA 1OGGA 1TE1A 3RMEA 4WLCA 3WUGA 2VZVA 3VD3A 1CTNA 1IZJA 1H11A 5A8QA 3MU7A 2ZXBA 3WSUA 4PMYA 5A1AA 3ARTA 4M82A 4NZCA 4PMOA 3ARQA 4P8UA 4CVUA 4JIEA 2O9RA 1QI2A 4BS0A 4GKLA 3AMKA 4U2ZA 4PYSA 1V0LA 3MS8A 3VGEA 1BG9A 1W1PA 3AXXA 4H8UA 2CKSA 1CZ1A 4TVDA 3B9EA 3ZJ8A 1V3LA 3BMWA 1TR1A 4NSBA 2XHYA 3NSMA 5GQBA 1XD0A 5JUVA 3PTQA 4IPLA 3W53A 4FK9A 2ZXAA 4CD7A 3W24A 1J0YA 5AY7A 2D0FA 1VBRA 4PUEA 4AD1A 2BNJA 2VUYA 2J25A 1OD8A 1ITCA 5FCZA 4TTUA 3PZGA 2BY3A 5HPOA 1XC6A 2YOCA 1NM9A 1CXLA 3BAKA 1WAWA 1ZB5A 4ACYA 4D6DA 3ZR6A 4UFLA 4J3VA 5A3HA 3W6MA 3F5JA 2WVVA 2VQTA 3BH4A 5D8WA 4ZEPA 5IDIA 5AC4A 3DYPA 5DFAA 3WH6A 1JL8A 4L4PA 4TX8A 4UQAA 3W0KA 3AMLA 3WNPA 4E2OA 1C7TA 3FN9A 2A3CA 4S3JA 2YL6A 2J8GA 3WEMA 1U33A 2W91A 1DWGM 3A47A 4DWSA 4MJ4A 3II1A 2CHOA 1MW0A 4HOWA 1KBBA 3RM9A 2WMKA 5M17A 3AIEA 1H49A 4Y7EA 4BA0A 1JZ7A 4GZJA 1EO7A 2WZIA 1KBKA 1OT2A 3RO8A 4DWSB 2Z1SA 5CPQA 3IAQA 3QR3A 3WH7A 4QCEA 4AYSA 1ZBVA 2XGIA 3MV11 1JZ3A 3VIOA 4C7FA 5A6MA 4FLRA 4H41A 4BCEA 1SMAA 2GJXA 3CHDA 1V0MA 4U3CA 4D6IA 4A4AA 4RE4A 2F61A 1E6NA 4IPNB 4PSRA 1C8XA 4ZE4A 1V3MA 2QV4A 3O9NA 2XYLA 2OWWA 3EBVA 5C70A 1GJWA 3VIGA 3FY1A 2VRKA 5GNZA 1D3CA 4UQEA 3VUPA 3W28A 1JI1A 4M29A 3T09A 4QP0A 4OBRA 1HJSA 4U3AA 4UZUA 1EO5A 4M1RA 1EOMA 1VF8A 3VU2A 3AMGA 2E9BA 3AXIA 2XSAA 3TP4A 1UKQA 3WQ4A 5ABGA 1W9BM 4KWUA 5A95A 1TFVA 2ZUMA 1E0WA 1W9VA 3UR7A 3PZTA 5JIWA 4E4PA 5FL0A 1VAHA 3IAPA 3CZLA 1QI0A 3POHA 1H2JA 3KL3A 1FH9A 1V3JA 1O7AA 1GZJA 2BY1A 2ZWZA 3VX1A 3L4VA 2YBTA 2QLYA 3NJ3A 3W38A 5A2CA 1JAKA 1LL7A 2J7FA 1EOKA 1XGZA 4ZENA 3PTKA 5LA0A 3VIKA 1VFOA 1WKYA 5BXSA 1JF6A 4WKFA 2F2HA 1B3XA 4KRTA 2XGBA 4D6CA 3VD5A 4P7RA 5I79A 3WQ6A 2V38A 4PTMA 1GHRA 1J10A 3WIJA 1E6SM 1UWTA 2E9MA 3AOFA 3KL5A 1R87A 4HOZA 3QHMA 1KWKA 2WXDM 1Q6EA 3MUIA 1EA9C 1E4LA 1V02E 1KGWA 2VOTA 1UYQA 1MWOA 1UR0A 2WPGA 1QBAA 4HMDA 1VEOA 4Z2KA 1GORA 1OD0A 4X9YA 1UR4A 1CGYA 1ECEA 1W1VA 1W91A 3L4ZA 4MB5A 2WBKA 3LPFA 3LPOA 1WB0A 4OKDA 1BLIA 4MDPA 5TD4A 2O9TA 4M24A 2X1IA 1AQ0A 1JNEA 3N04A 4WKHA 5BYWA 1UA3A 4HP5A 3W26A 4D6GA 1ITXA 3VIMA 2CERA 3AHYA 4PMVA 2YBUA 4BQ5A 3B9AA 2RGMA 1B1YA 2EPNA 4OIFA 4PN2A 4D72A 2J78A 2ZX9A 1E4MM 5HXMA 3WNNA 1WZAA 1C8QA 1MFVA 2VVNA 4BZYA 1OWQA 4H2CA 1WZLA 5I77A 4IUGA 2W4XA 1PEZA 4RE2A 1JYVA 4WJXA 4TVUA 3VD4A 2PWHA 5DMYA 3T08A 3WH8A 4NRRA 1QW8A 2CBIA 1DWFM 2VTFA 4QCFA 1KQYA 3OGVA 3WFZA 3ZT6A 1U30A 2XIBA 3UCQA 2J62A 3SCNA 3EYPA 3O6AA 2ZX6A 4QDMA 1UD5A 4JFSA 1BPLB 3G6LA 3CZKA 1JI2A 1GNXA 1CXIA 1OSEA 1B31A 1PBGA 2G3NA 1BAGA 1E72M 3QOKA 2E3ZA 4JCMA 1JXKA 1HKJA 4UOJA 1J18A 1CECA 1SYTA 3OZOA 1OCQA 2VZTA 1QOXA 2NT1A 1B30A 1CENA 5A6BA 1VJSA 2BV9A 2A3BA 1XH0A 1JNDA 3MUY1 4BQ2A 4IM4A 1HP5A 1L8NA 3MSGA 3I3EA 4B3KA 4UTFA 3K1DA 5HNNA 1W3KA 1CLXA 1J0KA 4Z2HA 2FGLA 3CO4A 2B31A 1HKMA 1E3XA 1NWRA 1W3LA 1G94A 2VQUA 4NF7A 1HXJA 1G9HA 6TAAA 1PX4A 1IV8A 1QNPA 3RDKA 3PZVA 3GDBA 5GNXA 3ARYA 5JBFA 1FH7A 3SCUA 1AMYA 5D4YA 2YIHA 4MB4A 2V3EA 1R86A 1XYZA 4W5ZA 1EDGA 3CIVA 5E70A 2C7FA 5CQ1A 3CZJA 1DHKA 3WF1A 5JIPA 1UUQA 4JZ5A 3VNYA 3SCRA 1CGVA 1FP8A 2JALA 5DF0A 2CXGA 4MAZA 3VM5A 4PTWA 5A8PA 1CXEA 2CITA 4UQ9A 2EEXA 3S2CA 1OT1A 2D1ZA 4R5EA 1PZ3A 1WE5A 3WMSA 3A4WA 1JXJA 4TVCA 1CGWA 1HJWA 1A47A 5BRQA 1C90A 2D3LA 2DT1A 3ALFA 1VRXA 4MB1A 1ISVA 2O9PA 1J0ZA 3RJYA 2WHLA 3HMCA 1JYXA 1EHNA 1GW1A 2E8ZA 3I3DA 4OOUA 2CIPA 4CKQA 1BF2A 2WANA 3NSNA 3U7BA 3KL0A 3ZJKA 3N1AA 1TZ7A 3WD1A 1DEDA 2CEQA 2BHUA 3K8KA 1JZ5A 4MAVA 3SURA 3GH4A 3FW6A 4URIA 2X0YA 1E6RA 2E0PA 1R85A 2YDRA 3WQVA 2CBJA 4MDOA 3NIYA 3K46A 4D6HA 3T0BA 4WK9A 3SCQA 3PZQA 3GTNA 4PCTA 3AI0A 4FF5A 3VIIA 1XV8A 3ARRA 2QPSA 2WC4A 4HA4A 4F66A 4MNKA 4EANA 3GXMA 1UG6A 1GQLA 1TA3A 1GUVA 4JKKA 1QNOA 2W67A 1LG2A 4ACZA 3DECA 4RL3A 2D22A 2UY3A 4B9YA 3KWXA 2AOSA 1E0XA 5A2BA 2VMFA 2AAAA 3N11A 3GXIA 3DHUA 1VBUA 1TA3B 2J79A 2ZX8A 2D2OA 2VZSA 2PB1A 4GI8A 2G8ZA 2W61A 1ZBWA 4W93A 2ZUWA 2VZUA 5CXPA 4ACZB 1GOMA 3GNOA 3WF3A 2G4FA 4CD6A 4Z2JA 4AIEA 1RPKA 3VGGA 5IFPA 3OLDA 4QFUA 1N82A 1BQCA 1E1EA 2WB5A 4GXPA 4XX6A 4OOZA 2JEQA 3VMNA 1PAMA 1BYCA 3LPGA 1QVBA 4GI9A 8CGTA 4PMQA 1HN1A 1K9EA 4F79A 4CD4A 3IK2A 2A3HA 5ABHA 4J28A 1QI5A 1K9DA 1GOWA 1MW3A 1M04A 3BLPX 1C3FA 2NSXA 3A4XA 3U5YA 1W1TA 1Q6GA 4EE9A 3IJ9A 5I0DA 1GOKA 1DWAM 3PHAA 3GXFA 5D9OA 5A94A 5DEZA 3OGSA 1OB0A 2YL5A 1JG9A 4EKJA 1ZJAA 2XM1A 2UY2A 1BYBA 4UFHA 2X0HA 4B9ZA 2D0GA 2XPKA 1E15A 3T2OA 3LMYA 2WVTA 2WMJA 4XZBA 4AC1X 3AYSA 2O9OA 3DHPA 5BXPA 2W62A 1EIBA 4XB3A 3WN6A 1TVNA 2DSUA 6CGTA 5JBEA 1G5AA 2OSWA 4LYPA 8A3HA 2VNCA 2PBOA 2A3EA 2OYMA 1C7SA 1J0JA 4DM2A 3CZ8A 3VGDA 3AS2A 1UQZA 4GQQA 4V27A 1WDQA 4FLOA 1CGUA 1WO2A 2W63A 1ODUA 4DM1A 1HL9A 3HN3A 3L4XA 2EPLX 3NCOA 3VIHA 1KCLA 3ARVA 1GJUA 1PX8A 1VENA 3W37A 4FLQA 4ZXOA 1PX3A 3BAYA 1BYDA 1IT0A 1J12A 2G3IA 3WD4A 4DWSC 2PF0A 5D9PA 4JFWA 2VX7A 3W27A 3MKKA 4H8HA 4JFVA 4QLKA 3WNLA 2DSWA 2FH6A 1CXKA 1HJVA 4LYQA 1FA2A 3CLWA 1QI3A 1E3ZA 3F5LA 2WLYA 2WVVB 3N12A 1WDRA 4HMEA 3AZRA 4MNMA 1LLOA 3T2QA 1UWIA 4H8VA 1G01A 5I23A 3HJEA 1UR9A 2NT0A 1RP8A 1W1YA 1OGBA 2X09A 2VO5A 4UFMA 1OIFA 4Q7NA 2WNWA 1QNSA 3OLIA 3MO4A 1WDPA 2HISA 3OG2A 2WC7A 4W88A 3CH9A 5KEZA 4D1IA 1NWSA 3ARWA 3NDYA 4IISA 2G41A 5C71A 2JFEX 3D3AA 1UWSA 2XIIA 1MXDA 4MB3A 4X0NA 2WBGA 2ZUSA 4ZXLA 2J47A 3ZOAA 4HZ8A 1E0VA 4XV0A 5HPCA 1JYWA 2PWGA 3SCOA 3K4DA 7A3HA 3SEPA 1U2YA 2GJXB 3N15A 1B3WA 3K4AA 2OSXA 4JL1A 4U33A 3VGBA 3WUBA 5E0CA 4XZWA 1V02A 1CXFA 2XVGA 2E9LA 5F7UA 4D71A 2Y8KA 2W92A 3UG5A 1HX0A 4MNJA 3K8LA 4P7NA 1MFUA 4LYRA 4GZEA 4CVWA 4V28A 2Q8XA 2DSVA 2DGAA 2Y4SA 1H1NA 3BAJA 2XJ7A 3NSXA 1PZ2A 2YA2A 1B90A 4U5KA 2G3MA 3AHTA 3AIWA 4JHZA 2VX5A 2UY4A
chains in the Genus database with same CATH superfamily
5LNRA 5A5WA 2O56A 2VR2A 4GBDA 2FJKA 1FBAA 1QPNA 4JNYA 1EP1A 1KXHA 2J4GA 1SW3A 3V0UA 4F2BA 3TN6A 1OVDA 1TCMA 4FR6A 1ZCCA 3RPTA 1VD6A 2WSRA 1YYAA 1QU4A 4BQ3A 3C52A 3HQ1A 1E55A 2UY5A 3SN1A 4WDWA 5ABFA 5HQMA 6PTDA 3L2LA 5CC5A 1H7PA 1YTEA 2XFYA 5EB8A 4H7VA 2FDMA 4P8WA 4ATWA 1TMLA 4W89A 3EXTA 4FXSA 2C6QA 5CJ5A 5DCEA 1KO0A 1F8MA 1JRBA 1Q8AA 1TO3A 3AIUA 1E9ZB 3MDUA 3ENLA 3LCLA 3LSBA 3RFAA 1I2PA 1F05A 2W66A 1IZKA 3ATZA 1JDAA 5TQLA 3IJDA 4CNPA 3G3MA 1XYFA 1HL8A 1RCOB 4J3TA 5MF5A 4LRSA 1E9YB 1WOAA 3N34A 3LXCA 2Y70A 3WNKA 5J5RA 4EF9A 1JZ4A 1LDCA 4RCXA 5EMYA 4GMEA 4EACA 4NU7A 4AXKA 2FYMA 3ORWA 4GWEA 3V5OA 4C1NA 1PKNA 3A9IA 2C1HA 1SZRA 1AL8A 3BLFA 4LX4A 3UA3A 2C8NA 4WF7A 4CEXC 3IGUA 4AMAA 3SUVA 4AX6A 3VKKA 3KBJA 2QEZA 1R3WA 3QKZA 1G7UA 2P88A 1VBJA 3WQ8A 3MSDA 4Z2LA 3NQ7A 4JIRA 1J6PA 4MG4A 3G1RA 3RJXA 3RU8X 4LUSB 5AHLA 3UJ2A 1SUXA 1CXHA 4BI7A 5LNSA 2VJXA 1R8LA 1NY1A 3YPIA 2OFJA 4TO8A 5E09A 5DMLA 3DZ1A 4AISA 1QNQA 1PYFA 3GY1A 3HPZA 3AUJA 3RIKA 3CQ0A 4ZB5A 2ZUUA 4D6FA 4HQVA 3PJUA 4DXXA 1R9XA 3E5PA 1M53A 3Q4DA 5L6UA 4Y9MA 3TYZA 3XISA 3T6CA 1AQHA 2VYOA 2EKCA 3TK7A 1HTIA 1TWDA 2PGWA 5I3IA 3ZVHB 1Q4NX 2YX0A 1JUKA 2OU4A 4S3EA 4EX4A 3W82A 1WA3A 4Q4KA 4AZ7A 1LLWA 4PCSA 4YCOA 5HMDA 3WFAA 3NPVA 4NZFA 1JD9A 3CV6A 2VURA 1U5HA 1FFQA 1XIMA 3LGEA 4M56A 4N6EA 3SN4A 4WJEA 5GJNA 3HFTA 3SGUA 1ZUAX 1A5AA 4OBSA 2AGTA 1M01A 3PWGA 2PLJA 4ATDA 2XG9A 1ESWA 4YL2A 3BC9A 4PMZA 4MM1A 5LYRA 1PJ9A 1GQKA 5BWFA 3T0AA 3UFYA 2G37A 2WSQA 2VP8A 2ABBA 4MZ1A 3VGHA 5HJYA 1EYWA 3K8MA 1E73M 1VCGA 3HGRA 1W54A 2VX6A 4YS1A 3PP7A 4QISA 4M8UA 3TZFA 4MWAA 5IOBA 1KGUA 3R12A 1V03A 3PNZA 2J66A 5D02A 4GUJA 3OLEA 3L4TA 5A2AA 1ZZMA 4GVFA 4UCFA 2CLKA 5AC6A 4NZ1A 4HCLA 3UG4A 1DJIA 3M64A 3UWWA 1FX6A 1EJRC 3HG4A 1WUFA 4V1YA 3RCNA 4JPGA 3PS7A 1G4TA 2TYSA 1OZMA 3DYMA 1TTIA 4NAFA 3WDQA 1B4KA 4XKYB 2QW5A 3CO8A 3QW3A 4YTUA 3P5YA 4XBJA 3JUGA 3AFBA 2EKGA 4FI4A 1I60A 3WJYA 1D9EA 2PC8A 4O11A 5M03A 4B5WA 4HZ7A 4O12A 2FPYA 2WZEA 1R9ZA 5HBFA 3M5YA 3A4AA 5BXTA 1SZGA 4CLMA 1KC7A 3SUWA 2A6LA 3BOLA 1DJQA 1FCVA 4OJYA 4FB7A 2QNEA 3NVDA 3W76A 3VOGA 1UD3A 3VE7A 4R33A 5HULA 3VPLA 1R7OA 2ESCA 3AXKA 1X6NA 4GIAA 2A2IA 1TQJA 2AL2A 4BEQA 5AYIA 1TV4A 2XVPA 3WX7A 3EX6A 1LT7A 4UZSA 1BF6A 1B3YA 3QM3A 4UMBA 3VCCA 2EPOA 3W74A 4PA8A 1GZGA 3F4NA 3QHNA 2CLPA 4N7QA 2REQA 2QDHA 1JF5A 3DI1A 1E56A 3LM7A 4UQCA 4I9AA 1UZ1A 3AAMA 3EX3A 4JN8A 4F9JA 4Y9NA 2GJLA 1GVSA 2VC7A 5EMMA 3MWAA 3GHTA 3W81A 7REQB 2IQDA 3LU2A 4PRTA 3A9BA 2DZVA 3TX9A 4TXEA 3GVWA 1KQZA 5A8MA 4E3TA 3CAQA 3BMXA 5I78A 2A7PA 1DXIA 3ABSA 3DEQA 1IGSA 3UVIA 2YDAA 5AVNA 2ZTKA 2DSZA 3A3HA 1I2OA 2WYSA 1TREA 5G2WA 4RDYA 2GVGA 1KGXA 1I8JA 4MLRA 1RLDA 1ZJIA 5DT5A 4RV8A 4KEVA 2VEFA 1G4EA 3IIZA 1TPUA 3WQOA 1TMQA 3BXWA 4XIAA 4Q4SA 2ZC1A 1S46A 4BFAA 1D8WA 2DZXA 5A6LA 1YTKA 3BSHA 1PUDA 1H5VA 1TTPA 3GIYA 1E1FA 1S2AA 3L9CA 3FSUA 1ISXA 1Q13A 4AD4A 2P8BA 4DJEC 4M7SA 2VD9A 4KT2A 2R1PA 1A0EA 3H54A 4DF0A 9CGTA 5FKYA 2SFPA 3W2UA 1SW7A 5D37A 4AU0A 1W31A 1TG7A 3VNJA 4YJ5A 2A85A 3FJNA 1Q2RA 1XLIA 2Y2WA 4WIWA 4DF2A 2V3FA 3CQHA 2YZRA 4PMUA 3UYCA 3KVJA 2ZA2A 1J2WA 1V08A 1TRIA 1G4SA 2LLEA 4GJ1A 1FWNA 5D9NA 1ZBKA 1FY6A 4NNAA 3SY1A 1F6YA 1MVYA 4LNYA 1IWBA 2YA1A 2JKPA 4AEOA 1W3TA 2BFGA 4D1JA 3SCVA 4NASA 4E6MA 1QHPA 1XH2A 3H53A 1XKJA 3RUBL 3ZWTA 1POJA 3MMDA 3QPEA 2YCLA 4UFJA 4KEZA 5LKYA 2ZIDA 4TUFA 3ZQ9A 2EPKX 2EG7A 2BVWA 1US2A 5LNUA 1REQB 1Z6KA 4S23A 1Q7QA 4LBSA 4YLWA 3T40A 3W1UA 1XCFA 4RUBA 4ATLA 4XBKA 2BGNE 1H3GA 3QTGA 3KBWA 3NQ2A 1Q5MA 2C15A 1E70M 3HURA 3UCDA 4ZZ9A 2EBNA 3M0XA 3HFYA 1ZS2A 3WMBA 2A0NA 1FXQA 5CKSA 3TONA 3CUHA 4MPKA 4E2DA 1S5VA 2BS9A 5DO8A 4FNPA 4O28A 4Q4QA 3W7OA 3W7JA 1H7NA 3HQNA 4XO7A 3RM4A 1DVJA 3ZZ1A 3N6QA 4KEMA 1AQFA 4AF0B 3P84A 2FLIA 1UD4A 1BFNA 1V6UA 4S3CA 1GVIA 3FJ6A 3GTHA 3PZIA 4AZ5A 3U2EA 4UR7A 2OWCA 5ECUA 2VWSA 4A8RA 2XN0A 1UOZA 1R3SA 4E38A 3WKZA 1BKHA 5T9BG 3ZO9A 3UGRA 2BVTA 3B40A 1XD1A 4N0RA 3VIPA 3DKJA 2OGJA 1AG1O 1W17A 4LUTB 1B0IA 3MUAA 3LI1A 2INZA 3G22A 3SO7A 3TSDA 3DFTA 4RZ4A 4W7UA 2FGZA 4ZOBA 5LA2A 4W7VA 3MV01 3VE9A 3CT2A 4TX9A 1KTCA 3W87A 1QR7A 3F4DA 4DY1A 1Z32X 3PB0A 4QNWA 4JTRA 3EXSA 5D2YA 1K70A 2FZMA 4GC3A 3WLMA 5AYYA 1LF1A 1FWIC 2FQIA 5KINA 3LTSA 1I0DA 6A3HA 2PE4A 3SAZA 2EF9A 3KVLA 1ZBCA 1M68A 1D3HA 3H6OA 5CZKA 1OFQA 1TV3A 3W4RA 3NUKA 2NQHA 3N3MA 1IR2A 1NFPA 2R6OA 5LHFA 1J0HA 1PV8A 2NQLA 2DU2A 1Q7ZA 1JZ8A 2YLAA 4OGZA 4EK7A 3PUDA 3QGAC 3KE0A 2Y24A 1JZ6A 2XN2A 4J2MA 4IPPA 2ODOA 1OFAA 2DY3A 2GK1B 3FAXA 1KXVA 2VZOA 2R1LA 2X2YA 2H9AB 3U7VA 3L12A 4WEVX 4GH1A 4GYFA 2UWFA 1P6WA 2RFGA 3WO8A 3CV2A 4PSPA 1W8SA 1XRSA 2J7EA 4NXSA 3NXFA 2ZDSA 3T2PA 1H4PA 4DLFA 3G3DA 3LMZA 2WSYA 4CQAA 2FDSA 1JDDA 2YKKA 3F4CA 2HXUA 1MQRA 2GYIA 1QW9A 2YDQA 3CASA 2VM8A 4K8EA 3H26A 1NP2A 5D30A 2BHYA 1RAKA 3MO7A 5EMLA 5I3DA 4QQ3A 1R2TA 1UQYA 2GDUA 3LRLA 4B3LA 1WV2A 3MMUA 1L2UA 2BXZA 4MVAA 1ZALA 2ZXDA 3U5UA 2ASHA 3OVPA 3N73A 4A3HA 2Z1KA 3O05A 2WCAA 1PL9A 4RPQA 1BXBA 3CUZA 2P3ZA 4P2VA 3GBDA 1LUCB 2XINA 1F6PA 1AK5A 1PB0A 2E25A 2WWDA 3V5CA 5A6KA 3GHUA 3COTA 3WLTA 1WZMA 4RZ5A 1GVYA 1K7XA 1KM6A 5EFFA 1VC4A 4EIVA 1Q6DA 4Y8FA 3UXKA 4NNCA 4ADSA 2V2HA 3RX3A 2X1SA 3GLCA 4M6UA 4NYUA 1DJZA 4CN4A 4FA3A 3URAA 3GU9A 2XIQA 2FIQA 2YSWA 1DL3A 1AZ1A 2JEPA 2HDJA 1QNRA 2QDGA 4AWEA 1TELA 3GH5A 2GQAA 3IK4A 2VRQA 3E0WA 3SCPA 1ZCOA 4AZCB 4MKVA 2PWFA 1K1DA 2ONEA 1WDSA 3CUIA 2HWGA 1KCZA 3L2IA 4AD5A 1TJ2A 3GAKA 4AY7A 5D2VA 1B9ZA 2I5GA 4QJ4B 3BMVA 3WK1A 2PC4A 2XVLA 5HR7A 3ITOA 3VOCA 4B2DD 1BHGA 4DO7A 3TTYA 2ZZ5A 2D0HA 1W9UA 2Z6JA 1CYGA 5HQLA 4GE8A 3HU7A 5I6SA 1GTEA 1I2QA 3LY0A 5JXQA 3AIQA 3VNKA 3Q45A 4P8VA 3DYOA 4Y90A 3EX2A 5BZAA 4PUDA 4XUYA 3GC5A 4KKXA 1S2VA 1UC4A 4HMCA 3FK4A 3GWQA 5DY2A 1GQJA 2J6XA 1A4MA 2V3GA 3C2OA 4HU8A 1BTMA 1AQMA 1NVMA 1TX0A 3B0UX 2H3DA 3B9DA 3N6JA 1LOLA 3PTMA 4PB5A 4BHYA 4P7LA 5A6BD 4JAWA 4PTNA 2GWGA 3CHEA 1VS1A 3MHUA 4KWWA 4W84A 4MIMA 1SW0A 4NNBA 2AKMA 4XZMX 1ME8A 1W5MA 5E6ZA 1W9XA 5BU6A 4DUXA 5LIWX 4UTTA 3GH7A 2JKEA 4YIWA 4ALDA 1WP6A 2ISWA 4R27A 1GYNA 2PODA 1OGGA 3QV7A 4WLCA 1VZWA 2VZVA 3VD3A 1CTNA 2FMOA 2C16A 4E3VA 3R94A 1BXCA 2C1IA 4PMOA 3L65A 4JIEA 1QI2A 4GKLA 1O5QA 4PYSA 3MS8A 3VGEA 3QLLA 1JUEA 1U5VA 3AXXA 2CKSA 1CZ1A 4D2JA 3VKAA 4OT7A 3ZJ8A 6ENLA 2DVXA 1A5BA 1TR1A 4NSBA 3THUA 1BQGA 1QASA 3KW3A 1QT1A 3W24A 2NQ9A 1J0YA 5AY7A 1RPXA 4PUEA 2D0FA 3D0CA 3DGRA 4LB3A 3GD6A 3FVDA 1JEZA 2O7SA 3PZGA 4FZIA 5DY3A 3ITLA 1NM9A 2QJIA 5MKGA 4LY8A 3LI0A 4Y6GA 3VNDA 3BZGA 1ZB5A 3PC0A 4ACYA 4J3VA 2NSOA 3C0SA 3VC6A 5D8WA 4ZEPA 5IDIA 5AC4A 5DFAA 4TX8A 2DQWA 2VEMA 1ZQ5A 2CZFA 3AMLA 4E2OA 1C7TA 3FN9A 1XYCA 2YL6A 2VOMA 3LXAA 1MW0A 1YNPA 4HOWA 3V0TA 3PBMA 2WMKA 4O17A 3VC5A 2RKXA 4BA0A 1JZ7A 3KAOA 3REQA 3BJSA 1EO7A 1F3EA 4Q7BA 1YDNA 2Z1SA 4NX5A 1KFBA 1Q3NA 2Y6ZA 5J5DA 3QR3A 2YXXA 1O94A 1ZBVA 3MV11 4BCEA 3IV8A 1V0MA 4M1BA 3S6DA 1K4HA 1K7EA 4D6IA 1YBQB 2BMBA 2IPWA 4A4AA 4ROQA 1E6NA 2QJMA 1C8XA 1OF8A 1V3MA 3KVMA 2XYLA 3GXPA 4K3ZA 3W1XA 3VIGA 1D3CA 2PDXA 3W28A 1QDSA 3BSMA 3Q67A 4YYCA 4FP1A 4M1RA 1DBTA 1NF0A 1W5PA 1YEYA 4R88A 5LIXX 3AMGA 2PDMA 4ZOEA 1KNWA 3TYUA 1VKFA 4Z1YA 5A95A 1GW9A 3UR7A 4DPQA 1TJRA 4U4MA 2G3FA 5FEPA 3CZLA 3W7GA 1J2BA 3KS5A 2RAGA 4KFNA 4NYYA 3G1DA 5D03A 3DU0A 3L4VA 4IX0A 5EMKA 1YADA 5A2CA 3FA5A 3CWOX 1RCXB 1XGZA 1V5XA 1JCMP 5LA0A 5KZMA 3NURA 4OQVA 1WKYA 3KRZA 2RJGA 3ZLHA 1KV5A 1TIMA 4FX7A 2Y7DA 3VD5A 3CEUA 4EAYA 5I79A 3NEVA 3R8GA 1UUMA 3PPFA 1X6UA 1EC8A 4K7VA 1M65A 3VK5A 1J10A 3BUVA 3WIJA 1E6SM 3RPDA 1PKLA 4HOZA 1D8CA 2CLOA 2WXDM 3MUIA 1KGWA 1Z9AA 3T78A 1VPXA 1G69A 4Z0JA 4H00A 3KOYA 5JVLA 3P3BA 2X1RA 4IQDA 3MVTA 4BR1A 2ZTJA 2JKAA 1UR4A 1QCWA 1W1VA 4MSSA 1WKFA 3LPOA 3EA2A 3PSVA 5TD4A 1W8GA 1AQ0A 2X1IA 1TPFA 1S2UA 1UPMB 4HP5A 3Q58A 4O53A 3GVQA 1Q63A 3PY2A 4MZYA 4PEKA 3B9AA 1EZWA 5EA9A 1OABA 4OIFA 2TODA 4JIIX 4K8GA 5DRIA 1XIEA 4L1WA 4LAUA 1WZAA 4DEFA 1VPQA 4QGCA 3GC2A 1MFVA 2VGBA 2NWRA 4H2CA 1KM3A 4B2DA 2BG5A 1JPMA 2W4XA 3WLPA 4RE2A 4WJXA 4TVUA 4JTQA 4M3PA 5B80A 2PWHA 4JTCA 2I5QA 4UUIA 2YW3A 3R25A 4I9TA 1DIKA 3EWCA 2CBIA 1DWFM 4IMGA 4QCFA 3EWYA 2QDDA 3ZVHA 4EVZA 3ZT6A 4IQEA 3UCQA 3SCNA 4CNUA 3W3OA 3G8EA 1A50A 2PU1A 3E49A 1UD5A 3UZYA 4JFSA 3G6LA 2NZLA 3M47A 1BAGA 1E72M 4H4IA 5HA7A 4N2YA 1JXKA 4UOJA 3ITGA 3OZOA 2VZTA 1QPOA 1CENA 1T5AA 5A6BA 4J1OA 3VDGA 1WDWA 1S39A 3B06A 4XZNX 4PFHA 4BQ2A 3QMSA 1RXOB 1QO2A 3K1DA 5LIKX 3USBA 1W3KA 1TPVA 3NPWA 4V1XA 3ISIX 3CIXA 2W0UA 3SRDA 2PDHA 2OEJA 1E3XA 1W3LA 5D05A 2ZFAA 4MKNA 5I00A 2C0AA 4G2DA 5CZJA 2QVHA 3FXGA 1D3GA 4RDWA 4XZLX 4NAEB 3UWVA 1P48A 2V69A 4Z08A 3SB0A 1AMYA 3PPGA 5D4YA 1EX5A 3HMJG 4MB4A 4HHLA 1XYZA 4W5ZA 4GJIA 3STPA 4GH3A 3P6LA 3T0CA 3NQ8A 1ICPA 3SCRA 2IW0A 5DF0A 3H2OA 4PTWA 2JQXA 4LC6A 2QJHA 3UBPC 2CITA 3EOOA 1VJIA 4YTQA 3G2GA 5FSDC 3S2CA 4HGXA 1OT1A 1P0DA 4DO4A 4J35A 1K6WA 3B03A 3BV7A 3TN5A 2ZRZA 1JXJA 4TVCA 5E0KA 4EXAA 1A47A 4JEQA 2OEMA 1AL7A 3FDKA 1LRQA 2E67A 3HZ3A 2PDLA 3H2AA 4MB1A 1J0ZA 2QCDA 3RJYA 3NWRA 3HMCA 3VFCA 3FKRA 1GW1A 2CIPA 2WANA 2ZE3A 3KL0A 3ZJKA 2BHUA 1QPRA 3S5OA 3EB4A 4MAVA 3A4JA 1R85A 4IMFA 5I07A 3I68A 5HINA 3SIZA 3GAYA 3K46A 4H8NA 4WK9A 3SCQA 2HSAA 5XIAA 1W3NA 4E4FA 3AI0A 3TKFA 5DCDA 4DWDA 4IT1A 4F66A 4EANA 2F2KA 3NL5A 1ZP3A 4JKKA 1QNOA 4LVBA 3KOWA 4PL2A 4ZOCA 3DECA 4B9YA 3STGA 1E0XA 2VMFA 1VHNA 4S3DA 2YZ5A 2E09A 2D2OA 2PB1A 4W93A 3TW6A 4CQDA 3GNOA 2GLKA 4UTIA 4AHQA 3WF3A 5H8UA 7XIMA 2V5KA 4AVOA 2VFDA 4MJMA 1OYCA 3QR0A 4AIEA 3JS3A 3EOEA 1PAMA 3AYTA 3HV9A 1BYCA 3UNTA 1A5CA 4QM1A 8CGTA 4PMQA 1HN1A 4F79A 3NR0A 4NL1A 5IBXC 2PMQA 4A3RA 1GOWA 1Y8BA 1MW3A 1XR2A 1K8YA 1P7TA 1OG6A 3HQOA 4LUYA 4I5UA 1JPKA 4H6QA 5D9OA 2AQWA 1YE6A 3WLQA 1JG9A 6TIMA 1ZJAA 2XM1A 2CLHA 4DN1A 1BYBA 2YPIA 3QC3A 4M5PA 1DIDA 2XPKA 4Q8QA 3IIPA 3T2OA 1OX5A 5CJNA 3NZPA 3NFUA 4AC1X 2O9OA 3S5SA 1EIBA 1EJVC 3BGJA 5JBEA 5FJTA 2OSWA 4LYPA 3GW3A 4LEQA 2VNCA 5H8MA 4GNJA 2QUNA 1J0JA 3LNMA 5CGQA 2NQZA 3IJ6A 1PO9A 4A29A 1VYRA 4PCNA 3R8RA 1LBMA 1UQZA 2J9ZA 4L6OA 2W63A 4G1NA 4DM1A 1HL9A 2G5WA 3UD6A 3MKCA 1EJSC 5T26A 3OEXA 3W37A 3XINA 1PX3A 5M1TA 3CQIA 3H7UA 3WD4A 3RMJA 2PF0A 2VDIA 4I8YA 4JEJA 3MYPA 4ZTYA 3OZYA 1MNZA 3MKKA 4JFVA 4H01A 3M0JA 4QLKA 2DSWA 2FH6A 2GSEA 3TAOA 4K38A 3C3NA 3QC0A 2YXOA 2WPBA 1TPWA 3M5ZA 5HMFA 2WVVB 1R3RA 3FCPA 2DV0A 1WDRA 2A79A 4GGBA 1LLOA 4O0QA 1LP6A 3SQMA 1X96A 2VO5A 2P10A 4Q7NA 4NJKA 1WDPA 3OG2A 3ATYA 3GO2A 4W88A 3SR7A 1ZGDA 4D1IA 2KZHA 2Z1BA 2JFEX 2XIIA 1KKOA 3CL6A 4U28A 4X22A 4H83A 4HZ8A 1E0VA 4LCRA 5C2CA 2GJXB 2W6RA 2OSXA 5CZ0A 3VGBA 4QX4A 4GGHA 1J96A 2X0SA 3KDNA 1CXFA 2O55A 2XVGA 1FRBA 2P76A 2PLMA 3ITYA 5F7UA 1X7IA 2C14A 1P43A 1UW9A 1VFLA 3K8LA 4GZEA 3QZAA 4UBPC 2DSVA 2DGAA 3BAJA 2XJ7A 3GVGA 4DXVA 3NZRA 2KAUC 3RX2A 3TSMA 2VX5A 1XC4A 1N7KA 4GQRA 3OA5A 1WNOA 2BVDA 1EFZA 2GDQA 3KTXA 1SJAA 1H1YA 4GI4A 4AW7A 2DP3A 4HSHA 1HVXA 1EL3A 4UOQA 4LRTA 2PAJA 1SU5A 3P7YA 5FD0A 2POTA 1TR9A 3LCFA 2RDTA 3SZ8A 3GFYA 3ZJ7A 3BCJA 4O1CA 3OBKA 2ZRVA 3ARZA 1C92A 3TFXA 3VZXA 3FS2A 2Z1VA 3UU0A 2PRLA 3VUSA 1EEXA 5ABFB 2OX4A 3MKVA 3RK8A 4E4UA 1UROA 3B8WA 4IGSA 2CW6A 5EMUA 1WBJA 2ZC8A 3OG3A 2BBFA 4C6PA 3R0UA 3UWUA 1KFKA 4KPLA 1KD0A 3GNPA 3EMQA 4HPJA 4RV3A 1TCDA 3LTPA 3M7SA 4MFDA 3UJSA 4Q8PA 4XISA 2PWUA 1K9FA 5IDZA 2IKHA 2GJNA 2QUTA 3BL3A 5BROA 1SSGA 1ZAIA 2OZTA 1XLKA 3W1TA 3ZR4A 3W1RA 2NX9A 4DAIA 2POZA 5CZSA 1KKRA 3S5ZA 4F3HA 3DFQA 1NJJA 1I1WA 4GZIA 3NL3A 4MUPA 1Q66A 1VFSA 4MTVA 2PRMA 3PBUA 3UEQA 3G1SA 5LXXA 3MMTA 4RXFA 1EX1A 3WF2A 5HAOA 1QRQA 2XGZA 4D6EA 2G95A 2W5FA 4KWVA 4H6KA 5EMJA 3N17A 3A21A 4C1NB 3H12A 1TJ0A 5FA5A 1DQUA 4IIGA 1OINA 3HG2A 1P4CA 5FEXA 5G2HA 4CCEA 4DLMA 4FALA 3WMCA 4JCLA 8XIAA 3QOMA 3WF4A 3RM8A 4QEHA 4H6RA 5CAKA 4AZHA 2FFCA 1W9PA 4B5VA 2PDGA 3BOFA 3ES7A 3W7CA 9RUBA 1J4EA 4CQ9A 4F4RA 4CGTA 3VO0A 5G5IA 1UD6A 2ACRA 1I75A 4HN8A 2CC0A 3KFTA 4AB4A 1EC9A 2J74A 3OO2A 4JGDA 3D5HA 1VJZA 4JHMA 2HNEA 3VGFA 2OG9A 3S46A 3CXOA 3ZJ6A 3LHYA 2YLLA 1OJXA 5M5DA 5F4XA 3Q94A 1Q4WA 4QHRA 4A3YA 1ISZA 3R10A 4ZQCA 1ZPTA 9XIMA 4Q3MA 4CU6A 3R0KA 1K9TA 5M2FX 2V5CA 2WK2A 1UD8A 2VX4A 1QAPA 3DOPA 3LBOA 1FHDA 2J7HA 2WKGA 5EGRA 3GVRA 1KB3A 4A21A 4FLSA 3SUTA 2DT2A 2E4TA 4JTHA 1K7FA 1XL9A 5ABEA 1F2JA 4LB4A 3VD9A 1FHLA 1TVPA 1J79A 3ARXA 1F4HA 1EKOA 2V5LA 4MNLA 4PUNA 1HL2A 2XSXA 3BLEA 4JDBA 4CNSA 3I10A 3B0PA 1IT7A 1UKSA 3PBYA 1SFLA 2PZ0A 1SO3A 4O8RA 4LXFA 2FTPA 1JCJA 3R11A 2IQ0A 2PA6A 3L4WA 3GU2A 3JW7A 2PGFA 4E5TA 1GVQA 1XCWA 4DZAA 4HYWA 4ZVJA 4MWAB 1X1OA 3VNZA 3OQ8A 1ADOA 4OUEA 2GVLA 1WX0A 3P80A 5K9DA 5AC8A 2PD9A 2PP1A 2VRJA 4GPNA 1SZFA 3PZMA 4N4PA 4C6LA 2NUWA 3KVKA 2PCEA 2IXUA 3IGXA 4HU4A 4NAFB 3ECQA 2PP3A 1UH4A 4GIEA 4NI8A 1A0CA 1E6PA 2VWTA 1D7KA 1XQLA 2VELA 2OO6A 4KWOA 4HA3A 3W2MA 2GOKA 3MI2A 1GPFA 4UOZA 1CGTA 1XBYA 4Q8TA 3RF9A 4QE1A 4PMDA 4H04A 1XGDA 2J77A 1JCLA 3SI9A 2F9RA 1VFUA 3B04A 4H3DA 3SJNA 2WJZA 3MJYA 3FLUA 2BTMA 3FGCA 3FHQA 1YIXA 3W29A 2HPIA 5G1TA 3EX4A 3WEZA 1QTWA 3EDJA 3L4UA 1NSJA 4I6VA 4G8TA 5I3KA 3EMCA 3W88A 2HS6A 1ENUA 5CZTA 2AL2B 4X63A 3UGVA 4C1LA 1H09A 4GFSA 4E8DA 1SJCA 1GGOA 2PLKA 1U1UA 4WSHA 5GVJA 4FNTA 1GVFA 2VR5A 3EKGA 2QPUA 3E0FA 1SMDA 4OU1A 3MWCA 4X3ZA 4JYDA 4S38A 2REQB 1AUSL 1H5YA 3FA3A 1BRLB 4EXQA 2OPJA 2J9XA 2QUUA 3JZEA 2ABAA 3WLKX 4W85A 3NQFA 4RDVA 1R46A 3C4UA 3OHMB 3H2MA 5BNKA 1XGEA 1IEIA 4F0MA 3M0LA 3BAWA 1CI1A 1R9YA 2F84A 1FFRA 1E9IA 2YJQA 3WLNA 4S2BA 4IG2A 3H4XA 4WSKA 1YTDA 2BGQA 5HQEA 3B8VA 3K4WA 4JTJA 3QPYA 2ZICA 3N2MA 3WD2A 2VFHA 1ZAJA 2R14A 1Q6FA 5CSYA 1Z41A 3WL0A 2X2GA 4IPJA 5FL1A 4EAMA 3GR8A 4JTIA 3SCWA 5IHRA 2XIMA 5KZDA 3GYCA 3BG5A 1V3IA 4RNHA 4PB3A 2FZ8A 1F76A 4ICCX 2PLCA 4XKMA 1AA1B 5I3GA 3BLKA 2BY0A 3OHIA 5A8NA 2PF8A 1XLHA 3SGGA 2WM0A 4L65A 1EBGA 4OECA 1JCXA 4MJZA 5XIMA 4PBGA 2XH4A 3KRBA 1A5OC 2WCSA 1KM1A 3HPXA 3S2NA 1XSKA 4DBUA 3BLOA 1KR1A 1O68A 3JZUA 5EU9A 4GO8A 3GDRA 1QPKA 3VOFA 5HR6A 3KCLA 2NV2A 2YDSA 3PZ9A 3LCHA 3EXRA 3SBFA 4J3XA 1GCYA 2EO7A 3QPZA 4KMQA 5IM51 4UTWC 2V67A 3BOXA 4A3QA 2D69A 2WQPA 1TUFA 3TWBA 2QMKA 1YMYA 2JF6A 2Y89A 2ZCGA 3TTQA 4A2SA 1VR6A 2VT0A 4M7TA 4Q6XA 2ZXQA 3HGJA 1K3UA 1PHWA 1XSJA 1EXBA 2AQVA 2WSPA 5CBBA 1WZKA 1M9HA 3BW2A 1NP0A 3UF9A 3DERA 2NV9A 1GHSA 1RVKA 2IPJA 1W5QA 4Q8OA 3VTRA 2YCLB 4KERA 3SCTA 4G6CA 4R7WA 3KWSA 4L4OA 5FIPA 3GDLA 3LQLA 4AIUA 1H62A 1KBLA 4KESA 3ARUA 2HQAA 4AD0A 1EGVA 1VIZA 4UQBA 4PR4A 1GKRA 5U7SA 4NXKA 1CPUA 3MUZ1 1ZL1A 3B97A 5BWAA 1OFDA 4BWLA 2L5HA 4DQWA 3S8HA 2XWDA 1IWAA 2WNZA 3TJIA 2CCRA 1CGXA 4HMNA 5C54A 2CLMA 1OM0A 3UZZA 5AC7A 4PFMA 3T42A 1UMYA 2WHMA 3TROA 4BF7A 2EXOA 4JN7A 4V15A 1OYAA 2DVUA 2HJPA 1S5WA 3SECA 1IXOA 3U2CA 1MQPA 4UB9A 5C6MA 2GJRA 4FIRA 3B9NA 3LS9A 3AHZA 1U22A 3CNYA 3FJLA 1P0EA 1PWMA 5LSMA 4YHGA 3VIFA 1XSIA 3EEZA 3D6NA 5H2ZA 1I2RA 3E0LA 4HZ6A 1B5TA 5CG0A 4XG1A 4LT9A 1JD7A 3AISA 2ZUTA 3HB9A 3P5ZA 4FOKA 3W7IA 1PDYA 2BVYA 2PWDA 5K2ZA 4PH6A 1UP3A 1U83A 3R13A 1TWIA 3EDFA 4DWSD 1RJQA 3LNPA 1LROA 4NRSA 3O0FA 2Y88A 2FFIA 1V6XA 4LBUA 1V0NA 3SW6A 1XFBA 2GGJA 3EDEA 3A12A 1F3XA 3OIXA 3VD7A 2YL8A 2VUNA 4KBXA 1AW1A 4OHQA 3TXVA 3TFCA 4Q4MA 3WDJA 2EJ1A 3IRSA 1G1YA 1H7WA 1RALA 4XAZA 2CZVA 5EPDA 4Q22A 3S4TA 2X16A 2CNCA 3UCCA 3OW1A 1E5JA 2OOFA 2ZKMX 3OQEA 1V93A 2WMGA 5I06A 2FPTA 4IIDA 3QHOA 1V79A 3SUSA 1O1ZA 4B15A 3O2LA 1XIDA 4O14A 3A23A 4AHOA 3ZLGA 1AMKA 3SY8A 2A3AA 1XCXA 4ZOAA 1ODZA 5CPNA 3OLGA 3FYOA 2GDVA 3WMLA 1T6MA 1Z7AA 4A8LA 2ZUNA 2DPEA 3WDPP 2V6AA 1VCFA 3ZSTA 3NXLA 3H24A 3HJZA 5BXRA 1H61A 3I3BA 2NUYA 2Z00A 3V35A 2HPMA 2Z1WA 3G5EA 2UZ9A 1DP0A 5CJMA 1GT8A 2DW7A 1S3HA 1NAL1 1A5UA 2AMXA 1LRTA 5C9UA 3M46A 5C9RA 3BCFA 4O1AA 5K9CA 4GY7A 2OZ3A 2GQ8A 1QWKA 4FR1A 4O54A 4Y96A 4KH2A 4MLJA 2JGYA 2ZUVA 3OYXA 4PMRA 1RH9A 4MWAC 3U8GA 4JHOA 1MUCA 3V0SA 1Y7VA 2C0HA 4ERGA 1W3JA 1XRVA 2ATMA 4OV9A 2I5IA 1EGZA 2GVYA 3T0DA 2Z2AA 1IR1A 4MFEA 2OLSA 1HT6A 3G24A 2BY2A 2CKRA 3CWNA 1A80A 3O6YX 1TV5A 4ZO7A 3CZGA 4CU8A 1X8CA 2C1GA 3MVIA 3DESA 3THDA 2PUZA 1T41A 4A8NA 1FOBA 1KR0A 1FH8A 1UKOA 2WMHA 3C2VA 4KCVA 1IYXA 1JIBA 3NGJA 1EH9A 3E0VA 5A6TC 1KTNA 1C29A 4B90A 2PGEA 4H19A 5GJMA 2E68A 5I24A 2WSKA 5I3JA 1DXFA 1YNYA 1I2NA 4AAJA 3S83A 3WENA 3RYSA 3RNDA 3GXDA 3TA9A 2IXVA 3BW3A 3PZNA 3BAXA 4Z2GA 3CHVA 3FYYA 3E74A 4R53A 1VRDA 3ZSSA 1UWRA 1WQ5A 4Q8MA 1XS2A 3WQDA 4IWWA 5DXXA 2XN1A 4LPCA 3GG1A 3MPGA 2WWCA 3FXYA 1C93A 5FJIA 3VCRA 4OWGA 4C1KA 1UD2A 4BK9A 2J8FA 4MY9A 3H2FA 4EWJA 4A22A 1B3ZA 3WELA 5BOOA 1WOBA 2WMFA 4LAOA 3DBNA 3BARA 4LS0A 2TRSA 5AOUA 2XVNA 5EBUA 1VB9A 3OBAA 2BHZA 3PFMA 3T4WA 1FWAC 2ZOXA 2QMJA 4QLJA 3W83A 3VINA 3GXTA 1DIEA 3W86A 5I3HA 4QG9A 3CUFA 2OLHA 4O1FA 1Z44A 2HBXA 4S3FA 2YW4A 5E6YA 3FAWA 3POCA 1W3HA 1RCQA 2QS8A 4WXZA 4JD4A 4BF5A 1F3WA 1GONA 3FVMA 1GQIA 1QBBA 3ZT5A 3N9RA 4AIBA 3BGAA 1XRFA 2WCGA 2WLZA 4BKNA 4YVVA 3W7EA 3L5MA 4JYEA 1F74A 3CQKA 4RW5A 1LL4A 3WQWA 2Q09A 2GJPA 1Y0EA 5CSRA 4DBEA 1AW2A 3RG6A 2ZDRA 3SQLA 4Z1DA 4AVFA 4IJBA 4FXJA 3DFOA 1IZJA 3MU7A 2ZXBA 3PPHA 3ARTA 4M82A 3A13A 4QITA 1FWJC 1UIPA 2O9RA 1H7RA 2BB0A 1C9DA 4U2ZA 2XIOA 5FF3A 3MHGA 2QQ6A 2HROA 4FF7A 4H8UA 1T99A 2QCLA 4IIEA 5HNRA 3RX4A 4I7VA 3NSMA 5GQBA 3NM3A 3SFWA 3G77A 1SGJA 4AD1A 2BNJA 2VUYA 4FPSA 2H3BA 3EWZA 3FX4A 4RK8A 4JYFA 4ZQPA 4IP5A 4BEUA 1OC7A 3S1GA 1NDVA 3BAKA 4O50A 3T44A 4HJFA 4L80A 3VKBA 1ECQA 1QFEA 3MDWA 3LHTA 3W6MA 2WVVA 4PUMA 1SO4A 2YGYA 1JL8A 4L4PA 5MKGB 9XIAA 4UQAA 1GK8A 1QNVA 4JX5A 4LNCA 3VKDA 3W0KA 1TYGA 1S1RA 2W91A 4DWSA 3R1ZA 3Q2DA 2QIWA 5M17A 3V5FA 3G1FA 1KV8A 4Y7EA 3S42A 2P3EA 4GZJA 1F9CA 1KBKA 4K36A 1OT2A 3P8IA 3B0VC 2GSHA 3RLUA 3EZ4A 3IAQA 4ADTA 4QCEA 1JZ3A 3VIOA 1IZCA 3REQB 4H41A 1UC5A 3UPWA 1SMAA 2GJXA 3Q65A 3CPGA 1XLFA 1FKWA 5HWNA 4L61A 4PSRA 3PUGA 3IGHX 4ZE4A 3EA3A 2EG6A 4L9YA 2BX7A 5C70A 2OZ8A 3STFA 5GNZA 4UQEA 1UJPA 1JI1A 3T09A 1XJBA 4G5DA 4QP0A 1HJSA 4U3AA 2CWXA 1EO5A 3H70A 1QO5A 3S2LA 3CC1A 1BKSA 3LUTA 4WQ6A 3MCMA 3VU2A 1DQXA 3HM7A 3TP4A 3K5XA 5ABGA 1Y5WA 4MF4A 1M1BA 2HS8A 1E0WA 2EJAA 3QMRA 3CS2A 4E4PA 5FL0A 1VAHA 4KEUA 5D32A 3B4YA 2ZADA 1QI0A 4TV6A 3KL3A 4O57A 4CNOA 1V3JA 3H4GA 3N6HA 4FSAA 4ZCWA 3KOFA 3VX1A 3NJ3A 1DHPA 1LL7A 4C91A 2J7FA 1XBZA 4ZENA 2QCNA 3S5NA 1RBLA 1VFOA 4JTSA 2HTMA 3R4IA 1RSCA 4GHRA 3P67A 1N55A 3VCNA 3S1WA 2F2HA 2XGBA 4P7RA 1ITUA 4IGMA 4IFRA 3VXGA 1IEVA 4GX9A 4R34A 4PTMA 3ZS4A 4C6EA 1A3WA 1ZP4A 1UWTA 1TMHA 3MT1A 3ONCA 1KWKA 3GQYA 4LAZA 5DBUA 2X1TA 1UMLA 3KP0A 1EA9C 4IIHA 3C61A 2VOTA 1UYQA 1UBPC 4GUGA 1UR0A 2WPGA 3VOHA 4A8IA 3ME3A 3NO3A 1XM3A 2C18A 3PULA 2C13A 5DN1A 4CNNA 3OBEA 3L4ZA 4LVAA 1LBFA 1YXCA 2WJDA 2CZDA 3W2NA 1Q8JA 2O9TA 5C9XA 5BYWA 1UA3A 3VA8A 2E6DA 3E6EA 4AUBA 1ITXA 3VIMA 1OF6A 3E12A 3AHYA 3TDFA 1JVNA 3P0XA 3PK7A 4US6A 2EPNA 3DHDA 4D72A 3B8TA 2ZX9A 1WKDA 2E5DA 3JR2A 4RPPA 4QXIA 3TEVA 1WZLA 4BY3A 1JYVA 2Z28A 1SQ7A 3WH8A 3CYVA 1XUUA 4QJ5B 2VTFA 4IOTA 1AW5A 2BWGA 2PDBA 3M4HA 3O63A 3WFZA 4C90A 1FXPA 2J62A 4C6OA 3O6AA 3NZQA 4QDMA 1BPLB 3WJXA 3RCMA 5JU6A 3S3GA 1GWJA 1B31A 3QOKA 1FWGC 4DB7A 4X9SA 4ROPA 1XH0A 1JNDA 3AALA 4YTSA 3G18A 1OCJA 1RQBA 4PUJA 3E2SA 2P0OA 4Z2HA 1Q65A 4AX7A 2FGLA 1XLDA 1HKMA 2W3ZA 1UP0A 1NWRA 2R82A 1G9HA 2NXIA 3CU2A 3D3FA 1KRAC 1QNPA 2QCEA 2ZA3A 3LM3A 3IUHA 3ANUA 4AYGA 3URQA 1FH7A 3IIOA 3SCUA 1FCUA 3HIJA 2ACSA 2V3EA 2GZXA 1TTJA 1EDGA 3UVAA 5E70A 3WF1A 5JIPA 1EWDA 1UUQA 5LNWA 3WLOA 1CGVA 3M0MA 3S9ZA 1TV8A 1BWLA 1T40A 4UQ9A 4GVIA 3B9OA 3WLIA 1SZNA 2EEXA 2FJUB 3LX9A 5C55A 4MY1A 3WMSA 1PZ3A 1WE5A 2DZSA 4YTTA 4GG9A 5BRQA 1C90A 3EPOA 1YPFA 3VZZA 2OGYA 2D3LA 3ALFA 4IJCA 1VRXA 3HGSA 1JYXA 1M3UA 2OLAA 3GC4A 1JRCA 2J13A 3DENA 3W7KA 1DEDA 2ZZ7A 1IGWA 3K8KA 4HHMA 1JZ5A 2PDPA 5FEWA 3BQ5A 3FW6A 4K37A 2X0YA 1E6RA 4URIA 2E0PA 1FCQA 2QCDB 2V0TA 4UCGA 1IEQA 3UP8A 2NVAA 1YNQA 4EPDC 2JBMA 4MDOA 3WQFA 3NIYA 3E9AA 4D6HA 4NVTA 3M0KA 2FGBA 3PZQA 1PSCA 3I6RA 4MKSA 3VIIA 4DXKA 3ARRA 3GIQA 1SSDA 1IT8A 1W1B1 1V77A 4GLEA 5DX7A 1E1CB 4ZTXA 1JPIA 5LHEA 3APYA 1IIHA 5K4ZA 1ONRA 4AG0A 2AOSA 4I5RA 2HEJA 3RN6A 4NHVA 3DHUA 3MY9A 3HV8A 1VBUA 2PPGA 1S3TC 2W61A 3BE7A 5CXPA 2ZUWA 1GOMA 2PRHA 2ISVA 4ZFCA 4XD3A 4UTTC 2G4FA 4IQJA 3UPBA 4GY0A 4Z2JA 1RPKA 5IFPA 1N82A 4XX6A 1RK6A 2I56A 2RDWA 3LPGA 1QVBA 2NX1A 3NVTA 4NG3A 1BRLA 1VP5A 2ISDA 2QAFA 1FWCC 3OOQA 4CD4A 3M5XA 7PTDA 2A3HA 5ABHA 3AXMA 3N29A 4J28A 1OFRA 3MI6A 2YYUA 5H8PA 3WBYA 1C3FA 3IJ9A 4DF1A 3DI0A 4Q4PA 4KF1A 3M43A 3N2BA 1OB0A 4EKJA 3T55A 3W84A 3P82A 2UY2A 1XLCA 4LVGA 3WLJA 4UFHA 5AZ1A 1TX2A 1P7TB 3W23A 2D0GA 4DBSA 1E15A 1ADSA 4XZBA 2WMJA 3W85A 3AYSA 2PCQA 3LCIA 1NFBA 2OJPA 4N9EA 2DSUA 2DZBA 6CGTA 3PSWA 3C2RA 4IQLA 2C91A 4JTTA 3USZA 2A3LA 1XDLA 4Y9OA 8A3HA 2PBOA 1XP3A 3NPUA 2OYMA 3QYSA 4DM2A 1XBVA 3VGDA 2VEKA 4WY0A 4QTGA 1PKYA 1EJ7L 3CB3A 2PGRA 1FTXA 3F7JA 1MEIA 1ODUA 1H60A 1OEPA 3L4XA 3T8LA 3VIHA 1NELA 1X39A 4FLQA 3T4CA 4DJDC 2J9YA 2PZNA 3A64A 1VH7A 5D9PA 5K3VA 2VX7A 3W27A 4N4QA 3M0VA 3WNLA 2CLIA 1QW7A 4AWTA 3CLWA 1E3ZA 1TV7A 3R0DA 2ICSA 3F2DA 3UWYA 2PTZA 1S2WA 1R2RA 4L4MA 5K4XA 3C5QA 2WLYA 4QDPA 2VC6A 2XIJA 2OZ0A 3ITXA 4HNOA 3WK3A 3LGGA 4G9PA 5MHBA 1UUOA 4JTGA 4WJ8A 1W1YA 3CEPA 1CCWB 4UFMA 5FF0A 4A35A 3OLIA 4IXHA 3ITTA 3WLHA 2HISA 2MNRA 1HO1A 5CPOA 2XU2A 4ZSTA 1NWSA 4IISA 2R1MA 3HPSA 1MXDA 4MB3A 1FVPA 4O1DA 1MDRA 2J47A 2NVCA 4AHPA 3DX5A 3SCOA 4E2BA 3DAQA 3SADA 3SEPA 4HK5A 4EOUA 1OFOA 1FHVA 4EPBC 5BOFA 3K4AA 4GKTA 4JL1A 4DUOA 4W9TA 3LOTA 3F2BA 2NQJA 2DORA 2BGSA 1TIWA 5G1MA 3VAVA 2Y8KA 3AUOA 3UG5A 4KCUA 1HX0A 4LYRA 3CV7A 3T0TA 2Q6ZA 3RR1A 4LC8A 2RJHA 2XH0A 4U5KA 3AHTA 4S2CA 6ALDA 3LZ3A 3GVVA 3PG8A 3MZNA 4NT0A 1H1ZA 3EAUA 2VGFA 1H7OA 2EAWA 4K1WA 2BOGX 3IJLA 2RUSA 4L1XA 5D2XA 1V6YA 4MOZA 4J3WA 1JFHA 3GB6A 2Y85A 2DT0A 2YFOA 1LCOA 4CCCA 2Q01A 1QPQA 3O07A 2GSJA 4KRUA 1E5NA 5D9MA 3TLQA 3GBEA 2Q71A 3GG0A 2DZUA 2V82A 1HJQA 1TWSA 3AQUA 4FNQA 2Z6IA 3H2NA 2WAGA 5CH9A 4GO9A 5BOEA 2XISA 3N2TA 1DE6A 4ZB2A 4XSLA 3W73A 2CLEA 3FFSA 1QK0A 4B4HA 5CPSA 3GRIA 3L4YA 3LHVA 5FOOA 3TMLA 3UWZA 3FNDA 3W22A 1VFHA 3CTTA 3N2XA 2A5HA 4F0RA 1SR9A 3G6MA 4KS0A 1XLMA 1R3VA 1ME7A 1H7XA 3VMOA 3GNRA 2O4QA 3CPUA 4WZHA 2DH2A 2YCIX 3THCA 4PUKA 1XI3A 2FKPA 4DJFD 4DJDD 3U6WA 3URNA 3QZ6A 2WVSA 2F6XA 1OK6A 5JH1A 3GX9A 3QBUA 3DC0A 1M5WA 1W5NA 2X1UA 3FDGA 3R43A 5DRCA 1VFTA 3WEOA 3SRKA 4H6EA 2HBVA 4UFKA 1FUYA 3IANA 3N4EA 3UQNA 3MMWA 2W79A 3N2CA 4MYXA 4AH7A 2GGIA 2YXGA 1PPIA 3MZ2A 1IEWA 4WDTA 1NARA 5C0QA 3TQKA 3LRMA 3ZM8A 3V16A 5HJXA 3TCEA 1O5XA 2DUXA 3APTA 2WC3A 4W86A 2WW5A 4KWSA 6XIAA 3PR2A 2IPGA 4Z17A 3SIMA 1MO0A 2XSBA 2ZWYA 2D2JA 4UTMA 2QF7A 4ORIA 1E6ZA 1KXQA 1DWIM 1JQXA 1LWJA 4B92A 3PUEA 3AJ7A 3QGVA 3AYRA 4HJWA 1GKPA 1QXLA 1R0MA 3KP1A 3EB3A 3B8DA 1KCKA 2PDNA 5H91A 1WCGA 6REQA 2WZHA 2QCFA 1TB3A 2DJXA 2QCCA 2ZQ0A 5AHNA 4D8LA 2I16A 3TTSA 2CETA 4JL2A 4HIBA 4ZO8A 5HMSA 2X05A 5TNVA 1K8XA 1ICQA 3IPWA 3NOYA 4HK6A 3CMJA 4ZQMA 3NDOA 1OBAA 1PTAA 2JGQA 3WL1A 3KCJA 4PBEA 4UFIA 2Y1HA 1H0GA 3NQBA 3B8IA 2PD5A 4F0SA 1E6QM 1WPCA 4L64A 4DNHA 2PDCA 4IJRA 5I5RA 1E43A 3WD0A 3GDTA 1T8XA 3TAKA 1NOFA 8RUCA 5FF7A 4OFCA 4IXXA 1KFCA 3R89A 2J8TA 4ZFMA 3H55A 4JBRA 4TQTA 3QKEA 2JIWA 3M41A 3HOJA 3U3HA 2IS7A 1P6BA 4HTBA 4YCPA 1OX4A 1X7FA 3PVFA 3IEBA 3WJWA 2J7CA 1RVGA 3GUWA 1GQNA 3LLDA 1SO5A 1VFMA 3GSMA 4L7ZA 1SJDA 3M6YA 2Z7KA 2WZTA 4B4FA 1V6WA 1HJXA 4O13A 5D2WA 1ZENA 2ZX7A 3C2FA 5GPRA 4UNIA 3ZR5A 2QHAA 2QIIA 4C6DA 4MMWA 1RP9A 3W02A 1EP3A 4C60A 2Z4GA 5A69A 3WDHA 1XISA 4G7EA 1C8VA 4PRRA 3LD5A 1TZZA 1SJBA 2HE8A 3ZLFA 3NQVA 3H4WA 1F6KA 3WH5A 2VFEA 1CEOA 3AWNA 4DNMA 2IKJA 3UG8A 2FVKA 4PUWA 4HKPA 2WKLA 2ZYFA 3W6YA 5C8BB 4JICA 2CHNA 1E4IA 2EQDA 4UWMA 5C9ZA 1HKKA 5F1VA 2VR4A 1ZJBA 3FIGA 1SR0A 3UJEA 3XIMA 1Z42A 1RQHA 2Y8UA 1BD0A 5CAHA 2I9EA 4QAWA 5JQ9A 4O15A 3ARSA 2D23A 3LLFA 1G0CA 1RV8A 3UG3A 2GOUA 3M1ZA 1KXTA 3TUUA 3DFSA 1KM5A 3NGFA 4KFOA 1Z89A 1PIGA 2Y5JA 2YB4A 1DJWA 2HVMA 2OSYA 3QV8A 5IHSA 4GIRA 1EPXA 4JFTA 2VCBA 1UZDA 3W25A 4QLLA 1JFXA 1LG1A 3FGCB 1LQ0A 1XYLA 3C0QA 4PUUA 5EL1A 3IJ8A 1RHCA 4CU7A 1YDOA 5AC5A 4WDUA 4HD5A 2JF7A 5I03A 4Z1BA 3P93A 3HG5A 1WDDA 3ABQA 3GDMA 2B7NA 1EBHA 3SQSA 4GNVA 1BVZA 1XFCA 4Q4OA 4EF8A 3NPXA 4GFIA 3B0YA 3NYDA 1F4AA 3SSZA 5D38A 4AY1A 2F8QA 5CGMA 5DMNA 2Z2UA 1W2VA 4M6PA 2G3JA 1UH2A 4C6CA 1W1A1 3RCYA 5I2UA 4YMZA 5CSSA 5EYWA 2HK1A 5RUBA 2X30A 1JAEA 4AEEA 1XLLA 2NWSA 4OV4A 5CPMA 1F5ZA 4JTKA 2WKJA 1VQTA 2AKZA 4X61A 2E6YA 1J5TA 1KFLA 4W8LA 1NDWA 2E40A 1CWYA 4ZQOA 3AZSA 3AU6A 3R7MA 1FWFC 5CLWA 1H0IA 3FSTA 8TIMA 3WF0A 1O66A 4AQLA 4M51A 4Q6JA 1RK5A 4IG2B 1UA7A 3PUOA 4WKAA 4D6JA 1JDCA 1JR1A 1A0DA 1F3TA 2ZZ2A 3W75A 1R30A 3N9KA 4FMVA 2WJFA 3UR8A 2AMGA 2QR6A 5LZLA 1RJRA 4JKMA 2XUCA 4Q8WA 3PZUA 3MP4A 3MSYA 1K8CA 4RNIA 3WG6A 4A05A 2QV5A 2J27A 1MUWA 3JRKA 1GJPA 3GTIA 4BI6A 5LNVA 3UT0A 3ARPA 2YL9A 3BAIA 4GYJA 4DJFA 2PDIA 4OZOA 4DJDA 4CCZA 3MI3A 2VCAA 3AROA 4DUVA 4HNUA 1F7BA 3AHXA 4QS5A 1M03A 3CMGA 1V3KA 4GX8A 5HWJA 1EXPA 1KW1A 4DYKA 2VC9A 2E6AA 1PCWA 4GBUA 1UR2A 4U31A 1IQ8A 4TTGA 4AXNA 3KBVA 3KOXA 4LWWA 3M44A 4FXRA 4XWUA 3UERA 4Y8EA 2CBUA 1PVNA 3TA6A 3V7PA 5FESA 3A5VA 1PIFA 3P60A 1DORA 3H21A 4K39A 3QR1A 4Q4RA 1I1XA 1CB2A 2X40A 2NXHA 2FTYA 4HPGA 3HQPA 4TX6A 3KBNA 1MW2A 1JZ2A 3Q37A 1HF6A 3BPWA 4WOQA 1YDVA 2NLYA 4P8XA 2FMNA 1EF3A 1LWIA 3VDAA 3OIHA 5HOSA 2OQLA 3AS1A 3L67A 3WBWA 2CBVA 3KRSA 1GYLA 3W07A 1VFFA 2XWEA 2AQOA 1I0BA 4DZHA 1EZ2A 4H9VA 1BG4A 4H9ZA 1UWUA 5BMWA 1KFWA 3TR9A 1BVNP 4LW7A 3KRUA 3WDRA 3L2MA 1TJ1A 3CWHA 2R94A 1EGMA 3CZEA 3KEHA 5EKYA 3WYZA 4J3UA 4U10A 4GUFA 3W7LA 5JBDA 3EWWA 3LBCA 3NOEA 3W00A 2DSKA 4GK8A 1FWTA 1T7LA 1W32A 5M3WA 4LS2A 1HZYA 4YPJA 4FOJA 4EXBA 5A6SA 3S6TA 1F8IA 1XLJA 4XIMA 5CC6A 1XHGA 4H7ZA 3L0GA 1MXGA 1JYNA 4JQAA 1SPQA 4QROA 2F38A 1XIBA 2PDKA 3EDKA 2OR2A 2IMRA 2QJGA 4HU0A 1GOIA 3LN3A 2NQ5A 1VEMA 4C5YA 1YQ2A 4XQ6A 2X8RA 1T0OA 2OYLA 4KIEA 1LT8A 5BCAA 1RD6A 3OGRA 2WHJA 3W7DA 5A8GA 1XF0A 1YX1A 5CCZA 3CHCA 1SFJA 3CQJA 3NO1A 2ALDA 1KM2A 3CHFA 3CK5A 1UHVA 1BGGA 3MUXA 1POKA 3KHJA 1X1NA 5FACA 1FWDC 3VNIA 1I6NA 1Y65A 3L7RA 2W9MA 4GUIA 1US3A 3W1LA 4NI3A 1RLCL 1W6TA 5FJOA 2PS2A 5D09A 1UWQA 3E0IA 4XAFA 4WD0A 1J01A 1OADA 1JULA 3M9YA 2FHCA 3PN8A 4JNZA 3IUDA 1NWTA 4DZ5A 3UWEA 4Q7IA 1YXDA 3A3WA 5G4EA 5A8OA 4B91A 3UA4A 1P1MA 4IHCA 1XH1A 1LYXA 3W2KA 4JOMA 4IPIA 2OKOA 4AD3A 4Y2WA 1E0UA 1BYAA 2JIEA 3CIWA 4UMAA 4AZGA 3P0WA 1MZHA 4K68A 1B2YA 5EBAA 4FXFA 3WBEA 1W1IE 4D8AA 3C6CA 1LQ2A 3DBPA 4AZIA 5TF0A 4FIQA 1UR8A 4GQ0A 1US0A 3GFXA 2ZE0A 3GDKA 1ZJHA 3UETA 1R3QA 1TZ9A 1Q85A 1HFBA 3KOZA 2BLEA 3LCGA 5AYXA 1GOXA 3E38A 4YNGA 4O8AA 2OQYA 1B9BA 3MW7A 5KZ6A 4IP4A 4IFKA 3CAKA 2OCZA 4H9MA 4B16A 3MBDA 4DBWA 4Q8UA 3TR2A 1UBSA 1FDYA 3TU9A 1X6LA 1TSIA 4PCFA 3F5KA 5AVHA 1IXQA 3M07A 4JY9A 1GVRA 4NKCA 3AMCA 3QLDA 4QSFA 1CW2A 3NQCA 1LJYA 5TIMA 4E8CA 2Z7GA 1C8YA 5HANA 5E93A 1S2CA 4E0CA 5KITA 3QRHA 2WVUA 3VZYA 4O19A 4QQUA 2B7OA 5HUOA 4UQDA 4IP7A 1BTCA 1R47A 5FJRA 4WRHA 4R9XA 1NQ6A 1DV7A 3GTFA 1LBLA 1QI4A 3LTYA 2DIKA 4C65A 1GOOA 1P5BA 1UCWA 3QXBA 3WJSA 1NH6A 4GNKB 1EYEA 2VL4A 3GM8A 4MYAA 3PPCA 3GR4A 1RJPA 1VHCA 1JPDX 2BOEX 3RLHA 4U5IA 4IUOA 2EPMX 3W7NA 4KGLA 3WLRA 4WUIA 2I1OA 4HOXA 3JU2A 1SFSA 2DIJA 3MC5A 1AH0A 3SN0A 4WSJA 2VCCA 5HDRA 3WFLA 4A2RA 4IL0A 4R7OA 2H8XA 2QGYA 3V36A 4HSOA 2FTWA 4AY8A 3VDBA 5AHIA 4LF1A 4QG6A 3RO6A 1E1CA 3ALGA 1B57A 2FH8A 3NZGA 4QIUA 1CLVA 2PTDA 1ZAHA 3IVTA 5C7HA 4PZVA 3UZ5A 1Q6QA 3C56A 3G1XA 3TNOA 3S1VA 3GUGA 2Q3RA 2P53A 1C91A 5CGTA 1G7VA 1F61A 4DI8A 1DJYA 4WOZA 2IUZA 2V9DA 3VI2A 1H51A 4F40A 1FWHC 4PCPA 3OB8A 2Y61A 2WV8A 2WMIA 2NXGA 3BJTA 1QHOA 4C7DA 4F9DA 3KBSA 3MUCA 3MYOA 4TOQA 3WNMA 4I6KA 4RX0A 5DT7A 3E02A 3S0CA 2J7GA 3CBWA 3QF0A 3AIBA 2I9UA 4UR9A 1HUVA 2XM2A 1J5SA 4YN5A 1FHUA 3BDKA 3QTPA 4QSHA 1ZLPA 1YHTA 3DFYA 1CDGA 3TV8A 1QHZA 3F4VA 4UNLA 1HW6A 3GNDA 3KZPA 7TIMA 3N14A 4LU0A 4D8ZA 3DFPA 3CYJA 3KTCA 5A8QA 2X7WA 4PMYA 3E2VA 5D33A 3EOSA 3NZ1A 2PDJA 3AMKA 2V8ZA 1UP2A 3B4UA 3F1QA 1IF2A 1V0LA 1W1PA 3T07A 1WYIA 4M19A 3CM4A 4F2TA 3UR5A 3BMWA 3NQDA 1ADDA 2QUMA 1MZRA 3BG9A 5JUVA 1XD0A 4QRNA