3AFBA

Crystal structures of catalytic site mutants of active domain 2 of chitinase from pyrococcus furiosus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
300
structure length
300
Chain Sequence
GPNANPIPEHFFAPYIDMSLSVHKPLVEYAKLTGTKYFTLAFILYSSVYNGPAWAGSIPLEKFVDEVRELREIGGEVIIAFGGAVGPYLCQQASTPEQLAEWYIKVIDTYNATYLDFAIEAGIDADKLADALLIVQRERPWVKFSFTLPSDPGIGLAGGYGIIETMAKKGVRVDRVNPMTMDYYWTPSNAENAIKVAENVFRQLKQIYPEKSDEEIWKMIGLTPMIGVNDDKSVFTLEDAQQLVDWAIQHKIGSLAFWSVDRDHPGPTGEVSPLHRGTNDPDWAFSHVFVKFMEAFGYTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus- the role of conserved residues in the active site
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Putative chitinase
total genus 113
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3afbA00
4FMVA 2ZX9A 4NZCA 4DM2A 1GORA 1B9ZA 4JCLA 3WN6A 1JFXA 3KL3A 1HKKA 4D6IA 1UZ4A 5CGTA 4AIUA 4CVWA 3ZT6A 4M56A 1B2YA 1NWUA 2JEPA 3M7SA 5FOOA 3EDFA 4JFVA 1VFMA 1RP9A 2ZXBA 3AROA 4UQAA 3AFBA 5EBAA 1XD1A 9CGTA 1C3FA 2V5DA 1IV8A 3WNMA 3L4YA 1WZMA 5AY7A 1PIFA 4GXPA 1XD0A 1V0KA 1HJWA 4TVCA 1C93A 5M5DA 4GO9A 1E4NA 1EHAA 1H4PA 4NF7A 1KWGA 3MKKA 3SUVA 4H8HA 5GPRA 4AW7A 3OGVA 1M53A 3OGRA 2AMGA 3O2LA 3PZ9A 3WKZA 3CO4A 5I2UA 2RGLA 3IJ7A 1JZ6A 4AZHA 2O92A 2WLZA 2UWFA 1UR8A 1ZL1A 3OLEA 1J0IA 1XH0A 3WMCA 3NJ3A 4AD0A 2QV4A 3CUGA 2DSUA 5LA2A 5ABFB 3OIHA 3OZOA 4M8UA 4U2YA 4F79A 5FL0A 4EKJA 1DWJM 2VZSA 3SCPA 4AZ6A 4CU8A 2ESCA 1KWKA 4EANA 2G3JA 2J7BA 1ODUA 4MPKA 2CITA 4DWSA 4V2XA 3TP4A 4AIEA 1UWUA 5FL1A 3CTTA 1CEOA 1ESWA 1HJVA 2EEXA 4DWSC 3VD4A 1FFRA 1CXKA 2JALA 4P8XA 1E0WA 3VX0A 3ARSA 1ITCA 2WHKA 4Q7NA 3L4ZA 3NDZA 3F5KA 1W9PA 3B9EA 1XHGA 4CU6A 4Z2IA 1G1YA 1XV8A 4JHOA 1E9LA 1UZ1A 2J7CA 2CHOA 2E9LA 5IFTA 5A2BA 4AEEA 2CBJA 4CGTA 4CN1A 2VJXA 5A8MA 3RM4A 5EFDA 1UH4A 4MTVA 4HMEA 5A6KA 2JF6A 4WK9A 4ATDA 1QW9A 3ECQA 1GPFA 1E15A 1US2A 4P7NA 5CLTA 1Y7VA 3ARYA 3TONA 5A1AA 4W8BA 4W7VA 3QHNA 5ABEA 2CKSA 5HOSA 1NM9A 1BLIA 3AS2A 1QNQA 2VZOA 4MAVA 3BXWA 1R86A 2VVNA 2XPKA 4PCSA 2OYKA 1UUQA 1I1XA 3RILA 1H41A 1B3ZA 1GJUA 2J7DA 5TD4A 3RM8A 1V3JA 2VZVA 2ZXQA 5CSYA 2DH3A 1WCGA 1NP2A 2GDVA 1CBGA 4UQ9A 2CNCA 3ARPA 4HZ6A 1LWHA 2ZUNA 3GXMA 1H0GA 4WLCA 5FKYA 2IUZA 2DT1A 3HN3A 1C8XA 3UG4A 2C8NA 3CZKA 3ZJ8A 3SCQA 2DDXA 3S6TA 1JGIA 4AZGA 4EAMA 4R27A 3ZJ6A 1UKTA 3PZGA 1EQCA 2VCAA 3AIUA 3GH7A 3ZJ7A 1G01A 1OCQA 2WB5A 1XGZA 2WMGA 1V02E 1PPIA 3OLDA 2O9OA 3WENA 1FHDA 4GPNA 2YL8A 2GUYA 2BXZA 2E9BA 3AICA 4H8UA 3AYSA 1HKIA 2OYMA 5BRPA 3WH8A 1JZ3A 1WKYA 3IAPA 2W92A 4D6JA 1WDPA 2JIWA 1W3LA 4ZEPA 2CIPA 2X0HA 3RDKA 1KXVA 1R7OA 4TX8A 1KR0A 3VGGA 3GNOA 4W93A 3UR7A 1VF8A 1EO5A 1HP4A 2WMJA 1J10A 1SFSA 4W7UA 1ISZA 2PB1A 1V6YA 1UH3A 1TVPA 4HZ8A 1MW1A 1UHVA 2UY3A 1CECA 3WUGA 4UFKA 2XGIA 2DQXA 3VO0A 4C7GA 3WMBA 1JYWA 4HZ7A 5JIWA 1UYQA 3VILA 2ZOXA 2ZE0A 5A2AA 5I6SA 3ZR6A 3BMVA 4UFIA 2W61A 2Y2WA 1JAKA 2GSJA 5A6SA 3DYPA 2VQUA 4AWEA 2G8ZA 1V3HA 4CD6A 4MB1A 1D7FA 1DWAM 3KEHA 1QI5A 2PWFA 3CUFA 4V28A 4GZEA 4WIWA 5E0FA 5E9AA 4QCEA 1NWRA 4B16A 4AZBA 4A4AA 2CBVA 5C71A 2O9TA 3ARXA 1QBBA 4MNLA 1JYVA 1W3JA 1GQIA 2ZXDA 2O9PA 3EDDA 3MANA 3KL0A 4DWSD 2BNJA 4QP0A 4ZE5A 4CD8A 2VX7A 1YQ2A 5E0CA 1XYZA 2Q8XA 1R7AA 3AHVA 1DWIM 1UD5A 3ARTA 3ARRA 4YHGA 3VIKA 1UWRA 2CXGA 4PTWA 3ZQ9A 1GOKA 3F4VA 3CHEA 4FLQA 2Y5EA 4J3UA 3SCOA 1OT1A 2OSXA 4RL3A 1JDAA 2FH8A 3AS1A 1KCKA 2O9RA 1N82A 3FN9A 4KH2A 3MO4A 2XWDA 5A8QA 1US3A 1KQZA 3ALFA 2VCBA 3BMWA 3WD3A 4BS0A 1PX8A 4W8LA 3II1A 1UWSA 1H2JA 1MQQA 3FAXA 2WMHA 2DT3A 3WDRA 5I24A 3VPLA 4N0RA 1QW8A 4BQ3A 4AD2A 1H49A 1J12A 4NI3A 5IDIA 3QHOA 5FIPA 1HJSA 2WVSA 4W84A 3TOPA 2ZXAA 3VGDA 1FH9A 1UR1A 1ISXA 5I3DA 1J0ZA 3AHYA 1U2YA 1VIWA 4E8CA 1W3HA 1RP8A 1UD6A 4XZBA 3VIJA 1C7SA 3LPPA 1E56A 4HU0A 4CCDA 3BC9A 1B3XA 1MW3A 2EO7A 3BAYA 3K1DA 5DO8A 2PWHA 5A8PA 2QPUA 1E1EA 2EPNA 2BVTA 1E3XA 2VNCA 3RJYA 4Y7EA 1LQ0A 3ZSTA 1JF6A 2VZUA 4J7RA 1UQYA 5JBEA 1NWTA 3W6LA 1KQYA 4UZUA 3N13A 5I23A 3MV01 3VD3A 3WNOA 4URIA 1E6QM 1MW0A 4CN4A 1ZBVA 3NIYA 2X09A 3T09A 1SMAA 2G41A 2CKRA 1WB0A 4AZCA 1ECEA 2JF7A 3WNLA 3MU7A 4GI9A 5I0DA 2DSZA 2W91A 3IAQA 1JZ4A 3T2QA 4XUYA 5A6JA 1FFQA 2YDRA 4LYRA 2XWEA 2YA2A 4GZIA 5BXSA 1UR2A 5I79A 5AC5A 2BV9A 1EOKA 5M17A 3QR3A 4DUWA 3WFZA 4CD5A 5BCAA 3L4TA 4JFTA 5IXEA 2BY0A 1JI2A 1O7AA 2VRQA 4OBRA 3U5YA 3WF1A 1KCLA 2EPMX 2XVGA 1MXGA 4JIEA 1D3CA 3QOMA 1QBAA 4X0VA 5BROA 3MUAA 1GHRA 4UOZA 3SCRA 1U33A 3AIQA 3MMDA 1UWIA 2WCAA 3CGTA 4PSRA 5CPSA 1JG9A 1GHSA 3WH7A 1E55A 1Q6FA 3N11A 1HIZA 2XFRA 1OGSA 1OIFA 2WHMA 1LL6A 4IM4A 4KRUA 2OLHA 3E1F1 4PBGA 2V3DA 3MUY1 2PBOA 1BVNP 4JCMA 1NOUA 3VMOA 4QDMA 2WMFA 1MFVA 4M24A 3L2LA 1C8YA 2WVTA 2WXDM 2J4GA 4D1IA 1B90A 4KWUA 4UFMA 1VJZA 3CPUA 1BYCA 4UR9A 1A3HA 1JDDA 2VUYA 4MJ4A 3WDQA 5A6BA 2YA0A 2WMIA 2UY2A 1H5VA 1IT0A 5D8ZA 4LXFA 1CXLA 4LQ1A 1BYBA 1OM0A 3WDIA 1FHLA 3B9AA 2WVVB 1J18A 1F4HA 2EJ1A 1UKOA 3VNZA 1VFUA 4HP5A 1EO7A 4B9ZA 2ZIDA 1TFVA 3CIVA 1VB9A 3DYOA 7CGTA 2EPOA 4D72A 1MXDA 4HA4A 4PMVA 2Y24A 2FH6A 4M29A 4WSJA 3W26A 4CD4A 5ECUA 2WVUA 4CCEA 1MYRA 4BF7A 4M82A 1AQMA 1Q6DA 1IZKA 3VIPA 3WMSA 1CTNA 1LL7A 2FHBA 1UQZA 4TVUA 2OSWA 5DT7A 4TTGA 1G94A 3W28A 1UOKA 4AZ7A 2E9MA 3ZO9A 1CNVA 1KB3A 1H09A 4D71A 2A3EA 3K8MA 3POCA 2DPEA 1TMQA 4J28A 4XB3A 2VR4A 3WDHA 4PYSA 1UA7A 1CGWA 3WFLA 2E0PA 2W62A 1X6LA 3TTYA 4PMXA 3ZSSA 1GOMA 4MAZA 1CGTA 4M80A 1FA2A 5D8WA 2BHZA 3CBWA 3WUFA 2J79A 1NP0A 3CUIA 1K9TA 2JE8A 2BVYA 1V03A 1B3WA 4CN6A 1E4MM 1LG1A 4UQEA 1HKMA 4WSKA 3WQ5A 1R8LA 2VVSA 5KEZA 3DC0A 2VI0A 5A3HA 1W3KA 3WY1A 1ZJBA 1GZJA 3A47A 5ABHA 1UR0A 3DYMA 4JL1A 3SCWA 5I78A 1W91A 3VKKA 3HJEA 4AY1A 1V02A 1EDQA 2PC8A 4PMZA 2XYLA 4H41A 3AZRA 3N17A 3KE0A 1CPUA 4KMQA 3MUZ1 4UCFA 1CGXA 3EMCA 3W27A 3MMUA 3WD0A 1OWQA 2OWWA 2ZUVA 1X1NA 4HOXA 4PMRA 4IPNB 2D23A 3PHAA 5A95A 3T08A 4S3JA 4DUVA 1HKJA 5CXPA 4NRSA 1VBRA 1PBGA 4ACYA 1EDGA 2XGBA 4HTYA 2WM0A 4KRTA 4CCCA 3K8LA 1E6XM 1BQCA 3AHZA 2VURA 3FNDA 2J7HA 1JF5A 2WSKA 3SCSA 2YLAA 1E0XA 1W1VA 4W5UA 3RM9A 3W29A 4RE2A 2ZUUA 4HMCA 1J0KA 4U3AA 1GONA 1RH9A 3ZOAA 5CZKA 3SUUA 2VL4A 2QMJA 3J7HA 3W53A 4PRWA 3U5UA 2D3NA 4KGJA 3N12A 1CXFA 5BXTA 5CQ1A 3UEQA 3GDBA 3U7VA 1QI3A 2WPGA 5EFFA 5HDRA 1UKPA 1PIGA 2OWXA 5DMYA 3PZMA 2FGZA 4U2ZA 4DWSB 3W37A 3VIOA 1V6WA 1KBBA 3SUTA 3ARZA 1JZ5A 3EMQA 4BA0A 1NOWA 3VVGA 3HU7A 2J74A 3POHA 3VM5A 3QGVA 4MNJA 4ZXLA 4CUCA 2PWDA 4NSBA 3B8SA 4PMYA 4PTVA 1RPKA 4MDPA 1PZ2A 2PWEA 3MMWA 2XJ7A 3OLIA 3PTMA 1E72M 1WE5A 2ZUMA 4JFSA 3UCQA 1OGBA 3OB8A 3T0BA 1V6XA 4MNKA 2WZHA 1MW2A 1B1YA 1V08A 2CESA 1JYXA 3OBAA 3L4WA 3AXHA 3GH4A 2E3ZA 1CYGA 1CXEA 2WAGA 3VD9A 1O6IA 3PZOA 1HNYA 3ZMRA 5FD0A 1BTCA 1HXJA 2C7FA 3WF2A 3ZIZA 4K68A 4LYPA 1EH9A 1W9BM 1J0HA 1JNEA 2AOSA 4CKQA 6TAAA 3AJ7A 3PZIA 3WEMA 3O9NA 2WHJA 1MQPA 3OLGA 2WMIB 1OGGA 1HJXA 4OJYA 2E4TA 1E71M 3BSHA 2D2OA 4H2CA 1B3YA 3UR8A 2A3AA 4Q22A 2F2HA 3VIFA 1J0YA 3VNYA 2CPUA 2NW0A 3VOCA 4OOUA 1FP8A 4AD1A 2G3NA 2W67A 3WQ8A 1QVBA 5AC4A 1BHGA 3WDJA 1GNXA 2PBGA 3ARWA 1QI0A 2YIHA 2IXVA 1TR1A 3T2PA 1ZBCA 3G6LA 3GNRA 4QAWA 4W5ZA 2VZTA 2E40A 3WBAA 4D6HA 4HU8A 1KXQA 3THCA 5CPTA 2VOTA 2HVMA 1HJUA 1E6ZA 1TUXA 1JD7A 2XVPA 3W25A 4AD4A 5D9PA 3F5JA 3VGFA 1AQ0A 3ARUA 2ZUWA 1PEZA 4HOZA 5A6LA 5IHSA 3ZT5A 5A8NA 2WC4A 4MADA 4ZENA 3CHCA 2W66A 4H8VA 4AD5A 2YL9A 5A6AA 2YL6A 4B15A 2A3HA 4W89A 5EMYA 1I75A 3VGBA 3PZTA 3QOKA 4FLRA 3AMCA 1VEPA 2UY4A 4UFHA 2X2YA 4GKLA 3UG3A 1HL8A 3NDYA 5E09A 2YOCA 4Z2JA 4J3SA 3NUKA 2ZUSA 3AS3A 1W32A 5M3WA 1XSJA 2WCGA 4AYSA 1M03A 1WZAA 3WQ4A 2WANA 2A3BA 1OBAA 1OINA 1PX4A 3WELA 4TVDA 4AEFA 1V0NA 3GM8A 1GOWA 1QNOA 2J8GA 3AZTA 1WO2A 2DSKA 7A3HA 1P6WA 5D4YA 3T0DA 4HPHA 2WKLA 4OOZA 4Z2LA 1OSEA 4D6DA 1FOBA 2VX5A 4HA3A 2OYLA 5CJ5A 2QMKA 1XCXA 1ZJAA 2G3MA 1SR0A 4KGLA 3OA5A 2VX6A 4GI6A 1KXHA 2WHLA 3SCNA 1UWQA 4C7DA 4GINA 3BAIA 4A3HA 4EE9A 1W2VA 3D3AA 1BSIA 1J0JA 3I3BA 1V6UA 1WDQA 4IISA 5DF0A 3VU2A 2YKKA 2B31A 2W63A 3AHXA 4PMNA 1K9DA 3PBGA 4UQCA 3RCNA 3WSUA 3WF4A 4D6CA 3AXIA 4PUDA 2PWGA 4E4PA 2EXOA 4HA1A 5A8OA 2GJRA 2ZUTA 1GOQA 3CH9A 3W38A 2EPLX 3LPOA 1EOMA 1W1YA 3LMYA 1WZKA 5IFPA 4M1RA 2UY5A 4PUEA 4QLKA 4OZOA 2FGLA 1KFWA 4PSPA 2FHCA 1JXKA 4GQRA 1B0IA 3L4VA 1KGWA 3PZVA 3W24A 1VAHA 3PTQA 4AD3A 5DEZA 4FK9A 3GBEA 3WIJA 4DM1A 2XTKA 3CMGA 2OWCA 1VEMA 2DGAA 3W81A 5D9OA 3BAWA 2XM1A 3GXDA 5BRQA 4F9DA 4W85A 3FAWA 1CLVA 4UQBA 2XFYA 3S2CA 1ZS2A 2WLYA 2BXYA 2GDUA 4AZIA 3AMGA 2VTFA 2VQTA 4UTFA 2CBIA 1ZB5A 2ZWYA 3EYPA 4AXNA 1ISVA 1E6SM 2XVNA 1QNSA 2D0HA 2PI6A 2VT0A 3MSDA 1EDTA 3N18A 3U7BA 2XG9A 1BAGA 1FP9A 3UETA 1NARA 2JIEA 7TAAA 1GOIA 1MFUA 2WYSA 3ZR5A 1K9EA 2J7FA 1QI2A 4X0NA 3AIBA 3RIKA 5CG0A 1U30A 1VFOA 1ZBWA 1R85A 2F61A 1E6PA 3EDJA 3AZSA 4P7OA 1WAWA 3WNKA 3KWXA 3N04A 1VENA 1BG9A 3VTRA 1ITXA 3VMNA 4P7RA 4U3CA 4LYQA 1IZJA 3BAKA 2DEPA 1CGYA 4V27A 2J7EA 1G9HA 4E8DA 2WNWA 4GIAA 3W6MA 1E5JA 4X9YA 4HOWA 4U5IA 1HX0A 1DTUA 2V3GA 1JXJA 4ML4A 4JFWA 2ZWZA 5GQBA 1JFHA 2CBUA 4LX4A 3CZJA 2G4FA 1K6AA 4HPGA 1PAMA 4UFJA 5GNYA 2J8FA 4WJXA 4F9JA 4XX6A 2XSAA 3GXIA 5IHRA 3F5LA 4OBSA 3EMZA 1KXTA 1MQRA 2X8RA 4Z2KA 1BGAA 2CCRA 2QLYA 3CLWA 3VX1A 4ATWA 1V3MA 3BCDA 4FF5A 4IPLA 5EB8A 2BY3A 3AS0A 3NCOA 5C70A 4CVUA 3AMKA 1LLOA 3APGA 2EPKX 3NSNA 3M07A 2BVDA 2E8ZA 1R87A 1JIBA 4MDOA 5JBDA 1V0LA 1HP5A 1VFFA 2XVLA 1BYAA 4DUXA 2WKGA 3A3HA 1CDGA 4ZE4A 4W86A 3VD7A 3VDBA 2J25A 1DWFM 4CD7A 4D1JA 5CLWA 2WC3A 4R5EA 5LA1A 2CERA 4WKAA 5CPQA 3SEPA 3VINA 2GJXA 1MWOA 1EQPA 3GXFA 2NT0A 2HISA 4FLSA 5A6MA 1UA3A 1A47A 2GJXB 2V3EA 2ZX5A 3PN8A 3SIMA 3ZJKA 1GCYA 1CGVA 1GW1A 1KGUA 1XH1A 1PJ9A 3VDHA 3BH4A 4E2OA 1JZ2A 4BCEA 4GZJA 3DHPA 3PTKA 1QHZA 2XIIA 3IK2A 4OUEA 2J47A 1CWYA 4LGXA 3RJXA 4LPCA 1V3IA 1DEDA 1NQ6A 2BFGA 1PX3A 3WNNA 3DECA 1ZU8A 2WBKA 1W1PA 5A94A 1GUVA 3AOFA 2GVYA 2J78A 5E6ZA 1HN1A 4P8WA 3MUIA 2F8QA 1GOOA 4GQQA 4YHEA 4MB5A 4RE3A 4PTMA 2WZIA 2OSYA 3I3EA 4AZ5A 2X0YA 5I77A 4JHZA 1CENA 2NT1A 1XSKA 3U57A 1V6VA 3BSGA 4U31A 2A3CA 3FXYA 5CGMA 1M04A 1QNRA 1X6NA 1CIUA 4XZWA 2V38A 1UH2A 5HXMA 4J3VA 1H1NA 2YLLA 3AISA 1WZLA 2DIJA 4WKFA 1FH7A 4TOQA 2Y8VA 4A3YA 1Q4NX 3KL5A 5A2CA 3VIIA 3VDCA 3RPMA 5A6BD 4Z2GA 1BVZA 3FHAA 1MVYA 3VMPA 3AMLA 4PMUA 3CMJA 1UR4A 2D3LA 2EBNA 3BLPX 4QFUA 1E40A 2YA1A 2DSWA 1V3LA 4W87A 3EDKA 4WKHA 1UKSA 1TZ7A 1HVXA 4B3LA 2YJQA 4BQ5A 2PF0A 2V5CA 3IJ8A 2XVKA 1TE1A 3SUSA 4IUGA 3TA9A 5AYBA 3WUEA 1CXHA 1OT2A 1W9UA 1ODZA 2XSBA 4L4PA 1GVYA 2CEQA 2D0GA 4UZSA 3ALGA 3ARVA 5LYRA 4GI8A 1WP6A 4XV0A 3AIEA 3BGAA 1JZ8A 1V0MA 5BXPA 1UR9A 4D6FA 3G6MA 3W82A 4JFUA 4JKKA 2WSPA 1H11A 4UNIA 2ZX8A 5BYWA 3UG5A 1M7XA 3CZLA 3L2MA 2VX4A 1LL4A 1OIMA 5A69A 3KZSA 2D20A 4JL2A 2YDQA 3CZGA 1DHKA 3W4RA 1SYTA 1GVIA 1H0IA 1K9FA 4F8XA 3FW6A 1EA9C 2E8YA 2MANA 1KR1A 5KZ6A 4NRRA 3B9DA 3VIMA 3A6OA 1F4AA 1LG2A 3SURA 2BHYA 2VMFA 1RD6A 4PMQA 1HL9A 3OG2A 4U5KA 5JBFA 3BLKA 3A4WA 1E5NA 4JAWA 1OD0A 2D1ZA 2VCCA 1Q6EA 2BY1A 2J77A 4TX6A 2Z1KA 4TUFA 2CYGA 4ZFMA 3K4DA 1WDRA 3TTOA 3M46A 3IANA 4CU7A 4YN5A 5HNNA 3MV11 1W2PA 2VR5A 5HPCA 1W9DM 1E4LA 1WNOA 3WH9A 4H04A 3TTQA 3NSMA 3EDEA 3NSXA 1BGGA 5ABFA 3WH6A 4P8UA 2EQDA 2AAAA 2YBTA 3GZAA 4ZXOA 3TTSA 1QHPA 4AC1X 5D9MA 1NH6A 1C8QA 5D9NA 4J27A 1DP0A 1V3KA 1LWJA 1XSIA 3GTNA 4EK7A 1E6RA 1GQJA 1QI4A 1VRXA 2NSXA 2VRKA 1JNDA 3MS8A 1B31A 1JL8A 2GFTA 1JAEA 1JYNA 5BWFA 1C92A 1VJSA 5F7UA 3O6AA 3AIVA 4U33A 3WD4A 4OKDA 2GK1B 3T2OA 4JZ5A 1BFNA 5E70A 2WZEA 5M03A 2GK1A 1CLXA 3K8KA 3LPGA 3CHFA 4L4OA 3WQ6A 4ACZA 1QOXA 4WF7A 1TA3A 1JZ7A 2W5FA 2IXUA 1BYDA 2C0HA 4P8VA 6A3HA 2DSVA 3CZ8A 4TXEA 2D24A 5JIPA 4J3TA 2RGMA 4Z2HA 1JDCA 2Y4SA 1J9YA 8A3HA 1B30A 1XH2A 2YBUA 1TVNA 4PMDA 4MB3A 1M01A 1BPLB 3AIRA 3T0AA 1UD4A 4QCFA 2WC7A 1XCWA 3WL1A 4P7LA 1Q6GA 2WWDA 4TTUA 3BAJA 4S3KA 1J11A 3HMCA 5GNZA 1W1TA 1EXPA 5LA0A 4UOQA 5HPOA 5ABGA 3SUWA 1L8NA 3FHQA 4BQ2A 2WBGA 4W7WA 1HJQA 3VIHA 3VM7A 2XHYA 1H3GA 2YL5A 2JFEX 3AMDA 1E1FA 2XM2A 2J7GA 3AIWA 4MNMA 4D6GA 4UFLA 5JUVA 4M81A 2FHFA 4UOJA 1AQHA 3VD5A 3WDPP 3PZNA 1VEOA 3OGSA 3W0KA 5I5RA 1JD9A 1HF6A 2VC9A 3WL0A 3PZQA 2CETA 1E6NA 1NOFA 2CHNA 4P7QA 2XUCA 3JUGA 3MSGA 4AZCB 3I3DA 3GBDA 3AHTA 1WPCA 3PZUA 1E73M 2WWCA 1JI1A 2TAAA 1QHOA 1UD3A 1OD8A 3N1AA 3A4XA 2WCSA 5AYIA 1UD2A 4N42A 4QLLA 1XRVA 3WQVA 1C91A 1W9VA 2X05A 2ZX7A 4BZYA 3FY1A 3ZM8A 4B3KA 2QF8A 3VGHA 1EGZA 4UQDA 1BG4A 4B9YA 4PCTA 4PTXA 4YPJA 4HMDA 4JKMA 2D22A 4JKLA 5C8BB 1AMYA 4J3XA 5FCZA 2VRJA 3GYCA 1LF1A 1CXIA 2BY2A 3K46A 4QLJA 3GNPA 8CGTA 2DT0A 1UG6A 4GO8A 1UWTA 2DT2A 1CGUA 3L4UA 1E43A 3VIGA 1BF2A 3N15A 4PMOA 4RE4A 1E3ZA 4AISA 1QNPA 1Q6CA 2BS9A 3WQWA 3AI0A 3WNPA 3WF3A 1AVAA 1UKQA 2D0FA 1KBKA 1E70M 3VUPA 3SCUA 3WEOA 3WUBA 1OB0A 3CHDA 4H7VA 3SCTA 2WW5A 1C90A 3BAXA 3NYDA 4PN2A 3AQUA 1CZ1A 1GQKA 3K4AA 3UESA 3GH5A 6CGTA 3WF0A 1QPKA 2WMKA 1B3VA 2G3IA 2FDMA 2Z1SA 2WVVA 5BXRA 3WBEA 3M6DA 1TCMA 1D2KA 3RO8A 1G0CA 1LJYA 4MB4A 2ZX6A 4BQ4A 1VBUA 4W8AA 1HT6A 2BHUA 1G5AA 5CSUA 2QHAA 2Y8KA 1S46A 4W88A 3WD1A 1ISWA 2J75A 3WEZA 3N9KA 5DT5A 4FLOA 1SMDA 2XIBA 3WH5A 1UD8A 3OZPA 1GQLA 3AXXA 1EHNA 1Z32X 3ZT7A 4OIFA 3L4XA 2XFFA 1DWGM 1E0VA 2QPSA 1ISYA 1PZ3A 4PEEA 2X1IA 3IJ9A 1HVQA 1GJWA 5GNXA 2WK2A 2V3FA 2DIEA 3QHMA 2ZICA 1EIBA 3UERA 4ATLA 3A4AA 1KGXA 3EBVA 3WD2A 2JEQA 1W9XA 1ZBKA 4D6EA 5E6YA 1I1WA 5HBFA 3CZEA 4F66A 1NWSA 3AYRA 1XYFA 2DH2A 3VGEA 4AMCA 4AIOA 3BCFA 3THDA 2J62A 3ARQA 2W4XA 3CUJA 3LPFA 1E4IA 1WDSA 4ACZB 2YDSA 1FH8A 1DWHM 1YHTA 1C7TA 3DHUA 2GJPA 1TA3B 5DFAA 1TG7A 4C7FA 2VO5A 3CUHA 4J3WA 4MJ2A 3SCVA 3VDAA 1L0PA 3RMEA 1J01A 3D5HA 1XC6A
chains in the Genus database with same CATH superfamily
4FMVA 2ZX9A 3HG5A 1GORA 1KV5A 3KL3A 4K38A 4D6IA 3GXTA 4ZBCA 4AIUA 4CVWA 1WXZA 4FS9A 3EX4A 4JFVA 2IQTA 1RP9A 1UP2A 2YZ5A 2OT1A 2FVKA 2UV8G 3WNMA 3H2CA 5AY7A 4GXPA 1XD0A 1V0KA 1FTXA 1C93A 1QMLA 1KWGA 3MKKA 3SUVA 3WLTA 5E9XA 4H8HA 4AW7A 2FVMA 1M53A 2AMGA 3OGRA 3O2LA 4JPGA 3DENA 3LDVA 2RGLA 3IJ7A 3SFKA 1KM4A 4I7UA 4AZHA 2O92A 1RCQA 1T6MA 3OLEA 4YYCA 5DN1A 1XH0A 5BWAA 1AW1A 1U22A 5BOEA 4WD0A 5LA2A 2KX9A 1W5MA 3SSJA 3APYA 5ABFB 3WYZA 3SQSA 4RUBA 1H7WA 3OJGA 4N6EA 4M8UA 4U2YA 4XD5A 4F79A 1DWJM 5HUOA 1NDVA 4UMBA 4CU8A 2ESCA 4EANA 3TWBA 1ODUA 3C3UA 4NXKA 3LM3A 2CITA 4DWSA 4IMCA 3GHSA 3H2AA 1UWUA 1IWBA 1ESWA 3HQOA 1HJVA 2BTMA 3M0JA 1CXKA 2JALA 2E6YA 4CNOA 1BF6A 3ARSA 1EPXA 2WHKA 4PE8A 4LJ3A 5LHEA 1A5CA 3NDZA 3W1UA 3F5KA 1D7KA 3UZZA 2XFWA 3LI0A 1XWYA 1MEIA 4JHOA 1E9LA 1MNZA 2CHOA 2QGHA 2QIWA 3S83A 4JTAA 4L1WA 1ZZMA 3WZ0E 4IWWA 1RAKA 4Y6GA 4MWAE 3MCMA 4P2VA 4KPLA 4Q6XA 4HMEA 2WZMA 1XGDA 3N34A 1QW9A 1XDMA 1H61A 4X60A 4B4HA 3R12A 3I68A 4P7NA 4WOQA 3E2RA 2E68A 4H6EA 4BY3A 3AU6A 2PGFA 3N6QA 4B5NA 1DIDA 3O1NA 5CH9A 4JTLA 4ZOBA 5HWMA 3AS2A 3S2MA 3QSTA 1UUQA 1I1XA 2NV2A 5C5YA 1B3ZA 2OFJA 3FK4A 2C15A 3URQA 3DHFA 4XIAA 4YL2A 3W7RA 2ZXQA 4WEVX 4LOCA 1WCGA 4UR8A 1CBGA 1GYLA 4UQ9A 1AJ2A 3QPYA 1C8XA 3UG4A 3ZJ8A 5PTDA 3NL3A 1XIGA 4EAMA 2WOQA 2PGRA 2VCAA 3HTWA 1M6JA 3E12A 3ZJ7A 1G01A 1OCQA 1XGZA 2HQAA 3QY6A 1KM3A 1I8JA 3BLFA 3W1NA 2R8WA 4HK6A 3E5PA 4FP1A 1U1UA 5AHLA 1TWSA 4DWDA 3WH8A 3ITXA 1WKYA 3IAPA 3MA8A 4D6JA 2HPMA 3BCJA 3GC2A 4LCRA 4GVIA 2W0UA 3NZRA 2X0HA 2TYSA 3UCDA 3NZGA 1JVNA 1R7OA 1KR0A 3S9ZA 3VGGA 3GNOA 4XTDA 3T40A 1EO5A 4L9ZA 1A4MA 3ITCA 1J10A 2WQPA 4W7UA 1ZHAA 1UCWA 4DELA 1UH3A 1H51A 1UHVA 3QLLA 1WXYA 2UY3A 2V5BA 2ISDA 1O5XA 4A8RA 3H54A 5LXXA 2FB3A 1JYWA 4HZ7A 3V7PA 1UWAA 3LV5A 1Q45A 3QXBA 3KHJA 3VKAA 5A2AA 2DV0A 4JX4A 5I6SA 3SSZA 2W61A 1XIIA 4C1NB 3G3MA 2FJKA 4CQ8A 1V3HA 1W56A 2VXNA 4YS1A 2QAFA 1D7FA 1DWAM 4JN8A 3RU6A 1W3TA 4D2JA 4N9DA 4I9MA 4I5UA 4J3ZA 1NWRA 2EKGA 5JXQA 1Q5MA 1G4SA 1EF2A 4DI9A 3TE9A 2OGYA 4A4AA 4X3ZA 1TPH1 3T6CA 2XIOA 4LUTB 1GQIA 1DV7A 3LD5A 2ZXDA 2Y8UA 3MANA 3NR0A 2ZQ0A 2EJAA 3M5XA 1SPQA 3VXGA 3FEQA 3AHVA 1UD5A 4YHGA 3GIYA 3VIKA 1GOXA 3V1PA 4DQWA 3PBMA 1GOKA 3F4VA 1CX9A 3W3OA 2EGZA 4JTSA 3WLLA 3HGJA 4FLQA 3XINA 1OT1A 4RW5A 2FH8A 4AH7A 3WLOA 3AS1A 4FNPA 2O9RA 3FYYA 3MW7A 1ECQA 1US3A 1FXQA 2V63A 4ASTA 3WD3A 4DYJA 2UBPC 4Q3MA 3II1A 1SW3A 1H2JA 1ML1A 2WMHA 2DT3A 3KX6A 4O16A 1T8QA 3L2IA 3LLFA 2P8BA 1SFTA 2QYGA 3ES8A 3NZPA 4PGLA 3MYPA 3NXLA 1J12A 4MPQA 4QAIA 4WVXA 1HJSA 4J2MA 3WJZA 3VGDA 5I3DA 1J0ZA 2IKJA 4DBUA 1AD1A 4CQAA 3LNMA 1UD6A 4XZBA 4IG2B 2I1OA 4CCDA 1B3XA 3MJMA 2EO7A 3TYCA 2BLEA 5E1QA 2VGGA 2BGQA 2Q02A 3BV4A 2VNCA 3RJYA 3B8TA 3E2SA 2HK1A 1V6TA 2VZUA 4ZO9A 3UVAA 1UQYA 1Z44A 1FCUA 2Y62A 1AL8A 3B9NA 4GISA 1OFDA 1RY0A 2PTZA 5I23A 2W9MA 4JTDA 3WNOA 4CN4A 1MW0A 1JPKA 2C14A 1VBGA 2G41A 4GVFA 5CZSA 2NQLA 4LVAA 3UXLA 3WNLA 3TQVA 1GEQA 1JCYA 4XAYA 1EGVA 2W91A 1RA5A 3S1UA 1LT7A 3R6IA 3U8GA 2YA2A 5BXSA 1UR2A 4HBKA 4FNQA 5AC5A 2OT0A 4O8RA 1XBYA 1HO4A 1EOKA 2JKEA 5M17A 1WDWA 4JFTA 4WOZA 5ECVA 1XINA 3VCCA 4QBXA 3EGJA 1JCMP 3AIQA 3MMDA 2QUUA 5G2IA 2WNNA 1AZ2A 3LCIA 5CPSA 7ENLA 4LS0A 3C2YA 4PZVA 3P5YA 1HIZA 1TPUA 3HG4A 2WHMA 1LL6A 4MFEA 4KRUA 4ZB2A 3AWOA 4GJJA 4QDMA 4KFNA 2AQWA 3RG6A 1MNSA 4IX2A 1C8YA 2DVUA 2J4GA 4D1IA 4DBDA 1XYMA 4CCZA 4UR9A 3WDQA 4ZFCA 2YA0A 1FWEC 3TV8A 2WMIA 4QS6A 2AL2A 1IT0A 2YZRA 3B9OA 4LRSA 1BYBA 1OM0A 4JTTA 8TIMA 1FHLA 3B8UA 1GZ1A 5FJRA 3OYXA 5HR7A 1EO7A 4HK5A 2V6AA 2DIKA 1VB9A 3IIOA 5FEPA 4HNVA 1YDYA 2Y24A 4M29A 4I9TA 5G1TA 5FJPA 4O53A 4CCEA 2FPYA 3GXPA 4M82A 3GSMA 3W6YA 2QVNA 1PO9A 1Q6DA 3SB0A 4REQB 3VIPA 4HSOA 2VFFA 1CTNA 1UQZA 3VFLA 2OSWA 2WJEA 3IWPA 5K9DA 2HK0A 3SM0A 4HU3A 3BV7A 4E38A 5B7ZA 4D71A 3K8MA 3VAVA 1VKFA 1TMQA 3ATYA 4XB3A 3BG5A 3RN6A 3P81A 1QATA 4JDBA 3TTYA 4PMXA 3T7VA 1LCOA 3QMRA 4M80A 5LIXX 1TWDA 1SFLA 2IMRA 4KFPA 3ZVIA 3OA3A 2JE8A 2BVYA 4KFOA 1HKMA 2FJUB 4B92A 1DOSA 1R8LA 1SFJA 3RGTA 3PSVA 1W3KA 1XYLA 3F4CA 2NWSA 1UR0A 4D8ZA 3VKKA 3RFAA 1V8EA 4AY1A 3BO9A 3DFTA 4PMZA 3PP7A 3HQPA 3N17A 1FX6A 3MUZ1 3QC3A 3MTWA 3EMCA 3WD0A 4S1FA 4O50A 3DC8A 2ZRWA 3UQNA 3EPMA 4PULA 3OU8A 4HOXA 4PMRA 4XQ6A 4IPNB 1LORA 5G4HC 3OVGA 1IEWA 4S3JA 1HKJA 4GZ7A 3S5SA 3DFNA 2G4JA 4XD6A 1MZRA 3A21A 1I2RA 4UTWC 1PUDA 4M6VA 3MWCA 2J27A 2VURA 4F48A 2J7HA 2WSKA 1W0MA 3GK0A 2YLAA 1E0XA 4W5UA 3ZXWA 3EWYA 3XISA 4XO6A 4HMCA 1RH9A 2DVXA 3IEBA 3ELFA 4LUTA 3O0KA 5CZKA 1K4HA 1QOPA 5HJXA 3SJ3A 4KGJA 2ZZ7A 3N12A 1F7BA 3UEQA 4OWGA 3FS2A 3U7VA 4H83A 2Z4GA 4BI7A 5D33A 4QSHA 3UXKA 5EFFA 1XLIA 4ZVJA 2FGZA 4A3UA 2HMCA 3T1GA 1R9XA 1RJRA 4RV3A 2Q01A 5T9BG 1GT8A 1V6WA 1ADOA 4L5ZA 3ARZA 1KBJA 2FZBA 3EMQA 1UP0A 3W7QA 4EPKA 2IS7A 1AW5A 3TX9A 3NGJA 2G97A 1J8VA 4PTVA 1WE5A 2ZUMA 3W01A 1TV5A 1ADSA 5C6MA 4CLMA 4G7EA 2CESA 3EOOA 3L4WA 3L0NA 3M0VA 5LNWA 2YDAA 1O6IA 3PZOA 1OG0A 4U10A 1HXJA 2DVTA 2C7FA 3ZIZA 1YIXA 1OX4B 1L6WA 1Q7MA 1J0HA 3LHUA 4S3FA 4HNCA 2AOSA 3MP3A 6TAAA 2ZZ2A 4IG2A 3RMJA 1RXOB 1SZRA 3DERA 3QZ6A 1R2RA 5CSRA 2WMIB 2E4TA 2PCQA 1E71M 2D2OA 4X9SA 3FDKA 2F2HA 2RJHA 1N8IA 5AZ0A 5D04C 1AMKA 1FP8A 4GIYA 4AD1A 2RKXA 2PWVA 3WQ8A 1ALDA 4ZZ9A 1K7FA 4OBTA 1GNXA 2PBGA 3ARWA 1TSIA 3PULA 2FLIA 4N02A 5DXYA 4W5ZA 2VZTA 3LRMA 3GYEA 5KTLA 3PJUA 5K4XA 5BOOA 4D6HA 4Y8FA 2FZMA 1F8IA 3THCA 1J4EA 1DJIA 4R7JA 3W00A 1AQ0A 3ARUA 2I9UA 1PEZA 3CEUA 5IHSA 2QNEA 2XH0A 3TQPA 3DFSA 4ZENA 3LN3A 1RBAA 3FJ6A 4D9PA 3DCPA 2VFEA 2W66A 1FRBA 4H8VA 4AD5A 4QISA 1PZ0A 2YL9A 5A6AA 1FCQA 2YL6A 1OQFA 4Y9NA 4W89A 3UP8A 1I75A 3AYVA 4GWEA 3RNDA 4UFHA 1WOAA 4GKLA 1HL8A 3HG2A 1D3GA 3NDYA 2ZZ5A 3UU0A 4J3SA 3W2MA 1W17A 2WSRA 4O57A 2X7VA 2O4MA 1PDYA 3IRSA 2JGYA 3HG3A 2CZ5A 9XIAA 1C9DA 4TVDA 2A0NA 4DBEA 4I7WA 2VP8A 4JQAA 2J8GA 6XIAA 1WO2A 3U4FA 4MUZA 3PUDA 7A3HA 1P6WA 4S2CA 5D4YA 4ECLA 4HPHA 1K8CA 2PU1A 2VX5A 4YVVA 1UC4A 2I57A 3NPUA 1XCXA 2J9YA 2G3MA 2VX6A 3HO8A 4DY1A 3EOUA 3Q4DA 2Z7GA 1ZUAX 4RNIA 3AWNA 4C7DA 3BAIA 4A3HA 1IXQA 1YNPA 6TIMA 1W2VA 1Y5XA 3IIXA 1BSIA 4J35A 3SO7A 4HNLA 3R79A 2WV8A 3LHYA 4BEQA 2QXWA 5CAHA 1N2VA 2NQ5A 1K9DA 3RCNA 1VPYA 1DQWA 2P76A 4L56A 5KINA 3EWWA 1NFPA 1Z9AA 2EXOA 2ZA1A 2YGYA 3FIGA 3FOKA 2QCNA 3ABXA 3GVVA 3BDKA 4A3QA 2R94A 2CLPA 5D03A 2I7GA 5IFPA 3W87A 3O16A 4M1RA 1IIHA 2CXEA 4QLKA 3HPAA 4PSPA 4JX5A 4GQRA 4DN1A 2B7QA 2I9EA 2RUSA 3CAVA 3WK2A 3WQOA 1KGWA 4GIEA 4KWOA 4AD3A 4U28A 3WIJA 1YTKA 4DM1A 2VOMA 1OX5A 3KBNA 1FDZA 5E93A 3WJXA 5ABTA 1AH3A 1QPNA 1IZCA 4Y8EA 4UQBA 1ZS2A 2QDEA 3F7JA 1H7OA 2GDUA 4Q4MA 3QW3A 1ZB5A 4HHHA 4GABA 3VKBA 3UY8A 5IDZA 2VEPA 2GSEA 4UTHA 3OYZA 3C52A 4G7EB 3KBMA 4GQBA 3P5ZA 1IWAA 3G24A 3U7BA 1BAGA 7TAAA 1ZRQA 2WYSA 3ZR5A 3MYOA 3BGJA 4IMEA 2OQYA 3LTYA 3AIBA 5D2XA 2Z27A 3AZSA 4P7OA 3KWXA 3N04A 1JCLA 3GLCA 3DEQA 1VD6A 4P7RA 4G9PA 1R3SA 1TV2A 5FF0A 1XBZA 4E8DA 1LM1A 2ALRA 3W6MA 5H1WA 4C6QA 3CIWA 5HQMA 4Q8VA 1UOZA 2AL1A 3VOHA 3EWCA 1F3WA 3IARA 1P0EA 3B8VA 5MF5A 3LMZA 3Q45A 3M6YA 2QW5A 3NQGA 1W5NA 5TAOA 4M0XA 3A12A 4FOUA 4AF0B 3CZJA 4RZ4A 4Q8TA 2R9RA 2Z00A 3QPZA 2PDQA 4NZ4A 4RX0A 4WJXA 2PP1A 4XX6A 2V5JA 1XLDA 3F5LA 4OBSA 1X39A 1MQRA 2XH4A 4Z2KA 2CCRA 2QLYA 4ATWA 3AS0A 5C70A 2EPKX 4M7SA 3F2DA 2BVDA 1I2QA 4MDOA 1V0LA 1RJPA 4NJIA 1VFFA 2DZXA 3PJWA 4H6KA 2OLAA 3PS7A 4DHGA 4R34A 1F2JA 3QZEA 3W7OA 2NXHA 5LIUX 4H9UA 4JIHA 1RHCA 4D1JA 4R5EA 1EX5A 1OC5A 1K7EA 4XKMA 2V67A 4WJEA 5CPQA 2J9ZA 2QDHA 1MWOA 4MMWA 5AHMA 1GG1A 2H8XA 1K3UA 4PCNA 5JH2A 1E51A 4EX4A 4KCVA 5A6MA 5JVLA 1EZWA 1A47A 1PWLA 2ZRZA 2ZRUA 2P3EA 3A23A 3VDHA 1N55A 1PJ9A 3BH4A 4E2OA 1JZ2A 3K30A 3O3RA 3UWQA 5BOFA 3PTKA 3IK2A 2EPHA 4OUEA 2J47A 4E3VA 5G2WA 3JW7A 3L7RA 4Z1BA 4X2PA 1DEDA 3P0WA 3PNUA 4GG9A 4NNCA 5FA5A 3G1DA 1IR2A 4XSMA 1ZU8A 1W1PA 2OZ8A 4GC4A 5A94A 3AOFA 4GKTA 2VFIA 1A5SA 2F8QA 4MB5A 2NZLA 3I3EA 3S6OA 1P7TB 4IL0A 2KAUC 2X0YA 1XSKA 3BSGA 4U31A 2E1DA 3FXYA 4R3UA 1FWHC 1OFRA 4M6UA 4XZWA 3JVAA 4J3VA 5FI8A 3AISA 3QH2A 2R24A 2VKZG 3L67A 4WKFA 3TN4A 3H22A 1LUCB 5G2HA 4BKNA 2PDKA 3RPMA 3WFAA 4PMUA 1DQUA 4QFUA 4MZ1A 2DSWA 4WY0F 2P88A 4ZMGA 3RU8X 3UXDA 3WLSA 4B3LA 2PF0A 4UTUA 2V5CA 5F1VA 2I56A 2ATMA 4AWTA 3C2FA 1U5JA 1DJQA 1Z89A 4L4PA 3RLHA 2D0GA 3GDTA 3TK7A 3VOIA 2F84A 3AJXA 2BOGX 3EX3A 3MZ2A 4LB3A 5BXPA 1UR9A 4GY7A 5I06A 2VENA 4JFUA 3G2GA 5I09A 2Z2BA 4NT0A 1D3HA 4UNIA 2ZX8A 4C6MA 2JKPA 4PUMA 3KZSA 2D20A 2V2HA 3W7PA 2G37A 2NQZA 4GUFA 4RPPA 4LH8A 4NVTA 5DANA 3W4RA 3TUUA 1RBLA 3O7UA 4H01A 1QUMA 1J96A 1EA9C 2E8YA 4OT7A 4RJEA 3A6OA 1F4AA 4H1ZA 2DZTA 2HWGA 2VMFA 5C2XA 1TZ9A 1VP5A 4JAWA 2Z0IA 1POJA 3KRZA 4QE4A 2VCCA 2X1TA 3PUGA 2Z1KA 2OOFA 3B8WA 3M46A 3PJXA 3TTOA 4CQDA 4Q7BA 5HNNA 3KDOA 2VR5A 4K7VA 3KRBA 2ABAA 2ZKMX 4UNLA 3V1HA 3OBEA 1ZNNA 4H9TA 1V3KA 2OQHA 1LWJA 3COTA 3LZ5A 5I3HA 1OY0A 3OHIA 3GTXA 3F1QA 1KBLA 1JNDA 1B31A 3A3XA 3HV8A 1KNWA 4IFKA 3WLQA 3QF0A 1ZJIA 4U33A 2GQ9A 4OKDA 3T2OA 3FDGA 4JZ5A 3DN5A 1XRSA 5E70A 1DHPA 3VUSA 1QOXA 3N9SA 3ES7A 1EXBA 1JZ7A 3IK4A 1VQTA 1SJAA 1RV8A 1G7VA 2C0HA 5AC7A 1UJPA 4P8VA 1VCGA 3CZ8A 5JIPA 2Y4SA 5AZ1A 1R2TA 2EG7A 1GVSA 4TMBA 1BKSA 4POCA 2BMBA 1UD4A 2ON3A 3WL1A 2YCLB 2INEA 3ZWTA 3UFYA 1S1PA 3RX2A 2RFGA 2P3ZA 3RPTA 5T9CE 2TPSA 5LA0A 1VC4A 4R9OA 1ZAJA 1RQHA 5CZ0A 3W22A 4JIRA 1VPQA 3FHQA 3NQ2A 3E0WA 1HJQA 2ZADA 3S0CA 1ZAHA 1H3GA 1OK6A 1TMHA 2JFEX 3FX4A 1SSGA 1TYGA 3V5FA 4ICCX 4MNMA 4D6GA 4UFLA 1KRMA 5H8MA 1XJBA 4UOJA 1S1RA 3VD5A 3WDPP 1NSJA 4GY1A 2V68A 1CI1A 3D46A 4OECA 3EB3A 4PCPA 4NX0A 2XUCA 3S1XA 1X1OA 2EG6A 4BWLA 2GPTA 1DXFA 3DBPA 1GWJA 2PTYA 1PKYA 3PZUA 4HZMA 3QJAA 4DF0A 2WWCA 3FFSA 3VZYA 1JI1A 2TAAA 3LCGA 3A4XA 2WCSA 1TPC1 4B5XA 1UD2A 1DVJA 4G7FA 4B5VA 1U1HA 2ZX7A 3W86A 3FY1A 4GX9A 2QCLA 4IIFA 3C0JA 2EF9A 4K1GA 4H9ZA 4B9YA 2HTMA 1XGEA 3EA2A 1Z7AA 5DX7A 2TODA 5C7VA 5C8BB 1R0MA 2Z7KA 3GG0A 1H62A 2ZZ6A 1HO1A 1EZ2A 5EU9A 1VBHA 4IUOA 2J9XA 1YMYA 3M47A 3KCOA 5I3KA 4QEEA 2BGSA 4XZHA 3CAQA 2F6UA 4AC7C 3R0UA 4IIEA 4WX2A 3VIGA 3KLLA 3GY1A 4RE4A 1E3ZA 3N15A 4PMOA 1KD0A 5AFDA 1PYMA 4R53A 1SSDA 2E5CA 3WF3A 3TLLA 2D0FA 3LSBA 2QJJA 3R2GA 3G5EA 2GJLA 3WUBA 2PDXA 3GD6A 3CHDA 4WDUA 1P43A 3EX1A 4BI5A 3GR7A 4S23A 4YXGA 3AQUA 1CZ1A 3ABZA 2F9RA 3GH5A 4FNUA 3WF0A 1QPKA 1B3VA 3EOEA 1EBGA 3A9BA 5EMUA 1OCNA 4I90A 3M6DA 3WBEA 5C0QA 4CNTA 1GQNA 4H2HA 1EYWA 2O0TA 3RO8A 2D69A 4MB4A 4QXIA 4W8AA 3WK1A 2BHUA 1G5AA 2QHAA 1YRRA 3WH5A 1UD8A 1OFAA 3AXXA 1M41A 1P0KA 4IZGA 2IQDA 1ONRA 4NYYA 1DWGM 2QPSA 4ES4A 3IJIA 4LSBA 3IIVA 4PEEA 3ABQA 5HULA 3IJ9A 3SRKA 1BRLB 3E5BA 2DIEA 3QHMA 1ZSXA 4V1YA 2QKFA 1KGXA 1XIDA 1LTDA 1TPWA 3CPGA 1JCTA 1I1WA 3W7KA 1JR1A 2CZFA 4DXXA 3A13A 2DH2A 4A8NA 3L23A 4DJFA 2QS8A 1FUYA 4AIOA 1YNQA 2J62A 3KTXA 3LPFA 4X61A 3TMQA 4H9XA 3MSYA 1FH8A 1K4GA 1YHTA 5MHBA 4Q4PA 3H23A 3DHUA 1F6PA 4EP8C 3S46A 5D32A 3W23A 2G5WA 3VDAA 3RMEA 2B7OA 1TJPA 3TW7A 4YVXA 3BTNA 1OADA 1B9ZA 1JFXA 1WXJA 3W7JA 2Q8ZA 2FMNA 2GGIA 3M7SA 5FOOA 2NV9A 2YCKX 1VFMA 3ZLGA 4EWJA 5EBAA 2IQ0A 1S3HA 2V5DA 4Z17A 4DO6A 1IV8A 4XG1A 2CLEA 4XZIA 1MUCA 1PIFA 2C18A 3PAJA 4G1NA 4IGHA 4XD4A 5F4WA 3E0IA 4S3CA 4HSHA 4ADTA 4GJ1A 1O1ZA 4DB7A 4C6CA 3WKZA 3CO4A 4KEVA 1JZ6A 5F2IA 3TSDA 1XXXA 3Q58A 4AX7A 4GNVA 3NJ3A 4Q6JA 4AD0A 4ZQPA 2QV4A 3TSMA 2DSUA 1FWBC 5HJYA 1UROA 1Q8AA 4XVEA 4Q7IA 1Q85A 1OCJA 1XCFA 3OIHA 4RE0A 3OZOA 3UVIA 4WHBA 5FL0A 3NZQA 2VZSA 4O1FA 4FSAA 4KT2A 3L66A 1XC4A 2J7BA 4US5A 4UWMA 4V2XA 3TP4A 4AB4A 3D47A 4AIEA 2P0OA 2EEXA 4GGHA 4JNYA 4K1WA 1FFRA 4P8XA 4HQVA 1DJNA 3LB0A 2HXTA 3H2MA 4HNTA 1ITCA 5C2CA 3PFMA 5D05A 4Q7NA 1PB0A 1W9PA 3B9EA 4CU6A 5IRPA 1G1YA 1GK8A 4QQUA 3B03A 2J7CA 3GXNA 5IFTA 3OW1A 1NDYA 5A2BA 1TV7A 4G1KA 4AEEA 1XLLA 4LRTA 4CGTA 1IHIA 4CN1A 5A8MA 1T5AA 5REQB 4GQGA 3GU2A 5K3VA 4ZOAA 1I9CB 1A80A 4WK9A 2FB2A 2E09A 4KCTA 1E15A 2XN2A 3BL3A 1US2A 1Y7VA 3PWAA 3ARYA 3TONA 3PPFA 1EP3A 1NDZA 3UR2A 4W8BA 4W7VA 5B80A 2GL5A 2CKSA 4WY0A 1NM9A 1SR9A 5AC8A 3TYUA 3G3DA 1QNQA 3L65A 3L21A 5XIAA 4EXBA 3FA5A 4PCSA 2OYKA 2J7DA 5TD4A 1BD0A 3WQPA 4PL1A 3ABOA 2CHRA 5CSYA 3CWHA 4K39A 4GUGA 2GVGA 4LW7A 2GDVA 2V9DA 2QQ6A 4WLCA 2IUZA 3HN3A 4NX5A 1KRCC 4BEUA 3SCQA 2DDXA 3S6TA 4AZGA 1KTCA 3ZJ6A 5D2WA 5TF0A 3W7CA 2Q6ZA 2ISVA 4OTKA 3HQNA 3TVAA 3ITYA 4A8IA 2WB5A 4IXHA 3W2UA 1V02E 3K2GA 3WENA 4GPNA 4HCHA 3CT2A 1TVLA 3LCLA 3GNDA 3TQKA 3AYSA 1HKIA 3GAYA 4NNBA 1A5OC 2WJZA 4MSSA 1JZ3A 3NQEA 3AALA 1N8WA 1QO2A 2XH2A 4A2SA 1KXVA 4GFIA 5EL1A 3SRHA 3GS6A 3IJLA 1J2BA 1RZMA 3SR7A 1Q2RA 4CNSA 3UR7A 1S2AA 2Y7EA 1T40A 4Q8MA 4WGXA 1SFSA 3BQ5A 4MY9A 1XG3A 3A24A 4R7WA 3A5VA 3OODA 2J24A 4HZ8A 1MW1A 3WUGA 4UFKA 1LZOA 2DQXA 4C7GA 1MO0A 4QX4A 1R3YA 3A64A 3PSWA 3PANA 1UYQA 3VILA 1W8GA 1JCXA 1TX2A 4UBPC 3BLOA 3KVKA 4UFIA 2Y2WA 5A6SA 3DYPA 2VWTA 4AWEA 2G8ZA 3IIZA 2HE5A 4CD6A 4MB1A 1UZHA 3GKFA 1LWIA 1QI5A 1YYAA 3CUFA 3CXOA 3KEHA 4WIWA 4O8AA 5E9AA 1UPMB 4QCEA 1ZENA 4QG8A 5DBUA 2DY3A 3B4YA 2OR2A 3WQDA 4K2SA 2O9TA 4HYVA 2PDNA 1QBBA 1JYVA 1Q6QA 4UXDA 3ZLHA 1VCFA 1W3JA 2VEFA 5AYXA 3UWEA 3MWAA 4DZAA 3EDDA 2BNJA 1PTAA 3ABSA 4UTLA 3IV8A 3MUXA 1YQ2A 5E0CA 1XYZA 1RCOB 1R7AA 3ARTA 1DWIM 3E9AA 3NL6A 4RXFA 3W1LA 4L1GA 1WA3A 1TX0A 3SZ8A 5EMLA 4PTWA 3ZQ9A 3CHEA 3SI9A 3BE7A 1O68A 4RL3A 2QT3A 3GUGA 2OO0A 1N82A 3EB2A 4IL2A 3MO4A 4ADUA 2XWDA 1POKA 3VKJA 4E4UA 3R10A 3CS2A 1KQZA 3EKGA 2DZSA 4M3PA 2PE4A 4W8LA 1PWMA 1JCNA 3WDRA 5I24A 2ADAA 4MKVA 1G4TA 4HNOA 3IJDA 3VZXA 4AD2A 5CZJA 4RCXA 4KCWA 4NI3A 2WVSA 4O1AA 2YCLA 3TOPA 4XZLX 1FH9A 1UR1A 1AW2A 3CU2A 4E8CA 3VIJA 1G7UA 1C7SA 3LPPA 1GVFA 3SW6A 4ZO6A 2VEGA 5M1TA 5DO8A 2QPUA 2EPNA 3HBLA 3CPRA 3ZSTA 4Y7EA 1JJKA 2PZNA 4MY1A 5JBEA 1NWTA 3TSBA 3W2NA 4UZUA 3N13A 1EJTC 4O1EA 4PEKA 3CB3A 1F6KA 4XAPA 1S2TA 1OEPA 1ZBVA 3NIYA 1SMAA 2CKRA 4UTJA 3SADA 1ECEA 2JF7A 1O66A 1IEIA 1SJBA 1F73A 4ENLA 4I9AA 2DJLA 4FIRA 1EEPA 3TDFA 2PDMA 5A6JA 2YDRA 4LYRA 4XISA 4IT1A 5I79A 2BV9A 3QR3A 4DUWA 3WFZA 5BCAA 3L4TA 1G6CA 3IVUA 3G1SA 3H12A 1TCDA 2VRQA 4AYGA 3WF1A 1KCLA 2OJPA 1MXGA 4JIEA 3VFCA 2GYIA 1K70A 1WQ5A 5BROA 3MUAA 1GHRA 1YE4A 4B4FA 1DPMA 1I6NA 3EX6A 4PH6A 1W6TA 1C8VA 4NYUA 2RDXA 1E55A 2NWRA 3ZR4A 3N11A 4R88A 4DBWA 2XFRA 1OIFA 3THQA 4HNUA 4YTRA 2OLHA 4ZCWA 2PBOA 1HKWA 1S5WA 5LXEA 2E6AA 1MFVA 4M24A 4ILSA 1BXNA 2WVTA 3VC5A 4RDWA 4LWWA 5A6TC 2PDLA 4JS3A 1PSCA 1FWFC 1E9YB 1MSSA 3FSTA 2QPXA 3CPUA 2YXOA 2DZAA 1A3HA 2Z24A 2VUYA 3LENA 4MJ4A 5A6BA 2PDHA 4Q4SA 4UIOA 3LM7A 1JPIA 3R8RA 1E1CA 5D8ZA 4LXFA 1CXLA 4UTKA 5CPLA 1M68A 3M43A 1P0NA 3WDIA 3E3HA 3WQFA 5BU9A 1EP2A 2EJ1A 1LLZA 5H8UA 4B9ZA 1TPFA 1AH4A 2ZIDA 5FJIA 3DYOA 1PHWA 2EPOA 1MXDA 4HA4A 1F05A 4WSJA 4OQVA 1DKWA 2O7QA 4BF7A 1ZAIA 3LXAA 3W1MA 3WMSA 4B2DD 3NA8A 2DZWA 2OG9A 1VFHA 4TTGA 3W28A 3ZO9A 5CJMA 2D2JA 4I3GA 2A3EA 4E8GA 3MVTA 3WLRA 3V18A 2OEJA 4PYSA 3O6YX 1UA7A 3T44A 1X6LA 2HNEA 4JBRA 2CWNA 3ZSSA 3NL5A 4MAZA 4NZ1A 2I14A 5D8WA 1FA2A 4GYPA 1R3WA 3W75A 3CBWA 3WUFA 3E2QA 4YYFA 5E5CA 3CUIA 4AEOA 1CW2A 1B3WA 1RJQA 3PM6A 3VK5A 4UQEA 3R8HA 4DJFD 2CWXA 5FJJA 3FKRA 3CM4A 2GUUA 3KM8A 4O1CA 2QJMA 4PODA 4C6LA 3MHUA 1KV8A 1GZJA 5ABHA 3DYMA 1F61A 1O4UA 3KOZA 5I78A 3L0GA 3GAKA 3UPBA 1OC6A 4IF2A 2ACRA 3AZRA 2PPGA 3KE0A 4UTTA 1OABA 4KMQA 3GHUA 4UCFA 1CGXA 3MMUA 1OWQA 2ZUVA 1U83A 4EAYA 1X1NA 1CT5A 2PRHA 3B0UX 1Q63A 2D23A 4DUVA 4DJDD 2MNRA 2PDWA 3TNBA 4ACYA 4GJIA 4KRTA 3NO3A 1TTIA 1BQCA 3FNDA 1AD4A 1JF5A 3SAZA 4L4MA 3W29A 4LV4A 3VNKA 4U3AA 4O10A 1GONA 3ZOAA 2VR2A 3J7HA 3YPIA 4NZ3A 4PUJA 2AAMA 4K3ZA 2D3NA 5CQ1A 3GDBA 5CJNA 1DIKA 1UKPA 1PIGA 1FHVA 2PP0A 1TPVA 3QRHA 3IVSA 5GJPA 3DH7A 3RAOA 3TEVA 4U2ZA 4DWSB 4I8YA 3ITOA 1KBBA 3KVLA 1JZ5A 5CCZA 5FEZA 2ZZ3A 4Q4KA 2J74A 3MMTA 1PKMA 4ZXLA 4CUCA 2PWDA 1PZ1A 1RPKA 2PWEA 2XJ7A 3PTMA 4KERA 4JFSA 3UCQA 4PBEA 3OB8A 4NZ5A 4MNKA 3P14A 2WZHA 1MW2A 1V08A 4R9XA 2XN0A 1KKOA 3UNTA 1JYXA 3IPWA 4JOMA 3GH4A 2CLKA 1CXEA 2OPJA 1B57A 5BU6A 3VD9A 2LLEA 1TMLA 1HNYA 3ZMRA 5FD0A 1BTCA 3QW4B 3QR1A 2V0TA 2DU2A 1K8ZA 2WQDA 4K68A 3BZJA 4ZQCA 3JU2A 2DJXA 4CKQA 3WEMA 4DF1A 3NURA 3TQ0A 1H1ZA 2GLKA 4JYDA 3AYTA 3OLGA 4JNZA 2CU0A 4ROQA 3BSHA 4H2CA 5AYYA 1GGOA 4LC6A 3UR8A 4OOUA 4LUIA 2A2IA 3NG3A 4H9MA 5ENLA 2A79A 2QJHA 4MKNA 1B5TA 3GX9A 1QI0A 2G95A 2ZE3A 2IXVA 3MP5A 4TV5A 4ERGA 3P6LA 4JN6A 3T2PA 1ZBCA 2OTDA 3PTDA 5DY2A 3SY5A 4AF0A 4AU0A 4LVBA 3RK8A 1KXQA 1TRIA 1V51A 2ACSA 3CJPA 2Z28A 4LV9A 2VDHA 1JD7A 2ACUA 1PYFA 2Z2AA 3F5JA 4LNCA 1YADA 3G22A 5A6LA 1BWKA 3GDRA 3TU9A 3NQCA 2BB0A 2WPBA 4OFCA 1NTHA 1T0OA 1Q8JA 3M0MA 1UZDA 3W83A 4J5NA 2POTA 1BWLA 3VGBA 4DO5A 1KRAC 2UY4A 4LAOA 3EEZA 1W31A 3ZFHA 1OFEA 1EL3A 5M3WA 2Y61A 1XSJA 3DZ1A 4LBRA 4GOAA 4QSFA 1EWDA 2A3BA 3GE7A 1OBAA 1JUBA 3M9YA 4C60A 4Z08A 3R89A 3TFCA 4KESA 1ADDA 3CO8A 3S5ZA 2E5DA 3DXIA 3UXAA 2DSKA 3M5YA 3GG8A 4GRSA 2GJNA 3UZWA 3U9IA 2PUZA 1IXPA 5HQEA 4D6DA 1FCVA 1L6GA 4C6EA 5CJ5A 1HKVA 1PV8A 2QMKA 4IJRA 4JTIA 1ZJAA 1O60A 1T96A 3OA5A 3PAOA 4GI6A 2FMOA 3SCNA 4TO8A 5BNKA 3TCEA 4GINA 3ITGA 1OFPA 2X40A 4TR9A 5JMUA 3I3BA 4MWAB 1V6UA 1WDQA 2Z6JA 4IISA 3WJWA 2YKKA 2B31A 4MWAC 3AHXA 4A35A 4PMNA 3KBJA 1XKJA 3SQLA 4DJEA 3PBGA 3WSUA 3KLKA 4D6CA 3AXIA 1JDFA 2V5KA 1L2QA 3SFWA 5FF3A 4PUDA 2PWGA 4E4PA 3H24A 5XIMA 3LG3A 2GJRA 2ZUTA 2ATSA 3GFYA 2NQHA 4JYEA 3BJFA 4N6FA 3WLJA 2TMDA 3ZYZA 1JULA 2JGQA 2UY5A 4PUEA 4NU7A 4OZOA 1ME7A 2FHCA 3H7UA 2PGWA 4Q8NA 3F03K 2CLHA 3W24A 3PTQA 4ORMA 3QN3A 3MUCA 4FK9A 3PG8A 5L9FA 2XINA 4J1OA 3CMGA 3WO8A 3S1VA 4Y9OA 1DJYA 3M0IA 2DGAA 1ENUA 1GTHA 5D9OA 3M5ZA 4YNGA 1JPHA 3GXDA 2QUVA 3LRLA 4F9DA 2RAGA 4FX6M 3GU9A 1P0BA 3AMGA 3PG9A 2O4QA 3WLPA 2GWGA 4CQ9A 3HPFA 2AKMA 5HJLA 3TW9A 2PRLA 3G77A 1N7KA 2ZWYA 4A3RA 1XLMA 1ISVA 3JS3A 4ORIA 4NJKA 1HG3A 2PI6A 3STEA 3IV3A 1EDTA 4L61A 2XG9A 1A50A 1XIEA 2JIEA 2OB3A 2J7FA 3SN4A 1BXBA 2Y5JA 1MUWA 1TWIA 2A3LA 3LXBA 1HQTA 4XAFA 1VFOA 4XZMX 4IJBA 4GYFA 1E6PA 3NQ8A 4NY2A 1BG9A 5I7GA 3G1VA 1NFGA 3FYOA 1IZJA 4ZSTA 3BAKA 5I3FA 2NXIA 1M7OA 2WNWA 3BQ6A 2XH7A 3Q67A 4GIAA 3M0KA 1EEXA 2WNQA 1HX0A 1DTUA 3BUVA 4C1KA 3R94A 1D9EA 1RBOB 4QJ5B 1JFHA 1X7IA 1Z6KA 2G4FA 1K6AA 3LTSA 4LB4A 5HNTA 2PDGA 4CQBA 4NNAA 3IUIA 2J8FA 1S2UA 1TO3A 7ODCA 2XSAA 3GXIA 5IHRA 4AXKA 3EMZA 3V16A 1A49A 1BGAA 4MZYA 4E3TA 3PUEA 4AIBA 2OKOA 3BCDA 4UTMA 5EB8A 5CBBA 3NCOA 1XISA 4GUHA 5FACA 4XBKA 1AJZA 4HJFA 4HCLA 4Q8OA 1X1ZA 4C1LA 2ZRYA 3WLMA 3H70A 2C71A 2XVLA 7REQA 3UWWA 3G0XA 3JZUA 1D8CA 4Q4QA 4PB3A 4ZE4A 2PTXA 2PAJA 4H9YA 4W86A 1V4YA 4YTUA 4O4WA 1DWFM 2WC3A 3S9YA 3RX4A 2H6RA 3T9PA 3VA8A 3VINA 3N19B 3SEPA 2FYMA 3BARA 2NT0A 2A5HA 3E96A 1UA3A 2GJXB 2V3EA 3LHWA 2YCJA 3MI3A 5LGZA 1K6WA 1GW1A 1KGUA 4Z42C 4KIEA 1TRDA 4GZJA 4FAMA 2VEKA 3RF9A 1SJDA 1CWYA 4O0QA 3M0LA 1VYPX 2J6XA 2AL2B 1E1CB 4LPCA 1T41A 1V3IA 2QF7A 1PX3A 3WNNA 3DECA 2C3ZA 2WBKA 3BLLA 3LQLA 3E6EA 3BG9A 2GVYA 5E6ZA 1HN1A 4P8WA 2IPWA 5AVHA 2ZA3A 5DMMA 4ZSUA 4MF4A 2B4GA 4GH1A 4IFOA 4AZ5A 3GHTA 1EC9A 5I77A 1CENA 2NT1A 1OZQA 1MMFA 3STFA 5C9ZA 1UPPA 3CQ0A 5LSMA 1JQVA 3TC7A 3BMXA 1OYBA 1XYAA 4QS5A 1DBTA 4DXKA 2G0WA 4QJ4B 4K7YA 3S1WA 1UH2A 1A53A 5FJOA 2HBXA 1H1NA 2YLLA 4WR3A 2RDTA 1WZLA 3TJ4A 1TREA 4OU1A 3W02A 4A3YA 5D38A 5DLCA 5A6BD 3CQJA 3APTA 1AH0A 4Y9AA 3FHAA 5HATA 5CBJA 3CAKA 2VDGA 1UR4A 2EBNA 2P1FA 3BLPX 2PGEA 4W87A 1AZ1A 3EDKA 4GYJA 4QR6A 2ANUA 4AFYA 2NLIA 4BQ5A 1GEHA 2IW0A 1TE1A 1EP1A 4HNNA 4Q4RA 5AYBA 5TNVA 1OYCA 2H3BA 2XSBA 1LBLA 4RK8A 4EPEC 2CEQA 4GE8A 3ALGA 2HXUA 4A8LA 4XV0A 4GI8A 3AIEA 3BGAA 2DW7A 1JZ8A 5H2ZA 5FAJA 2FGBA 3W82A 4JKKA 4H19A 3I6EA 3QGKC 1H11A 5BYWA 1M7XA 3CZLA 3L2MA 1FWAC 1SQ7A 1E9IA 2QDDA 2GDQA 3CZGA 3C2RA 3LHVA 1IWPA 1IE7C 1GVIA 4H6RA 2A6LA 1Q66A 4BJHA 2MANA 5C9RA 7TIMA 3XIMA 1I2PA 3M0XA 1PHQA 2E25A 5AC6A 1W8SA 3SURA 1TWZA 1PIIA 4MWAA 3KOWA 1X6UA 3URBA 1AA1B 3W1PA 4NKCA 3FA4A 1UASA 2ACQA 2FZDA 4TUFA 1KLZA 1PVNA 3BZGA 4FEZA 3NZ1A 2GVJA 4CEXC 4FI4A 2X1UA 1W2PA 5HPCA 5IOBA 3CT7A 3GHRA 3WH9A 2W6RA 5EPDA 3TTQA 3B8DA 1SM9A 3BOFA 3RPDA 3UPWA 4E4FA 1BGGA 3P80A 3KTCA 4YMZA 1BRLA 3GZAA 3TTSA 1QHPA 1XL9A 1NH6A 5KITA 4AMAA 1EUAA 1XSIA 3V3WA 3PR2A 4RDYA 1ZQ5A 3QC0A 3TC3A 5FJUA 1VRXA 4RNHA 3MS8A 1HUVA 1JAEA 3AU2A 3N3TA 2PD5A 5F7UA 4C6KA 2XIJA 1UMYA 3P61A 4JTKA 4IP4A 2GK1A 2CLLA 3UPMA 3K8KA 1LROA 1RK5A 4OHQA 1HL2A 1ICQA 2FZ9A 4QROA 4L4OA 2HS6A 1FWCC 4WF7A 3QTPA 1UW9A 2IXUA 1X97A 2HPIA 3WBXA 1X98A 2DSVA 2C13A 2F2KA 4J3TA 2RGMA 4XAGA 1CB2A 5HA7A 4QEHA 2Q71A 1B30A 5CSSA 4S3AA 1XH2A 4PMDA 3W2KA 1M01A 1NJJA 4NI8A 3H2NA 3R7MA 5CPMA 4O1DA 5JH1A 4F4RA 3GDKA 2NLYA 3D3FA 3HMCA 5GNZA 1EXPA 4UOQA 1DXIA 3SUWA 4RZ5A 3A9IA 4BQ2A 2RDWA 2WBGA 3VIHA 1GVRA 1I4NA 2YL5A 3AMDA 3VE7A 2J7GA 1B3OA 5I00A 1OFOA 5JUVA 4WY0B 3W85A 1QK2A 2FHFA 1XLGA 4DZ5A 4JGDA 1JEZA 2VM8A 2OGJA 3OGSA 2DZPA 1SZFA 4FALA 1JPMA 2XIQA 1JD9A 1I2OA 3UYIA 3RR4A 2QULA 3AXMA 4DUOA 4DF2A 4LVFA 3BLDA 3STGA 3HZ3A 4LEQA 4TV6A 4AZCB 1S2WA 1A0EA 3AHTA 4LCSA 2PLKA 3T8QA 3MT1A 4KBXA 5BMWA 2PDYA 5TQLA 4X2RA 3FSUA 4QNEA 3P62A 3HFTA 1TWWA 2R14A 4QLLA 1C91A 1W9VA 2INFA 4LNYA 2FVLA 1REQA 4B3KA 1W1ZA 1VBJA 4YPJA 4HMDA 4JKMA 2D22A 3R4IA 4JKLA 1SUXA 4HGXA 2ZRVA 3LI1A 1AMYA 3GVWA 1OCBA 4L6HA 2E77A 3WLIA 1CXIA 3O05A 3K46A 3T0CA 3R0DA 1MRAA 1N8FA 3GNPA 3P7YA 8CGTA 2DT0A 1UWTA 2DT2A 1LP6A 2A85A 5C54A 4QM1A 3L4UA 1E43A 1J6PA 1F6YA 4MG4A 2Q8LA 4BF5A 3ITVA 3B0PA 1Q6CA 1P1XA 2FZNA 3WQWA 3DG6A 3AI0A 5BZAA 3LQGA 3M16A 1ONWA 1KBKA 1EGMA 5AVNA 4B3ZA 3VUPA 3SCUA 1F8MA 4YTQA 1C90A 3BAXA 4PN2A 1ELSA 1EFZA 1GQKA 1K03A 3K4AA 6CGTA 3NFUA 4F0HA 2PLJA 3IRDA 4JTCA 2WVVA 1LJYA 2VC5A 4O19A 1NF0A 2WZTA 4GGBA 3TH6A 2JQXA 4W88A 5HQLA 3WEZA 1THFD 5CG7A 5DT5A 3LSCA 3ZT7A 3L4XA 2XFFA 3BPWA 4G6CA 1T99A 2X1IA 1HVQA 3VNJA 1GJWA 2WK2A 2V3FA 3WG6A 1MEHA 1GPWA 3ITTA 3OP2A 3MPGA 3DX5A 5U7SA 2PP3A 1W9XA 3CASA 3OBKA 1JPDX 3AYRA 1F74A 2A7RA 4GMEA 4AMCA 4YCPA 4IJCA 1EA0A 3BCFA 2CLOA 1E4IA 1WDSA 5LNVA 1J79A 4H7CA 1TA3B 2ZTKA 1XQLA 5DFAA 4E0CA 2VO5A 3CUHA 4J3WA 4E2BA 3SCVA 3LHTA 1NDWA 2REQB 1XC6A 1RK6A 5LZLA 4C6NA 3B0VC 3ZT6A 4MJMA 1B2YA 1NWUA 3TR2A 2OZ3A 3AROA 3AFBA 4PMJA 9CGTA 3DGBA 1C3FA 1DQXA 1WZMA 1FWNA 4A6GA 5M5DA 2HE8A 4FR1A 1EHAA 4ADSA 5D30A 3NQBA 3MZNA 4L6DA 3PZ9A 3MKVA 3DKJA 4JTFA 5I2UA 1UBSA 2QCDA 2UWFA 1ZL1A 1J0IA 2CC0A 2V82A 1G4EA 3HPSA 4Z1DA 3CUGA 4AHPA 1Z41A 1RY8A 4LALA 3GTHA 4XBJA 5F4SA 4IFRA 3MO7A 4PFMA 3OQ8A 1Q3NA 2B7PA 1TQXA 3AUOA 4EKJA 3WQEA 3D0CA 2E1WA 4R33A 3SCPA 5CGQA 4C90A 4IIGA 2G3JA 3JZEA 3UWUA 1RSCA 3CWOX 3SRDA 5FL1A 1G69A 3CTTA 3N4FA 2HVNA 3VD4A 1CCWB 2AQOA 3QEZA 3KS5A 1SO3A 3EZ4A 1EJVC 3QV6A 3PK7A 3GR4A 4B5WA 1XHGA 4P5UA 1SZGA 2ASHA 4O28A 4Z2IA 1XV8A 3VKCA 1CB7B 2Y1HA 1UJQA 5D02A 1OX6A 3S2NA 2AGTA 3JRKA 2VJXA 2NX9A 4MTVA 2OQLA 3P67A 5A6KA 4DJFC 4DX3A 2G3FA 1XLHA 3OVQA 1R9ZA 1GPFA 1RCXB 3UD6A 5A1AA 1J93A 5DELA 4MM1A 3QHNA 4F2BA 1XYCA 4DYEA 1H7NA 1H7PA 1BLIA 2HEJA 2P8CA 1VS1A 1GG0A 4ZR8A 4YWIA 3EPNA 1R86A 2YBVA 2XPKA 1QCWA 3MBDA 1IXOA 3RILA 1H41A 1GJUA 1UP3A 1V93A 4XVDA 1XRTA 3SN1A 1P7TA 1V3JA 5DBTA 2DH3A 3ISIX 3TROA 4JQ2A 1O5QA 1NP2A 5AYZA 4HZ6A 2ZUNA 3GXMA 1H0GA 2E7FA 2FFIA 5FKYA 2DT1A 1K77A 4CNNA 4B91A 3IJ6A 2C8NA 3CZKA 1F3EA 2PDUA 4WDTA 4Q8WA 5F1UA 1JGIA 2BASA 4R27A 3SJNA 5IM51 3PZGA 1EQCA 3HIJA 5F2MA 5K4ZA 4BR1A 4N2YA 1OZMA 2VC7A 1Z48A 3S47A 3R1ZA 1PPIA 3W7NA 2VYOA 1FHDA 3R58A 4Y9MA 2YL8A 1S5NA 2GUYA 5FESA 5BMXA 2R6OA 3WLNA 1SO6A 5BRPA 6XIMA 4XK2A 1QDSA 1R30A 2JIWA 3E0LA 1W3LA 2GUBA 1KCXA 4WGHA 4HTBA 1QJWA 1RQBA 1OF6A 4TX8A 3OIXA 2PDBA 2QV5A 2KZHA 4HHPA 5XINA 5DRIA 2OEMA 1NY1A 3OEXA 3G1XA 6ENLA 4RNJA 3E49A 1ISZA 1V6YA 1OK4A 4LY8A 3FYPA 3VO0A 2QDGA 3WMBA 5JIWA 4AWSA 5I03A 1QO5A 3QV7A 2ZE0A 2E6FA 3BMVA 2GSJA 2QCCA 1PS9A 3P0XA 4WDWA 1RVKA 2O55A 1JCJA 4V28A 1TZZA 2PWFA 5E0FA 1V5XA 4FR6A 4RPQA 2YSWA 4S3DA 1VFLA 3L9CA 2PDPA 4K8HA 4AZBA 4B16A 4M6QA 4PUUA 3WK0A 2NVCA 4EXQA 2CBVA 5C71A 3BWWA 3ARXA 4JQ3A 4MFDA 4MNLA 2AGKA 1ZP4A 3B06A 2QCDB 3VNIA 4UR7A 2YXXA 2OZ0A 1FWWA 3GUWA 1EJUC 2PDJA 2VELA 3KL0A 4DWSD 3T07A 5AN7A 4ZE5A 4CD8A 3W1TA 2VX7A 1XIMA 3ARRA 1DYSA 4XAZA 1GVOA 3GVRA 5J5DA 2YCIX 3LBOA 5IBXC 1I2NA 2Y5EA 3SCOA 1YKWA 4M6PA 1KCKA 1NELA 1KBIA 3RITA 4HPJA 3FN9A 3ME3A 5A8QA 4ERAA 4BS0A 1PX8A 4QNWA 4LAUA 2BBFA 1UWSA 1H5YA 4F0RA 1MQQA 2ZTJA 3F2BA 4FPSA 4BQ3A 1LOSA 3PBVA 3E02A 3CNYA 1L6SA 1SGJA 2FTPA 3QHOA 1L2UA 4W84A 1WBHA 3W7EA 1A5MC 2ZXAA 3O07A 2Y6ZA 3PY2A 5L6UA 1F07A 1ISXA 4RV8A 3LGEA 4AHQA 1U2YA 1ZLPA 1JRCA 1IGSA 1MRQA 4V15A 1E56A 3N2MA 5HMSA 5D09A 3K1DA 5A8PA 1E1EA 1P1MA 1E3XA 1LQ0A 1R3TA 2NVAA 2H90A 3LK6A 2QGYA 3ZZ1A 4ICMA 4NXSA 1KQYA 4YLWA 2EHHA 4GVGA 3QR0A 3MV01 3VD3A 2QUNA 3H4GA 3KRSA 2ISSA 4QE5A 3T09A 3DIPA 2OMAA 3TIMA 4AZCA 1AG1O 3MU7A 4GI9A 5I0DA 4NIRA 3DFOA 2ZBTA 2DSZA 3IAQA 1JZ4A 4JTJA 4L65A 2I16A 3T2QA 2VFHA 2NQJA 4GZIA 2BX7A 3UZJA 4MGGA 1D8WA 4CD5A 3O6DA 4NQ1A 4UNKA 1JI2A 1O7AA 3TKFA 1REQB 3NPVA 4OBRA 3U5YA 2EPMX 2XVGA 1S2VA 1D3CA 3QOMA 4FXJA 4EF8A 4Q8UA 3NVDA 4X0VA 3W1QA 2ZA2A 4HHLA 3UYCA 1Q2SA 4UOZA 1GTEA 2FIQA 1KTBA 5CC7A 1UWIA 2WCAA 3CV6A 1VPXA 2VGFA 5IBXA 1GHSA 4LTSA 2FDSA 3KFTA 4IGSA 1M7PA 3GIQA 3SY1A 3EXRA 3LEPA 2VD8A 2V3DA 3B0XA 3MUY1 4JICA 5GJNA 1BVNP 4C5ZA 3MB9A 4JCMA 1NOUA 3UT0A 3TZFA 2R1MA 2WMFA 1SU5A 2WXDM 3MKCA 3GZ3A 3LHZA 2V81A 1B90A 3LRKA 4KWUA 5A5WA 3KP1A 3NOYA 4S2BA 4UFMA 1VJZA 4GYKA 3NEHA 4GLEA 2PDFA 1U1JA 3QGAC 2UY2A 1H5VA 2R1NA 6ALDA 4LUYA 4NJHA 5CC5A 4B90A 1F4HA 1UKOA 3VNZA 4NAFB 3CIVA 3G0UA 3KP0A 4D72A 5ECUA 4GI4A 2Z1BA 2WVUA 5AHNA 1R6WA 1KM1A 1TQJA 4IMGA 2BWGA 4Z1YA 3GG7A 1XLAA 2QCGA 3S8HA 2PDIA 4LT9A 4TVUA 4RXGA 1X38A 3PBWA 4AZ7A 2E9MA 1CNVA 1KB3A 1H09A 1L6YA 1Q65A 1GZGA 4IIBA 2DPEA 3LZ3A 1TB3A 2IKGA 2VR4A 3QMTA 3WFLA 3RLGA 1YEYA 3W7DA 1GOMA 4L7ZA 4PUWA 2BHZA 2HVOA 2J79A 1NP0A 4H7ZA 3ENLA 3TYDA 3OZMA 1V03A 1TJ0A 4CN6A 1E4MM 5FSDC 5GVJA 4GUIA 1LG1A 4HN8A 4ONVA 4WSKA 3WQ5A 4JY8A 3SBFA 2VVSA 5KEZA 3DC0A 3KBWA 2VI0A 4JTUA 5A3HA 1TJRA 4MYXA 3WY1A 1YBQA 3A47A 4UCGA 4JL1A 2ODOA 3HJEA 1V02A 2PC8A 3CK5A 4HK7A 4M7TA 1WUFA 3M0HA 4GD0A 3EWXA 2NSOA 4OE7A 4NG3A 1UC5A 3RX3A 1O12A 6REQB 4LBUA 1SZNA 1TJ1A 3P74A 2RHGA 5A95A 3T08A 1FWSA 5CXPA 1OC7A 3H8AA 2PC4A 1PBGA 1EDGA 2I17A 2XGBA 3HA1A 2WM0A 4J2PA 2FQIA 3SECA 1E6XM 2ABBA 2PF8A 1TV8A 3RM9A 4FOJA 2DZVA 4PFHA 2XU2A 5CPOA 3N25A 4N9EA 1EC7A 3ANVA 2H9AA 3O63A 1TR9A 2G50A 4ALDA 3LX9A 3EB4A 3W53A 4JR5A 5G5IA 5DCEA 1QI3A 4YVPA 3GTIA 4E6MA 4G8TA 5HDRA 3MJYA 3BICA 3PZMA 5D37A 2Y85A 4GUJA 4GNKB 3NEVA 3W37A 3NYZA 4JX6A 3SUTA 4BA0A 1DL3A 1XS2A 3T4CA 1LRQA 3I6TA 5KZMA 2FKPA 2V5LA 3POHA 5C9XA 2INZA 3QGVA 2PS2A 4MNJA 3QQ0A 4NSBA 3B8SA 4PMYA 3GFXA 4IPIA 1GW9A 3T0TA 1YDVA 1K8YA 1E72M 1H1YA 1R47A 4LBSA 1ME9A 2X30A 2R82A 1T7LA 2VD9A 1V6XA 3RYSA 3QQ1A 1B1YA 4LU0A 3PVFA 1FVPA 3OBAA 3QY8A 1XR2A 1IGWA 1IEVA 3T78A 3HB9A 4FXSA 3FEMA 4LFYA 1EH9A 4O52A 4WJ8A 5DXXA 2XZ9A 1JNEA 3SY8A 3AJ7A 3O9NA 2WHJA 1MQPA 4L4LA 1OGGA 1HJXA 3TXZA 3VKDA 3EXSA 2A3AA 4Q22A 3ICJA 3HPZA 3VIFA 4ZTXA 1QWGA 2CPUA 2ZCGA 2NW0A 3VOCA 4JQ4A 1TIWA 1E9ZB 2PDCA 2PLCA 3B97A 3UZXA 5LIYX 5AC4A 4PR4A 4KRZA 4I7VA 3S5NA 1TR1A 3GNRA 5F2LA 1R3RA 2E40A 4HU8A 4I8DA 3P60A 2HVMA 1BXCA 1HJUA 3C56A 1E6ZA 1TUXA 2F6KA 2XVPA 3W25A 4N7QA 4O15A 3VGFA 3WLHA 1EPVA 2ZUWA 1UBPC 2OEKA 4HOZA 3ZT5A 2W27A 1K8XA 1AUSL 2A3HA 5EMYA 3M0ZA 3CIXA 3QOKA 4FLRA 3AMCA 1VEPA 3C6CA 3UG3A 3GRIA 1W1IE 5MKGB 3IUHA 1A3XA 1KFKA 4MUPA 4Z2JA 3ONBA 2ZUSA 1W32A 2OELA 5EMMA 2WCGA 2OXNA 1W1B1 2XIMA 1M03A 4DAIA 3WQ4A 3IUDA 5FF7A 1PX4A 1IEQA 3WELA 1S5TA 2IPGA 2VFDA 4AEFA 3G1RA 5HAOA 4AG0A 3OG3A 1GOWA 3OO2A 3AZTA 1EJWC 2YR1A 2QCEA 4DI8A 2ZC1A 3V0TA 3M4HA 3T0DA 2A21A 2BP1A 4Z2LA 2QCFA 3MDUA 2QCMA 1FOBA 2OYLA 4XBSA 1SR0A 4GC3A 3K5XA 1KXHA 1XLJA 1EF3A 1Y8BA 3OVPA 3RRAA 4PB4A 3QTGA 4W4QA 4EE9A 3TYAA 4QHRA 3D3AA 1J0JA 1J5SA 1XIFA 4JEJA 3VU2A 2W63A 1UUMA 1A5LC 3PPGA 1RALA 3WF4A 3OQEA 1NIUA 3Q2DA 3K4WA 4TIMA 2Z1VA 4HA1A 3M5VA 4JD4A 1GOQA 4ZGYA 3CH9A 3MBFA 3LOTA 3W38A 2EPLX 2Y7DA 1LYXA 1W1YA 3LMYA 1WZKA 4NILA 4Z0JA 2NQ9A 1RLCL 4IGNA 1Z3NA 4FX8A 3LV6A 1EJSC 4FHAA 2FZ8A 2GGGA 3PZVA 4HYWA 1VAHA 1F76A