2PDFA

Human aldose reductase mutant l300p complexed with zopolrestat.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdfA00
5LIKX 3M64A 1GVEA 3BV7A 1YNQA 4XO6A 2ACQA 1MZRA 5LIWX 4JIRA 4YVPA 1RY8A 1S2CA 2ISFA 3QKZA 1QWKA 2NVCA 2HE8A 3CAVA 3V35A 4JTDA 1LWIA 2A79A 4XZIA 3VXGA 2QXWA 4DZ5A 5KETA 1PWMA 1IEIA 1S2AA 4JQ3A 1OG6A 2PZNA 2IKGA 4WDTA 1AH3A 4XO7A 5M2FX 4FZIA 1ZUAX 2IQDA 1AH4A 4IGSA 3V36A 1Z3NA 2ALRA 1R38A 5DANA 1XJBA 3UZWA 3Q67A 2F38A 2PDUA 2HVNA 5HNTA 3LZ3A 1A80A 2PD5A 1Z8AA 4JTCA 4JTAA 4XZHA 3WBWA 1YE6A 1VP5A 1Q5MA 1AZ1A 1IHIA 1X96A 4YU1A 4EXBA 2PDIA 1ZQ5A 4YVVA 3H4GA 2IKJA 3R43A 3O0KA 4QX4A 3R58A 3F7JA 4AUBA 1PZ0A 4LAZA 4PMJA 5AZ0A 3R94A 5LIXX 2INEA 4HBKA 4IJCA 2PDJA 3BUVA 3U2CA 4XZNX 4L1WA 4I5XA 4PUUA 2FZ8A 4PUWA 1XGDA 1EXBA 4YVXA 3UYIA 4NKCA 4PR4A 3ERPA 3H7RA 5C7HA 3G5EA 4LBSA 1S1RA 4R9OA 1VBJA 4EXAA 3R8HA 2PDBA 3M4HA 1SM9A 2I17A 3LQGA 3ONBA 3P2VA 5AZ1A 4HMNA 2HVOA 3N2TA 4XK2A 1K8CA 1J96A 2HE5A 3RX4A 4QR6A 1RALA 1YE4A 1C9WA 4FAMA 4WDUA 3LBOA 2FZBA 4FALA 2PDXA 3RX2A 3GHUA 2ACSA 3LZ5A 1ZSXA 2PDGA 2IKIA 3S3GA 4PRTA 1QRQA 3LNMA 3CV6A 1X97A 3DN5A 2R9RA 2PDCA 4JIIX 3EAUA 1X98A 4XVDA 1MI3A 1RY0A 2IQ0A 1AFSA 3NTYA 3T42A 3CAQA 4QXIA 1AH0A 2IS7A 3RX3A 4LBRA 4JQ1A 3UZXA 3KRBA 3GHRA 5JH1A 4IJRA 3R6IA 2ACUA 4L1XA 4Q3MA 3FX4A 3ONCA 2IPFA 2IPWA 2AGTA 2FZDA 2BGQA 4JQ2A 1MRQA 2C91A 2PDFA 4ICCX 2PDLA 3EB3A 3UGRA 2WZMA 2FGBA 3UFYA 1ADSA 3UZZA 2FVLA 4LAUA 3MB9A 2DUZA 4JQ4A 1YNPA 4GABA 1M9HA 5HA7A 2NVDA 2PDPA 4GCAA 5HNUA 1HW6A 3GUGA 1Q13A 2HDJA 3CV7A 4GIEA 3LUTA 3WBYA 3D3FA 1PWLA 3UZYA 1T40A 1AZ2A 2PDKA 2INZA 1XF0A 2PEVA 4WDWA 2DUXA 4F40A 3CMFA 4LB4A 4MHBA 3G1RA 2BP1A 4H7CA 1EL3A 3BCJA 4FA3A 3EB4A 2PDYA 3LQLA 1UR3M 3UG8A 1T41A 2PF8A 3GHSA 4DBSA 4G5DA 4DBUA 2PFHA 4JIHA 2PDHA 1EF3A 1PYFA 3COTA 2ACRA 4GQ0A 3GHTA 3LENA 3MC5A 3R8GA 2IPJA 2J8TA 3WG6A 1HQTA 4JQAA 2PDNA 5LIUX 1JEZA 2HEJA 4WGHA 3C3UA 2CLPA 1FRBA 4GACA 3WCZA 3O3RA 4OTKA 1Z9AA 2PD9A 3LEPA 3B3DA 1LQAA 2F2KA 4QBXA 4ZFCA 2R24A 1PZ1A 2DV0A 4YS1A 2PDWA 3DOPA 3M0IA 4WDXA 4H8NA 2BGSA 2PDMA 3V0SA 3H7UA 2PDQA 4JTRA 3V0TA 5LIYX 4DBWA 1S1PA 3WBXA 3N6QA 4XZMX 4XZLX 3FJNA 1US0A 4XAPA 1Z89A 4JTQA 2HV5A 3R7MA 3LD5A 2VDGA 3V0UA 3BURA 4LB3A 3CASA 5JH2A 2I16A 3LN3A 4ASTA 4GQGA 4PRRA 3UP8A 2P5NA 2IPGA 4Q7BA 2WZTA 4RPQA 3Q65A 4WEVX 1EKOA 4XVEA 1ZGDA 4GA8A 2IKHA 3UWEA 2FZ9A 4WRHA
chains in the Genus database with same CATH superfamily
1MXSA 3R1ZA 4KRTA 2G4FA 2AMGA 1X8FA 4GIAA 1V6YA 4O14A 5DXXA 1DEDA 2WJFA 3UF9A 3GDTA 1UIPA 2D23A 1CECA 2OX1A 5CG0A 1QWKA 1IWBA 2VGIA 5AVNA 3BAIA 2UY2A 3BE7A 3A9BA 3KOXA 1YNYA 5CXPA 2A7RA 3F4WA 4LS1A 4HA0A 3U2OA 1O66A 3ZVHA 1PX4A 2YXGA 4UTHA 3A4JA 1K4HA 4KEUA 2O9TA 2QCEA 3VKBA 1X1ZA 1G01A 1V77A 5HMSA 1UROA 4V1YA 3BCFA 3SRKA 3ZT7A 4DJFD 2HPIA 3ZS4A 1Y5VA 1B4EA 3N4AA 5KMYA 4TVDA 7CGTA 4PCTA 2QEZA 3WN6A 3B03A 3SFKA 1UR8A 4XISA 2RFGA 4E8DA 3U3HA 1W56A 1QWGA 9RUBA 2PD5A 4OGZA 3TP4A 4XZHA 4N42A 1YIXA 1CNVA 1IHIA 4JY8A 3LU2A 1DHKA 3VNJA 4MUZA 1WDWA 5EMMA 1EA9C 1M3UA 4S3EA 3JVAA 1OFAA 1N8WA 1J10A 4Y2WA 5M17A 3VU2A 1OX6A 4XTDA 1JGIA 1Q3NA 2C71A 3F7JA 2OFJA 2PRMA 5HXMA 2XINA 3IJ8A 2BFGA 4UMBA 1R2SA 3QKEA 3MKCA 3FAXA 1UHVA 1FQ0A 4WSHA 3T0CA 2WVSA 2VRKA 4GCXA 4I5XA 1QO2A 1GOXA 6ALDA 1ZFJA 1UZ1A 2FZ8A 3VMNA 1GKRA 1F76A 4M82A 4AZCA 1VJIA 1XYCA 5B80A 1DWFM 3I4KA 3WNKA 2VKZG 3PPCA 3CQHA 3BJTA 2DY3A 2ZRZA 3QOMA 2OEMA 1W3TA 3PM6A 1NDYA 3ABRA 1KCKA 3NM3A 4J7RA 2YPIA 4KRZA 4YJ5A 2OOGA 1GG1A 2XWEA 2H9AB 4Q4OA 4WY0F 3N25A 4KPLA 4QDWA 2ABAA 1E5JA 2NQHA 3T55A 3VABA 1P7TA 3WJWA 2GGEA 5CZSA 4CCDA 3D5HA 4IL0A 1XI3A 4WDUA 1RBAA 3PTDA 4DY1A 5A6KA 4RX0A 1LP6A 1XYFA 1OFPA 5HBFA 1U1UA 1VD6A 3WL0A 4MYAA 2Z1KA 2EJAA 1HG3A 4PUNA 3Q94A 2JF6A 4BWLC 4HHPA 1C8QA 1A3WA 2YBTA 4XV0A 2RJGA 4GNKB 5FJJA 3RNDA 2DPEA 4R7OA 2EQDA 4DUWA 4B16A 4ICNA 3VDBA 1ZP3A 1IZKA 1YXDA 3N1AA 1XWYA 1RPXA 2PRHA 4O10A 4IIDA 3O63A 4NYUA 1WOBA 1W3JA 4LVDA 1LL4A 1GQJA 4LBRA 2Y4SA 3NUKA 5CGMA 3KRBA 5FAGA 2ZXAA 3R6IA 1GJWA 1KXVA 1AODA 1TSIA 3KX6A 3CIXA 1JFXA 2IPFA 4KESA 4U5KA 4NZ1A 4JQ2A 1CT5A 4RZBA 4E0CA 2FTPA 1XLMA 3OJGA 3NQEA 3S1VA 3NQCA 2XFYA 3BLDA 3UFYA 3GW3A 5CSYA 3ZWSA 1Q65A 4QQ3A 1M7PA 4IUOA 3WQ8A 4PMDA 3MMDA 4AU0A 1TTIA 1XLDA 2XU2A 1W5OA 1XLFA 4PZVA 1XCFA 1TV2A 3EYPA 1E1EA 1FDZA 4D1JA 5H8PA 2X16A 4GHRA 5FL1A 1VPXA 5J8LA 3WD3A 2Y7DA 4MMWA 4HA1A 1GVQA 3KP0A 1LROA 1J9YA 1SR9A 4I7UA 3GY1A 4XX6A 3ELFA 1QR7A 4NJHA 3UG4A 4JTGA 1MUMA 4GZIA 4PODA 5FJPA 4L80A 3CGTA 4JTFA 1OX4B 2ZE0A 5A1AA 3BCJA 3ARTA 1MVYA 2RKXA 1ZENA 3PUDA 3NA8A 3WKZA 3BQ5A 1K6AA 2WHJA 1TREA 3IJQA 3EWYA 2B7PA 4JN7A 4N6FA 4NIRA 1W54A 5J04A 4UCFA 5AYBA 3JW7A 2PCQA 4L9YA 5AYYA 4LXFA 3O15A 1YDOA 1OYAA 2J77A 1Q8JA 1BXBA 1X7IA 3SSZA 3DYOA 3HO8A 4FIQA 2YZRA 3WCZA 5LA1A 3PNUA 4NNAA 3CK5A 1ZTVA 2A4AA 5H91A 1SJCA 2QPXA 3W7RA 4AIUA 2QCFA 3IIOA 1BTCA 1PZ1A 3SJNA 2TRSA 1KC7A 2EG7A 4Q4SA 3M0IA 3AIUA 1ZS2A 1SW0A 5FD0A 1KFBA 1EWDA 1DJXA 1S1PA 2Z29A 4F66A 4LUJA 3KFTA 1XR2A 4Y9NA 2E5DA 3S6DA 3WLQA 1JG9A 1A5BA 4DF1A 3I3BA 3W86A 4L7ZA 1GYLA 3DG3A 4S3CA 2HMCA 4DBEA 3PZGA 3SY1A 4ASTA 7REQA 2Y61A 1FWEC 4S38A 1XGEA 5REQA 4YLWA 3M0KA 4CU7A 5U7SA 1OCNA 3ZO9A 1QDSA 1W1VA 4OOUA 2OKOA 4CD5A 3KDNA 4JIPA 1TIMA 4POCA 4E2BA 3H2EA 4G56A 2FPYA 2XFWA 2C79A 2Y8KA 5ABHA 3LG3A 1RY8A 3UG5A 4MKSA 5EMYA 4OIFA 2XWDA 3PS7A 3HQOA 3H6OA 1TV5A 3O07A 3U0HA 3GDBA 4ZR8A 1GQNA 4B90A 2PWEA 1W6TA 3ISIX 3WH8A 5BZAA 2GJRA 2V3GA 3B06A 3ZJ8A 3CHEA 3GFZA 4Y6GA 4M0XA 5H8MA 3RPTA 3TWAA 4HA4A 4H8VA 3O6YX 3NL2A 3TH6A 4L4LA 4D6DA 5H2ZA 2R1PA 1XLJA 3GTNA 3XISA 3KDOA 1AL8A 3F4CA 5AB3A 2EGZA 3G1SA 4YMZA 3NDZA 2ALRA 1UBSA 1KV8A 4AXNA 4S2BA 2PCEA 1UUMA 3PUOA 2OR2A 3AO0A 2POTA 3W27A 3PANA 5AC4A 3NOYA 4NRSA 3E49A 2Z26A 4IMAA 4LS2A 3TROA 1TZ7A 2XYLA 1F3EA 1AA1B 1TR9A 2B4GA 3QC0A 1G94A 1K3UA 3S9IA 2UV8G 1E43A 4D8AA 3BG9A 1OEPA 9XIAA 1FDJA 1WXZA 1I0BA 1IIHA 2EG8A 1MSSA 4ZXOA 1H62A 3FN9A 3NSXA 2XIOA 4GJIA 4GIYA 1UP2A 1WUFA 3EZ4A 3VD3A 4ROQA 1R85A 4XZNX 5I2UA 2UY4A 3IUIA 2C3ZA 1TRIA 2PLMA 4ZO7A 2QDEA 3IVTA 3I4EA 3OA5A 4NKCA 2BODX 1V03A 4PR4A 4ZZ9A 3ID7A 1KM6A 2V3DA 4LUSA 1FWRA 1UIOA 3TYZA 4KCUA 4GJ1A 3MMWA 4EAYA 1VLIA 1VJZA 1ITCA 1QNVA 3EXSA 3PNZA 2VVNA 1V7AA 4D6JA 1QHPA 4ZQRA 4FAMA 1AQHA 4NT0A 2AL2A 3SCQA 1M6JA 2VI0A 3STFA 4MLRA 3WLIA 2PGRA 1H49A 1XM3A 4INFA 2Z24A 1X97A 3R89A 4HP5A 2GVJA 3ARSA 3WLNA 1TV8A 5E0KA 3PPFA 2GJXB 1H51A 3LY0A 7PTDA 2ZKMX 1S5NA 3WFAA 5A69A 2G0WA 4MFEA 2FFIA 3MBFA 5FACA 3WNPA 3IEBA 1FH9A 1RQBA 2I14A 5AVHA 1PIFA 3DHPA 2WC3A 5D2VA 2PWVA 4C6CA 4IJRA 2ACUA 3R5EA 4Q3MA 3FX4A 5AHIA 3HN3A 3LI1A 1OZMA 4M80A 3GVQA 3PBMA 2BGQA 3PBWA 2OYKA 3GNNA 3WY1A 3TDFA 1A5LC 4CKQA 3V5FA 1N8IA 1QNOA 1O6IA 5TIMA 1VLWA 2A85A 4GJJA 2B31A 1NVMA 3OGRA 2A3CA 1Y8BA 1A5UA 1PKMA 2G3NA 4F0KA 4DWSC 3CQJA 4AY1A 2ZTJA 2Z1BA 3VGDA 4U5IA 2XVNA 7XIMA 1OWQA 1XKJA 1JYVA 4UTJA 2Y5EA 3DGRA 1MNSA 3U9IA 4AZHA 5GJNA 3PAJA 1XYBA 2Z1VA 1MUWA 4L9ZA 2OWCA 3NNTA 4GUFA 1MW2A 1CIUA 1WQ5A 3QQWA 1SZGA 2GL5A 3GE7A 3PZIA 3BOXA 3H2MA 4UTMA 3GVVA 3ZVIA 2CITA 4Q8OA 1TJ1A 1DWHM 5A6TC 1LJYA 4RK8A 1TX0A 2OEKA 5JU6A 3VIGA 3EB4A 3UG3A 5CZTA 1V6XA 4DPQA 2PF8A 2NT1A 4EIVA 3P8JA 4W7VA 1GW9A 3CU2A 4FNUA 4W7UA 3TNOA 1QOPA 4RE2A 3A22A 1E4NA 3FA4A 2W63A 3MWCA 5I6SA 3W84A 3UXIA 1TJRA 1Q6LA 1PKLA 2ZE3A 3GTFA 3VINA 4HPXA 4XIAA 3SCVA 2OX4A 2PD9A 3B3DA 3MWAA 3MUAA 3LCLA 1EH9A 3ZXWA 1ITXA 8A3HA 1E73M 5L9FA 1IZJA 3U2ZA 4DF0A 2HVMA 3WDQA 3CZLA 2ISWA 3W1XA 6TIMA 1GHRA 5F2GA 1JXJA 5IFTA 1DTNA 1FTXA 2OXNA 4GLEA 1FWTA 1MW0A 4XZLX 2DIKA 3RJYA 1HVQA 4GI9A 2OTDA 3TNBA 2E7FA 3C86A 1E55A 5A8QA 1A5NC 2O0TA 3CUFA 4H9YA 2EKCA 1QK0A 3F2DA 4JNMA 2XIMA 1BVNP 3C0SA 2YGYA 2J7BA 3EMCA 4Q8MA 1J0YA 4KWUA 1OX5A 4MNJA 4Q7IA 5LSMA 1OK4A 4GQGA 3WMLA 3ITXA 4D71A 3PY2A 1VC4A 2W5FA 3B8TA 3MUCA 2YYTA 4JTEA 5DRCA 1GCYA 1C93A 4O8AA 4ZB5A 1R3YA 2EEXA 8CGTA 2WVVB 3GW0A 1ZL1A 4JD4A 1Z41A 5BWFA 1KQZA 1XIDA 3VIIA 5K7JA 2V2DA 2YCEA 2Z1XA 3L67A 1SMAA 3S9ZA 3T0DA 2J79A 3KAOA 3W75A 2ZZ4A 3WF3A 3B0PA 3KBSA 5ABEA 1KW1A 1S2AA 4UR8A 4WJEA 2J6XA 4MNLA 3SO7A 4BI7A 5HPCA 4O12A 1B1YA 1WX0A 4Q8TA 3RM4A 3H12A 4CNSA 1H2JA 2BOFX 4UTTA 1TUFA 2NV2A 2FZNA 1KM0A 4KT2A 3LLXA 1EGVA 5JBEA 1W2VA 4PMVA 3UJFA 1P0DA 2GYIA 4TVCA 5FEZA 3N19B 1XRVA 4W9TA 3ZSTA 1VP5A 1QI5A 3W1RA 3LLDA 1CENA 3HGRA 3MO7A 3UA4A 1E0XA 3MSDA 4A6GA 3P6LA 4G2DA 3A6OA 5BRQA 5D2YA 3K4DA 4OOZA 3HURA 3W2JA 3ZLHA 3R58A 2WHMA 4P7LA 3PFMA 4ZGYA 4L65A 2GPTA 4QG6A 1H50A 4X2PA 3VC5A 2VFEA 2C1GA 2GUYA 5T9BG 3KL5A 4XAGA 2PDJA 5KSWA 1ITQA 4F79A 4KEZA 3SIMA 3WLPA 2CLHA 3FHQA 3LSCA 3U2EA 3EOLA 3A9IA 1W2PA 4R34A 2J78A 4GI8A 3IJ7A 3D3AA 2B7OA 1XCXA 2FKPA 2H9AA 3TAKA 1JNEA 2WSPA 2YCIX 4I5RA 5ABTA 1Z69A 4AD4A 5C71A 1H4PA 5I3KA 1H1NA 2J47A 5AZ1A 3T44A 1W1A1 4QE1A 3ZZ1A 1H7XA 2CCRA 4PMXA 1T5AA 1DWAM 1K8CA 4QLLA 5HJLA 3VCNA 1TVLA 4DN1A 4F9JA 4X2RA 3AS2A 4A35A 3CS2A 2NXHA 2E25A 1EPVA 3GTXA 5C2XA 4PCPA 1OCJA 3ARZA 2OKTA 3K13A 4MJ4A 1QRQA 3G8EA 3VGHA 1L6YA 3RXZA 1GOIA 1XIFA 3LCGA 4JL1A 2VOTA 3ATZA 1X98A 1KM2A 1Q85A 3PF3A 3WDRA 2VD8A 3BLEA 3P5YA 4AYGA 1MI3A 3KZPA 3BSGA 1LBLA 1H0IA 1J8VA 4LY8A 4JYDA 4O18A 4A8NA 1A4MA 2DZXA 5HOSA 3IGSA 2XH7A 4H6EA 3UPMA 4D6IA 1O4UA 4H9ZA 1BLIA 1VYPX 1U1JA 3ARUA 4ECLA 2G95A 1VFUA 1RCOB 3WLRA 3NSNA 3TYCA 4IMDA 2BXZA 2I5QA 4AISA 5KZ6A 5CPNA 2R1KA 2J7DA 4MUPA 2PDFA 3WD2A 4PTNA 1K8YA 3UQNA 1FFRA 3PUEA 3PJXA 3BLIA 2XFRA 1XSKA 1W37A 1LM1A 5T26A 3NZ1A 4AC1X 1MXDA 4P8WA 1C90A 4CD8A 1E40A 2GVGA 1F9CA 4Z1DA 4B15A 2OT1A 1V0MA 3ZMRA 1VENA 3G22A 3EA2A 4LV9A 1QNQA 3VILA 1OX4A 5AC7A 2O4QA 2NUWA 2X2GA 2NQZA 2QYGA 1O5KA 1ALDA 3A3WA 3RR4A 2FDSA 3E2VA 1A3HA 2HRWA 3GG8A 3AWNA 3OG3A 3UD6A 1S5MA 4LW7A 3MV11 5AC8A 4AXKA 3H2OA 4CVWA 3ANUA 4J28A 3W7PA 4G5DA 1SMDA 1CXKA 4C1NB 5E6YA 2YDAA 4RNFA 5T9CE 1QNRA 3CL6A 3COTA 5EPDA 3LI0A 4DIAA 4JFSA 1TIWA 2HZGA 3BICA 4GYPC 4Z2LA 4HPGA 5CJ5A 4JQAA 4N0RA 3HG3A 2V67A 4RZ5A 1YLVA 3W87A 1I60A 4LRSA 1XLEA 2CLOA 3C3UA 3GU1A 4GACA 3VKDA 1W1ZA 1WZLA 2QUVA 1OB0A 3MZNA 3EWWA 6TAAA 4KWSA 4FSAA 3GBEA 4PULA 1Q63A 1EHNA 4YTRA 4IOTA 4LGXA 3MW7A 1SFTA 3A4AA 2E6FA 4H8NA 4WDXA 1LQ0A 4BEQA 1Q6EA 3IIXA 3LSBA 4AB4A 1CLKA 1XHGA 3SAZA 2EBNA 4S3FA 2PSNA 1NSJA 4JCLA 4LUTA 1VF8A 1SVDA 2V8ZA 5FF7A 3GNXA 2UBPC 4NAEB 1KV5A 2G37A 3MTWA 4PB5A 3U7VA 2BOGX 1SZRA 6XIAA 1X6NA 3AOFA 3VIHA 2W61A 4W88A 4TMBA 3QGVA 1KWKA 3DU0A 2AAMA 4JFTA 5DX7A 4D2JA 2WZTA 4RPQA 2YFOA 3CZGA 1S38A 4M51A 1TPVA 5B7YA 3ZJ6A 1W9DM 1PX8A 2ZUVA 2CKRA 4FLQA 3IK2A 1A49A 3ZWTA 3EB2A 3M5YA 4UFHA 5T8GA 8TIMA 3ZT5A 1UD8A 3M0YA 1FY6A 3QVQA 3AHYA 2WHLA 1UZ4A 4AX6A 2MUCA 3UZ5A 5I24A 3LV6A 3VI2A 4WOQA 1JZ3A 3V35A 1XGZA 2TYSA 1DORA 3RK8A 3WUFA 2A79A 4HJWA 2XH2A 4ZOEA 1WNOA 1VYSX 1A0DA 1CX9A 2C6QA 4AZ5A 3RR1A 4IICA 5LKYA 2ZXQA 1PTAA 4WDTA 3SCOA 4NYYA 1HGYA 3OQ8A 4N02A 3K46A 5AC6A 3ECQA 3GZAA 4O52A 3V36A 4NX5A 4JYEA 2YYUA 3Q37A 5I3HA 3Q67A 2WJEA 2B7NA 1O5QA 3AJ7A 4ZB2A 2FH8A 2XHYA 3WBEA 3WJXA 1UPMB 2A2IA 4ORMA 3H4WA 1UB3A 1Z8AA 1XSJA 1PE1A 2OLSA 1X96A 4R85A 5I7GA 7TAAA 1RP8A 1KBBA 2Z6JA 4PTMA 4HJFA 5FJTA 1NP0A 1UASA 3NVDA 1J12A 2GDUA 2A6LA 1QPNA 5FEPA 1OFEA 5FF2A 1J0IA 4ERAA 2G5WA 5XINA 1T6MA 2EG6A 3EKZA 4K7VA 2NX9A 4L1WA 4QS6A 1SO6A 5HWNA 1RUSA 3OG2A 1JRCA 4K1GA 1JCJA 4MYXA 2WZEA 3A23A 2J13A 1V3KA 2DZPA 2JGQA 1J11A 3AMDA 1HJVA 2V63A 1SZEA 5LXXA 4AD3A 2V5CA 2VZOA 1H7OA 4HU8A 1XYAA 3T0BA 2OCZA 1Q7MA 4XK2A 2PBOA 4B4FA 3TTOA 1M68A 1S39A 2YCJA 4L4MA 3L2IA 4J40A 5AYIA 3SEPA 4FALA 1JCMP 2I1OA 3RX2A 3CHCA 3DC0A 1LCOA 2YBVA 3M6DA 2GJXA 4B3ZA 5LHFA 3S5SA 1JJKA 3S3GA 4I90A 5LA0A 4B2DD 3DKJA 3LNPA 1UCWA 5BOEA 5CKSA 3L21A 1K9EA 1EHAA 4Z2HA 1LL6A 3REQB 4HOWA 2SFPA 4U10A 4JBRA 4PFMA 1GGOA 3NURA 4Q6XA 3AIRA 2O4MA 2H8XA 3VE7A 1L2UA 1H61A 4MNKA 1W3NA 3W81A 2GLKA 4UNLA 3IJ9A 4HQVA 1XPYA 4CNNA 2ZA1A 4HNTA 3K5XA 4OWGA 1TMQA 3S83A 1LQ2A 4LOCA 3K8LA 3N2CA 4E6MA 1M7OA 3EWCA 4MDOA 2OEJA 5RUBA 4IX2A 4E2OA 1B54A 1RHCA 4ZE5A 3S47A 3W7LA 4CQBA 3HQNA 2WZMA 3BO9A 3UR2A 1DP0A 4LS0A 3RAOA 2V5DA 2R1MA 3QZEA 4BHYA 3PR2A 4JKLA 3QTPA 2QT3A 3N9SA 1QI0A 1P43A 4U3CA 2NVDA 4V33A 2CU0A 2ZC1A 1P0KA 3GUGA 2ZBTA 4RW3A 1ISVA 1B3XA 5CSUA 1BGAA 2E67A 3EA1A 4W4QA 5D2TA 2XGZA 1BQCA 1IR1A 1G0CA 2V68A 1AK5A 1EWEA 1OHLA 1XBYA 4AD0A 1NEYA 1UPPA 3S0CA 3TK7A 2YB1A 4KIRA 5DXYA 5G4WA 2WZHA 3BXWA 1D7KA 1M53A 4DBUA 3PZUA 1PIIA 1LWHA 2HNHA 4QGCA 1R47A 2ZUSA 4O53A 3WD0A 1Z42A 4LU0A 2DSVA 2VGGA 4J3ZA 2RHGA 1Q6FA 3WG6A 4DZHA 5FOOA 3V1PA 3GQYA 4OTKA 5AN7A 1T99A 4JTKA 4XKYB 4UTUA 2KZHA 2BOEX 1OABA 3ARXA 3HBLA 3QJAA 4GY7A 3BLFA 4ZBCA 6ENLA 4C6EA 1TWZA 2BGSA 5M1TA 3WLOA 3MVIA 1HKMA 2J7EA 1LORA 1OY0A 4O50A 4KGJA 2D20A 1EBHA 4ADUA 1PZ2A 1MO0A 3R7MA 4JAWA 4FS9A 3FVDA 3MV01 4MY8A 4S1FA 1W1B1 3WQ6A 4S3DA 1HP4A 1YBQB 2PB1A 3DX5A 1W3KA 5FJOA 4R9XA 1H41A 1NOWA 4IXXA 2WVVA 2WXDM 3NM1A 1F3WA 2JALA 4DAFA 5I3JA 1HXJA 3UA3A 2BV9A 5A6SA 3FJLA 1UWSA 1JL8A 4M3PA 2PP0A 2BVWA 2A3AA 5HQMA 1ZCCA 2EJ1A 3EX3A 4FOJA 4HHMA 3MHUA 2P3EA 2OSWA 3PTKA 4JX5A 2YCKX 1M7XA 3NQFA 2HE8A 3OGSA 3OVRA 4ZO8A 4R5EA 3QGKC 3OU8A 5KETA 5A8GA 4C6BA 1QVBA 5KEZA 5KZEA 4FXSA 3VGFA 2WNQA 2TSYA 2IKGA 5D37A 1M04A 1SUXA 4B3KA 1X8CA 1NP2A 2WK2A 2VEPA 3R2GA 4FZIA 1XX1A 1GK8A 1JZ8A 3UJRA 3OLIA 4HK6A 4XQ6A 3T4CA 4E4UA 1A80A 1OZQA 5IM51 1M03A 3SM0A 4YCPA 3QY6A 1VJSA 1E70M 1WA3A 3VGGA 1XP3A 1QBAA 2PGEA 3W9ZA 3AI0A 3OLGA 1VEPA 2ZWZA 1T7LA 1E15A 4I7WA 3VD4A 2I57A 1ISZA 3SJ3A 1VFMA 1W91A 4NI8A 4Z17A 3ZT6A 4GI6A 2HS6A 5CEWA 3TTQA 3CUZA 1UYQA 4LF2A 1DVJA 1TRDA 2OELA 4HNUA 4IIEA 4UTWA 4KCVA 3LPFA 3DENA 1EZWA 1XISA 3FSTA 3W1LA 3V7PA 1W32A 5I77A 4TMCA 5A8NA 2W6RA 2RJHA 3G0XA 3TTYA 4P2VA 2OGJA 1SM9A 3W7DA 1QASA 1ZP4A 1JPMA 2CLLA 1MFVA 4TXEA 4QJ5B 1TX2A 3PPGA 4LY4A 3WFLA 4ACZB 2YXOA 1D7FA 2F84A 3GK0A 3QR0A 3I10A 4EE9A 3WEMA 3ANVA 3KOZA 3L2LA 2FGLA 1SU5A 1B3ZA 1HO4A 1NWUA 1ZNNA 1ZSXA 2OO6A 3BL3A 3W2UA 4F8XA 2VX7A 1FWJC 5JIPA 1FWHC 1QCWA 2EPLX 3GU2A 3F03K 3I3DA 2PWGA 1W5PA 3CUHA 3T7VA 2PDCA 3MJYA 4DLMA 1ZAIA 3ARWA 2XVGA 1E3XA 4M81A 4XVDA 4PBFA 1KGUA 1RY0A 3TZNA 4FNQA 5HMDA 3EX2A 2D0GA 5BRBA 4R27A 4OBTA 2JEPA 1ICSA 4C6QA 2WPGA 1WDSA 4YWIA 5FJIA 1UP3A 3TZFA 3VOJA 1LBFA 1DJWA 2E5CA 1GYNA 4B5VA 1IGWA 3VNMA 4O16A 4GVGA 4UBPC 3ZIZA 3VD9A 3LMYA 4JHMA 1EQPA 1VEOA 4K7YA 5DCEA 1MW1A 4F2UA 1HL8A 1QHOA 1WDPA 3SW6A 4UQCA 4US5A 3RLUA 1JFHA 4A3QA 3PG8A 3EA3A 4NJKA 2FVLA 4M7TA 3JR2A 1T8XA 4CNTA 2PTYA 4L5ZA 1R9ZA 4UQEA 4GABA 3FYOA 5EMLA 1XV8A 4K3ZA 3QFEA 3B8DA 3VGBA 5CCZA 5F4WA 1I4NA 2W79A 1H7WA 3ARYA 4S23A 3SUSA 3PB0A 1SR0A 3UESA 1DWIM 5GNZA 3CUIA 4HSOA 2NUXA 4GGBA 3IACA 2INZA 3B8WA 3ZLGA 1Q4NX 3INPA 4W87A 3CYJA 3G0SA 2BB0A 1Q6GA 4HCDA 4Z1CA 4EPKA 1EEPA 1DIDA 2HWGA 4H7CA 4IISA 2QJNA 3IARA 4UR7A 4FIRA 3SURA 2OZ3A 4N9EA 1E51A 3A64A 3GHSA 4JIEA 1GZJA 3GIQA 3TN5A 4L6OA 1JCNA 1ZBKA 4RXFA 3CZ8A 1IT8A 1Y5XA 1BF6A 2FLIA 5CGTA 2XN1A 4NRRA 1E0UA 1HKKA 2Y2WA 3PBGA 4GRSA 3AMKA 2HNEA 2W3ZA 5LIUX 3NVTA 2HEJA 3V18A 2C0AA 1V02E 1CB2A 1B3WA 2YJQA 3O3RA 5IRPA 1X6LA 3ZVHB 2EKGA 1E1CA 2JFEX 2POZA 1GOWA 3FSUA 4A3HA 2DV0A 2X1TA 2CLMA 5JUVA 1M1BA 1K4GA 4KWOA 4ZL1A 2QDHA 5DELA 1JZ2A 4PC8A 5LIYX 1ZJBA 4DBWA 2GWNA 4PA8A 2EHHA 2ZXBA 1W5MA 3PWIA 1VBGA 1NH6A 2ISDA 4ORIA 3PTMA 3FJNA 4J1OA 2OYMA 1Z89A 4UMAA 1DJQA 2CFFA 3VMOA 4LV4A 5A8MA 4ZTXA 4AMAA 3UWQA 4O17A 3IJ6A 5AHEA 4DLFA 1NF0A 3BSMA 1FWNA 3WQFA 1W1TA 2ANUA 5BWAA 1UW9A 2YXXA 3PG9A 1XLKA 4OV9A 1EO7A 1IGSA 1LWJA 1AUSL 4QS5A 3N9RA 4JHOA 4B2DA 4GA8A 3V3WA 3URBA 3SN4A 3PSWA 3M9YA 1B30A 3KTXA 1H11A 3WEZA 5D04C 1FA2A 4LWWA 1J5SA 5MHBA 3RU6A 2DH2A 2XPKA 3LHZA 5LIWX 1XBVA 1RXOB 3B97A 4IMEA 1TVNA 3FEQA 3GDKA 1IT0A 4X0NA 3VX1A 3WQCA 3CL7A 3TONA 2O7QA 1C91A 3BMVA 1TPEA 3E5BA 2R1LA 3U5YA 1DJYA 4PUKA 3HG4A 4PL2A 2X1UA 4UXDA 2QF7A 1ZUAX 1ITUA 2IQDA 3KWXA 4MJ2A 3CB8A 5AHMA 2JGYA 4Q8PA 3TU9A 2O9PA 3UWZA 4EVZA 2W92A 1HGWA 3UVAA 1JPHA 1CGWA 5HNRA 4HGXA 4WXYA 3STPA 3R11A 3E0WA 3IUDA 1VPQA 3NZGA 1TMLA 2P10A 4DVOA 4I9TA 3L4UA 4NJGA 3H4GA 3FDGA 3L0NA 5I0DA 3L4ZA 4NZ5A 2ZRVA 3T8QA 3DHFA 2R14A 1O1HA 3R94A 2INEA 4TV6A 3WDIA 1B9BA 2QV5A 2ZZ7A 4KWVA 2NSXA 3OB8A 3SDOA 4BI6A 3UNDA 3LCXA 3WENA 2GOKA 2QF8A 4HCLA 4JGDA 1L8NA 5AC5A 2NQJA 3IJIA 4Q22A 5ENLA 5I3GA 2CHNA 5E9AA 1KGWA 3LHUA 4MY1A 1E71M 4AYSA 3GH7A 4I8DA 3HJEA 1M65A 4BCEA 1IXQA 1PSCA 2QIIA 2GDQA 3TN4A 3VKJA 4AWEA 2IQTA 4ZA0A 2XG9A 3VVGA 1MNZA 2E6YA 3BW3A 4W8LA 3G3MA 3KS5A 3T40A 3MANA 2VELA 3LMZA 3HG2A 2HVOA 1TO3A 3KOWA 4MG4A 5DT7A 2G3JA 1R46A 3JRKA 3C4UA 1HN1A 1YE4A 4N4QA 1V8EA 1EUAA 1HJQA 4LAOA 1PPIA 1UR2A 4FXJA 3CH0A 3LZ5A 1FHUA 2Y1HA 1XLLA 1FWAC 3H53A 4JTUA 3KTSA 4RNJA 1JRBA 4PMYA 3BAKA 4WKHA 4GQRA 2J9YA 1GQIA 2WM1A 1MQQA 1PS9A 1U5VA 4NHVA 2DGAA 4HN8A 2ZDRA 1PL9A 3B8UA 1AH0A 1F6PA 3NDOA 3M47A 3AICA 2WQPA 5E9XA 1R0MA 2OT0A 3WLSA 5JH1A 3ITOA 2DJLA 3T2PA 3MCMA 3EEGA 3LOTA 4DX3A 2WBGA 1ODZA 5E5CA 4YYFA 1UA3A 4HCHA 2DT0A 5BCAA 4RDVA 3PBVA 3PBUA 2CLKA 4DJEA 2GFTA 3OO2A 1EYWA 4DI8A 1WCGA 3KCLA 4AHQA 4LAUA 3F4DA 1WYIA 3LCWA 1KKRA 4K8GA 3GB6A 1E0TA 4JQ4A 3RPDA 3MVTA 3IGXA 2VWTA 1VIWA 5LGZA 2VXNA 3IIVA 2OPJA 4GIEA 3NPXA 1W9VA 2PE4A 2D69A 4J3VA 1OFRA 1QT1A 2FHFA 2HSAA 5CZJA 2XFFA 3CHVA 1DJZA 1AZ2A 3SB0A 4F48A 4P7OA 3MP5A 4TTGA 1ZPTA 3WH6A 2LLEA 2FHCA 4FF5A 3BPWA 3ANYA 3DFQA 1KO0A 3WNLA 2WJDA 4C90A 3BAJA 4HNCA 3URNA 2BDQA 2FJUB 1YTEA 3UG8A 2E4TA 1Y0EA 2BX7A 1B31A 2PFHA 3I7QA 3N34A 3IK4A 4FP1A 4PTVA 3AZSA 3ABOA 4UTTC 1Z44A 4XKYA 2ZRUA 4FOUA 2J7HA 4MWAE 2PDNA 2PF0A 1S2VA 3D6NA 5I03A 1RBOB 3MUXA 4EAMA 1VRDA 4MIMA 4GZEA 3GNOA 4GD0A 3N29A 3WJZA 1LQAA 4XD3A 1YKWA 2XVPA 1IE7C 5DBUA 3TA6A 4BK9A 3APTA 1CXIA 4HKPA 4MZYA 2BXVA 4X9YA 5DMMA 3UJSA 3EDDA 2D2GA 2OWWA 4H19A 4BA0A 3WQOA 4NZCA 1ZBCA 3SSJA 3TTSA 4QJ1A 4HMEA 3D0CA 3NZQA 2F8QA 4ENLA 5DCDA 1KXQA 2REQB 1YBQA 1WO2A 4MB4A 1AQ0A 1KM1A 4C7GA 1GORA 5FAJA 1JUEA 5CLTA 3PAOA 1IEXA 1A4LA 3SY5A 3RYSA 2WC7A 4QDPA 4GVHA 4IGHA 2VC9A 2ABBA 2YDSA 3IIPA 4KFNA 4L64A 2VFHA 2W27A 4H8UA 2A0NA 3B0UX 1VGAA 3IS4A 2JQXA 1PXGA 3JUGA 5CLWA 4Q7BA 1DJGA 3L0GA 1E4IA 4FNPA 4REQB 3DG6A 1DIOA 4G1KA 1R3QA 2GK1A 3VMPA 1OCQA 4ZXLA 1ZB5A 1GPWA 5LIKX 2NWRA 1HTIA 2PC4A 1GVEA 3KL3A 3VAVA 1PTGA 2VTFA 2ZQ0A 1KTCA 1V08A 1LUCB 4FI4A 3LDVA 1OGBA 1GT8A 2YCLB 4K37A 2RAGA 1EBGA 1GKQA 4AWTA 1G4PA 2Y89A 1ZZMA 4QHRA 4WF7A 2VX6A 3HV9A 3CPUA 1J2BA 3RLHA 2VC7A 1XICA 3FYYA 3SY8A 3WF1A 3W74A 4C6PA 1UD3A 4CQ9A 1CW2A 1R6WA 3BZGA 3EGJA 3DERA 3W53A 1DKWA 3LV5A 1Z3NA 4HZMA 4RDZA 1HJXA 4XSMA 3PWAA 4FOKA 2XTKA 3WNMA 3HGJA 2J66A 3QW3A 2NW0A 2BXYA 1OD0A 2NT0A 3BG3A 4R33A 4ZODA 4N9BA 4IQEA 3FA5A 2WLZA 1AZ1A 5HAOA 4W84A 1N7KA 4YU1A 3ZYZA 2DUAA 3VKAA 1WKDA 2IKJA 1K8ZA 2V82A 5AKQA 1E6QM 2Z1SA 4LVGA 5K9XA 7ENLA 4PMJA 2VZVA 3DFOA 4U2YA 4GIRA 1V6TA 3FEMA 3M43A 2ZX9A 1UR9A 7ODCA 3S5YA 3OP2A 5BXTA 3VM7A 1KLZA 3BUVA 3DFNA 2VP8A 3TXVA 1LLZA 4M5PA 4PUWA 3PJUA 4XBSA 3SR7A 1JR1A 3E74A 1SW3A 1LBMA 4Q8NA 4YVXA 3GRIA 4J5NA 3OVGA 5C7HA 4A4AA 4E3VA 1J0KA 5C6MA 1CGVA 3M0XA 2AOSA 4DB7A 1UKQA 1PKNA 2P76A 4US6A 4HMDA 3A12A 1AL7A 1HL9A 1OC5A 2I9UA 4U3AA 1TZZA 2ZX7A 2TAAA 4MSSA 1EIXA 4HMNA 1JYWA 4WQ6A 3AXMA 3OBEA 2X8RA 1MEWA 3MHFA 3N2TA 3R0KA 2HE5A 3UVIA 4QR6A 3AU6A 1ML1A 2R91A 2WYSA 5M03A 3WZ0E 2TPSA 4WGXA 2Y7GA 1ZJAA 3W38A 2QVHA 2Y6ZA 4IXHA 4AEOA 2ODOA 4QIUA 3M5VA 1A5AA 2Z1WA 4P5UA 4YTQA 2G4JA 3AS1A 4IL2A 3HGOA 3UETA 4JTTA 4DAIA 3M0LA 1QI4A 3W71A 2JIEA 3B4UA 2GGHA 4KEVA 2E77A 3CV2A 3CAWA 3GU9A 3W4RA 2ZUNA 3BSHA 3TJ4A 4CNUA 4DPPA 3RX3A 3MUY1 3KRUA 4JQ1A 4K2SA 3U4FA 1MEIA 3NQBA 3K4AA 1XQKA 4EP8C 3G1HA 2DT2A 5HUOA 1DOSA 4WKFA 1G4SA 1JF6A 1BKHA 3TE9A 1KBIA 5CBIA 3SRFA 4QROA 1ZJHA 4MPKA 1NELA 2ZDSA 4GQQA 4O1AA 2YKKA 3BLLA 4PTXA 3NQVA 4UQAA 4ICCX 2NLIA 2PDLA 4P8UA 1DJHA 3OLDA 3UGRA 4IIFA 4HTYA 2FGBA 2OWXA 1RQEA 1E9YB 3OZMA 3BARA 3KE0A 3KUMA 5HMFA 2B81A 1JDEA 1WBHA 5KTLA 2C15A 2JKEA 5AHFA 3E0FA 4L1GA 1LRTA 1V6UA 3POHA 3QQ1A 2OZTA 2XSBA 3TMLA 1LOQA 4N9DA 1QJWA 3WBYA 5ABFB 2XH0A 2VRJA 3NYZA 3AXXA 1KM5A 4WDWA 1CB7B 3BC9A 3CMFA 3ITYA 3CTLA 4MB1A 1EZ2A 2XSXA 1RLCL 4GVIA 1OINA 4HN4A 1J0JA 3EOUA 3FKRA 3FNDA 2RDXA 4IP4A 2ZX6A 3QLDA 4PMQA 1NDVA 1YPFA 1XCWA 2TMDA 2JBMA 4F0HA 1OIFA 3KRZA 4H2CA 2R94A 3R79A 2DH3A 2DSKA 3UY7A 4GQ0A 1XG4A 1SO4A 4CD7A 1XL9A 4GK8A 4B91A 2J8TA 3NPVA 4C7FA 2GGIA 4C5ZA 1VKFA 3CTTA 3PZ9A 3QHOA 3TR2A 4P8XA 1OM0A 2I5GA 4LVAA 3PN8A 1UBPC 3SCRA 4KERA 1L8PA 5EFDA 2PZ0A 3RPMA 3KBVA 4KRUA 3J7HA 1BF2A 1VCFA 5E0CA 1S5WA 3MQTA 3NQGA 4YTSA 1JDFA 2D24A 3A5FA 2G3FA 1O68A 3ARPA 3B04A 1US0A 5HANA 1KM3A 2WMGA 2J7CA 1XIGA 1G6CA 4AZ6A 3GIYA 1CLVA 2WMHA 1VH7A 3CIWA 1P6CA 5DN1A 2I16A 1PZ3A 4IIGA 5T91A 3VFCA 1LTDA 3IGUA 2RGMA 1WDDA 1KFLA 3CQIA 3WDHA 3IAPA 5IXEA 2AQOA 2XN0A 5BW6A 2WKLA 4DO4A 2QZRA 1JQVA 1ONRA 1YDVA 4FK9A 1BQGA 3UPBA 3UWWA 5D8ZA 3EWUA 5E09A 3PP7A 3G1YA 2V30A 2VNCA 1E0VA 4MZ1A 3UGVA 4JZ5A 3P5ZA 3B9NA 3CAVA 4JTDA 2J8GA 1UMYA 3AUOA 1SFJA 2QJMA 2QPUA 4RL3A 1U5JA 4L9XA 1ME8A 4TUFA 6XIMA 3OBKA 3GVRA 1TPH1 3QBUA 3TIMA 1VS1A 2WO5A 3FK4A 1BG9A 3RLVA 3GXPA 3A4WA 2PZNA 1UWIA 1EGZA 4JY9A 1C7SA 4JX6A 3VIFA 4NZJA 1OC7A 1SJAA 3KCOA 4DUVA 3CZKA 2AMXA 1JZ7A 4NJJA 1XRSA 4U33A 3WQEA 2OQYA 3UZWA 4BF9A 5K4ZA 3TC6A 4KETA 1QPKA 1KFCA 3BOLA 3KCJA 1FWSA 3BW4A 2Q8ZA 2WBKA 1KFWA 4GUIA 3WF4A 4Y8FA 4EXBA 3IJDA 4F0SA 1I2NA 3OZOA 4EK7A 3BAXA 3FXGA 3N4EA 1HJWA 4E4PA 3O0KA 4E2VA 5H1WA 5DY2A 5D2XA 5H6HA 4RPPA 2BY0A 1MUCA 1DWJM 1PIGA 2X7VA 2ZUWA 5TBOA 1GUVA 2ZICA 2YLAA 1TB3A 4IJCA 3MI6A 4CQAA 4JHZA 2Y85A 5CGQA 3QV7A 1EDQA 4PUDA 1NOFA 4CU8A 2O9OA 4B5UA 4Q4MA 4JL2A 3NL3A 4JICA 2Z4GA 1P0BA 3WO8A 1EXBA 4UQ9A 2QNEA 1D9EA 3UYIA 1LDCA 4EANA 4D6EA 3ERPA 5HJXA 2A6NA 5KZDA 3WQPA 2ZUUA 4A2RA 2QCCA 3RG6A 2JKAA 1K7FA 1QW8A 1B3OA 3LQGA 2BLEA 3TFXA 4W5ZA 3GR4A 4TIMA 4LBUA 3T05A 3VM5A 1JVNA 1BSIA 3L4TA 3M46A 1OYCA 1ADOA 3WF2A 2G3IA 4RXGA 4UZSA 3GH4A 2XJ7A 4PSRA 2ATMA 5CPLA 4B9YA 5HNNA 3TX9A 3L12A 4PCNA 3TFCA 1W3HA 3NQAA 4X63A 3G1XA 2Y63A 3FCPA 4AFYA 2BG5A 3B8VA 4DQWA 3CV6A 1J2WA 4J3XA 4O57A 4ZQOA 4QEHA 1XC4A 4JIIX 1C8XA 4YNGA 3MCOA 5K3VA 4H9MA 3THCA 3GXDA 3VZXA 3IGHX 3QW4B 2DSZA 4OT7A 2DORA 3WSUA 3NTYA 1IEVA 1E9LA 3TAOA 2B0MA 4JFUA 3V5OA 2WCAA 3O0FA 4BEUA 5F2LA 3VIOA 4MTVA 3MDUA 4ZENA 2P0IA 4O8RA 3L23A 4XD6A 1GOKA 2R6OA 3ONCA 4IH3A 5FEXA 3AQUA 4GZJA 2JIWA 4HZ8A 3ZJKA 5B7ZA 3B0XA 1EJTC 4P7RA 4PTWA 1AD1A 3TYBA 4GI4A 1NOUA 4IMGA 4DNHA 1VZWA 3QPYA 3W1UA 4C60A 2VFGA 3UZZA 1QU4A 3I6TA 1YADA 1NAL1 3A4XA 2EAWA 1CGYA 2CBVA 2PUZA 1A53A 3C2VA 3W1AA 2ZZ1A 4I3GA 1RK5A 4L6DA 3C0JA 4JN6A 4GCAA 4LUTB 4GG9A 2NQ5A 3APYA 3WMBA 2BWGA 3N3TA 1G7VA 4AIOA 4CN4A 2Z0IA 4H9VA 4NP7A 4TVUA 2AKZA 5A6MA 4O4VA 3T1GA 1BVZA 1GOOA 1UWTA 1BG4A 1BHGA 5D9NA 5D9MA 3RIKA 1BXCA 2XVLA 1XRFA 1TELA 3FDKA 3W88A 3L2MA 1DV7A 1V7YA 3E2QA 3LQLA 1DBTA 1GNXA 4BFAA 3DYPA 2WSKA 1HFBA 1TE1A 1F3TA 1UUQA 1K9DA 5AOUA 3TEVA 3W73A 2V5JA 2PDHA 4BI5A 4M6VA 3ABXA 4EKJA 3VDAA 3IVSA 5XIAA 3AIVA 3GHTA 1EIBA 3D47A 3MC5A 3FYPA 3G1VA 3ZR6A 1YQ2A 5DEZA 3ITCA 3RCMA 3BAYA 1XQLA 4Z0SA 3QC3A 4Q4QA 4UFKA 3MSGA 5G2HA 1PV8A 3U4AA 4MPQA 1RA5A 4WVXA 3FKKA 2REQA 4GZ7A 1RBLA 4CD4A 3EWZA 2BSLA 3H7UA 3WQVA 1G4TA 1WUEA 4JTIA 2W9MA 3TCSA 3TJXA 1IXPA 1AMYA 4R7WA 4TTUA 4TX9A 3AHVA 5AECA 2HV5A 3GDMA 1IIGA 1WZMA 1BD0A 4GYFA 4DYKA 4UTWC 3VUSA 3AZRA 5D9PA 4ZFMA 3RM9A 4REQA 2XM1A 4H3DA 3TQKA 3LN3A 3QZAA 5H8UA 2ZRYA 3RF9A 2V81A 3KLKA 5CC7A 3W6MA 4CCEA 2BS9A 2V9DA 2D73A 2GZXA 4WEVX 2VX5A 2ZZ3A 3PZTA 2I5IA 4LYRA 3W26A 1WKYA 4QG8A 1W17A 1K8XA 2OZ8A 1LUCA 2QAFA 1DWGM 1L6FA 2YCLA 4KCTA 4QCEA 2D0HA 3QSTA 2V6AA 3BTNA 4IM4A 3E2SA 4EF8A 3SECA 5LHEA 1YNQA 4XO6A 4TX6A 3CUXA 2ISFA 5JIWA 2Y0FA 3SUUA 4UOQA 2EXOA 1SSGA 4XWUA 4XZIA 3H4XA 5BU9A 2HQAA 1R5YA 2J6VA 5M5DA 4FXFA 3DKLA 1A50A 3WQDA 1UH2A 3JZUA 3LHTA 3OOQA 2CZDA 4ZQMA 3W1TA 2E40A 1AH3A 1WXYA 3CL8A 2NV9A 4G7EB 5A2CA 3UYCA 3WNOA 2Y62A 3BK0A 4Y9OA 3VNKA 4M1RA 3AU2A 5HWJA 1HKIA 5JBFA 3A3XA 4KQNA 1B0IA 1R38A 4YTUA 4E8CA 3K8MA 1EJXC 3UBPC 2E0PA 4KGLA 2F38A 2VCBA 3MI3A 2VR2A 1RR2A 4S3KA 3W24A 2C16A 3OYZA 3NPWA 2HBVA 3WK3A 4FNTA 4WK9A 2AQWA 1I9CB 1B3YA 1VQTA 4M6UA 3E5PA 2OSYA 4DJDC 3R25A 3DXIA 1ZQ5A 1EJWC 2UY3A 3LM3A 5DCBA 1XLGA 1BKSA 1RAKA 4NG3A 3AIWA 3AC0A 3QR3A 3P84A 1FHDA 1VBUA 1PZ0A 3DEQA 1SO3A 3H21A 4O1EA 5AZ0A 4D6FA 4MWAB 3GC5A 3UU0A 2WMIB 3S2MA 1V5XA 3ME3A 1TCDA 2H3BA 4I9AA 1OGSA 3E96A 1U5HA 2GWGA 1ECQA 2YL6A 2FIQA 2Z00A 4RNHA 2DSUA 9CGTA 1S2UA 5I3DA 4I7VA 1UZDA 2WKJA 4YHGA 4M56A 4W93A 4XZWA 4QTGA 4PUEA 1TVPA 1S1RA 1VBJA 1XW8A 2Z7GA 2PWDA 4QNWA 2C1IA 3K1GA 3SUWA 1I2RA 5XIMA 1XDLA 2CLFA 2PLKA 3R0DA 3CEPA 4PMZA 5JVLA 3UXKA 1RALA 4WX2A 3BMXA 1AQFA 2OSXA 4HOXA 5D9OA 2O55A 3K2GA 4YCOA 4ML9A 1GVYA 4F0MA 1AJ2A 4L61A 1JYXA 5A2AA 5CJMA 2GQ9A 3CLWA 3DESA 5CH9A 4LALA 4A3RA 1E4MM 3USBA 3KL0A 2XSAA 4GX8A 2EPMX 4D6GA 1OGGA 4IHCA 1ISXA 1BYAA 1OFQA 3VA8A 4UFLA 3THAA 4HU4A 1LZOA 2PTXA 1FXQA 4FR1A 4MAZA 1TV7A 1Q7ZA 1TZ9A 4DNMA 4FR6A 2CZVA 1AFSA 4ADTA 3AJXA 1POJA 3ATYA 7TIMA 3M7SA 1JZ5A 1F2JA 1XXXA 3GHRA 4FX7A 3H23A 3OBAA 4NI3A 1GQKA 4L1XA 4FLOA 1RPKA 1YTDA 4IIHA 3QMSA 3S4TA 2G97A 4Z2KA 4BQ4A 1NTHA 1KCLA 5TAOA 4NAFB 4XD5A 2D0FA 3C61A 1EJSC 4OBSA 1ADSA 4DUOA 4R3UA 2PLJA 5A6JA 2ZADA 3DBNA 1PUDA 1S5VA 1XPGA 3W7HA 1FWIC 5ABFA 3LS9A 2PDPA 5F2MA 3QY8A 4LVBA 1JNDA 1DXFA 1JI1A 2XZ7A 2YOCA 3NXFA 1UG6A 1NDWA 3LCFA 5I79A 1YX1A 4MWAD 1GONA 1K6WA 2NX1A 3SN1A 1TMHA 3W02A 2PP1A 1LOSA 1KFEA 2A3HA 4LUYA 3UZYA 2VZTA 1AQMA 3H2NA 5LGXA 1I45A 1BWLA 2DIJA 1OT1A 1POKA 3VOCA 3E3HA 1VCGA 1DTUA 1L9WA 5A3HA 2WW5A 4KIEA 3V16A 3P61A 1O7AA 4FA3A 3LYEA 1UD2A 1EDGA 3NQ6A 3E1F1 3NIYA 3NG3A 1M7JA 3GDLA 1BPLB 1T41A 2NXGA 3UZJA 2TODA 1ICQA 3FGCB 4O4WA 4U2ZA 4LSBA 3W23A 1PYFA 3EWDA 4PN2A 4RV3A 4ZQNA 2DZBA 1CCWB 3L5MA 1QXLA 4P8VA 4UCGA 5SWUA 4GMEA 3WLLA 1CGXA 1A5KC 4L6HA 4IPJA 2VC5A 3PPHA 4AWSA 1WBJA 3GXTA 1TG7A 2W0UA 3ZJ7A 3AWOA 3QXBA 2G8ZA 2F2KA 3LRKA 4RUBA 1D3HA 2J7GA 4J2PA 2QR6A 2YZ5A 3DHDA 3CLMA 1B57A 1R86A 1UUOA 3TVAA 4ACYA 1H1YA 3PJWA 3U8GA 4ZO6A 2ESCA 2XVKA 5BNKA 2O7SA 1G5AA 4UFMA 4H6KA 3IUHA 3SGGA 2GVYA 2H8ZA 2HCVA 4GH1A 1CXLA 3LRMA 2J88A 3C56A 4XAPA 4J3WA 3O6DA 3M0JA 3M0HA 5JQ9A 3B9AA 1UOKA 3H70A 5CC6A 8XIMA 3NOEA 1GKPA 4NNCA 4ZQPA 3MMTA 3NL5A 1CGTA 4ZO9A 4K39A 3C52A 3TA9A 4NZ4A 2XISA 4O13A 2PS2A 2OQLA 1E5NA 3MUZ1 5DY3A 1VBRA 2QUUA 4O15A 5FF3A 1W3IA 1OJXA 1KGXA 3L68A 4MM1A 1EP2A 4Y7EA 5A6LA 5HINA 2WB5A 5LNRA 1CPUA 3QEZA 3EKGA 3TW9A 2IMRA 2IKHA 2EPHA 2PC8A 1VFSA 1CZ1A 1VFHA 2JE8A 2ZYFA 4LYQA 3AUJA 3NL6A 4JIRA 1G1YA 1WXJA 5FSEC 2P8BA 3HOJA 1VFTA 3KVJA 3LX9A 4LYPA 4G9PA 3L5AA 1UH4A 2X09A 5I5RA 5HR7A 4QSHA 3VXGA 2DSWA 1JGMA 4J2MA 3M5XA 1XLBA 1OF8A 1REQA 4O0KA 1IEWA 2OMAA 4JQ3A 1WP6A 1HJUA 3BJFA 5A6AA 3R0UA 2WCGA 3H54A 2YL8A 4YL2A 2GGJA 3GG7A 1KRMA 2FQIA 4HPNA 5C55A 2ZFAA 3GFXA 2DZUA 4PFHA 3ARRA 1GJUA 1I1WA 1TJPA 3HM7A 1B5TA 3UW6A 3A24A 1D3GA 4R88A 1TTJA 3TYEA 3G1DA 4AQLA 2PDUA 1F4AA 5HNTA 3T2QA 3P0WA 3WQWA 1NWTA 3W7QA 1TPFA 2HROA 1O1ZA 1V02A 4NASA 2XIBA 4QLJA 3QV8A 3SCPA 1FWWA 1MDLA 2VVSA 1GOMA 4IGMA 1FX6A 1E6RA 1O94A 4C6JA 4DJEC 3B0VC 3OW1A 1V51A 4EWND 1YW1A 4N7QA 3B9OA 3OVQA 2PU0A 4IG2A 6CGTA 5DMYA 3WJYA 1TPB1 4QE4A 4EPBC 3RO6A 2H90A 1JAEA 3W2NA 4JKMA 4NY2A 1M5WA 2GSJA 3SRDA 1IV8A 3VGEA 6PTDA 4K38A 2PGFA 3W25A 1XFCA 3HPSA 2DZAA 1X1NA 3G6LA 4R9OA 1SQ7A 3FA3A 1ME7A 1IXOA 2PDBA 4K8EA 3C0LA 3ONBA 1O60A 2VUYA 2QJGA 2X40A 2C1HA 1GHSA 4FO4A 4GWEA 4BF5A 4S39A 4UIOA 1NFBA 2XIJA 4PMRA 3PJTA 1J96A 3TN6A 2OJPA 2XUCA 1F4HA 3MKKA 4GO8A 3B0YA 3IIZA 1J01A 5E0FA 2AKMA 5ECUA 4IP7A 3VIPA 2QCMA 2IKIA 1C7TA 5C7VA 1BFNA 2Q8XA 2Z7KA 4DZAA 4HNOA 1W5NA 1Q2SA 2VCAA 3HPAA 5K9CA 2PWFA 3TLQA 2CERA 4LEFA 3ORWA 3GDRA 3LPOA 1HT6A 2J9XA 1IT7A 3O6AA 3SIZA 1G7UA 1F7BA 1NWSA 4JTHA 3TSBA 4GYJA 4A05A 1W8GA 4BF7A 1NQKA 3OHMB 4DHGA 1CXHA 1E6NA 4WUIA 1OADA 4HSHA 3LLFA 4H00A 4PGLA 4OKDA 3W2MA 1UZHA 1QPQA 3W00A 3MT1A 4CU6A 1JIBA 2BNJA 3SQMA 1IR2A 2IPWA 1E1CB 5DMNA 3HB9A 1PX3A 4IZGA 4Z2GA 5AY7A 2GOUA 4C6LA 1MRQA 1RD6A 1JI2A 2DQWA 5PTDA 3UEQA 2PTWA 3VUPA 2R1NA 4Q8QA 4IFRA 4U4MA 3GYEA 3VOIA 3MS8A 3W1MA 3NPUA 1SPQA 3W37A 5J5DA 1SYTA 2V5LA 4LC6A 2GDVA 2GUUA 3MB9A 4GC4A 4UFJA 3P82A 2E1WA 5G5IA 3WMCA 3RN6A 2IXUA 2VEFA 4FF7A 1H7PA 2C13A 2BMBA 5GJPA 2EF9A 1YMYA 3B4YA 2OG9A 4Q8VA 2FH6A 1J4EA 4IX0A 2CNCA 1HKVA 3KM8A 2DUXA 3HPZA 4DJDD 1JZ6A 4F40A 5LNUA 4GX9A 1V3JA 4IPLA 2DVXA 4C1KA 3EKLA 1S2WA 5HWMA 1TQJA 2BP1A 1HVXA 4LAKA 2A7PA 1MW3A 4RV8A 4US5D 5C9UA 2VGBA 4JN8A 3W85A 2DQXA 2GQAA 1FCQA 3FXYA 1TA3A 3EXTA 4DI9A 4GY1A 4XIMA 1FP9A 4FX8A 3VC6A 2GSHA 5AFDA 4HPJA 4YPJA 3ZQ9A 4A3YA 2QUMA 2DT1A 5FESA 1Q6QA 1I2OA 1BWKA 4WGHA 2PBGA 2D3LA 4WHBA 3SGZA 1F07A 1G4EA 3A21A 4MFDA 3WQ5A 1ZCOA 5IBXA 4RKAA 3CB3A 3RRXA 2FYMA 3B8IA 1FUYA 4NSBA 2OGYA 2DDXA 3MBDA 1XYMA 2PDWA 4BJHA 1R3SA 3KBMA 3DOPA 2ZX8A 1BYCA 3W6LA 4A3UA 4RDWA 1Y65A 3GNDA 3AYTA 1CYGA 3AIEA 3NZRA 5GVJA 1WZAA 4KCWA 3W6YA 1OFOA 4PTDA 5D09A 4C6MA 4AEEA 4L4OA 3GAKA 3DFTA 4JS3A 2V2CA 3DECA 4RZ4A 4IFKB 3NO3A 3AROA 3L7RA 2CEQA 4ZCWA 2YBUA 3GTHA 1UKOA 1UKSA 2VDGA 3V0UA 1TV4A 4CUCA 3BURA 2CBJA 3NFUA 2DT3A 4AAJA 5G2IA 1TWDA 3MZ2A 5LNSA 1FWCC 5C9RA 3UP8A 1IQ8A 3SI9A 4UNKA 3W7OA 3S6OA 2IPGA 3TC7A 5LA2A 2XGBA 4EWJA 1UWRA 1XH0A 4U31A 2VX4A 4HD5A 1CXFA 4CLMA 1BVWA 3SCNA 4J27A 4Z1BA 1PAMA 1EFZA 4A21A 2ISVA 3PULA 2C18A 3KBNA 4WR3A 4G7FA 4YVPA 1KTNA 4UC5A 4NJIA 2H6RA 1E6PA 2HK0A 4GINA 2YW3A 1PTDA 1LWIA 4G7EA 3GNRA 3F5JA 1XG3A 3DC8A 4O0ZA 3ALGA 4OFCA 2YL5A 4MJZA 4KF1A 3H2FA 1PWMA 3LHYA 4MF4A 5AHLA 1OG6A 2VJXA 4GUJA 3QGAC 1KFJA 1T8QA 4AD1A 1NFPA 4XAYA 1JF5A 5HQLA 3MPGA 2DZSA 4KMQA 1AH4A 4OU1A 4EPDC 1HZYA 2Z6IA 3CV1A 5BRPA 2VEIA 3C2YA 4PBEA 4X9SA 1VHCA 1B9ZA 3IV8A 1J5TA 4TR9A 1F74A 4F0LA 4OZOA 1EB3A 4K1WA 5BYWA 3HPXA 3LA4A 1D8CA 3PZNA 1DYSA 3HIJA 3DBPA 4MWAA 2CBIA 4D1IA 2WMIA 3CT7A 1C8VA 3CYVA 2PDIA 3T81A 2QCGA 1TKKA 3N12A 3N15A 3TYUA 2VMFA 1QO5A 2GUBA 1G67A 3EX4A 5A8PA 2YA2A 3LPGA 4B4HA 3MO4A 4WOZA 4UQDA 3LBCA 1GVIA 4DBDA 2Y8UA 3NGJA 3THDA 2NX3A 1I8JA 3HMJG 1I2QA 4XSLA 1ICPA 3AS0A 2E28A 2HTMA 3U2CA 3QTGA 1U22A 2YX0A 1C8YA 1FFQA 2YDQA 4JDBA 2E68A 1QATA 4ZOBA 1DHPA 1RVGA 4GISA 3PWGA 5FF0A 5LNVA 2YDRA 1NJJA 2FTYA 2YR1A 2I17A 1GZ1A 4CVUA 1R30A 1UR4A 3KBJA 2VDIA 4PE8A 4KH2A 4AMCA 2UZ9A 1D3CA 3VE9A 4QDMA 4JOMA 1ZAJA 2BY2A 2ZC8A 2OZ0A 2ZOXA 3LCIA 1QTWA 1XBZA 2C8NA 3C2FA 2ACSA 3MHGA 2ZZ6A 4IT1A 5FIPA 3KTCA 3AXHA 2QVNA 4PRTA 3SCWA 1T96A 1U1HA 3UERA 3FW6A 2V2HA 3EAUA 1KBKA 4MADA 1XD0A 4Y9MA 1W31A 1J93A 2ADAA 2ZXDA 3PHAA 4A8LA 3BGJA 4ZMGA 3E38A 4F3HA 1JULA 1ZY9A 4RR4A 5A6BA 1O5XA 3KVLA 1TCMA 3SCUA 3UZXA 4LNCA 2H3DA 4AIEA 4WKAA 3GAYA 4UZUA 3NO1A 1EC9A 5IDZA 2D2OA 1FXPA 5DQPA 3O2LA 4NAFA 5EY5A 2OB3A 1CWYA 2WWCA 2P8CA 1JDDA 4HOZA 1L0PA 2HS8A 3WUBA 3WIJA 4CCCA 1FCVA 2FZDA 2J62A 3WH9A 3GZ3A 2D2HA 1P1XA 3BJSA 1KA9F 4F4RA 3EB3A 4JX4A 2GSEA 3HQPA 2JEQA 3BLPX 3O7UA 2BVDA 3AMGA 4TO8A 3CMGA 2DUZA 4XZBA 3UCQA 2OYLA 1T0OA 3LK6A 4H2HA 3CJPA 1YDYA 2C0HA 4HA3A 2HDJA 3CV7A 2QJIA 5TNVA 4H41A 5C9ZA 2WNZA 5C2GA 1QPOA 1Q8AA 4ZVJA 1PWLA 4A2SA 1UJQA 4ZOAA 2PDKA 3CPGA 3BVJA 1XF0A 2PEVA 4G1NA 4NL1A 1E6ZA 4QNEA 1HNYA 2PTZA 2HPMA 2P1FA 3MU7A 2VFFA 4PMOA 2BVYA 3FGCA 2UY5A 4HNVA 4C65A 3G24A 3WK0A 4DJED 1EL3A 2GK1B 4GO9A 3VZZA 4Z2JA 4XD4A 1J6PA 2Q8LA 4QFUA 4EXQA 3V75A 2HJPA 1ECEA 1YHTA 3T78A 4WY0B 3H2CA 1A5SA 3CHDA 5IHRA 4G8TA 3EMZA 4WCJA 3GYCA 3RJXA 2A5HA 4FMVA 3UR5A 3UXDA 4K68A 5FSDC 4YXGA 3OVPA 4HZ6A 4DEFA 3LXCA 3EOOA 5EBAA 4UWMA 1PHQA 3GVWA 5DLCA 3MYPA 3NQDA 1XH1A 2VM8A 2E9LA 5HPOA 3WNNA 4CNPA 2HISA 4YN5A 1LOLA 2IW0A 2WOQA 3UWYA 4C5YA 2VWSA 4HMCA 4TU1A 3EDFA 5BROA 1KRAC 1H09A 1JZ4A 1LRNA 5L6UA 1AW2A 2R8WA 4GUHA 3P0XA 2UWFA 1KB3A 1C92A 4GFSA 4Q7NA 3CO4A 3GFYA 2YL9A 3CAKA 4ROPA 5FKYA 2PMQA 3P93A 4IPNB 3WL1A 4XZ9A 2WMFA 3CASA 3HPFA 1G69A 2E6AA 4AZ7A 3QYQA 3F2CA 1F8MA 3C0QA 3OIHA 1A0CA 5DMLA 5J5RA 4O1BA 4I6VA 3CUGA 1K1DA 2IXVA 2J9ZA 3Q65A 3UCDA 1UD4A 3CWHA 1S2TA 4DZIA 2VZSA 4W85A 3DAQA 3DH7A 4C6IA 1BTMA 1TWIA 4DJFA 1TWSA 3S2LA 3UWEA 4QRNA 2NQ9A 3D46A 3FLUA 4Y8EA 3LTYA 2R82A 1QNPA 3BV7A 1H60A 4U28A 1VCVA 1E1FA 5BMXA 1S2CA 4L4PA 2WCSA 3HJZA 2NVCA 1BWVA 3TSDA 1JAKA 1KXHA 2OU4A 3UY8A 1NF7A 3BG5A 2QXWA 1VBHA 3AISA 4DZ5A 3R8RA 1UWAA 1W1IE 2QULA 3M7WA 1UC5A 1WPCA 1KNWA 3BW2A 3LGGA 3QV6A 4ATLA 5EYWA 4RZ6A 3JS3A 3DFYA 4AY7A 3EEZA 4HTBA 3VIMA 3E9AA 5CZKA 2QCDB 3VNZA 4C1LA 4GXPA 4N6EA 1KCZA 2ZZ2A 3EDEA 3XIMA 3E0VA 5HJYA 3FFSA 4RDYA 2QUTA 3N14A 4X60A 3LZ3A 2VUNA 2YB4A 3WLMA 3NQ2A 1JCYA 1F6YA 4JTAA 4NVTA 5GQBA 2YSWA 3WEOA 2CLIA 1Q5MA 3KP1A 4FB7A 2D2JA 2FTWA 2YFNA 5AYXA 4YVVA 4DXVA 1H5YA 1KWGA 3C2OA 3N2XA 2Z27A 5I06A 3NQMA 3A5VA 4QX4A 2WANA 3DZ1A 3MUIA 2ALDA 1CXEA 4AIBA 4DJDA 1F73A 5LIXX 3TQPA 1TWWA 3T08A 1JCTA 4IIBA 3STGA 5EU9A 3QR1A 3O6CA 3N2OA 2Y7FA 4HBKA 2PI6A 3AFBA 3USZA 2DW7A 3RCNA 1CI1A 2W62A 4NQ1A 4QITA 3CIVA 3WH7A 4XUYA 1RJPA 1HX0A 1UA7A 1EYEA 3WJSA 4GE8A 2MANA 3TSMA 3W7KA 1OFBA 3W7CA 1FDYA 4LBSA 3T0TA 3N17A 1KCXA 2E9BA 3R8HA 1DXEA 4JPGA 1EEXA 3LRLA 1QUMA 1B2YA 4LFYA 3QLLA 4PUJA 2WSRA 1I75A 1GOQA 1X6UA 4H9UA 1JD7A 3I7RA 4CCZA 3TQVA 5BOOA 2Z25A 4FPSA 4CQCA 2KAUC 1RCXB 2FGZA 1AMKA 3KBWA 2CWXA 3FIGA 1GVSA 2OVLA 3W70A 2GQ3A 1J0HA 2D22A 3SQSA 3MSYA 2RDWA 2P50A 2VEMA 1W9PA 3M44A 3H7VA 5FJUA 5KINA 1L6SA 4HVXA 2P53A 2E6DA 4MKNA 1ZLPA 1WB0A 4O1DA 4XBKA 1XLAA 1KR1A 3P14A 4XB3A 3QQ0A 2XM2A 1NARA 3W7GA 4OE7A 5F1VA 4WIWA 5TF0A 1P48A 3LGDA 1P4CA 3AIBA 3ALFA 3AIQA 2DVTA 1LT7A 3QF0A 1S3TC 3KVKA 4RE3A 4RNIA 2C91A 1FH7A 5D4YA 3XINA 1U33A 3S6TA 1BRLB 3PSVA 4QP0A 1GQLA 2X41A 5HK4A 2Y7EA 4QJ3B 3QFWA 1M9HA 1A0EA 2QJJA 2VCCA 5ABGA 5HA7A 3RUBL 2BHYA 2ATSA 5BXRA 3QZ6A 2F61A 5HNUA 5I23A 1K9TA 2PWHA 5E93A 4P7QA 4XAFA 3L65A 2VFIA 3GIPA 3W1NA 3GKAA 4B5NA 1A5OC 5BMWA 3NO5A 3W82A 3IPWA 4GKTA 3LB0A 1GVRA 2P3ZA 2DEPA 1BYDA 4H9XA 1EO5A 3C8FA 2PP3A 1XD1A 1EOKA 2FPVA 5F7UA 1XDMA 3QHNA 1WAWA 3N18A 5CPSA 2BHZA 2PWUA 4CEXC 2RDUA 4MHBA 1Z48A 5BXPA 2OO0A 3G8RA 1FKWA 2C19A 2PDYA 1K02A 4R53A 3BLOA 5G1TA 4BQ3A 1KRBC 5I09A 2QDGA 4HU0A 1NY1A 1KBLA 1UWQA 3EPOA 1WKEA 5GNYA 2WVUA 3NGFA 1RH9A 3FS2A 4JCMA 1VFOA 3TCEA 3M6YA 1W3LA 2QLYA 4QSFA 1NDZA 2ZA2A 1GEHA 3QMRA 2Z2UA 3AXKA 2QV4A 1QOXA 4NZ3A 3PZMA 5FA5A 1SFSA 4ZB0A 4KEMA 1B90A 2Q71A 3CNYA 1IF2A 1YEYA 5EGRA 4WLCA 4YS1A 1XUZA 2WMKA 1U30A 2CHOA 4IFKA 3B8SA 5AYZA 1YTKA 3P8IA 3CM4A 1KRCC 1FWGC 2PDMA 4JTLA 3N04A 3O05A 3RGTA 4FLSA 1E72M 1FHLA 1UD5A 3ITTA 1GVFA 1PHWA 3TTEA 4DXKA 2QCNA 2EPKX 4PEEA 3NYDA 1SJBA 3U5UA 3N3MA 3TR9A 1QW9A 3HGSA 3BCDA 2AL1A 3C6CA 3ZOAA 3W7MA 4KW2A 4AC7C 1NQ6A 1YPIA 2B7QA 4MB5A 4ZTYA 4QG9A 4IJBA 4QE5A 1W8SA 2BHUA 3WD1A 2IUZA 4ATWA 1QPRA 1UQZA 3L66A 2NV1A 1BEUA 4RJEA 2P5NA 2VENA 4N4PA 5F4XA 4B3LA 3NCOA 3VO0A 5EL1A 2YA1A 4J4KA 2X0HA 3OQEA 2W66A 1GPFA 3EMQA 1PEZA 3UJEA 1MFUA 1A5CA 2QKFA 1VPYA 3EOSA 4DWSB 4XBJA 4WD0A 4AH7A 1Q6CA 3GXNA 2BY1A 5GNXA 4GXMA 1P0EA 3VNYA 1DJNA 2QJHA 1HKWA 5G1MA 4E8GA 1H5VA 5IDIA 1UQYA 4PBGA 4BY3A 1UKPA 4QEEA 4F0RA 3DHUA 1EX5A 1E3ZA 5JBDA 4H7ZA 1HUVA 3VFLA 4AVFA 4LYKA 5CPQA 3SRHA 1ISYA 2OODA 3EXRA 2CC0A 5DFAA 4GKLA 1V3IA 4AEFA 2F9RA 3ICJA 3AS3A 5G4HC 3QN3A 1ZALA 4HK5A 5FEWA 1PJ9A 4IGSA 3S42A 1Z7AA 4BQ2A 3TXZA 1XINA 1AVAA 3NWRA 3ZLFA 3W72A 3L4VA 1TPC1 4OHQA 3N2MA 1XS2A 4H01A 2E09A 1QW7A 3VCCA 3GUWA 4MOZA 2QQ6A 5CAHA 4JTCA 2CPUA 1TV3A 1YE6A 5EFFA 4AZIA 4ZE4A 2VDHA 3S1XA 4UB9A 4EF9A 2P88A 1RSCA 3SQLA 1LYXA 3NJ3A 1E6SM 3UR7A 1R3TA 4HIBA 3AAMA 4CN6A 3WK2A 3AZTA 3W1QA 2NLYA 3RO8A 4MNMA 3A3HA 1V6WA 3LPPA 2WLYA 4JDYA 4C6DA 4LAZA 5I78A 1ENUA 3C2EA 1WDQA 3P74A 4C6KA 3BANA 5C9XA 1C3FA 3U48A 2X7WA 4GUGA 1H63A 1Z32X 1GEQA 2EO7A 1K7EA 1JCLA 3W3OA 3EBVA 1E4LA 2VOMA 3IWPA 2A3LA 4GOAA 1W9UA 5I3IA 3G3DA 1F5ZA 1BAGA 4O0QA 3DDMA 3CZEA 2C14A 2BY3A 3DIPA 4Y90A 5A2BA 5A8OA 2YIHA 3DGBA 4GYKA 4EXAA 1V0KA 4PMNA 1EOMA 1DJIA 1RLDA 1DPMA 1OD8A 3VKKA 1SZFA 2VT0A 3ARQA 2A1YA 4C6FA 4ZSTA 4IQDA 3IRSA 3VDCA 4OV4A 5GPRA 4HPHA 5HQEA 1CLXA 1RVKA 2AAAA 1RD5A 2CBUA 4OJYA 1N8FA 5CC3A 1RP9A 2BTMA 3LTPA 3W01A 3LBOA 3KZSA 3VDHA 4NU7A 1TFVA 4AY8A 4H4IA 4DWSD 2PDGA 4KKXA 5HR6A 3M0VA 4V2XA 4TQTA 1EA0A 2BASA 1I6NA 3KHDA 2E8ZA 1VR6A 3LNMA 2Y24A 4IQJA 1J79A 4W8AA 1WZKA 1XDJA 6A3HA 3DN5A 2WSYA 3G77A 4E4FA 1R9YA 4AF0B 1Y5WA 5FJRA 5IHSA 1RJQA 2Y70A 4JTSA 2QPSA 1TPUA 1A47A 4QXIA 2PU1A 4OVXA 2A3EA 3VD7A 4HNLA 2ONEA 3N2BA 4DM1A 5HULA 1JD9A 4O1FA 1EQCA 3SGUA 1FVPA 3T4WA 4RE4A 4C6OA 3EDKA 5DT5A 2W67A 3GG1A 1UKTA 1F6KA 4YHEA 4ZEPA 1TJ0A 2CWNA 1IWPA 1XKYA 2AGTA 2JKPA 4IP5A 2J27A 1KD0A 1R7AA 2VGFA 5C70A 2J25A 3PTQA 3P60A 4W86A 4MY9A 3LBMA 4V27A 3WDJA 1LRQA 1I1XA 1W1YA 2QDDA 1R2TA 1XLHA 3AMCA 1F61A 2FVMA 2X0SA 1SFLA 3N13A 4TX8A 4V1XA 3UNTA 1XYZA 4KS0A 2EPNA 3NXLA 3R10A 4MJMA 2QHAA 1Q13A 1QAPA 1AW1A 3F2BA 4GY0A 5C2CA 1SO5A 3VCRA 3ES8A 5U4NA 3S2NA 3LUTA 1EUNA 3W22A 4A8RA 4Y96A 2GVLA 1O12A 1T40A 3VOFA 2CETA 4IPPA 3H55A 2CZEA 3PB2A 1K9FA 2V3EA 1XIMA 1JDCA 3LTSA 3CZJA 4WY0A 4AHPA 3UR8A 4S3GA 3RMJA 3WK1A 1VRXA 2INFA 6REQB 4J3SA 3OPSA 1L2QA 2FHBA 3DCPA 2E1DA 4ERGA 1D2KA 1Q7QA 3LM7A 3VZYA 4I9JA 4JIHA 2WNWA 1KM4A 3CXOA 4TV5A 3UJ2A 3RITA 2VR4A 2G3MA 1JPDX 3LENA 1EPXA 2PPGA 3GD6A 3THUA 1KBJA 4ERIA 1HQTA 3W7NA 5MKGB 3V5CA 4A29A 1BSLA 4GFIA 4CN1A 4DYJA 3W7IA 1FRBA 3T07A 3HZ3A 4PCFA 3F4NA 4BWLA 2GJNA 5CPTA 1QNSA 1FWFC 4HZ7A 3T2OA 2QMKA 4ZFCA 2VD9A 1FCUA 4HYWA 3QPZA 4LNYA 2V69A 3PBYA 3P80A 1K77A 3DYMA 3V0SA 3HQ1A 3M5ZA 2W91A 1YPXA 1GTEA 4NX0A 2F2HA 3AYVA 3ABZA 1PVNA 2DZVA 1KLYA 1V0LA 3KRSA 3F1QA 3MP4A 4AD5A 2CXGA 1DL3A 2E5BA 2HK1A 4HB7A 1MWOA 4H6RA 1MDRA 3STEA 5JH2A 1ESWA 3AYRA 4C7DA 5MF5A 1UWUA 1Q66A 3G6MA 3CWNA 3B05A 3AHXA 4Z1AA 1Q4WA 3RCYA 4DO5A 5K9DA 3HTWA 2J7FA 1R9XA 1B4KA 2O56A 1VB9A 2X1RA 1UMLA 1FKXA 1GYMA 4PB3A 1MYRA 2CW6A 3ITVA 4H9TA 4IPIA 3EPNA 3FJ6A 2VYOA 5A5WA 5EBUA 2ACQA 4Y9AA 3TQ0A 4JYFA 2VEKA 4S2CA 2DP3A 5EMKA 4LT9A 1R3VA 3TW7A 1H7NA 3L9CA 3SCSA 3BDKA 2WC4A 2NSOA 3C8NA 1M41A 2HBXA 1TE6A 4E38A 3R13A 3RHGA 4MDPA 1SZNA 2QCDA 1QBBA 3CQ0A 3H2AA 3P67A 2C7FA 2PTDA 7A3HA 1ONXA 4LVFA 1EX1A 1US3A 1TUXA 4E5TA 8XIAA 2CLEA 4BKNA 4CEUC 4S3BA 4OUEA 4QAIA 1MZHA 2FJKA 1W1PA 1O95A 2WMJA 4GH3A 3WELA 4D6HA 1QI2A 2X0YA 1AJZA 4K36A 3ABSA 5CBJA 4I8YA 1BXNA 2E8YA 4B5SA 2DVUA 5DANA 2QS8A 2KX9A 3E0LA 4ZSUA 1GJPA 3S1WA 1V6VA 3SBFA 4CGTA 5F4SA 2Z2AA 1OYBA 3VDGA 4GPNA 2HXTA 3B40A 4UTKA 4W7WA 1OFDA 1YYAA 2O92A 3QV9A 3BGAA 3GM8A 4NILA 4B5TA 3BQ6A 1ZRQA 4DM2A 4D9PA 3LXBA 5HATA 5DBTA 4ZOCA 1LLOA 3R43A 2P0OA 1VEMA 1ONEA 4QM1A 1DQWA 4Q6JA 1IWAA 3Q4DA 1BYBA 1WV2A 3VPLA 3LXAA 5FF4A 3VIKA 1JPKA 3QYSA 2QCHA 1VFLA 3AXIA 2X30A 2VFDA 3TOYA 2L5HA 4UTLA 5IOBA 3BGGA 3MDWA 3RM8A 1IYXA 3NQ7A 4GC3A 2NZLA 3I68A 4P7NA 1UD6A 2ASHA 5FCZA 3K8KA 5BU6A 1R8LA 1SJDA 3GLCA 4JNYA 3E12A 4O11A 3E2RA 4Q8UA 4JTJA 4CNOA 3I65A 3M4HA 4LANA 4NXKA 2VL4A 1S3HA 4D72A 1ODUA 1W9XA 1A3XA 1E56A 4JNZA 4WJ8A 3NEHA 1OT2A 1XBXA 1OIMA 3RX4A 3MP3A 2VQUA 3NZPA 5A95A 1UP0A 3T0AA 1C9WA 3WUEA 2DFAA 3KWSA 4N9CA 1UJPA 1ISWA 2PDXA 2J4GA 1N55A 3GXFA 1C9DA 4MLJA 4YYCA 4ILSA 1J18A 2NUYA 1RCQA 3EX1A 2YW4A 3EPMA 5LNWA 1MXGA 5IBXC 3HG5A 1YRRA 2WPBA 3QPEA 4NNBA 2IQ0A 1FBAA 3WYZA 4YWSA 1YXYA 4DO7A 3VX0A 4F2TA 1XIBA 3JZEA 5I07A 5CJNA 3H8AA 4Z08A 1EJVC 5LZLA 1JYNA 2I9EA 2VR5A 4B5XA 2Z28A 1GTHA 3O16A 1BRLA 3OGVA 1ME9A 4KFOA 2I7GA 4B92A 4F9DA 3C3NA 5A94A 1CEOA 4V28A 2FMOA 3I7SA 4CQDA 1MRAA 4UOJA 5DO8A 2WQDA 4UQBA 3TJLA 2Q6ZA 4GNVA 3S5NA 2ZTKA 5LYRA 1FWBC 3ZR4A 1QK2A 4LJ3A 3S5OA 2GJPA 2YA0A 3UWUA 1XRTA 1YNPA 5HMEA 3L5LA 1AG1O 4IGNA 4UR9A 3KXQA 4HK7A 3BOFA 1X1OA 1DQXA 4AW7A 3IVUA 3SADA 2QCLA 3BMWA 3PZQA 3VK5A 3S9YA 3EOEA 3S2CA 1WE5A 3KEHA 2ZZ5A 2ZWYA 3GXMA 4JKKA 3CQKA 4IMFA 1NFGA 4LAMA 1B3VA 4LB4A 2Y5SA 2Z2BA 3G1RA 3MJMA 3BAWA 3I6EA 4MKVA 3TUUA 2WKGA 3L4XA 4DBSA 1ADDA 4QLKA 2V5BA 1S46A 4PSPA 1IZCA 1ZBWA 1DXIA 2OOFA 3G18A 2QAPA 1PB0A 3VIJA 1MQRA 3TMQA 3R8GA 3Q2DA 4DRSA 3W83A 3FHAA 4ZQCA 3IV3A 2QIWA 5C54A 4MVAA 1P1MA 1RQHA 3RFAA 1OK6A 3H22A 4LQ1A 2F6KA 1QHZA 1REQB 3CEUA 1XIEA 4MWAC 3W7EA 3G2GA 3WLHA 3QSRA 4QBXA 4PCSA 2OLAA 3K30A 1GWJA 3S5ZA 1FH8A 5BOFA 4Z1YA 4LH8A 3P62A 4LC8A 4AD2A 3FVMA 4AZGA 3T8LA 3GBDA 2QW5A 1OVDA 4Q4KA 1XIIA 5E6ZA 2BGNE 5CAKA 4EACA 5D33A 3NAVA 4JTQA 1PDZA 3FJ4A 1RZMA 1FOBA 4LB3A 3KHJA 4W8BA 1F05A 3IJLA 5C8BB 1SGJA 1VHNA 4O19A 1E0WA 1YDNA 3N4FA 4IFOA 3YPIA 4ALDA 2XZ9A 3B9DA 1TR1A 3WLJA 3MSRA 1XLIA 4DWSA 3OODA 4IG2B 1TJ2A 3M0MA 1EP3A 1P5BA 1QI3A 4XVEA 3UWVA 4GGHA 3HV8A 1JUKA 2OQHA 3IRDA 4GVFA 3M64A 1ONWA 4CD6A 4Q4PA 4C1NA 1H1ZA 4XG1A 3KS6A 3MKVA 1ZAHA 3APGA 4KBXA 4Q33A 1K70A 4FXRA 1UR0A 4IWWA 2CESA 4GBDA 4L56A 4HSNA 2PA6A 3O06A 3ITLA 2WAGA 2VRQA 2WSQA 1XFBA 3OZYA 3G1FA 3GS6A 4H6QA 3M07A 4Q8WA 4H7VA 3VNDA 2FPTA 1Q6DA 4BZYA 3I6RA 1IEIA 4O28A 1RJRA 4RCXA 5TQLA 1NIUA 2WWDA 2FMNA