2PDFA

Human aldose reductase mutant l300p complexed with zopolrestat.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 102
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdfA00
4DBUA 3LQLA 1X97A 2PDXA 2AGTA 2HV5A 3H4GA 3CASA 2PDCA 2VDGA 1PZ1A 4JTRA 4IJRA 1AZ1A 4IJCA 2IQDA 2ACSA 1ZSXA 2HE5A 1S2CA 4XAPA 1PWLA 1ZQ5A 2IQ0A 3CV7A 4L1XA 3R8HA 1IHIA 3V0SA 2FZ9A 2PDWA 3WCZA 2IKGA 4YVVA 1S1RA 2HVNA 3S3GA 4LAUA 3M64A 3UZZA 2CLPA 1YNPA 4DZ5A 2BGSA 4GQGA 4PUUA 1MRQA 1AZ2A 3UYIA 4FAMA 2IKHA 2I16A 4LAZA 5DANA 2BGQA 3UZWA 3BURA 2P5NA 1X98A 3R8GA 3RX3A 4WGHA 2F2KA 3LQGA 1ZUAX 2PEVA 5AZ0A 5C7HA 4JQ3A 4XO6A 2PFHA 5M2FX 4XZHA 3B3DA 3LN3A 4FALA 5LIKX 3D3FA 1EL3A 4JIRA 4H8NA 3G1RA 1YE4A 3LNMA 2PDNA 4GIEA 2A79A 3GHTA 3LBOA 3C3UA 2IPJA 1LWIA 4GCAA 4PUWA 1HQTA 3WBWA 2DV0A 3ONCA 2FVLA 1US0A 1JEZA 3FJNA 2INEA 3UFYA 2IKJA 3CMFA 3UZXA 3R58A 2NVCA 2R9RA 1K8CA 3ONBA 4LB3A 3UGRA 4GABA 2PDPA 3LD5A 1YE6A 4HBKA 4EXAA 4JIIX 4JQ2A 2PF8A 2R24A 2QXWA 4LBRA 3GHRA 4FZIA 1LQAA 3R6IA 2WZMA 4DBWA 3R94A 3Q65A 4PRRA 1X96A 3G5EA 3MB9A 4RPQA 2PDMA 3GHSA 2PD5A 4JTQA 4QBXA 5LIUX 3BV7A 3FX4A 4XVDA 2PDKA 1EKOA 3WBYA 1FRBA 3DOPA 2PDQA 4H7CA 3NTYA 1RY8A 1XJBA 4JTAA 2PDFA 2ACUA 2IPGA 4QXIA 2PZNA 2PDUA 2IS7A 4QR6A 1J96A 4R9OA 1C9WA 4JTDA 2HE8A 3EAUA 1Q13A 4YU1A 3T42A 2HDJA 4PRTA 1GVEA 3WG6A 1AH0A 1S1PA 2PDHA 5JH2A 1Z3NA 4WEVX 3V35A 1OG6A 4ZFCA 2IPFA 1T40A 4JQAA 3H7UA 4QX4A 3QKZA 1RALA 1XGDA 2HVOA 1IEIA 2DUXA 2I17A 2IKIA 3ERPA 3N2TA 2PDBA 1R38A 3COTA 2NVDA 1AH4A 2BP1A 2FGBA 4JQ4A 3U2CA 3UG8A 3RX2A 2FZ8A 4YVPA 4XO7A 4XVEA 3GUGA 4GA8A 1QRQA 2F38A 4GQ0A 1A80A 3N6QA 3DN5A 2ISFA 5HNTA 4Q3MA 4XZIA 1Z89A 5LIYX 4FA3A 2ACRA 4XZMX 3V36A 3KRBA 3R43A 2INZA 4JQ1A 2PD9A 1EF3A 1VP5A 3P2VA 1PYFA 4MHBA 3UP8A 1M9HA 2DUZA 1Q5MA 3MC5A 4YVXA 4WDUA 2PDIA 4JTCA 3V0UA 3M4HA 3V0TA 5AZ1A 2ALRA 3EB4A 4G5DA 4L1WA 1MI3A 5JH1A 1QWKA 4GACA 1RY0A 5HA7A 3LEPA 2FZBA 1YNQA 1VBJA 4OTKA 4AUBA 4WDXA 4HMNA 1PZ0A 3UZYA 1ZGDA 4WDTA 1HW6A 4NKCA 3R7MA 4I5XA 4WRHA 3O0KA 2PDLA 4XZLX 4LBSA 4IGSA 1MZRA 3CAQA 2IPWA 3LUTA 2FZDA 1S2AA 2PDGA 3H7RA 5LIWX 4ICCX 4WDWA 5HNUA 3VXGA 1Z8AA 4LB4A 2WZTA 3EB3A 2HEJA 3LENA 3RX4A 1T41A 3CV6A 4YS1A 3F7JA 3GHUA 3WBXA 3Q67A 3M0IA 3LZ3A 4DBSA 1UR3M 4F40A 1AH3A 4EXBA 1ADSA 4XK2A 1Z9AA 3LZ5A 1AFSA 2J8TA 4PMJA 3UWEA 1EXBA 3CAVA 3BCJA 5KETA 2PDYA 4Q7BA 3O3RA 5LIXX 1PWMA 2C91A 2PDJA 4XZNX 1XF0A 4JIHA 1SM9A 4ASTA 4PR4A 2ACQA 3BUVA
chains in the Genus database with same CATH superfamily
1EOKA 2J8FA 3B9AA 4GY0A 4ACZB 2XN0A 1M03A 4JNZA 4M6PA 2Y24A 4RNJA 3W84A 3O2LA 1TPB1 3WUEA 4H9VA 3NQGA 1AK5A 4L7ZA 3WLJA 4LCRA 4FIRA 5DY3A 3KM8A 1DQUA 1CXEA 4HTYA 1J93A 4JIQA 1XCXA 1ZQ5A 4KIEA 3S9ZA 1LL4A 4LRSA 3TA9A 4C6NA 4IF2A 4UTIA 4JN6A 1VLIA 3TU9A 4M6VA 3OQ8A 2EJAA 4ADUA 3PTDA 2EG8A 1IEQA 4D6CA 4HKPA 3KVLA 1KFJA 3B06A 3NIYA 4DUXA 1MNZA 4IXHA 4A8NA 4K36A 2WVSA 5A94A 1SJAA 2D20A 2NQ5A 3V4BA 4INFA 4E2DA 5EBAA 3LV6A 2RDTA 2GPTA 4WGHA 3LQGA 2ZE0A 2E1DA 3PANA 4GUFA 1ECEA 1W3KA 2ZE3A 1J5SA 4RXFA 4ZQCA 4DXVA 4JQ3A 3VYLA 1AW5A 1SZEA 3N19B 4N4QA 2ZZ3A 3VFLA 2GOUA 4E6MA 1AJ2A 3VIPA 2GK1B 6A3HA 2AMGA 2FZMA 1YE4A 3HB9A 4U28A 2ZA3A 3DFQA 1UD8A 3T9PA 1F5ZA 2A6LA 4LC6A 3MU7A 3VO0A 2WMIA 2FMNA 2FVLA 4B5XA 5T9BG 3VA8A 3DYPA 1BXBA 4ATDA 3K5XA 1MWOA 5K9XA 2YFOA 3UZXA 3C2RA 1U30A 4JFSA 1E4MM 4LB3A 5SWUA 2DFAA 1OCQA 1T8XA 3CUIA 3EXSA 3W1RA 4ZO9A 3MO4A 3PPFA 2WLZA 1QO2A 4NG3A 1K4GA 4JFWA 3EOLA 3WNNA 3PZNA 4JN8A 2AKMA 2DZBA 3WQ8A 1F3TA 1JRBA 3E49A 2YCKX 3GK0A 3PPGA 2I14A 1XD1A 1TTIA 1L6YA 4E4PA 3AS2A 4HCDA 3OVQA 4UWMA 1Z7AA 1GJPA 2A3LA 2BNJA 3FDKA 3GB6A 3ZM8A 4WOQA 1YTEA 2WK2A 1EB3A 3OU8A 3R12A 3PZGA 3TN6A 3RM4A 3P6LA 2ZZ6A 3ARWA 4M6UA 2PDUA 4BEQA 4ROPA 3Q58A 1OD8A 4YIWA 4CD8A 2F84A 2AQWA 4YU1A 4PBGA 2HK1A 3R2GA 3DDMA 5H8PA 2FHFA 1EBHA 4FXFA 3GFYA 4HK7A 4JNMA 3C2VA 1GG0A 4ZFCA 1I2PA 5PTDA 1GJWA 3UBPC 2J7BA 3ALFA 1UH3A 5CJMA 4LS2A 4GGBA 3QKZA 3ABZA 3H7VA 3LI0A 3T0TA 5HK4A 5HOSA 3M0MA 4DUVA 2PC4A 3ERPA 2SFPA 1R38A 1P7TB 4K7VA 4ENLA 3FKKA 2QCNA 5CQ1A 4BFAA 1B3YA 1DPMA 3C61A 5EU9A 1FKXA 3N6HA 1GQJA 2VEMA 4JY9A 3RX2A 3M5ZA 3B9DA 1DKWA 3UD6A 4XO7A 4NF7A 2A7RA 4XVEA 3VM7A 3VOHA 1BWLA 7A3HA 3AAMA 4X2PA 4IGNA 4MVAA 3ITCA 3KRSA 4L9ZA 3DYMA 3VNJA 1MUWA 1BGGA 5FEWA 3LLXA 3KTCA 3TFCA 1RQHA 2PLMA 5HDRA 3CS2A 1BG4A 2ABAA 1BYCA 1VRDA 2BB0A 3WLPA 1XLJA 3NFUA 1I2QA 3WQFA 2INZA 3EOUA 5E5CA 1S3TC 2VO5A 1XLEA 4LUYA 2DSWA 1G7UA 4O54A 4EP8C 3ZLHA 2QW5A 3KWXA 4Q4PA 3URBA 1U2YA 1LRTA 4HNUA 4B9YA 1F3WA 5CLTA 4ZTXA 3GR4A 1NEYA 4F9JA 2OZ3A 4OHQA 5HA7A 3WH8A 1V03A 2OQHA 3H2FA 1RSCA 1YNQA 2P76A 1BTCA 4DJDC 3R89A 3CWOX 3VIHA 3B8WA 1TQXA 4P7RA 3EPNA 3O15A 3NVDA 1IXOA 2V82A 1NY1A 4X2RA 1E9YB 2QR6A 1CLKA 4AWSA 5C2XA 3NQ7A 3TK7A 1VZWA 3CNYA 3II1A 3OHMB 1QNOA 3ID7A 3TP4A 2RGMA 3T0AA 2EXOA 2V3GA 3F2CA 5IDIA 1TJ0A 1BSIA 2TYSA 5AKQA 1UWIA 4Z1BA 3FY1A 1ADSA 1VFFA 2QMJA 4HA3A 1CZ1A 3G22A 3LZ5A 2ZICA 4DIAA 1E5NA 3MWAA 4QRNA 1XXXA 2NZLA 2ZUSA 3ZR6A 4PEKA 2QPXA 1EJUC 1TELA 4C65A 1GWJA 5CC5A 2P88A 2W5FA 4M80A 4AZ6A 2ESCA 4AIUA 1OEPA 3IJ7A 5FJRA 3Q37A 2XFRA 1YXDA 2VT0A 2DJXA 4A3HA 3E0WA 3QZEA 4PR4A 2KZHA 2ZTJA 3BAYA 4NVTA 4QJ5B 1E51A 3EDKA 4MAVA 4HB7A 4DWSD 4CU6A 2YDRA 3NQVA 4UQDA 2AGTA 4HU3A 4US5A 4HSHA 4E8GA 1F73A 5D2WA 2F6UA 3A47A 3AIQA 3VZYA 3IJDA 3PVFA 2QDHA 1JZ3A 4ACZA 2WJDA 3S1WA 4L64A 2Q09A 3W1QA 3RYSA 2YBVA 2FYMA 3B8IA 4A4AA 4XWUA 4JFTA 4JX5A 4Q7NA 4HGXA 1POJA 4BY3A 4HHPA 4AVFA 2VC6A 2PWEA 3MHGA 1KM0A 4LF2A 1XLIA 4UOJA 3USZA 4AAJA 4RZBA 4WK9A 1RBAA 5E6ZA 1D3GA 2Y0FA 3QFWA 3UERA 1FFQA 2DZVA 2XVLA 3ZMRA 3WJZA 4O1EA 3FEMA 2A4AA 4C6EA 2F2KA 1R2RA 4KERA 1VEOA 3LCXA 4Y96A 4H8HA 3A3XA 5FA5A 1NIUA 3TC3A 3DX5A 3F2DA 2OSYA 2C1IA 2OWCA 2OGYA 3D3FA 4ERIA 3G8RA 3GZAA 5EL1A 3QV6A 4LV4A 1CLVA 3LNPA 1KB3A 2X7VA 2GK1A 3GTHA 8XIAA 4NAEB 1TJ2A 2VFEA 4V33A 3BJSA 3RN6A 1JEZA 3FJNA 3K1DA 2C0HA 4WXZA 4GE8A 5CC3A 3I3DA 2JEPA 3PN8A 1H1NA 1K8CA 2QUNA 3ONBA 3CQKA 4DJED 5CH9A 3GXIA 3FXYA 3NUKA 2VZTA 3XIMA 3UETA 3OOQA 1P5BA 3QW4B 1AJ0A 3ARPA 4FZIA 5I06A 2X2YA 3H22A 2WZMA 3O6DA 2XFWA 3Q65A 1O5XA 4PCNA 3R1ZA 4MB5A 5A6BA 3LPGA 3A64A 1A5MC 2GVYA 1POKA 5FL1A 1LUCB 4I90A 4C6FA 1R3SA 3BV7A 3M07A 3CIVA 3FVDA 1R2TA 5K4XA 2BTMA 4NY2A 3DFOA 3WBYA 1PL9A 1TPDA 4JDBA 3SB0A 3F1QA 3ORWA 4HMCA 4H7CA 3PTQA 3NTYA 4H4IA 4JHOA 1V4YA 4GUHA 4S3AA 3M0XA 4PA8A 2IS7A 4HOXA 3WMSA 4QR6A 5BW6A 3BMWA 1UA3A 1JFXA 4NI3A 2TRSA 2BY0A 2XSXA 2YCEA 4FNTA 3RLHA 1G1YA 2NUXA 3H2EA 3N14A 4A3RA 2FQIA 1DJHA 2HRWA 4DXXA 3TOYA 3EB2A 3AS1A 1XG3A 4QJ1A 4OKDA 5HULA 3UG3A 4P7NA 3SY8A 3SI9A 2A3HA 5G2IA 1QASA 3MY9A 2W66A 4JDYA 1FKWA 3DESA 1RK6A 4MYAA 3LV5A 2WKJA 3T78A 3VGFA 3U2CA 3UWUA 3V5FA 4RZ4A 2WANA 2OSXA 4EACA 1LWJA 1P7TA 3T0DA 1XFCA 1EFZA 2PWHA 2W91A 4FXSA 1T5AA 3RMEA 1VEMA 1RP9A 4JTIA 4PTMA 3WYZA 2DQXA 1WXJA 2ISFA 1UJPA 3MO7A 2BG5A 4GI9A 1KQZA 2OZ0A 6PTDA 3IVUA 5H8MA 7CGTA 3CIWA 4J3XA 3WENA 3AUOA 4ICNA 1WZLA 4UQ9A 4XIAA 4MHBA 2Y88A 1ZRQA 2DUZA 4R9XA 1KGUA 2V5LA 4QTGA 5BOEA 2QT3A 3W7IA 3TYDA 2ZX7A 1FQ0A 3I3EA 3GFZA 3M43A 5I3IA 3NDYA 1FHUA 2DZUA 4PL2A 4PB5A 4Q4RA 4I9MA 3AFBA 3PUEA 1UP2A 3ZT5A 2HVMA 4G6CA 4QM1A 1AMKA 2E7FA 2G96A 4CVUA 4DYKA 4DF2A 1SZNA 2Y7GA 5DQPA 3B0PA 3G1XA 4A3YA 4CD6A 3WH5A 1TCDA 4R7OA 1XW8A 3M0HA 2CBIA 3H2OA 3NQBA 5HBFA 1QPOA 1JXKA 3AMLA 4QHRA 2HISA 2AL2B 4MKNA 1HJSA 4KEVA 4LCQA 1RXOB 3NO1A 4PL1A 2PB1A 4F2BA 1XIDA 3CL8A 1FHVA 1JPDX 2TSYA 3MT1A 4LGXA 3SRDA 4AD0A 4IHCA 1YX1A 2XIBA 2GGIA 4KCUA 2PBGA 1XLBA 1AW1A 3WMBA 1SU5A 3POCA 4G1KA 1D3CA 1YTKA 4W7WA 1VAHA 1VIWA 4IX0A 3WK3A 1DL3A 3NL2A 3TN3A 1EXBA 2WO5A 3BAKA 1PUDA 1GVYA 1UZHA 3DYOA 3FNDA 5I3HA 1GONA 4UFIA 4P8VA 1PDZA 2OLAA 1DWJM 3EMQA 3S5YA 2ODOA 4C6IA 3PNZA 3OIHA 4IGMA 2C6QA 1A3XA 2VD8A 4S3EA 4Q8VA 4JIHA 3FK4A 3U3HA 3VK5A 3QMRA 4JYEA 4ZZ9A 5BRPA 3LGDA 3AJXA 3BUVA 4DBUA 3ARXA 3Q4DA 2NV1A 5CZ0A 1KFEA 3B40A 4JCMA 5IDZA 2WJEA 4GVHA 2DZSA 3W4RA 4ADSA 1BYAA 3GM8A 4Q7IA 1YIXA 3LHVA 1H11A 3LU2A 3W02A 3WK0A 1P0DA 2POZA 3AU2A 5CBIA 1TTJA 4H04A 4L1XA 3A4AA 1EZ2A 5CSSA 4HZMA 3V0SA 3A3WA 5GNZA 1J0KA 5E9XA 4O11A 4FI4A 1SVDA 1YNPA 2BOEX 4B2DA 2OO6A 1A0CA 3RO8A 1ZBVA 2VQUA 3DFHA 5AY7A 4GPNA 1XRFA 3E38A 1K7XA 2ON3A 3VINA 4A35A 1UR1A 1BF6A 2YBUA 3ITVA 1ML1A 1CT5A 4GY1A 3CAWA 5FCZA 1MMFA 1XIEA 3VX0A 5EFDA 3RRXA 4C1KA 1BTMA 1O5QA 3GS6A 3LERA 1J10A 2ZC8A 2ZRYA 4Z0JA 1W3NA 1HZYA 7ODCA 2X09A 4TMBA 2QPUA 1HGWA 4GI4A 2INFA 4WHBA 5T9CE 5A2BA 3N18A 4PE8A 1L6SA 2CHOA 4GIEA 1FDJA 3QH2A 2XVNA 1KQYA 3DHPA 4IT1A 2EF9A 4XAZA 2WMKA 2HZGA 4ZQOA 2Y61A 3Q2DA 5CPNA 3CEUA 4BHYA 1ZPTA 1LOQA 4FR6A 1US0A 3NL6A 3OJGA 5AHLA 4AIEA 4CQDA 4NAEA 2A3CA 1UKOA 1OM0A 1SJBA 1HN1A 8A3HA 5L6UA 2YXGA 3OEXA 1B0IA 1TVLA 4HJFA 2F6KA 1UWAA 2FLIA 1B4EA 5GJPA 4GABA 4QS5A 3LD5A 4DWSC 3QY7A 2EPNA 5I79A 1A4MA 1J12A 3ZZ1A 2P0IA 1TPWA 4GJJA 1CB7B 1JCLA 4JD4A 1WDRA 2ZRZA 3IGHX 4PRRA 3FV9A 3AXMA 3ABOA 3G3DA 3AIBA 1QPKA 3KBJA 4UQAA 1JYVA 5D9NA 3PZUA 1X38A 3BLFA 1JQXA 3OG3A 5G1TA 4FOJA 3HV9A 1LUCA 3A23A 3MUXA 2E8ZA 1GTHA 3IIPA 1U22A 1W1B1 3MCOA 1B9ZA 1FWFC 5HUPA 4MWAA 3SCWA 5F4XA 3CHEA 4JEQA 4JTDA 2RH9A 1Q6OA 4Z1YA 2D24A 5HNNA 4E0CA 2BY1A 2PLCA 4I8YA 4DPQA 3W85A 4RW5A 5FSDC 1FCVA 3VKKA 1HL2A 4CU7A 2OLHA 4O1FA 2WBKA 2PDHA 4NSBA 3DH7A 2C3ZA 3FA5A 1Q6LA 1VD6A 3PPHA 4U5IA 2DT1A 1LL7A 2HMCA 3EPOA 1ICQA 1GZJA 5ABFB 2PI6A 4GVGA 3GDLA 1RALA 5G1YA 2DUXA 4ZR8A 2VCCA 4GZJA 3XINA 3WQOA 4S3JA 1G94A 4GUIA 1J0ZA 3MV11 3STGA 3WEMA 2Q3RA 1OYCA 1KA9F 4JQ4A 4CCCA 4NZFA 3CQ0A 3GH4A 1MQRA 4FXJA 5EMLA 4Y90A 4MUZA 1A5AA 1UKSA 1ADOA 4L6HA 2Z7KA 3B0YA 5C8BB 3C56A 4I8DA 1A80A 4DJDA 4DJEC 4WR3A 1OBAA 4TR9A 1OFDA 3ITLA 4K2SA 2ZUUA 4KFNA 4V15A 1Q45A 3LA4A 4U31A 2YA0A 1RK5A 3PZVA 3D46A 3PBWA 1V7YA 3R5EA 1VLWA 2YYTA 1RJPA 1V08A 3UWVA 4IIEA 1BAGA 3ZWSA 3A24A 3N9SA 1E9ZB 1I0BA 2YA2A 4ML9A 4N9DA 1WKYA 4M0XA 3LTYA 3BJTA 2QCEA 1H7RA 4C5ZA 1VHCA 3S6OA 1XLMA 4CCZA 4J4KA 1RCQA 2RFGA 3DFNA 2UY2A 1RY0A 1MW3A 1EJVC 1EOMA 2YW4A 3ZFHA 3CTLA 4XBSA 1XRTA 3XISA 4YXGA 4X61A 3LXCA 3RJXA 1L6FA 4Q8QA 4O10A 3LRLA 4TVCA 2IPWA 1TV4A 2ZZ4A 4Q8TA 4JY8A 3TYUA 2PDGA 4LU0A 4MJ4A 2DJLA 1YMYA 3QSRA 1XIBA 1E70M 5I7GA 1VBUA 1Q66A 4AZ5A 1Q85A 4F4RA 2AL2A 3WQPA 2YL8A 3ZSSA 2GSEA 2RDXA 2DZWA 2PWGA 4QSHA 3AHXA 4IPLA 3BG5A 2VCBA 4Q6JA 3SY1A 1XDLA 2PP0A 2CWXA 4RK8A 1Q65A 4PMJA 4Z2LA 2YIHA 1N55A 1D8WA 7ENLA 4IL0A 4PUDA 1PE1A 3AYSA 3MBDA 3LB0A 1GNXA 4W7VA 3PWGA 2H9AB 3EOEA 2O9RA 2DZPA 2QCDB 1A5UA 3SGZA 5K9DA 5CGMA 1RCOB 1ELSA 4K1WA 3PBUA 2NXGA 4V1XA 3LCGA 3SW6A 1CEOA 2PP1A 2B31A 4O0ZA 1W3HA 2QCMA 4E8DA 5HMFA 5C54A 3H6OA 5AYXA 2Y62A 3L4WA 4JX6A 1O1HA 4DLFA 4EE9A 1W8SA 4QG9A 2HSAA 3VGEA 1U1JA 1AZ1A 2O9OA 3H26A 4R85A 1H2JA 4YWSA 4E4FA 5FJJA 4DF0A 1G67A 2VZVA 2DVUA 1W1TA 5JUVA 2ZZ1A 3OYZA 4RL3A 1YYAA 4L6OA 4PCSA 2WHMA 1ZCCA 2H6RA 1LLZA 4UFKA 1RA0A 4H9YA 3PB0A 2CLIA 1CNVA 1MRQA 3FJLA 1XKYA 3VKDA 4NYYA 9XIAA 4RDVA 3IIOA 1EHNA 4QEHA 3WD2A 2WWCA 2AKZA 4LY8A 4M7SA 3EMCA 3OLEA 1KBLA 1W1VA 3KBMA 1ITUA 1QK2A 4ZQPA 3IEBA 5LXXA 1U33A 1S39A 3CUXA 2QEZA 3CUFA 3G8EA 3FGCB 1G01A 2Y70A 1IZCA 4H8NA 4IMCA 4Y8EA 2OYMA 1KGXA 1UPMB 4PUWA 3SRFA 4XD4A 5EMYA 3OBAA 2BV9A 3WQDA 2DV0A 5C0QA 3U7BA 1Z42A 1VFOA 1VPYA 5AB3A 4Q4OA 1GQKA 3ZQ9A 4Z2IA 2QAFA 3AYTA 1IV8A 2YKKA 2O4QA 3EWWA 2INEA 2FTWA 2XYLA 4RE2A 3ARSA 2R1PA 4U2ZA 4J9JA 1I0DA 1EPVA 2C14A 4CQ9A 3BQ6A 4HNOA 4GXWA 1QI5A 4CCEA 2E9MA 3WLRA 4I6VA 3UJ2A 5CBBA 1R3WA 4W93A 1D8CA 1UD3A 4M3PA 2NT0A 2VX4A 5I3FA 2OWWA 3W7RA 1HFBA 1DJXA 4KCTA 4QJ4B 3R94A 4NRRA 3W6MA 3G5EA 1TJ1A 2PD5A 1XBVA 4QISA 3NSNA 5HXMA 3QJAA 2BASA 3GG8A 3EWUA 2WCGA 1ZBWA 3TROA 2D2JA 2E6YA 3FX4A 1OC6A 2QF7A 3BOLA 4EWND 2Z2AA 3IJQA 4EWJA 2DSVA 2PRHA 3SN1A 3IJ6A 1NOWA 2F8QA 3SCVA 2BVYA 3VKJA 4FR1A 2IPGA 2Y63A 4QXIA 1RVKA 1GEQA 1HJVA 3HJEA 2C19A 4CQ8A 1A53A 2FPTA 3TR2A 2XFFA 3GWQA 4MJZA 5LA1A 4PMYA 1K02A 3WLIA 2V5CA 4HU0A 1R7AA 1H51A 3L7RA 1S1PA 3DERA 1GW9A 3VC5A 3GTIA 4KS0A 5A5WA 1VYRA 1R3TA 1MXGA 3H7UA 4UNLA 1FWNA 2PWDA 4YN5A 3CH9A 4JTGA 1YW1A 1GVFA 5H6HA 1C29A 3TQKA 1WO2A 1XBYA 2Q8LA 4PMRA 4POCA 3SUUA 4DO6A 2V81A 1GPWA 3UR8A 5ABFA 2EJ1A 3IGSA 3QR0A 2BP1A 2E40A 4ZGYA 2HWGA 4TVDA 1CXFA 1W9UA 2WQDA 3S2JA 1UPPA 2YX0A 3TKFA 3TTQA 3G1AA 3BCDA 5E9AA 3GUGA 2C1HA 3OA3A 1FHLA 1CI1A 3QVQA 1WXZA 3S2NA 3DN5A 1AL7A 1JJKA 4UFHA 5U7SA 4IMAA 1TV5A 1XYLA 1Z89A 2VX6A 2ACRA 1FWHC 4PCTA 3A4JA 1DTNA 1NP0A 2HK0A 1KR0A 1XC4A 3KRBA 5CZJA 2D0FA 3W38A 4GH1A 4GX9A 4NJHA 1I1XA 5LA0A 1TG7A 1M9HA 4D9PA 4NZCA 1TQJA 5LHEA 5DCEA 1AJZA 1SZFA 3NOYA 4ZQNA 4OBRA 2VXNA 4PN2A 3W81A 1MI3A 3CUGA 2OWXA 3NAVA 5HQEA 4HVXA 2DORA 2FZBA 4CQAA 1C93A 3B4UA 3BW2A 3OBKA 4JOMA 4H6QA 4O17A 1PZ0A 4G7FA 3FXGA 2ZA1A 4NKCA 4S2BA 4I5XA 1JI2A 1QI3A 1HUVA 4XZLX 1N8IA 5T8GA 1Q4WA 2EHHA 4ERGA 2CBVA 1O60A 2QDEA 1TE6A 1R87A 3INPA 3R10A 4HYRA 3IGUA 2NWRA 1E6QM 1WX0A 2HEJA 1NDWA 4F0MA 1E0VA 4FNSA 5I07A 4DLMA 4LAOA 1NJJA 3UWQA 5D09A 3SQSA 3S46A 4XK2A 1BKSA 3I4KA 4LOCA 5BMXA 1VS1A 2H3BA 2OKTA 2DSKA 2BHYA 4HN8A 1TV2A 4AMAA 2E68A 3TFXA 3BLEA 5CZSA 1C7TA 4WKFA 2YSWA 1DJIA 2X1RA 4Q7BA 3DHFA 5F2LA 4ZB5A 3DENA 2V3DA 3N25A 2ZZ7A 2ADAA 4FLOA 5FF7A 4O57A 3BMXA 2ZWYA 1XYFA 4H00A 4C6LA 4UBPC 2QAPA 4CKQA 1LM1A 4R7JA 4RV3A 2H9AA 3P5ZA 1TWIA 3NXFA 1PYMA 1GKPA 5XIMA 2J24A 1EX5A 1KTCA 5TNVA 4KIRA 2J6XA 4L1GA 1J18A 4KKXA 3VGHA 2BMBA 3EXRA 3FW6A 1I2RA 3L23A 3PNUA 3UU0A 4BKNA 4OOZA 3FJ4A 1TX2A 3PBGA 3V18A 2CETA 4W8AA 2WHLA 4J3ZA 2JQXA 1OSEA 3W2NA 3K46A 1LJYA 2FZ9A 1TPEA 5E6YA 1ISYA 3UW6A 6CGTA 4GCXA 1CECA 1HF6A 1T99A 4F0LA 4O8AA 5LNUA 1S2TA 4IL2A 2IKHA 4ZB2A 3C86A 3IANA 2BGQA 1ZJAA 3ECQA 5BNKA 4M5PA 2OEKA 5KZDA 3GW0A 1V3KA 4JTJA 2O0TA 5CPTA 1EJ7L 1XYMA 4AEOA 1PIFA 4OUIA 1TO3A 3CLMA 4HMEA 3OO2A 1JZ4A 1IT7A 2UY4A 4GINA 5D37A 4LEFA 2CFFA 1EJXC 3ZIZA 3RGTA 3IRDA 3CAKA 4NXSA 1ME7A 4TV5A 5CCZA 3IIVA 5B80A 1EL3A 4BCEA 2DT2A 5BROA 3VNMA 5KZEA 1Y5XA 3O06A 1WZAA 1HT6A 2ICSA 3FGCA 4U10A 3PFRA 3O8AA 5G5IA 4GIYA 3OGRA 2QNEA 3LRKA 2P8BA 1F76A 6REQB 3U7VA 1EH9A 4J3SA 2DPEA 1HL8A 2KX9A 2PCEA 1K3UA 1GT8A 3IGXA 4AVOA 5GQBA 1FH7A 1ZAHA 3SIZA 4UNIA 4MNLA 1VPXA 4UTKA 3P82A 1MUMA 4CLMA 4TU1A 5KITA 2A1YA 1UOKA 2V5KA 1QDSA 5D9PA 4NIRA 1VH7A 2CITA 3TTYA 4C5YA 4BJHA 2QGYA 4F9DA 1QOXA 1LQAA 4QNEA 5CSRA 3ZLGA 4FNUA 4M1BA 3GTFA 3UXKA 2EQDA 3M7SA 4H6RA 4HT3A 1F8MA 1ZCOA 3TTSA 3VIJA 4D1IA 4KWUA 1T7LA 3MHFA 3NL5A 5I3DA 1LG2A 2J7DA 1O1ZA 1Y5VA 4R9OA 2RAGA 3DHUA 3ARQA 1UP3A 1KBJA 1KM4A 4MGGA 3UPBA 4Q4QA 3T42A 4A8RA 3TLQA 3F4NA 2J74A 4K1GA 2Y4SA 2GSJA 1AH0A 1XLFA 4Y9AA 5FOOA 2V2HA 4DJEA 3VGBA 2Z2BA 3UG4A 1E6XM 3HPFA 2G95A 4US5D 3H12A 1IWBA 3DFTA 5FL0A 5FEXA 1RAKA 1GEHA 3RRAA 2I17A 5HJYA 2YGYA 4Q33A 3A9IA 3UNDA 3PWIA 3S0CA 2E8YA 4BWLC 1PJ9A 1DBTA 2UBPC 5DCDA 4F79A 1Q2SA 3A6OA 4CNNA 4UTHA 5IXEA 2OQYA 5MF5A 1XICA 2BBFA 1HP5A 1QW9A 4NHVA 2KAUC 4D6DA 1BWVA 4IPPA 2DEPA 4MZ8A 3W1MA 1FWBC 4CNOA 4N9CA 5A69A 2NXIA 4K38A 3JR2A 4M82A 4ZFMA 4GQ0A 1TV8A 3GSMA 3PULA 3S2CA 4BR1A 3W7MA 4DB7A 4BF9A 3CK5A 4GKTA 4IXXA 2WC4A 1TIWA 1EEXA 1KCZA 4IIDA 3FDGA 3UYCA 2ZFAA 3AHYA 1XDMA 4Y9NA 3CJPA 4GFSA 3N9KA 4M6QA 1NM9A 2YW3A 4PTNA 3TXVA 1K70A 1QFEA 2YXOA 2EPLX 2QUVA 3VCNA 3SCRA 4IICA 3VZXA 3DUGA 3LXBA 1GKQA 1MO0A 4HSOA 4J3WA 2ZYFA 3TXZA 2P3ZA 5TBOA 2CXEA 1UROA 1XFBA 3UZYA 1Y5WA 2X16A 4J3VA 5G4HC 4JKLA 2PTYA 3R7MA 3EMZA 4PRWA 5ABHA 3A21A 3VM5A 4TX6A 4LQ1A 1S2AA 5AHIA 3I65A 4AY7A 4EPDC 5HNUA 4PYSA 2H90A 3OVPA 1EGZA 3W7CA 4L4MA 1PO9A 4MNJA 4LVBA 1G4SA 1OK4A 2OVLA 1RCXB 3I7QA 4JTTA 1YBQB 1P0NA 2J27A 1Y65A 1UWRA 5A6BD 2B7QA 2ZX8A 4KRTA 1L8NA 3LHUA 4RNFA 3REQA 1ISZA 3AZRA 1QNVA 1G69A 1GZ1A 2V3EA 1CPUA 1UWSA 5E1QA 2HPIA 5BRBA 2CC0A 3OYXA 3QBUA 4QEEA 3VE7A 1FA2A 4JYDA 5D32A 5LIXX 5F4WA 1LOLA 4W5ZA 1US3A 5A6MA 1W9PA 2C91A 3ANUA 2OODA 2V68A 4GYPA 1F3XA 2PDJA 3NQFA 3H24A 2FDMA 3UF9A 3ABSA 2GJXB 3BV4A 5ABTA 5EMJA 1V6WA 2TPSA 1O4UA 3RCYA 2ZXDA 2YCLB 4JTUA 4YYFA 3CBWA 2PE4A 3G6MA 4K8HA 3QLLA 3TAKA 5DRCA 1JF5A 2R14A 2Y89A 3V1PA 2VRKA 5HR6A 3SCSA 4D6IA 4U4MA 2HV5A 1S38A 4PTDA 3KDNA 4I5RA 4KQNA 3GKAA 3BG9A 1DWFM 5A8OA 1F05A 4Q8OA 5LGXA 1C3FA 4C6JA 5GNXA 1EJWC 1GOXA 4IP7A 4RLIA 5I3KA 2A3AA 1J0HA 4ICMA 3NVTA 3LM7A 3S83A 4ES4A 5DRIA 3RJYA 3ANVA 4NT0A 3JW7A 3WL1A 4W7UA 2JFEX 3FVMA 5D05A 2CZFA 4EANA 4LAUA 5AYIA 1LT7A 3K4DA 3UWYA 3CXOA 4L9YA 4ZO7A 3KCOA 3UY8A 2A85A 4H3DA 3CUZA 3MKCA 1H0IA 4DPPA 4LAZA 3GUWA 1C9DA 1B30A 1FWEC 3AIEA 3DI1A 2DY3A 1L6WA 1XGEA 3VMOA 1HX0A 3HGRA 4TOQA 2PEVA 1AQMA 4H8UA 1D3HA 4GBUA 3C0QA 3G18A 3F4VA 3MSRA 3SJ3A 4A2RA 1BRLB 1XCWA 4J2MA 3ZWTA 5DT5A 5HUOA 3B3DA 3SRHA 1CWYA 1DHKA 3T2OA 5D03A 2WCSA 1LCOA 3G1RA 7TAAA 4FP1A 1IGSA 1XUZA 3F03K 2YLLA 3CTTA 3G1FA 4IM4A 2ZKMX 1J79A 4Q32A 4W87A 3A13A 1OCBA 5JIPA 3PBVA 9CGTA 2R1LA 3PY2A 4X0VA 1JPIA 2Z4GA 1PEZA 4QROA 3VDAA 3EX1A 4H7ZA 1M5WA 1SFSA 3I6TA 3T8QA 6REQA 4I6KA 2E25A 1ZU8A 1NFBA 1K7FA 4MLRA 5CG0A 2QJGA 1V6XA 3KBWA 4AXNA 3K8KA 4PMUA 4FPSA 2DDXA 2OOFA 2FB2A 1EIBA 1JAKA 3F4DA 4GJIA 3TE9A 2FVMA 2X41A 1EO7A 1DIDA 1GOKA 4RJEA 5AYBA 5I77A 2IMRA 5K3VA 3AXXA 4LS0A 3W2JA 2XGBA 2BDQA 4QITA 4WJEA 2QJMA 4JNYA 4NZ4A 1FWAC 2WSQA 1NQKA 5U4NA 5IRPA 4XZWA 2WNWA 4LVGA 1T0OA 3OGSA 1VJSA 1CCWB 1EKOA 5HPCA 3P0WA 4GD0A 4AZ7A 3VPLA 4J3TA 4MMWA 3NQCA 3MDWA 2VHLA 5BXSA 3W1UA 1M7JA 2FPYA 5H1WA 1XQKA 3W7OA 4A05A 1MEIA 1S5VA 4HIBA 2R1MA 4PGLA 3T6CA 2ZUMA 3VMPA 1SMAA 2ASHA 5C9WA 3QMTA 1GVEA 5BWAA 4HJWA 2XGZA 3KUMA 4DYEA 4N6FA 2X1UA 4LTSA 1DQWA 1CGXA 3VNYA 1XIFA 5DT7A 2HVOA 1IEIA 3M44A 2ZWZA 1XINA 1WCGA 3W76A 3AMGA 2WM1A 1AH4A 4G56A 1GKRA 1X1ZA 1PVNA 5I5RA 4HZ7A 3GNDA 4M19A 1MRAA 1GVIA 5HMSA 4LUSB 3WIJA 2YB4A 4HPXA 4D8AA 4D72A 3QRHA 3M0KA 3CMJA 3B05A 2FZ8A 1XYCA 3CB8A 1XH2A 4B2DD 1O94A 1QNQA 3OG2A 3DG7A 3JVAA 2EEXA 1VRXA 1E55A 2GJLA 3VU2A 2YPIA 3P67A 3MCNA 1O66A 4F0HA 4P8UA 4UCFA 2BVDA 1W54A 1XIGA 2PWVA 4Q3MA 2G0WA 4A6GA 2C13A 3QQ1A 4HD5A 3EWXA 3BVJA 1JCNA 3AMDA 3ISIX 3STCA 1AL8A 4C60A 1OF6A 4UMBA 3FKRA 1KM1A 1AA1B 3B8VA 4QP0A 1BYDA 4M29A 2A3EA 3MW7A 4L4OA 1M65A 1FX6A 4R53A 3GU2A 3RU8X 5AZ1A 2ALRA 2EPKX 2G3IA 3UA4A 2JALA 3B04A 2WLYA 3LEPA 2OXNA 3FAWA 2CLLA 2QUMA 1X6UA 1YPXA 2PGRA 3AMKA 4QG8A 4BF7A 3BPWA 1VEPA 1JGMA 1B57A 1QHZA 3IUIA 4GKLA 1G4PA 1WZMA 4LH8A 2DVXA 1Z44A 1OFAA 4XD3A 2W61A 1IEWA 3MDUA 1E6ZA 1Z8AA 1PX8A 2GJRA 4PCFA 3EWZA 4DWDA 3R4IA 3OBEA 3P61A 4XAFA 3DU0A 3VX1A 3JZUA 4N02A 1XP3A 4PTWA 3GG0A 4NZ3A 4F40A 1AH3A 3H2NA 2EBNA 3AS3A 1EC9A 4GWEA 1YBQA 1IT0A 2QV5A 4CGTA 3MBFA 2X0HA 1VC4A 4OWGA 3G24A 3PZIA 3KRUA 3P74A 3P8IA 1UUMA 4QQ3A 2VOMA 1W5PA 4RNHA 5HWJA 2ZRXA 4J2PA 3O3RA 3L0NA 3O7UA 2W62A 1R6WA 3OZPA 4KEMA 4MWAD 4AX6A 2VC5A 4LALA 1JYXA 2PGFA 4JTLA 1XLCA 3MI6A 3M0ZA 2GWNA 3NYZA 3ELFA 3QGAC 1ONRA 1UJQA 3TNBA 4ASTA 1FWSA 3N17A 5FF2A 1G7VA 2PU1A 4LV9A 3L4TA 3SEPA 3LMZA 4IG2B 1TMQA 4BS0A 2GJXA 1Q7ZA 3UQNA 1E0XA 1WBJA 5TAOA 2LLEA 4JN7A 2YCLA 4L61A 4MPKA 2FFIA 2L5HA 4UQBA 2XN2A 4CNTA 3SY5A 3EOOA 1R8LA 1ZSXA 1V5XA 3RDKA 1R9YA 1VBGA 3W27A 3T4CA 3BZJA 4IUOA 2OG9A 2OELA 1S1RA 2DZXA 1DE5A 4DY1A 1S2WA 3B03A 1OHLA 3NZRA 3T0CA 2V5JA 1WA3A 4CNUA 1R46A 3VNDA 3T55A 4MG4A 4DYJA 3QR1A 2GVJA 4Z2HA 1XUUA 4N9EA 1NU5A 4RDYA 3AC0A 2P5NA 3HOJA 1KFBA 3GG7A 3TZFA 1W5NA 2Z28A 4AZGA 4OV9A 4OV4A 3GNNA 5D4YA 3PUDA 4Q8WA 3VD4A 2P1FA 1EWEA 4X9YA 1BSLA 1HP4A 1SO4A 4B90A 1E0UA 2XZ9A 1A0DA 2BXVA 2QVNA 4DN1A 3RR1A 4NP7A 2DSUA 3W22A 3PSVA 1LRNA 4ZOEA 3VOFA 4IPIA 3LCWA 1BRLA 3HQ1A 3VCCA 1ONWA 1R3QA 3VI2A 1UA7A 1E4LA 3WBWA 1L9WA 4WSHA 1VFTA 2CKRA 3ONCA 1W1A1 1OZMA 4H9XA 4UTTC 1OFQA 2VD9A 1QCWA 1H3GA 1KO0A 3AYVA 1QK0A 2J88A 1RD6A 4DZHA 3OQEA 5CG7A 1FH9A 3PBMA 3VVGA 2GQ3A 4Z2JA 1UIPA 3GBDA 4KEUA 4PUEA 2WW5A 5CSYA 1PZ2A 4UFMA 3O63A 2ATMA 2EO7A 3CHVA 2REQB 5TQLA 4PFMA 3LBCA 3CLWA 2QQ6A 5BU9A 2DIJA 1G4TA 3O1NA 1JPKA 3MHUA 6ENLA 3AIWA 4U3CA 1OJXA 1R3RA 3MUIA 1DIOA 1X96A 5BXPA 4KPLA 2XH7A 1F74A 2NT1A 4MLJA 1UWTA 5J04A 2C18A 1KXTA 4KH2A 3NCOA 1B3VA 2NSOA 3S9IA 3CPGA 2FHCA 4XUGA 1KXHA 1THFD 5EY5A 5HQLA 3LPPA 4AEEA 4I9TA 3KLLA 5FF3A 3WLLA 1GHSA 3VZZA 3EDFA 2E77A 5CPMA 3W1NA 3STFA 3IUHA 3LBMA 3HO8A 1VQTA 1E43A 3AZSA 1ENUA 5JMUA 1NELA 1DE6A 3TQPA 4IFRA 3M1ZA 1NH6A 1QR7A 1WDQA 2BHZA 1JUKA 2DGAA 2D2HA 2OZ8A 2NUWA 3VILA 2ANUA 2G97A 4N6EA 3W6LA 5I03A 4FB7A 3PZOA 3EDDA 1JG9A 1CLXA 5A6SA 1I45A 2G4JA 5BCAA 2PAJA 3ITGA 4O53A 1BQGA 5AECA 3M6DA 2Y7EA 1I4NA 4H8VA 3NQDA 1NAL1 4E8CA 1I9CB 2PZ0A 3I10A 5GPRA 3UXDA 1IIGA 4IIFA 4LVDA 3LDVA 2XIMA 2VRQA 1FTXA 4KFOA 4WY0B 4GX8A 5A6TC 4C6OA 1HKWA 4YLWA 3BARA 2J25A 1V0MA 3K4WA 4LUIA 3GY1A 1M7OA 4B5VA 1QU4A 3L12A 1VPQA 4R27A 3VIKA 1KM2A 4UFLA 2I5QA 2JEQA 4NNCA 2XVKA 1GQLA 1LWHA 4LUSA 4P61A 4GA8A 2F38A 1NSJA 3L68A 3ZJ8A 1HL9A 2V9DA 2Z1WA 2IQTA 1ZBKA 1XBXA 3SUWA 5LIYX 4K68A 3LHWA 3KOXA 2ALDA 3OLGA 4TXEA 4PUMA 3S42A 3AHTA 1XPGA 2POTA 4NJJA 5EFFA 1HXJA 3BK0A 3BLOA 3TCSA 2PRMA 1TMHA 3GXTA 4FOUA 4Y9OA 4DZAA 3AHZA 3EB4A 1XRSA 5DO8A 3BSGA 3C2EA 3L65A 4A3QA 1BG9A 4E3VA 5A2CA 1NWUA 1IXQA 3D47A 1NFGA 3U4AA 3RIKA 8RUCA 5D2TA 1JCJA 4LBSA 2V8ZA 3CIXA 2YZ5A 2NQHA 4UB9A 6ALDA 2GVLA 4GRSA 1NDZA 2G3JA 3M7WA 3VKBA 3NM3A 2QJNA 3LS9A 4NRSA 4UTMA 3RPTA 4DQWA 1EXPA 4HNNA 4TV6A 1DTUA 1O5RA 4QDWA 5FF0A 2XTKA 3B9NA 1TWWA 2O7SA 1DWHM 1JZ2A 4DBSA 3KFTA 3MJYA 3TOPA 1H4PA 3W7NA 1JUBA 3E5PA 1CXKA 1TZ9A 2ZDRA 3SO7A 3QOKA 1JYWA 2CBJA 5HR7A 1WKFA 5GNYA 2D69A 3U5UA 4TTUA 3W23A 1TSIA 3TW7A 1W2VA 2PDYA 1SZRA 4S3GA 3ABQA 3A3HA 4LX4A 4XISA 3VNZA 1G5AA 3VD5A 2X2GA 5E09A 3OZMA 1H7PA 3NPUA 1K7EA 3BTNA 3CQHA 1SO6A 1U5HA 3N2MA 5HQMA 1OYBA 1PTAA 5L9FA 2EPMX 3BAIA 4JTSA 1JZ5A 3LQLA 2G3NA 1E1EA 1RR2A 5AC4A 1QHOA 1IQ8A 1B90A 4WSJA 1WUFA 4TX9A 4IJRA 4IG2A 1W5OA 4IJCA 1H5YA 3BAJA 3W2UA 4GUJA 3UR7A 3AO0A 3O6AA 4GLEA 1A5LC 4D8LA 2PLKA 5RUBA 2YYUA 1G0CA 3B0UX 3SUTA 5D2YA 1E3ZA 2R94A 4HOZA 2R6OA 3HG4A 3WH9A 2V2CA 1XISA 1AUSL 3NURA 2VFDA 1OT1A 4MKSA 3UYIA 3VDBA 5CGTA 1PHWA 2I16A 2OTDA 4MWAE 3QM3A 1FCUA 4ORMA 5I00A 2J7EA 1CGWA 1CXIA 3CYVA 4DELA 4EF9A 4FS9A 3TJXA 5D38A 1MXSA 2WPGA 4JHZA 3QMSA 1ME8A 4AHQA 1FP8A 4RXGA 3B0XA 3N73A 4YTTA 2BXYA 2X40A 1K8YA 2ZXAA 4JZ5A 4MJ2A 1XM3A 4AISA 1W9BM 5HNRA 3KTXA 5LIKX 1ODUA 4HMDA 3SQLA 1MYRA 1J4EA 3C3UA 2DH2A 3BSHA 2PA6A 3W6YA 1HKMA 4MWAC 4F66A 4NZ5A 1WDPA 1CXLA 1G9HA 1WYIA 3I6RA 3AQUA 4P7QA 4O4WA 3KX6A 3E12A 1WDWA 4WQ6A 3SCUA 2IKJA 3CMFA 1FH8A 5F2MA 4ILSA 5I23A 3KW3A 4WIWA 2VL4A 4BZYA 1V6UA 2OPJA 3EDEA 1IEXA 1UR0A 3GIYA 1D9EA 4JIIX 1JCXA 4S23A 2QCGA 1LZOA 3DC0A 4L65A 3NZ1A 3GHRA 2OEMA 3L2LA 1JGIA 2REQA 1S3HA 1GQNA 1O6IA 4NJIA 3NJ3A 3DFPA 3MB9A 4U33A 4QGCA 2QYGA 2W0UA 3NR0A 3V75A 1EX1A 4OECA 3GIPA 2E9BA 4Z42C 4Q8MA 2F7FA 2QPSA 3AXHA 2PDKA 4QCEA 2OGJA 4AB4A 4AIBA 3PHAA 3NO3A 1EEPA 3SIMA 4WX2A 1F6PA 4GBDA 3F4WA 1UZ4A 3BO9A 3QGVA 1WPCA 3W7GA 1IE7C 3DAQA 2ZRWA 4R7WA 3CEPA 3K4AA 4AFYA 1E9LA 4PRTA 2Q01A 3CO8A 3CZGA 4JIPA 5AYZA 4MUPA 5F1VA 1YEYA 3TV8A 4W5UA 4K8EA 3QXBA 2PTDA 3EKGA 2IPFA 4RCXA 1ESWA 3BSMA 4DO4A 4QX4A 4IGHA 4RZ5A 1UASA 4E3TA 1UWQA 1NARA 1RBOB 4PBFA 1OFRA 3WF1A 3S2MA 1DIEA 4HU8A 2NQLA 3W24A 1W8GA 1UMYA 3W7JA 4WVXA 5T91A 3MVIA 4BK9A 4WY0A 2QCCA 1G6CA 3UZ5A 1B54A 9XIMA 1PSCA 4MZ1A 2PODA 3MUZ1 1SO5A 1L8PA 1LT8A 1LL6A 3TVAA 3QZ6A 2HCVA 3VOGA 3HFTA 4LSBA 3NEHA 3SRKA 5IHRA 5DMNA 4JFUA 3WDIA 3A4XA 3V36A 2Z2UA 3UCCA 3UPWA 1KM5A 3LHYA 4NU7A 1P0EA 4Q8UA 1VP5A 3WEZA 3PG8A 3N4FA 4U5KA 4IP4A 4N7QA 1RV8A 4B15A 4AIOA 3DI0A 1RPKA 2BX7A 1GYNA 3W2KA 1FVPA 2VFFA 4IH3A 3L4YA 2W27A 3E2QA 2OT0A 3WDHA 1KRBC 1NWTA 1QWKA 4MDOA 3N11A 3I7RA 4M24A 2XZ7A 5ENLA 1FY6A 4OTKA 2YDSA 3NL3A 1RA5A 1LRQA 4WDXA 2E3ZA 3ITXA 1HW6A 1KFKA 5AN7A 3O0KA 4MB3A 3TYZA 3WJYA 3UJFA 1OX6A 1MZRA 1WZKA 2GVGA 2ZDSA 2WSYA 4ZSUA 2J9ZA 3Q45A 2GDQA 2CZ5A 1UC4A 3HM7A 4H2HA 1Q8JA 4M7TA 2I9EA 3EGJA 3VXGA 2ZX6A 3A12A 3VIIA 2NVAA 3M5VA 2J77A 3QFEA 4E5TA 3WBXA 1SFLA 3IJLA 3Q67A 5EA9A 3DKLA 4EXBA 1J2BA 1A5OC 1JVNA 1S5WA 3BCFA 1GUVA 4ZO8A 5DMLA 3HMJG 5DMMA 4C7GA 5IM51 3EX6A 4CD4A 1K9FA 3CAVA 1QBAA 5D02A 2BS9A 5KETA 2JF7A 4ERAA 2YCIX 2Y7FA 1KXVA 5C6MA 2WC7A 3MZNA 3QTPA 3AIRA 3MV01 4ZVJA 3WQEA 3E3HA 1OK6A 2DSZA 3ZJKA 4JEJA 5A8QA 2X1IA 4V2XA 3C0LA 3QHMA 3M16A 2EKCA 1VYPX 2CYGA 4GG9A 4F3HA 4E38A 4UTLA 1KFLA 3CPRA 4EAYA 3UCQA 3N1AA 5C70A 3W00A 4ECLA 3QTGA 3KCLA 1KBKA 2J7FA 1H50A 3KE0A 3CZ8A 1X97A 5A1AA 1XD0A 3VIGA 3FA3A 2VR4A 5HINA 3N04A 3L67A 4O1AA 1DJNA 2ISWA 2O56A 5LNSA 1E71M 1TB3A 1S2CA 2OFJA 3O07A 1BYBA 3WX7A 4O16A 1QO5A 4Z1AA 4OFCA 3KRZA 3GC2A 4Z2GA 4MWAB 4UFJA 3P80A 3RF9A 4HPNA 3O16A 1TA3B 3WEOA 1TR1A 3LMYA 3WUBA 4C6CA 4XG1A 1U5JA 4A8IA 3DGBA 1H1ZA 2MANA 4KWSA 4B91A 1H0GA 2E5CA 3ABXA 4UTTA 3GTNA 3BURA 1DVJA 5REQB 3SBFA 4WZHA 2Z24A 4YL2A 4DAIA 4S3KA 3DKJA 3VGDA 1QW8A 1XHGA 2CNCA 1C92A 3IWPA 3HV8A 5M2FX 1E9IA 4Q8NA 1KCKA 4MFEA 3TUUA 1QPQA 1KM3A 4D6EA 3CGTA 3EPMA 1QHPA 3LCHA 3AXKA 4KGLA 4J27A 4BQ4A 2UY3A 3LBOA 1YHTA 3GHTA 1LWIA 2J75A 1EUNA 3HG3A 3PM6A 4TX8A 2R1KA 1DORA 1SGJA 2VEFA 1J2WA 1EP2A 2O7QA 2BWGA 1EJSC 5CBJA 3PUGA 3W83A 4QIUA 1GVRA 5G2HA 3UFYA 1MQQA 3TJ4A 5AC8A 1F4AA 3MKKA 3VNIA 4GYFA 4AHPA 3WNOA 2VENA 3CM4A 2NLYA 3ARYA 2HJPA 3MMUA 3MTWA 4O50A 1W31A 2X8RA 1VB9A 2WHJA 5DFAA 3A5VA 1IZKA 2F6XA 1TE1A 4JQ2A 1CBGA 1SQ7A 3WQGA 5D30A 3VIOA 5CPQA 4DBWA 3GG1A 2C16A 4K37A 4QCFA 1NOFA 3TYBA 4RNIA 3OA5A 4QLJA 3PP7A 4FNRA 4PMQA 4QDMA 5BU6A 3LGEA 3E6EA 5LIUX 1K6AA 2ZX5A 3HBLA 4U3AA 1LQ2A 5BZAA 4TVUA 3E02A 4MNMA 3E74A 4FX8A 5DF0A 1FWWA 3DCPA 3C6CA 1RHCA 2ACUA 2MUCA 5IHSA 4C1NB 1J96A 1C9WA 2G37A 2XGIA 3N13A 1V3HA 1EUAA 4ML4A 5XINA 2J7HA 2HDJA 4W4QA 3L5MA 3MYOA 1CTNA 3GD6A 2OMAA 4H1ZA 4HSNA 2Z0IA 5BOFA 1TUFA 5JH2A 3RU6A 1WV2A 3TJLA 3ZOAA 3QHNA 3ZR5A 2ISVA 2PGWA 4EIVA 5I3GA 5LXEA 2QHAA 2VZUA 3APTA 4H9MA 2YA1A 3UGVA 4WOZA 5HWNA 2UWFA 3LYEA 4WSKA 5KSWA 4YHEA 1W1PA 3AJ7A 5FAGA 1V8EA 2NQJA 3GDRA 1YLVA 3WDQA 1EA0A 4ZENA 4DM1A 3EEGA 1KRAC 3COTA 5EPDA 2E28A 1EPXA 3QN3A 1AQFA 4RPPA 1K03A 4V27A 1ZLPA 3QQWA 2V30A 3W75A 3OODA 2EPHA 3ATYA 4GZ7A 1TFVA 3E2VA 1L6GA 3WLTA 1V0LA 5D9OA 4O13A 3STEA 4B9ZA 2G41A 1KWKA 4PEEA 3GE7A 4IQEA 2W79A 4XTIA 1QRQA 3N6QA 1OCJA 5EB8A 3N12A 3PZ9A 4X9SA 1ISXA 3B8UA 1VFUA 2QJJA 4E2BA 1SFTA 4XZMX 5HMDA 5A95A 3R43A 1ZENA 2PD9A 3OHIA 4MADA 3L2IA 3P2VA 1GTEA 1E6NA 5M03A 3W7HA 5H8UA 1JD9A 3HF3A 1R7OA 1DWAM 1VGAA 3T2QA 3AUJA 1E6PA 1UKPA 4PODA 4L1WA 3BQ5A 1A0EA 2QCFA 4EOUA 4H83A 2Q8XA 1EZWA 5CPLA 1L2QA 3UVAA 1AW2A 3KOFA 1EDTA 4C6PA 3BGAA 1HKJA 3IVTA 3W3OA 4DBDA 5LA2A 3N3MA 5CAHA 3LUTA 1JDDA 1ZAIA 3GW3A 1IT8A 5JBDA 2WZEA 4ZE4A 3WD3A 4IX2A 4HOWA 3VDGA 1OX4B 4OU1A 4OBSA 3EB3A 2J6VA 4UMCA 1TMLA 4HYVA 4MIMA 4XD5A 1ZTVA 4FSAA 1R2SA 2V6AA 3M0IA 3ZT7A 3LZ3A 2FJUB 1V0KA 5JXQA 3UEQA 2XH2A 1JCMP 3ALGA 1EDGA 2JKEA 1Z9AA 2ZA2A 3T7VA 4Q4SA 5I09A 1XIMA 1I2NA 5FESA 4D6JA 4UOQA 1E3XA 1WUEA 3W1LA 3MSDA 3O6CA 1GZGA 2ZTKA 1DEDA 2VVSA 4IQLA 3WJXA 4KRUA 4PZVA 1C8VA 2D2GA 5K2ZA 2CLMA 1C8XA 4AXKA 3NSXA 5TD4A 1KBBA 3B8DA 1OVDA 4ADTA 4KCVA 1E5JA 2PGEA 3QQ0A 4JGDA 3S9YA 4XSMA 4D8ZA 1M68A 2C15A 2YFNA 1PB0A 2VEGA 3GXMA 4J1OA 1IGWA 4JTKA 3GQYA 4FF5A 4MTVA 3WLHA 1CDGA 1U83A 1IHIA 3T40A 2PDWA 1W1IE 3TMLA 4LVFA 2ZADA 2BXZA 1BXCA 4MZYA 3R13A 2FHBA 3GC4A 3FS2A 3TONA 1BEUA 1FDYA 4DZ5A 5C7VA 2XJ7A 1OFEA 2VX5A 3AWNA 4BI7A 3GAKA 1OFPA 3R0UA 1ALDA 1F6YA 1LLWA 3KOZA 1R0MA 3UZWA 1V0NA 4FLRA 1EQCA 3BANA 4L5ZA 1TA3A 1KBIA 3VGGA 2OYLA 2IUZA 1PBGA 3IVSA 1RVGA 3TH6A 1XH1A 4N2YA 1A5SA 2OSWA 5REQA 4XAGA 4G9PA 3PBYA 4XO6A 3URQA 1WOBA 4AD5A 2PBOA 1JULA 3U2ZA 3AALA 1DOSA 2A2IA 3N9RA 3KLKA 3VOCA 2D73A 3LNMA 4AZHA 3U5YA 4RE0A 2DVTA 3KL5A 5EBUA 2HNHA 3WELA 3N6JA 1H7NA 4UC5A 1C91A 3IACA 3CV1A 5DY2A 1H09A 4G8TA 4N4PA 5EKYA 1F2JA 5BXRA 4WXYA 3TQVA 1C90A 2O55A 3WF2A 2ZUTA 4MDPA 4Q4MA 3TX9A 3E5BA 3HGSA 3NA8A 3SUSA 4ZE5A 2OR2A 1T6MA 2PU0A 1M3UA 3S8HA 4RE4A 1OIMA 4KCWA 3VD7A 3WD1A 4CN1A 4DVOA 2ZQ0A 1KW1A 2FJKA 2FGLA 1OQFA 5A6AA 5E0FA 3UA3A 5H91A 1ZP4A 2W3ZA 4J40A 3GHSA 3GR8A 1FOBA 3UG5A 2BVTA 3S2LA 3EBVA 3DHDA 3FSTA 2QF8A 4TQTA 2BSLA 1B3XA 1FRBA 3DOPA 3WUGA 1A50A 2J79A 1JUEA 4DJFD 2PWFA 4XX6A 2PDFA 3QC3A 1MW2A 2AAMA 4WLCA 3TYAA 4XZBA 4A21A 3WNKA 1F07A 2Y1HA 1W9XA 4BEUA 2ZBTA 4CD5A 3EAUA 4CU8A 2V69A 3LHZA 4PULA 1LLOA 2FGZA 4ROQA 4QNWA 4C1NA 4F8XA 2QS8A 1DV7A 1B3OA 5D8ZA 3NQ2A 4XQ6A 1TTQA 3WQWA 4WEVX 2CZEA 4RDWA 3TDFA 4AD4A 3N2CA 5A6JA 3HPZA 4WUIA 2Z6JA 4GXMA 3MP5A 3W86A 2QZRA 4UNKA 3W0KA 4ALDA 2WQPA 4P7OA 3UESA 3SFWA 3SDOA 3H4XA 3B9OA 2ABBA 3N2TA 4ZEPA 3GVWA 2NVDA 1KTBA 1Q3NA 1ZY9A 3T44A 3BW3A 4GXPA 1E1FA 3L9CA 2PRLA 1ZBCA 3F2BA 2G3FA 3MUY1 5G2WA 2VI0A 5EMMA 3AU6A 4X63A 1PKYA 1E0WA 2EAWA 2HBVA 4JPGA 5CLWA 1OINA 1UD5A 3R0DA 3W82A 2AQVA 3HIJA 2OQLA 2Z7GA 3G2GA 1R30A 2WMGA 4QE4A 1FWTA 1SMDA 3TW9A 1K9EA 2E5BA 3SSJA 4BI6A 3D3AA 3PJXA 1X6NA 1IWAA 1P6CA 4RZ6A 3TSMA 1K77A 1MEWA 4EPKA 2XIJA 4XZ9A 4B3ZA 3IJ9A 4DNHA 3H4WA 3WFLA 5CJ5A 2Z29A 3KOYA 1HJXA 4IMDA 4YPJA 2HROA 1XR2A 4KW2A 3IIXA 3RFAA 1R3YA 3GDTA 4HZ8A 1SR9A 3VE9A 4CD7A 3PC0A 3PTKA 4AEFA 3RCMA 3TWBA 5FJPA 5GJMA 4Q22A 4GO9A 3GKFA 4GI6A 4J28A 1WKDA 3NM1A 1Q63A 3C0JA 2RJGA 2DIEA 1FHDA 1VBJA 3IAQA 1A5NC 1EYEA 1OD0A 2QUTA 4GYPC 2ZUVA 8TIMA 3AWOA 3AXIA 3KAOA 3QV8A 4L4LA 1GYLA 3R79A 4K7YA 4XBKA 3TYEA 1MUCA 2VFIA 3U48A 3QW3A 3I7SA 5LIWX 2J9YA 1SJDA 4UTJA 2WAGA 3HG5A 4AZIA 1BD0A 4M81A 1JFHA 3LENA 2VR5A 3QF0A 1SSDA 1KC7A 4GQQA 3VABA 2PP3A 5F2IA 1OX4A 4ZXLA 4AX7A 3RAOA 1PDYA 3NZGA 1YKWA 2H3DA 5I3JA 3WNLA 4I7WA 4QLLA 1ICSA 1S46A 3J7HA 1KD0A 1CGUA 5HWMA 1X8FA 1AFSA 1VYSX 3W7EA 4IPNB 4ATWA 4I5UA 4MY1A 1TPFA 3PK7A 1U5VA 4HA4A 1XLLA 4IZGA 3UY7A 2VFHA 1C8QA 4LAMA 3LLDA 1SSGA 2E0PA 4J35A 1KXQA 5CZTA 1RJRA 2V5BA 4MF4A 2GVEA 4JL1A 3WD4A 4UXDA 3BZGA 4HNCA 1RPXA 4UR7A 4Q4KA 2CCRA 3GVRA 1ITXA 1FWRA 2WHKA 1FWIC 3AMCA 2P0OA 1JPMA 1EIXA 1EWDA 4CN4A 4QQUA 3CASA 3A9BA 4M51A 4YTUA 3IRSA 5I02A 4EXQA 1GQIA 4WF7A 1UKTA 1Z69A 4AC7C 1BKHA 3QZAA 1FCBA 3EA2A 1TWSA 3GZ3A 3USBA 1MFUA 2VCAA 3CZKA 2IKGA 2NUYA 3L66A 2VNCA 2A6NA 3IJ8A 2HVNA 4JBRA 4OJYA 3V5OA 3UZZA 3EDJA 3ICJA 2CLHA 4GQGA 3VD9A 4PUUA 5IFPA 1JPHA 2F9RA 4FX6M 1OC7A 3UXIA 4MJMA 3BLIA 3AIUA 1ZZMA 2G5WA 3GR7A 3AHVA 4NL1A 4FK9A 3T05A 3RK8A 4QAIA 2VZOA 4CQBA 3W71A 4NX0A 3CB3A 1LQ0A 3HURA 1H63A 3H2MA 2NX3A 5JIWA 3CZEA 2V5DA 4FMVA 4UUIA 1XLDA 2ZC1A 1XIIA 4FALA 2YLAA 3BWWA 2XH0A 3W28A 2OYKA 2A79A 3C8NA 2V3FA 2IPJA 1OX5A 3BW4A 3H55A 3GNPA 1J01A 2GGHA 3UVIA 4XKYB 3LXAA 1H60A 1MEHA 1NTHA 4RV8A 3TNOA 1FWDC 3ARVA 3FA4A 1VCVA 3KL0A 2HS6A 5BXTA 2WBGA 2RUSA 3W74A 1W5QA 7XIMA 3OTRA 1JAEA 2HQAA 1PCWA 1V3LA 3NGJA 1HVXA 1B9BA 1DP0A 1HKVA 1TX0A 1OCNA 2JE8A 3VCRA 5LZLA 3NZQA 3EWYA 3GAYA 2Z1KA 3MP3A 5CAKA 3QY8A 2J7CA 3FN9A 3OPSA 1QVBA 4I9AA 1R86A 1KLZA 1ECQA 1GOIA 2PDMA 1GVSA 2QCHA 2BLEA 2Y2WA 1V3IA 4OT7A 3OVRA 1FFRA 1VBRA 1BVNP 4QBXA 3B0VC 3PUOA 1PCKA 1RBLA 3GH7A 1ITCA 4HPJA 1VKFA 4RX0A 1O5KA 1RUSA 1YDYA 3SZ8A 5CXPA 2FZNA 4DUWA 5FKYA 3QYQA 3ES7A 5B7ZA 2E6FA 3B4YA 4ZMGA 3GH5A 3IV3A 2HE8A 4PBEA 3QHOA 2FB3A 2JIEA 4AD2A 4F2UA 3M5XA 4B3KA 2OOGA 4MYXA 2Y5EA 3AS0A 3KS5A 3T07A 2E9LA 1TVPA 2WVVB 2WNNA 1A3WA 3WG6A 3WLSA 5IOBA 5CSUA 3SCOA 1FWCC 3CL6A 1F8IA 3DZ1A 4C6MA 3KP1A 1UD4A 4JKKA 4GQBA 1DWGM 3DIPA 3ZLFA 5KINA 2VRJA 1B2YA 1SYTA 3IK4A 3KXQA 1R9XA 5B7YA 1ZALA 1UMLA 1YADA 3REQB 4J3UA 2VJXA 3JZEA 3NNTA 3HTWA 4MAZA 4LW7A 2NLIA 3NPVA 4C7DA 3PZMA 6TAAA 5JQ9A 2W63A 1EGMA 4NJGA 1FCQA 1YRRA 1BFNA 1T96A 2DT0A 3GU1A 2OT1A 4YVPA 1SFJA 4DI8A 4KGJA 2X1SA 5A8PA 3H21A 1XLHA 2X7WA 3T4WA 4B4HA 1V02E 1WOAA 2V2DA 3PAOA 1VJZA 1GK8A 3UT0A 4ZXOA 4YTRA 3WMCA 3TW6A 1BVZA 4XZIA 1W9DM 3E0FA 2WPBA 1EBGA 5LHFA 2V0TA 1JDEA 4B92A 4DBEA 2Z1VA 4AD1A 3HG2A 3VKAA 4L9XA 5CZKA 3UPMA 1X8CA 1K9DA 1KTNA 4LNCA 1PYFA 1C8YA 4KEZA 2E4TA 5E0CA 3NPWA 4IISA 3DGRA 4YVXA 2NV2A 3WQVA 2QIWA 3BLPX 4G7EB 3M4HA 3QV9A 3FHAA 2VQTA 2Z6IA 2VURA 3OVGA 4G1NA 3WJWA 2BY2A 2X42A 4MY8A 4G5DA 1ONXA 3VTRA 4YCPA 4DJFC 3PSWA 1W17A 4NJKA 2VGGA 2FKPA 4PH6A 3T08A 1B31A 1P6WA 2RDWA 4IWWA 3LCIA 1HIZA 4WRHA 1KV5A 3CL7A 3M41A 3ITYA 2GQ8A 1S2VA 3CWHA 1J0IA 2E6AA 2GJPA 2AMXA 3LLFA 3ZO9A 4B16A 1IEVA 1OADA 3APGA 3SCQA 3UXLA 3V7PA 1OGGA 4QLKA 4WDWA 4QFUA 2O9PA 4UCGA 5AHMA 5JBEA 3G77A 2GZXA 1R5YA 3OGVA 1KFWA 1T41A 5M3WA 2ZZ2A 2X0YA 4Z08A 5LNWA 3PJUA 4Z1CA 1JIBA 4GFIA 4PB4A 4LEQA 4KWVA 1ISWA 1YXYA 4XD6A 4NI8A 4NNBA 1A47A 3HFYA 1H62A 3BDKA 2RKXA 5AC7A 5F7UA 3HQOA 3L0KA 4N9BA 2NQ9A 3WLKX 3DG3A 3GTXA 3B8SA 1AD1A 3CZJA 1TPUA 3PR2A 4JFVA 4Z0SA 3LCFA 4W85A 2WV8A 3LRMA 1PXGA 1WBHA 4PUKA 7REQB 3H8AA 4O18A 1HKKA 2J4GA 1AG1O 3FYPA 3G1DA 6XIMA 1UBPC 5HATA 4K8GA 2GGJA 3GC5A 1A5BA 4Y9PA 2XM1A 1KR1A 3AI0A 3HJZA 2E6DA 2DQWA 3M5YA 1FWJC 5DMYA 3H4GA 3FFSA 4D6GA 4LAKA 4ORIA 2PDCA 5EMUA 3QY6A 2VR2A 2EG6A 2Y8UA 1NQ6A 3EKLA 3C3NA 2IQDA 3MYPA 1JNEA 2OCZA 4FHAA 1OGBA 3WN6A 5FJUA 4W9TA 3R8HA 5I6SA 3G0SA 5K7JA 4FNQA 3N2OA 2CLPA 1BHGA 2W4XA 1KRCC 1A5CA 3TA6A 2BGSA 3W7QA 1P4CA 4H9UA 1TREA 3GVQA 2R91A 3RM8A 1QI4A 3TR9A 3AOFA 4G2DA 1W32A 2WJFA 3N15A 3WF3A 3OB8A 2HS8A 2XVPA 3V16A 3HPAA 4JX4A 2WVTA 1XBZA 3V1HA 1B4KA 5C7HA 4F0RA 4XV0A 4QE1A 5DLCA 5AFDA 3P3BA 3LN3A 2VKZG 3K8MA 3RR4A 3WK1A 3DECA 4NAFB 4AZCB 2OEJA 4PMOA 1UR9A 2FH8A 1RZMA 3NZPA 3MS8A 3QEZA 1XIHA 1R47A 5GJNA 3GNOA 3WNMA 1VBHA 4GIRA 2E1WA 2XIOA 3FJ6A 1OT2A 3MUCA 3G1YA 3L21A 1TPH1 3PF3A 1Q6DA 3CHFA 3AISA 2Z1SA 2B81A 4ZODA 4HNLA 2CKSA 1R3VA 4LC8A 2R8WA 1MSSA 4HU4A 3CUHA 2YB1A 1V3JA 4XKYA 4M56A 3W26A 4V28A 4B5WA 1PTGA 1K9TA 1H49A 4YCOA 1TUXA 2PF8A 3M0VA 3T2PA 4DHGA 5C2CA 3WDJA 4S3DA 2WSPA 4LBRA 2B7NA 2NX1A 1KFCA 3EKZA 3K13A 4EVZA 1TJPA 1J9YA 4H6KA 1M41A 4ZOAA 3W7KA 4E2VA 1IF2A 3M0JA 1MVYA 1LG1A 2J8GA 4RPQA 4UQEA 1AD4A 5ECUA 4GJ1A 4EAMA 2BODX 4AYSA 2P53A 5A8NA 4PSRA 3TLLA 3O05A 1TWZA 1XLAA 4H9TA 2XWDA 4EX4A 2WMJA 1V7AA 2PDQA 3W87A 4PUNA 4OVXA 5FI8A 1RQBA 2P10A 1BXNA 4S1FA 1E4NA 2QUUA 3WLMA 3TYCA 1QUMA 2WM0A 4CNSA 4KWWA 1XPYA 5C2GA 2V38A 2X1TA 4IIGA 4JIEA 3T0BA 3W29A 4P5UA 3VIFA 1QI2A 1M6JA 4LYKA 4QDPA 1FBAA 2Y6ZA 1XX1A 2WVVA 4V1YA 1LROA 4GGHA 1ZAJA 1WQ5A 5AHEA 3FHQA 5E0KA 4IPJA 3MZ2A 4W8BA 1WDSA 1XGDA 4JTFA 2J13A 4KMQA 2WOQA 5LGZA 1I60A 2EPOA 5AC6A 2Z1BA 4FO4A 5CC7A 1KCLA 4O14A 4MY9A 2BZNA 1GG1A 2FMOA 1UHVA 5C9UA 4WJ8A 3P14A 2HPMA 3WF0A 4YWIA 3SADA 1KLYA 3K2GA 4UQCA 5DBUA 1AVAA 1J11A 1GOWA 3K8LA 3ZJ6A 2J78A 4Z17A 2G4FA 3WBEA 3KDOA 5AYYA 3WMLA 4C1LA 1EP3A 1E72M 3KVMA 1CYGA 1J0JA 2Y5SA 1JDCA 3RG6A 1L2UA 3WFAA 4AWTA 4NNAA 4ZQMA 1RLCL 1M53A 1Q6EA 2AL1A 4IFOA 3PAJA 2ZUWA 2VP8A 2OX4A 2CZVA 1V6TA 4LFYA 1ZJIA 1BGAA 3QPZA 4PUJA 2PDIA 1OFOA 1Q8AA 3QC0A 2VGBA 1TPC1 1KCXA 3V0UA 1UD6A 3BMVA 4KT2A 5FJTA 4CVWA 3KS6A 3WKZA 1BQCA 2EGZA 2XISA 2YCJA 2VC7A 3MJMA 5MKGB 4MOZA 1K8XA 1ITQA 3N4AA 1H41A 3TN5A 3I4EA 4G7EA 4GACA 2X05A 4O0QA 1HJQA 1UW9A 2J47A 4PMNA 1ONEA 4LJ3A 4FEZA 6TIMA 1WE5A 5D04C 4XUYA 1PIIA 1CGVA 2YR1A 2DW7A 3V5CA 4B5TA 4NUWA 3TMQA 3D6NA 1TV3A 5F1UA 1XLGA 3K30A 1QNPA 3VD3A 1GW1A 4PMDA 1E1CB 2WZTA 2UV8G 4GZIA 3W2LA 1S5MA 3WSUA 1UP0A 4BF5A 4O19A 2CHNA 3DFYA 1ZS2A 2GJNA 3SQMA 4PFHA 1TKKA 1UUOA 3PWAA 3F7JA 5MHBA 4P8WA 3S47A 1UR3M 3RPDA 3VC6A 4DF1A 2E5DA 1Q2RA 4ZOBA 4LCSA 3VOJA 3NQ6A 3UWEA 2Z27A 2GQAA 1FDZA 2WMFA 4KRZA 1VIZA 1P43A 2W6RA 5F4SA 1V79A 1IIHA 4S3CA 2CIPA 2CWNA 4FLQA 1CGYA 3NG3A 3MMWA 1GGOA 1Z32X 2GWGA 2XN1A 4JKMA 5D33A 5CC6A 4AW7A 2HXUA 4D6FA 1Q4NX 2OJPA 2W67A 3KWSA 3QR3A 4WY0F 1DXIA 1NWSA 3TSBA 4L4PA 7REQA 1TJRA 3ZR4A 1XWYA 3LTSA 2PDXA 6XIAA 3BC9A 1XSJA 3W07A 1JZ6A 4X0NA 1LORA 3JU2A 2Z00A 2D3NA 1CIUA 2QVHA 5AOUA 1US2A 1TPVA 5TF0A 2WJZA 5FACA 2HE5A 3G1HA 3FAXA 3MUAA 1LBMA 1QXLA 2Y85A 1GPFA 2YBTA 1UR4A 2RJHA 3L4VA 4IMFA 2UY5A 4YVVA 3CUJA 3BG3A 3RLVA 1J6PA 3RMJA 3UXAA 3SJNA 3GFXA 1TV7A 5CEWA 2A21A 5J5RA 1AZ2A 1FXQA 4GVFA 5J8LA 2XM2A 1LTDA 4REQB 4DX3A 3ITOA 4JTEA 1YDNA 3JRKA 3CO4A 4AQLA 3CH0A 3B9EA 3RM9A 1X98A 3O6YX 3POHA 1K4HA 1RH9A 1ZUAX 4IUGA 3SURA 3TQ0A 5HANA 2D1ZA 1C7SA 4UTWC 4HCLA 4DNMA 5BRQA 5HPOA 2PFHA 2VC9A 1QWGA 2IW0A 4BI5A 1H7OA 4YNGA 4HA1A 4O15A 4RE3A 2CLEA 1X7IA 3ME3A 4AZBA 1TWDA 3MI3A 1UUQA 4IIBA 4NAFA 1XKJA 4GCAA 2DU2A 4AZCA 1WAWA 4L56A 3GXDA 3HZ3A 1XYBA 3M46A 4O8RA 3VNKA 4NXKA 3PZQA 4UOZA 4GK8A 2CW6A 3LHTA 1UR2A 2TODA 1Q6GA 5H2ZA 4M8UA 1YTDA 3FYOA 4YTQA 2VZSA 1UQYA 1W37A 2CEQA 5M17A 3VMNA 4U2YA 1ADDA 3LTPA 2R9RA 1SW7A 1UD2A 3P5YA 2AQOA 3W01A 1EO5A 4AG0A 4JTHA 1JCTA 1ZP3A 3CQJA 3QV7A 2R24A 1YPIA 2A7PA 1JXJA 3ARUA 3R6IA 1BWKA 4XSLA 2PTZA 2FTPA 3GYCA 1IXNA 4XBJA 1GCYA 4FIQA 3EWCA 4ZBCA 3ATZA 3G3MA 1AQHA 4ZO6A 1I75A 1RQEA 1XC6A 3OZYA 3RUBL 3GDMA 1X6LA 1BPLB 3V3WA 1ZL1A 3WQCA 4KFPA 3E1F1 4HTBA 2PSNA 2VYOA 1JZ8A 1ISVA 3AYRA 3RXZA 2Y8KA 2VUYA 1PAMA 4LRTA 1P0KA 1EHAA 3K1GA 2VGIA 1TVNA 1NDVA 2Z26A 1N2VA 1IYXA 3G6LA 2VM8A 1H61A 4DWSB 3S5SA 3RLUA 5I24A 1UBSA 3T09A 3C2YA 5JVLA 2HNEA 4S39A 2FH6A 3SFKA 4DO7A 4URIA 1XDJA 3P8JA 1EJRC 2I7GA 1R9ZA 2PC8A 3MMDA 4WKAA 3L2MA 4LYPA 3SN0A 3UJEA 1JD7A 5C9XA 3TJIA 2PDBA 4HN4A 1E0TA 3ARZA 4HPGA 5FEZA 3WY1A 4ZCWA 4AMCA 3ZXWA 3UG8A 3WJSA 1MXDA 2FTYA 3PTMA 2VGFA 2GL5A 1PX3A 1H7XA 3HGOA 4DJFA 4NZJA 1V02A 1CB2A 2WVUA 3L5LA 1E4IA 2DP3A 1W1YA 4UTFA 3AIVA 3WQ5A 4CN6A 1E15A 3MKVA 2I57A 4HYWA 4RW3A 2VMFA 4DUOA 2R1NA 1UZ1A 3PG9A 1N8WA 3URAA 3EOSA 3CHDA 1VFSA 3P81A 1EF3A 2PS2A 4A29A 1P1XA 2WNZA 2CU0A 2WMHA 2Q71A 3CV2A 3R25A 3KHJA 3QKEA 4C91A 4GZEA 5DX7A 4JCLA 4JTCA 2FIQA 3V0TA 3KOWA 1DJZA 5I78A 5A6KA 2Z1XA 1QT1A 3PFMA 5I2UA 3GXPA 3EZ4A 3LM3A 1PTDA 1I2OA 3DBNA 3Q94A 1JRCA 4HK5A 2ISDA 3EX3A 4I3GA 4XAYA 4YTSA 1SPQA 5MKGA 3CHCA 1V6VA 2XIQA 4R5EA 1H5VA 3KZPA 3HPSA 3MCMA 3LOTA 4WD0A 3W72A 4LPCA 3GXNA 1JYNA 2FZDA 4HP5A 4K6AA 4ICCX 4LB4A 4B5NA 3ENLA 3IPWA 4US6A 5A2AA 2DUAA 3DEQA 3BOFA 1YDVA 4HPHA 3C2OA 1EP1A 3B8TA 4YS1A 3GIQA 4XIMA 2VVNA 2ZZ5A 1E1CA 5EMKA 4LANA 4Q6XA 5ECVA 5LNVA 3A22A 3HA1A 3QGKC 1UZDA 3D5HA 4LT9A 4E4UA 3DG6A 4RKAA 3OLIA 2QCLA 4WKHA 4Z2KA 3E2RA 3BLKA 3NDOA 1AMYA 4B4FA 4LWWA 2PTWA 4ATLA 2AGKA 3EX2A 3EX4A 4JHMA 1PKMA 2DZTA 4FX7A 2VWTA 1EC7A 2F61A 2J9XA 4DXKA 1TTPA 2Y8VA 3JUGA 4O1BA 3SGGA 4GYKA 4AVNA 4IQJA 1K1DA 3WFZA 2UZ9A 1OB0A 3EEZA 1XF0A 3WLNA 3TN4A 2QJHA 3C0SA 4XTDA 4KWOA 3SSZA 3RCNA 2WZIA 3ZVHB 4Y6GA 2B7OA 3QYSA 2WZHA 3G0XA 1A4LA 1DYSA 1OC5A 3CQIA 2CLOA 4C6BA 2VDGA 4RUBA 3HPXA 3UNTA 3PB2A 4HHMA 3NQMA 3TEVA 2NXHA 4GNVA 3SAZA 1HVQA 2Q6ZA 2IXUA 1A49A 1EF2A 1XSIA 1JF6A 3WCZA 4W88A 3VAVA 4Y2WA 1H7WA 3M64A 5CJNA 5ABEA 1NOUA 1J6OA 5C5YA 2E67A 4PB3A 4GMEA 1P0BA 2H8ZA 3U8GA 4MKVA 1MNSA 1J8VA 1UIOA 5DN1A 3FYYA 3GLCA 2DW6A 3GVVA 1Q6FA 4TO8A 5DCBA 4AF0B 3RX3A 4REQA 1JCYA 1EA9C 3BAWA 2WNQA 4OE7A 1NF0A 4EKJA 3GRIA 3BLDA 7PTDA 3FEQA 2GOKA 4N0RA 5XIAA 3VUPA 3STPA 3WUFA 1RP8A 1B3ZA 1EC8A 4MB4A 1EQPA 5BYWA 5G1MA 4AD3A 2GUYA 4W84A 3UCDA 3W25A 4NQ1A 2PDNA 1B5TA 3P60A 2PPGA 1WP6A 3ARTA 3IIZA 3E96A 4X60A 1IZJA 1UKQA 3VOIA 1ZJBA 2O9TA 4W89A 4X22A 5AHFA 4MM1A 3BLLA 3PZTA 1FXPA 3VDHA 1IR1A 4A22A 2QCDA 2NVCA 2PMQA 2GLKA 4XB3A 3G1VA 1OWQA 4A2SA 5C55A 2A5HA 2XFYA 3IAPA 3W1AA 3LY0A 1G4EA 2B4GA 4EXAA 2P3EA 2JGYA 2ZX9A 4PMVA 3L5AA 5A8GA 2JF6A 5C71A 2VEPA 4DZIA 3F5LA 3MA8A 4F2TA 1VHNA 4R3UA 4GISA 2ZRVA 4PMZA 2YL6A 4GO8A 2QDDA 4X3ZA 4O12A 4ACYA 3G1SA 1L0PA 2HTMA 3CU2A 1LDCA 4BQ2A 3M0LA 4XVDA 1RJQA 4AYGA 4KETA 1BF2A 4K3ZA 3FSUA 1GVOA 4GQRA 1UB3A 2C79A 4M1RA 3U0HA 3TZNA 4FXRA 5E70A 2PZNA 4GC3A 3U2OA 2A0NA 2VEKA 3UR2A 2GSHA 1PPIA 1MW1A 4P2VA 1JDFA 2XVGA 1TZ7A 3N3TA 3S1XA 3EXTA 1F6KA 3PJWA 3TTEA 1HKIA 1M1BA 4RDZA 2DT3A 4PMXA 3V35A 4O52A 4DWSA 1DJYA 1GYMA 1CGTA 2PWUA 3W2MA 3NPXA 2PURA 5HJLA 4D71A 1KNWA 1GHRA 3ZYZA 3CYJA 4NYUA 3TC6A 5IBXC 2QDGA 4P8XA 3VFCA 3WLQA 2D23A 1N7KA 1O68A 3C4UA 2FGBA 3EYPA 1F4HA 5FD0A 1UH4A 1A5KC 3GXFA 2GDVA 3SN4A 2GQ9A 2J62A 5CGQA 4IJBA 2QLYA 1XYAA 3WO8A 4EPEC 1NWRA 1U1UA 1IXPA 2WKLA 5CPOA 5FIPA 1P6BA 3H70A 5HNTA 2FPVA 4PTVA 3UR5A 3OW1A 1Q6QA 4HHHA 5FF4A 4D6HA 2XPKA 2BGNE 4TTGA 3HGJA 3WBAA 3VUSA 1X1OA 3UP8A 4HNTA 1XRVA 3MC5A 4F0SA 3SCPA 4QE5A 3LSBA 2VDIA 2FFCA 3F5JA 3FLUA 1V51A 3E2SA 1GVQA 1VR6A 3MANA 3BAXA 2WKGA 1W3IA 5A8MA 2MNRA 5JH1A 1SO3A 4LY4A 1PIGA 3HU7A 4EK7A 4K39A 2I1OA 3THAA 2DH3A 3P93A 4WDTA 2ZRUA 2CZDA 3BICA 2P8CA 2GDUA 2CLFA 1GOQA 3LG3A 5BWFA 1Q6RA 2I5IA 4GIAA 1S2UA 1Y0EA 3DBPA 2VFGA 2AOSA 1N82A 1E6SM 4MNKA 3FCPA 3HQNA 4CEUC 3O0FA 2CBUA 2WSRA 1F7BA 3ZSTA 3MQTA 1ZJHA 2E09A 1NVMA 3GHUA 1Q7MA 1ZFJA 3P62A 4PTXA 3NDZA 2I56A 4C6DA 2CERA 1X7FA 4BQ3A 4AY8A 1IWPA 2RHGA 2PCQA 3QPYA 3NOEA 1ZNNA 4OGZA 1O12A 3KL3A 1WKEA 1GOMA 1XI3A 5DXXA 1B1YA 2D2OA 3WL0A 2VUNA 2F2HA 1W3TA 3RLGA 2NWSA 3NXLA 2ZXQA 1PS9A 1OY0A 4KBXA 4PC8A 3CT7A 5AVHA 3TIMA 3N4EA 3MSYA 4L80A 3HN3A 3GDBA 3P84A 1UOZA 1T8QA 2X0SA 3D0CA 2W92A 3BXWA 3N34A 4LUJA 4HQVA 1QAPA 3GU9A 3S1GA 3KZSA 3W9ZA 2C1GA 4O1CA 2TMDA 1WXYA 2BFGA 1DJWA 1QMLA 1QPNA 2I9UA 3HQPA 3BJFA 4H19A 3ZVHA 5HMEA 1ICPA 2GUBA 3G0UA 4Q8PA 1P48A 1OABA 4JTRA 2DZAA 2CESA 1BVWA 1JDAA 3W53A 8XIMA 1TYGA 4UTWA