2PDFA

Human aldose reductase mutant l300p complexed with zopolrestat.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCAPLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Merging the binding sites of aldose and aldehyde reductase for detection of inhibitor selectivity-determining features.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 102
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2pdfA00
1Q5MA 2BGSA 3NTYA 4NKCA 4JQ2A 4FAMA 3UWEA 3GHUA 4FALA 4Q3MA 3V0SA 4OTKA 3ERPA 3BUVA 3UP8A 3D3FA 1ZUAX 3R43A 2PD5A 2AGTA 3GHTA 4JQ3A 3UGRA 1FRBA 2ALRA 2HVOA 4JQ4A 1Z9AA 4RPQA 1X98A 1PYFA 1X97A 4XZLX 2VDGA 3WG6A 2FZBA 2INEA 4IJCA 4DBUA 5JH1A 5JH2A 3WBXA 1XF0A 4LBRA 4H7CA 2IS7A 3CMFA 3KRBA 3RX2A 3LNMA 3UZXA 4GQGA 3R8HA 1QRQA 1AFSA 2PDNA 4JTCA 3N2TA 4HMNA 4IGSA 2IQ0A 2DUZA 1VBJA 4XO7A 2NVCA 1GVEA 1XJBA 5LIKX 4DBWA 1MRQA 3MB9A 2HE8A 3V36A 2PF8A 3WBWA 2PDJA 3R6IA 3P2VA 3B3DA 4FZIA 2DV0A 4GA8A 3GHSA 4WRHA 1QWKA 5DANA 2HE5A 3GUGA 4Q7BA 3O0KA 1XGDA 4LAZA 1JEZA 4ICCX 1SM9A 4WDXA 4JQAA 3R58A 4GCAA 1Q13A 3LD5A 4LB3A 1K8CA 1PWLA 3CAVA 2NVDA 1J96A 2PDLA 4FA3A 2IKIA 4F40A 2A79A 1RALA 2FVLA 2HDJA 4DZ5A 1AZ2A 4XZHA 2IKHA 4XVEA 2C91A 1ZGDA 3S3GA 3F7JA 3WCZA 2F38A 3CASA 3R94A 2PDBA 1RY8A 3DN5A 3UZYA 5AZ0A 4IJRA 4GIEA 4GQ0A 1YNQA 2PDFA 4EXBA 4PUUA 5M2FX 4JTDA 2CLPA 4YVPA 3LQLA 4QX4A 3LENA 1A80A 2WZMA 3H7RA 1T40A 3ONBA 2I16A 2INZA 3Q67A 2PDKA 4YU1A 1VP5A 4HBKA 4WEVX 2FZ8A 4XAPA 3LQGA 4QBXA 1S1RA 4PMJA 2IKGA 4WGHA 1R38A 1S2AA 5LIUX 5HA7A 2IQDA 1US0A 4LB4A 2PFHA 3WBYA 1RY0A 3V0UA 4XVDA 2PDXA 2ACRA 2BGQA 3COTA 1EKOA 1S2CA 3M64A 4G5DA 4WDTA 4QR6A 1M9HA 4GABA 1YE6A 5KETA 3CV6A 2ACQA 2ACSA 1EL3A 2WZTA 4H8NA 4EXAA 3MC5A 3GHRA 4ZFCA 4XO6A 2FGBA 2J8TA 4XZMX 2R24A 3UFYA 3RX3A 1AH4A 1Z89A 1YE4A 4JIRA 3FX4A 2PD9A 3EAUA 1S1PA 2PDGA 4PUWA 3EB4A 1IHIA 1ZQ5A 3BURA 3RX4A 4MHBA 1UR3M 3UG8A 2IPGA 4YVXA 1HQTA 5LIXX 4JTAA 4WDWA 1AH0A 3LN3A 1ADSA 1T41A 1YNPA 1EXBA 4L1XA 3ONCA 1OG6A 3G1RA 3M0IA 2PDMA 4JTQA 3C3UA 3FJNA 1IEIA 3CV7A 4YS1A 4JQ1A 3UZZA 2IKJA 2PDUA 1LQAA 3H7UA 4JIHA 1LWIA 3VXGA 4I5XA 3DOPA 1Z8AA 4LBSA 2I17A 4JTRA 2PDWA 4ASTA 2FZDA 1MZRA 3R8GA 5LIWX 3T42A 3UZWA 4XZIA 2F2KA 2PDYA 3U2CA 3M4HA 4PRRA 3QKZA 3LZ3A 5HNUA 3UYIA 2PZNA 2FZ9A 2HV5A 4DBSA 2IPWA 3LBOA 1X96A 2PDIA 4XK2A 4LAUA 3LEPA 2PDQA 2PDCA 2PDPA 2R9RA 3LUTA 2BP1A 3EB3A 1AZ1A 1PZ0A 5HNTA 3V0TA 5C7HA 2ISFA 2QXWA 1ZSXA 4GACA 4AUBA 1PWMA 2IPJA 4QXIA 1MI3A 4YVVA 4PRTA 2PEVA 2HVNA 3V35A 4L1WA 1AH3A 1PZ1A 3BV7A 4WDUA 3H4GA 3CAQA 2ACUA 1HW6A 5AZ1A 4XZNX 3BCJA 5LIYX 3G5EA 2IPFA 1Z3NA 3LZ5A 4JIIX 1C9WA 3O3RA 1EF3A 2HEJA 4PR4A 2P5NA 3Q65A 4R9OA 2PDHA 3R7MA 3N6QA 2DUXA
chains in the Genus database with same CATH superfamily
3AS2A 3A22A 3DFHA 3UNTA 3J7HA 3VO0A 5ABFB 3KX6A 3QGKC 3RXZA 3NTYA 2QJMA 2NQZA 1B30A 3CLMA 1FCQA 2XIIA 4D6EA 3B05A 1BRLA 3T2QA 3W73A 1O4UA 1E4LA 3RG6A 1YNYA 1TRDA 2RH9A 3TIMA 1PIGA 2ALRA 3EDDA 1XIGA 5AC4A 4KRZA 4JFUA 1DJGA 2OCZA 2GOKA 4ZO8A 3VGGA 3G3MA 3MP3A 3ZR5A 5KSWA 1BF6A 4NZ5A 7ODCA 2Y8VA 3QMTA 3I10A 4X60A 1F3WA 2OT0A 1UH3A 2BS9A 4BQ4A 1HL2A 3KRUA 4ZTXA 5FF2A 1MSSA 4QDPA 3MKKA 2POTA 4M29A 3G3DA 2X7WA 4REQB 5TD4A 4WSHA 3QRHA 1F07A 2JALA 3VOGA 4AYGA 1JPHA 2YL6A 3ES7A 1CZ1A 4QE4A 1D8CA 4DELA 4R7JA 1KCZA 3AMCA 3NA8A 4H41A 2DH2A 4OHQA 4R7OA 3BAKA 3HZ3A 2E0PA 5IBXC 4NRRA 3H8AA 3LXCA 4M56A 4C60A 2YL5A 2DV0A 4ZE4A 5A94A 4E8DA 3L12A 1A3WA 1OFRA 5D9MA 5IHSA 3MV01 1R9ZA 4O17A 1HFBA 1MW1A 1XGDA 2GOUA 1SZNA 4EPEC 1DORA 1I2RA 2CETA 1WOBA 4NU7A 1J4EA 1R47A 4XZ9A 1F61A 1G94A 4AD2A 1J93A 1VKFA 3USZA 4JL1A 1LL7A 2XIJA 2HNHA 3CAVA 2WVSA 2AAAA 1TPB1 3QMRA 1LRNA 1Q2RA 3PR2A 4BQ3A 3AXXA 3WDJA 1BQGA 3LCXA 3BJTA 2TRSA 2DVXA 3WH5A 1GHSA 2G8ZA 4AZCA 4GLEA 3NZRA 6PTDA 3POCA 4B16A 3WCZA 3GDLA 1KRCC 4IMAA 2HCVA 1PB0A 2DJXA 4LT9A 1WCGA 1FWWA 3DN5A 4PCTA 1TO3A 3NJ3A 3JW7A 2VC6A 1DE6A 2X42A 4A8RA 5BXTA 1R30A 4B2DD 3ZSTA 1J6PA 1QFEA 3EMQA 4QX4A 2V3DA 3NUKA 1T0OA 3GG1A 5HMDA 1VFHA 1JGIA 2BNJA 3KLLA 4YWSA 4LVBA 1GVIA 4A29A 2INZA 3DZ1A 3STFA 3W0KA 3N13A 1QBAA 1IZJA 1B3OA 4AVNA 2VFFA 3SY5A 2VI0A 4AY8A 1Y8BA 2GQ3A 1UD5A 4XIMA 5CSUA 2XH2A 3P81A 1VBUA 4HIBA 1A0EA 5EMUA 2IKGA 4UXDA 3RDKA 4EWND 1XC6A 3G24A 1C8YA 3RR1A 1RY0A 4ERIA 3GYEA 2V30A 3JZUA 4EE9A 1U1HA 5BRQA 1Q6DA 3HURA 1S2CA 3CBWA 4Z1DA 3TDFA 1SGJA 3PANA 2XFYA 1M9HA 3L68A 4JBRA 1E0UA 4AIOA 2QLYA 2Y0FA 4YTTA 4F79A 3UU0A 3QY6A 3KL3A 5A2AA 4J2MA 1UR4A 1GJWA 1Z89A 2NXGA 4LS0A 4C5YA 2AAMA 2PBGA 1XXXA 1OHLA 3EAUA 1S1PA 3APGA 2PWHA 1B4KA 1TZ7A 3EB4A 2C1GA 3P8JA 4UTJA 3CL6A 4WY0A 3TFXA 2NXIA 1QNRA 3VZYA 3EYPA 3EDJA 4AX7A 3ZVIA 3MY9A 2Z1WA 4HYWA 4HA1A 2X1RA 2IPGA 4NNAA 5LGZA 3FHQA 4KETA 2C3ZA 3K8MA 3SRKA 1WB0A 4A05A 3VFCA 1G69A 4MY1A 4S3BA 5I78A 3SQMA 3SJNA 4EPKA 1UB3A 2ZYFA 1SZRA 3RM8A 3APTA 3G1RA 5KMYA 1REQB 4K68A 4S1FA 1QK0A 3I6TA 1TX2A 3GVVA 3H7UA 3W7QA 4Q4OA 1GQIA 4O4WA 4GC4A 4ZZ9A 3VCRA 5K4XA 4GZIA 1M68A 2WWCA 4AEFA 3RPTA 4KFOA 3GC4A 1O5XA 2QCDB 4PRRA 2VEKA 5F1UA 4AZHA 1K4GA 4GFIA 3VYLA 2XU2A 5BNKA 1EZWA 3PPHA 1E6XM 4ZTYA 4W9TA 5JBDA 3UWWA 3K8KA 3VFLA 3CHVA 3JS3A 2PDCA 2XH7A 4GGHA 4E3VA 3N34A 3IAQA 2X0HA 1O95A 2O9RA 4C6DA 3WLQA 2EJAA 1XLGA 3ZFHA 3EXTA 4JEJA 3V0TA 3WUFA 4HSNA 2YR1A 4ACYA 2GWNA 5H91A 1EOKA 4QS5A 3W7HA 3LRKA 5RUBA 3AQUA 4HD5A 1J0IA 4RDYA 1H0GA 2VCAA 3PF3A 2O4MA 5D8ZA 1IZCA 4FF7A 5D09A 2CERA 4WKFA 4C6BA 4QJ4B 2NLIA 2Q09A 3WH6A 3A47A 1KBBA 4AYSA 4LYKA 1XINA 4HPGA 5LIYX 3KL0A 1RQBA 1WYIA 1HGYA 5ECVA 1QTWA 3CUHA 2WV8A 4G6CA 1GYMA 2CLEA 4U3CA 3S83A 3KP1A 1TX0A 1P7TB 3KVKA 2PF0A 1FKWA 4HN8A 4HMDA 3EWXA 3ABXA 2E9MA 1Q5MA 2BGSA 2YA2A 2D69A 2WCGA 2BODX 1PV8A 2FZMA 1CEOA 4B3ZA 3ERPA 2ABBA 2B7NA 2V38A 2VENA 1KR1A 1W1ZA 3WEOA 3L9CA 3IIOA 2I5IA 3T7VA 2OB3A 3VKBA 3NAVA 1M5WA 4MDPA 5C8BB 1CW2A 4FIQA 2EG6A 4F8XA 4JQ4A 2ZDSA 4NI3A 1KFLA 1PYFA 1X97A 1F6YA 3M7WA 3EWDA 3WG6A 2FZBA 4TXEA 3W76A 3TX9A 4PCFA 4G7EB 4F0KA 1A5UA 1LF1A 2CWNA 3P0XA 7REQB 4RDWA 1TZZA 3MO7A 1SFJA 4MUZA 4AY7A 4GQGA 4ZO6A 4IISA 1XKYA 3UESA 2GGHA 4WGXA 2WCSA 4FHAA 4W8LA 2BHZA 1GVEA 3FW6A 1N2VA 5I24A 2PF8A 5FEXA 1F76A 3V16A 2DIJA 1EOMA 1I0BA 1SU5A 2V6AA 3PS7A 5E93A 1VR6A 3M5YA 3MI3A 1XQLA 2XG9A 1VFOA 3NVDA 2H3BA 3NM3A 4XD3A 1SMDA 3W1RA 5G4WA 4RCXA 1MO0A 3OTRA 1V0KA 4RV3A 3O7UA 4H6EA 1E6ZA 3W23A 1K4HA 2WMHA 2D2JA 1EJVC 3PK7A 5DELA 4R85A 2W79A 3K1DA 2NWSA 1VHCA 2J25A 3KXQA 3RFAA 4DO4A 1W5PA 4K37A 1XIIA 3CWOX 4NX0A 3N17A 3L2IA 5T9BG 2ZRXA 3O8AA 1OT2A 1O1HA 1AZ2A 1WDSA 2IKHA 3NXLA 4HTBA 3S3GA 2RGMA 2OX1A 4WJXA 1JPKA 1ME8A 3U2ZA 4D9PA 2Z24A 3GNDA 3ITGA 3WZ0E 1IT0A 5BMXA 3MU7A 1RA5A 4N42A 4WXZA 2PDBA 5C2XA 3MBFA 5EBAA 4NQ1A 1L6GA 2JIEA 3NDOA 3W27A 1AW1A 4FMVA 4YVPA 3LQLA 1RZMA 4XAYA 1AQ0A 2X40A 4UQBA 4LTSA 4WSKA 1LP6A 2OFJA 1WV2A 3IACA 3FK4A 4KCTA 4HU3A 5DFAA 4DJFA 1T40A 3TSDA 5M03A 3SCWA 2B81A 1R2RA 1ENUA 4EWJA 2UY5A 3P60A 4L64A 5CXPA 2I5QA 5I03A 4EF8A 2FZ8A 1HKKA 2PWEA 5KEZA 3HG2A 4IH3A 2Q8ZA 2J77A 2BVWA 5A6MA 3IARA 1US0A 4ROPA 2A7PA 3GIPA 1VIWA 1Y5VA 1BXNA 3E5PA 5E0KA 2J9XA 3OB8A 1NELA 2A3AA 3PWIA 1TWDA 1QAPA 5HMEA 4WR3A 1DPMA 3A4WA 3S2CA 2GJXA 4E2BA 1NJJA 5DMMA 5FF0A 1IZKA 5J5DA 1SJAA 2AQVA 1CB2A 2VWSA 3DENA 3CIXA 4IG2B 1TIWA 4H2HA 4GGBA 3CXOA 4XZMX 1FHUA 4N0RA 5AVHA 5C9UA 3KVJA 3WL0A 4JIRA 2Y70A 3VOJA 3MSYA 4O1CA 2PDGA 2XN1A 4EACA 4TMCA 4H2CA 3WKZA 3GWQA 2WNNA 4GMEA 3RCNA 2JGQA 1XLFA 1UR3M 1S5MA 2RDWA 1UZDA 3WQOA 3BH4A 2H3DA 3PVFA 3SN0A 3SRFA 3VILA 4YYCA 4ZOAA 3WENA 1T8XA 4PC8A 1EWEA 1ADSA 1XLEA 3SSJA 3GXPA 1W2PA 3ONCA 1ZL1A 4MPKA 4ATDA 1IWBA 1HJWA 2BBFA 5E9AA 2QV5A 3PZTA 2QQ6A 1KTBA 2Q01A 4HOXA 6CGTA 5DLCA 2VZUA 1YYAA 3MTWA 3URNA 3BARA 2PDWA 4AD3A 2D2GA 3WNPA 3NQAA 2WSKA 1OY0A 5BXSA 2VM8A 4JCMA 2OYKA 1FWTA 1YADA 3F2CA 1FWEC 1YBQA 1E6PA 3L0GA 2LLEA 5LHEA 1UPMB 3LBOA 4KQNA 5EFDA 4HNLA 2CLLA 2E6DA 2FB3A 3W01A 1H7XA 1E51A 4HA3A 4HNCA 3PP7A 2QIIA 2VL4A 2XVPA 2C71A 5A69A 5H8PA 5C7HA 4S3KA 2ZTKA 3NCOA 1DP0A 3M0VA 4H01A 1UD3A 1V3KA 3R79A 4GACA 4P8UA 1SO6A 3CMJA 3WNNA 3GBDA 1EGZA 3S6OA 4R88A 1YRRA 3EMCA 3DFQA 1U83A 1XUUA 1UJPA 4B9YA 2L5HA 5CZSA 4PUKA 3K4DA 4XZNX 3MCMA 3SCSA 2E5BA 2IPFA 4LOCA 4BWLC 1Z3NA 3LZ5A 1Q2SA 4V27A 4DJDD 4C1NA 5HWMA 3GC5A 3WELA 1E5JA 1W3KA 2QEZA 3AZSA 3S2MA 1TPWA 4AVFA 1JZ7A 4DI8A 4PR4A 1IGWA 4PTVA 1FVPA 5EB8A 3NL3A 3UCCA 2YZRA 4LAKA 2PDHA 3QHMA 2RDUA 1SJBA 4KRUA 4PZVA 3TYDA 4XSLA 2A4AA 4G2DA 3QYSA 3KHDA 3PAJA 4HGXA 4GC3A 5DXXA 1OT1A 3IVUA 2XGBA 3UWEA 1W56A 2PGRA 5EFFA 5HQLA 9XIAA 3EWYA 4AG0A 4W93A 4INFA 1JVNA 3UA4A 4NT0A 4GJJA 3HMJG 1NWUA 2V81A 4PFMA 3DXIA 4Y9MA 3TMQA 3GHTA 2W62A 2GUYA 1FQ0A 3NQEA 2PWDA 4QP0A 3NQVA 2OQHA 3CUIA 4IX0A 4BI7A 3HPAA 3TW9A 3AIRA 4LY8A 4ADSA 4HB7A 1LBMA 3PFRA 3APYA 5TIMA 3PPCA 5C55A 2AKZA 2WHKA 3EKLA 4IJCA 3T08A 3V1PA 4GYPC 3IGSA 3MUXA 3WFZA 2CLIA 1U1JA 1EJSC 5FOOA 2F6KA 3F5KA 3WQEA 4U10A 3GTIA 4GQRA 3HB9A 4E4UA 2Y85A 3W29A 5LXXA 5FJPA 3RNDA 3TQVA 3N29A 4HU8A 1AQMA 4LAOA 5CJMA 3W75A 4MGGA 4C6OA 3R25A 2NT0A 5FIPA 1JCNA 5G1TA 1FHDA 4UNIA 2QDEA 2C19A 3U57A 5EBUA 1E56A 5BOFA 4DM2A 3L4WA 1BQCA 3NGJA 2W67A 3LI1A 1YLVA 3PBVA 3L23A 1VFMA 4S23A 2I57A 3BMXA 3W7JA 2YGYA 3THAA 4AX6A 1B4EA 3FYPA 3KOWA 3TP4A 1R9XA 1UR0A 3LHVA 3DH7A 4DXKA 3C2VA 4Q4QA 2GWGA 2PTYA 1B3WA 1XWYA 2WWDA 2FKPA 4IWWA 4CKQA 5F4WA 1IWPA 1K8CA 4KWVA 1NAL1 4Z2HA 3WLRA 1CBGA 2VEFA 3SCNA 5C9RA 1A5MC 4ONVA 1K8YA 3M0ZA 2R6OA 4O10A 4ZQNA 2XVNA 4EXQA 1XBVA 3SSZA 4Z2JA 3E12A 3LPPA 3GTFA 1P0KA 2FMOA 1JF5A 5CGTA 1OF6A 3KZPA 4AXKA 2C16A 3S8HA 4OJYA 4X2RA 3UNDA 4J4KA 4HK5A 4PMQA 2C14A 3CV1A 5GNXA 3FJLA 2VO5A 3ZT6A 5I3JA 4QQ3A 4CGTA 1B3VA 3W02A 3OVGA 1JPMA 1E70M 3P61A 1X8FA 5A5WA 1DJQA 3HIJA 3TH6A 3THDA 4IUGA 2WXDM 4Z42C 4UNKA 4H04A 3VUSA 3QTPA 3GSMA 3DGBA 1W8GA 1R3YA 2V82A 2D20A 4BJHA 3VIGA 1LJYA 2OYLA 3WLTA 4F48A 4Z2GA 1UIOA 1CXHA 1CT5A 2NUYA 1BYDA 1DJWA 4LB4A 3BAXA 1UD4A 3TTYA 4PGLA 5I3GA 2HPMA 2WSQA 3VDHA 1UP2A 4Z0SA 3NYDA 4BY3A 1XLIA 3M0YA 1CDGA 1EL3A 1FA2A 2F6UA 2YA0A 1J0ZA 3GHRA 1CPUA 4HCHA 1Q7ZA 4E5TA 4PBGA 1TV7A 1JCLA 4PUMA 4XKYA 1AH4A 4FS9A 1LQ0A 4M81A 4MNMA 3BGGA 4NZFA 3ITCA 3WX7A 3WDHA 3T55A 2WOQA 4NYYA 1E9YB 2RKXA 3I7SA 3AHVA 4A35A 1V93A 5E09A 3RLVA 4MHBA 4IIHA 3SRDA 2BB0A 1AMYA 3ARVA 3AIBA 2GYIA 1IQ8A 1SW7A 2YOCA 3BG9A 4DBEA 2QGHA 1PVNA 3UT0A 1BD0A 2FIQA 3WYZA 2YCLA 4F3HA 1V0LA 4MDOA 1UMYA 4EANA 1KC7A 4YS1A 4HNVA 3GDMA 1W3LA 2BY0A 1XYAA 3CQJA 3ATZA 3B97A 3M0KA 4MG4A 4JYEA 1U22A 5D2TA 5AFDA 4QS6A 1AG1O 4BQ2A 1UUOA 3BOFA 4UMBA 5HDRA 1ECQA 1BHGA 4FEZA 4PTXA 4JR5A 1US3A 2YB4A 2E6YA 4DLMA 1FCVA 3UPWA 3RM9A 1V3HA 2V8ZA 3MMDA 3OQEA 1KBLA 3OYZA 3VNMA 4LPCA 1CECA 3GUWA 1OD8A 3MZNA 3HG4A 1EJ7L 1EO5A 1FDZA 1X96A 3SCRA 2OO0A 4QRNA 3PNZA 1KBIA 4PULA 2PZ0A 5JVLA 3NWRA 3LGDA 1IXNA 3EB3A 4L9XA 3Q4DA 3FXYA 4AWUA 1TYGA 3WMSA 3HMCA 1EUAA 1ZENA 2EO7A 4I6VA 1J0JA 4BQ5A 3GFZA 2ZKMX 1K7XA 2D23A 4AZ7A 3MA8A 2VCCA 1B9BA 4WQ6A 1FTXA 3NZGA 2CFFA 3TOPA 4CN1A 3W53A 3NZQA 5J04A 5BU9A 1PHWA 3G5EA 1WZAA 3R89A 4CNTA 1EYWA 1GVYA 1XHGA 2PC8A 1LBLA 3AUOA 3MPGA 1Q6FA 1XBXA 1AODA 1J6OA 1ZLPA 2WYSA 1NVMA 4MMWA 2DZPA 3SUTA 4KERA 1D7FA 1ODUA 1UHVA 1QHZA 3MVIA 3C2YA 3VNDA 2A21A 4YTUA 3VINA 4BEUA 3TJIA 3AZTA 4P5UA 3ARYA 2YLAA 4W5ZA 1FP9A 5BWFA 1XW8A 1F9CA 3VC5A 5HMFA 4B90A 3WQ4A 2BXYA 3O06A 2OWWA 1QO2A 4RXFA 4C6CA 3EWCA 3KBWA 5CJ5A 1FRBA 1C90A 1V3IA 3QPZA 3OZOA 4NAFB 4YN5A 3AS1A 2OSYA 1W31A 1CENA 4QM1A 1QNSA 1M7OA 3BLDA 5TNVA 3VD5A 2VR4A 3U0HA 1WZKA 1NOWA 2D2OA 4PYSA 4WY0B 3EZ4A 3QM3A 2UZ9A 3U7VA 3ITYA 2QCCA 1TWSA 1JQVA 1GCYA 3T09A 1S3TC 3ECQA 1JPDX 1TMLA 4JFWA 1R8LA 4JIEA 4RL3A 1FXQA 5ABTA 3LM3A 1X6UA 4KF1A 4DBWA 1Q6RA 2WZEA 4H83A 5L9FA 1R7OA 3BQ5A 3XINA 1ZP3A 3NQBA 5HJYA 2PDJA 1HN1A 3QOKA 1YIXA 3WY1A 4GCXA 4YTQA 1LROA 3ANUA 4MUPA 2V0TA 2FVMA 4BF9A 3DYOA 1N7KA 2C1HA 3STPA 1JEZA 3UWZA 1TQXA 2C15A 1LOQA 2C8NA 1CNVA 4KBXA 3UXAA 3QW3A 1AA1B 1FWRA 4PCPA 1J10A 2EXOA 4NSBA 5FJTA 2NV2A 4J3VA 6ENLA 3SM0A 4J3UA 2PTWA 4H6RA 1NWSA 1XIMA 4DUXA 3OGVA 1LL4A 4DJDC 4XD5A 5LNWA 3PULA 2QCNA 3WBAA 3F7JA 3AHYA 2C13A 4Y9PA 4JKKA 1NWTA 4AD1A 3SADA 4MWAE 1AJ0A 4E8CA 1GW9A 1L8NA 4KKXA 4AZCB 9RUBA 5CLWA 4YWIA 4O14A 4YXGA 3BTNA 4JN7A 1DJNA 4LCQA 1NQ6A 5HQEA 2E09A 3BAWA 1QCWA 2VELA 3GXDA 1OSEA 3E6EA 1GQLA 4GUFA 4M7SA 5FESA 1TVNA 3WQ5A 3N3TA 3MANA 1C8QA 1H62A 1A3HA 3RO6A 3K13A 3EB2A 4LQ1A 1V0NA 1E4NA 2PFHA 3TCEA 4XVDA 4M82A 4MPQA 2BOEX 1W5MA 2DZWA 3NPXA 1XPGA 3GH5A 3SCVA 3BICA 3F4CA 5DMYA 4DF2A 4DX3A 1KD0A 4PFHA 4EXAA 3WDIA 3S47A 4UTFA 3CQIA 2NQHA 2FGBA 3MQTA 1DQXA 4MJZA 1XYBA 2QW5A 1RBLA 1FXPA 2XSXA 3FX4A 1RK5A 4JTLA 3W1MA 3TC7A 1Q8AA 4C6KA 1B9ZA 5LA2A 2Z4GA 3T0BA 4RLIA 1ZQ5A 3UCQA 3LHTA 3SQLA 1W3HA 2J7GA 3DG3A 1N82A 4LFYA 1LWHA 4GO9A 4HP5A 2CYGA 3GD6A 5DT7A 4QAIA 4HHLA 2E40A 3QSRA 2R8WA 4HK6A 4R27A 1AJ2A 2ALDA 2E8YA 3IUDA 3EXRA 2XZ7A 4LV4A 2Y8UA 1XIFA 4EPDC 3VABA 3RITA 1M7JA 2WHLA 5K2ZA 3EOSA 3WSUA 3TR9A 5EGRA 3DOPA 3CHCA 1WAWA 1IT7A 5C5YA 4GE8A 2NQJA 5CG0A 4PMNA 1XD0A 8A3HA 1ZBCA 1XP3A 3BE7A 3QKZA 2XVKA 1Z42A 3R8RA 3EPOA 3TYZA 1UR9A 4XIAA 4OBTA 3C61A 3IIXA 4RZ4A 1TG7A 3D3AA 4QEHA 1KR0A 1NDYA 4G7EA 4S3GA 1VBHA 4JTSA 3BG3A 4KH2A 1EGMA 4MB4A 1ZJAA 1X39A 4IXHA 4MWAD 2PP3A 1JZ5A 1G9HA 2PTXA 4MIMA 2ZUTA 1W5QA 4U31A 5D33A 1HUVA 2RDTA 4UTUA 2XJ7A 1TZ9A 4AZBA 1A5OC 3B0XA 3UXKA 3V35A 1FWCC 3UF9A 1CLXA 2OXNA 5M1TA 1PZ1A 4TVUA 2VD9A 3KBJA 1HW6A 4QNWA 2JKEA 1FDJA 2GQ8A 3GK0A 4YIWA 4CD8A 3NPVA 2ZUNA 2BVYA 3O0FA 3T4CA 4XTDA 4BEQA 1ZJIA 4PN2A 1ITXA 3IK4A 3W87A 2J47A 1ZB5A 2CBIA 4W86A 1A5SA 4YTRA 5ABHA 1NF0A 1ZY9A 3FV9A 3SO7A 1JULA 1UUQA 5G2IA 3VD4A 3G1SA 4ATLA 2V2HA 3ENLA 1L9WA 2F6XA 4P8XA 4ZQOA 4DJFC 1BWVA 4IIFA 2VCBA 1FFQA 1LTDA 3WUBA 3MKCA 3UZJA 1MXGA 5CBIA 7A3HA 3B0YA 2OG9A 1L6FA 4M6UA 2OOGA 2YX0A 4WJ8A 3WD1A 2DSZA 3GC2A 3R43A 1EEXA 5HPOA 5AY7A 1EJTC 5XINA 4MOZA 2YIHA 2R91A 1FH9A 3ZS4A 3QBUA 2FGZA 3MCNA 1OC6A 2CZVA 5I7GA 5HPCA 4FNRA 5EA9A 5E6ZA 3S1XA 1H61A 1GHRA 3CMFA 4JTKA 3UWYA 4RUBA 2E6FA 2G37A 5IBXA 1FWNA 2RJGA 3EWWA 1XIJA 1ZPTA 1OYAA 2QCDA 4EP8C 1SZFA 2QZRA 3PWGA 2EG8A 3SCOA 3MCOA 5FACA 4LYPA 4JTCA 4NXSA 1I2PA 3C2FA 3TN4A 5DBTA 3WEZA 1KKOA 1V6VA 4OFCA 3B8SA 4Z1BA 1LDCA 3CC1A 4LH8A 5E0CA 1A0DA 1NARA 3MB9A 3E1F1 3LTPA 1ZALA 3QY8A 2HK0A 4FR6A 4GUJA 4OKDA 3QW4B 1AD4A 1KBKA 3PJTA 3RN6A 2FZNA 1JPIA 1VFSA 2Y8KA 5CCZA 4WRHA 2XGZA 3R11A 3KDNA 3SCPA 5HNRA 4JGDA 2PP1A 4J7RA 2JE8A 2BWGA 3WFAA 2FTYA 2QPUA 2Z1VA 5M5DA 3W7GA 1NDVA 1KFKA 3ABSA 5C9ZA 1DTNA 3BCFA 2I9EA 3GU9A 4C5ZA 2OOFA 3GAYA 3GNNA 2XIBA 3BK0A 1L6SA 3ZJKA 1LUCB 3BLPX 5D9OA 1ZBVA 2BG5A 3CUJA 4UFLA 5A6JA 3W7CA 2BSLA 1V4YA 4IIEA 5D04C 3S2NA 1I75A 4FA3A 4PMRA 2XIQA 5EMKA 1QOXA 4XVEA 3WNMA 4AIEA 2V5JA 4NL1A 4M5PA 5B80A 2OGYA 4AAJA 3HJZA 4GFSA 3NZ1A 3AS3A 1DBTA 3CM4A 3P0WA 3FAWA 6ALDA 3R94A 4PH6A 1IIHA 3CWNA 5A6BD 5TQLA 3DYMA 1F73A 3G8EA 1JF6A 2PDFA 4AMCA 1V6WA 3GE7A 1VD6A 3M7SA 4X9SA 5D30A 2R1MA 5GJPA 2J66A 1DIKA 1YW1A 3OLEA 3Q67A 1GOXA 4UZUA 3ZVHA 3BSHA 4EPBC 1C93A 1EPXA 5JQ9A 1R3VA 5HMSA 3AWNA 4BKNA 2TYSA 1IR1A 3LHYA 1GJPA 3JU2A 2DZSA 2D73A 5DCBA 4F0LA 3GNPA 3ZWTA 3EGJA 2NVAA 3QHOA 1AD1A 1Z44A 2CU0A 2DZXA 4DXVA 3TJXA 2PS2A 1BWKA 4GWEA 2PDXA 1KFBA 1Q6EA 2BGQA 3C0JA 4FOJA 3BXWA 1WUEA 2ZDRA 3AALA 4LCSA 4B2DA 4G5DA 3VNIA 8XIMA 4DO7A 1YE6A 4H3DA 1RP8A 2WZTA 5D2YA 2GDQA 1P1MA 4QJ1A 3QZAA 3CV2A 2VEMA 1E0XA 3G0UA 3CQKA 4JTJA 1PX3A 4JL2A 3S1VA 3L4YA 1R46A 3EA1A 3A23A 1OYCA 1H09A 1PIFA 2QJIA 1BGGA 3UXDA 3QKEA 2GQ9A 2BGNE 5T9CE 3PTMA 2SFPA 2OTDA 3H4XA 4PTWA 1IEQA 1O6IA 2HBVA 3WN6A 1A5AA 4JTFA 3LA4A 2VT0A 1C91A 1MMFA 1E15A 1W1PA 4CNPA 4GQQA 4OZOA 1IEWA 4O19A 2EPNA 1E72M 4IMCA 3WF1A 1EXBA 1PXGA 4HOZA 5XIAA 3AICA 2EQDA 3W2KA 3UXLA 2XYLA 4TIMA 5C71A 3FJNA 1XLJA 2WVTA 2YCJA 3B03A 3UZZA 1EA0A 1LQAA 4CU7A 1Q63A 3TJLA 2G0WA 3CUGA 2HVMA 2OYMA 3H2EA 2X09A 3UGVA 4ASTA 2NW0A 3U2CA 4LUSB 3WD3A 4JFVA 3A24A 4HPXA 2HMCA 4WJEA 3W37A 1L0PA 4B5TA 3EDKA 2BHYA 3N73A 4IXXA 3TC6A 4OOZA 5G5IA 2OKTA 1J0HA 3THQA 3PZVA 1TCDA 1VS1A 2BP1A 1AZ1A 3W81A 2E1DA 2JF7A 3ELFA 1R85A 1R3SA 1J2BA 3T6CA 1HNYA 1ONEA 1RA0A 1VH7A 2ZXAA 1YXDA 3U4AA 3H7VA 5AYIA 4ERAA 3EPMA 5ECUA 2VRJA 2A3HA 5TF0A 2BXZA 4Q4KA 4KCUA 4P61A 3CU2A 1W3NA 5ABFA 2JKPA 3P80A 2PCEA 1UJQA 1TPFA 4IGNA 1JIBA 4HCLA 1VIZA 2P5NA 1GKQA 1E1FA 1XIDA 3UQNA 4P7QA 2IUZA 4C6PA 1QUMA 1CI1A 1EFZA 4GXPA 4JXCA 2C18A 1XBYA 2UBPC 4JCLA 3TC3A 1Q8JA 1UROA 5H8UA 5E1QA 3WQ8A 1TPC1 2BY2A 1XX1A 4DAFA 5MKGB 2J74A 5A8GA 1SJDA 4GXWA 4JQ3A 1ZU8A 4FOKA 4KW2A 4QJ5B 2V68A 3H21A 1TV3A 5AHIA 1OCBA 2HRWA 3OP2A 3O2LA 4M6QA 4AF0B 1QI4A 2DIEA 1KM4A 4LEFA 4ERGA 1K70A 1XLCA 1WOAA 3CLWA 1D3HA 3M9YA 4JOMA 3P62A 2EBNA 4I9MA 3N9KA 1Z69A 1LL6A 1PKNA 5M3WA 3O1NA 3EPNA 3TONA 3PPGA 4ECLA 3ME3A 1RR2A 1M04A 1GNXA 2NX1A 4S3JA 1D8WA 3KL5A 2P1FA 2QPXA 4HTYA 4QGCA 3HOJA 4UR9A 4DUWA 3RCMA 1KRMA 1ME9A 3LSBA 2QVNA 3V4BA 4H9VA 2DW7A 2PRMA 5CPOA 4QEEA 3QH2A 4TX6A 5D05A 5J5RA 3WLOA 4ZA0A 4GQBA 3UPBA 4AD0A 1O94A 1DWJM 1G01A 2X0YA 5I79A 1EJXC 2GUUA 4O12A 3W6LA 3MP5A 3VNJA 3DGRA 4E2OA 1UP3A 4I9TA 4O57A 5I3FA 1K7EA 1G4PA 3RMEA 1X6LA 2CZEA 4PCNA 2ZRWA 4U2ZA 3W84A 2O0TA 1H7NA 4LAZA 4LS2A 4ZB0A 3C8FA 1BYAA 4DLFA 2QKFA 1G5AA 4NAFA 1HO1A 4XG1A 4FPSA 3LD5A 4MYXA 3DFNA 5LNUA 4X0NA 5AVNA 2DQXA 2QAPA 1J96A 3SCUA 2IKIA 2G95A 2KX9A 4YHGA 2A85A 2Z1SA 1HJVA 3ZR4A 1V6UA 3P6LA 1UWAA 1MNZA 3W86A 4XISA 2GK1B 4Y90A 3P74A 1HL8A 4AD5A 2QJJA 4W5UA 4A3UA 3L2LA 1RBOB 5M2FX 2CLPA 4O0QA 1TIMA 5FL0A 2QCLA 3HGOA 4LWWA 3G18A 1VCVA 3ABQA 1EC8A 2VRKA 3KWSA 1OJXA 3ZIZA 3I65A 3ONBA 3VU2A 3S2LA 1JCYA 4UR8A 3GH7A 5C7VA 6A3HA 3ARWA 4XBSA 2AL1A 3H4WA 4JY8A 2DZUA 1GEHA 3C56A 1BGAA 3O05A 3LRLA 4J3WA 1DYSA 3TLLA 4F2TA 2X30A 1VENA 3F5JA 3E2VA 2XH0A 4S3EA 3LB0A 1YHTA 4KFPA 1X1NA 3VNYA 4DVOA 1F3TA 1QO5A 4DJEA 5A6BA 4ZENA 1POKA 1N8WA 4PMZA 4C6EA 1CGYA 2WZHA 1IEXA 4C1LA 1ONWA 5EMJA 4CCZA 3S5YA 1ICSA 2ACQA 2BVDA 3M41A 5HOSA 4JZ5A 2D0FA 1XFBA 1FWBC 4ZFCA 3G77A 5FSDC 3SW6A 4US6A 3BLLA 4A3RA 3WD2A 2X7VA 2E7FA 1QATA 2PI6A 2YCKX 4HU0A 2WLYA 2BFGA 1JRCA 3ZSSA 3D6NA 1RSCA 3MUCA 3C52A 2V5KA 1Q7QA 3WQGA 5LA0A 4Y9OA 1UC5A 3I3BA 1KFCA 3R4IA 2QHAA 2DGAA 3C2OA 3UWUA 4WD0A 5I09A 3KFTA 5FJJA 3P84A 3P93A 4NZ1A 5LIXX 4MY8A 2WC3A 4ICMA 3N6HA 3QVQA 4F9DA 3LN3A 4U5IA 3E9AA 3MUAA 3B9EA 4QE1A 2YCLB 3I3EA 4GVHA 2EF9A 5CH9A 4ILSA 3T9PA 3GB6A 1Z7AA 2XWEA 1R9YA 1ZS2A 3L65A 4D72A 1LQ2A 1GKPA 1JUEA 5D8WA 4JIQA 1CXLA 4AWEA 1S38A 3NPWA 2QNEA 4LBSA 3C2RA 3ID7A 3A9IA 5A8QA 3IJLA 4FLSA 2QCMA 4LW7A 2F2KA 4C1KA 2EHHA 3OOQA 1V6YA 4LAMA 3QSTA 4YHEA 4A2SA 1LM1A 2J7EA 1I1WA 1QI2A 2O7QA 4QAWA 3I7RA 4J9JA 4LUIA 1XLKA 3W1UA 2IPWA 3U6WA 3DHUA 3FYOA 3QPEA 5HR6A 3ZXWA 3VIHA 1J0KA 2ZCGA 4LNCA 3A4AA 1W2VA 3LUTA 4DUVA 1OZQA 1TV4A 2VEPA 1A5LC 3G0XA 1OK4A 1W0MA 5E5CA 7PTDA 4I9JA 2OR2A 1GOQA 1P0BA 3BOXA 3OLDA 2QXWA 5K4ZA 1ZSXA 3W00A 1PWMA 5CAKA 2Z25A 3ITVA 3W6MA 2WHMA 3KZSA 3UVIA 3G1HA 1LLWA 4GX8A 2ZOXA 1QVBA 2XSBA 2OPJA 1TE1A 3QLDA 1JDEA 3CPRA 3M46A 3OBKA 3PB0A 2ZUVA 2OLHA 2ZRYA 2CZDA 4KIEA 4S38A 2XN0A 3BPWA 1EF3A 2E9BA 5CPSA 3MI2A 1OWQA 3THUA 2ZX8A 1DHPA 1MEHA 4K6AA 4C6MA 4E0CA 2VZSA 3V5OA 1U5VA 4JX4A 1ADDA 3TSMA 3LPGA 5HATA 2VFGA 4JHOA 3GR7A 2OSXA 3SAZA 2BVTA 1RD6A 5MHBA 3IJ6A 3L5LA 3NVTA 5FF7A 4JQ2A 3WMCA 4IPPA 4Q3MA 3AXKA 4HHMA 3ITXA 3VIMA 3DEQA 3I3DA 5U4NA 3CZ8A 3KBVA 1SW3A 2GGJA 4XZBA 3WQPA 4DJFD 2WVVA 3N1AA 2HVOA 1DL3A 4O53A 1WKFA 1WP6A 3BDKA 4Q8MA 3M5ZA 1WNOA 1XYLA 3FY1A 2DEPA 2OMAA 1C9DA 3TA9A 1A4MA 3AO0A 1HL9A 1M7XA 2DVTA 3VX0A 3GNOA 1VEMA 4QITA 5IRPA 1DV7A 3A21A 1TE6A 2F7FA 3A3XA 4IPJA 2IS7A 3L5MA 4D8LA 1MVYA 1KCKA 1ESWA 1VCFA 3GDTA 4GI6A 3L2MA 4RK8A 5B7ZA 3TU9A 3CB8A 1HJXA 3UBPC 4K7YA 2I5GA 3S5NA 3ALGA 4MB1A 2ZUWA 1NDZA 3B4UA 3UG3A 4K2SA 4R53A 1MRAA 4EX4A 2HZGA 3B4YA 2G50A 4UB9A 2G3JA 2OSWA 2BTMA 2VQTA 3OU8A 4O28A 3URBA 4QNEA 3VDCA 4YTSA 3LSCA 4D1JA 5G4HC 4EIVA 3II1A 3NL6A 1H63A 2ZFAA 4R3UA 1EBHA 4GA8A 1AK5A 3ZT5A 3TTSA 3V7PA 1ECEA 2V9DA 4NASA 2YBVA 3R0KA 4Q7BA 2Z1BA 3NQGA 1GVRA 1B0IA 3Q94A 1RQHA 5DY3A 1GOKA 3N19B 1R3QA 2F8QA 2QCHA 2D2HA 2ZRZA 1YQ2A 1QPOA 1G7VA 1ICQA 3E49A 3NO1A 3WH8A 4D6DA 1GQJA 2PBOA 2VXNA 2ZA2A 1Q45A 1GEQA 3QFWA 2ABAA 4KIRA 2GVLA 1IYXA 1GVFA 4GUHA 4LVGA 4JEQA 4ICNA 3RLUA 2F38A 1SO3A 2V2CA 2WSRA 3ANYA 2BOGX 2XN2A 3VKCA 4WSJA 4MNJA 2B31A 2VHLA 4JTDA 4XTIA 4RE2A 4CNUA 3P3BA 4UTHA 2PLKA 4XB3A 3VGBA 3CB3A 2I7GA 4GYKA 1E43A 4IQJA 2QUTA 4UOQA 1WZMA 2V5LA 2XH4A 1SZGA 4IQDA 1T6MA 3VKJA 3VKAA 2EAWA 3I6RA 3S5ZA 1HIZA 1XH1A 4S3FA 2NX9A 1XLMA 1JXJA 2G3NA 1KNWA 3GXTA 4ES4A 2W4XA 4Q6XA 1KXQA 2VZOA 4HYVA 4ZB5A 1SPQA 4OIFA 2YYTA 4HZ6A 3VX1A 2J7BA 4Q8PA 4BR1A 1NH6A 3LS9A 1M01A 1LRQA 5D4YA 1HVQA 1RHCA 5LNRA 1CWYA 3KS6A 1TJRA 3JUGA 3B0PA 5BOEA 2GL5A 2E8ZA 4N9CA 2NXHA 1TUXA 3CZGA 3O15A 4P7OA 2PRLA 3S0CA 2B7PA 1YBQB 3UFYA 4B91A 2ESCA 1UKTA 1P0DA 1MW3A 4RZ5A 4WOQA 3W9ZA 2J7DA 3AWOA 3GXNA 3C2EA 3SFKA 3WJYA 4WOZA 3W83A 2Z29A 5FI8A 3HN3A 6XIMA 4B3KA 1E6QM 5REQA 1CXIA 3HQ1A 1MWOA 4GY7A 1NP0A 5DY2A 4QG6A 2DZTA 2HNEA 1M65A 2V5BA 3H2OA 1RCXB 3LLFA 1QBBA 1NFBA 2QS8A 4H9XA 3CV7A 2Y5SA 5DT5A 5GPRA 4E8GA 1L8PA 1HP5A 2P3ZA 3ES8A 5CPLA 2EPHA 2H90A 2Y5JA 3M44A 4Q8OA 4NZCA 1IE7C 2CLFA 1KFJA 1E3ZA 1H49A 3OIXA 2ZX9A 3Q37A 3S42A 3WQDA 2ZA1A 3IGUA 2ZWYA 4FIRA 3UZWA 1UC4A 3M4HA 3OQ8A 3S1WA 1L2UA 3TK7A 5K3VA 3GAKA 3U48A 4O50A 4K3ZA 2NT1A 4ZFMA 3T07A 4DN1A 2HV5A 2J9ZA 4JN6A 3E2SA 4IG2A 4XX6A 3FGCB 1WPCA 2B4GA 4FOUA 4LAUA 2PDQA 1TQJA 4UTWA 2WKLA 5EMYA 1FWAC 4C6LA 1H1YA 5H2ZA 4IP4A 1PZ0A 1JUKA 3IV8A 2XHYA 3UXIA 4M3PA 3VOFA 1CGXA 2ISFA 6TIMA 4RJEA 4S3DA 2WKJA 4RW3A 4BS0A 1IIGA 4CQ9A 1UKOA 3PJWA 3AXIA 2DH3A 4KMQA 1F4HA 2FQIA 2NV1A 3QTGA 4O4VA 5AKQA 4DYEA 4MKNA 2HS8A 2XFFA 3ARUA 4FLQA 3HPXA 2PMQA 3BVJA 4DWSC 3UJFA 1LOLA 3AU6A 1G4EA 3AHZA 2ZZ7A 3NNTA 3TZFA 4XKYB 2YFOA 2XFRA 2WJEA 5KTLA 2FHCA 3O3RA 4U33A 3MSRA 2D24A 3DU0A 2FVKA 3TCSA 4TV5A 1RK6A 4JTUA 3SIZA 3B8IA 4UTIA 3OJGA 4QQUA 4I8YA 1V08A 4FAMA 3GHUA 4RDZA 3AAMA 3W2MA 2DVUA 3C0SA 1YEYA 3UWQA 1XISA 2QMJA 2PD5A 4I5UA 1EYEA 3UGRA 3MHUA 3TWAA 1XYCA 2YJQA 3OVRA 4CVWA 1UD2A 4AW7A 3LLDA 5CBBA 3AOFA 3CIVA 1PTGA 4PMVA 3OODA 3S6DA 1GYLA 2NQLA 5I0DA 3B9NA 2TODA 4PBEA 1Y7VA 2Z2UA 1VJIA 4K8HA 1XF0A 5FCZA 3ARRA 4AZ5A 2ZZ1A 3OG3A 2A7RA 4LVAA 5C6MA 3KCLA 3VUPA 4HNOA 2QT3A 1E6RA 5F7UA 4UWMA 3GVGA 3PZQA 3SUUA 3KOXA 3TXVA 4LC6A 2IMRA 2W27A 4HKPA 4L65A 2PC4A 4I9AA 1D7KA 2J7CA 1XJBA 1JZ8A 2IXVA 1MRQA 4LCRA 3MHFA 4GIAA 1OCJA 4AY1A 5KZMA 2OEJA 4N6EA 1HG3A 1I6NA 4L4MA 3RILA 2E3ZA 3QQ1A 4P8WA 4UNLA 3ARTA 4MTVA 1K6AA 1W9BM 4MZYA 1XRFA 2AQOA 3GHSA 1DXEA 1ZCCA 2XIOA 2BY1A 3H53A 4HPHA 2HE5A 3FA5A 4W7VA 4HN4A 5FAGA 4KEVA 1OYBA 1PEZA 1XIEA 4L4PA 1MDLA 2PP0A 3FKRA 1UBPC 4XAZA 1W3JA 1DXIA 3KLKA 1HTIA 5T26A 3WNKA 2JBMA 4O1BA 1S3HA 1HF6A 1M1BA 1TREA 2OELA 1OBAA 1VPYA 3PUGA 4MVAA 4OVXA 4AIBA 2QAFA 1E1CA 1UKQA 3EDEA 3O16A 1VEPA 3CNYA 3R1ZA 3ARSA 4HCDA 3ZOAA 1P43A 4JTEA 3W28A 4JD4A 2ATMA 2Z27A 4H00A 4MZ1A 2YDRA 4FNSA 3TEVA 4GUGA 4MADA 3DHFA 1TTPA 4A22A 4DWSB 3VD7A 3W38A 1JR1A 2EPOA 3E0LA 2A0NA 3OHMB 1P5BA 1MEIA 4N9BA 4V1XA 5CPTA 1LWJA 2DUXA 1TV8A 4JDBA 3L4ZA 4MAVA 3F1QA 1H50A 1PE1A 2GJRA 1EQCA 1JFHA 1L6YA 4UIOA 1TPDA 1BXCA 5IXEA 2CLOA 2Z2AA 3BLIA 4ZO9A 3HO8A 3U7BA 4ZOBA 3VOCA 2PU1A 2ACRA 2DZVA 2JKAA 3STGA 1CGTA 2C6QA 1LOSA 1CXKA 1QNPA 2A3BA 1EKOA 1LCOA 1GPFA 1EB3A 2VFHA 4PEKA 5G1YA 1T7LA 3E0WA 1RD5A 3PG8A 4AZ6A 3VA8A 4IFKA 1KM6A 1UWUA 4HPJA 3A13A 4CNSA 2J8TA 4C1NB 2CHNA 1EO7A 2J7HA 2EG7A 4Y8FA 3QY7A 2QF7A 2G41A 1Q4WA 4O0ZA 4Q8TA 2ZVRA 2HBXA 2WHJA 4NAEB 3ABRA 4IMFA 5HBFA 2J13A 2WC7A 3DFYA 3SBFA 1GZ1A 4HYRA 1UP0A 4K39A 3B8DA 3N2XA 1TVLA 1W1TA 2P0OA 1REQA 2NLYA 4LU0A 4GKTA 4B9ZA 3KAOA 1WDPA 3K4WA 3RIKA 1UA3A 2VYOA 5HWNA 1UUMA 3R12A 1ZP4A 3S9ZA 4GIRA 4IF2A 2DSWA 3SCTA 4B4FA 4LY4A 2G4JA 2GGIA 2R82A 3FFSA 3N18A 4HVXA 1NY1A 2D0HA 4FX6M 4IP7A 4IPNB 3N4AA 1JYXA 4GH1A 1OFPA 3IV3A 4X61A 4F0SA 3GDRA 4B5NA 4XZIA 2DIKA 3W7OA 2HK1A 4CNNA 3LZ3A 5G2WA 1MZHA 1BVNP 1Y0EA 1F8IA 3PTQA 2QULA 3A9BA 2TPSA 1FCUA 1HT6A 3WQVA 2RGLA 5ABEA 3LEPA 1M53A 1ME7A 2VQUA 2WMJA 3HGRA 1CYGA 3T81A 2JEQA 2E4TA 4HOWA 5CSRA 2H9AB 3S2JA 5DCEA 4E3TA 1TTQA 3FVDA 2Q8XA 1V6TA 3DDMA 3H70A 4JAWA 1GJUA 3TSBA 1XIBA 2WM0A 4GUIA 2VDIA 4NX5A 3B0UX 4W8BA 1C7TA 3NEHA 3WJXA 4D6FA 2PGWA 3SY8A 2FJKA 3DYPA 1I60A 1SR9A 4PMYA 4DM1A 3T4WA 4GI9A 4HMEA 3W88A 5AYZA 3T2OA 3KVLA 1AL8A 3RU8X 5FJUA 1H1ZA 3GR8A 4KEUA 2YDAA 4AHQA 2DT3A 3A5VA 5DBUA 4J3ZA 1IXPA 4R7WA 1W9XA 4Q4RA 3L4TA 2R1NA 4DBDA 2DT0A 3CAWA 3VGHA 4IM4A 1XS2A 4AWSA 4RZBA 3WLHA 1UR2A 1QR7A 4MWAA 1TPVA 2GJXB 3NR0A 1SVDA 2BY3A 3P82A 3RU6A 3QQWA 3LY0A 3WK0A 4DF0A 3N6QA 1PIIA 3L7RA 3R13A 3LOTA 3G6LA 1WZLA 1LLZA 1XBZA 2Z7KA 4N9EA 4TVDA 3OLGA 4KGJA 1GOWA 5AB3A 1OFAA 5C2CA 4XBJA 1BKHA 1Q7MA 2FB2A 1G4TA 4GZEA 1F8MA 4QDMA 1TWWA 2X2YA 2PCQA 4CCCA 2V5DA 4FSAA 5A6LA 2QUUA 3ALFA 4KGLA 3UR5A 3GXIA 1TPEA 4TQTA 3WIJA 1OFQA 8TIMA 2DT1A 1T8QA 4J28A 5CJNA 4JNYA 4TX9A 2X8RA 2XZ9A 5BCAA 1H7RA 1ZBWA 3SRHA 4H7CA 1Q6OA 1W9PA 4P7LA 5JXQA 5LHFA 1BLIA 1TCMA 1EBGA 1W3IA 2G3IA 3R0UA 3WLIA 3K1GA 4EOUA 4I3GA 1XR2A 3IANA 3H2CA 4BI5A 4BCEA 2I9UA 4C90A 1TRIA 4XO7A 1R3TA 4REQA 3VIFA 1OADA 4H8UA 2ZQ0A 1JI2A 5M17A 1BYCA 2XGIA 2VKZG 1OG0A 1V5XA 3ZZ1A 1ZAJA 3GDKA 4HHPA 5GNZA 4V1YA 3W2UA 1MQRA 2VR2A 1BG4A 4XAFA 1ISZA 2NSOA 1DWGM 1QU4A 4I90A 1B54A 5DCDA 1V02A 1YPXA 3O6AA 1D3GA 1M41A 5T91A 3SECA 1HP4A 5LKYA 1Q13A 3TYCA 1OB0A 3PC0A 2CPUA 4RV8A 4J1OA 3EOEA 3NQDA 4LEQA 1QNOA 4Q8WA 1T99A 3PZOA 4GG9A 2OLSA 4LUYA 3XISA 4PSPA 1H7OA 1DWHM 3WLMA 2QCEA 4NJJA 2EPMX 4TU1A 1ZGDA 2OQLA 4CCEA 1DVJA 3SB0A 3IIZA 3PBMA 2VEGA 3UJRA 4GD0A 4G8TA 3NURA 4GRSA 2WMFA 3SUWA 7REQA 2VGBA 3L0NA 5AZ0A 2CCRA 3G1YA 4PB4A 3N2OA 1XM3A 4PUUA 2ZUSA 3TQKA 2DW6A 1VZWA 3EMZA 2HWGA 4M1BA 4HPNA 1QXLA 2PU0A 1KV8A 2CXGA 2AKMA 2R1PA 3WH7A 4GIYA 3L67A 4IGMA 4JX5A 1WDDA 3PZ9A 4DZIA 1V6XA 4KPLA 1AL7A 4PTDA 2HTMA 2OGJA 1EGVA 5DEZA 3WH9A 2FLIA 1UOZA 2P3EA 4AC7C 3CO4A 2ZXBA 5LIUX 4DF1A 2VDHA 4Z1YA 3TXZA 2YYUA 1EA9C 1IWAA 1UKSA 1OX4B 1UQZA 3NSMA 1AQHA 2Z00A 1X8CA 3W26A 1IT8A 3AJXA 1GK8A 1C8VA 1VLWA 3WO8A 2XPKA 3BW3A 3BGAA 4IFRA 2J88A 3UY8A 1GUVA 5HUPA 3AISA 1P7TA 3GG7A 2ACSA 4MNKA 3SGGA 3OBAA 5H8MA 1DHKA 4H8NA 3QQ0A 3NDZA 1B1YA 3LX9A 4OECA 1FKXA 2J62A 1XKJA 3AIWA 4O1FA 3RX3A 4GI8A 4UZSA 4AFYA 1EH9A 3VI2A 2W91A 1XRSA 2AMGA 3VGDA 3VE7A 3AXHA 1GTHA 4LNYA 3CGTA 5JIPA 4GVGA 1IHIA 2FPTA 2CIPA 2E28A 2NUWA 5F4SA 2FHBA 4WY0F 1SSDA 3RRXA 5I3IA 1A50A 4IFOA 4H9UA 1C29A 1W91A 3TFCA 1U30A 1VYPX 2FGLA 2WJDA 3L4VA 4QG8A 2G3FA 4HA0A 3TQPA 1Z41A 1EQPA 2ZUMA 2BOFX 4LUTB 3WQ6A 2KAUC 4MF4A 1ADOA 3K46A 3PZIA 1IEIA 1E0TA 4D8AA 3H54A 8XIAA 3W1QA 3UG4A 4GISA 3F03K 4JFSA 1RJQA 4TX8A 2ZZ5A 3W1PA 1EJWC 3WEMA 4OGZA 3LBCA 3EEGA 3W7DA 5CSSA 2ZX6A 4AEEA 4TO8A 3NL5A 4N4QA 3SDOA 3L21A 3BO9A 1WDQA 1KCLA 3VZZA 2XUCA 4K8EA 4XUGA 3F2DA 2TAAA 3W7PA 3N2BA 2TSYA 3BJFA 5CQ1A 1W3TA 1JDDA 2R9RA 4DPQA 2PAJA 3GH4A 3TE9A 3CZEA 4JTTA 5HNTA 5MF5A 2FMNA 3UR2A 4C6NA 3NEVA 4I7VA 3GM8A 2CNCA 4QLKA 1H11A 1Q65A 1MI3A 3IS4A 2ASHA 4YVVA 3ARQA 2PEVA 2HVNA 2WBKA 1M6JA 1N8FA 4KWSA 4WDUA 3CAQA 2ACUA 5AZ1A 1ONRA 1P0NA 2P8CA 4GBUA 4J3TA 2PSNA 4QCEA 1J11A 4UQ9A 3RPDA 1RXOB 3VIOA 3OGSA 1UKPA 1E6SM 1EZ2A 1GW1A 4UBPC 4Q4MA 2GVGA 3DESA 3S9YA 1GKRA 1KM1A 2UV8G 2D1ZA 5F2IA 1Y5WA 1LBFA 4WHBA 2YSWA 2V5CA 1JZ2A 3R2GA 2DSUA 2I14A 3CO8A 2WCAA 5HWJA 3T78A 1EP1A 4Q8VA 3G2GA 4F0RA 4NKCA 4IIDA 2GJLA 3M07A 2YW4A 3GVRA 2AQWA 4E2VA 3D3FA 3PAOA 2V3EA 3VDAA 1YDNA 4B4HA 1EHAA 3ISIX 3PSWA 4CU8A 3O07A 4UFJA 3EOUA 3HQNA 4NF7A 4NP7A 3HFTA 3W6YA 1X98A 3GFYA 3MYPA 2HJPA 5BYWA 1B5TA 1BAGA 3TYAA 3FYYA 2CW6A 3UR7A 3MBDA 6REQB 4D6HA 4D71A 4QFUA 3RHGA 4CNOA 1PX4A 1NFPA 1GT8A 1Q3NA 2VRQA 3WF3A 1TTIA 1LORA 1PDZA 4W7UA 2ISDA 3GW0A 4HMNA 5A6SA 1FWFC 4GKLA 3AHTA 3EA3A 3UJ2A 2VP8A 4IMDA 1HJQA 3QOMA 4HNNA 4I8DA 4Q7IA 2J9YA 1H41A 3IJIA 5AHFA 2Q02A 3VKKA 1N8IA 2QJHA 2XIMA 4HNTA 4DZHA 4M80A 1NM9A 4E2DA 3WBWA 3PBYA 4LRSA 3GO2A 1OQFA 5HANA 3A4XA 3HGSA 2V69A 4UCGA 1Q85A 3STEA 1QWKA 5F1VA 3G1AA 5F2GA 1Y65A 3HJEA 4QROA 3UW6A 2PUZA 1XH0A 4JQAA 1ELSA 4WLCA 2XDFA 3R58A 1OIFA 1NOFA 4FX8A 5FJIA 3V5CA 5AYBA 1F6PA 1DWIM 1AJZA 3BAJA 2QDDA 4HMCA 3T2PA 4C7DA 1J12A 3OA5A 1YTDA 1TWIA 3I68A 3DFPA 1DQWA 1F5ZA 4W85A 4ATWA 1TKKA 2PDLA 4LVFA 4JN8A 3FDGA 4EKJA 3M0XA 2FVLA 4H7ZA 4LYQA 4J3SA 2GFTA 3DCPA 3QV7A 1XG3A 2C91A 3HU7A 2XSAA 3F5LA 1TELA 1UWQA 4UUIA 4HZMA 4PUDA 3V18A 4W89A 5A95A 4BWLA 3M5XA 3AXMA 2IQTA 4CD4A 4A8IA 2J4GA 2Y88A 1EC9A 4F4RA 4ZB2A 2PB1A 3LENA 2HXUA 1JI1A 5LA1A 2J7FA 5D38A 4IUOA 1WAUA 3PM6A 1E0VA 2P88A 3NM1A 3SGUA 3PUOA 2XM1A 5BXPA 1KTNA 3W2LA 4O52A 3G0SA 3HBLA 4AH7A 3N15A 4ML4A 3QMSA 4KESA 3NYZA 4C6JA 1H5YA 4OUEA 2JGYA 5CZTA 1QDSA 5KITA 3THCA 1BRLB 3QV9A 1EPVA 1R3WA 2D3LA 4H9TA 4IIGA 1HKMA 4GHRA 5D9NA 3UG5A 3EXSA 5JMUA 4D6IA 1EJRC 1WBJA 1RP9A 2HS6A 3WBYA 3HG5A 3IGXA 3VGEA 1VEOA 2Z7GA 1R87A 1OGGA 3Q2DA 1NOUA 1HVXA 4JYFA 3T8LA 3M64A 4QR6A 4UQDA 1XRVA 3GX9A 4O13A 1MFUA 3IJ7A 5GQBA 3FEQA 4HJFA 1RJRA 1DWAM 4E6MA 4U28A 4M51A 1EF2A 3L66A 2FFCA 4GYFA 1LT7A 3S46A 1QJWA 5BRBA 2NWRA 4O15A 7XIMA 4I7UA 5HQMA 4IX2A 2GZXA 5DMNA 3H22A 1O5RA 3LGGA 1R7AA 3TQ0A 3SR7A 4ZSTA 2Q3OA 3L4XA 2W6RA 1ITCA 4ZL1A 3HQOA 1NFGA 4H9YA 4PUEA 1HQTA 2WW5A 3DFTA 1U5JA 3W24A 3CHFA 4JTAA 2VZTA 3PBGA 5CAHA 1T41A 4L61A 3KWXA 4X9YA 3GW3A 1RCQA 3M0IA 3WK1A 4NVTA 2AOSA 4JQ1A 1RVGA 5EPDA 2BV9A 2WNQA 1LWIA 1TFVA 3ZM8A 3YPIA 1FWIC 1EHNA 3DBPA 4F2BA 4JNMA 4G7FA 4KEMA 3K4AA 3LI0A 5I06A 5CZJA 2PDYA 1XSJA 2O92A 3PG9A 5HNUA 4ROQA 4Y9NA 1J01A 4DBSA 1F3XA 5CZKA 4ZODA 4PL2A 1JZ6A 3GBEA 3KTSA 3UYCA 1KXTA 4Y7EA 2YBTA 3POHA 3MDUA 1EDTA 3VIPA 1P6WA 1ZNNA 4Z1CA 1V0MA 3I7QA 1OGSA 3QEZA 1DEDA 2GJNA 1O7AA 1FOBA 2NQ5A 2F9RA 3LG3A 4HSOA 1AH3A 5TAOA 3P5ZA 3BG5A 1KGXA 4F0MA 4TR9A 3UETA 1DJIA 4CD5A 1VFUA 4NI8A 2OEKA 3GVWA 4MFDA 4RZ6A 3DECA 1FUYA 4UR7A 3P67A 4Q4PA 1SFTA 3GZ3A 4ZXOA 1FH7A 4FNQA 2VC9A 1ISYA 3VE9A 2WJZA 3DKJA 3LHWA 4MJMA 1E5NA 3USBA 2UY4A 3SGZA 3LHUA 1RCOB 1QOQA 3TW7A 1MUCA 1B3YA 1QASA 3GKAA 4B5WA 4V2XA 1VB9A 3PHAA 4JKLA 1H7PA 4O54A 4FALA 3LLXA 3W7RA 3DI0A 4O8AA 1XCXA 3N25A 2Y24A 3WDQA 3VD9A 1NTHA 3QYQA 4H1ZA 3VNZA 4U5KA 3MWCA 5KINA 3WBEA 2QIWA 3FXGA 3SI9A 4WZHA 1VPQA 3ZYZA 1UG6A 4LJ3A 3TN6A 3M6DA 4YL2A 3KW3A 1FWDC 3F4VA 2QYGA 2X1IA 3O6DA 1W17A 1FH8A 5AHEA 1M3UA 3CJPA 3HQPA 5JH1A 5IDZA 5JH2A 3O63A 1S5NA 1QPQA 1ITUA 3ZLHA 3W7IA 4ZQCA 1I2OA 3WDPP 4WKAA 5D9PA 3UVAA 3UZXA 3R8HA 3GKFA 1B2YA 4JICA 5FAJA 4M6PA 2IXUA 5CC3A 4AD4A 1XLHA 4IGSA 2Y2WA 3HPFA 4PMXA 3T40A 2ISWA 3NSNA 2DUZA 2D22A 4AEOA 2Z26A 4MKVA 5LIKX 3F4NA 4W87A 2HE8A 2VGGA 4L6OA 3VMNA 1Z48A 5CC5A 5HAOA 1V3LA 5DN1A 3ZMRA 4A8NA 3MS8A 3AUJA 3A64A 3UZ5A 3GNXA 4A3QA 1F7BA 3HFYA 1FHLA 2G96A 3A12A 4FLOA 4B5XA 4TTUA 1EC7A 1P4CA 4WDXA 5AYYA 4UQCA 4FR1A 1ALDA 1WKEA 2NUXA 1E71M 3VZXA 4TMBA 1KCXA 4MSSA 4LB3A 1LG1A 3DG6A 3VAVA 3W74A 3QR0A 1JYNA 3CK5A 3W7EA 1A5CA 3K5XA 2C79A 4XQ6A 4XZHA 3ZR6A 1XYMA 3N2CA 3IUIA 5CBJA 4JHMA 2A6NA 3BSMA 3OGRA 3N11A 2C7FA 3CASA 4ZVJA 2H8ZA 3CL7A 4IJRA 5A6KA 4PODA 1E1EA 4EXBA 2F61A 1KBJA 2MANA 2AL2B 3IRDA 2WMIB 1X38A 3H7RA 5DF0A 3N4FA 3LV6A 4L9ZA 1Q66A 1JCXA 3UEQA 3AU2A 4TTGA 1PUDA 2D0GA 5AHMA 1A4LA 4V15A 2Y4SA 2WLZA 3CUZA 3TNOA 4WXYA 1QPNA 3CQHA 5D02A 2WB5A 4URIA 2ZUUA 4CEXC 5IOBA 3K2GA 2AL2A 3M47A 4GYJA 5FF4A 1S46A 5CLTA 3CHDA 5IDIA 4XKMA 4IL2A 5C2GA 9CGTA 1BYBA 2UY3A 3PY2A 4Z2KA 1GGOA 1R3RA 3GTNA 4GXMA 3D47A 3HM7A 1CIUA 4WDTA 3NQ8A 1FP8A 4GABA 4KEZA 5H1WA 1I2NA 3ZJ6A 2Q6ZA 1PS9A 1NDWA 4Z2LA 3WL1A 4DEFA 3MC5A 1DQUA 4I6KA 1W1A1 3W4RA 2GSEA 2PA6A 1DIDA 1UIPA 1I9CB 3M5VA 4DWDA 1QWGA 1XYFA 3KM8A 3MHGA 4XBKA 2R1KA 4L9YA 2XVGA 4U4MA 1ML1A 1BTCA 3FHAA 4JKMA 2E68A 1TR9A 4BK9A 2P0IA 1MNSA 1S5VA 6REQA 1UMLA 3RM4A 1RVKA 1DJHA 4ADTA 4AB4A 3U2OA 3C3NA 1NSJA 3ZQ9A 1X7IA 1PZ3A 3VM7A 2YFNA 5ENLA 3U5UA 5I00A 3G1XA 3S6TA 1WKYA 3TAOA 3TOYA 1K9TA 4HHHA 5B7YA 1M7PA 2REQB 4L1XA 3LCWA 3QGAC 4RPPA 1UD8A 3ITTA 4UFMA 3ZT7A 2EGZA 3T8QA 2PDUA 1GVOA 4UTTA 2OX4A 4JIHA 4C65A 2C1IA 3KP0A 5G1MA 4Z08A 2GVYA 1XI3A 5AHLA 4PB3A 1DE5A 3FSTA 1V7YA 2WO5A 4JTRA 4RE3A 3SURA 1XLAA 3C5QA 3VTRA 2CC0A 1SJCA 1KV5A 4QG9A 3EX6A 3FLUA 4KCWA 3LDVA 3L4UA 1PKMA 3CYJA 4QLLA 1GORA 4GNJA 3XIMA 4L1GA 3N12A 3FA3A 4RNFA 4X3ZA 2J78A 3QXBA 4L56A 7TIMA 4Z1AA 2TMDA 1BG9A 1EX1A 5G2HA 3DFOA 3RO8A 2A6LA 4XSMA 2CWXA 4G1NA 2WKGA 3MWAA 4Q33A 2CBUA 2NX3A 4J35A 2DSVA 1QPRA 1J5SA 1LZOA 1JCJA 3BMVA 2VWTA 1HJUA 2HROA 1G0CA 3NO5A 2GGEA 3C6CA 4B92A 1ZCOA 1FWHC 4PRTA 1JDCA 3MO4A 3BGJA 1BWLA 5AN7A 1YDYA 5TBOA 3B9OA 3MYOA 4YLWA 2XFWA 4QSHA 3S4TA 3KVMA 4DYJA 1CXFA 3OZMA 4JIIX 1C9WA 3ZO9A 4O11A 4KCVA 1KKRA 3ZJ8A 1UH4A 4C7FA 2YXGA 3M1ZA 5FSEC 1UWRA 3R7MA 4ACZB 3DX5A 3W70A 2VFEA 3V3WA 1MFVA 1ZJHA 2YCIX 2CLMA 1SO5A 4L5ZA 4O1DA 3IJ8A 1KGUA 2PLCA 3RK8A 3W3OA 5C54A 3GQYA 2OQYA 3EDFA 4FX7A 3RR4A 1JZ3A 3GR4A 3UP8A 3SZ8A 1KWGA 2AMXA 1ZUAX 3E5BA 3WLSA 3LYEA 4NY2A 4N02A 4UQEA 4LUTA 1HKIA 4RX0A 3U4FA 4L7ZA 2VDGA 2PTZA 3UD6A 1OGBA 2GPTA 5DO8A 1KFEA 1OVDA 3PZNA 1KXHA 2QCGA 1UCWA 4E4PA 5BU6A 1UPPA 1K1DA 1LLOA 4N7QA 2CBVA 2VC5A 4PMUA 2F2HA 3FJ4A 3UPMA 4HZ8A 1H4PA 2OJPA 4Q8QA 2ON3A 1TR1A 3STCA 3PZUA 5F2LA 3T0AA 3KCJA 5C0QA 1U2YA 1PDYA 2PDNA 5HULA 3N2TA 4IZGA 4O1AA 5FEPA 3DERA 3B8UA 1VYSX 1ISVA 3WJZA 4HA4A 1JXKA 1V02E 1W54A 3TYBA 2D3NA 3BLFA 1KTCA 1MQPA 4R9XA 3RMJA 2QUMA 3FA4A 5FEWA 1A3XA 4QLJA 5HNNA 2QJNA 3GZAA 1XCFA 3WJWA 3R6IA 1EDGA 4XD6A 3AZRA 2O9TA 4OBRA 1EJUC 1B3ZA 3GIQA 1UOKA 4JPGA 5D37A 2FPYA 1GOMA 1JD9A 3GUGA 5EYWA 1RAKA 2OU4A 3O0KA 3VNKA 3VOHA 4DQWA 2FJUB 5A6TC 4EVZA 1QW7A 2FFIA 1WDRA 4JX6A 5LXEA 4FP1A 4H9MA 3KE0A 1E4IA 4S39A 4C6QA 1GPWA 4IJBA 1SUXA 4ZSUA 3E02A 2O4QA 4A8LA 1I4NA 5D2WA 3URQA 3EBVA 1GOIA 2GDVA 3HV8A 3TWBA 4RE0A 2WJFA 3ARXA 3REQA 1AQFA 4J40A 1KFWA 1OZMA 3BC9A 4X63A 1DKWA 4X22A 3WK2A 3H6OA 1O60A 4FXJA 2OZTA 2V63A 1F05A 1F6KA 1UBSA 1JG9A 3UZYA 1VBRA 3GLCA 1MEWA 3H2MA 1JJKA 1JD7A 3WLJA 1EDQA 4AMAA 5A8PA 4MYAA 2YPIA 1LT8A 4D8ZA 1E40A 3GG8A 2CEQA 4M0XA 1P6CA 1S2TA 3TN3A 1LRTA 3RF9A 3TUUA 5LNVA 1OF8A 2QDHA 3RPMA 1CCWB 3SN4A 2PDKA 2G3MA 3GDBA 4GZ7A 1K03A 2W66A 1OC7A 4ADUA 4WEVX 3P8IA 4Z17A 4IT1A 4M7TA 3DI1A 4D1IA 4PMJA 3AMGA 3W22A 4LGXA 1Q6GA 1SSGA 2X2GA 1E9ZB 2QJGA 3PBUA 1PX8A 1SW0A 4AU0A 3CT2A 4O0KA 2V67A 3PJUA 3VDGA 3T0DA 5FF3A 1KM3A 2EKCA 4UOZA 5A2BA 4B5SA 2PRHA 1DIEA 1PSCA 4MZ8A 2R1LA 2EPKX 4ML9A 3DKLA 1OD0A 4ZOCA 4Y8EA 4K1WA 3QLLA 3E0VA 3A5FA 4PUNA 4F2UA 2JFEX 2XINA 9XIMA 3VK5A 4R5EA 1F74A 1HKWA 3W1LA 2FTPA 2WNZA 4DNHA 3LGEA 5BW6A 2PD9A 1WXJA 1VRDA 2PWUA 4AZGA 4R34A 5A8MA 3CIWA 3LCIA 2ANUA 4M6VA 2FH6A 4AIUA 3UCDA 2YW3A 1X6NA 3MMUA 3QZEA 4LYRA 2UY2A 4MLRA 4NYUA 3CPUA 4FLRA 1YNPA 4IOTA 3BQ6A 3D5HA 1AW5A 1PCKA 1J79A 4WCJA 1DJXA 4UFKA 1H7WA 1UR8A 4GX9A 4IPIA 4WVXA 3HV9A 4MB3A 4GI4A 3F2BA 3KOFA 1XC4A 4HNUA 4NNBA 4OT7A 3I4EA 3AIVA 5KZDA 2O9PA 3OIHA 4FO4A 5JBFA 2VX4A 3OPSA 3LERA 4IL0A 4YYFA 4NG3A 4DXXA 1IXQA 4OU1A 3FN9A 2ZC1A 2E25A 3AI0A 3AYSA 3WLLA 2I56A 1Z6KA 1SYTA 2J6XA 2OZ3A 3E0IA 1A49A 1KXVA 2CLHA 1QOPA 1T96A 1QHOA 3V1HA 2W92A 2CITA 1PKYA 2QR6A 5DXYA 3T0CA 2VJXA 3TKFA 4DJEC 5I77A 2BX7A 1TA3A 2Z2BA 3E38A 3VDBA 3W25A 3QPYA 4PSRA 4ZMGA 1S5TA 2XISA 4W8AA 3VVGA 3AIEA 1NU5A 2CLKA 3NGFA 1ISXA 3VGFA 1MYRA 4OV9A 3MMTA 4N4PA 4S3CA 2PURA 1JNDA 3G8RA 3OZPA 1R2SA 2HPIA 2H9AA 1R6WA 2C0AA 1PPIA 1XSKA 1B3XA 4MJ2A 4NZ4A 1LG2A 4U3AA 3CZJA 5CC6A 3FS2A 1DJYA 4LF1A 1VRXA 2GGGA 1E6NA 3WNLA 2INFA 1TJ1A 2ATSA 4V28A 3GRIA 4X2PA 2W3ZA 4FNUA 1HKJA 4JHZA 2ZZ6A 1ISWA 4RNIA 1FCBA 1QK2A 2YZ5A 4PBFA 4A6GA 2X41A 3V75A 1THFD 1E9LA 2DT2A 2JK2A 3GTHA 2BLEA 4XWUA 2VGFA 3I4KA 4QJ3B 4EF9A 4UTKA 1VGAA 3TAKA 2VGIA 4OTKA 1WA3A 1WDWA 1JFXA 1R0MA 1JCMP 2X0SA 3T44A 4BF7A 4MJ4A 1L2QA 3PBWA 4OBSA 3RUBL 3TNBA 2AGTA 4CUCA 1O68A 3ARPA 3N3MA 2QF8A 1VJSA 4EAYA 5IFPA 3P7YA 4LSBA 4XZLX 1PO9A 1DTUA 1TMQA 4PTNA 2CZFA 5C9XA 1E4MM 4XAGA 2GQAA 1BPLB 4NJIA 3V5FA 3M0HA 3MUIA 3DIPA 4PEEA 2YA1A 4AISA 3OBEA 4S3AA 3RX2A 3LNMA 1VLIA 1AFSA 5CGMA 2FPVA 5GVJA 4DHGA 2OVLA 3O6YX 1QI0A 1V7AA 1G67A 4UMCA 1JDFA 1VBJA 1TPUA 3QJAA 5CSYA 4IFKB 1OFBA 1I0DA 5HINA 3BWWA 4LVDA 2BXVA 2RDXA 3TVAA 3DBNA 2GSJA 1MXDA 3EWBX 5FKYA 2YDSA 2O56A 3B9DA 1X1ZA 1A47A 4AC1X 4WK9A 3FEMA 3E3HA 3EA2A 3OEXA 5LGXA 2G97A 5DANA 3PUEA 4PMOA 1K6WA 1UD6A 5EMMA 3PWAA 4J2PA 3DHPA 4QCFA 1YDOA 1H5VA 2V3GA 2JQXA 4NUWA 3BAIA 1SFLA 4CN4A 4H8VA 4MM1A 4H9ZA 2WPBA 4CLMA 5BROA 4DWSA 1BEUA 3PNUA 5ABGA 2X05A 3EEZA 3PN8A 1BSIA 2VURA 1MUWA 3SQSA 4JIPA 2A5HA 3B40A 3U3HA 1Q6CA 1PZ2A 3GG0A 4FF5A 3WD0A 3GY1A 1NF7A 1H51A 3WQFA 3DHDA 1OFOA 1E1CB 2Z1XA 4WIWA 1OX4A 1YNQA 2GUBA 3AYTA 1TUFA 5BXRA 3OVQA 3F4WA 2GSHA 2ZXQA 3W2JA 2BMBA 1R2TA 5DRIA 2KZHA 3MI6A 2VZVA 3GS6A 1Q6LA 2WQDA 1O12A 5BOOA 3W1NA 3O6CA 3UERA 4W88A 1JQXA 1I2QA 3D0CA 3H2FA 4MAZA 4JTIA 4POCA 5JIWA 1YXCA 3NOEA 2QVHA 4MWAC 4AHOA 2VTFA 5I3DA 3M16A 3M0JA 3LK6A 1KLYA 2R94A 4QE5A 3VIIA 4K8GA 3CTTA 1S5WA 2Y89A 2J27A 2C0HA 3KBNA 4NIRA 2ZADA 2JEPA 4DIAA 3DG7A 1KLZA 2RJHA 3TROA 1OFDA 1A5BA 1CGUA 1KRBC 1WUFA 1F3EA 4XO6A 1VFTA 2XTKA 1X7FA 2P53A 3TZNA 2Y7EA 2A3EA 2WQPA 2B7QA 4K7VA 3AMLA 3BMWA 2VX5A 1MW2A 1ICPA 2CKSA 3B06A 3EWUA 5HJLA 1G1YA 2WAGA 5BRPA 4YVXA 5FL1A 3OLIA 2Y5EA 2CESA 1UZHA 1FDYA 5G4EA 3RRAA 1G7UA 2ZZ4A 1PYMA 2BHUA 2PDMA 1JAEA 5I3KA 2XM2A 4W4QA 1K8ZA 3WNOA 4N2YA 4FB7A 4NXKA 4M1RA 3VXGA 1QI5A 3VD3A 2E5DA 3W1TA 2E67A 1H60A 2VUYA 4IHCA 2I17A 3N2MA 4PCSA 3C4UA 4LC8A 3VCNA 1BSLA 5E9XA 4MFEA 4FI4A 1CGVA 2FDSA 5A8OA 1W9VA 3C0LA 2PZNA 4ZCWA 1NIUA 4ALDA 3MKVA 3U5YA 3QZ6A 4B15A 4L80A 4XK2A 4GZJA 1OIMA 2ZA3A 3ZJ7A 3HPSA 1N55A 2DJLA 2QV4A 3IVTA 1V79A 1CTNA 4QTGA 1NQKA 1FX6A 2VEIA 2H6RA 4US5A 5FD0A 3RYSA 4FK9A 2ICSA 4PTMA 2ZRUA 4JFTA 1OEPA 4MB5A 4I5RA 1ITQA 2E5CA 1IXOA 4QXIA 5JU6A 4UOJA 3QGVA 2A3LA 3R0DA 1TJPA 3CT7A 1UW9A 3H4GA 3MP4A 2Y6ZA 4S2CA 4F0HA 4FXSA 1EP3A 4DJED 3G1VA 3CYVA 3LCGA 1LYXA 4CQAA 3CUXA 2W63A 4MWAB 3N9SA 1W37A 2POZA 1KM0A 4G9PA 6XIAA 3VOIA 5A1AA 4O8RA 3VCCA 2YB1A 3MUZ1 2J8FA 1P1XA 2WANA 5LSMA 1YDVA 3P14A 3HG3A 1NP2A 1U5HA 1TB3A 3CUFA 3WK3A 5E70A 4RNHA 1W9DM 2QGYA 5D03A 4KWUA 3V0SA 2WBGA 3W07A 3G1DA 3KTCA 1C8XA 4D6JA 3BUVA 1HX0A 4CEUC 2OEMA 3REQB 3IIVA 2OO6A 4BI6A 4P8VA 3KDOA 5CG7A 2FDMA 5I3HA 1JDAA 3LRMA 1SMAA 1W5OA 3NPUA 3VPLA 2DPEA 3LPFA 4I7WA 3FVMA 3VC6A 1KM2A 4ZOEA 3G22A 1PKLA 3B9AA 1VAHA 2CXEA 4DWSD 1KRAC 5DQPA 3PB2A 1XUZA 1XH2A 3NSXA 4LBRA 1PL9A 3MSGA 3KRBA 3UY7A 2VOMA 2PGEA 1QW9A 3CZLA 4NRSA 3UR8A 4B3LA 4R33A 3GXFA 3NIYA 1VC4A 3ARZA 1WXZA 4HT3A 2YCEA 3FDKA 4GVIA 5HR7A 5T8GA 1PJ9A 3NQMA 3BANA 2PE4A 3ZLFA 4UFIA 4Q32A 1K8XA 1VPXA 4ZO7A 1J5TA 3V36A 3OG2A 2Q8LA 3H23A 4IIBA 4DAIA 2DY3A 5BZAA 3P2VA 5XIMA 3B3DA 3MUY1 3BLOA 2OWCA 1YTKA 1R86A 1P6BA 5CPQA 1J2WA 2VX7A 3WD4A 4ICCX 4ZEPA 5K9XA 1W5NA 2DSKA 3SFWA 3IRSA 4NAEA 3TTOA 1XV8A 2Y7GA 3GU1A 1HO4A 4YMZA 3WF0A 1UYQA 1ZFJA 1XSIA 4DJDA 2W9MA 1IF2A 3TLQA 1H2JA 3ANVA 4ZQPA 1GZGA 1WO2A 3EOOA 4F40A 3WFLA 3JR2A 1UQYA 4NZ3A 2DP3A 2FYMA 3CH0A 4IGHA 5I07A 3P5YA 4CU6A 2ZX7A 4US5D 1XYZA 5U7SA 3AMDA 3UJEA 4M8UA 2WMKA 4LANA 5D2VA 3IK2A 3OZYA 1UZ4A 2PPGA 3MSDA 4HQVA 4F9JA 4LXFA 3VKDA 3OW1A 1KQYA 2ZIDA 2DFAA 2DQWA 2ISVA 5DX7A 2DZBA 1ODZA 2CHRA 5HK4A 4J3XA 3E96A 1U1UA 3AJ7A 3CZKA 4TOQA 1PAMA 3VMPA 1AVAA 4YU1A 1VP5A 1XG4A 3CQ0A 3URAA 3IWPA 1XFCA 4XAPA 3LQGA 1AMKA 4ZQRA 4QBXA 4WGHA 3B8TA 3HA1A 4HSHA 4LBUA 4GO8A 2IW0A 5HA7A 1RPXA 4ORIA 4RKAA 3OHIA 2NZLA 1W1B1 4YCPA 3SY1A 1CB7B 5BWAA 1I8JA 1E73M 3C0QA 2QCFA 3U9IA 1V03A 1POJA 5D32A 2VUNA 3TW6A 4Z2IA 1O5QA 4Q22A 1OFEA 5KETA 3DUGA 2E1WA 1A0CA 3AIUA 3W7LA 1OABA 2Y61A 3FOKA 5E6YA 5AC6A 1JGMA 2CKRA 5FA5A 4E4FA 3M0MA 3O9NA 1BVZA 5J8LA 1FHVA 1HJSA 1YPIA 2ZBTA 1BVWA 2X1TA 4W84A 5BMWA 4DB7A 2ZC8A 3MJMA 3BV4A 3K30A 3IJQA 1RPKA 2CHOA 3W1XA 4FNTA 3NOYA 5A2CA 5EL1A 2PWVA 3SCQA 1TA3B 2VFDA 4Q8NA 2QUNA 3PZMA 3N9RA 1AH0A 1XCWA 4UC5A 2REQA 2B0MA 3AC0A 3FSUA 1US2A 1FFRA 4CQDA 1EEPA 2E6AA 4NJHA 3A4JA 1GONA 4OOUA 3EX1A 3CAKA 4HU4A 2VR5A 1O5KA 5AC7A 3TA6A 1SQ7A 4I5XA 2X16A 4IP5A 2DZAA 3WLPA 1YKWA 3AFBA 3IEBA 3G1FA 1QW8A 4IQLA 4O16A 4H7VA 1RV8A 3VIJA 1UA7A 3R8GA 1XGEA 2VOTA 1RH9A 4ZQMA 2J75A 1XLDA 5I23A 1JAKA 1QI3A 4EAMA 4MY9A 3UYIA 4ENLA 2JIWA 5IHRA 4F66A 4NJGA 2PDIA 4ZBCA 1R5YA 2WPGA 1H3GA 2XWDA 3EX4A 3TR2A 5AC5A 5I02A 2Z6IA 4G1KA 3VIKA 3LMYA 1GWJA 3PTKA 3CTLA 4GNKB 3FNDA 5EU9A 4NHVA 1U33A 1UZ1A 3C8NA 4K36A 1TWZA 1KB3A 3MW7A 2FHFA 1VYRA 1VJZA 4K1GA 2OZ8A 2PWFA 1UR1A 1ZTVA 1TPH1 1ZAHA 5K9CA 2W0UA 4C6IA 1PTAA 1QPKA 3ITOA 3EKZA 3LXAA 1PTDA 2EEXA 2PODA 4H4IA 4KRTA 3LCHA 4CQ8A 1X1OA 4KWOA 2E9LA 3LXBA 5E0FA 1K9EA 1BF2A 4C91A 1RJPA 1W6TA 3QV6A 3WUEA 3BAYA 2HEJA 3CEUA 1VF8A 4QISA 3EWZA 2X1SA 1A5NC 3IGHX 4R9OA 4XD4A 1I45A 4KWWA 5FJOA 4ZE5A 4OV4A 3W72A 1FBAA 1W32A 4H19A 2NSXA 3JRKA 1KGWA 3LHZA 4UTWC 4CN6A 1ZZMA 3LU2A 4A3HA 1E0WA 4JY9A 2YL9A 2I1OA 5AYXA 1ZJBA 3KBMA 1JRBA 3MVTA 4A21A 3ZWSA 1D3CA 2WSPA 3WQCA 3MJYA 3MMWA 3RGTA 4L4OA 3SEPA 1B90A 1Z9AA 1TVPA 2GVEA 2PTDA 1O66A 3W2NA 1W1VA 1GOOA 3Q58A 3SIMA