3VGBA

Crystal structure of glycosyltrehalose trehalohydrolase (gthase) from sulfolobus solfataricus km1
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
550
structure length
550
Chain Sequence
b'GNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
molecule tags Hydrolase
source organism Sulfolobus solfataricus
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
total genus 187
structure length 550
sequence length 550
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgbA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgbA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgbA02
1H3GA 2XFFA 3G5ZB 4JFDB 1KEML 3CMGA 4MA8H 1CZ8L 4JRXA 1CGTA 1CGSL 3T2PA 3ECQA 4G6ML 3VJ6A 3PF2A 4PGCA 2Y5TA 3QIBA 4BKLA 1KEGH 3QO0A 3WLBA 1ZT4B 2WHKA 1KB5L 1QP1A 2VL5B 3PGCB 4J1UA 3ZHLA 1WBXB 4HIXL 4WUKH 4JFQB 1BD2D 4WHTB 3L9RB 5IFJB 2XFRA 3GBML 2W9DH 5CGTA 3H55A 5CEZL 4JDZB 4OZHE 1HH6B 4K9EH 1FVCB 3HE7D 1R24A 4KK8D 1G9NL 4JFXA 3W26A 1XGPA 5CCKL 5LGJA 5IR1B 1HZHL 4GPNA 4OKDA 5D5ME 4J7RA 2I25N 3AZTA 1UD2A 4P9ML 5E08L 5EOTA 1ZA6B 5J1SC 3THMH 4OFKA 1MNUH 5EU5A 3BN9D 5CLWA 2CLVB 1D9KD 2EH7L 1JHKH 4KROB 3QUZD 5JW4M 5HHME 1F4WH 1Y0LB 3D69B 3F8UB 1N3NA 5JIIA 5I6XC 1VFUA 2DTMH 5F9AC 3JTTA 3DYOA 3WHXB 2F1BA 3IK2A 2X1IA 5GRUL 2JIXB 1MPAH 1IE5A 1YNLL 2NY6C 1QSFA 3DX4A 4QCFA 4WIWA 3TTOA 4LSQL 2CESA 4NQEE 3BP5B 3PWUB 4UUJA 2UVEA 5EFFA 2NTSP 3OQ3B 3TBTB 4N9GB 1C8XA 4AXNA 2YD1A 5E99H 4GZIA 1WITA 1IEAA 3EHBD 4MJ5B 4JHWL 3SGJA 4K2UH 2Y5TB 3CH8A 5TGBA 4QXGL 5E5RB 1OT2A 4QRTA 3LXBA 4K7FB 1FJ1B 1TIUA 4YNYA 3VI3E 2YMXL 4Z6AT 2BNUB 3TT1L 3RVXD 3QSKB 4XMLH 1OD8A 3CMOL 4QYOA 3QQ9D 1NLDH 3KS0J 2ZX6A 4KAQH 3VJ6B 4A3HA 2VO5A 4P23B 2PW1B 5DTFB 2XA3A 4IM8A 4PJ8C 1D6EB 2A0LC 4MAUH 2VDNH 5ANMA 5CGYC 2IH1B 3GKZA 4JZNB 2F53E 4XVSH 1RZFL 5TPWH 3N12A 4CJ0A 3DECA 3HZVA 3T2QA 3EGSA 3AIRA 3FQRA 2LQRA 1DBAH 4YHGA 3MV11 1ESWA 5E70A 4N5UA 4R4BB 5JPMA 3CZSA 4NRXB 3SURA 3CVIH 5SWZE 3FN0H 1RV6X 2OQJA 2Z92B 1NMCB 1X5FA 1W2KT 1YEJL 1VSCA 1WGOA 4LCUB 4TYUA 4O02L 4XC3L 4MDPA 5IBUG 1H49A 3QHTC 1K2DA 2BSED 1YC7A 2GW5A 1G7HB 3CDFA 4KKLD 3KPLB 1UR1A 3TA3B 1N3NB 1W2VA 1TTGA 3AHXA 2CUMA 4PG2C 4DTGL 4CJ1A 1H11A 2XTJC 1ZK9A 3RUGF 4RE3A 5TE4H 3LRSA 4OBRA 3VFRA 4MD0A 1CYGA 3SGDH 4LBEA 1NBYA 4LPWA 3TBVA 2OZ4H 2ADIB 2YD6A 4AIOA 2V5CA 1OGAD 5EU7C 1DR9A 1Z9SA 4LSVH 1UB6A 1RVFH 1WAAF 4OTXH 2IFGA 3PIQA 4MNQB 4M82A 3MC0A 5E0FA 3MBED 5IHUH 4W87A 3JWOH 1YYMH 3LIZL 4OZFG 3WMSA 1JZ3A 4OFPA 1TJHH 3O9WA 4OGYH 1JV5A 2CUHA 4YXLH 3NBNA 3EYFA 3EOAB 2XGIA 2VR4A 4AD4A 3CIVA 4U6VL 3IFPB 3VXRA 4CDGC 3O6KH 1MCEA 4JZNA 3RDTA 1DVFB 4G7YL 1Q0YH 1C5CH 4LFHD 4ODTH 1WWCA 2X4TA 3MUGA 3BKCL 4MHHI 2YL5A 1DE4B 2D9QB 4QRPD 4BA8A 2CJUL 3A22A 4NZJA 2XWBA 1YNLH 3T2NL 1YEKL 3K2MC 3FOMB 3TH4T 2EDYA 4JREC 4NKMA 2KQNA 4M43H 3CSPA 2QR0A 4HT1H 5KOMC 5DR5H 2D03H 1HZHH 5EZOH 1W1VA 4D3CH 3VXQA 4UBDC 2P5EB 4QY8A 3BKYH 4O4YH 1A6ZB 5SWZA 4QXUH 5GZOD 4RGNB 4PJXA 3EMZA 1EPFA 1RK0B 4LSUH 2F53B 3FQTA 3LPFA 2XG5A 1EJOL 2HJLA 1I8IB 2H8PA 3OMZA 4Z5RA 4LRIA 4OZHB 4G42B 2GJRA 2V7HB 4O51B 5T1KB 3O3DA 1KJ2L 5DHVH 3UBXA 1I8MA 1GCFA 2DQHH 5TE4L 1MJJB 4UTFA 3PQYB 4N9OB 1AGDA 5F1IB 4ZUUA 1HI6B 3QUYA 3V6ZB 4FQHA 3KLHC 4LU5H 3MRCA 3IJSA 2RR3A 4PJHE 4GOSA 3KXFE 3L3GB 5IGXL 3HI5H 1KBGH 5D1XC 4XP5L 3UTSA 1EO7A 2HT3C 1HH9A 3Q3GA 1J8HB 3ZYIA 2AJYH 3ZE0F 1V0LA 5ACLA 3GMPA 2QL1A 1B3YA 1EMTL 2E6JA 4P4KB 1CG9A 5E1AA 4PTWA 3VIPA 1CD8A 1H3PH 3KPSD 4YXHL 3SE3A 4DGIH 1L0XA 3ESUF 2YSSB 3ULVL 3RILA 2DLGA 1RUMH 1MFEH 2DT1A 3IFNH 2DRUA 1OAKH 5LJYH 5KVGL 3WF2A 1V6UA 1CXFA 1P4IH 4EOWL 5CPSA 1IFHH 2DD8H 2WIIA 3DURB 5GS0H 2R4SL 3ECBA 4FQ2H 3WS3B 5GGTH 4IOFD 1BG9A 1CD9B 4KRPB 2CDGB 3K1DA 3SGDI 4ACZA 2VUOA 1HYSC 5GS1A 2PWHA 1Z2KA 4MQ7A 3LHPL 5KSAD 2A6KA 1X7QB 3U0PA 2AQ1A 1R33A 4PJAE 4G6AC 1RAMA 3CZKA 1PZ5A 3KPTA 1BZ7B 4UOW1 5FGRA 2ZX7A 2VC9A 5HDBF 2WWKT 1TQUA 3NN8B 4DO6A 4Z7VF 4P46C 3MA7A 3RKDC 1RUQH 4YXLL 1KNOB 3IF1A 1NOFA 3JTSB 4Q6IC 5E8DH 3IU3A 1IAMA 1F45A 1PYWB 3Q5YA 4GUPA 4MLSA 1WBZA 4OZHA 3RU8H 2WMGA 5DJ8B 4JM4L 3ARXA 6A3HA 1G7IB 2B20A 4OI7A 4CVWA 4U2YA 3U9UA 1AJ7L 1KSRA 1BECA 1IQDA 2WPGA 4W8AA 2NCMA 5TJWK 4PMOA 3QWOB 3RVVC 1AD0B 2R2HB 5J6GA 2XKUA 1UVQB 4WKAA 3FY1A 1BP3B 5AYUH 2FCBA 5FM5M 2FJGA 2KKQA 3PBGA 4HUXB 4U1JB 2UWEE 4DWSD 4W7WA 3MLTB 3OHXB 3CVIL 1T03H 4QXUL 3IJ7A 4WW2F 2MHAA 4RFNB 4R2GD 4ZPVA 5TH2B 1HHIB 4A2LA 3KPSA 2GTZA 2V2TA 2PKDA 4LIQE 5D2NE 1FQ9C 2XIDA 3TM6A 4K23H 1VESA 1UEMA 3VKKA 1E6XM 5IESL 1N5AA 5ICXA 1DUZA 3SOBL 1B0IA 4OZFB 1H0IA 4N8VG 1F2XK 1F11B 4HZAA 1GQLA 1I1AB 3FQNB 1VRXA 4QLKA 4X83A 3QH3B 2OZ4L 1JWMB 3QCTL 4G6KH 3U0WH 1AP2B 3H9ZA 4X7FC 4V1DD 4KI5D 1LL6A 1NWTA 3BISA 1DBJL 1HF6A 4JGMA 1NC2B 1WAWA 4Z8FL 4MYWB 2UY6A 4OIBA 3WN5A 4IRJD 1OIMA 1NC4B 1XIWB 1LQSR 5E56A 3C2SA 2WHMA 1TZGH 3QDGB 4Y1AB 2P5ED 1A7OL 3ULVH 1A1NB 2VLJB 1SYVA 4B3LA 2J79A 5E94A 4W4OA 4LLVA 4B0MM 4Z78A 4RDQG 1GGUA 3VXSD 2DQJL 3OF6A 1MCCA 5HPMB 1BZ9A 4V2CB 1S7VB 2IALA 1IQDB 4D0CA 2WYSA 1XF4A 3HI5L 4LKXA 2ZCHL 1A7NH 2FHBA 4M8VA 4NQDB 5TDPA 2VXSL 2EDTA 2A74A 1S9VB 2E6PA 2NY3C 3CC5A 4UIKH 2EYRA 5CWSA 3WFCL 1JI2A 1XF1A 4XVUC 1GONA 3S34L 2NY4D 4Y16C 1RUAL 1MJUH 5CG0A 2GT9B 2OTWA 5FDYA 2BJMH 1PIGA 1VFMA 2V5TA 3VFTB 4DGVH 5EU6B 3TVMC 2PR4H 1ORSB 2Z8VC 4D0BA 3LKQB 1E5JA 4R27A 3OR6A 4OZOA 1G9NH 2OWXA 4NQDD 5J06A 5D5MB 4KZEL 3WFHA 1AP2A 1IBGH 1QEWB 4N90D 1VPOL 4MB5A 3F5JA 1NAKL 2ZSWB 4HG4K 1ISWA 5DO8A 3DYMA 5F6IC 3EBAA 2Z91B 4TSBL 1DLHA 2DI7A 3MRGB 1BTCA 1FO0H 3WN5B 1NMAL 2NLJA 4XMKH 3EOBA 1AR2A 1XZ0B 4X4YB 4OV5A 1YMHB 3LB6D 4R8WL 4AD3A 1MJJA 2R1XA 2V6HA 3BAIA 2CQVA 2V3GA 2XTKA 4TVDA 2PO6A 3UEZA 4HF5L 3I2CH 5AWNH 8FABA 3C08L 3N0PB 5D7JC 4AIXA 4ZNCD 4G80B 3GRWH 3ULUH 1QRKA 1NANI 2JB5H 5F88A 2G75A 4PR5A 1A1MB 2A9NL 2IAMB 3SDXA 5HPMA 4Q58C 3VSUA 4AYGA 4P4KD 4NN5B 4PGEB 2DDXA 2OI9B 1U8IA 4EBQH 2JF6A 4NN6B 3VFUA 1UZ1A 1RZIA 2DS4A 4X9GA 4WCYL 1A1OB 3MACH 5LCVL 1HSBB 4UQBA 4KQ3L 4J28A 1BGGA 3IANA 5ENWB 4ZDHB 1BZ9B 3B9EA 2XYCA 4HCRH 4YZFE 4D0CB 4EN3C 4PGBB 4Y89A 1MY7A 1LL7A 3WEZA 2CIPA 1RUAH 2A74B 4I4WA 2YEZA 1OAYL 3L3KA 4M9OA 1SBBA 3IB4A 4CCCA 1VGKA 2B4CC 5EG6C 1KGXA 5M03A 4LIQH 1SR0A 3FONA 2IGTA 3WQWA 2CR6A 4PJGE 4E5XA 1B0RA 3CFCH 2G41A 3DMMC 5H2BA 1UWRA 3HS0B 1GCYA 1OGAA 4R97B 4ATDA 5BXPA 3FMGL 5FB8A 2AJUH 2AOSA 1LEIB 1U42A 1V7ML 2ZX8A 4HWUA 1NFIB 3CXDL 4R4NC 5E6IB 1TENA 3UPAA 5A8MA 2P8PB 3T0DA 4U6HB 2VSCA 2HVJA 1MJ7L 2FYVA 3NA9H 3BSZL 4OF5A 3MLXH 3BT2H 2VZ1A 1E73M 2PW1A 1J1OH 2DMBA 1XCQB 4UAOC 4H0IA 3W29A 4U1HA 5FEBA 4D6IA 3WKNA 1GOOA 3VFWB 4FQJH 3SY0A 2EAEA 4HPOL 4S1QH 1HHGA 4PLJC 1LO2H 4P3WA 5GGSB 4Y2DC 1N0XH 1MCDA 4R90H 1J12A 3FQWB 4HMEA 4JGJA 3U36A 3VFOB 3VFNB 3TO2A 4PB0H 2JJUA 3ZTNL 1NFDE 2XIBA 3SN6N 2Z92A 3VCLA 3P9LB 5BS0B 5F1OB 2W67A 3C6LB 4E5XB 1IKNC 4I4WB 3CUPA 4O2EB 2FJHA 3UYRL 3FO1A 1DBJH 3D0LB 5HVGB 4WWKB 1FN4A 4F7EA 1V02A 1JMXA 1ECEA 2W9EH 2X4PA 3CFDB 4KI1A 1TTUA 1MQQA 1UD6A 5DVNA 1JF5A 1ZHNA 4I18B 4LSTL 1DWGM 1OCQA 1CE1L 2NY0C 1E6ZA 5IBTH 2ZOKB 1SM3L 1NGXA 3PGCA 5FUOL 4LARH 3FO0L 1AGBB 5ALBH 4U7MA 2WVVA 4Q0XH 4TX6A 3NOIA 1YNKL 4OB5L 3VXME 4Q9RL 5GNYA 1CDIA 3SCTA 1OY3B 1HH6A 3IS0X 5FL0A 1MHEB 5DZOA 5HVFB 3DVNB 4OSUL 4JFFE 1RIVL 5IMKB 2BNJA 1QLEL 1IGYA 3MV9D 4DUXA 5F9DC 4U6HA 3N18A 1U93A 3O2VL 4U3AA 3BGMB 3T8XA 4YHKL 1U2CA 1KJMA 1A6UL 1EFXD 3GHEH 5FV1L 4HV8A 2UWFA 2H3NA 1JFHA 4LSSL 4GS7C 3KLAA 1T7YA 2VLKA 5EBAA 2R4RH 4DWHA 4M48H 5GHWH 5L2KA 4KMTL 5CZXC 3H8NA 3JTTB 2JB6B 4L8SC 4U7SA 3E6HB 1HEZA 4R3SB 1WIUA 1ORQB 1G9MC 2BMKB 4KHXL 3UMTA 5C0BB 3TNNA 2HAZA 4XPHL 3C60A 3CUPB 4O2EA 5I3DA 5E8EB 4KV5F 1W0WA 2IANE 2P7TA 4ZYKB 3QRGL 4NN6C 4Y0GA 4H8WL 1H0GA 3WF0A 3LIZH 4WV1B 3VCLB 1AGCA 2ZCLH 2P42B 3D2UA 1HIML 3SKMB 2V7HA 1WIOA 2FJHB 2VNCA 2ESVB 2QKIA 3O3DB 4PLKD 3LEXA 5M7QA 1I3VA 1S7UA 1R7AA 4P48A 3MLZH 3U57A 2WLZA 3FW6A 4LOUD 2NR6C 5F7FA 4F37F 1S9XA 2JK5A 5ADOL 4BQ8A 4Y16A 4ODHH 5LA2A 1QLRA 4UB0H 2VQUA 2QPUA 3OGCA 1EO8L 3G6LA 1QFPA 4AIEA 1DQML 4QCEA 1A6TA 2EH7H 4C83A 4R26H 3VH8B 4RMUA 1GGIH 3BRGC 4JO2H 1QO3A 1SYSB 2J3SA 2OM5A 2F1AA 5I24A 5F7EL 4QHNA 1FE8L 2X2HA 1VB9A 4MD4B 1B2WH 4WFED 3IJHB 4PJ9C 3BWUC 4ZD3H 4H25B 2VI0A 3WDPP 3QQ3A 4LIQL 4DN3H 1HXJA 1NMBH 5F1KC 1KJMB 3MSPA 3OLIA 1LO3H 3P11H 3RKPA 3OB0K 2J6EA 4LLUA 4PMUA 3LZFL 3IKKA 5IMOB 5HI5D 4FXKB 4NCDA 3P3YA 5JUVA 1JYNA 2GTWA 2OJEB 3FL7A 4HWBA 4E8CA 3EFDL 3O6FB 4HKBB 4ORZC 3HMXL 1J05B 4LSRH 4NO2A 5CSBA 4AJ0A 4H8WH 4QXTA 4X5WB 1ETZB 1PX4A 2V7NB 2VDKL 3NH7L 3PP3K 1XV8A 2UYLB 3AMLA 3MRLA 3X14A 1A6VH 2AJZA 4RISH 6CGTA 2PBOA 1FFRA 2EXYC 2HLAB 4JY5L 5H37G 2JK5B 1OAUL 3SKMA 3HE7C 1VGEH 2BZDA 4X6DE 5JUEH 4DVBA 2DJSA 1QG3A 3FFDB 3C5JB 1F3RB 2J7HA 4WSJA 1TQCB 3DC0A 1KN4L 1U3HD 4OZIF 5DMKB 2LVCA 2H32A 2NY6B 3I2CL 5AWNL 4BQ3A 4M02A 4QRRB 2AERT 1AD0A 2R2HA 4LL9A 4KHXH 5T5NG 3WFEL 2IQ9L 1IFHL 2DD8L 4AEEA 5L8LB 4J3XA 3CHDA 3CIQA 5E2VL 3QIWA 5TDNB 3DGGB 2YPLE 4PJBE 4QRQA 4WTZA 3DI2B 3LEYL 4HGMA 4U5IA 1FFOB 2EH8L 1UXWB 4YWGL 3P0VH 4ODUA 1WZ1L 3QEGH 3EYOA 5I73B 3ZL4L 4NSKB 5ABGA 3MACL 4W6YB 4X6EB 4NHCL 4NYLA 4OCRL 2XYLA 5F7KC 3GFUA 1BVLB 4OTXL 2GYSA 4JCMA 1I9JH 1SVCP 3VIFA 2NY7L 4EUPA 4OIIH 5AZ2H 1VFAB 5BZDA 3JWDH 3U83A 2IAMC 4X6BA 1JWMA 2E27H 4DVRH 4YDKH 3QIWD 2FX9L 3GM0A 4X99A 4QT5A 2H9GA 1A2YB 3NCJH 3QIUC 1MOEA 2N7BA 3RIFF 3IFLH 2PTTA 3UTSB 1WDRA 3CPLA 5FV2A 5CJQL 1K8IB 4IRJB 3LPOA 5F1IA 1J8HA 3VXRE 3TV8A 4OCXL 4ZD3L 4FQHB 5BZWA 1S7XA 5LAXA 3ZM8A 4XB3A 4FQIL 4NKIH 4P4KA 2F5BL 4M5YL 3S9DB 2J4WH 3WYRA 3TN0B 2EDDA 4GO8A 4QO1A 1I8KB 3FN3A 3LSOA 3MLUH 1QI2A 2BDNL 1E56A 1H5VA 1YUHB 3W2DL 2ESVD 4KQ4H 4IPLA 3PWJB 4LSPL 3TBYA 1F4HA 3V5KB 3TYGH 3ULUL 3VDAA 2YKKA 3FB6B 1K9FA 3RBSA 2RCSH 2EYRB 3SQBA 4DGYL 1RULL 5IFTA 2BRQA 4MNQE 4ZFOB 4GKSA 1IEBB 2OS7A 3D25A 1J0ZA 3TPUB 4NRZA 4IMLA 4UFJA 4HUWA 1K6QL 3F4VA 3BIKB 4WU7A 1MAJA 5B38B 2P44B 4KJWC 5LXGL 1NJ9B 2AI0L 1KTLB 3KYAA 3VILA 3ECBB 5D7KD 4ZUSB 4XBPB 3IJYA 1HIMH 4APQC 3ARUA 3O3AB 4ACZB 3IF1B 1P7KB 1NQBA 3O3UN 5GRXG 4HKJA 4YHYC 2Q87A 4QXWA 2XM2A 2WBGA 4OD3L 1XH3B 4GMTH 3X3GL 1FGNL 2XIIA 3TO4C 3HG1D 1KCSH 5EU7E 3B5HA 1YMHA 2OTPA 3M1BA 2CH8A 2DLHA 4S0TD 5D1QD 5HYQA 4L3EE 1O7SA 2FO4B 1NGPL 3QUXB 2E7MA 5DFWH 3MCKB 2MKLC 1INEL 2HT4D 3UJIH 3WNLA 4ZFZB 4NQCB 4KUZL 1BD2E 3SIMA 4YDLB 3KJ6H 4OIAA 3DO7B 4MNJA 1S7QB 1IRAY 1INQB 3MV7A 1ISZA 1NEZA 1N82A 3VGAB 4N0CD 4P7QA 2WZHA 3G5YB 3CFBB 1B2WL 4NQUA 4HEPG 3MRQA 4M6ML 2VTFA 1XIWC 3CXHK 3BGAA 5J6GB 1QFHA 1ZANH 4HJGA 4WTXA 2NYYC 3DX8B 1FBIL 3IXAB 4R96A 2R29L 4GKSB 1UWXK 4M62H 4MAZA 3ARBB 2XOTA 3JUGA 3TPUA 2P43B 4OLWL 2CKSA 1ODAA 3CVHB 4M8UA 1IGJB 4AZCA 4M29A 4ZOCA 4ZEPA 4WY7H 2GSGB 3P4OB 5A6SA 2EICA 2YPKB 2O9OA 2IH3B 5I8OH 1FZJB 4G6FD 3AMGA 1I3GH 4UQ2B 4IEFB 3HG2A 4GJTB 5K93A 2FGWL 1UM5H 3TONA 3QIUA 1XH3A 1I1AA 3OJMB 3PL6A 1A6VL 1P4LA 2DWEB 4RISL 3F5LA 3POCA 2IXVA 2LVEA 5F8QC 4OM0H 2P48B 2FO4A 3OKYA 1JNLH 3RTQD 1OAQL 2BVPB 5IUSA 4WEBL 2BSSB 1N2RB 1TR1A 3PZVA 2ZUXA 2DGAA 5T5NF 4WKHA 3U7YH 1N7MH 3DGCR 4NCC1 2P8PA 3I9GH 1OAZH 1WBXA 3QPQC 4FNLH 5TFSL 1XF2B 2WC7A 1WCBA 4YXKH 2AK1L 5FOJA 4DOHE 2HVKA 3GSXA 1JHKL 4JAMA 3LQMA 2ICWB 4PJ8A 1JF1A 1AD9A 1QSED 3CHCA 2HFFA 1AI1H 5GRJH 1WBYB 3IT8D 4Q6IB 2QTEA 5DJAB 1HYSD 4U33A 4BZYA 2EACA 3QG7H 2MCG1 1QSFD 4URTB 5KSAC 4XCEB 3DPBA 4H88L 1Y6KR 1CFQA 5F97E 1EHXA 5JDSB 3LKQA 4ONGL 2CSPA 1CXHA 1D6VL 3QXUA 3BUPA 1UQSB 4PRBB 1UWGH 2YBRA 1NM9A 1Z3GL 3BEWB 1QEWA 4AK1A 5I8KH 2VN7A 2YPKA 4YLQT 2Z9TA 5J6HA 4P2RE 3JV4A 3GK8H 2BXZA 2Y06H 3IDMB 1QSFB 4GAGH 5IW1A 2Z8RA 2DQTL 2QSCH 3A67H 1A7OH 3GI8L 2A3CA 5SWSE 1J0JA 3EDJA 4CN1A 3X11A 3RQ3A 2NY1D 3NIGE 1JDDA 1XH2A 2D7OA 4F8QA 3ROLA 4JDVA 2XTLA 5BQ7A 4JREB 2BP3A 3LXAA 3BLBA 3SOBH 5GZNC 4X7DC 4JANA 4PJHA 1D9KB 1G9HA 5FCZA 3QCTH 4G6KL 1XF2A 1CFVH 1NP0A 1T89C 4UIMA 4OGYL 4OKVA 2GJ6B 4P57B 4K71C 3LRMA 1CS6A 2ZUWA 4R2GC 2VUYA 1DQDH 1AD9B 5C3TA 4F80A 5DJYA 3BAKA 4YDIH 3S5YA 1X1NA 1E0VA 4QHKI 5IK3A 4MMZC 2VXUL 2IPUG 1JTPA 1X9QA 2OXHA 2YPVH 3LV3A 2E4TA 4H5SB 1VACA 3BXWA 5H35B 3VXOB 3VIKA 3IETA 4KXZI 1S7RA 2PYFB 1DSFL 5DJ0B 4YQXH 3H9SD 2FB4H 1RJZA 1KV3A 1SJEB 1G7PA 2W5FA 1INDL 4XB7A 1P2CA 1P84J 3MRHA 4MX7A 2CERA 1VGKB 2XVPA 2R2EB 1EEQA 4KI5C 1FFPB 3OXRA 4HU8A 4Z77A 3BDBA 5IOPA 4H2CA 5IIEA 2ARJQ 1JGDB 2J75A 5F3BA 4ENEC 4E41A 5C71A 3DXAD 3UYPA 1VENA 4BYHA 4GI6A 1AFVH 2DQGL 3D48R 3O45B 1YMMA 3QG6B 1ED3A 2J12B 4IRZL 1FNEA 4QP0A 4KZEH 5FUCC 1B0RB 4JFZL 4FQLL 1G7QB 3AXXA 5A6AA 2W0FB 3KXFD 4G9DA 1R85A 1EFXB 2WNWA 3FB5B 3WFLA 4Y7EA 3OV6A 3VGFA 3L3HA 2FIKB 5DVKA 1EGJA 3NCCB 4QWWD 3V6OA 4XMKL 1XCQA 3VDHA 1LE9A 5DMIH 3R0NA 1UQZA 4WENB 3RDTB 1OD7A 2WUBH 2WWMD 4CD8A 3HZYB 3LV3B 1IM9A 1MFVA 1W72H 4EDXB 4GBXA 3L2MA 2LABA 4UFMA 1FNSL 1V6XA 3AHVA 4BA0A 1S7RB 2JEQA 2VDOL 3EHBC 3VD9A 4LASH 4Q9CA 2EPLX 2J8HA 2PCPA 1P2CB 3PZQA 3V8OA 4WWID 1Q38A 3AM8C 5HI4D 3VFWA 3AVEA 5CIPH 3ARFD 3P4NA 1CWYA 1H8SA 4YN5A 1A6AB 1TJIL 2PC8A 4JPWH 4OM1H 3QQ9C 1PLGH 5ABHA 2HG5B 4MS8D 1Q4NX 5CILH 1INDH 4TVUA 1RU9H 5F3BB 4GRLA 3PWVB 4YHNA 2A0LD 2XN9A 4XI5D 4MAVA 2AJ3B 4YHIA 5EDXA 3KR3H 4PS4H 3H9SA 1A7BA 3PGDA 4G5ZH 3D3VA 5EMYA 2A3HA 3SO3B 4OLVH 1IM9D 4NQTA 1C8PA 2UY3A 4L4JA 2VAJA 2YL6A 4LSUL 4W5ZA 3BVWA 4OCRH 4G9DB 2X4PB 2UYLA 1TQVA 1LJYA 3O45A 4A2MA 3FB5A 4LRIC 3O8XD 3WEXA 4CD6A 4RA0C 3P73A 5CJ5A 2R9HC 3FKUS 3QUXD 3WV0A 3QISA 1M1SA 4DM2A 3QA3A 1QW9A 5T5FL 1FG2A 4ZSOB 1GGBL 3L5WA 5I17A 3GBLA 3CZNA 2EIZB 4LF3A 4RGMC 1NCAL 1A21A 3K80A 5DR5L 2IPUK 1QR1B 3BXNB 3BUYA 5GS2H 4X9FA 1FV1A 3FNDA 2GITB 2BSRB 2G60L 1X5IA 1CFBA 2NXYD 3MBEC 3O6FD 1UACH 4NJAH 1A4JB 3B9VA 3JBG7 2ID5A 2ZCKL 3EGSB 3MI6A 1AXSB 4O58H 3KAAA 3TNNB 1R47A 3GSNL 3AICA 2H3NB 1G7JB 1K3ZA 4ZO7A 4ATWA 2WAHA 1U41A 4BSJA 2CDEA 2HH0L 1E0OB 2C7FA 1T83C 5E8DL 4ZYKA 5GS1B 1BYAA 5C0ND 1LVEA 3BRDA 2E9IA 4KJQC 2IGFH 3VM5A 1LO0H 3RWDA 5EBWB 2F61A 2FJFB 1CN4A 4QRPA 1VF8A 4UILL 3NFNB 1FAIH 5J4MA 2BOCA 3HG3A 3LKRA 5EUOF 3H9SB 1BVZA 5T33L 4J12A 2D7MA 4YDJB 5CFHA 4MNHB 5L8JB 3TWCH 4CVZB 2FX7H 3D3VD 4Y16B 1BLNA 4FZEH 5INCB 5JXEC 3CDCA 4IRZH 3ARBC 4JRXE 4HZ8A 1U8LB 2EO9A 3D9AL 2XG9A 4OAWB 4CDHA 2ADJA 4KJYA 4W86A 4LNRA 3EW3B 3W0WB 1S9XB 4OM1L 4PLJD 5E5UB 1DHKA 4RNRA 3BXNA 3WNPA 2DYPB 1CXEA 1UD8A 1G0DA 4H7VA 4JKWA 2CLZB 3MGAA 1LO5A 2DJ4A 5D96B 4KTEL 5FA4B 4ZMAT 1RUPL 2CKBH 1MVUA 1I3UA 1VKXB 3QHFH 1E4NA 3CC1A 3OZPA 3VRIB 3BUYB 1IAII 2RIKA 1FNGB 4RGND 3GNOA 3QJFA 1P4BH 4L8DB 3MLRH 1IM3A 1RUKL 4AW7A 4CCDA 2IPTL 5JZ7C 2BS9A 5LA0A 3P77A 5E00A 1AQDB 3NPZB 2CR3A 4MGXA 3B3IB 4BQ5A 5EZJA 5I1EL 1CFNB 3I50L 4M00A 3S35X 3U46A 4NO2B 3VXQB 4XMLL 3VO0A 1CD1A 3Q2CA 3INUH 3GJFB 4NUGL 4QXTB 3LMJL 1UG9A 2P1YA 1J9CT 3ZT6A 2KZ1B 1I1AD 1Z3GH 1RP9A 1XSIA 1ERNA 2UWEB 3AB0C 3MJ9L 4KTDH 1MEXH 5DYOB 2ICWI 4LARL 1OARL 5GRUH 1NGZA 5GGSY 2W63A 2X2JA 4JO1L 5HVHB 1WZMA 2BOCB 3OLGA 1DQLL 1IZJA 1OL0A 4AZBA 4AL8H 3MPCA 3EO1A 3OLEA 4GKNB 3QUYD 4FQCH 2C3GA 1BM3H 4L9LB 1M7IB 1D5BA 4I0PD 1K85A 2PYED 3U7AA 4P46D 1ZHLB 3RAJH 4JKKA 1IGFL 4NJ9H 1HKLL 4JN1H 5TQ2L 1H3XA 1R3IH 2GJ6E 1QI4A 1Y6MR 1KIRA 3C5ZD 4LVNC 1QKZH 4W4OC 4QRRA 3AZSA 2J2ZA 4F33A 1T1ZA 2GK1B 3L3OA 1GGBH 3T0XA 3IRZA 2WZIA 2HFGL 5MHSE 1S9VA 3CC5B 4NSKA 3QULA 1KXTA 3DETC 1KT2B 1S9WA 3S96B 1NLBH 1BF8A 2QV4A 4EN3B 2ZUTA 5DURD 4KC3B 2ARWA 3KPPB 4TRPL 1P5VA 3H9YA 4XVSL 1XD0A 1BREA 1AIFB 3BO8B 3C6SA 5IKCA 1HQRB 4AZCB 2OSYA 3DX7B 4OLXH 3P9MA 3U1SH 2DBJA 2MQ3A 2APTA 3LRGA 1B31A 2BRRH 4UT6H 5HDOA 3BH9A 3SDDC 4JFVA 3VXSB 4LFHG 3WY4A 4X99B 4HK0A 1FZOA 3MYZA 5SWSD 2WBJD 5BRZA 2ZG2A 1DBMH 5BVPH 1KLUA 5C08D 1SMDA 4EUPB 1NGZB 1BAFL 5F9OH 1NL0H 2E6QA 4CAGA 4JFED 4GG6A 1JCKA 3L3JA 3W9EB 5ILTH 3GK8L 4QF1B 4TUKL 5HY9B 1UQYA 2XZAH 1N2RA 2VDRH 4H88H 2G75B 4P2QE 4HT1L 3HPLB 3E8UL 1F2QA 1URLA 2FLBT 5KSVA 3CZLA 4W93A 1A8JH 3WFDH 3KPRD 1GVIA 4FZEL 3IRPX 5T3ZL 3PZGA 1KXVA 4UFIA 5EIVA 1NDGB 5C0CD 2P46B 4GKNA 4K3DL 5JR1H 3HNVH 4ONHA 1HE7A 3K2UH 4G8GA 4AMXA 2WVUA 4ZE5A 2Z8WC 5L8KB 4P9MH 3H9SE 3Q5TA 5E08H 2NW2B 1IC4H 3AFLA 3CH1B 3B6SA 1UXSB 2MCPH 1H1NA 1LO0L 1PG7W 3WS6A 5FUZH 3KPRB 3AHTA 5A6BD 2QBWA 4OF8A 4YX2L 5J7CC 5DUBA 5CKGA 2ARJA 1BLIA 3B5TA 1MI5A 2A9MH 2GSIB 5ALCL 4DFHA 2ZG1A 3HR5A 4OFDA 3DXAA 2Q8AH 3VXSA 2NY5L 3WQ8A 3V6FA 3DBXA 2J77A 5IJVB 4UV7L 4IJ3B 1KLUB 2OL3B 3MMDA 2GY5A 2DIJA 3H2WA 2AXHA 5EOCL 2IJ0C 4NNYB 4XVUD 4YHOL 1R34A 2R0WH 3RDTC 3OIHA 4JJ5B 2CIKA 2QQQA 1IGIH 3VG0L 3X11B 1MRFL 1PG7L 5I73C 4X8XA 4TUFA 3HE6B 1FGNH 1LP9B 2BVYA 4ZAKC 4ZUWA 1JHTA 1JNEA 3BKCH 2DLTA 1ZGLP 4U1IB 1INQA 2KH2B 3MV7B 5HXMA 4YO0B 2AXGB 1YC8A 4HIHB 1NEZB 3LCYA 4XVTL 3N1MC 4B9ZA 3NTCH 4W7UA 5AC5A 4KJPD 1KENL 2XZCH 4ZXOA 2X0YA 4LDEB 1HJWA 4HZLA 3TESA 5ESVA 2WMFA 2ENSA 4ONHB 3AIQA 4WNQB 3L3IB 5HHOB 2W9DL 2V17L 3WNNA 3U7WH 2PNDA 1ISVA 2BY0A 5I6XB 2ZXQA 4OCYL 4OI9A 2IFFH 1FORH 4TUJB 2I9LA 4NQVB 2XACC 1U30A 3BMVA 2O26U 3JV6B 4I0PB 1I7RB 4F2MA 3SDDA 1U0QA 2D7TH 2ZIDA 4TXEA 1JF6A 3MJ7A 1ORSA 4P99A 4WUUD 3GSUB 3S4SG 4LU5L 3BPOB 3OR6B 5FO7A 1EZVY 4NNYA 3QQ4B 3DXAB 1YMMB 4EXKA 2WZEA 3LH2L 2DQIL 4EN3D 3UC0H 3UZEA 1I1RA 3C9NB 5EN2B 3A21A 4CCEA 4WI6A 1NCNA 1U36A 5ECUA 5LBSH 3BD3A 5FECB 5KSBA 4MD5B 2X4OB 5C0RL 4YC2B 1TXKA 2ILLA 3RVUD 3MRRB 3KR3L 1DBML 1YPZE 4PS4L 4R6UA 1EFXA 4U1MB 3FT4B 5ANME 3VNYA 2DDQL 4M80A 3WO4B 4PP1C 3ZDYE 3GMMB 3PZNA 5DXWA 5DHXB 2ICWA 4PJ8B 5IVXE 3BVXA 3DMMD 2R0ZL 3OKOA 2HFFB 3H7LA 1NKOA 2HP4A 5DVMA 2NY3B 2VIRA 1MW0A 4FNQA 3SDXB 4MCZB 3O0RL 5FCUH 3CHFA 1IARB 1RIVH 5ESVB 3QEHB 1JF1B 2H2PD 2J6EL 1R3HB 2N4IA 2XI9A 3EOYG 4APQD 1EZVX 4LEXL 4R4ND 5DD1L 5IVZA 3AIWA 4MAYD 1MAML 1RY7B 5AYQA 4AQ1B 1HX0A 2EECA 3DVGB 3OBAA 3I85A 3UXFA 1UR4A 5I6SA 3RFZC 4ZUTB 1ZV5A 5DD6B 2HKHH 1CFTA 4DK3A 3II1A 4I18C 3CSYB 3FB8B 2R15A 1O7VA 4NKDA 4QHLA 5IXEA 5FYKU 3LVEA 1NH6A 3KPMA 4QXGH 1PEZA 2XSAA 1WC7B 5D7JA 1OTUD 5DJCB 2GJXA 2WM0A 3IDMA 4OFYD 4MADA 1TCRA 5EBMB 2E7BA 4MXQC 4PY7A 4PJHB 3RM4A 1WV7T 3ZYOA 4UDUA 1QFWM 1ZMYA 1CI5A 1DZBA 5EBLB 4OUUA 1C12A 5ISZA 2VRAA 4TULH 3LPWA 3PGFH 4WGVB 5GJSL 3BZEA 3L7FA 3TCXA 5FECA 1JGUH 1Q9LB 1W9UA 3QG7L 4HIIB 4N0UE 5I17B 2X9WA 3Q6FA 3RWHA 4Z7OF 1T5WB 4I48B 1MIEH 1CDBA 4WHTA 5IFJA 4YGAB 4XCYA 1D3CA 3VSVA 3W53A 4Z7NF 3HRZB 4KK6C 1QR1A 2B1HL 4AL8L 3GMMA 4AG4H 3NIYA 1KCRL 3HLAA 2VN4A 5DJ0A 4C56A 3GH5A 4OUEA 4PMZA 3RVWD 1T7WA 2EO7A 1T66C 3LEYH 1NWRA 2GK0B 4OIFA 1P4IL 4D1JA 1U3YA 3T0WA 1FE8H 3O2LA 5A43C 2OYMA 5F3HB 1JTTA 1OP5H 4PJHF 4LAQL 3O81A 3SQOL 1WFNA 4OQTA 3NGBC 4HK3N 4POYA 3UTTA 2G2RB 1VGEL 2HFTA 2KUTA 3B9KA 5EUKB 3WIFB 1OGBA 4D6DA 5LG1A 5DD6A 4JRWA 4YNYB 5EBWA 1WZAA 5D7SL 3VE0A 1I75A 1MWOA 2QJDA 4NI3A 4B16A 1GZPB 1S7SB 1K8DA 3G04B 4MSWA 4PIRF 2J47A 4QYOB 4X6CE 1GXEA 1IT9H 2D3NA 1D6EA 4XHJD 4V27A 4HFUL 1ZBVA 1T7ZA 1G7QA 4Q97A 4FABH 1GH7A 4FQXA 1G6RL 1BD2A 2NXZB 4XB8A 4XAWH 5KG9A 3PHAA 1KF9B 4K7PH 2VCBA 1T5WA 2BNUA 4I48A 2H32B 2J88H 2GIYA 4JPKH 2EDXA 4U1SA 4P4RB 3W11D 3QI9C 5JPMB 4UTAH 2WHJA 3NIDE 4JPVH 5E2UL 1FZMA 1Q9LA 1WFTA 2V2WB 3GGWB 3MOQA 2NT1A 1FFOA 2DM7A 5DQ9B 3S98A 1TNNA 5C0GA 1K2DB 4OZ4A 4X6DF 2F5AH 5LKNA 3QDHA 5C0JB 3SO5A 4ZQKA 3AOFA 5AZEH 4HLZG 4P5MB 4FQXD 3T4AA 3W5NA 4BF7A 2BNRB 1KR0A 4BQ2A 3J7HA 2DM3A 2OQJB 2UV3A 3HZMA 3HZKA 2J8UA 1ZVSA 2R56L 1J87A 1NOUA 3POHA 1S9KC 1VDGA 4JO3L 5TE7H 1U8JB 1WNOA 3WQVA 2ZWLT 7CGTA 1WUNT 2Z4QA 4ZTOL 4M1CC 2RGSA 2Q8AL 2VB5A 5AUMA 1VBRA 3CFKA 2B8OT 2IBGA 1I85A 3MRIA 4J4PD 2FBJL 2G5BA 3L3DA 2MMXA 4AD0A 1UKSA 3WSQL 4BQ6A 4PBXA 3VM7A 3GSVB 3ZDXF 2R0ZH 2EH8H 4ERSL 4ODWB 3VFPB 1DUYA 1RULH 4YBHA 4JG0L 3EYFB 5KSBE 3ISWA 3PHOA 1KJ2A 5MEOA 3BAJA 3V2AR 2A3EA 1MCJA 1UFUA 3P2TA 1PLGL 1MAMH 5DD5L 1QSZA 1KIQB 3WJJA 3TEUA 3U7VA 2UY7A 1JGUL 1E4JA 4LF3B 2EDWA 1YEDA 2WMKA 2Q20A 2VRJA 1ZHKB 1E6JL 2ZXBA 4I77L 4AMWA 4K9EL 1PX8A 4K9EC 1QLEH 4GI8A 3DIFA 4KMLB 4P5KA 3ZE0E 2Y6SD 3KPPA 4HPYL 4OGAD 3RGHA 1CIDA 1MI5D 1U3HA 1RIUL 1SEBB 1LGVA 2XV6B 1PGRB 5E1HB 1ZJBA 5C0JA 4AY1A 4BK5A 2WB5A 4ZUUB 2W0LA 1NGPH 4X7TB 3BHBA 2PYEB 3DSFL 1E4KA 3FZUC 3MO4A 3CMOH 2F53A 2WUCL 2EE3A 3DX2A 3AAZB 4PCSA 3Q48A 1QBLH 2BVUA 5EC1B 4GAYA 5JPNA 1KPUA 3LN5A 3FFCA 2C3HA 3KNBA 5GGVL 2YIHA 3MRIB 1E70M 4QRPB 1H5BB 1QNQA 4TOQA 3TNMB 1DBKL 4TX8A 5FHAL 2BDNH 3LKRB 4GG6B 4OAWA 3OKLA 3QUXA 4MQXD 5F7WC 3CJJA 3MV8E 3QEQE 4YDJA 1TJGH 4X80L 4CVZA 2JIEA 4Z2KA 2GJZB 1YEEL 2DQUL 3RWIB 1K9EA 3MFFB 3WEOA 4ODXB 3JXAA 5MEOB 4R5EA 4NKOB 3TBSB 3ULVC 3SJVD 4L1HA 1UKPA 4AG4L 3GKWL 3H3PL 4YE4H 4YBQD 3ZE1F 3D1MC 3MODH 3RL1A 1QFUL 3SDCD 1HHHB 2F53D 2WANA 5IW3A 3TO4B 2HVMA 2EEBA 4W89A 1QSFE 3V7AE 4ODHL 1W3HA 4MJIB 1OGGA 2UZIH 4G8EA 4PRHD 5FO9A 3BLKA 1NCDL 3WCYA 5GPRA 2NPLX 4FTVA 4P5KB 3WO3B 1P6AB 3ZLQC 3LD8B 5BRQA 5EZIL 3VRIA 1RQ5A 3IDXH 4HC1A 4HUNB 4YC2C 2WSKA 3WF1A 5D6DC 3MRJA 1JPSH 4WEBH 2FH6A 3JWOL 1CR9H 4R7NB 4X7TA 4Y2OA 4GMSH 1DFBL 2NXYB 5E00B 4M1RA 3HI1B 4JG1H 3MBXL 3S97C 1CLZL 1G7IA 3KNBB 5I2IB 2JF1A 4PRPD 4Z7OE 4K8RL 2VMFA 1OP3K 4NRYB 4S3JA 4HFUH 2O5XL 1QVBA 1UENA 1XR8B 2ZUQB 1GIGH 3NABL 3JTSA 5F6HJ 5TF1L 2PXYC 3QFJD 1JBJA 1MHHA 2QQLL 3BZDA 2Z31B 1U2YA 4L9LA 1NBZB 4K94L 1NMBL 1T04B 3N13A 2VVSA 3JWOC 5E2WL 4ZFFA 2Q7YA 1LO4H 2APBA 2JJSC 3L5HA 4GG6E 1M7DA 4UFHA 3ULUC 5I8KL 5I1CH 2YN3A 4G7VH 1U92A 3SCUA 3MFFA 1M7IA 1NAML 1KWKA 3IYLW 4XNQB 4Q6IA 2YLAA 1KN2H 2P8LA 3G6MA 4G8FB 1SY6H 5DI8A 2NW3A 5C6TL 4POZD 3S37H 4X6FB 3ZIZA 1C7TA 5GRJL 2P49B 3WD5L 4EUPH 1MH5A 2X40A 4Y4FA 4LPVA 1QUNA 4V1DB 4OF6A 1RZ7L 1J10A 4NN5C 1A22B 2GTZB 1IGIL 3BH9B 2YC1B 3UX9B 3VG0H 5L9DL 5MENE 2O5YL 3FCTA 1GQJA 2LAAA 4KTEH 4PRHA 3QPXH 5IB4A 4NBZB 3TC9A 2VLKE 4JQIL 2NW0A 1YN6A 2VAAB 1E6OH 1XIWD 4FQQB 3JVGC 3V0AC 1UWTA 1W3JA 2PB1A 1KTLA 5IW1B 2B4CH 2HFEB 3P9MB 5FD0A 4PLNC 3GXTA 3O2WL 3W6LA 3KDMB 2WC3A 4PJCB 4F7PA 3O3AA 3RY4A 1CLZH 4XBEL 4HIJB 2W1NA 1GOGA 5EA0L 4QHMA 4HBQA 1VBUA 3VFSB 4NUGH 5I2IA 1R86A 2ADFH 1NBZA 5I8CA 4HGKC 3FRUB 2IALB 1R3IL 3HUJB 4HMCA 1H0DB 1EEUA 1XR8A 4Y1AA 3PNWA 4MJ4A 4UZSA 3C09C 1AR1D 5CD3B 5EUOE 2MWCA 2UZIL 4Y88A 4LLVB 1ZT7A 1TZ7A 4M4PA 4KFZC 2VQ1B 3WSUA 1DQLH 4G8GB 1JNHA 4PLOB 1TFVA 3RNQA 5I1IH 4C56D 4PJ7B 5E9DA 1KCVH 2VZVA 1S5IL 1OF2B 5HTSA 3RTQC 4YR6A 4OZIB 2PYFA 2ZG3A 4X4ME 1TVHA 1KJVB 1YEIL 3ELAT 5IB3B 2W07A 4D0DB 3PZTA 1DLHB 4G8FA 3WY2A 3D39B 1LNUA 5C0FA 5HDLA 5EUOB 1L7TH 4X6FA 5F7LB 5FYLH 1A6PA 5I8EA 3CSYA 2BERA 4PJ8D 3QUMA 2AEWA 5I19L 3WF3A 5B3JE 1U8KB 3U1SL 1X6LA 3UYRH 4EQ2A 43C9A 1JHTB 4H0HB 5HGHA 3QIUB 2XSBA 4I0PC 2IBBA 5ICZB 1QWNA 5IVXB 1UZ8B 4HIHA 2CBJA 3OKKB 3L5IA 5E6IC 1CVRA 3LQAL 3PE9A 4HIJA 4HXBL 1S7WA 2ADGA 3SGJC 4OQTL 4XXDA 4U2ZA 4R0LC 5ENWA 2VDLL 1BHGA 4ZDHA 2ED7A 4X6CB 3WFBL 5IQ7H 3BQUD 2Z93B 4ZPTB 4MZ3A 2L7JA 4MZ2A 3R06B 2AQ2A 4ZOBA 2MCPL 4FRWA 4QAWA 5D9SB 4GINA 1M6OA 3EDKA 4NM8H 5HNNA 4BZ2H 2YEZB 1GL4B 1MREL 2R4SH 4HKZB 3LS4H 2A83A 3HLAB 2XT1B 2EKJA 4LKCB 3A47A 4D6JA 2Z31D 5C07E 5JW4N 2V9RA 1QSEA 1B4JH 3DDFA 1GQIA 4F2MB 3HNSL 1YEFH 32C2A 5E5MA 2WBJC 4QOKD 5TE6H 1EGJH 5J3HC 2AJXH 4P2QD 5D71L 1V03A 3MBXH 5C0AD 3PWVA 1DJSA 2EDRA 2YDRA 2AJ3A 3VGEA 5A3ID 3JV6A 1LE5A 4W81A 5IT2L 3HKFA 4WVRA 1LNUB 3QO0B 3WLBB 5C0FB 1XRVA 4AISA 1NFIA 5E6IA 4AH2A 1YEGL 1FNFA 4OJYA 3VE0B 2PTUA 1A5FH 3ARTA 5FYLE 2HVJB 4F7TB 2B1AH 5BMFH 4LRNL 1OGSA 1WPCA 4A3YA 5BO1L 3FT4A 2ZKHL 1X5YA 3T77B 5SV3A 1T0NA 3ZOAA 1LEIA 2FECL 4L3ED 3S34H 4YJZL 2I60L 2IF7A 5EWIL 5GGVY 3WD0A 4ENED 5HHQA 3WN5C 1U95B 1OSPH 2BHUA 5GZOC 4PN2A 3LPPA 1M6OB 2QF8A 1TG7A 2EEXA 1JZ5A 3WBEA 4NWUL 1P9MA 2ZX9A 1HKKA 3QEHA 4HJJL 4NZUL 2XZCL 4Z18A 3O0RH 5FCUL 1RP8A 1MPAL 5FUZL 4RBPK 2YK1L 4XVTH 5D9SA 4C55A 2VSDA 5K9JL 4GG8A 4N42A 4UT9L 5GGRY 4V2XA 2OSXA 1CLYH 2V3FA 4G5ZL 1OP3H 4Z8FH 3L95B 3SCMB 4RX4A 2XA8L 3OKNB 4ZENA 2OJZH 3QUZA 4GW1B 1FFPA 3OXRB 4YHOH 2E7LA 4WLCA 2IFFL 1Q9WA 3T65A 1JZ8A 2X1XR 5CP7B 4K7FA 3V4VL 2C1OB 1KLGA 1YNTB 1AGEA 4PJ9B 4PBGA 3INUL 3FB8A 4PY7B 5IQ7L 1JWSA 1V3JA 1TQSA 5JBDA 4ETQB 4IISA 1JWUA 4Q2ZA 1CNVA 1DDHB 4JGUA 1KCUH 4LLQA 3OF6D 2OR9H 3SE8L 5D7JB 3RM8A 1MCPL 1WCGA 1I3RB 1BLNB 5INCA 3NVQA 1X5LA 4X9IA 4NM4L 3HJEA 3AREB 3QUMH 1AO7A 1OW0C 1L8NA 2X5PA 4HQQH 3VPLA 3MNVA 3M8OH 2V5DA 5I1IL 4P23D 3SDYL 1ZLSL 3HAEB 1T0OA 4N0YH 3MJ8B 1I7UB 5I1HH 2XWJA 3F5WB 4HC1L 5AYBA 1IZKA 4OLZH 4M7KH 1W32A 3DSNA 1U93B 4X5LA 5EORH 2CIIA 1P53A 3HZYA 2D4DA 4GG8B 1XGUA 4OGXL 5E2TH 2VR9A 2O92A 4JY4B 4WCYH 3N15A 5D93B 4TSBH 3VG9B 3LRSB 3BP4B 1R5VB 1VEMA 3HC3H 1FHLA 4NZCA 2C8NA 4XP4H 2IC2A 4GW1A 5J13B 1UB6B 3BZFA 4K3JH 1BIHA 3GO1H 2NY2D 3PIQB 1Q6FA 1Q6GA 1S7UB 1BOYA 3ARFA 4MJIE 1OLLA 2HTKD 1T20A 2CYGA 1V3IA 1BM3L 3VD3A 1WF5A 2W60A 3PDGA 5HBFA 3QR2A 3O6FC 2YOCA 4DO5A 2O5YH 4DWSC 2ZPKL 5DT1H 3MREB 5AZ2L 1CEOA 3MUJA 1OP5K 1UR0A 5CJ8A 4S1DD 3GI9H 3WL9B 1FC1A 1UA7A 3LN9A 4IRSD 3QHZL 3NACH 4HUMB 3MBEA 4NZUH 2V5MA 4KDTC 3HE7B 3WL1A 4C54A 2XZAL 4LLWA 2D23A 3AY4A 1XGZA 4ODXA 3DRTB 1XH1A 3G6JB 3QQ3B 4LLDA 5DFTA 4FNSA 3I84A 2N56A 3KYNB 4HIXH 4WUKL 2DTML 4MAYC 3FHQA 5DA4A 3RP1A 1FYHB 3SDYH 5I23A 2NQCA 4AMKL 1T83A 2XZZA 2JCCE 2ERJB 2I60H 3IDNA 4YPGB 1GZQA 4JJHA 4M7JH 3GXPA 4QHNB 3U4BL 1EIBA 1FV1B 3WBDA 3NIGF 2CBIA 3F7YA 15C8L 5GGTA 5D2NA 1NWUA 2BNRA 2JIXA 1TTFA 1QRNE 4H25A 3STZB 3ZR5A 4RAHA 1OTUC 3BP5A 2ENYA 2DM4A 4NN7B 1JPST 3WXVH 3QXAA 3GMRA 2WQ8A 2VXTH 3QUYB 4QNPE 4MCYB 4I3SL 4H20L 5KJRH 2W65A 5BJTA 5DEGA 2XG4A 1YNKH 2X0HA 1XGRB 2WP3O 3F7VB 3HI1A 3PDDA 4OLYH 3BZFB 1OWWA 2CKBA 1MQPA 4DVBB 4CUCA 1KEGL 5CJXC 3LXCA 3D3AA 2V3EA 4HXAL 5HSFA 3IDGA 1PQZB 3DUHA 4ZE4A 3KL3A 4N1CA 3OJDA 3GSVA 4Y5YA 1MF2L 1KFAL 3MXVH 3QEUA 3QIWB 3VMOA 3UG5A 1QSVA 2PUQT 2F19L 5E4IA 5K9QI 2ITCB 1KJ2B 4TPRH 4CL7A 3M17A 4PBVC 1EA9C 1T66D 1MQRA 4U1KA 3DX9B 4WW2A 5HDBE 2F74B 5DMKA 2FZ3B 1XHGA 2ADJB 3N1QC 4XC1L 4FFVD 1EEZA 4LPTA 4JFWA 1ZHKA 4RNRB 1LEGA 1SJHA 4KPHH 1QNZL 2DI9A 2J88L 5KVFH 3ARQA 5EOQH 2AW2A 5I1JL 4HTYA 1N64L 5D8ZA 1IAOB 2WBKA 4K7PL 4OZGF 2F7QA 1KIQA 1MFAH 5EPMA 4EQ3A 4F9JA 1H8OA 5CUSL 1VFOA 3EYOB 4NT6B 1BYCA 3BJLA 1UB5A 3DRQB 4XMPL 1KB3A 3PTKA 4MD0B 1YPZF 4GXVH 2PYEA 2DI8A 4BSVB 4URIA 1A14L 4P4KC 2XQYK 1XGQA 3T4YB 4PGJA 4MNQA 1NBVL 3V6OC 4AT6B 1UEYA 1F58H 1E15A 3IVKB 3EBVA 1V7NH 1J88A 5SWZD 1E6NA 3IDGB 3TA3D 4AYFA 1S7XB 3DETD 3BVNA 5LAXB 3QRGH 2PTVA 2R56H 4PMDA 1XGRA 2DOCA 1SEQH 3QI9D 1I1XA 1GGCH 3FFCB 2G4FA 4OZGB 1DWAM 1GHRA 3ARDB 1YUHA 4RMQA 3GBNH 4NC0B 5FYKL 4ZS6D 3PWJA 5C09E 4UQ3B 3A6BL 4YUEH 5ETUA 5HYFA 2OSWA 4DUVA 4C7DA 4TTDC 5EU4B 3MRMB 1M7XA 1IV8A 3G6DH 25C8L 4X98A 1TA3B 4ZFOA 3O6ML 2QHLA 3ILQD 1E4KC 5ACZA 5C08A 2P8MA 2EKSA 5AAMA 1DBBL 4PJXE 1FHDA 1NCUA 1ZE3C 2R2BB 2P5EA 3WD3A 3TO4A 3ARGD 3K4DA 4JLRA 3GSQA 4JY5H 1WIPA 3L4ZA 1BYBA 2P5EE 2VZTA 4NFBA 5C0AE 3D39A 4TUOB 3HMWH 3MUY1 3UTQA 4NO5B 4X7SL 1JNNL 3KHOA 4HGWB 3D85A 3ZHDA 4UDTA 4CMMA 3WIHH 1I7ZA 4U49A 3VH8G 1P7KA 3EFDH 4BSVA 1R6VA 5IP4A 1XGYL 5A6JA 1X6NA 3DX6A 1ZLWK 4H20H 5KJRL 1NCAH 5KSBB 3ARGA 3F65A 1PSKL 3SBWA 1P6WA 4HS6A 2Q7YB 4NQDA 1G7LA 4HG4J 3D5HA 1MFNA 4NQCD 2YSSA 1DQTA 1ONQA 5D7LB 2J25A 3DX8A 3ARDA 5T3XD 2ZCKH 4PMNA 2OTWB 5ACZB 5HYSB 3BD5A 2Z93A 4ZPTA 2VITB 2VLLA 4M43L 2NNAB 1WDPA 4EK7A 3MXWL 1E4LA 3DDGA 4M6OH 2EE6A 5DFVD 4HCRA 1CLXA 4A4AA 4Z2LA 3K7UA 5ESAB 3VD4A 2R1WA 4ZAKD 4W7VA 1HCVA 4FTVD 1K4CB 4ELKB 5MI0B 3DXAE 1CGYA 3GKWH 2VDPL 1HXYA 2B1AL 1W3KA 1A9BB 5IG7A 3FCTB 5GS3A 4ORGB 2LU4A 3ULSB 3UR7A 4PYGA 2MKWA 5CILL 3MA7B 5KZCB 4ELME 1VFBB 2CK0H 5EO1A 4FQQA 2ZE0A 5KW9L 3AREC 4HH8A 2XM1A 1N0LA 5JORB 4AZ6A 3LDBC 4S1RL 4QCIB 5I16A 3HR5B 3LQAH 3W0KA 4U0RB 4W70A 4Y5VC 4YZFF 3VXMD 5MI0C 2P4AB 2A6JA 2G3JA 2Q3ZA 3SKNA 3PL6B 2OWWA 1AKJB 4ETYA 3GSXB 4I3RL 2FX9H 2OJZL 4F9LC 3RIKA 3PNWB 4QRSB 3OZOA 1TMCB 5EIIB 3BYYA 1UZ6F 3QNYA 4QFUA 2NY1B 3SUWA 4ZUWB 2BSSA 5B22A 1SBSH 1ZT7B 1B6UA 5F44A 1F4YL 2K7PA 5GS0C 2JJVA 1JUFA 1MUJB 3CMJA 3S37L 1RSFA 1WWBX 3WUWG 1E3ZA 4WU5B 1ACYL 3NCYP 3PWNA 4P2RD 1KIPA 4MXVF 4PYHA 5TH2A 2DLFH 3RX8A 4FQ1L 4UOZA 1EO5A 4NKIL 3B2VH 2GJ6D 1TVHB 5TQ0L 2W38A 2F58H 4OT1L 2WUBL 3ARDD 4P0DA 5I1CL 1F4XL 5LQBL 1UC6A 2GK0A 1LWHA 1A4KA 5HHPB 1T0MA 1WTLA 2VE6A 2VXQH 2IG2L 3FT3B 4RMSA 1IGTA 4EXPX 3HFMH 3DWTA 5CBEB 3RL2B 2E8ZA 1C91A 1F42A 2XXCB 5GISH 3VXNB 1FFNA 5ID1B 1C5DB 1KB9J 1NC4D 2JCCA 1IGCH 2PXYD 2OTUA 5IFAL 1ZT4A 3MRPA 1HHKB 1LEKA 4J1UB 1J8KA 2UY2A 4X4MA 1RHHA 4S1RH 5FO7B 4RIRB 3L9RA 2AV1A 1OHQA 2GJ6A 5L88L 2AAAA 1MWAB 5E2UH 5DUPH 1BQHG 2GCYA 4JFEE 4YH6A 3AS3A 43C9B 1J0KA 2B4CL 4XPTL 5CEYA 4DGYH 3VXMA 4H5SA 1ZKAA 5EB8A 1MCSA 2PO6D 1XR9B 4MNGB 4XZBA 2C26A 2X4QB 5A8NA 1B90A 4QRSA 3RIAK 3QR3A 4HDIA 4LHUB 1WQVT 1F8TH 3AXIA 3M46A 1WZKA 1ZS8A 2F54A 2L7UA 3K0WA 1RZJC 3KJ6L 4ZG1A 4LKCA 3GSOB 4KY1H 2FATH 3P9LA 3CK0L 3IS1X 4LLAA 3B8YA 4MCZA 5BVJA 2V5YA 1RUPH 4Z2GA 1E40A 2JJSA 4W85A 4NO0B 2VLRA 5FF6B 4XP1H 4L4TA 1H5BC 1AC0A 3OPZL 5DJXA 5L7XH 5A6MA 3UR8A 1ED3B 1C08A 4I18A 3T4AB 1II4E 1A4KB 2XKNB 1U3HC 4OD2A 3QAZC 4JRYE 2O61A 3AFBA 2ATPA 3ETBF 3VX0A 3CZGA 4WI2A 3ARFB 4NO0D 1RHHB 3RIAF 4O2CB 1IGMH 1PKQE 4DAGL 3LS5L 3P0YH 2XJ7A 4JRXD 1YEGH 1AR1C 4XNUH 1SHMA 1E4WH 1AO7E 2GEEA 1FDLH 4UILH 2CO6B 3MV8D 3QEQD 1F00I 5D72H 1TCRB 5EBMA 4MJ6B 5KS9E 3KPQA 1RZKL 4PGEA 3T8XB 1KR1A 1ZWIA 2WINA 4I77H 5BXTA 4PJBB 1U95A 2W91A 3T1FB 3H3BC 2D24A 1FBIH 3K74B 1YN7B 1R7OA 2ED8A 4R4BA 3OB0H 1W8OA 3PHOB 5FKAB 4FFYL 3B9KD 5D96C 4M9PA 1JGIA 1BWWA 2O9RA 1NPUA 1ZS8B 3P4NB 5ITFB 1IGFH 2VOTA 4NJ9L 4Y8DC 5C70A 5HOSA 3WDHA 2QLYA 1W1YA 2H26B 1J5OH 4YHNB 3MKKA 3WKZA 2V9TA 1HILB 3WFZA 3DX3A 1L6ZA 3EO0B 4YIQA 2CJUH 4H1LB 4DN4H 1A0QH 1NBYB 2BHZA 4OQ1A 3O4LA 3TBVB 4UT7H 3MLWL 3O9WC 4K94C 1ISYA 2D3VA 4JKPL 3RWCB 4XNYL 3WIIL 5JBEA 1MRFH 3FQXB 3BPNC 5HYSG 5IQ9B 5HI3D 3LRLA 5I66A 1DLFH 9CGTA 5CSZB 1UM4H 3T09A 5C8JA 2OX5A 5I71B 1XC6A 4GMSL 1OTSD 3QUZB 1JWUB 4Q2ZB 5DEGB 3E3QE 5E6ID 4BSWA 3BKYL 4M7LL 2XUCA 3CZ8A 3O11A 2R2CA 4Y2DB 5K9OB 3PJSA 4KH2A 1KLGB 5D9MA 3VMPA 4EVNB 5LWYH 3Q6GL 4MMXC 3HUJE 4L4VB 4FFZL 4FQXC 1QBLL 4YHMH 3QHNA 3RI5K 4ZTPH 4Z2JA 4KK5D 3S4SA 1F4YH 1LD9A 1QOKA 1R24B 1BBJA 3EDFA 1ITXA 1W72A 4PJ7F 3AUVA 5M95B 1FH7A 5FFLA 2YA0A 4TQEL 2XRAL 4KJWD 2Q8BL 1O0VA 3KHQA 3AIUA 1EHLH 4NC1E 3MV8A 3QEQA 4UT9H 1BGAA 3TCLB 2F58L 1OGAE 1QFOA 1JD7A 3O41A 5IMOA 3F12A 1ZB5A 4I9WE 4JQVC 4GH7B 3MJ8A 1EMTH 4PJGA 5LCVH 2GTWB 2OJEA 3EO0A 3VMNA 3TO4D 5I76B 4D8PA 1I7TB 3QOKA 3MNWB 5SV4A 4YHPA 1F8TL 5CGMA 4NSBA 4WRLA 4LLMA 1KJ3L 1I1YA 1HL8A 4RQQB 5DDHB 1KB5H 5F9OL 1UKOA 3UZVB 2Q86A 5INDB 1UB5B 2VLKD 5GGRA 3WHE0 4EI6A 5KBNC 4QTHA 1TZIA 3S5LA 3IJSB 3TN0C 2DSUA 4MJ5A 3REWB 5E4EB 4RWYL 1IQWL 3C5JA 2VX7A 1UD4A 4C7FA 5FM4A 3RWDB 3E8UH 4MXWH 4N1EA 5CJOH 1LO3L 2FSEA 3P11L 1C92A 1ODZA 3S5ZA 1REIA 2XQBL 3BKMH 2Z4QB 4K68A 1S5HA 1UR8A 4IPNB 2I9TB 2LTQC 1GPOL 1OVZA 2VABB 3VWJA 1AFVL 2DQGH 5MERA 4ODSL 1TQTA 1NAMA 3O4OB 5DUMH 4D6EA 3U30B 1K6QH 3LKPA 3BEVB 4OCLC 2QADD 3J8F7 5FM5O 4PV9A 4L4VA 1NCWL 4JFFB 4HUUB 3S4SB 1V3MA 4TSCL 2FD6L 2Z8SA 3KPOA 5FA3B 2EDOA 2FL5A 4L8DA 3TF7C 3MRBA 1ND0A 4S10A 1NUGA 4JM2D 1PKQA 2CRZA 4KZDL 1PIFA 3FO9A 4F79A 2P5WB 4OJFL 4P2CG 5D2NB 4EIGB 5HHMD 1E4XH 1LO5B 5FA4A 5FGBA 3WEMA 5C0BD 2EYSB 1QZ1A 5DI8B 1MIEL 3NN8A 1ZEAL 2KL6A 4OCSL 3BWAB 4WFHE 1PX3A 4QRUA 3UTOA 3CZFB 5ITBH 1QYGH 2H9GB 1GAFH 3ULVD 1RZJL 3MCLL 4LSTH 2N7AA 1FL5B 1ULVA 2GHWB 1E0WA 4LLMB 2HN7A 3KPSE 2RGMA 2E9WA 1FH9A 5D8JL 4RQQA 5DDHA 1HWGB 1U2HA 3SDCA 2Q86B 3ES6B 1JHLH 3WUZA 4EIZC 4GQ9L 4JKPH 4NQSA 3VFGH 4DKDC 1OSEA 1P1ZB 3K8MA 1QI5A 5MP6H 3OJDB 4M6AA 3WNMA 4RCAA 4BZ1H 1VEPA 2UWEA 1QVOA 3UPCA 4LYRA 4P23C 1RURH 3G08A 2FJGB 1L7IH 2D2OA 5EOCH 1MVYA 1MCQA 2ITCA 3NAAH 5FDWA 3EJPA 3GNPA 4C83B 2VZSA 3MLTA 1BPVA 2F7PA 4WW2B 1KELL 1V0KA 4KRLB 1T7VA 4X9HA 4MD4A 5T3XL 4Y4HA 5E8OA 2CHNA 5DK0A 4M7KL 4NDMA 1IEBA 3D4YA 3MRBB 3ZJKA 1LEGB 2X4NA 1GQKA 2VQ1A 3GXNA 3V52H 3PTMA 5IJKA 2VITA 1IC4L 5T1MA 1AIFA 1RHFA 2DWDA 2XNAA 4PJ7A 4XC1H 3DROB 5E9DB 2FZ3A 4RDQF 1G1CA 1EHAA 1CU4L 2BY3A 4LEOB 1VERA 1A64A 5DEZA 2D3LA 3QFJA 1HKIA 1YY8A 4Q7DA 2ZCHH 2HTKC 4LSSH 2JIXD 3C08H 1DN2A 4WO4A 2FEEI 4XX1G 4B50A 3FQTB 4J27A 2FX7L 2ZOLA 4U1GB 2XVKA 4LGPB 4A6YB 3QRFM 4JL1A 1DQJB 4FTVB 3P0GB 4DKAA 5EPMB 4PMYA 3ULUD 2WP3T 4K55A 1G94A 1NEUA 1BJMA 4NT6A 1UJ3A 5HYQB 2QQKH 3BDYL 3BWAA 3ES6A 5I8EB 3VX1A 4S1DC 1C8YA 1G1YA 4ALAL 1IC7H 4OV6F 5IT2H 1MCRA 1EBPA 2QMJA 5D7LD 4LCCB 1Z9MA 5FHBH 4XHQA 2HN7B 2XVGA 3A5VA 4LVOC 4O5LL 4POZC 1V6VA 1J86A 1T1XA 3UCQA 3MV01 4HAFA 3RUGB 1LLOA 2R1YA 1DQMH 3BI9X 3DHMA 1UM5L 4RAVA 3ESVF 4P59L 5BRPA 5D1ZA 1JRHI 1HKJA 2EDJA 1CG9B 2OP4H 5E1AB 3NFSH 2YD2A 1XFPA 3HG1A 3U0WL 5FYJE 2FBOJ 4WV1C 2Z31A 5CHNA 4QRPE 4HUKB 5A2CA 4M1GL 4O9HL 5E8NB 5IEHB 1SYTA 4ZXBD 1G9NC 1M7DB 3DROA 3NSNA 1KTDB 3CFEB 3TBWB 4EE9A 5D93C 2OCFD 1YJDL 2GSGA 5DMJB 2A83B 3OAZK 4J6RH 1MEXL 2FE0A 4HWNA 2LFGA 4G6JH 4WO4B 4Y8AA 1U8MB 4F7CB 3DBXB 2IEPA 4XGZA 3SE4C 4RGNE 1DQJA 1I9RL 1J1XL 3QDJE 2NW2A 4LQFH 2VXTL 1U8QB 3FAWA 1LMKA 3OAUH 2ZKHH 4LDOB 2CIKB 3ZDYF 4MLIA 1C3FA 2QQNH 3QFJB 3VGGA 5HJ3B 3GSNA 3ZDXE 3QCVL 3GMNB 1MCWM 1L7IL 3UTSD 4M1DH 5BRZD 3H54A 4P49A 4HPHA 4HWEL 5I1KL 4F9DA 1GC1L 2VH5L 5JW5B 5DSCA 4U31A 3TJEL 2D4FA 1R8LA 2X1WL 3O6KL 3BUTA 1MIML 4IHOA 4HULB 2XN0A 4NO5A 3JWDL 4HIEB 4RMRA 4RRPG 3L1OL 2G5RA 2HVKB 5KVGH 5C92A 4XCNB 1U8IB 1RK1B 2J1KA 4HS6B 5BROA 1W9BM 5AYIA 1QBMH 1LQ0A 1G7LB 3LMJH 1A7QH 4PD4K 3EMQA 3V52L 5ELIA 5DWUL 5CEZD 2I26N 4NQDE 1WBYA 3RWEB 1H4PA 5J13C 4XZUB 2E9JA 5CEYB 4PP2B 3PGFL 2XPGB 4X5XA 4XI5C 3FT2A 3WO4C 3OR7B 4OCNC 1DL7L 3WQ4A 4XP6H 1EBAA 5C2BH 3G6AB 4PJEA 3MGOA 4FQCL 2DIEA 5ESQA 3X17A 1R3JA 2CMRL 3CXHJ 3BSZH 4LCIH 2HJFA 2GDUA 5DT7A 4PTUB 5FYKH 3AC0A 3OGVA 4OI8A 1JK8A 5HHOA 4DWSB 4K8RD 3L4WA 1A9BA 1U8QA 5IMMB 4WK9A 5GRVK 2J8FA 1KCLA 1VFBA 5EO1B 3TIDA 1NL0L 5DJXB 1A9EB 1UJ3C 4ACPA 3GSNB 3TA3C 1AGFA 1CK0L 3BQUC 1RPKA 3N17A 4AQOA 4HKJB 4JDVB 2B7DT 3FO0H 4GXPA 3N85L 5IG7B 3SCMD 1RMFH 4JANB 4PMXA 3AU1A 5HYJE 4NNXA 2VLJE 3GRWA 3L4YA 5F89B 1YNTA 3LRKA 1F3DH 4HIEA 3V6OE 4JIEA 2C7UB 5AC4A 3O6LH 5E94B 3IJ9A 1BFOB 5JQ6H 1V0MA 1S7QA 2GJJA 4Z78B 1A02N 3CUIA 3LQZB 2VISA 3RM9A 2A6JB 3PWPE 1UA6H 3NZ8A 5A8PA 4M6OL 4JFZH 3B2UC 3WIHA 3VXOA 1I8LC 1YN7A 1GJWA 4KUCF 4HS3B 4M5ZL 5C0NC 5EIIA 3DHUA 4PTVA 5ALCH 1GOHA 3AY4C 1PJ9A 3A24A 3SUTA 1J7VR 4W8BA 1C8QA 2NX5B 1L0QA 4ISVB 2BVTA 3DLQR 4QHUB 5IOPB 4JHAH 2DL9A 3SKUD 4ZUTA 4AD2A 5IROC 3CLFH 3HMCA 4JPKL 3IGAA 3MLPA 2AEQH 1CFVL 1HXMB 1MFCL 3PWUA 5FXCH 2J5LC 4PG2A 2W9LA 1R3JB 4F9LA 1KXVC 3MLXL 1N8ZB 4O00A 3RL2A 4GI9A 4DKEH 2OBGA 4Y5XB 5I1GH 1UWEH 1EVUA 1PG7H 3ARBD 2R69H 5LGHH 1OAQH 5HHPA 32C2B 5E5MB 4YHML 2JIWA 5MEQA 3L4XA 1VHPA 1NGXB 3U2SA 5D8WA 1U6AH 4FZ8L 2ZP0T 1CQKA 2VDRL 4KKNA 1VADA 1JYVA 5FUCE 3NSXA 3O11B 5BV7L 4JY6B 1I8LA 4FP8H 4FNRA 2DBLH 1CTOA 1UM6L 5J0BA 3Q6FB 3V4UH 1UHVA 3QHOA 4IDJL 3QXDB 1FZKA 4E0RA 4M24A 3RNKA 4IS6A 1P69B 5JIHA 1OWQA 2DQFB 1QQDA 1HWWA 1A1OA 4JFDE 4M48L 5GHWL 1TVPA 1IILE 5FKYA 5HGBA 4RSVA 1VA9A 1K3IA 5L2KB 4CD4A 1WJ3A 4X6CF 3U4EA 4KWUA 5GGQL 1DN0A 3ZJ6A 4P2RA 2EDLA 4U6YA 4ML4A 2X4QA 1GUVA 5T5FH 2XZQL 1NMAH 1H15B 1U8NB 1JZ4A 4U1NB 4L4TB 1F6FB 3O8XA 3JZ7A 5D2LE 5HGDB 3CK0H 4PJGB 4ISVA 1Q9OB 4EDWL 4I5BB 2PF0A 1T3FB 2VDKH 4YHPB 3VFMB 2AK4B 3IGAB 2EIBA 3BKML 2XWTA 4R0LB 3QCVH 1E6QM 1K8DB 3G04A 4L3CB 1I1FB 1NANH 5J9PB 2CRMA 3D9AH 1H8NA 1OB1B 1H9VA 1MCKA 5DQDH 2HKFL 1KBGL 4M6NL 2XFYA 2BJML 4KMQA 2X09A 3G5ZA 5D1ZC 1KG0A 3WUWB 2BVDA 3MXVL 4Z76B 4GRLD 1Q0XL 4BFIB 3SUVA 3V5HA 3GJFH 5DJ2B 3H42L 2C1OA 2NXZD 1N7ML 1AGEB 4PJ9A 4CD5A 1FGVH 1FO0A 4YK4C 2EIZA 1FZKB 4WI4A 3G9AB 4U1SB 3FB7A 3K81A 4P9HH 1L9MA 5A2KH 2I9TA 3VI4E 4Y5YB 5DEFA 3C8HA 2YS4A 3QYCA 4JFXB 2BNQE 4YPJA 2DKMA 4N8PA 4QNPF 1JAKA 2X89D 2DPEA 3M7SA 5A16B 1E9LA 5ISZE 4G9FE 1UCTA 3AIVA 5F8RC 4JFOA 3WXWL 5DQ9A 1WE5A 3PV7A 4O58L 4IM4A 1ZA6A 4IS6B 4N8CL 4HUUA 2E3ZA 4JZOA 2AJSL 1XGPB 4TPRL 1N4XL 1RJZB 3KVQA 4KDVA 3GHBH 4KAQL 3S3JA 3HAEA 2C3VB 1I4FA 1CFSB 1LK3H 3HUJF 5FO8B 3WIJA 4WI5A 2O9PA 2YPVL 3GGWA 2OK0L 5HHVH 5AY7A 4DUWA 4PRNB 3WS6C 3WD4A 4IRSA 4JY4A 3RU8L 5CZVH 1KJ2H 3ULUE 1GGCL 2WWCA 4LYQA 1HTYA 1Q9OA 3WUWA 1AMYA 4GQPH 3GBEA 1FNEB 5IV2A 3W25A 3QBTB 3UC0L 3D2UD 4NZTL 2QQLH 4F8TA 3QCUH 1FP8A 4GFTB 3OPZH 2DSWA 4UUJB 5D7LE 1FNHA 2VVNA 5E2WH 3O2WH 1F90L 3IVKA 2WMHA 3MV7E 5KN5B 1FNLA 3AMKA 3QFDA 3U0TB 3L3HB 3FTGA 2I5YH 3JUYA 5TGBB 4M56A 1KCRH 1KB5A 3EYVA 4P3DB 4P2OC 5FYJD 3THML 1OD9A 1C5BH 5C0CE 4NQCE 2CKBL 1FRGH 1UXWA 3EDEA 1IM9B 1NGYB 3JVGA 3ZL4H 2EC9T 5FYKD 5C6TH 2D0HA 1N64H 3FO2A 1ZT1B 2V5RA 5KVEL 1HVQA 5DEFB 1EXUA 1G9ML 1H3UA 5D2NC 4KPHL 3O6AA 4ZFGH 1EHLL 5EBGA 3WUEA 3P77B 1I4FB 3QXVA 3GBMH 5I1GL 2X89A 2F5BH 3WE6A 1KCVL 1ORQA 3L5JA 3FQRB 5EZIH 3UAJC 5K59E 5KZ6A 1QI3A 5MEPB 2A6IB 4P5TB 1R5IB 3BJ91 4EI5D 4XP6L 5IBTL 5C2BL 1G7HA 4HHAB 3BESR 2C3VA 4O2FA 2FYYA 1YY8B 4HOXA 4UFKA 3TA9A 2Z35B 3T2NH 1HCFX 3B43A 2D73A 1LG2A 4WV1A 3BVUA 3VFRB 3IU3B 3VDCA 4KUZH 4X7EC 3ZJ7A 5DS8B 1KB9K 3TVMA 5AD0B 4KJPC 1UZ4A 3T3PF 4MDOA 4JM4H 1GGTA 3QHFL 5I9QC 1CDUA 1T6VN 3U0TA 2AXFB 1UM6H 3I6GA 2HMID 1JV5B 2NY4B 5CQ1A 4LCCA 4AEHH 1RUQL 3GJFK 5F21B 3RWFA 3FTGB 4P7LA 4NO3A 4PJFA 1ZHLA 2UVFA 4RA3A 5GQBA 1KB5B 1TETH 3T0VA 5KN5A 1LK2B 2WBJB 4OGXH 5SX5H 2AEPH 3VH8A 1V08A 1NWSA 1MNUL 5JIWA 3OKLB 5KTEH 4GRWF 1CWVA 4PB9L 1OIFA 2VDPH 1ZLVK 2GITA 4LQFL 3IJHA 3MUAA 3KJ4B 1IEHA 2XWEA 1INEH 4PJEF 4AENA 4B53A 2DLIA 5D70H 1T6WA 4HUWB 1T1YA 4JEGB 3VA6A 3M6DA 5CGYD 3VWKB 3EOTL 3C6SB 1V3LA 4CU8A 5DWUH 1BQSA 4P5TA 1MHCB 4U6XA 5F9WC 5CSUA 4QY8B 4AEIL 3IJYB 4LP4A 1PKQB 4WI3A 3F5KA 2J4WL 4N5EC 1JL8A 4TTDD 3TT3L 3GNRA 1HXYB 4X0KB 3TVMB 3AYSA 3BW9A 4NBYB 1R5IA 2UWEF 4NRYA 2JEPA 3O4LE 2CPUA 2D7QA 1CGWA 5DT5A 4PP1D 1JRHL 2VR5A 3I3DA 1BVNP 3OAYK 3SUSA 1HI6A 4WJXA 1KJ3H 3MRCB 2K3TA 1CD0A 3GIVB 2XTJD 1PAMA 4KK5C 4AM0B 1QVOB 4O51A 5T1KA 5JW4R 4AT6A 3CUJA 3SDCB 3GO1L 4N0UB 1LK2A 2WBJA 1R46A 2H2PC 1EDTA 2OR8A 5DQJA 4RBPH 5JO5B 4JO3H 5TE7L 3VWJD 2DAVA 3SDXE 4RFOL 1QBAA 4NO3B 4BH7A 2D03L 3SO3C 4XZUA 1KFWA 1LWRA 1BF2A 1RUKH 3EDDA 3MLRL 4ZS7H 3SDAA 4AENB 3SUUA 3OGRA 3GMPB 3VFTA 4PB9H 4D0BB 5TE6L 1KQYA 2WIIB 1QHOA 2GAZA 4JM2A 1SBSL 3WS3A 1E0XA 2SEBA 1J18A 2ZSWA 5B39A 4TSCH 3W37A 3DSFH 3TN0D 4L8SA 5EZJB 4OD1H 4X0KA 4GQ9H 2CEQA 4MDIB 4TNVK 4PJ5E 4Q9QL 1NP2A 5CBEA 1D5MB 5CXPA 3WDIA 4X80H 1M01A 5C9JA 3S36L 4I2XA 3TV3L 2EXWC 5IHUL 4UV4L 5K59F 1E72M 5ABFA 2JCCB 1JNLL 4QRRE 3FOLB 4L5FH 4GW4A 4EJ1C 1J0IA 3ZDZF 4NFCA 2B2XL 3D39D 4KK6D 2NMSA 3KL0A 1KNOA 4Q22A 2ZJSH 4P3CL 1NFDF 3PUCA 1BZQK 2JFEX 1QHZA 1C1EL 4J2XA 2DMKA 1E6PA 1KACB 1BFOA 4QGTA 4AM0A 4JHZA 1A14H 3TN0A 5D70L 2EDNA 4YGVB 3TJHC 4H8UA 2AXJA 3PV6B 4NPYB 1OAXH 1NDMB 2H6PB 3BE1H 2CLRB 4WWKC 2YLLA 2Y9RT 4PGBA 5BO1H 5A3HA 3V5KA 2A3AA 4JFEA 5JNYA 3ZKND 4F33B 2GK1A 4YDVB 3HG1B 4WI7A 4Y4KC 5JUEL 3VGAC 2J7EA 3BAEH 1F6AA 4XBGB 3WH9A 4BH7B 5DRWB 3GYCA 2NX5A 4EANA 2SEBB 1BIIA 2ATKB 3V9FA 4XP9L 3U4AA 2G3MA 4KROC 2XPKA 2OYPA 3KYKL 4N0RA 3NDYA 3LS5H 4MA1C 5E2VH 5CIPA 1QLFA 2C4XA 1AY1H 1FH5L 1TFHA 3KPSB 2BC4A 1N8ZA 5HJ3A 1L6XA 4UU9B 2JALA 4UT7L 3RX5A 5BOZG 1FCCA 3O6LL 2XKNA 1P84K 4G43B 2J7LA 4M61A 4NZDA 2CXGA 4KRTA 3DUSA 1CL7H 4UIMB 3T04D 2PWDA 2ADGB 4JDTL 3RKDD 1KCKA 3N9GH 2EEAA 1IBGL 3SE9H 1VJZA 2XVLA 3FOLA 1U8PB 4DOHB 5KSAB 4LCWD 1KXQA 2IQAA 5HGHB 4MJ6A 1NDMA 2H6PA 1HP5A 1GRWA 1TQCC 5ICZA 3KWWB 1Q9KA 1XF4B 2RB8A 3EOTH 1T2XA 4HD9A 4QOKE 5CJBA 3LKSA 1X5ZA 4TQEH 2PXYA 1Y7VA 3H53A 2YK1H 2WC4A 3ZDZE 4IMKC 4W6XB 3SEPA 3VRLE 3MYJA 2EEDA 4PTUA 4PYSA 5EU3B 3HB3C 1XF5A 3FJTA 1UWQA 1CT8A 1T22B 4Q9QH 5A8OA 3CLEL 7FABL 4HOWA 4LSPH 4WU5A 1ZBKA 4HS8L 5BXFA 1QPKA 4E41B 4OCWL 3VOCA 5DUBB 4H1LH 3QZWA 4XP9H 2VLMD 3MUZ1 1OTTD 2HTLD 1BGXH 3MROA 5EU6A 1A3HA 5I5RA 2AK4A 4GRMA 2PO6C 3ZKMC 4R0LA 4QOKB 3UJJL 2NLJB 2BOBB 1P4LB 2DWEA 4PJAB 1EAPA 3W9DA 3WD5H 1HNYA 5I9QB 1FL3A 4Y5VA 3WJLC 5GNZA 1IAIM 2K7QA 8FABB 4U4BA 2OK0H 3HG1E 4GKZA 4JE4B 2BRRL 4UT6L 3MV7D 4E9LA 5C9KA 1LE5B 1RZ7H 3VXTB 1HSAB 3L4TA 1N59B 1H2JA 2WSPA 2HISA 2WLYA 5F89A 1FL6A 1N4XH 1Y18B 3VGHA 4EVNA 3EYSH 4HWBL 3U9PH 2F7OA 4XCYB 4IOIA 5GJTL 1RZ8B 4ZXBC 4P5TC 3BH8B 4R97C 2PR4L 1U8PA 4OGAC 5FYJL 1WFUA 2ZNXA 2L0DA 4LLYB 4LVHC 1MW1A 4WHCA 4FG6D 3BN9C 3EJSA 4RZCA 3RWJB 3EZJB 1L4IA 3E6HA 2CK0L 3AXLA 3BP6B 4PRID 4R3SA 4XCEA 3FXYA 5IFPA 3U79A 5JDSA 1FA2A 5GSRA 5IM7B 2OLHA 1W0WB 4MB4A 4NOBA 3W39B 1UQSA 4PRBA 2XN9E 1ZLWH 1V05A 3GHEL 4KZDH 4XXCC 2F8QA 2NY4C 3D3VB 4Y16D 1ADQH 4ODVL 5EUKA 2MPAH 5J6HB 3ZT7A 1G7MB 3QQNA 3G9VA 5BVJB 3ZKXC 4MQXC 4B7IA 4M7LH 1YEHH 3QQ4A 4OFIA 2BCKA 5JBFA 1UWIA 4U6VH 5INDA 3MV9E 4XX6A 3B9KC 2M2DA 5H94A 2BVOA 4ONFL 5GGRB 5E03A 4DW2L 5DJZB 5JHDA 1JGEB 3NIDF 3ZSSA 4PB0L 4L8CB 2QEJA 4ODSH 1GZJA 3QNZA 4OOZA 3VXTA 4CD7A 4PGCB 2KPNA 3EFFB 2DQDL 4FQXB 1T5XB 3TFKC 3AGVA 5JMRA 4KXZH 2YJQA 1OGAB 3SDCC 3NIFF 2FGWH 4NOFA 4Z7UE 3PWLA 4FHBD 3QFDB 2VT0A 2WXDM 4LSVL 4RL3A 3APGA 1UA3A 5C09B 2E9MA 2BFGA 1DDHA 1IAIL 2G60H 4LLQB 2X7LB 3PZIA 1A7RH 3GHBL 1I3RA 4H04A 1K4DA 2IG2H 2J7DA 3D0VA 3QXDA 1A4JA 4AMKH 1DQQA 2NT0A 5IWLA 3U7WL 5EU5B 2DQFA 1N6VA 3LY6A 1KCSL 4DN3L 4B9YA 3QDGE 5KAQG 3FQWA 5IR1A 1OOAA 5HGBB 5BV7C 3JWNC 4KRUA 1W9PA 1X4XA 5A6KA 4PJ5A 3UBXG 5F7EH 2GK2A 5DGQA 2LTQB 3B5GA 3C6LA 3IAPA 3SCMC 1IL1B 1C16B 1MREH 1ZSDA 1KGCD 3MCG1 5F7DB 5DD5H 3U36B 3VFOA 2CKNA 3OL2A 2W60B 5FGSA 2V7NA 3ABZA 5GRVL 1HILA 1LL4A 4GQQA