3VGBA

Crystal structure of glycosyltrehalose trehalohydrolase (gthase) from sulfolobus solfataricus km1
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
550
structure length
550
Chain Sequence
GNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 187
structure length 550
sequence length 550
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgbA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgbA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgbA02
5KVFL 1T22A 2AQ3A 4M48L 3U36A 8CGTA 4KDVA 2JB6B 3HHRB 2YKKA 4NXSA 5SX4H 4XPGH 1VFBA 4U3AA 5ANMB 3MMUA 2Q8AH 4MWFA 1KWKA 3RZWA 4AZCA 1KEML 1T0MB 4A6YH 5I5RA 2GT9B 1EXUB 3RVWD 4R2GB 5A69A 4Z2KA 1D5MB 4FZEL 3B9KA 1FFOB 4M43L 1QSFA 5MHSE 2J5LB 3OX8B 4HKJA 4ATWA 2IFFL 4P46B 4HWZB 2JCCE 1KJMB 1MVUB 4XAWL 3W5NA 1MFBL 5C0JB 4RNRB 1FL6B 1SBSL 4HJGA 4R90L 3D3VD 4LKXB 1W1TA 4JRXB 1QBLH 2KBGA 3KJ6L 3MV7D 4IOIA 3PTMA 2Y06L 5IBTH 4W7VA 4U0RB 3P9LA 4KJPD 4DN4L 1JPST 5GGTH 3O45A 1KLGA 1NOUA 4KPHL 1CVRA 1GHFH 4EQ3A 3EJJX 5C8JA 1NEZG 1WSST 4K2UH 4HZAA 2X1QA 4J12A 1DQJB 1V5JA 1P1ZA 1P7KA 3IDJA 5IKCA 5ISZE 1MCJA 2ZXAA 4GW1A 5ADPH 4IS6B 4NWTL 2APVA 3IU4H 4BQCA 3NIGF 4OF7A 1KEGH 5IBUB 3LS4L 1TVHA 3H6JA 4BSWB 1K5NA 3FRPA 2HKHH 1A9EA 2B1AH 4KMLB 4JQXA 3RWIB 4BH8B 4HUWA 3ZYJA 1WAAE 1NCWL 1F4YH 2AJSL 3HR5B 5FGBA 1XYFA 3VFMB 3AU1B 4PLKC 5L8JB 4XZWA 1W1VA 4B53A 3K2UL 3SJVE 2A3CA 4LSDA 2J25A 5E5MB 3ARFA 2VDPL 2FL5A 3GMLA 1UEYA 3L95B 1UZ1A 3WBAA 1ZHNB 4KK6D 3EYVA 3BKMH 3NFPA 4YXHL 1ISVA 4A2MA 1WV7T 5JW4M 4PV9B 3B9KD 4TNWK 1HWWA 1QSFD 5C2BL 4WV1B 1QFUL 4BZYA 2B4CC 4ZDHB 3TBSB 4P7QA 4DCQB 1O5DT 4TSCH 3DX9B 3KYKH 1OAUH 5T33H 3F7PC 1YDPB 1N8ZB 5SX5H 1G9MH 2CLVA 4CD6A 3B2VL 5EA0H 4YR6A 5IT2H 2QQKL 1ZK9A 2J8UF 1KT2B 2HJFB 1RZ8A 4FQXB 4KI1A 3VG9B 4XMLL 4Y16A 4NUGL 2E27L 3OJ2C 4K94C 4LVOB 2ZNWA 2ICWA 4XNZC 1JZ3A 2GJ6A 5BWFA 1VEMA 1U8MB 1K4CB 2D7OA 2HVKB 2NTFA 3IDIB 4XPHL 1BX2A 1G6RL 2UZIH 5I8KH 1KB5L 5SWZE 3GKWL 5M95B 4ODSL 2Y2WA 2C8NA 4JFSA 1CFTA 4FFVC 3RKPA 3L4VA 5CKGA 3PXJA 3V6OC 3QXAB 3J8F7 2EDXA 4OZIB 1A5FH 1CFQB 3I02A 2WHMA 1R24A 3PDOB 5F3BA 3WFDL 2IH3B 3KPNA 2VXTH 5F96L 5DS8A 1OT2A 3ARFD 3IAGC 1F3DH 3VVGA 2V3GA 4ISVB 4OZ4A 1S5IL 2BS9A 3MLPA 5BRQA 3OLIA 1N5AA 2V6HA 1SYSA 3GIZH 5DT1H 3OKLB 4FXLA 3CSYA 5L8LB 3CK0L 2X42A 2WC4A 1D5IH 3FO0H 4YAQA 2FJHB 5J11C 4DKEL 1MLBB 5K33A 3OJDA 3RUGF 3CMGA 1DLFH 2CEQA 3SGJC 5KZ6A 4XI5D 1UXSB 3QCVH 2Q7YB 4RSVA 4ML4A 1S9YA 4NNYB 4K3HA 1V05A 4GG6B 4UQCA 3AISA 5FHAH 5MEQA 4Y16D 1LEIA 2GEEA 3WLBB 5AZEH 3VH8G 4L8SA 1F3DJ 3EJYC 3ZTNL 3BD5A 4AQOA 5KAQF 2GJ6D 2R56H 4YHGA 5I17B 3DIFA 5JA9A 1IQDB 1XGQB 1W9XA 2F74B 3AJ7A 2WCGA 2ZPKH 5BXRA 3NH7L 1C5DA 2BJML 1OARL 3RVXD 1ZHLA 1U8HB 2MHAB 2PW2B 4R0LA 5C0AE 4M1RA 1N7MH 2WMGA 3MXVL 4G6MH 2VZ1A 1T7WA 1UADC 2R23A 4U5IA 3C6LB 4K9EC 4MCYB 2Y1VA 4AIXA 1RZJC 1QW9A 5I1JH 1NMCC 2EXWD 4BQ6A 1FZJB 1I4FA 4Z7VF 1QNQA 4LHUB 2XWEA 1UWEH 4OIIH 1KTKE 5D4YA 1G6RB 2EO7A 5GRWA 1KB5B 1AKJB 1HZHH 1KTCA 2VCCA 2R2HB 2HLFD 4O58L 1Z9OA 1B90A 3E6HB 1NGPH 3O6LH 4CN4A 4NZUH 1AR2A 1FNSH 1K9FA 5IV2B 3GEWB 3CPLA 4K3DH 5GRVK 3HZMB 1XGUB 4BQBA 2EDOA 4MZ3A 1AO7B 2CHOA 1EHXA 3B6SA 4J3SA 2XWJA 5ENWA 4AD5A 1LE5B 4KROD 3G04A 4V2XA 4M1DL 3MNVA 2PO6A 4WUUE 1CZ1A 5I15L 3U6RB 3ULVE 3H3PH 1O7SA 3TN0C 2RFXA 3EDEA 1AI1L 4APQB 1Z3GL 3A22A 2V5YA 5C0IB 4UILH 1ODZA 1JJUA 1U8KA 3EYSL 5JIHA 4MZ2A 4MA8H 5I78A 3ULSA 3DXAB 3U48A 3CFKA 4D0CA 2W67A 4KQ4H 2WPGA 4MADA 4GXVL 4WU7B 3GSVB 3HG1A 3VFUA 3L3KB 1MJJA 2WBKA 1BM3H 1B1YA 4YHIA 2DQUH 3VNYA 4HJ0D 5ESVA 1I7UB 4HWEL 2JEPA 2NY7H 3VXUB 4CVUA 3W5MA 1RUPH 1PYWB 3IVKB 4Z7UA 2XFRA 3WDRA 3HE6C 3TBWB 1XD1A 1AQDA 3PV7A 1MRCL 4U1MB 1MH5B 1IEBB 4HF5L 1QRKA 3LD8B 3E8UL 4LBEB 3OB0K 3V52L 3QFJA 3LKSB 3M45A 1QG3A 4H25B 3WUWA 1BIIB 2YLLA 1VADB 1FFPB 3M07A 2PO6D 4LQ1A 4Z95L 2ZWZA 2B0SL 4PBGA 3LVEA 1FAIH 2ZG3A 1P7QB 1WIOA 1YECL 3OAUL 1XF2A 4UFHA 3V2AR 1CWVA 3HAEA 1DQQA 3VPLA 2MQCA 4WI5A 4X6EB 3MMEA 1KCVH 3KJ4B 4PRIB 5JORA 5HGGS 3CC1A 4RISL 1XZ0B 5H37H 2OSLB 4HT1L 4GIAA 3BVNB 4HGKC 4WFHE 5I1KL 2VCAA 5EU3B 3C8HA 4GQ9L 3ARXA 4XNYH 4JY6B 3HG1D 4P2OA 3VXQB 3GZKA 4X5LA 4XP1L 3GSOB 3ZJKA 4YHLH 3ZDXF 1EDGA 2PR4H 5FO9A 4KUCF 5E2JA 1MREH 3O3EB 3QFDB 1MRFL 5AAWA 4LSUL 4Y8AA 1OTSC 2BSSA 4M7ZC 4Y5XA 5H2BB 1R0AH 4ODTH 1U3HB 1EGJA 1T5XA 1U8IB 5B22A 5I74C 1I7RA 3IYLW 1BFVH 1MJUL 1CDIA 1JAEA 4XP9L 1EHNA 3VD3A 3BH9A 1II4E 3QFJD 1MCOH 5JMRA 4WWKC 4JCLA 3MRFB 3RBSA 5E4EC 3VIOA 2CH8A 3A5VA 2CESA 1E1EA 2P48B 4OD1H 3HU7A 3RZCA 3O6FA 1NFKA 4HKBA 3QJHB 1X44A 4ONOA 5DC4B 4YX2L 1QLFB 2YL8A 1PKOA 3GSQA 4GZIA 2VL5B 2BV9A 4MXQD 2Z1SA 3WJJC 2D73A 1MWAA 4JL2A 1UR0A 3VKKA 1YEDB 1U58B 4YDIL 3QI9A 2VZVA 4HS8H 2D7QA 4NFBA 5HHOA 4RWYL 3HZVB 4P2OD 1C1EH 4F7PA 2HLAA 3QR3A 3HMXA 3TH4T 1G7HA 1EO8L 1QFWM 3QHTC 2AXJA 3U1SH 4G7VL 1HK6A 1NUNB 5F71A 1JBJA 2P44B 3QUXA 3GH4A 4XGZB 2ERJB 1XF5B 3RWGA 4HEME 1M01A 5FA4B 1ZBCA 1HSBB 2XVGA 4FLOA 2G8ZA 2JK5A 3SOBL 1OAQH 5DHVB 3PZQA 5HYQB 1L7IH 1BPLB 2R15A 3FHQA 4FNRA 1XSKA 4GKOA 3HPLB 2OTUB 4UT9L 1A47A 3FAWA 3QXDB 2WQRA 5JDSB 3WV0A 3CFCH 2O5XH 3RZCD 3O6FD 4YFLF 4U6TA 2VRQA 3AOFA 3JTSA 3TYGL 4TVUA 1ZJBA 3GDBA 3FTGA 2Z92B 3T08A 1VBUA 4CD5A 1WCBB 2VDLL 4GQRA 5CPSA 1VA9A 2FJFA 2IEPA 2HJKB 1JCKA 3WELA 1Q9WB 4J4PA 1RJYB 4H2CA 3LMJH 3PZNA 3S3PA 3JV4A 1UHVA 3QI9D 2J74A 4P57A 3REWB 1LNUB 4J1UA 4R97C 2BHYA 4NCDA 5HHOD 5I8OL 3DC0A 4C7DA 2W9EL 3R06A 3O81A 1TNNA 3DX7B 2VLME 1R3IL 1UCBH 2DQCH 4IRJA 4B50A 4F58H 4U6VH 1KACB 3E2HC 2NY5C 3DETD 5DGRA 1YN7A 1EPFA 4GKZB 2EZ0D 4JLRA 4X8JB 5DD6A 2OW7A 3ALFA 4QDMA 1ACYH 3QUXD 1BZ7B 4KRMB 5FM8A 1UD8A 5E6YA 1PZ3A 1WC7B 1S7SA 4Z7VB 3GMPA 5DD0L 5E0QA 1ZHKB 1MCEA 3V0WH 2VR9A 3L3DB 2PYFA 4F7MB 4JVPA 2P46B 1DEDA 4L9LA 2IGTA 3QIWA 4XWOC 3TEUA 3VWKA 5ALBL 3PGCA 4U1KA 1FZOA 1T89A 2CGRH 3KYOA 3SURA 2EDLA 4LSQH 5CSZA 3SDDC 4LHQB 5CZKA 3RY6A 1LMKA 1RJCA 2NY2C 4WY7H 4HD9A 3L3HB 1XH2A 1KBBA 3D50A 5J9PB 2A2QT 3BKCL 4G8IB 1CICC 1FVEB 2G75A 1E3ZA 2X0YA 1UJ3B 4JREC 1MW1A 2AJ3A 2P8PA 3ZOAA 3UTSE 4J4PD 3PWJB 4LLVB 2FX7H 4ODUA 5DA4A 4RGOH 5FYJU 7A3HA 4C56A 4EI6B 1H0GA 4IMKA 4JFOB 1J8HB 1MW2A 4EUPG 1I9IH 3PDGA 4GRWF 4LPYA 4ZOCA 3GJEA 5SWQB 1Y6NR 3DO7B 1YY8B 3C6SA 4R26H 1YYMH 2J8HA 4MXWH 4IRJD 3ZE0F 1JFQH 3O3UN 3CFDA 3UCQA 3SQOL 3ZKMD 1TJGH 4XCFL 3LIZL 1CXIA 1XGYL 3SKOA 3K4ZA 1C08B 2NMSA 2EIDA 4DGVL 2VRJA 4NBXB 5IHUH 5IFTA 5E03A 3HJEA 4CMHB 4O2FA 5KS9A 1DBJH 4X6BA 5AG8A 1SEBA 4OD2B 4WFGE 4P7RA 3W53A 5C0BA 2XPKA 1OM0A 2HFEB 3NZ8A 3QIWD 2VAJA 4K8RD 3VWKD 1SZNA 4S1RH 4N9GA 4ZOBA 4AC1X 1KGCE 4PY7A 2EYSA 2YSSB 3PIQB 4LIQH 4NZFA 7CGTA 4YBQD 2C3HA 2H6PA 3MV9B 4IOFD 5C07E 2XSAA 1DN0A 1JWSB 1HHKB 4XHJC 2TAAA 2KZ1B 3TJHD 4E42A 2AW2A 5BRZE 3WNMA 3QR2A 5A2LH 4QCFA 2FGWH 2EDEA 1RIUH 2HKFH 3EJZC 5EO9A 4C56D 2B1HL 1DBAH 4EE9A 3LEYL 1YEHH 3DOSA 4KH2A 5DD5L 1ZWIA 4U1LA 3LV3B 4JZNB 5FYLL 1XGPB 1MCLA 1IMHC 2DSUA 1OGAA 3NCYP 4HOXA 2VXUH 1LK3L 3CLFH 5CWSB 3GXPA 4PJ7B 2ZZUT 4PJIB 3CHCA 3FB6A 4G5ZH 4G6AD 1H8OA 2DJUA 4G6KL 1W9UA 1Q6FA 2YK1L 4I3RH 1GGIH 3TNNA 2X4SA 1F97A 1KC5L 3L7FA 5AZ2L 4GXUN 2ENYA 4DUXA 1S9KC 1R8LA 3GJFB 1FZKA 5C0BD 1HJXA 4ORGA 4AZIA 1MF2L 4RFOL 5TQ2H 1IKFL 2MWCA 5IWLC 2I9TA 4MNLA 5CJQH 2MPAL 2XXCB 3WNLA 3UR8A 3UBXB 3ARDB 3LRMA 5SX5K 4PCSA 5D8JL 3L7EA 3V5DA 3BXNA 4KK9D 4HOZA 1B3YA 2W4XA 5KJRL 1DUZB 3SE4A 4KRNA 4HXAL 1HKKA 2VI0A 2A3EA 2IPKA 4X0VA 1AY1H 1IBGL 1RK1B 3LSOA 5C0DA 2R0LL 3OKEB 3DRQA 2H26A 1I7TA 1ITXA 4XX6A 2ZXQA 2FBJH 3EJTA 4DAGL 4OAWA 2A73B 2BFVH 3S4SG 4MD0B 4BH7B 3WSQH 3DHJA 1W72L 3MUGB 2H2PD 3DMMA 4L4JA 3RGVB 4C83A 3VD4A 1DQLH 2PBOA 1NANI 1WITA 2L0DA 5LYRA 3S5ZA 1NGZB 1E4XL 1JRHL 3GSRA 5BXFB 1OGAD 1OTUC 1KB9K 2ZCLL 3NIYA 3WDIA 4PSRA 3RKDD 4C59B 1AR1D 4UQ2A 1JGLH 4LVHC 3QQNA 3B9DA 4J3TA 3PWPB 3OV6A 4HC1L 4XPFL 2VQTA 2GW5A 3JWDL 1U93B 5GISL 3C08H 2OYLA 5I73B 3O0RL 2AK1L 3QULB 1WAWA 4XBEH 4PJ8C 3WYRA 4ONFH 2ICWJ 1YJDL 3QJFB 4EI5B 3MLWL 5CGTA 4QNPE 1S3KL 2YPVL 4QY8B 3BLKA 4LYPA 1YYLL 3TBVB 2XHYA 1TZGH 2AJXH 2P42B 4FQIL 4ZPTB 2P49B 2A9NL 3P4OA 4BFGA 5C70A 5DVNA 4M29A 3BUBA 2E0PA 4ZS7L 4PGDA 5MEPA 4U1NA 3ULVH 3H7BB 4JPKL 3OBAA 4Y5YA 5CD3B 4G8EA 1BYDA 1VGEL 4G9FE 4YN5A 5JW5A 4EUPH 3DMMD 1JHLL 3BQUA 3FQUB 3KPOB 1BD2A 3MNZA 3V95A 3ZJ8A 3G5VA 4MNGB 2OYPA 3QEUA 4XCNB 1R87A 2G3IA 1FJ1A 4F2MA 5F1OB 3S36H 1NFDB 3K8MA 2DLFH 1RPQA 1ZS8B 1B2WH 2P5EE 1V7NL 3X11B 2ZOKB 1W72B 4FFWC 3BEWB 3CZSA 3UTPE 2FGZA 5ITFB 1OY3B 4EXPX 1TNMA 2X05A 5M3WA 1FG9C 3VWJB 3HUJE 3V7AE 1IGCL 5K9KA 5DRXB 3VW3L 1J0ZA 1I8LC 1BQLL 2QQNL 3IGAB 4U2YA 2GHWB 2OJEB 4OZGB 2DMBA 1AD0B 2J7LA 2QSCL 2DIAA 1GAFH 1XYZA 1TETH 2WCAA 1OAYH 3GMQB 3MOAH 4KKNA 3ZL4L 4WIWA 3W2DL 5KOVC 2NXZC 2VDMH 5CXPA 3BQUD 4TVCA 1BD2D 1BFSA 2XKUA 3FQTA 3Q6GL 4Y4HB 4TX6A 4U1IB 4P2RA 4U1JA 5D96C 3X12B 2CIKA 2YPKA 4F80A 4AT6B 4OCRL 1JZ4A 4HGWB 4S1QL 2ZX7A 4YGVB 5CZXD 3MROA 3WD4A 1GPFA 3WXVL 4NN7C 3N1MC 4K55A 2GJPA 3CC5A 3GHBL 4JHAH 5CHNB 4M56A 1C93A 1PSKL 2XN9E 4NSBA 5DJYA 4GI8A 1NEZA 3P3YA 4W4NA 1F11B 3CDYA 3ET9F 1FO0H 2VDQH 2J77A 3MCKA 3QEQE 2VLLB 2G3JA 4Q9CA 5IOPA 1KSRA 3KR3L 3Q6FA 3QCUH 2FEEI 1JNLH 5HHPB 1LP9A 4M03A 1H15A 4Q2ZA 3QIBB 1L7TH 5CQ1A 1KLUB 2Y6SC 3PWUA 3MOQA 3HI6H 4BA8A 4G6FD 2ZNXA 2EEDA 3BUDA 1MSPA 4OLUL 5IMOA 1MFEH 2BNRE 2VRKA 5E08L 3WO4C 2FWOA 5IB4A 5DURB 2CKBH 2BZDA 4MX7A 1FP8A 1UVQB 3MX0A 3BSZL 3IAQA 3BN3B 3BESR 4XVSH 3O9WC 5I71C 1VJZA 3ORJA 5ADOH 1LGVA 1H3PH 1NBZB 4P2RD 5B39B 1RU9H 4JJHA 1QLRB 3SY0A 3M1BB 2NYYC 4PRPA 3IFPB 5E2UH 4AM0B 1X4XA 2RAMA 4GAFB 1SFSA 3CUPA 4RE3A 1KFAH 3I9GL 1JZ6A 3EO0A 5CKAA 2EYTA 1J5OL 3FO1A 5DJ2A 4HCRH 2JIXA 3G6DH 4OOZA 4WI8A 3MO1B 2FECL 1D5ZB 2Y5EA 3BUQA 5HHME 4M6OL 3SDYH 4JM2B 4MNKA 5CZVH 5I2IB 1E40A 1X5LA 3LRSB 5EULV 5DO2C 2HN7B 3O41A 1OP9A 4IIQC 3UZVB 2ZCHL 3L5WA 3F5KA 3AS0A 1DFBL 5EUKB 4HLZH 1MQKL 3AYSA 1NWSA 3H7LA 2DMCA 5E4IA 2H8PA 1BAFL 4JHWL 1E3XA 3SE3C 4AIZA 1ITBB 1IAIL 1EGJH 4TOYL 3BVVA 2XTJE 3D85B 3U0WL 3IRZA 5ID0A 3LPFA 1EA9C 1TVBB 3UTTB 1SJHB 1KOAA 1F4WL 3IXTB 1G1CA 2YD3A 1DLHA 2W65A 3Q2CA 3LRHA 1GIGL 4ZO7A 2JF1A 4IHOB 4PB0L 3BLBA 4HXBL 4HIIB 5JHDA 2BSRB 4P2QE 5D72L 4UFMA 1LHZA 5CSYA 1ODUA 3DUUA 2Y07H 4KKCC 4UTBH 5BZWB 2ITDA 4XB3A 4PRPD 2GCYA 1ZGLB 1AXTL 3D5HA 3OG6B 1KIPA 1XF4B 1FG2B 1Z5LB 1G0CA 4D6HA 1DUYA 4JFYB 4I0KA 4KJYA 5I1CH 4L9DA 4KDWA 3OHXA 1EZVY 2CDFA 3RY4A 2LTQC 5HD8D 5MP6L 3SCRA 2BHUA 1E28B 2JIXD 4M62H 4F33A 1K8DB 4E41A 2Y8VA 3N1FC 2CK0L 4PJHE 1P6AB 1AQHA 2WMIB 3K1KC 1J9YA 2NLJB 4YIQB 2CBVA 2WBGA 4JO1H 1CDHA 1YN6A 3BAKA 3DX3A 3MV8A 1EJOL 1CD8A 3OKOA 3IXAA 1EXPA 4HX1B 4GQQA 4PRHA 4JG1L 4PJ9A 1MRDH 2DAVA 3HZYA 4DKDC 3PWLA 4IRSB 4P4KB 4X6DB 1C90A 1UGNA 3MRLA 2Z4QA 4KQ3H 1TJIL 1TUXA 5DMGC 1MCQA 4KMTL 4G7YL 2FD6L 3MA9H 4PJXB 1QRNE 1V3LA 5TGBB 1FP5A 1FH5H 4LOUC 3U0PB 4UNIA 3GSNA 3TJEH 5JHDD 2DKSA 4Q9RH 2JJTC 4YZFE 4E5XB 5DK0B 3FZUC 1IGML 3U2SB 2NSXA 3H9SB 4FNLH 3MCLL 4JN2A 4Z2HA 1E27B 1UR1A 2PTVA 1K4DB 2Q6WB 1G0YR 2IANB 5EBLB 4OGXH 5L2JB 2D4DA 3EMQA 1HXMB 5D7LA 4NCC1 4GZJA 3WS3B 4M9PA 5DJDA 4OKVA 5DTFA 3T0EA 1QVBA 3TTOA 3L4TA 1UQZA 2XPGA 2NX5E 3F5WB 4KZEL 2R69L 4JDZA 2J6EH 4ZXLA 4TN9A 1BFNA 3JV6B 3VXME 2WC7A 2EDNA 5IVXB 4HK3J 4E41D 3B2UC 1GQKA 1R6VA 2DLGA 4PRBB 4U1SB 4I5BB 5FYKU 4UIKL 1H1NA 3DBXB 4ZFGL 5A8PA 3RIFF 5BXTA 4C4KO 4DVBB 4FF5A 3MV8D 4GRMA 5LGJB 3QUMA 4L8CA 2OWWA 1DE4A 4ORZC 3IFLL 4PRHD 4D6GA 1GHSA 1ED3A 4PJ9D 3GH5A 2A0LC 3V7AG 3VFOB 2P5WA 1QTYT 3Q3GB 4TNVF 3CJJA 2NNAB 2V9QA 5JIPA 3MLTB 2ICEB 2NXYC 4NUJA 1E55A 4ZXBB 5HY9A 5GZOD 4X5XB 2QEJA 3MRBB 4PRHE 4UFLA 1EEZA 3P9MA 3F12A 4LKCA 4P99A 4BK5A 1FLTX 1JI2A 1DTUA 3NCEB 2PWFA 3QNXA 4U3CA 32C2A 5KAQG 4MDJB 2Z8WC 4YO0A 3OB8A 1MCPH 3F6IA 5IB3B 1CD9B 5D7LD 4OM1L 4UDTA 4OLWH 3T0ED 2J8OA 1EHLL 3RO8A 3EAKA 1K8IB 4N8VG 1IGIH 4YEFA 4CVXA 5B38B 3BRDA 1C8PA 5D7IB 2AJZB 1WKYA 1NC2A 3WL9B 5CIPA 4Y4KA 1AGBA 1CDUA 3VIMA 3RBGA 2FJGB 1T03L 3H0TA 1CGWA 5KTEL 2Y7QA 1WF5A 4LU5L 4MNHB 3MRHA 3LN4A 3LB6C 3LRGA 3L3JA 1TZ7A 2PB1A 3AB0B 4XNUL 3MJ9A 3FFCA 2HVMA 5BXSA 4PP1D 5MEOA 1WWBX 1WZAA 3TOPA 1HTYA 2P5WD 4UU9A 1AIFB 2R1XA 4MS8C 5FO8B 3ARZA 2FR4B 4Z2LA 3OKNA 1GGBL 4M5ZL 1NCDL 3SCMA 4P9HC 3OKKB 4YWGL 2A6JB 4XMKL 1LILA 1D9KC 4PJ5A 2EPMX 2WSPA 1MYRA 4LARL 2ATKB 3SE9L 5ALCH 1JNJA 2VSDA 4RRPG 5HBFA 4JRYA 1E1FA 5CEYA 2NY6D 4NKOA 1DL7L 3IDNA 43CAA 4PSPA 4PP1C 3AREC 1NEUA 4NO5B 4Y19E 4M93B 3G6JA 1KV3A 4FP8L 1N0XH 4MD5A 1U8NA 3TBYB 2HFTA 5C9JA 5JO5A 3OAYH 4D0DB 2X4OB 4FNQA 4MAUH 1UQSB 4K68A 1VAHA 4O2EB 3T0XA 1QSEB 2G9HB 4BCEA 3RU8H 1BVKB 4LFHG 4PGEA 1I1AC 3GKZA 1NC2D 2X4QB 3F7VB 3KLAB 3MRGA 4EN3C 3KZSA 4Y4KD 2Z0BA 2EDDA 5F7HA 1INDH 2EDTA 4L3EA 1ZA3B 3LS5H 5I75C 3UEZA 4ZOEA 1QQDA 1UZ8B 2GAZB 1FHGA 2OI9C 2XZQH 3D69A 1P5UA 3DV4A 3QUZC 3Q1SL 2JEQA 4HWBH 4TUKL 3WFEH 3VO0A 1JUFA 3FFCD 2EH7H 4MNQA 4XC3H 3TT3H 1CXEA 1KGUA 1YPZB 3L4XA 1GJWA 3UX9B 4FQ1L 1U95A 1D5XB 4JZOB 3H2WA 4L3CB 5DDHA 4BJLA 1WPCA 3SCMD 4NJ9L 1BYBA 3FB5B 4PJ5D 2WBJA 1KN2L 2WIMA 1JVKA 2CRMA 4BKLA 4HFWB 4X83A 4JRYD 2I07A 1NCUA 2H32A 5CILL 1CPUA 2MANA 5FM4A 4CL7A 3EYOB 1J0IA 4MTVA 2YKLH 1NMAH 4MDOA 2Z9TA 4QF1A 4PJEE 1JN6A 5JZ7D 3I3EA 4X99B 4L4VE 1PX4A 2CUMA 4P5MA 3WD5H 3UTZB 3OA5A 3MRRA 5I1AB 5MENE 3GB7B 4Z2JA 1VKXA 1VEPA 4L3ED 1RHHA 3QDMB 5GRXG 4E0RA 1BJMA 5SWSB 3VI4E 1JGUL 2OQJA 4OCXL 1DBML 1J0KA 2BRRH 4N9OB 2PTUA 3T8XB 4B15A 1NSNL 3MUJA 1ADQA 2ADGB 3VXSB 3UCRA 1Q9OB 2W5FA 3WSUA 3KLDA 4MNQD 4Z7OE 5IB1A 1U6AH 4X6FA 3OGVA 3L3GA 4ZUVB 4JB9L 2DQEL 4OZFB 3DSFL 2Z35A 5ETUA 1S78D 2WLYA 1E4NA 2R0ZH 1PKQE 5JBFA 1OSPL 4NFCA 4GBXC 3VI3E 2YFNA 1EBAA 2APWA 2NY4D 2DJ4A 4WI7A 2IH1B 4P46C 2DKMA 2W9DH 4UDUA 4GSDL 3S34L 1M6OB 2WBJD 3BD3A 5D1XA 1IKNC 3RQ3A 3OXSB 3WIHH 1PZ5B 2YN5A 2XIDA 5F7DB 4MA1C 3TVMA 4DKAA 5CEZD 2ZOLB 3JSSA 3CDGB 1XCQA 4CMMB 5BJTA 4J8RA 3UTQB 4D9QE 2V3FA 3QPXL 4HPGA 3OGSA 4LPXA 4D9LL 4QWWC 3FB8A 2FB4L 5TE7L 5IFHH 3ULUF 2EAEA 3TCLB 5H8DA 3P73A 2J88L 5JNYA 4TOQA 4J6RL 4V1DB 5DMIH 4D3CL 3N9KA 5EBAA 1E71M 2EJ1A 2EIZA 3O3AB 3MLVH 3CH1A 2IMNA 3HLAA 4NO3B 5DRZB 5H35B 1OP5H 5GPRA 3UJIL 3A67H 1JZ7A 1ERNA 3C5JB 4OQTL 1FIEA 2X5PA 4B3KA 1YQVL 2LAAA 1A6UH 4I77L 4Z8FL 2VXSL 2AEPH 4LASL 4NGHL 2UZXB 2VDNH 4YE4L 5ESAA 3EYPA 2VXQH 5TE4H 1HHJB 1HI6A 5JXAH 1ZA6A 1AFVL 5IDIA 2BOBA 4JG0H 5FOBA 3D2UB 4OLXL 3AHXA 4OCYL 5HJ3A 1KPVA 5FUCE 4Z78B 1H11A 3MA7A 4KHTH 3NACH 4ZFZB 4Q6IC 4PJGA 2VUOA 4Z5RA 1E43A 5KVDH 2FATL 4I4WA 2ZUSA 3RTQB 1B4RA 5D1XD 3MRKA 4OZHB 4KAQL 4DOHB 2UY3A 1GYAA 3SGEI 3TVMD 3NCBB 2BNQB 4YC2C 5EZOL 3BZFA 3OR7B 1IC5L 2O61A 3I50H 1GOHA 1A6WH 3ELAT 2NY1C 4TNWF 3LKPA 1T6WA 3GI8H 4JR9L 4W68A 4DUVA 1WBZB 3T2NL 2XVKA 1HOCB 1E6ZA 4ZE4A 4NQEA 4QT5A 2PCPA 3SDXE 4N0UB 3GYCA 1ZT4A 1MCSA 3Q5TA 2D7MA 5GXBB 4I3SL 2UY5A 2CD0A 4OSUL 5EU6B 2VCBA 2EIBA 4OTXL 4PJDB 2EE6A 2QV4A 2APBA 1RH9A 4MDPA 1NCCL 1KJVB 3OKMB 5E2WH 4V28A 2DBJA 2F8VA 5KSBE 4WO4C 4LLAA 4UQEA 3N85L 3MSGA 5F9OH 4OF0A 4PYGA 1YNTB 2AAAA 3QDJE 3MOBH 2RGLA 3HC3H 1Q94B 1WCQA 3BDXA 1G7JB 5EUOF 5JDJA 2XIBA 3CZFA 2FHBA 3LQMA 1UOKA 2J7HA 3I3DA 5FYJD 3AXLB 3QXTA 4P9MH 1X5XA 5FUOL 4X7EC 4G6JH 5JHLL 4PLJC 2DM7A 3IJSB 3KNBB 3QZWG 4PJBF 2AAVA 5IROC 1I1WA 1X5HA 4WHTB 4R7DB 2Q8BL 4X4ME 3BDYL 2EO9A 4P3CH 1QKZH 1KXHA 4TUJB 5D7SL 1B3WA 3PHOA 4TPRL 4NQED 3JWOH 4DJMA 1HJUA 1NP0A 2D9QB 3D39E 4NQCB 1T2QH 5C0JA 3L4UA 5DFVD 2HVJA 3V6OA 3L9RA 4P49A 2E9WA 2CLZB 5I18L 2YZ8A 3BW9B 4LKXA 3V8CA 2ZUMA 4PLKD 1CIUA 3LKNB 3IS0X 1NGQL 1D2KA 3EJRA 1IM9A 2BCKA 3EO9H 4H20L 1TJHL 2L4OA 1EVTC 3WFCL 1CR9H 3HNVH 4K3EL 1Z9LA 4QRSB 1DQML 3SKMA 5DUMH 3R8QA 3C6LC 2RJMA 2VWEC 4S2SA 3DNKA 2E7LC 4P23C 4ZUTB 4IS6A 3MRJB 1MFDL 1DJSA 2JJSC 1S7UB 4FQPA 4J3WA 4PJFB 1KTBA 4ZSOA 4OGYH 3QEGL 2B5IC 2OJZH 5F88A 1OAXL 2BVEA 4K3GA 4BH8A 3SGJA 6FABH 1EFXA 3VJ6A 2VX5A 1RURH 3HR5A 3VFMA 4N0FA 2VXVH 1E73M 2ZKHH 4HUVB 4LLUA 4AMKL 3ULUL 1U41A 4LLMB 4QRQB 3D3VB 4LGRB 4F37K 1ZHNA 1OAZL 2IG2H 1VFAA 1QW8A 3SCPA 5AWNL 3MV7B 1LVEA 2VLJA 4KTEL 3HPJA 2A1WL 2OXGA 5ANME 1ZJAA 3D1MC 1A1OA 2P24A 4JO3H 2A6IA 3AROA 2AV7B 4FFVD 1CZ8H 4GQPH 3UO1L 3TGXA 4O5LL 1A7RH 1NUGA 4RBPH 2LU3A 1UM4H 5BO1L 4RA0C 3W11D 4JAMB 3S3JA 4RMSA 2VMFA 3BGFB 3MJ7A 3RVUC 3TNMA 5CLWA 4NZCA 4APQC 1RUMH 3TWCL 3VIGA 2X1XR 1DSFH 1IM9D 2WLZA 1T22B 4MLSA 2DF3A 1JDCA 3U4EA 4NI3A 1ZXQA 4XC1H 5LBSH 1HHIB 3L2LA 1VFBB 2OR9L 3GO1L 2V3DA 5HYEA 1E4LA 4OLYH 4MWFB 1YMMA 4JRXE 4Z7UF 2UWEF 5J13B 3NUKA 4AZCB 2AJVH 1JD9A 3SE8H 3QOMA 1GRWA 5DHXB 1CL7H 3VFRA 2PWHA 3B9KB 2FLBT 1QSFB 1EFXD 5IR1A 4HKJB 4UT7H 1V3MA 4NF7A 1NMBL 1JNNL 2R39A 2LU4A 1O7AA 3HE7C 5E6ZA 5HDQL 1F4XL 2R29L 1GGUA 4HJGB 1A1NA 2CDGB 3EJYD 5FKPA 5J56B 4O9HL 2X2JA 2B2XH 4N1HB 4IOIB 3WMCA 1N59A 4KWUA 3VUPA 2VLJD 3P9LB 1ZMYA 4QHLA 3MFFA 3TN0A 3O45B 1KLGB 4LLQA 3SDCC 3UERA 2W62A 5EOCL 2XT1B 5C8JB 2XTKA 5EZLA 4XVTL 1QNPA 1U9KA 1P1ZB 1P7KB 3IDJB 5IKCB 5LWYL 4GW1B 3VGBA 5IF0A 1EEQA 3LEXA 4X6CF 2GTZA 1XCTA 3ALWA 4NQUA 5IB2A 3O11A 1K5NB 1E6XM 1A9EB 5DJCA 4HUWB 5CJ5A 3A6CH 1PLGH 4P5KA 5GS0C 2A9MH 1J12A 3IT8D 4YDJA 1CD1A 2DT0A 2J7DA 3CSPA 3IDGB 3ZDYF 5CBAA 1CF8H 2DL9A 4JKLA 1YMMD 3ARFB 2FL5B 3GMLB 1BF2A 5DHYA 3EYVB 3NFPB 2VLRA 4NNPL 5BV7L 2IAMC 2A3AA 1T5WA 4OIFA 1A3LH 3B4NA 1U2CA 1X5JA 3OZ9H 2HH0H 2HYMA 4E2OA 4F9DA 2CLVB 3RPMA 1UXWA 4R6UA 3FO2A 5JPMA 4MA7L 4Z77B 2WMFA 4KRPD 1HHGA 1KB5A 1RZ8B 3HC0A 1AKJA 2E9BA 4OZIE 3BKJH 1HP5A 5JOFA 5ILTH 2HT3C 4Y16B 4G8GA 3TN0D 4OJFH 3O2VH 1PD6A 1EMTH 3BFOA 3VXRA 2ICWB 2GJ6B 3T3PE 4F15B 1OPGL 3NIFF 4X80H 3T1FB 2NTFB 1BX2B 4IISA 1HINL 4LEOA 1M7DA 1RIVH 3I2CH 4JPWL 1NGWB 1RIHH 4AEIL 1O0VA 4CJ0A 5J6GA 1CFTB 3JTTA 1YEIH 1NARA 1CBVH 2R2BA 2H1PL 5CP3A 3I02B 3MBXL 1R24B 1YY9C 5F3BB 3KPNB 5DS8B 4GG6E 4CDHA 4FQCL 5L6YL 2YA2A 5LG1A 2GSJA 4OZ4B 2VLRD 4LAJH 4LPTA 4YHKH 1RUAL 1N5AB 1CQYA 1IC4H 5L2KA 1BOGA 3RX8A 5EZIH 4UIMA 3CSYB 3WD3A 4YAQB 3U7WH 5AUMA 2E7MA 4HIJA 1MHEA 2D7TH 5FB8A 2UUDH 4WWKA 1XFPA 3ZDZF 2XZAH 2W0FA 4MMZC 4QRUA 3E6FA 5GGQH 5K9JL 4CD7A 1D6VH 4QOKA 2OP4L 1S9YB 1U8JA 2AABH 5HDBF 3T77A 4KROB 1AKJD 2GFBA 5GRVL 5BQ7A 5MEQB 2D22A 2VWEE 2O5ZH 1LEIB 4G8GD 1KXVC 4EVNA 5JW4N 3MLUL 5BVJA 3TBWA 1W0VA 5BV7B 4L8SB 1KUMA 2W0PA 1GGYA 4G3YL 3VXRD 3CUFA 3WJJA 3K7UA 3MMDA 2QL1A 3DIFB 3EFDL 2XKSA 2CBIA 2C9AA 1PW3A 2VNCA 2FX8H 1BBDH 5M03A 5FF6A 1E0VA 3OAYK 3QHNA 2OWXA 4H25A 1ZHLB 5F7LB 4R0LB 4JN1H 3S2CA 4JPVL 5GS1C 2R23B 4W5UA 3VFGL 3VE0A 1AJ7H 1QWNA 4B9YA 2WWMD 4OD3L 1MAML 1OTSD 4N8CH 4W70A 1AO7E 1S9WA 5C0RL 1I3UA 3PXHA 1JPSL 1I4FB 1R86A 1N26A 4FQJH 2F7PA 4WCYL 2R4RH 4PRIA 5D4QA 5EO0A 1JP5A 1OW0C 3RIAK 4C54A 1XZ0A 5L2KD 4CADB 4IM8A 1N2RA 2H45A 4ZNEA 2CRZA 1B0WA 4HBCL 4RFNB 3WY2A 4CKQA 5EBWA 5D7JC 4JY6A 4WWKD 2X44D 2DD8L 1JFXA 1JWMA 1LE9B 3CU1A 4QOKD 3B6SB 5ENWB 3GHEL 3DXAE 5DD1H 3G04B 3S97C 1XR9A 1NLBL 1CK0L 2YWZA 5DLMH 5I2UA 4P59L 3IDXL 3MNVB 3SCUA 2PO6B 4FG6C 3EFFA 2COQA 1IVLA 3ZKSD 1MEXH 3WH9A 5I76A 4CVZA 1HIZA 2HG5A 3S35L 3VXUE 4W89A 4LSPL 2RFXB 1TMCB 1WEJH 4FABH 2YPLA 1SMAA 1D5BB 1U8KB 2CUHA 5D5MF 1T0PB 1HCVA 1I75A 3QCTH 3QPQC 3RA7H 4B9ZA 4U1GC 1WFOA 3C9NA 3E0GA 5H94A 1U33A 4D0CB 9CGTA 5IQ7L 35C8H 1UH4A 4R4FL 2J8UA 4M1GH 3LH2H 2DIBA 3HG1B 3D9AH 3RNKA 1UD6A 3VFUB 3LEVH 1MJJB 4YHIB 1WB0A 5ESVB 2V17H 3BUYA 2D31A 4TQEL 4PRID 2VZOA 4JFFE 5AD0A 5I1LA 3TYFB 4WFFD 2YOCA 4Z7UB 2UWEB 3TA3C 1X5KA 5ICXA 3AY4A 4KV5F 3OJVC 2F53A 4G80A 4WJ5A 1NKOA 2R0WL 3SDDA 1PPIA 2KDGA 2Y25A 2D7NA 3LZFL 4WFED 5FOJA 4HG4J 2VVSA 3QFJB 3WUWB 1CICA 4DQOH 3BE1L 4UT6L 4XGZA 4UFKA 1CE1L 1QHPA 5L88L 1PDKA 4LSSH 1X4ZA 5GSRA 4D8PA 3MUAA 3HMXL 4D6DA 1XF2B 5FL1A 2ZJSH 3HAEB 4NRZA 2X9XA 1DQQB 2XRAH 3BISA 4KUZL 4OT1L 4BYHA 2ZUQC 4PUDA 2VH5L 2YPLD 3RUGA 1CDJA 5JORB 3HRZA 5KG9A 2Y36L 4S10A 3MV11 4KVNL 1HE7A 1S7RB 3DYOA 5JOPD 4PJCF 4AIEA 2YD7A 1OP5K 4FZ8L 4MJ6A 4MMXC 3NPSB 4P2OB 1I8MA 1YMHA 3LKQA 5C0CB 2IPTH 5HI4C 2DLEA 1NWRA 1GQLA 1GGCL 4PJAF 4NN6B 1NL0L 1N3NA 2BSSB 2O92A 4AZ8A 4Y5XB 4H88L 3REWA 3INUL 4OF8A 4XWOD 5KOMC 4FRWA 1T5XB 4EIGB 3EYUL 4GAGH 1V7ML 2DSKA 2GTWA 1I7RB 2F53D 2VO5A 3DX7A 2OBGA 3KDMA 1OM3L 2MCG1 3SDDD 4IRZL 5FA3A 5D70H 2NY2D 2PETA 4XP4L 3BH9B 1CXKA 1NOFA 3CZEA 5A3HA 3II1A 4ELKA 4OCWL 5KSAB 1CICD 4NC0B 4PLNC 4OCMC 4YLQT 3NTCH 4ZTOL 4ZFMA 5DVMA 1W91A 4MAVA 3THCA 5CBEA 3O6FB 3RZCB 2BY1A 1KGXA 5DQ9A 3L1OH 4URTB 3MGTA 5IW1A 4FNPA 3U5UA 1IEAA 5IHBA 5FYKD 25C8L 4DFIA 1T7ZA 2GIYA 2XA8L 4NC1C 1FNGA 4HZ7A 3GNML 2YD6A 2UVEA 1MWAB 2V9RA 4AZ5A 4I9WE 4NFDA 1E4MM 3M17A 3QI9B 1LEGA 3BAEL 2BSED 4LYRA 3OIHA 1WTGT 3L3HA 4EOWH 2I60L 5C3TA 5HHOB 5GJSL 2OZ4H 2DTMH 3OGOE 3LAFA 4K8RL 4F7PB 4RMVA 5DMJB 1A7PL 1G7HB 4AEHL 3MRQA 4RRPA 4OLVH 1AP2A 4KY1L 5KW9L 2CIIA 1WISA 5GS2D 4QXTA 3NIDE 3B9VA 1XSJA 3PWJA 5IW6A 4PG9A 3MGOA 5LGKA 4EI6A 3DGGA 3QUXB 1AXIB 1J7VR 3RWGB 1AQKL 1CDYA 5IWLA 3IETB 1NBVL 4GI9A 3CUJA 5FCZA 2JK5B 2VISB 2Y9RT 4UOQA 4YDKL 4ETYA 2V7HA 3R1GL 1V6YA 3MMWA 3P0GB 1NKRA 4P7OA 1S7WA 4XHJD 5C0GA 1A0QL 4M7JH 2YD1A 4ZTPL 5DUPL 4ZFOA 3EJZD 3JTSB 5IG7A 4BZ1H 1HQ4A 3WKMH 3FTGB 4IMLB 1GZQB 1FAKT 2HFEA 4NM4H 4YDLC 2DBLL 3O2DH 4RGMC 2FJFB 4LHUG 2DQHL 4LGPB 5C0NC 1RMFL 4Z7VE 4XX1G 4Q97A 3JV4B 2WWCA 5IHSA 4P57B 1OF2A 2BVUA 5HXMA 4J1UB 2W59A 5DQDH 5HHVL 3V5HA 1OBAA 3WQ6A 3R06B 5ESQA 1X3DA 4IRJB 4OFDA 3KE0A 5TFSL 1I8KA 3FOLA 4YUEH 5DEFA 1YN7B 3BPNC 1JPTH 1MFCH 4JLRB 3VDCA 5DD6B 2HA1A 5I1GL 1PIGA 4PJ8A 1S7SB 3EHBC 2P4AB 3GMPB 3DHMA 3TIEA 4Z9KB 2CSPA 4LCWA 5DMYA 2PYFB 4LFHD 1G9NC 3PHQB 4KTDH 3LQZA 3QIWB 1J1PL 4M5YH 2EEBA 5EB9A 1XGPA 1MQRA 4PV8A 2O5YH 3PGCB 4U1KB 5D2NC 1J8HE 1FZOB 2HFGL 5E9DA 1ZANH 3KYOB 5E2VL 1T7YA 5CSZB 3UTOA 3UR7A 3B3IA 1FFNA 3U4BH 1A3RL 2F5BL 1ZL1A 5L8KB 2G75B 1CLOH 4OCSH 2AJ3B 2P8PB 2NW3B 3VM5A 1YEJH 5F1NA 5B8CC 2EDYA 4ODUB 1QUNA 2X10A 4RBPK 5I6XC 4C56B 5JXEC 4GRLA 3U46B 4AJ0A 5KVFH 3BH4A 4ELMF 4S3KA 4M48H 4KRTA 1F2QA 4N68A 1OTUD 3GJEB 5ADPL 2VJXA 4Y4HC 3DI3B 3C6SB 4K07A 5CJXC 1KEGL 3DVNA 4RGNC 1T20A 4NZTL 3SKOB 3G6MA 1KEMH 3BPLB 2A73A 5I0ZA 1CGSL 3P30L 4MD0A 3K80A 1BG4A 4FZEH 4Z7WF 4PJ8D 4M43H 3MV9E 5KS9B 1Z9MA 4XNMA 3HI5H 1SM3L 4X6BB 1SEBB 2IFFH 3CNKA 5IMLA 4LCWD 5C0BB 4XAWH 1NGXA 1MFBH 3NZ8B 1I8LA 3F8UB 1SBSH 2X1OA 4R90H 4MB1A 3PGDB 5E9DD 3TT1L 1JPGB 4PY7B 3MLYL 2EYSB 5DJ8A 3KPSA 3U79A 2CXGA 4KUCD 6A3HA 4DN4H 2CITA 1EEYA 3UC0L 4KPHH 1V3JA 2N7AA 4ONGL 5B3JE 2P7TA 1DN0B 4E42B 3LRKA 2XG9A 4PJ7E 4PJIE 4POYA 3ES6A 3WHXA 5E24E 4NWTH 1XF3A 1WJ3A 3RM8A 3ZDXE 4L8DA 4P8XA 2J7EA 1ORSA 5EO9B 1UWQA 4N90E 4GRLD 4HEPG 3M6DA 3EZJB 5L9DL 1LG1A 1UM5L 1NCWH 3MRIB 2AJSH 1ZWIB 3WUZA 3WJLC 3B43A 4U1LB 3FO9A 1XCWA 1TVNA 2YDSA 3K2UH 2PUQT 1K9TA 5I1EL 5F1IA 2CJUL 1ZVSA 2VDPH 3BGMA 1OGAB 4UV7L 3FB6B 4YXHH 3X14B 4FFWD 4NRXA 5CP7A 3TNNB 3FQUA 4PJAB 2DI7A 5C2BH 2VXTL 5ABGA 3PL6A 2X4SB 4LMQE 3RVTC 3L7FB 4WGVB 4LEXL 1FZKB 4XCNA 4B41A 4A3YA 2E7BA 3NGBC 4JM2C 1A7OL 3RFZC 5ERWA 3L5HA 3W24A 1D6EA 2I9TB 3B2VH 4QHKJ 3OG2A 2OL3A 4FNTA 2QQKH 2N4IA 3KPSD 3L7EB 4E4PA 4GKSB 1XCXA 4XMLH 3V5DB 3BXNB 4NUGH 2E27H 1B0RA 1TQBB 4QRPA 1FE8L 5E95B 4AD3A 1WVZA 2IPKB 3BWAA 5A2AA 1C92A 3O9WA 3LSOB 1KG0B 1IL1B 5C0DB 3LDBB 4GAYA 3H3KA 3DRQB 2H26B 4XPHH 1G6RH 1I7TB 4TTDD 1KB5H 3HR6A 3PWPE 4OAWB 4FMVA 5T3ZE 4LX4A 3PUCA 2DQGL 2VX7A 3DMMB 3RX7A 5A8MA 3VD9A 3SUUA 2OJEA 3QXWA 3MRMA 1NAKL 4J3XA 3MRCA 3NABL 3WFDH 2K1MA 3DURA 1IC1A 4LLYA 5F96H 3GSRB 5FYLE 4NHCL 1S5IH 5JMOC 1GC1C 2OXHA 4GLRH 5EPMA 2PYEA 4IIQA 2CPUA 3PL6D 3CK0H 3VCLA 4EDXB 2Y6SD 3BEVA 1TPXC 4DKEH 4PREA 1UWEL 5DR5L 3UXFA 3SE3A 2NZIA 2UUDK 3H8NA 1B31A 1FYTA 12E8L 1G7LA 1MHHA 3TTSA 4PYHA 3T04D 1NCBL 1O7DC 4MNGE 2JIEA 1TQCB 4O4YL 4RE4A 1S9XA 3WFLA 2CXKA 1FDLL 3MCG1 4QRPD 5LQBL 1HP4A 1GXEA 4UV4L 3ZTNH 1F90L 3P4OB 3S6CA 1NFDE 3O9WD 3STLA 3IJ8A 1XIWC 4PGDB 5MEPB 1L0PA 2FGLA 3CFJA 4U1NB 2ZUNA 3NH7H 4GUPB 5GGUA 4Y5YB 2BJMH 1OARH 2E3VA 4G8EB 3W9DA 1LF1A 5I1DA 5JW5B 2EO1A 3MXVH 4UQ9A 3BQUB 2EE9A 1BD2B 3MNZB 5ELIA 3G5VB 3N17A 3H3PL 1LO5B 1GZPA 2GKIA 4S3JA 3QEUB 5JQHC 1FJ1B 4F9PC 4F2MB 4NQDA 1P4LA 1E9LA 2EDFA 4XMPL 4GS7C 4DWSC 5AYUL 2Z93A 1JV5A 1CYGA 4OZGE 1O7VA 4P0DA 2PYED 4O58H 4BUHA 5A6JA 3HFMH 2HT4C 4B16A 4M7KL 4TRPL 3ZHDA 4ETQA 4D72A 2DT2A 3VFSB 2GJXA 5HVFB 3WBEA 1FYTD 2KUTA 1A4JA 5K9KB 1G9MC 4G6FB 2F2HA 5INDB 1D5ZA 2C1OA 5FGCB 1K9EA 1QPXA 5C09A 1VEOA 4BQ4A 3VXPA 2XKNA 4JFEA 2VQ1A 3PE9A 3LHPL 2JJTA 5IM7A 4Y4FC 2CO7B 2C4FU 5I15H 4KKCD 1AI1H 3FKUS 4ODXA 4RAVA 1Z3GH 2JCCF 4X9HA 4ZO8A 5EUKA 1LJYA 2CCRA 4LHJB 4OOUA 4MJ2A 1FC1A 2E6QA 4Y1AA 3RAJL 3IDYC 3EYSH 2VABA 4MB4A 3FQTB 1SVCP 2ZX8A 4JM4L 4L1DA 5D6CA 2UZYB 4P2RB 4ZOAA 4Z0BL 4U1JB 1CU4H 3CZLA 2CIKB 2YPKB 4NQDD 4QHNA 4O2CA 2VTFA 3O6KL 3BDBA 2X6MA 4HHAA 3MROB 1C16A 4D1IA 1ZV5A 5HGBA 5EU4A 1WUNT 2NZ9C 3FONB 4HWEH 3CC5B 3VGFA 2W60A 1AH1A 1LD9A 1T83C 1W9PA 1QBAA 3MLZL 3DVGA 5F7FA 2XUCA 5DJYB 1NEZB 3SGDH 3OMZA 1ZU8A 4PMDA 4HJJL 1T21B 1RZIA 4XZBA 3T4YA 5IOPB 1MRCH 3Q6FB 1MREL 5DWUL 1Z5LA 1LP9B 1H15B 3PG2A 4JFYA 4HF5H 4Q2ZB 1WAAF 2IXUA 1JZ2A 3PWUB 4FXGA 3E8UH 3V52H 5DMGD 4JRWA 4W88A 1WIPA 1V6XA 1K8DA 1XRVA 5EOTA 2DSWA 5IMOB 1IRAY 1JDAA 5C09D 4LOUD 1UKQA 4XCEA 4OFPA 2B0SH 5D7KD 4JFED 1CN4A 1UKTA 2EE3A 2FWOB 1YECH 3FZUD 3OAUH 1CFVL 5IB4B 2PKDA 3ARBC 3JXAA 4ZUUA 4MX7B 2X89A 1REIA 4PYSA 1FHLA 3QISA 2AEIT 1M4KA 2HT2C 4Y1AD 2WHKA 4RISH 4DO4A 4HT1H 3L4WA 5I1KH 3LPGA 3HKFA 1NM9A 4GQ9H 5DHVH 3SY0B 1Q6GA 3QWOA 3ECBA 2WVVA 2DM2A 1YC8A 4PRPB 5IFJA 4XP1H 3L5XL 3B2UD 3CUPB 2X4RA 3KXFA 3RWCA 5IK3B 4OI7A 1RZKC 1UM6L 1MRFH 3EO0B 4LSUH 2EYTB 1A14L 3CO4A 3U2SA 2YL5A 5DJ2B 4W84A 2JIXB 4ZYKA 1MFAL 4RCAA 5E94A 1KIUA 4HS6A 1K4DA 1WWWX 3UTTE 4FTVA 1GOFA 3QWQB 5CUSL 4ZD3L 4NZJA 4O51A 1MCBA 3WHE0 2H9GA 1BMGA 1MJUH 3GSNL 2A0LD 4XP9H 2ESVA 1FPTL 3O41B 2MQ3A 4LQFH 4FFYL 3L5WB 3HG2A 1FGVH 4JDTH 1W2PA 2Q8XA 2NXYD 1BBJA 3MRPA 1MCNA 2H8PB 3TZVC 4AIZB 3PTQA 4JFDA 5E8DL 1GORA 1X5GA 4GXPA 3DBXA 2CRYA 5ID0B 3W0WA 3BZEA 1W2VA 5D1ZC 4YX2H 2QADC 1DLHB 3AREA 2X89D 3LPWA 2W65B 2WSKA 1JMXA 1NCAL 1XEDA 2FE0A 1I9RL 5JHDB 1Y18A 4LCIL 3V0VA 3WS6A 1MIEL 4YDIH 3WFBL 3DUUB 4H0GA 5EO1A 4AG4L 1VGKB 3ARWA 3EOYG 4FN0A 1LQ0A 3MLTA 1I1AA 2ITDB 3I6GA 4H8WL 1TR1A 1UWIA 1Q72L 4PTXA 3QUML 1G7PA 1ZT1A 4XBPA 2GCYB 4Y2DC 4EN3A 4HP5A 4UQAA 1F3JA 1KIPB 2R1YA 4LLDA 1DUYB 5HPMB 3KXFD 4FLQA 3DUSB 1EO8H 2HJLA 3G5XA 3MJ6A 4KJYB 1Q9KA 2ENSA 5HI3C 4G7VH 3QQ3A 4WTZG 2CDFB 5EIQA 4X6DE 4URIA 3LB6D 4Y5VC 2AKRA 3QUZA 4F33B 3TA9A 4E41B 4OF3A 1LEKA 2A74A 4FTVD 3RRQA 3IU3A 5F9WB 5LA0A 2A77L 1E0WA 4PJXE 1FNFA 3SOBH 1K8IA 1YN6B 1ZAGA 3N0PB 2ESVD 3MV8B 4MS8D 1I3RA 4X4XA 1KBKA 3IXAB 3H9SE 3WMSA 3FN0L 2YUXA 5B38A 1Z0MA 1I3VA 2QHLA 2VL4A 2IANE 2W91A 4PJ9B 4UT9H 5JR1L 4LPWA 2PF0A 3CMOH 3HZYB 3PWLB 4JFDD 5TE6H 4I18C 3MRLB 2PNDA 2Z4QB 2ARJA 3W0WD 1QBML 3FT2A 2Q86A 3TYGH 4UTAH 4BF7A 2H3NA 3H3BC 1QOXA 4LYQA 2CGRL 2P45B 3ARED 3PWVA 1T2JA 2RQ8A 4HGMA 3MJ8A 2VDLH 1U3ZA 3N50A 5AYBA 5IVXE 3GSNB 3LQAL 2VYRE 5ITBL 4NT6A 4Q6YA 4JN2B 1TMQA 1JHKH 2MKWA 4WU5A 1I1AD 5I8OH 4C7FA 4DKFH 2OK0L 3MJ9L 2W9EH 4J3OC 4EN3D 5DJDB 4OKVB 5DTFB 5E5RB 2FX7L 3T0EB 1AC0A 2FH8A 1R3IH 4WHYG 4KC3B 1YNLL 1LO3L 1WBYB 3QH3A 2XPGB 4YHYB 3TIDA 4JDZB 3CH8A 3GH7A 2XG5A 3QUZD 4MCZA 5DD3L 3BSGA 5KSVA 4AL8L 3FRUA 2Z31C 2QPSA 2J1KA 5DD0H 5INCA 4NP4L 5TF0A 1RJLA 2ZSVB 5E70A 1QSEA 4GRMB 2IQ9L 4GBXA 1EAJA 3QUMB 4L8CB 4FMKA 1DE4B 3ZE2E 1IQWL 2VDKL 3QUYC 5ALBH 1LDSA 5IUSA 4AK1A 1ED3B 1I3GL 2P5WB 1UWGL 1IKNA 5HY9B 2YUZA 4U7KA 2F19H 3CX5K 3BKCH 4FQLL 5D7IE 1EEZB 3P9MB 3F12B 4LKCB 1E6OH 3K74B 2NY6B 3QNXB 5AAMA 32C2B 2ADIA 4KI5E 4HZ6A 4YO0B 2E8YA 3GJFH 4F7TA 3ECQA 1E6JL 4UDTB 2BK8A 4J3UA 4Q58C 3VGAB 4K7FA 2WZPD 1HT6A 5I23A 2DIJA 3SKJL 2H2SC 4CVXB 3GM8A 4XCFH 5EFIB 1XGYH 4DGVH 1E4KC 2BVPA 1NC2B 2WMHA 1EFQA 5T3XD 5CIPB 4PRAA 1AGBB 4Y4KB 4KRLB 1OD0A 4ODVL 3ZT5A 3H0TB 2Y7QB 3MRHB 3LN4B 4R96A 3L3JB 3STZA 2VXUL 3CLFL 4H1LG 1KWGA 1QSED 4J2XA 2A6DA 4GBXD 3FFCB 5CEZL 3VIFA 2XNAA 4FNSA 2DT1A 3GM0A 1C8YA 5MEOB 4BELD 4Q6IA 2J78A 3U30C 3APGA 1XGTA 4XP5H 4UU9B 2R1XB 4X9BA 1QNSA 4P8UA 1JI1A 3OKNB 1QSEE 3SCMB 1Y6KR 2APXA 5T5NG 2C3VA 4PJ5B 1FCCA 1BVNP 4QWWD 3DX4A 1G7QA 4YFEA 4JRYB 5TDPA 5CEYB 5A8QA 2NW0A 4NKOB 3S96A 3IDNB 2B1HH 3F7YA 1EOKA 1IAMA 3LEYH 3ESUF 3F6LA 4OI8A 4MD5B 1U8NB 2JF6A 2WYSA 5C9JB 1P9MC 4I2XA 1MCWW 5JO5B 2I26N 5DD5H 1TTUA 4OKDA 4ZO6A 2BDNL 2DMKA 1YPZE 3C09B 5EZJA 1KCUL 3QWRA 4RX4A 2ZXDA 4PGEB 5FYLH 5FXCH 3OAZH 5F7DA 2X2IA 2OYKA 5DFTA 4B5EA 5GGVL 3MRGB 4WO4A 4G6KH 5I9QB 4L3EB 4WI6A 5D9OA 5IHLB 1CEOA 1QQDB 1KC5H 5AZ2H 4PMXA 3D69B 4I0PC 4JJ5A 4M6AA 4DWHA 5M7QA 2DT3A 3WEMA 3A3HA 5JIWA 3BPOC 1JUFB 5J12C 1MF2H 4RFOH 4MNQB 5FGSA 3O3AA 3DTXA 1UACL 2QSTA 5H35A 1GZJA 2MPAH 1E4XI 1JRHI 4M02A 5HYIA 5D8JH 1U95B 3D0VA 2QHRL 2O9PA 2XGBA 3GNPA 3AIWA 3D5OF 1NC4A 2GUOA 3NCFB 5HGDA 5IROA 1LL6A 2WZEA 2R4SL 2NY4B 1ISXA 1WDRA 1UCTA 2Z91A 4HXAH 1IBGH 2D9CA 2NY1D 2WBJB 1CGXA 3G6AA 2R0LH 4BKLB 2DLTA 2A3HA 2I07B 2WWKT 3KPMA 5F6IC 3QDME 1TZGL 2H32B 4DAGH 1AGCA 4U49A 5SWSE 1WGOA 1XHGA 1ZHBB 2ZUUA 5FUZL 1W72H 4HU0A 4ZFZA 1EIBA 4KJPC 3VXSE 4QF1B 5GGSA 1NAML 1JN6B 5IJKC 4DN3H 4ZUSA 5A6AA 3PP4H 3M8OL 3QWRD 4RX4D 3VXTA 1JRHH 1E4XH 4P5MB 3KPRA 4M7LT 4LDEB 3MRRB 3AXHA 4GAJL 1BP3B 2ZCLH 5GGRA 4WO4D 4F37F 1P7HL 4F66A 3WIIL 1VKXB 5EU5A 2E7LA 5FYJL 4P23A 1RHHB 3CGTA 4Y7EA 2IWGA 1L0XA 2JJSA 1CT8A 3I6KB 4HC1H 1BZQK 1ZLUH 2OQJB 3JWDH 4HU8A 4M80A 5E99L 3RVVC 3O0RH 2AK1H 1VPOL 5FIPA 15C8L 4ZAKC 2FLRT 2QSQA 1MVFA 5IB1B 4X6FB 1MPAL 2QQLL 3L3GB 5DA0B 2VSCA 3MLWH 5ETUB 2Z35B 2Q7NA 1OWRM 1S3KH 2YPVH 3SCOA 4UAOC 1DDHB 4JQVA 1YYLH 1NOWA 4NRSA 1NC4D 4CCEA 1DBBL 2FDMA 4V1DE 4KJQC 5FD0A 2A9NH 4ODWA 4UDUB 2DWDA 1U42A 4Z76B 3BHBA 4GW4A 1TDQA 5GHWL 5LXGL 5D1XB 4ZS7H 4GKLA 4QRRA 1QI5A 3GXDA 3MLRL 3TVMB 2M1KA 3ZTJH 5I1IL 1XCQB 2CLRA 4LGSB 1VGEH 4OB5L 5BJTB 3RL1B 2EBNA 4KDTA 1BTCA 1H3TA 4YPGA 1JHLH 3FB8B 1OAYL 1V02A 4XB7A 5D71L 1JYXA 1M05A 2MOVA 1T2XA 3S36X 3P73B 4U6XA 3F62A 3CD4A 5JNYB 2B4CL 2F54A 3KNBA 5FV1L 3C2AL 3VGHA 2EIZB 2OR8A 1IGFL 1I9JH 3KPRD 3CH1B 4QGYA 4DW2H 2ZUWA 4RA3A 4G8FB 1B6DA 4P23D 3AZTA 1KTLA 2ILLA 4TUJA 4OFKA 1FLRL 3N9GL 5HGAA 1L4IA 1OHQA 4OZHE 5ESAB 5A6SA 4DOHE 3OZOA 4K94L 5I77A 1RD6A 2BNQE 1HI6B 2FYVA 1ZA6B 1KCRL 3BWUC 3BW9A 2BOBB 5IESL 2MQ0A 3HE7A 2AMGA 1IGCH 5FOBB 5DZOA 5HJ3B 1KPVB 4DTGH 3UESA 4RMUA 5IHZA 3VW3H 4N0UE 1BQLH 2QQNH 3MA7B 2C4FT 3P0VL 3VIJA 3O3BA 4PJGB 1L7TL 3RHWF 5GRJL 3S5LG 5EU6E 4Z5RB 2QSCH 4TTGA 4L4TA 4I4WB 4UOZA 3NCMA 4QRRD 3MRKB 4PJDE 3BO8A 3SDCA 5I1HL 2CBUA 1Z9SA 2JELL 4XI5C 1CFBA 1FSKC 4M82A 4EK7A 4Z0XA 3BZFB 4MGXA 5J3HC 2XN2A 2XYLA 4NQSA 1B88A 3Q6GH 2CKBL 3RVUD 5SX4I 4NQEB 3PQYA 4QT5B 2F54D 4OCRH 1ZT4B 4OZOA 5EG6C 4S1QH 3RDTC 4PGZA 4G42A 4LAQL 5DK2A 2PWEA 1CWYA 3WXVH 3GHBH 4U1HA 1RU9L 1V02E 1PSKH 3DX8A 4D94A 3HMCA 4QTIL 4FA8A 2XXMB 1EERB 2AXGA 3W82A 3KR3H 2IAMA 2C3XA 3Q5OA 4YEEA 3R0NA 1WFTA 3OSKA 3MNWA 4MJIA 1HNYA 3UPCA 1H5VA 3AFLA 3HE7D 2PF6A 8A3HA 1T1XA 3SDYL 4KKBC 4PG2C 3AZRA 3GRWA 1YHTA 3BP7A 3CZFB 3C60A 1BZ9A 4NQCE 3VFPB 1HHIA 4OLUH 4PUBL 1P2CA 2HLFC 2OTWA 3NJ3A 5E08H 2BVQA 1GC1H 4K9EL 4L4TD 4ZNCD 2WUBL 3L4ZA 1RZJL 4XBGA 3SDCD 1DWIM 1HKJA 1PGRB 1Y6MR 1YZZA 3BSZH 3A4XA 4XNZB 2PXYA 1SYVA 3RJQB 1INQB 1DVFC 3ZM8A 3PZMA 3ULVC 3VTRA 3DDFA 3ROLA 4XZUA 2LQRA 3PHOB 1IAII 3TO2A 3PQYD 5KEZA 3MLSL 2RGSA 1G7IA 4PJFE 3GTNA 1AE6L 2BC4A 2HVJB 3BP5A 3L9RB 5GRYA 3X3FL 5GS0D 2CDGA 3I9GH 4NJAL 1ZTXL 1J5OH 1HL8A 5EDXA 1IM9B 4UTBL 1J1XL 2BCKB 4R4NC 4CU8A 1YC7A 1U8PA 5EB8A 4M6OH 3S35X 3SKMB 5BS0A 3HMWL 3D3VE 2ESCA 4S2SB 2IAMD 3BI9X 4JY4A 4AIOA 2Y72A 1H09A 4WSKA 3MV7E 2IPUK 1FL3A 3JV5A 5J11B 2ZCHH 4MJID 3WUEA 2LVCA 1DFBH 4ZSOB 5DJ0B 1MQKH 5F88B 1VFMA 1BAFH 4JHWH 3P77A 3EZ8A 1YEEL 1EFXB 1IAIH 3C60D 3VJ6B 4TOYH 5IGXL 1ES0A 4N0FB 4KZDH 4NN5B 1MJ7H 5E8OA 2WP3T 4LLUB 1A9BA 3IDGA 4BSJA 1CXHA 1ND0A 1DBKL 1SJEA 2HT3D 4MYWB 5C7XL 2YD4A 1BQUA 1F4WH 1KXVA 2YS4A 3QA3A 1EUUA 1L6ZA 4W87A 3CXDL 1AGFA 1VFAB 2PXYD 4PB0H 2YBUA 5TF1L 1IC7H 5HOSA 2AK4A 4D6EA 1ZBKA 5D72H 3QBTB 2EABA 2VLJB 3RIAF 1OAKL 4XVUC 1PS3A 3HPJB 5DC0A 5A6LA 5FGRA 1AGEA 1IAKA 4FFZH 1A1OB 2P24B 2A6IB 2XY2A 4QNPF 1A3QA 3K81A 1MNUL 1AXTH 5GS1A 5FEBA 1SBBA 2ICCA 1RY7B 4Z77A 1QSFE 1RPKA 1YY9D 4H41A 3MJ7B 1FH8A 3TNMB 3WN5C 5E09A 4LIQE 2KQMA 5MP6H 2XV6B 1WP6A 3U4EB 2GQHA 3HG4A 1F02I 2HRPL 2CK0H 3RIKA 5BS0D 4QCEA 3NPZB 2L7UA 1OW0A 4WW2F 1VHPA 1PFCA 3T1FA 1YMMB 2ZSWA 1EJOH 3BN9D 1X5ZA 4H0IA 3ULUD 5D7JA 5GZNC 1NGWA 3VFRB 1D7FA 4JG1H 3CZNA 3KL5A 2DDQL 4QXUL 5IR1B 2XQYG 5H37G 1SY6A 2OYMA 3AQUA 5D6DC 4D6FA 1TJIH 2MCPH 1N5YL 4JFWA 3C5ZC 3O4LB 3IDMA 1KJ3L 3K4AA 4KMTH 4YFDB 2FD6H 1HEZA 2NY3C 2AI0H 1A1NB 5FKPB 3OWEA 3GIVA 4KRPB 2AK4D 1N59B 1A21A 1JYVA 2DH3A 1MCHA 2B39A 3PV6A 1IGMH 4QHLB 1DN2A 5FV2A 4CRPA 5C92A 3MFFB 2X1WL 4LLQB 4R3SA 3TN0B 4LL9A 3UYPA 1XH3A 5C6TL 5EZLB 5CFHA 3EDJA 4KK5D 3HUJF 2K3TA 1I1YA 5EUOA 2Q76A 5J4MA 1PX3A 4NPYA 4TVPD 4U31A 1LK2A 5IF0B 4ZQKA 1GQJA 4Z2IA 3LEXB 2GTZB 3QQ4A 1RP9A 1W9BM 1XCTB 2XWBA 4KZEH 2AVGA 5IB2B 3O11B 3QGVA 5DJCB 5KSUA 3MACL 4MXQC 3KLKA 4PJBA 5A43C 4P5KB 2VZUA 4GO8A 4YDJB 3WHE1 1JGEA 1CD1B 4UIKH 2DM4A 4ZFGH 3FQNA 5CBAB 1W32A 4G43A 2A38A 3TA3A 3NPSC 1ORQA 1KBGL 3HE6B 5KVGL 4WKHA 1QR1A 1YEFL 5D7JD 2ZUXA 5DHYB 2VLRB 3IFLH 1CDBA 3HRPA 4W85A 1T5WB 2GJ6E 4U6YA 4YDVA 3UJJL 3WN6A 4GKNA 4LVNC 5CMAA 2DL2A 5DJAA 1RZKH 2ZOXA 5T5FL 1G7MA 2UV3A 1UXWB 1Q6EA 2XVNA 4AD4A 1ZE3C 3C2SA 3FO2B 4N0CC 5JPMB 3ZQ9A 4FG6D 3NA9L 1ZLWH 1HHGB 2GSIA 3HC0B 3T1WA 4W4OC 4CADA 5JOFB 2E9JA 2N56A 1UQYA 4G8GB 1HJVA 3S5YA 4UI2A 3AFBA 3ZLQC 3VXRB 4FQ2L 3D6GA 4OM1H 1CLCA 3QPQD 1PY9A 3OJMB 3RZCC 1UWUA 2ADFL 1MI5A 3GJFK 1EHLH 2PBGA 5F9AC 1LE9A 1UB6A 4NHUB 3QQ9C 4LEOB 4OV6F 1RZFL 4OIBA 5DVLA 1M7DB 2DQJL 2XYCA 3IJ9A 5J6GB 1GOKA 3QO1A 4GW5A 3JTTB 2VLKA 3G5YA 5A94A 1WCGA 2R2BB 1T03H 1BOYA 1IILE 4HUUA 4MAUL 5GQBA 1ZB5A 4HUNB 5D1QC 1KQYA 5KTEH 3ZT7A 1FVDA 3RU8L 4AMCA 3TCXA 3FHAA 4LU5H 3VIIA 4XAKD 2G2RB 4KJWC 3TA3D 2HFFA 4X4YA 1CVSC 4XNUH 5BRZB 3ARRA 4JVWA 1TITA 1RULL 4XT1C 3X3GL 1D5BA 4NO0B 2FO4A 5I74B 1BAGA 5L2KB 1BOGB 3GK8L 4FMFA 2AV1A 4UIMB 3NAAL 2OS7A 4QXWA 1MELA 4UB0L 5LVEA 3QUXC 3GBML 5AUMB 4QLLA 4HIJB 1MHEB 1MXGA 5FB8B 4WWKB 1J1OL 1GGBH 4M5ZH 1NCDH 1MAKA 3HNTL 5E4EB 4YWGH 4MNMA 4XMKH 2IC2A 4JEGB 2W0FB 4QRUB 3AS3A 1A7NL 3E6FB 3HCVA 2G60L 3IF1A 1S7QA 4LARH 4QOKB 3SE9H 1U8JB 3VGDA 3T77B 3TYFA 1ISZA 4D9RD 3RPIA 2GFBB 1V0MA 2LAGB 5BQ7B 1JGDB 1DL7H 4WW1A 2NY5L 2XN1A 2UWEA 4EVNB 3LN9A 3N1AA 5BVJB 1W0VB 4MDIA 4FP8H 1RZ7L 4CBPA 1RUQL 1MI5D 4DK6A 4JZ5A 1F8TL 5FF6B 5EBMA 4OZFH 5IEHA 4K71C 5HGHA 4P5TC 4PTUA 4PMRA 4PTWA 2VLKD 5HI4D 5HSFA 1HIML 3OAZK 2ZCKL 3VE0B 2FSEA 1S7TA 5GNXA 3QDGA 2C3WA 1S9WB 5EC1A 3Q1SH 4TUKH 4F8QA 1UD2A 4UCFA 3GI9L 3KPPB 1FHDA 4NIKB 4UOJA 1CG9A 3W38A 3O8XC 2GJZA 5EO0B 4PMZA 1TTGA 1CENA 5TPWL 3Q0HA 3QSKB 2NT1A 1N2RB 1S7RA 1UKOA 1NP2A 5EBWB 2X2HA 4X6CA 5L7XL 4DM2A 3BT2H 4OF6A 3O9NA 5FYKL 5CD5D 1JWMB 5C0CA 4NJ9H 4HAFA 5JLZA 4WTZA 3BZ4A 1KN2H 4PJHF 4L9LC 3BAIA 5F7KC 5A1AA 2WANA 4RQQB 1XR9B 5CILH 3VWKC 4PMQA 4QCIA 1F3RB 4X7CC 1F45A 2QJDA 3HG1E 2V5MA 2W9DL 2O9OA 4LCCC 4F8TA 3EFFB 2PN5A 1SMOA 1JXJA 3KEHA 4WNQA 4JZJC 5I76B 4CVZB 4KXZI 1LL7A 2KL6A 4N42A 2HG5B 3WQ4A 4Z7UE 2YPLB 5KSAA 3AICA 1JD7A 5IFHL 5T1LA 4X5WA 3C9NB 5H94B 3E2HB 3WBDA 5I79A 5DMIL 3QDGD 2J8UB 1JGUH 1AGDA 3RNKB 4OCXH 1DBMH 3QIUC 4YZFF 4IM4A 3ZT6A 3QFJE 3ISWA 1NSNH 1NPUA 2DQIH 1ZLUK 3QO0A 1B3XA 3BUYB 3REVA 2D31B 5AD0B 5I1LB 5D2LA 2R8SH 1BLNA 1OB1B 4JB9H 2DQEH 1A4KA 1OCWL 3DSFH 3GBNH 2ZX9A 3V9FA 5ICXB 1QO3A 1A6PA 1OSPH 4I48A 4QHUA 4GINA 2W0KA 1AHWC 4HV8A 4M3JA 4OLZL 3SO3C 5A16A 4KXZH 4UUJA 5D2NA 2O93L 1K6AA 2F53B 4G80B 4WJ5B 5C0CD 2EPLX 3O3DA 3SDDB 3S34H 2VC9A 2F7OA 2NY2B 4XPAL 4U7SA 3PBGA 2DKUA 3THDA 1CICB 3FRPG 4KHTL 2QSVA 5M94B 4F7CA 3AMKA 4MAYC 2RCSL 4JREB 3CHFA 3GZAA 3BMVA 1KIQA 5GSRB 4W81A 3IETA 4D9LH 3LXAA 4IDJH 4M8QA 5C0ND 4D8PB 5B8CA 2VISA 2FB4H 5TE7H 1U8OA 3KHQA 3TC9A 4NRZB 2J88H 5I30L 4PGCA 4J6RH 2YXMA 3BIKA 4D3CH 3RUGB 1HJQA 4RFEA 5KSAD 3HRZB 5KG9B 3UJIH 5JQ6L 5T1LD 5CJXA 5HTSA 3SCVA 2Y24A 4OQTH 3NFSL 1F4AA 1YQVH 1QNRA 1RI8A 4MJ6B 4LSVL 1N4XH 2H2PC 4Z8FH 1I8MB 1P4IL 4IMLA 2VXSH 4LASH 4MJ4A 1GZQA 1YMHB 2W0LA 3LKQB 4NGHH 4YE4H 3WIFB 3EHBD 1NCTA 5I0DA 3WMBA 4R27A 3PN8A 3SCWA 3H9ZA 4I1NB 5E2WL 1N3NB 1AFVH 5TDOA 2PC8A 5CSBA 5GNYA 4ZFOL 1N6VA 3ZJ6A 4Q9QL 4OLXH 1H3UA 4OCYH 4L4OA 1BJ1H 1XGRA 1PQZA 3C5SA 3U5YA 2GTWB 2JE8A 3KDMB 5FA3B 2FATH 4U3XA 2B31A 3DDGA 4KRUA 1FBIL 3ETBF 3EMZA 4KAQH 4RAHA 4ELKB 4X7TA 3WUGA 3WXWH 5EZOH 5HHOE 1J0HA 2AXHA 2F7QA 1KXQA 3WDQA 3MUHL 4XH2A 5EC2A 4J3VA 5CBEB 3P11L 4JR9H 5HVHC 4HA3A 4H1LA 3CFEA 5DQ9B 3T2NH 3MGTB 4WW2C 5IW1B 3GMOA 1JGIA 3PHQA 3CU7A 1IEAB 5AYIA 1TZIA 3HC4L 3RY5A 1FNGB 5FDWA 4I3SH 4F9LC 4BZ2H 4OSUH 4YQXL 1BJ1J 3LDBC 5EN2A 3WJLA 3M17B 4OTXH 2EXOA 1LEGB 5FKYA 1MFVA 1F2XK 1NCCH 3AGVA 3N18A 4RGND 2PW1A 5A2KH 3QRGL 2WKLA 2GSGA 3N85H 3MRQB 2NW3A 1AP2B 2CIIB 4GT7A 3GMRA 3P40A 2FHCA 3C8KA 4QXTB 5A2JH 5IW6B 2I9LA 4PG9B 3RI5K 1R34A 3MRNA 1EQPA 3MGOB 4Y7MA 2JALA 3DGGB 4TSAL 5HDBE 3U46A 3U9UA 5DUML 4TSBL 3L3OA 3DPBA 1US3A 4YHOL 1NUDA 5AEAA 4R7NA 2ZG2A 1R3JA 5IQ9B 3MRDA 4IPLA 5D5MA 4NCC2 3KPTA 4K7PL 3VFNA 5JHLH 3VILA 4U33A 2JB5L 3VXNA 1S9VA 2V7HB 6FABL 2D20A 1CTOA 1PG7L 1S7WB 2Q8BH 5E1HB 2ZKHL 3BDYH 5C0GB 3E1F1 3ZKXC 4ZFOB 5D7SH 3S8WA 2VKXA 4HIEA 5IG7B 1TQCC 4TPRH 1HQ4B 4XUYA 4ZEPA 4YHNA 3VRLE 4TTUA 5BVPL 3KYAA 1BEYL 5DRWB 4M1CC 4AYSA 2YL6A 3PGDA 3W27A 5I18H 3BIAX 2YEZA 1B3VA 1JPGA 1V08A 4NKMA 1NGQH 1OF2B 1BQHA 2VZSA 4H20H 1TJHH 1MIML 3WFCH 1VSCA 3V5HB 5DEGA 4K3EH 5L0QC 2XWTA 4D6CA 4FXKA 4FLRA 5ESQB 3MS8A 2ATPA 4HUMB 4LVHB 2KPNA 1RUML 3OR6A 2CKSA 1I8KB 4A6YA 1DSFL 3V6FA 1MFDH 3FOLB 3HB3C 5DEFB 3ILPA 3LOWA 4N0YL 3QEGH 5CZXC 4PJEF 3VRIA 5IP4A 1Q9LA 4IDLA 1NCNA 1OAXH 3UJTL 4NSKA 4PJ8B 3MRIA 2P8LA 1HH6A 3TIEB 1QNOA 4LCWB 5EFFA 5BOPA 1VRXA 1UA6L 3SE8L 5HI5D 5A2IH 2QTEA 3LQZB 4AMKH 1KR0A 4PJCA 1QHZA 5F1SA 3ULUH 4C56E 4GJTB 4PV8B 3VI4F 4UT7L 5E9DB 4JKKA 1OAZH 1A2YA 4O00A 5AWNH 4JFUA 3FMGL 5D9SB 3DVFA 2QLVB 3B3IB 4JGJA 1FFNB 3X14A 1XIWA 5GGTA 4DEPC 5IMKB 2YUVA 4PJAA 3UPRA 3IAPA 5F9JA 4KTEH 1SEQL 2A1WH 1FIGL 2ICWI 4Z7OF 1MUJA 5CSGA 2AJUH 1LDPL 4O5LH 5K59E 5BO1H 3VI3F 5F1NB 4M4PA 5KS9E 1CCZA 4AYGA 3TWCH 4GKSA 4GRLB 5HDOA 3EJPA 3ILQC 5DZLA 5BW7C 5C0BE 3DHPA 1P4BH 4DWSA 1R47A 3W0KA 3T09A 1M7IA 2OR9H 3GO1H 4AMXA 4LCUA 2DQTL 3QHOA 2AP2A 2OL3L 3DVNB 1KG0A 1IL1A 4YPJA 4W7UA 4BQ8A 5HHXL 2VE6A 5D93C 1X5FA 1T20B 3VXOA 4OFIA 4WUKL 3WFZA 4PBWD 2V5CA 3GGWA 3MXWH 4YK4C 1HILB 3VD7A 4XNMB 1CF8L 1VJSA 5IMLB 1NMBH 3U0TA 1DQDL 1JNNH 2EH8L 4HZ8A 2VN4A 4JFPA 1ZBWA 5HDQH 4ERSL 1GJUA 1NGXB 3WNKA 3AS1A 4K23L 1XH0A 3G08A 5CGMA 3NBNA 1F4XH 2R29H 2XTJC 3LXBA 2E6JA 3PDDA 4O9HH 5E8NA 5DJ8B 3KPSB 1XIWD 4Y4FA 4FHBD 2XN0A 1DCLA 1L8NA 1UA7A 1QACA 1EEYB 4EDXA 2HWZL 5EOCH 2V5TA 2P7TB 4XVTH 4AIUA 2NXZB 3TESA 3IGUA 1OGAE 4L3AA 5LWYH 1ACZA 1JTOA 3WDHA 2Y23A 3ES6B 3WHXB 3Q5YA 3UYRL 1XF3B 3JWOC 4L8DB 1WE5A 2CMRL 5D96B 1ORSB 3O2VL 2ZICA 1QYGL 1EMTL 3QNYA 4HLZG 5F8QC 4UBDC 5DK3A 1M04A 2CETA 4DWSD 3WEXB 4F57L 3S5LA 2VZ3A 4NN7B 4S0SD 5DJXA 3S3SA 5F8RC 3FO9B 3ZR6A 3S37L 3I2CL 1KCSL 5JW3L 5F1IB 1ZVSB 1L0YA 4GUPA 3BGMB 3WDJA 3U7BA 5EOCJ 4KKAD 1ZBVA 4NNPH 5FKAA 1KCLA 3SDXF 4ACPA 1D3CA 4NRXB 5CP7B 5BV7H 2XACC 5DUBA 1JYNA 3PL6B 4UOW0 1LO5A 4XP6L 4CU6A 2AQ2A 1F6LL 1FZMA 4S1DC 1KN4L 5ERWB 5E6IC 4RE2A 1D6EB 5DJ6B 2CPCA 5KSBF 1Q0XL 2OL3B 4MA7H 3SDAC 1VFUA 3WO4B 4BQ2A 5HDLA 4Y4FD 1BWMA 1CLXA 5DEZA 1FYHB 3ARBA 1ZLWK 1B0RB 2YL9A 2YD9A 3S9DB 3GBLA 4QRPB 4EEEA 1X5YA 5GGQL 4CGTA 1TA3A 2FH6A 3BWAB 1E6QM 2YRZA 2AABL 3QHZH 3O9WB 4XPBH 1KJ2L 4NM8L 3VFSA 1OPGH 5I71B 1KR1A 2QHAA 2C7UA 4GAYB 1QPPA 3MQIA 1UWSA 1JYWA 4UMGA 4BSVA 4CN6A 5CCKL 4JPWH 2J62A 4AEIH 5INDA 4NYLA 4MQXC 4UR9A 3SKNA 3MBXH 3MRMB 1R5IA 1YNKL 1PEZA 3MRCB 1UZ6E 3KVQA 1JHTA 3DURB 4LLYB 3LKRA 1I8IA 5LKNA 3WD0A 4FQCH 5L6YH 4RMQA 2CKRA 4MHHG 3VMOA 1KTDB 1RUAH 1AJ7L 4LNVA 4ODHL 1CQKA 5EPMB 2PYEB 4IIQB 3VDHA 5C8BB 2OW6A 3VCLB 2CBJA 1ROWA 3BEVB 3SEPA 4PREB 5GNZA 1EUTA 2BY2A 3QDHA 3TZVA 2K7QA 1UWXH 5DGQA 1WZ1L 4ELMA 2ADJA 4GRWB 1MWOA 3QUKA 5K9JH 3BZDA 2F8OA 2VZTA 4QGTA 3CVHL 2F9BT 1FYTB 2OP4H 1G7LB 1MHHB 3FONA 3CIVA 1MQ8A 1BD2E 1MXDA 3PZIA 3ARBD 3EJSA 4HWUA 4Q0XH 5D1ZA 2CDEA 1S9XB 3MLUH 1T21A 4PJ9C 3NZHL 3DHUA 4ZODA 3KYMA 2HT2D 1PZ2A 3STLB 1QP1A 1DWFM 1DWHM 3EFDH 4NBYB 4Z7WA 5ABEA 3RDKA 3U4AA 3ZKQD 4XXCA 3LPPA 3BUTA 3CFJB 5GZOC 4PLOB 5GGUB 2GK2A 3OTTA 3W9DB 3BP6A 1DR9A 1INEL 5I1DB 4JPVH 4Y2OA 3VFGH 1GZPB 4OD3H 3GBDA 1W3LA 3P4LA 4M6ML 2LTQB 4P3WA 3UAJC 4Y5VA 4NQDB 1P4LB 5FK9A 3IFOA 5C0RH 2D3NA 1JPSH 2Z93B 1HQRA 1JV5B 1KJ2B 5C08A 4WCYH 5EWIL 5FGCE 2FNBA 3WEOA 1UD5A 1CNVA 3EOTL 1H3XA 3MYJB 4HBCH 4JQIL 5F7EL 2XQYK 4ETQB 3HAEH 3MODL 2DD8H 3TZVD 2MMXA 4LSRL 1DQTA 2GJXB 4WENB 2RGMA 5IK3A 4I18A 3ZZ1A 2PWGA 1A4JB 1HVQA 3QAZC 3GHEH 4P2RE 3LCYA 5D1ZD 4C58B 2QADD 4M24A 4EBQL 1CK0H 2C1OB 3I6LD 3WCYA 1VESA 4P59H 3IDXH 4P8VA 5C09B 2J4WH 3VXPB 2XKNB 4JFEB 2VQ1B 5IM7B 3D25A 2X2YA 4AEEA 2HP4A 3DWTA 3S35H 2ZWLT 4LSPH 4LCYA 4ODXB 4RAVB 3WQVA