3VGBA

Crystal structure of glycosyltrehalose trehalohydrolase (gthase) from sulfolobus solfataricus km1
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
550
structure length
550
Chain Sequence
GNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 187
structure length 550
sequence length 550
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgbA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgbA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgbA02
3CFKB 5CEZE 1NDGB 5M7QA 1G94A 3S3PA 1K4CA 3H55A 1BFNA 4TQEH 4C57C 3BIKB 2WUCH 4U1GB 4DK6A 2FATL 4MDJA 5D7JC 1S9XB 3WFEH 1CI5A 3PZTA 1C16A 2Z31D 1BVKB 2AEPL 3GNOA 3DETD 4GG6E 5GZND 5I1GL 4L8DA 1KN4H 1OIMA 1OM3H 4YGVA 2V38A 3Q5TA 2F7QA 1P4BL 4TUKH 5C0AE 3MRPA 5A2FA 3BPLB 5TE7L 5EMYA 3MROA 3IJ7A 1MFCH 3JV0A 4L3EB 4X98A 3LAFA 3ZYJA 2GKIA 4HQQH 4F7MB 1P2CB 5F1OB 2DM2A 3D0VB 4RFEA 4LCIH 4KDTA 3ULVL 1KLUB 1A6VH 3F6LA 4PFEA 5EFIB 4PMQA 2WWKT 2G3MA 1YN7A 3HTLX 2AJUH 4JO3H 4ZAKB 4AYSA 4V2CB 1BD2D 5HI3D 5KSBF 1CWYA 3LDBB 3JWNC 3FB6A 3MR9A 5KBNC 4MZ2A 5CHNB 2YC1A 2NY3B 4CJ1A 3ARDA 4LRNL 3HPJA 1V3KA 3T77A 1U8KA 2BXZA 3FCTA 3AIRA 2G75A 4WFFD 3JV5A 3LOWA 3QZWG 3KPRA 2OI9C 2X1PA 3IVKB 2IANE 2OP4L 2JCCA 4PJ7E 3QDJB 1LP9E 4M4RA 3SPVB 1LILA 3E2HC 2V5YA 5T1KA 5FV2A 3SE8L 3L3GB 5FA3A 5DHVB 3P4OA 4DO5A 5DK0A 5BV7L 1T03H 1IL1B 1CE1H 4OM0L 4S2SB 3O41B 1IC4L 1CDHA 3A6OA 4KRUA 2GSIA 3HZYB 3ARFB 3QIBC 3HE6A 1ACYH 5KN5B 1PLGH 4TVPL 4JZNA 4RDQG 2Z93B 2NY6B 1SY6A 3HNSH 4FMKA 5DT1L 4JANB 1JN6A 2Q20A 1XIWA 3LPPA 2VL4A 1HQ4A 4ODXB 3N06B 5BOZG 3THMH 1AD9B 2E7MA 2PWDA 5GGUA 1Q94B 1JXJA 5KAQG 1P5VA 2ITCA 2OL3A 2C7UB 3OKMA 4CN1A 4MTVA 3MU7A 1QYGL 3IKKA 3IU3B 2OK0L 3IDJB 2EH7L 1MJ8L 5E24E 5E95B 4PCSA 5SWSE 3QH3A 5INCA 1E6ZA 3RWCB 3ZSTA 1GL4B 4TPRH 1A22B 5DSCB 1IAKA 4PJDF 3BKYH 3WL9B 1JNHA 4PUDA 4KU1A 4L3EE 4RZCA 5KANG 4BSVA 2NR6D 2UWEE 4F7PA 4YPGB 5JW5A 3ZTJH 2MANA 2G60H 6CGTA 1UR8A 2A6IB 4QTHA 3SE4A 5I16B 3HI6H 1I1FA 1Z5LB 3FQUA 2WBKA 4Z0BH 2NY2D 1IJ9A 3T2OA 2EC9T 2Y06H 4UIMB 3V0AC 1FFOA 3KHOA 3BC9A 4OQTH 2CBIA 1QBLL 1B0GB 3QIUC 2ICWB 2PXYC 4OUEA 3SGDH 3SDAD 2Z8WC 1BBJA 4Z77B 4QFUA 1G7LA 4UQ2B 2IADA 3QO0A 1R24A 5TDOA 1U3HA 2D7TL 1AKJA 2ARWA 1T7VA 4HJJH 2LAAA 4W89A 3K1KC 1JK8B 4D6JA 5L2KD 1YY8A 4JG0L 4RMWA 4KK8D 5E8OB 1E6OL 5HI3C 3VJ6B 4UBDC 2CKBL 3ZHLA 3SKNB 2J8GA 2A6KB 3FB5A 1ZJBA 3QDJE 4GQPH 4IRJC 5IQ7L 4I5BB 1TUXA 1X5GA 2VNCA 1FCGA 1FG2A 2EDTA 8A3HA 4Y4FB 1HTYA 5CZXC 3NCJL 2H32H 4HKXB 2J6EA 3C60B 3DX7B 3VXMD 5JMOC 5L2JB 2VMFA 2WINA 1GIGL 3HZVA 2C3VA 4JB9H 4L9LB 4CD5A 4GW5A 4P2QA 3A67L 3UCRA 1TQBC 5I71C 3TO4C 1WFOA 4LCWB 3UYOD 4KTYA 2DDQL 1S5IH 4R96A 4K3EL 4XVJH 3WF0A 5I0ZA 3MMWA 5EOTA 1BFOB 2TAAA 5FYKD 4WW1B 4HGWA 3RZCD 2ATKB 1I8IB 1FSKB 1M4KA 5GGSA 3IFNL 4TULL 4U1KA 4EEEA 2ZCLH 3HB3D 3LVEA 2YKLH 3H6JA 1ZMYA 1OLLA 5F3BA 3HG1A 3RL2B 1H3XA 2AK4D 2NY0B 4Y19E 4BSWB 3W39B 2QMJA 3G6DH 3VXUD 3QYCA 3UTSA 3WUWB 4TTUA 4FFYH 3VSTA 1KJ2L 1E1EA 4OF6A 1XGTB 3WD2A 5DJ6B 3RZWA 2HWZL 5JHDD 4G42A 4P7OA 2XWDA 3MO1A 4UNTA 3QPQD 2WWDA 1MCOL 4HH9A 2EKJA 5FGCB 3IETB 3E6FA 4RAVB 4MJID 4PJ5A 2Q76A 2HFFA 3AXLB 1CXEA 5F72S 3DX6A 4X5LA 3S5LA 1YZZA 3IFPB 1LO2H 1QA9A 3DV4A 3JZ7A 3UDWC 1T04B 3UJTL 2PI6A 1E6QM 4M9PA 4L4TB 4WHTA 4M7JL 1UKTA 4CADA 2JK5B 1J8HB 2BVOB 3CUFA 3MRGA 2HKHH 4XCNA 3PWNA 4YDIL 3BUYA 4HAGA 5HYIA 3QJHA 1CDYA 3MNVB 4XWOD 5L9DL 4O51A 2R0LH 1OIFA 1XT5A 4EI5D 5D1QD 1UZ8B 3QFDA 3X12A 1RFDL 1DQMH 3A3HA 3QDHA 4DWSC 1OSZA 3P30L 2W0LA 3WQVA 1NPUA 3ZKND 4RWYL 4K7PX 1UZ1A 2APTA 4JFED 4JQXA 4KUCD 5E08H 3TZVC 3WFCL 4HXAL 2HISA 2BOBB 4HKJB 4HT1L 1MCHA 4NBYB 1QSVA 1VFUA 3B9DA 5JOPE 3M46A 1HJQA 1SYVB 5GRVK 4PJFB 5AWNH 1KB5L 2NW2B 4JPKH 3U36B 2AS5M 4KK8C 3PZGA 3TT3L 1P7HL 3LXBA 3UZEA 1V3HA 2FX8L 2X6MA 5DFVC 4WWID 5AYBA 4LCWE 2F54B 5LWYL 4TX8A 3GGWB 3WKMH 3MA7B 3E3QC 1LK3H 2CIKA 3L4UA 3AB0C 2FH6A 1EOKA 3OMZA 4PR5A 2W0PA 5HHPA 4XHQA 1EDQA 2DH2A 3DXAD 2AGJL 3T3ME 1XF3A 1NAMB 3SDXA 3UZQA 1JP5A 1U58B 2XRAL 2J79A 2LU7A 3G5YB 2Y25A 3VFOB 1JTOA 1E28B 1AXTL 1OCWH 3MCLL 1R3KB 2ZUWA 2BSTB 3DO3A 1HIMH 1MELA 5F7WC 1JG9A 4PSPA 3DSFH 3N04A 4FQCH 4M7ZC 4X9FA 3RZCC 1MW2A 1H1NA 4ONOA 3WFDH 3CZKA 1QLEL 2R2EA 1OPGL 1KQZA 3HB3C 1I75A 1H0IA 3GSNA 5SWZA 1H4PA 1RAMA 3WIHL 3BP5B 4MDPA 3QUZD 1U3ZA 3QZWA 1BGXL 2L4OA 1GCYA 2LTQB 4FOMA 4ORGB 3W37A 2ZP0T 4KDWA 3WFHB 4JFFA 3ZKMD 4XB3A 5TDPB 4AMCA 3V7MA 2R2BB 4L4TE 4GKZA 3CIVA 4ZENA 4CVXA 4ZMAT 3GRWA 3QPQC 3UERA 1J8HE 3DX8B 5E5RB 2BY1A 4KJWD 1XD1A 5CUSH 4KRMB 3CVHB 1ZE3C 4JVWA 1CLVA 1LWJA 1UOKA 4QXUL 1V3JA 3GHEL 3FMGH 4GPNA 1LO0L 2GCYA 2DYPD 3RIFK 3BEWA 5IUSA 2NX5A 2ZOLA 2Y7QA 4YPJA 1REIA 5DRWB 1LE5B 4WEUD 1FN4B 5KS9F 1UGNA 1EUTA 3BZEA 4OKDA 1OAXL 4YEFA 3B6SB 4I4WB 4C83A 2HVKA 2HT4D 4FNRA 1T6VN 5JXEC 4XWOC 3GXIA 1MWAH 4EI5C 4PY7A 1G1YA 4LSVH 4PJFE 5D1QC 4UNIA 3H7BB 3GMRA 5JLZA 4UU9B 4Q9CA 1JPFB 1IAIM 5E8PA 5F7DA 3MRLB 3SJVB 4DO4A 3U0PA 4QWWD 5I66A 2VCAA 2CD0A 2CGRH 5A8QA 3C6LA 2DT0A 2HFEA 4JEGB 2F54E 3QWQB 2VCBA 5JBFA 2FO1A 3A21A 3TCLA 1XMWA 4UFIA 4WEMB 5D1ZA 2AQ1A 4K3DH 5ISZA 4XCCH 1OGAB 3CCHB 1A14H 2P5WB 5GGTA 4NKMA 1RJYB 2VT0A 2W61A 2LV4A 3BZFA 2GAZA 4P5TB 3UPRB 3UBXG 3DX1A 1A9BA 3OKKA 2XZAL 2H6PB 2RGLA 2HTKD 1C93A 3PWJB 4R26L 4YDJB 3HAEH 1JGDB 3MBXH 4PLJD 2YBRB 3IDGA 2FYVA 1N2RB 4KRLB 1KPVB 3KE0A 1RZ7L 2FJHB 3E6HA 4PJCF 4OLVL 3UO1H 1DCLA 4AYFA 3TH3T 2EDXA 5FF6B 3VW3L 1WICA 5DJDB 4RGMB 1G9ML 4UZUA 1F02I 5C8JA 1DBKL 2N1KA 3MJ6A 1SJHB 3S96A 2XFFA 4E41B 3H9SA 2F5BL 1CLOH 3BKMH 3AVEA 4Y16D 1J9YA 3S9DB 5FOBA 4NXSA 2AJXH 2VDPH 3QXDB 4F58L 4JY6B 1X5AA 1Z2KA 4FFZL 4G5ZH 2BVPA 2FJFA 4TUOA 1FNHA 2FCBA 2CLVB 4H5SB 1W1PA 4X9IA 4AH2A 4H8WC 3O2DL 4OCSH 1R3LB 1YEJL 4AC1X 3ZYZA 3TN0C 4XZUB 3QUZC 4YHNB 3AY4A 5C08D 3VFTB 3OKNA 1BREA 3CDFA 3RFZC 3QSKB 2VQTA 1NBVH 4OIIL 1MRCL 4XBGB 5C2UB 4GBXD 3ZKMC 4LLYA 4XCYB 4OZIB 3B2UD 5CJXC 1D5ZB 1JF6A 4GQ9L 2QQLL 3V6OE 4L8BA 2ZG2A 1G9NH 1UWIA 3L5JA 1T66C 25C8L 4PRAA 1ZV5A 2J4WH 3M07A 2WC4A 3CZ8A 5F93C 3ZDYF 5ABHA 4S1RH 1QBAA 1P5UA 5FO7A 4UQDA 7A3HA 3BD4A 4URTB 3AZRA 5E7BA 4BKLA 1KB3A 1WBYB 5ACMA 3MGOB 3BVTA 3LN9A 5EO9A 1V02E 4I0KA 3TV3H 1WO2A 5AC4A 2GHWB 4Z7UB 5E9DD 5I30H 2F8XC 2HT4C 2D3NA 1RUPH 3DMMB 1B30A 4LU5L 4NDMA 1FGVL 3LQZA 4MNHA 4OF5A 5ANME 3MGTB 5F88A 2NNAB 2JE8A 5F9WC 4MA1B 2FBJH 2YA0A 1L0XA 4O2EA 5DO8A 5F9AC 1H5BC 2VN7A 3LMJH 4HA3A 4NYLB 2UUDH 2Z31A 2OWWA 4G3YH 4UINH 4PGCB 5CP7B 4NQDB 1IEAB 3BJ91 2EDNA 1EFQA 1NGYA 4UB0H 1EO8L 3I2CH 1KLFA 1T0MA 1NBZB 4BM7A 4L4OA 2HTKC 4NUJB 1UWUA 3DUSA 2Q6WA 4UDUB 2ED7A 3EO0B 1HSAB 3UG5A 5A2JH 4EN3B 1KGCE 2HJFA 2X4NB 4M5YL 1ZWIA 3JUYA 4CDHA 5J1AB 5D9OA 5BZDB 4JL1A 1CXHA 1BD2A 4I3RH 1LO4H 5JUEL 3I50L 4PJIF 3EOYG 1UM5H 1KCVH 2AEQL 3FT2B 4BH8A 3EJSA 2VXUH 1IAOA 5I8CB 1T0PB 4AZ8A 3PZNA 1FAKT 4Y16C 5F1IB 4DCQB 4WEBL 1SMDA 1RZGB 3DGGA 4WTZA 3DC0A 1SFSA 2E9JA 3CFCH 3NFNB 4Z76A 3PP4H 5E00B 1HXJA 1AMYA 1UWGL 4GMTL 2IXVA 2XQYK 3O0RL 4OZIE 4KXZH 1R85A 3WKZA 3LQAH 1FV1B 2XOTA 2BFVH 43CAA 2XPGB 2CDEB 1KG0B 4NZCA 2VERN 1ZBKA 1JHLL 3CAFA 2EYTA 3BVUA 4ZUWB 3EYSH 4YAQB 1AJ7L 5D7IF 2F58H 1IGML 4GXUN 4ODHL 5HVHB 5HYSB 1E6JH 1CFSB 2EQDA 5I8KL 1WAAF 3F5KA 4M6NL 2J47A 2PYFA 4DZ8B 1S9WB 2RGMA 2IPUK 3NAAH 2WW8A 5EZJB 1J1OL 4TYUA 4Z7UE 3P11L 3MBED 1NKRA 3EDEA 3G6LA 4AD3A 3WF3A 3WSQL 2X4UA 2DQCH 5BVJA 3VFVA 1RIHL 2DI8A 1ISZA 2WHKA 2I25N 4ZUSB 4W87A 3QNZA 1HHHA 4QXGH 1AGFB 3CX5K 5CBEA 2Q7YA 3MSDA 3QG6A 3C5ZB 4H7VA 3HCVB 2KKQA 2WNGA 4K2UH 5D4QA 1KCSL 4HCRH 3QHOA 3R1GH 1WP6A 4V1DD 1QSED 4PGDB 2OTUB 1JMZA 1CEOA 3VIHA 4HHAB 1VSCA 2ESVB 2X44D 3GM0A 5CJQH 4R2GD 1MLCB 1AI1L 3CX5J 3RNKB 1VGEL 1G6RA 3V6ZA 1MCIA 4NQDE 4BQBA 4C4KO 1MXDA 1WC7B 2DJSA 2HTLD 4XPFH 4JZJB 5L8LB 3KPSB 1MHEB 5D9SA 4DUWA 1E6RA 1SJEA 3U83A 1K9TA 5HPMB 3DVIA 3T3PF 2R69H 3VRLF 3N17A 2W59A 2CIPA 4U1IA 3T65B 2GJXA 3O6FC 4PYGA 5EWIL 1W1TA 1XCQB 2JJVA 1OAQL 3VXQA 4JDVA 4DZBA 4KAQL 1Y6NR 4U1JB 2BFGA 2ZXAA 2FHCA 3OG4B 1E4KC 4KVCH 3OPZL 5HDLA 2Y2WA 3JWOL 4N90D 2F19H 4WCYH 1M7DB 1S7SB 3OGCB 4WW2C 4YH6A 4ZS6C 2R0ZH 1KIQB 2YOCA 1FCCA 3SDAA 3REWA 5DQ9B 4WI5A 4X7EC 1JZ6A 2BNJA 1TZIB 4E5XB 3L95A 4Z7WA 3TT1L 5IW6A 2XN2A 4LKXB 1IM3A 3EYQD 2VDLL 4ZOEA 1PS3A 4OGAC 5C0RL 2DSWA 4DGVL 4JKWA 3WNMA 2E9LA 2DSVA 1Q9OB 3AMLA 4L8SC 5T3ZL 4F9LA 5DJ8B 4JFDE 1ZSDB 1HWHB 4FLOA 4I9WD 4U6YA 3VGHA 2NXYB 2VUOA 2XICA 5T1DH 4YO0B 4BFEA 3PE9A 3RWFB 1MAMH 5EUOE 4X7SH 1C5DA 1KXQE 3UBXA 2QQQA 2NXZD 3RDKA 2O61A 1D9KB 5IFPA 3BQUB 3VXMA 1E6XM 3JBG7 5CSZB 2DT1A 4WUUB 3MV9B 3MLVH 4M1RA 3BH8A 4J28A 4TQEL 2WUCL 4MNQA 4LCUA 3WFEL 5ICZB 5DYOB 5HHQB 1WQVT 1JXKA 1FO0A 1KN4L 1OM3L 4FRWA 5DJ0B 3TV8A 4H1LB 5GRVL 5FOOA 4TUKL 4XGZA 1TTUA 4MHHG 4PN2A 2OWXA 1MFCL 3SOBH 5EIIA 3UAJD 3GSOA 1T3FB 5C0GA 4RSVA 1YNKH 4PJEB 2G2RB 3WBEA 3G08B 4HQQL 3FN0H 3PP3H 2MMXA 1CFTA 1KCUH 3L5XH 4QKXB 2WVVB 2NLJB 3EMZA 3P9LA 1EFXB 4LCIL 2SEBA 1A6VL 1J12A 4QHKI 3QXAB 4DKFH 3L7EB 4W6WB 1DVFB 2AJUL 4JO3L 1F3DH 2EPOA 1GJIA 1GC1C 2Y07H 4TTGA 1HP5A 3VXOA 2BNRE 1VKXA 1JHKH 5JHDA 1A6AA 3VIMA 4BQ4A 2C1PA 2BK8A 4HIIA 4MJIA 2E7HA 1JZ8A 1E72M 3KYKH 4ZFMA 2Y9RT 4QF1B 1L9NA 4NI3A 1BVZA 4U6HB 2PC8A 2YD2A 1WSST 5F8RC 3O9NA 3LKOA 4YBLC 2ID5A 1WBZA 3ALXA 4V28A 5IXEA 2J8FA 4NRZB 4YNYB 1HOCA 1T4KB 4P23D 3ULUE 3FQRA 4FXGA 4J3TA 2WMGA 3U6RA 3QDAA 3SCVA 5A16A 2WSPA 1T03L 4KK5C 1IC1A 1CE1L 1MXGA 4FHBD 3AM8A 1S8DB 2WQRA 4K94H 4EUPB 3W6LA 5E7FA 3LKNA 1ACYL 3ZT6A 1PLGL 5FYLH 3S2CA 2UUDK 1YNTB 1TITA 2R9HD 4GW1B 1P6AB 3FN3A 3HNSL 4LCCC 5C3LD 3EYQC 4ATDA 1I1WA 1ZJAA 1UWXH 5E0FA 2XVGA 3QHFH 4JJ5B 3THML 2A38A 2AABH 5F7FA 5C0DA 1KXVA 3FN9A 4WUUE 3MV9E 4BJLA 2HVMA 4RFOH 4HJ0C 4TVCA 3V52H 4TSAL 3CO4A 2UYLA 1L6XA 4HFWA 3NCBB 4B9YA 4H2CA 1H2JA 1RJLA 4C56D 2JALA 3VG9C 1F00I 5B3JE 1VB9A 3QIWB 5ESVA 4PV9B 3ZJKA 3D5OF 1OCQA 4TPRL 1YYMH 4LYRA 3BKYL 3DXAA 1HNFA 3ZL4H 2FGWH 2X40A 3U79A 1S7TB 3JUGA 4PJEE 3S36X 1C12B 3VGAB 2XI9A 4HWZB 4AIXA 1XF1A 2G60L 1XHGA 3X17A 1UG9A 1ZHBB 3HI6L 4K71B 1E43A 3HUJB 3ZE2F 4NQEE 1BYBA 2G3NA 4Z0BL 1F3JA 4FQ2H 5A2LH 2Y06L 5FUCC 5MP6H 2B8OT 2XFXA 5KEZA 4OQTL 1B4JH 3D69B 3QUXC 1BLNA 4CVZA 1J88A 3HE7A 2WYSA 1AC0A 1AO7D 2EC9U 2JJUA 1NCBH 4HJJL 4JY4B 3W25A 4GIAA 4N8VG 3S98A 4FTVA 1K4CB 4FFWD 2EJ1A 3NBNA 5JOEA 4QRPE 4MDJB 3IDNA 4LPWA 5GISH 1OLZA 1C16B 1B3WA 1DR9A 5A2KH 3MFGB 1CGUA 4QGTA 2NY4D 3BXNA 4KFZC 4LSPH 4YGVB 3TBSA 2B31A 3MRPB 3FY1A 4CMHB 4ALAH 1KJ3H 4U1HB 1US3A 5CXPA 1ND0A 2VSCA 3STZA 1JCKA 2ED8A 4X98B 1YMMB 4JB9L 3RWJA 2HLFD 5MEND 3KEHA 2J8HA 4O4YH 4RFEB 2F2HA 3V7AE 3GBNH 5T1MA 2VVSA 4Z2HA 4YBHA 1S5IL 1YN7B 4QGYA 1X5LA 4XMPH 3ZE0E 4XVJL 4N9GA 3U0TA 1VFMA 5DI8A 5C9KA 1B88A 2DLTA 1PIFA 3MR9B 3OKOB 1XCTA 4X9HA 3KG5A 2YC1B 5CP3H 1VADA 1QFUH 1A6PA 3ARDB 1MQQA 2ZCLL 3HPJB 1QLFA 3GB7B 2YKLL 3T77B 1U8KB 1IE5A 3UEQA 3FCTB 1MH5A 4P2OA 4AYGA 2G75B 5ABGA 4D0DA 3KPRB 5KSAC 4UV7H 3G6DL 5ID0B 5K59E 2JCCB 4FFYL 4HU8A 5EO1B 5T1KB 5C6WH 1YN6A 2QJDA 1E5NA 3PWLA 1BFSA 5FA3B 3WO4B 3BN9C 3P4OB 2V5RA 2BCKA 5DK0B 5D96B 3RWHA 1NGXA 4J8RA 5C3TA 3CZEA 3HUJE 4ODSH 4UDTA 3DX9A 1NWSA 4PJ8D 1WCQA 1A47A 3KXFE 4JGUA 2WZEA 4LFHD 4HOXA 1LO2L 2FGLA 1OTSC 3HE6B 2ZUVA 5DHVH 4JZNB 5JW4M 5EU7C 2D0FA 1FBIH 2HKHL 3L3HA 2CQVA 5C8BB 3OLIA 4BZ2H 4GRLA 1JN6B 1XIWB 1HQ4B 4M8QA 2R0LL 1MRFH 1UH2A 5GGUB 4NQUA 1QW9A 5T3XE 4CD8A 1A6TA 2OL3B 2ITCB 3OKMB 5H35A 4JFQA 5C2BH 1DQML 5FM5M 3T0VA 4TVPD 1BSIA 4U1NA 3RKDC 1ZL1A 5E08L 2G9HA 3NCYS 1OGTA 2IAMD 3QH3B 4RE4A 5INCB 5HDBF 1I8MA 3WV0A 3FHAA 3T0DA 4X4ME 3A47A 1JNHB 2OCFD 4RZCB 5AWNL 4GBXA 4BSVB 4JPKL 4F7PB 4OB5H 4XCEA 5JW5B 3FO9A 2Y5EA 1YMME 5D7LE 1J1XH 2VLJE 3G9AB 4QTHB 43C9B 3GSWA 3FQUB 4NNYA 3BCDA 3S3JA 3QUYC 1HCFX 1QO3A 2CK2A 1W9DM 4LVOC 1FFOB 3CZFB 3WKML 1LK3L 4Y1AD 4RMTA 1TJIH 3KYMA 4JKLA 1BBJB 1G7LB 3DRQA 2HYMA 4PJXE 2IADB 3KPPA 3QO0B 5TDOB 5IVZA 1A5FH 2HLFC 1AKJB 4ZOAA 1PG7H 3VMOA 1L7IH 1YY8B 3D87B 5E9DA 3MZGB 3KPRE 2GIYA 1OCWL 2R1WA 4EKJA 4JRYB 1HIML 3UZVB 3DSFL 3FB5B 4FQCL 3S36H 2CKSA 3NIFE 4Y5YB 3WFDL 5IJKC 1DWHM 5FO9A 3M7SA 4PJAA 1B90A 5C0CE 5KSBB 1AHWC 1E4XI 3W0WE 3MPCA 2COQA 3T04D 3WYRA 4FA8A 1U8PA 3IJSA 1Q6FA 3L4TA 2WINB 3HZVB 4WO4D 5IMOB 3GBDA 3SGEI 2I9TA 4GW5B 1V0KA 1CDCA 1NLBH 2RHEA 3BIAX 4Y4KD 5E1AA 2BMKA 4ZPTA 3V8CA 5BJTA 2OW7A 3BSGA 5BCAA 1S7XB 3I75A 1UZ6F 1TA3A 4R96B 2EAEA 5EFDA 4NIKB 4Q9RH 1BQHG 5EOTB 4NXKA 1EBPA 1WWBX 4HGWB 5CUSL 4PTUA 4KHXH 5TD4A 5FO8A 3FMGL 1GOMA 4HIHA 1KR1A 5GGSB 4U1KB 1UWXK 2BVUA 1NBQA 1KTRL 3TO2A 3HG1B 2EO9A 2XZQH 2DQHH 4WV1C 5HI5D 1IC5H 1DBJH 5IM7A 4HPOH 3QHZH 1T7WA 2DEPA 3OAYH 4P46C 1EA9C 3UTSB 3HMWH 2MKLC 2OYKA 2M1KA 1QW8A 2DQDH 1MWAL 2Z9TA 3BPNB 4G42B 1FAIH 4UQBA 3MO1B 4LSVL 3X14A 4O00A 4RRPG 4HH9B 3E6FB 1KEMH 4PJ5B 2JIWA 2WVUA 4E8DA 3JV6B 2Q76B 5KVMC 2HFFB 2CGRL 3OLEA 4BFIA 2BNQD 3VXNA 1GOQA 4J3SA 4L4VE 1G9NC 3DX6B 3VXSD 3S5LB 1MSPA 1QA9B 3DV4B 2DMKA 2VABA 3THCA 1M04A 2VKXA 4F7CA 5GNYA 2XTLA 4KK6D 1MRDH 1U8MA 4K3DL 4XCCL 5EC1A 4CADB 2IWGA 5C70A 4UAOB 4D6IA 1A14L 2KDGA 3MRGB 4XCNB 4CVWA 3PWNB 4AZCA 4J12A 3BUYB 1UYQA 4HWEH 2EE6A 4TNVF 4O51B 1C8YA 4WI2A 1B3VA 3MBEA 3MBXL 3CSBA 3QFDB 5JORA 1T22A 1JD9A 5IMKA 1OSZB 4JRYE 2VR5A 1H9VA 3UO1L 3ZYIA 3IDMA 2W65A 4R0LC 2N7BA 1S7UA 3VSVA 4LQFH 3L3JA 2IMMA 4N8VA 1U8IA 1QSEA 4F15B 5KSBE 2QKIA 3RPIB 1R7AA 1RK0A 1CLOL 4LSQH 3BKML 3DPBA 3OZ9H 2AJXL 2VDPL 1BPVA 3G5ZA 1G0XA 4Z8FH 4HUNB 3PWPD 4G5ZL 2CR3A 3RBSA 1KBKA 1UA6H 3K4AA 1JRHH 2BVEA 4KI5D 2ZPKH 3QUMH 5CIPA 5HD8D 1T0NA 5MEQA 2GTZA 4JHZA 1WIPA 4OCSL 3RVTD 3GMOA 1DN0A 2CIKB 2EH8H 5IWLA 3U7VA 1A9EA 4PR5B 1GNXA 5HHPB 4M56A 4P2RB 2WMKA 2E7BA 1FHDA 1NBVL 2ZSVA 3W82A 1F6LL 4QOKA 1XF3B 3SDXB 1CICB 4Y4KC 4X8JA 1L4IA 3HG1E 2X4SA 3D5HA 5A1AA 1E0WA 3WD5H 2JJTC 1ISXA 1G9NL 2EXWD 4U1MA 4LFHG 3LKPA 3TBTB 1YUHA 3SKOA 2J4WL 1N5YH 2EADA 1I1XA 2BHYA 2J75A 1NAMH 5DTFA 1FNLA 5HJ3A 2YFOA 4PMUA 5A6JA 2R2EB 5DGQA 3RA7H 2AXGA 1NMBH 4S1RL 1GRWA 5GSRB 3GSNB 5SWZB 4Y4HD 5A2AA 4X0NA 1XV8A 3QRGH 4PJ5E 1PQZA 5HI5C 5E03A 3DYMA 3TV3L 3LQAC 2BP3A 5DA4A 1QPPA 3LPGA 2MOVA 4PRHB 2ESCA 4FLQA 3WUGA 5I30L 4JFFB 1RUPL 1FORH 1JNNH 1M7IA 2VDQH 4GKZB 4MB1A 4CVXB 1P6WA 1J0HA 4N0UA 3MQIA 2P7TA 3TJHD 3WBAA 3OX8B 2IMNA 4Z7VF 4PMVA 3MCG1 5J12B 2FBJL 3HZKB 2VR4A 2AI0H 3CHEA 2GCYB 3BEWB 1VCAA 3LMJL 3F5WA 4O58H 4FZ8H 2YK1H 1YEIH 3MLWH 4G3YL 4UINL 5L8JB 1ULVA 3QEHA 2ZOLB 2Y7QB 1CZ8H 4IRZH 5TF0A 4LHUG 3CFIC 1XRVA 4YHIB 4FQ1H 1R33A 2O5XH 4UB0L 3ZHKA 2O9OA 5B21A 3RMEA 3K2UH 3I2CL 2HVKB 4C83B 4D8PA 3ZJ6A 3Q6FA 3SCOA 4PY7B 1N4XH 3MRNA 1MW0A 5C7XH 3GMRB 5JLZB 3EJQA 4XI5D 4GKSA 5E8PB 5ELIA 5F7DB 3WJLC 4BZYA 1ZHNA 8FABA 3U0PB 5I66B 4AIEA 5D7SH 3CMOH 3ZDZF 4JQVC 3C6LB 5TQ2H 1IRAY 4ZUUA 3MTRA 4HKBA 1FNSH 4QRQA 3LS5H 4I3RL 1LO4L 3IYLW 3VI4E 4OZHA 1Z6JT 1UM5L 1KCVL 4PRNA 3TCLB 2YL8A 5SV4A 3AHXA 1R87A 2VXUL 5D1ZB 1U8QA 5ISZB 1W8OA 2DIAA 5ALCH 5BXPA 2D0HA 4P2RE 4APQD 4EVNA 5CEZD 4NKMB 4A3YA 3SCRA 3VWKD 3CFCL 1KNOA 3BZFB 2GAZB 3RVXD 3PP4L 1VEPA 2NMSA 1I9EA 5E4EC 4XBPA 3SDXE 1A9BB 1E6NA 3UETA 4MXWH 3OKKB 3KPQA 1NUDA 3RVTC 3T2PA 2P42B 3ABZA 3CHCA 4LX4A 3LQAL 5KTEH 4D1IA 3IDGB 4ZNEE 2BFVL 4R97C 5C0AD 3E6HB 4YHLH 2X1WL 3EYSL 4P23A 1I3RB 2F58L 3ULVF 2IALA 4LKCA 5EORH 5C8JB 5SWZE 3S96B 1E6JL 2OWCA 1S5HA 5FOBB 2ICWJ 2IF7A 2EXWC 4L3CA 3NAAL 3VTRA 4PRHE 1CN4A 2FJFB 3MNWA 4TUOB 2NT0A 4JFFE 3QO1A 3MUIA 4AH2B 2DQCL 1VBRA 3BGAA 4QXGL 1FNFA 2L7UA 4Y2DD 1B0IA 1UCBH 4K2UL 4HCRL 3PHOA 3MSGA 2X4RA 3R1GL 2VSDA 4G8EA 2F7RA 2F8QA 5INDA 2JB5H 5T5NF 1S3KH 3ILQC 1NMCC 5I6SA 1AFVH 5CJQL 2FLBT 3H7LA 4LLYB 4OGYH 2V7NA 4AIOA 2IAND 2QPUA 1JPTH 2AOSA 5KAQF 1SQ2N 4L8BB 1BQHA 5IVXF 1IEHA 5GNXA 1OP5K 1DWFM 1QNPA 1IZKA 5ABEA 4XPFL 4PRAB 3JTSA 4D9LH 2FBOJ 5HHVH 3WFZA 2R69L 1K8DA 3OAYK 2CETA 4LDEB 3SBWA 4WSJA 4H8HA 5FO7B 5FEBA 1WK0A 4G8IB 4BKLB 1AQHA 4NRYA 4YHKH 1CIUA 5EO9B 4KVCL 3UTQA 1MFAH 3EFFA 3GUTA 2F19L 4WCYL 2DIEA 2LVCA 1Q6DA 5M03A 1I7RA 2R0ZL 3HJEA 1MUJB 4NDMB 1FYHB 5ISZE 4RRPA 3LQZB 3ARRA 4XI5C 5KS9B 4MNHB 2DT3A 1AO7A 5F88B 3SCMC 3TWCH 4PUBH 4Q9BA 4XTRD 1U2HA 2F7PA 4O2EB 5CEYA 1DQJA 1GW1A 5AYQA 3VD5A 3MMEB 3TA3B 1UWRA 5SWSD 1XGYH 4KHTH 3JWDH 5EO0A 5T1DL 4APQC 1MAML 3D1MC 3S35X 4WKAA 1BYCA 3VWKC 4L3ED 4R4FH 4X7SL 2DLGA 1T0MB 1H8SA 3T1FA 1F6FB 4WGWB 3MLVL 3DUSB 2Q6WB 5JBDA 2AXFA 5IV2A 5GS2D 4KQ3H 4XCFH 3WNKA 2HJFB 2VLKA 1TQVA 1ZWIB 4ZAKD 4U2ZA 1HHKB 1RJCA 3GBEA 2X70A 1BD2B 1PZ3A 3DECA 4BH8B 3B5GA 2WBWB 1Y18A 1IAOB 1ES0B 2P43B 3SOBL 4UTFA 5CJ8A 3DGGB 4NO0A 1YNKL 3FL7A 3BHBA 5GRZA 4PG2A 5FD0A 4Z76B 1MCSA 3FN0L 4M93B 4NCDA 2RCSH 1KCUL 4LBEB 3L5XL 2A77H 3AFLA 3TH4T 5FKAA 3G5XA 4XB8A 4DJMA 1JWMA 4WI4A 5D5MF 4DKFL 2ENSA 3U1SH 5J11B 3FOMA 1S9YA 43CAB 2Y07L 2NZ9C 1T2QH 4U0QB 1JHKL 2H2SD 3DX2A 2EYTB 2MFNA 3HZ3A 4LXFA 2BVTA 3OHXA 5IJVA 1WDSA 5DK2A 1N7MH 1GZPA 4QHUA 2BJMH 3KYKL 4PG9A 3AROA 4U2YA 4EDWH 3BT2H 1FZMB 4PJ8A 4Q6IC 2PYFB 3D39E 2E9WA 2EIEA 2ZUXA 1JF5A 4RGOH 2WHLA 3KYOA 4CUCA 2NY6D 5F7YC 4RMRA 4NZUH 2X4UB 3ZR5A 3VFVB 3OGVA 4YXKH 3QNZB 1HHHB 1BJ1H 4LOUC 3BH4A 5CBEB 3VX0A 5KS9E 2Q7YB 3QG6B 1J11A 3EGSB 5EU6B 1A4KA 1T5WA 4JAMA 2UY2A 2VX4A 1QG3A 1G7QB 5AEAA 4V2BA 3ECBA 4XC3H 3TA9A 2XTJC 4JY5H 3EHBC 2DTMH 4Y19D 2BSRA 4K94L 4MMXC 1AQ0A 4OKVA 3FONA 3IFLH 2F8OA 2YUZA 3EBVA 2KQMA 5FYLL 5JDSB 2IAMA 2RQ8A 5EZOH 2WMHA 1N6QH 5C1MB 4XTRC 3HFMH 5D9SB 3HC0A 5F9JA 1SJEB 3RUGF 3QHFL 5EDXA 4UFJA 4U1IB 2AABL 3SGKA 1X4XA 3MRMA 2GJXB 4B3KA 4N5EC 2D31A 3VXQB 4JDVB 4RFOL 3H42H 4DZBB 2HT2C 3V52L 3O2VH 3WDQA 2NY2B 4LHUA 1H3GA 4HK3N 4OD2A 1CBVH 5LKNA 4KKCC 1JFXA 3H9ZA 3J7HA 1FYTE 4Y1AA 1UR1A 2AW2A 2UZYB 4PB9H 2D22A 2I9LA 2OS7A 4LNRA 3W11D 4XNYH 2PTTB 5IB4A 3SDAB 3REWB 2CHNA 2AERT 1YYML 1E4XH 3UYPA 1BWMA 4PJCE 3BSZH 5DRXA 1Q8MA 3L95B 4Z7WB 3ZL4L 2FGWL 2D7QA 5I1CH 5IW6B 5FKYA 1MHHB 1G7HB 1IM3B 1GOOA 5E2WH 4M8VA 2NW3B 3LDBC 2XIIA 2CDFA 4FQ2L 3U7AA 1A1OA 5MP6L 2QL1A 5T33H 4LEXH 1B4JL 1EXUA 4U6YB 5D2NA 3UP1A 1FDLH 2NY3C 3P0YH 2GJZA 5GJTH 1NKOA 4X6CF 1C5DB 1OARH 3UBXB 5DQJA 2O61B 4C54A 3H54A 2DKSA 5SWQA 3C8KB 4OFKA 5E8NA 1ZAGA 1NCBL 3GH7A 3NCFB 4WWKD 3BH8B 4WO4A 2CKBA 4JL2A 4HIEB 5FIEA 1UVQA 5GGRY 5ITBH 4MNQB 1FNEA 3X3FH 2O26U 5A3ID 1UYWH 4UZGA 1HINH 5GISL 3WIFA 4AEIH 3P9WB 2Q7NA 1UC6A 1GAFH 1UD6A 1GVYA 5IGXH 3ES6B 3EDFA 4LSPL 4GQRA 1N26A 3H3BC 4XGZB 4ALAL 1KJ3L 3CFEA 3MODH 4R8WH 5EU6E 5EIIB 1BOGA 5FM4A 5TFSH 3GSOB 5C0GB 3KPNA 3ARFC 5BWFA 3EDDA 3O9WC 3ZYOA 5IHUH 1CFTB 2NY0D 2NY6C 4JKMA 3WHXA 4E0RA 2YXFA 4H1LH 4O4YL 4E8CA 2SEBB 1T83C 4PUEA 3GBNL 1TQSA 4DGYH 4XMPL 4XNUH 4KGLA 1NANH 2H2PC 4OFIA 3VXOB 1WV7T 1VKXB 3LH2H 3MLYH 3MXVH 5JHDB 1OWWA 3WJJC 3ARQA 4CW1A 1NBYB 1A6AB 1LGVA 5DMYA 2C1PB 5IBTH 4DOHB 2DSUA 3U46A 4MJIB 1QFUL 3U0WH 1PDKA 2D9QB 4OIAA 2BNQA 3RVUC 4E4PA 1OTUD 3VXSA 4CRPA 4LLMA 4MJ5A 5D6DA 4AD4A 1KJ2A 4UV7L 5EC2A 1CD1A 1J8HD 3LKOB 3MRRA 1TIUA 3VFUA 1GOIA 3EO1A 3O3UN 1HOCB 1PYWA 2RBLA 3FQRB 4FXGB 3U6RB 5A16B 2AEWA 1V6WA 1BEYH 2VUYA 4HULB 5K9QG 1UB6A 2ITDA 4PY8J 4ODSL 4TVSa 1Q9WA 4ELMF 4PB0H 1XSIA 2AXJA 3CZNA 4OCXH 2OSXA 4GINA 3LKNB 4IRSB 4G6JH 1K6AA 3DYPA 3WENA 3RWDA 1FBIL 5KOMC 5FGBC 1OTTD 5A8OA 1YPZA 3PDGA 4BZ2L 1RZFH 4EUPH 3V5HA 5C0DB 4XH2A 1MRFL 1GGIH 3PWPA 1F2XK 4HUXA 2F54D 4MNQE 5C2BL 2UYLB 4HFWB 3TC9A 4JCMA 1WAWA 1RJLB 3SO3B 1PZ5B 4Y4FC 2CESA 2XKNA 2H45A 3C60C 4I0PD 5ESVB 3G6JA 1QSZA 4HH8A 5K33A 1HYSC 4L9LC 3EJTA 4Z7NE 5CZVH 3TVMD 1BQUA 4NT6A 5HSFA 2EDRA 4FQIH 4OB5L 4U3CA 4X4ZA 1A3LH 1J1XL 5ERWA 1G9HA 5F1NB 4HPGA 1NCAH 2FHBA 5JR1H 1JF1A 2APVA 2XFXB 1FSKC 4WDIB 1TJIL 4RNRA 1ODZA 4MA7H 2GQHA 5E1HB 1BLNB 4CVZB 3BDBA 2ZX9A 3C8DA 3HE7B 4DOHE 4Y4HA 3BVVA 1A5FL 1UHVA 2B2XH 3QI9A 3ALWA 1WVZA 1B2WH 3CFDA 3VA2C 1PG7L 4F9PA 2H9GA 4FTVB 1L7IL 2ZG1A 3RNQA 3O3EA 2APWA 2I07B 3DHUA 5DVOA 1JMXA 3IDNB 4K8RD 4KQ4H 5D70H 4MB3A 1I1YA 2LFGA 4WI7A 3S36L 4OV5A 1UD8A 5FUZH 4XNMA 4M6AA 3HR6A 3TBSB 1I8KA 1A8JH 4RE2A 3NSNA 2F7OA 2Y5TA 1J01A 5BS0E 2GEEA 1EIBA 4KUCF 1JDCA 3STZB 2XG5A 4LIQH 4YZFF 3VRLE 4YHMH 3ARZA 3RWJB 4U6XA 1MW1A 3AC0A 1NLBL 3PZOA 3C6SA 3LY6A 5IB5A 1LK2A 5T1MB 2IBZY 1BJ1J 4WENB 3V4VH 4POYA 3FRUA 4Q9RL 3U0TB 5DI8B 5MEOA 2DMBA 3WNOA 4B0MM 2LU3A 1W3KA 3NSMA 3OGRA 4BUGA 4KHXL 3MNZA 4NC1E 3KVQA 4M29A 3MRKA 1QLFB 4I8DA 3KL5A 1MH5B 2MWCA 4FXKA 2V2TA 2H3NA 4P2OB 2XZQL 5ILTH 2DQHL 1R6VA 5E6ID 1IC5L 4D0DB 1DBJL 4HPOL 3QHZL 3C9NA 1C08B 1DBBH 4A2LA 2EZ0C 3GI9H 4JKPH 3HMWL 3QULA 2DQDL 1XCWA 3DURA 3RM8A 5EBWA 4P9HH 1FAIL 3OLGA 1YN6B 3IT8D 3PWLB 3TGXA 4AIZA 4D0BA 1SEQH 2BCKB 1IARB 3MV7B 3RWHB 1NGXB 4EI6A 4XUYA 4J8RB 4GG6A 1P7QD 4NNXA 4UDTB 2DIBA 3DX9B 1EHLH 5D7KE 5K9OA 5C0AA 2JFEX 1E4NA 3TBYA 4YFLI 1FVCA 4BUHA 4YK4B 5IEHB 1CTOA 4IMKC 1MRDL 2VL5A 1NQBA 1CGWA 3MRHA 4GRLB 3VWJA 1EQCA 1EH9A 3NVQA 4M8QB 3NPZB 4HWEL 2QQKH 1KGCD 2GDVA 1Z32X 1NP0A 4FTVE 4G6AC 3NCYP 4MD0A 4PGBB 1A6TB 5H35B 4JFQB 3A24A 4PLNC 1JGIA 1UKQA 2X0YA 3D0LA 4U1NB 3ZT5A 1I1AD 2G9HB 4Y2DA 3EFDH 1E56A 4RMSA 4LQFL 2LTQC 4MAYA 1I8MB 3D3VA 4QLKA 4Y2OA 4U5KA 4LSQL 4GBXB 3OZ9L 1VBUA 5BXTA 4XCEB 3CFJA 4Z8FL 3GSWB 1UA6L 3PV6A 2C4FT 1TZ7A 1BTCA 1LP9A 1JRHL 1QO3B 3VFWA 5IFHH 2ZPKL 3QUML 4M1GH 1HKIA 5DR5H 2VRKA 4M02A 2EH8L 3RDTC 5IMLA 5J57B 4LRIC 5DJCA 1WWWX 1O7VA 1JVKA 3KYMB 2D0GA 4KVNH 3DRQB 3KPPB 5IVZB 2R1XA 2ED9A 3MJ9A 5HXMA 1ORSA 5IB2A 2PF6A 5E9DB 3DMMD 4HG4K 3WD5L 4LHQB 2QSCH 4BELD 3MLSH 3AZTA 4WI6A 1N5YL 1HH6A 1MCWM 2FSEA 1NAML 5FO9B 3RA7L 3C87A 1QI4A 4PJAB 1NOFA 3TPKA 3D52A 1NMBL 4H0HB 3BIKA 4HG4J 4M80A 4OF8A 2OTPA 3MV7E 3QRGL 1U8OA 1BYDA 1U8PB 3HRZA 1BM3H 4NQDD 1F2QA 2NY1D 2I9TB 3QFJA 3STLB 4D6HA 2CLZA 4Y89A 5SWSA 1TCRA 3A0OA 4ZPTB 1FORL 5E1AB 5BJTB 1V03A 1JNNL 3I75B 4P5TC 2VDQL 5DD5H 2VKWA 1TZHA 4ODWA 3O3AA 1E27A 2UWEA 1N82A 1FZJA 2IH3A 2V2XA 1AE6H 2EE9A 4PTUB 5BRZB 3AS0A 1GZQA 3BMVA 1P2CA 3LEVH 5FO8B 2E7LA 2AI0L 1ZANH 4HIHB 4EN3D 1A3RH 5I76A 2VX5A 3WDPP 4KC3B 4NOFA 4O58L 4ZAKA 4FZ8L 2UY4A 2YK1L 1YEIL 3MLWL 4JM2A 2DQGH 5SV3A 4RGMC 5HNNA 1CZ8L 1X44A 4IRZL 3P2TA 2R39A 2ZCKH 5IM7B 5DJYA 2EEBA 3HPLA 3RTQD 4FQ1L 2O5XL 1EHXA 4EANA 3EOBA 3K2UL 2F15A 3KPTA 3NFSH 4OLXH 5LXGH 2BVDA 3IJ9A 1A7OH 5HYJA 1N4XL 4MVBD 3X14B 1GOWA 1P9MA 3PXHA 3NN8A 5C7XL 2G4FA 3SUWA 4PJBF 2HH0H 1MCPH 2VX7A 5D7SL 4JFDD 3CMOL 2J8UF 4M7LT 2QSVA 5TQ2L 3VXNB 3SCNA 1FNSL 3LS5L 4F7CB 4G43A 4NPYA 1U8MB 1BECA 5EC1B 5ALCL 1HQRA 5IBLC 2CUMA 4HW6A 4HZ6A 1XH2A 4XP6H 4AZCB 1KPUA 2E6PA 4YHEA 3HHRB 2BX5A 4MXWL 1ZLVH 1P6FA 5DZOA 1FVDB 1LL7A 3AI0A 5KN5A 1DLHB 2QADB 5HBBA 5KTEL 5JORB 3WN5A 1LWHA 1T22B 3VFGH 1E5JA 2VXSH 5IMKB 1UA3A 4JANA 4FLRA 4YHLL 4JLRA 3CDCA 1JPGA 1OY3B 3IDMB 2W65B 3ZKSD 1TQUA 1S7UB 2VVNA 3W38A 3F7YA 4PJAE 1Q94A 3L3JB 5EORL 3VIIA 3WQ8A 4N8VB 1U8IB 1QSEB 2C7UA 1RK0B 4WW2F 1EEUA 2QR0A 3LPFA 4R2GB 3B9KD 3G5ZB 4Y19A 1LD9A 3WSUA 1CXKA 4UT6H 3N1FC 3UR8A 4N0CD 1X5FA 3JWDC 2BNRD 4MA1C 1DBAH 4WU7A 5CIPB 1MOEA 2X4PA 5MEQB 2GTZB 3RX8A 5DFTA 3GMOB 5DHXB 1DN0B 2Z92A 1ZVSA 3BRDA 4OZGF 1A9EB 3ESVF 3LRHA 3VDHA 1UCBL 2HG5B 2UVEA 5BRZE 2DLEA 3RVWC 4AWEA 2FO4A 2JB5L 3ZO0A 1S3KL 2ZSVB 3VGDA 1DANU 3FFCB 5SX4I 4QOKB 4UIMA 4UQ9A 2PW2B 4MPKA 4OGYL 4X8JB 4OOZA 1JPTL 5ADPH 1LE9B 5EA0H 2YBUA 2QV2A 2X4SB 1VF8A 2WMIA 1VHPA 4U1MB 2HRPH 4KK9D 3LMYA 4LDOB 2AJSH 2DWEA 1YUHB 3SKOB 1EO7A 2A0LC 4D9LL 2FLRT 3LN5A 5HHVL 1U8HA 3SDCC 4EN3C 1RZIA 1MQKH 5I6XB 3TIDB 1JWUB 4U31A 3HI1A 3LXAA 5C09E 2XIBA 4P4KA 4YHKL 1PQZB 5C0ND 2DDXA 1GORA 3BCFA 1ZU8A 4DKEH 3RIFF 3NFPA 2NXYD 4Y5XA 1MFAL 1OD7A 1K85A 1E6PA 3OZPA 1RZJH 4I3SH 1M7IB 3GSNH 4HDIA 3ARED 3CUHA 3VCLA 4N0UB 3VGEA 1ZGLA 4HKXA 4JG1H 4NSBA 2NXZB 3DX7A 2P7TB 2CNCA 1HI6A 1JNLH 4F57H 1AQDA 2V2WA 3TWCL 3MV9D 4RL3A 3PUCA 4PUBL 2EPMX 1YYLH 4Q9QH 4KRTA 4WWKA 4XHJD 4PJHA 5EIQA 2GK1A 4HMEA 5GRUH 3WD4A 5FYJE 3F5WB 1X5HA 2ADFH 3GRWH 3SE3A 3QEHB 2EDEA 2IQAB 4XBEH 3O4OB 1VENA 1OP3H 4FQJH 1BFOA 4XNQB 5HVHC 2ALWA 2ARJQ 4KHTL 3JWDL 5LGHH 4LF3A 4M3JA 1R0AH 3VGBA 2ATKA 4AD2A 4Q58C 4R4FL 1BZ9A 4YBQD 3V4PH 4WHDA 4D8PB 2XV6B 2Z91A 3Q6FB 4P8VA 2X2JA 2A9MH 5IVOA 3AIBA 4LYPA 3MRNB 1T7XA 3QISA 4NQED 5A95A 1EFXD 4U3HA 2CMRH 4GKSB 8FABB 1ZHNB 3QXVA 1QFPA 3W39A 4KQ3L 4XCFL 1IZJA 1DVFD 1J87A 1XH3A 3C5ZC 3QEGH 2BHUA 4ZUUB 4HKBB 3BGFB 2PCPB 4QRQB 1GZJA 1PBGA 2X89D 4OZHB 1NOWA 4HS6A 4PRNB 3GSQA 3CXDH 3T09A 4EVNB 4NP4H 1HXYA 5JPNB 1KNOB 1C7TA 1MNUH 1FFQA 2L7JA 3FFCE 2X4OA 1UENA 2RCSL 4QOKE 2DJUA 3JSSA 4QRPD 2A77L 4XBPB 4N0CC 4NHCH 2WUBH 4JZJC 3KPQB 4QRRE 1MAKA 1W0VA 5HOSA 3N1GC 5ICXA 1NGPH 3NMEA 3U1SL 1U91A 5HHMB 3EJZC 5CINH 4NFCA 4DKAA 1T2QL 4QTIH 2X2HA 2B20A 4JFOB 1NUFA 3D18B 1A0QH 4P23B 2WAGA 1LDPH 2BZDA 5KSUA 1P4IH 1UJ3A 4F80A 1T1XA 2IALB 4LKCB 1UZ6E 2PWGA 2WAHA 1HKKA 1JJUA 1N7ML 5I2UA 1QD0A 2BJML 1E4IA 1QFHA 2OMNA 4EDWL 1T1ZA 3BT2L 1S5HB 32C2B 1KQYA 1GOKA 4L3CB 1ISWA 4KK9C 1OM0A 3UTPE 4RGOL 4I9WE 4LPXA 3ULUC 2EIZA 4OI8A 3QO1B 3BAJA 3Q48A 4JHAH 5DRZA 4IHOA 1TQCC 1J0YA 4NZUL 4I2XE 4LCYA 1LQ0A 1TNMA 2OXGA 4YXKL 1RU9H 1SYVA 1ZHLA 4N0UE 3QUKB 5DGRA 4ZO7A 2WIIA 2X2IA 4EIZC 3PHOB 2X4RB 4S1DD 4G8EB 5INDB 1HJVA 2NXYC 4WGVB 3PTMA 3P4LA 4XC3L 1Q9KA 3EZ8A 3NACH 5CILH 1INQB 1TXKA 3MA7A 2DTML 3OR6A 4JY5L 2V7NB 3ZM8A 2V9QA 3QIWD 1AGBA 3OQ3B 3IFLL 4FP8H 1D9KC 1BQHB 4M61B 4I0PA 3BQUC 3L5WA 5EZOL 1N6QL 4NKDB 2P47B 3HFML 2DB8A 3JTSB 1EVTC 3K80A 4WFGE 4XHJC 3RX7A 4CN6A 5IF0A 4GO8A 3TVMA 1U58A 4XAKE 3BXWA 5KOVC 1KT2A 3H42L 4UOW0 3KXFD 3O2VL 4NRYB 4P5KA 2Q8BH 2EXOA 1CBVL 3UTQB 3EFFB 3GUTB 3RX5A 1EQPA 2E3ZA 1QFWH 4YBQC 3CX2A 4PB9L 1I7RB 1HZHH 3EKCA 4XNYL 1CTNA 1MREH 4OF3A 1E4XL 3BKJH 3BSZL 5I1CL 3D9AH 3VIFA 5FDYA 1K2DA 5IEKB 4ORGA 3FXYA 5T3XD 1DVFC 4KRPD 5E2WL 1CD8A 4R5EA 3O2WH 3RGVD 1DQJB 2GK2A 3BAKA 3F6IA 1CL7I 4QY8A 4ACZA 3HC3H 2VZOA 5HHME 5T33L 3BP4B 4JJHA 4H26A 4LEXL 2NY4B 4UILH 1FDLL 3P0YL 1TTFA 3AISA 3IJYB 3O81A 4M7LH 5GJTL 4NN6C 5D93B 1OARL 5DVNA 4WF7A 4ML4A 1I7UA 2V3GA 4UFKA 5CKGA 1E3ZA 1YMMD 5D7LD 1OAKH 1DFBH 2VLJD 4X7DC 3GMPA 2O9RA 1UWQA 3MV01 5AYUH 3V6OA 5TF1H 3ROOB 1PX4A 5HPCA 1LQSR 4HK0A 5IV2B 2VXTH 1RIUH 1NGWA 5ITBL 3X3FL 1UYWL 4Z0XA 2D4FA 2VLKB 2D03H 4AEIL 1GAFL 1Y0LA 3OB8A 9CGTA 5IGXL 3TTQA 2H32A 3BDXA 3BEVA 1Y18B 4KV5F 5D4YA 1MHPH 3MODL 4R8WL 5TFSL 4H04A 4HIJB 4TXEA 3ARDD 3T0BA 3ZE1F 1XR8A 4NO0B 3RVVD 1V02A 2WWMC 3BHBB 2MQ0A 1YQVH 4M03A 2O5YH 4F33A 4M62H 5IHUL 2YIHA 3CPUA 3KPRD 2IBZX 4N68A 2MNUA 5FKAB 1TMQA 1VGKA 5E6IA 1JWMB 4QLJA 2D9CA 5BROA 4DGYL 3CCHA 1WGOA 4XNUL 5IMMA 3FOMB 2JJWA 1XF5A 5ANMA 3S6CA 2DKMA 2DLHA 5T1KD 3LH2L 1Q6GA 3MLYL 3MXVL 2Y8VA 5C0CD 2ICES 1QKZH 3P77A 3W0WD 3F5LA 4OUUA 1JWSA 5GGQH 2NW0A 5I74B 5IJVB 5IBTL 5DK2B 4W68A 4QHUB 3U0WL 2YBRA 1DWAM 4BK5A 1P7QA 2JJSA 4PJ8B 1V6VA 1I8LC 3K1DA 3TYGH 3WF2A 1P7KA 5DO2C 3KYOB 5DJDA 3OGSA 3VI3E 2QBWA 2CLRB 2V9RA 4HEME 4BZ1H 5GIRA 4AIUA 3QNYA 4B15A 2IH1A 3EDJA 4K71C 4WUKH 5BV7B 4YQXH 2KPNA 1BAFH 1A4KB 4JAMB 2XA3A 4JHBA 5A6SA 1BEYL 1K3IA 3IKCA 2J7GA 2CLVA 3P0VH 3FTGA 4X99A 2XNAA 4J3WA 4LLQA 3S8WA 4PB0L 2BSRB 3L6FA 1U93A 2CRYA 3KLSA 4OKVB 4OCXL 3FONB 3BYYA 1I1AA 1NH6A 3NZHH 4G6JL 3D51A 1JYWA 4W4NA 2IAMB 3EUUA 3RP1A 1JYNA 2CBUA 4HA1A 3DI2B 3BLBA 1MFUA 3HC0B 5F9JB 1KJMB 5IHZA 1RZFL 3UMTA 4KTEH 2J7BA 5A2CA 1D5ZA 3MRMB 1G6RH 1GGIL 2AJ3A 4XT1C 2O5ZH 4L4VD 2XWTB 5GS1A 1H8OA 4LHUB 3QHNA 2VLKE 4CMHC 4OD2B 3LD8B 2X4QA 2XN9D 4Y1AB 1V8HA 1O5DT 2I9LB 4LNRB 4NSKA 3BAEH 5IB4B 3PIQA 4OIFA 4KDTC 3GXNA 5CZVL 4FQIL 5D9NA 4CN4A 1A6ZA 3ULVE 1A3LL 3W2DH 2H41A 4OI9A 5D2LF 3DMMA 4JRYD 1F8TH 1NCAL 3PZVA 1AXIB 2CDFB 5JR1L 1A1OB 3OJDA 4CDGC 4HWBH 3CUGA 5D2NB 4Q0XH 3V8OA 2CHOA 3SGDI 3ARDC 1W2KT 4FG6D 4MA7L 3OGOE 2A3HA 3RVVC 4P9HC 1GONA 5DQJB 3HG4A 2B2XL 2D7OA 3CMJA 5SWQB 1SJXA 1B2WL 5E8NB 4AZ5A 4WO4B 2CKBB 1AR1D 2MPAH 4KUZH 1UVQB 2W60A 2XQBH 3LQMA 1FNEB 4HBQA 1A3HA 4KQ4L 4P4RA 5D70L 3WIFB 1E1FA 1WCBA 1CLYH 1ZVHA 3D25B 3WO4C 3D4YA 3ZDXF 1TPXB 3II1A 1T5XA 4K7FA 5D96C 4Z2GA 5D5MB 2HFGH 3GDBA 1W1VA 3CFEB 1BOGB 4EN3A 3KPNB 4LIQL 5F96H 2QHLA 3HE6C 2GJ6A 2Y1VA 3HG1D 1FO0H 4IEFB 5F8QC 5BZDA 2WBJD 3M1BA 4YHML 3FQWA 5GJSH 3WHXB 4E0RB 1GGBH 1OT2A 4H20H 4TVPE 5FYKH 2LABA 3P40A 4WFHE 4JFPA 3VD4A 2DWDA 3PHQA 1XIWC 4KJPD 3RTQA 2A3BA 2CBJA 6FABH 3V4VL 1BAGA 1RZGA 3V0VA 1PFCA 2F1AA 2HKFH 2O92A 3T4AA 3I6LD 4IOIA 4CW1B 4PJ5D 2Z35A 3OXSA 4UOJA 3U46B 4CNIA 5HHOA 1PX3A 4JFDA 2BNQB 4LSUH 1G0CA 4C7GA 5ILTL 3VXSB 4LASH 5J89A 5E2JA 1QOXA 4PIRF 5EUOA 4LLMB 4MJ5B 4ZUWA 3NDZA 1KJ2B 2ZOKA 5EC2B 5JQHC 1DBBL 2C3GA 1CD1B 3GI9L 3MRRB 4JKPL 4K7PY 2O9PA 3UX9B 3VFUB 2WCGA 3EO1B 3OAUH 4AG4H 1KWGA 3SE4C 2EABA 4P9HL 3WEOA 1PYWB 5IHSA 1U3JA 4MQXC 4KY1H 1SEQL 3X11A 5CBAA 3RUGB 4D9RE 1UB6B 2ITDB 5I2IA 4JPWH 1EHLL 1Q9WB 1F97A 1ISYA 1SVCP 2VLLA 5FL0A 3SIMA 4PJGF 5D2NE 3IJHA 1U3HC 5CQ1A 3MJ7A 1H09A 4FFVC 1UEMA 4U3AA 1YPZB 1DUYA 4FQHA 5SX4H 5C6TH 4GI9A 2A6DA 4X6DF 3FB8A 4HC1A 3V5HB 2QQKL 3B9KA 2WWCA 4XH2B 1F4AA 1IQDA 5BW7A 2FX9H 1TQBB 4HUXB 5K93A 2OM5A 3QDGB 4K3JH 1XH1A 2BNRA 4FG6C 1RUQH 2XKNB 4ENEC 4P2RD 3T65A 5D5ME 3EFDL 3G6JB 2Z8SA 4PRIA 4IISA 3GXTA 2FB4H 1CICD 1SVZA 1AR1C 4MAUH 1F58H 3VE0A 4RGNC 2VE6A 3GMQB 5ERWB 5JMRA 2N56A 4XNXH 1W9BM 1J0JA 4QO1A 4HZ7A 4ZODA 4QNPF 4OGXH 5IFHL 5HVFB 1JF1B 1P1ZB 1WWAX 4M1GL 5DR5L 5DQDH 2YDSA 1M05A 5LAXA 3APGA 4LKXA 3LRMA 1DL7H 1BZ7B 4RNRB 5I24A 2X4TA 2CO6B 5SWZD 2EPLX 5I78A 1UKPA 4WKHA 2C4FU 3DROA 4KVNL 3GNPA 2ORBH 5I1JH 4ZO8A 4Y5VA 4Y4HB 1TFVA 3QI9B 1V5JA 1B9ZA 3CFDB 4PRHD 2H9GB 3D85B 4JFFD 3FFDA 1HNYA 5T5FH 3RNQB 3WQWA 3G6AA 3O3EB 4H8WH 1J18A 1KC5H 3MJ8A 1EEQA 3BPNC 3A4AA 1US2A 1BOYA 2QSCL 3TTSA 3MACH 3MLSL 1I1YB 3AREA 2BY0A 4OV5B 3UJIH 1RY7B 1I8KB 3EYFB 2OBGA 1JV5A 5AAMA 3MV9A 4RMQA 3AUVA 2J7HA 1XGRA 3RUGE 1HJUA 1V7NH 1BM3L 4DWSB 2J5LC 4UAOC 1UKOA 4U6XB 4GAGH 4HIXH 3C6SB 3BW9A 5IB5B 1LK2B 1WF5A 5DURD 3TZVB 5DD5L 4Z9KB 3BAIA 4AZIA 3FRUB 4IBLT 1H3UA 2G3IA 5MEOB 5TQ0H 1CENA 5CMAA 1AE6L 4M4PA 2M8XA 3MNZB 3LEVL 4NQEA 1ZT4A 1ZANL 1A3RL 3AYRA 3QXAA 3LCYA 4HTYA 1CT8A 1IGJA 3C6LD 3VFRA 3MRKB 4GRWB 4JQXC 2VTFA 1CR9H 1KIRA 3QDGE 1MPAH 2O9TA 2DQGL 4FXKB 4X6BA 2V2TB 5DDHA 2H3NB 4W7UA 4KI5E 2ZCKL 4YXLH 4F15C 5D1ZD 3C9NB 2OYPA 5ISZD 1J0ZA 3BISA 2CYGA 3G6JE 5B4MD 3QULB 3DURB 3NFSL 3QB7C 4OLXL 2B39A 3I84A 4KKBD 5EBWB 4QF1A 5LXGL 1A7OL 2CUHA 3FT4A 4L5FH 4AIZB 4QRPA 5DZNA 4U6HA 2HH0L 1MCPL 3QWRD 3PZIA 1AGDA 4GG6B 3GJEA 3K7UA 4NNXB 4PPTA 4GMSH 5AG8A 1HHIA 3TFKC 4NRZA 5DMGC 5C0AB 3CSPA 1FVCB 1I4FA 1YNLH 3BRFA 3K46A 1CICC 4Z5RA 2YPKA 4MA8H 1KCRH 2VDRH 2VL5B 3EOTH 4LLAA 4N1EA 3I02B 4XP6L 5KVEH 3MRHB 2Y8KA 1NL0H 1S8DA 4MJ6A 4Y88A 3VWJB 3DDGA 3U4AA 5L7XH 5I8EA 1R5IA 2DI9A 2E9BA 4P8WA 1U3YA 3VFGL 3HRPA 2VXSL 1RZJC 2GJPA 3NIGF 4R9HA 3D0LB 3C5SB 4JJ5A 4Y2DB 1O7DC 4H8UA 4ZSOB 4MAYB 3CUJA 1CXFA 1M6OA 3D3VB 1KLGA 5FM5O 3MLTA 12E8H 1U8NA 3CFJB 2HT3D 4UT6L 2XFYA 3QIWA 4G9FE 3PV6B 4PV9A 2JF7A 3EMQA 1YY9C 3VFWB 3NABH 1DBAL 5J12C 4FNPA 5A2BA 4HCRA 1TQWA 5IMLB 4TSCH 2CPCA 3CPLA 1HXKA 3GSRA 1HKMA 2IPKA 1A2YA 2P44B 1U30A 1AY1H 1CL7H 3D39D 3KXFA 2W9EH 2R1XB 4CAGA 4GRWE 1ORSB 3CFBA 5ADPL 2EICA 5EA0L 5IB2B 3D69A 3B9AA 3MLPA 4W8BA 1T80A 2HRPL 1DEDA 4LVNB 2AJSL 1HH6B 5GZOC 2FSEB 4GS7B 8CGTA 2VLRA 4JY4A 3QR2A 3MV11 1UB5A 1MQKL 3C6LC 3WEZA 3IXAA 3RAJH 1NCUA 1E4JA 1RURH 3RGVA 5H37G 4OLEA 2Y6SD 2DPEA 1U8OB 3DIFB 5J06A 3HRZB 3H8NA 5D1ZC 3TA3D 4DKEL 1QNQA 5F89A 3L5HA 4H0IA 3QFJB 2CLZB 1S7QB 5SWSB 1TCRB 1CDBA 5DEZA 1XSJA 1RZJL 4I3SL 3GSNL 1XYZA 4X4MA 1U41A 4U1HA 5EOCJ 1TZHB 4JG1L 4ODWB 1E27B 2UWEB 3O3AB 1FZJB 1JNLL 2IH3B 2V2XB 2VISB 3IRZA 4F57L 1YMMA 5D7LA 2VLJA 1YYLL 1S46A 4BA0A 1GZQB 3C08H 4Q9QL 3I6GA 4S1QH 5GRUL 2Y36H 5I76B 5FCSH 3PDDA 5DD6A 1FYTD 2ADFL 3GRWL 4JM2B 1KGWA 1IGTA 4XBEL 1HK6A 4FQJL 4POZC 1KFWA 2BVQB 5LGHL 2YSSA 1R0AL 5DJYB 3BSHA 3OKOA 2R0WH 3HPLB 4PJXA 4PJ7F 2XXMB 2HAZA 4ZSOE 3EOBB 3V4PL 1ECEA 3ISWA 3MRFA 3GB7A 3D3VE 2A9ML 2R4RH 5HYJB 4M6MH 3NN8B 4QYOB 4HEPG 2HJLB 2CMRL 3ARYA 4MAZA 5A6AA 2ZXBA 5ID0A 2VYRE 1WTGT 3RI5K 1CDIA 3QEGL 4NFDA 3OA5A 3AY4C 1WITA 3O3DA 4N9OB 5EO1A 4DUVA 5EFFA 3L7FA 5I17A 2XYLA 1V6UA 5C0CA 4G43B 3W0WA 3CXDL 4NPYB 4D2NA 1HQRB 2IJ0C 4YE4H 5E6ZA 3U9UA 3SCPA 4GG8A 4M1CD 1KPUB 4NP4L 4TNWK 2W92A 1N8ZA 1MNUL 1JFQH 1X6NA 2KL6A 1MJJB 4Q74A 5BXSA 1GHRA 2XKUA 4NHCL 2FHFA 2WUBL 2GT9A 4KXZI 4JFYA 5IHRA 1IEBA 5LVEA 4GAFB 3C2AH 2NYYC 4X4YA 1H0GA 5L6YH 4MQ7A 1T2XA 1NGPL 1MLBA 2LVEA 4YZFE 1G0YR 3WN5B 3WQ4A 5FOJA 5CINL 3QCTH 3D50A 4QTIL 4JLRB 1JPGB 1X7QA 5EU6D 1A0QL 2ZUMA 1LDPL 3F7QA 4A6YH 1P4IL 4P3WA 4KKLD 3F7YB 1CFVH 1FZOA 3P3YA 3L5IA 3EYVB 4UUJA 4MB4A 2QR0B 4MD5A 2Z4QA 3ET9F 4Y19B 1LD9B 4YR6A 1BGAA 2UZXB 2WIMA 2RR3A 3QFJE 3AU1A 1GC1H 4JHAL 4WU7B 5FYKU 1W2VA 4MJ2A 5EH1A 2X4PB 4UOQA 3CU1A 1RU9L 2W07A 4X9YA 3BD5A 4XAWH 2FNBA 2Z92B 1ZVSB 4LSDA 3GKWH 2YWYA 3NOIA 2Z31C 43C9A 3DETC 5GZNC 4OZFG 2FO4B 5D1XD 3O8XA 4L4VA 2V7HA 3NACL 5CILL 4U1LB 3CZFA 2DF3A 5TE6H 1FFPA 4QRUA 5FXCH 2XN9A 4FP8L 4UOZA 2WMIB 1P53A 2C1OB 2CR6A 3BE1H 4JFXA 4OFYD 2DWEB 2I24N 1OAYH 5FV1L 1ZA6A 3ZSSA 1OGGA 2HJKA 1R46A 3LN5B 5EG6C 1U8HB 1RZIB 5HYJE 3MXWH 3HI1B 4AMXA 1NMAH 5E2VH 4P4KB 2Q8BL 3LIZH 4JRYA 1Z0MA 2AJYH 3Q6GH 4NQVA 2VQUA 3NFPB 1ORQA 4Y5YA 4Y5XB 4OAWA 4AQ1B 3L4XA 4HF5H 3CMGA 1QFWL 2NTSP 1HDMA 1MCCA 3SDYH 3TCXA 1HZHL 1JZ5A 1YEEH 4G80A 3BUTA 4M93C 5KSBA 3TOPA 4HDIB 1IKNA 1MREL 3VCLB 1ZGLB 3QGVA 1H11A 4AZBA 3B2VH 3BKJL 4NZFA 1HI6B 1VFAA 2D1ZA 3D9AL 2XVLA 1AIFA 1AQDB 2V2WB 3NPSB 3HN3A 5IMOA 1ZLUH 4WWKB 5J11C 4MX7A 3MYJA 4MNQD 4PJHB 2GK1B 3O2WL 3S4SG 4PRWA 4KGJA 4MB5A 1S7XA 2B0SH 4O2FA 4P5MA 4PS4H 3HC3L 4PJBB 5IG7A 1BQSA 1FHGA 4UILL 4GI8A 1N64H 3M8OH 4LF3B 4UCFA 5E09A 4M7LL 5IW1A 4P59H 3U7BA 3PHSA 1BZ9B 1YEKH 4DN4H 2FX7H 2Q3ZA 5MEPA 2Z91B 4DN3H 3BI9X 1QI3A 1OAKL 1DFBL 2GK0A 5AYUL 2WBJA 4RIRB 4XP4H 5TF1L 5IT2H 2VXTL 3E8UH 1RIUL 1FRGH 2DLIA 2D03L 5D72H 1XH3B 1HH9A 3TPUA 1MIMH 2C0HA 4KMQA 1V7MH 4KKLC 3B4NA 3T0XA 3BZ4A 5BOPA 4L4PA 4HS6B 1E15A 3GSQB 1MHPL 1U33A 4H88H 4D94A 2D3LA 1WKYA 4LGRB 4BQCA 3SURA 1C92A 3JV6A 1BMGA 1HXYB 4B50A 5KW9H 1YQVL 2EDJA 5A8PA 4U6TA 2O5YL 3BH9A 2X4OB 4M62L 2HRLA 3WDRA 3VVGA 3K4DA 1KUMA 1KENH 1W0VB 5ICXB 1U2YA 1U91B 2NR6C 1BZQK 1QR1A 5FM8A 4LK4A 4UQ3A 1B3ZA 5BS0D 3EBAA 3U48A 5KSUB 1GOGA 1QKZL 1T21A 1UJ3B 2AK1H 2NY2C 1T1XB 5GGQL 1FOBA 1W0WA 4PJDA 4GKOA 1UQSA 1B3JA 1A4JA 2GSGA 4W4OA 4Y7MA 4HP5A 4PTVA 4Z95H 4OZGB 4PP1D 4ZG1A 4PGJA 1T1ZB 5T1LD 3CXHK 3W5NA 4NQXB 1N5AA 1QX1A 3TYGL 1UA7A 3SDAC 1KFAH 4ZOBA 4IRSD 1CWVA 4QHNA 3WY3A 2EIZB 4KMTH 2DD8H 1DJSA 5DRZB 4IHOB 1I85A 4LCYB 4BZ1L 5B39G 3RPIA 1ZHLB 5KG9A 3HA0A 2BRRH 2ZWYA 3CXHJ 5HGBA 1IM9D 4WUKL 4YQXL 1QI0A 2B4CH 5L8KB 1BAFL 2WIIB 4WTZG 4F9LC 3SUSA 1MFBH 2JEPA 4PJHE 4N8CH 1TVPA 3WL1A 4RBPH 3P0VL 5T3ZE 3T3MF 4XPAH 4J6RH 5GS0D 1A6UH 1Q9KB 4DFIA 3OR6B 2V3DA 4PJBE 4FQLH 1AGBB 4JVUA 2OMBA 1WJ3A 3NZHL 3C2SA 4P2RA 2J8UE 1FFRA 4I0PB 2Z1SA 3L5WB 2QMKA 1U8LA 5JW3H 5IF0B 3LXCA 4OTXH 2JKXA 1CICA 3O4LA 1GPFA 2ZUUA 3TVMB 2CSPA 4KTEL 4E42A 2A9NH 3HG3A 1YEFH 1Q72H 1G6RL 1U8JA 1NSNH 2O5ZL 1KT2B 1MEXH 4ZNEA 4J4PD 5D7KD 4P5KB 1W72H 3TBTA 3E1F1 3CLFH 4U1SA 4U3XA 1ODAA 1ODUA 4RAUA 3QT2A 2XTKA 2K7PA 2AVGA 5GSRA 3HE7D 4XNZB 4AENA 3BAEL 2OSLA 5LCVH 1FH9A 1KCLA 2J4GA 3QHTC 1K2DB 4FTVD 4PRHA 5CGYD 1INEH 2BSSB 2EPKX 1DQLH 1T7ZA 1FPTH 4RFNB 3W2DL 5HYQA 2MQ3A 1F8TL 4QY8B 4LP4A 4ACZB 3GXFA 4HWBL 4H26B 1CG9A 3OX8A 4Q0XL 1S9VA 4HUMB 2PBGA 3HZKA 5J1SC 1G7MA 1TVHA 2ADGB 3ECQA 1I7UB 4H41A 1Y6KR 4PJFF 4OZGE 3GMPB 2MPAL 4HK0B 4KUZL 3AHYA 1NGWB 2XQBL 4YHIA 4Z0XB 3CZSA 3SDDA 1JD7A 1Y0LB 1CLYL 3O2LA 2F53A 3X3GH 3MV8B 2H32B 2HFGL 3BEVB 4F3FA 3AM8C 4ZUVA 4XP5H 3ZKNC 4FNUA 1XR8B 2EO7A 5F96L 1Y7VA 3TONA 4P2OD 5A43C 3KLKA 1FO0L 5IESH 4F33B 2E8ZA 5GJSL 4UNUA 3FO0H 1GGBL 1VGKB 4H20L 5E6IB 5FYKL 1JAKA 4UQAA 4P0DA 5E5UB 6FABL 5LA0A 5IMMB 1XF5B 5ANMB 1KXVC 2HKFL 4LGPB 5TJWK 2G5BA 4OZFA 1GCFA 3P77B 2IC2A 4OUUB 1JWSB 3MV7D 5GS0C 3SO3C 2WLZA 4WLCA 2PUQT 1ZS8A 3U2SA 3VIGA 3QWRA 1KEGH 2W62A 3L4ZA 1YC8A 4Z2KA 1P7QB 4NKIH 1CBGA 2AJZB 3UPCA 1YHTA 4CJ0A 4LSUL 1EGJA 4UQEA 3OIHA 3RU8H 4U4BA 4LASL 2EDBA 3F58H 2XGIA 1UJTA 1P7KB 1I3RA 1BF2A 4WTWA 5IKCA 3BESR 2B1HH 3MRQB 2FYYA 1KXTB 2C9AA 5GIRB 3TBVA 3OAUL 3QNYB 4GRLD 4AG4L 4IIQA 3NUKA 1DWIM 1WDRA 2IH1B 3LRKA 4P3CH 4EZMA 1PD6A 4OCLC 4KY1L 5E70A 3IKCB 4C7FA 4JFVA 3FTGB 4X99B 2XNAB 3HG2A 3RJQB 3M45A 4JPWL 3GZKA 2EACA 4LLQB 4X4XB 1ZLUK 3L6FB 1U93B 1CNVA 4GSDH 1MAJA 3HE7C 4HFUH 1C7SA 1FP5A 1I1AB 4Z7OF 1ZEAH 3ARGD 4CL7A 4PP2A 2JF6A 3PBGA 3BX7C 1N59A 1JTTA 5E9AA 1T7YA 4K7PH 5CGYC 5C6TL 5IHZB 3FJTA 5EU5A 3S4SA 1BFVH 4TSBH 2ZIDA 1VEMA 2DH3A 1XAUA 1HHJA 2AJ3B 2FX9L 2ZXDA 1RZKH 1X6LA 5GS1B 3HLAA 4K3JL 5EBLA 4KJWC 2P24A 4NGHH 3K8KA 5C07D 2X4QB 1GOFA 5GXBB 1RUQL 1HKJA 2FEDD 4JFUA 1EUUA 2BY2A 3NCMA 3MV8E 3WDJA 1IV8A 4NSKB 1I9JH 4PTTA 4G8IA 2J12B 1TQTA 2FB4L 3PIQB 5BYWA 3KPLA 4GXVH 3D39A 4AY1A 2CO7B 4YDLC 4P99A 4MAUL 1AQMA 3GH4A 1F58L 1A6ZB 3FO2A 1IMHC 3QUMA 1DSFH 4XNXL 1ONQA 1AGEA 1MUJA 3O6AA 2DSKA 3C09B 4OGXL 3DDFA 3KJ4B 3OJDB 4QCFA 4ZE5A 2YL6A 5KS9A 5DQDL 1AGCA 3GJFA 1DL7L 3WE6A 4QWWC 4DK3A 1CGTA 3TF7C 2WC7A 3GH5A 2FGZA 4P2OC 3QHMA 2C3WA 2ORBL 3B9VA 4LAJH 5I1JL 1EXPA 1BVNP 1GGUA 1GQLA 3MMEA 3VD7A 3TA3A 5J4MA 3PZ9A 3J8F7 2J1KA 4YFDB 5BVPH 2BC4A 2NY1B 2ICWI 5T5FL 2W60B 1KC5L 4H8WL 5EPMA 3WL0A 3EO9H 1SMAA 4P4RB 1WCBB 3CVIH 3MACL 1GHFH 2EXYD 3A22A 1Q1JH 2OYMA 2GTWA 5E2UH 3UJIL 1T5XB 5JZ7D 4K7FB 5BRZD 1EAJA 1L8NA 1OBAA 2JELH 3A23A 4PLJC 1VJZA 4GZEA 3HR5B 2D23A 4HUKB 3D48R 2IFGA 3S88H 1HHKA 1MCFA 4XPHH 1HX0A 1JGLH 4YK4C 1U6AH 1V7NL 2GJ6B 1FYTA 3OAZK 3M1BB 1LNUA 2VDKH 1BWWA 3FQWB 2F18A 4OZIF 4GAGL 4C4KT 1PY4A 4RBPK 5B39A 4HIXL 4WI8A 1D5XB 4JFPB 4GRLC 2DWDB 1Q9LA 1ES0A 3PHQB 3RTQB 4CMMA 4PJCA 2D24A 3V0VB 2ZKHH 2XXCB 4ZTPH 5TQ0L 4UTBH 4U6VH 5C09D 3T4AB 4LBEA 4Z7QE 4IOIB 3ULSA 4EK7A 2MSPA 2MJWA 2Z35B 3GSVA 3GXDA 3WH6A 1CGYA 3OXSB 4CNIB 3TIEA 1Z3GH 2AP2A 5HHOB 1FG9C 1R47A 3VRIA 4JFDB 2GFBA 1CR9L 2KUTA 1MPAL 4LGXA 4HKZA 1MWOA 1DDHA 4YXLL 1Z9LA 4Z7UF 2RIKA 5EUOB 2ZOKB 4KROB 1QI2A 4GBXC 5F7LB 4DQOH 4LPYA 4AD0A 2XSBA 1OW0A 3U30B 2VN4A 2Z8RA 1CLZH 3B2UC 2FZ3A 3TYFB 4TOQA 1YEDA 1FZMA 1MI5A 2YD8A 3NA9H 1F4XH 4OCNC 4L5FL 4QCEA 5AZEH 5C9JA 3FQTA 5FYJD 2QADD 3X11B 1CD9B 5CBAB 3MUY1 2JLLA 5I2IB 1FFNA 4GMSL 1LG2A 3ME0A 4QCIA 3IGUA 4HK3J 1W3LA 2VLLB 3VXRA 5I1HH 4X7FC 1YNLL 4XVUD 4ATLA 3EGSA 3IJHB 5EU6A 4N5UA 1HVXA 1ZB5A 4MA8L 1G7QA 1KCRL 2VDRL 3EOTL 3MFFA 3MJ7B 4LPCA 4ONHA 4WHYG 2PWFA 1AHWB 4MWFA 5KVEL 1DUYB 4FQHB 2Y23A 4W6XB 5FHAH 1NL0L 5HI4D 5JDJA 2A6DB 3HAEB 5D9MA 1D5BA 3FB8B 5L7XL 3B9KB 3QDMB 1LEGA 3T0EA 5AG9A 1IQDB 2OYLA 1PG7W 5JDSA 2DQUH 1SYSA 2BNRB 4YXHH 1CFBA 5CCKH 2J88H 5EU7E 7CGTA 5E0CA 5CPSA 2XZCH 1JGVH 1GVIA 4NWUH 4YN5A 4XVSH 3U5YA 4MA3A 4PRIB 3N1PC 5DFWH 1IT0A 1P4LA 4BQ6A 2IQ9H 3FFCD 4QOKD 5IFTA 4BF7A 5D1XA 3MKKA 2PYEE 5HDOA 12E8L 4FNSA 4QRRD 3VE0B 4DM2A 2GJ6E 1B3YA 2VE6B 1XSKA 3CLEH 1PZUB 5CSYA 4J3XA 4HS8H 1JRHI 3RM4A 4MYWB 2PTTA 3NABL 3EJYD 4Q2ZA 4OFYA 5GRXG 1M05B 1XZ0A 5LAXB 1MHHA 2LAGB 4TSCL 1G7HA 3POHA 1QVBA 4HWNA 2WHMA 2G41A 2IBGA 2X4TB 3WQ5A 5I23A 2XIDA 3DROB 2NW3A 4QAWA 3NCCB 4Y5VB 1AY1L 1CL7L 1A7PH 2W9EL 5HHOE 1G7JA 1CYGA 3IDXH 4KJYA 4AM0A 4WFEE 3UTPD 3BPOB 3IDIA 3FFDB 2IBBA 3G6AB 4OD1H 1IGYA 3MJ8B 1FJ1A 5JPMA 5I77A 1SM3H 4AT6A 4ZFOA 4WJXA 4HZAA 4GOSA 3AREB 3QQ9D 1VIWA 4K3GA 1FIGH 3C8KA 3QXUA 1JV5B 1F13A 1JDAA 4J3UA 4HIEA 3DLQR 2WXDM 3RAJL 1RURL 4XVTH 5SX5H 1XGRB 3ORJA 3A6CH 1MFNA 4CCEA 5CKAA 3GNMH 3ES6A 4OCMC 3LV3A 4FN0A 4MZ3A 1I1CA 1CCZA 3BW9B 4ZOCA 1EX0A 4EXKA 4WFGD 2PWHA 1CFNA 3RWIA 2YS4A 3KDMA 4XAKD 3SGJA 3FRPG 4LMQE 5E1QA 1TR1A 5D7IA 1UR4A 2QADC 5CMAB 3MMUA 3MBEC 1YECH 1EVUA 1FP8A 3C08L 3ALPA 4NQEB 1ZT4B 4S1QL 3QDME 2Y36L 4GKNA 1WAAA 3WBDA 1LEIB 1CT8B 2D7MA 3VDBA 1IGJB 3VFRB 3FOLA 3SN6N 1KIRB 4K68A 4HX1A 4X6BB 5DDHB 4PTXA 2R0WL 2MTPA 4PRBA 1NBYA 3H3KA 3O6KH 4R2GC 4PRIE 1IKFH 3KLHD 1ZTXH 4PTWA 3B8SA 4PJGB 3NYDA 3ULUF 2R4RL 4M6ML 2UZIH 3HKFA 3FT4B 4RE3A 1V6XA 2A83A 4QRPB 1BVLB 1NC4D 2YD7A 5BRQA 3SY0A 3VDCA 2HTLC 3B5TA 1AGDB 1BP3B 5IWLC 3GJEB 5HHMD 2YZ8A 4OZ4B 4WVRA 1HHIB 5CEZH 3V5DA 1E4LA 4QRTA 5BS0A 1I4FB 1PZ2A 3BVXA 4R4BA 4X5XA 3LSOA 1NC2A 4Z5RB 2YPKB 3T0WA 3STBA 4YE4L 5E94A 3D6GA 3MLUH 2X8RA 5A69A 3QCUH 3TH2T 4MJ6B 1JFQL 5T1LA 3AIUA 3VRJB 1BQLH 1NP2A 1TVBA 5KVGH 4MS8D 1T0OA 4IRSA 5I8EB 3C2AL 1R5IB 5L6YL 4KMLB 3B3IB 1JNEA 5I6XC 2HN7A 3GK8H 5I73B 3QCTL 3GMNA 1O7SA 4K9EH 1XGZA 3ARXA 2A74A 2VWEC 1OSPH 1IM9A 2W5FA 2YPVH 4A6YL 4HJGA 2RFXA 2GVYA 1CFVL 1F4YH 1M6OB 1B0WA 3HNTH 3BUQA 2X9WA 3VXTA 1KLGB 4PJEF 3VOCA 3MLTB 1PZ5A 3AS3A 1U8NB 4M9OA 3LKQA 3C5JA 2NXZC 4G6KH 1GC1L 2WMFA 3LZFH 4JRXE 3O3BA 3GSUB 1IVLA 4XAWL 2W4XA 4N1CA 3CPLB 4WIWA 3GKWL 3GSRB 2IPKB 3QG7H 5F1NA 1A2YB 5A2IH 4RA0C 3WEXA 3O4OC 4J4PA 1MQ8A 3KXFB 4GO6B 4QXTA 4W8AA 4X5WA 1K9EA 1OT1A 5TE6L 2ERJB 4WDIA 3CFBB 3WH9A 3ZKQD 3UAJC 1ACZA 3DHPA 3CUPB 3BE1L 1OAYL 2DS4A 2QSTA 1QHPA 4PJGE 5I1LA 2NTFB 2VLRB 3MJ9H 1UB5B 4HLZH 3CHFA 5E4EB 3MXWL 4NO2A 1O0VA 4KRPB 3IXAB 3RKPA 1NMAL 3BGFC 1PBYA 2I07A 4PYHA 4QEGA 5E2VL 3RGVB 3LIZL 1HL8A 2AJYL 3Q6GL 5IROA 4PY8I 4X6DE 4HBCH 4YHZH 2FE0A 3ZT7A 5F89B 3L2LA 4HF5L 1NFDF 4LEOB 4YDVB 1NEUA