3VGBA

Crystal structure of glycosyltrehalose trehalohydrolase (gthase) from sulfolobus solfataricus km1
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
550
structure length
550
Chain Sequence
GNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 187
structure length 550
sequence length 550
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgbA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgbA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgbA02
2O92A 4HT1H 1P4IL 2JLLA 4Y4HC 3DBXB 5C0GB 4GRMA 4HIJB 3MRIB 2VDPL 3N9KA 4HS3B 4CU8A 5A2AA 3QR2A 4ZE5A 5I73C 1GHFH 4G7YH 4PJ5B 5IUSA 2W9EL 4NZUL 3MRJA 4KJPC 1W72A 1X4ZA 2W0PA 1R3LB 3LKPA 1GVYA 4EBQH 3GSQB 1RUKH 2XPGA 5H94B 4XZUB 5HPMB 3GXFA 1RVFL 1E6JL 1ADQA 1NLDH 4ZXOA 1K4DB 4JY4B 2AJUH 3ZTJH 4NF7A 1GIGH 3WO3B 5EO9B 2JF7A 1GOWA 5D93C 4MNQD 5D1QD 1DEEB 1KG0A 4JE4B 2AQ2A 4O4YH 4J6RL 1EMTH 3AC0A 3L3HA 3GMQA 5KS9E 1TQTA 2G2RB 3OQ3B 4M56A 4G3YL 1EGZA 1B0GB 3BDBA 5MENE 3RAJH 3MBED 3TP4A 4OD3L 3A4WA 1MCKA 3STZA 1NCWL 3O45B 4NOFA 5ANMA 5DJXA 4RFNC 4MWFA 4ODTL 5F93C 5JW5B 1MFNA 2XZAL 5EUKB 3NFNA 4O58H 1VACA 3BUYB 5TE7H 1R7AA 1MIMH 1R24B 3ZYJA 3DMMA 1OF2B 4NFCA 3RQ3A 3VA2C 4XAKD 2ZCLL 4FG6C 4AXNA 4ZAKD 3FFCE 2FGLA 3QXAB 3KG5A 1Y0LB 5MENB 4E4PA 5LKNA 2W1NA 4KUZL 1W9PA 3SO3C 5L8KB 3LHPL 1K6QL 1CK0H 1VFUA 3T0VA 4XBPB 3ULUD 3DVIA 3MJ7A 5D7IA 3CVHB 3BI9X 4HS8H 5EC2B 2IFFH 4WO4B 3VDBA 3O4OC 3NVQA 2RAMA 4N0YH 5IESL 1PS3A 2GW5A 3WIFA 4GOSA 5A6BD 4QHNB 3IXAA 1OAKL 4TSBH 1BLNB 2VXVL 2NYYD 3FFCB 4A4AA 2Y06L 1CF8L 2G75A 3KEHA 2VXQH 3IDMA 3RWDA 1WAAA 1WISA 2F8QA 3KNBB 3MCLH 4HWBL 1ULVA 1BGXL 1FRGH 3SJVE 1I3RB 3GMPB 1OW0A 3FMGL 3DUSB 2VQUA 1AE6L 1LE9B 2YWYA 1YYLL 3T2NL 4OIIH 3WS3A 1GNXA 1LL6A 2ZJSL 2ALWA 2CMRH 1DQTA 1CD8A 5FM5M 3GBEA 2BRRH 3UJTH 2ZOKB 4OAWB 1I4FB 2OR9H 3MNZB 4XX1G 2YOCA 3HC4L 4WW2F 3T1FB 4BFIA 4OF0A 4WV1C 3DXAD 3SJVB 1UG6A 1A3HA 4NDMB 2B39A 3OR6A 5LQBH 5GGQL 4CADB 3UTTB 3RWCA 3QNZA 4PS4L 3MGTB 1AD0A 3E1F1 3GI8L 1RP9A 3Q3GA 2E0PA 3PWPE 4W4OC 3OKNA 4AYFA 3GGWB 3L9RB 3HI1A 4ZO7A 4AIUA 4B3KA 3H53A 3IDNA 1CXLA 4L5FL 3WLBB 5IB2A 1MJ8H 2UUDK 4TVSa 3D0LB 4HG4J 3BC9A 3HS0B 2XN9E 1IAIL 2CDFB 4PB9L 1I9JH 3BKYH 5D7SH 1ISZA 1FO0L 1PLGL 1X4XA 3RBGA 3GBMH 4X98B 4LSVL 2Q7NA 4OD2A 3SCMA 3WN6A 3ZKMD 3TO2B 1GL4B 1NH6A 5D1XB 4XGZB 1ITCA 3B9KA 4GQ9H 4IMKC 3MOBL 5DTFA 2J8OA 3PWPB 3WD0A 2Q8BH 1YYML 5F7DB 1G01A 3FW6A 4V2CB 4LYPA 2DAVA 3MUAA 3U6RA 2GYSA 5SV3A 4NQVB 4OM0L 1TZGL 3I6KA 3WFHA 1CL7L 1ZANH 3DSFL 1I7ZA 1OCWL 3EO1B 4XI5D 4Z78B 5A2FA 1WCBB 2DBLH 4JFYB 3A5VA 5BV7C 4UT9H 3BSZL 5DQDL 2FIKB 5TDPB 4WUUE 5I30L 3VWKD 4C4KT 4J3SA 2Y6SC 1H8NA 1P4BL 3QUXC 3BGMB 3E6FA 4TYUA 2Y7QB 2DKUA 2ESVA 4LLWA 3SDAC 1NMAL 1CFQB 5E4EC 4UTBH 2R4SH 3DETD 5D2LF 1TVHA 3QIBC 2X4UA 4PGZA 1ONQB 1XHGA 1OB1B 4ODVL 4N9GA 5BRZE 1HKJA 1BBDH 1RJLA 3KPPA 4G6FB 5DHVA 3TC9A 3I9GH 2LVCA 2P45B 3DVNB 4JZ5A 1R5VB 1A6TA 3FB7A 1BVZA 2DLHA 4HKBA 4WUUB 1B30A 3PL6D 1HQRB 4OF5A 1OAXL 5DT7A 4OFDA 3QCUH 4FLOA 4X0VA 2ENSA 1CENA 1OQXA 5H35A 2PW2B 4EQ2A 5IFJA 2F8VA 4NQCA 1RZ8B 4PGDB 4X6EB 3KLHC 2F8XC 5HDLA 4GKNA 2VDLH 4NUGL 1S9KC 2YEZA 3EO0B 4K2UH 3OXRB 4HX1A 4PUBL 3FTGA 3SGKC 5IB5A 4P2RA 1C5CH 4L8DA 5JPNB 5H37G 1MCCA 4WI4A 5EBGA 5LWYH 1HZHH 1C5BH 4L4PA 5I66B 1CLZH 3RL1A 7A3HA 5E5MA 1H3PH 1X5FA 4NCC2 3HI5L 4QYOB 3SKUD 3QDMD 3RTQC 1HH9A 4U7KA 5IB3A 1PFCA 1A9BB 3T2OA 4F7TA 1RZGB 5JW4R 4IRJA 2JCCE 3AQUA 3LQZA 1JFXA 4EIZC 2VLJA 2WZIA 2OI9C 3QUXB 2DMKA 3S34H 3MTRA 4IRSA 3MRFB 3MREA 4WJ5B 3D39E 4P48A 5E6IC 3OA5A 2YK1H 5D9SB 2ZX5A 1UZ6E 2Z31B 1WWCA 1UA3A 1KPVA 4HG4K 4OQTH 4JGMA 2J7HA 1MLBA 2VDQH 5ELIA 2APFA 3M07A 4PCSA 4L29A 2JCCB 5E8NB 4WEUD 2EACA 1F00I 4YDJB 2NQCA 3T0EC 1P1ZB 3U9UB 2CSPA 1MRFH 5IMMB 4FQHB 2FBOJ 2VZ3A 4NQDE 2LTQB 2NXZD 1UH2A 3D39B 1I8LC 4K71C 4GFTB 1SYTA 1RU9L 3AB0C 3O3UN 1XZ0B 1MCHA 5D5ME 2NMSA 4ZS6C 3U7YH 4TUJB 2HJKA 5JBEA 3O6KH 4MA8H 3RVUC 1ZB5A 5TDOB 4FXKB 4OZOA 4JN1L 5DR5H 3TPKA 4S1RH 5ACZB 1OP3K 1XGYL 4NQDB 4LVNC 3TZVD 2EXOA 1KBGH 2AJYL 2J8FA 2YWZA 1X6NA 5E6ZA 2VLKA 4PJHA 2YLAA 2YPKB 5JQHC 1MCOL 2FSEA 4C54A 1N64L 1QZ1A 2J8HA 1CZ1A 2GAZA 2HRPH 2AGJH 5CJ8A 4XPHH 4C56E 4PEEA 3CXDL 1E6SM 4AQ1B 4OI7A 3P40A 4RMVA 3WQ8A 1BQHA 1QA9A 2AKRB 1T22A 3MACH 5EIQA 3TLRA 3KZSA 2ZUTA 3GSNH 4Y4FB 3U46B 2NSXA 2ADJA 4OZIB 1SEQH 2A77H 3O9WA 5LCVH 3RY4A 3RZWA 4DKAA 3FO1B 4OGYL 3CFJA 4GSDL 2FB4H 3JWDL 3W27A 5IQ7H 5E0FA 1M7IA 2J7LA 4GAGH 4U6YB 5K9OA 3BXWA 3LN4A 3G5VB 2WHLA 1NBZA 1I7RB 2ZP0T 1BYAA 4UT6H 3NN8A 1AMYA 1IGFL 2FNBA 1G9NH 1NJ9B 4QHMB 1E9LA 1LD9B 4QF1B 3VG9C 1JMZA 5F89A 3SCQA 4QY8A 4PRAA 4FZ8L 3VA6A 5EOCJ 4LOUC 1NWSA 4LSQL 1S9VB 2D7OA 2W0FB 5LA0A 1FIGL 4D0BB 2AK1H 2C3VA 2ESCA 4Z7VE 5DVNA 1U8OB 5FKAB 2NX5E 4TTGA 1PZ3A 3MLUL 4OKVA 3P4NA 3WEXB 3VGDA 3KYMB 4PJAA 3S88H 1MCJA 2NZ9C 4G5ZL 3LV3A 3RU8L 1TVBB 2JEPA 2R0ZL 3CC5A 1EO8L 2VDNL 3T77B 3ULVD 1C90A 4PJFF 1FLRL 1PAMA 3GKWH 2EO1A 2A3HA 2PO6D 4JR9H 5IJKA 5DK3A 3EDDA 4TVPL 1A8JH 4E5XB 3SUTA 2VZOA 3V5KB 3SDCA 3BN3B 2NX5B 1Q9OA 3B9AA 3P4MB 3WN5A 4HDIA 4HHAB 2Y36H 5C0NC 3LEVH 1WZMA 3RGHA 4ELMA 1CZ8H 1A02N 1QI3A 3VXTA 4QRRD 1K2DB 3OZ9H 2F5AL 3BP7A 4RMQA 4LNRA 4OCYL 3BDYL 3LPFA 2QADB 1CGUA 4LSTL 4V2BA 1FL3A 5EB9A 2YBTA 1JK8B 5T5FH 5JOFB 3CUJA 2YLLA 3C5JB 2F53E 4S1QH 3X11B 2HTLD 5GIRB 4LLMB 2ZSVA 1BQCA 1CLYL 2VZVA 3QZWG 2FDMA 1SJXA 4XNXL 4FXGA 2RFXA 5FOBA 4HOXA 1INQA 1HXMA 3S97C 1RPKA 2NR6C 2NTSP 3VGEA 4WW1A 1MCNA 4NQED 1CNVA 4XP1H 5IFTA 4J3VA 1PZ5A 1DQQB 2FYYA 4G6ML 2ITCB 4HFUL 3LOWA 3RWJA 4R3SB 3T04D 1F11B 2F5BL 4XXDA 1B2WH 3MUHL 5FM5O 35C8H 3OJDB 5C3LD 2FHFA 3IVKB 5JLZA 5B3JE 2F53B 1T0MA 3LN5A 4PV9A 4FTVA 5KZ6A 2JEQA 1E0XA 1W9VA 3BVUA 3VXUA 4O2CA 4XP4H 4JQVC 5F70A 5CBAB 1ORSB 1KOAA 1DWFM 2VLLB 3GMNB 3IKCA 2BSTA 5EZJB 3FQTB 2C0HA 5DVOA 2DBJA 3HZ3A 2BFVL 1O7VA 4FRWA 2FX9H 3UYPA 4C4KO 5E1AB 5SV4A 3WLWC 1S8DA 4ODWB 2DT1A 3VXNB 5I1GL 1UQYA 1W9DM 5DSCB 1WITA 1MAMH 2G4FA 3SQBA 3CHEA 1ETZB 4MNHB 2WMHA 3WIHH 3MRGB 4W68A 3M46A 4XZWA 1UADC 3GMLA 4AC1X 5ITFB 2Y07H 3X12A 3SBWC 4X5WA 2I5YL 4B3LA 5L2JB 2A83A 5DQJB 1F13A 3AIBA 1KGUA 1V7NH 2X44D 4GKLA 2NXYC 1I8MB 4X9BA 5IKCA 2EDFA 2VB5A 3UTQB 4PMQA 4B16A 3MYZA 1K9EA 5M5DA 3HNSL 3MNWA 5E9DE 4MX7B 3DRQA 4QHLB 2H41A 3CAFA 3EYQC 1FP9A 2XTLA 3FN3A 2DWEB 2WVUA 5F9DC 3GO1H 5JA8B 1RJYA 4JO2H 1GOMA 1NCDH 1L0QA 3TYGL 4PGCA 4RNRA 1QQDB 4QXGH 4D0CB 4HZAA 3RM9A 4M81A 4LVOB 1YEFH 4K3EH 3EYUH 3AXXA 1JGEA 1JYWA 2BOCA 3V6ZA 2HKFH 4HJJL 5CSYA 4BKLA 4KI5E 2A9NL 1MVUA 4FA8A 1AQHA 1W0WB 1UVQA 4HKJA 5D4QA 4RGMB 3B5HA 3S5ZA 5LYRA 4BQ6A 3C5ZD 3NCYP 4BSVB 5F6IC 3AHTA 4QHKJ 4N0UE 3JTTB 3K3QA 1LE5B 2VQ1A 4NRSA 1CXHA 1R3JB 1AO7A 5I1EH 4MZ3A 3L4ZA 2W0LA 1RULL 3CZFA 3DIFA 3KPOB 1CGTA 3CU7A 5C2BL 5J12B 4N8CH 1IGYB 1CDGA 3RNKA 2WSPA 1ND0B 2ZPKL 3BDXA 3QUZA 3BWAA 3NIGF 5GGRA 3H3PL 5DJ6B 3MLXH 3UJJL 5MEND 2NXYB 1N5AB 3GSWB 1JYNA 2CLVA 3IRPX 2MCPH 5C0BB 2DPEA 2HVMA 2D7QA 1RURH 2WC3A 3C9NA 1DQDH 3GMOB 1UD6A 3IGUA 2KBGA 1A4KA 4JVUA 1V6YA 2VDKH 4JZJC 1Z9OA 3LKRA 4BQ9A 2OMBA 4GKOA 1FG2A 2PYEA 4DWSA 4GW1A 5F1NB 2H32B 5I0ZA 5DUPH 1K8DA 1T6WA 5K93A 3QGVA 3OF6A 1BBJB 1JPST 3VD4A 1WIUA 4XWOC 3TCXA 1RZJH 1KC5H 1PYWB 1YEDB 4P2OB 5GJTH 4PJ7E 3FFCD 4DVBB 1DBMH 1MRDH 4KROD 4Z18A 4G8FA 4LCIH 3QHZH 3CZNA 3MLVH 2XV6B 4LIQH 3RA7L 2MSPA 4DCQB 3L5HA 4QTHA 5T33H 1FFRA 1E28A 4NJ9L 5CMAA 1NFIA 3B4NA 1QFOA 3VILA 2XKNB 1AY1H 1OARH 3T3PE 4HZ6A 4WU5B 2HP4A 3RPIB 4PJXE 4BZ1L 1UACL 1BP3B 5IB4A 1QSFA 4QRUA 1KCVL 4OLWH 5I1JH 1S7VA 2YUZA 5T1LB 3SJVD 3HG1E 3VFNA 4ACPA 1P4LA 2DQHL 1UYWH 2W59A 3F65A 3WBEA 5ID1A 4TNVF 1EHLL 3VIGA 4FQXB 4KV5E 3GNOA 1TQWA 2FJGB 2Z35A 4P9ML 3ARDC 3B8YA 4AEIH 4K7PX 4PMRA 4PJXB 3QQ9C 1FC1A 1T66D 2IGFL 1S7RA 1G9ML 4XRCA 2K7PA 43CAB 2WYSA 2ED8A 3O6LL 1R3IL 1MWAA 1HSBA 1H2JA 2Z1SA 4LRIC 4P2YA 5HYEA 5D6DC 1IAKA 3UYOD 3VFWA 4D6HA 2R23A 4QRSB 5AWNL 1E6ZA 3ES6B 3QRFM 5I77A 5FGBC 5GZND 4LGXA 2EDEA 4P99A 5D1XD 1YEEL 5CINH 3N17A 2D0GA 5IW6A 5HGGS 3SKNB 3PWPD 3ROOA 5KSUB 4JGUA 4BSJA 4MJ6A 1JPSL 2XQYK 4HF5L 2XN9D 3SE4C 4NO5B 4AZ7A 4HXBL 3VRJB 3EFFA 3ARBB 2F54E 4GZJA 3WD2A 2F58L 2WCSA 1T0PB 4W6XB 2YHGA 1G1CA 3P30H 1A7OL 1DUYB 3WUEA 4MDIB 2DB8A 1NGQH 1RK0B 2AEQH 3QIUA 1A7NL 3CK0H 3WS6A 4OI9A 4JFVA 1VFOA 1FBIH 3CDYA 3AIWA 5DK0A 4PJEB 4WIWA 4G6FD 5FDYA 3L3GA 2SEBB 4LIQE 2G9HA 4LHUA 4WUUD 3VGFA 2PTTA 4KVNH 4Y5VA 4JHZA 3SCPA 1UENA 3NZ8B 4XC1L 3OGRA 3Q6FB 3UDWC 4KKAC 5AAMA 2XZQH 4JRXE 4MDOA 4HMDA 5F9AC 4ZFOB 2J12B 5C7XH 2CRYA 3KPNA 1D9KB 4LSPH 4IOFD 2NY0C 4XTRD 3QHMA 5BRZD 4DKFL 5I2IB 2C1OB 3H7LA 2DL9A 4QGYA 1RD6A 4S2SA 1QD0A 2P49B 1VSCA 1KTLB 3B2VH 3BZFB 1FAIH 3OJMB 4MNLA 4GRMB 3LS4H 2ZX9A 5GRJH 4RRPA 4Z2KA 1DFBL 2O5ZL 3AU1A 4KTDH 4UINH 4NXSA 2XY2A 5DMGC 5E5RB 5ADOH 4YHML 4QHKI 3MRJB 4P5KA 1QBML 4NZTH 3SE9H 1W72B 3K0WA 1YHTA 3GM8A 3LKPB 2YD1A 1UWGL 2XPGB 1HEZA 1NFDF 4K3JH 4M93B 5FAAA 3K4DA 5ANME 3O2DH 4HMEA 2VVSA 3HE6A 4LEXH 3CFCH 1R3HA 1KG0B 3CFBA 4M4PA 3J8F7 2Z31D 4FQCL 3T3ME 4NKDA 4P59H 4OJYA 3L3HB 4AY0A 3GMQB 2NY6D 1OW0C 5MEQA 1P2CA 5I8OL 4WHTA 3U9PH 1MFAH 2P1YA 4JVWA 1P9MC 12E8H 3EOTH 3STZB 4NNPL 4ODSH 5ANMB 5DJXB 3U30C 4MWFB 5B8CC 3VFOA 1IGCL 1NGYA 3D39D 3NFNB 5D7IE 2XFRA 4HSQA 4A2MA 1VACB 4HULB 4YEFA 5J6HA 3OX8A 1OGAA 4X8XA 3SDXF 1QEWA 4R4FH 2NY0B 4KHXH 3DMMB 1MNUL 1ZJBA 2DQFA 3OG2A 1KN4L 2DKMA 4EJ1C 2CKRA 5F3BA 3D0VA 4NQDD 5KW9H 1PKQE 2BXYA 1VJZA 4K9EC 2XZCL 3AREA 3U82B 2R8SH 2PR4H 1E40A 3LAFA 3MJ7B 2JJTC 5D7IB 1U3HD 4JFFA 2IALA 4OJFH 3VI4E 1A9EA 1QR4A 5TPWH 1A7RL 2ICWI 3WIFB 3SE8L 5EU7E 5ISZA 4DO5A 2J4WL 2X1PA 3HRPA 5FGSA 3IXAB 3THCA 2ADFL 5FL1A 4QWWD 1RHHA 5KSBA 2VITA 3B9KC 2G75B 1J1PH 2CK2A 1MCPL 4IIQA 4IOSD 2VL5A 3IDMB 4Y4FD 3RWDB 1KJ2A 5K59E 3IXTA 3P3YA 2GJPA 1MELA 1DL7H 4IRZL 4JPWH 3VRLF 3UC0L 5GNXA 1OM3L 3IK2A 4I1NB 3BUQA 4PTVA 2NZIA 4PB0H 3ZE0E 1INEL 5F1KC 1F58H 3HI6H 3DX1A 3UCQA 1MREL 4UT7L 3M1BA 3WKNA 3BGAA 4Z7UE 4C56D 2Q76A 5C8JA 1RP8A 1NEZG 3KL5A 3WS3B 4G8IA 5IVXA 3R8BB 3U30B 2YL8A 4MTVA 2D31A 4OT1H 1FN4B 1ZHKA 1KEML 5DMIL 1NBVL 2EEXA 4Z76A 3TV3L 4XMPL 2Q6WA 4JQIH 1NFKA 1XFPA 4HCRA 15C8L 3V0VA 2ID5A 3GI9L 6TAAA 3OR6B 4ZFGL 4MA1B 1JHKH 3RWCB 2O5YL 1AD0B 4WEBH 4YHPA 2J7DA 3Q3GB 3DI2B 3OKNB 3HI1B 4F15B 3IDNB 1KT2A 2MQ0A 2UVFA 5IB2B 2G41A 3MRPA 3MA9H 3H42H 1X5HA 4YUEL 3K8MA 1CDCA 5FF6A 2R69L 4H8VA 3OJVC 1BFOA 1A5FH 4OD2B 3SCMB 4KK8C 3B9KB 2XIIA 2ZUQC 5DTFB 2ESVE 2NX5D 3AUVA 3OWEA 1NL0H 4JANA 4GJTB 3A6BL 3U6RB 3EHBD 5EU4A 4XX6A 3MOAH 3W53A 3VGBA 3I6KB 2IH1A 3WFHB 1I7ZB 2H2PC 4NO0D 5HVWA 4YFLF 2KPNA 3BKML 3DROA 2DQTH 1YEIL 1NGXA 3CVHL 4IRJC 1ZBKA 2QADD 2QQNL 4TRPL 2X9XA 1YQVL 3O6FA 1O7SA 3E6FB 3OV6A 5LGHL 3V95A 1EHAA 4G42A 4G6KH 2D7TH 2ESVB 5D1ZD 4LLWB 4LX4A 4UFJA 1T03H 1QNZH 4JM2A 3SN6N 2X4UB 1IJ9A 1UH4A 1L7IL 4NHCL 5T1DH 3RZCA 3DX9A 1IM3A 1VGEL 5T5NG 1H5BC 4RWHA 3PV7A 3DARA 1CPUA 1JNNL 1RJLB 3KPPB 5DHVB 1ZJAA 4P2RE 2QR0A 4P9HC 4LF3A 3WQWA 2EYRA 3FB7B 1A6TB 4R4BA 4HKBB 3IT8D 5GNZA 5H35B 1B0RA 5DVMA 5IFJB 4YDVB 4NQCB 2F53D 5I18H 5JXED 2YKLH 4OLXH 3LQAH 3RDTD 3QFDA 5C07E 2APWA 1UEMA 4M7LT 4AJ0A 1YDPA 4I18A 1F4YH 5IMLA 4POYA 4UOZA 2YEZB 3GEWB 4HX1B 1QVBA 4D3CH 4MAYA 1KPUA 2VLJE 5IB5B 4P2RB 4L8DB 3F62A 5CHNA 3EYFA 5ETUA 4C7FA 4Q9RH 1GZPA 4IBLT 3QHOA 3WF2A 1F3DH 1D6VH 1W32A 2DI9A 2YDSA 2EIZA 5E5MB 3F7YA 1UD4A 1NARA 5D7KE 1G9HA 1HH9B 5IB3B 4IM8A 4L1DA 4F7TB 1F6AB 2R0KL 2ZOLA 4HJ0C 3QB7C 3N9GH 4IRJB 3WEOA 5CJ5A 4DN4H 3LQZB 1NLDL 2VLJB 5DT5A 1GIGL 4PLKD 4IRSB 2YRPA 4N0FA 3MREB 4NO2A 4MXQC 3ZO0A 5C0EA 3WQVA 2APVA 2WC7A 2C5DC 1YEJL 4ZNCD 5B4MD 1AI1H 2DLIA 3MV11 3HZKA 4I48A 1SBBA 1J9CT 5IBTL 1WBXA 1KPVB 4O2EA 2R1YA 2J5LC 1MLBB 2QQKL 1A22B 1HOCB 4PP1D 3RAJL 5L7XL 4L29B 5D7JC 4B9YA 2O61A 2WMGA 4TTDC 1BYCA 1JPTH 3ZLQC 4DTGL 2R0WL 3GSVA 1F4XH 3S36H 4U1LA 4O58L 5JHDA 4W81A 1E5JA 4PJGF 2F2HA 1TG7A 1MIML 4JKPH 5A3IC 2UZIH 1WB0A 4NNXA 2FJFA 1ITBB 2HJKB 2QL1A 2DICA 5E9DD 3BAKA 3MLSH 1XEDA 1OTTC 1KB9J 5KAQF 3KXFA 4AEFA 3BQUA 3SKMA 3GBLA 4KKBC 3FN0H 2VIRA 4YHNA 2CXGA 4JDTH 4DW2H 3QCTH 2H2SD 2YD8A 4HS8L 2CRZA 5CD3A 4M7LL 4MAZA 2VLKB 2CKSA 4PJHB 5FGRA 4YXHH 3OLIA 3F7PC 2FSEB 2XTJC 5D7LA 5GGVH 2GAZB 5SWQA 4TSBL 1JCKA 5EO0A 3M8OH 4KI5D 2XGIA 6FABH 3QCVL 2VZUA 5IJKC 1HHIA 1YA5A 1BQHB 1QA9B 2F7PA 1T22B 5L9DH 4UR9A 1REIA 3GXPA 1NANH 3SDCC 5B39A 2W9LA 1KFWA 1QHPA 3MCLL 2ADJB 1W2VA 1SM3H 3O9WB 2VZ1A 2LV4A 3CFJB 3LH2H 3U83A 1M7IB 1G6RH 2P5WA 5K9OB 3LN4B 4WI5A 1WE5A 3KL0A 1NBZB 5EBLA 4OCMC 1CR9L 1MCQA 4YK4B 4YH6A 3V7MA 1SYSB 3NN8B 4XHJD 1C12A 4PJAE 1EEYB 3UJTL 4WTXA 3AY4A 2HH0H 1XYZA 4QAWA 5F89B 2BSRA 1XF2A 3LEYH 4PRAB 4QY8B 3P4LA 4HBCH 1OB0A 5J13C 2WBWB 3RKPA 4H7VA 4G9FE 1CE6A 5F7UA 4CL7A 5LQBL 1XF5A 1ZLWK 1SJHA 5JR1H 2X9YA 5CGYC 2C3VB 4YDKH 3FXYA 1GPOH 5HSFA 2HFEA 4NM8L 3SEPA 3F58H 2J1KA 3AS2A 3AYRA 4I0CC 4OKVB 3P4NB 5I8KH 3JZ7A 4PJAB 3DSNA 5ABGA 3LV3B 5JW4M 4I13B 4Z7WE 1I9JL 3CC5B 4Y5YA 4MDPA 1AGBA 1UQSA 3GBML 2FZ3B 4G9FB 4KC3B 2FRGP 4U1GC 1K8IA 3BP6A 1P6WA 4F7PB 3OAZK 2NY1D 2AXJA 1I9RL 3QUYD 4OZFG 1UR2A 3PV6A 2Y8VA 1GAFH 1IE5A 1YEGL 1Q9OB 1KXQA 1FV1A 1YJDL 2PC8A 4PD4J 4P4KA 3WN5B 1MCFA 5JPMA 4TN9A 2BNUA 4HDIB 3A67H 3FQWA 1J7VR 4MQXD 1ZANL 1IKNA 3BKCH 5TFSL 2DI8A 4ELMB 1U2YA 3QHFH 2J3SA 2X4OA 3A0OA 4LNRB 3EYPA 2O5XH 1OP9A 2VVNA 1FL3B 4LHQB 4Y16A 5E8PA 4HEPG 1Z6JT 3HG1D 3QISA 2BSSA 4FTVE 2VDRH 2ZSVB 4HAGA 4ONFL 5FUOH 4ZMAT 3E2HC 3UPAA 3OHXA 4FXGB 2RFXB 4OF7A 5FOBB 1CDYA 1HXMB 1INQB 4M7JL 4CCDA 4WW1B 1JDAA 3V8OA 3KLLA 5D72L 1PZ5B 2FYYB 5EA0H 4YN5A 2OP4H 4CVZA 2VRKA 4RMUA 4DGVH 1N4XL 4FP8L 3RWJB 3BPLC 3KWXA 1CIUA 4XXDB 5DQ9A 3SDYH 1ZVSA 5JLZB 1T0MB 3LN5B 4PV9B 4Y8AA 1KACB 4FTVB 2GFBA 5CSBA 3T0AA 3VXUB 4O2CB 1I1AA 3GNRA 2DQCL 3IDJA 1MPAL 5IFPA 4FQIH 1KENH 4NQUA 1UCBH 3FT4A 3IKCB 2QMKA 5GS1C 2BSTB 5GZOD 3LRSA 5ICZA 4UQEA 1CLZL 5GGTL 3JV5A 4Y7MA 1ED3A 1JD7A 4PJCA 3ZT6A 5EZIH 4OCNC 1BFVH 1MUJA 2EYTA 3MV7A 3PHQA 1S8DB 2GJJA 2CHNA 1T1XB 2F54D 3W39A 2E3ZA 4ZO6A 2B1HL 4Y89A 2Y8KA 4OLZL 3G5YA 3DUHA 4PRPA 1LP9E 4TTUA 2J6EH 1N3NA 4ZXLA 3VCLA 5BV7H 1F90H 2VRAA 3TBTA 1RFDL 3GMLB 3RMEA 3X12B 1HNGA 1XSJA 4X5WB 2YK1L 2A6IA 2XVNA 4MXWH 3QPQD 2A83B 1GOHA 4GH7B 4W88A 3HFMH 5DD0H 2JIEA 5HI4D 5IF0B 4M9PA 4ZOCA 5IKCB 2VDQL 2EPOA 3MNWB 2PWGA 2YD9A 4J4PA 1R3KA 1N0LA 3DRQB 1KTDA 1RJCA 3I3EA 3PWNB 4JRXD 1MOEA 3NGBB 3RL2A 1RJYB 1WJ3A 3BIBX 4WFGE 1J05A 4PGCB 4RNRB 3AXIA 1UWTA 3ARPA 2KQMA 1H9VA 5E2JA 5EORL 1RUAH 1MFEL 1AO7E 1S7WA 4Y88A 3A24A 4JFHE 2XNAA 1JGEB 1LWRA 2BOCB 3V6ZB 5GS0D 4BKLB 1GC1H 1MVUB 2Q8XA 4V28A 1UVQB 3G6LA 2DIAA 1V0NA 4HKJB 1ZGLA 4S1RL 4DKEL 1KEGH 1WICA 4EDWL 1KBGL 2IEPA 2V5MA 2QQLL 3BIAX 2XQYG 3PP3H 3WDIA 1FNLA 1KXHA 3NABH 4QLLA 2VQ1B 1U2CA 3G9VA 4QDMA 1AO7B 4Y19A 1AXSA 3GBNH 5GRWA 4D71A 2V7NA 2P8LA 1JGVH 2EC9T 3E8UH 3UZEA 3CZFB 4KGJA 3DIFB 4NP4L 1KLFA 4OD1L 2BJML 4CMHC 2JF6A 3N50A 1G6VK 4XX1E 3F7QA 3RVWD 5C71A 3RNKB 1LGVA 1Y18A 2DI7A 4WFFE 5LCVL 3A6CL 3QUZB 4W93A 1QBLH 4XAWL 5IQ7L 2CLVB 1OAYH 1YC8A 2W63A 4X8JA 4WHYG 1A4KB 2GSGA 4N1HB 2CO7B 4HEME 3KYOA 3LKRB 2AXGA 1CTOA 4NIKB 3WFCH 4FQJL 2VC9A 4DWSB 4GW1B 4JCMA 1K8DB 4P5TC 5HHVL 2BP3A 2VURA 2F8OA 5CFHA 3CNKA 4G8FB 3DHMA 1Z9LA 2AK1L 2XRAH 4XVJL 4I0KA 4XXCA 3VINA 3ISWA 1Q9WA 5M17A 4QTHB 3L3KA 1E28B 2AJXL 1NFIB 3GH5A 3S88L 4I2XE 4X6CA 4FQ1H 1QNSA 3KYKH 5GGVY 4EANA 5F6HJ 1EO5A 4ZXBA 1XGTA 3CZJA 3GKWL 4KDTA 4GUPA 4ZO9A 3OSKA 1BVKA 3CH8A 4AK1A 1G94A 3V0AC 3QIUC 1HKKA 5IB4B 1QSFB 4QRUB 3VXMA 2W9DL 4NC1E 4HA4A 1S7VB 1RIHH 1BWMA 4BZ2H 4XPBH 3VFNB 1P4LB 1J1XL 5K9QG 5ID1B 2N4IA 3EYSL 1M6OA 1OTSC 3LEVL 5D9MA 4YPJA 1CZ8L 3RX7A 3BH8A 4M7ZB 3KPMA 3OZ9L 2GUOA 2NNAA 2Z35B 4Y5VC 1D5MA 4BQCA 3KPSA 2AAVA 1IGMH 1TVDA 2Y5EA 1Z32X 2JCCF 3HNTL 2C3XA 3FONA 1S7RB 4WIQA 3U7WL 3EKCA 3QPXH 4XRCB 3UBXI 4W6YB 4XWGL 1QFUL 1MWAB 1HSBB 4OV6F 1UD3A 3PDOA 4JFDE 1IAKB 5D96C 3VFWB 3ZKQD 2R23B 5DO8A 5KG9A 2M26A 5IW6B 3U4EA 1W9UA 1X3DA 5M03A 1DQMH 4KHTH 3ROOB 3O2LA 4LASH 4I3SH 3B2UC 5A8MA 5F72S 1PX8A 2EBNA 4MJ6B 3A21A 5ALCL 3RUGA 2BNQA 2HN7A 4Z6AT 1V0KA 4CD4A 3EFFB 2ZX8A 4U33A 2Z4QA 3T0EE 2CBIA 4LVHB 2OSLA 3N85H 3ARGA 2ESVD 4F9LA 5HD8D 4DUWA 2CPCA 3FO9B 2AV7A 5DC0A 2H3NA 2J7BA 2CDGA 3VXOA 2FX9L 3DV6A 4LRNL 5DK0B 1QYGH 1KJ2H 3BH4A 3PP4H 3L3GB 4U6HA 4D6FA 2G9HB 3WELA 4LHUB 4OZIF 4DJMA 2DTSA 4H0HB 5FYJH 1HCFX 1MAML 2PTTB 4X7SH 1OWRM 4Y5VB 2EZ0D 4EDXA 2DTML 4ZOBA 4J3XA 1RMFH 3QG7L 5DLMH 5I19H 5JUEL 1NSNH 3KPNB 2YZ8A 4L4TE 1Y7VA 4RL3A 2ZCHH 4G8EA 3C6LC 1VFFA 1OAUL 4MJ4A 4X5LA 4P2RD 4NKQB 3NSXA 3O2VL 3BN9D 4S2SB 3HB3D 2EXWC 5ABEA 2DRUA 2ED9A 4MYWB 4D9LH 4DM2A 4GXUN 2W65B 2DN7A 1GGBL 1V0MA 2M2DA 1Z3GL 4L8SC 2HLFD 2OJZH 1U8JA 3DHPA 2VC2H 2YXFA 3FRPA 1S5IH 3AU1B 4ONOA 5C07D 4JO2L 1NCDL 2Y24A 4P5KB 1EGJL 4UOJA 3GZAA 4QKXB 5DXWA 2VLJD 1HEZB 3UYRH 2ZXDA 1PD6A 5IGXL 3WNLA 4F7MA 4BELD 1RZKL 1GGCL 3S37L 3MRNA 4IRSD 2ZXAA 1EEUA 4F58H 1V6UA 2HKFL 5JW4Q 1UM5L 5GHWL 1W3LA 3HE6B 1MYRA 1R3HB 3BAEH 5D7KD 3CFBB 3BISA 5ECUA 4EN3D 3D69A 3OJ2C 5KVEL 1IC5L 2EE3A 2X05A 4NKDB 2H9GA 2F74B 3BD5A 2J8UE 3DC0A 5MEQB 1P2CB 1ISYA 3LQMA 4YXKH 5M94B 2YA1A 1XR9A 3QQNA 4P7LA 5CSGA 2VQTA 3MS8A 4F33A 4ZD3L 3VFOB 1NGYB 3TBYA 1CL7I 5J6HB 1J8KA 3OX8B 1OGAB 1QEWB 5FXCH 1DWAM 1HI6A 2Z1KA 5D9NA 1JRHH 2APBA 3BH9A 4QXTA 2DQFB 3GH7A 2XG9A 4LSSH 3WNOA 2X4PA 1OCQA 2R56H 4A3HA 4FN0A 2DH3A 3AMDA 3LMJL 1O6IA 1RURL 1G7HB 1QBAA 2WVSA 4GT7A 3EUUA 3R0MA 2VDKL 4YHGA 4HIEA 5I1HL 3D0VB 4PMYA 3AREB 4F7EA 4UFMA 1LHZA 4JFFB 2IALB 3Q2CA 1JGLL 1A9EB 1QI0A 4WEMB 1BREA 5F6HI 3VFPA 1ZA6A 4KVCH 1KC5L 5CUSL 1YNKH 4MS8C 4HGKC 1OPGL 4R97C 3W9DA 5ISZB 5GJTL 4TVCA 1YY9C 1XD1A 4PYSA 1VEPA 2DDXA 1RHHB 4YFDB 3D85A 5KTEH 2X40A 5J7CC 4TX6A 4M61B 5KSBB 5CSZA 2VITB 1CE1H 3QRGH 5I15L 4XMKH 1EPFA 2IXVA 4IIQB 4Z2HA 2VL5B 1KJ2B 1ZV5A 3IXTB 1GRWA 3O9WD 3U7AA 1FHLA 4J2XA 4Z7OF 3WJJC 4HWUA 2VCAA 2KQNA 2XVKA 1AY1L 5I1KL 1W8NA 1Q6DA 3PWUA 3M1BB 2IG2H 3N06B 5B3JF 2QSCH 2Q76B 3VFTB 5C8JB 4AD5A 1W72L 1SBSL 5IVXB 5TE4L 3NTCH 2N7BA 5FHAL 1ZHKB 1JP5A 1JFQH 1ADQL 3JSSA 1HL9A 4XB3A 1PIFA 2X4RA 1UJ3A 3UR7A 4OGXH 4Z76B 4QCIA 4M48H 1UYWL 2Q6WB 5GS0L 1FL5A 1I85A 3ILPA 5DURD 3V0VB 3MBEA 4I4WA 4OGAD 3HPLA 1HKIA 4KAQH 4PBWD 1KCRH 2IH3A 4YHPB 5DJ8A 2IAMA 5A2LH 3ZL4H 5KSVB 3GIZL 3O9NA 1KT2B 5D70H 1ACZA 1HDMA 3UAJC 3WNMA 3LRMA 4GG6A 4ODHH 5HHNA 5FK9A 4G9FD 4I18C 4ZAKA 1DBJH 1WFOA 5FF6B 2W91A 3WXWL 5DUBB 4MXVE 1BFOB 4MAYC 1NGZA 5CINL 2RR3A 1I9IL 3MLWH 1P84J 4OB5L 3VX1A 4PTMA 3S7GA 3MBXL 2D0HA 3HNVH 3GMMA 2VDOH 3OPZL 2EO7A 3IFPA 2CPUA 5M7QA 4JANB 3U0TA 4MVBD 5B21A 1VBUA 5EU4B 1AJ7H 1CLCA 4M03A 3TGXA 3UTOA 2IH1B 1HKMA 2BV9A 1JZ3A 3ARFC 5DD1L 4JHOA 4QOKE 3DROB 1NGXB 4WHDA 5LXGH 3BZEA 5DMYA 3V0WL 4JO4L 3H9YA 3V4PH 3N1QC 3O6FB 3UMTA 5AC4A 1GOOA 1PBGA 3MRMB 4P23B 3WL9A 3LXCA 4G42B 4UTFA 2OSWA 2B0SH 1DBAH 2ATKA 3VW3L 4JM2B 3QFJA 1FBIL 2E27H 5HI3C 3TT3L 4QLRA 3RZCB 3BD4A 3U4BL 1CLOH 5GRYA 3DX9B 1MF2L 1IM3B 4D6CA 2YSSA 2CHOA 4JAWA 2K1MA 3I50L 1F4HA 4N0CC 3VWJD 2QR0B 3CUPA 4LF3B 3MO1A 2EYRB 1OAZL 6A3HA 4JRYA 4R4BB 1CXEA 1P7QD 3LPGA 4YR6B 1X5ZA 2ITDA 2AQ3A 1B0RB 1V02A 4KJPD 1MQKL 5CJQL 1V6WA 3TH3T 1LWJA 3K74B 3WSUA 4FTVD 3IDYC 4MZ2A 3DXAA 3QFDB 4LPWA 4LSPL 4OV5A 1YDPB 4H20L 4I18B 4RDQF 5IMLB 1QI5A 4P5MA 1W0VB 1X1NA 1FZKA 4HJGA 1QUNA 4MAYB 4YQXL 1KPUB 1FLTX 4AZ8A 1QHOA 5HHPA 4M5ZH 5CHNB 3EYFB 5ETUB 4HUUB 5GRVL 4YE4H 5AZ2H 1I3VA 1NLBH 2DMBA 3LS4L 4O02H 2EIZB 3DWTA 3BQUC 3F7YB 4Z7NE 5I1DA 3LDBB 3S3SA 4AL8H 1WTGT 5IP4A 2ZOLB 3QBTB 1HIZA 4JFZL 1LG1A 2OYMA 3BPOB 1ISVA 4QO1A 1V3LA 1JTOA 4K3JL 1N6UA 2EPLX 1A7BA 3OKOA 2W60A 5F3HA 3CFCL 4N0FB 1WDQA 5DRNA 4NO2B 3ILQC 5C0EB 3GHEH 1QTYT 2XWEA 1YPZA 3VIOA 3HZKB 4I48B 4PJDE 5IWLC 3AVEA 2UWEA 5TF1H 2HT3C 3WFEH 2DDQH 1WBXB 4O2EB 2AW2A 2R1YB 1K9TA 1ZSDA 4LVEA 3VNZA 4BM7A 1I3GL 4O5LH 2WNWA 3T3PF 1ZWIA 2O61B 3KXFE 4ODSL 4XCEA 3A6OA 5ITBL 5AYBA 1F2XK 1P84K 3GSVB 4NSKA 4WRLA 4U1LB 5DHYA 1GHRA 3SGDI 3QIWC 3WD1A 4NNXB 4PR5A 1KQYA 1BECA 2FJFB 5D7LE 2E6JA 3IGAA 5HYJE 2ZCKH 4XCFH 2YXMA 4POZC 2DSVA 3PZGA 2BY1A 4WSKA 4M1RA 1KTKE 3K4AA 4TUOA 1KN2L 3KXFB 1VJSA 3BQUB 3SKMB 5FYKH 3N0PB 2VIRB 4YHNB 4WFGD 4GLRI 5CD3B 3U0WH 2EC8A 5LGKA 1D6EA 3BPNC 1AO7D 5D71L 3NA9H 2D7PA 5E94A 4JCLA 4JFHD 2P5WE 3DUUA 5D7LB 5SWQB 4EI5B 3EJQA 3N04A 4H8HA 5EO0B 1OSPL 1ZLUK 2DQDL 1Z9SA 3QYCA 1HHIB 2ICWA 3QEUA 3QDMA 2V17H 4CAGA 1UXSA 1DL7L 5B39B 4S3KA 1V3KA 1E4NA 1JYVA 5TE6H 1F3RB 3P11H 1KR0A 5ENWA 1DDHA 5IFAH 3PWJA 4PJEF 5IHUL 4J28A 1FNGB 2P5WB 3NFSL 2UUDH 3DYOA 2AABH 4ZPTA 1ZHBA 5EBLB 4P7NA 3UP1A 1HXKA 1OIFA 4Q9BA 4K94L 1NPUA 2AERT 1TNMA 3OF6D 4C55A 2XVLA 4Y16C 1I8IB 1C12B 5CPSA 3ROLA 4WFFD 5IHBA 4AG4H 2X8RA 3SIMA 2I24N 2BSRB 5AUMA 4LP5A 1XSKA 1CE6B 4H88H 1H15B 1XF5B 4ZO8A 1SJHB 4KRTA 4HZLA 3QAZC 4FMVA 4WEBL 2D2OA 5ICYA 2HFEB 3MMWA 1SJEA 3BT2L 2AAAA 4U0RC 1KXQE 1V7MH 4JFEA 4K9EH 1EDGA 4XBGA 1XGZA 4P8UA 2D23A 4LYRA 4PJ8A 1H09A 4YBLC 5KVDL 5B38G 4A6YA 3WXVH 1PX3A 4PRDA 4PIRF 2CKBA 4Y5YB 3KJ6L 4CU6A 1AGBB 4ZNEE 1UQSB 1H3GA 1I1AC 2YL6A 4WUKH 1QW8A 1MHHA 4QEGA 1GH7A 3BP6B 4D6JA 4Z8FH 3T1WA 3HAEG 2ZUSA 3SCUA 3TZVA 5E08H 4F8TA 2XXMB 5DWUH 3PV6B 1ERNA 5AYIA 4UI2A 2E7LC 5MI0B 1H41A 1JNHA 3PJSA 4BQ4A 1FV1B 4P4KB 4XCYA 2NY5C 5JPMB 3OLDA 1FL6A 2BNUB 3FQWB 4F57H 1EQCA 2Z92A 4ZUWA 2IPTH 5L6YH 4P7RA 3K7UA 3IS0X 3V6OA 2X4OB 3SKJL 5FUZH 4PJ9C 2Q7YA 4RAUA 1IL1A 1KUMA 2PWHA 4Y16B 5E8PB 4PUDA 2QV4A 4R26L 1T03L 4HPYH 4LGRB 2BSSB 3G5ZA 2M8XA 1WBZA 5T1DL 5TF0A 3UPCA 4CD8A 1SZNA 2COQA 1Y6NR 4ESKA 1CD9B 3AS3A 1JHLH 2CKNA 5E8DH 1MFBH 3UBXG 2VMFA 3QAZB 1J18A 1A1OA 4JVPA 4J4PC 3MZGB 4I5BA 4CVZB 4AD3A 1AFVL 2W62A 3QJHA 3KJ4C 4U0RB 5DQ9B 4B41A 5I18L 2VL4A 2YKLL 3MV7E 1ZVSB 2MOVA 4YX2H 5DUML 5KZCD 4JFDD 4JY6A 1B2YA 2CJUL 2GFBB 5C6WH 2JALA 1KLUA 2WWDA 1I1AB 1UB5A 4D3CL 3IDJB 1QNRA 3WBDA 5E6ID 3OGSA 3FT4B 1B9ZA 2CCRA 2C3WA 3LRSB 5ICZB 1D6VL 3B9DA 4PJCB 3UPRA 2XVPA 5C0RH 1MUJB 2EYTB 1RIUL 2P7TA 3MV7B 3PHQB 1WAAF 4LHUD 3T0ED 3W39B 1C92A 1FG9C 2WBJC 3N9GL 1W1TA 3G5YB 5FD0A 4PRPB 1ITXA 5FCZA 3DX0A 1O0VA 4CD6A 1KTRL 1N3NB 2EICA 3K8LA 3VCLB 5IV2A 2DJUA 3WH8A 2W4XA 1WCGA 3TBTB 2ERJC 5CBEA 4ZS6D 3FQNA 4XPGH 1P5UA 3LY6A 2FATL 3RI5K 2A6IB 1A6VH 4G7VH 2WMFA 1CDJA 1FH5L 1KXTA 2OQJA 4XV0A 2D9QB 4PSPA 1N8ZA 4NRXA 1R3KB 4WK9A 4RWYH 1KTDB 4P9HH 3PTMA 3H6JA 3LIZH 1BQSA 4ALAL 4TULH 4DAGH 3VIKA 3RL2B 4DEPB 4L4TD 4HWEH 5E2WH 3MCG1 1HVQA 4F8QA 1DR9A 4YFLI 1J05B 1FJ1A 4Z0XA 3HMXH 3MR9A 4JKPL 4P57A 3TONA 1HYSD 1XAUA 4OSUH 4Y19E 5HVHC 4BSWB 1JAEA 2XNAB 2WPGA 5IEHA 3JVGC 3QP3A 3HE6D 3MUGA 3WD4A 2OBGA 1BZQK 4ZUTA 1ZGLB 3ZKSD 4WKAA 3FN0L 3MJ9H 4RGOL 2HKHH 4DW2L 1Q0XL 5JHLL 1FGVL 1KGXA 3F5KA 4X0KA 3VI3F 1A0QH 3S35L 4Y19B 1AXSB 1IEHA 3OGOE 1TJGH 2V7NB 2P8LB 3H3BC 3ZYIA 6FABL 1E43A 2IGTA 1RIVH 1H5VA 1U8PB 5J56B 1IT9L 2ERJB 4K8RD 1E4JA 3W25A 1Z5LA 3WKZA 4LOUD 1TQSA 2OCFD 1Y18B 3H55A 2HJLA 3AS0A 3X14A 3LH2L 4OLYH 1R47A 5CAYB 3RWGA 1E4MM 4WTZA 4PJIA 5IROC 4AT6B 3PABA 4X8JB 4PLNC 2GSGB 3ZDXE 3KYOB 1GGIH 2AXGB 1YN7A 2OTWA 5I76A 2BVQA 2ORBH 4FNLH 3RVVD 1Y6KR 3M7SA 3IFLH 4M6MH 2EH8H 4XPFL 5KVGH 3ETBF 4X6CE 4IS6A 1BJ1J 3V6BR 4HBCL 1LG2A 4WU7A 5KANI 5GQBA 2ARWA 3ZKXB 1DBBH 4LLDA 4U1JA 3GKZA 1Q9WB 2XKUA 2YD6A 3VXME 1LO2L 1QPXA 3I75A 3O11A 3PZNA 4LSUL 3L3KB 2L4OA 3Q5YA 4WVRA 5C0ND 1A6AA 4UV4H 4X6CB 2VH5L 3U4AA 4JZNA 4FQ2L 3C2AH 4LYQA 3PTQA 1T21A 4QNPE 4YDIL 3AFLA 9CGTA 4GBXC 4LCWE 4ZXBB 4MD4A 1XGTB 4ZTPL 4GUPB 5BRQA 1T0NA 3KPSE 3TVMD 4NZJA 1BVKB 2PXYC 2DM4A 4OFYD 4JFSA 2EPNA 4F9LC 4YHIA 3SDDB 1H1NA 3IJ8A 1MFCH 3RGVA 3VXMB 2P4AB 2XFXA 4HPOH 3C5ZA 2B7DT 4WY7H 5HOSA 2VRJA 1RAMA 4PJBA 5EO1A 3A67L 1M6OB 1KGCE 3HUJA 2Q1EA 3IFNH 3N12A 5A8NA 3BH8B 2O9TA 3KPMB 2UY5A 2GUOB 2NNAB 5DVKA 4PRHA 3SCTA 1D5MB 2IBZY 1Z0MA 3KPSB 4JG1H 2O5XL 4HXAH 1B0WA 1F6LL 4Y2OA 5ABDE 2AI0H 3FONB 3RP1A 4NX0A 5KS9A 1IM9A 3RUGE 2VLME 5J3HC 4YFEA 2D73A 3PDOB 2MMXA 3K2UL 4KPHL 2WINA 4NFDA 2YMXH 5KG9B 1T4KA 4K3HA 4R4NC 2BC4A 3U4EB 3WV0A 1IVLA 3DYMA 2X41A 1LQ0A 4P3WA 3WLWD 5D2NC 1TQCB 3HMWH 4NKIL 5FCSH 1WQVT 5EOCH 3RUGB 1X5LA 2BNQB 2HN7B 4H2CA 2VT0A 1O7DC 1GPFA 5A6SA 4I8DA 1LDPH 3O4LE 1KPRA 2C4XA 3CTTA 4U6XA 5L88L 3G6JF 3OAUL 4PJHF 3O6FD 2B5IC 3L4YA 3C60A 4GW4A 3WFBH 5I6SA 4HK0A 3ARGB 5BVPH 4P23D 1JWUA 5DDHA 4IM4A 3BZ4A 1UCBL 1YN6A 4DQOL 1ODAA 2AV7B 2H3NB 3S9DB 5DFWH 3EOAA 2CDGB 4GMTH 2A3AA 2J75A 1WSST 3ZKND 4OLUH 4TUFA 4M1GL 2JB5H 3VXOB 1CG9A 3DV6B 1CICD 4QOKD 1SY6A 4U6HB 1LNUA 5FV1L 4AIEA 4PGEA 3EYQD 3KL3A 3U36B 3W4RA 3HZVA 4LMQI 3JUGA 3NBNA 4EDXB 3D25A 1R87A 4DM1A 4NHUA 2GSJA 3TN0A 3MPCA 5IG7A 1RI8A 4OZFH 3KE0A 3X13A 1FDLL 3GSRA 4MD0A 3F7RA 4G8EB 1XIWC 3VD7A 2XM1A 4JREC 3G08A 5DD0L 4PMUA 1L0PA 2V38A 3WQ5A 3L5WA 3L9RA 1E4WH 3IJ9A 5CJOH 4PPTA 1ZKAA 1LO4L 1NGPH 5EG6C 5CD5C 3D0LA 2XG5A 1MCDA 3RRQA 1U8JB 4DGIH 1EJOH 5E99L 4HOWA 4DUVA 3GHBL 2YD4A 5FB8A 5EC1A 2IFGA 5T3XH 4ML4A 4O9HL 3HG3A 1BTCA 3X17A 1NGWA 4F7MB 2QPUA 1M05A 2X4TA 4EUPG 3MRNB 5B22A 3JWDC 1FA2A 1IQWL 1ORQA 4Z95H 3TWCH 3FB8A 1JTPA 5IK3A 3QO1A 1KCSL 4F66A 3WY1A 1CECA 1JHTA 1GXEA 2XN9A 1WGOA 2FEEL 3D69B 1E4XI 3O3BA 1US3A 2H9GB 1VADA 3VMNA 4G8GA 1JZ6A 2CGRH 1S3KL 2UWFA 5D2LA 2EECA 1YMME 2Y7QA 5IBUB 4JZOA 1XR9B 4WF7A 5C8BB 1ZTXL 4H1LH 2XXCB 3O41B 4ELMF 1LK3L 5C9JA 3E8UL 5FYLH 4PG2C 5D1QC 4X6DE 4UDTA 3TBYB 1HF6A 5HVFB 2DSKA 4X9FA 1HI6B 3MSGA 1BOGA 3DVNA 2AJSH 1CD0A 1GZJA 3BH9B 4QXTB 1NOFA 2QLYA 2P24A 1QBLL 2X4PB 3S6CA 5CZKA 1OAYL 1JD9A 3KDMB 1M4KA 4R7DB 3KXFD 3AXLA 2NY7L 4HIEB 2ZOXA 5DD5L 1ZT4A 4ODXA 4OGZA 2VXUH 4YIQA 2VXSL 4X6DB 3LZFH 4F7EB 3EO0A 1NBYA 1T83A 1MCSA 5BRZA 4CRPA 1F4WH 2NY3B 3VFPB 1ZA6B 5D7LD 4EI5D 4S1DD 2V5YA 5HYJD 2XM2A 1HINL 3EJPA 1WT5A 3D85B 2XRAL 4PN2A 3C8HA 5CSZB 3BLBA 1EK3A 5I9QB 3ULUC 4WKHA 5HDRA 1D5BA 3FQXA 3V52H 4KJWD 2I9TA 5BXRA 4LEOA 2EDOA 4YHLL 3PWUB 5SWSE 2P5WD 1RSFA 4L3CA 4OCXH 2NYYC 3VGGA 3IDXH 3AGVA 4L9LC 3ARZA 1A21A 3QI9C 5FHBH 1N26A 3L1OH 3TBVA 5DEGB 2P5EE 2X4RB 1UJ3B 4D9QE 2VABA 1RIHL 1AD9A 3EMCA 2BHYA 4QCIB 1FNAA 2DLTA 4X7TA 1FL5B 3RHWF 3BRGC 1FORH 1ZEAH 1B3ZA 3MBEB 3MRQA 4RAHA 4R8WH 4I4WB 3HPLB 3M6DA 4J8RA 1MFDL 1UXWA 4E41A 2IH3B 4UMGA 3TA3C 3D39A 4FFYL 4M6NH 1EUUA 2IAMB 5DJ8B 2FX7H 3BWUC 4UIKL 3TYFA 1LO0H 5TQ2H 2WZPD 2A3BA 3IYLW 1L7TH 1HDMB 3GSXA 1FAKT 4YDLB 5I1CH 4GG6B 3VFUA 1HH6A 4KY1H 4B7IA 2DGAA 3KPRE 5FK9B 2FHCA 4ZAKB 5FYLE 1FZMA 4JHWH 3DLQR 4JM4H 1BIHA 4R27A 4K8RL 4LPCA 5EMYA 2GT9A 1NGZB 4XNMA 3KLKA 1MXDA 2R9HD 1OAQL 3WKMH 3W5NA 1UD2A 1JGUH 3OKKA 3WUBA 3GMMB 1U3HA 2EE6A 3IFPB 4ZS7L 2J25A 3U0TB 3UTZA 3QFJE 5D5MA 4Z7QF 4EZMA 3AXHA 1NAKL 1FFNA 1PZUB 3AIUA 3K1KC 3BZEB 4JRYE 4PRIA 1EAPA 3HHRB 4OZGE 3NH7L 1UZ8A 4RZCA 1CGXA 2DM2A 4NN6C 4CW1A 3WL9B 2ATKB 1TJIH 2DLFH 3QFJB 1QYGL 1KJ2L 4FS0A 1WO2A 2YSSB 1ZGLP 3HG4A 3ZE1E 4OZHE 4C56A 4AEHL 3PP3K 3VWKC 3CUPB 5F96L 3MO1B 4JRYB 4ATDA 4OZGB 2ITDB 5HYSG 3GB7A 4UOW1 5F1IB 4N8PA 4LLAA 1E72M 4YLQT 3DETC 4MNGE 5D8JL 3T8XA 1IBGH 4BH8A 4WJXA 3DXAB 1LEKA 3S4SG 3SGJA 1JPGA 1R5WA 2CLZB 4OV5B 3G6DL 4FFZL 1AH1A 1T2XA 4H8WL 4P5MB 1FZKB 4HJGB 3TT1L 4FQPA 5GNYA 3PL6C 1ZE3C 5MP6H 5HHPB 2EPKX 1X5YA 4FK9A 2K3TA 4HCRL 2BY0A 4XVUC 2YBUA 1R6VA 4LCCA 4X7CC 2N56A 2OJZL 3FB6A 3MV7D 2HWZH 2VC2L 1H3UA 3T2PA 2B8OT 2CH8A 5I1DB 1YPZE 1M7DA 4KJYA 1KCLA 4HQQL 3CLFL 4D6GA 1NCUA 1JBJA 3BYYA 4FFVC 4Z7VA 1NWRA 4M62L 1KF9B 3TOPA 3OKOB 4KRPB 4E9LA 2W60B 1DN2A 4OQTA 3OGVA 4ZUSA 4YC2C 4OIBA 4MLSA 3Q48A 4NN6B 5F3HB 2QKIB 5CKAA 2EDLA 5T1MA 5DRNB 3WYRA 4XUYA 4N0RA 5AZEL 3S5LG 4GPNA 3WFZA 5CZXD 3CMGA 1YPZB 1CXKA 2R0LH 4NO0A 4UBDC 2UWEB 2WK2A 3L2LA 2GK2A 1RUMH 1ZSDB 4PMZA 3I2CH 1UWEH 1IC7L 1ZWIB 4HWZA 5D1ZA 4Q0XH 3C08L 3QEGH 4XCEB 3THMH 1AGFA 2DSWA 2PBGA 5D4YA 3H2WA 4JO1L 4OOZA 1ZK9A 2UY7A 3TH2T 1NCCH 1FVDB 5JW3H 5DHYB 4M7KL 1UQZA 4XT1C 2Z0BA 4KTEH 4PR5B 5IDIA 4JQXA 4H26A 1HVXA 4FZEL 4LSSL 1G7MA 3IGAB 1J87A 1V6VA 3W29A 2RCSH 3WEZA 3BIKA 4TUOB 1CFVL 5JXEA 5J1AA 2YJQA 2HVKA 2GK0A 2Z8VC 1CD1A 2GY7B 3O3AA 2NXZC 4K7PH 1UCTA 3RDTA 5JDJA 1HWHB 1JXKA 4HC1H 5DFVD 3U57A 2G5RA 2W0KA 1HKLL 5I8EA 3EO9H 5I6XB 4MDJB 4XNQA 1D6EB 2GIYA 1UB6A 3GSNA 3U0PA 4Y19D 1Q1JL 2B2XL 3PTKA 5I5RA 3OXSA 5E94B 4B50A 1TVPA 1EXUA 3DUUB 3FN9A 5A2KH 4HUWB 1CBVL 3FQTA 5KTEL 3P77A 3UJIL 1CE1L 2F7RA 2OXGA 2ICWB 3QEUB 3NPZB 3QDMB 3UTPE 4NWUL 1UXSB 2CLRA 3VSTA 4GS7B 4TUKL 1BM3H 2DQIL 1G9MC 4LDEB 1DDHB 2DT3A 3C8DA 3H9ZA 1SMAA 4OZ4A 4ZPTB 1ZHBB 3R8QA 4NBYB 4GRWF 5F44A 3S37X 4LARL 2WVVA 4JFEE 4GAFB 3ROLB 3QDGA 4V2XA 4WFEE 1OWQA 4XP5H 1KGWA 5AUMB 3BRDA 5GGRY 1QLRA 1DQLL 1S7QA 3U1SH 4NN7C 4NWTH 3ZZ1A 5HGDA 3VM5A 3NIFE 4HZLB 1KCRL 3UZQA 2LFGA 1I7TA 5ICYB 1FE8H 4WWID 3NUKA 3TO4C 5IBLD 1SJEB 1NUDA 3LKSA 3V4VL 5KANG 2H2PD 4JFEB 3PZUA 5D70L 1BAFH 1DP0A 4XBGB 3SY0B 1B0IA 1FNSL 1FSKB 3BOVA 4GKSA 4PJ8B 7FABH 2HFGH 4A6YB 4PRDB 3UZVB 1DBJL 5E9DA 2CKBB 3V6OE 1MHHB 1FGNH 3MXWH 1UM4H 2QLVB 3SDDD 1BVLA 3HC3H 4XVTH 1JTTA 4GAJL 1SFSA 3VXMD 4M4RA 1YECL 3DO7B 4AD2A 2VNCA 3HNVL 3QO0A 3TZVB 3QR3A 2VDOL 1EFQA 1T89A 4M3KB 3A47A 2AJVH 4XBEH 1JNHB 1NCNA 3PJSB 4JHAL 4UFHA 5E1QA 4FLSA 4XCYB 4R0LC 1FL6B 4J27A 3ULVC 3TBSA 4YGAB 3CHFA 1BOYA 4LCWD 2Z92B 1Q0YH 1RZFH 4ZUWB 2GSIA 3KPSD 5IR1A 3D48R 4CD7A 3MCKA 2PO6C 1AXTL 2YA0A 4M1DH 4QGTA 1KULA 1U41A 2VE6A 1MHPL 4NN5C 1IL1B 1NAMH 1HILA 3AS1A 4RAUB 2Q7YB 1WPCA 1QNPA 4KKCD 3VDHA 3WUGA 2G60H 3BCDA 4N5UA 1OT1A 5CZVH 4N0UA 5ESAA 5C70A 4GRLD 3G5ZB 1WBZB 4ONHB 4UFIA 1CLOL 1KGCD 2MPAL 1MRCH 3KR3H 1H3TA 1MJ7H 4DFIA 3V79C 3FT3B 4UU9A 4TXEA 1MEXH 1A1OB 4UQ3A 5DJDA 2PF0A 4I5BB 1Q72H 4AISA 3QJHB 1D3CA 1SEBA 2VLMD 4EE9A 3CX5K 2CXKA 2HTLC 5F7KC 1B4JH 5JQ6H 3VFRA 3F7VA 4JY6B 4PY7A 1KLUB 4KUCF 1DE4A 1UB5B 4I9WE 3D18A 3GJFH 4MXQD 4WDIA 1E5NA 1NM9A 2J7CA 3UPRB 5KSBF 1WDRA 2E7CA 4PJ7A 4WU5A 3WIHA 2O26U 2P7TB 3O4LD 1KQZA 5D7JD 3WDHA 1L9MA 3QWOA 3VH8G 1J12A 1DBKL 4KQ3L 4PMVA 2XA8H 4K3DH 4PRNA 2R2HA 3QUYA 1MY7A 2DQGL 5IV2B 4NJAH 5CBEB 5I1LA 5IVXF 3FQNB 3GK8L 4GZEA 1A3LH 2H1PL 1INDH 1A6ZA 2A73A 2CEQA 2XVGA 2DDQL 1E3XA 4UQAA 3DDGA 3WDRA 1VPOH 2ICEA 1DVFA 1KXTB 5GS2H 2OQJB 4MNKA 4O5LL 1N8ZB 4UTAH 4JRWA 1K4CA 5C0DA 3BKJH 4LQ1A 5HDQH 4R6UA 1ZGLM 2Z9TA 3HG1A 2A74A 2VO5A 1N0XH 2DOCA 5D8ZA 5JUVA 2VKWA 2OS7A 2FJHA 3K8KA 1FJ1B 4Z0XB 3MR9B 3EW3B 4P57B 2VZSA 5IXEA 3WJLC 4HS6A 4U7SA 3SCVA 3GNMH 1IZJA 2C7FA 3EJJX 1X7QA 2UY6A 5IEHB 3MUGB 3FT2A 4KMTH 4QXWA 1DUZA 5EIIB 4PTUA 8CGTA 4NZRH 1NCAH 2BVPB 4ZUTB 1EBPA 3II1A 4ZTOL 4U6VH 3AIVA 4BQ3A 1ECEA 1GVIA 1HIMH 1PSKL 5D6CA 5HI5D 1HP4A 4X0KB 2A3EA 4OKDA 3K80A 3C09B 4PJIE 1NAMB 3LD8B 3POHA 2YN5A 5FUCC 4TOYH 4PTTA 4QRPE 1U9KA 1S7UA 3BJLA 1J5OL 1N7MH 2SEBA 3PF2A 1ZLWH 1OGBA 1Z5LB 1HN1A 1II4E 1J8HE 2NCMA 4ATWA 3TFKD 2F54A 3RKDD 2XQBH 5LVEA 3P11L 4W89A 1YMMD 2JJWA 3ZTNH 4JM2F 3X14B 3RIAF 2CBVA 1QPPA 3RY6C 3RWGB 4PJIB 3PABB 1ZBCA 1BHGA 4PMDA 1U91A 2AABL 1XCXA 1YN7B 2OTWB 4QRPB 2BVQB 1YEHH 5I76B 4CUCA 3VXQA 3O8XB 1VFBA 1JAKA 4XP6H 3B5TA 1G7IA 4IOIA 4JO3L 4TPRH 1B3XA 4IS6B 3OAZH 1F6FB 4MB5A 2DQEH 1A7PH 4FQQA 1I7UA 5BO1L 3D85D 4KK9D 4WU7B 1EUTA 3VGAB 3SGEI 3CSPA 1CGYA 2XACC 4LLDB 4U1JB 4K7PY 4JRXA 4WO4C 4JDZA 1UR4A 2D20A 3CC1A 1U8HA 2CD0A 3I75B 3O11B 4H41A 4PP2A 1V7ML 2X89A 5F7LB 3HR6A 1A6AB 3R1GL 5BJTA 1NKOA 4PJBE 4JZNB 3HUJE 3A23A 4FNPA 1T21B 1IAIM 1P7KA 3RJDA 3A22A 1EXPA 4MD4B 2OWWA 4PRHE 1T0NB 4KU1A 1J0JA 3MOQA 1FH9A 3VGHA 4YHIB 4U31A 5E2VH 5E08L 3RGVB 2XFXB 4OF8A 3C5ZB 3SE3C 1ISWA 4P3CL 5SWSD 3FOLA 3SCOA 4QXUH 4PJBB 5EO1B 4F57L 2X42A 1NWUA 4Z77A 1OTUD 3HUJB 2BVOA 5L6YL 1NCBH 2IAMD 1QFWM 3Q6GL 4PRHB 1UA6H 3MODL 4UAOB 2E3VA 5FUZL 3LXBA 1WZ1L 2P5ED 3ZTJG 4D9QD 3MRHB 2ADGB 4I3RL 1IM9B 5E4IA 5KS9B 1HT6A 2BZDA 2BHUA 1OLLA 3KAAA 5ILTL 4ZSOE 1QP1A 3S96A 4UV7L 1M01A 2JJSC 1CFBA 1WLHA 5E2UH 1QRNE 2WINB 1CDIA 1QLEH 1T4KB 3V5HA 1E4KA 3KLSA 2BC4B 5T3ZH 1VHPA 4IDJH 5ABHA 4LKXA 1T66C 4A3YA 1QSEE 1BIIA 2GITA 3GYCA 3L3OA 4KMLB 3KPRD 5EPMA 2J77A 5KVFL 5FYLD 3L5XH 4KROB 1KPRB 4LU5H 2QF8A 5GZNC 5D1XC 1QNQA 1U2HA 4U6XB 1ZLSH 3MGOA 1SMOA 5BYWA 1T7VA 1PKQA 1KWKA 3C60B 4AZ5A 4GW4B 1PG7W 3RJYA 4HK0B 1KYOJ 1JWUB 5DDHB 3BZ4B 1YN6B 2NT1A 4YHKL 3R06A 5E5UB 3BEWA 3HE7A 1KIPA 3QFJD 3EOAB 1KXVC 1PG7L 1W2KT 5C0RL 1CG9B 3LS5H 5GISL 3DNKA 4UZGA 1U33A 4GI6A 1LNUB 1KTBA 4X5XA 4JRYD 1LF1A 1BQLL 2EH7L 4PGEB 1FN4A 3VG0H 5FOJA 4YXLL 4JFXA 3HA0A 3HZVB 2FD6H 1K5NA 4QCEA 4I77L 4XNYL 3D25B 1IKFL 3B6SA 4F9PC 2F18A 4OOUA 4KRLB 4NHUB 5F7FA 2WMKA 3TN0B 1CTNA 4GMSL 1R7OA 5IG7B 3P0YH 1MVYA 1P4IH 1PEZA 4RBPK 5DD6A 1T7YA 4Z7UA 1A6VL 4G7VL 3X13B 4MD0B 3GSRB 4I3GA 5EDXA 1BF8A 2VDPH 2Y4SA 1B6UA 3G08B 5ECJE 3L5WB 4YHYB 2W9EH 4NZUH 5KSAA 2QSTA 1U8KA 1LL4A 5EU6A 5K9JL 5I74B 1CWVA 1RVFH 4PREA 3O2DA 3L4WA 1E6JH 4IOFC 2WWMD 4G8GE 3P2TA 5EC1B 4W6WB 5FB8B 5D2LE 2B4CH 4KRPD 1NGWB 4KXZI 1WT5C 4X4XA 5A1AA 1YNLL 4QTIL 5ESVA 1M05B 2X4TB 2XYLA 2C4FT 3WUWA 4J6RH 1E27A 1ORQB 1WZAA 5GRVK 3FB8B 5IK3B 4Q9QL 2IQAA 3QO1B 7CGTA 1YMHB 2N7AA 5JXAL 4BQ2A 1JHTB 3D1MC 3MLYH 2XN9B 4XVSL 2QJDA 4S0SD 1QFWL 4OD3H 3O3BB 3CZLA 3C87A 1VADB 4G8GB 5CJXA 1GUVA 3QDJA 4ODTH 3AIEA 5D2LB 2XZAH 3KS0J 4ETYA 1R33A 4ONGL 1U3JA 3AM8C 1K9DA 1Z0NA 2R1XA 4JZOB 1Q9KA 5JBDA 5C9JB 2CESA 1RUPH 2D4FA 4KQ4L 1RIVL 2ZCLH 1PVHA 5EOQH 3SPVA 1P7HL 4PMOA 4UDTB 2Z31C 2DJ4A 3HJEA 1MJUL 1HX0A 1EFXD 1HXYA 4UNTA 1BOGB 1DSFL 1D2KA 3LHPH 1CDBA 1OD7A 2P24B 4P7QA 5I16A 4KKLD 1TETL 1J0IA 4APQD 5C9KA 2E7HA 4OFPA 4YDVA 4S1SL 2LTQC 1E0OB 1AGCA 3AXLB 5IESH 1CT8B 1ZT4B 4ODXB 1KYOK 4YIQB 5A2IH 1R86A 1NBYB 2J74A 2VXVH 5BRZB 3IFLL 2F19L 3O6MH 4X83A 3KLAA 3P0VL 2Y06H 3ZR5A 1C7SA 1JNDA 1YJDC 2ZG2A 1AQKL 1JWMA 4HWBH 1BGXH 1RUQL 1IZKA 2J62A 2EEAA 2J7FA 1F6AA 5C07A 1T04A 1U3HC 1AE6H 1KJVA 1JI2A 1IC4L 1OTSD 2VOTA 1D5BB 3IJHA 4LAQL 3T2NH 3W2DL 3FQXB 5I8CA 3KPTA 4UV4L 2I9TB 4PJCF 2ZJSH 4LEOB 3S36X 4HP5A 1W1VA 4L3CB 2KZ1B 4QWWC 5BW7A 1DLFL 4E41E 3I3BA 3JV6A 4HUKB 3HC4H 4WI8A 4Y4FC 1EVUA 3UTPD 1IMHC 3AISA 5ERWB 4EN3A 3TBVB 4RFOL 2VABB 4PS4H 1AD9B 1HOCA 2NY6B 3GI8H 3W6MA 4X7TB 4OLVH 3WDPP 1NC4D 3MRQB 4PJGA 2E9WA 5EULV 5BZDA 5INDA 2QSQA 3B2UD 2EIBA 4J8RB 4L5FH 1UXWB 4E41B 2G3NA 3WEMA 3L6FA 4PRWA 4WWKA 1UOKA 4JG1L 2PTVA 3S35X 4JFED 4HXAL 1ODZA 3TYFB 1FO0H 1PLGH 1HK6A 4WENB 3QXVA 4LSVH 4WFED 5DHXB 5KJRH 1T7XA 4FMKA 4PJ8D 5KOVC 3GSXB 2VJXA 3SGJC 3VFUB 1HH6B 1CI5A 2J4GA 4W86A 1FZMB 2AEPH 1YYMH 4PRIE 4FF5A 1RZ7L 4ERSL 2GT9B 4XNMB 4R90L 2H26A 2MKWA 1U6AL 1CGSH 1A4JA 4OM0H 1CU4L 3OKKB 3GDBA 1CL7H 3DSFH 3F12A 2DD8H 5AYUH 1U3HB 4ZOAA 1MCEA 3UTZB 2HMID 5I30H 3BSZH 5D5MB 5DQDH 3IAQA 1T7WA 1F3JA 5ALBH 2NW3A 4K68A 1P4BH 3GIVA 1LDPL 3CVIL 1FFNB 5ADPL 4LPVA 1NMAH 1AC0A 1C1EL 2WUCL 1EAPB 4PRIB 2G5BA 1QKZL 3WFBL 1UZ8B 4RZCB 2D3LA 4ODVH 3HMCA 4CW1B 4FXLA 1IAOA 4M8VA 3A4AA 1UD8A 3C6LD 3EHBC 1FHGA 4OTXL 4OLUL 3F6IA 4HA1A 1AGDA 3GXNA 5HGBA 1OAXH 2OJEA 4U05A 1U8MA 2DF3A 4C56B 2QADC 1UZ4A 3CSGA 1BGGA 2XWJA 1SYSA 4RX4A 1GCFA 3BLPX 3ZO9A 4PJFE 1EEYA 1FYTE 3GB7B 5D1ZC 4DGYL 3THDA 1BPVA 4PUBH 1XCQB 3T8XB 4BH8B 5F71A 1LEKB 1US2A 1AVAA 1C8PA 3FL7A 1JPGB 1R5WB 5I23A 3QA3A 1NC2D 1V8HA 5F9OL 4AZIA 1JF5A 1S78D 1MCBA 2GI7A 3HI5H 4YZFF 3D4ZA 1YNTA 2VWEC 1TA3A 5E03A 5GS3A 5DRZA 1WP6A 4LSDA 4RMTA 4LCCB 1LVEA 4P0DA 3FB6B 2XFYA 3ZDXF 1J0ZA 2PWDA 1M7DB 4KJYB 1XH2A 2FZ3A 4G9FA 3WUZA 3MUIA 4F7PA 4P8VA 4I9WD 1HP5A 2X1IA 3AMGA 4Z7VB 4RIRA 4V1DE 4X6CF 2X70A 4Q6YA 4HKZA 1C5DA 3AI0A 4PY8J 4ZUSB 3B43A 4PGBA 4JFOA 3TWCL 5FCUL 4U3AA 2EDRA 5T1MB 1S46A 2FDBP 4Z7WA 3FJTA 2EIEA 2CITA 4WCYL 4NO0B 5CP3H 3ULUL 1B6DA 5AAWA 2CGRL 1VCAA 3UG3A 2EDNA 4ORZC 4P2QE 1AC6A 1UT9A 2EEBA 4HWZB 5D1ZB 3BFOA 3EZJB 1AGFB 5FEBA 4NI3A 2R4RL 5IMOA 4MS8D 5B4MC 2P44B 5CS7A 3BUTA 4K23H 2CK0L 4YHOH 2D3NA 4U2YA 3VWJA 4K7FA 2QV2A 3R4DA 4H26B 3IU3A 4JN1H 4PP1C 3REWA 1G7MB 4Y7EA 4N90E 1XF1A 1XGYH 1P7QA 2V5RA 4M5YH 1XH3A 3A3HA 1V3MA 2AJYH 3EJZD 1I9EA 3BIKB 3Q0HA 2BXZA 1TTFA 3OMZA 4LQFL 1GGTA 1ZS8A 5FYJU 5J1AB 2HVKB 2GK0B 1WKYA 1CD1B 1MCOH 3DO3A 4NBZB 2VXUL 3O3AB 1N64H 5HYFA 3RDTB 2DQXA 3C6SA 5IVZA 3QG6A 3AAZB 5I8EB 3CXDH 4LVOC 3NACH 2VXTL 1U8NA 4XNQB 3U0PB 3GSNB 1UB6B 3RUGF 2JK5A 3OXSB 5A43C 1C8XA 2IADA 1EXUB 1TE1A 2V7HA 5IB1A 3FOMA 1G7QA 1UWUA 4RGMC 5A6AA 4L4VA 4GZIA 3P77B 1Q6EA 5EOTB 1QFHA 4OGYH 4GSDH 1G6RA 4P46D 1ES0A 3DX4A 1KIUA 1T1XA 3QDGE 1E6QM 2CLRB 1MAKA 1S9YA 2A2QT 4FABL 5C0AE 1IGFH 4KI5C 4QRPD 4OZ4B 4RDQG 3ZMRA 2I9LA 3O8XD 3VFMA 5J12C 5D2NE 4C58B 2OW6A 3SKOA 2YD5A 3UAJD 2V5TA 3O2WH 4EUPH 2WVVB 1J8HD 1Z2KA 4HIXH 4LSQH 4BCEA 3QDGB 5IF0A 6CGTA 1BQUA 1C3FA 1LP9A 1JF1A 1FORL 1QLRB 1ZEAL 3PWNA 1S7QB 4R8WL 5C0AB 3MLUH 2NW0A 1IFHL 5HGDB 3BE1L 3VRIA 1WVZA 3RFZC 2MQ3A 4NM4L 1A2YB 1I7TB 4G5ZH 3RU8H 4NQXB 1B88A 3D6GA 4XHJC 1JNLL 1EO8H 2FX7L 3LKSB 4PLJD 1JGDA 5TQ2L 4P2OC 5DYOA 1SVCP 1P53A 1XGQA 3G6AA 5IHRA 4OUOA 4IPLA 3UCRA 4GKSB 4TVPH 4E42A 5E9DB 4UILL 2FHBA 4RE2A 4XPTL 2XWDA 1BVLB 5FKPA 3WKML 1L0YA 3RGVD 3CZKA 1L8NA 5HI3D 3QO0B 3SGDH 3WENA 3UTSE 5GS2D 2VSDA 3WD3A 4X6BA 4EOWH 1X4YA 3VO0A 4MGXA 2F5AH 4POUB 4IUGA 2WUBL 1BZ7A 4YJZL 2ZKHH 3D5OF 3TBSB 4LSTH 5BROA 2GSIB 4PRHD 5IR1B 3MCKB 3NCFB 1GOQA 2D7MA 1VERA 1LILA 4XNZB 1IM9D 3W9EA 3ALGA 2VE6B 1HILB 3CMOL 4GLRH 3H3KA 4XNXH 1CBGA 3SURA 2OXHA 1TJIL 3OR7A 2D22A 4UZUA 4FQXC 4N0UB 5ESAB 3PIQA 1JDCA 4BQ8A 4UNUA 4MQXC 3LB6D 4F80A 4G6MH 2V9RA 3ZE2E 4W4OA 3WO4B 2KH2B 5FGCE 2F5BH 1T5WA 2WKGA 1WFUA 4UU9B 4UQ3B 4YO0A 5DJDB 3LRGA 4KH2A 2E40A 1I1XA 2GJRA 3MU7A 1EBAA 3Q1SH 1SEBB 4U1HA 1RZKC 3WL1A 5A6JA 4JPIA 5L8JB 1CLXA 1BEYL 4JKKA 4RGNE 3LN9A 1WNOA 4RA3A 3VFRB 3F7VB 4PY7B 3EMZA 1QRND 3FO0L 4IMKA 2E9LA 3C60D 3NZHH 4XCCH 5DD3L 1TPXB 1DWJM 1DE4B 5FGCB 4LXFA 2BFVH 1MW1A 3D18B 4PY8I 3V5DA 4BFEA 4WDIB 1IGIH 4RQQA 1QSED 2P43B 3AICA 4I0PD 2J6EA 5I1GH 5BMFL 3ARBC 1FPTL 4PJ7B 4KWUA 4RGNB 2FGWL 2EDBA 3QWOB 1W1YA 2RB8A 5IEKA 3SDAA 3LKNA 5CILL 2NY1B 1KCUH 3QIBA 4PRNB 3TN0D 2R2HB 3ORJA 3QUYB 5EFFA 5KOMC 4A6YL 2CKBL 1W8OA 4TVPE 4I2XA 5I1LB 4RE4A 2W5FA 4IHOA 1O7AA 4Y8DC 2Y72A 3NDZA 1G7JA 2PN5A 3HNSH 1A6ZB 2A73B 3TCLB 2P47B 4AMWA 2OL3H 2UZXB 1UR8A 2ICEB 3WD5H 1DVFB 2JB6A 3PQYA 2WKLA 3WY2A 1UWEL 1K4CB 2XT1B 5DZOA 5C0DB 1N5YL 3NFPA 1D9KC 2A74B 3HG1B 1HHHA 2QTEA 2FBJH 3QPQC 1F8TL 3SGKA 5LGJA 1ZLUH 4GXVH 5FL0A 2FJHB 4HJJH 3ESUF 1T1ZA 2A9NH 2CIPA 5DT1L 5HI4C 5FM4A 4UQBA 4HS6B 4KDWA 1JV5B 5I24A 4PBGA 4GG6F 2V2XA 3ZT7A 1X7QB 3RTQA 3FT2B 4JB9L 2R2CA 1DUZB 3MV8A 1X5XA 1F5WA 4PTUB 1J10A 1WZLA 2Z93A 4G8GD 2A6DA 2VN4A 4JFDA 3O3DA 3ULUF 1PIGA 4LGPB 5D6CB 3EO9L 3MUZ1 4G6JL 3KYNA 4M93C 1RULH 3BVNA 3G9AB 3QH3A 4W8AA 3IJYA 5C6TH 3W11D 2A6KA 4L3AA 3FO9A 5DZLA 2EDDA 4YHZL 5E6IA 5GS0C 4PTTB 2ZPKH 1T0OA 1S7UB 3CFKA 4RISH 3UJJH 3H3PH 2NLJA 1KFAL 4HBQA 4RMSA 2OZ4H 2F54B 3T0EA 3DX7A 3SUSA 4Y2DD 4OCSH 1KBKA 4V27A 1BPLB 1HJUA 4MA7L 4DOHE 3PGFL 1E1FA 1I8LA 1U91B 2X0YA 1NFDE 3ULVL 5GJSL 4JJHA 2J47A 5FV2A 3VXQB 1ZT7A 3DMMC 3NAAH 1VFBB 3RVWC 2R39A 1G7IB 4IOIB 5F9WB 4N5EC 5E7BA 4MJ2A 4WI9A 3RVXD 4FQQB 2W65A 1W3KA 1I7UB 1W2PA 3RA7H 4DWHA 4U49A 1RK1A 2WBGA 1E4KC 4NWTL 4E0RA 4JRXB 1FE8L 4JDZB 1U8HB 4L4TA 3QHNA 1TMCB 3RIKA 2HT2D 4PP2B 3SUUA 2G3MA 2NY2D 4BFBD 5BJTB 2FO4A 1UACH 1A3RH 2D0FA 4M24A 2R29L 1P7KB 1TQBC 4PJ9D 1KCVH 5E8EA 3S3JA 4U1IA 4XH2A 3ZT5A 1TJHL 2XICA 3ARXA 4LL9A 4XVTL 1EHLH 4ZUUA 2ZUMA 2F74A 1XV8A 5C09E 2FO1A 1LWHA 1DANT 3WF1A 4XBEL 4XNUL 4P9MH 1ZOXA 5FYKU 4GAYA 3FOLB 1GW1A 5JZ7D 3X3FL 1N6QL 2X1XR 4Z77B 4E41D 5E7FA 1YPZF 2IGFH 2BVOB 4WTWA 3ESVF 2B31A 2UWEF 5DMKA 3BAXA 1R3IH 5DO2D 2FEEI 1IQDA 1NAML 5AWNH 4F2MA 2J8UA 1YEEH 4AMKL 5CLWA 3S96B 4AD4A 5CZVL 3TTSA 3MSPA 4MA1C 1G7HA 2ZX6A 1E0VA 1JYXA 2E9IA 1FIEA 1OD8A 1MRCL 4CJ1A 3KR3L 1MHEA 3V5HB 1JPSH 4HF5H 1U8LB 4F15C 4LKXB 4D6IA 2IC2A 2HFFA 2OSXA 4LSRH 4HXBH 4H5SA 2OK0L 1BIIB 1D5IL 1B31A 2D03H 2GITB 2FX8H 3VIJA 2F58H 4M6OH 3L3OB 1GGUA 1K9FA 1HWGB 2GHWB 5EPMB 3VD9A 3SCMC 4PRID 1HYRC 4M61A 2IANE 1A7NH 1QW9A 1TQBB 3MGOB 4AMCA 3JWOH 25C8H 3MKKA 1PKQB 3WFLA 1S9XA 1DCLA 2C9AA 3R06B 2WV3A 3KYAA 3CSYA 4NZFA 3BEWB 3HE7B 1KIPB 1BX2A 1N2RA 1RZIA 2ZG1A 1XH1A 3CPLA 2K7QA 3VXSE 3UR8A 5TQ0L 3QT2A 1SJVA 3LRHA 3VFTA 1VEMA 3AHZA 4CN1A 3MANA 4XC1H 1DWGM 5K9QI 3NJ3A 1E6OL 4X5XB 2WHMA 7TAAA 4XMLH 3TVMA 4OFYA 3NCCB 3LKOA 4JFXB 4FMFA 1K5NB 5EU6E 5J11B 3B6SB 4KJQD 1WFNA 4GI9A 4JKWA 3RX8A 3OB0H 3DX3A 1V3JA 4OI8A 3GXIA 4RMRA 1INDL 5DD6B 4Z7UB 2ZWZA 2VLRE 4KZDL 1QI2A 1UUQA 3ARTA 5L2KA 1DFBH 5KSVA 5CPTA 2EZ0C 1V6XA 1FYTD 2IMNA 1I1RA 4YHMH 5KSAB 5E95B 4MJ5A 1U8KB 4X4ZA 1YEKH 5C0CA 5EU6B 2ENYA 5HDQL 1UWGH 3QZWA 1TTGA 4KKNA 4JQVA 4PREB 2DSUA 5DUBA 3QDJE 1WEJH 4UQ9A 3N18A 3MLRH 1AQDA 1FNEA 3PHOA 3HB3C 2CIKA 5GRUH 4X4XB 3N1GC 4FQCH 5ESVB 3WSQL 3WUWB 2HVJA 1E27B 1KLGA 1U93A 3BCFA 1M04A 2IQAB 4FFWC 5MERA 4X0NA 4NZRL 5I8OH 5A8PA 4K94C 2IUZA 1HIML 3B3IA 4NNPH 3MFGB 1A6UL 3QDJB 4ZQKA 1T2QL 4V1DD 3CHCA 1IGCH 4MAUL 3V6FA 3MRMA 3AMLA 4P23A 4IRSC 2GJZB 1NUGA 5EIVA 5HDBF 3SBWA 5BW7C 2R1XB 4AIXA 1NOUA 4LPYA 1Q9KB 1MNUH 1VRXA 1KN4H 3SPVB 2GTZA 2A9ML 2X2HA 3ZHLA 1CICA 5DJZA 4QOKA 5JO5A 1HXYB 2FWOA 3WL0A 4XPAH 4YR6A 4JPKL 5CPQA 4P2QD 1T20B 5I16B 1KIQB 2HG5B 4Q9CA 3W38A 4OCRL 3CDFA 5AYQA 4OCWL 2V5SA 1AGCB 1SY6L 3OZOA