3UWQA

1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
229
structure length
222
Chain Sequence
NDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPARRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP)
rcsb
source organism Vibrio cholerae
molecule tags Lyase
total genus 77
structure length 222
sequence length 229
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3uwqA00
5EL1A 4MY9A 3DBPA 2E68A 4LVGA 1Q6RA 3EXRA 3AJXA 1TTIA 4QAIA 3NA8A 1YPFA 1PCWA 3LB0A 5C55A 3HB9A 5D2XA 4O17A 4HNUA 3FFSA 4LT9A 5KZMA 4JTGA 2V5LA 3P8JA 5E0KA 2P1FA 5D03A 1TTPA 1ZFJA 5DY3A 2CZEA 1DBTA 2UV8G 4JY9A 4WXYA 4GBUA 4KFOA 3B0VC 2VEIA 1QWGA 3SIZA 4TMCA 4U28A 1JCXA 2WQPA 5CZSA 2BXVA 2Q8ZA 5FEPA 2R94A 1D3GA 4PODA 3TAOA 4OHQA 3EWWA 1ADOA 3TMQA 1YLVA 2YYUA 4X9SA 2WO5A 2QJGA 3C52A 4UMAA 3O6YX 2EAWA 4OBTA 1J4EA 4GUHA 5K9XA 3TSMA 2NUWA 5F1VA 1GG1A 1SZEA 3LHVA 3KVKA 4K36A 3NVTA 1I2PA 2Y89A 1KFKA 4KWVA 4DO5A 1RPXA 4O18A 5CPMA 3LV6A 1GVFA 1G7UA 2FB2A 1KLYA 1EA0A 4BI5A 1L6YA 1O4UA 4R53A 3STGA 2E6FA 3LRMA 1G4SA 3E9AA 1DQWA 2DZWA 3G22A 5BNKA 3TXVA 1NSJA 4POCA 3S42A 2RKXA 2FPVA 2NLIA 4IOTA 2VFGA 2PRMA 1TQJA 3QMRA 4JY8A 3KRZA 2YGYA 3CIWA 4CNNA 5J5RA 4WY0F 1TPVA 5CG7A 4S2CA 4NZFA 2EGZA 3NZRA 4O8RA 5AFDA 2J9XA 3O8AA 3TR2A 3C2FA 4JDBA 3IRDA 1ZAJA 4AF0B 2NWRA 3CQ0A 3NQEA 4XTIA 4JTHA 3QW3A 1XUZA 1H61A 2NX9A 4GE8A 1Q6LA 1Y0EA 2R14A 1VLWA 4N4PA 3ANYA 4ZZ9A 1LBFA 1SFJA 4GJ1A 2CZ5A 2TYSA 4PFMA 2VFHA 3UZJA 3NPXA 2B7QA 5CGQA 1OX6A 2V2DA 2CLKA 3THQA 1WOAA 1VCFA 2ISVA 2FJKA 3YPIA 3KRUA 2VEKA 3PC0A 1TJPA 2DP3A 4UXDA 3W1PA 1Q6QA 4HT3A 4JX5A 1FBAA 5D04C 3GDKA 2HMCA 4AAJA 1EWDA 5D09A 4LVFA 1HTIA 3M16A 4K39A 1IXQA 2WSYA 1TIMA 4OU1A 1ZNNA 3TSBA 4LUJA 1AL8A 1FWNA 3W2JA 1X1ZA 2F84A 4RXGA 1XDLA 1R2SA 1QDSA 1LOSA 2AGKA 2C18A 1GTHA 1WDWA 3U8GA 4DEFA 2CLHA 2OT0A 3M9YA 2BTMA 1JCJA 3K30A 3W7HA 5HR7A 3FIGA 1LTDA 1TO3A 1WQ5A 5TQLA 1ICQA 3S0CA 1JULA 2PURA 1FXPA 1AW5A 4NU7A 4MY8A 2H6RA 2QKFA 5I3IA 3C61A 2GQ9A 1WBHA 3QSRA 5FF3A 3I68A 3A21A 3HG5A 3UQNA 1GVQA 5D05A 2CW6A 1H7XA 1TV7A 2B4GA 3ATZA 2DZUA 3H54A 4NUWA 4AHPA 1GT8A 3FKKA 3RFAA 5FF2A 5U4NA 1W3NA 5D2VA 4DBDA 5F2LA 3SI9A 1G7VA 1QOQA 4O28A 3KAOA 3KX6A 5G1YA 4K8EA 1X6UA 3BLFA 4E0CA 3P61A 1OFOA 4BI7A 3W1LA 4ZQCA 4UTWA 1MEIA 4NXKA 1GEQA 3N9RA 1WAUA 2Y62A 3E02A 2VFDA 1R2RA 3PBWA 3W86A 4GXMA 1VS1A 2WSQA 3TQVA 4O15A 1ZAIA 3BLIA 5AYYA 4NZJA 1W1ZA 4Q33A 4AMAA 2WPBA 5A5WA 1GJPA 1Q3NA 3PB0A 4E38A 3PSVA 1EUAA 4HKPA 3PWAA 3MI6A 2Q3OA 3P8IA 1MSSA 3O06A 3NQVA 2ZRZA 3TU9A 3PR2A 1FWWA 1F74A 5G2HA 1O94A 1Q45A 3BPWA 1AMKA 3S1XA 3CEUA 2Y7EA 4IUOA 3CLMA 3UXAA 1VYPX 2G97A 5AHMA 2Y7FA 1LM1A 2OJPA 3LDVA 4ZVJA 4TIMA 3GR7A 3NO5A 1KM6A 3E0IA 3HBLA 3QYQA 3HGJA 3W74A 3S5OA 2OCZA 1YADA 4QIUA 1GVOA 2FQIA 4QM1A 2E6YA 1JUEA 1S5TA 1VHCA 1R30A 5KZDA 2QCHA 4Z1AA 4UFIA 3C2OA 3C56A 3M5VA 1N7KA 3MW7A 3IGUA 2AAMA 2JGYA 4ZQNA 5DCBA 5AHNA 4A22A 3HIJA 1QO2A 3VI2A 2FFCA 4MZ1A 3TK7A 2E5BA 4A2SA 3MHUA 2ZA1A 4UTWC 4JYDA 5AHLA 1YTDA 5LHFA 1D3HA 4QQ3A 1WV2A 1X1OA 2A4AA 2P0OA 4XKYA 1S5WA 3W88A 3LOTA 3HG4A 3O6CA 1KW1A 4QITA 5DELA 4FB7A 5CPNA 7TIMA 1OFAA 3QF0A 3M5ZA 4O14A 1I45A 4IMEA 4MYXA 4LW7A 2TPSA 1JUBA 4Y96A 4WOQA 5FEWA 3G8RA 1T8XA 2ZZ4A 2QCMA 2CU0A 4O50A 3GDMA 1TPEA 2PRLA 4JYEA 2H8XA 3A9IA 2GQ8A 2JKPA 4RXFA 5AHFA 5KITA 4CQAA 3JRKA 1OYAA 3NDOA 1LCOA 1LLWA 4QNWA 3DFSA 2Z1BA 1SPQA 4UTJA 1ZAHA 1SQ7A 3QEZA 2O7SA 2A0NA 3KVMA 2AQWA 3L0NA 4ZQOA 2X2GA 3DAQA 2DZTA 3NQ8A 5E1QA 1IXNA 3N2XA 1S3HA 2X1TA 4JIQA 3N34A 4RZ5A 3N14A 2ZRVA 1B4KA 3PM6A 4FHAA 1KTCA 4LVBA 1TPFA 4JXCA 2C1HA 4O12A 1C8VA 5AHIA 3W85A 4UTKA 4FXSA 3UXDA 4JTKA 3S1UA 1ME9A 3PUOA 5H2ZA 4MLJA 5K9DA 1W31A 1F05A 4ORMA 4Y90A 3GB6A 4N9CA 2I14A 1K03A 5CSSA 3LERA 3S5NA 3EX1A 3P82A 4HIBA 4HNTA 4O54A 4UR8A 2NX1A 1R46A 5HUOA 3NZ1A 2Y63A 1VR6A 4WZHA 5MHBA 1W5OA 5FF7A 3M43A 1M6JA 1OF8A 4ADUA 1VCGA 3HG2A 1TRDA 3B04A 2P10A 2ZBTA 3G1XA 3R5EA 5TBOA 3OEXA 3L5AA 2RH9A 5FESA 2G5WA 1OABA 2A7RA 1SO5A 4HSOA 3W1MA 1OX4A 2Y6ZA 3BVJA 3M41A 2X30A 5LSMA 4LTSA 5F4SA 3NPWA 3TROA 3WFAA 1YTKA 4UFKA 2QCDA 3L0KA 2XFWA 2QUUA 3H53A 1XUUA 4LS0A 2B7OA 5EPDA 4YCOA 4JYFA 4XKYB 3IIXA 3LXCA 3RK8A 1T96A 5I3JA 5CSRA 3C6CA 3BG3A 3Q2DA 4IXXA 1VC4A 1XL9A 5LNRA 1NFBA 4BR1A 3IIZA 2E5CA 1EP2A 1EWEA 3QMSA 4CNPA 4JTSA 1KM2A 1FDYA 2D73A 1BTMA 4AWSA 4R7JA 5L9FA 1VZWA 5LKYA 2JGQA 1ICPA 3GNNA 4UCGA 1FWTA 2G95A 2ZTKA 3B0PA 4O4VA 4Z1DA 4LU0A 2VENA 3TE9A 4UMCA 3EKZA 3VCRA 5LNUA 1GOXA 1M7OA 4Z1BA 3W2UA 2J27A 3UY7A 2OX1A 1TREA 1TPH1 2FB3A 5BRBA 1XKYA 4NJJA 3IVTA 1DJNA 1NEYA 4A21A 4ADSA 3LBCA 1G69A 3ZS4A 1PVNA 2B7PA 1FWRA 1H1YA 1FWSA 2ZFAA 3LCLA 3SW6A 1RZMA 1UJPA 1SSDA 4QJ1A 2TSYA 4JTJA 3LXBA 3NYZA 1OX5A 2Q3RA 3RLUA 5GVJA 4KFNA 3G1AA 1T0OA 3LCFA 3QMTA 4RZ4A 4ORIA 1MZHA 3QSTA 3W2NA 2V0TA 2JK2A 1W5PA 1L2UA 4CQ8A 3O07A 3NPVA 4N4QA 3W22A 4GWEA 4O53A 2NZLA 4DELA 1TPUA 2YSWA 2CZFA 1IF2A 1WA3A 1GQNA 1U83A 5KTLA 4X2RA 2E5DA 3BW3A 2W6RA 1ZENA 3PS7A 4O1BA 3TSDA 1KM5A 1I4NA 4Y9AA 3W7KA 3GKAA 2VC6A 3THAA 3IEBA 3S1WA 1QOPA 3I65A 4HNNA 3OHIA 3GXTA 2VFEA 3GAKA 3TH6A 3FJ6A 2NUXA 4JDYA 1FDJA 2CLEA 1IXPA 3W87A 1QPRA 3PBYA 5HNRA 2ZRUA 3DI0A 5BOOA 3LCHA 2DU2A 3DKLA 1TYGA 2NX3A 4TX9A 1OX4B 4DO6A 2J6XA 1L6WA 4ZQPA 3ABRA 2CLLA 4FX8A 3T4CA 5KZEA 3DKJA 5DLCA 4JN6A 3NM3A 1XCFA 1LRNA 1UUMA 1KTBA 2QCDB 3NQ6A 2A85A 3UWQA 5K7JA 3LTYA 3MP4A 1XBZA 2Y85A 3PULA 4IGHA 2C3ZA 3PUDA 3TUUA 1VYSX 1IXOA 4LC8A 1N8FA 4UTUA 3PB2A 1GG0A 1TPC1 1TCDA 4LNYA 3W1QA 3GR8A 1PIIA 3LI1A 5AC6A 1IIHA 2YFNA 5F2MA 5HULA 3C2EA 2YDAA 4JR5A 1ME7A 5G2IA 3HPZA 4OT7A 3LXAA 3N73A 4OE7A 4DF1A 3WK3A 4MY1A 5D2TA 3MO7A 3R13A 4J9JA 3BGJA 3W7CA 2NV2A 3UPWA 3DHDA 4M6VA 1A5SA 3LGEA 4GFSA 3P5YA 3WJSA 3LCIA 3N3MA 1FUYA 4JTUA 3EXTA 2Y70A 3PVFA 1VCVA 4R33A 5D02A 4GUIA 3B06A 3NQGA 1THFD 2YXGA 3M5XA 4XBSA 3W7GA 3G0XA 3PG9A 4RZ6A 3L67A 4YLWA 5HQEA 1VYRA 4XUGA 1SFLA 4H3DA 1JQVA 3G18A 4LV4A 5C6MA 3W2MA 2R91A 1G4TA 3LHYA 2C16A 3W83A 3F4WA 3UWYA 3DH7A 3LLDA 1E51A 3EWUA 1K7XA 3RNDA 3JS3A 2VOMA 3L9CA 4ZQRA 3QM3A 3EX4A 5DN1A 1BWKA 3PSWA 4C1KA 1XC4A 3WK1A 3WJWA 1YDVA 4N02A 4RR4A 2B0MA 4M7SA 1VHNA 1H7OA 3A5FA 5HWJA 3BW2A 3I7SA 2YFOA 1JRCA 4FIQA 3G1YA 3G3DA 4BFAA 1TV8A 4FIRA 2HSAA 2NWSA 3QFEA 2WV8A 1B9BA 4Z0SA 4EF8A 3CC1A 1O5XA 4I7UA 3W73A 2VFIA 3L0GA 2W0UA 3I7QA 5EBUA 3FOKA 3QPZA 4CCCA 2V2CA 3P84A 4O11A 1M5WA 4JEQA 1A5AA 4QNEA 3O63A 3NL5A 4TMBA 5K9CA 1Z41A 3NXFA 3UD6A 3BGGA 4HNVA 4AEOA 3PY2A 2ZRXA 4NNAA 1ME8A 4UMBA 1XFBA 2ZRYA 1QCWA 3F1QA 4GNJA 5LNVA 4G1KA 1TPWA 1FCBA 1PCKA 3RU6A 3QZEA 3TV8A 3GXNA 2DZVA 1PS9A 3M7WA 4MFEA 5F2GA 2WNZA 4L4MA 4YMZA 1A5BA 3VFLA 1W5QA 2QJHA 3S1VA 4DPQA 1Z42A 2YPIA 3M47A 2QJIA 3M44A 3MHFA 5BW6A 1JR1A 4JICA 4NX5A 1W37A 2RDUA 5KINA 1YXYA 1DQXA 3CEPA 3NQDA 1F5ZA 1H5YA 1OK6A 3ZWSA 2WSRA 4RV8A 1TB3A 2QCCA 3STFA 1H63A 3TW6A 4E2DA 4JTTA 4GUJA 1QR7A 4FNQA 4LY8A 3W1NA 3OA3A 3DENA 5HR6A 5LGXA 3MYOA 4WQ6A 1G4PA 3TQ0A 3W2KA 3MHGA 4LV9A 4HPJA 1QNVA 4RLIA 4P61A 3L65A 4NJGA 3SGUA 3M6YA 3IIPA 3IIOA 3G3MA 1I8JA 1UUOA 3NM1A 1HL2A 1YDNA 4LVAA 1JRBA 1X8FA 4P2VA 4UTHA 2Y61A 3IVSA 3DXIA 4PEKA 4XWUA 3TW7A 4ZL1A 2DZXA 3Q94A 1JQXA 3ZFHA 1TMHA 2E6AA 1O95A 2PE4A 5DY2A 4MFDA 2V5BA 4AHOA 1ALDA 4AHQA 3MBFA 4M6PA 4IXHA 1ML1A 3CHVA 3NQAA 4ALDA 3C4UA 4JD4A 1VH7A 4UTTC 3W1TA 3ATYA 1D9EA 5DXXA 5D32A 1OHLA 4JTEA 4O0ZA 1F2JA 5KSWA 1SZFA 5EMUA 3W70A 2E09A 4H6KA 5DCDA 3HPSA 4O4WA 4RK8A 2F7FA 5G1TA 4O0KA 3CU2A 1P4CA 3HQ1A 1RR2A 3DFOA 2C15A 2W79A 3PG8A 4LVDA 3TQKA 2WKJA 2DJXA 2CLOA 4RKAA 4DF2A 2CLIA 4ZMGA 2Y7GA 3WK0A 1BEUA 4DBEA 2ATSA 4JNMA 4WD0A 3G0SA 1W8SA 1NF7A 3G1FA 4ML9A 1UBSA 6ALDA 1LYXA 2HS6A 1TV5A 5D30A 4EVZA 4QISA 3H55A 3C0JA 2RDTA 5BMXA 1VRDA 4IPJA 3W7NA 4LS2A 1P5BA 3GZ3A 1DL3A 3HF3A 2BSLA 4LRSA 2GQAA 1J5TA 5G5IA 4IX2A 4UNLA 1PV8A 6TIMA 4MIMA 1NVMA 3HOJA 3TIMA 1JVNA 1L6SA 4Q32A 3SECA 3USBA 1BWLA 4LS1A 1JCLA 4A3UA 1ZJIA 1LLZA 2GOUA 3M5YA 1I2RA 3TNOA 3LHTA 2QDGA 1SR9A 3LCGA 4AXKA 5SWUA 3TXZA 1H62A 3S9YA 4PH6A 5KMYA 3FJLA 4NJIA 3VKJA 3WJZA 1WXJA 1AW1A 2GPTA 1S5VA 3O1NA 1GWJA 3U2OA 4HHPA 3W7RA 1PHQA 3PBVA 5AB3A 1XDMA 4K38A 4U4MA 5E93A 2BX7A 3GXPA 4KFPA 3UWWA 1W5MA 4IMGA 3LTSA 3LX9A 2QUTA 1GYNA 2WNNA 3BG9A 2FTPA 2LLEA 1I2OA 5LGZA 4ICNA 4YWIA 3G0UA 4LC6A 4MKNA 4JTFA 3TFCA 4PC8A 2OZ0A 2X1SA 2JKEA 4WX2A 1WBJA 3ABOA 2ZCGA 2A5HA 2CLMA 5EA9A 1F6KA 1LRTA 2V81A 3EWYA 2VELA 3L21A 1MEHA 2A6LA 2GVGA 3G1SA 4XZ9A 4N9EA 4Z1CA 4JIPA 4UC5A 1DKWA 4IQLA 2PCQA 3EEGA 4MLRA 3CM4A 2A2IA 3NQ2A 4UTLA 2A1YA 3GK0A 2X1RA 1OFQA 3KOFA 4TR9A 1MO0A 4RCXA 2CWNA 1LORA 1TTQA 1G4EA 1SW3A 5C5YA 4O19A 5FI8A 2X16A 1SW0A 5FF0A 1HG3A 2ZZ3A 5I3HA 2GJLA 2NXIA 4CNOA 4N2YA 1RVGA 3GLCA 2VEMA 4BWLA 2J9ZA 3LHUA 4NVTA 3UZ5A 3LI0A 3MYPA 3NR0A 2RFGA 1EEPA 5AOUA 1K8YA 3LHWA 3TC7A 5DBTA 3FKRA 2ISSA 3HO8A 1LOQA 5DXYA 4YCPA 2J24A 1JCMP 2NXGA 1ICSA 3R8RA 4X3ZA 1YPIA 4UIOA 3S8HA 1FX6A 1TTJA 3NOEA 2C19A 2QCFA 2YR1A 3W7MA 4EOUA 3W75A 5HWNA 1TPDA 2C6QA 2YZRA 4CQ9A 1B57A 3OVRA 3SJ3A 2Z2UA 3QJAA 1RV8A 4JX4A 2HS8A 4PA8A 1M7PA 4JS3A 3I6RA 2EHHA 2VXNA 1SZNA 3HJZA 2QCLA 4N6EA 5G4WA 3GYEA 3DFTA 2ALDA 3MP3A 3UWZA 3W7QA 4LRTA 3TKFA 1DHPA 1OFDA 4FX7A 3SZ8A 3P60A 1R47A 3SR7A 2QCEA 1EPXA 4IX0A 3BO9A 3W1AA 3MJYA 2Q8LA 2GVLA 4IMDA 1H51A 3D0CA 3IIVA 1EB3A 1EX5A 2ZDRA 3DGRA 3MMTA 4MOZA 4O1AA 4JTLA 5LHEA 1KTNA 4B5NA 4W9TA 2C13A 1W3IA 1VQTA 2Y7DA 4IMCA 1KFCA 2FLIA 3BARA 3W6YA 1NAL1 3NQ7A 1KFBA 1IGSA 2I9EA 5D38A 1HUVA 1FCUA 4BWLC 3PBUA 1QAPA 3GVGA 3STCA 5D2YA 4NX0A 1H60A 1TRIA 3N9SA 3HMJG 4UR7A 2ZZ6A 2H3BA 1VJIA 1KA9F 2EPHA 1Q6OA 3BW4A 4AWTA 5K2ZA 1YDOA 1QFEA 3TX9A 4MVAA 3F4NA 4Z08A 2C0AA 3DZ1A 4RX0A 1W5NA 2Z0IA 3G8EA 4Q4KA 3LBMA 5AC7A 3W84A 1RQEA 3LTPA 2XN2A 1QO5A 1X7FA 3FA5A 1KV8A 1LROA 3MUXA 4K7YA 3LLFA 4L4LA 3P62A 1Z48A 3BK0A 3SSJA 1VGAA 3Q58A 3WJYA 1XI3A 3LCWA 1OF6A 4MZYA 4XTDA 5HWMA 3L5LA 3DU0A 5K4XA 3ZR4A 2VFFA 3I7RA 2A6NA 3P5ZA 2ZZ1A 3W7DA 8TIMA 1B3OA 3FS2A 3EX6A 3LRKA 3P81A 1P0NA 1I2QA 2FDSA 4O57A 5H91A 4KKXA 2DJLA 3W1RA 4GC4A 1KFLA 3DFPA 4M19A 4Z0JA 3W7EA 1A50A 3HGSA 1K3UA 5HINA 2A7NA 3TJLA 1DORA 4FX6M 4A29A 4WUIA 4DQWA 4NNCA 4NJKA 4EIVA 1JJKA 2YW4A 2WJZA 3WJXA 3OG3A 1A5CA 4K7VA 3TMLA 1C9DA 1EP3A 1OK4A 1W3TA 3LHZA 4UTMA 4N9DA 3N2MA 1SSGA 5CZ0A 3NQMA 1FDZA 3P67A 1L9WA 4M6QA 5AN7A 1CI1A 1BKSA 3QW4B 4M5PA 5LZLA 2C14A 1GYLA 3KFTA 3O16A 2VEPA 5AYXA 3NNTA 4XQ6A 4EF9A 3EWBX 4MJMA 1GVRA 4MYAA 4UNKA 3QQ1A 5J5DA 3A5VA 2Y88A 1KV5A 1JCNA 4DXVA 4E2BA 4IMFA 1SO3A 3R12A 1V7YA 3W7JA 2WOQA 3E49A 1FY6A 3LRLA 3OBKA 3HGRA 4UFLA 4UFJA 4GRSA 3VE9A 5AC8A 5T26A 2V8ZA 5CKSA 3W3OA 1OFBA 3QPYA 4N9BA 3O15A 2B7NA 2QUVA 2ZTJA 1HO4A 3WK2A 3B8DA 4OV4A 1SO6A 3FEMA 2R8WA 1OFRA 4WXZA 1F76A 5F4XA 4ADTA 2XN1A 5K4ZA 4NXSA 2GUUA 2QDHA 4N6FA 3V1PA 1F6PA 5D2WA 1K02A 1ZCOA 3Q37A 3LCXA 3KXQA 2A7PA 2BLEA 3OVPA 2TRSA 1H1ZA 3NQCA 3P80A 2QF7A 3OVQA 3DFQA 3EWXA 2ZZ7A 2DZPA 1VPXA 3KRSA 3W23A 3G1HA 1DVJA 1JCYA 1AG1O 1EIXA 2FIQA 1OYBA 3TJXA 3B0UX 2GVJA 3TCEA 1P0KA 4LWWA 5AHEA 1F73A 3BG5A 4UTTA 4HPXA 3P7YA 1UCWA 4IWWA 1EP1A 3PAJA 1SUXA 4HN4A 5C2XA 5DBUA 3INPA 2J88A 3EX2A 1ZHAA 5I3FA 1YTEA 1SW7A 1QPOA 4PCFA 2CLFA 2E1DA 1SU5A 1RD5A 1TSIA 1KBIA 1OYCA 3VNDA 2FPYA 1ZALA 3GKFA 2ZZ5A 4MZ8A 2ABAA 3CT7A 4Y6GA 1RQHA 2O7QA 2H90A 1W0MA 4WOZA 2G96A 2ZA2A 2EKCA 4PTNA 3GIYA 5A8GA 3W7IA 4DPPA 5G4EA 5FEXA 3IGSA 3IVUA 2NXHA 3G24A 3CWOX 4O1CA 4DO4A 1TPB1 5EYWA 4H4IA 4KWWA 4XBKA 2QAPA 3UWVA 1JUKA 2KZHA 4DF0A 5U7SA 3EWZA 4O1DA 4AWUA 5G2WA 2J9YA 3GDTA 3L68A 4UUIA 1AW2A 1YXDA 5HMSA 1G6CA 1HFBA 3UPBA 4C1LA 4OQVA 1W54A 1LP6A 4UFHA 1W56A 1WYIA 3IGXA 1LRQA 3ZWTA 3L2IA 2ATMA 5FF4A 2NUYA 3NAVA 1OJXA 1FCVA 3CPRA 3CB8A 3EKLA 1SZGA 1QPNA 4M7TA 5F2IA 3FYPA 4IPIA 1V5XA 3L5MA 3GDLA 2Z6IA 3C2VA 1LOLA 3MI3A 1GZGA 5CZTA 4O10A 1XBVA 1K7FA 3R2GA 4X22A 3S5ZA 3ABQA 4YXGA 3STEA 2ZYFA 3CTLA 1Z44A 4K8HA 5D33A 1LBLA 4WY0A 1TJRA 1I2NA 2I1OA 2YCEA 1U5JA 3T7VA 1PHWA 5LNSA 2CZDA 4S2BA 5F1UA 1N55A 1TQXA 1KM0A 1PL9A 4UTIA 1H50A 1C29A 4ZQMA 5C54A 1CX9A 3NL6A 1AK5A 2FPTA 3RF9A 3T78A 2ZA3A 3T40A 2JKAA 4K6AA 4PL2A 1MXSA 4NNBA 4ONVA 1QPQA 3O05A 3B05A 3M1ZA 1XBXA 3NGJA 4FNUA 5LNWA 4FEZA 3EX3A 1VLIA 4CCEA 4O16A 2QAFA 2QCNA 5CZJA 1UB3A 1R2TA 3HGOA 5L6UA 2NV1A 1OVDA 4Y8FA 4AH7A 5DCEA 3NPUA 2JBMA 1H7NA 4PL1A 1K8XA 3EXSA 1GPWA 4NJHA 3ELFA 2BWGA 5ABTA 1KM4A 2YYTA 2V9DA 1OFEA 5IBXA 1KFJA 3V75A 3W7LA 4AVFA 3DFNA 5I3GA 2V30A 1EUNA 3W76A 3M0ZA 1F7BA 3O6DA 4A2RA 1H7RA 1DOSA 3NQFA 3S6DA 1XXXA 3GDRA 3TC6A 4FO4A 3W7PA 3JR2A 5CPLA 2ZZ2A 1MEWA 2ABBA 2HTMA 5BMWA 3W72A 5D37A 4LOCA 2RHGA 4I7WA 3UYCA 2WNQA 5F4WA 4FNTA 3FYOA 2VKZG 3GAYA 3MBDA 1G67A 4HSNA 2TMDA 4RJEA 1OFPA 4YL2A 3RLVA 3DHFA 4FF7A 1AL7A 2ZQ0A 1HO1A 4JGDA 1UASA 1IIGA 3P74A 5K3VA 1OG0A 3NL2A 3QRHA 1SO4A 4TU1A 1XBYA 3OIXA 3PF3A 3TFXA 3PUEA 5AYZA 4I7VA 3SGZA 3W07A 2DZSA 1FXQA 4UFMA 4CCDA 4QSHA 1K7EA 1O5KA 1H7WA 3IV3A 3C2RA 1ONRA 1A53A 4BK9A 3W1XA 3UWUA 2X1UA 1LZOA 2H3DA 2YX0A 2PRHA 1O60A 4MPQA 4OWGA 4OV9A 3SY5A 4R34A 5CPOA 3T44A 1PE1A 3S5YA 3A24A 4BF9A 1GVSA 2V82A 4LUIA 3W1UA 2E77A 3W9ZA 5HJLA 3LV5A 3EB2A 5IBXC 1XM3A 1YXCA 4WY0B 2RDWA 3DI1A 3E12A 5I3KA 2EF9A 1WX0A 4FXRA 4NQ1A 1KFEA 3AO0A 3E96A 3A23A 1K8ZA 1KM3A 4JX6A 3TDFA 4TO8A 3UY8A 5TIMA 3KVLA 1B4EA 3F03K 2QEZA 3FLUA 1FQ0A 4GUFA 3W7OA 1RQBA 4FNPA 2GJNA 2BZNA 3C3NA 1J2WA 3GNDA 3W2LA 2QR6A 2ZRWA 4K37A 4FNRA 4D2JA 1WOBA 4EWND 2CFFA 4WJEA 3BV4A 3MWAA 2PC4A 2DORA 2QCGA 3NG3A 2OMAA 3B03A 1QMLA 1YYAA 3MI2A 4IJBA 3SFKA 2E6DA 2V2HA 3L66A 1DJQA 4GUGA 1FCQA 3A22A 3C8FA 1H7PA 3HG3A 1DV7A 4JTIA 3VE7A 3U6WA 2OT1A 3CIXA 2H8ZA 1T99A 3TA6A 2ISWA 2Z6JA 4NT0A 3G1DA 1CW2A 1KBJA 4OGZA 3T55A 1KM1A 4AF0A 3UNDA 3B4UA 3TAKA 2XN0A 3RMJA 5FEZA 4MJZA 5EY5A 3G1VA 3QC3A 5EKYA 3R89A 4I9AA 4S1FA 4O52A 3GX9A 3ABSA 4MUZA 2IQTA 2YW3A 1GTEA 3HPXA 1ZY9A 3MP5A 1KLZA 5HUPA 1NF0A 3W71A 3N19B 4AB4A 1LBMA 4FNSA 3BLEA 3KHJA 1P1XA 3KVJA 2A21A 3LM7A 3QQ0A 3NL3A 3CWNA 3NEVA 3QH2A 4BI6A 4O13A 4CLMA 5IM51 1LDCA
chains in the Genus database with same CATH superfamily
4GC3A 1P43A 2WYSA 1Q6RA 4Q8UA 1PWMA 4PSRA 2J8TA 2PU0A 3T4WA 4JZ5A 1PKYA 3LB0A 4O17A 3KL3A 4LT9A 5A6KA 2CBIA 4BHYA 3P8JA 1WZLA 1AQHA 1XRVA 4I8YA 4WXYA 1W9BM 4L1WA 2VEIA 1QWKA 3CUGA 3GRIA 4TMCA 4U28A 4XZHA 4UZSA 3TYUA 3VUSA 5CZSA 2BXVA 2R94A 1UC4A 4OHQA 1C3FA 1BLIA 4X9SA 3TJ4A 1E70M 1E40A 3C52A 3EMZA 4G2DA 3O6YX 2EAWA 3ZOAA 4OBTA 4GUHA 1DP0A 3TSMA 1CLVA 1QNQA 2GGHA 4LAOA 3LHVA 2A3EA 1SJBA 3EPNA 3EMQA 1KFKA 2WKGA 5CPMA 1ISZA 3LV6A 1GVFA 3GXMA 2JQXA 1BXCA 2FVLA 5CSUA 1NIUA 1VEPA 2OKTA 4BI5A 2PDYA 4R53A 2HE5A 4OJYA 1M03A 4QS5A 4J27A 4BCEA 2ZADA 4DLMA 4POCA 1ELSA 3QKZA 3JZUA 3S42A 4LB3A 1TQJA 4QG9A 3H2AA 4JY8A 7XIMA 2PDMA 3RRAA 2BVWA 1TPVA 4JQ1A 5CG7A 1W9VA 3FA3A 4NZFA 3AHXA 1V3KA 3WFZA 3BZJA 4O8RA 5DANA 1NH6A 1KO0A 4LEQA 4L6OA 3CZKA 4JDBA 3FJNA 2CIPA 4W5ZA 2PWDA 2HBXA 4AF0B 5JIPA 3NQEA 4U2ZA 4XTIA 4FLRA 4JTHA 1XUZA 1CECA 2QW5A 4IMAA 1RUSA 4R7OA 4XZBA 4ZZ9A 4E8GA 2TYSA 1T40A 1HKMA 1FHUA 2B7QA 5FA5A 4HQVA 1OX6A 5AECA 3GVWA 1Q65A 3GIPA 3ARSA 1GCYA 3KRUA 3PFRA 3PC0A 2DP3A 1YQ2A 4UXDA 3W1PA 3URQA 3AXIA 1LT8A 1FBAA 1TUFA 1E1CB 1A80A 3GDKA 5D09A 2VCBA 1H41A 2VQUA 2WSYA 1VJSA 3KM8A 4GD0A 4M29A 3SRKA 1DWGM 5AKQA 2NQLA 3AS2A 2GZXA 3ABXA 2F84A 4TX6A 4Q3MA 1GTHA 1WDWA 3M0HA 4I5XA 1ZSXA 3H7VA 2BTMA 3XINA 1JCJA 1Q6CA 5HR7A 1WQ5A 3H2OA 1NQ6A 4LCSA 1FXPA 1FA2A 4LQ1A 1CPUA 1W32A 4HYVA 4XD5A 1MQPA 4X63A 3B9AA 3QSRA 4PRRA 5FF3A 3I68A 3HG5A 3WN6A 1GVQA 3AUJA 1H7XA 1TV7A 1LWIA 3ES8A 4NUWA 4AHPA 3BWWA 4GQ0A 5U4NA 5D2VA 3WBYA 4DBDA 4PUWA 3SAZA 3KAOA 3SDOA 4Q8VA 3WH7A 4PCTA 3W1LA 4FLSA 4UTWA 1MEIA 4NXKA 4EXQA 1Q13A 4UOJA 4QG6A 4ZCWA 3PBWA 4GXMA 3VDAA 3AHYA 1XYZA 3TQVA 4JQ3A 4O15A 3BLIA 3FAXA 3TN6A 8XIAA 1JYXA 1NWRA 4DJED 4Q33A 1OADA 2OSYA 2VTFA 3VMPA 2UZ9A 3MI6A 3N25A 3TU9A 3PR2A 3IJ9A 1F74A 2OZ8A 1O94A 1AMKA 4G1NA 8A3HA 3CLMA 3NJ3A 2HWGA 5EFDA 3F4VA 4IGMA 3VIMA 2OJPA 3NO5A 3HBLA 4XK2A 2VWSA 2OCZA 4H2CA 4DJDA 1YADA 4ZXOA 1GVOA 1JUEA 1VHCA 1A5NC 4KCVA 2QCHA 3VIKA 2OEJA 1N7KA 2GFTA 1EBHA 3RGTA 2IKJA 3WBEA 2PS2A 1X97A 4MKSA 4R7WA 3TK7A 2OQLA 2YXXA 1HKVA 3WMLA 2X40A 3WQCA 3CUZA 5AHLA 3GY1A 1X1OA 2P0OA 1VB9A 3PFMA 1E6PA 1PEZA 4GVIA 2XWDA 2ZC8A 4PUMA 3PZNA 1KW1A 5CPNA 3EPMA 1F4HA 6REQB 1I45A 1KRCC 2ZZ4A 1OD0A 4JNZA 3B8IA 1DQUA 2WC3A 4XVDA 2HBVA 2XM1A 1LCOA 1O68A 3RN6A 4A4AA 4X2PA 1FWIC 1SPQA 2W61A 5LXEA 4GNKB 3QEZA 2BFGA 4S38A 1QTWA 1QVBA 1KGXA 3LD5A 2DZTA 2WM1A 1IE7C 1S3HA 2X1TA 4JIQA 4RZ5A 3N14A 3TN3A 1UR0A 3GNXA 1H09A 1KTCA 4C6NA 3D3AA 4O12A 4FXSA 3ITYA 1DJGA 3S1UA 2OSWA 4HSHA 1F05A 5E6YA 4E3TA 3B9EA 4ORMA 1H2JA 1HJUA 3SY8A 4E8CA 1K03A 3AALA 4RW5A 3R25A 3P0XA 5B7YA 2E3ZA 1Q85A 3E5PA 4W93A 4HNTA 1RK5A 3RO8A 4QLJA 3TYBA 3VXGA 4XO7A 4WZHA 2HVNA 3M43A 1M6JA 3R6IA 2VDIA 4ENLA 3B04A 4NRSA 2ZBTA 5ABHA 1EJUC 3STPA 3OEXA 1S1RA 5JH1A 2PGFA 3TZNA 2G5WA 1QNPA 2PDLA 3W1MA 2ZX6A 5CJMA 2XVNA 3WDJA 3TC3A 3TROA 1YTKA 2AQOA 1B9ZA 1P48A 2QCDA 1E5NA 4IFRA 1YMYA 2CHNA 2QUUA 3GBDA 4KBXA 1XUUA 4MNMA 5TD4A 1PXGA 2QJNA 3MTWA 4XKYB 1T96A 2IQ0A 3EB3A 3C6CA 3BG3A 3Q2DA 3MANA 3VD7A 3O7UA 3DCPA 1ECEA 1RY0A 2D73A 2PBGA 3GYCA 4Z2JA 4JHMA 3EAUA 1JF6A 2WC4A 2CNCA 2X05A 1FWTA 3B0PA 4LU0A 1KBKA 1E73M 2CESA 3QR0A 4PZVA 3W2UA 1XCXA 3CO4A 1TJ0A 5EFFA 2HROA 3AMKA 2WBGA 1XKYA 5F7UA 5H6HA 5GNZA 4ADSA 3R10A 3UG5A 1G69A 2B7PA 1FWRA 1H1YA 1FWSA 3B9NA 3DBNA 3O6AA 2ZFAA 1RZMA 4WJ8A 1UJPA 1RK6A 1SSDA 2TSYA 3BAJA 3DHUA 1WKFA 1OY0A 3G1AA 2AKZA 2G3JA 3MMUA 1U2YA 3LCFA 1E0WA 2VDGA 3F2DA 2NV9A 4AIOA 3W2NA 1XPYA 1W5PA 2ZDSA 4HNOA 3NPVA 4N4QA 1KWGA 1Q6EA 2NZLA 5JU6A 4GZIA 1D8CA 4HPHA 1Q6DA 3ZJ8A 1GQNA 2W6RA 3FA4A 4I9MA 1U30A 5IDZA 2QVHA 2Y8VA 3IEBA 2O4QA 4K2SA 1U5VA 3I65A 3GXTA 2VFEA 2NUXA 1FDJA 3L23A 1IXPA 3AMGA 1QPRA 4XSMA 3M0LA 4DHGA 5MKGB 3DI0A 4F2UA 3B0XA 1LUCB 1TYGA 4TX9A 1EZWA 1I75A 1WZKA 3ABRA 4FX8A 3T4CA 3DKJA 2OODA 4L7ZA 4MHBA 4HJWA 3VK5A 3T0CA 2R1NA 3LTYA 3MP4A 5LIUX 2Y85A 2QDEA 5FL1A 1VYSX 3FGCB 1N8FA 1VPYA 1DWHM 2YLAA 1K8CA 4XD4A 3GR8A 3LI1A 1E3XA 1IIHA 5F2MA 2IPFA 5HULA 3UYIA 3IJ6A 2OQYA 3HPZA 3LXAA 5CC6A 4DF1A 2VJXA 4F0LA 3BGJA 3UPWA 1J0ZA 5DT5A 2PWHA 2PDKA 3LGEA 2EPNA 2WVVB 3FX4A 3P5YA 4C6OA 1TX2A 1CIUA 3LY0A 2ANUA 4M0XA 3L67A 4HU0A 1VYRA 4XUGA 1JL8A 1XYMA 1CDGA 3OTRA 4H3DA 2ZUTA 1JQVA 4LV4A 1QJWA 2D1ZA 4KRUA 3P0WA 1TVPA 2R91A 2XDFA 2XM2A 1XG4A 3F4WA 2J7EA 4QGCA 4JIHA 3CQHA 2J79A 4ZB5A 3V35A 4LBSA 3L9CA 4GYPA 2X42A 2BDQA 5T9BG 2ACUA 4WEVX 1XC4A 2PC8A 3M6DA 3WK1A 5ECVA 4ATDA 4N02A 3AAMA 3U4FA 2B0MA 4YU1A 1VHNA 4WDXA 4IIEA 1C8QA 4AXNA 3I7SA 2GGIA 3UVAA 2X0HA 1SMAA 3OLEA 4NAEA 2C1IA 1XLEA 2Q02A 3GSMA 3ARWA 2DDXA 2WV8A 2VR5A 2PDJA 3NZPA 3NGFA 3SFWA 3W38A 1E6NA 2W0UA 3FOKA 3QPZA 2OEMA 3THUA 1GJWA 2WHKA 1Z8AA 1M5WA 4JEQA 1I1WA 3W6MA 4F0KA 1ZS2A 4TMBA 4NNAA 3VNIA 1XFBA 4PMVA 1QCWA 1IEVA 3UW6A 4LFYA 5LNVA 1TPWA 4DZIA 1FCBA 4JBRA 4DJEA 3WBAA 1CXLA 4H41A 3VGGA 2ACQA 4WGXA 2DZVA 4B4FA 1PS9A 1OCQA 3VC5A 2GUBA 3QZAA 1UKTA 1W5QA 3S5SA 4WLCA 3PZVA 1TMLA 1GQLA 1BVWA 1PYMA 1Z42A 3FDKA 2QJIA 4A05A 4U3CA 4W84A 3PTDA 5GQBA 7A3HA 4NX5A 1IEIA 3DYPA 1W37A 5KINA 1VEMA 1IHIA 1H5YA 2Y5SA 3ZWSA 3IJLA 4AZCB 1REQB 2INZA 4GUJA 3V0UA 3DGBA 4IIGA 5LGXA 1VRXA 3A3HA 1G4PA 2TODA 3W2KA 1U1JA 4LV9A 1JZ7A 4HPJA 4R9XA 3BCJA 3L65A 5JVLA 4ZSUA 2D3NA 3IIOA 1L2QA 2FYMA 1X8FA 3T2PA 2D2OA 3ENLA 3TW7A 3RCYA 3ZFHA 3U2EA 1O95A 4GKLA 5DY2A 3ARPA 2INFA 3IK4A 4MFDA 4NF7A 1OIFA 4ECLA 1EJ7L 4AHQA 2VD9A 3CHVA 2PDHA 4ALDA 1T5AA 4HNCA 1VH7A 5IFPA 4KF1A 5D32A 1OHLA 3OZYA 2FZ9A 5I09A 1F2JA 2X7WA 1SZFA 5DCDA 1UIOA 4O4WA 4RL3A 4UQAA 4MJ4A 3FVMA 3CU2A 3UZWA 5EMLA 4CU7A 4U3AA 4LJ3A 2XH7A 2C15A 2ZXDA 2CLOA 3ANVA 4RKAA 1H3GA 2Y7GA 2QJJA 1P1MA 4WD0A 1Z9AA 4US6A 3AXMA 3CV1A 1EDQA 1LYXA 2HS6A 3QY7A 5HK4A 3BMVA 3VX1A 5C9WA 3LZ3A 1XD0A 4QP0A 4S3JA 3HF3A 4MWAC 3U2ZA 3UZZA 4MB4A 3HQOA 4PMYA 6TIMA 3HOJA 3TIMA 3SECA 3U9IA 4F2BA 3WKZA 3USBA 2GGGA 5BZAA 1JCLA 1DTUA 1AH0A 1YEYA 4DAIA 3W02A 1A0EA 2GOUA 1HKIA 5I77A 2E8YA 4CKQA 1PTGA 3LCGA 3LQLA 3P93A 1TWIA 3TXZA 3WCZA 1FH9A 4KCTA 3PJWA 5KMYA 3GC4A 3BLLA 5ABGA 1VFHA 1HL9A 1WXJA 1AW1A 1WDPA 3UFYA 1XLKA 2VZOA 3OLIA 3U2OA 2WVTA 1PHQA 5AB3A 5E93A 4KFPA 5ABFA 1ZUAX 3S4TA 3LTSA 3I3EA 4PSPA 1GYNA 3BG9A 2LLEA 3G0UA 1M53A 4JTFA 2VL4A 3WQGA 1MWOA 5HNUA 3TFCA 4PC8A 3E2QA 1F6KA 4B5VA 1BVNP 1V51A 1BYBA 1DXIA 2VELA 2JIEA 3L21A 4IIFA 4ROPA 2QMKA 1TCMA 2ALRA 4R85A 1M01A 3CM4A 4P5UA 3QGAC 4UTLA 2V5KA 4GGBA 5EMKA 1VEOA 2X1RA 3Q67A 5H8UA 2CWNA 3KBNA 1TTQA 1E1FA 1VFFA 5C5YA 4O19A 5FI8A 3CUFA 1IZKA 1AVAA 3HV9A 3DN5A 2WVSA 1M9HA 2ZZ3A 5I3HA 3CMJA 1WKYA 3L4WA 4P8XA 2OO0A 1RVGA 2J9ZA 2W67A 1RBAA 3LI0A 3OODA 3WLKX 1V6YA 3VPLA 4CD5A 1GONA 2V67A 5I78A 3G5EA 4INFA 3V0SA 3A3XA 3WQFA 5FJJA 4QS6A 3FKRA 2XUCA 2J24A 1JCMP 4GIAA 5CSYA 3ZJ6A 1ICSA 4C1NA 4X3ZA 3G1RA 4S3CA 5CZKA 4UIOA 1S2WA 3EDEA 2QCFA 4B9YA 4EOUA 4CQ9A 4DN1A 3BH4A 2Z2UA 4UR9A 4DZAA 3WDQA 3VA8A 4LBUA 4JS3A 4M1RA 1SZNA 1SJAA 3HJZA 3DFTA 4C6QA 3BJSA 7CGTA 2NSXA 3WEZA 2NT0A 1KD0A 3W7QA 1R38A 4GQRA 3LPGA 3TKFA 4DWSC 4GO9A 4G5DA 2QCEA 1EPXA 1UP3A 3W1AA 3BURA 4LANA 2Q8LA 4IMDA 5TNVA 3ARZA 3CYJA 4FPSA 4HB7A 4MOZA 4AG0A 2CERA 1KTNA 4JFSA 1W3IA 4A8RA 1VQTA 4IMCA 2FLIA 2XVLA 3W6YA 4EKJA 5CJNA 4NASA 3UBPC 3DX5A 1IGSA 4BWLC 1QAPA 1GEHA 1A3XA 3KBVA 4P7RA 2ZZ6A 2VEFA 4REQA 3UXLA 2EPHA 4EPKA 3K8KA 4H8NA 4MVAA 1E9IA 3RMEA 3LBMA 1RQEA 1NFPA 1QO5A 1X7FA 2YBVA 3FA5A 2ZUVA 1LJYA 3WELA 5LYRA 1XYLA 2D2HA 2Y24A 3P62A 1JIBA 2XZ7A 3BK0A 2DSZA 1VGAA 1EXPA 2RDXA 3AIRA 3Q58A 5IRPA 1UW9A 4XTDA 1KCXA 1ZBVA 1Q66A 3IV8A 3L5LA 3BICA 4PB5A 3UG3A 3W29A 9RUBA 3MO4A 2A6NA 8TIMA 3EX6A 3SEPA 2FDSA 4H00A 3KOZA 5H91A 2W3ZA 4KKXA 3QTGA 2E9MA 1CGVA 3W1RA 3DFPA 4J3VA 3CB3A 1B3YA 3W7EA 1A50A 4FXJA 1K3UA 3GBEA 5HINA 2A7NA 3TJLA 3S2CA 3LA4A 3ALFA 3KW3A 4JPGA 1CXKA 4A29A 4DQWA 4NNCA 4EIVA 1CB7B 1UR1A 2YW4A 2WJZA 3WBWA 3OG3A 3DEQA 1CTNA 1OK4A 3N2MA 5CG0A 1FDZA 3WQ8A 3KCOA 3P67A 5AVHA 4EAYA 2J66A 4TV6A 3NSMA 1Q7MA 4ZO8A 3WLLA 3LLXA 3QW4B 1U33A 1GYLA 5AYXA 3O16A 3MDWA 4XQ6A 4EF9A 4JFWA 3A5VA 4HHLA 2Y88A 4NG3A 3UG8A 2PWGA 3E5BA 4DXVA 4E2BA 3H2NA 4IMFA 5CH9A 3WL1A 3E49A 3LRLA 3OBKA 3CH0A 1AZ1A 1S5NA 1AZ2A 4AD3A 4Z1YA 1RCXB 3FCPA 2R24A 5AC8A 3E2VA 2V8ZA 4HA3A 5CKSA 4B5XA 3WZ0E 1XINA 1MUWA 3AIWA 4J2MA 3AWOA 4GZ7A 4G7EB 3T8QA 2B7NA 2HRWA 3ZXWA 4W7UA 4B91A 1RPKA 4GZEA 2R8WA 3EOSA 1OFRA 1F76A 1MDLA 4ACYA 1XQKA 2QS8A 2VRJA 3BQ6A 2GUUA 3GG8A 4N6FA 2VNCA 1WDSA 4Q8WA 3K4AA 4PBFA 2A7PA 4IGNA 2TRSA 1VFTA 4N0RA 1J0KA 3UVIA 1U22A 4HU4A 3KRSA 3OZPA 3VKCA 4F2TA 1U1UA 1P0DA 2FIQA 3B0UX 1HP5A 4CQBA 3EB4A 4Q8OA 4PUDA 4PBGA 1XGZA 3U0HA 1WUEA 2XSAA 3INPA 5I3FA 1EA9C 3L4XA 2FPYA 4BEQA 3GKFA 2ZZ5A 4BF7A 4MZ8A 2WHJA 4E5TA 3UXIA 4Y9OA 3TTSA 3PZIA 2W27A 3TCSA 1HJVA 2P8BA 3REQA 5A8GA 3BLPX 3DHPA 3IGSA 2HNEA 3VU2A 3UR5A 2NXHA 2DH2A 5M1TA 1V0MA 4H4IA 1XLGA 3FW6A 4W7VA 2E1WA 3UWVA 3EWZA 1IV8A 3ZLGA 3S2JA 5AC4A 1AW2A 1YXDA 4ILSA 2D2GA 5E09A 3VOIA 1W54A 1KNWA 3SUTA 1W56A 1WYIA 1Q6GA 3IGXA 3L2IA 3SCRA 2F6XA 5F2IA 1V5XA 1WDRA 3PWGA 3GDLA 2Z6IA 3C2VA 1LOLA 4PULA 4G56A 5DT7A 4FR1A 1DWIM 1XBVA 1CXHA 1K7FA 1XSKA 1HT6A 3R2GA 4X22A 1MI3A 4CNSA 3AHVA 3ABQA 3LZ5A 3N2BA 1Z44A 1V3MA 4KT2A 3Q65A 3QQWA 2I1OA 1EDGA 1Y65A 1QBAA 1J93A 5KZ6A 3KUMA 3ALGA 1GOIA 4H8HA 5PTDA 4NYYA 1C29A 2VZSA 3OQEA 1AK5A 1EQCA 2ZUUA 2ZA3A 3T40A 3GM8A 5JBFA 2YIHA 2PDQA 2C0HA 3B05A 4FOUA 3CAKA 4KPLA 3GIQA 1D7KA 3V18A 4FEZA 3UNTA 1VLIA 4ICCX 4H83A 3HGOA 2FTWA 4J4KA 4V1XA 5L6UA 3IRSA 5DCEA 2WWDA 1SMDA 3SN0A 1JXKA 1H7NA 4PL1A 2BHYA 5KEZA 4Q22A 5LIKX 2JALA 4WIWA 1BRLB 2WMKA 1EUNA 3ITCA 4D1JA 1IZJA 1H49A 1UIPA 4QE4A 3S6DA 4DXKA 2WXDM 1KXTA 3AIEA 5A6MA 3W7PA 1GVEA 3EKGA 2ZZ2A 1MEWA 5AYIA 2PTWA 4UB9A 2W92A 4LOCA 4TVUA 4XV0A 4AY1A 4I7WA 3PNZA 5DRIA 3WF2A 3FYOA 2VKZG 1CWYA 4GVGA 3GW3A 4RJEA 2FZMA 3WLPA 1OFPA 4YL2A 3RLVA 2WHLA 2I5GA 4FF7A 1A0DA 2ZQ0A 4JGDA 1K9TA 2POTA 1PIGA 3CWHA 4ZE5A 2HISA 3UR2A 1XYBA 1UOZA 4QEEA 1Y7VA 3PUEA 3VOJA 5AYZA 2CITA 3SGZA 3W07A 2DZSA 5EB8A 3TJIA 3N1AA 1YDYA 1A53A 3WQOA 1M68A 4W85A 3B3DA 3ITOA 1KCKA 2H3DA 4IFOA 2PRHA 4MPQA 3RM9A 2ZX7A 3RX2A 4OWGA 3QY6A 5CPOA 2Y2WA 3A24A 2V82A 3WDIA 3W1UA 2E77A 4AIBA 3R43A 1RCOB 1XM3A 1B54A 2J4GA 2AL2A 2ZE3A 3DG7A 3M0VA 5I3KA 1UUQA 3K8MA 1E6SM 2ZUNA 4FXRA 1R3RA 2WVUA 3TDFA 4DJFC 1O12A 2WCAA 5JXQA 1ZL1A 2RGLA 3SN4A 4ACZA 3ZYZA 2QEZA 1F61A 1W1PA 4K68A 1RD6A 4EWND 3BV4A 3AHZA 2OMAA 1ZU8A 3C5QA 3HFYA 1YYAA 3MI2A 4IJBA 1G01A 4KCWA 3CMGA 2F38A 1DJQA 2XSBA 4C91A 3A22A 1TKKA 1DV7A 4PGLA 4GPNA 2H8ZA 4NT0A 4B9ZA 3G1DA 1JI1A 2FZDA 1RY8A 4JQAA 3SQMA 2E9BA 2L5HA 1K77A 3B4UA 1UD2A 4QEHA 4MJZA 2X09A 4L6DA 3LM3A 5C7HA 3L2LA 4I9AA 3WH9A 3GX9A 3C3UA 3ABSA 4XZMX 2YW3A 4QDWA 3MP5A 2NT1A 3KBWA 3S9IA 1Z89A 3QV7A 3N19B 4AB4A 1LBMA 3BLEA 1AJZA 1P1XA 3KHJA 5FJRA 4KETA 3AZRA 2IKHA 1EC8A 3NL3A 1QXLA 3QHMA 4O13A 5IM51 3DBPA 2E68A 2PGWA 4CCZA 3EXRA 2GJRA 3WG6A 3SUSA 3NA8A 1YPFA 2RJHA 2CWXA 5KETA 2P88A 3BLKA 5E0FA 5KZMA 2V5LA 3R8HA 2HVOA 4GXPA 5E0KA 1TTPA 5A2CA 1DBTA 1KQZA 4JY9A 4GBUA 2PDBA 5CLTA 3B0VC 4O0QA 3WNNA 1S2TA 3SIZA 4FALA 5M5DA 5JUVA 2WLZA 3PZMA 2Q8ZA 4KWOA 4FMVA 3XISA 1FWCC 3EWWA 4HMEA 2XIJA 4WDUA 1QRQA 2WO5A 1XR2A 2G3IA 3BSGA 4KGLA 4UMAA 3OB8A 1AJ2A 3GNRA 2JE8A 3LENA 2VR4A 5K9XA 1PZ0A 1GG1A 1SZEA 3NVTA 1HP4A 1RBLA 6XIMA 1JGIA 4WR3A 2DSVA 3GNPA 2FB2A 1KLYA 1HGYA 3QGVA 4ZOAA 4J7RA 1TWSA 4GQQA 3STGA 4WDTA 3N4FA 1JEZA 4F48A 3LRMA 1NFGA 3E9AA 1DQWA 2DZWA 1I1XA 5A6SA 1DJYA 1GORA 1W2PA 1S2CA 1XYAA 2I57A 2Z1WA 1W9PA 4DRSA 3KRZA 4CNNA 5DMMA 1XGDA 2EGZA 3NZRA 6A3HA 5AFDA 4C7DA 4TX8A 5GJMA 3LUTA 2VGIA 3IRDA 4GMEA 3UT0A 3DC8A 1RALA 3CQ0A 4YTQA 5IXEA 1PKLA 3MUAA 1H61A 2NX9A 1VLWA 4N4PA 3SURA 3LBOA 1SFJA 3LPOA 2PDIA 1JXJA 2VFHA 3UZJA 4HNLA 3O3RA 3M0IA 3NPXA 4DM2A 3SGGA 3ISIX 3QN3A 3WLIA 2ISVA 3W81A 1O7AA 2FJKA 1AA1B 4XZIA 4HT3A 4H04A 1ZQ5A 3VKBA 5AYBA 8RUCA 4TTUA 1X98A 2HMCA 3HQNA 1F9CA 2XISA 3JVAA 3SIMA 1XISA 1V3HA 4DIAA 4RPQA 3AYVA 3N18A 1TIMA 1RLCL 2V3DA 3WQWA 4OU1A 4HA4A 3TSBA 5AZ0A 1AL8A 1FWNA 5HMFA 3W2JA 2GDVA 4D6IA 2UBPC 2EPKX 1XDLA 1R2SA 5HMDA 4MG4A 3U8GA 4DEFA 2CLHA 2OT0A 3K30A 3W7HA 5LA0A 1P0EA 1LTDA 4QXIA 5TQLA 4UQDA 2XJ7A 2G0WA 3S0CA 2X8RA 4LB4A 1AW5A 4MY8A 4HCLA 3C61A 2J75A 3AC0A 1UWIA 1IEQA 2QLYA 3AXHA 3A21A 2O9TA 5D05A 2CCRA 2CW6A 5BOFA 1IQ8A 2B4GA 2DZUA 1TE6A 3RFAA 1OBAA 3NSXA 3SO7A 3SI9A 3KX6A 2Y8KA 4IF2A 3RRXA 1ZP4A 4E0CA 1OFOA 2FZ8A 4BI7A 1IWPA 4C5YA 4QE1A 1WAUA 3E02A 3EZ4A 2QZRA 4C7GA 4Q4PA 3GDBA 1SZRA 2GLKA 4A35A 1VS1A 2W63A 3VX0A 5AYYA 1OB0A 4GXWA 4D6GA 4AD1A 3TR9A 2GYIA 2I17A 1E0UA 3EA1A 4GYPC 3E1F1 4E38A 3PSVA 2Z28A 4HKPA 2Q09A 2Q3OA 4ZA0A 1MSSA 3O06A 3WDHA 2ZRZA 1G5AA 1FWWA 3S1XA 3GZAA 4AU0A 1RJQA 2Y7EA 3Q4DA 2EG8A 4AZ5A 4IUOA 3R7MA 4PR4A 2XTKA 2EG6A 3UXAA 4HU3A 4CN4A 3SM0A 1VYPX 4P7NA 4NRRA 2Y7FA 1XLIA 3LDVA 4ZVJA 2AMXA 2OOGA 5BWFA 2OO6A 1V03A 3NWRA 2FQIA 2Y8UA 2E6YA 1V6XA 1S5TA 1CYGA 2ACRA 5KZDA 4B90A 4Z1AA 2O55A 4AUBA 3C2OA 3M5VA 1XC6A 4DJEC 4IPNB 3ZT6A 1PSCA 4UQ9A 3H4GA 1V6WA 2WC7A 2VZTA 1E43A 4A22A 3HIJA 1QO2A 3VI2A 1ZP3A 3ZT7A 3MZNA 5CC7A 4WDWA 4XAPA 2ZA1A 2CKSA 1VFUA 1D3HA 2RGMA 2A4AA 3AYRA 5CXPA 4LSBA 1S5WA 4W86A 3VD3A 3W88A 4YN5A 5CGTA 4EK7A 5C9ZA 2PP0A 4QITA 3BE7A 7TIMA 1OFAA 2QV4A 3QF0A 4O14A 3OA5A 1EBGA 1G1YA 4WOQA 3V16A 5FEWA 1FWAC 3GHUA 1E6XM 1XFCA 2BHZA 3GDMA 1VFLA 1TPEA 4JYEA 2H8XA 2F61A 3ITLA 3ZQ9A 3E38A 2JKPA 4Q4RA 4CQAA 2YCLA 1OYAA 5EGRA 1AUSL 3BOFA 1GZJA 3BL3A 4QNWA 2AMGA 1F6YA 4H6RA 2GVYA 2UWFA 3GUWA 1ZAHA 4PMZA 2DT2A 2ZC1A 2O7SA 1O1ZA 3ARTA 4EXBA 1KFWA 2XFFA 4MGGA 2VO5A 2ZRVA 4LYPA 3PM6A 4LAUA 4ZB0A 4GCAA 1ISVA 4Q4QA 4MSSA 4AD5A 1SM9A 4JXCA 3ES7A 3W85A 4N7QA 3UXDA 4P7OA 3PUOA 5H2ZA 4MLJA 1EEXA 3WY1A 4GCXA 3O0FA 2QMJA 1BPLB 5CBIA 4Q4OA 3KBJA 4XIAA 4R9OA 3GTXA 3ZR5A 3S5NA 3KBMA 2E0PA 2MNRA 1KRAC 5HUOA 2Y63A 1VR6A 5MHBA 5FF7A 1OF8A 1VCGA 3HG2A 2QF8A 2P10A 3L12A 3G1XA 2QIWA 2GK1A 1IYXA 1OGBA 3UG4A 1JZ3A 3NDZA 3EDDA 4YVXA 3B9DA 1HF6A 1OX4A 4LUTA 2Y6ZA 2X30A 2C7FA 1X6LA 5LSMA 3FV9A 4UFKA 3E2RA 3WLSA 5EMMA 1X8CA 4XVEA 4B3LA 1QUMA 2ESCA 2XFWA 3H53A 3L0KA 4H6EA 1I9CB 4JYFA 3RK8A 4IXXA 1VC4A 4BR1A 3WEOA 4A3RA 1GOWA 2REQA 3FXGA 2E5CA 2ZXBA 1EP2A 1EWEA 4IP4A 4XAGA 3QMSA 4CNPA 3MWCA 4JTSA 1KM2A 1FDYA 1XSJA 3TZFA 4R7JA 2JGQA 1ICPA 3GNNA 1GYMA 4QR6A 4Y2WA 2DUAA 3VD9A 1J0IA 3RCMA 4PEEA 4KERA 3EKZA 3VCRA 3DYOA 1OCNA 1JYNA 1M7OA 1GQIA 4Z1BA 5CBJA 2J27A 1TPH1 5GNXA 3V7PA 1R9YA 1BAGA 5BRBA 3WF3A 2DEPA 4NJJA 3WEMA 1DJNA 2POZA 2J8GA 2Y5EA 1PVNA 2FVMA 1F3TA 1GOQA 4V2XA 3LXBA 3T0AA 1PTDA 3QMTA 2CEQA 4PMRA 4AY7A 3G6LA 4M51A 4CQ8A 3WENA 3E0FA 1HIZA 3J7HA 4GG9A 4MMWA 4GWEA 3V5CA 2YSWA 2CZFA 3CZEA 3EDFA 1WA3A 5IHRA 1FTXA 1A47A 4J3TA 4FLQA 1RLDA 5DMLA 3RG6A 3ARVA 3TSDA 1KM5A 7REQA 3K4WA 4Y9AA 3W7KA 1QOPA 1R3YA 3EWCA 4ZR8A 3OW1A 3GAKA 5HXMA 3FJ6A 1ISXA 4JDYA 3W87A 3F4DA 4GY0A 3D47A 3PBYA 3A4JA 4IIBA 4L9XA 2OZTA 3B8SA 5BOOA 3LCHA 3RITA 3DKLA 1EO7A 4NHVA 2V6AA 2J6XA 4R88A 3OGSA 4L64A 2VZUA 1I0DA 4JN6A 1XCFA 1LRNA 3U2CA 2QCDB 2BXZA 4F0MA 1WXZA 4IGHA 1GW1A 3B9OA 1IXOA 1N8IA 1VFSA 4X60A 3UA4A 1JF5A 1HJQA 5JMUA 1TCDA 4LNYA 1QI4A 1PIIA 3QR3A 1S39A 2YFNA 2YDAA 3N6HA 4OT7A 1ISYA 3WK3A 5BXTA 4MY1A 3RAOA 1Y8BA 1TE1A 3DHDA 3UETA 5D8WA 2PTYA 1A5SA 3WL0A 2A79A 2DVTA 4EAMA 3WJSA 1OGSA 3N3MA 1FUYA 5EMJA 5IDIA 1HKWA 1POKA 3PVFA 4XD6A 3TOYA 3T0DA 1JPDX 1OEPA 1KR1A 3M5XA 5G1MA 4JFVA 1KCZA 4XBSA 1P6WA 1HKJA 4YLWA 5HQEA 3IUIA 1SFLA 4AEEA 4RW3A 3RU8X 3G18A 3N4EA 1G4TA 3GD6A 2C16A 3T8LA 3AWNA 3BSMA 3UWYA 5A8NA 3UR7A 3MVIA 3ERPA 4M81A 3JS3A 3PZTA 4NI3A 3LG3A 1XWYA 5DN1A 1BWKA 2PDFA 5AZ1A 1YDVA 1X6NA 4M7SA 3LNPA 3TN4A 4GI9A 1H7OA 3AOFA 5HWJA 3DYMA 1JRCA 4AZ6A 4BFAA 1TV8A 1B9BA 3MC5A 4Z0SA 4EF8A 1R3SA 1OC7A 2V3FA 1JNEA 3I7QA 4FLOA 3E0WA 3GO2A 2V2CA 2G41A 1UROA 3KEHA 6REQA 1A5AA 3ARQA 3MZ2A 4S23A 3NXFA 3UD6A 2Z27A 4HCHA 1ME8A 2V3EA 2ZRYA 4IIDA 3MB9A 2WKLA 3V4BA 3RU6A 2GGJA 2QPUA 2IPWA 1XLCA 4F0HA 4S3EA 4L4MA 4NIRA 4HHMA 1UC5A 5I24A 3QPEA 1K70A 4DPQA 3ZLFA 3MHFA 3KZSA 4HZ7A 4LPCA 1UD4A 4JICA 1KXHA 2DW7A 5D8ZA 1YXYA 4K8GA 2V69A 3USZA 2WSRA 1J0HA 3W6LA 3SRDA 1V6UA 1TV3A 1QR7A 2DGAA 2FGZA 4PCSA 4PMXA 1B2YA 2R1PA 3DENA 3ZVHA 1RA0A 3MHGA 1OCJA 3A9BA 4MWAA 4NJGA 3I4KA 5D9OA 2PAJA 1E5JA 3IAQA 5TAOA 3NZGA 1HL2A 4HOZA 2YDRA 3DXIA 2XIOA 3SCWA 4PEKA 4XWUA 4ZL1A 4V1YA 1HXJA 3LEPA 1JQXA 2Y4SA 3F2BA 2X0SA 2PE4A 1RCQA 1U5HA 1SFSA 3H2MA 1P7TA 2V5BA 4AHOA 4H01A 3H2EA 4ZEPA 2BMBA 4GLEA 1D9EA 5DXXA 3VOGA 4JTEA 3HTWA 2AQVA 2PA6A 1QHPA 3T07A 3W70A 3TA9A 3IARA 1GUVA 1NDWA 2F7FA 5BXSA 3EYPA 4X9YA 1HJXA 4X0VA 1RR2A 5BU9A 2I5QA 5A8MA 3DFOA 3TQKA 4NAEB 2OELA 2GGEA 4N42A 5C70A 4RE4A 3APYA 3R4IA 1W8SA 5BOEA 1NF7A 1QU4A 1AQ0A 3G1FA 4ML9A 5D30A 4E4PA 4EVZA 4QISA 3C0JA 1W2VA 2PFHA 5BMXA 1VRDA 4IPJA 3W7NA 5EU9A 3HV8A 1P5BA 3GZ3A 2ZKMX 4G8TA 1H4PA 2GQAA 2PB1A 4QLLA 5C9RA 1JVNA 4A3UA 2RUSA 1GHRA 3M5YA 2BS9A 4NAFA 1TWDA 3RPTA 3TNOA 3LHTA 2QDGA 2BG5A 2WANA 3GHTA 5SWUA 1H62A 3WUGA 4PH6A 4GH1A 3VKJA 1EGMA 4C6LA 4JIEA 1FHDA 3UCQA 3UPMA 4DVOA 1PZ1A 3U57A 1OQFA 4K38A 2BX7A 3GXPA 4V28A 1QHOA 1W1YA 4IMGA 3LX9A 4DJFD 1XQLA 2WNNA 4NL1A 1MQQA 2V38A 4ICNA 2DIEA 1QT1A 3V3WA 3APGA 2A3HA 2QNEA 4G6CA 5H8PA 2X1SA 4TTGA 3ABOA 3OP2A 5XIMA 3UGRA 2GVGA 4XZ9A 1ITXA 4HZ6A 2PLKA 1LQAA 4UC5A 1BKHA 1C7SA 3EEGA 3TWBA 3FAWA 4DWSA 4UOZA 4GZJA 4Y9NA 2ODOA 3W37A 4JTQA 5DRCA 2EJAA 1E72M 5ECUA 1JPKA 1MO0A 1V93A 2G50A 2E4TA 3II1A 1SW3A 1W1B1 1DJIA 3NO3A 1SW0A 1HG3A 2XZ9A 1L0PA 4WCJA 1IWBA 3KTXA 4JIRA 4N2YA 4LY4A 1FWJC 2VEMA 4BWLA 1GHSA 4NVTA 4D71A 3UZ5A 2R1KA 3HZ3A 4HA1A 3QYSA 4Q8QA 3CMFA 1ZBKA 5AOUA 3LHWA 2OWCA 1LG2A 2ISSA 1LOQA 4GACA 4YCPA 4FR6A 1YPIA 2ZWYA 1TTJA 1O6IA 4FS9A 4WKAA 3WD4A 1JNDA 2ZXAA 3RILA 2V5JA 1UMLA 4FP1A 2WBKA 5HWNA 1TPDA 4M1BA 1R9XA 2OB3A 1E6QM 3QJAA 4RNJA 4I6VA 4DY1A 2PP1A 3ITGA 3I6RA 4N6EA 3GYEA 3MKVA 3H23A 2ALDA 1TIWA 1PZ3A 1E4IA 3SCUA 4LRTA 3FXYA 4I3GA 4FX7A 3OLGA 3SZ8A 3SR7A 3BO9A 2EJ1A 5CAKA 1KC7A 2BHUA 4LAMA 3QGKC 1BQCA 2DQWA 4EANA 3MMTA 4FOKA 2X0YA 4O1AA 5J04A 4JTLA 4B5NA 2C13A 5ABFB 2QGYA 2D0HA 5E70A 4KQNA 2PTDA 2D0GA 4F3HA 4A3HA 3I10A 1PIFA 4U2YA 1KFCA 3BARA 2AOSA 4D72A 3CT2A 1R3QA 4Q6XA 4NYUA 3PBUA 3WLRA 4E3VA 4ZOEA 2QXWA 1ZGDA 1H60A 1TRIA 4E4UA 1KA9F 1Q6OA 4AWTA 1EGZA 2PMQA 3F4NA 2YL9A 2WZIA 2C0AA 3DZ1A 1DJHA 3W26A 3AS0A 3G8EA 4TVCA 2XN2A 3EA2A 4UQEA 3MPGA 1EL3A 3CH9A 1KV8A 2QULA 4MB5A 1L6GA 3TTOA 3LLFA 1PUDA 1M3UA 3PTMA 1O5RA 3FYYA 1NARA 4H1ZA 1OF6A 1B90A 5B80A 2BOFX 3N17A 1Q7ZA 4ZO6A 3WNMA 3KE0A 3DU0A 5K4XA 3ZR4A 1NP0A 2VFFA 2ZUMA 3I7RA 2JEPA 1CT5A 1MW2A 3P5ZA 1WKEA 2ZZ1A 3A4WA 1B3OA 4ZBCA 3FS2A 2GWGA 1W3KA 2DT1A 3GXDA 3UU0A 3VOHA 4J40A 4O57A 4DM1A 3WMSA 2DJLA 3LK6A 4GC4A 1JPIA 5HJYA 2WZEA 4ATLA 2QIIA 1CXEA 4C1NB 3VAVA 4A3YA 3M07A 3AYTA 4IGSA 3K5XA 4O1EA 3PJXA 1XLHA 1KGUA 3WJXA 4OZOA 4B15A 3TMLA 1Z3NA 4C6EA 4UTMA 4N9DA 1EF3A 3MSYA 4L80A 2GVEA 1R85A 3ORWA 4ZSTA 3LU2A 3DESA 4P8VA 2O56A 5LZLA 3KFTA 1OT1A 3NNTA 1GVRA 3QQ1A 3BJFA 5J5DA 1KV5A 1BXNA 1SO3A 3R12A 3NOYA 4FA3A 3AS1A 1KQYA 2WOQA 2OGYA 2V63A 3HGRA 5HPCA 2YB1A 3WQ5A 1A5MC 4IQDA 4AD0A 3CXOA 4M8UA 3A12A 1OFBA 4RE2A 2OGJA 1RAKA 1VBUA 2VRQA 2J7HA 3LGGA 5BXRA 3CUIA 2IPJA 2XN1A 4ZFCA 3S83A 2QDHA 1JFHA 4REQB 3V1PA 1QNOA 3R94A 4OKDA 3TYDA 4MB1A 4PRTA 2QF7A 2QVNA 2DZBA 3CZGA 3EWXA 2ZZ7A 1GW9A 4GY1A 3G1HA 4GI6A 3N6QA 3VM5A 4KH2A 1JCYA 4HZ8A 4DWDA 1OYBA 3TJXA 3PJTA 5AHEA 4LUSA 3FHAA 4HPXA 4IFKA 2R6OA 1OZMA 1R6WA 4CQDA 5C2XA 3EX2A 3RX3A 5A2BA 3OGRA 2BY3A 1IT0A 1SU5A 1RD5A 3WIJA 1US2A 4A6GA 2J47A 3B0YA 1VBGA 2G3MA 1OYCA 3VNDA 3N2OA 3CT7A 3OZMA 1T8QA 4L6HA 4WOZA 2G96A 3S2LA 2ZA2A 2X41A 2EKCA 3FSTA 1E0VA 3W7IA 3RJXA 2XFRA 5FEXA 1R87A 3IVUA 4KWWA 1JCTA 3PZGA 4XBKA 4IL2A 4CQCA 1JUKA 1SFTA 4DF0A 3GS6A 4O1DA 1WDDA 4CVUA 3GDTA 1A5UA 1XLLA 1FWHC 4YIWA 4XAZA 4C1LA 3CTTA 1EH9A 4DX3A 1LP6A 4UFHA 4ZO9A 2Z1KA 1EJRC 4PCNA 5A6JA 3WNKA 4DYEA 1FCVA 3EKLA 1QPNA 1Z32X 3PHAA 1VENA 3GHSA 2VOTA 3AMCA 1M65A 2G37A 3GU2A 1FWGC 2J74A 3S5ZA 1UWQA 3STEA 1XYCA 1L6FA 3CTLA 2ON3A 4WY0A 3EA3A 3BAKA 4TOQA 3KS5A 5M2FX 2WWCA 5HMEA 1W9DM 4MDOA 1D8WA 5I5RA 1KM0A 1PL9A 3DDMA 4J35A 1XV8A 4ZQMA 2P8CA 3B40A 3AUOA 2JKAA 2WMFA 1QPQA 1XP3A 2FH6A 1YBQA 1XBXA 4ERIA 5LNWA 3VIPA 2Q01A 3HMCA 4O16A 2QAFA 2E7FA 2QCNA 5E9AA 4F4RA 2AAAA 1OVDA 2ZIDA 1V6TA 3NZQA 3KLLA 1A4MA 4YYFA 5FAGA 1TR9A 3ELFA 2NLYA 3BGAA 5ABTA 1KM4A 1OFEA 3ME3A 3W7LA 5I3GA 3VO0A 1F7BA 2BP1A 1H7RA 3WBXA 4LYQA 1DOSA 4E8DA 2HXUA 3NQFA 4DJFA 3OPSA 3ZT5A 3JR2A 3GFZA 4MNLA 3WF4A 4JKKA 2ABBA 2HTMA 4US5A 3CHDA 5BMWA 4Z17A 4Z2HA 5DQPA 1XCWA 2RHGA 3REQB 1AODA 5F4WA 4CN1A 4DO7A 4L9ZA 1M1BA 3DHFA 4W87A 1AL7A 4PUKA 3R0DA 1UASA 5K3VA 4XISA 3NO1A 3GH4A 3H24A 2PZ0A 2VVNA 1SO4A 1VJZA 2YJQA 4DLFA 4F9DA 4J1OA 5LXXA 1A5OC 1FXQA 4QSHA 3RDKA 3NDYA 1K7EA 1W3LA 3C2RA 1ONRA 4BK9A 2BVTA 2DUXA 2XGBA 2VC5A 3UWUA 1LZOA 1O60A 4OV9A 3QLLA 1PE1A 1XW8A 3S5YA 1GVSA 4TUFA 3K1GA 4R3UA 1MZRA 2F2KA 4Z2KA 5HJLA 5A1AA 3WYZA 3LV5A 3EB2A 4YTSA 3V36A 2GOKA 3SQLA 3E12A 2EF9A 3DOPA 1UP2A 4NQ1A 1KFEA 3E96A 3KWSA 2ZE0A 1B4EA 2OSXA 2C8NA 5HQLA 3F03K 3FLUA 3BAXA 3W7OA 1Q2SA 1EHAA 1RQBA 4FNPA 3ZSTA 3QHOA 1J2WA 3GNDA 3W2LA 4TXEA 3JW7A 2PDXA 4D2JA 1FRBA 1WOBA 3NXLA 4BY3A 3KOXA 2PC4A 3MMDA 2GJPA 2DORA 2QCGA 1IEWA 4NSBA 1QMLA 3NTYA 2D69A 7PTDA 3A64A 3L66A 4HN8A 3WH5A 3FN9A 1QBBA 1VAHA 1FWFC 1EGVA 1EC9A 1M7XA 3VE7A 3U6WA 2OT1A 1T99A 4PUJA 1CW2A 1KBJA 1EDTA 3T55A 1E9YB 4PE8A 3KLKA 2XN0A 3W27A 2OQHA 2FJUB 4YTTA 3QC3A 5EKYA 4DI8A 4QX4A 4IH3A 5LA1A 1JYWA 4FOJA 2A3AA 4BQ5A 1J8VA 2JIWA 2IQTA 2R1MA 5HUPA 1Y5VA 1POJA 4FNSA 4AVNA 3KVJA 2J77A 2A21A 3QQ0A 1FHVA 4BI6A 2Z00A 4CLMA 3SSZA 4MY9A 1EKOA 3KP1A 1ITUA 4LVGA 2OX4A 3AJXA 5C2CA 5HAOA 3VGFA 2R1LA 2QPXA 1UZDA 5B7ZA 1DJWA 3CUXA 1W1A1 5A8PA 5C55A 3SQSA 1S2UA 2YL8A 5D2XA 3OHMB 4HNUA 3FFSA 1XF0A 2NVDA 3ITVA 3UR8A 2P1FA 2Z1VA 4RDYA 3H4WA 5DY3A 3NIYA 4B5UA 2PDUA 1QWGA 2HJPA 4J28A 2VEGA 3MCOA 2C79A 2WQPA 7ENLA 3BQ5A 4M56A 4J3WA 3A47A 1D3GA 4PODA 4PRWA 3TAOA 1ADOA 3TMQA 1YLVA 4AZIA 2QJGA 2QT3A 2QGHA 2WNWA 2DV0A 1B5TA 2AL2B 2NSOA 2CHOA 1J4EA 2NUWA 2QHAA 3ZR6A 4W4QA 5CPSA 5F1VA 3PK7A 4K36A 1XHGA 1CXFA 1ZJAA 3DFYA 4QG8A 1I2PA 2OXNA 4KWVA 4C6PA 4O18A 3N12A 4ACZB 1G7UA 3CK5A 4KW2A 4PTXA 3CS2A 1DHKA 1LL4A 1EA0A 4Q8NA 2ZX8A 3IJIA 2YA1A 2E6FA 4GYJA 1G4SA 2HXTA 3TXVA 2RAGA 4AMCA 2RKXA 2G4JA 2D23A 1K9EA 2PRMA 5DF0A 4GISA 3UESA 3AYSA 1X39A 4WY0F 4S2CA 5E9XA 4D8AA 3QBUA 4S3DA 2J9XA 3IANA 3TR2A 3IWPA 1ZAJA 3OO2A 5I23A 1CLKA 1Q6LA 4Z2LA 1A4LA 5ABEA 3ANYA 4CD4A 4S3AA 1Z6KA 1LBFA 4GFIA 2CZ5A 3P6LA 2V2DA 1F4AA 2IKGA 1WOAA 3P14A 1G0CA 3YPIA 1IR1A 2VEKA 2ZVRA 1ONWA 1Q6QA 1O5QA 2VX5A 3KOYA 1CEOA 5D04C 4AAJA 1EWDA 4LVFA 1JI2A 1IXQA 2ZX9A 1ZNNA 4LUJA 3WH8A 2Y0FA 4ZENA 4RXGA 3RXZA 3IUDA 1QDSA 1LOSA 2VX4A 2V5DA 1FWDC 4AX7A 3MSGA 1WXYA 1UR3M 3FIGA 2YBTA 1EOMA 1TO3A 3VIGA 1ICQA 1JULA 4YWSA 1V4YA 2QKFA 5I3IA 2GQ9A 1B3ZA 5IFTA 4OTKA 4WSKA 3UQNA 4E4FA 3QZ6A 3UWEA 4P8UA 1V79A 3RPMA 3ATZA 3THDA 3U7VA 5CPTA 5FF2A 1EZ2A 3TP4A 3P61A 3MA8A 4DZ5A 3N2CA 3PANA 1LF1A 2VFDA 1R2RA 3W86A 3CUJA 1OIMA 3AIVA 1LQ0A 1ZAIA 4IQJA 4NZJA 4QCFA 1W1ZA 1V3LA 3V5FA 2WPBA 4R5EA 4PTMA 1WP6A 1ENUA 1OWQA 1PPIA 3PB0A 1R8LA 1XIHA 1EUAA 3PWAA 3P8IA 3MCNA 4PB3A 1OG6A 1M7JA 1Q45A 3BPWA 4BZYA 3BLDA 4L9YA 3IAPA 1AFSA 4GH3A 1DE6A 4J3ZA 5AHMA 1LM1A 4XKMA 5AVNA 3HGJA 5FKYA 4F0SA 1PX4A 4QM1A 5A6LA 2EO7A 1QK2A 3CV6A 4HZMA 1QPKA 5C8BB 4HTYA 3C56A 1N8WA 3VNZA 4B3KA 1EYEA 1UP0A 7TAAA 3GW0A 1KWKA 2PDGA 1ISWA 3VNLA 4ZQNA 1P6BA 5DCBA 4B5SA 1XICA 2FFCA 2XVKA 1AQMA 2E5BA 3MHUA 2GWNA 2AKMA 4JYDA 1EC7A 4D6FA 1YTDA 5LHFA 4QQ3A 4JCMA 3LOTA 3GTIA 3O6CA 1KRMA 1RP8A 1UWAA 5DFAA 4M82A 1ODZA 4IMEA 1JUBA 4Y96A 1OGGA 3G8RA 2OLHA 1T8XA 1J18A 2CU0A 3RIKA 4O50A 4WF7A 1W9XA 2PRLA 3N9KA 3A9IA 2PBOA 5KITA 1TV4A 1UHVA 3SN1A 2HCVA 1JZ4A 3OIHA 5LIXX 1LLWA 3DFSA 3COTA 4H8VA 2XG9A 2F8QA 1AQFA 3FSUA 1S1PA 1OSEA 4C60A 1GKRA 2A0NA 3PBMA 5FCZA 1F3WA 3OU8A 2AQWA 3VIIA 3L0NA 4ZQOA 4JL2A 2X2GA 2ZUSA 3N2XA 1TR1A 3AISA 3N34A 1B4KA 4FHAA 3W25A 4YTRA 4BA0A 3AFBA 1F07A 4LVBA 1TPFA 5M3WA 3JZEA 4DBSA 1C8VA 1YNPA 2PUZA 4G7FA 4UTKA 4ICMA 8CGTA 2FMOA 5K9DA 5E0CA 1W31A 1LWHA 3NEHA 1FP9A 7ODCA 2A3BA 4N9CA 2I14A 5CSSA 3LERA 3OBAA 1ODUA 4M80A 1A49A 2FKPA 3EX1A 3P82A 3I4EA 4O54A 1Z69A 4EACA 1LLOA 2ZOXA 1W5OA 1PKNA 5FACA 3AHTA 3QOKA 4ADUA 3URBA 1TRDA 3MCMA 4TVDA 2DQXA 3R5EA 1PAMA 4NZ1A 3TQPA 3L5AA 2FHBA 2BGNE 1GKQA 4MM1A 1OABA 4HSOA 2P3EA 3MJMA 2CETA 5JIWA 4B3ZA 2PF0A 4H9UA 3ITTA 4LTSA 3NPWA 3PWIA 3WFAA 3VDHA 2BY0A 2PGEA 4JQ2A 2VDHA 5I7GA 5FSDC 3TONA 2XVGA 4XBJA 1EF2A 2B7OA 5EPDA 3TTYA 3URAA 4W88A 1GOKA 1XL9A 3WQEA 4I9TA 3GXIA 5LNRA 1Q5MA 3RM8A 1UR4A 2D2JA 4XZLX 4GABA 1I6NA 3VGDA 3CQIA 3MQTA 2RJGA 4AWSA 3TYZA 5L9FA 1VZWA 5LKYA 2E40A 2YBUA 4UCGA 4O4VA 4Z1DA 4CD8A 2OOFA 2VENA 5I07A 1ONXA 5LNUA 2YCLB 1RJRA 1LL6A 1Q4NX 1XLMA 3UY7A 3NQBA 4YHGA 1W1VA 1NELA 5HNNA 1S2AA 3KCLA 1XRTA 4EXAA 4A21A 5H1WA 3LBCA 2HK1A 1XIIA 4JOMA 2P5NA 4HHHA 3L4VA 4ZODA 1DIOA 1TVNA 3AMDA 4PCPA 4QJ1A 4JTJA 2KAUC 3NYZA 1OX5A 2Q3RA 3RLUA 5GVJA 3B8TA 3GHRA 3VIHA 4RZ4A 1MZHA 2BY1A 4QJ4B 3OLDA 1L2UA 4QTGA 4FK9A 1P6CA 1ADSA 4J2PA 2CYGA 3W22A 1PYFA 4DELA 3SCPA 4HK6A 1FP8A 3AIQA 3OG2A 4HYRA 1K4GA 5KTLA 4X2RA 3DG6A 3LMZA 3BW3A 4MAVA 3PS7A 5XINA 1WPCA 3ZSSA 3TEVA 4L1XA 4WK9A 1I4NA 3U4AA 2VC6A 3THAA 4WHBA 3S1WA 3VNMA 4EE9A 4B5TA 3TH6A 3RHGA 2CLEA 1UH2A 3WH6A 3VDCA 1JFXA 5HNRA 3O0KA 2GK1B 3TTQA 3T08A 4U33A 4MDPA 3QV9A 3VGEA 3LPPA 3AIBA 2NX3A 1OX4B 2Z29A 4LUTB 1L6WA 4KWUA 1HQTA 3QV6A 4B16A 5DLCA 4JTDA 4JTRA 1UUMA 1V6VA 3XIMA 3MU7A 4Y9PA 2A85A 1XBZA 1HJSA 3W53A 2VQTA 3TUUA 2VX7A 4LC8A 2BY2A 3ANUA 1W9UA 4GIRA 4HOWA 1TPC1 1I60A 4D9PA 3W1QA 2DSUA 2REQB 3C2EA 2Z24A 4MAZA 3GFYA 4OE7A 5D2TA 3WUFA 4XUYA 3R13A 3W7CA 2NV2A 4C6CA 4I8DA 4M6VA 4GFSA 4LF2A 5CQ1A 2D3LA 2P0IA 3EXTA 2CBUA 3CLWA 2FGLA 5CBBA 3AXKA 2WMIA 3B06A 3NQGA 1UR2A 1OM0A 2YXGA 3U3HA 4UQCA 2QPSA 3W7GA 2PWUA 3G0XA 3PG9A 3C0QA 4DYKA 3I6TA 5GPRA 4MPKA 1UWSA 2WHMA 3QLDA 4OVXA 5T91A 5C6MA 3W2MA 4A8IA 3LHYA 3W83A 1E15A 1KXVA 2F6KA 2NVCA 5AC5A 1SGJA 3DH7A 1E3ZA 1E51A 1K7XA 3E74A 2EBNA 2P50A 2VOMA 1DEDA 3EX4A 2H9AA 3PSWA 4C1KA 3QR1A 3VM7A 5REQA 4RR4A 1BTCA 1HKKA 5FJPA 3A5FA 3R8GA 4H9VA 4NI8A 1CENA 1S2VA 3G1YA 4C6FA 3F4CA 4FIRA 3BAYA 2HSAA 3QFEA 3W28A 7REQB 3G2GA 3W73A 2VFIA 5EBUA 4CCCA 4O11A 1B0IA 3O63A 8XIMA 4RZBA 4M6UA 5K9CA 1CBGA 3BGGA 3BJTA 4AEOA 4H7CA 4DXXA 4QRNA 3WO8A 4ZO7A 5M17A 3TYCA 4G1KA 2OPJA 3OZOA 3SJNA 4JIIX 1DIDA 4WKHA 1PCKA 1TA3A 3MKCA 1TMQA 3TV8A 3E0VA 3WQ6A 3M7WA 4MFEA 4GINA 2XINA 5F2GA 2WNZA 4BS0A 4YMZA 3VFLA 2QJHA 1ZJHA 2YPIA 3M47A 3M44A 4IT1A 4CGTA 3UEQA 5IOBA 5BW6A 1JR1A 1AD1A 2RDUA 3CEPA 3NQDA 4DAFA 1OK6A 4RV8A 3GE7A 1YE4A 3U5UA 3TW6A 4JTTA 2IXUA 1GQKA 4FNQA 3H12A 2BODX 3OA3A 4LAKA 3VIOA 1XPGA 1KCLA 3BMXA 4WQ6A 1EX1A 1UA7A 1QNVA 4P61A 3LSBA 3PPFA 3M6YA 3EWDA 2OEKA 3G3MA 1PX3A 1I8JA 2PPGA 2VC7A 1UUOA 2W62A 2YDQA 3L2MA 5A6AA 1YDNA 1FWEC