3UWQA

1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
229
structure length
222
Chain Sequence
NDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPARRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP)
rcsb
source organism Vibrio cholerae
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 77
structure length 222
sequence length 229
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3uwqA00
3OVRA 2VEIA 1MZHA 4N9DA 3W85A 4UXDA 4D2JA 2A7RA 1FXPA 1E51A 2JGYA 2E1DA 4NJIA 3OA3A 3LI1A 3W07A 5D09A 1TRIA 1H7XA 3IVUA 4IMDA 3C2VA 3MI6A 3M5ZA 1PVNA 2NUYA 5C55A 5HR7A 4HKPA 1F6KA 4IMFA 4GUGA 4K7VA 3YPIA 2VEMA 2CZ5A 4JTJA 3TJXA 5AHLA 3HPXA 1GVSA 3FIGA 1YDOA 3TR2A 5AFDA 3N2XA 3ELFA 1M6JA 2RKXA 1VGAA 7TIMA 1MSSA 2YW3A 4MYXA 1FX6A 1AW1A 1FWSA 3VE7A 3O07A 3LGEA 1L6WA 3A5FA 3PBWA 1JQVA 5I3KA 3O05A 3KOFA 5AN7A 3HPZA 3TCEA 1TTJA 3W9ZA 4JTGA 1PE1A 3FJLA 1KTCA 1SW3A 1XFBA 2GPTA 2AGKA 3W2NA 1BWKA 3KRSA 4Y96A 1K8ZA 1LZOA 3GDTA 3HGOA 4KFPA 2R91A 4Q32A 1KFEA 4O15A 2GUUA 4HSNA 3JR2A 4C1LA 1EEPA 3HBLA 4JD4A 4O57A 4GBUA 4O50A 1X8FA 1X7FA 1QOPA 1VYSX 4O1DA 1F5ZA 2ABBA 4IWWA 1QO5A 4K36A 1O60A 2C14A 1YPFA 2ZRWA 2VFHA 4AF0B 2Z2UA 3BG5A 4BFAA 4N6FA 2V5LA 2BXVA 2J9XA 4OT7A 3HG3A 3TAKA 3C2OA 1X1ZA 3MMTA 3W7DA 3L21A 1CX9A 5IM51 4RX0A 1RPXA 3Q94A 4JY8A 2UV8G 3EWBX 3GLCA 5KINA 1Q6OA 2A0NA 4HNTA 3T44A 4M6QA 3QH2A 3CIWA 3IVSA 4GUIA 4RCXA 4YLWA 1TYGA 1G6CA 2CW6A 1EP2A 1Z41A 3LERA 3PUEA 1I2RA 4QSHA 3L0KA 3G1HA 1ZY9A 3RFAA 1H61A 4IOTA 3P82A 3PULA 1QPQA 2H3DA 1M7OA 1VLIA 3C8FA 2QJHA 3N2MA 3L0NA 1YDVA 3DGRA 3GKFA 1LM1A 1G69A 1L6YA 4H4IA 2NLIA 3LRMA 4M6PA 3CTLA 1S5TA 4HSOA 2CLKA 1EP1A 2DZUA 3SFKA 1I45A 3LXAA 2QDHA 3UWVA 2A6LA 2ABAA 5GVJA 3HB9A 4MFDA 2B7QA 4LNYA 2TSYA 3KAOA 4A2SA 4WUIA 3PY2A 1Q6QA 4JYEA 4FNQA 1PL9A 1VCVA 1A5AA 2RDWA 4LW7A 3NGJA 4AAJA 3R13A 5D2WA 4NZJA 1FCBA 4UR8A 1P5BA 1KV8A 2AAMA 1KFCA 3PAJA 1GT8A 2WNQA 3O15A 4O4WA 2E5BA 4BI6A 5LNWA 2ZA2A 3W71A 3GZ3A 3LV5A 1YXDA 3MI2A 4G1KA 1ZNNA 5K3VA 1TSIA 1W5OA 5AYYA 5FF4A 2YYTA 3N3MA 2OZ0A 3A24A 4PH6A 4MLJA 1JCLA 3MYOA 4JN6A 5CGQA 5AHMA 2OMAA 1FBAA 3WJZA 4WD0A 1UJPA 3DAQA 1JCJA 2HTMA 3W1LA 4TR9A 3UWUA 1KBIA 3O6CA 3EX4A 1B3OA 3LX9A 3QJAA 3T55A 3VKJA 4CNPA 3OBKA 1ZAHA 1J5TA 4PC8A 1B4EA 3VI2A 2Y61A 2JBMA 2ISWA 1VC4A 3PS7A 4EOUA 3BV4A 1JVNA 2V2CA 4IGHA 4O0ZA 1F76A 3TA6A 3PG8A 4UMCA 1SPQA 2DZWA 3IGUA 2ZRXA 3CT7A 3QW3A 5D04C 3E12A 3G1DA 3L5AA 3GIYA 3CQ0A 3BGGA 1UUOA 3DENA 1GJPA 2NZLA 5C6MA 4HT3A 4ML9A 3P74A 4PA8A 4WY0A 3L5MA 4QIUA 1S5VA 3ZFHA 2C16A 4KWWA 2V2DA 4RJEA 3EEGA 5CPMA 5DELA 1R2RA 3LCGA 3GXNA 5I3FA 2Y7DA 2FTPA 3C61A 3NL3A 4AXKA 3TROA 2VFFA 5D05A 5I3HA 4QNEA 3DI1A 5AC6A 4GWEA 5FF2A 1NF7A 4K37A 4X9SA 1QWGA 5DCDA 1ZAJA 1VYRA 5F1UA 1OG0A 3TQKA 2A21A 3EWWA 4DBDA 1QO2A 3H54A 4ICNA 2W0UA 3NQCA 3M5XA 1JRCA 3D0CA 3L67A 4ZVJA 4LT9A 1H7OA 3L0GA 3W83A 4AWSA 3ABSA 4UMBA 4CQAA 1EWEA 1P0NA 4O10A 2WOQA 2AQWA 4OHQA 1XBVA 1B4KA 5LGXA 4JYFA 3KRUA 2VEKA 4WOQA 2WSQA 1HL2A 1G67A 1TPB1 1GVRA 1QPOA 1SQ7A 4MUZA 4A2RA 4K7YA 3LHYA 4GUHA 2CLFA 1G4EA 5LGZA 2ZRVA 5DBTA 3SR7A 1UUMA 3BW3A 4LS0A 4NZFA 4O28A 3W7OA 3W7LA 4I7UA 4O19A 2A5HA 2VFIA 2EKCA 4HNVA 1D3HA 2A6NA 1GG1A 1OF8A 1W1ZA 3DHDA 4MZYA 3GAKA 3HGRA 3QSTA 2Y7EA 4MYAA 1XKYA 2ISSA 3NQ7A 1A53A 4UNLA 4XZ9A 5F2LA 1NSJA 3HG4A 2VXNA 3WK0A 3IGSA 4M19A 3TSBA 2YYUA 4R33A 2V82A 3DFSA 2QCNA 3N73A 4M7TA 1JCMP 4JR5A 2X16A 3NPWA 1LLZA 3ATZA 3SSJA 2DZVA 1I8JA 3OG3A 1MEWA 3UY7A 3GB6A 4LTSA 2QJGA 3P8JA 4YCOA 2C1HA 3FYOA 3S1XA 1IXPA 1WA3A 2CZFA 3UY8A 1TMHA 3F4NA 2Z0IA 2DZSA 3LI0A 3NEVA 2X1SA 3GKAA 4UFIA 2V2HA 3ZS4A 3EWXA 3HG5A 5E93A 5I3IA 1IXNA 2H8ZA 4DF0A 4EWND 2VENA 4ORMA 1T0OA 2WPBA 1VS1A 1XDMA 3BPWA 4MVAA 4OV4A 4Z0SA 3LCIA 4IMEA 1NFBA 4XBKA 4UFKA 4NX0A 2GOUA 4DO5A 2TMDA 1Z44A 3LM7A 4K8EA 4AB4A 4R34A 2Z6IA 1KM4A 3W7NA 3OHIA 1OFPA 5K9XA 1KM6A 3NPUA 3FEMA 5D37A 1W54A 2R14A 3TW6A 1YTKA 2DZXA 4HNUA 5A5WA 4UTLA 1ZENA 3RNDA 3THAA 1P0KA 3NQ8A 3B0VC 2ZRZA 1K03A 2VOMA 4LVDA 5AHEA 3QYQA 2C6QA 2WJZA 2O7QA 3W86A 1LRTA 2FPVA 4WY0F 2V30A 3W2KA 3W7JA 3W2LA 5L9FA 2XN0A 5LZLA 2E77A 4UCGA 2P1FA 3KFTA 1CW2A 3HG2A 5U7SA 2V5BA 4GFSA 2ZZ5A 1S5WA 3E0IA 1MO0A 3G8EA 5DCBA 2LLEA 3LOTA 5G5IA 5BRBA 4JX5A 1O5XA 2Z1BA 3LLFA 4K6AA 3G0XA 3GYEA 4TX9A 4P2VA 2ISVA 4MLRA 3TH6A 4Y9AA 2BSLA 5K7JA 3T78A 1GVFA 1W3IA 2JKEA 4TMCA 4LC6A 1OFEA 4UIOA 4A22A 1H7WA 1Q45A 3DU0A 3NM1A 2YPIA 3MWAA 3P60A 4ZQMA 1PV8A 3LCFA 5D2XA 4IX2A 1R30A 5CZTA 4JXCA 1EX5A 1V7YA 1YPIA 1RQHA 2QAFA 4UTJA 2F7FA 5KITA 1VHNA 3A23A 2VKZG 3WJXA 3G1SA 3A9IA 2XN2A 3UZ5A 3QMSA 2V9DA 4GUFA 5J5DA 5E1QA 4L4MA 2QCCA 2H90A 3QPZA 4JX6A 3EWUA 3WK3A 1OYCA 1PHWA 1SW0A 4MPQA 2A4AA 1UCWA 3WJSA 5EMUA 4JYDA 1LCOA 4JTLA 1SZGA 3NM3A 1K7FA 4MJZA 3UPBA 4OE7A 1ZHAA 2HSAA 4WZHA 4LWWA 4CLMA 3S42A 3W7QA 2QCDA 5F2IA 2TRSA 5LHEA 4MZ1A 1G4PA 4YWIA 1FQ0A 2E6FA 3SECA 4AHPA 3FFSA 3P80A 5FEXA 1G4SA 3FKKA 3KVMA 3G1XA 1SO4A 6TIMA 3TE9A 1R2SA 3NOEA 3DH7A 3PC0A 2Q3RA 3W1NA 1UBSA 5LKYA 3P5ZA 4N9CA 4GNJA 1W31A 3V1PA 1NF0A 3IIZA 5FEPA 4K8HA 4UTTA 1W5MA 2PC4A 4ORIA 4A29A 1K8XA 3S8HA 4JTUA 4IQLA 3STEA 1AW2A 2C18A 1ADOA 1QAPA 5A8GA 3NVTA 1H5YA 3BLIA 1G7UA 2JK2A 3KVKA 5D03A 5AYXA 3EWYA 1TREA 4BR1A 5F2GA 3RU6A 4Y90A 3W1PA 3EB2A 3F4WA 4LVAA 4FIRA 3W7HA 4AHQA 2HS6A 1TCDA 1DKWA 5TIMA 2Q8LA 3S5ZA 1J2WA 1GG0A 5BMXA 3GDLA 4DF2A 4KFNA 2WKJA 5CZSA 3HPSA 3LCWA 3MI3A 2BWGA 3ABRA 2RHGA 1WX0A 5G2WA 4YXGA 1OJXA 3C2EA 3DKLA 3PF3A 3H53A 3S1VA 1ONRA 2J6XA 1H50A 5E0KA 4QISA 1AG1O 3CC1A 3VCRA 4ZMGA 1ME7A 4FX8A 1LYXA 5KSWA 2YCEA 3RLUA 4AHOA 1OFQA 1KM0A 4NU7A 4HN4A 4O17A 3I7SA 5BMWA 1LP6A 4LVBA 3N19B 3TU9A 3NYZA 1JJKA 3ZWTA 2JKAA 3R12A 4XQ6A 1U83A 2E6AA 3C3NA 2YGYA 5BW6A 4IPJA 2YW4A 2OCZA 5DLCA 1C29A 3BW2A 3LBMA 4Z1DA 3NQDA 3P81A 4O8RA 2NXIA 3CPRA 4BWLA 4KKXA 4X22A 2FDSA 3BARA 3C2FA 1OVDA 3NPVA 2QUUA 2D73A 2WQPA 4JICA 3EXSA 4RV8A 3T4CA 1ZJIA 2NXHA 2ZFAA 4GUJA 2GQAA 3W7CA 3UPWA 1ZALA 3IGXA 3DI0A 3U2OA 3TC6A 2B7NA 4UC5A 3TC7A 1OX5A 2WNZA 1QFEA 1AW5A 2PCQA 4DF1A 4IMGA 4UTWC 4PTNA 1X1OA 3W7EA 2ZZ3A 1H7PA 1YTDA 3EX6A 8TIMA 5DN1A 1B9BA 5HR6A 3TIMA 1V5XA 3JRKA 4NJJA 2Y88A 2H8XA 1ICQA 3UD6A 3KX6A 2VELA 4ZQPA 4O1BA 3DBPA 3Q37A 4MFEA 4M5PA 1WDWA 4UTKA 3QQ0A 1GTEA 1RZMA 3PB0A 4JTKA 4OGZA 3G3DA 4HNNA 3MO7A 5G4WA 1FDJA 3VE9A 3W73A 1XI3A 3UWQA 5K2ZA 4Y6GA 3W22A 1LOQA 1K8YA 1OFOA 5D32A 4ADTA 3NQFA 2J24A 1VH7A 3MHFA 1VZWA 5HWJA 3R2GA 4UNKA 1H51A 3TFXA 3LHWA 2Y70A 3G0UA 4MIMA 4OQVA 1GYLA 3PBVA 3BG9A 4LRTA 3VFLA 4FF7A 3WK2A 2DORA 4JIPA 5BNKA 1K7EA 3CIXA 2Z6JA 5F1VA 3W7MA 5H2ZA 3TMLA 4JY9A 1WBHA 3WJYA 5AHFA 4N2YA 3BK0A 3N14A 4EIVA 3QRHA 4FEZA 2QCMA 1Z42A 3A5VA 4Z1CA 2V8ZA 3W2JA 1DHPA 4S1FA 1IIHA 3LLDA 1VJIA 2PRMA 4ZQOA 3DFTA 2RFGA 1J4EA 1YDNA 3QFEA 1XL9A 3NPXA 4O4VA 4RK8A 1GYNA 1R47A 2EHHA 3P61A 4Z1AA 4EVZA 3QMRA 5HNRA 2G95A 1GPWA 3QQ1A 2Y7FA 4NNCA 3JS3A 3THQA 3GK0A 5EA9A 3G22A 3W75A 4O52A 3TQVA 6ALDA 2CZEA 1PCWA 5K9DA 2JKPA 1C8VA 4JDBA 2GVJA 5J5RA 3G1VA 1H7NA 1SZNA 5AC8A 1LORA 3S5NA 4UFMA 4NVTA 1EP3A 1F6PA 1LBMA 2OT1A 4FNTA 3OVPA 4MY9A 2Y7GA 4O12A 2HS8A 2QF7A 2I14A 3BLEA 5FEZA 4GJ1A 4O54A 5DBUA 2PURA 4WJEA 2YFOA 1OK6A 1RQEA 2C13A 3UWZA 1KV5A 1LTDA 1DJQA 3PVFA 5HQEA 2DZTA 1TJRA 4HPJA 4WXYA 3HJZA 3EX3A 3HO8A 2E09A 1CI1A 2WV8A 3M41A 1KM5A 4DQWA 3W70A 1QMLA 4ZL1A 5CSRA 3PUOA 3W1TA 3M9YA 3HGSA 3P84A 1OABA 1KFLA 2O7SA 1DOSA 5AC7A 3PSWA 1N8FA 2GQ9A 1XUUA 3TSDA 1TRDA 2B7OA 2FQIA 1A5BA 4EF8A 1HFBA 3RMJA 1DQXA 3EX2A 3MP5A 1SUXA 3KHJA 2RDTA 2YX0A 3HQ1A 4S2CA 4OWGA 4O53A 5AHIA 3S1UA 4CQ9A 3TK7A 3R89A 2QDGA 2OT0A 3MUXA 4UR7A 4CNOA 5CSSA 3PR2A 4N6EA 1YLVA 5EY5A 3SI9A 1OFRA 3DXIA 3W72A 3LTYA 2NXGA 3PWAA 1KM2A 1F74A 4J9JA 4CCDA 3C52A 1I2QA 1MEIA 5D33A 1H1YA 1LOSA 3USBA 3DFNA 3L9CA 3T7VA 1XDLA 1WAUA 2HMCA 1HO1A 4FNUA 2ATSA 4UTWA 1SZFA 3A21A 3LB0A 4LUJA 4Y8FA 3W1AA 3NQVA 1TV7A 5KZMA 4EF9A 3R5EA 1QCWA 1YYAA 3FLUA 1GOXA 1R2TA 1XXXA 1BKSA 3LHVA 3TAOA 2YZRA 3G18A 4PFMA 3W84A 1HTIA 5CPOA 3DFPA 3KRZA 3I65A 4I7VA 4IJBA 5FF3A 3G1YA 1O4UA 3DFQA 3CWOX 3BGJA 4UFLA 3DZ1A 2QKFA 3W7KA 2YSWA 4O1AA 5EPDA 3TDFA 4MKNA 1GVOA 1ZAIA 4WQ6A 2ZBTA 4LS1A 3M5VA 1FXQA 3QM3A 3MHUA 3UWYA 1QDSA 4FX7A 2WSRA 3CB8A 3UNDA 1JUEA 3M44A 3LDVA 3TQ0A 3SGUA 1VRDA 1NVMA 4HPXA 4WY0B 1FCQA 3LXBA 5KZDA 3NL5A 2EPHA 2ZDRA 2XN1A 5C2XA 3HOJA 4R7JA 3W76A 4LU0A 3E02A 4AVFA 3PBYA 1IXOA 4LVGA 4YL2A 5CG7A 1P4CA 3BO9A 2DU2A 3RF9A 2E68A 4FXSA 2QCDB 4NXKA 2EGZA 4DO6A 1JRBA 3G24A 3TFCA 4W9TA 4QQ3A 2ZYFA 4ZZ9A 2CU0A 3W23A 3NZRA 3L66A 1JCXA 4CCCA 4DPQA 2FB3A 3O16A 5HUOA 2V81A 3QW4B 3M47A 1VHCA 2CLLA 3W1UA 4E2BA 5IBXC 2GVLA 1XBZA 2VFDA 3W1QA 2DJLA 3E96A 1T96A 1IXQA 1TPVA 2OJPA 3GDRA 1RVGA 4N4QA 3G0SA 4O18A 2TPSA 3B4UA 1OX4B 5G4EA 2R8WA 1T99A 3LCXA 4M6VA 3TX9A 3AO0A 3EX1A 1D9EA 1OK4A 3P5YA 3W7RA 2B0MA 1F2JA 1L2UA 3RLVA 1KFKA 1GQNA 1TV5A 1P1XA 3I68A 3I6RA 3LXCA 3MW7A 4FX6M 5KMYA 1TB3A 4N02A 4MY8A 4ZQRA 2Y89A 3M43A 3DHFA 3W2MA 2P10A 1ZFJA 2OX1A 5FF7A 4XWUA 2E6YA 4HHPA 5IBXA 1K7XA 3SGZA 3W6YA 3CEUA 2FPYA 1G7VA 2W79A 1ME9A 4NT0A 4JEQA 3MBFA 4KWVA 3Q2DA 3MHGA 1W37A 1F73A 4BI7A 4BI5A 1JUKA 3B05A 3S1WA 2PRHA 1TPDA 3PB2A 2FPTA 2NV1A 3B04A 4MZ8A 4ZQCA 1FCUA 3LBCA 3ATYA 3M5YA 1RV8A 1WOAA 1MXSA 1KBJA 1Y0EA 1SZEA 2EAWA 2X1TA 4UTHA 4JTHA 4LV4A 2X1RA 3NXFA 1WV2A 2ZZ1A 5EKYA 4TO8A 2ZZ4A 2I9EA 1VYPX 4Z0JA 2YDAA 1SO5A 1SO6A 4Q4KA 3Q58A 1A50A 1I4NA 4IUOA 3CU2A 1BTMA 5DY2A 3TKFA 3ZWSA 3E9AA 5F4WA 4POCA 4UTMA 1DBTA 2ZCGA 1TTIA 2NWSA 4NXSA 4I7WA 3I7QA 3S5OA 2H6RA 4UUIA 3WFAA 3MBDA 1EA0A 3RK8A 1N7KA 1O5KA 1O95A 3NQAA 4LUIA 1PIIA 1W5NA 1I2NA 3W88A 1L6SA 4QITA 3GR8A 4N9BA 4JTTA 3SZ8A 4CCEA 2QCGA 3LV6A 4TMBA 4FIQA 5KZEA 2RH9A 2V0TA 3TXVA 5D2VA 3C56A 2BTMA 5G1TA 5LNUA 1VPXA 4N9EA 3TW7A 1FWTA 1L9WA 1TPWA 3MP3A 3L68A 1KW1A 3B06A 5EBUA 3FJ6A 1KLYA 3LCLA 4PEKA 3ANYA 4JDYA 1JR1A 2G5WA 4A3UA 3P67A 2QEZA 4GRSA 3W1RA 3KXQA 4BK9A 3HF3A 4TU1A 5KTLA 1YXCA 1DL3A 4O0KA 1O94A 5D2YA 1H62A 5U4NA 1FDYA 4JTFA 3SJ3A 3NL6A 3CWNA 3G1FA 1KFBA 1TPEA 4RKAA 3LHUA 4OBTA 1ZCOA 2Y63A 1I2PA 3IIXA 5T26A 2A7NA 1SFLA 1YADA 4ZQNA 3O06A 1TTPA 3TSMA 2CLOA 4LRSA 4LOCA 3W87A 3FYPA 5CZ0A 5F4SA 4O14A 5CKSA 5D30A 1ML1A 1N55A 1TQXA 2YFNA 3PBUA 1EIXA 4NQ1A 4DPPA 2PE4A 5F4XA 3NR0A 2C0AA 1OFDA 3LHTA 1K02A 4PODA 4QNWA 4C1KA 2W6RA 3M16A 1PHQA 3QEZA 4AH7A 3UZJA 1H63A 1KTNA 3INPA 3F03K 1GEQA 1Q6RA 5AHNA 1HUVA 1W5QA 3W74A 1Q6LA 1OYAA 3FOKA 4WX2A 1NEYA 1XBXA 3W1MA 1JCNA 2H3BA 4N4PA 5K4ZA 3U6WA 5EL1A 3TXZA 2QCEA 4BWLC 3OVQA 4XUGA 3PG9A 5LNRA 3NL2A 5D38A 1FWNA 4BF9A 3B8DA 1C9DA 1UASA 3DFOA 3G3MA 3O6DA 3E49A 4RZ6A 3FKRA 1S3HA 4UFJA 4MOZA 5HULA 2PRLA 3N34A 5HJLA 1R46A 1OX6A 3L65A 1ME8A 4RLIA 2QJIA 3T40A 1XUZA 5EYWA 4FO4A 1SSDA 2J27A 4B5NA 3O1NA 2QCFA 3W2UA 3M6YA 1RD5A 3MYPA 4FHAA 3U8GA 1GZGA 5HINA 4AWUA 2E5DA 1IIGA 3NO5A 2FLIA 5LSMA 2GJLA 4RXFA 2NX1A 1UB3A 1EUNA 3IIPA 4NJHA 4CNNA 1DVJA 1QOQA 5TBOA 5MHBA 3B0UX 1H1ZA 2WSYA 4JIQA 4NJGA 1GTHA 1OFBA 4JTIA 1VR6A 3IVTA 2QCLA 4MJMA 3O6YX 1KLZA 1TPC1 3EKZA 3NZ1A 3M1ZA 5TQLA 4L4LA 4ADSA 3G8RA 4FNPA 3EXRA 5HUPA 4LY8A 2A1YA 3ABQA 1H60A 2C15A 4UTTC 3NNTA 3L2IA 3PM6A 5D2TA 4O11A 1U5JA 5F2MA 5FESA 1SO3A 4OU1A 3KVJA 4AMAA 3STGA 2GVGA 3SW6A 3BVJA 5SWUA 2CLIA 3HIJA 5DCEA 3S0CA 3UXDA 1W8SA 1ALDA 3K30A 1TPUA 4XTIA 1TTQA 1EWDA 4RZ5A 2NUWA 2WNNA 1F7BA 4XKYA 2G97A 1VQTA 5AYZA 4MY1A 5HWMA 1QPNA 2ALDA 3QSRA 3WK1A 3GDMA 4UTIA 2DZPA 2F84A 3WJWA 3P7YA 1TPH1 1KTBA 2CLEA 3EKLA 4GXMA 3S6DA 1M5WA 4FNSA 4YCPA 4S2BA 1QR7A 2B7PA 4A21A 4HIBA 5I3GA 2IQTA 2ATMA 2E6DA 4LS2A 3DKJA 1XBYA 4QAIA 3GVGA 3GNDA 4ALDA 4DEFA 5I3JA 3TV8A 2Y6ZA 4ADUA 4GC4A 4DBEA 2BX7A 3C2RA 4LVFA 1VCGA 4NX5A 1XCFA 1VCFA 1QNVA 3NAVA 5HWNA 4NNAA 1JULA 1KM3A 3FS2A 5K9CA 3O8AA 3STFA 1KM1A 3BW4A 4RZ4A 1BWLA 2CLHA 1LROA 2QR6A 1JCYA 3W7GA 4JNMA 3GNNA 3SIZA 2Y62A 3NQMA 1LRQA 3BLFA 5L6UA 4IMCA 1AL7A 2QUVA 2WO5A 4K39A 1W3NA 3QMTA 4P61A 1FUYA 1DQWA 4NNBA 4PL2A 3CM4A 3IIOA 3M0ZA 4CQ8A 1OX4A 2NX9A 1HO4A 3UWWA 1OF6A 1H7RA 2QCHA 1EPXA 2ZZ7A 3TJLA 4WOZA 3FA5A 1TPFA 2G96A 1W56A 3MP4A 3IEBA 1T8XA 1I2OA 2CFFA 3GXTA 2J9YA 3L5LA 3QF0A 3UQNA 1PCKA 1TJPA 5DXYA 1FY6A 4IXHA 3P62A 4FNRA 2TYSA 4DO4A 4LC8A 1WXJA 1RQBA 4UFHA 3QC3A 1AMKA 1X6UA 4XTDA 4KFOA 1A5SA 4JTSA 3G1AA 1MEHA 3CLMA 3PSVA 3B0PA 1YTEA 2JGQA 3GXPA 4OV9A 2ZRYA 2YXGA 1OFAA 3A22A 3MJYA 2P0OA 3NQ6A 3P8IA 2VFGA 3NA8A 2FIQA 3N9RA 2ZTJA 2QAPA 3IRDA 4DELA 3GX9A 4DXVA 2GJNA 5ABTA 2Q8ZA 2ZA1A 1WYIA 2NX3A 3TMQA 3OEXA 1LBLA 3NG3A 3V75A 4H6KA 3LTPA 1BEUA 3C6CA 3NDOA 1WOBA 4IXXA 2X2GA 3IIVA 4PCFA 4NUWA 4X3ZA 2VC6A 3GAYA 2X30A 4K38A 3IV3A 2FFCA 1QPRA 4AEOA 4UTUA 1TV8A 4TIMA 5C5YA 3NQEA 2DP3A 1XC4A 1D3GA 1LRNA 4XKYB 5G1YA 1KA9F 2Q3OA 3NQ2A 1PS9A 2ZA3A 2NUXA 3ABOA 3LRLA 5DY3A 2C19A 1W5PA 3CEPA 2VEPA 3W3OA 3UXAA 3W7PA 2YR1A 1EUAA 4JTEA 1JQXA 1WQ5A 2GQ8A 3S5YA 1IF2A 3NQGA 4H3DA 3W7IA 2CZDA 4E0CA 1NAL1 5DXXA 3GR7A 1ICSA 1AL8A 1SW7A 3N9SA 3EWZA 4U4MA 1AK5A 5C54A 5LNVA 4NJKA 3QPYA 5FEWA 4QJ1A 2CLMA 4YMZA 2QUTA 3AJXA 3O63A 4GE8A 2A85A 3LCHA 1FWWA 3HGJA 3R8RA 4AF0A 4AWTA 4Q33A 2NWRA 3QZEA 3BG3A 1DJNA 1OHLA 3STCA 1EB3A 2CWNA 1HG3A 4O16A 1KFJA 1IGSA 4E38A 1DORA 2DJXA 2Y85A 2E5CA 3HMJG 1B57A 3F1QA 4LV9A 1LDCA 1F05A 2FJKA 3TUUA 1W3TA 3OIXA 2KZHA 1M7PA 1Q3NA 4QM1A 4O1CA 3W1XA 3ZR4A 2C3ZA 1Z48A 3B03A 2BZNA 1GWJA 5FF0A 4JX4A 1OYBA 2BLEA 1YXYA 3LRKA 2J88A 2FB2A 4PL1A 4JGDA 2A7PA 3C0JA 2ZZ2A 1W0MA 2VFEA 5CZJA 1FWRA 1K3UA 3I7RA 1SU5A 1THFD 4WXZA 2R94A 4JS3A 2X1UA 3UYCA 3SY5A 4X2RA 1FDZA 1TIMA 3GDKA 2ZRUA 4E2DA 4FB7A 5LNSA 2NV2A 1ICPA 1RR2A 4U28A 1SFJA 5D02A 3C4UA 1WBJA 4XBSA 4RXGA 2ZZ6A 1TQJA 1G4TA 1JUBA 3H55A 3S9YA 3M7WA 4Z08A 3VNDA 4RR4A 5H91A 3TNOA 4FXRA 5BOOA 5FI8A 5G2HA 2XFWA 3CHVA 5G2IA 5CPNA 5K4XA 1SSGA 1VLWA 5LHFA 1XM3A 2ZTKA 4Z1BA 5HMSA 5AB3A 5CPLA 2J9ZA 4IX0A 1SR9A 3EXTA 4R53A 4O13A 1DV7A 1LLWA 3PUDA 1LBFA 2RDUA 3KVLA 3LTSA 2EF9A 4ONVA 1LOLA 3LHZA 5AOUA 2B4GA 2I1OA 1A5CA 4I9AA 4IPIA 4M7SA 2A2IA 4UMAA 1GVQA 1TO3A 2ZQ0A 1FCVA
chains in the Genus database with same CATH superfamily
2A3CA 2VEIA 1W17A 5FL1A 4D2JA 4BF5A 2JGYA 2E1DA 3HFTA 1Q2RA 3LI1A 2ZX6A 4EXAA 2BMBA 3W6LA 1H7XA 3AS0A 3VMPA 3MI6A 4KRZA 3WY1A 4D6CA 2J8TA 1XIMA 4CD8A 4HB7A 1F6KA 4K7VA 1OGBA 5AHLA 3FIGA 4FLRA 3TR2A 3VDHA 5FSDC 3EA3A 4LYKA 7TIMA 1V03A 3R8GA 2PZNA 2YW3A 1AW1A 4C65A 1HT6A 3W00A 4DJEA 4UQCA 1JQVA 4KWUA 2R24A 3MKCA 3C0LA 3HPZA 2PD9A 4P8WA 1PE1A 1A47A 3VTRA 3GNRA 4NAEB 2PS2A 3REQB 4K1GA 3SQSA 3TOPA 3W28A 1KFEA 2GUUA 1DE6A 2DSZA 1W1YA 2PGFA 4JD4A 4GBUA 4O50A 3RCNA 1X7FA 2YA0A 1VYSX 4O1DA 2ABBA 1KGXA 2ZRWA 2VFHA 4BFAA 4AIUA 3HG3A 1X1ZA 3OHMB 2OLAA 3RPDA 2VX4A 4IQJA 2F38A 3MB9A 2PU0A 8RUCA 2VX5A 2BHYA 4RX0A 1FTXA 1OD8A 3Q94A 2UV8G 3GLCA 1DXFA 1OCJA 5KINA 1Q6OA 2A0NA 1ZGDA 3T44A 2PA6A 5DF0A 3CIWA 1UZ1A 3IVSA 4AZHA 1E9LA 1G6CA 1AD1A 4Z2LA 3FNDA 1I2RA 2WCSA 3H8AA 3L0KA 3IK4A 3TTSA 3ZJ8A 1ZY9A 3PTQA 2F2KA 3D3AA 1P0DA 2PDNA 1H61A 4ZO8A 2OSXA 1QPQA 1M7OA 4US5A 1YDVA 4LCSA 1L6YA 1U2YA 2F61A 2Z26A 2G50A 1S5TA 1N8IA 1EP1A 3SN0A 1QI4A 1I45A 3LXAA 1MW3A 2A6LA 2CERA 4AZGA 2ABAA 2WVSA 4MFDA 2TODA 5EFDA 1EJTC 2B7QA 3VD3A 4LNYA 2TSYA 4A2SA 4WUIA 2YA1A 3OOQA 1PL9A 1XH1A 3K8MA 3E2RA 4LW7A 4CEXC 2E9BA 3ZLHA 2PLMA 1ZQ5A 1P5BA 1OB0A 1KFCA 5C2CA 1RUSA 5JBDA 1GT8A 1V0KA 2WNQA 3WD3A 1LUCB 2ZA2A 4XD5A 1OADA 3W71A 3GZ3A 1XIHA 4L61A 3MI2A 3RM9A 3GU2A 4XAPA 2ZE0A 3B9DA 3E3HA 4AYSA 1EQPA 3CBWA 2YYTA 3N3MA 4MUPA 2YJQA 4MLJA 3MYOA 5I3FA 1V3KA 3WJZA 2OMAA 4WD0A 1F6YA 1QWKA 3B0YA 2PFHA 3AALA 3W1LA 4GZJA 3N4FA 1UKQA 3O6CA 1B3OA 2G0WA 4GJIA 1QBAA 4KQNA 4AEFA 1UWIA 2IPJA 2ISWA 4EOUA 1JVNA 3SADA 2V2CA 4MDPA 3FA3A 4UCFA 1F76A 3TA6A 3PG8A 1B1YA 1SPQA 5JU6A 2ZRXA 1QHZA 4B5SA 3E12A 4HHLA 5C6MA 1BF6A 4Y9PA 1IZCA 1VFHA 4HT3A 5IRPA 1QHPA 4PA8A 1WKDA 4WY0A 4QIUA 2ZC8A 5JBEA 2C16A 4QJ5B 4J5NA 4IIFA 3VKKA 4DAIA 3NL3A 4AXKA 3TROA 5I3HA 3DI1A 3MVTA 2I9UA 1R0MA 1NF7A 3R0KA 6TAAA 1K6AA 6PTDA 3EWWA 3H54A 2WMJA 2W0UA 4GIYA 3L67A 4ZVJA 3L0GA 4CQAA 4EP8C 3KBMA 3V7PA 4K1WA 3NSNA 2WOQA 2FVLA 1C8QA 1B4KA 2WC4A 3N6HA 1B30A 4JYFA 2R1NA 5EU9A 4WOQA 2WSQA 1CT5A 2VR2A 1SQ7A 4A2RA 2BHZA 3LHYA 4LAZA 5DBTA 1DWHM 1V79A 2XM2A 5A95A 3BW3A 4O28A 3N6QA 1XLBA 1VBJA 1BKHA 1GG1A 4HPNA 1XYAA 1W1ZA 4MZYA 1E6NA 3WSUA 3GIPA 4X60A 3NQ7A 2VCCA 1A53A 3TYUA 2P8BA 2XM1A 3HG4A 2ZKMX 3EMQA 4PSPA 1QI2A 2GOKA 2CETA 1T41A 3AYTA 1JI1A 3TSBA 2J25A 4R33A 4Z2GA 4WGHA 3UW6A 3N73A 3KLKA 3GU9A 3NPWA 1S2AA 1I8JA 3BH4A 1BSIA 4NILA 4LQ1A 4GY7A 3QY8A 1MEWA 2WCAA 3UY7A 2QDDA 4UQDA 3UXKA 3P8JA 1X8CA 4BHYA 4H00A 4ZSTA 1IXPA 1WA3A 2CZFA 2SFPA 3UY8A 3MUZ1 1O5QA 1IYXA 2XGIA 1N8WA 1FWIC 2DZSA 1FWBC 3GH7A 3NEVA 2V2HA 3EWXA 1IXNA 4XZWA 3SRDA 3VGDA 1XDMA 2TAAA 3KEHA 2YBUA 1UWAA 3LCIA 3BLKA 5HMDA 4NX0A 4DWSB 2GOUA 3IPWA 4V2XA 2P5NA 1ZL1A 4JNZA 4IFKA 4R34A 2Z6IA 1KM4A 3IAQA 3OHIA 3XINA 5K9XA 4A35A 2P8CA 3W38A 2R14A 2WM0A 4L56A 2QIWA 3RNDA 2Y2WA 3THAA 4GMEA 4QDPA 1A5KC 1C91A 1XRSA 2Z28A 3AMGA 3W86A 3E2SA 3GU1A 4OIFA 2PPGA 2V30A 1V8EA 3RX2A 2QJJA 2V5BA 2VC7A 1YE6A 5AZ0A 4ATWA 3XIMA 5G5IA 1GQJA 2ACUA 3R11A 2PDXA 2Z1BA 3T2PA 3LLFA 1R3SA 4DLFA 4TX9A 3FY1A 4P2VA 3QV9A 1FH7A 1Y5WA 4Y9AA 3T78A 1TX2A 4JKLA 4A22A 1JXJA 1H7WA 3CUHA 4L6DA 3DU0A 4MG4A 4H7CA 3RR4A 2C7FA 1E6ZA 4ZQMA 2GGJA 4GX8A 5CZTA 2NT0A 3BCJA 4JXCA 4KW2A 1EX5A 1V7YA 1RQHA 4D8ZA 4E8GA 3BICA 2XN2A 2G3FA 2POTA 4GUFA 5J5DA 5E1QA 2F2HA 3VDAA 4DJED 2H90A 1CECA 3CAWA 1PEZA 1EC7A 3KOWA 1X1NA 2GYIA 1ZZMA 1PHWA 2A4AA 3WJSA 1VFFA 4JTLA 1SZGA 1UKOA 1H0IA 4MJZA 2BXYA 1JAKA 4LAKA 1HVQA 4WZHA 4ZXOA 5IXEA 5GJPA 4CLMA 1TV2A 1KQZA 2QCDA 2FJUB 2TRSA 3K8LA 1BGAA 4YWIA 1FQ0A 4MADA 1IE7C 4AHPA 1G4SA 1SO4A 1UG6A 3CHDA 3WQVA 1ZRQA 4GI8A 1UBSA 3AJ7A 3P5ZA 1W31A 4GZEA 3IIZA 1FWAC 4K8HA 1W5MA 5XIAA 4A4AA 1ZSXA 3QVQA 1K8XA 4R5EA 2NQZA 5A8QA 1ADOA 1GZJA 1D8CA 4GO8A 1Q4NX 1H5YA 1P6WA 3BLIA 1XRFA 1J0YA 3EWYA 2DSVA 1SM9A 2VL4A 4Z17A 4Y90A 2XGZA 2YZ5A 2XISA 3VVGA 1TCDA 2XH2A 2HQAA 1GG0A 1UWUA 3QR3A 5BMXA 3GZAA 4E4FA 1EJUC 3GNPA 3GUGA 4E8DA 3VD7A 1YW1A 2WK2A 4F0RA 1E0TA 2WZMA 1MYRA 4HNCA 2BWGA 3N2TA 3MZNA 1HKWA 3UZYA 3WQ5A 1ISZA 3NGFA 5ABEA 3DCPA 2IMRA 2HXTA 2VP8A 4XIMA 1VP5A 1KBKA 5IDIA 4EK7A 1ONRA 4CD6A 4U5KA 4I90A 2B81A 4QISA 1MXGA 3TYAA 3MCNA 4I5UA 1ME7A 4FX8A 1IEXA 5KSWA 3RLUA 4DNHA 2YXOA 3B9NA 4NU7A 2XGBA 1V0MA 1Q8AA 3UU0A 3H4GA 2PGRA 2JKAA 3GS6A 4DJDC 2E6AA 2YGYA 5D9OA 2OCZA 3QKZA 3BW2A 4DUVA 1CGWA 4W88A 2X41A 1ESWA 1RK5A 2E28A 3S1GA 3U5YA 1OVDA 2D73A 2WQPA 3EXSA 1ZJIA 2XFFA 3DIPA 4KCUA 2ZADA 3UPWA 1ZALA 1BFNA 3DI0A 4JBRA 3WMLA 3FCPA 3WBEA 4UC5A 2P3EA 1AW5A 4DF1A 1H7PA 3DOPA 2V6AA 3KBJA 3EMZA 3OGVA 1B9BA 3TIMA 4D6HA 1M68A 3JRKA 1S39A 4O1BA 4AWEA 5I77A 5J04A 3CGTA 5AC5A 3KP0A 1FH9A 1Q63A 4HU4A 1GZ1A 4ENLA 1E5NA 5CSUA 3N12A 3QLDA 3VE9A 5C7HA 3UWQA 1K9DA 4REQA 3VZYA 1K8YA 2VR4A 5D32A 2DFAA 1VH7A 2VQUA 1UR8A 1VBGA 2E67A 4DRSA 5EB8A 5HWJA 3ZJKA 4UNKA 2WSKA 2BXZA 2Y70A 4OQVA 2UZ9A 3URAA 2ZX9A 3CO8A 5LIUX 5GNYA 1UD5A 4TOQA 5BNKA 3CIXA 3S47A 5AECA 4LXFA 2VGBA 2YXXA 3MKVA 3QRHA 2QCMA 3A5VA 3AROA 3MS8A 2V8ZA 2X7WA 4Y9MA 5LA2A 1EKOA 4NG3A 1DJIA 4U2YA 3APYA 4YVVA 2PC8A 4RK8A 5J8LA 5C8BB 3H22A 3IACA 3RJYA 5HNRA 1ZCCA 1GPWA 2WZIA 3JU2A 4GACA 5KZ6A 3JS3A 2PWFA 3VX0A 2IKHA 3W81A 2JKPA 3VNZA 1YKWA 1Z6KA 2E25A 4F0HA 3VDBA 2QZRA 3PZNA 4AVNA 4MWAB 1FHLA 1EP3A 3OVPA 2WBGA 4MY9A 2GJXA 4E4UA 3EDDA 2QF7A 1JGMA 1WO2A 1O12A 4GGHA 4GJ1A 4F66A 3K4DA 4O54A 3KTCA 3GVRA 5CEWA 2C13A 3BCDA 1ZJAA 1HGYA 3HO8A 1HIZA 3M41A 4DQWA 3GXDA 1Q85A 4JIRA 1ONEA 4F2TA 3PUOA 4FOJA 4IP7A 1L6FA 3M9YA 1IQ8A 3CYJA 4GCAA 4ZXLA 1YPXA 4GNKB 3LGDA 1XUUA 3VDGA 3O7UA 4YYCA 2JQXA 3SURA 1FHVA 2FQIA 1A5BA 1HFBA 3THDA 3MP5A 4XO7A 2YX0A 1F4HA 2IQ0A 4DJFD 4B15A 3R89A 3MUXA 3LNPA 3WFLA 3IANA 2FMOA 4Z2IA 3UZZA 1KCXA 2VWSA 4N6EA 5HNNA 2NXGA 3PWAA 4XKMA 1F74A 4CCDA 5A8PA 4GJJA 1MW1A 1YRRA 3T7VA 1DWIM 2G4FA 2OWCA 3T81A 4FNUA 3SCPA 3LB0A 4LUJA 4Y8FA 3TWBA 5FL0A 2X8RA 1RP9A 1XIJA 3WUGA 2WNWA 1Q66A 1R2TA 3TAOA 2YZRA 2XHYA 3DFPA 1E1CB 1NWSA 2J62A 3BZGA 3D3FA 1DTUA 1X39A 4C60A 4JTAA 1E9ZB 4UFLA 1EH9A 3L4UA 4AD0A 2X40A 4MKNA 3OBEA 3LZ5A 4UWMA 4WLCA 3MHUA 1DIKA 3UWYA 4FX7A 3CB8A 4JN7A 3M44A 1CXLA 3C5QA 3WF4A 1RVKA 5KZDA 3NL5A 4Q3MA 3I3BA 4HHMA 3UERA 2Z1WA 1GVEA 4LU0A 3GG0A 4US5D 3BZJA 1XISA 4ZGYA 2V63A 4YL2A 2WHMA 4LB4A 1JRBA 3G24A 4QQ3A 1L8PA 4XX6A 4HYVA 3QY6A 4RDZA 3L66A 4XD6A 5HUOA 3QW4B 2INZA 2CLLA 4M24A 3W1UA 4ZOCA 4E2BA 4KRUA 4JTDA 4YU1A 3RX3A 3E96A 4H7VA 1XYMA 4HN8A 1IXQA 1G1YA 3S5SA 4PMZA 4N4QA 4J3TA 1H5VA 1I1XA 3GD6A 3B4UA 2ZC1A 4QG9A 3QC0A 1OX4B 3QFWA 3TX9A 1M1BA 2PF0A 1DWJM 1OK4A 1K6WA 2XFYA 2GVYA 3HTWA 5BRQA 3W7RA 2B0MA 4DY1A 3BLPX 3LXCA 4I9MA 4I5XA 2VO5A 1TB3A 2NW0A 5CCZA 4N02A 3ZM8A 2PTXA 4ZQRA 3CH0A 5AYBA 4QCFA 2XPKA 4P8VA 1PKYA 3KL0A 2E6YA 3VNIA 1M04A 4PGLA 4H9XA 3SGZA 2C71A 2O92A 2W79A 8A3HA 4JEQA 1MQRA 1QI5A 5D8ZA 4IIEA 1F73A 1BAGA 1V51A 3C2YA 3UCQA 4ERIA 2PRHA 3PB2A 4HHHA 2XZ7A 3AHXA 3TONA 3UA3A 4MTVA 3FAWA 1FCUA 3APGA 1QBBA 3LBCA 4ACZB 4W93A 3F7JA 3H2NA 3B3DA 1QNOA 2IUZA 3W02A 2ZZ1A 3M4HA 1E15A 1KNWA 4QG6A 3WD4A 4KGJA 5EMMA 1EIBA 1SO5A 5E9XA 4CD7A 2O9OA 4Q4KA 2Y5EA 1A50A 1W1IE 4LAUA 1JDCA 3RITA 1BTMA 4UTMA 2WZEA 1US2A 2QPSA 1XGEA 2HBVA 2GVEA 4NXSA 3BQ6A 4QJ3B 4DN1A 2F9RA 4ZE5A 4EPBC 3VUSA 3WFAA 3RK8A 2GWGA 5DMYA 4AD1A 1PIIA 4DJEC 3NOYA 4AZCB 3GR8A 3LV6A 4FIQA 3GXMA 5KZEA 2V0TA 3VIHA 5D2VA 3C56A 1K4GA 3II1A 3IWPA 3VD9A 4LF1A 1FWTA 4CEUC 4WSKA 1TPWA 3CPUA 3FXYA 4C6OA 3L68A 1J0KA 3B06A 5EBUA 1A4MA 4IICA 1KLYA 4F2UA 4PEKA 3ALFA 3EA2A 3P67A 4TU1A 4CD5A 1EPVA 1YXCA 1DL3A 4O0KA 4IFRA 1H62A 2WMGA 1W9DM 1EJ7L 1FDYA 1EF2A 3BMXA 1KFBA 1TPEA 2Y63A 4FA3A 2E40A 4JQ2A 4DNMA 2ZUVA 1X38A 3O06A 3TSMA 5FJRA 3FYPA 1QUMA 1C8XA 4MAZA 5CKSA 5D30A 1ML1A 2VQTA 1TQXA 2FDMA 2QPUA 4DPPA 3W27A 2C0AA 5GQBA 1K02A 3B4YA 4PODA 2W6RA 1UR2A 3M16A 3WMCA 3N2CA 1H63A 1KTNA 3H2AA 1CGVA 1GEQA 3W74A 3K1GA 1J0HA 1YNYA 3LU2A 1JD7A 1XBXA 1JCNA 4IFKB 2H3BA 4UQAA 4N4PA 1KXQA 3MJMA 3U6WA 3TXZA 1VFUA 2QCEA 2GJRA 2X0SA 5LNRA 1FWNA 3UP8A 3B8DA 1RY0A 3DFOA 4QLJA 3O6DA 2D3LA 4UFJA 4MOZA 3CIVA 4E2OA 3AZRA 4LUTB 3HQOA 2DVTA 4XUYA 3VGEA 4QHRA 1OX6A 1V93A 1XX1A 3WLPA 1WDQA 3UR8A 2PTDA 3R1ZA 1T6MA 2QJIA 1VAHA 2REQB 5DMNA 3CZLA 3P93A 4L65A 3O1NA 3W2UA 8XIAA 1RD5A 4FHAA 3VC5A 1GZGA 5HINA 2E5DA 1IIGA 4IHCA 2C0HA 4RUBA 3L4ZA 1FH8A 1MNSA 4QX4A 3S83A 4CNNA 1DVJA 1QOQA 3WNKA 4H1ZA 2J77A 1UPMB 4FF5A 4A8IA 4W5ZA 4H9VA 4GD0A 3UG3A 3VM5A 2D69A 1VR6A 1XR2A 4WCJA 3IVTA 4C5YA 2CITA 3FHAA 4MJMA 3O6YX 4AD4A 1UWTA 1NP2A 3SRHA 4DWSC 1B31A 3VZZA 2HE8A 2XINA 1NELA 4DJFA 4FNPA 4X2PA 2A1YA 3ABQA 3H4XA 2V69A 1I6NA 1U5JA 4P8XA 2G8ZA 5FESA 1SO3A 4GH1A 4OU1A 1IGWA 4MNKA 1FVPA 2GVGA 4R9XA 3SW6A 3TZNA 1PX3A 1US3A 5SWUA 3DGBA 1L6GA 5DCEA 4GO9A 4AMCA 4H9TA 3LPPA 3NFUA 4XTIA 1EWDA 3RPTA 1E40A 1CNVA 4J3WA 4XKYA 1R9YA 1VQTA 3CWHA 3QSRA 2AKZA 9RUBA 3DFHA 4B90A 3PZQA 1TPH1 3VOFA 2CLEA 1T8QA 4GABA 4GXMA 2GZXA 1M5WA 4HIBA 5TF0A 4ML4A 2IQTA 3JZUA 2Z1KA 4LS2A 3AHVA 2Y6ZA 4ADUA 4LVFA 2J7BA 3GHSA 3QTGA 4AIEA 1QNVA 2YCKX 1U1HA 4CU8A 2W63A 1VBHA 3LN3A 2R82A 3O8AA 2BG5A 3AUOA 1UD4A 4RZ4A 1LROA 4Q8UA 2XSBA 1JCYA 3W7GA 3BAKA 4JNMA 2R1MA 4RNHA 3BLFA 3GVVA 2OR2A 1AL7A 2QUVA 2C1IA 2BY1A 3QMTA 3CUZA 4P61A 1EXPA 4NNBA 4PL2A 3V0SA 4AEEA 4K2SA 2NX9A 1HO4A 2ISFA 4JL2A 3DESA 4BA0A 4WKAA 4PRRA 4W8BA 1L8NA 3WEZA 4WOZA 3WLSA 2VZOA 2CFFA 4D6EA 3L5LA 2J9YA 1UHVA 3QF0A 1TJPA 5DXYA 1FY6A 5HOSA 3VZXA 2VZVA 1IEVA 4P8UA 1MWOA 3W24A 2ZICA 3GO2A 1VJZA 1FWEC 3G1AA 4FLSA 4BQ3A 3PSVA 3OG2A 4AIOA 3GXPA 2JGQA 1GUVA 2YXGA 4I9JA 3MQTA 3MJYA 2P0OA 3NQ6A 3P8IA 3H21A 2EPLX 3IRDA 1TZ7A 1E9IA 4DXVA 5CLTA 3LUTA 4B5TA 1J0ZA 2XG9A 2E7FA 2VZSA 5A8OA 1YDYA 3OEXA 1DJGA 3R0UA 4EANA 1GW1A 5A8MA 2E0PA 1M01A 4B4FA 1DIOA 3IIVA 4ASTA 2CBIA 4C6DA 2VC6A 3GAYA 4K38A 5CGTA 4ROPA 3CZJA 2J7FA 3M0MA 4TIMA 5A6AA 5ECVA 3NQEA 3ERPA 1D3GA 1LRNA 4XKYB 3SUVA 1KA9F 3VK5A 4M80A 1PS9A 3ITTA 3WF2A 2NUXA 3E5BA 3RPMA 3SY8A 2PDIA 1W5PA 1UIOA 3CEPA 5DEZA 5I09A 2VEPA 4HCDA 1EUAA 2RDXA 1O5RA 1HJUA 4EAMA 4RE2A 3JW7A 2QULA 3TNBA 3Q45A 3AAMA 1IF2A 4H3DA 1XYLA 3R4IA 3WNPA 4DVOA 4E0CA 5DXXA 2Z2BA 1LQ0A 3ZMRA 3N9SA 3EWZA 1UKTA 5LNVA 2J75A 1JF5A 4YMZA 3O63A 1D7KA 3EDEA 4GE8A 3UGRA 1JDFA 3R8RA 4AWTA 1HF6A 1EB3A 2HBXA 1B54A 4I6KA 3MU7A 3PFRA 1E55A 3CUXA 2BOGX 4LV9A 1W3TA 3OIXA 2KZHA 3OB8A 1SYTA 3CB3A 1U33A 1BQCA 1M7PA 3N29A 4H8HA 1Q3NA 1A0CA 1MW0A 3V5OA 1J2BA 5D9PA 1EBGA 2PAJA 4YJ5A 1OIMA 1A3HA 3SJNA 3OPSA 3MSYA 1K3UA 1C93A 1SU5A 4GXWA 1GJUA 4JS3A 1SJCA 2VYOA 4Q8NA 3WBYA 1V6TA 3SY5A 2HNHA 1BYCA 2CYGA 4HGXA 1PKNA 2Q6ZA 4X9YA 1PWLA 1XLFA 2JE8A 3N2OA 1RAKA 4KESA 5LIXX 3BGAA 4XBSA 1WBJA 3MCOA 5A6MA 3M7WA 3ARUA 1O68A 7TAAA 3GDBA 4LAMA 2XFWA 5K4XA 4IPNB 4TQTA 5CPLA 4MB5A 2J9ZA 1OY0A 1TWSA 4IX0A 3RCMA 4R53A 1KR0A 1QVBA 3ZSTA 3VXGA 1LLWA 3O9NA 3VIFA 1M41A 3KVLA 2EF9A 4ONVA 4YTRA 3GHTA 4PYSA 5JIPA 3EDJA 1LUCA 3UA4A 1PSCA 1A5CA 1MQQA 4UMAA 2E1WA 1VPQA 1ADSA 1MZHA 3W85A 4UXDA 2XWEA 5TNVA 1FXPA 3HQPA 4U10A 3T0BA 1TVLA 3GC2A 3OA3A 4EWJA 1E56A 2WCGA 3W07A 5D09A 1DJZA 2XWDA 3CPGA 3CXOA 3SAZA 3IVUA 2VMFA 3M5ZA 4GLEA 1V6WA 4O0QA 3FGCA 5HR7A 4HK7A 3DHPA 4GY1A 2CZ5A 3VKCA 2HVNA 3B97A 4NI3A 1GVSA 3POCA 1YDOA 2XDFA 4QLKA 3N2XA 5AFDA 2QT3A 3ELFA 4J40A 4MJ4A 1F3WA 1OGSA 3H7RA 3WF1A 4MYXA 1FX6A 3PZOA 1W1A1 1JNEA 3LGEA 3O07A 1L6WA 3A5FA 3PBWA 4DJFC 4INFA 5I3KA 5EFFA 4LFYA 4KCWA 4JTGA 4HJFA 2UY4A 4YN5A 4PUEA 1KTCA 5TAOA 1OC7A 2GPTA 3EGJA 2AGKA 3W2NA 1Q7ZA 1BWKA 2OYMA 3CAVA 3KBSA 1LZOA 3GDTA 4Q32A 4O15A 3RGTA 1GPFA 4HSNA 3BAWA 1FHUA 1EEPA 4XZMX 1BD0A 1X8FA 2OQYA 1V3IA 4LNCA 4DLMA 5JIWA 3D47A 4K36A 1YPFA 2FHBA 2Z2UA 2ZUSA 3BG5A 3VNMA 2V5JA 2BXVA 2J9XA 4OT7A 1US0A 2YDRA 1WDSA 3C2OA 3MMTA 1PYMA 4Q6XA 3RLGA 4NHVA 5CPTA 4BJHA 5IM51 1FWGC 3T9PA 4JHZA 4C90A 4JY8A 2J74A 2V68A 1HP4A 2EG8A 4M6QA 3QH2A 4GUIA 1TYGA 4MMWA 2CW6A 1Z41A 2ALRA 1H1NA 2NT1A 3LERA 3PUEA 4QSHA 3NZPA 3G1HA 4YPJA 1ZLPA 2YLLA 2V3GA 4BKNA 1J10A 2QLYA 3K46A 1ISVA 4XZIA 3DFYA 4JFSA 3DGRA 3GKFA 4U5IA 1LM1A 3H4WA 4JCLA 3LRMA 2NLYA 3QXBA 3CTLA 4XD3A 2CLKA 2DZUA 3SFKA 2QDHA 1K9EA 1UW9A 3N13A 1V0NA 1GOQA 4D9PA 2VZTA 4P5UA 1Q6QA 4JYEA 2R6OA 2CHNA 1I0DA 2BS9A 5LIKX 1GJWA 1PXGA 4AAJA 2CHRA 4C6CA 2PWDA 1R3YA 3PNUA 2GGIA 5CC7A 1IR1A 2ESCA 5HBFA 3UYIA 3RDKA 3NQBA 3O15A 3MUAA 2FH8A 2WMKA 2XH7A 2E5BA 4W8AA 4BI6A 1MXDA 2E8ZA 1ZBVA 3AXMA 1PTAA 1JIBA 5AYYA 5E6ZA 3GTIA 1A0EA 5FF4A 3G5EA 1J96A 2OZ0A 2H9AA 5AHMA 4PH6A 3S2LA 1UJPA 1IHIA 2F6XA 1ONWA 2HTMA 2ODOA 4ZOAA 1TWWA 3CT2A 4QE5A 5EGRA 4MB4A 2PDCA 1PTGA 1WUFA 3OBKA 4PC8A 3VIMA 1XPGA 2Y61A 4WIWA 3RMEA 3BV4A 1MUCA 2XIIA 4O0ZA 5C9RA 4UMCA 2DZWA 1E0UA 3IGUA 1YIXA 5D04C 1TCMA 4KETA 2J7EA 1A3WA 3CQ0A 4LBRA 1E71M 1H3GA 3OVGA 4C7FA 4DXKA 1EO5A 1YQ2A 4ML9A 3P74A 1MQPA 2W27A 5D9NA 2UY5A 3WLJA 3EEGA 3M0VA 4NAEA 4FZIA 4Z2JA 4NAFB 4LANA 1Z89A 5D05A 1CTNA 3M0IA 2PTZA 5AKQA 4X9SA 4JFUA 4IP5A 1KKOA 2I57A 2A21A 3AZTA 1HZYA 1JEZA 4ICNA 3M5XA 3M0JA 1H7OA 3U48A 3W83A 4AWSA 3ABSA 1BF2A 4AZBA 3VOHA 1UMLA 1P0NA 1SVDA 4O10A 1NWRA 2AQWA 4OHQA 1KRCC 1XBVA 1OQFA 1DWAM 5LA0A 1X6NA 4GYPA 7XIMA 2VM8A 4BQ5A 3T4WA 3UT0A 1HL2A 1G67A 1TPB1 4NI8A 1QPOA 1E73M 4MUZA 4PUDA 4U2ZA 5BWFA 4GUHA 1G4EA 5LGZA 3E0VA 1UUMA 3W7OA 3W7LA 4I7UA 1F3XA 2WXDM 2EKCA 1Q2SA 1NP0A 3WNOA 4MM1A 2ZWZA 3DHDA 3HGRA 3F5KA 1XC6A 4UNLA 4XZ9A 2FTWA 3WK0A 1S5NA 2YYUA 5T9BG 2V82A 4F40A 3SCWA 4M7TA 2X16A 3ATZA 3XISA 2G37A 3SSJA 4YCOA 2QMKA 3S1XA 2QVHA 1UR1A 1GQKA 3F4NA 4AC1X 5LIWX 3LI0A 3GKAA 5E93A 5I3IA 4A3HA 5ABFB 3E0LA 4ORMA 4OV4A 2MANA 1WNOA 4IMEA 4MWAD 4XBKA 4CGTA 2ANUA 2PGEA 3H26A 3R43A 3W53A 3ICJA 3KHDA 3OZOA 3KTXA 4RPQA 5C71A 2OEKA 1SR0A 1TELA 1E0XA 2TMDA 1Z44A 2PP3A 1AODA 3EYPA 3G6MA 2DIEA 5FKYA 3B8UA 2DZXA 4HNUA 4UTLA 3CL6A 3B8TA 1P0KA 3B0VC 4LVDA 2O7QA 1MMFA 1P1MA 3D46A 2HWGA 1PTDA 4IM4A 2XN0A 2E77A 1NOUA 1M7JA 1X6LA 4GFSA 3UJ2A 1S5WA 1MO0A 5CLWA 2GUBA 3VM7A 3G0XA 3GYEA 1EC9A 1HVXA 5EBAA 3TH6A 3U7VA 1GVFA 2JKEA 3RRXA 3VABA 4FLQA 4PUKA 1OFEA 4UIOA 2WVVB 1Q45A 3CJPA 3L4WA 1SFSA 2I16A 4GC3A 3WEMA 3NM1A 4QROA 2Y4SA 1XFCA 1W1PA 2YPIA 4HK5A 3P60A 3BJSA 1PV8A 2JFEX 4IX2A 1R30A 1E1CA 4E3VA 3DG7A 1J0JA 2YL9A 5CPSA 5DMLA 2YL5A 2FGBA 3IUIA 1UOKA 1VHNA 3A23A 2A79A 1GONA 2FVKA 3A9IA 4WK9A 3UZ5A 4B3KA 1QNRA 5I5RA 3QMSA 4W8LA 1WXZA 2V9DA 3WLHA 3GXIA 3QPZA 4WGXA 4F2BA 5C0QA 1SW0A 2FZNA 4MPQA 1UCWA 4DZIA 5EMUA 6REQA 1LCOA 4GYFA 4B92A 3HU7A 3GRIA 3O2LA 5A6KA 1ZHAA 2HSAA 2PTWA 3T09A 1UR4A 3W7QA 5F2IA 2E9MA 4DB7A 3SEPA 1G4PA 3SECA 5FEXA 3FKKA 3KVMA 1LL6A 1IT7A 6TIMA 2DSKA 3TE9A 3NOEA 3PJUA 3DH7A 4B4HA 5LKYA 4JQ4A 2QIIA 3N6JA 2XSXA 4H41A 4MJ2A 5GNZA 4F0SA 1BYBA 4AFYA 2OO0A 3S8HA 3ES7A 1QI3A 4IQLA 3STEA 3P2VA 4KF1A 1QAPA 3NVTA 4HU3A 1TREA 3NYDA 3KOXA 2D0HA 4PRWA 3W1PA 3F4WA 3PWIA 1PZ2A 2GSEA 3OYZA 2YBTA 1J2WA 3ES8A 4RDWA 1HJQA 3GDLA 3WIJA 4DF2A 1GK8A 1A3XA 4HPHA 1C7TA 3AS2A 3HPSA 3MI3A 4GYJA 3CTTA 1XD0A 1J11A 3WNLA 1WX0A 5G2WA 4YXGA 1S2UA 3DKLA 3H53A 2BVYA 2J6XA 1H50A 2DV0A 1EOKA 1AA1B 3AU6A 2GUYA 1WE5A 1AG1O 4GKLA 1LYXA 1DJWA 2YCEA 4GQRA 1OZQA 3MDUA 2A3HA 2WVUA 3VA8A 1JJKA 4JTRA 4XQ6A 2B31A 2C1GA 3R58A 1AJZA 4IPJA 4XVDA 2Z1XA 3LK6A 4LBUA 1QW8A 2WC3A 3UETA 5BXSA 3LBMA 3PBMA 3P81A 5D4YA 3T0DA 3CPRA 5A3HA 5DQPA 1OSEA 4KKXA 3IGHX 4KERA 2QUUA 4CQDA 5BXPA 4IP4A 1PWMA 3GE7A 1BWVA 1OM0A 3A4JA 2OYKA 2QHAA 2ZFAA 4GUJA 2GQAA 3W7CA 3U2OA 2B7NA 3TC7A 1OX5A 2WNZA 3TYZA 2D24A 5M17A 4Z1YA 4HA4A 1QTWA 1X1OA 3W7EA 1YTDA 5DN1A 2ZUNA 3KBWA 3OYXA 4HMDA 5HR6A 2NSXA 3GG1A 1ICQA 2PDPA 2VELA 4ZB5A 1R86A 4MFEA 4M5PA 2VX7A 2GSHA 1WDWA 4UTKA 3VNKA 1YHTA 2YCLA 3KP1A 2G4JA 3UJFA 1Z32X 1JD9A 5G4WA 2OO6A 3W73A 1OIFA 1EEXA 2CKRA 1XGDA 4Q8PA 1E0VA 2ON3A 1LOQA 3WQ4A 2X0HA 2J24A 3MHFA 2QV4A 5BROA 1R85A 1H51A 3LHWA 1GYLA 3BG9A 1CB2A 4K8GA 4FF7A 3WK2A 4GYPC 4TVCA 5F1VA 1TVPA 4JY9A 1WBHA 4EIVA 1PUDA 1AVAA 3ZR5A 3KL5A 1O6IA 1TV3A 8CGTA 3LLDA 1VJIA 3DERA 5FD0A 1ZUAX 3DFTA 2WKGA 1J4EA 3FVMA 2EHHA 2AMGA 1K8CA 3PHAA 3QMRA 2G95A 4Q8WA 2AKMA 5REQB 4C7GA 3TYBA 3QQ1A 2Y7FA 3CHEA 3GK0A 3P0XA 2PP1A 5EA9A 3V0UA 4UQBA 4E8CA 2CZEA 1RJRA 2OB3A 1B9ZA 3DEQA 1AMYA 4L1GA 1H7NA 2VJXA 4HNOA 3S5NA 2PP0A 1RALA 1B3VA 3CAQA 1HX0A 2OT1A 4JHMA 3F4VA 3EPMA 2YOCA 4O12A 1F61A 1TJ1A 1EJVC 5IHSA 4YVXA 3BLEA 1LG1A 5FEZA 2BOFX 5DBUA 4WJEA 2YFOA 2VX6A 1RQEA 1LTDA 1DJQA 4MWAC 3PVFA 4HPJA 3EX3A 3LPFA 1CI1A 5MKGA 2WV8A 1K77A 3NO1A 2Z24A 5LXEA 4WEVX 2VEFA 5E5CA 3PSWA 1GVYA 4HJWA 4CNUA 1TRDA 2B7OA 2CEQA 6XIAA 4ZB0A 3AWNA 4EF8A 1W1VA 3RMJA 1M65A 2BFGA 1SUXA 3T1GA 3HQ1A 3LLXA 2D23A 3E0WA 4OWGA 1HKKA 3S1UA 3CNYA 1VBRA 4ACZA 1H0GA 4NRRA 1VEOA 4UR7A 4CNOA 4WHBA 3PR2A 2QW5A 1YLVA 5EY5A 1YMYA 1DXIA 1R3QA 2HK0A 3C52A 1MEIA 2OWWA 4ICMA 2XJ7A 3DFNA 2W67A 4JQ3A 1WZKA 4MNJA 1WAUA 2QGHA 3PPHA 2J4GA 1HO1A 2PD5A 3A21A 5CC6A 1KCKA 2OOGA 1TV7A 1QW7A 5KZMA 2OPJA 1Y5VA 3FLUA 3LHVA 4PFMA 3QLLA 1HTIA 4FR6A 3RO6A 1EQCA 3I65A 4I7VA 2FH6A 5FF3A 2ZUUA 1O4UA 3PJTA 3ANUA 1ZTVA 3CWOX 4IIHA 1A4LA 4ZBCA 3L2LA 3WF3A 3HA1A 4QQUA 3ARZA 3DECA 1UZHA 3W7KA 5A6TC 3TDFA 4PTMA 4WQ6A 1QDSA 4FLOA 3WDHA 3E2QA 2WSRA 4K68A 5REQA 4S3KA 4Y8EA 3N1AA 3TQ0A 4HPXA 2YDQA 2ZDRA 5C2XA 4IGMA 3AS1A 4AW7A 1FWDC 4YS1A 2IXVA 3OO2A 3RF9A 2QCDB 2D2GA 1TUFA 2EGZA 5ABGA 3VILA 1ENUA 4W9TA 4TVUA 2ZYFA 2R1PA 2Z1VA 2D0GA 3ARXA 1MFUA 1WKFA 3HJEA 3W23A 4U3AA 4D1JA 3VDCA 1KCLA 2V81A 3THCA 4B2DA 1P43A 2AGTA 4X0NA 1JZ6A 3OODA 5IBXC 2GVLA 5I24A 2OXNA 2VCBA 3CZKA 2X42A 1T96A 5JH1A 4GVFA 3BSGA 3V35A 5CBIA 5G4EA 2R8WA 3AO0A 3EX1A 1RJQA 3C0QA 1D9EA 3P5YA 1ZU8A 4BCEA 3RLVA 4A6GA 1GQNA 1TV5A 2GSJA 2OEJA 4UTFA 4RE4A 3VMOA 1P1XA 3I68A 1NDZA 3I6RA 5BXRA 3MW7A 4FX6M 3ZVIA 4FS9A 4L1WA 1CLKA 3EOSA 2Y89A 3VU2A 2ADAA 2HNEA 3DHFA 1BVWA 3P3BA 5CXPA 1ZFJA 4JEJA 2YLAA 5FF7A 4JIIX 1ITCA 4L9ZA 1GOKA 1K7XA 1HKMA 3CV2A 7ENLA 2FPYA 1G7VA 5E6YA 4AXNA 2BB0A 4YNGA 1CGTA 4JIHA 3MHGA 1GOWA 4H9ZA 1KO0A 5T9CE 1PO9A 4BI5A 3CL8A 2AOSA 1NWTA 3L4YA 1SGJA 1I9CB 1RBLA 5CZKA 3ATYA 1MXSA 1CLXA 1KBJA 3DN5A 4HQVA 2X1RA 3WQPA 3NXFA 4TO8A 1AD4A 2ZZ4A 3KS6A 1BLIA 3IJQA 2YDAA 1WDPA 3ID7A 3Q58A 5H8PA 3CU2A 4IUOA 5DY2A 1TZ9A 4I8DA 2VNCA 5DT5A 4C6KA 3I7QA 1L0PA 3AXHA 4G7EB 3MBDA 4I3GA 1EA0A 3HQNA 2XVLA 1O5KA 2DGAA 3MZ2A 4LUIA 3C86A 1XLAA 1LJYA 3SZ8A 2QCGA 4TMBA 4C6IA 2WHLA 4D8LA 4H6RA 5M3WA 4AD3A 2IKIA 3I10A 3RAOA 5D8WA 1ZBKA 4N0RA 1XLIA 1QHOA 4JDYA 4OBSA 1QU4A 3WLQA 1QNSA 7CGTA 3E74A 2G5WA 2V5KA 1NOWA 1S2VA 3W1RA 3TYDA 3ZXWA 2WLZA 3HF3A 3DYOA 3USZA 4BS0A 1O94A 3AIQA 4R9OA 4GZ7A 4JTFA 3SJ3A 3NL6A 2V5DA 4KGLA 3LHUA 1ZCOA 1Z69A 3IIXA 1YADA 5DANA 2CLOA 4LOCA 3W87A 1E9YB 5DT7A 4O14A 1F9CA 2XSAA 4XG1A 3RRAA 1TR9A 3IJ6A 1JZ2A 1EIXA 3FAXA 5F4XA 3WQ8A 1HW6A 4F48A 1G9HA 5FSEC 5BXTA 2L5HA 4AH7A 1J18A 4V33A 1IWBA 4MWAA 3F03K 3INPA 5AHNA 4D6DA 3N17A 1RLDA 3G2GA 1UOZA 1BSLA 1Q5MA 4DI8A 3UESA 4ZOBA 5EL1A 1D3CA 4BWLC 4XUGA 4M56A 3NL2A 5D38A 4BF9A 3UJRA 3QV7A 1C9DA 1UD8A 3G3MA 3E49A 2WJFA 3V36A 1S3HA 2ZIDA 4ZFMA 2ZUTA 2PRLA 4XVEA 1R46A 3UG5A 2ASHA 5FJIA 5KETA 2X05A 2XFRA 1MDRA 1VKFA 1EDGA 4PMYA 4FO4A 1WDDA 3KS5A 1J6OA 3M6YA 1UKPA 3MYPA 3U8GA 4M0XA 2POZA 3ARYA 1TR1A 2Z00A 2NX1A 1UB3A 3WD2A 1DWGM 5I2UA 1EUNA 3F4DA 4HTBA 3IIPA 3WLRA 5ENLA 4I9TA 1CCWB 4XZHA 4NJGA 3AIWA 4LGXA 4FAMA 2VRQA 1GTHA 1OFBA 4JTIA 4QCEA 3L4TA 4BEQA 4A3YA 1TE1A 3GY1A 3EDFA 3VOGA 4W89A 5BU6A 2QCLA 3EKGA 3L4XA 4W5UA 1JG9A 4HMCA 1BRLB 2FMNA 3K5XA 3HZ3A 4GOAA 4HU8A 2OELA 3G8RA 4Q8OA 3ZJ7A 3PPFA 4TUFA 4NZ1A 3PM6A 3SY1A 4QS5A 5E09A 1DWFM 3R6IA 4PMRA 5CQ1A 3KVJA 4AMAA 2R1KA 4ACYA 3STGA 4CU7A 1R9ZA 3BVJA 4WR3A 4U3CA 3R10A 1D8WA 3S0CA 3UXDA 1RCQA 1XDJA 1ALDA 1N82A 3W6MA 1RJPA 3BL3A 1F7BA 3AYSA 4GCXA 2G97A 2P0IA 4MY1A 3DUGA 1OEPA 2VEGA 3WQOA 1W32A 4OJYA 3VIPA 4IJCA 5AVHA 4E3TA 5I3GA 5FA5A 2PBGA 3DKJA 2E9LA 1XBYA 4XAFA 5I3JA 3AI0A 3TV8A 2X2YA 4GC4A 4NX5A 2ZXBA 1VCGA 3BE7A 1XCFA 3NAVA 4Y7EA 5HWNA 2X09A 3T0CA 3S9ZA 1KM3A 3SCRA 1MDLA 5K9CA 1KM1A 1AUSL 3TTYA 3PANA 4PMXA 4IPPA 2CLHA 5EMKA 2QR6A 4Q4QA 3T6CA 3S3GA 1QI0A 3WO8A 2Y62A 4I8YA 3PJXA 3P0WA 1V3HA 4K39A 1TJ2A 1W3NA 1XKJA 4R3UA 2WWCA 3ECQA 4F0LA 4DWSA 4GKTA 4CQ8A 5M5DA 2QCHA 3ZJ6A 3M0KA 3G6LA 1DP0A 3KDNA 4QAWA 4A3RA 4F3HA 2ZZ7A 2ZVIA 3TJLA 2ACRA 2VGGA 1W56A 4PBEA 3IEBA 1XIBA 1T8XA 3OQEA 2EG7A 3ABXA 3P62A 4FNRA 4HYWA 2TYSA 4DO4A 4LC8A 1WXJA 4UFHA 4HZ6A 4S3AA 5CJ5A 4XTDA 1O1ZA 1A5SA 4AIBA 1E6SM 1MEHA 1GKQA 3CLMA 4HZ7A 1LWJA 4GXPA 3H2CA 3B0PA 1YTEA 2QUNA 1EX1A 3ONBA 6A3HA 3AIUA 4XZNX 2F6UA 2VFGA 2FIQA 3N9RA 2QAPA 2H9AB 1XYFA 3U2CA 2Q8ZA 4HZMA 2ZA1A 1VD6A 3TMQA 1TA3B 3VO0A 2BVDA 4J27A 5BU9A 3ZIZA 2XIOA 1JPKA 3V75A 1E5JA 5A2CA 3N04A 4MKSA 3A3WA 5IHRA 4S3EA 4TTGA 1JF6A 3EMCA 1HKIA 4IXXA 4GISA 2X2GA 3EB3A 4NUWA 4J3UA 3UFYA 4UBPC 2FFCA 4DM2A 3E6EA 1QPRA 4GY0A 2J8GA 3BAYA 2IKGA 2YB1A 4A8LA 1Q65A 2DP3A 5B7ZA 4QG8A 5G1YA 2Q3OA 3IUHA 3NQ2A 2ZA3A 4S23A 3RCYA 4AVOA 2PWHA 3WH8A 1EBHA 4J35A 5E0FA 3W3OA 3W7PA 4FXJA 2YBVA 1DHKA 5DFAA 4QE4A 4NAFA 3QZ6A 1WQ5A 1ECQA 3S5YA 1W9PA 3VCNA 3NQGA 1NAL1 4HU0A 4L9YA 5HJYA 4OTKA 1AH4A 4P7QA 3GR7A 2HJPA 1F3EA 3SCNA 3KLLA 1VENA 4OVXA 5C54A 1GKPA 1DYSA 4LCRA 4NJKA 2OFJA 2CLMA 3C8NA 1UP2A 3WMBA 5JVLA 4W86A 1FWWA 5HMFA 3HGJA 5M03A 3H70A 4G8TA 3BG3A 3HFYA 4O1FA 3POHA 1WZLA 3AXIA 2CWNA 2Z29A 1HG3A 3OP2A 3TWAA 3AIEA 5HAOA 1A49A 1E3XA 3HMJG 3F1QA 2OOFA 3V1HA 4XZLX 4GI6A 4RPPA 1R7OA 2EPNA 3W1XA 4O1CA 1TMLA 1C9WA 1E3ZA 2C3ZA 2BZNA 5FF0A 4Q4PA 4DZ5A 1TVNA 1YXYA 4AG0A 3S46A 4PL1A 4G1NA 4JGDA 1MVYA 1A0DA 1UJQA 1W0MA 3W29A 4W85A 2R94A 1CXIA 1DXEA 4KBXA 3ITCA 1C90A 5MKGB 1FDZA 4EPEC 1KBLA 4H2CA 1OC5A 3GDKA 4IIGA 4Z2KA 1IT0A 5LNSA 3QKEA 2NV2A 1ICPA 4U28A 3N2BA 1U5VA 3C4UA 1TFVA 1W1B1 1TQJA 1G4TA 3TP4A 5CH9A 4RR4A 5H91A 1FWJC 2FZ8A 4FXRA 1PKLA 5BOOA 1ECEA 1UPPA 5CPNA 1SSGA 5LHFA 3FJ4A 4Z1BA 3PN8A 1F07A 1OT2A 1SR9A 7REQA 3DDMA 3WL0A 1MNZA 1BYDA 3MPGA 1SZRA 2J7CA 4FMVA 4CVWA 1LOLA 5AOUA 2Q02A 4QLLA 1P0EA 1CXEA 1EA9C 4I9AA 4IPIA 3EZ4A 3OVRA 1JFHA 4N9DA 3PZMA 5C2GA 3WUBA 3SCUA 4P7OA 1V3MA 4CN4A 5PTDA 1E51A 2AL1A 1X7IA 2XVPA 1WCGA 4V1XA 4NJIA 3F4CA 2VDHA 1RP8A 3RG6A 2PTYA 5I02A 4IMDA 3DYPA 3C2VA 3BXWA 2NUYA 3ZR6A 5C55A 1XS2A 3H12A 3U4FA 4IMFA 3Q67A 1PBGA 1TJ0A 1EYWA 3TJXA 3AFBA 1DIEA 4ZCWA 4MHBA 3CUFA 3WBXA 1M6JA 2RKXA 1VGAA 2GWNA 3CAKA 3VOJA 1TG7A 5JUVA 3I3DA 3VE7A 2D2OA 2DQWA 2XVKA 3O05A 4NF7A 3TCEA 3E1F1 3W9ZA 3F5LA 1IEWA 4DYJA 1SW3A 1A5MC 3ITGA 2G41A 4HYRA 4MNLA 2J13A 3MANA 2OGJA 3KRSA 1XPYA 1GQLA 1BTCA 3GIQA 3GW0A 1K8ZA 3HGOA 4KFPA 3TVAA 1ADDA 1W8GA 4QR6A 5FIPA 4C1LA 2RGLA 4REQB 1OT1A 3HBLA 1H11A 1VFMA 4LB3A 3U3HA 6REQB 4B2DD 4IWWA 2ZXDA 1AFSA 1O60A 2C14A 3F5JA 3HMCA 2GFTA 4AF0B 1ITUA 2FTYA 2V5LA 1RH9A 5LIYX 3W7DA 4OKDA 3OJGA 5A2BA 1CX9A 3NSMA 4KCVA 3RO8A 1BXCA 3U2EA 1W3LA 3UNTA 2GJXB 3FSTA 5E9AA 3EWBX 1NIUA 3AMKA 4HNTA 2CHOA 4XIAA 4Q6JA 4BF7A 1E72M 1PDYA 3OGRA 4H2HA 5DRCA 3I4EA 1VFSA 4J2MA 3VKAA 4KMQA 3GM8A 4IOTA 2WMFA 3P82A 3PULA 2H3DA 2ZUWA 4AY7A 3SN1A 3DHUA 3WD0A 3L0NA 4PMDA 3T8QA 1EXBA 4H4IA 2NLIA 4RDYA 3A9BA 1FFQA 5JQ9A 4M6PA 4XB3A 4HCLA 1GHRA 2JIWA 3VGHA 2PLJA 3EBVA 5GVJA 3HB9A 2HXUA 2JF6A 3C3UA 3CHCA 4GINA 3URBA 4OOUA 1VPYA 4JZ5A 3ZYZA 3VOIA 3ZVHB 2OSYA 1VCVA 4UNIA 3NGJA 3R13A 5D2WA 1FCBA 2IKJA 5HANA 4IFOA 1TWZA 3PAJA 5LXXA 3V0TA 3MY9A 3UR2A 3GHRA 5H1WA 3SQMA 3LV5A 1YXDA 3PWGA 2Y8KA 4G1KA 1OG6A 1ZNNA 1W5OA 3V5CA 3WEOA 4J3SA 1A5NC 4HMNA 3ITXA 1KXTA 4QP0A 3A24A 5BCAA 2HZGA 4YTSA 1FBAA 1TE6A 2CBJA 3DAQA 1PIFA 4HA1A 1S2WA 2A3EA 3GFZA 1JCJA 3LQGA 4F0MA 1W3HA 3UWUA 2OZ3A 1KBIA 4IIDA 3QY7A 1I75A 3LX9A 3VKJA 3IJIA 1KD0A 1ZAHA 3V3WA 1B4EA 1NY1A 3VI2A 1VC4A 2VR5A 1KC7A 4U31A 4UR9A 4IGHA 2W3ZA 1AJ0A 1AZ1A 3CT7A 3L5AA 4AY1A 4IPLA 3GIYA 1LQAA 4WF7A 4IIBA 4NZ5A 3BGGA 3DENA 2O0TA 4D72A 4GI9A 3L5MA 3ZFHA 2DQXA 4KWWA 3PTKA 2V2DA 1XG4A 3SM0A 5CPMA 5DELA 4D6JA 3GG8A 1NDWA 3LCGA 3GXNA 2Y7DA 2FTPA 2OQHA 3BMWA 4QNEA 5AC6A 5FF2A 5BRPA 2QGYA 3CHFA 1QWGA 4PZVA 5DCDA 1ZAJA 3PUGA 2FYMA 1OG0A 1NDVA 2OTDA 4PTVA 3TQKA 4ZFCA 3B40A 1QO2A 1JRCA 3D0CA 1ONXA 1ODUA 1QK0A 2EJAA 2QV5A 1S1PA 3FDKA 3T2OA 5LGXA 1JPIA 3KRUA 2VEKA 2Y1HA 4NYUA 4C1NA 3W0KA 1GVRA 2WHKA 3MCMA 3FXGA 4XAYA 4K7YA 5E70A 2CLFA 2ZRVA 3SR7A 3M07A 4C6QA 2VFIA 4HNVA 4B5UA 4KT2A 3BJFA 2PBOA 3QSTA 2Y7EA 4MYAA 1HGWA 3VYLA 5HPCA 2GDUA 1JPDX 1JZ8A 1NSJA 2VXNA 4Y9NA 3UG4A 2BGSA 3A13A 3H2EA 3IGSA 3MUCA 4M19A 3WLLA 1TWDA 1MRAA 3DFSA 2QCNA 4EAYA 1CXHA 4JR5A 1LLZA 2GGEA 2V3FA 4MWAE 2DZVA 2XZ9A 1QT1A 4LTSA 1E4NA 2P50A 2QJGA 3CV6A 1R3RA 2C1HA 4TV6A 1TMHA 1WDRA 2HK1A 2PDJA 2X1SA 4UFIA 3ZS4A 2V38A 4O1EA 1KB3A 3U57A 2H8ZA 4DF0A 4EWND 1P7TA 2VENA 1T0OA 2WPBA 2ZX8A 4MVAA 3H7UA 2DW6A 3TA9A 4AZ6A 1NFBA 3VINA 4UFKA 1R38A 3VIJA 2OZTA 2O55A 4NZ3A 2O56A 4DO5A 4J28A 1BRLA 4LF2A 3LM7A 4AB4A 3UGVA 3N9KA 3W7NA 4PMQA 2VC5A 5A6JA 1KM6A 1W54A 3SBFA 3TW6A 3WLIA 1WZAA 3CQKA 1FP9A 2W61A 2ZRZA 3B9OA 1HJSA 5AHEA 1JI2A 3QYQA 2WJZA 3WLKX 2C8NA 4DUOA 3W2KA 4C6EA 3W7JA 3W2LA 5L9FA 3BSMA 5LZLA 4R88A 4UCGA 1EJRC 2P1FA 1ODZA 1CW2A 3HG2A 5U7SA 3E0IA 5DCBA 5EMYA 3UR5A 3LOTA 2P3ZA 5BRBA 2VDGA 4JX5A 3TJIA 1GW9A 1EHAA 1O5XA 2PWEA 2BOEX 3FVDA 1EC8A 3JZEA 3E38A 3KE0A 3RILA 3W26A 2ISVA 3LMZA 4FR1A 4MLRA 2BSLA 4LC6A 3H23A 1G94A 3AUJA 1UWQA 3LA4A 4ZEPA 3MWAA 4C6PA 5D2XA 2UWFA 3FYYA 1JPHA 1HKVA 1YPIA 4UTJA 2QNEA 3VGFA 3WJXA 4EE9A 4GHRA 4PTWA 3SUTA 1XQKA 4RNIA 4QJ4B 4L4MA 3EWUA 3KUMA 3GTNA 1E4LA 5M2FX 4JYDA 3WDJA 5HA7A 3NM3A 4RDVA 1VFTA 2V5CA 1YNPA 3UPBA 4OE7A 1ZJHA 3S42A 4X61A 4PCPA 2QMJA 4MZ1A 3FFSA 3P80A 4L64A 1TKKA 3G1XA 4PUWA 1R2SA 3W1NA 1B90A 3UF9A 4AQLA 4WSHA 4XAGA 2EQDA 3BANA 4AC7C 3EDKA 1Q4WA 1TX0A 4J3XA 4AZ7A 3EOUA 5FEPA 3F2CA 3R25A 4XK2A 4DZAA 1UD2A 3LSBA 4FOKA 4ORIA 3RM8A 2NQLA 3F2BA 3GH4A 2C18A 2VI0A 3FV9A 4ZSUA 1G7UA 5AYXA 4L4PA 3RU6A 1G5AA 3EB2A 1R7AA 3W7HA 4FIRA 3CZ8A 4OFCA 2HVMA 2EG6A 3OTRA 1XLGA 4AHQA 2HS6A 4XAZA 3S5ZA 2Q8LA 5I6SA 3QHOA 4JIEA 4QDMA 2WKJA 5CZSA 3LCWA 1P0BA 2WJEA 2Z4GA 4IL2A 2J66A 1NFGA 1RBOB 3GUWA 2VRJA 4QRNA 3C2EA 3PF3A 5FJOA 3PZIA 3G1RA 5D9MA 5ABFA 3FDGA 4LUTA 4R7WA 1TWIA 1RCOB 3NJ3A 3CC1A 3VCRA 4AHOA 1KM0A 3HV9A 4O17A 4KWSA 4ZO9A 1LP6A 3L7RA 3TU9A 3NYZA 3WH6A 3ZWTA 4WSJA 3ANVA 1EDTA 1U83A 1PKMA 1MFVA 1ZBCA 3AQUA 4XSLA 3MSRA 4Y2WA 1ZB5A 4H83A 2NXIA 1GGOA 4BWLA 2WLYA 5B80A 3TZFA 1VJSA 3BARA 3C2FA 4GVIA 3NPVA 3L2MA 2HRWA 2I7GA 2J78A 3T4CA 2NXHA 1XLHA 2W4XA 1TV4A 3N4EA 2DUAA 3MUY1 3TC6A 1PZ0A 2YL8A 1XCXA 4M6UA 1QFEA 4IMGA 4UTWC 2ZZ3A 3NURA 3EX6A 4G7EA 1NQKA 4DX3A 1EO7A 4O8AA 1KRBC 2PLKA 3UD6A 1DPMA 3DBPA 4M3PA 2PB1A 3QQ0A 1GTEA 1RZMA 4BEUA 5HK4A 3KWXA 4ROQA 4WKHA 3PB0A 4JTKA 3G3DA 1W2VA 1FDJA 3GXFA 5FCZA 4M81A 1XI3A 4Y6GA 1JCTA 1OFOA 4EKJA 3NQFA 2VD8A 1XLLA 1TIWA 1IZJA 3R2GA 3WQFA 2FHFA 3TFXA 3TQPA 3WD1A 3G0UA 2C79A 1BG4A 3BURA 1HKJA 3VFLA 2OLHA 3LM3A 4JIPA 2D2JA 4KCTA 3W7MA 5H2ZA 4BQ4A 2DUXA 5AHFA 3BK0A 1W3KA 3ZLFA 4QBXA 3J7HA 4Z1CA 1KFWA 9XIAA 1XYBA 5BOEA 1BGGA 3BUVA 3QFEA 3D5HA 3OZMA 4O4VA 1GYNA 2OODA 4WVXA 3P61A 1VFLA 2I5IA 4FSAA 3VMNA 4OZOA 5ECUA 2WKLA 1HJVA 3K2GA 2Z7GA