3UWQA

1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
229
structure length
222
Chain Sequence
NDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPARRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP)
rcsb
source organism Vibrio cholerae
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 77
structure length 222
sequence length 229
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3uwqA00
1CW2A 4O28A 4NUWA 1LBFA 3PUEA 2LLEA 5FEWA 1ZHAA 2WSYA 3HPZA 3TR2A 4DELA 5D38A 4TO8A 4EWND 2R8WA 3GDKA 2QCDA 3P8IA 3UZ5A 4FNRA 1R46A 2V82A 4NQ1A 2A7RA 4OWGA 4XZ9A 5GVJA 3HG3A 4OQVA 3NNTA 3LRLA 4O52A 4IPJA 3MO7A 3UPBA 1H60A 4JTJA 3BG9A 2V2DA 1J2WA 5D30A 3BLEA 4ZVJA 3VE9A 3ABOA 4UFJA 3W2JA 4WX2A 2WQPA 3E12A 4JGDA 5I3IA 4BI6A 4O14A 4P2VA 3R5EA 4LOCA 4WZHA 1EP3A 3W07A 1JJKA 3W1NA 1JCJA 3YPIA 5CSSA 1EPXA 3MYOA 3WK1A 3M5YA 1T8XA 2YX0A 3CEPA 4UTTC 2E5CA 3KVMA 4UC5A 4C1KA 3QJAA 4FO4A 2CZFA 4RK8A 1W5NA 3LOTA 3LCLA 1B4EA 3NPXA 3LBCA 2JKPA 4JDBA 4RX0A 2H90A 3W1QA 1SW0A 1ALDA 5J5DA 4UCGA 1O4UA 5KTLA 1SO3A 1RZMA 4ML9A 4JTFA 1TPVA 1THFD 2QAPA 3GDMA 5F2GA 2YYUA 4H4IA 3G0SA 2VEKA 3P62A 5G5IA 3GLCA 3TA6A 3O63A 3ELFA 2NXIA 5F1UA 5K9XA 5I3KA 2Q8ZA 1FQ0A 1JCYA 4XBKA 1O94A 2A4AA 1XDMA 4LNYA 3LTSA 4NNCA 3FS2A 5AC8A 4M6QA 3SGZA 4LV4A 1XFBA 5CPLA 3JRKA 1KLYA 1OFAA 3B04A 4UTTA 1HO1A 3LHTA 2I9EA 1TIMA 3BO9A 3TQKA 3HQ1A 4O19A 2OJPA 1MO0A 5HQEA 4MLJA 1GEQA 2OZ0A 4JX5A 1S5VA 3DU0A 2JGQA 2BLEA 5D04C 1PIIA 2ZZ1A 3M1ZA 1LROA 1TREA 4W9TA 4MVAA 4UUIA 5EL1A 4FIQA 2WNQA 3O8AA 3PR2A 4N4QA 3DBPA 4Z1AA 3MHGA 3U8GA 4RKAA 3LCIA 3EX6A 1PHQA 1KM4A 4LVDA 5DN1A 4IMEA 1G4PA 3W3OA 1CX9A 3HGJA 3UZJA 3LERA 4I7VA 2IQTA 3SGUA 4IXHA 1OFPA 3OHIA 4N9CA 3S9YA 1TSIA 4WQ6A 3S5ZA 3MP3A 5DBTA 5KSWA 3JS3A 3MUXA 4U28A 2DZSA 4RLIA 4QSHA 4CCDA 1ML1A 5D2XA 5FEXA 4JN6A 5HNRA 1P1XA 2CZEA 1RVGA 1FCVA 2CLMA 2VEIA 4RR4A 4UTUA 4DPPA 4IXXA 3E49A 2P10A 3M7WA 2VOMA 4UFKA 2J9XA 2YR1A 3KVLA 2E6DA 1ZCOA 4TX9A 3C8FA 1TV5A 2GJNA 2Y7GA 1ZY9A 4ORMA 3CU2A 4WJEA 1F5ZA 3G1SA 3L67A 1TQJA 1JUKA 1FWNA 4Q33A 3E96A 3P5ZA 5D2VA 3EX3A 3L9CA 3O6CA 3GB6A 2V5BA 4ZQNA 1T96A 1HUVA 3CHVA 2YW3A 3R2GA 3LV6A 5LGZA 1SZEA 1HG3A 3KVKA 3GDTA 3HBLA 4O50A 4QNEA 4YLWA 1GZGA 3W7EA 2NV1A 1WV2A 4X2RA 3SR7A 1XUZA 3TQVA 1GVQA 3THQA 2QJGA 1GOXA 2FFCA 5E1QA 5BMXA 1K8ZA 4UTKA 2C14A 1X7FA 3PG8A 3TDFA 1O5KA 3TROA 5C2XA 2J88A 1HTIA 5F1VA 2A21A 3UWZA 1KV5A 4KWVA 3AJXA 3P81A 2E6AA 3S1WA 3NL6A 2OCZA 3B0VC 3TU9A 1YYAA 3I7RA 3TKFA 2VKZG 2CLIA 3GAKA 3S5OA 4DF1A 1QO5A 2R94A 4J9JA 1U5JA 4H3DA 1ZJIA 4IMCA 4LVBA 1QDSA 2G97A 4NXSA 1K8XA 3NR0A 4LW7A 2AQWA 5FF3A 3W1PA 1W31A 3NO5A 3QSRA 1JVNA 3A5FA 1P5BA 3SI9A 3LRMA 4Z1CA 5L9FA 3KX6A 1FWWA 4O8RA 5D37A 2ZYFA 3L0GA 4Q32A 4GXMA 4UR8A 1I4NA 1W56A 1W8SA 4RZ5A 4RZ6A 1TV7A 2NZLA 3F4NA 3L66A 4A21A 3GYEA 4BWLC 4MUZA 3TCEA 3BGJA 3N14A 1EUNA 4FNPA 3IRDA 3QH2A 4GNJA 1EUAA 1W3TA 2NLIA 5LKYA 3KRZA 3L0KA 2W79A 3O15A 3S1XA 3WFAA 2Z6JA 3K30A 3QEZA 4LS1A 4LS0A 2DZWA 2OX1A 5EKYA 1VQTA 1Q6OA 2CLEA 1VYPX 3NEVA 3GXPA 1TJRA 3ZWTA 1H51A 4E2BA 4AF0A 2DZPA 4CQAA 1EWEA 1NEYA 1F6KA 2ATSA 5LZLA 3BV4A 3LHYA 5AHLA 1H7OA 3H55A 5G1YA 1XDLA 4XUGA 1SO4A 3NQ6A 3BLIA 4HSNA 1G4TA 1GTEA 1V5XA 1YXYA 3P80A 5AHNA 1EA0A 1TTJA 1G67A 4PCFA 1IXNA 2P0OA 4UTWA 2WNNA 3LHZA 2QR6A 2Z6IA 1M6JA 5CZ0A 3LRKA 1LOQA 4O16A 1OFQA 4AB4A 2QAFA 2XFWA 3NDOA 4K8HA 4Z0JA 4TR9A 4NJKA 1LYXA 4MJMA 3STFA 2QCNA 1TPC1 2QCMA 5DELA 1GG0A 2B7PA 2C13A 1W3NA 1I2OA 1RQBA 2AAMA 1FWRA 1JQXA 3FIGA 4GRSA 1TPFA 1SZNA 3O05A 2X1SA 2QCDB 1SW7A 4O18A 4O13A 3NQEA 1K7EA 3HGRA 1OHLA 1JUBA 3N73A 3LCFA 4Y90A 5K9DA 3QF0A 4K8EA 4MY8A 2DU2A 5AB3A 1KBIA 1R2SA 3GXNA 3GR8A 2DP3A 3FOKA 1PL9A 3C61A 3LDVA 4UR7A 3W1MA 4O1AA 3V75A 1I2NA 3W6YA 2QJIA 2BZNA 4E0CA 5LNVA 2G5WA 2Y7DA 3ABQA 3TX9A 5HWJA 4HSOA 2FJKA 2ZRWA 3W1TA 3W7RA 2DZUA 3B0UX 1X1OA 4ZMGA 2BSLA 5KZMA 4U4MA 3FKKA 5DCBA 2C1HA 2YFOA 3LCWA 2CW6A 3Q58A 4UNKA 1TPH1 4GUJA 4ZQCA 2A0NA 4FX6M 1XI3A 3NOEA 2X1TA 3ZS4A 3PULA 3R13A 2B7QA 3A24A 5HUOA 4AAJA 1FUYA 4OV4A 3LHWA 3HO8A 4N02A 4R34A 2ZTKA 1H7RA 2CLLA 2A5HA 3W76A 3BG5A 5D09A 3LV5A 3W71A 1F05A 3GKAA 5BNKA 3BW4A 1EB3A 1X6UA 7TIMA 3NAVA 3B8DA 3G1YA 4IQLA 3DFNA 1K7FA 3TAOA 5SWUA 1QAPA 3NL3A 4O54A 2X1RA 4EIVA 3PUDA 3JR2A 3MYPA 1SO5A 3GX9A 3R89A 4UMAA 3SY5A 1YDOA 2XN0A 5CPOA 1FDZA 4MJZA 1QOPA 4DF0A 4Y6GA 1UB3A 2Y85A 3A5VA 4UFIA 2NX3A 4NZFA 3NA8A 2A85A 2EPHA 5J5RA 4JTEA 3GIYA 1WOBA 1LBLA 1KFBA 4IPIA 2ZRYA 3Q94A 3B05A 3MHUA 1TTIA 1IXOA 1QPRA 2YGYA 4NU7A 3EWYA 1AMKA 1KM3A 1UBSA 3F4WA 2V5LA 1TRDA 3W2NA 3CT7A 5TBOA 3TJXA 5FESA 5I3HA 4FNSA 2Q3RA 3PBYA 2GUUA 3PBUA 1W5QA 3MI2A 1FDYA 2DZXA 3O16A 4WXYA 3W7CA 2VFDA 3QMTA 4ADUA 1KM2A 3BW2A 3NQ7A 4UNLA 3VNDA 1N7KA 1XM3A 3IGSA 4XBSA 2ABBA 5BW6A 3KFTA 2ZZ7A 1OFOA 1QFEA 4GBUA 3SIZA 1W3IA 5F4XA 4DBDA 2C6QA 4MY1A 3PB2A 3W87A 4N9BA 1JRCA 1YXDA 1AW2A 3OEXA 2W6RA 3NQVA 3WJYA 4DEFA 3GR7A 3GKFA 2E68A 2X1UA 2QKFA 1Q6QA 3FYPA 1GYLA 5HMSA 1WA3A 4UMBA 2Y7FA 2GJLA 3QFEA 4GUFA 4DF2A 3TFCA 3W2LA 1AG1O 5L6UA 3PG9A 3W83A 2WSRA 1GPWA 3SW6A 1IF2A 3C0JA 1X8FA 2ZRUA 1GVOA 3IVUA 4EOUA 3T78A 2O7QA 1FWTA 1AW1A 1W37A 4FHAA 3IIPA 4JTKA 3S1VA 5TQLA 2G95A 4PL1A 1FCUA 5LNWA 1C9DA 2HSAA 1LDCA 3HG5A 4XKYB 3S42A 2VC6A 1H5YA 2QEZA 5K7JA 1OK6A 2VFEA 1JR1A 1RPXA 1N55A 5K2ZA 2FPVA 5FF7A 1IIGA 4EF9A 1DQWA 1EX5A 1ONRA 1Z48A 5KINA 1K3UA 3G8EA 4NJJA 3F1QA 3CIXA 4K6AA 3W22A 4L4MA 4UIOA 4UTIA 1A5SA 5DXXA 1RQEA 3EXRA 1LTDA 2RKXA 2E6YA 4WY0A 4JTSA 3EXSA 1QMLA 1K02A 5AHMA 1S3HA 1IXQA 3N3MA 3HPSA 2NWSA 1QCWA 3L68A 4CCCA 4JYEA 1CI1A 3MW7A 2NUWA 3S1UA 4LUIA 1DJNA 1KM0A 4TMBA 4M7SA 3S6DA 3G1XA 1GTHA 3OIXA 3MMTA 1G4EA 3M41A 3F03K 1OABA 2JKEA 4UTWC 5KZEA 1B9BA 2FPTA 1VCFA 3IVTA 1HL2A 3G1HA 4S2CA 4N2YA 1Z44A 2QDGA 5CG7A 3R8RA 3UQNA 2P1FA 1GVFA 1S5WA 5C55A 3CPRA 1B57A 3DI1A 2Y6ZA 4IWWA 5G2HA 3OBKA 3RK8A 1OYBA 1TPB1 3QC3A 3LLFA 1KW1A 1Z42A 2V30A 5F2LA 3T7VA 3TC6A 1P0NA 3S5YA 3FYOA 3C2OA 5K4XA 3TMQA 3CIWA 3QZEA 3DENA 1F6PA 3N9RA 4XTIA 2BX7A 1OF8A 1SSDA 4UMCA 1YPFA 1VYRA 2TMDA 4GJ1A 2DJXA 4JTIA 1VHNA 2CFFA 3W75A 4O1DA 3CWOX 4OGZA 3USBA 4LS2A 4HKPA 3LHUA 1KA9F 3NXFA 2ZZ4A 3AO0A 5C6MA 4A3UA 5LHEA 3P84A 1DL3A 3MP4A 1H7WA 5F4SA 3TSBA 2A2IA 3EWXA 3P61A 1AW5A 1SU5A 3MI3A 1FXPA 1SFJA 3W9ZA 3L21A 5AYXA 1JUEA 4LT9A 5CSRA 3B4UA 1GT8A 3CLMA 3ANYA 3C2VA 4IGHA 4O4WA 1WBHA 4FF7A 3Q2DA 3QMRA 3L2IA 3W1UA 3UPWA 3TXVA 1WQ5A 1E51A 8TIMA 1FCQA 2E77A 3NQMA 4O1CA 5IBXA 4O1BA 4JX4A 3WK0A 2C0AA 1DBTA 4YCOA 1SZGA 3M0ZA 1I45A 1UUOA 4A2SA 2UV8G 4MYAA 3IVSA 1ZNNA 2V0TA 4UFHA 4OV9A 1K03A 2PURA 4AH7A 3W7MA 2VFFA 4UTMA 3G1FA 3PF3A 1WYIA 3QRHA 5D03A 2RDUA 3H53A 2B7OA 1W5MA 2YFNA 1NSJA 1Q45A 4H6KA 3TV8A 5CGQA 3MWAA 3PAJA 4NJHA 3STEA 3LTYA 2ZTJA 5FI8A 1JQVA 2QCEA 3KOFA 1IGSA 4N6FA 4DBEA 1QNVA 3VI2A 3MP5A 1D9EA 2A1YA 4LVGA 4ZQMA 4EF8A 2NUYA 3HJZA 5DBUA 1VHCA 5CZTA 4NNBA 1VGAA 3BW3A 4P61A 3LX9A 2VEMA 1M7PA 4IX2A 4MLRA 4MPQA 1VRDA 1VJIA 3U6WA 1TPUA 4AHPA 1MEWA 3LXAA 2RHGA 2E5DA 3DGRA 3HPXA 4DQWA 5DLCA 4UTLA 1OX4B 1LP6A 3P82A 4AMAA 1PE1A 2QJHA 2ZZ2A 1G7UA 1J5TA 1LBMA 4HNNA 4NT0A 3G1DA 1VCGA 2EGZA 4ZQRA 3W7IA 4PEKA 1SQ7A 1WBJA 4E38A 3QSTA 1W5PA 4PH6A 5KMYA 3W7NA 1G6CA 4ICNA 3SFKA 3SJ3A 3N19B 4O11A 3W7PA 1MZHA 3INPA 3W7HA 4ZL1A 1L6YA 3C3NA 2QCCA 3UWYA 1VCVA 3I6RA 1U83A 3QPYA 1LRNA 5D32A 4A2RA 2YPIA 1SSGA 1JULA 3T40A 5F4WA 2WSQA 3LBMA 5D2YA 4YMZA 4AHQA 3HGOA 3ZFHA 4O17A 3DAQA 5I3JA 4JR5A 2QCHA 4JNMA 4YWIA 4N9EA 1W0MA 1ZAJA 2X16A 4G1KA 3NZ1A 1P0KA 3G24A 2Q8LA 1T99A 1V7YA 2FLIA 5F2IA 2YW4A 2CLFA 2WKJA 1FDJA 5DCEA 4FIRA 5C54A 1H7NA 5K9CA 4PC8A 2FIQA 4O53A 3G8RA 4JTTA 4YCPA 1LLZA 1ICSA 5D2TA 1GVSA 3N2XA 1D3HA 3M5ZA 4NJGA 2GVJA 4FB7A 3UWUA 2DJLA 1ZAHA 3UWVA 3UXAA 1R47A 3W7QA 3BGGA 3RLVA 3QW3A 3PS7A 1OX4A 1KV8A 2WO5A 1W54A 4FNUA 3RLUA 2FTPA 1JRBA 1WDWA 3P5YA 3LTPA 4CNOA 4BI5A 3IGXA 2EF9A 3W7LA 2H6RA 3BVJA 5ABTA 1H1ZA 2A6NA 1EEPA 1DOSA 4I7UA 3PB0A 4JDYA 2Y70A 1BWLA 1KLZA 3NQ8A 4NJIA 1YTKA 4AWTA 1HO4A 4NNAA 4FNQA 3P74A 4LV9A 1F76A 2E1DA 5BMWA 4JTUA 3OA3A 2FB2A 1YLVA 3HB9A 3DI0A 4LRTA 3N2MA 5DXYA 3QMSA 1XL9A 5HWNA 3ABRA 4GWEA 4KFPA 1GQNA 5E0KA 2OMAA 1YDVA 2J27A 5C5YA 3CEUA 1H63A 5HUPA 3G3DA 1XKYA 1OK4A 3IEBA 1SO6A 3W7GA 3UNDA 3HG2A 4IMDA 4YXGA 5CZJA 3KAOA 3QW4B 3W2MA 2Y89A 4KKXA 2B0MA 4C1LA 4KFNA 3PC0A 4KWWA 3C2FA 2VELA 1A50A 2A6LA 2VFGA 4OE7A 4RCXA 4RV8A 3FJ6A 1O5XA 1OYCA 2AGKA 6TIMA 4CNNA 2V2HA 3TMLA 2CU0A 1TPEA 2TYSA 2FQIA 4HHPA 3PUOA 3LB0A 2NWRA 3W72A 3W73A 4HN4A 4M6PA 3MBFA 1H1YA 4MZYA 3EB2A 3TH6A 4O57A 5AHFA 5I3FA 1EP2A 5CPNA 4LRSA 1NF0A 4GFSA 2FDSA 2I1OA 3SSJA 5HWMA 4JX6A 2QUUA 2J24A 1ICPA 5HULA 4M7TA 4LC8A 5CZSA 4JYDA 4IOTA 3MI6A 4OBTA 1TCDA 2ZCGA 1I2RA 3KRSA 1I8JA 1W1ZA 3OG3A 4CLMA 1VH7A 5G2IA 3VFLA 1GVRA 3M5VA 3E02A 4JYFA 1DQXA 4HNTA 4K7YA 3DFPA 4MZ1A 5FEZA 4UFMA 3O6DA 3TFXA 4WXZA 2YDAA 4NX0A 1FX6A 4YL2A 4JY8A 3TSMA 1GWJA 1DVJA 3G0XA 5KITA 1A5AA 1H7XA 3G18A 3C56A 5LHFA 1DV7A 2PC4A 3LCHA 1EP1A 2B4GA 4FXSA 4DO4A 2YZRA 3LXBA 3M9YA 3HIJA 2C19A 1UASA 2GOUA 3GNDA 2C18A 2VEPA 2CLKA 2Y7EA 4QQ3A 5AC6A 5AHEA 3TUUA 3PSVA 1QOQA 1F2JA 2R14A 4AHOA 3DXIA 3IIVA 5LNRA 3LLDA 3W1LA 4Z1DA 1OX6A 2Z0IA 3CC1A 1A53A 1P4CA 1IXPA 4O10A 3QQ0A 4O4VA 2GPTA 4NXKA 3RFAA 5I3GA 4Q4KA 2WNZA 1VPXA 4QIUA 1SPQA 5IM51 4BR1A 2RDTA 2HS6A 2QCFA 3NM3A 4B5NA 4RZ4A 4IUOA 2F7FA 2BXVA 1TV8A 5FF0A 1SFLA 1YADA 2J9YA 4AXKA 3DFSA 2BTMA 2HS8A 5G2WA 2JKAA 1KTBA 4MZ8A 1LLWA 3PWAA 2PCQA 5K3VA 4HPJA 2Z2UA 3BPWA 4WY0F 1G69A 5EA9A 3DFOA 4NVTA 1FXQA 5D02A 2NXHA 1H7PA 1KTCA 2ZRZA 3WK3A 2O7SA 4RXFA 1PHWA 3NQGA 1QR7A 4R53A 1HFBA 3NQAA 3L0NA 3Q37A 1LRQA 3EKZA 4MOZA 2ZA2A 3BG3A 4LVAA 1EWDA 1DJQA 3NG3A 2Y63A 1OX5A 1SR9A 1SZFA 2B7NA 1FY6A 4FX8A 4GC4A 3NYZA 2DZTA 1Q3NA 5LNSA 4Z0SA 3WJXA 3EWUA 4UXDA 3W7DA 5HR7A 5EBUA 2NXGA 2YYTA 1TTPA 2PRMA 1KM1A 4WUIA 1G4SA 4D2JA 2GQAA 3BK0A 4HIBA 4JTLA 3W74A 1IIHA 1YDNA 3CTLA 4X9SA 5FF2A 4MFDA 4MFEA 1XBYA 1BTMA 4LC6A 2QDHA 1ZENA 3RNDA 4FEZA 1NFBA 1TQXA 4TIMA 1OJXA 1K8YA 1ME9A 1XBVA 4BWLA 3OVPA 1M7OA 5AFDA 3LXCA 4MIMA 1O60A 1PVNA 1AL7A 3L5AA 4M5PA 3SZ8A 1WOAA 3M44A 5CKSA 3D0CA 2Y88A 3W85A 4Z1BA 3OVRA 5E93A 3M47A 3TAKA 2TPSA 3RF9A 5LNUA 1OFBA 3RMJA 1KBJA 5A5WA 3W88A 3QPZA 5FEPA 3GK0A 1WX0A 1OFDA 1J4EA 1LM1A 3GZ3A 4JIQA 2KZHA 3W1AA 1ZFJA 3W70A 3BARA 4MY9A 4S1FA 4IJBA 3IV3A 3W84A 1G7VA 4LUJA 4Y96A 3A22A 4HPXA 3G1VA 4CQ8A 3PSWA 4K38A 3W7JA 2A7PA 3DKLA 2Y61A 1YTDA 1TPWA 2E5BA 2QCLA 4JIPA 1PCKA 5AC7A 1WXJA 2XN1A 1ICQA 4GUHA 4KFOA 3EEGA 3IIOA 3G22A 3NQ2A 4RXGA 4LU0A 1MEHA 1TB3A 3NPWA 2DZVA 1Q6RA 1YTEA 3EWBX 3FEMA 3T4CA 4JTGA 3S8HA 3C6CA 1Y0EA 1AK5A 1L2UA 3UD6A 1MSSA 2E09A 3CQ0A 4R7JA 2YCEA 4PA8A 1H50A 3TIMA 3W7OA 2OT0A 2GVGA 4UTJA 1M5WA 4BI7A 1VYSX 1BEUA 3DKJA 3IIXA 1KM5A 4S2BA 4LY8A 1DHPA 3LHVA 2RH9A 2Z1BA 4JICA 1LOLA 4WOZA 1UCWA 1XCFA 4XQ6A 3W2UA 1GG1A 1S5TA 2I14A 3P60A 1VLWA 3PVFA 1B4KA 3NVTA 3NM1A 3STCA 4IMFA 5EPDA 4JTHA 2X2GA 3UY8A 4O15A 3GDRA 5AHIA 4TU1A 4ZQOA 3W7KA 3L5LA 3O06A 4I9AA 4M19A 2F84A 3QQ1A 3P8JA 1KTNA 3ABSA 4LTSA 4QAIA 3P67A 4ADSA 1W5OA 3TXZA 3I68A 1C8VA 4DO5A 2TRSA 3HF3A 1OG0A 4XWUA 5IBXC 3DHFA 3UXDA 4HNVA 3LGEA 4JXCA 3GNNA 3B06A 1JCMP 2H3BA 1L6WA 1YPIA 2G96A 5D33A 2VXNA 4ALDA 4WD0A 3FA5A 3LM7A 1T0OA 4IMGA 4AVFA 1RR2A 1ZAIA 1SW3A 3TNOA 1EIXA 3G3MA 4MYXA 3L5MA 3UYCA 5H91A 4X22A 1QO2A 3A23A 5HR6A 2HMCA 5TIMA 1B3OA 3NQFA 5HINA 3O1NA 3FLUA 2X30A 4FNTA 1X1ZA 4GE8A 2NUXA 2EHHA 3MJYA 1KFJA 4N9DA 3KHJA 3STGA 3TW7A 2ZDRA 2YSWA 3IIZA 1LOSA 1JCLA 3N9SA 1ZALA 3QM3A 2GQ8A 1OFEA 1XC4A 1KFKA 1L9WA 4GUIA 2ZZ3A 1VLIA 1TTQA 4ZZ9A 1H61A 3ZWSA 5A8GA 2NX1A 5DY2A 3LCXA 1I2QA 3I7SA 3LI0A 4POCA 1D3GA 3OVQA 3SECA 2C15A 3B03A 2WPBA 1F7BA 3P7YA 3RU6A 1UUMA 5G4WA 4FX7A 3TQ0A 1Q6LA 4QM1A 5KZDA 1OFRA 2CLHA 2H8XA 3UWQA 3PY2A 4CNPA 3I65A 1VS1A 4AF0B 4DO6A 2ISWA 2ZQ0A 5FF4A 4DXVA 3LI1A 2ATMA 3EWWA 4Y8FA 3T44A 4HNUA 3MBDA 3R12A 4OHQA 1LRTA 3T55A 2VFHA 2W0UA 2V9DA 5DY3A 4HT3A 3WJWA 2R91A 2QUTA 1QWGA 4LVFA 1MEIA 4PTNA 2QCGA 1RQHA 1H62A 1PS9A 2FB3A 4L4LA 1NVMA 4WY0B 3W23A 4CCEA 2WOQA 2ZRXA 2TSYA 2EKCA 3DH7A 1A5CA 1C29A 2ZRVA 3FKRA 1OYAA 4E2DA 3TSDA 3W2KA 5EYWA 2WV8A 4BFAA 1R2RA 2Y62A 4N6EA 3ATZA 2ZZ5A 1RD5A 3U2OA 3MHFA 4RJEA 1QPOA 3BLFA 2E6FA 3C2EA 2ABAA 4QNWA 5BOOA 1GJPA 1NF7A 2QUVA 1L6SA 2OT1A 2CWNA 3TE9A 3WK2A 5BRBA 1BWKA 5EY5A 5EMUA 2GQ9A 1ADOA 1RV8A 4XKYA 1KFCA 4BK9A 4A22A 2EAWA 3EX4A 4BF9A 1GYNA 2C16A 1DORA 3NZRA 4JS3A 3TJLA 3IGUA 4CQ9A 1SUXA 4WOQA 5F2MA 3M5XA 2WJZA 3NQDA 1PV8A 2XN2A 1XBXA 3CWNA 4JD4A 2ZA1A 5MHBA 3W1XA 4R33A 1VC4A 4K39A 4K36A 3DZ1A 2JK2A 4FXRA 2CZ5A 3C2RA 3VCRA 6ALDA 4EVZA 3HMJG 1F73A 4UTHA 5U7SA 2DORA 1F74A 1FBAA 1JCXA 3HGSA 3NQCA 4OT7A 5G1TA 1OF6A 1TMHA 3H54A 1FWSA 4QJ1A 4AEOA 3EX2A 2H3DA 3B0PA 3NL5A 3E0IA 1UJPA 2D73A 4ZQPA 2NV2A 1TRIA 2H8ZA 2ZZ6A 3GVGA 1TPDA 3UWWA 4NX5A 1KFLA 1JCNA 1K7XA 2RFGA 2YXGA 3HOJA 4QITA 3QYQA 3M16A 3G0UA 3ZR4A 3ATYA 2CZDA 5H2ZA 2PRHA 5LGXA 1FCBA 4O0KA 3THAA 1DKWA 3C52A 3M6YA 5LSMA 2ISSA 3PBWA 3DFTA 4I7WA 4M6VA 5AN7A 1LZOA 1XXXA 2J6XA 3WJZA 3TW6A 3KXQA 3V1PA 3CM4A 3CB8A 3DFQA 2HTMA 2RDWA 2V2CA 2ISVA 1TJPA 3GDLA 2ALDA 4PODA 3L65A 1XBZA 1VZWA 1QPNA 3UY7A 4JY9A 3TC7A 3EKLA 3W1RA 1Z41A 3E9AA 3VE7A 4GUGA 3GXTA 4Y9AA 1AL8A 3GAYA 1VR6A 3A9IA 3WJSA 1PCWA 5AOUA 1QPQA 4A29A 1LORA 4X3ZA 4XTDA 1OVDA 3O07A 1ME8A 3DHDA 4QISA 5AYZA 2BWGA 5D05A 2V8ZA 1O95A 2PRLA 5D2WA 3S0CA 4LWWA 4AWUA 1TYGA 3S5NA 1XUUA 3LCGA 2NX9A 2ZFAA 4ADTA 1A5BA 5CPMA 1NAL1 3I7QA 3HG4A 2Q3OA 4K37A 1KM6A 1KFEA 4TMCA 4IX0A 3KVJA 3EWZA 4OU1A 1R30A 2GVLA 5AYYA 3C4UA 2JGYA 3NPUA 4PL2A 1WAUA 4UFLA 4PFMA 4O12A 1I2PA 1MXSA 4K7VA 4MKNA 4O0ZA 3G1AA 5U4NA 3VKJA 3FJLA 4ONVA 3NPVA 3O6YX 1TO3A 1N8FA 5DCDA 5G4EA 3KRUA 2QF7A 3EXTA 4NZJA 2ZA3A 2FPYA 3NGJA 4AWSA 4Z08A 3M43A 3FFSA 2A7NA 3TK7A 2VFIA 2V81A 2J9ZA 2CLOA 2VENA 3A21A 1BKSA 2JBMA 4DPQA 1YXCA 4N4PA 2ZBTA 4JEQA 3W86A 1LCOA 1ME7A 4ORIA 5HJLA 3N34A 1R2TA 5T26A 3PM6A 2PE4A 3EX1A 5K4ZA 2C3ZA 3NL2A 3PBVA
chains in the Genus database with same CATH superfamily
2DT1A 1NM9A 1UD4A 2OPJA 2VZOA 2C8NA 1J0HA 2WSYA 1TZZA 2J7EA 4FALA 4NAEB 2BS9A 4DZHA 3ZJ6A 4DAIA 4MJ2A 1JYWA 2GLKA 1W32A 2R8WA 3KLKA 1W2VA 3P8IA 3ALGA 2V82A 4XZ9A 2IKIA 3RCYA 2PI6A 3VGFA 4O52A 3B8UA 4ZE4A 1RVKA 1GUVA 3MO7A 4BQ5A 3BUVA 3UPBA 2XSBA 4QS6A 3H24A 1YNYA 2VGBA 3BLEA 4PCSA 4WCJA 5RUBA 3MANA 1DXEA 3R11A 5BROA 1JPHA 4QR6A 4BI6A 4P2VA 1FTXA 4JFUA 1EP3A 1JJKA 3MMUA 1TA3B 4U2YA 1EPXA 2CEQA 6REQA 6REQB 2YX0A 4FLOA 2E5CA 4C1KA 3WEOA 4LYQA 2G4JA 3L4TA 1XYBA 4P8UA 1W5NA 3HA1A 3LOTA 3LCLA 4ZTXA 3S9ZA 4P8WA 4M8UA 2NVDA 1GOQA 1NU5A 4LYRA 1FWAC 1SO3A 1RZMA 4ML9A 1S46A 3AYTA 1V6TA 3GDMA 3GU2A 3WLKX 2NT1A 3G0SA 3RR1A 3PHAA 3P62A 3CL8A 4IL2A 3RPMA 2EPNA 4AZBA 2FGBA 2VHLA 5ECUA 5G5IA 3GLCA 4TQTA 3O63A 1H1NA 1QJWA 4J28A 3LS9A 5A6AA 2Q8ZA 2OKOA 1ZU8A 4HYWA 3FJ4A 3QY7A 5LIUX 2P5NA 4LNYA 3LTSA 4NNCA 4IF2A 4PMZA 5CPLA 1KLYA 2GDUA 2X7WA 4UTTA 4GKTA 3LHTA 4JNYA 3OODA 3IJQA 2F9RA 3WDRA 2OJPA 1VP5A 2GJRA 4B92A 1GEQA 1G9HA 3DU0A 9XIMA 4AD1A 2RUSA 3M1ZA 2VJXA 4L65A 4W9TA 1HP4A 2AAAA 4JTRA 4WDUA 1TX0A 2WNQA 3KDNA 4Z1AA 3URQA 4OVXA 3WL0A 2Y5EA 1GGOA 3TW9A 4NYUA 4IMEA 3W3OA 2UY5A 1CX9A 3MUIA 1GEHA 1E6XM 4G7EA 3A4JA 1CGXA 3PZNA 3OHIA 5DBTA 1GOMA 1EF2A 5MKGA 1XIEA 4AD0A 1ZBKA 2FTWA 3AC0A 1MXGA 1UKSA 5HNUA 3TTYA 4QXIA 2XH7A 4KMQA 4BQ4A 4H7CA 1H5VA 3SRDA 2CZEA 3UCCA 4B5UA 1FCVA 1V0MA 2CLMA 4RR4A 4UTUA 4DPPA 5A8QA 4IXXA 3E49A 3M7WA 1KKOA 2HK0A 3T0TA 5CAKA 2VOMA 4AMCA 1QWKA 4UFKA 5AY7A 3FAXA 1Y5VA 2YR1A 3KWXA 4W4QA 3MS8A 3UWEA 2GJNA 1UKTA 4QG8A 3RAOA 2NQJA 2QXWA 3CU2A 4WJEA 4K2SA 1XSIA 2ZUUA 3QTGA 4XZMX 1A5KC 2PGRA 3ABXA 5I23A 1RBAA 3K4AA 3EX3A 3L9CA 3O6CA 1TVPA 5FSEC 2YW3A 4JFTA 2IPJA 2XWEA 1JNDA 3ITTA 2XVLA 3KCLA 1PTGA 1HG3A 3KVKA 4U31A 5DMLA 4O50A 4YLWA 2DEPA 4XAPA 1WV2A 3AIRA 3MC5A 4X2RA 4NI8A 2ZWZA 1XUZA 3AMCA 1GVQA 3THQA 4NAFA 2WZTA 2HXTA 4KBXA 3MB9A 3VYLA 2F2HA 4LSBA 2FFCA 1V3JA 5E1QA 5BMXA 3WO8A 1K8ZA 1J9YA 2YCJA 3OB8A 1A3WA 2O9RA 1X98A 4MWAB 3TTEA 3TYCA 5C2XA 1HTIA 2WQDA 1VFUA 3UWZA 3RN6A 1C7TA 1FWIC 1KV5A 3IUIA 5M3WA 1POKA 3E1F1 4ZA0A 4RNIA 4CVWA 3P81A 3S1WA 1S3TC 4FPSA 3TU9A 1MNZA 2OG9A 4GIEA 4H9UA 3GXIA 4DF1A 4AX7A 1U5JA 1ZJIA 2E25A 5E0CA 1K8XA 3T6CA 4ZB0A 2AQWA 3RYSA 1XIIA 3W1PA 1W3LA 3NO5A 3A5FA 1PSCA 4Z1CA 5ABGA 5IHSA 2PD9A 2ZYFA 4CQCA 1LWHA 1Q6DA 3E38A 1TV7A 4F0RA 5A6JA 3GYEA 3WD0A 4MUZA 1XYFA 3QTPA 4B4HA 2INEA 3WDIA 3QH2A 1U1UA 2QZRA 4GNJA 1W3TA 2PLMA 3KRZA 2W79A 4S3BA 3S1XA 4FF5A 3OBAA 5C9WA 3S2CA 3UJ2A 3WMCA 2J7GA 1FH9A 3BV7A 4A3QA 2CLEA 3KZPA 3KOZA 4L61A 5LIYX 1F6KA 2ATSA 3LMZA 4ZOAA 1PO9A 3LHYA 2QQ6A 2OOFA 4J3WA 4XUGA 1JF6A 1UBPC 3GM8A 4H2CA 5I77A 1GTEA 1K6AA 4EPBC 2PTYA 3NCOA 1EDGA 1X39A 1NOWA 1TWDA 3R10A 4L4PA 2DV0A 1M6JA 3QR3A 4HOXA 4O16A 1OFQA 4IIBA 5IFPA 5HOSA 4NJKA 2WHKA 2QCMA 4B9YA 3N11A 2B7PA 3BSGA 1E6SM 4NSBA 1RQBA 2AAMA 1JQXA 2CBUA 5FAJA 4CUCA 1VBJA 3VD7A 2AL1A 2QCDB 4GYJA 2BBFA 1XINA 1CXFA 3QF0A 4K8EA 1WAWA 1ZLPA 3RIKA 2DU2A 1KBIA 1Q85A 3GXNA 5HQLA 3GR8A 1NOUA 2DP3A 1PL9A 1C8XA 2QJIA 1LL7A 1H3GA 2Z26A 2HRWA 2Z24A 4CNTA 3APYA 3NVDA 2FJKA 2ZRWA 1UC4A 3W1TA 4Q7IA 4XKMA 3MZNA 3QQWA 3ISIX 1W1PA 2HJPA 4R88A 2BSLA 1AA1B 3BANA 5HMEA 5KZMA 4U4MA 4E4PA 3FKKA 3T2OA 1BGGA 5DCBA 1NJJA 1V02A 2O92A 2CW6A 4S3KA 4NIRA 1S2UA 4ZQCA 2A3EA 3CWHA 4U5IA 4PR4A 3FEQA 1OIMA 3SIMA 2GSEA 4LUTA 3LHWA 4FOJA 4R34A 2ZTKA 1H7RA 2VGFA 1PDZA 4DUXA 2D23A 4YVXA 1IT8A 1F05A 3NQBA 5BNKA 2DIJA 3BW4A 3OIHA 4QX4A 2ISDA 1DTNA 5JIPA 1PWLA 3CK5A 3G1YA 2AGTA 1ITCA 1DPMA 1Q66A 1SJDA 3VIOA 3W6LA 5A6MA 1FDZA 1E0VA 4DF0A 1A47A 1UB3A 2Y85A 4UFIA 3S3GA 5EMYA 2A85A 2EPHA 2DIKA 3DYOA 4CD8A 3HPFA 1V6WA 2PLCA 1XP3A 2FH6A 4NILA 1W3HA 4CD4A 4DO7A 2OZ3A 3MHUA 1IXOA 1QPRA 2PBOA 5JXQA 3N29A 4NU7A 2Z1SA 3F4WA 1TRDA 5HK4A 1LLOA 2AMGA 3W2NA 3CT7A 5TBOA 1VFSA 3TJXA 2Q3RA 3NWRA 3VFCA 1PTAA 4WXYA 3QMTA 4ADUA 1KM2A 3BW2A 4UNLA 3VNDA 3K46A 4EXBA 1N7KA 3IGSA 4XBSA 1JDDA 2PGFA 3CAKA 3EYPA 2GDVA 3VIFA 4MY1A 4N9BA 3VIGA 1XLEA 4KESA 3OEXA 3R0KA 3CHDA 2WKLA 4NRRA 3WH6A 4O8AA 4M1RA 3UR7A 1JGIA 1DIDA 4IL0A 9RUBA 2PB1A 5HNTA 4GUFA 3TFCA 3GTFA 3W2LA 1CXKA 3PG9A 1C3FA 3DOPA 1XC6A 2WSRA 3SW6A 1IF2A 4XZHA 3C0JA 1QNSA 2FYMA 1QI0A 4AUBA 4EOUA 5HATA 4ZOBA 1OWQA 2P3EA 5TQLA 4ZBCA 1LDCA 4DWDA 3IJ6A 5HJYA 3S42A 2GGEA 3LY0A 1OBAA 1IEQA 1OK6A 1REQA 4WEVX 2WVTA 2VZTA 4DJDD 1DQWA 1ONRA 1Z48A 2V6AA 1L2QA 4NG3A 3G8EA 4Y9PA 4IISA 1UIOA 2XINA 3VOJA 4HD5A 4PULA 3W22A 5I00A 5J8LA 4IIDA 1US0A 2V68A 3VAVA 4LBSA 4H6RA 4PZVA 1QK2A 1S3HA 3F7JA 2IQDA 3KL3A 4LAKA 3N3MA 3HPSA 2DW7A 3ITXA 3L68A 4CCCA 4JYEA 2NUWA 3UT0A 1NDYA 1LQ0A 3VIMA 1F8IA 2X0HA 3WLLA 4B3ZA 3S6DA 1G4EA 1OABA 3U7BA 5KZEA 1S2CA 3AU6A 1KBKA 1VCFA 3WLOA 4N2YA 4GJJA 3IPWA 3LYEA 4WVXA 3UQNA 1S5WA 5H1WA 2QMJA 3EWCA 3IAQA 3DI1A 4G1NA 3UJSA 3B9DA 3PJWA 3WDQA 2AKMA 4NZ1A 1QNRA 4JQ2A 1V03A 1V6UA 1VEMA 3LLFA 3VMNA 4OBRA 3R94A 1IR2A 1X97A 1Z42A 3S5YA 1S1PA 5K4XA 3CIWA 3N9RA 4XTIA 1RH9A 1JZ2A 1IZJA 1RAKA 3ARPA 1OF8A 4WLCA 4UMCA 1UR2A 2J66A 2VEGA 2HNHA 3USBA 5LIXX 3LHUA 2P88A 3GO2A 3HQOA 4A3UA 3VILA 1OM0A 3R25A 3UJFA 1UOZA 2ZUMA 1VJSA 1JI2A 3UJEA 3P61A 1AW5A 3WMLA 3L21A 1AFSA 4D9PA 4ROQA 1J6OA 3T4WA 3B4UA 1GT8A 3DG3A 4W8LA 1TWWA 3W1UA 2WPGA 8TIMA 2FHCA 1E4NA 3NQMA 3VIHA 3WK0A 4RNFA 4F48A 1O1ZA 1DBTA 1GOOA 1SZGA 1EYWA 4ZTYA 4GQ0A 1ZNNA 4DBSA 4OV9A 1DP0A 3FCPA 3EZ4A 1GVEA 3AHXA 3MKCA 1IZCA 1Y8BA 1MI3A 5FCZA 3UVIA 4UTMA 1WYIA 2WMFA 4PBGA 3PPFA 5D03A 3UVAA 3K4WA 3NYDA 4Q7BA 1FP8A 1W5MA 3BL3A 1Q45A 4NJHA 3EPOA 1CZ1A 2ZTJA 5G1MA 2PZNA 3KOFA 1IGSA 4N6FA 3B0YA 1IWAA 3MP5A 4LVGA 3EWDA 1NQKA 1F3WA 1VHCA 3NSMA 1OZMA 2OX4A 1H09A 1M7PA 3G6MA 4IX2A 3AHTA 5GNYA 3GVVA 1X96A 1WNOA 4AHPA 3MO4A 2GYIA 3VNZA 2E5DA 3OO2A 3HPXA 4DQWA 1PE1A 3XINA 4NT0A 3G1DA 2INFA 4E38A 3QSTA 2DVUA 1EDTA 1W5PA 4TXEA 2XM2A 3WLIA 2DUAA 3F2CA 2VO5A 4D72A 1CTNA 1KWGA 3UWYA 1J10A 2VCBA 1VCVA 4PUWA 1WE5A 4MM1A 1SSGA 3W29A 1DJWA 4HSHA 2J13A 4C91A 3ZFHA 1YNQA 2YA2A 4O17A 3DAQA 4AD5A 2G3IA 4NRSA 1W0MA 4UQEA 3VC6A 4G1KA 1P0KA 3G24A 3UXIA 1T99A 2FLIA 4PMXA 5D8ZA 1OY0A 4FIRA 5K9CA 2FIQA 1ICSA 1NFPA 4L7ZA 4NJGA 2HWGA 4PMRA 4B4FA 1R47A 2DPEA 4ZENA 1S2WA 3CJPA 1TUFA 3R7MA 2W4XA 3PS7A 1KV8A 4MB1A 4FNUA 3RLUA 2FTPA 2RGMA 4CNOA 1CGVA 3LPGA 4XD5A 5CPTA 4BI5A 4HK6A 3FVMA 3BVJA 3W7LA 5BWFA 1FWFC 2F6KA 3ES7A 4AEFA 1BWLA 4D6DA 4NJIA 2WMJA 5DT5A 4JTUA 3MA8A 4A8NA 4H04A 3HB9A 4LRTA 2DT3A 3BH4A 3L4YA 1XL9A 5I78A 5HWNA 1CYGA 5E0KA 4GWEA 5C5YA 1VEPA 4WGXA 7XIMA 3G3DA 4QJ4B 1SO6A 4D1IA 3HG2A 3AIQA 4YXGA 3F4VA 2FVKA 3KAOA 4WDXA 3NO1A 4XZNX 2QUNA 4MNJA 4C1LA 3PC0A 4KWWA 1CB2A 4FR1A 5PTDA 4CNNA 2AQOA 1EGMA 4Z2GA 2TYSA 4HHPA 2FMOA 1B31A 2NWRA 3ORWA 4HN4A 3UZWA 2FHFA 1H1YA 3WQOA 3TH6A 4O57A 5AHFA 1EZWA 3B0XA 2GJPA 2NW0A 2WZHA 4UBPC 1Y7VA 1NF0A 4M1BA 2PDMA 1GNXA 3SSJA 4HYRA 2QUUA 1NWUA 5HULA 2GVEA 5CZSA 4IP5A 3MI6A 3MVTA 1BG9A 1TCDA 4J5NA 3WENA 4DUWA 3SUTA 1W1ZA 3OG3A 5JUVA 3E02A 4TOQA 3DFPA 5FEZA 1A3XA 2A3CA 3GH5A 3O6DA 1FA2A 4ILSA 4JTQA 5FKYA 4NX0A 2XUCA 4YL2A 1XW8A 3V5CA 3G0XA 2PC4A 2QPUA 4C6FA 1NP0A 3LCHA 3LGDA 2BB0A 5HAOA 3AZRA 3ARWA 4ASTA 1FHUA 4J40A 2PDLA 3UG4A 3FYYA 3HIJA 1UASA 1V8EA 4XAZA 3WDHA 2CLKA 3E2SA 3PSVA 1PIGA 2C7FA 2NQLA 1R7OA 3OG2A 3IIVA 1B30A 1E40A 3TYAA 3ITGA 2R1PA 2NQHA 2GPTA 3EEZA 5I3GA 2WNZA 4QIUA 3PPGA 3MUZ1 4CNUA 2RDTA 3WBXA 2QCFA 1Z69A 1J93A 4IUOA 2F7FA 3JVAA 3ES8A 5FF0A 1SFLA 1J0YA 2WVSA 3RJYA 3MY9A 2XVNA 1GONA 1DJXA 2PCQA 3H7RA 3VNJA 5T9CE 3IARA 1TE6A 4KWUA 4NVTA 1LT7A 5D02A 1PHWA 1B5TA 1K9FA 4KIRA 2E8ZA 4MOZA 5BRPA 4LVAA 2BY0A 1EWDA 4LALA 1XIGA 1NARA 1SR9A 1FY6A 3S1GA 2DZTA 2ZADA 3WJXA 3EWUA 5EBUA 2G50A 3IANA 2YYTA 4MSSA 1TTPA 1VFTA 1KM1A 2PRMA 2GQAA 3BK0A 4HIBA 3A3WA 3TZNA 4KIEA 3FK4A 1E71M 1ZENA 3RNDA 4FEZA 1TQXA 3PNUA 4TIMA 1OINA 4DX3A 1B3XA 1K8YA 4CN6A 4X0VA 2VNCA 1M7OA 1PBGA 3WQFA 5AFDA 1UWTA 4MIMA 2NV9A 1AL7A 5IDIA 3SZ8A 3VGDA 4AD2A 3HQNA 3M44A 3D0CA 3W85A 4PTVA 4A3RA 4W8AA 5LIKX 4QQUA 3TAKA 5LNUA 4F79A 3RMJA 3GK0A 4GGBA 4JHZA 2WWCA 3UR2A 3WQGA 3W81A 4ERIA 1M41A 4F9JA 3BARA 4S1FA 3IS4A 5EMKA 4LUJA 1TWZA 4UNIA 3A22A 4HPXA 4K38A 3MWCA 3W7JA 5JIWA 2Y8KA 2R6OA 2QCLA 2Y2WA 4JIPA 1KFWA 4GUHA 4KFOA 2BVTA 3A13A 3KP0A 4AIBA 3G22A 3NQ2A 4RXGA 5A2CA 1A4MA 4HA1A 2CC0A 1MEHA 3FEMA 4JTGA 3H4XA 3C6CA 4IUGA 1EJWC 1L2UA 2VDIA 2DUXA 4GABA 1G01A 3EMZA 1UPPA 3VKDA 1YNPA 3QGVA 3SN4A 4H6QA 4PA8A 3T0DA 1U1JA 4XD6A 1YW1A 3ARSA 3PZTA 3VKAA 4LUSB 3W7OA 2XGBA 2OT0A 2GVGA 3ZVHA 2I5GA 3FDKA 2OYMA 1B3ZA 1US2A 4BI7A 2E3ZA 4J3XA 1W6TA 3DKJA 1KM5A 2E0PA 1NP2A 4LY8A 1DHPA 1ZJHA 5A6KA 4AG0A 1UCWA 4H7ZA 3W2UA 2I14A 4FS9A 1EJTC 5EPDA 4LAUA 4O15A 5GPRA 4H9YA 1OSEA 1ZBVA 1UKQA 3L12A 3W7KA 2VX6A 3L5LA 1JFHA 4GQGA 4KERA 3KBWA 2FZ9A 1DIKA 1KTNA 1N8IA 3UEQA 1C8VA 4DO5A 2I16A 3HF3A 3DHFA 2ZIDA 1Q8JA 5CLWA 2YBTA 4JXCA 1JCMP 4UQCA 2PU1A 3BJSA 2PWEA 2HVMA 3LM7A 4MMWA 1T0OA 1RK5A 4IMGA 4DYJA 3VUSA 1M7XA 3L5MA 3UYCA 3R58A 4FP1A 5HR6A 2HMCA 4MGGA 3FLUA 2X30A 3VO0A 4FNTA 3ZJKA 2NUXA 5C71A 3ZT7A 1GPFA 3STGA 2DDXA 3IIZA 2YSWA 5DF0A 5M5DA 3QM3A 3H26A 4QGCA 1XC4A 1KFKA 2G4FA 5HXMA 2NQ9A 4MHBA 3RM8A 3URBA 4ZO6A 1TTQA 4IJRA 2NX1A 1R87A 1I2QA 1RP9A 1VKFA 5BXPA 4RW5A 3SECA 2WM1A 3QZAA 1E4MM 2G3JA 3V4BA 2WPBA 2G41A 1WDDA 2BG5A 1V0LA 4FLQA 1UUMA 4FX7A 1Q6LA 1HJXA 1OFRA 2OO6A 3APTA 3ZIZA 1HXJA 1BG4A 2XISA 2CETA 1OGSA 2MANA 3T44A 3FN9A 4QE1A 3MBDA 3UG3A 3R12A 1I75A 4OHQA 2EG8A 3FJNA 3T55A 2VFHA 2V9DA 3WJWA 2QUTA 1RSCA 1FH8A 4Y9NA 1EKOA 3ZOAA 4Q4SA 5I03A 1H62A 1I1XA 3EOLA 2R1KA 2FB3A 3SCWA 3DX5A 3E0VA 3KTCA 3WQEA 2ZRVA 1C29A 3ZR6A 2PAJA 3VNMA 3A3HA 3T0AA 3WBYA 1ZP3A 2ZZ5A 1W3JA 1T41A 2HBXA 3MHFA 4RJEA 1GKPA 2DH2A 3BLFA 2ABAA 5BOOA 1L6SA 3TE9A 3ZJ7A 5BRBA 1BWKA 5EY5A 3WQCA 5A6LA 2GQ9A 4XAFA 4J3VA 1ADOA 4QJ5B 3ERPA 1TZ7A 3DGBA 3NZRA 4JS3A 1KRCC 2VWTA 1EHAA 4CQ9A 4PBEA 4WOQA 4BS0A 3BAIA 5A69A 3NQDA 3GFYA 4LCRA 4GI4A 4JD4A 3FSUA 2OB3A 1EC9A 5LXEA 2EBNA 4W88A 1RBLA 3POCA 2VGIA 3N6JA 3HMJG 2C0HA 2DORA 4R9XA 5C9ZA 4OT7A 1BYAA 1OF6A 2NT0A 4X0NA 3GSMA 3EA1A 4ZQPA 1GJUA 1QBBA 1W1B1 4IGMA 3GVGA 1ZJBA 4HYVA 4V1YA 3KRBA 5KETA 4NX5A 1JCNA 4RE2A 2ZX7A 4BA0A 2RFGA 2YXGA 4XVDA 5IRPA 3G77A 1EYEA 3ZR4A 3EA3A 2PF8A 4AYGA 2PRHA 2PGEA 5EBAA 2EKGA 4D6CA 4O0KA 3C52A 1BYBA 1W91A 3W38A 3MDUA 4FSAA 4XV0A 2Y8UA 1XXXA 3WJZA 4GI8A 3V1PA 4PMQA 3CM4A 3CB8A 4ZFMA 2V2CA 4BQ2A 3B9EA 4ZXOA 1Z41A 3VE7A 4PTWA 4GUGA 3QGKC 4Y9AA 1AL8A 3URAA 2BHZA 1HJUA 1KRMA 4C6LA 3TYBA 1PCWA 5AOUA 1QPQA 4X3ZA 5I3DA 4TTGA 4ACZA 2V8ZA 2PRLA 1FKXA 7A3HA 3S0CA 4AWUA 3H2EA 3H2FA 2OR2A 2E9MA 5CPMA 1OZQA 4GQBA 3KVJA 5CBIA 3VX1A 1IEVA 4LQ1A 2CHOA 4YWSA 1LWIA 4O0ZA 2YKKA 1XDJA 3FJLA 3R4IA 1UR1A 3EOUA 2XWDA 3HV8A 4F0LA 1QNQA 1VB9A 1J12A 3S5SA 2FPYA 2PP0A 4CQBA 5E6YA 2V81A 4L1GA 2JBMA 1P7TB 4DPQA 3OQEA 4JEQA 3RPDA 5I6SA 3N34A 1W2PA 3PFRA 4O0QA 5T26A 2I17A 1FVPA 5K4ZA 2C3ZA 3PBVA 1CW2A 1KO0A 2LLEA 2X0YA 5FEWA 1JPIA 3HPZA 1JDFA 3TR2A 4DELA 1C8QA 2PC8A 4EWND 3S4TA 1PX3A 5CC6A 3GD6A 2W61A 3UZ5A 3CNYA 4ATWA 4RV3A 2W62A 5GVJA 1P0BA 4OQVA 5J04A 4KGJA 4XAYA 1H60A 3BG9A 2V2DA 2XYLA 3DHPA 4UFJA 3IJ7A 1RY0A 3BDKA 2WQPA 4WX2A 4HU0A 4JGDA 4OIFA 4XB3A 4LOCA 2J7DA 4A3YA 4WZHA 3W07A 1JCJA 3YPIA 3M4HA 4PN2A 5CG0A 3WK1A 2DSUA 5XINA 1QW8A 1T8XA 5FD0A 2J4GA 3H4GA 3IUDA 4AZIA 2WCSA 4KEMA 2BP1A 4D8ZA 4ZO7A 2D20A 2EPMX 3RM9A 2CZFA 4RK8A 3NPXA 4UOQA 3LBCA 1M65A 1XWYA 4H9MA 4P7NA 2JKPA 5HMDA 4JDBA 1SW0A 2Z2AA 1V3KA 3MV01 5A8MA 4JN7A 1PYMA 3WF3A 1C9WA 3R6IA 4B90A 3SCOA 4DBUA 3HPAA 1X6LA 5K9XA 4AQLA 5CC5A 3MMDA 3UA3A 3C8NA 2A4AA 1XDMA 3AWNA 4QLKA 1G1YA 4ZOEA 4M6QA 1F8MA 5IDZA 2DSZA 3JRKA 4OUIA 3V0UA 2UZ9A 4XZIA 1KGXA 1QTWA 1JD7A 3BO9A 3TQKA 2VR4A 2WZEA 4MLJA 3N3TA 4J3SA 4HOZA 2ZUTA 2WAGA 4RE4A 3HU7A 3SAZA 3H8AA 2ODOA 1XG3A 4LF2A 4DHGA 3EX6A 1PZ3A 4Q8OA 3SADA 1PHQA 3T42A 4LVDA 4B15A 4GVGA 1XFCA 2REQA 1FWCC 3PPHA 3GVWA 4I7VA 3SGUA 4NL1A 3LD5A 1TSIA 4WQ6A 3S5ZA 1E0UA 3W0KA 1YBQB 3JS3A 1BKHA 4MB3A 1MXDA 2YBUA 1CLKA 4QSHA 3W6MA 1ML1A 4PUDA 1PEZA 1PIFA 4GIYA 5C9RA 1P1XA 5I02A 3KCOA 3B8IA 2DFAA 4H9TA 3BE7A 3S6TA 3N13A 2P10A 5CSYA 3PUGA 4KCVA 3T81A 2E6DA 4HA4A 1TV5A 3QLLA 2WBKA 3F2BA 1ZY9A 1SR0A 4D8LA 3MUAA 4GQQA 1C92A 4XUYA 1F5ZA 4ICCX 1TQJA 4GNVA 5E5CA 1P6WA 4Q33A 2WB5A 3N6HA 4PCTA 5D2VA 4MNMA 2D2OA 3GB6A 2V5BA 3UFYA 1T96A 3CHVA 3SCTA 4CN1A 3R2GA 1N82A 1IR1A 2YCKX 3LV6A 5C9XA 1GYMA 5LGZA 3H21A 3OZPA 3W24A 3GDTA 3HBLA 4CEUC 4Q8VA 1GZGA 3F4CA 2NV1A 4L5ZA 2A3LA 2Y5SA 1JFXA 3ANUA 3OZOA 4QFUA 2CKRA 2OLHA 3STPA 1VFLA 2QJGA 3FY1A 4YTSA 1GOXA 3TC3A 3GU1A 4DXXA 2UBPC 3IRSA 2DSKA 4IMAA 1X7FA 2ZUSA 4GYKA 4FI4A 4DY1A 1O5KA 3TROA 2WBGA 5A95A 1CCWB 4I5RA 4XD4A 5F1VA 1OCQA 4DIAA 1EOKA 3O7UA 3AJXA 4O1FA 2E6AA 4HK5A 1XPYA 5CC3A 1T40A 3AMKA 2G3NA 4B5VA 3B0VC 4LYPA 4LAMA 4WGHA 1RP8A 3I7RA 2PDFA 1BQGA 3S5OA 1GQKA 4J9JA 1B3YA 2JF7A 1G0CA 2PDKA 3Q45A 1AZ1A 1J0JA 1HZYA 3O6AA 1QDSA 3BTNA 4QLLA 4MKSA 4PRWA 3WEMA 4US5A 3PWGA 1P5BA 3IV8A 1S2VA 5D9PA 3VVGA 2UY3A 3AISA 5L9FA 2PLJA 4LAOA 4HPHA 1I4NA 1W56A 3T07A 3BMXA 3LQGA 1EUNA 3IRDA 1XLDA 1EUAA 1MYRA 2NLIA 5LKYA 3PTQA 1OG6A 3VIPA 2Z6JA 4TX6A 3MCNA 4X63A 1HJQA 2NLYA 5EU9A 2DZWA 3ARRA 2Y1HA 1ZUAX 2OX1A 1Q6OA 4LPCA 4IG2A 1H51A 4E2BA 3NSXA 4AF0A 4TX8A 5TNVA 4CQAA 4M80A 4ZO9A 2PUZA 1WDQA 1UYQA 1C8YA 3BLIA 4QCFA 1G4TA 4Z2HA 4AD3A 1YXYA 3P80A 5AHNA 2FZBA 4PCFA 2ANUA 3PJXA 4UTWA 2Z4GA 4J7RA 4PTMA 2Z6IA 2DUZA 3L2LA 2X1IA 4H7VA 2XFWA 1XQKA 3NDOA 3ONBA 4H00A 4PMYA 4JHMA 1MMFA 3AS2A 1GQJA 3N9KA 1KC7A 1K4HA 2CBVA 3STFA 2YA0A 2DIEA 1KNWA 1GG0A 2OXNA 5T8GA 1GOKA 3ZLHA 1W3NA 3MUY1 5I24A 5GQBA 3PZIA 4I8DA 1SZNA 2X1SA 1OCJA 4O13A 3NQEA 1K7EA 5D4YA 3O0FA 1OHLA 3LCFA 4Y90A 1P6BA 3HM7A 3A3XA 3BURA 3O3RA 2R1LA 3THUA 2VP8A 3LDVA 1VIZA 1WCGA 4D1JA 3W1MA 3S2LA 3EPNA 4E3VA 2PWGA 1XYMA 3QOKA 5LNVA 5LIWX 3FNDA 2G5WA 3EDJA 4PCNA 4JEJA 4DNMA 3W7RA 3QBUA 4JHOA 5C0QA 4ZMGA 2PGWA 3CL7A 2XVPA 1E9YB 3GHUA 1GVYA 4ECLA 4C7GA 4IGNA 2CNCA 2YFOA 1OQFA 3TTQA 4UNKA 1R86A 1BPLB 3WD1A 3WELA 3H70A 2Y24A 3NOEA 1R3TA 3P3BA 3R13A 3VUPA 4DWSB 3CQIA 4AAJA 3U2ZA 4F0MA 3IUHA 3TN4A 1MVYA 3WDJA 4Y2WA 3BG5A 5D09A 3LV5A 1S5MA 2XIIA 1QHZA 1GOWA 1SFTA 3AALA 7TIMA 2D2JA 3GFZA 1JAEA 5JBEA 3DFNA 1QAPA 2X40A 4ACZB 3NL3A 7TAAA 3PUDA 3WNOA 4MNKA 4ATLA 3MYPA 3BLOA 3R89A 2MNRA 5CPOA 1QOPA 2IPFA 1DHKA 4FK9A 3A5VA 4YNGA 4NZFA 3NA8A 1J96A 1WUEA 1AH3A 4FLRA 1WOBA 4IIHA 4IPIA 4JIRA 4LFYA 4CU7A 4HPNA 1VFMA 3TLLA 4QTGA 4WDWA 3OGRA 4WK9A 3WMBA 2YB4A 5DMYA 4V33A 2Y8VA 1AMKA 2V5LA 2NVAA 5I3HA 4FNSA 3PBYA 5EGRA 2D2HA 2HQAA 3MI2A 3O16A 2DZXA 2VFDA 2VWSA 1XM3A 3GG0A 2FZ8A 4OOZA 5JQ9A 3ENLA 3KFTA 4JBRA 5F4XA 4DBDA 1AJZA 3JZEA 5C7VA 1XIHA 3PB2A 4PMUA 2P8BA 2FH8A 2D3LA 1DEDA 1JRCA 2BXYA 4R7OA 1D7FA 2W6RA 2E68A 2PWVA 3LUTA 3LU2A 4WIWA 2QKFA 3OLGA 1Q6QA 4OUEA 1GYLA 2O4QA 1XH0A 4UMBA 2Y7FA 3T8LA 3MKVA 3T0BA 3E2RA 2INZA 3W83A 2J6VA 1TCMA 1GPWA 3M0JA 3IVUA 4QEEA 3WN6A 3T78A 1QK0A 4JTKA 1FCUA 3HG5A 1F3EA 3TZFA 4XKYB 1H5YA 5K7JA 3OP2A 4GI9A 4GG9A 1Q63A 4CU6A 4K1GA 2WLYA 3ZVIA 1A0CA 4EF9A 3NXLA 3W28A 5JH1A 3K1DA 3ZR5A 4UTIA 3UYIA 4V28A 1LTDA 4ZB2A 6TAAA 1JPDX 3EXSA 3OBEA 1K02A 3GIQA 3OPSA 1E9ZB 4DM1A 2J74A 5CPSA 2NWSA 1ZL1A 1MFUA 3MW7A 1HKKA 1KM0A 5CQ1A 1R8LA 4A05A 3DESA 3M41A 3F03K 1PAMA 1NDWA 5E09A 1P43A 2JKEA 3WH5A 1B9BA 1TVNA 4S2CA 4P8XA 3H12A 1GVFA 1AQ0A 4DB7A 2Y6ZA 3U5YA 1IWBA 2D1ZA 1XLFA 1O7AA 3RK8A 3KW3A 3B4YA 2VCAA 4HMCA 1IEXA 1FFRA 4H2HA 4PCPA 2YZ5A 2FVMA 4US5D 2A79A 4Q4RA 1F6PA 2Y4SA 3PFMA 1B3WA 2FGZA 1ODUA 1KRAC 1YPFA 1GKQA 2DSVA 2TMDA 4GJ1A 3UESA 2CFFA 4O1DA 1U33A 4LS2A 2DVTA 1KA9F 1YE4A 2P50A 1WZAA 1JZ3A 5FSDC 1B2YA 5LHEA 2BOFX 1EFZA 1U30A 4DWSD 1UMYA 5CEWA 2A2IA 3EWXA 4AZHA 2XFRA 2JEQA 4CD5A 3MI3A 3SCNA 3IJ9A 5AYXA 3SO7A 3CLMA 3ANYA 1WZMA 4ZSTA 3CZKA 3Q2DA 3ITCA 1GHSA 1E51A 4V27A 4EPDC 2C0AA 1CECA 4GMEA 4Q8WA 4YCOA 4DJFC 3M0ZA 2IS7A 3RLGA 3IVSA 1Z8AA 3WQVA 4JQ1A 3TTOA 3TTSA 1JDEA 4WKAA 3W7MA 5LYRA 2GUBA 3F5JA 4N0RA 3G1FA 3PF3A 4AZCB 1XV8A 4AYSA 3UBPC 4LUSA 2XVGA 1EL3A 1C7SA 1EJVC 2O4MA 4Z2IA 6CGTA 1TVLA 3TV8A 2CXEA 4ZFCA 2C71A 3LTYA 5FI8A 3WCZA 2QCEA 5BU9A 4NKCA 4EF8A 2R24A 3HJZA 4FOUA 3T8QA 1R3WA 1RJRA 1UMLA 1ADSA 1UWUA 4NNBA 3BW3A 3LX9A 4R3UA 1P0DA 3U6WA 1VENA 1ZPTA 3EA2A 3DGRA 5ABFB 3QKEA 2POZA 3MQTA 3KS5A 4UTLA 3VOFA 1LP6A 4AMAA 2ZZ2A 4BJHA 1G7UA 4NY2A 3AS3A 1J18A 4ZQRA 4PEKA 3W7IA 1Z9AA 5BXRA 4HZMA 4XK2A 3SFKA 4RW3A 1CPUA 4O11A 1Q5MA 1MZHA 3W7HA 4ZL1A 2BGQA 6XIAA 3RRAA 4O1EA 3EMQA 3VZXA 2QCCA 5E70A 3W37A 2VRQA 3AQUA 1CGUA 2YDRA 5LXXA 2WJEA 4KWOA 4Q4PA 2WSQA 1WDPA 2UY4A 3LBMA 3S6OA 1KQZA 1P0EA 1WZLA 1Q6EA 1RPKA 3WIJA 2C1GA 3WQ8A 1JZ7A 2XU2A 4JR5A 4JN8A 4N9EA 4Z17A 3O0KA 2EG7A 1V7YA 1GQIA 4JFSA 2CLFA 1X6NA 1XD1A 4F40A 2WKJA 4REQA 3BZJA 3TNBA 2VVSA 1H7NA 2J47A 2UY2A 1EIBA 4YCPA 1LLZA 1GVSA 1V3HA 1D3HA 1SZRA 2GVJA 1SJCA 4FB7A 3UWUA 5FJPA 1RCOB 4YS1A 1ITUA 4A8LA 3BGGA 4Q4OA 3QW3A 1W54A 3KOXA 1JRBA 5A2AA 4C5ZA 3CBWA 3P5YA 3NDYA 4YTRA 1BD0A 2W91A 1B90A 3GVRA 4KT2A 1P6CA 4HQVA 4UR9A 1H1ZA 1EEPA 3UP8A 3PB0A 2Y70A 3GC4A 4BF7A 4AU0A 2JFEX 4DJFA 1KLZA 3NQ8A 3H2OA 4E3TA 5FJRA 1O66A 1MDLA 3AMGA 4NNAA 2ZWYA 3BICA 4AX6A 1HVXA 3P74A 4EX4A 3SRKA 4ACYA 4AZ5A 4FZIA 2XHYA 1DJIA 3GC2A 1YLVA 1JGMA 3GVQA 1UR4A 3CAQA 4LEFA 3ABRA 3D6NA 1GQNA 1BTCA 2QVHA 2J27A 5HUPA 3CEUA 2ZX5A 3KTSA 5A6SA 2V3GA 2WC3A 3IEBA 3IJDA 3LZ3A 3W7GA 4F9DA 4B5WA 2OOGA 1YQ2A 2OQYA 3OJGA 3VX0A 1SM9A 5E6ZA 1VBRA 2PF0A 4C1NA 2B0MA 3GY1A 1DWIM 3NDZA 4KFNA 3U5UA 4OE7A 2VFGA 3FJ6A 4DJED 1OYCA 2AGKA 5AYIA 2IPGA 1VD6A 2V2HA 3TMLA 1TPEA 2JEPA 2FQIA 1KGWA 4LY4A 1BHGA 2V63A 4JZ5A 2X8RA 1RXOB 2YCIX 2ZUWA 3H2NA 5CPNA 4ZR8A 3CZGA 4HU4A 4CNSA 3GNOA 2FDSA 3PZMA 1AD1A 4JX6A 3L2MA 4EACA 3EDKA 5EB8A 1IGWA 4JYDA 3WMSA 1QU4A 4S3JA 4IOTA 4RZBA 4M24A 4WKFA 2QUMA 3TOPA 1DTUA 1YPXA 2VDGA 1Z7AA 1V02E 3VFLA 1CXLA 3F5KA 2CLPA 4Q7NA 3ZT6A 4AZ7A 3LBOA 4MZ1A 4HTYA 4S3GA 4HVXA 3WH8A 2YDAA 1FX6A 4P7QA 3TSMA 4LNCA 5KITA 1A5AA 5I07A 3SCSA 2OTDA 2B4GA 1V6YA 5EMMA 1U22A 3LXBA 1O68A 1Q8AA 3KP1A 3M9YA 1ZSXA 5H8MA 2C18A 4NF7A 4BCEA 2Y7EA 4M6UA 5AC6A 5AHEA 3RITA 4DWSC 4NP7A 1QOQA 4ZO8A 1FOBA 4BKNA 4EKJA 3W25A 1OX6A 1CXIA 4G2DA 3CC1A 1P4CA 1PPIA 1V0NA 4PMDA 4S3EA 3AROA 1E6RA 4Q4KA 2FMNA 1BGAA 4ML4A 4W7VA 1W9BM 4WHBA 1Y65A 3A12A 4DUOA 3ANVA 5CH9A 1UA3A 1TV8A 1VBHA 2J9YA 1LL6A 3UNTA 2HS8A 2JKAA 3WYZA 1UD2A 5K3VA 1HKVA 2Z2UA 3BPWA 4FR6A 4CQDA 1ZZMA 1G69A 2J62A 4F2TA 1FXQA 1Q4NX 4Y9OA 1H7PA 3WFZA 3NQGA 4R53A 4GIAA 3NQAA 3MKKA 1XLKA 3SURA 4B5XA 1MW0A 5CLTA 1DJQA 3AXKA 5CBJA 4J2MA 1MUCA 1KGUA 1D8CA 3RLHA 4FX8A 3AYSA 2PDHA 2WLZA 4NZCA 1F61A 3QV7A 4HK7A 1ITQA 1RLCL 2W63A 3W7DA 5HR7A 4FXFA 2CXGA 3IK2A 4V15A 3F4DA 3W74A 1YDNA 3GZAA 3CTLA 5FF2A 4MFDA 4MFEA 1XBYA 1BTMA 1IEWA 4LC6A 4JCMA 2QDHA 1OT1A 4WF7A 2QJJA 2I5IA 1NFBA 2KAUC 5E9XA 3OZYA 4BWLA 5AKQA 3NZGA 4KWSA 2YOCA 3VOIA 4H83A 3RJXA 3AIWA 3WLNA 4M5PA 3PTDA 2F6UA 2DT2A 2R9RA 3OVRA 5E93A 4EAYA 3NSNA 2A3AA 1HGYA 3VC5A 5FEPA 1OFDA 3PTKA 4JIQA 2KZHA 3VD9A 1QI5A 1UZDA 3W70A 4MY9A 2ZXBA 4IJBA 2PS2A 3IV3A 3CZLA 4Y96A 4JL1A 5I7GA 1L8PA 4MKVA 2Y61A 4ATDA 3DG7A 1K8CA 3U0HA 3EEGA 2XSXA 3U4AA 1TB3A 3NPWA 1NIUA 3EWBX 3WBWA 1OCNA 1Y0EA 4GH1A 1AK5A 3WZ0E 1MSSA 3VK5A 1O1HA 6PTDA 3PZ9A 4R7JA 2YCLB 2YCEA 5BXTA 5FA5A 5CXPA 1EO5A 2H9AB 1ZQ5A 4PB5A 2FFIA 2ON3A 1C93A 1UH4A 5REQB 4AZCA 3BCDA 3EPMA 1DWFM 4YVPA 1Q65A 4JICA 1XCFA 1GG1A 3P60A 5DX7A 3NM1A 4W93A 2IKGA 4IMFA 4JTHA 4Z1YA 3COTA 1PJ9A 4TU1A 3OVGA 1KB3A 2J8GA 3USZA 4M19A 4HU8A 3P8JA 1JNEA 4XISA 3ABSA 3OGSA 3URNA 4ADSA 3TXZA 4S3CA 5HQMA 2TRSA 1OG0A 1U2YA 3LQLA 2C79A 5IBXC 3VINA 3UXDA 3R0DA 3LGEA 4MB5A 4JAWA 5CSUA 3AZTA 4GO9A 3CAVA 5D33A 3ARZA 3A4XA 4HHHA 1RR2A 3AXIA 2OWCA 2BHYA 1KBBA 3CZ8A 3G3MA 4MYXA 3TCSA 5H91A 2Z28A 1Q13A 4X22A 3WKZA 3A23A 5TIMA 2J7CA 2VT0A 4GE8A 4F4RA 4ZE5A 2EHHA 4N9DA 3TW7A 1LOSA 1JCLA 3N9SA 1ECQA 2GQ8A 3GS6A 1OFEA 5FJTA 1ADDA 1MFVA 1WKFA 4GUIA 2BVWA 2PCEA 1BVNP 1VLIA 1TIWA 2WHMA 4JCLA 3E5BA 3I6EA 2E67A 1UWIA 3WG6A 3I7SA 4POCA 2VZSA 4RDVA 4QE5A 4GINA 1D3GA 4HNCA 3PNZA 4Z42C 3LNPA 2C15A 2J25A 1F7BA 3P7YA 3B8WA 3TQ0A 1GHRA 5KZDA 2XH4A 3DIPA 2A3HA 3SQMA 4CNPA 4TV6A 2ZQ0A 3LI1A 3OHMB 2WCGA 4HNUA 1IHIA 1J11A 1UP2A 3VD4A 2W5FA 3W02A 5DY3A 3EOSA 3R43A 3DCPA 3REQA 1V3IA 4XZWA 1PS9A 4PEEA 4L4LA 1NVMA 5C9UA 1EBGA 1IQ8A 3CMJA 5E9AA 2ZRXA 2TSYA 2EKCA 3FKRA 3ZQ9A 5EYWA 4BFAA 3GG8A 4N6EA 3ATZA 2E9BA 1H0IA 2CHRA 3U2OA 3CHEA 2E6FA 1RUSA 1B1YA 4B91A 1GJPA 1NF7A 2OT1A 2DVXA 2CWNA 1H4PA 4B5TA 1REQB 2HVOA 4IIGA 4XKYA 1GW1A 3SCQA 1GYNA 2C16A 1DORA 3FA4A 4L56A 2ZX9A 3RX3A 4XIAA 4A3HA 3M5XA 1YIXA 3K8MA 2WJZA 1PV8A 1XBXA 3VIKA 1MWOA 5MHBA 5IXEA 1BVWA 4R33A 1VC4A 1WKDA 3DZ1A 1W9XA 4FXRA 3EDEA 2CZ5A 3C2RA 4P7OA 1E3XA 1DE6A 3B8TA 4UTHA 1PKNA 1F74A 3HGSA 2ZC1A 3H54A 3S46A 2HK1A 2OSYA 2H3DA 3EX2A 3IACA 4LB4A 2D73A 5FAGA 3T08A 5BOEA 2NV2A 1TPDA 3RILA 3HMCA 3N6QA 1K7XA 4QITA 3M16A 3LMYA 3G0UA 9XIAA 4KRZA 5H2ZA 2ZC8A 3LGGA 3TYUA 2D0GA 5LGXA 2D0HA 3PBWA 3DFTA 3NO3A 3D47A 2PTWA 2EXOA 1ZP4A 1OGGA 4GYPC 3L65A 4JY9A 3V18A 3TVAA 3W1RA 2IUZA 5FOOA 1VR6A 4KCWA 4HNLA 1NWRA 4A29A 3TYDA 4DZAA 3H22A 1UD3A 1JDAA 3DHDA 1TMLA 2BWGA 3JZUA 3VDBA 5AC4A 5T9BG 5D2WA 4H8UA 4LWWA 1TYGA 3S5NA 1XUUA 4UCFA 6ENLA 1A5BA 3VD5A 1Z6KA 1NTHA 2Q3OA 4TMCA 1KFEA 5H8PA 3EWZA 2WANA 1R30A 1OC5A 3T05A 3NPUA 2VEFA 1AD4A 2Z1XA 1MXSA 3FSTA 3G1AA 3WLMA 4QHRA 4DJEC 1TO3A 2VI0A 4B2DD 2ASHA 5G4EA 4NZ5A 3M0YA 3KRUA 4QSFA 1EPVA 2DW6A 1T6MA 1R5YA 3NGJA 4YHEA 3CGTA 3H2CA 3FFSA 2X7VA 2VFIA 1OC7A 3DHUA 3M7SA 2O9OA 3ZJ8A 2VENA 4DXKA 3ARUA 4EP8C 4U10A 1ZCCA 3QR1A 2ZBTA 5D9NA 1CWYA 3PM6A 2WSPA 2VVNA 3NL2A 5CJNA 4L6DA 4O28A 1I9CB 4NUWA 1LBFA 2GGGA 3PUEA 4LAZA 4GX9A 2CBIA 3T1GA 1ISWA 3GXDA 4TO8A 5XIMA 2G8ZA 1LUCB 5I09A 3TONA 3CTTA 2QCDA 3FV9A 4EXAA 4FNRA 3SUWA 4NQ1A 2A7RA 4OWGA 2OO0A 4GXWA 2FKPA 3HG3A 2QDDA 3NZQA 3NNTA 1ENUA 3LRLA 3WH9A 2WHJA 2PDXA 4J3TA 5DFAA 1J2WA 1UZ4A 1VEOA 5D30A 3MSDA 3ABOA 3W2JA 3GFXA 3CXOA 1KKRA 4H9ZA 2I7GA 3AIBA 2BOEX 2W67A 1UKPA 1M01A 1PTDA 3SY8A 2QT3A 1R3QA 3LA4A 1L0PA 3M5YA 3EBVA 5IHRA 4IQDA 1XLCA 2VDHA 2PDWA 3GNRA 3QJAA 1RD6A 2OYKA 4IICA 1B4EA 2Q71A 2FTYA 4M29A 3W1QA 5J5DA 2P76A 3EOEA 4US6A 1H0GA 1XJBA 3KBNA 4JTFA 1THFD 4ZB5A 3B9NA 3PJTA 2YYUA 3VXGA 2VEKA 3H2AA 3CV7A 1XLHA 3TA6A 1LG2A 3ELFA 1GORA 4WSHA 5F1UA 1LUCA 1XYZA 2QYGA 5I3KA 3MTWA 4XBKA 4D8AA 2W92A 4S38A 1EEXA 2F2KA 2J7BA 3FS2A 5AC8A 3SGZA 4UZSA 3CYJA 1OGBA 1OFAA 2ZE0A 1HO1A 2VRJA 3A9BA 2WC7A 3DDMA 4YTUA 1S38A 3C0SA 4O19A 1MO0A 5HQEA 3QHNA 4J1OA 2BLEA 5C7HA 1AJ0A 1A5OC 5D04C 1PIIA 5M1TA 5EL1A 2PTZA 4FIQA 2O56A 4ES4A 1F6YA 4N4QA 1VPQA 1PKMA 4I5XA 2VUYA 4RKAA 3LCIA 3U2EA 2PDBA 2QLYA 4HCDA 5BXSA 2XDFA 5DN1A 1G4PA 4JQAA 1EJUC 3UZJA 2BY1A 1XPGA 1NQ6A 3G6LA 1OFPA 4KCUA 1AUSL 2Q6ZA 5D9MA 5BZAA 4N9CA 2IKJA 1KCXA 1EGVA 1ZS2A 3WLJA 2WM0A 3MUXA 1A0EA 3V5FA 3T9PA 2DZSA 4RLIA 4GPNA 1JYNA 3VZYA 4CCDA 1JDCA 2J7FA 4JN6A 2PDUA 1HJWA 3GWQA 1RVGA 1VF8A 3G2GA 4OTKA 2VEIA 4LX4A 2HROA 4D6FA 2GQ3A 4K68A 3WLTA 4ENLA 1E6ZA 1JZ8A 3QLDA 2J9XA 4TX9A 1A49A 2NSOA 1EO7A 4JTCA 4HHMA 1DJHA 8A3HA 4LH8A 2XIQA 3L67A 1PB0A 5JU6A 3U2CA 1QI4A 3JU2A 1FWNA 3E96A 5GJPA 5CAHA 1AVAA 3R1ZA 3WF1A 3A4WA 4ZQNA 1HUVA 3EDDA 3PBGA 3CHFA 4E2OA 2ZX6A 3VMOA 5B7ZA 1UG6A 3SR7A 1QNPA 3BJFA 3ALFA 1QHOA 4B2DA 2X09A 3VNKA 2IPWA 1UZHA 1XLGA 2O9PA 4PSPA 3FAWA 3SUSA 1TFVA 1J0KA 4UTKA 2P53A 4HTBA 3HN3A 1AQFA 2J88A 1EQCA 4HP5A 4DRSA 3FX4A 5CC7A 3ZYZA 4NZ3A 2OCZA 3CHCA 4YTTA 1YYAA 3TKFA 2VKZG 1KBLA 3LSCA 3P2VA 3IK4A 4H3DA 1OT2A 3V0TA 2F38A 4IMCA 4LVBA 1Z3NA 3VDAA 4NXSA 3NR0A 1EXBA 4LW7A 5FF3A 2VX7A 3D3FA 3QSRA 1JVNA 1R3VA 1W9UA 2YXXA 2V5DA 3LRMA 2GJXB 4Q32A 3L0GA 4UR8A 4GXMA 2NZLA 3F4NA 2G0WA 3L66A 2X05A 4QJ3B 4LBRA 3APGA 2B31A 3SQLA 2SFPA 4XBJA 4FNPA 3REQB 2FZNA 1UA7A 3I3BA 3L0KA 3O15A 3WFAA 3K30A 1KWKA 3RCNA 1R3RA 2Z29A 1I60A 1XCWA 1TJ1A 4RDWA 2ZXDA 3GXPA 1TJRA 4AVOA 3ZWTA 2DZPA 3OGVA 2OZ8A 1NEYA 3HZ3A 1H7OA 1XDLA 2CWXA 3BLPX 4HSNA 1V5XA 3V3WA 2EJ1A 1TA3A 1E15A 2DSWA 2BMBA 1TTJA 1G67A 1IXNA 2P0OA 1DE5A 2WNNA 1L6GA 3LHZA 4EPKA 2QR6A 3N2CA 4JKMA 5CZ0A 3LRKA 3VNYA 5JBDA 2QAFA 4K8HA 4Z0JA 4TR9A 4C6OA 4HA3A 4MJMA 2QCNA 4F0HA 1WZKA 1TPC1 3WNMA 1TZ9A 4S3AA 2C13A 2WVVB 2NQZA 3IAPA 3LG3A 2PDYA 1NWTA 2XIOA 2QIWA 4C7FA 4AEEA 1TPFA 1E73M 3D3AA 3GBEA 4IH3A 1UW9A 5C2CA 1SW7A 3N25A 3LPPA 5EFDA 3AS1A 3HGRA 3U57A 1JUBA 2HXUA 5K9DA 3RX4A 2PA6A 3CMGA 5AB3A 3U7VA 3UF9A 1R2SA 4Y9MA 5CCZA 4YU1A 3C61A 8XIMA 1F4HA 4EXQA 4O1AA 4MWAE 4Z2LA 5DT7A 1I2NA 3W6YA 3XIMA 3HV9A 4PSRA 2Y7DA 2IMRA 5JH2A 1EGZA 1KXQA 4M81A 4HSOA 4JIEA 3RUBL 1X1OA 2B81A 4Q4MA 2BXZA 3VIJA 7ODCA 3UPMA 2D22A 3DYMA 1XRFA 2A0NA 3U4FA 3RO8A 3ZS4A 4D6IA 1H41A 4IGSA 1BYDA 2B7QA 3A24A 5HUOA 4LCQA 4OV4A 4LBUA 1J8VA 3VPLA 3HO8A 1YEYA 4N02A 5DANA 3AAMA 1EF3A 2A5HA 3W76A 4IHCA 2CCRA 3N4AA 3POHA 4JNZA 3W01A 1EB3A 3NAVA 1E1FA 1XF0A 3HFYA 3NIYA 4PUUA 1K7FA 1E4LA 4L4OA 3AIUA 3WLRA 4IZGA 4IIFA 4HCLA 4EIVA 1ISYA 3JR2A 1M1BA 2YB1A 4UMAA 1YDOA 2XN0A 1MW2A 4MJZA 2HCVA 4E8CA 1A5UA 2X2YA 2NX3A 2L5HA 3CH0A 2PLKA 3OQ8A 5J5RA 1Q7ZA 2I57A 3GIYA 2Z1VA 1KFBA 2OEMA 3S47A 2ISFA 1SVDA 2HV5A 1JPKA 1H2JA 2OEKA 3B05A 4KCTA 1EX1A 4HN8A 5XIAA 3EWYA 3UETA 1DIEA 2E4TA 3ZLFA 3QR0A 4GCAA 5I0DA 2PPGA 5BU6A 4H01A 2YIHA 4J4KA 3KE0A 1BWVA 4ZODA 3KBSA 1BVZA 1W5QA 3WF0A 3W7CA 3NQ7A 4HZ6A 1TWIA 3HFTA 4DJDC 3VGGA 2OGYA 2VQUA 3SIZA 1Q6GA 2C6QA 3W87A 2QGHA 1ONEA 4EWJA 3NQVA 4DEFA 3GKFA 4ZCWA 3ITOA 2GWNA 2X1UA 4FXJA 4LCSA 1UR3M 4G9PA 1RJPA 3GTXA 4OBSA 5HMSA 4L6HA 3SBFA 2WMGA 4EPEC 4UB9A 1AG1O 1LWJA 1LF1A 3WF2A 4YN5A 3RGTA 1G94A 1X8FA 2CYGA 1MW3A 1GVOA 1W37A 3S1VA 4PL1A 5LNWA 1C9DA 2CESA 1AH4A 4RE3A 2VC6A 2GK1A 3AIVA 4HCHA 4WR3A 1N55A 5K2ZA 4H19A 1XQLA 1F3TA 1EX5A 5KINA 4PUKA 1K3UA 4NJJA 4UIOA 2MUCA 5HDRA 1A5SA 5DXXA 1E43A 2BHUA 4EE9A 2YL8A 4JTSA 4J35A 5AHMA 4D6EA 1IXQA 5D9OA 3UGVA 3MU7A 1HN1A 1FHDA 3VKBA 1CI1A 2EEXA 3S1UA 3PK7A 4LUIA 3CUFA 4TMBA 4M7SA 1J79A 1GTHA 3OIXA 3MMTA 3GRIA 4MTVA 4UTWC 4QE4A 2CERA 3QC0A 2D2GA 4A8RA 2GDQA 3G1HA 4GCXA 1W1IE 1Z44A 2QDGA 3S9IA 1DJGA 3R8RA 2P1FA 4XZBA 1B57A 1WO2A 1XH2A 1OEPA 5G2HA 1WPCA 3OBKA 1WUFA 1TPB1 3CQHA 3GTHA 1KW1A 3BAXA 5TD4A 2ACRA 1OIFA 3TC6A 1Q7MA 3T7VA 3FYOA 4QG9A 2PDJA 1T5AA 2IKHA 1CNVA 2PP1A 2ZICA 2BX7A 1SSDA 2PODA 3ZT5A 3WQ4A 1VHNA 3W75A 3MVIA 3CWOX 3W53A 4HKPA 2OLAA 3NXFA 4E6MA 1V93A 3UXLA 3AO0A 1XLIA 1Y5WA 3MP4A 5F4SA 2EPKX 1V0KA 4D6JA 3TSBA 2A3BA 3A64A 3PZOA 2AQVA 4Q3MA 2D24A 5A2BA 3ICJA 1WXYA 1SFJA 3W9ZA 4CU8A 3QHMA 5CSRA 5A6BD 3C2VA 2ZDSA 4IGHA 4O4WA 3V0SA 1KCZA 1EDQA 3L2IA 3UPWA 3TXVA 1UWQA 2E77A 2VL4A 2PWUA 4O1CA 5IBXA 4JX4A 4H8NA 1CLVA 3FGCB 3TQPA 3CO8A 1UUOA 4MYAA 4Z2KA 4C1NB 2V0TA 4UFHA 3W27A 1EJRC 1K03A 4AH7A 2VFFA 3SUUA 4V1XA 3BGAA 3VA8A 3TJIA 4HZ7A 4LJ3A 4OECA 5TAOA 3N4EA 4E5TA 2RDUA 4MNLA 3H53A 3ZVHB 2GZXA 1NSJA 4H6KA 1C91A 4JL2A 1E1EA 2FJUB 2VCCA 1JQVA 1DWJM 3AUJA 2OFJA 3MDWA 4DBEA 3UA4A 1D9EA 4ZQMA 2PMQA 3H7UA 2R82A 1CXHA 5CZTA 3PZGA 2VEMA 4MLRA 1VRDA 1TPUA