3UWQA

1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
229
structure length
222
Chain Sequence
b'NDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPARRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.80 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961 in complex with uridine-5'-monophosphate (UMP)
rcsb
source organism Vibrio cholerae
molecule tags Lyase
total genus 77
structure length 222
sequence length 229
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3uwqA00
2V0TA 1KLZA 1FWNA 4BFAA 3W7RA 1M7OA 2VEKA 1NAL1 4YMZA 3QW4B 4I7UA 3G1DA 3VNDA 1W5PA 3MJYA 3E12A 3W88A 1JJKA 1T96A 1QPNA 2X30A 2JGYA 4IXXA 5D30A 3W7EA 4HT3A 1ONRA 2PE4A 4LC8A 2C19A 4LS1A 3L9CA 3O63A 2QJIA 1VR6A 3S1UA 1SSGA 4M6QA 1TREA 1W5NA 4UTKA 3OBKA 1RVGA 2DORA 3VFLA 2PRLA 5HINA 3EWBX 3LRLA 1OF8A 3DH7A 1H7OA 1RQHA 2V82A 1TMHA 2A4AA 4FF7A 2ZZ5A 4AWSA 3L65A 3CWNA 4BI7A 3TSBA 1SW0A 4YWIA 1K03A 3TIMA 1H63A 3UY7A 4CNOA 3W73A 4Z1AA 3BW3A 3W87A 1I45A 1T8XA 3BK0A 1A5CA 3L0KA 1FBAA 2ATMA 2WSYA 1U5JA 1UJPA 3IVTA 3TA6A 1NF7A 4JTHA 1JVNA 1KFEA 4M6PA 5BMWA 4CLMA 5L6UA 2YZRA 3UYCA 3PUOA 3BO9A 2GOUA 3PBUA 5HMSA 3TQVA 3G8RA 1FY6A 2P1FA 1MEHA 2QCDB 3W7MA 1Z41A 2WJZA 2WNNA 1OJXA 3NQ7A 5KZMA 1OFPA 3WFAA 4ICNA 3LCGA 5D03A 1GG0A 5HWNA 3N2XA 5DN1A 4UMBA 1UB3A 3C0JA 1OX5A 4FNUA 5I3IA 1OFQA 4O1AA 3RLUA 1X8FA 3B8DA 1F7BA 1H5YA 3HIJA 3VE9A 4M6VA 3L5MA 3GK0A 3B0UX 1ZALA 3SZ8A 1VLIA 3TSMA 2VC6A 5AHEA 1IGSA 2ZRUA 3HGRA 3BGJA 4O4VA 4JDYA 1GWJA 2ZBTA 3LCFA 4DELA 1XBZA 1HFBA 1AG1O 3IVSA 1VJIA 1F73A 2NLIA 3DKLA 2NX1A 3LDVA 1ZENA 3C61A 4UTLA 4XTIA 5LGXA 2J6XA 1B3OA 3M9YA 4ZQNA 4K8HA 1FDJA 5EBUA 1OX4A 2V9DA 3W1AA 1EPXA 5DXXA 1TTQA 4EWND 2W0UA 1LDCA 4WUIA 4MIMA 2BXVA 5HWJA 1N8FA 4ZZ9A 3SIZA 2ZTKA 3W2LA 3N9SA 4I7WA 3LXAA 1LRQA 3R12A 3KRUA 2CLLA 4O11A 2ZZ3A 2HS8A 3GNDA 4Z0JA 1DQXA 4QITA 3TH6A 1OX6A 3CTLA 3W9ZA 2A21A 2Y89A 5EA9A 5HR6A 2NWSA 4WJEA 4NXSA 4N9CA 5F2LA 2HTMA 2EAWA 4ML9A 3Q94A 4JEQA 5MHBA 3C56A 5HWMA 4RLIA 4TMBA 3W2JA 5I3GA 1A50A 2ZZ1A 3EEGA 4K38A 1OVDA 2ZRXA 3PBWA 4FXSA 2YYUA 3Q37A 3LCLA 4WQ6A 1KFKA 1W54A 2B7PA 2OT0A 1RQEA 4LU0A 2C18A 3QEZA 5LNRA 1KBJA 2A85A 3BVJA 2WPBA 1WQ5A 2W79A 3W74A 1FCUA 5AC8A 3QRHA 3M5ZA 1GQNA 3IRDA 2DZPA 4K39A 5E93A 1JCNA 4UFMA 5DCDA 1W3TA 4FNQA 1DOSA 1Y0EA 2YFNA 2ZZ2A 4GXMA 3NVTA 4GJ1A 1QOQA 3CPRA 2ZRYA 1S3HA 3ABSA 3HG2A 1SW3A 1OYBA 1K8XA 1CX9A 4U4MA 2ZFAA 2QKFA 3IV3A 5K9CA 3MHUA 5EKYA 5HJLA 4BR1A 4A21A 3NQVA 1VCGA 3KAOA 3MO7A 3F1QA 4X9SA 4O57A 4XBKA 4B5NA 4CCDA 1OFBA 1G67A 2VFIA 2VEPA 3G22A 4PFMA 1GPWA 2ZRWA 3T55A 3LCHA 1EEPA 1GVFA 5D2VA 4Z1BA 1MXSA 3THAA 1GVRA 2Q3RA 1J4EA 4UFKA 1H7NA 5IBXC 4QSHA 4IGHA 4OV9A 3PUEA 2NUYA 3R2GA 3TV8A 3NA8A 4JYFA 2TSYA 1PHQA 1N55A 1Q3NA 5EPDA 3N3MA 1DJQA 3P7YA 3Q2DA 1EIXA 2E68A 2A7NA 3ABRA 2VEIA 4ZMGA 4BF9A 4NVTA 4GUFA 2AQWA 3NXFA 1KTCA 2IQTA 3IIXA 1G4SA 1WA3A 1VGAA 4J9JA 4O8RA 4UTWC 3FA5A 1ME9A 1PV8A 3E02A 4DEFA 3PSWA 2BX7A 3O1NA 3M16A 2NV1A 1Z44A 3NZRA 1XUUA 3W7GA 1LBLA 4LV9A 2ZCGA 3TROA 4CQ8A 1UUOA 3C3NA 4BWLA 4FIRA 4JY8A 3BLFA 4LNYA 2FJKA 3NPUA 1VYSX 1L6SA 4JN6A 3DHDA 1TPH1 3DHFA 2BTMA 2X2GA 3IGXA 1S5WA 3TJLA 1VLWA 2YX0A 1FUYA 2EGZA 3PWAA 1WBJA 3NL3A 4Y8FA 3FFSA 2HS6A 4GWEA 1TPFA 4GNJA 1L2UA 1VRDA 3DI0A 3N14A 5H91A 3W2NA 5FESA 5LNSA 1NVMA 2NX9A 3GDLA 3TXZA 4XZ9A 4O28A 1LBFA 4NX5A 3I7SA 4A2SA 4WZHA 5DELA 5CZ0A 1QR7A 2H6RA 4O15A 6TIMA 1DORA 1LTDA 1O5KA 5HR7A 5DY3A 5C54A 3C2FA 1LOSA 8TIMA 4JS3A 1TRDA 3W7NA 1ZHAA 1I2RA 2FPYA 4YCOA 3P61A 2ZDRA 5KTLA 1WXJA 4WY0A 4PL2A 1G69A 3O16A 4CCEA 2E6YA 3DENA 1LBMA 4MY9A 4N9EA 1SSDA 2WV8A 1TJRA 1YPIA 4TU1A 3ZR4A 4ZQOA 4BK9A 2FQIA 2H8ZA 1HO1A 2X1SA 2Y61A 2HMCA 3HG5A 3T40A 4RR4A 3OVQA 2RDUA 4C1LA 3U8GA 3B0PA 3L66A 3WK0A 4O19A 1J2WA 1DL3A 2NX3A 2QCMA 4JXCA 1Q6RA 2P10A 4M5PA 3CEUA 4ALDA 3PUDA 2OMAA 4O12A 2ZZ4A 3LRKA 3QSTA 2Z6IA 3MI6A 3OIXA 3DGRA 4P61A 1EUNA 5C6MA 5J5RA 3CHVA 3OHIA 1WV2A 4N9BA 3E0IA 4Y9AA 4QNEA 5CPLA 2ZZ6A 3GXTA 3G18A 2Z6JA 4M7TA 4ADTA 5LNWA 2B7QA 3CIWA 3ATZA 3MP4A 3OVPA 3QPYA 3NPWA 3MBDA 5A5WA 5TQLA 2Z2UA 4IX2A 4TX9A 4ZQPA 1ZAJA 3LCXA 3DFQA 3W6YA 3GAYA 2Q8LA 3GR8A 4XUGA 1RQBA 1DVJA 3M5YA 3GAKA 3MW7A 3OG3A 1KFLA 3RU6A 2Z0IA 2B7OA 3P80A 1B57A 3W7QA 2ISWA 3B05A 5D37A 3DFNA 3HJZA 5LZLA 7TIMA 2Y85A 4EF8A 3R8RA 3V75A 1S5VA 4AAJA 4H6KA 1UBSA 1U83A 3G1XA 6ALDA 4MZYA 4LT9A 1UUMA 3M0ZA 4LTSA 3TAKA 2E6FA 2W6RA 5D32A 2V8ZA 4MVAA 1YXDA 3TKFA 1K02A 3ANYA 3O8AA 1FXQA 1Z48A 3E96A 4JX6A 4N6FA 4NJKA 3W1TA 3G1YA 1QO5A 3S5ZA 1JULA 1FQ0A 1AK5A 1VYRA 3LHWA 4LS0A 5CGQA 5F4WA 4FX8A 4X3ZA 3W7IA 1OF6A 1BWKA 3G1VA 4LY8A 1KM5A 1GVSA 3W75A 2WNZA 2A6NA 3YPIA 3QW3A 1EWDA 2QDHA 4NNBA 5KMYA 4OBTA 2CLKA 3NQCA 4LVFA 2CLEA 3BG3A 1A53A 2XN2A 4UC5A 1EP2A 3HG3A 4DXVA 3M41A 3LHZA 2DJLA 3JR2A 2YYTA 4MFEA 3V1PA 5I3KA 4KFNA 1GTEA 4IJBA 3PAJA 4GFSA 4MFDA 3LHVA 2CWNA 2TPSA 4GUHA 1ICSA 1KV5A 2JBMA 1KA9F 1W3NA 1QNVA 1YXYA 4XKYB 4IWWA 2VFHA 3MI3A 2RDWA 2X1UA 3PS7A 3DAQA 2DZUA 4NU7A 3RNDA 1SUXA 4RZ5A 1TPVA 4X2RA 1IF2A 3O6DA 1X1ZA 3LI0A 1W37A 1JQVA 1PL9A 2Y62A 3A9IA 1P0NA 4O52A 1TB3A 1KM4A 4MYXA 1QPOA 5BOOA 2Y7FA 1L6YA 4Z1DA 1R30A 2PCQA 4ADUA 3P82A 3FKKA 2C3ZA 2R91A 2FDSA 2XN0A 4S2CA 2VELA 4WY0B 5EYWA 2GVJA 3TR2A 3M1ZA 1YTEA 1WDWA 5KZDA 3G0SA 2QCFA 5FF2A 1Q6QA 1G4PA 5BMXA 4R53A 3M43A 4HPXA 4ZQMA 3TX9A 2YDAA 4PODA 3C2VA 4Z1CA 2FTPA 5D2YA 5K9XA 4RKAA 2YFOA 3MP5A 3G3DA 2QDGA 4AF0A 3HF3A 1D9EA 4MY1A 3UQNA 2GVGA 3WJZA 5D33A 3QFEA 1ZAHA 1QPRA 2AAMA 2CZ5A 1Q45A 3BG9A 4JTTA 1DKWA 1H60A 3VE7A 1TCDA 5AFDA 1OHLA 3W3OA 1BTMA 2FFCA 4MJMA 3LCWA 5D2TA 3LTPA 3E9AA 2ISVA 1XM3A 3P84A 1H61A 4JGDA 4KWWA 2E5CA 4IMGA 4JTUA 4AMAA 1QOPA 3T78A 3P5ZA 3S1WA 1DHPA 3QQ0A 3W2MA 2FB2A 1P5BA 4O0KA 2R8WA 4N4PA 5C5YA 2QUUA 3EKLA 3L21A 3TMQA 4QISA 4EOUA 3NO5A 1TV8A 1YDNA 3VI2A 3HBLA 3KFTA 3FS2A 4LC6A 2GQ9A 4AEOA 3W7HA 4UTJA 1W5MA 2I14A 1WOBA 2CLMA 3HGOA 3LLDA 1GOXA 1TTJA 1TYGA 4N2YA 4FO4A 4DQWA 5BRBA 3I7QA 2CLFA 3GLCA 4MY8A 5G2HA 2PURA 4PCFA 1QAPA 1SW7A 3SSJA 2QCNA 1I2NA 5D02A 1I4NA 3QSRA 4CNNA 5FF7A 1S5TA 4OU1A 1FWWA 3L5LA 3CC1A 4LWWA 3PC0A 2QAFA 3L68A 3NAVA 2AGKA 3IIOA 4IQLA 2J27A 4MUZA 2UV8G 5C2XA 3N73A 1YTKA 1GEQA 4IX0A 3W1UA 1GYNA 4NXKA 4LV4A 1KW1A 4G1KA 2WQPA 5IBXA 3GXNA 3SR7A 4UNKA 2H3DA 1O4UA 5CPMA 4JY9A 1JUEA 3W1QA 3GXPA 1ZFJA 1H1YA 1TO3A 4UR8A 3FJ6A 3M7WA 3W2UA 1W1ZA 1ZY9A 3TU9A 4UTWA 4Q4KA 1VHNA 3HB9A 2Y88A 3GNNA 1FDZA 3LBCA 3TJXA 3FYOA 2ABBA 2I9EA 4UR7A 2E6AA 3AO0A 1F6KA 3M5VA 4CNPA 3R5EA 1FCVA 1TPC1 5HNRA 3C52A 5G2WA 3GDRA 4K7YA 3LX9A 3N2MA 1EX5A 4NUWA 5AOUA 4X22A 1KFJA 4Y96A 1ICQA 4HN4A 5DLCA 3W84A 3BGGA 1DJNA 3TDFA 3W1RA 1LLWA 1I8JA 1K7EA 3PBVA 1WX0A 3LHYA 3M6YA 1I2PA 2CLHA 1H1ZA 2GPTA 3ZFHA 2NUXA 4RCXA 2HSAA 1SZNA 4FEZA 2JK2A 3BW4A 1ME8A 5F2MA 1TQJA 3KRZA 2V5BA 2ZA1A 4FB7A 5D2XA 3NM1A 1GYLA 1RV8A 4NZJA 4O50A 3OEXA 1QPQA 1PCWA 4IMDA 1ICPA 1SU5A 3PULA 5CSSA 3RFAA 4MLJA 3A21A 5G4WA 4R34A 3ATYA 1VS1A 4HSNA 4GE8A 2Y70A 1EP1A 3QZEA 3TFCA 2GQ8A 3UZ5A 3IGSA 2OCZA 4AHOA 3G1AA 2A0NA 4XTDA 3HG4A 2QR6A 4MYAA 4W9TA 4NJIA 1QCWA 3IIZA 3TE9A 3P67A 2FLIA 3O07A 2QEZA 3LGEA 4IPJA 1AW1A 3W76A 2A1YA 4OV4A 1YDOA 1T99A 1SO5A 1ADOA 1SZFA 4A3UA 5BNKA 1XDLA 1SQ7A 3DFPA 4ADSA 4ZL1A 1UCWA 4JTSA 2C16A 1K7FA 1TPUA 4O13A 1Q6LA 5H2ZA 3W7CA 4JX5A 3MI2A 2NWRA 3THQA 3QMSA 1XBVA 1F76A 3EWWA 4AHPA 3GIYA 4EVZA 2E5BA 2DZXA 1SFLA 3W22A 4N02A 4PL1A 3UWYA 3KRSA 2C1HA 5G1YA 5K2ZA 4NNCA 1AL8A 3W1NA 2CFFA 4Q32A 3GDTA 1TTIA 5CZTA 1LM1A 2EF9A 3NQMA 5K7JA 3S5YA 2V2DA 1KBIA 3CWOX 1OABA 3KVMA 3O05A 3G1HA 4FNRA 4Z0SA 4A22A 1QO2A 4YCPA 3C6CA 1AW2A 2VFGA 1VYPX 3PBYA 2ZZ7A 4EF9A 1W56A 5AN7A 2B4GA 2RDTA 1IIHA 4UTTC 4QNWA 4E2BA 1YLVA 2BZNA 1H7XA 1GT8A 3PB2A 3ABQA 3SI9A 4HNUA 1HG3A 2ABAA 2YPIA 5F2IA 1F5ZA 1W3IA 2I1OA 5AB3A 1OX4B 5AHMA 1GTHA 5CZJA 3UPWA 1IXQA 3LOTA 3BARA 2R14A 1R2RA 4YL2A 3W7JA 2EHHA 2J9ZA 1JR1A 4FNTA 3QPZA 4O1BA 4DPQA 1H7PA 3ZS4A 3MYPA 1W5OA 3MWAA 3RMJA 1B4KA 3EX6A 3LB0A 4DBDA 1FWSA 3NQFA 4PTNA 3PVFA 2BSLA 3UY8A 2RH9A 3PM6A 3DZ1A 2B0MA 2QAPA 3SECA 3LM7A 2YCEA 3EX3A 1SFJA 4FIQA 5EMUA 3TSDA 4XBSA 1ML1A 2NUWA 3F03K 3KVJA 3LTSA 4QJ1A 1KTNA 4N4QA 3N34A 3JS3A 1CI1A 1TPDA 4GRSA 1AL7A 3QQ1A 4JICA 1GZGA 1MZHA 4O16A 5HQEA 3TMLA 4A2RA 4YXGA 1PHWA 5TBOA 2C15A 2ZA2A 4LS2A 3LBMA 3S5OA 4K6AA 3P8JA 3DI1A 4K7VA 4WOQA 4O14A 3BPWA 4JIQA 4UCGA 4IMFA 1LORA 4S1FA 1VCFA 1C8VA 2DZVA 3L0GA 3QMRA 3UXDA 3DU0A 2ATSA 4RZ6A 4K37A 3CIXA 3QYQA 4C1KA 2C6QA 1W5QA 1L6WA 5F4XA 4LVBA 4GC4A 3HPSA 3B03A 3M44A 3A5VA 2RFGA 2G5WA 3GKFA 1WOAA 2J24A 3DFSA 1LOLA 3I68A 3NL6A 5C55A 4FX7A 5K4XA 2A7PA 3FOKA 3H53A 4Q33A 3HGJA 3PB0A 5T26A 5EL1A 1VZWA 1NF0A 1NSJA 3FEMA 3QC3A 1PIIA 1XDMA 2OZ0A 3A23A 5FEZA 4O10A 1IIGA 4FHAA 2A5HA 4NJGA 2NXGA 3TCEA 1M5WA 3WJYA 1F6PA 3NZ1A 4CCCA 3TUUA 4WXYA 3KHJA 3EXRA 4O1CA 3NDOA 3TAOA 4JIPA 2OT1A 3P74A 2PRMA 1R46A 3SFKA 3W72A 3GYEA 1WAUA 3HGSA 4HPJA 3L5AA 3RF9A 2QCGA 1DV7A 3CT7A 5DBUA 2E1DA 2V5LA 3S5NA 1B4EA 2WKJA 3QMTA 4GUIA 2CZFA 1XL9A 2GVLA 4TMCA 2Q8ZA 3QH2A 5FF0A 1YTDA 5AC7A 2Q3OA 4NX0A 3OVRA 1X1OA 3HPZA 1A5AA 4H4IA 3F4NA 1XXXA 3PSVA 3LI1A 3INPA 5D04C 3W07A 3PG8A 2GJLA 1SZGA 1NEYA 2G95A 4O18A 2DJXA 4KWVA 4HIBA 5G4EA 3WK2A 3C4UA 3LXBA 1IXOA 2C13A 3USBA 2QCEA 3AJXA 4JNMA 3CQ0A 5D05A 1V5XA 1KM3A 4ONVA 1LLZA 2VOMA 3U2OA 1A5SA 3LHUA 2EKCA 3EX4A 3G3MA 5J5DA 2FPVA 1WBHA 2D73A 3NQ2A 1FXPA 1SO4A 3TQ0A 3WK1A 4E0CA 5LGZA 1Z42A 1OFOA 2J9YA 5TIMA 3FLUA 4POCA 4QM1A 1M6JA 3LHTA 2VFFA 4O4WA 3TC6A 1JCLA 2JKAA 1VQTA 3O06A 2EPHA 3G0UA 3FIGA 4DF1A 1E51A 2H90A 3UPBA 4UTMA 3CM4A 2TYSA 3EB2A 3LCIA 4UTIA 3LV5A 4LVAA 4PC8A 4WD0A 5KSWA 1KV8A 4YLWA 1H50A 5CPOA 3S0CA 1OFAA 1GVOA 1OK4A 1A5BA 4JTFA 3S1XA 2CLIA 4OWGA 1X6UA 1TV5A 1W31A 2WNQA 5LHEA 1I2QA 2CU0A 4MZ8A 1YADA 1LCOA 5GVJA 4JTGA 2F84A 1PS9A 1JRCA 4JDBA 1JRBA 3GR7A 1FCBA 1H62A 3M5XA 4WX2A 4IXHA 3NQAA 1JCYA 2QJGA 3QM3A 4E2DA 2VFDA 2DZWA 5FF4A 2X16A 4JR5A 3RK8A 3MBFA 4NJHA 1EWEA 4UMAA 4DF2A 3BW2A 3W7DA 2NXHA 2DZTA 1GJPA 1MEIA 2NV2A 3I7RA 4MOZA 5LNVA 5HUPA 3UWZA 4LVGA 4DPPA 3I6RA 4KFOA 3S1VA 1G6CA 2E77A 3CU2A 3KXQA 5F4SA 2A7RA 2QJHA 3O15A 1D3HA 4IUOA 1AW5A 1R47A 2E09A 2FB3A 3LRMA 4LUJA 1GG1A 1OK6A 3MHFA 4RXFA 2Z1BA 4AHQA 4JTLA 1K7XA 2A2IA 4CQAA 1JCXA 3NR0A 3GDMA 3STGA 3W7OA 3QF0A 1VHCA 2OJPA 2Y7GA 2ZTJA 1W0MA 2QUTA 4LVDA 2JKEA 4L4MA 4LOCA 4HNTA 3W7KA 5G2IA 4O53A 3C2RA 4O0ZA 4D2JA 3NM3A 4UFIA 3MP3A 2J9XA 3GDKA 1RR2A 1XBXA 2Y6ZA 2BLEA 2WO5A 3TNOA 1RD5A 3KVLA 1MO0A 3GX9A 4K36A 1YDVA 4FNSA 1UASA 1LROA 1JUBA 1H7WA 4JTEA 3ZWTA 5U7SA 3HOJA 3B4UA 3W86A 5F1VA 4LW7A 4N9DA 4HNVA 4BI6A 3L2IA 2XFWA 3L67A 1OFEA 2CZEA 4OE7A 1JCMP 3S42A 3UZJA 1J5TA 1H7RA 2WOQA 4IPIA 2CLOA 2Y7EA 1KM6A 3CLMA 4IMEA 3L0NA 4K8EA 3MHGA 1VC4A 3A5FA 3NPVA 1O95A 2FIQA 1R2SA 1BWLA 1PE1A 4HKPA 1KFBA 1EUAA 1TQXA 3GKAA 1LOQA 1VH7A 2OX1A 2E5DA 2V2HA 2YW4A 3VCRA 2V81A 4UFLA 2ISSA 1ZJIA 3SGUA 4O17A 1MEWA 1YXCA 4MZ1A 5AHFA 3W7PA 3KX6A 1EB3A 1P4CA 2FPTA 1TPB1 3O6YX 5A8GA 3T44A 4N6EA 3UD6A 2ZYFA 3EWXA 3JRKA 4ZVJA 4HHPA 4HSOA 3W1XA 3W71A 3EKZA 1TJPA 4QQ3A 1SO6A 4QAIA 5E1QA 1R2TA 1P1XA 1TPEA 3R89A 2RKXA 5DBTA 5CPNA 3B0VC 1RZMA 1I2OA 5AYXA 1SPQA 2YR1A 5FEPA 3ELFA 1Q6OA 1IXPA 3DKJA 2VFEA 4DF0A 5FEXA 5AYYA 4Y90A 2H8XA 4AWTA 3H54A 4AB4A 4WY0F 3K30A 4RXGA 3STCA 4OQVA 2NXIA 4H3DA 1XCFA 2G97A 4I9AA 4RK8A 4ORIA 5DCBA 3N9RA 1O94A 2YGYA 4UTTA 5F1UA 5LKYA 3D0CA 4RJEA 2QCHA 2PC4A 3NG3A 3S6DA 5LNUA 3U6WA 4OT7A 3NQ8A 4JX4A 1JUKA 4TO8A 1ZAIA 3SW6A 4Y6GA 1FWRA 1G7UA 3P5YA 3A22A 5BW6A 4EIVA 1KLYA 2JGQA 1V7YA 4AH7A 3WJSA 3FJLA 3P8IA 4AF0B 3MYOA 4NT0A 1QWGA 4NZFA 3T4CA 4DBEA 4MLRA 3GVGA 5G1TA 4M7SA 4NQ1A 1HO4A 1KM0A 4JYEA 1K3UA 4MPQA 2JKPA 3IGUA 4IMCA 1OFDA 1X7FA 2ZRZA 3PG9A 4UIOA 3S9YA 3IIPA 3KOFA 1CW2A 3G0XA 5D09A 1BKSA 2Y7DA 3TFXA 1SR9A 2F7FA 1GVQA 3LV6A 5AHLA 4PEKA 2O7SA 1YYAA 2O7QA 1FCQA 3NQEA 2Y63A 5AYZA 3G24A 3SJ3A 1TPWA 1DBTA 5KITA 5AC6A 5CKSA 4MKNA 4U28A 4WOZA 1HL2A 3N19B 2LLEA 3EXTA 4MJZA 4FNPA 5L9FA 3IVUA 5I3JA 3NGJA 5G5IA 1EP3A 3HMJG 4JYDA 4OHQA 3NYZA 3KVKA 3PR2A 5I3HA 2G96A 1OG0A 3G8EA 4P2VA 3SGZA 5IM51 1QDSA 2H3BA 2GQAA 3DXIA 3BV4A 4GBUA 5K3VA 4UTUA 3STFA 3UWVA 1AMKA 2ZRVA 1KM1A 1SO3A 4JD4A 4LRTA 1VCVA 1LRTA 2DP3A 1F2JA 3NL2A 1FDYA 4OGZA 4WXZA 4LRSA 1B9BA 1YPFA 1VPXA 1G7VA 2VENA 2NZLA 3FYPA 4XKYA 2X1RA 1TSIA 3FKRA 4M19A 3B04A 1QFEA 4UMCA 3ZWSA 5F2GA 1XKYA 3W1PA 1L9WA 5CSRA 1JCJA 4TR9A 3IIVA 1WYIA 1SZEA 1K8ZA 1F74A 1LYXA 1TV7A 3DBPA 3LXCA 2P0OA 2RHGA 2R94A 4UFJA 3SY5A 4O1DA 4XQ6A 5DY2A 2CZDA 1LRNA 3STEA 3EX1A 3PF3A 3LLFA 2C0AA 5DXYA 2J88A 3GZ3A 3EWYA 4CQ9A 3H55A 1ALDA 3F4WA 5E0KA 1ME7A 1HUVA 2QUVA 3BLEA 3LTYA 3G1FA 4GUGA 5KINA 5FI8A 2V2CA 1XBYA 1RPXA 3TW7A 1LP6A 1G4EA 4JTKA 2B7NA 4RV8A 2A6LA 2VKZG 1NFBA 5LSMA 1HTIA 2TMDA 3TC7A 1FWTA 2KZHA 3WJWA 3TQKA 4TIMA 4A29A 4DO6A 1OFRA 3C2EA 1DQWA 4GUJA 2DU2A 3E49A 1TRIA 3TK7A 3R13A 4E38A 2VEMA 2V30A 4XWUA 3W70A 4RZ4A 3DFTA 4UFHA 2TRSA 1W8SA 1QMLA 5CZSA 2ZA3A 1TIMA 2YW3A 5U4NA 1TTPA 2QCDA 1LZOA 5HULA 3PY2A 4BWLC 5D2WA 4IOTA 1T0OA 2PRHA 1FX6A 4FXRA 5EY5A 5AHNA 3W7LA 1O60A 2WSQA 1ZCOA 3OA3A 2GJNA 1C9DA 5FEWA 2X1TA 4NJJA 3W1MA 2BWGA 3DFOA 3B06A 5CG7A 3C2OA 3Q58A 4O54A 2QCLA 3M47A 3LERA 1JQXA 4FX6M 3O6CA 4UXDA 4HNNA 3HO8A 3BLIA 3P81A 3W83A 1PCKA 4AWUA 2C14A 3MUXA 4KKXA 4ZQCA 4BI5A 1PVNA 3W2KA 4AVFA 3W23A 5KZEA 3I65A 4UUIA 3EWZA 1G4TA 3UWWA 1XFBA 5FF3A 4PA8A 3RLVA 3UNDA 2DZSA 2YXGA 3NEVA 1F05A 5K9DA 2ZQ0A 3EWUA 3IEBA 1P0KA 1H51A 4AXKA 3GB6A 4L4LA 3WJXA 1XC4A 3CB8A 2QF7A 5I3FA 2QCCA 1KM2A 2GUUA 4S2BA 4R33A 3EX2A 4Z08A 5SWUA 3NQ6A 2ALDA 1EA0A 4PH6A 3QJAA 1OYAA 1M7PA 5AHIA 5D38A 3S8HA 5LHFA 2WSRA 4NNAA 2VXNA 1D3GA 1THFD 3C8FA 3NQDA 4ORMA 4DO5A 3W85A 4R7JA 4ZQRA 1XI3A 3P62A 1K8YA 5ABTA 1MSSA 3VKJA 4KFPA 3HPXA 3NPXA 4QIUA 2E6DA 5HUOA 3HQ1A 3NNTA 4UNLA 1KFCA 5K4ZA 3EXSA 3NQGA 4I7VA 1OYCA 3G1SA 3CEPA 3UWQA 3NL5A 3W1LA 1ZNNA 4LUIA 3WK3A 4DO4A 1O5XA 3UXAA 1XUZA 1KTBA 3UWUA 3TXVA 2CW6A 2XN1A 4JTIA 4JTJA 1N7KA 3T7VA 3TW6A 1C29A 2YSWA 4UTHA 1BEUA 1IXNA 4RX0A 3BG5A 3A24A 3MMTA 3NOEA 3P60A 5DCEA 3ABOA
chains in the Genus database with same CATH superfamily
4ZENA 3WBYA 1GOKA 1IHIA 1M7OA 1UH4A 1XD1A 3EA3A 1UOZA 4I7UA 1QNSA 3W88A 1KGUA 2PDHA 1YBQA 5CLTA 1V6YA 4IXXA 5D30A 3LMZA 2HROA 4HT3A 1FWHC 3KBWA 2PE4A 1ZGDA 2C19A 5C8BB 4LS1A 3L9CA 1VR6A 2AKMA 3WH6A 3I4KA 1SSGA 4M6QA 1TREA 4UTKA 1CTNA 3VFLA 3EZ4A 3EWBX 3OIHA 2EPNA 1Q6DA 3HU7A 4BF7A 2VX4A 2V82A 5CSUA 1TMHA 3SQSA 3R1ZA 4FF7A 4AWSA 1J11A 3VX1A 3DG6A 4EE9A 3LM3A 3CWNA 4J35A 3SCOA 4DJFC 4K1GA 3BAKA 1VB9A 3UY7A 1I45A 2Y2WA 4L4OA 2WMHA 2D1ZA 3NSMA 5A69A 4JN7A 1U5JA 4GNVA 1DJHA 2P5NA 4M6PA 5BMWA 1UR1A 3DUGA 1OD8A 1PKNA 1CGYA 3PUOA 4G56A 3TLLA 3BO9A 1W1IE 4C6QA 2P1FA 1MEHA 2QCDB 3W7MA 1Q6GA 2WJZA 3WDHA 1ZJBA 4EP8C 5KZMA 3WFAA 2G3MA 5DANA 5JUVA 4V1YA 3THUA 1TMQA 1GEHA 4FF5A 3BJSA 1KKRA 4Y2WA 3N2XA 1US0A 4DYEA 4FK9A 4FNUA 3F2DA 1Q8JA 1OFQA 2VR2A 1X8FA 2GDVA 4M6VA 4W7UA 3SZ8A 1DJIA 2CKSA 2R82A 4KBXA 2ZBTA 3W02A 1PIGA 4HMEA 5HNUA 3LCFA 3WF4A 2XFRA 3OLEA 3H21A 1BG9A 1XGDA 1HFBA 4GACA 3IVSA 1VJIA 1F73A 3A12A 2NLIA 3WH5A 2NX1A 1OC7A 3W28A 2PDMA 5LGXA 4HZMA 2FFIA 3UPMA 4ZQNA 2R1LA 5EU9A 3QR3A 1F9CA 3GXIA 2V9DA 2Y24A 1G5AA 5DXXA 1TTQA 4EWND 2W0UA 3KS5A 4WUIA 2QV4A 2D3NA 4IJRA 4ZZ9A 3SIZA 4DZIA 3N9SA 4I7WA 1JYWA 2DQWA 4CNTA 3ABXA 2FGZA 1DQXA 2VX5A 5EA9A 2Y89A 3S2CA 1UJQA 4MNKA 4NXSA 1ADSA 5MHBA 4KWUA 5I00A 4RLIA 2OG9A 4F0LA 1A50A 4K38A 1OGGA 2PGEA 3QGAC 4FXSA 4WQ6A 1OGBA 1KFKA 4FOJA 4ZXOA 2Y5SA 1CXKA 4LAKA 5LNRA 2A85A 1VFSA 3UZWA 2WPBA 4KCWA 4TVDA 2W79A 5AC8A 1EHNA 4FLOA 5E93A 4UFMA 4FNQA 1DHKA 4W7VA 1J0YA 3BL3A 3UG5A 4J4KA 4DB7A 4CVUA 1HJSA 1XV8A 3MB9A 4GJ1A 1JI2A 4Z2LA 3ABSA 2PWDA 5FACA 3IS4A 1B0IA 1FHUA 1WDSA 3H4GA 4U4MA 2BP1A 3IV3A 1DJWA 4JIHA 5EKYA 5HJLA 4BR1A 4A21A 2GDQA 4M24A 3MO7A 4O57A 1OFBA 1XYAA 5LYRA 3G22A 1SJBA 4YVXA 4RW3A 3DFHA 4PFMA 3L4YA 1UP0A 1VEOA 4Q4PA 5H8UA 4J2MA 2PODA 1JI1A 1XIHA 3KTSA 2Q3RA 4UFKA 4MJ2A 4IGHA 7TAAA 8A3HA 3Q2DA 4HN8A 2E68A 2A7NA 3MUY1 2VEIA 4ZMGA 4BF9A 1SR0A 5CAKA 2V69A 1G4SA 1PBGA 3HPAA 2DDXA 3WQGA 3M0VA 1RAKA 4A3RA 4DXXA 5ABFA 3QY7A 3E02A 5CEWA 3PSWA 3HFYA 3FXYA 2DIEA 5LIXX 2NV1A 1Z44A 1XUUA 4LV9A 2ZCGA 2GVYA 3AFBA 4KGJA 5BOFA 2OPJA 2PWGA 3BC9A 1UUOA 3C3NA 3R58A 1ZSXA 4FIRA 3BLFA 2I57A 1L6SA 4X9YA 4G2DA 4KGLA 3IGXA 1S5WA 3TJLA 3NJ3A 4AD2A 2YX0A 4U31A 3WLSA 3FFSA 3GBEA 1TPFA 4GNJA 6XIMA 4ACZA 1A49A 3W26A 3VDGA 3N14A 3W2NA 1H41A 2NX9A 1ZQ5A 1W8GA 4Q7NA 3CH0A 1S38A 5DF0A 3CPUA 3QOMA 4ZB2A 1F6YA 2A79A 4GH3A 6TIMA 5HJYA 4LCRA 3JUGA 1U1JA 4XV0A 8TIMA 4JS3A 1J12A 3H24A 1M53A 3SN4A 3MQTA 3W7NA 4DHGA 3P61A 2Y5JA 2ZDRA 1S46A 2BY0A 4H7CA 4PL2A 1PSCA 1I0DA 5DMLA 3OW1A 2YLLA 4CCEA 2E6YA 2DIKA 1AQ0A 2ZE3A 1GVEA 1EJSC 3BLKA 3ZR4A 4ZQOA 1WKFA 5AC5A 3S4TA 3OVQA 1P6CA 4S3DA 4HPHA 3VPLA 3U48A 3L66A 1PX3A 2AOSA 5IHSA 5KEZA 4JXCA 3UBPC 1C7TA 5CZKA 2OMAA 3WQCA 4KRZA 2QS8A 5E9XA 3QSTA 4RPPA 5CBIA 3MI6A 2EPOA 2OELA 2GJPA 3WDIA 1XRFA 5C0QA 2Z4GA 1KO0A 4GVFA 3CL6A 3GXTA 3VNJA 1GQKA 1WUEA 2Z6JA 1OINA 4WVXA 5LNWA 3CIWA 2P3ZA 3OVPA 1JDEA 5A5WA 5TQLA 2Z2UA 1XQKA 2WJFA 3A4XA 4ZQPA 3RGTA 1AJ0A 3LCXA 1BWVA 4Q4MA 1UZHA 2J7GA 3GAKA 3OG3A 1ELSA 4LYKA 2J4GA 3KBSA 1B3XA 1XLHA 3NSNA 1CGTA 4C91A 2VHLA 4W89A 4FAMA 1AODA 1S5VA 2QVNA 1TWIA 4QJ5B 2HBVA 4MZYA 4LT9A 3VUSA 3M0ZA 7ENLA 1EIBA 2E6FA 4J40A 4ILSA 1UR9A 4MWAD 1RJPA 4H9MA 3CUZA 3TKFA 3ANYA 1UP2A 3ITTA 1QO5A 1FQ0A 1MMFA 3REQA 4LS0A 2VCCA 1Q7ZA 4AW7A 5F4WA 1BLIA 3W7IA 1GHSA 1XSKA 3MKKA 2XU2A 4QRNA 2QPSA 1GQJA 1VEMA 4DJDD 1VJZA 3E0LA 1TJ2A 3YPIA 3KWSA 4M51A 5KMYA 2CLKA 3NQCA 3BG3A 1EP2A 3U2EA 4JFTA 3HG3A 3M41A 3LHZA 3N04A 3JR2A 3LPPA 1CCWB 5I3KA 2Y8KA 4KFNA 4GYPC 1UD4A 2PBOA 5I5RA 4GFSA 2FGBA 1X96A 4FR6A 4GUHA 1KV5A 1W3NA 1YXYA 3M0LA 2VFHA 2RDWA 2X1UA 1TJ1A 1RY0A 4NU7A 4RZ5A 3E0VA 1MW3A 4PTXA 3BQ6A 2VL4A 2FZBA 3GW3A 3LI0A 1DIDA 3BAYA 4WGXA 1V0KA 2BOGX 3U7VA 1CNVA 1YE4A 1XH1A 4FR1A 1L6YA 2V38A 4CD7A 1PZ2A 1FWFC 2PCQA 4ADUA 3FKKA 2C3ZA 1I1XA 4WY0B 5EYWA 1Q2SA 1ISXA 1EDGA 1HN1A 1WDWA 5KZDA 3CK5A 3NDZA 5FF2A 3BDKA 3PPHA 1VRXA 2WQDA 3C2VA 4Z1CA 1JGMA 4H8VA 4Q4QA 2YL9A 5K9XA 1SVDA 2QDGA 4AF0A 3HF3A 1D9EA 4U10A 2X40A 3CQIA 2ZVIA 3WJZA 3QFEA 1HJVA 2QMJA 3AQUA 1A3WA 2AAMA 2CZ5A 5D4YA 1Q45A 4DJEA 4AZ7A 2C8NA 5HAOA 3S9IA 1TCDA 2EPKX 1ECEA 2FFCA 2CKRA 4MJMA 3WQ4A 2FZ8A 3LCWA 5D2TA 3DC8A 3LTPA 4AIUA 1XM3A 2ISVA 4K3ZA 1K9FA 3UGRA 4M81A 3NZQA 3FAXA 3MV11 1CGWA 2VYOA 3W2MA 3CAKA 4O0KA 5M3WA 5C5YA 1FH7A 4KCUA 3L21A 1V02E 4QISA 1VFMA 5DFAA 4EOUA 4TVCA 1V3KA 4KCVA 4DWSD 1R3SA 3W7HA 5C9WA 1VFHA 2BHYA 1CXFA 3AXMA 4P8XA 2WZTA 2OSYA 4N2YA 3I7QA 1YEYA 2J25A 1I60A 3SSJA 1W3JA 5D02A 1I4NA 4URIA 3QSRA 5FF7A 1S5TA 4OU1A 3T2OA 2IKJA 1HKIA 2PU0A 4XG1A 1CZ1A 3NAVA 3M0JA 2VO5A 2X42A 2DT3A 4W8BA 3W1UA 2PDIA 4NXKA 3VNLA 2J7FA 1H11A 1OCBA 4AD3A 4CUCA 1E0TA 3GWQA 4OBSA 4MUPA 1JUEA 3W1QA 5EMMA 2EBNA 2Z26A 1ZFJA 1H1YA 1TO3A 4UR8A 4MF4A 3W2UA 1W1ZA 2E8ZA 3H23A 1LG2A 3GNNA 1FDZA 1JPDX 4XZIA 2QXWA 2ABBA 3N6QA 4MG4A 1LQAA 1F6KA 2Z1VA 3M5VA 4CNPA 3R5EA 1FCVA 1E9ZB 1TZZA 3C52A 2F61A 2H9AB 3SRHA 3GDRA 3N2MA 4EXAA 2GGHA 4NUWA 3OYXA 2CYGA 2OYLA 3CZLA 3QTGA 5DLCA 3TJIA 3W84A 3W1RA 1LLWA 3AUJA 3LHYA 3POCA 4US6A 2CLHA 1RK6A 2HK1A 3NQBA 4M29A 1KCZA 4U5IA 4B4HA 3BLLA 1W3KA 4F40A 1SZNA 4FEZA 4AXNA 3KRZA 1KXQA 3D46A 4FB7A 4ZO7A 1RJRA 2AGTA 1WDPA 4JIIX 1IWAA 1SU5A 2WHLA 2WHKA 4MLJA 3A21A 4R34A 3KDOA 3G6MA 4GE8A 4P8WA 4JL1A 1EP1A 3MCNA 3QZEA 5E5CA 3WF2A 3TCSA 2OCZA 3KW3A 7CGTA 4XTDA 3JU2A 1WUFA 4IG2B 1R5YA 4ZGYA 1QCWA 1YQ2A 4KWOA 2INZA 3SCUA 1RBAA 2JALA 4IPJA 3FAWA 3K4DA 3DESA 3VDHA 4QQUA 1SO5A 4A3UA 5BNKA 4GQRA 4M1BA 1O7AA 4ZL1A 3WBAA 1UCWA 2C16A 1K7FA 5H2ZA 3CMGA 1H09A 3W7CA 3MI2A 4DVOA 2OLAA 2WM0A 1XBVA 3B3DA 3EWWA 4REQA 1YW1A 2X7WA 1SFLA 1UC4A 5K2ZA 3R94A 2CFFA 2WZHA 4LFYA 4GIYA 1AJZA 1LM1A 2EF9A 4TUFA 2ASHA 2FJUB 1KBIA 3G1HA 4FNRA 5E70A 4K2SA 4XD4A 3C6CA 1VYPX 4EF9A 3WLHA 3WKZA 2BZNA 1X8CA 3ABQA 1C8YA 4UCFA 4NHVA 3SI9A 2ABAA 2YPIA 2CHNA 1F5ZA 2V5CA 1OX4B 4I9MA 2R14A 1R2RA 1KRAC 1W32A 1JR1A 4GCXA 4EAMA 4DPQA 1H7PA 2WMJA 3MWAA 3RMJA 4PSPA 3LB0A 4DBDA 2HVMA 3BSGA 3NQFA 1DJZA 3DYMA 4W5ZA 3PVFA 1A5KC 1MDRA 2J8GA 2JF6A 1RVKA 2QAPA 1XIMA 3N17A 3K8KA 3UXKA 1PAMA 4L1XA 3AOFA 2GYIA 5EMUA 1CEOA 4XBSA 1LUCB 2NUWA 1JGIA 4QJ1A 3N34A 1JZ2A 2DY3A 1CI1A 1TPDA 4JICA 1UIOA 4GGBA 2YDRA 3TMLA 2YXXA 4Q6JA 4TX8A 4YXGA 4DXKA 2ZA2A 1QW9A 1S2CA 3LBMA 1FH8A 4WOQA 2OO6A 1NOWA 4IMFA 2WC3A 3VNMA 4ES4A 2DZVA 4X0VA 1TX2A 2JEPA 2YBTA 4K37A 4ZO9A 4GHRA 3GUWA 2C6QA 4YTRA 1PKLA 4F4RA 1B3VA 2E7FA 5I09A 4EANA 1OD0A 4TTGA 2RFGA 4OTKA 4C1NA 1IR1A 1WOAA 4S3GA 3NL6A 4A8LA 1J01A 1EDTA 3ES8A 5K4XA 1MRAA 4PBFA 4V33A 3ZOAA 3AYSA 1NSJA 3QC3A 3WNMA 3APYA 4XAFA 5FEZA 5DMNA 3GZAA 1JD9A 2A5HA 2GL5A 2WC4A 3KBVA 3GFXA 1DYSA 3WX7A 4LANA 2XH7A 1F6PA 1ECQA 3TUUA 4PCTA 4MHBA 3EXRA 4LXFA 3M64A 1EHAA 3TAOA 5CC5A 3VD5A 2XH2A 3VGHA 1VBRA 2FHCA 1WAUA 1KQZA 2ON3A 2OZTA 5DBUA 2FZNA 2PBGA 2CC0A 3WEZA 4GUIA 4DI9A 2D69A 3XISA 3EMQA 4QDWA 3QH2A 4AISA 1OGSA 3L4UA 1YTDA 5FF0A 2YXOA 4IPPA 4DZ5A 4R85A 3HPZA 1A5AA 4H4IA 1GW1A 2X0SA 4EXQA 1VPQA 2GGJA 3LI1A 3PG8A 1SZGA 3UA4A 1GK8A 2DJXA 4KWVA 1EL3A 3WK2A 3C4UA 1IXOA 3USBA 4JNMA 1Y8BA 5D05A 1V5XA 4QG9A 4LCQA 2ZIDA 4ROPA 3GG7A 4AX6A 3PBMA 3LHUA 2EKCA 1BYAA 3MO4A 1FWCC 1WBHA 4GYKA 3NQ2A 3O2LA 4X63A 3GXDA 2WSPA 4E0CA 5LGZA 3SUSA 1OFOA 1PX4A 1E1CB 5A95A 4POCA 1EDQA 7A3HA 1RK5A 2VFFA 4O4WA 3TC6A 3O06A 2EPHA 1VF8A 4L9YA 4LUSA 1E51A 3E74A 4UTMA 1RALA 1U1UA 2X8RA 2BY3A 4GC3A 2TYSA 4AYGA 3WY1A 2J7HA 3H7VA 4GY0A 1TZ9A 2AL1A 4YLWA 2VGIA 3U2ZA 3UESA 2V63A 1EQCA 3UU0A 1HJXA 2WNQA 2OGYA 4ZB5A 1OT1A 3T0CA 2VURA 3B8IA 1XIFA 1YADA 5GVJA 3HQOA 5CGMA 4M6UA 3QZAA 1QT1A 3FGCA 1PS9A 1EX1A 3MKCA 3LSCA 4IHCA 1JRBA 1MQPA 3FSTA 4GD0A 3M5XA 3QR0A 4AG0A 1JCYA 1XH0A 4YYFA 5FF4A 2X16A 4JR5A 3RK8A 3WENA 3AU6A 1KFWA 4DF2A 1TV3A 2DZTA 1MEIA 1DWFM 3VX0A 3UWZA 5CG0A 4GG9A 1XIIA 1UR2A 1Z9AA 1QHPA 3RPMA 1BAGA 4CN4A 3CU2A 2BVDA 2O4MA 1KQYA 2A7RA 3L4WA 4IUOA 1F61A 4F0MA 4D6IA 4W87A 4I6KA 3EDFA 5AECA 3STGA 1OBAA 3QV9A 5BZAA 4LOCA 4Y9OA 1XIEA 3B8SA 4UFIA 4WF7A 3CV2A 3PZ9A 3IJ8A 4PEEA 1IEWA 1E3XA 3GG1A 2Q6ZA 1TKKA 3CJPA 4CQBA 1XLLA 1H4PA 3ZR5A 2J77A 3ZWTA 3QYSA 3GC4A 2GDUA 1J93A 2RUSA 3GBDA 3FCPA 1OFEA 1MXDA 3UZJA 3KTXA 2HISA 3TZNA 5E0CA 1H7RA 5FJJA 4OVXA 2Y7EA 1KM6A 3ZO9A 3CLMA 2QPUA 1BRLB 4K8EA 1R2SA 1W6TA 1PE1A 4HKPA 1QBBA 4QJ3B 1VH7A 2X7VA 4QDPA 2V2HA 4F9JA 2WYSA 2ISSA 3GFZA 1ZJIA 2OLSA 4CNUA 4ZFMA 1YXCA 4LBUA 3QV8A 5CGTA 5AHFA 3KX6A 4AEEA 4GO8A 2VZSA 4JHOA 3OP2A 3TYBA 3LK6A 3H12A 4ML4A 4Q8QA 1UYQA 3PZTA 2ZYFA 2D3LA 3JRKA 5CC6A 3BJFA 4RW5A 3VGDA 2V3GA 4Q8UA 2RKXA 1JPKA 1UA7A 1RZMA 3VIIA 1O5RA 5FEPA 5JH1A 4H9YA 4QEHA 3NFUA 5FEXA 1W1TA 1E4LA 2Q02A 3H54A 4CN6A 4RXGA 3V0UA 4M56A 3BUVA 2WVUA 3KDNA 4OQVA 2DSZA 3APTA 4TV6A 4Q7BA 4GINA 3N9RA 3K8LA 1J96A 1YE6A 2QCHA 5GJNA 1GOWA 3S6DA 1Y65A 3U6WA 1YMYA 4JX4A 2Y4SA 2GGGA 1JUKA 1R85A 3UCCA 4IGNA 4TO8A 1ZAIA 3ORWA 3JZUA 4HK6A 3CPGA 3P5YA 1WKYA 1KLYA 2JGQA 3WLKX 3B9NA 3RO6A 3NO1A 3PZVA 3IK4A 2O9PA 1QWGA 4NZFA 4MLRA 1JEZA 3VIFA 3L4ZA 4NQ1A 2YDQA 2KX9A 1HO4A 3TTSA 1PEZA 2JKPA 1OFDA 3MMDA 3IIPA 4PRTA 2DUZA 3WD4A 3SUUA 4CD6A 2DSKA 2PWHA 4Q8NA 3QC0A 3LV6A 4PEKA 2O7SA 5MKGB 4AVNA 2DUAA 3CUIA 1POJA 3KBNA 5AYZA 3VKDA 2WZEA 4IH3A 4H83A 5KITA 5AC6A 5CKSA 1P48A 1QUMA 1EZ2A 5JH2A 3HA1A 4U28A 4C90A 4ZO6A 3OBAA 1Z32X 1HL2A 4HK7A 2LLEA 2FGLA 4MJZA 3WCZA 5L9FA 4CQCA 3CXOA 4WKAA 5G5IA 1AMYA 3HMJG 4OHQA 3KVKA 3PR2A 4PYSA 2YL5A 3W0KA 4DJED 2G96A 1OG0A 5LA0A 5A8MA 4P2VA 3SGZA 2YDSA 1QDSA 1D7KA 4EK7A 1HL9A 3WLQA 2E0PA 3UWVA 3H7UA 1UD2A 3GIPA 4WKHA 1IYXA 3VA8A 1SO3A 4OIFA 3QKZA 2Z1KA 4LRTA 1VCVA 1LRTA 2QQ6A 4K8GA 1KCXA 1YPFA 3OOQA 3PJTA 4TX6A 1N8WA 3GC2A 3ZWSA 1D7FA 2W92A 3BLPX 1VKFA 5HNTA 3F2BA 1SZEA 1UKPA 5AC4A 1W91A 1AFSA 4KCTA 1EO7A 2NVDA 2RHGA 3SY5A 1REQA 3WUEA 3STEA 4W93A 4E5TA 1FWEC 3EWYA 1HJUA 3EWDA 4B5UA 1ALDA 2P76A 3F4WA 1QNPA 2FVKA 1H2JA 1O1ZA 3LTYA 2V2CA 1RPXA 2B7NA 5D9NA 2VDHA 2VKZG 5LSMA 4J2PA 3GNRA 4NZ3A 1DIKA 3GVVA 4QX4A 2IPWA 5ABGA 2TMDA 3TC7A 4PUNA 1E56A 3WJWA 3UF9A 1XQLA 2XSAA 1OFRA 1DQWA 2BS9A 6A3HA 1TRIA 4E38A 1TE1A 2VEMA 4XWUA 2ACSA 3W70A 1VFOA 2F8QA 1HX0A 1R3WA 4M1RA 3KP0A 3W01A 2ZA3A 2QCDA 1GUVA 3USZA 1RLCL 4IL2A 1T0OA 4FXRA 1FX6A 3W7LA 4JQ4A 4ZR8A 4S3BA 1ODUA 2J6VA 2GJNA 2O4QA 4MKVA 2AQOA 5FKYA 1O66A 5CG7A 3VC6A 3C2OA 4PRWA 3M47A 3AXKA 3PWIA 1QATA 3BLIA 5LA2A 1TVNA 4X60A 3LPGA 3P81A 4PMJA 4BF5A 2C14A 2OGJA 4ZQCA 1HQTA 1PVNA 3W2KA 1XLEA 3W23A 4H41A 1A3HA 1G4TA 3QHMA 2OOGA 3VGEA 2WMIB 3UNDA 3AI0A 3UZZA 5EMLA 2YXGA 5K9DA 3LMYA 4MB3A 3C8NA 1WDDA 4JQAA 3ES7A 4H9ZA 3CB8A 5I3FA 1MW2A 2QCCA 1KWKA 4R33A 3G6LA 1R6WA 2ZXDA 5SWUA 4H7ZA 4W7WA 1KCKA 2YCKX 3GG8A 2WSRA 4NNAA 1JZ4A 2VXNA 4ORMA 2NT1A 3W85A 4R7JA 4UOJA 3PANA 4HZ8A 1K8YA 5HMFA 5BRQA 3EGJA 4LUTA 4KFPA 3LNMA 4DAFA 4QIUA 3VZZA 1WDQA 4W88A 3UZYA 3S2NA 3V4BA 1BGAA 1BQGA 2PWVA 4IIHA 3NL5A 5AYBA 2EO7A 3WK3A 4HK5A 1W1B1 4QXIA 3TXVA 1OZMA 4JTIA 1GOOA 3RU8X 3CASA 1C29A 3CV6A 1GQIA 4YU1A 3AIQA 1KC7A 5I0DA 1BEUA 4RX0A 4B92A 2WVVA 3BG5A 1VFTA 4IPLA 4CU7A 5DCEA 1XLBA 2V0TA 1KLZA 2PI6A 3W7RA 1NAL1 2D0FA 3UWEA 1P6BA 4HHLA 1W5PA 3MJYA 1Z7AA 3E12A 1NY1A 1JJKA 1QPNA 3LEPA 4ERIA 1G9HA 3VCNA 2HPIA 2BFGA 2HJPA 1SJAA 3WLLA 4UNIA 4KS0A 3O63A 2QJIA 1W5NA 1Q85A 3TN3A 4UQBA 3WDJA 3AYTA 3DYOA 1OF8A 1H7OA 1Q4WA 4ICCX 4JNZA 4DUOA 1AQHA 3S2JA 5A6TC 2ZX7A 1SW0A 2GSHA 1H63A 4CNOA 3FJNA 3BW3A 1E4MM 3W87A 3PAOA 2DSUA 1VFLA 1A5CA 2G3NA 1JF6A 1EBGA 8RUCA 4C6EA 2ATMA 3QN3A 2HXUA 3OJGA 3TNBA 1UOKA 3RRXA 3IVTA 3WO8A 5IRPA 3FY1A 3MVIA 3BANA 2QW5A 1KFEA 4CLMA 2IKGA 3L2MA 1AUSL 2ZUUA 3N3TA 5L6UA 1X1NA 1VBHA 4N0RA 2YCLA 2EPLX 2GOUA 1FHLA 4H9VA 1M68A 3N15A 3PBUA 1ZP3A 3G8RA 3RM8A 1EJRC 1FY6A 1V3HA 3EDKA 4FPSA 1E72M 1P0DA 2OOFA 2XSBA 2CPUA 2WNNA 4I9JA 1OJXA 1H0GA 1HZYA 5D03A 1QK0A 5I07A 3U57A 4UMBA 1UB3A 2PFHA 3CZJA 3ZLHA 1UWSA 3QGKC 3VE9A 4L9ZA 1ZB5A 3B0UX 2XWDA 4JAWA 5AHEA 3BGJA 4JDYA 2F38A 3UJSA 4DELA 2Z2AA 1P6WA 3BV7A 3EOOA 1UZDA 2XWEA 1E43A 1EQPA 4LBRA 1E70M 4P7RA 1ZENA 3A4WA 4PUKA 4EPBC 1UH3A 1B3OA 4BY3A 3VOIA 2BXYA 2DT1A 2VM8A 4GI9A 4UQEA 4MWAE 2R24A 3UETA 2AL2B 2PTZA 3GU1A 3I3DA 2OWXA 2ADAA 1M04A 1S2WA 2ZTKA 3OBEA 4PUMA 4Q4RA 2ZZ3A 1FFQA 1V03A 3MMWA 1DWAM 1E0XA 4DJEC 1GOIA 3AZTA 1OX6A 3CTLA 3W9ZA 2A21A 5C9ZA 2D0HA 4WJEA 2O9RA 3SURA 4N9CA 1XS2A 1QI4A 3LGGA 1K1DA 2P53A 3C56A 5HWMA 8CGTA 1HJQA 1RBOB 4Q8MA 2ZZ1A 5JBFA 3IAPA 2V5DA 2PEVA 3LCLA 4DLMA 4NAFA 3SAZA 3MUZ1 2OT0A 1RQEA 5C71A 4J3ZA 3AYVA 1KBJA 3L4XA 3T8LA 1WQ5A 2J7DA 3KCJA 3QRHA 3S6TA 1D8WA 3IRDA 2QLYA 1GOQA 3GY1A 3K1DA 3PHAA 2YFNA 1O1HA 2Y8VA 3CPRA 1S3HA 1QASA 3VIOA 1OG6A 4S38A 1OYBA 4BQ3A 1K8XA 1CX9A 5BROA 3V5CA 3MHUA 2GUBA 2GUYA 2OKOA 1ISWA 2YA1A 3CYVA 1B5TA 4XBKA 1V3LA 4QS6A 2I56A 3B40A 1G67A 2Z25A 1A4MA 4B5VA 4H8HA 4R7OA 3VD7A 1GPWA 1Q13A 2JF7A 3GRIA 3H6OA 3AZSA 1Q7MA 3LCHA 1EEPA 1GVFA 3IAQA 3THAA 3P93A 1J4EA 1H7NA 4JCLA 2PDUA 4QSHA 1CIUA 3NA8A 1DPMA 1Q3NA 1IWBA 4PB3A 3ITYA 4V15A 4OBRA 2VD8A 4LAZA 2C91A 1EIXA 2OYMA 3ABRA 1XLAA 4KESA 4NVTA 3NXFA 2IQTA 1EJUC 4G1NA 3IIXA 3E0WA 4J9JA 4ZSUA 1TIWA 1ME9A 2EG8A 2BOEX 3V5FA 3IJDA 3O1NA 4NZ1A 1TG7A 1PYMA 1XLJA 3W7GA 3TROA 2V67A 3RXZA 4JY8A 1CENA 3SCSA 1UHVA 4AD1A 1VYSX 4JN6A 2X2GA 4WK9A 3PWAA 1WBJA 4Y8FA 4GWEA 4LB3A 5CBBA 4LPCA 1L2UA 4D8ZA 4CCZA 2ZX5A 4YIWA 5JIWA 5LNSA 3TXZA 2DQXA 3UEQA 1AH3A 1R3QA 5LXEA 1FHDA 4O28A 1LBFA 4A2SA 4ATLA 4WZHA 5CZ0A 4CD5A 3W24A 1W9BM 2H6RA 3EB3A 4Q8PA 3VABA 3LQGA 3PJUA 1LOSA 1T6MA 2WKGA 6CGTA 3I10A 1ZHAA 3VM7A 1G94A 2UWFA 1WXJA 4WY0A 4H04A 2ZX6A 2YL6A 1DJYA 3E1F1 2CERA 3ALFA 2EJAA 1TJRA 4TU1A 2FQIA 2H8ZA 4U33A 1HO1A 3HG5A 3T40A 2RDUA 4UOQA 1HKMA 1HL8A 1Q66A 1CDGA 3BCDA 4NZ4A 4GJJA 4O19A 1OQFA 2NX3A 2QCMA 5I78A 1Y7VA 2VUNA 3T09A 4M5PA 3OLDA 5C9XA 4O12A 2ZUTA 1YNYA 1G0CA 2FMOA 3DGRA 2CBVA 4XB3A 5J5RA 3OHIA 1WV2A 4RE2A 1H49A 5DRIA 4N9BA 3AALA 4NG3A 4Y9AA 3ITVA 2E9MA 1XLIA 2ZZ6A 3I6TA 3QV7A 5A6MA 3WMCA 3G18A 4GFIA 5E6YA 2Y8UA 2B31A 3NXLA 2B7QA 3K13A 1V93A 1M65A 3LENA 3QPYA 1YHTA 1JDDA 3KHDA 4AVOA 1VENA 1L6FA 3DFQA 3W6YA 4XD3A 4XUGA 1RQBA 4HJWA 4DNMA 1IT0A 1Q7QA 2ZWYA 1KFLA 1T8QA 2X1IA 1BTCA 5AZ0A 4FXFA 1UROA 2CCRA 4HOZA 5MF5A 3OLIA 1S2AA 4HNLA 3HJZA 5LZLA 3GU2A 3DGBA 1ZBCA 4J7RA 3R8RA 4WLCA 4HU8A 4ERGA 2XIBA 4GXWA 4B15A 1AA1B 1ITXA 3I4EA 4C6NA 2PTXA 1K02A 1Z48A 3MJMA 3W1TA 3G1YA 1HKJA 3S5ZA 3V7PA 2V3EA 1YPXA 3LHWA 3O0FA 5CGQA 3B0YA 3PJXA 1KBKA 3CMFA 1OF6A 1BWKA 2QT3A 2PDCA 3G1VA 1WP6A 3RX4A 1GVSA 1VEPA 5JXQA 1EWDA 1NM9A 2C71A 4EXBA 2VC5A 1ADDA 4UC5A 4OOUA 4AZCA 1LL7A 4TOQA 4DXVA 1G01A 3MWCA 2VWSA 2HK0A 1A0DA 2ESCA 3SJNA 1Q6CA 1NARA 4LUYA 3FX4A 3S9ZA 2OB3A 3PAJA 1XR2A 3KE0A 1LWJA 1ODZA 1ICSA 1U5HA 2JBMA 1QNVA 3RILA 4XKYB 3BZJA 3LUTA 2DT2A 3DAQA 3WD2A 3VVGA 4H7VA 3QZ6A 2VGFA 2D0GA 1EXPA 1WB0A 1IF2A 3QHOA 2WW5A 5AKQA 3O6DA 2YZ5A 5I06A 1W37A 3FXGA 4Y9PA 2XTKA 5DO8A 4DI8A 1PL9A 2Y62A 3WMLA 1P0NA 1TB3A 2OQHA 2Y7FA 1E6XM 4Z1DA 1R30A 2E9BA 1BXBA 1PZ3A 2G3FA 9XIAA 3M6DA 2NQLA 4JOMA 3R0KA 1YTEA 3VKKA 4XSLA 3ZJ6A 3L23A 1U22A 1Z69A 4MM1A 1IE7C 4RE0A 5BMXA 4R53A 2GLKA 4PODA 4DRSA 5T8GA 4RKAA 3MP5A 1GONA 1HGWA 1ZPTA 1EGVA 3G3DA 4MY1A 4U3CA 4M3PA 5M5DA 5D33A 3WLPA 3WH8A 1ZAHA 1W9XA 4BCEA 4XAGA 5CAHA 1XH2A 4JTTA 1DKWA 1H60A 3VE7A 1EJVC 2ALRA 3N29A 4IP5A 4LAOA 4XVDA 4IGSA 3SRDA 5DMYA 3U4AA 3P84A 1BXNA 4CKQA 3FDKA 4KWWA 3DN5A 4IMGA 2V3DA 3T78A 2VUYA 3QQ0A 2FB2A 4UQDA 4N4PA 5H1WA 4I5RA 3EKLA 3VI2A 1V8EA 3HBLA 3KFTA 3FS2A 2OVLA 3NURA 3BAIA 2OSWA 3ZT6A 3FHQA 2QHAA 5DT5A 3GTFA 1W3HA 4Q8TA 2CLFA 1KWGA 5G2HA 4NZCA 5LA1A 1XICA 4PCFA 5HBFA 1A5MC 5H8PA 1I2NA 4NKCA 4GGHA 1OC5A 1FWWA 4S3EA 7REQA 3VIKA 2QAFA 1R3VA 4H6QA 5DQPA 3L68A 4JFUA 4A3HA 2CBJA 3WQ8A 2XYLA 3TOPA 2O55A 3IIOA 2J27A 1M9HA 2UV8G 1SFTA 3PFRA 1YTKA 1NTHA 3BQ5A 3EEZA 1GYNA 4LV4A 1KW1A 4G1KA 2WQPA 3GXNA 3BOLA 1E0UA 1O4UA 2VCBA 5TNVA 5ABHA 1CXIA 2VMFA 1W2VA 3UJRA 4D9PA 3SCTA 3VAVA 2XGZA 1W1A1 4KEUA 1ZY9A 4YTTA 3TU9A 2OZ8A 4FXJA 2OR2A 4UTWA 4W4QA 1VHNA 1UQZA 3HB9A 1EKOA 3LBCA 4B91A 4TQTA 1S2UA 1R3YA 1UMLA 3O3RA 4PMRA 4PCPA 3LX9A 2W91A 1I75A 3PJWA 1KFJA 4Y96A 4AY8A 3BGGA 2VJXA 1ZJAA 3CUHA 4HPNA 4LYQA 3TP4A 4R9XA 3KZSA 3ZFHA 3GQYA 2VC9A 5G1MA 1E4IA 1EF3A 3IJ6A 2XIQA 2ZA1A 3QY8A 3CT2A 4NZJA 4O50A 3UR5A 4IMDA 1L0PA 1ICPA 2Z00A 4MWAA 3DERA 4TXEA 3UYIA 3RYSA 3VOHA 5G4WA 2PDPA 3ATYA 1VS1A 4HSNA 1JDAA 3NZGA 3TVAA 2PWEA 2Z1SA 3G1AA 4H8UA 4DJDA 3HG4A 2QR6A 4MYAA 3WQWA 1XLFA 4NJIA 2YA2A 5CPTA 2FLIA 2QEZA 3O6AA 3W76A 1R9ZA 2QIWA 1XSIA 1T99A 4B4FA 1US2A 2PWUA 4ADSA 1ONWA 4KEZA 4JTSA 2CZVA 4O13A 2XVPA 4JX5A 5BU9A 1V6TA 3THQA 4JIRA 4E2OA 2VT0A 3GIYA 4ACYA 2DZXA 3W22A 1U33A 1NOFA 2XZ9A 1JPHA 5G1YA 3W1NA 4RL3A 4Q32A 3GDTA 5CZTA 3VD9A 2PS2A 2J7EA 3TTOA 2V2DA 1X7IA 1I9CB 1ZS2A 5JIPA 2ZDSA 2WHMA 4IIEA 3CWOX 2XVGA 3O05A 2BVTA 4Z0SA 3D3FA 4E6MA 4S3AA 3RCNA 1W56A 5AN7A 2B4GA 1W9PA 1YLVA 4UR9A 2HEJA 2QNEA 4AFYA 1XHGA 4QTGA 3ITLA 1W3IA 4F0HA 2ZC8A 4PBEA 4XUYA 3R0DA 1IXQA 2Z1XA 4AC7C 4EACA 4YL2A 2EHHA 2J9ZA 5I6SA 3WLRA 2YKKA 2BODX 3ZS4A 3T08A 3EX6A 3DECA 1AH4A 4PTNA 3RJYA 4QBXA 2BSLA 2ZE0A 1SMAA 1XLCA 2RH9A 3PM6A 4PN2A 1T40A 1V0NA 3EX3A 1SFJA 4FIQA 1RUSA 4HOXA 3TR9A 3WF0A 2PF8A 3F03K 3KVJA 3NYDA 3CIVA 1KTNA 1GZGA 2WNWA 4NILA 1TWZA 5XIMA 5EB8A 3S5OA 4K6AA 5GJMA 4K7VA 4PMUA 4OUEA 3BPWA 1Y5WA 3DOPA 4S1FA 4FP1A 3IUIA 3DU0A 2ATSA 4RZ6A 4DWSA 3CO4A 1JF5A 5REQA 1X39A 4C1KA 1QI3A 4LVBA 2I17A 5IFPA 1UWTA 3B03A 4XVEA 3RHGA 4GIRA 4PTMA 3K5XA 3GKFA 1LOLA 1FP8A 1V0MA 4FX7A 4QEEA 4IFKB 3PNZA 3E2QA 4D6DA 3H53A 4P7OA 3PB0A 5T26A 5EL1A 3ZM8A 3FEMA 1W3LA 2JIWA 3GNXA 1XDMA 3A23A 3HZ3A 3NUKA 3F4CA 3K8MA 2ZWZA 4GXPA 4NJGA 1E9YB 2NXGA 1L8PA 3TCEA 5HANA 3UJ2A 3MUIA 1AQMA 3NZ1A 4CCCA 2XIJA 5HNNA 4NYYA 2VZOA 2XIMA 3WLMA 4C60A 2J74A 4GIAA 3P74A 3W72A 4L56A 2PZ0A 3GYEA 4HPJA 3L5AA 5FJTA 3ZQ9A 2QCGA 1HNYA 2VOTA 4GNKB 4AX7A 2WKJA 2VQUA 1V79A 4TMCA 2Q8ZA 2C1IA 1NWRA 2BG5A 2Q3OA 2D2JA 4RNHA 3EKGA 1X1OA 2WK2A 3TYUA 3B8UA 3VD4A 1GZJA 3F4NA 3W07A 3PSVA 5AVNA 5D04C 4WSJA 5BU6A 4O18A 1H5VA 4DWDA 2DZAA 3VIPA 2C13A 2QCEA 4O0QA 1KBBA 2RJGA 1HVXA 2TODA 1F4HA 2GGEA 4DLFA 1XCXA 4HMCA 2VOMA 3U2OA 1A3XA 3IUDA 1A5SA 1KR1A 3UZXA 5HQMA 3EX4A 3UVAA 5J5DA 2D73A 3PTDA 1C3FA 4XISA 4HQVA 1SO4A 4IJCA 3TQ0A 3ITCA 1Z42A 4UZUA 3F2CA 4HPGA 4GZ7A 3SRFA 4QM1A 1Q2RA 3POHA 3KCOA 3LHTA 1JZ8A 1FH9A 1JCLA 2JKAA 4H2CA 3N9KA 3G0UA 3A4JA 4XIMA 4C5ZA 1EOKA 4DF1A 4IIFA 1EPVA 3JVAA 3UPBA 4US5D 1J79A 4PMOA 3T9PA 1PO9A 5A6KA 1K9TA 9CGTA 1J0KA 4Y9MA 3LV5A 4PC8A 5A8NA 1JXKA 1R8LA 1PTDA 5JU6A 1OK4A 4JTFA 2PLCA 2CLIA 1TV5A 3GH5A 2WKLA 1I2QA 1LT7A 1NDYA 1NDWA 3M0YA 3MDUA 1LL6A 1POKA 1JRCA 4A6GA 1FCBA 4WDWA 1H62A 1IT7A 2QJGA 4MJ4A 1AH0A 2IKIA 4NJHA 3C0QA 3W7DA 3FJ4A 1GJPA 3QR1A 3I7RA 4MOZA 5HUPA 1IEQA 2HE8A 5AYIA 3WNOA 3I6RA 4GJIA 3P6LA 2DSVA 5F4SA 3O15A 5CLWA 3FNDA 1UR8A 3OPSA 5HA7A 3LRMA 4L1WA 1JIBA 1NQKA 1K7XA 4CQAA 4C6CA 1JCXA 3NR0A 2QJNA 5TD4A 3GW0A 4U5KA 3WLJA 4LVDA 1J18A 2XJ7A 4HNTA 5G2IA 1P1MA 4O53A 4INFA 1B3YA 4IP4A 3MP3A 3SCVA 5IFTA 2ZVRA 1RR2A 2Y6ZA 2QULA 3QBUA 2FZDA 3PTQA 2VDIA 2P50A 1YDVA 3QTPA 1LROA 1V3MA 3R25A 2ZXAA 3AIUA 1OWQA 5U7SA 2O0TA 3REQB 4N9DA 5C9UA 4HNVA 2CZEA 4OE7A 3S42A 2PDQA 2BB0A 1J5TA 2WOQA 3DG7A 1TV2A 4IPIA 1XLDA 4IMEA 3L0NA 4GY7A 2P3EA 3A5FA 1JNDA 1RHCA 2FIQA 3EDJA 1XYFA 3V3WA 2E40A 3VGGA 1KFBA 2DT0A 1TQXA 1QWKA 3FDGA 1WNOA 2YW4A 3CZGA 4KIEA 4XAPA 4IIBA 3VOFA 1HVQA 1UC5A 3SGUA 1RLDA 4AD0A 3RPTA 3PTMA 1MEWA 2RGMA 2HDJA 4H6EA 1A5UA 4YN5A 3W7PA 1EB3A 2CWXA 2FPTA 3O6YX 5FAGA 5A8GA 1HP4A 4ZVJA 3AC0A 4HHPA 3W1XA 3UR8A 2O56A 5FAJA 5E1QA 5CPNA 2E3ZA 5M1TA 1TWWA 4Q3MA 3AHVA 1SPQA 5EFDA 1P7TB 3DC0A 1Q6OA 4DF0A 4L65A 5AYYA 4KT2A 4WY0F 2DW7A 3CL8A 3C0LA 3WD0A 3RLGA 4M8UA 2NXIA 4H3DA 4H6RA 4HA3A 3VIMA 1D8CA 4J1OA 1WE5A 4UTTA 3D0CA 3AJ7A 1PTAA 3NG3A 1UD3A 4JPGA 5LNUA 4XO7A 2QGYA 3NQ8A 3GE7A 1LQ0A 4Y6GA 3A22A 5BW6A 1V7YA 4JFVA 4G7FA 3FV9A 2Y0FA 3IJIA 3T0TA 3CQKA 1E6NA 4AF0B 2PDWA 4BHYA 2WMIA 3N13A 3OODA 4BZYA 4DBEA 2RAGA 2YIHA 1ZRQA 3GVGA 4DYKA 1U30A 4OECA 5G1TA 4M7SA 1J0ZA 2VI0A 3LG3A 1S1RA 1EH9A 1X7FA 4XZWA 5HXMA 3TW9A 3KOFA 3W38A 1C93A 1BKSA 3TFXA 1E6ZA 5AHLA 1N82A 3AXIA 1YYAA 2O7QA 1JZ6A 1FCQA 3GG0A 2Y63A 3GHSA 4XAZA 3WL1A 3ITXA 1D3CA 2CEQA 3U5UA 4ATDA 1SZRA 2XFYA 1XYMA 5FSEC 3EXTA 2J8FA 3T8QA 3FK4A 3NGJA 1UA3A 1EP3A 5BRPA 3NYZA 3QLDA 5BYWA 4Z2JA 4CU6A 1IQ8A 5IM51 2H3BA 1BFNA 1YIXA 1DE5A 5K3VA 4GBUA 4GY1A 3TWAA 3STFA 1F3TA 1KM1A 1X97A 1US3A 3B9DA 3U2CA 3W6LA 2DP3A 1F2JA 2ZUSA 2NW0A 3NL2A 4OGZA 3PZQA 3KLLA 3CBWA 4XAYA 4LRSA 4L6OA 5AY7A 2VENA 1VPXA 4GVGA 3MSDA 3DBNA 2X1RA 3Q4DA 1TSIA 4GI8A 4M19A 2QUNA 4UMCA 4HYRA 4B3ZA 4D8AA 1S2VA 4I9TA 1B54A 1K8ZA 1F74A 1TV7A 5I77A 3PZOA 2P0OA 4KEMA 1EXBA 4AIOA 4O1DA 4XQ6A 3LN3A 2CZDA 5FOOA 1LRNA 3VKBA 2J88A 1JL8A 5E0KA 4ZTYA 1ME7A 2BVWA 3V0TA 3BLEA 3EAUA 5A94A 1KKOA 1Y5XA 2E4TA 2PUZA 5FI8A 4IICA 3GHTA 5LIUX 3TW7A 3N25A 4FMVA 4JN8A 1IZCA 3C5QA 1HTIA 2NSOA 4A3QA 6REQB 1JPIA 4QS5A 1FVPA 6XIAA 4GYPA 3B9OA 3C2EA 1XLKA 1UWUA 5C7VA 2RGLA 1H3GA 3KL5A 1PX8A 4JTDA 4RZ4A 4AMCA 2A3AA 3DFTA 4UFHA 4ZEPA 2BY1A 4CGTA 5A6SA 3URBA 3KL0A 3NWRA 1DEDA 3CZ8A 1TTPA 1CECA 3AAMA 4HTBA 2FHFA 3PY2A 3E5PA 5D2WA 4F48A 1XJBA 2EKGA 5EY5A 1M3UA 1QXLA 2GJXA 1ZCOA 2Z7KA 5FL1A 2CITA 1C9DA 4A4AA 2IPJA 4Q8WA 4NJJA 3B06A 3Q58A 4Z2KA 2QCLA 3LERA 1JQXA 4MNLA 4S23A 4FZIA 3M0MA 4AWUA 4Z1YA 1LF1A 5KZEA 3I65A 2QYGA 3GVQA 1XFBA 3RLVA 3ARQA 3CAQA 3VTRA 2DZSA 3NEVA 5KETA 3QVQA 4ENLA 1NU5A 4AXKA 4L4LA 3GTNA 3WJXA 1VAHA 2QF7A 4YS1A 2GUUA 1V6UA 1QNOA 1KD0A 3R10A 3ID7A 2VZUA 3NQ6A 3TYZA 3BCJA 1W9DM 5AHIA 5LHFA 1D3GA 3NQDA 4DBWA 4L6HA 3T4WA 4NASA 4REQB 1XI3A 1GORA 5ABTA 1MSSA 2GGIA 4KRTA 4JQ1A 3HPXA 3NPXA 3T2PA 3MS8A 1KFCA 3T81A 4HMNA 3NQGA 1A80A 3CEPA 3UWQA 5CH9A 5FIPA 4FA3A 4DO4A 2CBUA 3ZVHA 5GQBA 3WELA 1XIGA 1Z89A 3SCPA 4RZBA 2CW6A 2XN1A 3VYLA 3TW6A 2BBFA 1MFUA 3T0DA 3EOUA 4H1ZA 3W53A 4UTHA 1IXNA 1JAEA 5CXPA 3A24A 4BQ5A 3ABOA 2OTDA 4DIAA 1XP3A 4PUDA 4YMZA 1WZAA 3TEVA 3QW4B 3PZIA 3UG8A 3G1DA 1WO2A 1FP9A 3T05A 1T96A 2X30A 2JGYA 1ESWA 1NFPA 4HOWA 2DEPA 4ROQA 2DGAA 5HPCA 4LC8A 1ISYA 1UD5A 3PZMA 3MSGA 1MZRA 1XINA 3S1UA 3OBKA 4P7NA 1MFVA 3S2MA 2DORA 3RLHA 3SGGA 5HINA 3E2RA 5DX7A 1FKWA 4L4PA 3IARA 1S39A 1V3JA 4FOUA 4BEQA 1RQHA 1NDZA 1UD8A 4NYUA 2A4AA 3GU9A 3WQPA 1W1PA 4Z17A 4B3LA 1EBHA 3VILA 4F0RA 3L65A 2R6OA 4YWIA 1X6NA 1FOBA 3V18A 3WG6A 3W73A 4Z1AA 4ZBCA 3BK0A 5B7ZA 2O92A 4DO7A 4GZEA 1FBAA 2WCSA 1CXHA 2WSYA 1UJPA 4MDPA 3E2VA 3TA6A 1NF7A 2Q8XA 5D9MA 1JVNA 4J3UA 1MDLA 3UYCA 4JFSA 2UBPC 1C91A 2FVMA 4S3CA 1QI5A 4BQ4A 4CN1A 3CLWA 2L5HA 1OIMA 4C1NB 1OY0A 4OFCA 2VZTA 3NQ7A 3NVDA 4RDYA 4WKFA 4J27A 3LCGA 4Q6XA 3VDAA 1GG0A 5HWNA 3T42A 1WZKA 1OX5A 2W62A 5I3IA 2WZIA 1J10A 4O1AA 1Q4NX 3GSMA 1F7BA 1DXIA 4G7EB 1H5YA 4XZBA 3HIJA 5G4HC 3LNPA 3GK0A 4HB7A 1IWPA 1VLIA 3TSMA 3W25A 2ZRUA 3HGRA 3ZSTA 4O4VA 2DVUA 4AEFA 3MCOA 1AG1O 1YX1A 1Q65A 3HV9A 3DKLA 3AISA 1U5VA 2XINA 4UTLA 1B2YA 2J6XA 4DNHA 3PZUA 4K8HA 5M03A 1FDJA 3CHCA 4HZ6A 1BXCA 4LNCA 4PMDA 1C8QA 1FWGC 3W2LA 1LRQA 1MXGA 3PPFA 3KRUA 2HS8A 3GNDA 4DJFD 1QI0A 3MUAA 4V2XA 1FWJC 3A3XA 3GS6A 2PSNA 4MPKA 4DY1A 1XGZA 4DUWA 1GCYA 5F2LA 2HTMA 2EAWA 3Q94A 4JEQA 3JZEA 4TMBA 3W2JA 5I3GA 3EEGA 3IJLA 2ZRXA 4EPDC 1LLOA 2YYUA 3Q37A 1AQFA 2PZNA 4LX4A 1B31A 5C70A 3QEZA 3CB3A 3SCRA 4UWMA 3W74A 1V08A 1WZLA 3TQPA 3M5ZA 1GQNA 1QNQA 2DZPA 4K39A 1JCNA 5DCDA 1W3TA 1DOSA 1Y0EA 3BOFA 2ZZ2A 3AUOA 4O1EA 4GXMA 3AIEA 3D47A 3NVTA 1CT5A 2BASA 1QOQA 4A8NA 4FLQA 1XIBA 4GX9A 1SW3A 3THCA 3WEMA 3VUPA 2QKFA 4QGCA 5K9CA 3R4IA 5HATA 4LAMA 3NQVA 4QR6A 3F1QA 4YHGA 4X9SA 4B5NA 3VU2A 4MAZA 2VFIA 4QSFA 2OXNA 3MPGA 3AWNA 4ZXLA 2ZRWA 4S39A 3T55A 2Z27A 3H4WA 1N2VA 6ENLA 5D9PA 1MXSA 1ZZMA 1GVRA 3LZ3A 2YCIX 4C6PA 4QE1A 2PDYA 3PUEA 2NUYA 3R2GA 3TV8A 1PHQA 3WD1A 1N55A 5EPDA 4ZOEA 3W00A 4B9YA 8XIMA 3GNOA 4DUXA 3W81A 2CHRA 1R86A 3CAWA 4P7LA 4GUFA 4JBRA 1EC8A 4GI4A 2PGWA 3CQHA 5M2FX 1WA3A 1VGAA 4UTWC 1KCLA 1PV8A 2DZBA 5FJRA 2BX7A 3FVDA 3M16A 5D8WA 3O0KA 2F2KA 3HFTA 4JEJA 2WM1A 3P3BA 2FJKA 3NPUA 3K4WA 3G1RA 3DHDA 1TPH1 1RA5A 3DHFA 2BTMA 3WNKA 2G3IA 1CGUA 3VFCA 1VLWA 3KWXA 1WPCA 2EGZA 2F9RA 4D1IA 4D6EA 1VRDA 2A3CA 4HCLA 5FESA 2VX6A 3GDLA 3P0WA 5IDZA 2GFTA 4XZ9A 4NX5A 1EJXC 5DELA 1GJUA 1E5JA 4MWAC 2OEJA 3IK2A 4H9UA 1DORA 1LTDA 1KGWA 5DY3A 5C54A 3GM8A 4ZO8A 3C2FA 2DFAA 2E1WA 2TAAA 5BOEA 2IW0A 1TRDA 2VR5A 1I2RA 3TOYA 2FPYA 4GYFA 3WNPA 5KTLA 2J7CA 4DJDC 4ZCWA 2GSEA 5CJ5A 1G69A 3KOWA 3N2OA 3O16A 3UG4A 3AMKA 4NY2A 1YNQA 3N1AA 4XZHA 1LBMA 3AIRA 1YPIA 5BXRA 3OGRA 4V1XA 1QHOA 2X1SA 3N12A 3S5SA 1PZ1A 2HMCA 3WEOA 2G41A 1BD0A 1BYDA 4RR4A 7XIMA 3B0PA 3SDOA 3WK0A 3NTYA 2XM1A 3CEUA 2ZZ4A 1XX1A 4GKTA 3OIXA 4P61A 2VD9A 3L4TA 2PTDA 3CHVA 3QGVA 4GA8A 2VDGA 1JXJA 4QNEA 2WVSA 1UW9A 1DXEA 4M7TA 4ADTA 3N2CA 2NQ9A 3NPWA 2VEFA 3MBDA 1HKKA 4IGMA 1TWDA 3M0HA 4IX2A 4D6HA 3VDBA 3M07A 2ZOXA 2Q8LA 3GR8A 1PTGA 3O7UA 4WJ8A 3BOXA 3LLXA 4DBUA 1OEPA 3F5JA 3RU6A 3IGHX 2B7OA 4GO9A 4PUUA 3B05A 3ARRA 3G2GA 5D37A 3ONBA 4XO6A 7TIMA 2Y85A 1Y5VA 3V75A 4AAJA 2ZUMA 4H6KA 1UBSA 1U83A 3K46A 6ALDA 1VIZA 4LTSA 5A6LA 2W6RA 5D32A 2DVXA 5T9CE 5GNZA 1UIPA 2XVKA 4JX6A 2D24A 2VNCA 1K4HA 1JULA 1AK5A 3QOKA 1EA9C 4FX8A 4X3ZA 2I7GA 3LS9A 1KM5A 3CUGA 4Z2GA 2A6NA 1WCGA 1V6XA 4IQDA 2QDHA 4ZA0A 4Q4SA 4NNBA 1EO5A 1O12A 4NAEB 4OBTA 2PAJA 2DVTA 1A53A 2XN2A 1K9EA 1QVBA 2WCGA 2HQAA 4E3VA 3VNIA 3CYJA 2YYTA 1E73M 3PP7A 1EEXA 4DWSC 3RIKA 2CWNA 2TPSA 5RUBA 4PMYA 3UR2A 1KA9F 4WCJA 1E9IA 3IWPA 4IWWA 5ENLA 3AU2A 3MI3A 3EYPA 1VFFA 3PS7A 2QDEA 2WANA 2DZUA 1SUXA 1FRBA 4GI6A 1QPKA 1GKRA 1TPVA 3TN4A 4IMAA 5C2CA 8XIAA 2YB4A 3WFLA 3CTTA 3RUBL 2VZVA 1REQB 2HVNA 1K9DA 1QTWA 4AIEA 1XGEA 2J78A 2R91A 2FDSA 2XN0A 2VELA 1VIWA 3I3BA 2A3EA 4ECLA 3TR2A 3M1ZA 3MT1A 3EA2A 1UWRA 3G0SA 4JNYA 4JQ2A 3BAJA 1Q6QA 3WNLA 1JD7A 2XPKA 3M43A 5IOBA 1DTNA 3WLIA 2YDAA 4ZE4A 1CYGA 1JCTA 4F2UA 5J8LA 2Y1HA 1DWGM 5M17A 1R38A 2BGQA 3SUTA 1MNZA 3BG9A 2EQDA 2GK1A 3ZT7A 4C6JA 2QF8A 2AQVA 5AFDA 3W3OA 1BTMA 4QP0A 1QBAA 3GTXA 1TZ7A 2HRWA 4GQQA 3U0HA 1L2QA 3BLDA 1TWSA 2BHUA 3ZIZA 1H61A 3QHNA 2OQLA 4AMAA 1QOPA 3P5ZA 3S1WA 1DHPA 1KGXA 1TFVA 1BVWA 2XSXA 3TMQA 1V7AA 2CESA 1TV8A 1DWHM 2B81A 4W8AA 4GZJA 2BGNE 4LC6A 1XW8A 1NFGA 2VGGA 3OQEA 1MYRA 4UTJA 1W5MA 2I14A 2R1MA 2HCVA 1WOBA 3KM8A 3Q65A 4KPLA 3LLDA 4L1GA 3P14A 4RPQA 5T91A 1GYMA 1RJQA 5BRBA 4I8YA 2PURA 2IXVA 2JFEX 1W1VA 3U5YA 2F6UA 1XPGA 3B8TA 3CZKA 4HA0A 4J3VA 4P8UA 2PLJA 3VOCA 4CNNA 4P7QA 3L5LA 3WQDA 3PC0A 3A4AA 5A6BD 3ARPA 3L7RA 5C2XA 1IEXA 3N73A 2I5IA 3WDPP 1GEQA 1ONXA 2AKZA 4F0SA 3TC3A 3SR7A 5IBXA 4UNKA 3AS1A 4ZODA 4LUTB 5AVHA 3XINA 4I6VA 5CPMA 5DEZA 4L6DA 3BMXA 4F3HA 1XDJA 4XK2A 1OCJA 3M7WA 2V3FA 1DQUA 4YTQA 2XGIA 2MANA 4Q4KA 4ZTXA 1UZ1A 2E6AA 3OGSA 3AO0A 3PFMA 1UKQA 2WVVB 3E3HA 5HNRA 1KRCC 1VBUA 4TV5A 1NQ6A 4OJYA 5G2WA 4K7YA 3QLLA 4QE5A 3ERPA 2X05A 1HW6A 5AOUA 2VC7A 1B30A 4PUJA 1DJNA 3H4XA 3G5EA 3TDFA 3PBVA 2I5QA 3M6YA 1I2PA