4XSMA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xsmA00
4HHLA 3ITXA 4W4QA 1XYMA 5FA5A 1XLCA 4XIMA 2ZDSA 1A0EA 1MNZA 3AAMA 1XLDA 3CQHA 2XINA 4XSMA 1A0DA 4OVXA 4DUOA 1YX1A 3DBNA 3M0HA 4XIAA 2G4JA 4YTUA 3IUHA 4EAYA 1XINA 3KWSA 3P6LA 4YTSA 1OADA 1XLAA 1XLLA 1DXIA 4GLEA 3VYLA 5AVHA 4QE5A 2OU4A 1XLIA 5H1WA 1DE6A 1TZ9A 3KBVA 5EMLA 3M0YA 1XIBA 3P14A 4HHMA 2HK1A 5EMKA 4YTRA 4HNOA 4YTQA 4YTTA 6XIAA 5I7GA 2XIMA 4X61A 3C0SA 1S5NA 3UU0A 3UXIA 1XLJA 8XIAA 4QDPA 2Q02A 1XLKA 3AYVA 3KBSA 4XSLA 4K3ZA 2QULA 4PGLA 3IUIA 1XLEA 3VNMA 6XIMA 1DE5A 2GVEA 2I56A 5H6HA 3XIMA 4PFHA 4Q7IA 4DVOA 3TVAA 1XIDA 3KCOA 2NQ9A 3KCLA 4GJJA 1I6NA 4QEEA 1XYLA 3M0VA 3U3HA 3UA3A 3WQOA 4GJIA 5B80A 1K77A 3CWHA 4A8LA 8XIMA 4A8RA 1MUWA 3CQIA 1D8WA 3L23A 3N4AA 1XYCA 4QE4A 4K1GA 3VNLA 4XISA 3M0XA 3C0LA 3QXBA 3M0LA 1QUMA 1XIGA 4QE1A 3GNXA 3VNJA 3KBJA 3TC3A 3LMZA 3QC0A 1XYBA 4QDWA 5B7YA 2I57A 2NQJA 4XKMA 3BZGA 3KTCA 3ITYA 2QUMA 1XIJA 5C9ZA 3VNIA 1QTWA 5XIAA 4GQBA 3AALA 1BXBA 3QZAA 4G56A 2GYIA 5XIMA 1XIEA 2GLKA 4US6A 3NGFA 5B7ZA 4LNCA 2X7VA 1O1HA 3KBMA 1XIFA 2QUNA 3BANA 3KCJA 1XLBA 3CQKA 4E3VA 4X63A 1XP3A 1XYAA 2GUBA 2X7WA 3OBEA 4A8NA 9XIAA 1GW9A 1DIDA 4KW2A 3BDKA 2G0WA 3ITTA 4ZB0A 5XINA 2J6VA 1XIHA 1CLKA 3ITVA 3DX5A 9XIMA 3ITLA 7XIMA 2QW5A 3UA4A 2XISA 3CQJA 3ITOA 4HGXA 4ZB5A 2ZVRA 2HCVA 5AVNA 4J4KA 4EACA 1XLMA 1XLGA 1BXCA 3FVMA 4ZBCA 3CNYA 5EMMA 3JU2A 3IUDA 1XISA 1QT1A 3U0HA 4X60A 4A8IA 3KBNA 3XINA 3BWWA 1XLHA 3UVAA 2HK0A 1XICA 3XISA 3BZJA 1XIIA 3QYSA 1XLFA 1S5MA 5TNVA 3M0MA 4ZB2A 3VNKA 3C0QA 1XIMA 3KBWA 1A0CA 1I60A 2NQHA 5EMJA 4QEHA 3AYTA 5J8LA 1DIEA
chains in the Genus database with same CATH superfamily
1MW0A 3VNDA 1HVQA 5A8MA 1RSCA 5HPOA 1HKMA 1MDLA 1YX1A 3WUFA 6REQA 1RZMA 1F05A 1WXJA 4GH3A 1C8QA 1DIOA 3GAKA 1E1CA 2DZUA 4RE4A 1KWKA 4HNOA 2XFWA 4N4QA 3QLLA 3SUVA 4QNEA 3VOJA 2CHOA 4QISA 1UKQA 1PO9A 3LXCA 4I5RA 1VFMA 3NDYA 4GMEA 3F03K 3GVQA 1KM4A 1DXFA 4JTTA 2VXNA 3MV11 4UFJA 4DYKA 4KRZA 2JKAA 3PUEA 4HNCA 4Q8VA 3HG3A 2BY3A 3M1ZA 5M1TA 3VNLA 1IXQA 4ERGA 2AMGA 4W7UA 3TQKA 4S3KA 2VYOA 3IVSA 3W00A 1XPGA 4PSRA 5FL0A 5G4HC 3THUA 1UZHA 5IM51 3CV7A 1GYMA 2E68A 4ML4A 4P8WA 2V5KA 5D9PA 4CNTA 1DVJA 2YCLB 4ZA0A 4QX4A 3WSUA 3CL7A 3FV9A 2Y5EA 1S38A 3CWOX 3EOLA 3GDBA 4MSSA 4E8CA 1RY8A 3NZQA 3R8RA 3UXAA 4PMUA 1UZ4A 3EOSA 3L2LA 4OTKA 1V0LA 1TJ1A 3P2VA 4LUSB 2V67A 4JPGA 2V3FA 2C18A 4PMRA 3FXGA 4GUJA 5D2WA 4AZ6A 4US5D 4WXZA 1XI3A 4V1XA 2G4JA 4UWMA 3PWGA 2PSNA 3ARTA 2X0HA 3CUZA 5GNZA 2GVLA 1DE6A 3KBVA 4H9YA 3MDWA 3TZFA 1VCFA 4IIDA 4O52A 2GUUA 3LLDA 3ANYA 2GWNA 1R87A 1Q7MA 2Q02A 3THCA 3E3HA 2X0SA 1XSIA 4NAFA 2PDFA 3MUAA 1QPQA 3H22A 2IQDA 4KESA 1EC9A 2Z29A 3GS6A 3PZIA 1UR1A 3WEMA 4HYWA 3D47A 4JIPA 3VZYA 5ENLA 4KGLA 1PZ3A 3NGJA 3HPXA 4KCWA 3KTCA 3VKJA 5I24A 3O63A 4ZFCA 1X38A 4LNCA 2WBGA 4PUJA 5FJPA 1SR9A 2PUZA 1KB3A 3YPIA 3K30A 3LRKA 3VDHA 3SUSA 4HVXA 1AK5A 1S3HA 2ZXBA 4PUNA 3WBAA 4O19A 4L4PA 1X98A 5D2TA 1FWCC 2E6DA 3WLSA 3VM5A 4QEHA 1TWDA 1GEQA 1XLCA 3LCFA 1MNZA 2ZICA 2FVLA 3AWOA 3R0UA 3KOFA 4W86A 2PE4A 1EDQA 4XD5A 1I2PA 4ZODA 1R5YA 1FFQA 3BAWA 1TZ9A 3EWUA 1UD6A 4GH1A 3VD7A 4YHGA 4H9ZA 2WMKA 4JY8A 1E4IA 4AEFA 1XR2A 4O11A 4E5TA 1MYRA 2E9MA 3GU9A 4NJHA 2VT0A 4JN8A 2G95A 1ZJHA 2Z1WA 1Q85A 3LCXA 2EG6A 4M6VA 4GUIA 4CNSA 3T4WA 5DRIA 2NX9A 4ATDA 1A5SA 5GVJA 3LPPA 2VFDA 2PDKA 2PDBA 2ZIDA 2OGJA 4S2BA 4N9BA 2FHFA 4I9JA 3W1RA 2ZE3A 4ADSA 4GUFA 3IGHX 4JTQA 3MCMA 2CPUA 1ECEA 3E0IA 3G22A 4X3ZA 1ITUA 4MY9A 3BW2A 4GIAA 3HMJG 1RD6A 3PSVA 3M5VA 1EHNA 5EY5A 2Z1XA 4ALDA 4UQBA 3MT1A 1AJZA 1X6UA 4H6RA 1B5TA 3PTMA 3G1DA 5IFTA 1GONA 3AMDA 1EL3A 1UP2A 4IPJA 1XCXA 1I60A 3LU2A 5AYYA 1EHAA 4DZAA 3ITXA 4O14A 3FDKA 1B3OA 4NAEB 3BG5A 5GNYA 3C61A 3S0CA 1BWLA 3PZNA 5HNUA 2Q71A 4JTFA 1V02A 2BY2A 1ZB5A 4PUDA 5M5DA 3W1PA 5DELA 4UFLA 5AHMA 3WUBA 1R85A 2ZUSA 4AMCA 3EXSA 3TYBA 2DH2A 1VH7A 2BZNA 2XUCA 4PBGA 2BOFX 3H2CA 3LCIA 1TPDA 3NEVA 3MV01 3TW9A 4HZ6A 3KZPA 3T81A 3L4ZA 4O1DA 5M2FX 1NF7A 3FXYA 2NVCA 5E93A 1YPFA 4H8HA 4UOJA 1T0OA 4ZO7A 1ADOA 2GJLA 2HXUA 1J0HA 3ZOAA 2NXHA 3IJ7A 3WLTA 2DUZA 1Z42A 3W86A 3V75A 2CZEA 3LPGA 3MSDA 1GYLA 2J9ZA 3NQ2A 4S3JA 4RNJA 2UWFA 4UQEA 3PTDA 5GNXA 2W62A 2YXOA 3NL2A 3DUGA 1DJNA 3IJ9A 4HMEA 1H49A 1NTHA 3BURA 2BSLA 2BOEX 1OIMA 2IXVA 3PZGA 3VOHA 2DZXA 3ARYA 3FVDA 2W92A 4MF4A 1JGIA 2HS6A 2OGYA 3BGJA 3R58A 4H00A 1GEHA 1P6WA 3AC0A 4GUHA 4FP1A 4DXKA 4JIEA 1V77A 4LS0A 2MUCA 2DZBA 1UA3A 1S5WA 4LH8A 3IRDA 4QFUA 4J2PA 3N6QA 3CEPA 4X9YA 1EIBA 5J5RA 4IIEA 5GJMA 1YTKA 3PB0A 2VOMA 4XZ9A 1F4HA 3T42A 1ZJBA 1GOIA 1N8FA 4N9DA 4F2BA 1W3HA 3IPWA 3WQDA 1GNXA 2DZAA 3NQDA 4LC6A 4OHQA 2DJXA 4V28A 2PU1A 5LA1A 4J9JA 2FH8A 3S5SA 3HM7A 4FZIA 3IGSA 5FJIA 3EYPA 5G2IA 4KCTA 3TOYA 2D2HA 4H83A 4S3DA 2ABBA 1GOOA 4K8GA 3U5YA 1A5MC 1F3EA 1JZ2A 1GKPA 4JR5A 4AX7A 4R7JA 1H63A 2PODA 4CN6A 1S2CA 1FHDA 1XISA 1SQ7A 2BXVA 4XQ6A 3L2MA 4RDVA 4JZ5A 2V3GA 2WNNA 3TK7A 3G0XA 2W0UA 1ME7A 2FPTA 5F4WA 1V6YA 3KRBA 4W4QA 4CU8A 2WVSA 2Y70A 4WGHA 3AQUA 3LTPA 2PDYA 3EWDA 4Q4SA 2CW6A 1UPPA 3IUHA 4AIOA 2F61A 2ZOXA 1DXIA 3VKBA 1EJWC 2YCJA 1QHZA 2QPUA 4FLQA 2G3NA 6XIAA 3WUGA 3WQEA 5JIPA 5D9OA 4MG4A 4A22A 3UXIA 5FAGA 2BGQA 4Y6GA 2VCCA 3OZOA 2HPMA 5AYBA 4I3GA 1CXKA 4LUJA 1OD8A 5A2BA 4GHRA 2I7GA 1JF5A 1G7UA 4HZMA 1FRBA 4NT0A 1RH9A 4ECLA 5D4YA 4DHGA 5FJRA 2XTKA 2J47A 4IQEA 4H2HA 1J10A 3AO0A 3NXLA 3AS0A 3SN4A 3VNIA 2H3DA 1X6NA 3AXKA 4GA8A 1J79A 5FF2A 3IS4A 1WZMA 4A3QA 4IG2B 5DANA 1V79A 3LENA 3GDMA 3ZJ6A 4GXPA 3I4EA 3VMOA 5CJ5A 1KQYA 3AHZA 3LOTA 5EYWA 4P8VA 1K8YA 1SVDA 3S2JA 3ISIX 1UWUA 1QFEA 1JRCA 2H9AA 4KIEA 4IJCA 2OQHA 3SRDA 4L56A 1B0IA 4Q4QA 3EMCA 4BK9A 1RBOB 2VGIA 4O18A 4I5UA 4JHOA 3BAJA 1PAMA 3NM1A 1HZYA 3OYXA 3BCDA 3REQB 4JFUA 2PBGA 4MOZA 1UD3A 1NARA 4PCFA 3BG9A 4NF7A 3RILA 3W7RA 1TO3A 3QPYA 2DDXA 1SR0A 3GNDA 1U1UA 1QW9A 2GQ3A 2NV9A 2Y24A 3VGFA 3BJTA 4Q8UA 4AISA 1H7NA 5HBFA 4CD6A 3MO4A 4JHZA 4O17A 3WQOA 3W4RA 1T8XA 1ZHAA 2PDMA 4JTEA 3SDOA 1OG6A 3WY1A 4E3TA 1ZGDA 2XPKA 1QU4A 4JFVA 3A12A 1FHVA 4FNSA 1Q2RA 1BLIA 4UOZA 2CXEA 5IHSA 5ABGA 1WE5A 5A8OA 2H3BA 1GORA 3MO7A 4CQBA 3VNZA 1KC7A 4WOZA 4NHVA 1QTWA 2YLAA 2J79A 4UTHA 2DVTA 4IWWA 5B7ZA 4NASA 4OBSA 4UFKA 1S39A 4ONVA 1JNDA 1WCGA 1UOZA 4HK5A 3STPA 3VKAA 3KDNA 3M6DA 1IGSA 3ES8A 5FSEC 2VR2A 2ZTKA 2XSAA 1GW1A 5F1VA 3T9PA 4LUTA 2PTZA 5G5IA 4FNQA 1EP3A 3BWWA 1K3UA 3AHXA 1I1XA 4JY9A 3LA4A 2NQ5A 2ISWA 4B5TA 4ZQRA 1B9ZA 1JDEA 3ABXA 1Q6GA 3TQVA 1P0KA 3GR7A 2VNCA 1P0NA 2OX4A 3FCPA 4GIYA 2PWFA 3UQNA 3NL5A 1VR6A 4D6CA 1E0UA 4S23A 4JEJA 4JQ2A 3W25A 1Q7QA 4MNMA 2G50A 3A4XA 3PK7A 3MVIA 4MIMA 3K8KA 3IUIA 3VNMA 3WNNA 4Q8PA 4GX8A 4LB3A 1XIDA 3TMQA 1IZCA 1OX6A 3W38A 3HBLA 2GJXA 2Y63A 3VUSA 1W9BM 4TR9A 1MXDA 4C91A 1Q6QA 1XWYA 2DH3A 1OYAA 1BF6A 2BXYA 5BW6A 2RGMA 3PZUA 5JBFA 1U33A 3TN3A 2R91A 1US2A 3MS8A 1XIFA 4H41A 1JI1A 4X63A 2J7CA 1TX0A 3ITTA 3WIJA 4RNIA 2RAGA 4P7NA 5FEXA 3S5NA 3CZ8A 1IV8A 3TQ0A 2RJGA 1KKOA 3B4UA 3RO8A 2WJZA 3CO4A 1V3LA 1RPXA 2YXGA 3C3UA 5FF4A 4XD6A 3HPAA 5G2HA 3AFBA 1NJJA 3WLQA 4YTSA 1YE4A 1E6RA 2E8YA 3GTFA 4CNNA 3PVFA 1TCMA 3U5UA 4ZL1A 7REQA 1BD0A 3KWXA 4IXHA 1EF2A 3U4FA 3TUUA 4PMQA 3BGAA 5T26A 1XLEA 2YDSA 3QKZA 5EFDA 3BQ6A 3MQTA 2Z2UA 1LWIA 1H51A 1JCXA 4LEFA 2JE8A 1TSIA 1L2QA 5DT5A 5IFPA 2OLHA 2QMKA 2OOGA 4MVAA 2D3LA 4TTUA 4QDWA 4GVFA 2ALDA 4KRUA 1W5PA 3UW6A 4IX0A 4QTGA 4KEUA 2EAWA 2TODA 6ENLA 1CIUA 4QM1A 4O16A 3BE7A 3GM8A 3LHUA 4J4KA 1TJPA 3UPWA 2EPMX 2XDFA 3L0GA 3GC4A 1JCTA 4IL2A 4AZ5A 4WQ6A 2QCMA 1NFGA 4M8UA 2XVPA 3AXHA 3EX1A 3EX2A 3EX6A 5HMEA 1BXNA 1V93A 4UFMA 5J8LA 3BOLA 4S3CA 1YNPA 4IJRA 1ITQA 4GYPC 3R11A 3MU7A 1UASA 2LLEA 3AZRA 4D72A 1G4PA 2IQ0A 4POCA 3BLLA 2JKEA 1QK0A 1E0VA 4GQGA 2HJPA 3CIVA 3DHDA 1E72M 1PIIA 4JQAA 1W9PA 4AD0A 1QOPA 1XLJA 3B9AA 4QDPA 1HIZA 1FH9A 1KGUA 3HJEA 4JTRA 3GNPA 4F0MA 3ITGA 4JNYA 2I16A 4M0XA 3EOOA 1I2RA 1RVKA 3LM7A 3THDA 4X0NA 4IIHA 2Z7GA 4DBUA 4FI4A 4ZQMA 2XIJA 1XYBA 3MANA 3LHWA 2HTMA 1ADDA 2F2KA 2WC7A 1BGAA 4IXXA 1LRNA 1N8IA 1EH9A 3DZ1A 3E0VA 3W1UA 5I2UA 4AFYA 3VMNA 1GG0A 4OQVA 3PZVA 5LIWX 5C8BB 1W1ZA 2E6YA 3VIKA 1GVOA 2BXZA 1E0WA 4XB3A 4GI4A 5DCEA 1N8WA 2ZX8A 1CPUA 3QV6A 3RLUA 4H01A 4JICA 4NIRA 2VM8A 4UCFA 2IXUA 3PPGA 2PDLA 1IGWA 3ARRA 3DFTA 1ISWA 3ARZA 2RDXA 2EPKX 3LNMA 4GBDA 2PLMA 1JEZA 1ME9A 3V0TA 4B91A 2F38A 2G4FA 4YCOA 2ZRYA 5JQ9A 2W66A 1KCLA 3W75A 1VENA 3KW3A 1QNVA 2YSWA 4CNPA 4OOZA 1H09A 3R79A 4QITA 3AYSA 2PC8A 3PG8A 3CMGA 3K4DA 2A3BA 1T41A 3GX9A 4GJIA 4H7CA 1HL9A 3UJRA 1TZ7A 5CGTA 5FI8A 3FW6A 1P6BA 3W87A 7PTDA 4XKMA 3H21A 4MHBA 4UQAA 4C5YA 4AQLA 5CG0A 4LBUA 4ZCWA 4JDBA 2CWNA 3UPMA 2ZQ0A 1GCYA 5A6BA 3V0SA 2YXXA 4E3VA 3LY0A 4JDYA 4RDZA 3CMFA 4MZ8A 2W61A 3FKRA 9XIMA 3S5ZA 5I77A 4ZB5A 4MB1A 4HN8A 1OFEA 5C7HA 2HVNA 4HCDA 1OBAA 4CCDA 4RE0A 3E74A 5D2XA 4UTJA 2GDQA 4F4RA 1DORA 1UB3A 2PWVA 4CKQA 4DO6A 1QI0A 2J75A 5JXQA 1TKKA 2VI0A 2UY4A 3GXIA 4XAZA 7TAAA 4OKDA 1RJRA 1JL8A 1M03A 1H7WA 2QDDA 4FPSA 4J3SA 4YTUA 3UYIA 2YCLA 4AVNA 2V63A 5BROA 3F4WA 5CPTA 3F4NA 3RX4A 2B7NA 3R7MA 4IH3A 3VCNA 2ZZ2A 1VJZA 2OODA 1EZWA 1XXXA 5I3HA 1VD6A 1TPB1 3V7PA 5A3HA 1HG3A 1ZTVA 1E71M 3FX4A 3FYYA 4V2XA 5CXPA 4Z2GA 2V5LA 4PMYA 4H4IA 4H8VA 1YXDA 3RPTA 3RCNA 4C6CA 2EKGA 1FVPA 1GZ1A 2Z1SA 3A23A 4HNNA 3CPUA 5B7YA 2WMIB 4D6IA 2VZTA 4WSHA 4QBXA 1VBGA 1QOQA 4PCSA 1AFSA 3RITA 2YZRA 4LVGA 3ZT6A 3GW3A 5TF0A 3BANA 1LP6A 3FK4A 2ZX5A 4BFAA 3AIQA 7XIMA 1QDSA 3UA4A 3RRAA 5C54A 3CAQA 3WNOA 1EGVA 1UWRA 3EPOA 2XZ7A 4ZZ9A 5DXYA 3N9SA 1LOQA 4DWSA 1IWAA 1RLCL 1CXIA 3DENA 3VMPA 4K68A 2WHKA 3LPOA 3ARXA 3UGVA 1XYMA 1AL7A 3RUBL 5RUBA 4RLIA 4LT9A 2REQA 2VDIA 4KPLA 1LL4A 4IMEA 3LS9A 3G1XA 2XIQA 3P8JA 3W84A 3V18A 2PS2A 5HMDA 2DZSA 5KSWA 2OG9A 4GIRA 2XGIA 2Z0IA 1CTNA 1TPWA 3B05A 3N4FA 4QS6A 5CQ1A 2YKKA 3VNYA 4W5UA 1B30A 4BQ5A 1V6UA 3B8VA 4ICCX 4D8LA 1CECA 3XIMA 3JZEA 4PTWA 3CV1A 4K36A 3UXLA 1LTDA 1TELA 1GOQA 1EJVC 4NP7A 2SFPA 1X7IA 4QSHA 4JYDA 3V36A 2FVMA 3UF9A 4AWTA 3ARPA 5D05A 4EK7A 5I0DA 5XIAA 1FWEC 1WPCA 1QXLA 4J3WA 1EX1A 1JQVA 1LZOA 1N2VA 1W1VA 2R6OA 3PANA 4CCZA 2GUBA 4GZJA 4UFIA 1QPKA 2X30A 2QGHA 3SURA 4PB4A 4E4FA 3O6CA 2YCIX 1NF0A 2ZZ4A 4ASTA 6PTDA 3VXGA 3CASA 3CNYA 1GZJA 1GKRA 4QGCA 1DJIA 2FHBA 3AIWA 4MLJA 1UIPA 4AG0A 1W1A1 2DQXA 3C2RA 2P76A 1XGZA 4NI3A 3SRKA 2ZA2A 3SI9A 4IGHA 4GX9A 3VFLA 4EX4A 2PWGA 5AHIA 1KR1A 2DSUA 1NOFA 3T44A 3TYAA 4XBSA 1XM3A 2V9DA 3B06A 4HHMA 3W1LA 3FS2A 3OZMA 2J7DA 1LL6A 2NVDA 2CERA 5KITA 3DYOA 3W24A 1UYQA 4WF7A 5I5RA 2QCGA 2E1WA 3N3MA 3SCWA 1Q45A 2HEJA 3P62A 1THFD 3TN4A 5I02A 4AD1A 1XBZA 1OSEA 1G67A 3OGVA 3AIEA 1CLXA 4Z1BA 2D20A 1ISZA 3A4JA 5I78A 1EJUC 3KP0A 2GGJA 4Q8TA 1JVNA 3OA3A 3ITYA 4LYRA 3B9OA 3UR8A 2C7FA 2VRKA 4P7QA 4XZNX 2PDPA 1F9CA 3MUCA 4MLRA 1CDGA 1YTEA 4N4PA 3OHIA 1S2WA 4GC4A 2G3IA 2BVTA 1A80A 3IJQA 4UTWC 1E9ZB 3CK5A 3GHUA 3FHQA 3U0HA 1QT1A 1YADA 3OIHA 3XINA 4IUGA 3TLQA 3QGKC 5IRPA 1OFPA 5BRBA 1OGSA 5PTDA 3H23A 3C2YA 3KOWA 3GXTA 4C7DA 2FGBA 1UKTA 4WLCA 1ZBWA 4HCLA 4LXFA 2OZ3A 3L4VA 1YE6A 2JKPA 1TPVA 2YL6A 4ZO8A 3KWSA 4JN6A 1V0KA 4XZIA 3Q67A 3THAA 3L67A 3EKGA 1PB0A 2VEGA 1NP2A 5F2GA 3WD4A 4M7SA 4IMDA 4RR4A 5E6ZA 5DFAA 5A6MA 3SN0A 3ZS4A 1AQHA 1OIFA 4L80A 4UZUA 3E02A 4Z17A 1XF0A 3KCLA 3WLMA 3W3OA 4DBSA 5HJXA 1KGXA 2J6XA 3W70A 4QJ4B 1BG4A 4XISA 2VQTA 3QXBA 1HJUA 5D33A 3THQA 3DU0A 3LMZA 1SGJA 3H55A 2D73A 5ABHA 1CXHA 5CPQA 3PNUA 5DCBA 1KFBA 1ZCOA 4ORMA 4JYEA 4IMAA 1Q3NA 2YCKX 1YXYA 3NNTA 3R12A 3W76A 1V6XA 3G8RA 4AVFA 2WKLA 3CUGA 1B3XA 3NSXA 3BTNA 3NYDA 3MSRA 1QNPA 3K8MA 2BGSA 2WK2A 1P0DA 1FH8A 4PMDA 4QJ3B 1Y7VA 2D69A 1EJTC 1MUMA 4HOXA 3KBWA 1A53A 1TV5A 1TG7A 3TV8A 1RD5A 3OA5A 4TXEA 3W1MA 5E6YA 2Y6ZA 4FLOA 3NUKA 2C6QA 3C2FA 2ZRVA 4PMJA 2ZYFA 1E55A 5EFFA 3N19B 3Q94A 5FCZA 5D9MA 1FQ0A 4H7VA 5JMUA 3B0UX 2F6KA 3QMSA 1OX5A 4R33A 5HNNA 5A1AA 3OODA 2YA0A 1T99A 3TCSA 5CC7A 3MMWA 1VBJA 3W07A 4KFOA 5FJTA 1Q7ZA 3WK1A 3NQAA 3JW7A 4BQ2A 1I6NA 1HX0A 1WKDA 3E0LA 2WANA 4MYXA 3NXFA 4WJ8A 3S9YA 3A24A 4QE1A 3UCCA 1ONEA 1FUYA 1UG6A 4XVDA 3W2JA 2VEIA 2GLKA 2A7RA 1OX4B 3S5YA 3RO6A 3B40A 1W1IE 4QQ3A 3LI1A 4PUUA 3UETA 3VGBA 3VDCA 1UR9A 2VZOA 4FEZA 3QC3A 3BSHA 3LV6A 4S38A 4K2SA 1REQB 3WO8A 2BHUA 3KOZA 1UROA 2XG9A 1WUEA 1KXQA 1GTEA 5LA0A 2HROA 3N2BA 4L4MA 5JU6A 4Y7EA 3QR0A 5HXMA 3PS7A 1GQIA 2CLFA 2ATSA 1KBKA 1S2TA 4S3BA 5BXSA 4B3ZA 1GQKA 1SW7A 2XINA 1TB3A 4M3PA 2E5BA 3M47A 4JFSA 5BOFA 5DBUA 3MMTA 4NZ3A 4E0CA 3C56A 4LBRA 4GYFA 1NQKA 3BMVA 4HB7A 3UP8A 2YDAA 5EMKA 5CZKA 3W6YA 4ZTYA 3RGTA 1E5NA 3TU9A 4GGHA 2G8ZA 2WYSA 1TVPA 1KTCA 2Z2AA 4NSBA 4UNKA 3FFSA 6REQB 1VLIA 3QTGA 5BU9A 1QBAA 1XQLA 2PDJA 1E1CB 1F5ZA 3PP7A 1DEDA 4KMQA 2DU2A 5HPCA 1BTMA 1FWIC 1TPH1 4L9XA 4DJFA 3QR3A 1F4AA 4ROQA 3EA1A 1XJBA 4HPGA 3GIYA 4DXXA 3BSMA 1DJGA 3SJ3A 3VKCA 1R6WA 3FSUA 1E4LA 3S47A 2CKRA 4MWAD 1GW9A 1G9HA 3ZO9A 4W5ZA 3KHDA 1E6ZA 2Z6JA 4DJDA 1H50A 4TUFA 3SQSA 3S1XA 3H7UA 2Z1BA 1KWGA 3UY7A 1AQ0A 2GZXA 3KOXA 4RPPA 1ICPA 1MW3A 1VP5A 3CUFA 1ZZMA 2YR1A 3IACA 3OW1A 2OCZA 4DUOA 4HN4A 4C6OA 2XWDA 1DBTA 3DHPA 2WKJA 1T96A 3QN3A 3TH6A 4BY3A 2Y0FA 3NWRA 2ZKMX 3C5QA 2J7GA 3BV4A 3F5KA 5ECVA 1HKVA 4PSPA 4LRSA 1XHGA 4MWAC 3OVQA 3W1QA 3H7VA 3T08A 4C6QA 3B8TA 3GDRA 4H8NA 2GVEA 4KEZA 2J13A 2Y7EA 1JAEA 3RN6A 4HOWA 3P8IA 1J5SA 4QG9A 4UTFA 4W8AA 1CYGA 4N6FA 5C5YA 3DFHA 4LQ1A 3NL3A 2NZLA 3IWPA 3SCNA 1EJSC 3DFPA 3M9YA 4C7GA 5EMYA 4B2DD 4KEVA 3WK3A 1WP6A 4NAFB 2GDUA 4NXKA 4PMZA 1J0YA 1KCZA 5D09A 3TIMA 1XYZA 2WMGA 3O7UA 2NV1A 2XISA 3E2VA 1C3FA 4TMBA 1E9YB 2DJLA 5A8PA 4PC8A 3LV5A 3WQ4A 1KFCA 4ADTA 4TVUA 2PD9A 1UR2A 3VIPA 4LGXA 1UR0A 4R3UA 5FF7A 1YPIA 1Q66A 3B9DA 3KL5A 4S1FA 4YMZA 2WNWA 3LHVA 1VBHA 4YVVA 3DBPA 1H62A 2CLIA 2BWGA 2EG8A 3UFYA 2WBKA 5C70A 4A2RA 5TQLA 5M03A 4FSAA 3DC0A 1S5NA 1UWIA 3IGXA 3QSTA 1W91A 4D6HA 1LRQA 4AD2A 5CC5A 2BASA 2CZ5A 2CITA 4JQ4A 2VCAA 3WG6A 4XKYA 4PCTA 2WJEA 3ARSA 4RE2A 4Z0SA 4JHMA 1KTNA 2XFRA 4Z1DA 3M43A 1Y0EA 1FXPA 4N9EA 1P7TA 2ZRZA 4OV4A 3GYCA 2OZTA 1PDYA 4QRNA 4G2DA 3KBMA 5A6SA 2OFJA 1H1NA 2O9RA 2IKHA 4DJEA 1PKLA 4PL1A 1TE6A 4M7TA 1A47A 5A6LA 3CYVA 4HPJA 3UT0A 3NYZA 2P88A 4YHEA 5HAOA 3EOUA 2GUYA 3CXOA 1TWSA 5HNRA 5KETA 1H1ZA 2PDNA 3VE7A 4B15A 3TAKA 3LUTA 2VC7A 4C6EA 1FCUA 3A47A 4W89A 4XIMA 2YDRA 2GGIA 3QHNA 2WCGA 3C0JA 4GCXA 1KRAC 1UUQA 4YJ5A 3EXRA 4L6HA 1SPQA 2OOFA 1XRVA 1CB2A 1SJDA 1RP8A 4B9YA 3SFKA 3M0KA 1D7KA 4YS1A 2YBVA 4AHOA 2IKGA 1VYRA 2F7FA 4C6PA 2BX7A 4KIRA 4MZ1A 1J18A 2EPNA 4LTSA 5KMYA 1DJWA 4ACZA 3SSJA 2QDEA 4PB5A 1J4EA 1EWDA 1ADSA 3TAOA 4MB4A 3NDZA 2OKOA 1JZ4A 3URBA 4FO4A 5BRQA 4ZEPA 3BICA 3VNJA 1M04A 3EB4A 4CQ8A 4FX7A 1J6OA 1A49A 4R27A 4MDOA 2P8BA 3IARA 4E2BA 3BLDA 4C6MA 4ZVJA 2P53A 1XIEA 2PF0A 1TJ2A 1MI3A 4HA1A 1F73A 5CPSA 4LX4A 2C1IA 1XYAA 3AIRA 2JK2A 1XH2A 3WLNA 3TYZA 3O05A 3CQJA 3ITOA 2RUSA 3CZKA 4EACA 3CZLA 1R0MA 3PBVA 3CHDA 5MF5A 1U2YA 1XICA 4QSFA 3AICA 4CUCA 1P0BA 4AX6A 2D1ZA 2QCHA 5G2WA 3MCNA 4PBEA 1YBQA 4P8XA 3OQEA 2VZVA 4GO8A 3R8HA 3T05A 2ZXDA 4I90A 1E40A 4NX0A 4D6FA 3DC8A 2OELA 2QPXA 4Q8NA 3WDJA 5LNRA 4LALA 1D9EA 5BRPA 2VVNA 4WVXA 3C0SA 3RHGA 3KFTA 3ZR5A 2VEKA 2V5JA 4AWUA 3SGGA 4TX9A 1JIBA 4YPJA 3UCQA 3TR9A 4NKCA 4AIEA 4W7VA 4OZOA 3MSYA 3H2FA 1I9CB 4ZXOA 4E4PA 4KRTA 2IQTA 1OJXA 5AHFA 1O5XA 4MFEA 3PJWA 3VIIA 4GVIA 4DX3A 2ZDRA 5BYWA 1JCMP 2VC9A 3WFLA 4FR6A 3TYEA 4IP7A 2GYIA 5DF0A 1A5LC 1D7FA 1LBFA 3DG3A 2J8TA 5F1UA 4X22A 1C8VA 1EOMA 2POTA 3QHMA 1UHVA 3R8GA 5GPRA 3KOYA 4BJHA 3AHTA 1Q6FA 2GSEA 3W83A 2VVSA 4F9DA 1RQHA 1LLWA 1ALDA 3A21A 3UXDA 4NUWA 1CZ1A 3L65A 1TPEA 4L6OA 2XH2A 1VB9A 4RXGA 3SUWA 1PEZA 2ISSA 3AAMA 1IXPA 1O95A 2VR5A 2I5IA 5E1QA 3N6HA 4K7YA 1C9WA 1A3XA 2ZCGA 1ZAJA 1W1B1 3T8LA 1IWBA 1K1DA 2PEVA 1GJUA 4U33A 3RM8A 1MFVA 2FTYA 3MCOA 2B7PA 2FFIA 1WAWA 3AUJA 5FF3A 1HL2A 3G5EA 3TVAA 4HCHA 2B81A 4Q3MA 3WMBA 3ZM8A 4GBUA 4NJKA 4NJJA 5HMSA 2ZUUA 5DCDA 1V03A 4BS0A 3I3DA 2TRSA 4UQCA 4J5NA 2OTDA 1HJSA 2HPIA 5CZSA 5C0QA 4W7WA 9CGTA 4KEMA 2DSVA 1VF8A 3LXAA 4GYJA 3LN3A 1GVYA 2FKPA 3ANVA 1UUMA 5JBEA 3BC9A 3W2LA 2E67A 2KAUC 4KS0A 3ZWTA 3RAOA 3WMLA 1XP3A 2QUUA 3OVRA 5H8UA 1EXPA 1QMLA 4ZQPA 5LHEA 1PE1A 1TA3A 5CEWA 3LHYA 4KW2A 4MPQA 4IT1A 2PLCA 4FOUA 4DZIA 4DEFA 2ZVRA 1ZSXA 3S2LA 3VIJA 3HOJA 3UVAA 4FR1A 2BVDA 1JI2A 4BI7A 1LQAA 2VELA 1GPFA 2OMAA 3WJWA 3B3DA 4ZE4A 2TYSA 3CH9A 3DFNA 3DBNA 4CU7A 4DF1A 1MZRA 1WO2A 3GD6A 4IP4A 4Q22A 1Z6KA 4GLEA 1H7XA 1K9FA 1WBJA 1R3WA 2V30A 1UCWA 3LB0A 1KTBA 2H9AB 2QAPA 3PPFA 3ABRA 4WDWA 4GUGA 1R9YA 5LHFA 3LG3A 4B4FA 4BHYA 1S46A 4F0RA 3LCHA 1RP9A 1F8MA 3W53A 4I5XA 5H8PA 4OOUA 4LANA 5A6BD 4GXMA 1VEPA 1EPVA 3L23A 1OFQA 1Q6OA 2W27A 4HSHA 4CQAA 1QR7A 1E15A 3PFMA 3N2XA 2TSYA 2C1GA 3DFSA 4S3FA 2WLZA 3AXMA 2GVGA 1XIJA 1OC7A 3GKFA 2NLIA 1KBIA 3LHZA 5M17A 4J3VA 2A7PA 3ZQ9A 3RCMA 4TTGA 4CN4A 3OBAA 4ZQCA 1KRBC 1QNOA 5DT7A 3A64A 1QW7A 2DIKA 4O1AA 3VCRA 3WQPA 1JPIA 4Z2KA 3DOPA 2OJPA 4EKJA 3I7QA 4NZJA 4NZ1A 1SSGA 2FQIA 3UWQA 4H9UA 3VI2A 3M41A 4AWEA 4I8YA 2V38A 4J3ZA 3U7BA 5DEZA 1LUCA 2YDQA 2X0YA 3BO9A 5FA5A 2QJNA 5IBXC 2XFYA 2IKJA 1E6PA 2AKZA 3BVJA 3GH5A 2BS9A 3UNTA 1TIMA 3NCOA 4FNRA 2HSAA 4LUTB 1LF1A 3W7MA 3K1DA 3CWNA 1SFLA 1XBYA 2WWDA 1TTJA 2DY3A 4FNTA 3S4TA 4BWLC 3POHA 3WKZA 2FHCA 3C8NA 2DT3A 3LYEA 3SY8A 1RCOB 2UY2A 1V02E 1SU5A 5HMFA 4A8RA 5DO8A 4DPPA 4C6BA 4ZFMA 2Y5JA 3GDTA 3U7VA 1IR2A 2Q3OA 6TAAA 2ISDA 4Q6JA 3HF3A 4XD4A 1HVXA 2A1YA 2R8WA 3R4IA 1XS2A 1EEXA 2E6FA 4FX6M 4HU8A 3GZAA 3SY5A 1OT1A 2ZRUA 3HO8A 4XVEA 3I7RA 1XC4A 3OBEA 3ME3A 4V1YA 3GFZA 2GJXB 3UZYA 1C8XA 3DYMA 3L0NA 3WF0A 3MJYA 2IS7A 1OVDA 2Q8ZA 1S2AA 1UR8A 1O60A 2Z26A 5G1MA 4TV5A 2E6AA 3F5LA 3CO8A 4H7ZA 3L4WA 1GOXA 1XD1A 3TYUA 4B92A 1S5MA 4IOTA 2PBOA 3CC1A 3H2AA 3M0MA 1LBLA 3FLUA 1NH6A 3L4YA 5AC8A 1X39A 1XRTA 2WMJA 4HPXA 5EA9A 2OYKA 3M0HA 1B4EA 3MKCA 1OADA 3F4CA 1YMYA 3RMEA 4HT3A 4LAMA 3QEZA 1M7OA 2VEPA 3S1WA 3HQ1A 2J9XA 4YTQA 4AEEA 1PJ9A 2PDCA 3H12A 3CL6A 4KWOA 1WXZA 3UXKA 1OFRA 3SM0A 3VPLA 1R46A 3T7VA 4PMNA 2I56A 2GVYA 2Q01A 1E70M 1E0XA 4K6AA 4Q7IA 1I2QA 1GHRA 1I0BA 4Q6XA 3U2ZA 3F4VA 3EWCA 3EWWA 1RVGA 4IHCA 3W7KA 4RPQA 3CAWA 3QC0A 7REQB 1XSKA 1GVRA 5IHRA 1HQTA 5BXPA 3FJLA 1FP8A 2O92A 1XCWA 2QDGA 3M07A 5C7VA 1JYNA 4EE9A 2PP0A 1QO5A 4GYKA 4LYKA 1WDWA 4IIFA 2GOUA 2NQLA 2VMFA 3A4AA 3B8SA 4OBRA 1U5HA 2Y7GA 2DIJA 3NZRA 4LY4A 1ZP3A 1UKOA 1Y65A 2CLKA 1O5QA 1U5JA 3WQ5A 5LKYA 4OUIA 3H2NA 3HQOA 1D3HA 2BBFA 4U4MA 3U9IA 3KRSA 1VFUA 2XIOA 4NZFA 4G7FA 4FXFA 3GG1A 1H1YA 5LNUA 3KEHA 3ORWA 4S3EA 4HQVA 1ONXA 3A6OA 1XKYA 4J3UA 3GBDA 2OVLA 4LUIA 1BYAA 1E1FA 3G2GA 3OLEA 4R7WA 3WQGA 4B4HA 3F2DA 1KXHA 3WDPP 2XIMA 3DI1A 2G3FA 3G1FA 2X09A 3P0XA 4FIRA 1RJQA 3FEMA 1AH3A 4UR9A 1XH0A 3O1NA 2WC3A 1UIOA 4FNPA 4XTDA 5A2CA 3PUOA 4TX8A 3RJYA 1EGMA 3VU2A 3GHRA 5C71A 3LBMA 1F7BA 1VEMA 2WNQA 3WLRA 2V3DA 1V0NA 5MKGA 2D2GA 3A3XA 3ABSA 3WQ6A 3WH9A 3LEPA 2WWCA 5AHLA 1MEHA 4FMVA 5CC6A 2KX9A 1H41A 3IUDA 1KM0A 4KWVA 2VUYA 3W72A 4ZE5A 1H7OA 4HA3A 4O0QA 2NXGA 3GC2A 1P6CA 2ZE0A 2PTWA 3CZJA 1DL3A 1OX4A 2Z28A 4LVBA 3GC5A 1G01A 1WDPA 5AN7A 2VWTA 5EBUA 4GO9A 5AC7A 1KFJA 2YJQA 3HTWA 2ZWYA 4QE5A 2AL2A 3GXFA 2XSXA 4WIWA 3I3BA 1REQA 3S83A 2CHNA 1DJHA 2FB2A 3KTXA 3J7HA 4P7LA 5F2MA 3VGEA 3WJZA 2VUNA 1OC5A 4GK8A 4E2DA 3FOKA 4P2VA 3BMXA 2WQPA 3U3HA 5AYZA 3GFYA 2QCLA 3EKZA 3B8DA 3AU6A 3TSMA 2PWUA 3TEVA 4PFMA 3S8HA 3VZXA 4KCVA 5LXEA 1XIGA 1XYFA 3QZEA 1IYXA 4US5A 3UWUA 3ARQA 2NT0A 1J9YA 2AGTA 4LYPA 3I6EA 5I06A 1XBVA 2Y5SA 1BWVA 1HF6A 3QY6A 5DQPA 3DEQA 2EPOA 5A2AA 5KEZA 2E3ZA 1E51A 4CU6A 1JXJA 3G18A 1UD2A 3L12A 5REQA 4F66A 4H9TA 2H8ZA 4ADUA 1TWZA 2A3AA 1Z44A 4JTUA 3LD5A 4ERAA 3KX6A 1UWAA 4EF8A 2PRLA 1ITXA 2DSKA 4WDUA 1GVEA 1NM9A 1XLDA 2ZA1A 3TE9A 2OO6A 1FWDC 3MP5A 3HB9A 3SCQA 2WVVA 4R34A 3SGZA 1S2UA 4YTTA 3W1XA 4B5NA 5CBBA 3VK5A 4FNUA 3QW3A 1DJYA 3HIJA 8CGTA 2ZZ6A 3L4XA 1Y8BA 3RF9A 3KS5A 1Z48A 1Q6CA 3TP4A 1TR1A 1Z41A 1A3HA 4WHBA 1KM5A 2YPIA 3PZ9A 5G4EA 1CGWA 4GC3A 1D8WA 5HWNA 1ZBVA 4EPEC 4Z2JA 3S9IA 4HHHA 3MZ2A 4IGMA 1K6AA 1PUDA 4RV3A 1XW8A 2DORA 5D8WA 3AOFA 2GJNA 2V68A 3NJ3A 1FCVA 3T07A 3CV2A 1TZZA 3GDLA 4CN1A 1PKYA 1A5AA 1WKEA 1UC5A 1OCJA 3W7QA 5AVNA 2YIHA 2KZHA 2RDUA 5LIKX 1KFKA 2UV8G 1BSIA 2FJKA 3G1SA 3G1RA 1KV8A 4Y90A 1ZENA 2EPHA 4PTMA 1C7TA 2ZZ7A 3OLIA 3OGSA 1OABA 4FS9A 2YBUA 3MDUA 2PDGA 4H9VA 5ABFA 4FK9A 1GJWA 2WZEA 3WF3A 3MBDA 3PF3A 3COTA 3CIXA 1LCOA 4B5WA 3BG3A 2AQVA 3TONA 2OWCA 3B03A 3E38A 3BARA 4DI9A 4UR7A 3L4UA 1K02A 4LF2A 6ALDA 1J6PA 2WPBA 5I7GA 1E4MM 1WX0A 4DWSB 1W5OA 4U5KA 3UU0A 1NWUA 3W81A 4Q4MA 2JBMA 4HNLA 5L6UA 4DJFD 3SRFA 3RPDA 3KVLA 2REQB 2G96A 4GFSA 3O0KA 1TPUA 1UBSA 3QHOA 4XZWA 3QM3A 1OHLA 5A5WA 1N7KA 5EBAA 1KBBA 1R3YA 2R82A 2ZZ5A 1S3TC 4LUYA 4QG6A 4GZ7A 3VIGA 1FWTA 3NFUA 2MNRA 1YNYA 4Q4OA 2YX0A 2VC5A 2NSXA 1WZLA 1DIDA 5C2CA 3R0KA 5BNKA 3HFYA 5GJPA 5BOOA 3HQNA 3M0JA 3BK0A 3QV9A 4QCFA 1PX4A 3OG2A 5HQLA 1SFJA 4L9YA 4LAZA 4M24A 4RK8A 1EIXA 3EMQA 3T0AA 4DJFC 1X1ZA 1KA9F 5FJOA 3VNKA 3JUGA 4TV6A 1CBGA 4JTHA 1B90A 3E6EA 5DXXA 4FALA 2P8CA 2WO5A 2NWRA 1W2PA 1HFBA 2AQWA 3P60A 3FAXA 4IGSA 4PH6A 3NR0A 4DLFA 2PZ0A 4DJDC 1E6QM 1MRAA 3ZXWA 3GFXA 3U48A 1G1YA 3PAJA 3I4KA 1VFOA 3WEOA 2INZA 1EZ2A 2VGGA 1A5UA 2YL9A 3KHJA 2E25A 2PLJA 3SCPA 3A9IA 3QFWA 3UZXA 1G7VA 3HG4A 1GYNA 1OM0A 1M53A 2CBJA 3KCOA 2NSOA 2EHHA 3UNDA 1TQXA 3OLDA 2E40A 4ICNA 1EDGA 4QLJA 3FIGA 3OU8A 1R86A 2YL5A 3OIXA 2PTXA 1GGOA 2JF7A 4XWUA 4YWSA 3LERA 1LBMA 4XUGA 2QCFA 3CL8A 4URIA 3N18A 4X0VA 2PB1A 3CHEA 3GU1A 1SYTA 3QZAA 4GNVA 3OQ8A 1UQZA 2WM0A 5AZ0A 1YRRA 3QV8A 4US6A 1ENUA 2BVYA 4JYFA 3WH6A 5CJNA 1V6WA 1JUEA 1R3QA 3V3WA 1PKMA 4DZHA 4GKTA 1CGVA 1Z89A 3DFQA 1M41A 3Q37A 4JTAA 4FXSA 2E28A 2ACUA 1VYPX 4RKAA 1C91A 1E43A 2VRJA 3MKVA 3NURA 3DGBA 3VDAA 3URNA 1DWGM 2PDIA 4CQCA 3S1GA 2CIPA 2ODOA 1RQEA 4JIIX 3SN1A 3OP2A 4QIUA 4GI9A 2P5NA 1A0EA 3W22A 4LEQA 4UTIA 3ARWA 1BPLB 3FGCA 4X9SA 1PHWA 2QT3A 2NQZA 1W17A 2Y4SA 4GFIA 4EAMA 5EPDA 4JTLA 5F7UA 4DY1A 3TROA 2PAJA 4JX5A 3H54A 3HG5A 1FWAC 4RNFA 4HIBA 2VX5A 3G3MA 2BODX 3NQ6A 4DPQA 4PN2A 3WBYA 5GQBA 4DUXA 6XIMA 2NX3A 2VX6A 4FLRA 3C2EA 2QAFA 4PFHA 1NWSA 3T1GA 3WX7A 1B3WA 1DIKA 4QE4A 1K03A 1XYCA 4IGNA 1ZBCA 4PRRA 4MJ4A 3EEGA 2JEPA 1MQRA 4L9ZA 4JTIA 3G1HA 4AD3A 1RCXB 3S2NA 4G56A 1YYAA 2A6LA 5E0FA 3H70A 2BOGX 3RR4A 1VFHA 4WY0A 1O4UA 1V0MA 4QHRA 1Q6RA 2PF8A 3MUIA 2FDMA 1QO2A 2J7BA 4W88A 1QNRA 4Y8FA 2CETA 1G4SA 1B3YA 1QI3A 3CUHA 5CAHA 4DYJA 1XLFA 3PJXA 3TKFA 4V33A 4UMBA 3TXVA 3W37A 3UWZA 2NQHA 1B31A 3DCPA 3AWNA 4XSMA 3WL0A 1L6YA 1GG1A 5C2GA 4OBTA 4DIAA 1EOKA 4O0KA 1BF2A 1H5YA 1DQWA 2XVNA 4RZ6A 3IV8A 3P14A 2CLLA 4BQ3A 4AXKA 1JPMA 1ZAHA 4R88A 1IEIA 4OUEA 2EQDA 3AIBA 3DDMA 4IF2A 3W2UA 2XFFA 2C16A 1IT7A 2A0NA 1WUFA 3WLHA 1W3IA 2BP1A 3M0VA 3LX9A 1WZAA 1SMAA 2PLKA 1HL8A 3AISA 3ZVHA 5AKQA 2VC6A 3APGA 3OEXA 3QQ0A 3WNLA 3IAQA 1I75A 2XN2A 4IQDA 1LRTA 1JZ6A 4HD5A 1PV8A 3NGFA 1JCYA 5C9RA 2X7WA 3VILA 2QPSA 5AYIA 2DUXA 4YLWA 4UUIA 4F0LA 3FHAA 2GGGA 1VCVA 3WH5A 3U2EA 4ZMGA 3F5JA 4AY1A 1U22A 1X8CA 2J62A 5DLCA 4HZ8A 1RXOB 2OPJA 4CCCA 3S42A 3ZJ8A 3UD6A 2VFIA 2Z00A 4ENLA 3O0FA 3TJIA 5A6KA 3ZR6A 2C0HA 4PYSA 3URQA 2JF6A 4DM2A 2ASHA 2RGLA 1C9DA 3AUOA 4PUWA 2CZFA 3TOPA 2CBIA 2D2JA 5TD4A 1W9VA 3G0SA 4HKPA 1P1MA 3HN3A 4YXGA 2O7SA 2VFFA 1SO5A 3RJXA 1EQPA 1EJ7L 2OB3A 3ZFHA 1J8VA 4GPNA 3CS2A 3NEHA 3CU2A 4RNHA 2DT2A 3OLGA 1LT8A 1PTGA 4KERA 1EBHA 1R2RA 3PZOA 4EOUA 4AF0A 2EG7A 4GIEA 1Z69A 1T8QA 2VX4A 3TC3A 3WBXA 1TQJA 2BMBA 2D2OA 3WBEA 3NQ7A 2E0PA 4LS1A 3AMCA 3AMKA 2OO0A 3IK2A 3KCJA 3ARUA 1UD8A 3CQKA 3FJ4A 3O8AA 3D3FA 2FZBA 1JYXA 4A35A 2VX7A 4BI6A 1KW1A 3BAIA 4ZOEA 2HDJA 1RR2A 3FY1A 3O2LA 1UJQA 3BCJA 4U3AA 4M56A 2GL5A 3NQBA 1N82A 4L1WA 1L6WA 1SJBA 1YW1A 1NIUA 1V6TA 3V5OA 4LB4A 1VRDA 1A0CA 1GOWA 3WN6A 1LLOA 3UERA 2PA6A 2A5HA 2QIIA 3MPGA 4LCSA 2WJFA 3QPEA 1B9BA 3VIMA 3AU2A 4CEUC 1QASA 1PVNA 2RHGA 4QROA 4F3HA 4YVPA 3MTWA 4HMDA 4M6QA 2VENA 2GFTA 2YZ5A 3PAOA 4EWJA 3UCDA 2V0TA 1FHUA 3K8LA 3PUDA 1EGZA 1I0DA 1U1JA 4MJZA 4REQA 4XUYA 3VDBA 4GGBA 2UY3A 4B16A 4MADA 2ATMA 1P0EA 3LQGA 3VOCA 5CCZA 4A8LA 2FZDA 4K1GA 4JQ3A 4HTBA 3MI3A 4HZ7A 1FWJC 1MW1A 1PHQA 3G1VA 4KWWA 3W7JA 3UJEA 1TJRA 1AMKA 4DI8A 1A50A 1QJWA 2YLLA 3VUPA 1KO0A 1O66A 8TIMA 5LIYX 1O5KA 2PGFA 4MKNA 4K1WA 3NPXA 3MJMA 1ZS2A 2UBPC 3AYRA 3RIKA 2Y61A 3QR1A 3TC7A 2Z6IA 4NZ5A 1RK5A 5HANA 3VD9A 1XLGA 3QMTA 1JAKA 1KRCC 1Q65A 4L1XA 4MY1A 2H6RA 5FD0A 5LA2A 1VFFA 4NI8A 3BZJA 4NXSA 4XZHA 2A6NA 1GZGA 4GYPA 3GY1A 1EXBA 2PGRA 1AODA 4YYCA 3WELA 4DNMA 4HPNA 4JFTA 1W3KA 2DSZA 3R1ZA 3CUIA 1SM9A 4Z1AA 1UKPA 2CBVA 2QCDA 3K4WA 3E96A 2CZDA 4CD8A 3PSWA 2AGKA 3ELFA 1C7SA 4WJEA 1R38A 4Q4RA 3L21A 4P61A 1EA0A 2ZVIA 4CNOA 4GWEA 2RH9A 5CSYA 4B3KA 4K39A 4ERIA 4FX8A 2JALA 3LTYA 4CNUA 2HZGA 2FPVA 4Q33A 2EJ1A 3GAYA 1W9DM 5A8NA 4GY1A 3M0XA 3T0TA 2INFA 3WBWA 2DW7A 1ZPTA 3QOMA 3CIWA 4C90A 4F8XA 4GI6A 3A3HA 3AS1A 3AXIA 4HK7A 1W6TA 1XPYA 2A3LA 2WMHA 3MA8A 3QGVA 2C19A 4LAOA 3C52A 3SJNA 4GQQA 3T09A 4X2PA 4JXCA 3QV7A 5HDRA 4XKYB 4YL2A 3I10A 3U6WA 1EJXC 2L5HA 1SZRA 3Q58A 3ICJA 1TVLA 5F4XA 5LZLA 2XM2A 1LDCA 2ZZ3A 1R2SA 1KM6A 1P7TB 3B04A 5I23A 4MM1A 3PULA 1KM2A 1MSSA 3V5CA 4D1JA 4WGXA 4HMNA 1WDRA 1G69A 4RZ5A 3KS6A 1S1RA 4XZLX 4H9XA 4AH7A 2X1UA 1WV2A 3RMJA 5HQMA 2QJJA 5DBTA 1R3RA 3DH7A 1L2UA 1HGYA 1KD0A 2WCAA 3LCGA 4NRRA 2FJUB 4ZTXA 3O15A 4L5ZA 4AD5A 4F9JA 3I3EA 3ZSTA 3FNDA 3UESA 3N3TA 4W93A 2A2IA 8A3HA 2R94A 5DX7A 4DXVA 4WXYA 4WKHA 4PTDA 3GWQA 3T6CA 1JZ5A 4ROPA 2Y89A 2XN0A 3UVIA 4C6FA 3AJXA 1RY0A 1QOXA 4LYQA 2VHLA 1A3WA 2CLEA 4N6EA 3N04A 4M29A 2J4GA 1ZJAA 2J7HA 4L4LA 1DJXA 2OR2A 2BTMA 4EIVA 2JIWA 3BW4A 2ABAA 2W9MA 4RW5A 4ACZB 1Y5WA 2DEPA 1MWOA 1KR0A 4ZOAA 1Q6LA 3P5YA 2CNCA 1V3MA 4KGJA 3USZA 1XD0A 2W3ZA 4J2MA 3L5MA 2PGEA 4Z42C 2RKXA 2GSHA 7ODCA 4J3TA 1FDYA 3WQWA 3HG2A 1SW0A 1XFBA 4XTIA 5JVLA 5HWMA 1VZWA 3VIFA 1DXEA 3POCA 1XGEA 1JPDX 3IIZA 2YCEA 3LZ5A 3GRIA 1IT0A 4PTVA 3U8GA 1R8LA 2MANA 2FZ9A 2NUXA 1EYEA 3PBMA 1KV5A 2PDHA 5C9WA 3OHMB 4I9MA 4F2TA 2CC0A 1ZL1A 1EDTA 4WRHA 2QMJA 2EXOA 1EF3A 2G3MA 4ZQNA 4DN1A 3VGHA 2OU4A 2GGHA 4H04A 1EP2A 3VX1A 2Y2WA 3WNPA 1M68A 1DTNA 4HNUA 3N9KA 4JTJA 4IPLA 1JDCA 2A79A 1TE1A 4LV4A 1XLKA 3AROA 1YBQB 4NJIA 1D2KA 2CCRA 1FWNA 6TIMA 2XIIA 3EDKA 2WAGA 2HS8A 1KXTA 4KETA 2RJHA 3UZWA 6A3HA 4BZYA 5FJJA 1GT8A 1ZRQA 2V2HA 4U2YA 4JL1A 3RPMA 4YU1A 3W7NA 1XX1A 1G0CA 1TTPA 1JNEA 3AALA 3W2MA 4Y9PA 3KTSA 3BLFA 4IISA 3TJXA 3GVVA 4JOMA 3W1AA 3BLEA 2TMDA 1E3XA 4O4WA 4GXWA 2HE5A 1L6GA 3P67A 2JEQA 1VEOA 4UMAA 1NWRA 4LW7A 2HCVA 1LROA 2I5GA 1DOSA 3MB9A 3JU2A 1AQMA 1WKFA 3BAYA 3P3BA 3EDJA 1KQZA 3DESA 4RCXA 3GIQA 3CUJA 4PMVA 5FEPA 4M5PA 1ZALA 3NO3A 3VZZA 3PPHA 5KZ6A 5EMJA 1DIEA 4CGTA 3KUMA 1W1YA 4O10A 3BL3A 4MNLA 2QCNA 2Y85A 4WR3A 1ODUA 3MZNA 3K1GA 1FX6A 5JBDA 5H1WA 5D04C 3UWEA 1SUXA 2GOKA 3G77A 4G6CA 4PB3A 4X61A 1JDFA 2BY1A 1B4KA 4K8EA 1FWRA 3QRHA 3N12A 4DVOA 1AW5A 4J7RA 1K6WA 4CQDA 4DM1A 3QQWA 4FA3A 8XIMA 3KXQA 2FTPA 1HO4A 2YFOA 5A6JA 3BJSA 1EBGA 2PRMA 3O6DA 3DAQA 3T40A 3RX2A 3S46A 4IFRA 3T0BA 2G41A 2I9UA 1TIWA 3GQYA 1LORA 1I45A 5AOUA 1OCNA 4A2SA 2OXNA 1JR1A 4G1NA 1LM1A 3SCSA 3VKKA 3SECA 3ITVA 1CLKA 3PFRA 4HTYA 4ZGYA 2ZUVA 1X96A 4L64A 2QJMA 1ZLPA 1O1ZA 1XRFA 3WDIA 1JYWA 2BDQA 3SUUA 2B7OA 2WZMA 3PY2A 1BKSA 4GG9A 3AJ7A 4IPNB 3W7CA 4M1RA 1QI5A 4RJEA 1BRLA 1TA3B 2F9RA 2F2HA 1OZMA 3MWAA 1JD7A 3HURA 4FLSA 4O1FA 4FHAA 4G5DA 4HYRA 1ZUAX 3S3GA 2FZMA 2PFHA 2H8XA 1W3JA 3MUXA 2QQ6A 1BVNP 4EANA 4GJ1A 4KT2A 1R7OA 3ONCA 2AKMA 4BEUA 3AIUA 2GGEA 3LCWA 4MKVA 3GXNA 4XSLA 1H3GA 3H8AA 2PC4A 4A6GA 4NZCA 4AC7C 4JEQA 1A4MA 2O9TA 2Y8UA 4NY2A 3AI0A 1R2TA 1W2VA 4K8HA 5J04A 2J8FA 3CQ0A 5CSRA 1CGXA 3N14A 4GVHA 3SADA 1AD4A 2E1DA 1AG1O 1GK8A 3GSMA 3W1TA 2VKZG 4IZGA 1UP3A 2VEFA 3RG6A 2C0AA 1IZKA 5HK4A 4Y9AA 2J6VA 4UTWA 4J3XA 3HQPA 2QR6A 3EBVA 1Q6EA 2BG5A 4DWDA 3TQPA 4HU0A 4GRSA 4MGGA 3NSNA 3PJUA 1DQUA 5FIPA 3MSGA 4PMXA 3N13A 2BGNE 1ONWA 4M19A 5T8GA 3OZYA 4FOKA 5I79A 2HVOA 4LCQA 3HJZA 1DWAM 4D6DA 2WOQA 3EX4A 1HKKA 5AVHA 1W5NA 1BKHA 1ZAIA 2YL8A 1A0DA 1B3ZA 3E5BA 1UQYA 2ADAA 4UTMA 1YEYA 3GG8A 4AZGA 3UG3A 3SEPA 3S9ZA 3A9BA 1SO4A 4YCPA 4O15A 5FAJA 2YB1A 1FWBC 1VHNA 4UQ9A 4S39A 1Q63A 3F2CA 4PTXA 1SSDA 2QYGA 1FTXA 2NV2A 4ZOBA 4F0HA 1LUCB 3VAVA 4LC8A 3O06A 4Q7BA 1XH1A 2FTWA 4PGLA 2ISFA 3TLLA 1QHOA 3WZ0E 3N4AA 4TIMA 2JIEA 3W7DA 2BLEA 1GHSA 1B2YA 3GNXA 3G6LA 2VL4A 3PBUA 3VOFA 3GXDA 1KLZA 3CLMA 2AMXA 3ZJ7A 1B3VA 4XO7A 3W01A 1V3HA 4O50A 4IPIA 3QFEA 4O8RA 2W91A 3MVTA 3UR5A 2ACQA 5HATA 4P7RA 4AAJA 1QCWA 2WB5A 3QTPA 2ACRA 5CZJA 4PMOA 3CAVA 3W02A 3NTYA 2VD9A 4N9CA 2A85A 3IEBA 4AY7A 4HJFA 3GUGA 3DKLA 4ML9A 4QS5A 3GNOA 4JN7A 4JTSA 2DFAA 1HT6A 1ZCCA 3A5FA 3N1AA 3NO1A 5I07A 3S6TA 3S6OA 1JFHA 4I6VA 3P80A 3PZQA 4D6EA 3RYSA 4HU4A 2BHZA 1POKA 3NZGA 4AD4A 4G1KA 1JPHA 1LQ0A 2X40A 5AZ1A 1WDQA 1BTCA 4LOCA 1L6FA 2PCEA 3AYVA 5D30A 1M7XA 3GR4A 3GDKA 3KVKA 3PJTA 1EO7A 4GJJA 4DAIA 2NXIA 3E2QA 3H6OA 4HK6A 4UTUA 1ISXA 3GE7A 3DFOA 3V0UA 2Z4GA 2QXWA 3C0LA 4AIBA 1ICSA 2V82A 4EPDC 3B97A 3JZUA 3ONBA 4AY8A 2DV0A 3OZPA 3EZ4A 2J7EA 4AEOA 3UG4A 5T9CE 4OE7A 3IRSA 5LNSA 3MHUA 3FSTA 4PR4A 3WNKA 1JQXA 3CJPA 4GZIA 4HBKA 4V15A 4XO6A 1W3TA 4DAFA 2D0HA 3QW4B 1CGUA 2PI6A 2HQAA 1RUSA 3W6LA 4KCUA 2XHYA 4R9XA 2WJDA 2B31A 3CLWA 3CPGA 3GBEA 5K7JA 1E6NA 3QLDA 3QOKA 3APYA 3O9NA 3NAVA 1IEVA 1H61A 1PDZA 1BEUA 3FYPA 2WHLA 4MUPA 4HYVA 1MRQA 1J12A 1EUAA 1JZ3A 1QWGA 1MEIA 1SZNA 4Q7NA 1OEPA 5F4SA 4O8AA 3IJDA 4B5XA 1VJIA 3PWIA 1IZJA 5C6MA 4I9TA 4I6KA 3VINA 1MQPA 2P0IA 1DWHM 2ZUNA 4OECA 1XV8A 2O4QA 1WYIA 2VFGA 4GD0A 3D5HA 3QYQA 2EGZA 1VCGA 2OQLA 5LGZA 3TW7A 1BGGA 3BH4A 4NNBA 2QLYA 4Y96A 3QQ1A 2X1IA 2ICSA 1SZFA 4E2OA 4XAPA 1L8NA 5BMWA 4UNLA 1A5CA 1AD1A 1NDZA 5E5CA 1O1HA 1LOLA 3S1UA 1ZY9A 3BDKA 1SJCA 3EMZA 4CEXC 3WLIA 4R9OA 3OYZA 1AMYA 5G4WA 4XX6A 4DLMA 1M6JA 2E8ZA 1J0KA 2FZNA 1F3WA 1VRXA 4NU7A 1Q4WA 1H5VA 2EEXA 2O9PA 2HE8A 4MTVA 2OYMA 2OZ0A 2A3HA 2W67A 3ABZA 4E2VA 1PPIA 4DZ5A 4C5ZA 3UR7A 4NZ4A 4O54A 1UA7A 3R89A 5MKGB 4N7QA 1CX9A 4EXAA 3IIOA 3PN8A 2JQXA 1V7AA 4WKFA 2PP3A 2FPYA 4L6DA 4B3LA 4LCRA 1HKJA 4EPBC 3P93A 3K13A 2ZC8A 2HVMA 4Y2WA 4MWAA 2QUTA 2D0FA 4O0ZA 4M6PA 5G1TA 5FL1A 1UH3A 3RNDA 1PWLA 1A5OC 1XQKA 1CW2A 1TRIA 3HGJA 4D8AA 3H2OA 3A5VA 4UFHA 2NQ9A 3KVMA 2RDTA 3T8QA 2PMQA 1VGAA 1GVFA 3CQIA 3W23A 1GQNA 2P3ZA 5HNTA 2D0GA 3WCZA 2AL2B 1PS9A 2Q3RA 4D1IA 2DW6A 3UZ5A 4H6KA 3UEQA 1SZGA 3NOYA 4ZSTA 1NP0A 3BUVA 3L2IA 5A8QA 2X1TA 1T6MA 1O12A 1V08A 5K4XA 2PTDA 3N9RA 3VD3A 3TSBA 4C6JA 1JXKA 1RCQA 3NQCA 1PIGA 4ZO6A 1GQJA 4HP5A 3SCVA 2WM1A 3OVPA 3PUGA 2PWDA 4IFOA 5JH2A 1G5AA 2NUYA 3VX0A 2EPLX 4RX0A 4GZEA 4HPHA 1LQ2A 4PBFA 4JS3A 1WOAA 2VQUA 4GISA 2AOSA 2GWGA 3CH0A 3AYTA 5BOEA 3NDOA 2IPFA 1LLZA 4XBJA 4NILA 3BW3A 3M5XA 2YA1A 3PTKA 3VIOA 4RZ4A 3EOEA 4PUKA 4B2DA 4QAWA 2C13A 1IIHA 4EF9A 5REQB 3SQLA 1W8GA 3UWWA 4BA0A 1I2NA 1VHCA 3ANUA 1UMLA 4IMGA 3ZWSA 4YIWA 2CU0A 3IV3A 1FBAA 3W7EA 1MMFA 3KBSA 3CB3A 2J25A 1EP1A 3B4YA 1A5KC 3GXMA 1XYLA 5IDZA 2HBXA 4C1NA 5CZ0A 1EUNA 1ZJIA 4AU0A 3HGOA 2WVVB 4D71A 1H60A 4A3UA 1ISVA 3PPCA 2PD5A 1LOSA 1MQQA 3UYCA 2Q8LA 4O28A 1GKQA 3BLOA 5E09A 3IAPA 3G0UA 3E5PA 4LFYA 3W7OA 5I3IA 2OLSA 4AHPA 3C6CA 3QY8A 1E9IA 1IEXA 5KZMA 3VFCA 3DX5A 4JD4A 1W1TA 3I7SA 2VCBA 4MAVA 4JNMA 1W5MA 3A22A 1NOUA 3BLKA 3H26A 1JZ8A 5AFDA 5ABEA 3QVQA 3UJ2A 2FDSA 1J96A 3WK2A 1RV8A 3OTRA 3RM9A 4HU3A 1SZEA 1TWIA 2IW0A 1JF6A 3LLXA 1C92A 5DMYA 3MP4A 1EYWA 3LCLA 2X2YA 2ZA3A 4L4OA 4PCNA 2FLIA 3TN5A 2ZRWA 3GW0A 4HJWA 3WH8A 1DHPA 3NIYA 3H4WA 1VC4A 2D3NA 2HV5A 4DYEA 1M01A 4ZSUA 2FVKA 3LPFA 3QKEA 3RXZA 5CBJA 2QV4A 2YYTA 2C79A 4IM4A 5ABFB 1T7LA 1QPNA 3K2GA 2O0TA 1G6CA 1XG3A 1LWHA 3UJSA 1QWKA 5AC4A 4WZHA 2XH4A 2XJ7A 5CSUA 3WQFA 1JRBA 4H8UA 4PUEA 3M0LA 2TPSA 1UD4A 5LYRA 1E0TA 4XAYA 1IE7C 2PDUA 4IICA 1W9UA 1XSJA 5K9DA 2FFCA 1SFTA 2NVAA 3HGSA 2C15A 1RA5A 1HNYA 1HXJA 1JYVA 4S3GA 2HNEA 1EPXA 2V5BA 4PA8A 1Y5XA 4UC5A 1YDOA 2H90A 1DPMA 2ZFAA 1ISYA 2CFFA 2CZVA 2OZ8A 2GJRA 2QCCA 3AMGA 2O4MA 4MKSA 4ZOCA 3W2NA 1BHGA 3SY1A 7ENLA 4H19A 2VFHA 4IPPA 1S1PA 2C1HA 3APTA 1NU5A 2WW5A 1IR1A 4NX5A 3W71A 2QEZA 3BXWA 5DRCA 1XDLA 3T2QA 1QAPA 5AC5A 3G24A 3GXPA 4IFKA 4N2YA 1J0ZA 2WQDA 1AVAA 3JS3A 2NW0A 2OYLA 2E7FA 3MWCA 3C2VA 3ZIZA 3UY8A 1XCFA 5HINA 4YN5A 3SIMA 2Y8VA 1R3VA 2XGBA 1XBXA 3LHTA 2ZX6A 1MUWA 2WPGA 3P5ZA 4DUVA 3EWXA 1PZ0A 3PZTA 4Y9MA 3FA3A 3O07A 1XFCA 3E2SA 1MVYA 3EWBX 1MDRA 4QDMA 4DB7A 3P7YA 2GK1A 1VFLA 1ZBKA 2V2CA 1YKWA 3DG6A 2P50A 5G1YA 1VAHA 3GYEA 1TWWA 2WSPA 4UXDA 4TO8A 5XINA 3E0FA 4GQ0A 1NEYA 2PDQA 2XSBA 1PIFA 3N17A 3M0ZA 4U2ZA 2EBNA 3HV9A 5CJMA 2Q09A 3CZEA 3HV8A 1UMYA 1I8JA 3P74A 4IMFA 3R2GA 3UBPC 3GVRA 3D46A 1EC7A 3WDQA 1JUKA 1W3NA 3GR8A 1A5NC 1UZDA 2EO7A 3W0KA 1HUVA 2NX1A 2AL1A 4JAWA 2ZX7A 1GUVA 3B8IA 1OFDA 4RW3A 1XLAA 1XLLA 1B1YA 2V6AA 3WD0A 3GZ3A 3TTYA 1FA2A 2WVTA 1VYSX 1Y5VA 1TUXA 4LU0A 5D8ZA 3B8WA 1TUFA 4GVGA 4LS2A 2J8GA 4NNAA 4KH2A 2DGAA 1HJQA 1DQXA 2EJAA 3EEZA 1BYBA 4R5EA 3FGCB 1G4TA 4KKXA 1F3XA 1K4HA 1E6SM 3RK8A 2XYLA 4K37A 3SBFA 3N2CA 4UTTA 3BSGA 4WX2A 1AW1A 5LNWA 3EA3A 2CLHA 4UZSA 3B0PA 3FAWA 3VA8A 3P84A 2QUMA 4PEEA 5A69A 1TRDA 5IDIA 3TR2A 5E9XA 1GOMA 3TTOA 3QSRA 2DT0A 1J5TA 3VO0A 3WNMA 1K9DA 5BWAA 3FN9A 3IK4A 5D37A 3LM3A 1JGMA 5E0KA 3EDFA 2WV8A 1FKWA 4M81A 2IPWA 4UIOA 1VPYA 5DN1A 2QVNA 1IF2A 3M7SA 1UW9A 1XIMA 1XRSA 3H4GA 1JCLA 3ENLA 3BGGA 1KGWA 3TTEA 3TA9A 3SCUA 1TMHA 4WUIA 3P82A 4AUBA 1HGWA 4XIAA 4WY0B 3LZ3A 4AHQA 1CXLA 2OEMA 5HWJA 1FFRA 3M0YA 3HU7A 4LV9A 1DJQA 3MYPA 4GI8A 1R30A 4O12A 3DYPA 2OSXA 3OBKA 4HSNA 4P8UA 5I09A 4OV9A 2INEA 4UR8A 1N55A 4NYYA 4BQ4A 2CHRA 3NZPA 3CTLA 4QJ1A 1TV3A 2POZA 4Q4PA 3L0KA 1K77A 5K4ZA 3G1YA 4AYSA 4UNIA 3DG7A 4JIHA 3O6YX 3C86A 1PCWA 4J35A 2VDGA 2YW3A 3N25A 4QLKA 3VD5A 4R53A 5IOBA 3WQ8A 2PU0A 3VDGA 4F48A 1W37A 3M5YA 1KNWA 1XLBA 4ZQOA 3FEQA 4GNKB 4NG3A 3M16A 5FF0A 3TYDA 5U4NA 2IUZA 2VWSA 3W7IA 1K7FA 1TPC1 3KP1A 4GACA 3ZVHB 1HW6A 4H9MA 4O57A 3FA5A 3EX3A 3PTQA 1FP9A 1F3TA 2PGWA 1P5BA 2OWXA 2WZIA 5IBXA 1XG4A 4JCMA 4F40A 4R85A 2J27A 3GTIA 5FJUA 4U5IA 4BKNA 1FH7A 4ES4A 2ZUMA 3NM3A 1P4CA 2PZNA 2O7QA 2OSWA 4AZIA 1PBGA 1FWSA 3W1NA 3ATYA 1YPXA 2I9EA 3TWBA 3U4AA 3H24A 1SMDA 3D0CA 4KQNA 4AZBA 4NVTA 4BWLA 4PRWA 2OEJA 4OFCA 1UD5A 4RUBA 1FWFC 2ZADA 2C3ZA 2J24A 3BMWA 1RAKA 4V27A 5D03A 1KM3A 1YHTA 3WLPA 4DQWA 1ODZA 3CWHA 3D6NA 1E73M 2X16A 4OIFA 1AZ2A 4E8GA 2J78A 3TFXA 2WSQA 1JDAA 4E38A 3L7RA 5U7SA 2Z24A 1W1PA 3S2CA 3STFA 1BXBA 2IKIA 4BR1A 2QJHA 1F8IA 4LUSA 5CC3A 4LSBA 3WQVA 5CLWA 4WDTA 3M4HA 1UWSA 4C6DA 4ZB0A 4Q8OA 4EP8C 4Z2IA 4AF0B 3EPNA 4WCJA 3H2EA 1WB0A 2ZZ1A 3H2MA 1BXCA 1KFLA 4XZBA 1JULA 4GY7A 7TIMA 1X6LA 1G94A 1J0IA 4ZR8A 1WA3A 2X1SA 2PPGA 5JUVA 1XIIA 4JKKA 5CPOA 3GG7A 4MAZA 1UKSA 4WSKA 6CGTA 2OEKA 1J2BA 3TA6A 2QV5A 4CVWA 4TX6A 1X8FA 3WL1A 4QG8A 3NQVA 4INFA 4CD7A 3GH7A 1V51A 1UWQA 1XLIA 3N34A 1DJZA 3T2PA 1YTDA 4I7WA 3LQLA 1EB3A 3SCOA 2DQWA 4FOJA 1CLVA 3R6IA 1MXGA 4L1GA 4IIBA 3RDKA 3WD2A 3LI0A 1VJSA 3N73A 3URAA 4AWSA 2VRQA 5AB3A 3KLKA 1AZ1A 3HPSA 2XVLA 1K70A 2X2GA 2A21A 1HP4A 2NT1A 3LMYA 1CB7B 2QIWA 3EA2A 1YNQA 3IVUA 4O4VA 2FB3A 3T2OA 4K7VA 4GINA 5XIMA 2FYMA 3GIPA 4REQB 1VFTA 3L5LA 3SAZA 2R24A 1DYSA 3C4UA 2DZWA 3U57A 3W7GA 3TMLA 4WY0F 2PCQA 1NELA 3FA4A 2ZUTA 1P43A 5I6SA 4C1KA 1J2WA 3B0YA 3II1A 4ACYA 5BCAA 1OCBA 1OCQA 1BVWA 1XLMA 1XC6A 2WCSA 1KLYA 3O6AA 4A8IA 3KBNA 4O1EA 3UGRA 1F74A 2WNZA 4IQLA 3CT2A 5CBIA 2V8ZA 1I4NA 5TNVA 2D23A 2NLYA 4KFPA 2G3JA 2HMCA 3UG8A 4DBDA 4A4AA 2PTYA 3LBOA 3LBCA 4QJ5B 1AJ2A 4O53A 3IJ8A 1TJ0A 3CB8A 3OOQA 5FEWA 2VGBA 2ZBTA 3EGJA 1V3JA 2X8RA 4H6EA 3ES7A 1EKOA 4YTRA 1UR4A 1TCDA 3CBWA 3V5FA 4YYFA 4Z1YA 5H2ZA 1FWWA 3RLGA 8XIAA 2ZUWA 5EGRA 3MMDA 3NA8A 1KM1A 3H7RA 4M82A 5H6HA 1YDVA 1BVZA 2ON3A 3A3WA 3DI0A 3UA3A 1FCBA 4E8DA 4W8LA 4DWSD 1V3IA 1LYXA 3ZJKA 2QCDB 3CHCA 3JVAA 2G37A 3VIHA 4F0SA 2VO5A 2X42A 4GABA 1UJPA 2NQJA 4LVFA 1OFAA 1LL7A 2QKFA 1JUBA 1A4LA 4MY8A 2GQ8A 1AA1B 1BAGA 3ECQA 3GH4A 4NAEA 5H91A 4RV8A 4F79A 1I2OA 4DF2A 2AQOA 1XL9A 1YDYA 4FAMA 5D32A 3QPZA 1TMQA 4WDXA 1B54A 2DVXA 1EC8A 4AXNA 1M5WA 2C91A 3N29A 1XGDA 3KZSA 4DWSC 1V5XA 1W56A 4QQUA 4Q8WA 1RALA 1JD9A 1ELSA 5SWUA 4QR6A 1S5TA 2XM1A 3W9ZA 3C8FA 2WZHA 1OF6A 2QS8A 3LRLA 3INPA 1NSJA 5H8MA 3AMLA 3SIZA 2QHAA 3T55A 3P61A 1CGYA 1TVNA 3OB8A 1DP0A 2XU2A 1US3A 1EA9C 2V5DA 3A4WA 4UTLA 1S5VA 1U1HA 3KM8A 1U5VA 4G7EB 1O94A 4C6KA 3SGUA 5LXXA 2ESCA 4JL2A 2ALRA 3AZSA 2YYUA 3NO5A 3PBWA 5EKYA 4HOZA 1OY0A 1FXQA 2VD8A 1LJYA 2HISA 4HNTA 1EWEA 2D24A 3GB6A 1PX8A 3KE0A 2R14A 1K8ZA 1TYGA 4BF9A 3FKKA 1TX2A 3MHFA 4UMCA 2O55A 4LRTA 4W8BA 3GHSA 5I03A 1VLWA 4LBSA 2P0OA 1X97A 2ONEA 1RBLA 5JIWA 1FDJA 3SR7A 1WNOA 1UR3M 2QZRA 3LGEA 5E70A 1LG2A 2J66A 1TV7A 4HA4A 4XG1A 5LIXX 4FF7A 5BMXA 3AZTA 3LLFA 1R9XA 1ONRA 2WHMA 3CUXA 3GNNA 1UWTA 2FZ8A 4ZB2A 1BQGA 3TWAA 4CLMA 4FIQA 4JKLA 4BEQA 4M51A 4DF0A 2PWHA 4M6UA 4PUMA 1K8XA 1X1NA 3R0DA 3TNBA 1M1BA 1RJPA 2TAAA 5AY7A 5KZDA 4QP0A 3WMCA 1OQFA 7A3HA 4GNJA 1K7XA 3G1AA 3P81A 3LDVA 5C2XA 3CHVA 4MDPA 3G3DA 4Y8EA 2V2DA 1K8CA 3EXTA 2FGZA 5CG7A 4KBXA 4JTGA 1KXVA 3W82A 4H1ZA 1SJAA 1GTHA 1U83A 3L66A 1C93A 2Z7KA 1JJKA 4JX6A 1NDWA 3KBJA 4DNHA 5EU9A 5KZEA 1O68A 2GQAA 3LK6A 3C2OA 2IPGA 3GTNA 1H7PA 3EWZA 2DZTA 1LT7A 3NPWA 4L65A 3R13A 1WDSA 3LRMA 5D02A 4AZCB 3DN5A 2QUNA 2HRWA 4ATWA 3K46A 3ABQA 3B8UA 1TTIA 2YFNA 2E9LA 3GVWA 4W84A 3ITLA 3ARVA 1OK4A 5HJYA 1EEPA 4ZBCA 4MYAA 2BHYA 1CNVA 4N42A 3IIPA 5GJNA 2B0MA 3W6MA 1WZKA 1D8CA 3BAKA 3W29A 2I1OA 1TR9A 3STCA 3DKJA 4XK2A 4NL1A 2Z25A 3C3NA 3VCCA 3QGAC 4OU1A 2XH0A 3DECA 4HNVA 3MUY1 4ZO9A 3WLJA 1CI1A 3CMJA 1EJRC 3FYOA 3BLIA 2V81A 3ZMRA 2Z27A 3WF4A 1CENA 5EMLA 1W31A 1GVIA 1OYCA 2O56A 3OJGA 4UCGA 2DZVA 2HBVA 1TMLA 2V3EA 1FKXA 1PXGA 2B4GA 3N2OA 1PTAA 3N4EA 1L8PA 1PZ2A 1OD0A 2QULA 3KVJA 4IL0A 1DE5A 3SRHA 4IG2A 2A4AA 2HNHA 3VTRA 1Q5MA 2X41A 1AL8A 5FACA 3F4DA 1IT8A 3V16A 5B80A 1UUOA 3LXBA 3JR2A 2Q6ZA 5HR7A 4MB5A 3R5EA 3VGDA 2DT1A 4DO5A 1QW8A 3MYOA 2A7NA 4DUWA 1Q13A 1MO0A 2OT0A 3NL6A 3WK0A 1XDJA 4P7OA 1L0PA 4IX2A 1RLDA 1WOBA 3BV7A 3Q65A 4TVCA 5A95A 3U2OA 2E77A 3UZJA 3WFZA 5I00A 3WFAA 3VC6A 1M9HA 4GCAA 3B0XA 4NNCA 3REQA 3OPSA 2G0WA 2FIQA 3UZZA 4W9TA 2QW5A 3JRKA 1JPKA 1JG9A 3MKKA 4UBPC 4IP5A 1QHPA 1ZP4A 2NUWA 3IJLA 1PWMA 1OINA 3MMUA 4OT7A 2Y62A 2RDWA 3MUZ1 1M3UA 4JFWA 1GJPA 2I17A 2VGFA 3MI2A 1E9LA 1TREA 1XDMA 3N15A 2PDXA 1LWJA 3RM4A 3DGRA 1W54A 1GVQA 1JZ7A 3HZ3A 1JDDA 4F2UA 4BCEA 1BFNA 3GO2A 3ITCA 1F6YA 3W2KA 2YW4A 3N11A 4HA0A 2OX1A 1BG9A 4O1CA 4K3ZA 1NVMA 1UPMB 4Z0JA 4OWGA 1Z32X 4GOAA 1BRLB 3PHAA 3V1PA 3W26A 1R9ZA 1J0JA 3DHUA 4CQ9A 2EKCA 3E49A 3QJAA 3ZT5A 3E12A 1RK6A 4LPCA 3V4BA 1JCJA 3EB3A 1TV4A 4U3CA 1QPRA 1EO5A 2NWSA 3QH2A 3WLOA 3IIXA 2VURA 1E6XM 3W27A 3MP3A 1KFWA 3SSZA 3PNZA 5ECUA 4JBRA 3F7JA 2J77A 4UQDA 3NZ1A 2DP3A 2ZRXA 3QBUA 4JX4A 1AH0A 1Z8AA 5HUOA 1KKRA 3SCRA 5BZAA 1PYMA 3R25A 3EAUA 4LJ3A 1PL9A 4HMCA 3M44A 1ICQA 5CPLA 5K2ZA 4KWSA 2G5WA 2QUVA 3GK0A 3BCFA 1GQLA 4B90A 4LAKA 1QK2A 4AB4A 2W5FA 1BWKA 1BYCA 2WSKA 3KDOA 2VP8A 3BJFA 1H2JA 2DVUA 1IEQA 3NSMA 4GE8A 1PKNA 4WK9A 2QF8A 4ILSA 4JCLA 5HA7A 1OC6A 1DHKA 1G4EA 3WQCA 2VR4A 1OK6A 4GY0A 5HUPA 1UH2A 3RU6A 5E0CA 1QI4A 4HSOA 3EDEA 2OLAA 4WJXA 3ZYZA 3H4XA 4MUZA 1OFBA 5LIUX 4C1LA 1KFEA 2Y7FA 2J88A 1VS1A 1WDDA 2FMNA 4DJDD 3CEUA 2EF9A 1AUSL 3E1F1 1Q8JA 3S6DA 4EXQA 3WLKX 3WJYA 1W8SA 4Y9NA 4D8ZA 1IHIA 5CPNA 1P1XA 4NQ1A 3ZZ1A 1DWIM 5CGMA 5A8GA 5LSMA 1OFOA 2DIEA 2DSWA 5EL1A 2W63A 2X05A 3NG3A 4RE3A 3RCYA 4FXJA 3SCTA 3BOXA 2Z2BA 3ID7A 1US0A 1TTQA 1M65A 3MW7A 2X1RA 4MJ2A 1HN1A 1HKWA 4J27A 3L5AA 2CLPA 5F2IA 3BQ5A 4I9AA 2DPEA 3N6JA 3XISA 1QVBA 4ZXLA 3C0QA 4B5SA 1HJWA 5AHEA 1X1OA 2XVKA 3QF0A 4AMAA 2ZWZA 3M0IA 2OQYA 2WMFA 2I14A 3VGGA 1QRQA 3BLPX 5CZTA 4QNWA 5AHNA 4A05A 4DBEA 1XIBA 3O16A 1BQCA 3KAOA 1PSCA 4Q4KA 1WBHA 2F6XA 3ERPA 1FWHC 5I3JA 1V3KA 2YBTA 2PRHA 2FH6A 3WYZA 3WDHA 4TMCA 4D2JA 3KLLA 3TN6A 1O6IA 5CKSA 4XD3A 4A29A 5K9CA 1C8YA 4XV0A 1HO1A 3DFYA 3VD4A 5TBOA 4G9PA 3VOIA 5C9UA 4PEKA 5AC6A 4L61A 3GTXA 2IPJA 5HR6A 3TW6A 5D2VA 1UOKA 4H3DA 3LSCA 1E56A 1SO3A 1VPQA 3MI6A 1V6VA 4I7VA 3CPRA 5T9BG 2VZSA 3M6YA 4H6QA 1VIZA 3R43A 3HFTA 1I1WA 4DELA 3T78A 4EXBA 1QNQA 3ZR4A 3DERA 2F8QA 2OWWA 3CAKA 4I7UA 3WD3A 1M7JA 4FXRA 1OB0A 3WDRA 1TFVA 1W32A 1WAUA 2GJPA 3RLVA 4O1BA 2OKTA 1TV8A 3EPMA 1X7FA 1DWJM 3B0VC 4DBWA 1WQ5A 3TNOA 1QPOA 1OGGA 4Y9OA 3DHFA 4U28A 3AHVA 1HP5A 3WF1A 1PX3A 1JCNA 1D3GA 5A6TC 2VTFA 3GLCA 1A5BA 1MFUA 3CV6A 4C6LA 3O3RA 4DJED 4KWUA 2E4TA 1QNSA 1F61A 5CPMA 2R1MA 3GTHA 4C6NA 1WXYA 1NDYA 2W79A 4LAUA 2GDVA 1MXSA 4MZYA 3QY7A 4XZMX 2HXTA 5CSSA 2ZXAA 4LY8A 2R1NA 1QATA 1YLVA 4QEEA 3EKLA 1AH4A 4TQTA 2J9YA 2WXDM 2G97A 4JNZA