4XSMA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xsmA00
4QE5A 3VNJA 4J4KA 1XLCA 1XP3A 1O1HA 3AYVA 3M0MA 1CLKA 4X61A 2QULA 1DIDA 2XIMA 2XINA 4XSLA 1XYMA 1A0DA 3ITYA 4A8RA 9XIMA 4QDPA 5J8LA 1XINA 3M0VA 9XIAA 1XIIA 5B80A 1I60A 1TZ9A 1XLIA 3BZGA 4HHLA 1QUMA 2G0WA 3BANA 3CQKA 4ZBCA 3VNLA 1XIBA 4EAYA 1XIFA 1I6NA 3IUHA 3WQOA 5I7GA 5B7YA 4XIAA 3AALA 8XIAA 1QT1A 4GJJA 3C0LA 3TC3A 3C0QA 3UXIA 1GW9A 2HCVA 1DXIA 1BXCA 3UA4A 1XICA 4GJIA 4K3ZA 2OU4A 3IUIA 1XLMA 3ITTA 1XLLA 1S5NA 1XISA 1XYLA 3BDKA 3CQJA 4LNCA 3VNMA 1S5MA 4QE1A 4A8NA 1XLFA 2I57A 3KBMA 3BWWA 1XIMA 1XLKA 4YTUA 1BXBA 4Q7IA 2QW5A 3KCOA 4XSMA 3QZAA 2Q02A 2NQHA 5EMLA 5EMMA 4A8LA 4QE4A 4GQBA 3VYLA 3OBEA 2ZDSA 4US6A 3UU0A 1XIJA 4PFHA 3XINA 4YTRA 6XIMA 1DE5A 3KTCA 4X63A 3LMZA 3M0HA 3XISA 1XYAA 2X7WA 1XLAA 3AYTA 4XISA 3KWSA 4X60A 3QC0A 1XLGA 3VNIA 3M0YA 4YTQA 3M0XA 1DE6A 3KCLA 2X7VA 1A0CA 1XIGA 2J6VA 3DBNA 4A8IA 3C0SA 3L23A 2GLKA 3IUDA 4QDWA 3ITOA 1QTWA 5AVNA 3CNYA 3VNKA 1XLEA 1XIDA 1DIEA 2G4JA 3U0HA 1XLHA 4KW2A 2XISA 2I56A 4G56A 3BZJA 5H6HA 4ZB2A 7XIMA 5B7ZA 5XIMA 1OADA 3N4AA 3ITXA 5H1WA 4EACA 3P6LA 4QEEA 5XINA 3ITVA 5EMJA 2GYIA 5AVHA 3P14A 3UVAA 2GUBA 1A0EA 1XIHA 4DUOA 1D8WA 4XKMA 4PGLA 3FVMA 3CQHA 3DX5A 1YX1A 3U3HA 4OVXA 1XYCA 3CWHA 3GNXA 4ZB0A 2HK1A 1XLJA 4HHMA 3QXBA 4QEHA 3M0LA 4XIMA 3KBJA 4DVOA 2QUMA 2ZVRA 1XLDA 4HGXA 6XIAA 5C9ZA 2GVEA 5FA5A 3CQIA 4E3VA 4W4QA 3KBVA 4YTSA 8XIMA 3KBSA 3TVAA 2HK0A 2NQJA 1XIEA 5TNVA 3KBWA 3QYSA 5EMKA 4HNOA 1MNZA 4GLEA 2NQ9A 1K77A 4ZB5A 5XIAA 2QUNA 3KCJA 3ITLA 3JU2A 1XLBA 1XYBA 3KBNA 3NGFA 3UA3A 3XIMA 4K1GA 1MUWA 3AAMA 4YTTA
chains in the Genus database with same CATH superfamily
2PDMA 4C1LA 3M0MA 3HJZA 4P8WA 2NUYA 3GAYA 3VUSA 1E4IA 1VFHA 4JTIA 1L2QA 1NH6A 4L6HA 3VUPA 2WCSA 2DSZA 3AIWA 1WDRA 4RW5A 3B3DA 1LLWA 1C92A 3OA3A 4QNWA 2ZE3A 3H7RA 2VEFA 2OXNA 3BARA 4IZGA 3WUFA 2CEQA 1UROA 1W3IA 5D02A 2BHYA 1ZB5A 4UWMA 4IPLA 2PFHA 3M0YA 1MO0A 3TYEA 2ANUA 5GNXA 4OBRA 1BD0A 4Z42C 4A22A 5DCBA 5EMUA 1FDJA 4LRTA 1MRQA 1J2BA 4XKMA 1MQRA 1AL8A 3QOKA 3RAOA 2X2GA 4IJBA 2YW4A 1SSGA 3SCUA 3SAZA 1XR2A 2Y7GA 2BVWA 2QF8A 4J3XA 4LUYA 4B9ZA 4HMDA 1UBPC 1HQTA 4MSSA 4Q4OA 3TYAA 5E0FA 2J7BA 3MV01 3VMOA 1NY1A 2QCFA 1JYXA 1YYAA 4MWAD 2WCGA 3MDUA 2GVJA 1VIWA 1UD3A 1VYSX 2VFFA 4H6QA 1BYAA 2G3IA 4YCOA 2VCCA 5LNVA 3MPGA 4UCFA 1YE4A 3EXRA 1XUZA 4JR5A 4PRTA 4UQ9A 4FPSA 1A3WA 2XVNA 4WSHA 1UMLA 2YZRA 4IMAA 1S5NA 1ZY9A 5K2ZA 1ZUAX 3VABA 4ZO9A 4ZQMA 1EP1A 1L6YA 1ZLPA 1OFAA 4MFEA 3RM4A 4OTKA 1KTCA 4E4UA 1QBBA 3UYIA 4NG3A 4PMJA 2PZ0A 2OPJA 1EDGA 3HQ1A 4WJEA 1DHKA 2WMFA 5FJTA 3W29A 2DJXA 1IXPA 3MMWA 3V16A 4P5UA 2AAMA 1IIGA 3NDYA 4IIBA 4Y9NA 1OSEA 1OD0A 3WQGA 4NNCA 2QHAA 2ISDA 1NWUA 3O1NA 3GE7A 5D33A 4RLIA 1HXJA 4I9MA 3FIGA 4EPDC 5DT7A 4JKKA 4KESA 4CQAA 1NP2A 4WQ6A 4O57A 1UR3M 2OO6A 3OBAA 5FF2A 3TYUA 3ARUA 3BAKA 3CUXA 1LL4A 1V3JA 1R46A 1VQTA 3VD5A 1EGVA 1JG9A 4PMRA 5CPMA 3H53A 3GDRA 4Q4RA 3MUXA 3M5YA 4NASA 3GXMA 3W81A 2OKTA 2QULA 1CEOA 2VZUA 4DPPA 3M0VA 2NV9A 3A24A 3OG2A 1YDYA 2ZA3A 1JFHA 2GK1A 1EXBA 2VNCA 4QP0A 5IBXC 2E9LA 4HSHA 1B4KA 1X7FA 1KLZA 2E9MA 4XB3A 4GI8A 4ZTYA 3Q2DA 3W1RA 5JBEA 3ABZA 3UZZA 1QNVA 3B4UA 4LUTB 3LMYA 1BF6A 1JGIA 1XCXA 1UUMA 1Q6RA 2WB5A 4YTUA 5FD0A 2QPXA 4A8LA 4JTJA 1D7FA 1SM9A 4MPQA 1KFBA 3N9KA 2P53A 4WOZA 4L4PA 5JH1A 3GNRA 3AJXA 1H7NA 5C6MA 1JDFA 4X9SA 5AHEA 2QMKA 2CBIA 1W3HA 1ZJIA 4AC1X 2NWSA 3LX9A 3WLQA 1OFQA 5E1QA 4PMYA 2XDFA 1Q8JA 4FMVA 2PRLA 1BTMA 4UTJA 3HTWA 5TBOA 2WPBA 3GM8A 4HZ8A 4M1BA 1H2JA 3HU7A 5HNNA 1AQHA 4H9TA 2QDDA 2V2CA 1J12A 5DEZA 4ZO7A 4TXEA 5BXTA 3SUTA 3G77A 1JEZA 3U7BA 3HV8A 4HNOA 4K38A 1K8CA 3H55A 1VF8A 2QCCA 1EJTC 3S1GA 4JTUA 4LB4A 4BF5A 4QE5A 3M1ZA 3E3HA 4ZE4A 4LS2A 1FP9A 3NIYA 1XSKA 3M47A 1HJVA 1RAKA 2G8ZA 3ES7A 3W2JA 5LIKX 4PB3A 3WL1A 1EA9C 3SCPA 4EPEC 4LVAA 4CEUC 3BV7A 2GGJA 2FMOA 4NJKA 1J79A 4NJIA 1PHQA 4D2JA 3SEPA 2PP1A 2Z2AA 1P6CA 3CC1A 4F9DA 1Q4WA 1UYQA 1ZPTA 1RJPA 3UXKA 3W2MA 3L67A 4ASTA 3WLIA 5CCZA 5DRCA 4NHVA 4QEEA 3P5ZA 4NF7A 4UTIA 2PTWA 3TCEA 3DFOA 4ES4A 4PE8A 2NVAA 1D2KA 3BCJA 4CN4A 5DCDA 5HANA 5D09A 3BLEA 2NV2A 1V02E 1ADOA 4R9OA 4DM2A 5J04A 5I3IA 4U3AA 1H5YA 4DXXA 2Q71A 1KCLA 4L9ZA 4F3HA 3OLGA 3BSHA 1MFVA 1TMQA 5GNZA 2TSYA 1GUVA 4Y90A 1U33A 4AB4A 5LXXA 4JEJA 4M6QA 4MWAA 2WNWA 1XLBA 2VCAA 4ECLA 2B31A 3HPSA 2FHFA 1JNEA 5E6YA 3EWYA 4LSBA 5HNRA 4D72A 1XUUA 5TIMA 3P61A 2XIMA 4XSLA 4O16A 1V3KA 3WNMA 2PDNA 1FCBA 5F7UA 1UW9A 2G95A 2QJHA 3K1DA 4QROA 3OZPA 3WMBA 3STFA 4DAIA 3QQ1A 1OVDA 1BXCA 2BXZA 2DZAA 2XIQA 3LNPA 5ABTA 1QI0A 1VKFA 3I4KA 3OA5A 4HHHA 1OF6A 4NKCA 1E1CA 3S6OA 2Q02A 3CH9A 1UR1A 4MTVA 3WUGA 1WOBA 4HSOA 3W1AA 3W1TA 3TTQA 1P0EA 1KBIA 2ACQA 3M5XA 2MNRA 4PZVA 3NCOA 4Z17A 3LXBA 3NQCA 1HUVA 3WH5A 3EB3A 2PBOA 3UWUA 3ALGA 4AIEA 4XAGA 4B5TA 1WKFA 2VFGA 3W87A 1CXHA 4ATLA 1W1ZA 2QDHA 1K7EA 1FWCC 4FAMA 1EEPA 2BY1A 1NTHA 1J9YA 1EO5A 3NYZA 4Z1CA 4FNPA 1HJSA 1FWRA 2YW3A 4JNMA 2WVSA 2Y5EA 4Q4SA 4NAFB 4PODA 1EH9A 3STEA 3R79A 3GK0A 1I1XA 4LPCA 2Y61A 1BKHA 4UNIA 4B5WA 3TYDA 5L9FA 4ZQRA 1W9PA 2G3JA 3W2LA 1JULA 3SECA 1E0TA 2FTYA 1R2SA 3VU2A 1QMLA 3FDKA 4B5UA 4Q8MA 4MG4A 5EY5A 5LIUX 2OZTA 3WF1A 2R1PA 1US0A 4GUGA 5AHMA 3EPMA 3NEVA 3NZGA 4BS0A 3M4HA 3U4FA 3GDLA 4B5SA 1BWVA 2W0UA 1GKQA 3VVGA 3P7YA 3PPCA 5JBFA 3U57A 3W84A 1EC8A 3WQFA 3APGA 1Z44A 4PUJA 1BGGA 3VYLA 5ABFA 1TZ7A 3GNPA 6CGTA 3GH7A 1VENA 4JTRA 2YCKX 1FWJC 1B3YA 3H8AA 4ZGYA 3AXIA 2P8CA 4B5XA 2GUUA 4OOUA 2VX6A 2IKJA 3UPBA 1GQNA 4K8EA 2G4JA 4C6FA 1DWFM 3PFMA 3CV1A 3D6NA 3ZR5A 2VEGA 3STCA 4PUDA 3VNDA 5I79A 5FESA 1D7KA 1FWSA 5C54A 5LA0A 2O4MA 1W5QA 5H8MA 3CZLA 3C52A 2QCGA 3M43A 4GZ7A 3MUIA 4UR7A 3AS2A 2QS8A 2E7FA 3PPHA 1XDLA 4BKNA 5HNTA 1F7BA 1U30A 2XIOA 4RNIA 3EXSA 3WFZA 3IS4A 1J96A 3GWQA 2ZUVA 3C5QA 4Q7BA 1SVDA 2QR6A 1XXXA 3DBPA 5DRIA 3L4TA 3GC5A 3EGJA 3THQA 3EEGA 3GVQA 3CO8A 3NZPA 1ITXA 4IX0A 4H8UA 3W23A 5FOOA 4XZHA 4X0VA 4MUPA 4FOUA 1LQAA 3QMSA 3BLIA 3KDNA 2VX7A 2INEA 2J6XA 5CC7A 3QGKC 4ZQNA 1MI3A 5K3VA 1SJCA 1MW3A 2YCEA 3KHDA 3D46A 4AF0A 3L21A 2OQHA 1QJWA 4XZMX 4AEOA 4XAPA 3FA5A 3PULA 1V6VA 4YPJA 1TPWA 2X1SA 1B90A 2F38A 3KE0A 5D03A 4G5DA 5D2YA 5MKGB 1G01A 1V7AA 3N9SA 2BG5A 3TJIA 2E4TA 1W5OA 2PCEA 1KTNA 3V1HA 1H7XA 2FDSA 3DI1A 1OX4B 3FGCA 3G1YA 3MKVA 1WKYA 2FH8A 4MKNA 2PMQA 4OIFA 2YBUA 2O56A 3SUSA 4K2SA 3WNLA 2NQJA 3AYRA 4AMCA 4IT1A 4HU3A 4WR3A 1LROA 3L2LA 3FA4A 3BAYA 4I6VA 1DP0A 3NQEA 3DHDA 4AEFA 2ZZ3A 3M07A 4US5A 1ADSA 3K2GA 1IV8A 2ISVA 2EG8A 1F2JA 1KKOA 4DUVA 1SU5A 5B7YA 2XVKA 3KRBA 3AHTA 4QG9A 3C2OA 1S2UA 4HNCA 1RLCL 5L6UA 2PDCA 1J8VA 3MKKA 5DY2A 3AMDA 1J01A 4H8HA 3AIBA 3EBVA 4OJYA 3M0HA 1TV8A 3XISA 3DHFA 1LOLA 1XLAA 2ACSA 3AYTA 3SJ3A 2F61A 3PF3A 2V6AA 4CVWA 2PWGA 1LP6A 1XDMA 4ML9A 2QIIA 4H6EA 1XIDA 5IXEA 2F6KA 4DWDA 2R1KA 1LZOA 1W31A 1E6NA 4I9AA 4WKFA 3UG3A 1OFPA 3LD5A 1YDVA 1G94A 2J4GA 4MB5A 4ZODA 4BR1A 1Y5WA 1PSCA 2DUXA 2GVYA 4N42A 4PTDA 1JCXA 1UBSA 3T44A 1HT6A 4CNPA 1V51A 3LDVA 4E3VA 1O4UA 2PU0A 3QYSA 1A5CA 2X2YA 3S6TA 2GUYA 3L0GA 1TVPA 2IQTA 3A5VA 1UC4A 3TWBA 2VRKA 4LS1A 4JFTA 4O11A 5U4NA 4LBSA 1ZFJA 4X61A 4PBFA 5C9RA 1EUNA 3SN1A 2V5BA 1OZMA 3AISA 1R87A 4XZWA 3ZYZA 4F2BA 3OZOA 4JN7A 2CXEA 5I03A 3UY8A 3ZM8A 2WVUA 1J93A 4JS3A 3EWUA 3UETA 4RZ6A 1TREA 3QW3A 3B8VA 1JYWA 2QZRA 2ZZ6A 4GQBA 3GQYA 3OBKA 4CCZA 3W76A 1VRDA 6XIMA 3TONA 4JIIX 1BG9A 1BQCA 3PBYA 2PC4A 3P82A 4LS0A 3JW7A 1AODA 3CAWA 3S3GA 2PDWA 3JS3A 4FA3A 1R3VA 4UB9A 1KCZA 3KZPA 1BEUA 2VP8A 3DERA 2PBGA 4WD0A 4GBUA 2RH9A 4XO7A 4PGLA 1I2PA 4MZ1A 3LRMA 2GGIA 3GYCA 2XH2A 5IM51 4J3UA 4JQ3A 1GVSA 3G1SA 2FKPA 4RX0A 2G4FA 3OGRA 5DELA 2HEJA 1HGWA 1W37A 1MNSA 2VGBA 3A13A 3PWIA 3VMPA 5I3GA 2VQUA 5EA9A 3B8DA 3VGEA 4IG2A 4LFYA 1J5SA 1W3KA 3SR7A 4AVNA 3E0FA 3WDPP 5BXPA 3TZNA 4Z2KA 5CXPA 2NSOA 4E4PA 4N9BA 4HVXA 1NSJA 3VNLA 1PWMA 2Z1WA 4PSRA 4G1KA 1OGBA 3GH4A 3VDGA 3TA9A 2NX9A 4R7WA 1ZCOA 3SCVA 5D2VA 3W7RA 1W1A1 2GVGA 4A2SA 4HSNA 3BLKA 1RP8A 1O5QA 4QCFA 1YNPA 2TRSA 4C6MA 5A8QA 2XH0A 1A5OC 1X8FA 2IW0A 3EX3A 3GXNA 2VEPA 2BXYA 1B3XA 2XWEA 1OYAA 4DAFA 5LIYX 1G4EA 4HOXA 4BQ5A 1QTWA 2Z1BA 3LM7A 3JZUA 1JQVA 3II1A 5XINA 4W8AA 1QI3A 1W1PA 3PBGA 1E9YB 1X6LA 4U33A 4S3EA 1LWHA 1CGXA 2ZRZA 1E43A 2UV8G 3ARVA 4CNOA 3BLPX 1TV4A 4QDMA 4S39A 1OFDA 2WNNA 1QNOA 5AHIA 1IR2A 4H6KA 1KM3A 4BWLA 5LNSA 4HCDA 3UWVA 1K6AA 3GU2A 3GTIA 4XZNX 5CPQA 1H09A 2WZMA 1EQPA 1ICQA 1IE7C 3K8KA 2JIWA 4RUBA 5C2CA 5MF5A 1XPGA 2I17A 1JDDA 3G1VA 4TQTA 4L65A 4ZB5A 4GI4A 4H9MA 4KBXA 3AS1A 4G1NA 3MYOA 1RALA 4CNTA 3OIXA 2AKZA 1PYMA 4KQNA 4L4LA 4AHPA 2JQXA 2V8ZA 3NQAA 3PBVA 1R7AA 3SRKA 1QT1A 4LV4A 3VIFA 1YEYA 4DI9A 1S1RA 1GW9A 4EKJA 3W1MA 2FGBA 4W7VA 4GO9A 3U2ZA 1YTKA 4GA8A 3ABXA 1R7OA 3ABRA 2Q3RA 4L1XA 4FXFA 4U2ZA 1YNQA 1QU4A 3L66A 2ALRA 4L4OA 4LVDA 4AZ5A 1UR0A 3PJTA 3PY2A 4D6GA 1WBJA 4JN6A 4JAWA 1FP8A 5AHLA 2XTKA 1CXFA 1CENA 3M0KA 3BXWA 3LGGA 2PDUA 1AW1A 4D6CA 1A5MC 3USZA 1G1YA 4S38A 3UJFA 3SN4A 3RK8A 1V08A 1QRQA 3PUDA 2GDUA 2WHKA 4ROQA 3DG6A 4J9JA 1F3TA 1FY6A 3IJ9A 2DIJA 1U2YA 4FS9A 3RPDA 1CZ1A 1Z32X 1OCJA 5I77A 2BZNA 3QFEA 4JDBA 3ZT7A 3ANYA 3H26A 4YTSA 2NVCA 2V82A 1DXEA 3B04A 3KRZA 3WNPA 3E9AA 5DFAA 3W26A 2A2IA 2F8QA 4HYVA 4PR4A 4DM1A 2CESA 3HG3A 1PIGA 4IFOA 3VNJA 3DGBA 3UXAA 1KM1A 3UZWA 5ENLA 2VC9A 4F48A 4IGSA 1RBAA 3N2TA 4HA3A 3PAOA 5JIWA 2CETA 2YFNA 3OYXA 1Q6CA 4MMWA 4NRSA 4PBGA 1AA1B 2FMNA 3EDKA 4Z1AA 1VEPA 2YDAA 4RW3A 4TVUA 3IUIA 2HPMA 1EGMA 1FBAA 2X0SA 1SO4A 4PMVA 3RX4A 1R2RA 3RXZA 5A6BD 4Q33A 5CBBA 3DZ1A 4P8UA 3OGSA 1HO1A 4HK5A 3FKKA 1FWFC 1TTPA 5I3FA 2ZRVA 4W8BA 1UASA 4GGBA 2YX0A 4X60A 1HNYA 1LM1A 6PTDA 3H4GA 1EJ7L 3POHA 4IIFA 2OX4A 3S47A 1XSJA 4KERA 3L4ZA 3A4AA 3WQPA 3UD6A 2PTYA 3C6CA 3B9NA 1EPVA 1UOZA 2J7DA 1XIHA 3IIOA 5BWFA 2DIKA 1TR9A 1OABA 3T2QA 3QHMA 6TIMA 4BEUA 4MWAB 3W1LA 3W3OA 3THDA 2I5GA 4MLRA 3B97A 3TFXA 4NJJA 2EO7A 1MZRA 4S1FA 3W22A 3TYBA 3ZJKA 2ZTKA 2YL8A 2HVOA 1BYBA 3ZSTA 1RBLA 5GJMA 4QXIA 5BU9A 1DTUA 1CPUA 3R8GA 3B40A 1OF8A 4F8XA 1E1CB 5B80A 5C70A 3BG5A 2X0HA 5A6MA 1FWGC 1OK6A 2H9AB 4W5ZA 3VKCA 2C1IA 4RPPA 5FF3A 4GD0A 5ABGA 4NZ1A 4LYKA 2BX7A 3KOYA 3U2OA 4S2BA 4M51A 2J9XA 4IIGA 1VFUA 3GFYA 4XSMA 1I2NA 4OGZA 1T0OA 1CBGA 2A21A 3A22A 2UY2A 2GGEA 2OGJA 3V3WA 1Z89A 1JCNA 1EHNA 3EX2A 4NU7A 3TSDA 3UQNA 3S5YA 4GUHA 3RLGA 1MW0A 2JEQA 1M7JA 2C14A 2FTWA 3QSTA 1PJ9A 2YR1A 4ZSUA 1YXYA 3P84A 2OYLA 2A7PA 3TX9A 2OSWA 2E6DA 3T09A 4M6UA 2WZIA 3KUMA 5EPDA 1YBQB 3GNXA 4AVOA 1E9ZB 3WD2A 4KS0A 2PTDA 3W0KA 2XN1A 1CGYA 1JVNA 4AX6A 4UTFA 3AO0A 2PGEA 4E2OA 5AFDA 5E6ZA 1F9CA 2WSQA 1ISVA 4JL2A 3KBWA 2EPOA 3D3FA 1BVNP 1VFOA 2A7NA 4PN2A 4DBDA 4H7ZA 4V27A 4ZENA 4E5TA 1ZCCA 3MSYA 4IP7A 4R88A 4PTNA 2ZYFA 4NP7A 4FX6M 4W89A 3PB0A 1K8YA 1XIIA 3E02A 5ABFB 1RQEA 5CC3A 3VCNA 4M3PA 1IEQA 1HO4A 3IWPA 1FDYA 3URBA 2Q8LA 3TMLA 1VEOA 1H1NA 3KBMA 2IQ0A 1KLYA 1UA7A 5EMLA 3KL3A 1RA0A 1M53A 4DJFC 4WUIA 3DFHA 4PBEA 2ZUMA 1QW8A 4O17A 1KGXA 3MCNA 3SCWA 4HK7A 1HVXA 1P6BA 4JOMA 3S5ZA 2DFAA 7XIMA 4WKHA 2GJRA 1DQUA 3ELFA 3WMLA 3EX6A 4NZ5A 2JK2A 3OZMA 2FZNA 1PZ1A 4U28A 1YXCA 4LAOA 1D8WA 5D37A 4KWVA 5DT5A 3CPRA 2KAUC 3WYZA 2FZMA 3LBOA 4GABA 1H49A 3U2CA 2DH3A 2PLMA 3OTRA 1AL7A 4H6RA 3SFWA 1L6GA 4OU1A 4RNFA 2OZ0A 2NXHA 1LWIA 1Q6GA 4GLEA 2A3LA 2J75A 3ID7A 4FEZA 1GKPA 4EXBA 1JZ2A 3AAMA 3RPMA 1CYGA 2O0TA 3N3TA 2YDSA 1VD6A 2FPTA 2ZUUA 2J78A 4LH8A 4DO6A 3TAKA 4PH6A 4GKLA 1XFBA 1VBJA 1H3GA 3GR4A 3TMQA 3BK0A 4AF0B 3CUHA 5BRBA 3GKFA 3BOXA 4KCTA 3VDBA 4GUFA 4O54A 4DYEA 5A6BA 1RSCA 4IXHA 2HXTA 5CPNA 1XIJA 4FXJA 3VD9A 3LTYA 3FNDA 3FCPA 3THAA 4H9VA 1V6UA 4O28A 3H2CA 5BZAA 1PE1A 3HN3A 2W63A 3QMRA 4Z0SA 3EDEA 3SM0A 5AVHA 4DBWA 5BNKA 1QHZA 1JXKA 2XGZA 3W6YA 1R47A 6ENLA 4A3YA 2XFRA 1VJZA 3C8FA 4P61A 2V38A 3GNOA 4WX2A 1S2VA 1JXJA 3H2AA 4JKMA 3KOWA 4LNYA 1E1EA 2INFA 1X6NA 3LUTA 3N3MA 3SW6A 2PWDA 4X9YA 4ZQPA 4B91A 5HA7A 4RPQA 1SGJA 2OGYA 2YB4A 4JTFA 3C86A 3S1WA 2UZ9A 2GSJA 1PPIA 2BB0A 2R8WA 3BZGA 4FP1A 4HZ7A 4WKAA 1RD6A 4HD5A 4KIEA 1PDZA 1AZ1A 4S3GA 1I2QA 3LS9A 4PTWA 4UCGA 2XN2A 1R3WA 1TWIA 1VBGA 2W6RA 1QAPA 2HVMA 3GIPA 3IVSA 3B4YA 1T99A 2PSNA 5CH9A 5HULA 3QFWA 5LNRA 2Y24A 3FSUA 1UMYA 3VFLA 2AAAA 3C2YA 4X3ZA 3GS6A 1MUMA 3ZVHA 5A6KA 2OO0A 1SR0A 3PTDA 3VGBA 3LTPA 4F9JA 5D2XA 2O55A 1Q65A 4IF2A 1K02A 1BSLA 2PE4A 2PAJA 4F4RA 2Y5JA 3WLOA 1BF2A 5EB8A 4K68A 1XRFA 4OUIA 3NA8A 1Z42A 4NY2A 3W4RA 4M19A 4JZ5A 4S2CA 1WDQA 1FWIC 3U4AA 3CLWA 4K7VA 3L7RA 4MZ8A 3W6MA 4QISA 3L0NA 2XVPA 2ZXDA 3KL5A 1M03A 3RITA 4EAMA 1QNPA 3FHQA 4ZVJA 2ZDRA 4E38A 1MW1A 1WCGA 3PN8A 2IS7A 4YHGA 2PDHA 3DI0A 3ATZA 2O92A 3M7SA 5EKYA 4ZA0A 4KEVA 2J88A 1E9LA 1TZ9A 3RPTA 2KZHA 1S2AA 2VVNA 3DFSA 4NYYA 1J0HA 1IEWA 1KBKA 1UKPA 1EL3A 2Z27A 1EX5A 2RGMA 5HMFA 5KZDA 2J7GA 4M80A 2XUCA 1TIMA 2VR2A 1DIKA 4KFPA 3V0TA 5RUBA 3M7WA 3R25A 3EA1A 2FHCA 3A4WA 2WKGA 1ME7A 2Z1KA 4MGGA 2J7EA 1AQ0A 2KX9A 3KAOA 1M3UA 1Q2RA 4AY8A 4G8TA 3TZFA 3CEUA 1PAMA 1ZHAA 5B7ZA 3TDFA 3PZMA 1YMYA 2GOUA 4AD1A 4GFSA 2I1OA 1EIBA 3VD3A 5ECUA 3MANA 1FWHC 4Y8EA 5G1MA 4IG2B 1TWDA 1NIUA 1TWZA 3CHVA 5IBXA 2VZVA 1G4SA 3MC5A 5JUVA 5C9WA 3BCFA 1ZAJA 2VFHA 3QN3A 3KBSA 1CB2A 3NWRA 1S2TA 1PKYA 3V4BA 5A2CA 5LNWA 1R9YA 3ABQA 3PSVA 5KETA 4QJ3B 4FNSA 3PZTA 2VR4A 3LXAA 2ZZ2A 2DUZA 2X16A 2WLYA 1AH4A 4MLJA 1MXSA 2R94A 2OFJA 3ECQA 2YB1A 3BANA 3HG2A 4K6AA 1Q8AA 2Y4SA 4KPLA 4J3VA 2NV1A 3N14A 4Z0JA 1XQKA 2CLHA 1Q6FA 1F74A 2Y2WA 1JRCA 3S42A 4GJIA 3CASA 4IL2A 4O1BA 3W73A 3S2LA 1UG6A 1L2UA 2DVTA 1XIMA 1SFLA 2Z1VA 4UTMA 2Z1XA 4Z1DA 1EOMA 1WYIA 3W75A 2G41A 1AMYA 3P67A 2DZTA 2C3ZA 3RO8A 4EPKA 5FL0A 4XV0A 3R43A 4N4QA 4D1IA 4EP8C 3BV4A 4QR6A 1YDNA 1DE6A 2IKGA 3KCLA 3MSRA 3UNDA 4IPIA 1P6WA 1TPEA 4GXWA 2BY0A 4QQUA 3OLEA 5I78A 2V30A 4L1WA 1WZKA 3OODA 5FJOA 1I4NA 1QDSA 1T5AA 3UY7A 1ISYA 3N6QA 1XCWA 5HPCA 1TMLA 4WY0F 4O53A 3AMLA 1UA3A 5HR6A 4OE7A 4C6LA 5ECVA 3DHPA 2FZDA 3R6IA 5KZEA 3SUWA 3W71A 3QXBA 3P81A 1KFKA 2FGLA 1J0KA 1SQ7A 4XWUA 4KETA 4LAMA 2A5HA 2W66A 1OEPA 5FIPA 4NYUA 2AOSA 4HNTA 4A21A 2CWNA 3VPLA 1A53A 1PCKA 2YIHA 3P3BA 5CLWA 3XIMA 2CHNA 3GXFA 4PYSA 1GVEA 3ZXWA 3W7HA 1ZBVA 1KRBC 3PWAA 2OODA 3S9YA 1XHGA 1HGYA 2PDXA 3IVUA 5J8LA 4O0QA 1YTEA 1VIZA 2D20A 3BVJA 3C0LA 3LHVA 3WH9A 2G3MA 3URNA 2OU4A 1W56A 3AIRA 4B4HA 3M41A 4UQCA 3E0LA 3M44A 1XLKA 3K8LA 3UWZA 3KCOA 2GL5A 5JQ9A 1XGEA 5CQ1A 3WSUA 1EHAA 5HK4A 3KFTA 1HVQA 3QPZA 5F4XA 5H91A 3ARTA 4Q22A 2J74A 3P5YA 3NVTA 4CQ9A 3WD4A 1IGSA 3AS0A 2VKZG 4WDTA 2IMRA 1EO7A 2VHLA 4JHOA 1W9BM 2ZVIA 4U10A 5A6LA 2VDIA 4BEQA 4C60A 3VDAA 1SR9A 2PWVA 3M0LA 1VGAA 4JICA 1FHVA 4I5RA 1A5UA 2PRMA 3DFPA 3BMVA 4XTIA 3MJYA 1CI1A 2V9DA 4B15A 3VCRA 4R5EA 3TROA 1LTDA 3OOQA 4UFLA 1YDOA 3D3AA 1NP0A 2ZADA 2X8RA 3LHZA 3APYA 3RX3A 3GG8A 1GYMA 3UFYA 3IRSA 1A0DA 3UWWA 3IRDA 2ZWYA 1K4HA 4LWWA 3WK0A 3WQ8A 1J0JA 3WEMA 1FFRA 3CUZA 4QIUA 3IARA 4QSFA 4GY1A 2DT2A 5HWNA 4JXCA 2OYMA 1YW1A 3VD4A 2ISFA 3A23A 2E25A 3W01A 4A8NA 1EBHA 4IGHA 2CLPA 1GOMA 3AQUA 3GB6A 1XH1A 1JUKA 3VKDA 1YQ2A 1GPFA 1GZ1A 2UBPC 3W7OA 3ZO9A 3MZ2A 1WPCA 3WH7A 3LXCA 2WMHA 3PVFA 4OT7A 1XIGA 2OWXA 5AC8A 1QVBA 1GVQA 1E4LA 3NG3A 3OZYA 4S23A 5A94A 3LI0A 1H5VA 3T05A 3CQ0A 3NQ2A 1H7PA 4WDUA 2PURA 2R82A 2VOTA 1V6WA 1WZMA 4CLMA 4M5PA 2DT3A 3WFAA 2DZUA 4C6NA 1Q13A 3K46A 3W82A 4RNJA 4FZIA 1IWPA 4HA1A 2BVYA 1J0YA 4NAEA 1WDSA 3AHZA 4JTEA 4IMEA 5EBUA 1UD4A 2EG6A 3O7UA 3V36A 1KFJA 3KCJA 1H51A 3EWBX 3R58A 5HJXA 2CCRA 2XH7A 4EPBC 3TJLA 1XBZA 1EJUC 1C7TA 1PIIA 4N4PA 3VOCA 1VPYA 3O6DA 2OX1A 5LIWX 4IHCA 4H7CA 4IMCA 4L4MA 3EWCA 3F03K 5HOSA 5IOBA 4DZIA 3KWXA 1J11A 1QI5A 3EOSA 1IXQA 1XLFA 2WCAA 1LQ2A 4C5YA 1KGWA 2HE8A 5CGMA 1QPQA 2XSAA 3EWDA 4GIYA 3TFCA 4ERGA 1A49A 1W8GA 3BLOA 3L68A 5I2UA 4TMBA 3DG7A 4YIWA 1KV5A 5H8PA 5LGXA 4O18A 4DZ5A 4HPGA 3CNYA 1H7WA 3URQA 3GVWA 1X6UA 4LAZA 4LC8A 1K8ZA 4IIHA 3OP2A 2D2OA 4DHGA 1OIMA 1RJQA 3AXXA 3B9OA 1JCLA 4MNLA 1F05A 7TIMA 3ZLFA 5FEWA 3B05A 1EF2A 1W32A 1TE1A 4HGXA 2XHYA 2J62A 4I8YA 3CBWA 1LF1A 3TQPA 1Y7VA 4JHZA 1TX2A 1OK4A 4Z2HA 3O6YX 2B4GA 1NDVA 3VGHA 3VIOA 3SCRA 1SJDA 3W07A 3SCQA 1BSIA 5AC6A 2RJGA 2YCLA 4H83A 4AUBA 1TQXA 1G7UA 1O7AA 4W85A 1KC7A 1TELA 4ROPA 3W7JA 4GVGA 1UD6A 3DOPA 3HV9A 4XD4A 1V8EA 5D9OA 1FVPA 2CZFA 2FH6A 4XBKA 4DXKA 1U5VA 1B5TA 3E0WA 3O2LA 3UF9A 4MOZA 2VO5A 4J35A 1OCBA 4N02A 2WJFA 1CNVA 2H3BA 2FB3A 1E3XA 1QW9A 2HMCA 2EJ1A 4U5IA 1HKKA 1KRMA 3VX1A 4HNUA 1OCNA 2V5DA 3WQ4A 2FDMA 3CT2A 2PDPA 5F2IA 1ONRA 5BW6A 2PCQA 4MF4A 3W1UA 4M6PA 4DWSC 3K13A 3QMTA 3RU6A 4KFNA 1XS2A 1IXNA 2FVKA 2EPHA 2NUWA 3MT1A 5CZKA 3IEBA 2V63A 3REQA 5FI8A 5GQBA 5LGZA 1SFTA 2TAAA 1Q4NX 1ME9A 2Y85A 1S46A 3CWOX 4AD4A 2D22A 3PK7A 3LN3A 3DCPA 5I6SA 1W54A 3SRFA 3CJPA 1JPIA 3RCYA 1UKQA 4UZUA 3O3RA 3UG8A 1CW2A 3AC0A 4XTDA 1B1YA 1FWWA 2B81A 4GFIA 4R7OA 3T4CA 4O52A 1NF0A 1O6IA 2PWFA 3MUCA 1XRSA 3B8UA 1UH4A 1WV2A 4B5NA 3M0ZA 3NPXA 3D47A 2QCNA 2YA2A 3AUJA 4C6BA 1M1BA 2V3GA 3BOLA 3WNOA 4PRWA 4C1NA 5G1YA 1GEQA 2FZ9A 2ISSA 4GO8A 4JX5A 4O15A 1NVMA 4N9EA 4CD7A 4GMEA 3F4VA 4W8LA 3T9PA 4LY4A 2CYGA 3MV11 4PFMA 1JGMA 3LG3A 5F4WA 2C1HA 4PUNA 2PGFA 4YWSA 1HF6A 2GLKA 5BROA 5KSWA 2XN0A 4Y9AA 1QATA 3FVDA 1OZQA 3A6OA 3NURA 4JFSA 2ZZ1A 2HE5A 4ZL1A 3LENA 5D2WA 3ARYA 3ITCA 4HTYA 4IPNB 2IXUA 3RLVA 3GC2A 4K7YA 1KBLA 1DORA 4HT3A 3AIEA 4EXQA 5A6JA 1UP0A 3O6AA 5TQLA 1UH3A 1IQ8A 3SQSA 1BWKA 1SW3A 3W7GA 3L4UA 2BSLA 2ZIDA 3AMKA 3ZJ7A 3T1GA 3LHUA 1LYXA 4GBDA 3GDBA 2OLAA 3CEPA 1AD1A 3WDIA 1SZFA 2UY5A 4QAWA 1YKWA 4RE3A 4YYCA 5A8NA 1B3VA 1DEDA 3DFYA 5TF0A 2J9YA 5A8OA 2FLIA 3H2FA 4TTGA 3E0VA 2YXXA 3LLFA 1NQKA 1XLIA 3NQVA 1EKOA 5EFFA 1EJXC 4HKPA 3T2PA 3U7VA 4H19A 3TC3A 5A2AA 4R85A 4AQLA 1VPXA 1VFMA 3VNMA 4FLSA 4Q4QA 1IIHA 3U9IA 4OBTA 2DZWA 4F40A 1KFLA 2IPGA 2ZDSA 4Z2LA 2CITA 1TRDA 1BRLA 1MRAA 2GWNA 4CQCA 4MAZA 1GORA 1C9DA 3AHXA 2W62A 3WF0A 2R1MA 2ZICA 4B3ZA 1J18A 5IFTA 1R3TA 1LWJA 3VZZA 2QKFA 4HN4A 4XZ9A 2XISA 2ZRYA 2Q8ZA 2XSXA 5FJPA 3WJSA 5H1WA 5IDZA 1UWQA 3WLTA 4FK9A 1XL9A 3VNZA 2QCLA 2CZ5A 1KBBA 1WZLA 1UPPA 4AX7A 3W2NA 1XYCA 4ZB0A 3W88A 2Z28A 1FCQA 3ANUA 3MP5A 3D0CA 5DXXA 3V0SA 4B90A 3ANVA 1QK2A 4YL2A 2BXVA 2H3DA 4O10A 1HP5A 2DZPA 1V93A 3UYCA 3BGAA 5FEZA 2X1TA 2A3EA 2J9ZA 3H7VA 2EPKX 1DJZA 2ZRWA 4HP5A 4RE2A 1R6WA 3THUA 3WK1A 4HYRA 1W8SA 3ISIX 4H2CA 1HKVA 2G0WA 4ZOEA 3Q67A 5M1TA 2ZUNA 1AW2A 1P5BA 3ENLA 3AOFA 3R94A 4GYKA 3EPNA 3WH6A 1UR9A 1MEWA 2WO5A 3HOJA 1GOIA 3SCTA 5DF0A 4DLFA 1CXIA 1P7TA 1W0MA 3CAQA 2NQLA 3PBUA 3SRDA 2VYOA 1OHLA 1LRQA 2PF0A 3KWSA 1XBYA 3QC0A 2C6QA 1GVRA 3G1HA 3VIPA 2X09A 3FJ4A 3VAVA 1EZ2A 4BZYA 4CQBA 5AC4A 4ERIA 2HRWA 3DYOA 1G0CA 2J7CA 3PNZA 1JDCA 1E0VA 1RR2A 1BKSA 3GG1A 2Y62A 5LXEA 4PC8A 1A5BA 3NQBA 4C6IA 1Q7QA 3VE9A 4NUWA 5JVLA 3N12A 5CJNA 4JTCA 2WC7A 4GQQA 4YN5A 2FJUB 3FV9A 1LDCA 2P10A 3IIZA 4FIQA 2E1DA 2QCEA 1VFTA 3FK4A 1XJBA 3F4DA 2HK0A 3W1QA 2ZZ4A 4M7SA 1NQ6A 5C9UA 3E5BA 5C2XA 4DJFD 3OU8A 1TTJA 4IH3A 5LA2A 3OLIA 4G7FA 5K9XA 4XKYB 3UPWA 5D4YA 2VEKA 1UZDA 4ZR8A 1NDZA 5D38A 3TTEA 4MFDA 4RZ4A 4TX9A 1R8LA 4MDPA 1BLIA 3DFTA 4JNZA 2TODA 5DY3A 4HJWA 4HHPA 2VDGA 2QJNA 4V28A 2ZRXA 3S83A 1ISXA 2I57A 4HCHA 4K1WA 3V35A 1XI3A 4UFIA 3K5XA 4GCAA 4QE4A 3BE7A 4MVAA 4UFHA 2XGIA 3BAXA 3QR0A 2OSXA 2EHHA 3OJGA 1GOXA 3AICA 4PCNA 3RRAA 5DXYA 4AZCB 1EX1A 5FEPA 2VUYA 1M01A 3BURA 2BGNE 2WSKA 3DHUA 4FSAA 5MKGA 4JNYA 3N4AA 1REQA 3WF2A 3S5SA 3TIMA 3TW6A 2CKRA 1WDPA 3OIHA 3TKFA 3S46A 4GY7A 2P0IA 1L8PA 3DESA 4OVXA 3GZ3A 3PZGA 2Y89A 2H90A 3LCGA 2PTXA 3VKKA 5BOFA 5A6SA 4A3QA 1JZ6A 1TCDA 5CAHA 3R5EA 3DECA 1C90A 3WMSA 3UJRA 2XFYA 2C19A 4H04A 4AMAA 2Z26A 4NILA 2HZGA 5CKSA 2PD9A 4YLWA 3AXKA 2NX3A 3R2GA 1NWTA 1XYMA 1SJAA 7CGTA 4XBSA 2PDIA 1UIOA 3RM8A 2IQDA 5DMYA 1ZTVA 5HJLA 3INPA 1PKLA 3C8NA 4L64A 1Z7AA 1PZ2A 2QPUA 3TU9A 1KWKA 1UKOA 3BG3A 1XLLA 5CSRA 1JZ4A 4NZFA 2C7FA 3HM7A 1OG6A 3RNDA 3FKRA 1LBFA 4G6CA 2V69A 3IK2A 3IJQA 4JN8A 3WK2A 3GNNA 3QLDA 2ODOA 4KCVA 3BW3A 1KV8A 1J6PA 1XM3A 2QUVA 1TKKA 1RBOB 2V3FA 4PB4A 4TIMA 1W3LA 2ZX8A 4GWEA 5AKQA 5CZJA 1ISWA 4BHYA 1QASA 1XLEA 4MNJA 3MO4A 4KW2A 7REQA 1V7YA 2BS9A 1W2VA 3IAPA 1SFJA 4E8CA 4R3UA 3DU0A 1CGUA 1GG1A 1BHGA 3S1VA 3V5FA 2DZBA 3FA3A 3M6YA 4HPHA 3FJLA 4QJ5B 3DX5A 5D05A 1CLXA 1D3GA 5T91A 1DV7A 3HA1A 3LK6A 1I1WA 3O8AA 3UP8A 1VC4A 1ITQA 3SSJA 4CQDA 4W4QA 2VCBA 3NO3A 1JD7A 3K30A 3BC9A 1VCFA 3BW4A 1LRNA 4ORMA 4FLQA 3W53A 5CZTA 1K77A 4Q3MA 3VIKA 3NGFA 4CKQA 2PWEA 3BMXA 3LLXA 3JUGA 1E0XA 3P8JA 4WK9A 1R9ZA 1OC6A 2WMKA 3GIQA 1OT2A 3NNTA 5F2GA 4ZOAA 1XG3A 3MSDA 1DIOA 3I3BA 5C0QA 2BHZA 3R11A 1P0BA 1PHWA 3KOXA 5FL1A 4AHQA 4A29A 4UTKA 4J2PA 4WJ8A 2MUCA 1GVYA 4HMCA 4JKLA 4JIPA 4DUWA 2XIBA 1OWQA 2A3HA 3IJ6A 1SZRA 3SRHA 3AZTA 1B3ZA 4K8GA 2G37A 1TB3A 1TTIA 1FUYA 1P1XA 2YA1A 4MNMA 1C8XA 5K4XA 1LCOA 5BXSA 2FZ8A 1TX0A 1GOWA 3G22A 3TYZA 1KXHA 4QDWA 3MP3A 4QQ3A 4KF1A 3N19B 4GC3A 2V81A 3PSWA 4HMNA 1OADA 2WSYA 3SY8A 2VOMA 1BPLB 4NAEB 2D3LA 4DYKA 4DY1A 3MS8A 1FXQA 1AG1O 3BMWA 2FVMA 4AG0A 5F1VA 2QYGA 3QYQA 2PS2A 5IHRA 3HG5A 1KW1A 3OG3A 3UJ2A 4DJEC 1EJVC 1EUAA 4B3LA 1V6XA 2XGBA 1OT1A 2PDYA 4GNJA 4DJFA 4UOQA 2VRQA 4GACA 4QAIA 3DG3A 3WUEA 3FY1A 1S3HA 2QQ6A 1MQPA 2ZX5A 4V1YA 3C3UA 3W7MA 1X7IA 5G1TA 1XD0A 4FR1A 4QRNA 1W3JA 5REQA 3FHAA 4ZQOA 4O1FA 1RPKA 3F5KA 3FYPA 1XKJA 1K4GA 4IGNA 2ZXBA 3CL8A 3WENA 3ORWA 2DV0A 2GVLA 2PWHA 1KXVA 5MHBA 3IGUA 2ZZ5A 2X42A 5M03A 5GJPA 1IEIA 2I16A 4ZO6A 1TJRA 1CGTA 4JYDA 5CZSA 3TW9A 3ZJ8A 2QNEA 1EQCA 2EEXA 8A3HA 3W9ZA 3GVRA 4ICNA 4HNVA 1EGZA 3GTHA 4Q8OA 3W86A 3JVAA 4NI8A 3QOMA 3WD3A 2A0NA 3FDGA 2WMIA 2V67A 1PYFA 4ADSA 1ZBWA 5T9BG 1QBAA 1ZJAA 3CPUA 5JXQA 4UMBA 1E56A 4AYSA 5HQEA 3TSMA 1V4YA 3PPGA 4C6DA 1K3UA 4TV5A 4DZAA 4QG8A 3N34A 5HINA 4WDXA 4R7JA 4JTDA 4LJ3A 1ZP4A 1S5VA 4AIUA 1VRXA 3PANA 4UFKA 1Z69A 2W5FA 4QJ1A 5EBAA 2CFFA 3ERPA 1JD9A 3SFKA 2V5CA 3A9IA 2PLCA 4L5ZA 1MWOA 4BFAA 2YCLB 1S38A 1DYSA 2Y7EA 2PUZA 1ZU8A 4Q8TA 1XGDA 3LTSA 4QCEA 5CC6A 2DJLA 3AXHA 3VIJA 3W7QA 3NEHA 3BH4A 4CCDA 3QY7A 1B9BA 3F4WA 1UH2A 5C9XA 4XAFA 1F61A 4DJDC 4B16A 3KHJA 5G2HA 2WNQA 3MY9A 3QV9A 2AMXA 2HCVA 3FXGA 4ZFCA 3VDHA 3VGGA 1HG3A 3L4XA 3NTYA 4LF1A 3CQJA 3QPEA 4NJHA 4H8VA 1AVAA 4AY1A 3A4JA 1AD4A 5CPOA 4L1GA 2Y8KA 2WV8A 3ARZA 3KTCA 1HFBA 2X05A 2VX4A 3MYPA 1XYAA 1HJUA 1KO0A 1WAWA 4FB7A 3HGJA 3RDKA 1F6KA 1E1FA 4B5VA 3MJMA 1V3HA 3UWYA 1DIEA 3U0HA 3REQB 5A8GA 4BY3A 1ZNNA 2PWUA 3LHYA 1QHOA 3SDOA 8TIMA 1GVOA 2P0OA 2YXGA 2J8TA 1HTIA 3UVAA 4F0MA 1A0EA 4CVUA 3UZ5A 2DEPA 1GOOA 2NLIA 4HNLA 1OINA 3ZR4A 1XLJA 4IFKA 3T0TA 3RGTA 3NFUA 2FTPA 2VGFA 2YLAA 2DQXA 4EIVA 4UFMA 4E2BA 1WA3A 1Q6EA 1KD0A 4P7OA 4DEFA 5AYBA 2ZUWA 3OHIA 2J27A 3WQ5A 4IWWA 3AFBA 1O1HA 4C1NB 4GINA 3ZR6A 1O68A 3R12A 1GQLA 4UZSA 4LT9A 4O14A 3W7CA 4LALA 2O9OA 2RUSA 3WNNA 5D32A 1B0IA 4NXSA 2OQYA 1JUEA 4EE9A 1LRTA 1O66A 3N04A 2CBJA 4I3GA 2RGLA 4ZEPA 3UJEA 3TC6A 4XZBA 1DQXA 2CWXA 1A50A 3CLMA 3W70A 6REQB 5CJ5A 4URIA 3VXGA 1GK8A 1DOSA 1ECEA 3KXQA 3LU2A 4E0CA 4JTKA 1WP6A 4OBSA 1KWGA 3MUZ1 3T08A 4EWJA 4KKXA 1E6XM 2NZLA 3IAQA 3W37A 4QBXA 4GYPC 5LSMA 2CIPA 3B0VC 2VR5A 5I23A 3KS5A 3UZJA 4CN1A 1JYVA 3L4VA 4FR6A 1IZCA 2F2HA 2BVDA 2OZ3A 3GDTA 3WZ0E 2VJXA 4JYFA 4B92A 1F5ZA 2FZBA 4KRUA 1QR7A 4M82A 3UWQA 1P0DA 2H9AA 5GNYA 1B57A 3GDMA 2D2JA 3QHOA 1XPYA 5I7GA 1BRLB 4PTMA 1S2CA 4I9JA 3WLSA 2FPVA 3L5LA 3F4NA 4D8AA 3KRSA 4J5NA 4WLCA 1CLVA 3EB4A 3ARSA 3C2FA 3HPAA 4H9UA 4AD2A 1DE5A 4HB7A 3HPZA 3VNIA 2JF7A 1HX0A 4WEVX 1U22A 2PDQA 4IQLA 3TTOA 3W27A 1R86A 1XV8A 4M8UA 1VYPX 1KM2A 2CHOA 2DVUA 1W9XA 3E1F1 1BWLA 1VBRA 4MB1A 4MY8A 1W91A 2OR2A 4QLKA 5FSDC 1XRTA 2I9UA 2EPMX 4JTGA 3EDDA 4HU4A 3EOOA 2DVXA 3GTFA 4EK7A 5IDIA 3MMDA 1YBQA 1UD5A 3H6OA 1A4MA 1VLIA 2WNZA 3E2QA 3PJXA 4BA0A 1VR6A 2DSKA 4MAVA 1MYRA 3USBA 3G3DA 5E0CA 1CXKA 2E28A 2GWGA 3CUIA 5CC5A 4D9PA 5JIPA 1AW5A 3LHTA 5DO8A 2A79A 3LY0A 2GZXA 3DXIA 3CM4A 3ONCA 4C6KA 2CZDA 3DUGA 1P7TB 4LUJA 1XH0A 4LVFA 2UY4A 1QNRA 1GJPA 4FXRA 4AAJA 3UXIA 3EWZA 2PI6A 4RJEA 1XISA 3F5LA 4W88A 3VIIA 4YMZA 1TVLA 1JZ5A 1YPXA 1DJWA 1IXOA 3MQTA 4HOWA 3OVGA 1Q7MA 2X7WA 2O9TA 4UOZA 3MUAA 4M0XA 4O1CA 2WC4A 3FJNA 3W7EA 1JF6A 3GAKA 2HNEA 4IQDA 2FPYA 2RHGA 2QF7A 3P0WA 3T8QA 1TYGA 4NIRA 2NW0A 4FX8A 3LBCA 4PUKA 1E5JA 4RKAA 1VAHA 3P93A 4F0HA 1K1DA 2E5CA 3BUVA 3GU1A 4XZLX 2Q01A 5K9DA 1SZEA 3R4IA 3EWXA 2WXDM 4MWAE 4CD8A 3URAA 3GDKA 2VMFA 4IJCA 2ZC1A 3A9BA 5TNVA 4I7WA 3R7MA 4QJ4B 1H0GA 1TTQA 1CTNA 2VM8A 3IIXA 4LRSA 5JMUA 1RQBA 3T8LA 2HS6A 2X40A 3VTRA 3TQ0A 4MNKA 1EA0A 3KL0A 3N29A 3NOEA 2XINA 1TRIA 3DEQA 2H8XA 2VTFA 2A6NA 4CEXC 1TJ1A 5EL1A 3QJAA 2PDFA 1OY0A 4EAYA 4PEEA 1MW2A 3QRHA 3RCNA 1NFBA 2DGAA 2BTMA 4DWSD 3CHDA 3NPVA 1O95A 3AU6A 1H1ZA 3W7DA 3VI2A 1YLVA 3BWWA 3S9IA 1EJRC 5H2ZA 3W1PA 2QEZA 1RJRA 1REQB 3A4XA 2DIEA 3WDQA 3H21A 2PDJA 3PBWA 1GJWA 5AOUA 3CXOA 2YPIA 3L23A 4UMAA 3VDCA 3T0BA 2NQZA 1KGUA 2Q3OA 1TPC1 1X98A 2L5HA 4W9TA 5FJRA 4PL1A 2VENA 3RYSA 4AW7A 3EOLA 2BP1A 3E2VA 4GRSA 2IPFA 1EEXA 1ZL1A 3MHFA 4UTTC 2HK1A 2G5WA 4HPJA 1NEYA 1QO2A 3SI9A 3N4EA 5DLCA 4ZTXA 4GHRA 4MUZA 4AXNA 3NPWA 1B9ZA 3JR2A 3N11A 3CPGA 3SADA 4IMFA 4DF1A 4QG6A 1I2RA 3A12A 3VZYA 4N7QA 5G2WA 4J4KA 3M0JA 2VC5A 1QNQA 3O0FA 2ZUSA 1C9WA 4GE8A 2R24A 1NF7A 5DMNA 2P50A 1Q63A 4KWUA 5AC5A 3WQVA 2RKXA 2HTMA 1KCKA 3CL6A 3SN0A 3UA4A 3NXFA 2C79A 1I0BA 1THFD 3H2NA 4ACZA 4D6EA 1MQQA 2A1YA 1KM4A 2QW5A 7REQB 1N82A 3Q65A 2XM1A 1US3A 4LYPA 3AIUA 4PL2A 1MXDA 1RA5A 1IWBA 3EMZA 2QMJA 1NWRA 2ZUTA 2ALDA 1C8VA 4H9YA 2ATSA 4J40A 5AVNA 5A6AA 2X1RA 3W6LA 4H9XA 3B8SA 2CLMA 1R38A 3A3HA 3V18A 4C6OA 1UUOA 4REQA 2ATMA 1YHTA 1W17A 3PB2A 3PHAA 3GU9A 3CMFA 1FH9A 2TYSA 4CNUA 2OWWA 3W7NA 4LYRA 3FYYA 4I6KA 1E5NA 1FRBA 4RDWA 1AJ2A 2XIIA 4FXSA 2R1NA 2I7GA 3BICA 3TE9A 4AD3A 3LQLA 2VURA 3BQ6A 1V0MA 3QHNA 1ME8A 3VOFA 5CPTA 3COTA 3WLMA 3T4WA 4JEQA 3GY1A 4GKTA 1TSIA 1HIZA 2D73A 2WLZA 4HJFA 4RDYA 1J0ZA 3R8RA 2E6AA 4YTTA 4Z08A 3PUGA 2F2KA 4N6FA 4ORIA 2E09A 3BJFA 1O94A 3CL7A 4NVTA 1MUCA 9XIAA 4Z1BA 4YS1A 4EVZA 3FFSA 1F76A 3SCSA 4GC4A 4XK2A 4GJ1A 4UFJA 3CZEA 1DWIM 4OV4A 1UHVA 1OCQA 2YKKA 1EJSC 2V0TA 4CNSA 3W24A 1LBMA 4IICA 3DKJA 1E73M 3LI1A 4NSBA 1VJSA 4B4FA 1V79A 3LCLA 3GFXA 3NO1A 4L6OA 3CZJA 1W2PA 3FEQA 2D2GA 2QPSA 3B0PA 2A4AA 3U5YA 1P1MA 4ACYA 4AWEA 1NFGA 3KP1A 2FIQA 5H6HA 5E9XA 5XIMA 3TW7A 2P88A 5FF7A 5D8ZA 2PB1A 4P2VA 3LGEA 3RLUA 3G1AA 4DUOA 2I5IA 1JRBA 1S39A 3HQOA 1L8NA 3CUJA 5BRQA 3BL3A 4ATWA 4HU8A 2OB3A 4RV8A 4DB7A 3T6CA 3T0AA 2ZE0A 4H1ZA 4KCUA 2J13A 3EYPA 1VFFA 5REQB 3VOJA 2A6LA 4NNAA 1UUQA 2BOEX 2W61A 4DELA 4K1GA 4L6DA 3N17A 1U5JA 3OPSA 7ODCA 4UQAA 5BCAA 1UJQA 4AWTA 3CH0A 1LBLA 1IHIA 1J6OA 1SZNA 3N15A 5AYYA 2ZFAA 3TJXA 1O1ZA 3CZGA 4AYGA 4FI4A 4GIAA 6A3HA 4Z1YA 4DO5A 3EX4A 3IJ7A 2WMIB 3S6DA 4FX7A 1WNOA 4DQWA 3CMJA 4LAUA 3XINA 3R1ZA 1JDAA 2XZ9A 2VEMA 1E0WA 4NQ1A 1V3IA 5CSYA 3C0JA 3CB3A 3OVPA 4YTQA 3L2MA 3BGJA 4UUIA 5HJYA 2F7FA 1TJPA 2DZSA 1V0NA 3CV7A 2PC8A 2JALA 4NT0A 1UP2A 4OHQA 1WXJA 5GJNA 2UWFA 3CO4A 1W5PA 3P14A 4J28A 4X2RA 1ONWA 1G69A 1Z6KA 2C18A 5LA1A 4JCMA 1JAKA 4IM4A 2XVLA 2BWGA 1AJZA 3G6LA 1MVYA 1GQJA 2Z29A 2Y0FA 2WOQA 4N0RA 3A3XA 3K4DA 3LZ3A 4H41A 3WX7A 4MADA 2EPLX 5FAGA 1Z8AA 2GOKA 4C7DA 3FEMA 1SO3A 1XX1A 2GSHA 5A5WA 1AMKA 3C3NA 4O4VA 2OOFA 3RRXA 4HTBA 1VH7A 1K8XA 2DW6A 3BSGA 1G4TA 4A8RA 2WWCA 4AH7A 1ZAHA 9RUBA 4UXDA 1MEHA 2ZX6A 4IIEA 5HXMA 1QW7A 3H12A 1N7KA 4GQ0A 4IISA 4JQ1A 1UKSA 4KWOA 3WLJA 3KW3A 4F0RA 3WN6A 2V68A 5HMSA 5DANA 4INFA 1KNWA 1V6TA 2YA0A 3MBDA 3IJ8A 4JY9A 3OYZA 1XFCA 1PKMA 3PG9A 1GQIA 1UC5A 4GX9A 4MB3A 5E93A 3WLRA 2QIWA 1PTAA 3NM1A 4J7RA 3NL2A 4GVIA 3KP0A 1OIFA 1GTEA 4IFKB 2NVDA 3ITXA 3P6LA 2Z4GA 2HBXA 4UQDA 3S5OA 4P7NA 2I9EA 1BFNA 1A4LA 3PTMA 1RH9A 1UWTA 3CQHA 1RXOB 3PS7A 3R89A 3WBEA 3A5FA 3E74A 1RK6A 3I7RA 4F2UA 2E68A 3ZT6A 4PMOA 4WY0A 4FNRA 2QJJA 2LLEA 3L4WA 3I10A 1MNZA 4XG1A 5BU6A 2X30A 2JGQA 3IIPA 1EDQA 2DU2A 3GX9A 4XD5A 4GYJA 3L12A 3GSMA 3LBMA 4TX6A 2WQDA 4Q6JA 2V5JA 1XINA 1AZ2A 4GISA 1EC9A 5KZMA 3GKAA 1BGAA 2VI0A 1VBUA 4DO7A 1ZJBA 4XIAA 4GJJA 4TTUA 1KFEA 3C0QA 4N2YA 4MM1A 3C61A 2NLYA 3NL6A 4LCQA 4H01A 3H70A 2WKJA 1UQYA 1W1VA 4CCEA 4I5UA 1ITCA 2ZC8A 3LPFA 1FCUA 1GHRA 4RDZA 5FF0A 3MW7A 5G4EA 3E12A 4LEFA 1PKNA 2FQIA 4ADUA 3L65A 2CLLA 2Y6ZA 5BYWA 2WM0A 3DIPA 3NXLA 4KCWA 2J47A 3CIXA 4DPQA 3ITVA 4W87A 2NQ5A 1RCOB 3DAQA 3QGAC 1GJUA 4XBJA 2D0HA 2FJKA 7A3HA 3P2VA 4O1AA 1LL7A 2PU1A 2YFOA 2B7QA 3U48A 1EC7A 4MYAA 5HBFA 3O06A 3UPMA 4LANA 3DC0A 1FOBA 1V02A 5E5CA 3B9DA 1JCMP 3TEVA 5XIAA 4A6GA 3UA3A 3LA4A 3LLDA 2VC6A 4LVBA 4JBRA 3LSBA 1QUMA 4Q8PA 2OQLA 1N8WA 1OFOA 3GFZA 2W92A 4GQRA 1OJXA 4TUFA 3I6RA 3H22A 3N9RA 3KTXA 4M7TA 2IKHA 4IX2A 4JIEA 3NQDA 3BPWA 3EAUA 3IANA 5TAOA 3VIGA 2FYMA 4AVFA 3LSCA 1M04A 4UR9A 2J79A 4HU0A 1OC5A 1G6CA 4DJED 1KM0A 1M65A 4PSPA 2GQ3A 3CYJA 3OQEA 1TFVA 3V5CA 4MKVA 2PGWA 5DCEA 2J6VA 2YL6A 1M7OA 1Y8BA 3ITOA 2HBVA 2WANA 4GY0A 2BASA 1W3NA 3MI3A 1SO6A 1XGZA 3OVRA 4EACA 5AYXA 3IACA 2RFGA 4LCRA 1J5TA 3ABOA 4DBSA 3MWCA 4TOQA 1FWAC 1AH0A 2ZKMX 3G8EA 2QUMA 3SZ8A 3WQ6A 1WUFA 3CB8A 3ZQ9A 3EDJA 1FH7A 1D3CA 1VCVA 2OJPA 3LB0A 5DQPA 1XD1A 2PPGA 3LCFA 1C8QA 4W7UA 4M24A 3SJNA 3TN4A 3QKEA 3B8IA 4JQAA 4NNBA 4R53A 4IPPA 2HNHA 4FF5A 3E49A 3NVDA 2YXOA 3D5HA 2IPJA 2E67A 3GBEA 4Y96A 4EF9A 1HL2A 3LV5A 3M9YA 1F07A 1OGSA 3G0SA 4KWWA 1OQFA 2QDGA 3JRKA 5EYWA 4P8XA 1S5TA 1EYEA 4LAKA 3P62A 1ENUA 1P4CA 1DPMA 1JF5A 1X38A 3ZZ1A 1EOKA 1LJYA 2XFWA 3O6CA 4Z2GA 4H7VA 3ZWSA 4RDVA 3DBNA 4A8IA 2YCIX 3TSBA 3WBXA 4HK6A 2VFDA 2WHMA 2WVVB 2G97A 3H2OA 4LBUA 2R1LA 4DBUA 2P3ZA 3KZSA 1TUFA 3KS6A 5LNUA 1TPUA 2ZBTA 3DGRA 1OM0A 2CERA 3LERA 3UT0A 3W85A 4I7VA 4D6IA 4KIRA 2JKPA 4DJDD 3W74A 4B2DD 2Z25A 3S1UA 1Z48A 5G2IA 1ZALA 3LCWA 5I3KA 4O13A 3CQIA 3KVLA 5FJIA 1B2YA 8XIMA 3CK5A 2HQAA 1GWJA 1PS9A 2JKAA 1PTGA 1O12A 3LPPA 3THCA 3W2KA 1FWBC 5K7JA 3QV8A 4W84A 1DIDA 4RR4A 2AQVA 1D3HA 3NQ8A 1I60A 4WDWA 3IGXA 1CGWA 1E6ZA 2C71A 2OLSA 4JTLA 3S4TA 2QV4A 2C0HA 2OYKA 1RLDA 1BXNA 1YIXA 1XICA 3ITTA 3BDKA 4MY1A 2WJZA 4CNNA 4US5D 3NR0A 4N9CA 4PUUA 4WXZA 2W79A 1FWTA 5AY7A 5C71A 1L6SA 1CGVA 2Z6IA 1HL8A 3B03A 1A5KC 1V5XA 4D8LA 2J7FA 5C2GA 5I02A 3ONBA 3STGA 2ACRA 3IVTA 3NPUA 4KEUA 3BLFA 3PTKA 1UPMB 1WZAA 2OVLA 1GOQA 2E8YA 4FOKA 4XAYA 1LLOA 3AMGA 4YHEA 1TPFA 1CIUA 3AHYA 1A47A 3GIYA 2E5DA 1JZ3A 4DNHA 5AZ1A 3WLNA 3KVJA 1MEIA 1EFZA 4JFUA 2Y63A 3WQWA 1PEZA 3G24A 1VFSA 4PA8A 3SGUA 2GVEA 4MYXA 5CJMA 2QCDA 5T26A 2PA6A 3N25A 2XPKA 3N2MA 1WDDA 2Y7DA 3ITLA 3QTGA 3BCDA 5CAKA 3CWNA 3W28A 3ZFHA 4ACZB 5CPSA 2IUZA 4YXGA 2Z7KA 3IJLA 4UTLA 3W7KA 1A5LC 4HA4A 3TTSA 4ZFMA 3NL3A 3R0UA 5HATA 5JU6A 3L5MA 3A64A 4GZIA 3H23A 2R9RA 3GNDA 1E0UA 1F73A 3GW0A 5JH2A 1V03A 3RM9A 4REQB 1UOKA 1R2TA 3SCNA 1QFEA 4S3DA 4DJEA 5C7VA 5C8BB 3M0XA 3GBDA 4PTVA 3KTSA 3TQVA 3V5OA 2NUXA 4XD3A 1ZBKA 3U8GA 1TV7A 4G56A 2VQTA 5KMYA 3AWNA 2PD5A 1DWJM 2FFCA 3NAVA 2V5KA 3CT7A 1TPDA 1GEHA 2OZ8A 1K6WA 1VCGA 4GVFA 5LZLA 2JKEA 3TQKA 3CHCA 2DZXA 4MJ4A 3UCQA 1E6QM 3FVMA 3W25A 3O63A 4L61A 3QVQA 3S2CA 4PMUA 1KTBA 1Q6LA 2VZTA 3CTLA 1F3WA 2INZA 1X1ZA 3F1QA 4HQVA 4JIRA 1MDLA 1QNSA 4OECA 3QEZA 3TOPA 4FALA 1W5MA 1Y5XA 3UXDA 1SPQA 2GSEA 3ARXA 3JU2A 3V0UA 3N13A 3GG0A 2NSXA 4PUMA 3UXLA 3I3EA 4H8NA 2PLJA 2TPSA 4LV9A 3FYOA 4L56A 2XZ7A 4JTHA 3R13A 1SYTA 1QOXA 2ISWA 1Q6QA 1QK0A 3WK3A 1TPB1 3W38A 3YPIA 5D9PA 1DWGM 3K4WA 3KRUA 3PUOA 3VM5A 1NDYA 1WBHA 3HIJA 1OFBA 4AIOA 2HXUA 1Q3NA 3UU0A 3LMZA 3UG5A 2R6OA 2VFIA 1TQJA 4C6JA 3EOUA 3KLLA 4FF7A 4BF9A 2OG9A 3O9NA 3RMEA 3NZQA 5U7SA 4O1EA 3IV3A 4DRSA 4F0SA 2IPWA 1IR1A 2QXWA 3U3HA 1FWDC 3R0DA 4WGHA 3R8HA 1ZAIA 4DJDA 3MZNA 4HCLA 4B2DA 1M41A 4QEHA 4GIEA 1ZENA 1RCQA 5AHFA 1XYZA 5FEXA 4K39A 2O4QA 4M6VA 3E96A 3VX0A 1CT5A 1XDJA 5CLTA 4L9YA 3TYCA 3BAIA 4KT2A 2P76A 1EP3A 1T8XA 1X1NA 3O15A 2DPEA 5HNUA 2E77A 1TWSA 1JZ7A 4XKYA 2H8ZA 3HF3A 4DWSB 2CBUA 1Z3NA 3ITYA 1TA3A 3I7QA 4DIAA 3UERA 4ZBCA 4D71A 3BO9A 1LOSA 2WJDA 2AKMA 3CAVA 3UNTA 3VE7A 3WNKA 3TNOA 4A05A 1W9VA 2PTZA 1G7VA 1IGWA 3RJYA 1RUSA 4DLMA 1W5NA 4QE1A 1ODUA 5KEZA 1V0KA 1X97A 4ZO8A 3TOYA 3GG7A 1ITUA 3H24A 3KEHA 3GR8A 3ZVIA 2EXOA 1I75A 5F2LA 4AZCA 1JNDA 3PNUA 4U5KA 1TPH1 4U3CA 2PDGA 3MI6A 2W91A 4LXFA 1UWIA 1ZZMA 3UW6A 1RK5A 1XLHA 2QUUA 2DW7A 2EPNA 3GUWA 3N2XA 3M0IA 2GUBA 4FNTA 1HN1A 3K4AA 3MI2A 1IWAA 2F6UA 1TR1A 2HVNA 3I4EA 4FNUA 3WELA 2YOCA 2GQAA 1JCJA 3L2IA 4G7EA 4X0NA 1LLZA 2W9MA 3RIKA 3MA8A 4C6QA 5E70A 4JFVA 3UR5A 2DUAA 2VL4A 4GI6A 1R85A 2B0MA 3DYMA 4C6CA 1QPKA 3G6MA 4UQEA 3VM7A 1UR4A 1R9XA 3TK7A 3VILA 1KCXA 4JY8A 3U2EA 1H11A 4UTWC 4CCCA 1JDEA 3VKJA 4GI9A 1DQWA 1DL3A 1EP2A 3FJ6A 3LHWA 1U1UA 1YTDA 2OKOA 3IIVA 4A3UA 4PUWA 2PDLA 3HZ3A 4E8GA 3H7UA 4FHAA 4OFCA 2QVHA 3F2CA 4Y6GA 4AXKA 1VHCA 1YE6A 4GYPA 2WMJA 3SSZA 4Y9OA 1T40A 4AC7C 1OFRA 1W9UA 4BJHA 4WCJA 2BY3A 1TJ0A 1RCXB 1ZBCA 1XC4A 4MB4A 4WY0B 4GPNA 3Q45A 1Y0EA 4I90A 3O05A 2BOGX 4ONVA 4I8DA 3PZ9A 3Q4DA 5KITA 4HPNA 3FSTA 3W7PA 2PZNA 5HWJA 3HB9A 3ZMRA 1HW6A 1TWWA 3B0YA 3UWEA 2E6FA 3VD7A 1LG1A 2PDKA 1I0DA 2CC0A 5EFDA 3HPXA 1F6YA 4ZMGA 4X2PA 5IHSA 5EGRA 1KR0A 4KGLA 3O16A 5AYZA 2P8BA 3W7LA 3MKCA 1IZJA 1JCYA 4CU6A 3GVVA 1W3TA 4YCPA 3WQOA 3GR7A 2BV9A 4PEKA 4ATDA 1AK5A 4HOZA 3N6HA 5DMLA 3W02A 1XBXA 1HP4A 2WVTA 1PB0A 1BYDA 1JUBA 4DX3A 3G5EA 2WW5A 3NSXA 1NOFA 3NQ6A 3CTTA 5D9NA 3QZAA 4HPXA 2QT3A 4TU1A 3OQ8A 5FSEC 4PB5A 4PFHA 2VUNA 3HFYA 1GZGA 2OT0A 4UOJA 4JFWA 1PL9A 2CZVA 4XUGA 1IF2A 1JCTA 4K36A 1EF3A 3PP7A 1J0IA 1QXLA 1M68A 1UB3A 1SSDA 1KFCA 1KXQA 1EWEA 5KINA 4XVDA 3TWAA 2BLEA 5I3HA 1H0IA 3WF3A 4FNQA 3N2CA 2XYLA 2EAWA 1AFSA 1CECA 4IL0A 4J3ZA 1JI1A 4IP5A 1BAGA 1PCWA 2CNCA 1XW8A 3BAWA 2G3NA 2P3EA 2YLLA 4Z2JA 4IQJA 4LUIA 1GG0A 2GQ9A 5HAOA 5FAJA 3CIVA 5KTLA 3RR1A 1KQZA 3NDOA 3MMTA 2G3FA 1MXGA 2ONEA 2ABBA 5BOEA 3EMCA 4J3TA 4MY9A 4Q6XA 2CBVA 1UJPA 4EANA 4CN6A 1EJWC 1U5HA 4Q32A 5AB3A 1FWNA 1K9FA 2GK1B 4WOQA 4RNHA 4HMEA 2CLKA 4MJZA 1YRRA 5CSUA 4KRZA 2Y1HA 2POZA 1IT0A 3EB2A 3SGZA 1KBJA 2DSVA 4AEEA 4EWND 4GZEA 1T41A 1QHPA 1KB3A 3MO7A 4JTSA 3H4XA 3WDRA 4NXKA 4MJ2A 3UR7A 1TUXA 1B4EA 4WJXA 2PGRA 4IFRA 3F2DA 3OO2A 4QX4A 3S0CA 1E40A 3QQWA 1HZYA 3HMCA 3P80A 4O8AA 2V2DA 5PTDA 1PX8A 4PCTA 3UR2A 3QF0A 1H50A 3G1DA 5EMJA 1KM6A 3H2MA 1N55A 1NFPA 2Q6ZA 3KVMA 4JL1A 1NAL1 8CGTA 4U2YA 2VRJA 3V1PA 4HHMA 3QZ6A 4AZ6A 4AIBA 4LC6A 4EX4A 1DJQA 5BXRA 5A6TC 3HURA 2DDXA 2VZSA 3S5NA 4RK8A 2VD9A 3FW6A 2OOGA 1AH3A 3AXMA 3EMQA 1OC7A 2E1WA 1A5AA 1US2A 2PLKA 3B8TA 3T7VA 4GX8A 1RZMA 3C4UA 1U1JA 2AMGA 3RMJA 3TNBA 2VEIA 2ZCGA 4NX0A 5CG7A 3LCIA 2WYSA 3L5AA 5M2FX 4GUJA 3TTYA 4LVGA 4AWUA 5KZ6A 3T07A 3MHGA 3CZ8A 1HJWA 3BG9A 1JR1A 3SGGA 3QR3A 4JX4A 2B7NA 3ALFA 3DN5A 1G5AA 1IZKA 3WCZA 3LCHA 1KRCC 4UTTA 2WBGA 4NX5A 3EKZA 4M56A 4O0ZA 1AUSL 2Y7FA 5D2TA 3VA8A 3AZRA 1DJYA 2BNJA 1POJA 4L9XA 4QS6A 3VOIA 3WLPA 2Q8XA 3VNKA 3NOYA 3SY5A 2I56A 1E51A 1O5RA 1L9WA 3OVQA 4LF2A 3MP4A 3W1NA 4AY7A 5AZ0A 3P60A 3SUVA 1PX4A 4TVDA 1JIBA 3OGVA 3PAJA 2GJNA 4AD0A 4TMCA 2DQWA 3OW1A 3GZAA 1NOUA 2YDRA 3R10A 1H7OA 1B3WA 3HQPA 3W72A 1GCYA 3KBJA 2ON3A 2FFIA 3S2MA 4XZIA 2AQOA 4ZE5A 3RR4A 3AS3A 3MVTA 1WKDA 3ZOAA 3M5VA 4QSHA 3EKGA 2QGHA 1E9IA 2J8FA 1L6WA 4YVPA 3VMNA 1CCWB 1TV3A 2WHLA 3NGJA 4LW7A 4AZBA 3WMCA 3QV6A 2AL2A 2YCJA 2ACUA 3CQKA 1B31A 1KFWA 3Q37A 1R3SA 2XJ7A 5D8WA 1AJ0A 3BLDA 4F79A 3UESA 3QBUA 4ADTA 3PZOA 2HDJA 5I3DA 3TN5A 2D2HA 2IXVA 3LPGA 1BQGA 4CD4A 3PR2A 6REQA 3DYPA 1O5KA 1P0KA 3RFAA 2ZZ7A 2XWDA 3ME3A 4LCSA 2YYUA 3ZIZA 1EBGA 2BVTA 3GTNA 2YL9A 3N2OA 9CGTA 1I9CB 5DX7A 5G4HC 2V3EA 3PWGA 2XM2A 3M6DA 2O7QA 3ARPA 3TJ4A 2DSWA 4FIRA 2QCDB 1PXGA 3S2JA 2E6YA 2VFEA 2YSWA 2VELA 4OUEA 2EG7A 5CGQA 3ZSSA 3BSMA 2AL1A 4B9YA 3E2RA 1SMAA 2D23A 3TLQA 1N8IA 1XRVA 5M17A 3GXDA 4F2TA 3S9ZA 2JBMA 3LCXA 3WDJA 3RX2A 1GVIA 3IV8A 3I7SA 4JDYA 3V75A 2NXGA 1E15A 2OTDA 1XIFA 1S5WA 2PF8A 5AYIA 4W5UA 2QVNA 4BQ2A 3ZLHA 3ARWA 1XYLA 3CMGA 4CQ8A 1XF0A 3EOEA 3MHUA 4Y8FA 4AFYA 4ZXOA 3QH2A 1TJ2A 4PTXA 3GHUA 5K9CA 4EXAA 1DJHA 3TR9A 5T9CE 2BY2A 4MIMA 4D6HA 4O50A 3BQ5A 3PZQA 1XWYA 3WLLA 4IMGA 3GW3A 2YZ5A 1LORA 2BBFA 3RG6A 1QOQA 3WL0A 1EIXA 1UQZA 3L4YA 4EOUA 3O07A 4ICCX 3M5ZA 4OOZA 4BF7A 3K1GA 2DSUA 2CLOA 2NXIA 4DVOA 3KX6A 2JEPA 3WBAA 3LZ5A 4OV9A 1Q2SA 4HBKA 3B0UX 2G96A 3WF4A 4ILSA 1VB9A 1KA9F 3LQGA 3TAOA 2QUNA 3KBNA 3I68A 2CU0A 3K8MA 3UJSA 3P74A 1DJXA 1C93A 3CAKA 1YNYA 4HZ6A 4IUOA 4QDPA 1M6JA 5M5DA 1O60A 2HISA 2I5QA 2QCHA 2Y8UA 8XIAA 2E5BA 4GVHA 4BQ3A 4KRTA 3W83A 2J7HA 4XX6A 5A1AA 2ZRUA 3EXTA 1H1YA 1FCVA 5F2MA 1JPKA 4WZHA 3ABSA 4KEMA 1S2WA 4YNGA 3PTQA 3B0XA 3GXTA 2XFFA 4US6A 4PCPA 3A21A 2CLIA 2E9BA 3AUOA 2CPUA 3PJWA 4I9TA 1PDYA 1I45A 3PJUA 2VGGA 1L0PA 4Q8QA 3QQ0A 2NWRA 3CUGA 5HUPA 4UMCA 2C16A 5SWUA 3SUUA 4ML4A 2XIJA 5FJJA 2WMGA 1GNXA 3CYVA 4R27A 4QLLA 4UTHA 1KXTA 4UNKA 2YBTA 3WBYA 1ZSXA 1N8FA 4DBEA 3QSRA 2C1GA 3FGCB 3TN6A 1YPIA 4CGTA 4XIMA 3I3DA 3RHGA 4Y9MA 3U5UA 3GHTA 1TA3B 1PUDA 4QGCA 5HR7A 1C91A 4D6JA 4Q8NA 3MU7A 1ESWA 5CPLA 3EKLA 1ZJHA 1G67A 4GQGA 1T8QA 1LT7A 4PRRA 2QAFA 3VZXA 2XG9A 3DH7A 2EQDA 3AWOA 4OKDA 1QPRA 2OMAA 3ITGA 1T6MA 2EF9A 3PG8A 4O8RA 3NUKA 1JI2A 2NQHA 3QY6A 2FVLA 3CIWA 2I14A 4HYWA 3GD6A 1EYWA 4M29A 1RVKA 3IJDA 5HWMA 2O7SA 1I2OA 2F6XA 1BTCA 3PM6A 1H62A 4UBPC 2YL5A 4LUSA 4JHMA 4O4WA 1FQ0A 4G7EB 3MB9A 3VOGA 4Q4KA 1YPFA 3UBPC 1TMHA 4HZMA 1QOPA 3DENA 2ZA1A 2C91A 2ZX9A 1HKMA 3T55A 3CWHA 2F84A 5C5YA 2E8ZA 2HS8A 4ZQCA 3TUUA 1WO2A 2OCZA 4E2VA 1HKIA 4PULA 4CD5A 4FOJA 2IKIA 1H41A 3T2OA 4YWIA 3EDFA 4WSKA 2PDBA 3Q94A 2NQ9A 1VPQA 3GC4A 2FGZA 4PCFA 1VFLA 4JX6A 1W6TA 2PP0A 1VHNA 4ERAA 2D24A 4DN1A 2Z24A 3L0KA 4P7QA 4E4FA 3NQGA 4WIWA 5DBUA 2OT1A 4Q8VA 1NJJA 4ICMA 4YVVA 4JD4A 1DJIA 4BI5A 1GKRA 1NU5A 4J3SA 4BI6A 3H54A 1MFUA 4MDOA 1XLMA 1IT8A 2WZHA 4LBRA 3QTPA 4R9XA 3VO0A 3WLKX 4Q7IA 3WFLA 4MWAC 1FWEC 3FXYA 4AZGA 1G9HA 2PP3A 3IPWA 3TP4A 3WKZA 1SJBA 4Q4PA 3GLCA 1EWDA 3E2SA 2JE8A 4TR9A 1A0CA 3TXVA 1VS1A 2HROA 4DO4A 4Y9PA 2WPGA 5CZ0A 1LUCA 1NARA 2Z2BA 2OWCA 5DMMA 3IGHX 1LL6A 1GZJA 4LY8A 3ICJA 2VZOA 3WJYA 1ZS2A 4DF0A 5ABHA 1C29A 1WUEA 4OZOA 5EU9A 3B06A 2ESCA 2C13A 4P8VA 4AD5A 5BOOA 4GG9A 3PFRA 2ICSA 3CGTA 3P8IA 5LIXX 4ZZ9A 4C65A 1LOQA 2CXGA 1PX3A 3P0XA 1WE5A 1JL8A 3WD0A 1A5NC 2RJHA 2CZEA 4F66A 3PBMA 1C3FA 3DDMA 3LV6A 4J3WA 1TO3A 1ISZA 4NZ4A 4GGHA 2Y8VA 1FHUA 1C8YA 2J66A 4XO6A 3HQNA 1XC6A 2V3DA 4W86A 2Z6JA 1X8CA 1XYFA 3CU2A 3NZ1A 4LOCA 3ZT5A 3FS2A 3KOFA 4J2MA 4H9ZA 5BRPA 5C55A 1FX6A 1QI2A 1K9TA 3MCMA 3F5JA 4S3BA 3TCSA 1PVNA 3RUBL 4JIHA 1W1B1 1S3TC 1VYRA 4RZ5A 1V3MA 1BXBA 1ECQA 1XQLA 2GQ8A 3UEQA 4GCXA 3QR1A 1CB7B 2ZX7A 1JQXA 3HGOA 1VLWA 1UD8A 3ATYA 2AGTA 3GVGA 1OYBA 3EWWA 1ML1A 1H4PA 4D6DA 1R3QA 2Z0IA 3TA6A 3OB8A 4RL3A 4BK9A 1RY8A 4RXGA 4R33A 5I5RA 1ZQ5A 5DBTA 4H00A 4IQEA 4IOTA 3POCA 1C7SA 2AQWA 4IJRA 3UZXA 3SCOA 1DJNA 3KVKA 4UNLA 1YX1A 4A35A 1W1YA 1LT8A 3NSNA 4N6EA 3WEZA 4MJMA 3WIJA 4S3KA 4TVCA 2V5LA 6XIAA 5D04C 2VGIA 8RUCA 4PMZA 1XBVA 1DWHM 3BTNA 4XQ6A 4WVXA 4W93A 3EPOA 1XYBA 4AZ7A 1E6PA 5I3JA 4E3TA 1FHLA 1MUWA 3STPA 1XLCA 3Q58A 4IIDA 3WQEA 3RF9A 9XIMA 4E2DA 3F4CA 1TZZA 2VWSA 2BOFX 1TE6A 2DP3A 4U4MA 3WD1A 1B3OA 1R5YA 2OEJA 4HA0A 1RHCA 1DKWA 3DFNA 4GIRA 3G3MA 3RLHA 3W00A 4LNCA 3APTA 2A85A 4F0KA 1U1HA 4S3JA 3E0IA 1MSSA 4D6FA 1ICPA 1Q6OA 4JTQA 1GQKA 1Y65A 3CHFA 2GJXA 2C8NA 3WJWA 4AU0A 1H63A 1XSIA 1F8MA 3T42A 3C0SA 4CU8A 1QI4A 2W27A 2GPTA 2POTA 3R0KA 3BJTA 6ALDA 4A3RA 2Z2UA 3VC5A 3HBLA 1N2VA 1EDTA 4E8DA 2QDEA 4D8ZA 5AHNA 2E40A 2JGYA 3UG4A 2A3CA 1O5XA 2B7OA 1A80A 2DT0A 3O0KA 2ASHA 4AHOA 2REQA 4UQBA 1MMFA 1SW7A 2CLFA 2BGQA 2J24A 2JF6A 1B54A 4M1RA 5CBJA 3MDWA 1E4NA 5DN1A 3HGRA 1F4AA 2GFTA 5CGTA 2JIEA 2EKGA 1G4PA 3PPFA 1XH2A 3M16A 4HNNA 1EXPA 5ABEA 2JFEX 1LG2A 1A3XA 1IEVA 5EMYA 2QJGA 3RILA 4GUIA 3UVIA 1P48A 3VINA 1DXIA 4D1JA 4E6MA 1HJXA 4DYJA 4ALDA 4XAZA 3N18A 1LQ0A 1ICSA 3T81A 1UZHA 4LEQA 1M7PA 2CLEA 3WEOA 3SQLA 2GDQA 1HJQA 3HG4A 4DF2A 3V7PA 1UP3A 2WQPA 1S1PA 4Q4MA 2EKCA 2PODA 3C2VA 1P0NA 3LYEA 2EGZA 4FO4A 3HMJG 4R34A 5IFPA 4MKSA 3IUDA 1OD8A 3UZYA 1H7RA 3UR8A 3VCCA 3T78A 1Q5MA 2RDXA 2EBNA 4ZB2A 1UR8A 4LX4A 3NYDA 2RDUA 4KEZA 3T0DA 3NQFA 1XKYA 3VKAA 2WZEA 4C6PA 3NJ3A 4RE4A 2MANA 3LPOA 1RV8A 2GJPA 2P5NA 2QJIA 3B9AA 4XVEA 3LNMA 1SO5A 2GGGA 3QW4B 3SY1A 1Q6DA 2B7PA 2O9PA 3WUBA 1RP9A 3IGSA 2VXNA 2AL2B 4AISA 3G0UA 2CW6A 2XU2A 4AZIA 2W67A 4ENLA 2X0YA 4Z2IA 4LQ1A 1ELSA 2XSBA 1TCMA 2YDQA 3I6TA 1IT7A 1PIFA 3B9EA 4QLJA 3LOTA 1K03A 3GUGA 2ZXAA 1W1TA 3UGVA 1UIPA 1I6NA 4ZOBA 5CEWA 3VIHA 2J8GA 5GVJA 2D0FA 4IPJA 1SZGA 3VNYA 1JZ8A 3M64A 5A8PA 4GH3A 4C7GA 2X41A 1WQ5A 3KM8A 4RE0A 5EMMA 3S8HA 2OEMA 4LU0A 1QWGA 5E09A 3A47A 1Q66A 3NQMA 4IGMA 3I65A 3PZNA 1K7FA 5HMEA 3RO6A 2Q09A 1RQHA 3KOZA 2VWTA 5A69A 1MDRA 2YYTA 4V1XA 1R0MA 1UZ4A 1GGOA 2A3BA 3G18A 1YADA 1E3ZA 2RDWA 1GYLA 3UCCA 3N6JA