4XSMA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xsmA00
2GLKA 3XIMA 1XIMA 3C0QA 4X60A 3U3HA 3CWHA 2OU4A 3AYTA 4QEEA 5AVHA 3KWSA 4J4KA 4LNCA 3CQJA 3OBEA 1XLBA 4PFHA 3VNMA 2GUBA 5EMJA 1K77A 1XIJA 3KTCA 4EACA 4XKMA 3UA4A 3ITVA 3BDKA 1YX1A 3ITYA 2GYIA 3M0MA 3UXIA 4ZBCA 1XYLA 3IUHA 1BXBA 2J6VA 4KW2A 6XIMA 3AYVA 6XIAA 4Q7IA 3C0LA 1A0CA 1DIEA 3M0VA 3N4AA 3UU0A 4GLEA 4US6A 3TC3A 3ITLA 5I7GA 1XIDA 3KCOA 5EMMA 5J8LA 4DVOA 1I6NA 3CQHA 4W4QA 4GQBA 1I60A 4EAYA 1XLKA 3VNKA 2X7VA 3VYLA 1XLEA 5C9ZA 3KBWA 2I57A 3CNYA 4QEHA 3BZJA 2XISA 3ITTA 3QC0A 3QXBA 2NQHA 3KBMA 4GJIA 1XYCA 1QUMA 4DUOA 3KBSA 5AVNA 1XINA 1A0DA 1XICA 1XLCA 2QUNA 4ZB0A 1DIDA 4XISA 5H1WA 4QE4A 4QDPA 2ZDSA 2X7WA 3M0HA 5TNVA 4A8IA 3U0HA 3KBNA 4E3VA 1XYMA 2Q02A 2QW5A 3M0LA 1XIHA 3P6LA 2NQ9A 1XISA 3QZAA 1XLAA 4HHMA 4HNOA 3P14A 1XLFA 3DX5A 4YTQA 5H6HA 4QE5A 4ZB2A 1CLKA 1XIEA 3ITOA 9XIAA 4OVXA 3AAMA 1XIBA 3VNJA 3XINA 1XIFA 4ZB5A 4QDWA 8XIAA 1QTWA 4YTUA 2QUMA 2I56A 4X63A 7XIMA 5B80A 3JU2A 1O1HA 1DE6A 4XSMA 3LMZA 4XIAA 1BXCA 2XIMA 3KCLA 4YTSA 3VNLA 4A8NA 3C0SA 3UA3A 4G56A 4PGLA 4HHLA 4X61A 3TVAA 3IUDA 2GVEA 3CQKA 3M0YA 5XIAA 4QE1A 2ZVRA 3KBJA 4K3ZA 1XLHA 5XIMA 1XLGA 3BZGA 1XYBA 4GJJA 3L23A 3KCJA 3AALA 3VNIA 4A8LA 1QT1A 8XIMA 5B7YA 3CQIA 5EMLA 4XSLA 1DE5A 3KBVA 4XIMA 3BANA 1MUWA 4YTRA 1XIIA 5B7ZA 1XLMA 1XYAA 1GW9A 5XINA 1XLDA 2G0WA 3NGFA 3UVAA 4YTTA 2NQJA 3M0XA 5FA5A 1MNZA 3WQOA 4A8RA 2HK0A 1OADA 3QYSA 9XIMA 3IUIA 1XLIA 1D8WA 2XINA 4K1GA 4HGXA 1S5NA 3ITXA 2HK1A 2HCVA 1XLLA 3FVMA 1TZ9A 1XIGA 3GNXA 2G4JA 5EMKA 1XLJA 3XISA 1DXIA 1S5MA 1A0EA 2QULA 3DBNA 1XP3A 3BWWA
chains in the Genus database with same CATH superfamily
4RV3A 3E2RA 4HOWA 4HU0A 1DJXA 4GA8A 3LA4A 3WUGA 4JBRA 4QX4A 3T1GA 3N13A 3TR2A 2D2OA 3S6TA 3HU7A 1VBUA 1EEXA 4AX6A 3HFYA 1JPHA 4M29A 4YNGA 1C8VA 2B7OA 1LL4A 4LVDA 2NT0A 3GDKA 3LDVA 2WANA 4I7WA 1PTAA 3LV5A 2XH4A 4PMOA 4V1XA 1V3KA 2VC7A 3CK5A 1RR2A 2HBVA 5BZAA 4K7YA 2HS8A 4N9EA 4W85A 1DIKA 4ADSA 3TTQA 3ITOA 5LA0A 1DIOA 3CIWA 1KTNA 3DGBA 2QVHA 1VEPA 1J8VA 1TV7A 4NAFB 2GDUA 2NSOA 1GGOA 4Q4RA 1NH6A 3TN4A 1VYPX 2YL9A 4J3TA 1FWCC 3AISA 3RX2A 4UNLA 2XZ7A 3RMJA 3I3EA 2OLHA 1QI3A 1NF0A 2XGIA 5HPOA 2OKOA 3I68A 4Y9OA 4ZTYA 2VENA 2QDEA 3W0KA 1YW1A 2PDHA 4KCWA 1NWRA 1YRRA 2OLSA 2GWGA 1ISWA 2QJMA 2TYSA 5E70A 3TTOA 4AD5A 4O17A 1DWHM 4XAFA 3GTHA 1G1YA 3R0DA 4RPQA 4MWAD 4BI7A 1S39A 3E1F1 4ZENA 1LF1A 3B8WA 2YDAA 3C52A 4Q4OA 3WEMA 4RNJA 2J78A 1VBHA 6XIMA 2A4AA 4LYKA 3L4XA 2WXDM 1NU5A 4GXMA 1OCBA 2FVMA 3S42A 2G8ZA 1OFDA 5EGRA 2XSBA 1ICPA 3CO8A 4RW5A 1A5NC 4DUOA 4DYJA 4LBUA 2GJNA 2Z7KA 4LANA 1KM3A 3L0NA 1T0OA 2W4XA 1J79A 3SADA 4C6KA 4P2VA 4GYJA 3M7WA 1TV8A 2OQHA 4KWUA 3ZJ7A 3ZMRA 3MUCA 2EG6A 3W7NA 2R1KA 3EOLA 5A8OA 1EJXC 3WD2A 2GGJA 1KD0A 1W3HA 4UTUA 4NJKA 1Y5WA 4M19A 1O5QA 2DVXA 2A3EA 2MUCA 3DBPA 3B04A 5CGQA 4MB4A 4RNHA 4UCGA 2ABAA 1DJZA 3LXBA 4UBPC 1LLZA 3AMLA 4LYPA 5FA5A 4GHRA 3GU1A 1OT2A 2Z0IA 1CCWB 2DT2A 1FHUA 3UWQA 1MRQA 4NJHA 1K9EA 2JKPA 4A3YA 4GVIA 4UFMA 3GC5A 4XV0A 4AD2A 2BY1A 5AC6A 3GZAA 2V2CA 4NXKA 4S3DA 1P6WA 2BY3A 4Y8FA 2XHYA 3PB0A 3ZLGA 4IIFA 4ACZA 1IXQA 3LD5A 3NQAA 2BODX 3MCOA 4JYEA 1AJZA 1UKPA 3SIZA 3TZNA 4LRTA 3W74A 2J47A 3KEHA 3WLKX 4NL1A 1QBBA 1HO4A 2PWDA 4LGXA 1HKWA 4QE4A 1Y7VA 4Y9MA 4PYSA 2HE8A 3G3DA 2UV8G 2Q01A 4IJRA 1AK5A 2XH0A 1LT8A 1OIFA 2XG9A 3SQLA 1BFNA 4QLLA 3E0VA 5CBJA 3KCLA 3DHPA 1E0TA 4PRWA 1T99A 5CZKA 1BRLA 4L9ZA 3A3HA 3FGCA 4LS1A 5A6AA 4KKXA 4Q6XA 2YBTA 1E51A 5GJMA 3LPOA 4M6PA 1L9WA 5HDRA 3ARVA 4ZO7A 1R87A 1W1IE 1TWWA 3RMEA 4HP5A 4XQ6A 1XLDA 3VGBA 1UUOA 5GVJA 4DYKA 4AWUA 1IQ8A 1X98A 3WFAA 1CZ1A 3KLLA 4UQCA 3HV9A 1E6ZA 3TLQA 3WLMA 2D2HA 2YYUA 2A6LA 1XV8A 7ENLA 1GKRA 4CQDA 1TQXA 5PTDA 1TZ7A 1JF6A 1DXIA 3DBNA 3ZJ8A 1KA9F 1RD6A 4EWJA 3KL5A 3WDIA 2WJEA 4MWAE 1J11A 4O0ZA 2UBPC 1UPPA 3IAQA 3WJXA 1DHPA 4I5XA 2WPBA 3AHXA 3F4NA 4AZCA 5KZMA 3FA5A 3EBVA 2C16A 3MUY1 3SUUA 4DJEA 1LORA 4KWOA 3LRMA 1K9FA 1VGAA 4F0SA 3BZJA 4UTWA 3ANUA 3QPEA 5D9OA 1Z9AA 4ZO6A 1AH3A 2WO5A 2XJ7A 3TOPA 1EHNA 5HK4A 4O1AA 1BGAA 4UMAA 3EWYA 4I90A 4D6FA 3GKFA 3SCQA 2VWTA 2QUMA 1AW2A 4GWEA 3N2XA 4NKCA 4AH7A 1L6GA 4AZGA 3QRHA 1FHDA 2C0HA 3AHVA 3F5LA 3OB8A 4CNNA 4WIWA 1VFFA 4DHGA 4IFKB 2QJJA 3OGRA 3PJXA 5G4WA 1I0BA 4N9DA 3HF3A 2WNNA 1XC6A 1FKXA 3LS9A 2CKRA 4H4IA 3GNOA 3QV7A 3GO2A 1VC4A 2J6XA 1J0IA 4KCVA 2YB4A 5MF5A 1J4EA 3PBWA 4IMAA 2DQWA 4GG9A 3W6YA 1XC4A 1ZAJA 1JUEA 2BSLA 3TAOA 1M65A 3VDAA 2GVGA 2XH7A 4NNBA 3EWWA 2E6DA 2V3GA 4GBUA 3HFTA 4DF1A 1W9VA 1S2VA 1IXPA 3BJTA 2CW6A 1ICSA 4S3BA 5I3DA 3WH5A 4QEHA 3WK3A 2VR5A 3CT2A 1SU5A 2VFEA 3KOFA 3RLUA 5A8MA 3G1RA 4CNSA 1DIDA 3LX9A 1FTXA 1TE6A 1E4NA 1UR1A 4REQB 1ME7A 1AJ0A 1XBYA 3NPWA 3AAMA 4DWSA 1HJQA 4IGMA 5B80A 2GVYA 2CBUA 1E0XA 4ACZB 2F38A 4TOQA 3GTNA 3QH2A 5T26A 4C1KA 1E1FA 3MVIA 5C6MA 3NUKA 1TPFA 4B5SA 1W2PA 5FACA 1O6IA 2F7FA 3T78A 3UGRA 2WMIA 4XIMA 2W27A 2HVOA 4WK9A 1EL3A 3CV2A 2Y61A 3N25A 2QKFA 2WLYA 4HCHA 2WVSA 3A4JA 4AYGA 4K39A 3P2VA 2VX7A 4O18A 3KDNA 3LCGA 3T9PA 3CM4A 3ITXA 4O1EA 3TYAA 3V18A 3QMRA 1GQNA 4ZGYA 2HWGA 3BE7A 1E3ZA 4P5UA 3UQNA 1TRIA 1MO0A 4XBSA 3KWSA 3CV6A 4J2PA 4IMDA 1A5OC 1KCLA 4I3GA 4XZHA 4LS0A 2XVKA 4RCXA 2CETA 3AUJA 3VKBA 3M0MA 1Q13A 4BQ2A 4GX9A 2REQB 4NZ1A 1B3ZA 1DQUA 3TW9A 1NWSA 3VA8A 4DBDA 5LIKX 3IGXA 1VEMA 3T0DA 4J27A 3DZ1A 3O1NA 5CBIA 2PBGA 4W7VA 1OCQA 4UOJA 3G1YA 1LJYA 3ELFA 1GVQA 1MEIA 1QK2A 2IPWA 4ZSTA 4DZ5A 3RGTA 3T40A 1FDZA 5HQMA 2VJXA 2VZVA 2J24A 2Y8UA 1EO5A 4LFYA 1XHGA 4G2DA 1XBZA 3ARYA 1IZCA 4CU6A 1AA1B 4EX4A 3WQDA 4HHLA 4GACA 4JCLA 1JZ4A 3I3BA 1W3NA 4AUBA 3CH9A 3W87A 3MUXA 4UTJA 4PH6A 1CXKA 3FHAA 3VOGA 3TA9A 5U4NA 3UJSA 4GQGA 1KNWA 1WA3A 4IM4A 3U5YA 2DSZA 1CGTA 4BF7A 5TAOA 4O19A 1EB3A 6REQA 1GOXA 1MYRA 4OWGA 3EDFA 1T7LA 1R3YA 2BHZA 4CN1A 4FHAA 4N6EA 3OVPA 5EU9A 2PDKA 3U8GA 1E0WA 2D0FA 4Q6JA 3SCOA 3ABZA 2DT1A 4JQ4A 2GWNA 1G7VA 1GOQA 1I4NA 3KVMA 3M0VA 3UXDA 2HVMA 1F2JA 2GDQA 4NXSA 1L2UA 3QFEA 3GHRA 1JPMA 2E9MA 3RO6A 1OHLA 1BVNP 3GNNA 1YQ2A 1PXGA 2O7SA 4GBDA 3R89A 1B5TA 1CIUA 4Z1DA 2F6KA 5LSMA 2W91A 4ZMGA 2ISDA 1ODZA 4C6QA 1ZJIA 2O9OA 1W37A 1XIBA 1KFCA 1DJHA 2VDGA 1EUAA 1FWGC 3NDOA 2IXVA 2D2JA 4CU7A 3CLWA 1MMFA 4ORIA 3UJFA 1BYBA 4HOZA 3M44A 3ENLA 1H5VA 3N6HA 1X6UA 4LUSA 3I6TA 4O11A 3EB3A 1C29A 4IIGA 4I8YA 5I0DA 3M0XA 3GZ3A 5CXPA 2Q09A 4LT9A 5A8QA 1WP6A 1VFHA 4ATWA 4B92A 3WG6A 4NYUA 4BWLA 2R9RA 2YSWA 4QHRA 5CZSA 2GUYA 1UZ4A 5HUPA 1V8EA 3NXFA 4DPPA 2Q8LA 1LTDA 2QPSA 4E5TA 1YYAA 3CUXA 3FKRA 3I7SA 5C0QA 3PN8A 1VYRA 3UWZA 4OHQA 1EPXA 3LOTA 1LRQA 1CDGA 1MW1A 2F6XA 4AIBA 4PC8A 3HPZA 4QG6A 2RFGA 3PPHA 4LV4A 1XFBA 5GNZA 1W3LA 3F5KA 4XTDA 1F4HA 1GOMA 5D9PA 3OA3A 3S2CA 2PLMA 4N4PA 4A2RA 4G7EB 4F2TA 1U5JA 4H8UA 1ADSA 4AFYA 2W5FA 3VOIA 3RCMA 2KX9A 4DEFA 3KL3A 4FR1A 4OGZA 4R27A 1J6PA 3TQPA 1ZJAA 3BV4A 1QPQA 2YPIA 4E2VA 4MY9A 4UMCA 2FPTA 3FY1A 1LLWA 1OFRA 4JQ3A 3S83A 1V6WA 5LKYA 1IEIA 1VPYA 4UQAA 1K3UA 3L67A 1LLOA 3UCQA 3E6EA 5K9XA 4MY8A 3QHNA 1KTCA 5A3HA 1OGBA 4C60A 2PURA 4AIOA 3NQ8A 1ZS2A 3TWAA 1GTEA 5I02A 1KCKA 2BBFA 4JL1A 4D72A 3HQ1A 1TYGA 4CVWA 4EXBA 4HK6A 3A24A 3E0IA 1PE1A 3UY8A 4LUYA 1TTJA 2HNHA 4Q22A 1UASA 1BGGA 3NFUA 1OC7A 1HZYA 2GJXB 3WLTA 4S2CA 3OQEA 3HG3A 1FQ0A 2DT0A 3AIWA 4KFNA 1FWAC 1B54A 3UFYA 4GCAA 5HXMA 2DGAA 2YYTA 1NJJA 4DXVA 1BHGA 3OBEA 2CBVA 4DO6A 4DI8A 3CASA 2VDIA 2HBXA 3LZ3A 1C9WA 4ZOBA 3ARQA 2GVJA 1P7TB 4Q33A 1SYTA 1F6PA 4ORMA 4GZIA 2J27A 4JYFA 2ZZ2A 4GJIA 1TPWA 4UZSA 4IQJA 2GQAA 5HULA 2I9UA 1REQA 3GU2A 3EX6A 3VUPA 1J0HA 2F9RA 2E8YA 2Y1HA 3S9ZA 2V82A 1I75A 2L5HA 4IUOA 1HVXA 1H7WA 3LCHA 2RDTA 3SFKA 3WQPA 3QHMA 1YEYA 1EP3A 3LCLA 3PWAA 4OUEA 2PGFA 1DTNA 3THUA 1WE5A 1YKWA 3W24A 4GUFA 5GQBA 4R7JA 5GJPA 5KZEA 1JCXA 1PUDA 4JNYA 4HYVA 1W5MA 1UC4A 5H8PA 3GYCA 3EA3A 1IXOA 4NRSA 4DX3A 1E3XA 2DQXA 2WVVA 4HZ6A 3DFSA 3S2JA 3LHUA 3NR0A 3GTXA 2WC7A 1HKKA 3VKKA 3HV8A 1ZAHA 2UZ9A 3CUGA 3QPZA 5LIYX 1X8CA 2DH2A 1VJSA 3SEPA 1GT8A 4HA0A 3HN3A 2QCDB 2YDSA 3LLXA 3M5ZA 5LXXA 2D20A 1ZHAA 2DZXA 2EGZA 3DG6A 5CPSA 4JEJA 3W1MA 3QHOA 1FWFC 3UYCA 3MKKA 3OYZA 1WDWA 2BDQA 2J9YA 4J40A 1G0CA 3DC8A 3H7RA 4AZ5A 3RG6A 3BSMA 1OJXA 5F1UA 3UWYA 2ZTKA 3DI1A 4UTTC 3IRDA 4O4VA 1GOOA 2TMDA 3BLDA 3MMTA 3O6CA 2DUXA 4O1FA 2D3LA 4TX6A 3RPTA 3WLJA 3CPUA 4GVFA 3CGTA 1UROA 3MSRA 2KZHA 3AJ7A 3HG2A 4IJBA 3WNOA 2GK1A 4WSKA 5A6MA 3NGJA 4Q8TA 4D1JA 4P7RA 3KX6A 3PWGA 1B3XA 2PWUA 2X30A 4XZNX 3MWCA 1EXPA 1RAKA 3CO4A 1OT1A 4Q4KA 2UY4A 2VVSA 3WNPA 4KQNA 3OU8A 1QRQA 2ZUVA 4H9XA 1EA9C 1FP8A 1XBXA 2QCFA 4E8CA 2O56A 1NFBA 3OHIA 4J3VA 1Q4WA 4PTMA 3W6MA 1NP2A 4PMQA 1E0VA 5CPLA 3MVTA 1VQTA 4IFKA 1LL7A 4OV9A 1OQFA 2B31A 1CTNA 1W56A 2WSRA 4YHEA 3WDQA 3ZSTA 1EJSC 1QDSA 1TZ9A 1RCQA 4EIVA 1P0BA 1XP3A 1MXSA 3BWWA 1HVQA 2JIEA 1NFPA 1IT0A 4AVFA 1PTGA 3FYYA 1B90A 1PZ0A 1J0JA 1RBOB 1POJA 2PC4A 3H7VA 3REQB 3CAKA 1MDLA 1H51A 2QXWA 5IBXC 4F0RA 4FNTA 4UFIA 4F2UA 4UOQA 4O1CA 4AD3A 3PHAA 2INFA 3GXFA 1PIFA 1PKYA 1J0KA 3UETA 1BQCA 2QCHA 2Y2WA 3CTTA 4G7FA 3TJLA 2FMNA 3VVGA 3PJUA 5FOOA 3WDPP 2RKXA 2PE4A 2WVUA 1Q6CA 5U7SA 1PHWA 1CGVA 4R34A 4PTVA 1ITUA 2WMIB 1H1NA 3QQ0A 3FX4A 4M1BA 1G4PA 3ECQA 1X97A 4ILSA 3BAIA 1REQB 5HMSA 4BF5A 2Z1WA 3CHDA 2CLFA 4QE1A 3T2PA 4UXDA 4K6AA 1WOAA 5CKSA 5CPMA 3VFLA 1UD3A 3S1XA 4HSHA 3GR7A 4MTVA 4ACYA 3HJEA 2FQIA 1K8YA 3QTGA 1WAWA 1I8JA 1BWVA 1PB0A 3VDGA 1XKJA 1XJBA 1DQXA 1H0IA 3VI2A 2CHNA 4C6MA 4GUIA 5ABEA 1UD4A 1V0KA 3VKJA 2ZRVA 3C0JA 4Q4SA 1XX1A 4AZ6A 2V5JA 1F3XA 2OEKA 4K8HA 5TIMA 3DFNA 4H6RA 4MUPA 4GXPA 1OCNA 3IJDA 4B5XA 2IW0A 1J0YA 3W27A 4L1WA 3GK0A 3FJ6A 3TX9A 1V03A 1I60A 1UR2A 2DZTA 3VYLA 1P6CA 5I3FA 1YE4A 1VFMA 4IIHA 4GGBA 3VD4A 1HO1A 1BWLA 4YXGA 5DMYA 3GRIA 4UUIA 3QZEA 5FEZA 3FDGA 4A21A 3LN3A 1E6PA 1G01A 1YPFA 4DLFA 4XSMA 3T6CA 1CT5A 1ZCCA 4KGLA 4HMDA 5CJNA 1KBLA 1TPC1 1YXCA 2XFRA 4RDZA 5EPDA 5FF4A 3VNIA 2E9LA 1ZP4A 1C8XA 4JTUA 4TVCA 1E5NA 2YCKX 4IFRA 5B7ZA 3MMUA 4RR4A 1O1ZA 2XFWA 3AS3A 2IQDA 3ZR4A 2VZUA 1DL3A 3H53A 4S3AA 1RQBA 1ZUAX 3DCPA 2EPHA 6A3HA 4B3LA 1VFSA 4FK9A 2VEMA 4CNPA 2VQTA 2XUCA 3LQLA 1SZFA 1V51A 3GXNA 3NWRA 2BX7A 2J9ZA 4FNSA 2VC9A 4ZTXA 1K77A 4PMXA 5ABTA 2J6VA 1UWIA 4Z17A 5FJIA 3M7SA 5DXXA 3B9AA 1KLYA 3K30A 4G1KA 1WKFA 2XSXA 2ZTJA 4FOUA 3BQ5A 2C14A 4GI4A 4GKTA 4LCRA 4C6OA 4NJIA 3ANYA 4C6EA 1US3A 3O0KA 4GCXA 3QBUA 2ZUSA 1ECQA 2PD9A 3LERA 4I7UA 2PAJA 2YXGA 1WO2A 3M9YA 4UTLA 5EB8A 3HTWA 2J25A 3VINA 3NZPA 3EOSA 1KXTA 3O07A 4AW7A 4Y7EA 4UNIA 3WJZA 3UG8A 1GVIA 3T8LA 3LSBA 5D30A 2X2GA 3QV8A 1THFD 3U57A 4NZ4A 3TYCA 3UCDA 1AMKA 3GH4A 2V69A 2Z2AA 2E1DA 3OZMA 2GJPA 1EO7A 2E3ZA 4ML4A 1UC5A 1H0GA 3F2BA 1PO9A 2PDPA 3LPFA 4DQWA 2PA6A 3VNDA 3EXTA 3TN6A 1TTIA 3R43A 3M0IA 1UZDA 4BWLC 3OW1A 2D69A 2INEA 3DECA 1MRAA 3NQEA 5G4EA 1TVNA 4HK7A 2VFDA 1AFSA 4O8RA 3QFWA 5FI8A 5IRPA 2PP3A 1E4LA 4U5KA 4HA1A 4KBXA 1QXLA 1O12A 2C71A 2YL5A 2A79A 4IP4A 3VNKA 4TU1A 1XRSA 3O2LA 3QVQA 4IQLA 3IIZA 3L68A 1VFLA 3I3DA 3PUEA 4PB5A 3DI0A 1TV4A 5HJLA 1GG0A 3UERA 1IV8A 1P0EA 1DWGM 9RUBA 4C5ZA 1EGZA 1HN1A 2OX4A 2ZRXA 1BXCA 2NV9A 3W1AA 5J5DA 1JZ8A 1XW8A 1PPIA 1L6SA 3W75A 2YFOA 5K9DA 2CLPA 4LCSA 3H8AA 4QAIA 3OOQA 1Y8BA 4TR9A 3SRHA 4UTHA 4S39A 3PBUA 1EF2A 1WDRA 4NF7A 4DBEA 3FSTA 3MMWA 4IG2A 1P0DA 1WCGA 1KFEA 4Z1CA 5G4HC 9XIMA 3BAYA 3IGUA 3ZR6A 3TE9A 4EK7A 2VFFA 2FGBA 4QCEA 1JAEA 4YHGA 1MDRA 1NIUA 3BLFA 2WVVB 2WBKA 1H3GA 4MZ8A 1NEYA 3MJYA 4S2BA 3UA4A 1PHQA 3TMQA 3ITVA 4PCSA 3LHVA 4U2ZA 3ZO9A 4B91A 5FF2A 3SIMA 3E49A 2E6AA 1K03A 1Q7ZA 2EXOA 2IQTA 4O54A 3CNYA 3LXCA 4QNWA 2CLKA 4WRHA 4F0LA 5M2FX 4K37A 4LYRA 4XX6A 2Q02A 3VZYA 1EQCA 4AEEA 4TVUA 3GNDA 4FO4A 2HMCA 3JW7A 4PULA 1TA3A 2X41A 3BW3A 3RXZA 3LCFA 3KRSA 4MADA 1JDDA 1KQYA 3LCIA 2XWDA 4WKAA 3KS5A 4E4FA 4LF2A 3K4WA 3FV9A 3P67A 4FNRA 1XIIA 1WNOA 1XLMA 1RLCL 4HU4A 1QPKA 1EOMA 5AN7A 1GUVA 3NPXA 4GFIA 1K8CA 1SGJA 5AHEA 4AD1A 1DJIA 3MV11 3R5EA 4B2DA 3SN4A 4W86A 1PKNA 2PDMA 3MA8A 3MCMA 4NAFA 2HXUA 4HMEA 1AMYA 5CC7A 4LAMA 1VS1A 1R38A 1SJDA 4D2JA 4C5YA 4LCQA 2GOKA 3NQCA 3KTSA 3DESA 3B97A 1R2RA 2BMBA 2FPYA 2BVDA 4HNVA 4MM1A 3GNPA 1CXEA 3QLDA 1XIDA 3TH6A 1HKIA 4KIRA 1ME8A 3H4GA 1T96A 2VTFA 3NQ6A 4AIEA 4U3AA 2Y8KA 3EWXA 3SDOA 3MP3A 2GQ9A 3QLLA 5C5YA 4DBUA 3KBSA 3SQSA 4KFPA 2JFEX 3SECA 3NM3A 2CBJA 1AQ0A 1JVNA 3NQ7A 4WDXA 2JQXA 5CLTA 1MQQA 3VGHA 3GXMA 3W25A 3L4VA 3BCFA 1QHZA 3AXMA 3C0SA 1NDZA 1JCLA 5FKYA 1H5YA 3SZ8A 3GXIA 1UH4A 1UUQA 2A21A 2WQPA 4QLKA 4TVDA 1J0ZA 2GZXA 5G1YA 3L4UA 3I7RA 4JN8A 1F7BA 4J28A 3PFMA 1LWJA 1S5TA 4URIA 3W88A 1R7OA 2YLAA 3R4IA 1XCWA 4S3CA 3UPWA 5AECA 1JZ7A 1TKKA 4XO6A 4G7EA 3B0XA 1YADA 4FLSA 2I5IA 3R8GA 4NZCA 1UJQA 3R13A 2XWEA 3SCPA 3H4WA 1C3FA 1JL8A 1L6WA 1XIJA 1OVDA 5IOBA 1IZKA 3MCNA 1ZRQA 3O63A 5BRBA 2J7CA 6CGTA 2O92A 4YVPA 4IMFA 1YMYA 3R11A 5DXYA 1YDOA 2WJDA 5F1VA 4JX4A 3WIJA 1BG9A 2WOQA 1B30A 2WM1A 2X1UA 4B4FA 4EWND 1XYMA 1XIHA 1OFEA 1D3HA 1Z7AA 5I03A 1YBQB 1DWAM 2O4MA 1NP0A 2X05A 3APTA 1QTWA 3CHVA 3M46A 1SO3A 3CL8A 3CU2A 4DJFA 3I6RA 4J3SA 4QQ3A 2OO6A 3VKAA 2OXNA 3AHYA 4ZQCA 2E77A 1LOSA 5HQLA 3I7QA 3GDMA 2QZRA 1HKMA 3OHMB 3OG3A 4JYDA 2OJPA 1QOXA 3B8DA 5AKQA 1UD8A 3EKLA 3R79A 2XGBA 1YDNA 3WNKA 3MU7A 4XAZA 2Z25A 4RXFA 4K1GA 5A2AA 2A2IA 3WF0A 4F4RA 3WQWA 1ICQA 1M6JA 5CPTA 4P61A 5JH2A 1S38A 4C6DA 2YJQA 4PCFA 3CL6A 4O12A 4C1NA 1FH9A 2QR6A 1ISVA 3ID7A 3GH5A 2WMGA 1AD1A 4US6A 3TROA 4FMVA 3B9OA 4X0VA 3N12A 1QNQA 1WKYA 1TR9A 1W1VA 2YCLA 2OGJA 1QW8A 4FZIA 1XICA 2VRQA 2XU2A 1XLCA 3UYIA 4F3HA 1D3CA 1JCJA 3RR1A 4WJEA 1XCXA 3N2MA 3H2CA 5I3JA 3USBA 1W3TA 4WSHA 1V4YA 1TUXA 4CVUA 5A6BD 3BICA 3R12A 3PJTA 5FAJA 1Q6QA 2R82A 4OU1A 1OWQA 2ZA1A 2J7GA 4JTIA 1NWUA 1OFPA 1GZJA 3GWQA 1QNRA 4DWSB 2Z2BA 3C4UA 2E67A 1DWJM 3PZNA 2NQZA 5E93A 5HPCA 2O0TA 1FX6A 1YNYA 2HISA 2R1LA 2EPKX 4WGXA 1LBMA 3Q45A 5FF0A 1FHLA 1YTKA 4WXZA 3I65A 3M0KA 4PMNA 3BK0A 2WPGA 4AHQA 4GQ0A 1WKDA 1JAKA 3QOKA 3D47A 3RM4A 3U5UA 1A47A 3POCA 2UY5A 2ZZ6A 4LY4A 2FIQA 1QMLA 2Q8XA 4TX8A 1FXPA 4AYSA 1UWRA 4S1FA 1BKSA 2QV4A 4JHOA 3EWZA 7REQB 1S5VA 3OZPA 3T8QA 3UY7A 3WJWA 4DJEC 4UTMA 5EY5A 1MVYA 1EUNA 3CZJA 4AEFA 3W7IA 2YXXA 3DXIA 1FWWA 1SO4A 2ZRYA 1NARA 5CG0A 3AWOA 3W2JA 2C18A 2X0HA 4M3PA 2BGNE 4YTSA 1QASA 3PK7A 4MFDA 2OEMA 4EPKA 1AZ1A 2V3FA 2V5CA 1VJZA 1OINA 3H70A 3FIGA 3AXXA 1BF2A 3TR9A 6TIMA 1X8FA 2C19A 1EZWA 3PAOA 4W8BA 3R7MA 3AQUA 1XGDA 3P60A 1OADA 1YBQA 1FA2A 2NXIA 2RH9A 3ATZA 2WKGA 2O9RA 3Q4DA 1K70A 2BXYA 4PCPA 1E9YB 2VNCA 1JI1A 1W8SA 4GVHA 1U5HA 6TAAA 1GWJA 4AF0B 3ITYA 3UJEA 5T8GA 2CNCA 1NWTA 4MB3A 1P43A 2QUUA 2Z4GA 5FJTA 3W2UA 3NSXA 4WUIA 3ATYA 2CLMA 2BGSA 2FZ8A 3WF2A 2I57A 4BQ4A 3W7CA 2X0SA 1XH1A 2VDHA 3DFOA 1P5BA 3W71A 2Y62A 3GVGA 5D32A 1ML1A 2IUZA 2NQ9A 2C3ZA 1V6TA 3VZXA 3WLRA 2G97A 4PL2A 4E6MA 1ZB5A 1HT6A 5L9FA 3L9CA 5FEXA 2X09A 2OZ8A 5D2YA 2ZWZA 4UMBA 2BB0A 5FCZA 4LF1A 1XRVA 1JXKA 1AH0A 4R33A 4IQEA 2OPJA 1UQYA 4G56A 1GOKA 5K7JA 5DBTA 1QPNA 4DM1A 4IPIA 3NQVA 1DQWA 5LNVA 5G2WA 1XPGA 2G50A 3WH9A 2E40A 2C0AA 3PZOA 3VIIA 1WBJA 3EMZA 4O53A 4FF7A 4YTRA 1UYQA 2WSYA 2E6FA 3HGJA 2YGYA 1DEDA 3G2GA 3VC5A 5TF0A 4KWWA 4WOZA 2HV5A 1BRLB 4AVNA 3T7VA 3RR4A 4PSPA 4BA0A 2GJRA 3CZLA 3RFAA 3C0QA 4Z1YA 2Z2UA 4MNJA 4GVGA 1T5AA 3ALGA 1RBLA 3B3DA 3LI1A 4JN7A 4HA4A 3R25A 2NZLA 3WH6A 1E9LA 2WHKA 1WUFA 4P7LA 3UG4A 3W1QA 1B2YA 3NM1A 1H7NA 1KKOA 1P6BA 4QCFA 2V2HA 2AMXA 1P4CA 1PS9A 4HMCA 2PDYA 4EPBC 2FVLA 3CBWA 1OGGA 1AODA 4GH1A 4NSBA 2NVDA 4BJHA 3M0LA 2B7QA 4JFVA 4Q4PA 4JFWA 3M6DA 4H6KA 4QDWA 2VD8A 1IEQA 5JMUA 3B0YA 1NQKA 1IR2A 4JPGA 5A6LA 4NX0A 5JH1A 3KBJA 2UY2A 5AHLA 2HNEA 3STGA 3O6AA 2XH2A 1KRMA 1K8ZA 3OLIA 1N82A 4IICA 3CIXA 3IPWA 4OFCA 5T9CE 3RLHA 3GG8A 4XVEA 3NOEA 3QF0A 5M17A 2VC6A 3WQOA 2XVGA 3ZM8A 2QF8A 4UFLA 5FD0A 2W62A 3THAA 1D8WA 2HTMA 5D2VA 3LRKA 2JKAA 3VMOA 1VH7A 5BNKA 2NVAA 2D24A 1BG4A 3LGEA 1W5NA 4N9CA 2GDVA 4XBKA 5DBUA 1OFBA 3RO8A 2H8XA 1R6WA 3QW3A 3F1QA 3EX4A 2WZHA 2D0GA 5A6TC 4DUWA 3KVJA 2J7FA 2FVKA 1ZTVA 1R3VA 2C1HA 4UB9A 1K02A 4NZ3A 3SUWA 1UD6A 4XISA 3TQKA 1B9ZA 4PL1A 3UXKA 2OTDA 3CYJA 1HX0A 1VFOA 3EPNA 3KDOA 5JVLA 1PCWA 3WUBA 3DKLA 3DFQA 3B9DA 3QGAC 3KAOA 4XIAA 5AYIA 3VNLA 5A6SA 1S2CA 3VD5A 3EAUA 1XYBA 1M01A 2XTKA 1RPXA 2E4TA 3UBPC 5BYWA 2CLIA 3HG5A 1TREA 1GK8A 3WCZA 1R8LA 1YNQA 5A8GA 3VX1A 2WMFA 2OYMA 3W02A 3N15A 3W53A 2JIWA 2WJZA 2A3CA 5ABFA 3E9AA 4P8XA 4FXRA 5REQA 3GM8A 4Q8MA 1OM0A 1C93A 4MUZA 3M1ZA 4FS9A 2Z29A 2W6RA 3EEGA 3T4WA 4RZ5A 2F2KA 3PNZA 2VWSA 1PL9A 5FL1A 3WBWA 1PTDA 2R1MA 4IGNA 3KOXA 2E9BA 3UU0A 1EA0A 3ARRA 3VU2A 4O52A 2QCDA 1FWRA 5A8NA 3M0ZA 1G69A 3SR7A 2EF9A 4XZMX 1H7XA 3KRBA 3UF9A 3WENA 1XCFA 4HSOA 4OKDA 1B4KA 4ZXLA 1FUYA 3LPGA 5J5RA 1XISA 2OWWA 1XSIA 3N3MA 3IIVA 2ZX9A 1H4PA 4G9PA 5M3WA 3BAXA 5LZLA 3HPXA 4X0NA 3E2QA 2Y4SA 3VE7A 4GK8A 4PUMA 4QG9A 5I3IA 3LHWA 2ZZ1A 2OODA 3T0AA 4AXNA 1JCMP 4A8LA 8XIMA 4RPPA 4Y9NA 2QUVA 1FOBA 3V5CA 1XGEA 2J13A 3N29A 5AHFA 2RHGA 1VR6A 3KW3A 4PMYA 4ERAA 3TDFA 2JKEA 4Y90A 4C1NB 3IK4A 2D1ZA 3CTLA 4HCDA 1NTHA 3AC0A 2Z1VA 1TO3A 4HSNA 7A3HA 1IEXA 1QWKA 4J4KA 4D8AA 1HG3A 2P10A 2PB1A 3KFTA 4IP5A 5ABFB 4EACA 3W7LA 3AIVA 1QATA 4ZBCA 4B90A 4GABA 2GGHA 2VEKA 4RL3A 4QFUA 1V3MA 2YZ5A 3EYPA 4PRTA 2GSHA 5K4ZA 4HN8A 2IPJA 3W22A 4CD4A 1NDVA 3GHSA 4DWDA 2QV5A 3SY8A 4O13A 3N14A 4P7NA 3BO9A 3IJIA 1W3JA 1I2OA 2CZ5A 3HPAA 4LRSA 4F0KA 2WQDA 1RY0A 3OVRA 3QKZA 3BAJA 4UZUA 5FJUA 2X1RA 3RJXA 1LM1A 1V5XA 1GCYA 3VIKA 1MWOA 2XFFA 5G1TA 1XSKA 4WKFA 3D3AA 3MTWA 5GNYA 1BYAA 4CCDA 2OOFA 4I9MA 2PU0A 3V3WA 2R1NA 4IPJA 4QGCA 2XM2A 4MDOA 5H2ZA 3CZKA 4JIQA 1GW9A 3LNMA 3NGFA 4F2BA 3RAOA 2E1WA 3LV6A 3TYBA 1X1ZA 1R9ZA 1K6WA 3N73A 4RV8A 1X1OA 4PUNA 2ISVA 1S5NA 4Y96A 1M1BA 5I06A 3IVSA 1JQXA 5EMKA 1NDYA 5AHNA 1FCQA 4JTHA 2YW3A 4FOJA 4IQDA 1K7XA 2PEVA 1CBGA 1QK0A 4QJ3B 4N02A 2H3DA 4MFEA 3DHUA 3MKVA 4YLWA 1UD2A 2V67A 4RZBA 4O1DA 3ZWSA 2CBIA 3AYVA 3WELA 1XG3A 2NX3A 3TONA 3KCOA 3VDBA 3LHTA 1C9DA 1ONEA 3BPWA 2VGGA 4CQCA 3OO2A 4YPJA 1W1PA 4HJWA 4LS2A 4PFMA 2BFGA 3ABQA 1A3WA 2VX5A 2ZDSA 5HNRA 2IQ0A 5LYRA 3TEVA 2YDQA 4OJYA 4UOZA 3HQPA 5DRIA 4GNVA 4TMCA 2VXNA 3W38A 5AY7A 1Q6RA 2EBNA 3TVAA 3N04A 4QDMA 4C6CA 3EKZA 3ARWA 4EANA 3BZGA 4PRRA 4LUTB 4X9SA 3L5LA 1HL2A 3DFYA 4NI8A 3W84A 4FLRA 2X16A 4NAEB 4JOMA 4QR6A 1LT7A 4KRUA 2CXEA 2XIJA 4BCEA 1RHCA 1WPCA 1AG1O 2GJLA 2FPVA 1G94A 3MT1A 5C71A 2CERA 3XISA 4XKYA 2NQ5A 1OX4A 5CSYA 2IPGA 1O5RA 4FLQA 3SQMA 3RDKA 4B16A 4TTGA 1BEUA 5AC7A 3U3HA 4A3UA 2QGHA 1H09A 4PN2A 2VOMA 1TPUA 2BXZA 1R9XA 3PR2A 2PF0A 4PMUA 4DELA 2OFJA 2Z26A 4Q4MA 1JUKA 3NO1A 1JFXA 2WNQA 2PPGA 3URAA 5LGXA 1GJPA 4AHPA 3OZYA 1WXZA 1XYCA 3BLPX 5EBAA 4EP8C 1QAPA 2B0MA 1TPEA 2VCAA 4GQQA 1AL8A 4QITA 4CCCA 3O7UA 1WOBA 4U10A 4KT2A 1A3XA 4MNMA 2ZA2A 3E0WA 5FIPA 3S5NA 1SZEA 3QC3A 4EKJA 1YLVA 5G5IA 1ONXA 1OBAA 4MVAA 3THQA 4Q3MA 3VZZA 2ZVRA 5LXEA 1ITXA 1MXDA 5EMLA 3OZOA 1FKWA 2FH8A 2Y5SA 4Q8WA 4IGHA 3PZUA 1V3IA 4K2SA 3R8HA 2O9PA 5A2BA 3N6JA 4DO5A 3L5MA 4W9TA 3UR7A 3AYRA 4DB7A 5HMEA 3P0WA 4H41A 1UZ1A 3TQVA 3OVGA 4UR8A 1UA7A 2QCGA 5C70A 2JF7A 1JPIA 4MGGA 3OEXA 4QM1A 3WUFA 1A4MA 1JR1A 3EWBX 4IP7A 4HHHA 5AVHA 3KRZA 3ONBA 1UZHA 1QCWA 1QVBA 2WBGA 1HJSA 5FEPA 5L6UA 4HYRA 3VOJA 4CCEA 4G8TA 4GIYA 3H21A 4UC5A 1AUSL 1XKYA 1ZBKA 3DYOA 3MW7A 5E09A 1SVDA 3H26A 1WAUA 2ALRA 3G1XA 5EMMA 1HKVA 4BI5A 1Q7MA 3MYPA 5F2MA 3QY7A 1QI2A 5FJOA 2WCAA 5I07A 2YZRA 1UB3A 4CLMA 2E25A 5ECUA 1Q3NA 1CGWA 2Z1XA 4H9ZA 2VEFA 2XN0A 1UWTA 3REQA 1RCXB 3WF4A 4E0CA 1TVPA 1OCJA 3LNPA 1J96A 4GYPA 1IEVA 7XIMA 1ZPTA 2I5GA 1ZJBA 3MHUA 2W61A 4MSSA 3BVJA 3M0YA 4FA3A 3FVDA 2QPUA 3LENA 4W93A 1K1DA 3WLSA 1RVKA 3DC0A 3VOFA 3EOOA 2UY3A 2EKGA 1E72M 1HL9A 3LSCA 3N4FA 2XN2A 3SAZA 2NW0A 3P93A 4XD4A 3CIVA 4J3ZA 4QJ1A 5A94A 1KBIA 5KZ6A 3B8VA 3HM7A 1OB0A 3LU2A 4O57A 1PSCA 2BVTA 3JS3A 2CLOA 1TTQA 3ABXA 3FVMA 5MKGB 4ICCX 3TQ0A 2YKKA 1NOWA 1A4LA 3LYEA 1QNSA 1EDQA 2O55A 2NLYA 5DANA 4D8LA 3NCOA 4C6IA 2FYMA 4E4PA 1LRNA 3GIYA 1CEOA 3T4CA 4LUTA 2GGEA 3GVWA 3SCSA 3ZXWA 2VFHA 3GU9A 2OLAA 2PFHA 2DZSA 2WKJA 5I77A 3VIJA 4IXXA 4R88A 5AYBA 4Z0JA 1AH4A 3BJFA 3GDLA 2ZC1A 3RU6A 3CB8A 2DW6A 2EG8A 3OQ8A 2QVNA 4TIMA 2CU0A 2R6OA 4OE7A 1I1WA 2FZBA 4L6HA 1TCDA 4D6IA 2QW5A 2DSUA 5D9NA 5BWAA 1ADDA 2PDNA 4U28A 3C2FA 4JFTA 2EPLX 3B4YA 4I9AA 1LCOA 3G18A 1TWSA 4PMVA 3W70A 4IISA 5XIAA 3KVLA 3PPGA 4HK5A 1BD0A 1CGUA 2D73A 2ZA3A 1Q65A 3NL2A 4LUIA 1XS2A 5G2HA 2BASA 4HTYA 1BTCA 1TJRA 1UD5A 3TXVA 3PZVA 2B7NA 3OTRA 1SJAA 2ISSA 2X1SA 3M5VA 5BMXA 1A50A 3P62A 4PUDA 1SZRA 2XVNA 3UZWA 4NG3A 2DVUA 3TTYA 3F4DA 1RALA 3UZYA 2P3ZA 3OA5A 2V9DA 5I23A 3TJIA 1VIWA 4HVXA 4E2OA 3QQWA 4RX0A 4TXEA 3RM8A 2FTWA 5D04C 3Q94A 1OIMA 2QCNA 3WNMA 1U30A 2JGQA 6ALDA 1CGYA 4ZR8A 3U6WA 4M7SA 3MZ2A 3WD4A 3VKDA 1L6YA 1CI1A 1MUMA 2I14A 4PMDA 1EOKA 2I1OA 4NZ5A 3UCCA 4LUJA 2V3DA 2V3EA 4MF4A 3PC0A 5BU6A 4KWVA 3QV6A 3A4WA 1EWDA 3C8FA 1B1YA 4R9XA 5E6YA 2Z00A 1KCXA 3BMVA 4U2YA 4XAPA 1HP4A 4HNOA 1U2YA 5E5CA 3RLVA 2P1FA 1W91A 1S3HA 1A49A 5I3KA 3SCWA 5DCBA 2FB3A 3WQ6A 5RUBA 4KS0A 4C7DA 3BGAA 1UMYA 1W5OA 1U22A 4EOUA 4V28A 4N0RA 1V93A 4PBEA 1LQ0A 1QI5A 2PDQA 3FDKA 2WMKA 4LQ1A 1KBBA 2Y89A 4GYKA 1B3OA 4E4UA 3F7JA 1F9CA 5CZ0A 1QO2A 1MFVA 1TJ0A 5BOFA 3ZIZA 3DENA 1V6YA 5GJNA 7PTDA 5FAGA 1TJ1A 1PBGA 3LTPA 1GYNA 4AAJA 1FWNA 1DJGA 3WMCA 3QMTA 3A5FA 3WYZA 3RUBL 3EMCA 5DMMA 3H2MA 1QJWA 3C3NA 1NSJA 1P7TA 4HQVA 1E6RA 4KEZA 3E0FA 3TC6A 1AW5A 4DZHA 3ISIX 4F9JA 2PI6A 4ML9A 3RYSA 1PWLA 1A80A 2A5HA 3GB6A 1DJQA 1MXGA 2NQHA 2QJNA 3W1LA 3CPGA 3N34A 3SY5A 1Q6DA 2Z1SA 1Q6FA 2AAAA 4FIRA 3BCJA 3R94A 1GKQA 1XLAA 3G24A 7ODCA 5D33A 1TX0A 4W7WA 4CQ8A 4GY1A 3VNJA 3ZLHA 4Z2IA 2XN1A 4JXCA 1SQ7A 2QS8A 3T44A 5IXEA 4WXYA 4NZFA 1CXIA 4JTKA 4C65A 1Q7QA 4JY8A 5C2CA 4GJJA 3HG4A 5HJXA 1KW1A 4H3DA 3TNOA 5KITA 3SJNA 2PWVA 3MO7A 3OJGA 1EH9A 1RA0A 4JTTA 4NUWA 3TNBA 2OSXA 3M41A 4KGJA 2AQWA 3V0TA 1KCZA 4H9UA 4EVZA 2REQA 3HQOA 4L4OA 1XLIA 1BXNA 4PCTA 5EMUA 3T0BA 1QFEA 2HZGA 3A6OA 4IXHA 3CHCA 1K9TA 3S2MA 3LTSA 3GHTA 3NTYA 1Q2SA 3UJ2A 3MBFA 3ARZA 1A0CA 3N2CA 1J10A 2FJUB 1OFOA 1IYXA 3IJ9A 1JRCA 1XRFA 2YW4A 1X7IA 3PUGA 4MDPA 2V30A 3GFZA 3SUTA 3AS1A 5LA2A 2YA0A 3W7KA 3QC0A 1UA3A 5JIWA 3IWPA 5EFDA 2PC8A 2E28A 3F5JA 1NF7A 3AMDA 2CIPA 5F2IA 4A8IA 1LQAA 2P5NA 1Y5XA 1WQ5A 1YTDA 5H6HA 3MO4A 5A6JA 3STPA 1GPWA 2DZAA 4GUJA 4ZZ9A 5BMWA 5I78A 1ZCOA 1W2VA 2J4GA 3W72A 1KKRA 2CZVA 4O28A 2VGFA 4XD3A 3LXAA 2QDHA 3ONCA 5F2GA 4AIUA 4NY2A 2IXUA 1RXOB 2VZSA 2AGKA 2HRWA 2CWXA 3WD1A 2F6UA 3PWIA 1RQEA 1E55A 1MW2A 4O16A 3V35A 1W31A 3P0XA 4YWIA 4HOXA 1VLWA 4MNKA 5A6BA 4ZQRA 2BOFX 3A13A 2F61A 1XM3A 3IJQA 3R1ZA 1XLLA 1R85A 1P0KA 1UIPA 1UOZA 1FWDC 4Y6GA 3NQDA 2WWDA 3MHGA 4IPLA 1EP1A 1ALDA 3AYTA 4FNUA 2QIWA 3II1A 2EJAA 4MJ4A 1QNVA 4J5NA 2C1GA 4DBWA 3BXWA 1E1EA 3HJZA 5CZJA 4MPQA 4QSFA 1JUBA 1IT8A 1E6XM 3BGJA 3IVTA 4IOTA 2YA2A 3SCTA 2OVLA 3URQA 2VM8A 3TK7A 1X96A 1OK6A 3UG3A 1Q6GA 3O15A 3IS4A 3VILA 3AO0A 3LCWA 4N9BA 2QUNA 2PS2A 5D9MA 3AHTA 4F40A 1J2BA 4M6QA 4NRRA 4MLJA 2WYSA 4G1NA 3L12A 1C7SA 4J3WA 2P3EA 3GBEA 3PZTA 1A3HA 4W5UA 2DVTA 2ATMA 3QMSA 3GXDA 3FA4A 4A8NA 2FHFA 3L4ZA 2AL1A 3SRDA 3CQKA 1GNXA 1VBJA 3ARUA 1S5WA 2FZDA 1DE5A 3MSGA 1R3TA 4MNLA 3RU8X 2QCLA 1JPDX 2PDXA 4JTRA 1PZ2A 2OOGA 3D46A 4JKKA 3EMQA 2DZWA 4GUHA 3W82A 1XD1A 1ODUA 3U2CA 3VD9A 3C3UA 3H2NA 1JYWA 2DZUA 3CH0A 1M53A 3WEZA 2FZMA 2P0IA 3O9NA 4LAZA 3PB2A 3SUVA 1BVWA 3FXGA 3APGA 4ZFCA 1W3KA 4AY7A 4GI8A 3ZJ6A 2VZOA 1AQFA 3OLGA 5F4WA 2E09A 3LHZA 1JYXA 4K38A 1Z8AA 5HWMA 1QWGA 1OSEA 2W79A 4HA3A 1JDEA 3P82A 4TV5A 4HPNA 3UWWA 3P6LA 3E2SA 3QZAA 2OO0A 4NHVA 5K2ZA 3G1SA 2Y7EA 5DMLA 3JUGA 4TQTA 3KXQA 3MANA 3H2FA 3W2MA 1B0IA 2PDCA 4BHYA 3WL1A 3OPSA 1G67A 4QRNA 1OFAA 2ODOA 1OF6A 4JHMA 1XDJA 4HD5A 2WHMA 2VOTA 4A35A 3W7DA 5XINA 3RN6A 4YTTA 1KWKA 2OX1A 1PKLA 2PBOA 1SO5A 3WX7A 3UJRA 4C6PA 3V4BA 2GGGA 4L4PA 1TE1A 3VD7A 3CWOX 3TYUA 1SW0A 2XGZA 1LOQA 1NELA 1E0UA 3NVTA 4KWSA 3TW7A 4L6OA 2Y85A 1US2A 1OGSA 1QI4A 2HPIA 3QYQA 3A3XA 3LM3A 3A3WA 3KLKA 1MNSA 4Q7IA 3L66A 3PVFA 1XYZA 5IFTA 1M04A 3VKCA 1O68A 3B4UA 4Q32A 1ZL1A 5HR7A 3KBWA 4QJ5B 1BSIA 3AXKA 2Z6JA 3WKZA 4HNTA 3AXIA 3WK1A 2VFIA 3WH7A 1JGMA 3GIPA 1OD8A 4B3KA 1HFBA 4XTIA 4BQ5A 2ABBA 3CUJA 2ISFA 4QS5A 3TJXA 5KSWA 4RUBA 4RE2A 4JN6A 3VMPA 1I1XA 4N4QA 3BW4A 1S1RA 1ZLPA 3GDRA 3COTA 3J7HA 4Z42C 4ZVJA 1GHSA 2C91A 3L7RA 3S2LA 4ZFMA 5HA7A 3L2LA 2DZPA 1V7YA 2OZ0A 4H9YA 5FEWA 3AXHA 2HEJA 5C54A 3GUWA 1KXHA 2BXVA 4MJZA 1JNEA 1N7KA 3S3GA 3QYSA 1OC5A 3GG1A 1JCYA 1EQPA 3BOLA 3EOEA 4QBXA 3EGJA 5M03A 1LBFA 1XUUA 3LQGA 1UP2A 2PWFA 1TPB1 1TR1A 4A3RA 1O7AA 3ABSA 2GUUA 3UXAA 3DU0A 1S2UA 3LLDA 3PNUA 5HBFA 2FFCA 3HZ3A 4BZYA 1V08A 3S0CA 1CLVA 5D2XA 3NQMA 3E0LA 4RJEA 1XGZA 3HMCA 3V1PA 1IF2A 1VRXA 1E56A 2C8NA 1ZNNA 2D23A 4DM2A 4F66A 5AVNA 3CZ8A 3W81A 3AWNA 2X7WA 2PDBA 4E3VA 4IMCA 4XB3A 2WWCA 1JRBA 1KBJA 3T08A 3HIJA 3FJLA 2C79A 3E5BA 1SJBA 4ADTA 3NNTA 2XIMA 2PGEA 2FGZA 3IARA 3Q58A 4L5ZA 2VGBA 3G0XA 4M5PA 1V3LA 2Y63A 3AI0A 3BLOA 3AROA 4OECA 4Z1AA 2WSQA 3CS2A 2XVPA 3TN5A 1AQMA 4POCA 3WLQA 1DOSA 3EA2A 4AC7C 3E38A 1A5SA 3EX3A 4K1WA 3DAQA 1H1YA 1JG9A 2ZRZA 2BP1A 2VC5A 3P81A 4N7QA 1AL7A 1GZGA 3ABRA 1N2VA 3MZNA 3QOMA 4PTNA 3TA6A 3A23A 1I9CB 3B8TA 4PODA 1UOKA 5D8ZA 3B40A 3EWDA 1XLBA 8CGTA 1TMHA 4XD5A 3SGGA 3S1GA 3V7PA 2PTDA 1WUEA 2PLKA 1ENUA 1N8FA 4OBSA 2J7DA 3PZIA 4UTFA 3CAWA 3W3OA 3WN6A 1XF0A 1V0LA 2DW7A 1ELSA 3DKJA 3TC3A 4UFKA 2VEPA 4OT7A 3VGGA 2E7FA 2PRMA 1XLEA 3AMCA 3LHYA 1UR8A 2YFNA 3B03A 2D3NA 1EPVA 3JVAA 3M0HA 3O6YX 1PDYA 3W7RA 4AF0A 3UGVA 1ITQA 3KWXA 5HNNA 2ZZ5A 4IZGA 1EDTA 2CZEA 1EIXA 1F5ZA 4H7ZA 1XYFA 1YE6A 3EPMA 4M7TA 3LCXA 3UZZA 1JGIA 4NP7A 1BF6A 3S5OA 3W2NA 1D2KA 3LLFA 3PPCA 3FCPA 1G7UA 3UZJA 3PG9A 1HGYA 3H4XA 3M64A 4H6QA 4J2MA 2VFGA 2Y0FA 2MNRA 4XKYB 4GI9A 3EPOA 4DAIA 4DLMA 2WJFA 3A21A 2XIOA 1MNZA 1CLXA 3AIEA 3GKAA 3IGSA 3IIOA 3GXTA 2TODA 3RPDA 1W9DM 3GNXA 2CEQA 1PYMA 2Y24A 1C90A 3T09A 4S3EA 1XIMA 3HOJA 1W8GA 3G6LA 4L4LA 3H55A 4IJCA 3K8KA 4NYYA 3NQ2A 3ZLFA 1Z44A 2A1YA 2BTMA 5F7UA 3N11A 5M1TA 3NXLA 2XFYA 3AOFA 1C7TA 2PP1A 3QKEA 4FI4A 3UXLA 4CQ9A 2EG7A 2OSYA 1R3RA 4UIOA 5I7GA 2YOCA 2YBUA 1I6NA 4EXAA 3FJNA 4K68A 5G2IA 4LVGA 2YIHA 5CGMA 2Z1BA 1NVMA 1UBPC 4D6HA 3OODA 5BXPA 2PZNA 5HANA 3TIMA 5D4YA 2ZZ7A 2Z24A 4CQAA 2OYLA 4ALDA 4H9VA 2Z7GA 3LMYA 4GIAA 1Q66A 1H41A 4AMAA 1X6LA 3NSNA 4DUXA 4YTUA 4IHCA 1P1MA 1A5AA 1TRDA 2ZUWA 4WR3A 4A3HA 4KCUA 3S1WA 1G6CA 3VTRA 1XLGA 4YCOA 2HPMA 3MYOA 4YJ5A 5BRPA 1FWTA 3P80A 1N8IA 4LVBA 2VGIA 3ZWTA 4GFSA 4LEFA 1BSLA 1KV5A 3HA1A 3TSDA 2AAMA 1TIWA 1PWMA 1Q8JA 3NQBA 3QGKC 3WQ5A 4X2RA 4D9PA 3PSVA 2A7PA 2JBMA 4OZOA 1H7OA 4AWSA 4YS1A 1A0EA 2QULA 3WQFA 1W54A 5H8UA 3W37A 5KEZA 4LNCA 1S46A 1G4SA 1TIMA 4BQ3A 1S2TA 2POTA 5BRQA 3SGZA 2PLJA 2J62A 3MDWA 1VIZA 3GDTA 3P5ZA 1PZ1A 3BH4A 3GAYA 2CFFA 5CZTA 4DIAA 3K8LA 2ZUNA 2F84A 4BS0A 4PZVA 2CESA 3EEZA 2NT1A 2XISA 3G6MA 1KBKA 3SJ3A 2ZVIA 2NUYA 5JBDA 4S23A 3RRXA 1KLZA 3P5YA 1OX5A 2DP3A 4L64A 1U1HA 3AZSA 1KRBC 3PBGA 1EJTC 3G22A 1A53A 2QGYA 1VJIA 2D22A 1ZBWA 4F0HA 4X9YA 1QW7A 3CT7A 3A22A 1EJRC 3NO3A 3NDYA 1XLHA 1MI3A 3CZEA 3KZSA 4R3UA 1OG0A 3D6NA 5HR6A 3ES8A 3DOPA 4FXJA 3VM5A 5JUVA 3UW6A 4JIIX 1LZOA 4DJDC 2QCCA 1NY1A 2QAFA 2OEJA 3ABOA 4IX0A 1H60A 1W1ZA 3S8HA 4A29A 1C92A 3MI3A 4KRTA 4NILA 1M7XA 2G4JA 5EMYA 1HNYA 4LTSA 1U1UA 4V27A 1WZMA 4A3QA 3KRUA 1VCVA 3SO7A 1QHPA 3MP5A 2A3BA 3L5AA 3SSZA 1W1B1 5K9CA 4OTKA 3V36A 2WB5A 3EX1A 3PPFA 4FX8A 2FHBA 1M68A 3KL0A 3HGRA 2AKZA 1ZFJA 3KTXA 1HGWA 4ZOEA 3U4AA 2OSWA 1XR2A 3KOZA 4RLIA 4AZBA 3WLPA 3PY2A 2W67A 2OG9A 3HURA 3N9RA 4LW7A 4AG0A 3LEPA 4LNYA 1TX2A 5TQLA 4ADUA 3A64A 4KESA 2V68A 3PZQA 1FXQA 1LP6A 2QMJA 3CMFA 4GX8A 1AVAA 3AIQA 5HNUA 1UR9A 5DF0A 3XINA 4FNPA 3R58A 2PCQA 3CQ0A 1ZBVA 5I3HA 3DFPA 4R7WA 2OWXA 1XXXA 3FLUA 3FS2A 2AL2A 2DZVA 4DN1A 2C13A 3MUIA 2ANUA 3N2OA 2ZUMA 2Q3OA 3KOYA 5DFAA 2J8FA 2YCEA 3PFRA 2Y88A 5C9WA 3TC7A 5DCEA 1TPH1 3PUDA 3NO5A 4W89A 1VF8A 1I2PA 5CPNA 3T55A 1YXDA 3CEUA 3N18A 3BV7A 3BARA 1A5BA 3T05A 4XZIA 3M07A 3JZEA 5E6ZA 3G0SA 3TP4A 3IAPA 2DSKA 1X1NA 2ACRA 1FH8A 2QPXA 2J74A 4C7GA 1HP5A 1GJUA 4GOAA 3VCCA 4AZIA 4J9JA 1WZLA 3WLOA 2OWCA 2TAAA 1CXFA 1GVSA 1BAGA 1Z42A 5T9BG 3MBDA 5D03A 3L0KA 4TV6A 2DUZA 1FCUA 4W4QA 4ATDA 1IWAA 1SZGA 2DEPA 1Z48A 2P88A 4A22A 3TCSA 3L21A 1G4EA 3HPFA 3LK6A 5I24A 3KM8A 3P7YA 8RUCA 5EYWA 3UZXA 3AYSA 3UVIA 2WSKA 1E9ZB 4FR6A 4J7RA 3AZRA 3WJSA 5CC5A 3M43A 6REQB 4L61A 1AW1A 3PAJA 4DYEA 4JICA 2A6NA 8XIAA 4WQ6A 3QSRA 2WHLA 1KM4A 1YXYA 4JEQA 1U1JA 1GW1A 2QDDA 2V63A 1JDCA 2ON3A 2X40A 1L8NA 3GTIA 3W1XA 4ZE5A 4DXKA 4L1XA 1KO0A 1W5QA 2Y6ZA 1J12A 2ZX8A 3EDEA 2PTXA 4PEKA 4GO9A 1W32A 5ABGA 1E71M 1CB2A 1VPQA 3VOCA 4D6CA 4BEUA 7TIMA 2XM1A 3F2DA 1NQ6A 4DO4A 2O7QA 3WMSA 3HB9A 3ITGA 3MB9A 3AZTA 3OG2A 2AQVA 3UZ5A 3WO8A 2ZOXA 2B7PA 1JZ5A 2I16A 4L9XA 2H6RA 3IUHA 3SUSA 2C6QA 2VHLA 3DG7A 5D2WA 3N4AA 1UUMA 2DIJA 1H7RA 1XRTA 3H6OA 4TTUA 2WAGA 1U83A 3FJ4A 4Y2WA 4N6FA 3ZZ1A 3E2VA 1IGSA 3W1NA 4OQVA 4I5RA 1LRTA 2YCIX 4E3TA 2PDUA 1R86A 1XG4A 1BQGA 2OMAA 3W1UA 5I00A 4WGHA 1M5WA 2V81A 4OV4A 2ATSA 2R8WA 3C5QA 3IJLA 2CZDA 5DRCA 3H12A 2DDXA 5AOUA 4YU1A 1M7JA 4H04A 1B3VA 1RK5A 2IS7A 3DFHA 5LNUA 2ZRWA 4US5A 4KETA 2FJKA 2PDLA 3B9EA 2R91A 5FL0A 1P1XA 3NVDA 4FX7A 2G96A 1PX4A 4FAMA 1DXFA 1SZNA 2F2HA 3K2GA 5HMDA 3CB3A 2Z1KA 4DUVA 5EKYA 3V0SA 3BAKA 3D0CA 4JIHA 2Q8ZA 1KQZA 5CQ1A 3W07A 1ECEA 1VCFA 4MJ2A 1WDDA 3ZYZA 5BXRA 4XVDA 3B9NA 1Y0EA 2V5KA 1V3HA 1GG1A 4QROA 4GISA 2CCRA 3EWCA 3S4TA 4Q7NA 3T0TA 3FFSA 1JNDA 8A3HA 1TPVA 3W7HA 1NFGA 3KBMA 4JQ1A 1F6KA 4HZ8A 3VABA 1A0DA 1RV8A 3TV8A 3NYDA 3VGDA 3B0PA 4GZJA 4LH8A 3ITCA 2AQOA 4INFA 3GFYA 1BTMA 4HB7A 3B06A 1HXJA 3N3TA 1XIFA 1NM9A 1JYVA 5A5WA 3VPLA 2PDIA 3G1AA 1JXJA 1SJCA 9CGTA 2OR2A 4JTDA 1G4TA 3RLGA 1IR1A 1JDAA 4H9TA 5D02A 1SM9A 4GMEA 2FH6A 3L23A 5HMFA 2QCMA 4GIRA 3MKCA 2ZX5A 5JBFA 4MOZA 4JL2A 3WQ4A 4C90A 4JCMA 4UWMA 1B31A 3W26A 3N19B 3R8RA 4A05A 4BY3A 4CUCA 1E1CB 1VCGA 4E8DA 5HUOA 3VIMA 1EWEA 2EPOA 3WF1A 4LWWA 4AQLA 2VD9A 3W1RA 3KE0A 4WHBA 4ZO9A 2H8ZA 4DBSA 5LNWA 4US5D 5DT7A 4XZBA 3NSMA 3LB0A 1VB9A 4IL2A 3H2OA 2E5DA 1VP5A 1JPKA 3RCNA 4DF2A 5EMJA 3DIPA 3U2OA 4PBGA 1RZMA 2WM0A 5D09A 3BG5A 2VQUA 1SO6A 1IGWA 3WY1A 2V0TA 3WLLA 2Y7DA 3OGSA 3S5YA 4A6GA 2DSVA 3CZGA 3CQHA 1KXVA 4KERA 3A4AA 4PTDA 4Q8PA 3QZ6A 2POZA 4JFSA 3ITTA 3QXBA 4MYAA 3I4KA 4CEUC 3CHFA 4MPKA 2OGYA 1JF5A 1TVLA 1FBAA 4JTQA 4FOKA 3DX5A 4I6VA 3GX9A 2EO7A 1EBHA 4IT1A 2HSAA 3VGFA 2JK2A 3W01A 1VKFA 3O6DA 2NLIA 2P76A 1RVGA 3JU2A 1AZ2A 3BLIA 1TMLA 3UEQA 1CWYA 2HDJA 3IUDA 1PCKA 4HBKA 3BMWA 5C2GA 5CG7A 1TUFA 3M6YA 1LUCA 5GNXA 3G5EA 5G1MA 1K7EA 4MY1A 3A4XA 1Y65A 4LAOA 4HZMA 3TLLA 1E15A 1SMAA 3F4VA 3IK2A 4ZODA 4XZLX 5FESA 1XDLA 2NUWA 2YBVA 1BYCA 2E8ZA 1ADOA 1GQKA 3W7OA 4ICMA 2QLYA 3VNZA 1FCBA 3WFLA 1GQJA 3E02A 2NX1A 1UWAA 2ZXBA 2VL4A 4A2SA 3XIMA 1E1CA 3K8MA 4MWAC 4ZCWA 3B8UA 3S5ZA 4D6GA 1B3YA 1J5TA 4WCJA 3G1DA 1UWSA 1M41A 2JE8A 4AZ7A 2VI0A 3AFBA 1E73M 4YWSA 3WJYA 3MHFA 3IV8A 4O14A 3T0CA 5AC5A 3HBLA 3JR2A 4ES4A 5J8LA 4AXKA 4KIEA 4AD4A 3MUZ1 1LWIA 2PTYA 2IKIA 3WK2A 4Z2LA 3BC9A 3AS2A 3HPSA 3N17A 1SUXA 3VIHA 2FFIA 3R0UA 5TNVA 5CPOA 3BURA 2V38A 1QNOA 1E6QM 2PWEA 2X1TA 2G3MA 3DDMA 3NG3A 2ACSA 1FFRA 2V6AA 4P8WA 3O16A 3URNA 4FB7A 2AMGA 1UP3A 1YPXA 3RX4A 1NAL1 4GIEA 1JZ3A 3KCJA 3AALA 3SCUA 2ZZ3A 3UWEA 1IWPA 1IHIA 3KBVA 4LY8A 4F48A 1VLIA 1RH9A 1W9UA 1HTIA 1WBHA 2ZX6A 4LOCA 3TW6A 3CXOA 1MQPA 1MQRA 2XINA 5FSDC 1GYLA 2BZNA 3KOWA 3SN1A 4OBTA 1P0NA 2OB3A 3K5XA 1RP8A 3AUOA 3RHGA 2IMRA 2PTWA 5DMNA 4YMZA 1DJWA 3GFXA 2NXHA 1QPOA 5DEZA 3P61A 2BHYA 3IACA 3L4TA 3QEZA 4D8ZA 1I0DA 3CUHA 1FWEC 4DVOA 2J7HA 1IWBA 1WDPA 1J6OA 4R7OA 1XSJA 2AOSA 3M5XA 3V16A 4RE3A 3UPMA 2WMHA 1O5XA 3CAQA 4L6DA 1QPRA 1FRBA 3GC4A 2J79A 3WD3A 4LXFA 3W9ZA 2CKSA 1MZHA 1KFBA 2F8QA 1K6AA 4FIQA 1RD5A 2RDXA 5XIMA 3W29A 1Q4NX 3PZGA 5IDZA 1H50A 1OK4A 5DQPA 1DWIM 3NL6A 4JNMA 4HHPA 3VGEA 3BANA 2WC3A 4KRZA 1SFTA 1EJVC 5CSRA 1BKHA 2J7EA 5D2TA 2VZTA 2PGRA 1R3SA 1PX3A 1F61A 3DGRA 3UWUA 1M03A 4IFOA 3IUIA 4RZ4A 4CN6A 3WEOA 1Q6EA 3OLDA 1XIGA 1E5JA 3ZOAA 2RJGA 3PF3A 1EJUC 2GSJA 4PTXA 4H8HA 2VP8A 1H62A 2OCZA 4RDYA 4HU3A 1HJXA 1QW9A 2VUYA 3N2TA 4O8AA 3TAKA 3ARXA 4H01A 2E6YA 2A0NA 3UXIA 1J93A 2P8CA 4Z2GA 4H8VA 2HJPA 4XZWA 5EL1A 2JGYA 3C0LA 1TMQA 6PTDA 4JR5A 2GOUA 2V5BA 3PZMA 3C2EA 1GJWA 1R2TA 1QU4A 2HVNA 3PBMA 3IEBA 2FKPA 1FWSA 5A95A 4GJ1A 1KTBA 2ZE0A 3C56A 2WNWA 3SB0A 3V5FA 5MKGA 4O0QA 1H61A 1UWUA 5MHBA 3TYEA 4BK9A 4O4WA 3NZRA 3H54A 3ZSSA 4FALA 5IDIA 4ZB2A 4M8UA 3G1FA 2EEXA 4ZB5A 3N2BA 2JF6A 1VHNA 3VNYA 5DO8A 3ZT6A 3V75A 4OIFA 4RE0A 4FF5A 3VDHA 2ZCGA 4K3ZA 3MDUA 1N8WA 1GPFA 5BCAA 1GORA 1QT1A 3CQIA 3BSGA 3HGOA 2EQDA 4PEEA 2IKGA 4NT0A 1SR0A 4V1YA 3MI2A 4H00A 2OZTA 2WC4A 1IIGA 3NEHA 4ROQA 4K8EA 3MJMA 2PDWA 3H22A 3C86A 3AMKA 2X0YA 1TJPA 1XH0A 4IUGA 2Z27A 1H11A 4M56A 3S2NA 3M5YA 4E2BA 4CN4A 1V0NA 2QJGA 2DJXA 3RJYA 1GVOA 5BOEA 3BTNA 4DZIA 5I79A 5HNTA 3CWHA 3W7EA 4TX9A 2J8GA 1T41A 1X6NA 4G5DA 2XIQA 2PDGA 3MQTA 4DJFC 1GOIA 3KHJA 2BOEX 4UQEA 3NJ3A 2PF8A 2WK2A 4J3XA 3JRKA 4F8XA 4CD5A 3BL3A 2YXOA 1B3WA 4DJED 2CPUA 1XINA 1OD0A 2BY0A 2DJLA 2FMOA 5DLCA 1R3WA 1U33A 4S3KA 3U0HA 4MAVA 1Z6KA 3PS7A 4NASA 5A8PA 5BXTA 4ZXOA 1SFLA 1JD9A 3THCA 4JTGA 1XBVA 1A5MC 4HPHA 4N42A 4WX2A 3W2KA 4X63A 1ZQ5A 1YDVA 4DXXA 4ONVA 1PEZA 1ZGDA 2ADAA 1GVYA 4PUEA 2GVLA 5M5DA 1V79A 4ZA0A 4FPSA 4EXQA 4IG2B 1F76A 1I2RA 1S2AA 4GZ7A 4C91A 3K4DA 2FTYA 1FCVA 4HPXA 3ZT5A 1CNVA 3W23A 3W7GA 1TA3B 1JFHA 4QNEA 4GKLA 3QM3A 4NNCA 4AMCA 3GVQA 2CYGA 2VR4A 3E74A 4DZAA 3GXPA 4L56A 3C2OA 3MPGA 4KEVA 5E9XA 4V33A 1V6VA 3S6OA 3PTDA 4JDYA 4PFHA 2GUBA 2OQLA 3FKKA 1TZZA 4DNMA 1XYLA 3CHEA 3LRLA 2ZUTA 4IIDA 3SRFA 1EC8A 3VIGA 4YL2A 1JJKA 2G3IA 2JALA 2BNJA 2VEIA 1E4MM 4LAUA 1EYWA 4QJ4B 3TTSA 4BI6A 4HHMA 3P14A 3IIPA 3OYXA 4OVXA 2E0PA 4D6EA 2G3JA 1PVNA 4P7QA 3VIPA 5C55A 5K3VA 4R9OA 1FP9A 4HKPA 1MEHA 2ZWYA 4DI9A 2IPFA 1UHVA 2BVWA 4WDWA 3W6LA 4KMQA 1LDCA 3TCEA 4NNAA 1H49A 3TYDA 5TD4A 1VPXA 1RQHA 1Q85A 3S46A 1B57A 3P74A 3K46A 2J9XA 1OFQA 2G5WA 1M7PA 4S3FA 1BVZA 1TTPA 1H2JA 3VMNA 4M6UA 1CGXA 3FSUA 3SW6A 2ZXQA 4Z0SA 1SMDA 4NI3A 4WSJA 4XD6A 1GQLA 1G9HA 1VRDA 3AJXA 5LNSA 2YA1A 1UCWA 4KH2A 1KC7A 2ZFAA 4Q4QA 3AICA 3C2YA 4WF7A 3TMLA 1EZ2A 1DHKA 1OEPA 2GYIA 3TFXA 3TOYA 4RNIA 1F73A 1Q63A 1W17A 1K9DA 3GBDA 1FFQA 2ZUUA 1MW0A 3L2MA 2VUNA 3RRAA 3WZ0E 3WBYA 4ATLA 4MYXA 1C8QA 4JTEA 2QJHA 2FZ9A 1X7FA 5C8BB 4NVTA 1WX0A 2CITA 1OABA 5HATA 1UMLA 3CJPA 5CSUA 1YHTA 3UWVA 3WL0A 1JEZA 3FN9A 2UWFA 1K4HA 4Z08A 5IM51 2H9AB 1V6XA 1Z69A 4BKNA 4ASTA 2GGIA 3MS8A 1H1ZA 2RUSA 4HN4A 3CYVA 1UH3A 4MKVA 4AZCB 3TSMA 4A4AA 1YNPA 4AISA 2GQ3A 3DUGA 2RAGA 3GE7A 3EB2A 3MP4A 1IZJA 4U5IA 4DF0A 1LG2A 1ITCA 3KS6A 4AEOA 1GEHA 2EAWA 1TCMA 2ESCA 5LIXX 5JBEA 2RGMA 5C9XA 3Q2DA 1EP2A 1UKSA 1TFVA 6ENLA 2JEPA 3UG5A 1GOWA 1M9HA 1J5SA 5F2LA 1AQHA 1LWHA 3RILA 1YIXA 1S5MA 4EF8A 2CZFA 1EGMA 4MKSA 1KB3A 4P8VA 4GRSA 3AU2A 4H2CA 4HCLA 3FXYA 1GVFA 3GNRA 1WB0A 1F8IA 4UFJA 2FDMA 2CHRA 1LQ2A 4AY8A 3EXSA 1KM6A 5HWJA 3U7VA 5KINA 3MC5A 4I9TA 2DPEA 1FWHC 4EF9A 4PUKA 3PJWA 1EC9A 3ZVHA 4JD4A 1PIGA 1UBSA 3FEQA 4B9ZA 4GQRA 4E38A 1Q8AA 1TWIA 4G6CA 1WZAA 4LPCA 1W1TA 1UPMB 3SCNA 3NL3A 2XPKA 5JU6A 2WSPA 4HTBA 4BR1A 2XIBA 2W92A 4H2HA 1TJ2A 2PWHA 3VFCA 5CAHA 1R9YA 2ZADA 3G0UA 2NSXA 1I2NA 1KXQA 1JYNA 2VMFA 3DH7A 4U33A 3U7BA 5I6SA 4IF2A 4FXSA 5KZDA 3POHA 1FY6A 3B0UX 4GNKB 1EDGA 4X61A 4JTFA 3WQVA 3FW6A 3EXRA 3UESA 3M4HA 1Z41A 1HIZA 1DV7A 4IIBA 1V02E 2PODA 4MIMA 1K7FA 2NQJA 4B5WA 1PX8A 3RK8A 2DIEA 1KRCC 4BEQA 4GD0A 4HT3A 3S5SA 3NPVA 1HJUA 3CPRA 4AB4A 1CPUA 4ZSUA 1ZU8A 1RBAA 3C2RA 2ASHA 2FLIA 1DYSA 3FYPA 3AHZA 3PTMA 4M51A 5AHIA 4ERGA 1JIBA 3LGGA 1GQIA 1EJWC 1KFJA 3WDHA 1W0MA 3MMDA 3SY1A 2AKMA 4PSRA 3BDKA 3SBFA 3UT0A 3PM6A 2BWGA 4B5TA 3U9IA 1MW3A 3S9YA 5CGTA 2ZXDA 4MLRA 4B5NA 4HNUA 4DRSA 3IJ6A 4NJGA 4FXFA 1XLKA 4EPEC 4DO7A 2DORA 5FJPA 4QTGA 3GVVA 3S47A 1QUMA 5DN1A 2G3NA 1PYFA 3CC1A 2ZXAA 1E4IA 1EBGA 1MUCA 3H2AA 1RUSA 1RSCA 4XAYA 3LBMA 5LNRA 4QE5A 4JZ5A 4C6BA 1XIEA 3I10A 1FWBC 4WLCA 4I7VA 2NV2A 3M47A 2PCEA 2I56A 3ZVIA 2O9TA 3QR1A 3WBEA 1VBRA 4EAMA 4E8GA 2YX0A 4DJDD 2FZNA 2A3AA 1DBTA 3F4CA 3SFWA 2VKZG 1A5UA 4C1LA 2W0UA 4KF1A 3STEA 1NOFA 2NVCA 2EJ1A 3UP8A 3VIOA 3V1HA 2B4GA 1LG1A 3AMGA 3T2OA 3UVAA 1VENA 2GFTA 5C9UA 1SW7A 5FF3A 3TFCA 3Q65A 4JQ2A 1EKOA 1TV5A 4DJFD 4CQBA 3V0UA 3IV3A 1W1YA 2PZ0A 4HMNA 2CLEA 2PRLA 1MZRA 4JIEA 3W7QA 3W28A 1T8XA 2GLKA 4D71A 3I6EA 4ENLA 1EJ7L 5E1QA 3WNNA 1WYIA 4JX6A 3BLKA 2BS9A 3K13A 1DPMA 1H63A 2WHJA 4GLEA 1SSGA 2AL2B 1XQKA 3KP0A 3HGSA 4PR4A 4H7VA 3CAVA 4M80A 4D1IA 1OZQA 3IJ7A 1D8CA 2DUAA 3KVKA 4U31A 1RJRA 3ZR5A 1UKTA 1MFUA 1CX9A 1IE7C 4AC1X 9XIAA 4ZOAA 3CL7A 4YIWA 5BWFA 1XUZA 1BWKA 4FLOA 2OT1A 1SW3A 1JZ6A 4B5UA 1TG7A 5LGZA 4CNOA 2OT0A 2XIIA 2ZE3A 1VAHA 1JDFA 1MSSA 3APYA 3BAWA 3GDBA 4GINA 2NV1A 3FK4A 2QDGA 1JZ2A 4N2YA 3ZJKA 1KM0A 2ZBTA 3S6DA 3VCRA 2Y70A 4FX6M 1F6YA 3WUEA 4PCNA 3CLMA 4PMJA 5HINA 5FF7A 4GNJA 5DX7A 5D38A 4NIRA 4GC3A 2WKLA 5DT5A 3QN3A 1OYAA 1Q45A 1HUVA 1O5KA 2YCLB 4ICNA 1HL8A 3H2EA 4JTAA 3OVQA 1E70M 1HF6A 1W5PA 3GIQA 4NQ1A 2XYLA 4WY0A 4AY1A 2TSYA 3DEQA 3JZUA 4O50A 3PBYA 1FH7A 2V8ZA 3AIBA 4DWSC 3G1HA 4Z2JA 3BOXA 4GE8A 2OQYA 3GD6A 3B8SA 5AYYA 2BLEA 4PB3A 3B8IA 4LX4A 1KM1A 1FWJC 1QNPA 1UJPA 5A69A 3CUZA 3MSDA 4QG8A 3NPUA 1MEWA 1Q2RA 2LLEA 1GKPA 1UR4A 1BYDA 4TMBA 2EKCA 3DFTA 4UCFA 1LUCB 1O1HA 2G3FA 3ZVHB 2IKJA 3DERA 5IHSA 3LZ5A 2QHAA 4V15A 5K4XA 1LL6A 1J9YA 2GPTA 3A47A 1JD7A 2B81A 2ZDRA 4MZ1A 1DVJA 1O60A 1CENA 5I3GA 5ABHA 3NYZA 2PWGA 4IPNB 5CJ5A 5LHEA 4O15A 2RDUA 1ZY9A 4WVXA 1M3UA 3C2VA 2OZ3A 4Y9AA 3GG7A 4JTSA 2ONEA 4Q8UA 4C6FA 3E12A 4O1BA 4W8AA 1AJ2A 4Q7BA 5HJYA 1F4AA 3ALFA 4I8DA 4XK2A 4NX5A 1UR0A 4WY0F 4IMGA 5CBBA 1S1PA 3GG0A 4LYQA 3N9SA 3IRSA 3Q37A 1W6TA 1EEPA 5IFPA 1HJVA 1BXBA 6XIAA 4NU7A 4WJ8A 5CPQA 1JI2A 4U4MA 4IH3A 5CJMA 2CHOA 1ZENA 3O06A 1UR3M 2ZQ0A 3QR3A 1OY0A 3ARSA 1WDSA 3FGCB 2J8TA 4QSHA 1IT7A 4MJMA 4YTQA 2DV0A 5E0CA 1IEWA 4Q8QA 3GR4A 5LIWX 2HQAA 1GHRA 2GQ8A 2PU1A 4PTWA 2X42A 3CV7A 1PKMA 1PJ9A 2BHUA 4K7VA 4AVOA 4HPJA 4MB1A 4H83A 1QOQA 3MUAA 4LALA 1LOLA 3GH7A 5AC8A 4XSLA 5LIUX 5ECVA 4ZQMA 4C6JA 1MUWA 2H9AA 3LG3A 4M24A 3TN3A 3QW4B 1H7PA 3ZS4A 4TUFA 1CYGA 3W4RA 2A3HA 3SI9A 2Z28A 4PBFA 1V77A 3ES7A 2YLLA 4AU0A 4LJ3A 1RP9A 3FA3A 3FHQA 1EC7A 3OP2A 1CXHA 8TIMA 3NIYA 4HIBA 3O05A 4JAWA 1SR9A 1VD6A 5E9AA 4J1OA 3FYOA 4I6KA 4JIPA 4TO8A 1E9IA 1GZ1A 2IKHA 5CAKA 2DFAA 2WCSA 4L4MA 3E3HA 4UNKA 2R1PA 4M82A 4GY0A 1Q6LA 3SCRA 3WBAA 4S3JA 3S1UA 3BGGA 4JKLA 3MV01 4LV9A 3CEPA 4KPLA 5SWUA 4GC4A 5C9ZA 4PMRA 4MKNA 5CCZA 3EOUA 1GVRA 3LGDA 1DTUA 3H23A 3CMJA 4QP0A 4B5VA 1O66A 3GY1A 3TWBA 2Y7FA 2PP0A 3EX2A 4RK8A 5BROA 3A5VA 5DY3A 5H8MA 1U5VA 2CXGA 4RKAA 5IHRA 4DAFA 3YPIA 2V2DA 1OX6A 2QT3A 1DE6A 4JTCA 4L1GA 1RK6A 4F9DA 2VRJA 3G1VA 4WY0B 4DWSD 2FGLA 4BF9A 3L4YA 1TV3A 2WVTA 3QV9A 4R53A 4UTIA 1OG6A 3WFZA 3T42A 4M0XA 5AFDA 3SN0A 2BY2A 3PTQA 5AYXA 2QF7A 4DY1A 2E68A 2E5BA 3TYZA 1XYAA 3TTEA 2VEGA 5C7HA 3GQYA 1LROA 2ZICA 4CNUA 4H9MA 2BOGX 1A5KC 4E2DA 3C61A 3W7PA 4CGTA 3N1AA 5AC4A 5KETA 3UNDA 3VXGA 2O4QA 4CKQA 4ROPA 5FSEC 2P8BA 1KFLA 4JHZA 4KCTA 3NZGA 4M6VA 2QJIA 4DPQA 3GLCA 1F05A 1LYXA 4UFHA 1GEQA 1IXNA 4NAEA 4IX2A 3IANA 3EZ4A 1X39A 1RJQA 3MWAA 3OLEA 4UQBA 4Y8EA 4JGDA 1F74A 4XBJA 5IBXA 4LB3A 5H1WA 5KTLA 3IIXA 4MHBA 3HO8A 3N6QA 4HJFA 3PUOA 5EFFA 1JCNA 1HQTA 3BCDA 2R14A 3S1VA 1F3EA 2RDWA 4W84A 3VK5A 2X8RA 4MWAB 4NJJA 3U4FA 4W7UA 4PGLA 2FHCA 3ERPA 5A2CA 4RE4A 2NQLA 2ZX7A 1O94A 3GTFA 1QR7A 2CLHA 4L65A 2XDFA 4S38A 1TB3A 3STFA 4H8NA 2Y5EA 2KAUC 4O0KA 2HK0A 4FEZA 2C15A 1VBGA 1DKWA 3CUFA 3HQNA 3FNDA 4MAZA 2HCVA 4EPDC 4CD6A 5FJRA 1IIHA 4C6NA 3W1PA 1R2SA 1R0MA 1KGXA 4X22A 3CV1A 4JY9A 3LY0A 4QEEA 4GYFA 3H24A 3KUMA 1GVEA 2VO5A 5E0KA 4WD0A 4WOQA 1RA5A 5EA9A 2YL8A 2WLZA 1DIEA 2HS6A 4GUGA 2VVNA 3SCVA 4GQBA 4H6EA 1QOPA 3LUTA 2X7VA 5I5RA 2VYOA 4ZE4A 1L6FA 5KMYA 1D7KA 1E40A 2ZC8A 4LUSB 2G41A 3TKFA 3WF3A 4QS6A 1HW6A 5CC6A 5HOSA 2OKTA 4UQ9A 3BJSA 1ESWA 1SFJA 4D6JA 5LHFA 2VT0A 1PIIA 4B3ZA 1DJNA 3RCYA 2FB2A 2H90A 2PD5A 1W9PA 1RY8A 3UA3A 1ISYA 1BPLB 2GVEA 1KWGA 3CWNA 2Y5JA 4NZJA 5REQB 4GI6A 1L8PA 3SURA 3D5HA 3OIHA 3W83A 1ZSXA 3NDZA 4H19A 1PAMA 1OYBA 1KGWA 1KM2A 3T81A 2BV9A 2ZZ4A 1B4EA 4HNCA 1UP0A 4IL0A 1ZP3A 2R24A 2GJXA 1EX5A 1CECA 4DJDA 3K1GA 1TELA 2HE5A 4EE9A 1P48A 1UKOA 2P0OA 1B9BA 2C1IA 1R46A 4H1ZA 1WV2A 1UW9A 5BOOA 2DSWA 3W85A 1QBAA 3CQJA 3W86A 4JTJA 4MZYA 4XKMA 5TBOA 3WQEA 4QISA 1KM5A 2NXGA 2EHHA 3Q67A 3LM7A 3QQ1A 2WV8A 5C2XA 2HXTA 4PE8A 2DY3A 4L9YA 3TU9A 5DCDA 1A5CA 4HZ7A 1F3WA 1EGVA 1UQZA 1C91A 1FVPA 1UH2A 4KFOA 4O10A