4XSMA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with d-talitol
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 113
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4xsmA00
3GNXA 1S5MA 3QXBA 3IUHA 9XIMA 1QT1A 3BWWA 3NGFA 1XLJA 3OBEA 4PGLA 3FVMA 4YTQA 3ITYA 1XLGA 3M0XA 2NQ9A 3AYTA 4K3ZA 1XIHA 4HHMA 4KW2A 4US6A 1XISA 1XLDA 4X61A 8XIMA 2ZDSA 3L23A 4QEEA 1XLFA 3KBJA 3CQIA 7XIMA 4HHLA 4ZB5A 5H6HA 1A0CA 2GVEA 2NQHA 1A0EA 1XYAA 1QTWA 1XP3A 3N4AA 3QYSA 4XSMA 3BDKA 3XISA 3WQOA 1YX1A 4GLEA 5C9ZA 4A8NA 2XISA 4XIAA 5TNVA 5B80A 1XLIA 5EMMA 1QUMA 3CQKA 4HGXA 1XYCA 4YTTA 3VNJA 3QC0A 4PFHA 2X7WA 3KCJA 3IUIA 4QE1A 3VNLA 4YTSA 4GQBA 5H1WA 4W4QA 4X60A 4ZB2A 3AAMA 3AYVA 2GYIA 3KBNA 1XIGA 2GLKA 4YTUA 4QE5A 3M0YA 2G4JA 3KBMA 2J6VA 4A8IA 1XIEA 3M0VA 3JU2A 5EMJA 3CQJA 1XYBA 4OVXA 4XKMA 4DUOA 3QZAA 2XINA 1OADA 1XYMA 1I6NA 3U3HA 1XLBA 4ZB0A 2OU4A 3CWHA 2NQJA 4GJJA 4GJIA 1BXBA 1XYLA 1XIFA 1BXCA 3VNKA 2QULA 9XIAA 1O1HA 5EMLA 6XIAA 3ITVA 3M0MA 3KTCA 3TC3A 4K1GA 3DX5A 4XSLA 3KBWA 4HNOA 5FA5A 1XLHA 2Q02A 2QUMA 4EAYA 1DE5A 3VNMA 1XIMA 4EACA 3VNIA 3U0HA 4ZBCA 5B7ZA 5EMKA 5AVNA 3ITLA 1XICA 4LNCA 4X63A 4QDWA 3P6LA 1XLLA 3C0LA 3AALA 2HK1A 1XLCA 4A8LA 3KCOA 3ITOA 4J4KA 3CNYA 5XINA 3BANA 1XIIA 3CQHA 3KBSA 3P14A 4QDPA 1XIBA 3VYLA 3KWSA 4E3VA 3ITTA 4QE4A 5J8LA 2QW5A 1XIDA 1DE6A 1K77A 3IUDA 1S5NA 3TVAA 3XINA 3XIMA 6XIMA 2HCVA 5I7GA 2XIMA 1XLEA 1D8WA 1DIEA 4G56A 3KBVA 8XIAA 3M0LA 1TZ9A 2ZVRA 3UVAA 5XIMA 2HK0A 3KCLA 1CLKA 1XLKA 2QUNA 5AVHA 3UU0A 4YTRA 1MUWA 2I56A 1I60A 3LMZA 5XIAA 4XISA 3M0HA 1XLMA 1MNZA 2G0WA 2GUBA 3BZGA 3UA4A 3ITXA 4DVOA 1A0DA 3C0QA 1DIDA 4XIMA 2I57A 1XLAA 5B7YA 2X7VA 3C0SA 1XINA 3DBNA 3UA3A 1DXIA 3UXIA 4Q7IA 4A8RA 1GW9A 4QEHA 1XIJA 3BZJA
chains in the Genus database with same CATH superfamily
1J12A 1Q85A 4QGCA 1H50A 4U2YA 4W8BA 3NFUA 3TUUA 1OBAA 1TJ1A 2PDBA 3SIZA 3MKKA 5JBDA 1MZHA 2B31A 4B5UA 2P50A 1J0IA 1Y65A 1CLXA 1K02A 4IGNA 2TRSA 1H09A 1XRTA 3VIOA 4OZOA 4MWAC 3UZXA 1K9EA 4LALA 1EF3A 4JDYA 2RJGA 1R3VA 1W3HA 3JR2A 4IJCA 1Q63A 5H8UA 5HMDA 2V5KA 2GDQA 1CPUA 1XIGA 2BY2A 3VDAA 3EX6A 5LXEA 1MDRA 3LSCA 4O0ZA 1VBJA 4J2MA 1ME9A 3I6EA 2PGEA 4NX0A 3W25A 3LHYA 3NDOA 3URAA 4HYWA 2DJXA 2QUMA 4PC8A 4XZBA 1RJPA 3QY8A 4LYQA 4FNUA 2EXOA 2PTXA 3CTTA 4C6KA 3NO5A 4LUSA 4Q6JA 3CAWA 5XINA 4ES4A 4KCWA 2WAGA 3BGAA 3WQGA 1WBJA 1SZEA 2XYLA 3TKFA 5HWMA 3GE7A 1QHOA 4FR1A 3STCA 4IFOA 1E6PA 2QUVA 4ENLA 1RD5A 3S5NA 1OFRA 2BX7A 3LLDA 3L68A 1WZKA 3ARPA 4NRSA 5A2BA 3P8IA 3G22A 1IZCA 4FOKA 4LAOA 1EJVC 1BG4A 3BWWA 3WDQA 3F4NA 4CU7A 3WYZA 3DYPA 2IQ0A 3MV11 3NPWA 3C56A 1JZ6A 2YBTA 5JUVA 1T96A 3TFCA 3MCMA 1W5PA 4A8NA 3WNKA 1P5BA 2VURA 3MVTA 3ARWA 2AMGA 3VGBA 3B4UA 1BVZA 3O15A 2P76A 1SUXA 5REQA 4PRRA 3RITA 7TAAA 1UZ4A 1FKXA 3ARYA 1UPMB 3JU2A 3AI0A 4ZENA 4JTUA 2NQZA 1WZAA 4MM1A 2J8GA 3G8RA 4RNHA 2HMCA 3HG3A 1TJPA 3IAPA 3E2RA 3C8FA 4LJ3A 1XLHA 5LYRA 2TSYA 4XB3A 3AJ7A 4YYCA 2ZA3A 4U5KA 3E6EA 3AU2A 1QASA 3SJ3A 4QITA 1TR9A 1TPVA 3F2DA 3WDHA 3MZNA 4JPGA 1K7FA 3LPPA 3H7UA 3MSGA 3WNOA 1ENUA 5BMXA 3HOJA 1RA5A 3DFNA 4QAWA 2RGMA 3PULA 1AL8A 1E70M 2BFGA 1N8FA 1ZNNA 3EKGA 1KCXA 3CEUA 1ZBCA 2Y5SA 4LYRA 3GNXA 3IUHA 2P8CA 3APYA 3EMQA 3PB0A 2PGWA 3TYEA 1FWFC 2CLIA 2FGZA 4GABA 1TPWA 4IFKB 3S2CA 3NPXA 1JIBA 3LS9A 2WK2A 3FK4A 1JGIA 2DIEA 1OB0A 3ALGA 3L65A 3UYCA 1K8YA 2V5JA 5CZSA 4UTKA 1BQCA 4J3WA 3OP2A 3R6IA 3GHSA 4ZB2A 5ABFA 3BCFA 3R11A 3WLIA 1OG0A 4KRTA 1P4CA 3U3HA 4X0VA 2XN0A 3R8GA 3V4BA 5JQ9A 3TYAA 2HBXA 4WGHA 5AN7A 1MWOA 3EPNA 4UOJA 2BVWA 2EAWA 2XDFA 3VCCA 4Y9OA 3QFEA 5JBFA 3QOMA 1RD6A 4ADSA 1UMLA 3PS7A 1S5WA 5DELA 4WDWA 1DVJA 3WH6A 4N9BA 5REQB 3CM4A 3IV8A 3W81A 1FA2A 1T8XA 3BGGA 5ABTA 4ZXOA 1RLCL 4NI8A 4EWJA 3SIMA 2QCLA 1GVFA 3HGOA 2C7FA 4LQ1A 3UYIA 4CNOA 1GORA 3P84A 3PZVA 3ARZA 3N4FA 1OY0A 3AMKA 4XBSA 3O63A 1NH6A 3N18A 1TE6A 1NWSA 3WEMA 4FOUA 3Q4DA 4OFCA 1MFUA 4IWWA 1HGWA 4KW2A 4HN8A 4FXSA 2I9EA 1AUSL 1PYMA 3REQB 1KGUA 4QLKA 1EF2A 3JZUA 5KZDA 5C9UA 4YCOA 2XISA 1SW3A 3QPYA 4Z17A 4LB4A 1OHLA 4E4FA 4QE1A 3ZSSA 4HMDA 1PXGA 2GL5A 1M41A 5FIPA 3A22A 4IL2A 2IMRA 2YL6A 3S47A 3LV6A 4A22A 4A8IA 4ZQNA 4IL0A 3RX2A 4BI7A 1TMHA 1E72M 2FMOA 1CGVA 3F7JA 3WK1A 2QULA 2OX1A 3TTEA 4US5A 3QQ1A 3B0YA 3W01A 3W73A 2BXVA 3FKRA 5FEPA 3IJDA 2G5WA 4FB7A 4LVBA 2CLLA 1KQZA 5DANA 4FXRA 3H2OA 1XXXA 1RHCA 1AMKA 3SUVA 4UC5A 4H7CA 5JBEA 3I3EA 3OO2A 2VTFA 4KT2A 5ABFB 1W0MA 1Q5MA 1FWDC 3DN5A 2CITA 3OPSA 4E3VA 1OD8A 3BLEA 3U57A 4YPJA 5C9WA 1M01A 1Q8AA 1Q7MA 5CPOA 3RX3A 3ZQ9A 4XD5A 1M03A 3GTFA 3NVTA 4HSHA 4I7VA 3VIMA 1LORA 1G01A 1Q66A 2QUUA 3M46A 1X6UA 4EAMA 3L4UA 5DXYA 3LHTA 4R27A 2W92A 4H01A 1UCWA 4UMAA 3T1GA 2FLIA 4P2VA 4BWLC 1J2WA 4D8AA 1L6WA 4HU0A 1C7TA 1ONXA 1XM3A 4PSRA 3PTQA 4X60A 3B04A 1RV8A 3PUOA 3M0YA 3FS2A 2V3FA 1I4NA 2JQXA 2D2JA 4GXMA 3GVGA 2E6YA 3ZXWA 4KESA 3W83A 3B9OA 1FWHC 3EKZA 4UR8A 1GZ1A 2PGFA 1YPIA 3IIXA 4R5EA 3U4AA 2VR2A 1SW0A 5JMUA 5HOSA 1BSIA 4TIMA 1SJAA 2R82A 4NXSA 3VMPA 2VNCA 3MMWA 3FJLA 3SSJA 1XICA 2GPTA 4AY7A 4LVAA 1E6QM 2NQLA 1GKQA 4G1KA 2OMAA 1W1TA 2JFEX 2EG8A 3AXXA 4XZ9A 2PDPA 4AEEA 3KFTA 3CO8A 2HSAA 2XVNA 4BEUA 3V7PA 2Y70A 1JEZA 2A21A 3DENA 1W37A 2R9RA 3MW7A 4GVHA 3GBEA 5I3HA 2NSXA 2DT1A 4WXYA 4U10A 1M7OA 3FOKA 1UW9A 4MJ4A 5FEWA 4HHMA 2G37A 3SEPA 1P0KA 4LUYA 4ZSUA 3RPDA 1JZ8A 1I2QA 3PNUA 1JQXA 3NQ8A 1WKDA 3SQSA 1V6VA 4MADA 1V3LA 4FPSA 1GVYA 1XFBA 4X2RA 1HN1A 4PUDA 5DFAA 4HGXA 4G7EA 3STFA 3ZMRA 3AU6A 1AH0A 1LUCB 3T0DA 1UH2A 3K46A 5IM51 3VGGA 4JFVA 1AJ2A 2Z2UA 4IMGA 1ME8A 1XH0A 3L2IA 1KXTA 1EYEA 1UC5A 3AIRA 2VEFA 1TPC1 3T9PA 4JIRA 4DXKA 1BRLA 1ADOA 1RK6A 2PPGA 4Q8MA 4O18A 4ZBCA 4AD5A 4MY9A 3CIVA 4M6QA 1KFCA 3BAIA 1R2SA 1PKMA 3GRIA 1D7FA 4HCDA 4P5UA 3MVIA 1OX4B 1XJBA 2V2DA 4WF7A 2ISWA 3N34A 1XBXA 1IGSA 3P61A 4UQEA 3TP4A 2PE4A 1XSKA 4S2CA 5K2ZA 2PODA 1MQQA 1UQYA 2ZZ6A 1K7XA 4DJFA 5HMFA 4MYAA 4JIIX 1PZ2A 3QF0A 1RY0A 1RVKA 2Y6ZA 1HL9A 3QHMA 4H4IA 4IUOA 1MUWA 1XCWA 1IE7C 3COTA 1CZ1A 3VOFA 4KERA 3RM4A 3E96A 4B5VA 4QG9A 2Z27A 1DPMA 2J88A 3BOFA 4Y6GA 2Z1SA 3OLDA 2DZBA 2NV9A 4M6VA 3IJ8A 1P6WA 4J27A 1Q65A 2JBMA 5CGMA 3MI2A 2FZ9A 3DFHA 3VI2A 1EO5A 3WQOA 4NZFA 3TZFA 1XHGA 3EKLA 3GSMA 1BKHA 4UQ9A 3L67A 1Q6LA 1ZQ5A 3EOOA 4OU1A 4O0QA 3W37A 3VINA 3NQAA 1UD3A 4IX2A 3HTWA 5FI8A 1F6PA 3GXPA 1XYLA 2PBOA 3DC0A 5HR6A 3EWBX 4F79A 4GYJA 1TV2A 3BQ6A 1KW1A 3NQMA 4JTAA 1BSLA 1L0PA 3WD4A 4EAYA 3QOKA 1Q8JA 2YCLA 3AZRA 3OU8A 3WQEA 1OFDA 3UCDA 2H6RA 3RR1A 3G3MA 1EJ7L 4S3GA 1R47A 2TODA 4A2SA 3RR4A 3KP1A 1UZ1A 3E3HA 1AL7A 1W5OA 1JUEA 2WMHA 2CZDA 4XV0A 3U7VA 1XL9A 1FX6A 5I3KA 1W91A 3NAVA 4YL2A 2CXEA 4I5UA 1CLKA 1CB7B 2YJQA 3CUIA 3AHVA 4LY4A 4H83A 1TA3B 1MQRA 2WVVB 2PTDA 1A0DA 2Y24A 1XBVA 1OYBA 3BLLA 3KL3A 4DZ5A 1GOIA 5AYXA 1GYLA 2RUSA 4MB5A 1GJUA 4TR9A 2GGHA 1DJIA 3TYUA 3KHDA 2FIQA 3L4TA 4AZCA 2GVEA 3C3UA 3W76A 1ZB5A 4WXZA 4FLQA 2PWFA 4D8LA 3IUIA 2QDHA 3W2NA 4LUJA 3B8VA 4UIOA 3R89A 4BQ5A 3MI3A 3AYVA 4F40A 3GLCA 3GTHA 2KX9A 2I9UA 4YTUA 1CECA 2V5BA 5AYBA 1OFQA 4LF1A 4HU4A 2IKIA 4L4PA 1VHCA 4HP5A 2X8RA 3IGHX 3EWUA 3LV5A 4E8DA 5FA5A 1K03A 1QAPA 1S2AA 4HQVA 4NZJA 1PDZA 4RNJA 2EGZA 1D3GA 1CGYA 3CXOA 3F1QA 3VKBA 2I17A 1TPEA 1AQHA 4DAFA 4H1ZA 1OGSA 1J11A 4OIFA 1A3WA 1A4MA 3WQ6A 3SM0A 5AHEA 1NVMA 2OKTA 1IEIA 4F2TA 5HJYA 4Q7NA 1P0DA 1OT1A 1M3UA 3V0UA 4H9MA 4QG6A 3U2CA 1US2A 4Q4OA 3T40A 2G0WA 1MNZA 3DI0A 4H9TA 1VQTA 3APGA 4Q7IA 4HZ7A 3J7HA 4F48A 3H7RA 1HJQA 1MFVA 4MWAA 5HNUA 3WNPA 1I1WA 3LCFA 3AOFA 9RUBA 4W7UA 5HR7A 2FFIA 3IVTA 3VD4A 2HDJA 2E1DA 2ISDA 3W0KA 4FNSA 1UD8A 1KD0A 3W70A 2XFWA 1T41A 3L4XA 3NL3A 4FA3A 2FB2A 4Q4KA 1EHNA 3IJ6A 4DWSC 5CPTA 3U5UA 3ZYZA 4N4PA 3VNMA 3MMTA 4PTDA 4HNNA 1XCFA 2C1IA 4UTFA 1QNVA 2QHAA 3NXLA 4X63A 3RFAA 2DZWA 4GXPA 1E4NA 1IIGA 2UY4A 3H2FA 4LYKA 3CL7A 3IVUA 4D1IA 2D20A 2Y8KA 3H2MA 2A7PA 1OF8A 4JTQA 4AY1A 3LQGA 2PWEA 3PZUA 3WBEA 2NX3A 1AQFA 5DMMA 3MJYA 3ABSA 4HHPA 4OKDA 3ZT6A 1LT8A 2A6LA 1EX5A 1UMYA 2VMFA 3PM6A 3C0SA 2WCGA 4JBRA 4W4QA 1L8NA 3ARVA 3C2FA 3ECQA 3U5YA 5E9AA 1VEOA 3OLGA 3VOGA 3GUWA 4P7LA 3POHA 1PX8A 2XIOA 5MHBA 1GHRA 1Q6CA 2NVCA 1TVNA 5HULA 4L4OA 2PWDA 5CBBA 4Z1AA 3BW3A 4GIYA 4ZEPA 1UJPA 3CO4A 3PFMA 4PA8A 2QVHA 4XKYB 3W87A 5EMUA 1ODZA 1CXKA 4CU6A 5IHSA 4TMBA 2FJUB 4J1OA 2F84A 4ORIA 2PC4A 2DUXA 3SFKA 5C9RA 3FJ4A 4MWAB 3GG1A 5CAHA 4S3DA 3S6TA 4UB9A 1R87A 3S2LA 3P8JA 1RBOB 1HIZA 3N6JA 3WK2A 1G9HA 2X0SA 2V6AA 4DRSA 3M7SA 3NURA 1SZNA 3VIIA 2VGFA 2ZXDA 2J27A 2PAJA 3ICJA 1A5BA 5CZJA 2DIKA 4MSSA 2Y1HA 3GNOA 1W8SA 1L6YA 1S5MA 3U2EA 1ZS2A 2VVNA 4DZAA 3LPGA 1DHKA 4PTNA 1HJWA 1QMLA 3EMZA 5CC5A 2QCDA 3WNNA 4TVUA 3N04A 3HJEA 3RU8X 3M47A 3T0BA 3T42A 1HUVA 5H8PA 1PYFA 1LLZA 3W3OA 5C2GA 2WVUA 3G1RA 3GYCA 1R6WA 3F03K 2ZUVA 5FL1A 5L9FA 3B97A 1KM6A 3UJRA 3UWUA 3NL5A 3KLLA 1YBQB 2QLYA 1MNSA 2PS2A 1TV8A 4Z2LA 2ZTKA 2E5CA 4O10A 1OK6A 4WR3A 4S39A 1RBLA 4MWAE 4DI8A 4OBSA 5A8PA 1WO2A 2CFFA 3OBAA 1VFMA 1PB0A 1XRFA 3IIOA 4FNRA 4LAZA 3K13A 5DXXA 1BQGA 1M65A 4WSJA 3IJ7A 3LRMA 5I00A 1K8ZA 4ZL1A 2OO0A 2Z1KA 3LHZA 3EDEA 5I78A 1UIPA 3ONCA 2CETA 4Q4MA 5D33A 1RCQA 1RCOB 5IDZA 4DF2A 1KRAC 2VZVA 3H2NA 5I7GA 3TYCA 1TUXA 4GH3A 1PHWA 5A6SA 3P60A 4EOUA 3C61A 3CUHA 3KCLA 2C14A 3W7HA 2R6OA 1TB3A 3A4JA 5FJOA 4C6PA 4TV6A 4H8HA 4NILA 3CL8A 3JS3A 3VX0A 1AQMA 4F8XA 5DMYA 4O17A 5DCEA 3W85A 1U83A 1V0MA 3UESA 3KOFA 3TJLA 1GQIA 3K1DA 3GDKA 3N12A 3ZLHA 2R1KA 3ZT5A 3BMXA 1K4HA 2QF7A 3FYOA 5H1WA 1B1YA 5I79A 4CQ9A 1ITQA 2OWCA 1U5JA 3O1NA 4DX3A 5A8OA 3AMGA 5AC6A 1LT7A 1POKA 3S5ZA 2WZMA 1UKTA 2NT1A 3BV7A 4HPGA 4EACA 2NV2A 1KC7A 3I6RA 3EXTA 4AVFA 1YE6A 3UWVA 2V30A 2YA0A 1XDMA 5DQPA 3HB9A 1XLLA 3C0LA 3TOYA 4O8RA 4YWSA 4N9CA 1IT8A 4YCPA 2X41A 4RR4A 4Z0SA 2YB4A 1KA9F 4H9UA 1EUAA 3MC5A 2HCVA 3V1HA 3SRHA 4R9XA 5AZ0A 1DWAM 1T0OA 1SVDA 4REQB 3TW9A 4PCNA 2GUYA 1C91A 2YL9A 4QFUA 1T8QA 4QP0A 1Z8AA 2BOGX 3M6YA 3U6WA 2BGQA 3WNLA 3O6DA 4ZQMA 2YA1A 5EU9A 4AYGA 4C6NA 4G9PA 4RK8A 3LCWA 5BRPA 1VF8A 1QI2A 3WBAA 3ZWTA 4A21A 2AQVA 3IGUA 3W1MA 4WCJA 3CUFA 3S8HA 4AZ6A 1PHQA 3ZSTA 2YIHA 4YN5A 3HV8A 4C6IA 3DUGA 1V6XA 4AB4A 3P80A 4MUZA 2OEKA 5RUBA 2D24A 2OTDA 4B15A 4ZOCA 2EG7A 3EZ4A 3HBLA 3VIJA 4PODA 3SGGA 5D9OA 3OHMB 2QUTA 3THAA 2UBPC 2Q8XA 4PL2A 1IV8A 3N2CA 2V38A 3P14A 3S5YA 1SZFA 4BQ2A 4CQAA 5FD0A 2VRJA 3SSZA 2O4MA 2BGNE 4Q8OA 1R5YA 2PCQA 4ICMA 1WUFA 1PJ9A 4LC8A 5BNKA 3GXNA 1O4UA 1C8VA 2WMGA 4RZ4A 5CC7A 7REQA 4QJ3B 3WF4A 2VR4A 3UT0A 3W24A 4IHCA 3GW0A 3PBMA 5BRQA 4NIRA 3U7BA 2PUZA 1H1NA 1RA0A 5HK4A 1G67A 3KWXA 4C5YA 1XYFA 3W1NA 3E2SA 1SM9A 1IXNA 2BVDA 1FY6A 5I3FA 1MSSA 3MHUA 5ABEA 1QPOA 2WQPA 3GDLA 2BY1A 3W88A 4H7VA 1K9DA 3DHFA 4XBJA 3CV1A 4IPIA 1KBIA 4NU7A 3KCJA 2BHUA 1ZRQA 8TIMA 3TU9A 3CUZA 3OA5A 2CWXA 3WF0A 3VO0A 2G4JA 2TMDA 4HJFA 4AFYA 2OWWA 4WOQA 2NXIA 3UJSA 2EKGA 1A5KC 3W23A 2HS8A 4B92A 3AXIA 1CENA 4Z2JA 1FTXA 4BKNA 1ODUA 2A7NA 5C5YA 1EQCA 3FNDA 3UNDA 1HF6A 3K8KA 1EC8A 4M1RA 4PH6A 4QIUA 4XTDA 1W9UA 1LJYA 2HK1A 3MYOA 4PFMA 1LQ0A 2GGIA 3NQBA 2V81A 2XWEA 2ZRUA 2OYMA 3UPWA 3QR3A 5MF5A 4GZJA 5CJ5A 4BZYA 3OVQA 1EZWA 3CWOX 4K1WA 3FA3A 4M29A 1XRVA 4CN6A 3PJWA 2OZTA 1P0EA 3A13A 3RM8A 2W4XA 4FO4A 3PJTA 4DVOA 2GJRA 2VCCA 3CUJA 5IDIA 4JDBA 1DJZA 3E02A 1XDJA 1OZMA 4QJ1A 5EPDA 1O95A 2QZRA 2VRKA 1KFWA 2WYSA 2IUZA 4DJDC 3WBWA 1MZRA 4MDPA 2PDXA 2HNHA 4PBEA 1A0EA 3NYDA 3FN9A 3KLKA 1LOQA 2ZXQA 3A6OA 1QO2A 4AIEA 1GEQA 4AMCA 5LA2A 5C70A 1DQWA 1YMYA 5ECUA 1JRBA 1UP3A 4O16A 4UMBA 5IRPA 5I5RA 5EMJA 3N11A 3SQMA 3N17A 2D3LA 3M41A 3APTA 4JX4A 2CLMA 2GSEA 4B5XA 1GT8A 1U33A 1GWJA 1J10A 1XUZA 4UTWC 4OHQA 3IAQA 5A3HA 4MFEA 4JHZA 1GOWA 3P82A 4D6IA 1BTCA 2JF7A 4NNBA 3ITOA 3G1YA 4DYJA 4EK7A 5ENLA 2IW0A 4BHYA 2BY3A 3BL3A 4H8NA 1M9HA 2C6QA 2G50A 1VKFA 5BMWA 4F2UA 4NKCA 1DIEA 3W7NA 3CPGA 2A7RA 1TJ0A 4PMNA 1VYRA 4WUIA 5EA9A 3CUXA 3EMCA 4HD5A 3CB3A 2D69A 3I7RA 1BXCA 3SECA 4DLFA 4JCLA 1C8QA 1AK5A 4UR9A 1JDCA 3NEVA 4HT3A 4HU8A 5C55A 1W1B1 1XLFA 1KR1A 1LYXA 2PRMA 4KMQA 3GIYA 8CGTA 2WNQA 3RUBL 5FESA 4LRTA 3UWZA 2ACQA 4JGDA 3CH9A 5BYWA 3CIXA 4FX8A 3GZ3A 1DTNA 4FF5A 1NIUA 3VKJA 5CPSA 5FJRA 1ELSA 4GJIA 2GUUA 2HJPA 3PWGA 1FH8A 3ITVA 4DB7A 1M53A 3S2MA 3EWWA 4AH7A 5A8GA 3VXGA 3W7OA 4PBGA 1XIMA 2JKPA 4KBXA 1OIMA 1XPGA 1OFEA 3W86A 1IEXA 3UWYA 3AHZA 3MS8A 3URNA 4UQBA 1KQYA 1AJZA 1W9VA 4ADTA 1WV2A 1OFBA 2D73A 5M1TA 4M56A 3CHVA 3OVRA 1EDQA 1YNPA 8RUCA 1HNYA 2AKZA 5FSDC 2XVLA 2HPMA 5M2FX 2XVPA 4GRSA 3GKAA 3P5ZA 4W89A 1PCWA 5C9XA 2PF0A 1RPKA 1GUVA 2XFYA 3BMWA 5AC5A 3EEGA 3SRFA 2J9ZA 2DSZA 4H9ZA 1B30A 2FTWA 4QNEA 3WZ0E 3RMEA 3FA4A 4GVFA 1GOOA 3D6NA 3WUFA 3M0KA 4YHEA 3K30A 3UETA 3GG7A 1J4EA 2F61A 1QTWA 4BF7A 1DL3A 5CXPA 4GYKA 1KR0A 2O56A 4YTTA 1V6TA 2PD9A 1TTJA 2IXUA 5KINA 3AMLA 1E55A 2QJJA 2VJXA 4DWSA 3PTMA 3BLPX 1C8XA 2J6VA 3RF9A 1DXEA 3UR5A 1KTBA 3CMJA 5I3JA 4UNIA 2VX7A 3IRDA 1EX1A 1FBAA 3WKZA 1GOMA 1N8IA 4BR1A 1QNOA 1KCZA 3PUDA 1BYAA 3CAQA 1VD6A 3N9RA 4RXFA 2E67A 3ITLA 5U4NA 3CJPA 4MLJA 3GD6A 5I3GA 1XGZA 4KWOA 3EWCA 2BV9A 4BF9A 1LZOA 4FNQA 1BGAA 2EG6A 4L1WA 5FAGA 3MP5A 2WVTA 3M5XA 4RV3A 1QJWA 3VILA 2W3ZA 2PBGA 4LAUA 3U2ZA 1I75A 3GC5A 1C8YA 4HSNA 1LM1A 1QDSA 3OLEA 4FLOA 4XZHA 1QNPA 1SPQA 4MAZA 1UA7A 5K4ZA 5HWNA 3MYPA 4Q4QA 4QEHA 1C90A 3ARTA 3GTNA 4L1XA 1V6YA 3R8RA 3L12A 4Q4RA 1Q6DA 3KOWA 3BUVA 3TV8A 3NZ1A 3THCA 4GNKB 1TIWA 5D04C 1KM3A 4H9YA 4GH1A 1E51A 4IQEA 3QM3A 4DBEA 3TCEA 1RY8A 2CIPA 4GI4A 4JTGA 2X1TA 1RQEA 4JQ4A 1F6KA 3QC0A 3WLJA 4PUWA 1A5OC 1EEPA 3LB0A 3O05A 2XH0A 3UJEA 1YTDA 1PX4A 3KDOA 3BW2A 3AS1A 4PN2A 5LNRA 4X9SA 1HJXA 4CD7A 5DX7A 4B2DD 4O11A 3QH2A 2NUXA 2RKXA 4GI8A 3OVGA 1Q6QA 3MUCA 3SZ8A 1L6SA 2AGTA 3WDIA 5F4SA 4GBUA 4PMYA 1VPXA 1O68A 2ZX6A 3OJGA 2ZWZA 3KBSA 3NM3A 2FTPA 2FZ8A 3USBA 4DWSB 1OK4A 4H6RA 4DJEC 4X3ZA 4J3VA 1ICPA 2GGJA 1XIDA 1E0WA 2G41A 2Q01A 5GNZA 4PBFA 1GOQA 1NF0A 5LNSA 1DORA 2FKPA 2GQ8A 3AROA 1K4GA 2BGSA 3V36A 5K3VA 4EIVA 2HXTA 3BSGA 2XU2A 4FLRA 2D2OA 4RDVA 4JEQA 4FS9A 1SFJA 2DIJA 5GPRA 2D22A 1JFXA 1EOMA 4NAFA 1M7PA 3OGSA 2P0IA 4C1LA 3EX2A 4XX6A 1R9ZA 2DP3A 2QAFA 4GFIA 5B80A 3WELA 3CQKA 5D05A 1L2QA 3GC4A 1E3ZA 2ZZ1A 1JFHA 2LLEA 4YWIA 1PIGA 4LVFA 2NVDA 3DGBA 2WMIA 4S3AA 1JZ5A 1AW5A 2R24A 1LF1A 1FWCC 3U2OA 1W8GA 2R1PA 1XLBA 1LROA 3C2VA 4N6EA 4DHGA 1OJXA 1EC7A 2ZIDA 4GI9A 2VL4A 3LCLA 3VIFA 1W17A 3RPTA 2DZTA 4ZTXA 2VZOA 2P8BA 2ISVA 4W93A 2POTA 1TKKA 3L4WA 1DYSA 4XUYA 4HA1A 3QZEA 1R9YA 1IEVA 3VA8A 2JKAA 1Z7AA 4Y8FA 2D3NA 1QOXA 4IT1A 2QCGA 2D0GA 1SSDA 3UWWA 2BOEX 3TZNA 5TIMA 3N19B 3C2EA 3RX4A 2PRLA 4DBUA 1H51A 1GTEA 1UYQA 2ZZ4A 4IZGA 4I8DA 3KRUA 3S1GA 3A3XA 4XIMA 1DIDA 2OSWA 1T5AA 4Y9NA 3W2JA 2O55A 1UJQA 4LS1A 3ERPA 4Z1YA 4AUBA 5FF2A 3W71A 2X40A 1TSIA 3OQ8A 1YXCA 4V1YA 1D9EA 4JL2A 2Z1XA 1XYAA 4O28A 2CKRA 4HZMA 5HBFA 2AGKA 3OBKA 4N9EA 1RLDA 4JY8A 1TPB1 2BODX 3CZJA 4P8UA 2F2KA 2VRQA 1E56A 1JQVA 1W54A 1LRTA 4WY0A 5I09A 4I3GA 4OVXA 4DYKA 5HPCA 3S9YA 3ZZ1A 4B5NA 4ZB0A 4GUFA 2GK1A 2VXNA 3HG4A 4QLJA 4MNMA 4QLLA 5EMYA 1Z6KA 4RE0A 3R0DA 3G18A 2J78A 2YOCA 5A8NA 2X1SA 3D5HA 5DMLA 3MB9A 1QNQA 1Y8BA 1FXPA 3FAWA 1NWRA 1PPIA 1FWTA 1V4YA 2WZEA 3L2LA 2DT3A 1X97A 3UF9A 4LVDA 2RHGA 2G3FA 1JGMA 1O5QA 4K37A 3O2LA 5A8MA 2WMIB 1V7AA 4XWUA 1L6GA 4LWWA 2WSYA 2ZRXA 4KEZA 1WOBA 1NJJA 1H2JA 1EXBA 1BEUA 1IZKA 1YQ2A 3VCNA 3IV3A 2ZUSA 1W3IA 4GUGA 1XC6A 4DBSA 1SQ7A 1VLWA 3SCVA 4FALA 4YTQA 3FVMA 1A47A 1J18A 1W1VA 3H21A 4PULA 2VC9A 4ROQA 2E9LA 4O15A 3MWAA 3W7KA 1RCXB 4E38A 3I65A 3N4AA 4DELA 3DXIA 1XP3A 1XX1A 2ALRA 4RXGA 4Q8NA 1LRNA 2O4QA 4L56A 4O14A 3S1VA 4AIUA 1R3TA 1VFFA 2GDUA 4GOAA 1UD5A 3B0UX 4RE3A 2AQWA 4F3HA 2CHOA 1ZU8A 2IPFA 4ZE4A 1XYBA 3WJSA 3QZAA 1IR1A 3PTDA 4JXCA 2R94A 1CEOA 5FJUA 2J7GA 2J6XA 3YPIA 2NXGA 3PPCA 5ABGA 1NM9A 4IFRA 3UZYA 2PDFA 3ZIZA 2ON3A 5LA1A 1CGTA 3NNTA 3CQ0A 4QDWA 1W1YA 4Q6XA 1MUCA 2ZUUA 1NEYA 3NQ2A 1GW1A 2WM1A 1OQFA 4JTEA 1Q6GA 2QJNA 4AYSA 2E5DA 4UTJA 1I60A 1US3A 1UP0A 3DFTA 3LHWA 1MUMA 1JYWA 4QAIA 1ZUAX 1AFSA 3QR1A 2OYKA 3VIGA 4IISA 3OBEA 2ALDA 4HPXA 5DY2A 3GXTA 3ZVHA 4JIHA 4UTHA 4JAWA 2IQTA 1Q2RA 2ACRA 3OZYA 3T8QA 2NXHA 1I9CB 3VC6A 1QPKA 3EPMA 4L4MA 4K6AA 4FNPA 3MUXA 3DG6A 4QXIA 3OW1A 1DXFA 3TMQA 1FCBA 4LV9A 2VD8A 2P10A 3GG0A 1RJQA 2PMQA 4JEJA 3FKKA 5G4HC 4C7FA 2XSBA 3E9AA 1A50A 3W1AA 2F6KA 4MF4A 4QJ4B 2BVTA 1W2PA 3GUGA 2YX0A 3G1XA 2Q02A 3VUSA 4GC3A 5HQMA 1TTIA 1M7JA 1MW1A 1YXDA 5CSYA 4GY7A 1B4EA 1CXHA 4PUKA 3AQUA 3E0VA 1HKIA 2MUCA 4E5TA 6XIMA 4M5PA 5A6BA 2QJGA 2ZVRA 3H8AA 4NP7A 3RNDA 4JIQA 1PL9A 3VNYA 4Q8VA 1XLMA 4PMJA 3JRKA 4DJDA 3PY2A 1ZJHA 4KEMA 4D6JA 1F4AA 4E4UA 2XGBA 3CWNA 3R0KA 4OT7A 1TWIA 1VC4A 4JQ1A 4H41A 3RHGA 3MUZ1 3PSWA 1Z41A 4PRTA 1KM0A 1DJQA 4E6MA 1XD1A 1HKVA 4Q8QA 3LLFA 1R7OA 4XAYA 3ZS4A 4MKVA 1UH4A 1GCYA 3IS4A 1WDWA 4CVUA 4PFHA 3EA3A 4AZ5A 1R3QA 3ABOA 5FJTA 1DWFM 2CESA 1NAL1 3CZKA 4NRRA 2NW0A 4AD0A 1YADA 1GQJA 1IXQA 1A5SA 4NXKA 3I4KA 3WDPP 5HA7A 4Z08A 4AZGA 3KTSA 1A5CA 3L4ZA 2X09A 3ZVHB 5T8GA 2NWSA 3CB8A 2OO6A 3WUGA 1SZRA 5HUOA 3GU2A 1UWQA 3HU7A 2DUAA 3LYEA 4J4KA 3ZWSA 1J93A 3LXCA 3BMVA 1UA3A 2O0TA 4R53A 4B91A 4J9JA 4EVZA 4KPLA 3NTYA 1PIFA 4IPNB 5K9XA 4K38A 1TZ9A 3CHEA 3PJUA 4DN1A 4WJEA 3LTYA 2HK0A 1Q2SA 4UZSA 2DSVA 2I56A 5CPMA 1T40A 1EZ2A 4Q8PA 1Q7ZA 2WJDA 4WRHA 1UZHA 1VHNA 3BG3A 3BH4A 1QHZA 1LDCA 3GU1A 2ZYFA 4W84A 1JZ3A 2J62A 5CGTA 4MY1A 3TW6A 1E6SM 3UXAA 3QYQA 3TXZA 1VCFA 1JAEA 1AD1A 4RNFA 3G1DA 3R8HA 3WD0A 3C3NA 4QE5A 1RQBA 2R91A 4UQAA 2J9XA 3CEPA 5A2CA 1ZY9A 2J7EA 1E9ZB 4KEUA 2VFGA 5E1QA 1O60A 1RALA 4GY1A 2RJHA 3SGUA 2GJNA 3SURA 1QO5A 3ITGA 2NLIA 3TA9A 4OTKA 4S3EA 1EB3A 3UY7A 3L21A 1YNYA 1UQZA 4W9TA 3GH7A 2E7FA 4F0SA 5I3IA 4KFNA 4O1AA 3NSMA 4GY0A 3W7IA 2CZFA 3VKAA 5HPOA 1QWKA 5D9PA 3KCOA 2ICSA 2BHZA 2UWFA 3URQA 3E49A 1RP9A 5I02A 2EPMX 4LGXA 3P74A 1JI1A 5A5WA 3I7QA 3WQDA 3AIQA 4L64A 1LL6A 5F2LA 1EPXA 4AWTA 1GVIA 3SRKA 1CGXA 4C1KA 4O4WA 3C5QA 1TELA 3L5LA 3B4YA 4DZIA 2JK2A 1W1ZA 5FF0A 3P0XA 2NUWA 3UVIA 1EC9A 3P3BA 4B9YA 3GH5A 9XIMA 1IXPA 1QT1A 3LHUA 4K7VA 2ANUA 4MPKA 2WBGA 4GIRA 4C6OA 2XH4A 1OF6A 1TX2A 4FAMA 4QEEA 3CZLA 3DBPA 4ZO7A 1MDLA 1B90A 2OPJA 4J3UA 3W53A 3GNPA 3MHGA 1U5VA 2VUYA 3VABA 2INFA 3ALFA 1XH2A 1F73A 1J0HA 3QY6A 3H12A 4A29A 1GONA 1ZJAA 5F2GA 3HPXA 3LGEA 2VCBA 2Z7KA 1KWKA 3RJYA 2Z00A 3N3MA 3R2GA 1ITXA 2FJKA 3R4IA 3RCMA 4I6VA 3H70A 1OZQA 4XZLX 3OZPA 4HMNA 2YPIA 4CQDA 2DZPA 2WMKA 5HATA 1NFBA 4E4PA 5LNUA 3NQDA 5BROA 2ODOA 2ZA1A 2Y4SA 4DJFC 1UBPC 4A8LA 4M7TA 4AX6A 1G1YA 4NNCA 5ABHA 2QMKA 4J7RA 3DKLA 3W72A 3VTRA 2G96A 2OQYA 2I5QA 3UR8A 3MDUA 4Q22A 4UUIA 3M16A 3P2VA 3LZ3A 2OODA 4Z42C 2YR1A 3S5SA 1ZL1A 1KGXA 4W7WA 2AKMA 1LLWA 1DXIA 4MLRA 3CZ8A 3M07A 4QBXA 3O16A 5FAJA 4PB5A 2F6UA 3VD3A 1O12A 2JGQA 1Y5XA 3EWXA 1EJWC 1WQ5A 1A0CA 4P7OA 5EKYA 4YVVA 2WZIA 3GNRA 3V0SA 5GNYA 3BLOA 1UIOA 5DBUA 1H1YA 2ZADA 3RILA 1RH9A 4UTTA 2YXGA 3W82A 3QFWA 3CC1A 4CNSA 3UWQA 2WVSA 1FVPA 3NG3A 2GVGA 3SY8A 4M81A 4XVDA 6ALDA 4IM4A 1Q13A 2FPTA 3DYOA 4B3KA 3VNKA 3VMOA 3NM1A 3LM7A 2PFHA 4J3TA 2FHCA 1HXJA 2CU0A 3LZ5A 1D8CA 5DO8A 5L6UA 5LNVA 4PB4A 1ZBWA 5JH2A 4F2BA 1YDYA 3OZOA 2JIEA 2CHNA 4MTVA 1YDOA 1MXDA 3B3DA 5MKGA 1CWYA 2VFFA 1KCLA 5HWJA 4U31A 4ROPA 2DZXA 2QCNA 2F7FA 2XIMA 3OYZA 4LCRA 4ACZA 2ISSA 4MMWA 4JCMA 2QMJA 3N29A 3QY7A 3TYDA 3RXZA 5EYWA 1SMAA 2HEJA 3SI9A 3D0CA 4R34A 4MZ1A 2VGGA 2ZE0A 2A4AA 1E0TA 4O54A 3AS0A 5AB3A 3W7CA 4PYSA 2NX9A 3IK2A 1W9DM 4AEFA 4GI6A 4GUJA 1VENA 2O9RA 3DHDA 1V6UA 2VEGA 2E25A 4UNKA 1TQJA 3MSDA 1R2TA 5H2ZA 2Y62A 1Q45A 1A3HA 2C1HA 1DJGA 4L5ZA 3L0NA 3P5YA 3VC5A 3TJXA 3BLDA 3IANA 5G1MA 1JYXA 4JTRA 3KBMA 1CXLA 3CQJA 1JDAA 2GQAA 4CCZA 5H91A 3QMSA 1QNRA 3KL5A 1GYMA 4JYEA 1EO7A 1CW2A 3RLGA 1LL7A 4NAEA 1VPYA 3EWDA 5BWFA 5LIWX 5FACA 2WWDA 1KM5A 1ALDA 3T2QA 1GNXA 1EGVA 5A6TC 2YYTA 4HIBA 2QVNA 1KFLA 1S38A 5U7SA 3WDJA 4C1NA 4EPBC 2XHYA 4ZFCA 4UTMA 2FVMA 4E8CA 1ISYA 6A3HA 3PWIA 4Q8WA 1VIWA 1G7VA 1TRIA 3FGCA 2WSKA 1SZGA 2UV8G 4NVTA 2WLYA 3QW3A 1B9ZA 2VFHA 2Y7EA 4AD4A 2HE8A 3KZSA 4ZQPA 4QM1A 1XDLA 4LXFA 4C6QA 3ITYA 2FHFA 1P7TB 3K2GA 1VLIA 5KZEA 2WSQA 3CQIA 1HG3A 4J3XA 1SFTA 4LC6A 2CERA 4LRSA 1H0IA 1X8FA 4GKTA 4M19A 2YFOA 4CU8A 4LB3A 1R86A 2YL5A 4L7ZA 4WGXA 3LMYA 3VM5A 5CSUA 4ACZB 4JKKA 4CNNA 1JNDA 1F8MA 1V0KA 3Q37A 3A23A 2OKOA 4C6JA 1H7OA 2GVYA 2POZA 3PR2A 3UGRA 3S6DA 3RMJA 4QDMA 2DPEA 1E5NA 2NWRA 4CNTA 2YDSA 2VWSA 2GWNA 4GJ1A 1WKYA 4FIRA 4IGHA 3S3GA 2WNWA 2A6NA 1SMDA 1XQKA 4JTCA 2WBKA 4YXGA 1L2UA 1XLCA 4XK2A 4Z1BA 1IWBA 3CYJA 4C6FA 3TYZA 1LG2A 1MXGA 1M68A 1ML1A 3FAXA 2DH2A 1TMQA 3ABZA 4INFA 2FB3A 3R13A 1UHVA 1KRBC 3UQNA 3LX9A 2XVGA 2QQ6A 4PTVA 2IQDA 4D71A 1JI2A 2CLKA 4GQ0A 2QCHA 4W8AA 2VP8A 3T8LA 4S1FA 4GINA 4HNLA 4NAEB 4K7YA 4DYEA 1K8XA 3HPSA 3C0JA 4LBUA 1EPVA 2CKSA 3FJ6A 1A49A 4GO8A 3SADA 3GU9A 3LUTA 2PDUA 1R85A 3S1UA 3W07A 3FXYA 2HISA 1AW1A 2QJIA 4OBRA 1PX3A 1HL8A 2J7FA 4TO8A 3KRZA 1QCWA 1EBHA 1GZGA 4R3UA 3SCQA 2FQIA 1BYCA 1HFBA 4H7ZA 3R12A 4H9XA 3F5KA 3O8AA 2YZ5A 3GDBA 5DRIA 3WD1A 2HVOA 1D3CA 1DJWA 5CC6A 5JIWA 4DF1A 2GGGA 5HXMA 1E4LA 1X7FA 2BXYA 1FHVA 2DW6A 3PBYA 2CHRA 5G4WA 1H5VA 4Y90A 3V1PA 3CH0A 3EB2A 3L66A 3NQ7A 4M3PA 3R43A 3TXVA 1CIUA 3T2OA 2FZNA 2EJAA 2ESCA 2SFPA 3KEHA 1VBUA 3LERA 4PEEA 1WOAA 1TUFA 2ZOXA 2AL2A 2J7CA 3LN3A 4C6MA 3WQ4A 4LUSB 1S5NA 3C8NA 4MHBA 1ZFJA 4QJ5B 3K4AA 3WLSA 2Q8ZA 2H8XA 3T05A 1POJA 2YYUA 3SN4A 3WBYA 1TV4A 1GPWA 4IPLA 4KGJA 4IXHA 2V5DA 3IPWA 4TVDA 3BZJA 1MEHA 4JY9A 2BB0A 5AFDA 2PLMA 2J79A 2G3IA 3TMLA 1VJZA 4W5ZA 5E09A 2HTMA 3GK0A 4HHLA 4O1FA 2I14A 2PDWA 2QCMA 3KRSA 3H4WA 4GHRA 4P7QA 5C9ZA 4YU1A 3UPMA 5BOOA 1R7AA 4MY8A 4NSBA 3EB4A 3CV7A 1JZ2A 3SY5A 3Q58A 1XFCA 2ATMA 4UFKA 1J9YA 3FSTA 1S1PA 4O4VA 4C65A 3KOXA 1BHGA 3HGJA 5GJPA 1G0CA 3N2BA 4ZTYA 1JG9A 4AC7C 4F66A 2Z0IA 2YZRA 1B54A 2WKLA 1EEXA 2Y0FA 3O07A 1MW0A 4A3HA 1QW7A 1TFVA 4AHQA 3CLMA 2V8ZA 4IUGA 3GR8A 1PKLA 3V5OA 3RK8A 1F76A 3SJNA 3R25A 3CASA 3PB2A 1P0NA 1BD0A 1RK5A 4MNJA 5KEZA 3I4EA 4ZOBA 1KV5A 5D2VA 4US5D 2AQOA 4JQ3A 2QIIA 2WQDA 5LGZA 3WF2A 4O57A 1GG1A 3W26A 3GM8A 4M7SA 1GPFA 5FOOA 3U48A 1X96A 1L8PA 4PUJA 4ERGA 3T08A 4RX0A 2X42A 4EXQA 1BWKA 4RJEA 3RRAA 4GWEA 3QXBA 4DI9A 3FEQA 1EGMA 2YA2A 2B81A 4GUHA 1F4HA 4MKSA 1B9BA 3NGJA 3PZGA 4TOQA 4IIHA 3M5YA 3NUKA 2RAGA 4JTJA 2O7SA 3DHUA 3WF1A 4TUFA 1EJSC 4CNPA 3EBVA 1LP6A 5LHFA 3EOSA 1V03A 4TVCA 4HHHA 2Z4GA 2WC7A 4L9YA 4HOXA 4E2OA 1JL8A 3E0WA 2RDUA 4I9AA 3LRLA 2R1NA 3HA1A 3WJYA 3UJFA 3VGHA 4PMRA 1EWEA 3W28A 2WHLA 3AHXA 3HG5A 3L5AA 4GMEA 3RG6A 2J8TA 1DQUA 4QISA 3K8MA 1NOUA 3NXFA 2CLHA 2B7PA 4Q8UA 3QQ0A 3IARA 3WLOA 3LXBA 2BZNA 3UERA 4HA0A 2YCIX 3TAKA 3ZR5A 3CT7A 3AS3A 5A69A 3GB6A 4XO6A 4P61A 1W9XA 1YNQA 1P0BA 4Z2HA 1AZ1A 1GG0A 2OFJA 2Y88A 4JR5A 1UH3A 3S1XA 3L0KA 2QDEA 3BOLA 2BS9A 4K68A 3ZVIA 3BLFA 3UA4A 1RQHA 4B5TA 3BG9A 2EBNA 5F1UA 2JGYA 3A4WA 2W91A 1QPNA 3G0SA 1IF2A 1QPQA 1XD0A 2ZCGA 2FVLA 2YBUA 3MA8A 4KIRA 1G4EA 4AEOA 4XIAA 3KRBA 5AYYA 1A53A 3BK0A 2BHYA 3Q2DA 4RZBA 4GIEA 4MZ8A 4NYYA 4F0RA 1AVAA 1XG3A 3NOEA 1VBGA 3BV4A 1OC6A 1X1NA 4O13A 3DHPA 2PLCA 1XIFA 2DSKA 2PU0A 1OEPA 3CHDA 3AMCA 4A3YA 3G77A 1A5NC 3G1HA 3S83A 3BAJA 4AD2A 5KZMA 1F7BA 4TU1A 4PMXA 2PLJA 3GVWA 2A79A 1K70A 4YHGA 1IWAA 1J8VA 3SFWA 4Q4SA 5GQBA 4DIAA 4D1JA 3DFSA 3W1XA 3AYRA 1QHPA 1MI3A 4ICNA 2GWGA 3HQ1A 4TXEA 3HJZA 5DT7A 3AUJA 4NX5A 4LS0A 2QGHA 3T55A 4DPPA 1G4TA 2IS7A 5HMEA 2HQAA 4GQQA 2HE5A 4GQGA 2MANA 4HCHA 3IGSA 1O94A 3A9IA 2EF9A 4A3RA 1W3JA 2H8ZA 1MO0A 4JNZA 1V08A 3HV9A 3BC9A 4LW7A 1MRAA 1EH9A 4AISA 1S46A 4L6HA 1S2UA 3S46A 3RU6A 3MP3A 2W5FA 4OE7A 4CD6A 2GDVA 1KXVA 3LGDA 1VIZA 1XPYA 4P8WA 2C15A 4GNJA 4XAGA 4RL3A 2KZHA 4E0CA 4ZVJA 1RSCA 3G8EA 1G69A 1ICQA 4GZEA 4NYUA 4OECA 5BOFA 5D9NA 3EDJA 2WPBA 2XSAA 1JPMA 1PWLA 1RBAA 2V67A 1TPH1 1LQ2A 5I06A 1NSJA 2PRHA 4KCVA 1C92A 4ZSTA 3WQCA 2VOTA 2CLEA 5E5CA 4QS5A 1WPCA 3WH8A 1KKOA 4ZO6A 4LNCA 3GW3A 3GR4A 4MIMA 4PMQA 3ZOAA 3WLKX 2XPKA 3AALA 3WLRA 5DT5A 5F2MA 3EGJA 3TSDA 1IXOA 1UBSA 1NDYA 3FCPA 3SQLA 1HKJA 1HP4A 3DEQA 5M5DA 1SJCA 3CAKA 2QYGA 1EP3A 1HP5A 1NQ6A 2HXUA 2CEQA 3AIVA 4GG9A 2EPNA 3MT1A 3WD3A 1X6NA 3BCJA 4R7JA 3L4YA 4XQ6A 1JCMP 4D6GA 1EL3A 3HO8A 3MWCA 3GH4A 5CJMA 2FDMA 2ZA2A 3N15A 2V69A 5B7YA 3P81A 3G0XA 4F0KA 4LAMA 3WFLA 2NUYA 4KETA 1E15A 1KM1A 2ADAA 4K3ZA 4A3QA 3O6AA 3UZ5A 4G8TA 5DLCA 4ERIA 4XSMA 4HSOA 4MVAA 3IJQA 3VAVA 4N6FA 3TTOA 2C0HA 2IPWA 4PTWA 3T09A 3W7GA 1O5RA 1QI0A 3KBNA 1E1CA 1NP2A 3PBUA 3V18A 1EJTC 5C71A 4G7EB 2PP0A 3VGFA 1C29A 1YTEA 3QLLA 2VC7A 4ZOAA 5M17A 2P88A 3O0FA 4EE9A 2WKGA 2WPGA 5HNNA 4C6LA 3RCYA 1VBHA 1VAHA 4H6KA 1H11A 4NQ1A 3OOQA 3TNBA 3ZJ6A 4M6UA 3DFPA 3KS6A 3RM9A 3ABQA 3LK6A 1WB0A 4HNUA 3S6OA 3GXDA 2C0AA 1WXZA 1F2JA 2A0NA 4FOJA 1BRLB 4NY2A 2TAAA 4JTLA 1TCMA 2MNRA 1OINA 2IXVA 5CGQA 3XIMA 3CZGA 4J28A 3XINA 2PDYA 4MNKA 4P7RA 1RAKA 2OEJA 4JFWA 2CPUA 3IRSA 4NZCA 4BI6A 5I23A 3UCQA 3LSBA 4ZXLA 1JF5A 4D8ZA 3UY8A 3BPWA 1O5KA 1DJNA 2I16A 4QNWA 3WLHA 3G6LA 4ZGYA 4H3DA 1LWHA 3TQKA 2WO5A 4O52A 3CHFA 2IPJA 3O3RA 2WCAA 4UMCA 4AWEA 3KBJA 3TWAA 4M80A 3O7UA 3UG5A 4URIA 5E93A 1JDFA 1REQA 2FVKA 3D46A 4LUIA 4DO7A 2ABAA 3SGZA 1VP5A 3W00A 4U4MA 3ELFA 1UPPA 4M1BA 3B8SA 1ZHAA 1ADSA 1CXIA 1MEIA 3M0VA 1OCJA 3F4WA 1B3OA 4MWAD 2OCZA 2P1FA 5FF7A 1OFPA 3CHCA 1D7KA 3ARRA 5TQLA 4N4QA 2C3ZA 2VUNA 1JPIA 1XYZA 4HK7A 1KFEA 3BG5A 3VNIA 5KZ6A 1H0GA 2XWDA 1BTMA 2VFIA 3QJAA 4AD3A 2C19A 2IKJA 2YCLB 1E1CB 4I7UA 3FFSA 1I2RA 3BJFA 3WENA 1UWIA 1BAGA 4AXKA 1HO4A 1U1UA 3MMDA 4XAZA 2DU2A 1M1BA 3HMCA 3LGGA 1JCLA 1KV8A 1B0IA 4AU0A 5LA0A 1AZ2A 4DO4A 4IG2A 3G2GA 1JPDX 1YPXA 2WJEA 1VB9A 2XG9A 5D2YA 7XIMA 2EKCA 4Z2KA 2OSYA 4GXWA 3VIHA 1GYNA 2J9YA 5E0KA 4LY8A 3PAJA 2QPSA 4AZCB 4BQ3A 4IMDA 4RZ6A 2Y7FA 2GVLA 1Q6FA 4RCXA 4H8UA 2FYMA 3ZLFA 1UR2A 3B9AA 4L4LA 3WCZA 4CGTA 3VIPA 5CLWA 1LQAA 1H1ZA 4V28A 1V79A 4J35A 2XSXA 2C71A 4GVIA 4DUWA 3T0TA 4JS3A 1FWBC 2B7QA 3QW4B 5CH9A 3QTGA 1TVPA 1ITCA 1EKOA 9CGTA 3B8TA 3R58A 4HK6A 4ZQOA 4L9ZA 4LUTA 3C52A 3CQHA 3B9DA 2DH3A 3W7JA 4L1GA 3AIBA 2BP1A 5CG7A 5DEZA 4AD1A 2XIQA 1MQPA 4PMZA 3HQPA 1QBBA 2VZTA 1VFOA 3BLKA 1T99A 3V16A 3GZAA 4PMVA 5XIAA 3BOXA 3TQVA 3OVPA 4KIEA 4EP8C 3DBNA 3UA3A 5LSMA 2OSXA 1QI5A 3NIYA 5AZ1A 3RJXA 1H41A 1RPXA 2DDXA 2DVXA 3MKVA 4B9ZA 1XV8A 4CD8A 5H6HA 1K9FA 4W7VA 4JYDA 3GHRA 4OOUA 1BF2A 1FWRA 1Q4WA 1EA0A 1PTAA 3BDKA 5D38A 2VZUA 2VKZG 1V3MA 4V27A 3UZWA 1PE1A 4F0LA 3VNJA 4O1CA 2GQ9A 2DQXA 1B3ZA 3ANYA 3VOIA 3AUOA 3AJXA 3B9NA 2ZWYA 1BXBA 5F4XA 1FQ0A 4DXXA 1UKPA 3PVFA 2OOFA 4CKQA 3TC3A 4JTTA 2W79A 4OGZA 4O53A 2QF8A 2V9DA 3NEHA 3NCOA 3QQWA 3P6LA 1Z42A 3A5FA 3FY1A 3WK3A 1F9CA 1AD4A 3E5PA 1NWUA 1V0NA 1B57A 1N8WA 2ZBTA 1O1ZA 1DWIM 1TMLA 3VD7A 3CPRA 1SR0A 5DMNA 5K7JA 5E0CA 3UPBA 3W02A 1S2WA 4ZO9A 4YVXA 2QS8A 2VM8A 4ZE5A 2E4TA 2VWTA 2WW5A 3DECA 1GW9A 3GFYA 4LCQA 3IACA 2EQDA 4HJWA 4RKAA 2J7BA 1XLGA 2ONEA 4GZ7A 3EA1A 4LPCA 4MJ2A 2ZC8A 2XH2A 3XISA 1RXOB 3S4TA 1Q6EA 4HYRA 3WQ5A 2BTMA 1PKYA 1OFOA 1V6WA 3WN6A 4BCEA 1J0KA 1E0UA 3B8UA 4CCDA 2ZZ5A 1UUOA 3S5OA 3W7MA 4N7QA 2Q6ZA 4Y9MA 3L9CA 5LIYX 2FH6A 2XINA 3TLQA 1OYCA 3CWHA 4UCFA 3QV9A 4QRNA 4NZ1A 1JAKA 3IIZA 6XIAA 3JW7A 2WHKA 3ITCA 1WE5A 4AW7A 4PUMA 2CW6A 4IMAA 4WKFA 1CB2A 2CYGA 2YKKA 3PBVA 2XM1A 2UY3A 1U1HA 2RDTA 4CCEA 4ORMA 4ECLA 1OC7A 4RLIA 3A3HA 1UD2A 2W9MA 1DOSA 2TYSA 4HOWA 5DRCA 3OODA 2QEZA 2V68A 1S5TA 2WMFA 3B40A 1D2KA 3R10A 3S2NA 3BW4A 8XIAA 1J0ZA 5HJLA 1OFAA 3QV6A 1ONRA 4IP4A 2X16A 1P1MA 4IFKA 1TZZA 4JYFA 1N82A 3FYYA 3HM7A 2CLPA 2ZX9A 2WJZA 2YBVA 3M0XA 3WMCA 5IFTA 3K4WA 4X2PA 3TN3A 3M1ZA 5EBUA 3LTSA 1V77A 3WBXA 2ASHA 3OEXA 3PJXA 1MVYA 1OC5A 1XS2A 1WAWA 2O9OA 1SW7A 2QCDB 1WX0A 3PHAA 4AWUA 3ANVA 2PTYA 3L0GA 4TQTA 4PUNA 3CTLA 4H9VA 4MPQA 3LEPA 2OLHA 1YRRA 2ZZ7A 3MUY1 3LQLA 3I7SA 5AKQA 1KB3A 5CEWA 1XBZA 3EWZA 3TCSA 4PUUA 2B7NA 2FH8A 4HOZA 1MW3A 4WD0A 1EOKA 4N0RA 1ITUA 1SFLA 1FWJC 1C93A 3EXRA 3N2XA 1JCTA 1EJRC 1XI3A 5LHEA 5D2TA 1OM0A 3PP7A 4HVXA 3AZTA 2PDGA 3WH9A 1W3TA 3H2CA 2WKJA 4PR4A 1W9BM 4GK8A 4UCGA 2X2YA 4E2BA 1HVQA 1K77A 2JIWA 3T0CA 1F3WA 1XF0A 2RDWA 2X05A 3UVAA 2JALA 2D1ZA 7PTDA 3C86A 2PDQA 3I3DA 5D2WA 2CLFA 3K5XA 3BJTA 3REQA 3GXFA 4MFDA 4BFAA 2EPOA 2D0FA 2DZSA 2VYOA 3WNMA 4LS2A 3E5BA 4US6A 1QK2A 3SN1A 3GTXA 3LBMA 1RZMA 2CCRA 4KWVA 2QJHA 4HKPA 3RYSA 1SFSA 1TQXA 1JZ4A 3BICA 1B3VA 1SO4A 2XFRA 3EEZA 3G0UA 4LOCA 3UFYA 4HMCA 4WVXA 1TPDA 2PWHA 1S1RA 4R7OA 4DEFA 1UR0A 3BAWA 1HJSA 2WLZA 4RDYA 5LGXA 2BSLA 3SBFA 5F4WA 4AIOA 1O1HA 2C1GA 2E40A 4WDXA 2V63A 5D8ZA 4J5NA 4RPPA 1I0BA 1O66A 3MBDA 3CPUA 4WJXA 3THDA 5G2WA 4ML9A 1I1XA 2Q3OA 2E28A 3VKCA 4FMVA 3FXGA 2GSJA 3O0KA 3WMSA 4OV9A 1V51A 7A3HA 2YXOA 2OGYA 3QGAC 4NJIA 2WANA 2YSWA 3QSRA 1MXSA 5J8LA 2E0PA 4JZ5A 1UWRA 1YLVA 1TTPA 2E9MA 3ID7A 4G56A 3DESA 4Q32A 3TA6A 2VI0A 4LNYA 5I24A 1GTHA 2OT1A 3GO2A 3V5FA 4YLWA 1J01A 2PDJA 4PB3A 1Z48A 4A8RA 1ZAIA 5A2AA 3TEVA 5IFPA 3GDTA 4IQJA 2G3NA 4NJKA 3BJSA 2AOSA 4HK5A 3W7LA 3W1LA 3FLUA 1KXHA 4JOMA 1M7XA 1UD4A 3WUBA 3KP0A 2A3HA 1DIOA 4CD4A 4Z2GA 2I5IA 2QDDA 2GJXA 2VC6A 4YYFA 3EOEA 4GPNA 5DBTA 3VFCA 3N2OA 3ISIX 1Q6RA 3A64A 3NVDA 4LTSA 1FFQA 4JIPA 3MV01 3V3WA 3UD6A 3RLUA 1KLZA 4Y7EA 5KTLA 3VM7A 1GKPA 1S3HA 1FFRA 1E0XA 3ORWA 3VGDA 5HDRA 3B8DA 1G4SA 1Q3NA 3KHJA 2DUZA 3HGSA 1JRCA 5KSWA 1XQLA 5G2HA 3ZJ8A 3WQ8A 3RGTA 3GR7A 3F2CA 3GHTA 2HROA 3MSYA 2Z24A 1AA1B 1TX0A 1XC4A 1B31A 2A85A 4ERAA 4EKJA 2WV8A 3A47A 5D8WA 1DEDA 4V1XA 2ZUWA 3W2MA 3OHIA 3PC0A 2X30A 4JIEA 3F5JA 1VJSA 1OT2A 3T78A 1IIHA 1O6IA 4GKLA 3LMZA 2VZSA 4M8UA 4FX6M 3IK4A 2ZX8A 1YPFA 4B4FA 3M6DA 2ACSA 1PCKA 4JFSA 3THUA 3H4GA 1OCBA 4A35A 4WK9A 7REQB 4DNMA 3EX1A 4I7WA 1LUCA 1FKWA 1ZCOA 5BOEA 1ZTVA 3KX6A 2YCKX 3G5EA 3Q94A 3TSMA 5CBJA 3RN6A 3PN8A 4L61A 2VGBA 2DZUA 3KZPA 3MUAA 1HT6A 1PZ3A 4M6PA 1N7KA 5BW6A 4KH2A 3NR0A 1J0JA 4QSHA 1HVXA 2GLKA 1FP8A 4NG3A 1ZALA 3GXMA 3ZT7A 4H8VA 4XAFA 4NZ4A 2WB5A 4LYPA 1WZLA 2CNCA 4HYVA 2Z1BA 3V35A 4GVGA 2O9TA 4FIQA 4CVWA 3OZMA 1OX4A 3DG7A 5FJJA 2JE8A 1UG6A 3QV8A 2GJXB 1C9DA 1WNOA 3K8LA 4QCEA 2RDXA 2YCEA 3B9EA 4JX5A 4HTBA 3VU2A 1EQPA 1PEZA 1PTGA 1WP6A 3P62A 4IMCA 3CNYA 4IIBA 3EOLA 2BXZA 4B90A 4S3CA 1M04A 1UWSA 4AMAA 4W85A 4MB3A 1DE6A 3W1RA 3TVAA 1J2BA 3BGJA 1E3XA 3UNTA 1EP2A 1S3TC 1YYAA 1EDGA 1XGDA 5HQLA 5AVHA 3SAZA 4X0NA 4D9PA 3M7WA 1FWGC 3W29A 3UXIA 5LZLA 4BK9A 5FJIA 1KTNA 1E1FA 2ATSA 4YIWA 1V0LA 1WDDA 5D30A 2QCCA 3D3FA 3HIJA 3LDVA 5HMSA 3AWOA 2ZICA 4MAVA 4QG8A 3TR9A 3MI6A 4I9MA 3O9NA 3IJLA 4TV5A 2X7WA 1QW9A 1VJIA 1LWIA 1E9IA 5EFFA 1OVDA 5IBXA 1WXJA 4XSLA 1E73M 4JNMA 2DFAA 3ES8A 4JTKA 4DLMA 2E8YA 2I5GA 4DO5A 4U28A 1H62A 2GFTA 2E09A 4DWSD 2PF8A 3W2UA 1R3YA 1E9LA 1HGYA 4CEUC 2YB1A 4S23A 2DQWA 3H55A 3RO8A 1XIIA 3SO7A 5C7VA 4AZ7A 1TA3A 2WVVA 2Y7DA 4WX2A 3ITTA 3QGVA 4JTSA 2E8ZA 1A3XA 3LI0A 1RVGA 1W3KA 2OOGA 3IJIA 4IIEA 2GVJA 1XWYA 2VDIA 5I0DA 4ZQRA 3B06A 3UZJA 1JCXA 1ICSA 4GISA 1JPHA 4FR6A 3G1AA 3UR2A 2REQA 4B3ZA 2PLKA 2VQTA 3QRHA 7ODCA 2NV1A 3KAOA 2PDIA 3FX4A 5AYIA 4D6DA 3LLXA 2PCEA 3VPLA 4QX4A 2CBUA 4WKHA 5AC8A 5AHLA 5KITA 3QPZA 2W66A 2BMBA 3R94A 1JCNA 5SWUA 2VEMA 2Z7GA 3AIEA 1XYCA 3MQTA 4JX6A 4JTFA 3II1A 3AO0A 1E4IA 2GYIA 5M03A 3CT2A 4QTGA 5T9CE 1DKWA 4ILSA 5C6MA 2A1YA 5FEXA 3F2BA 4FX7A 5CQ1A 3N1AA 2NQJA 1E5JA 1G7UA 4GJJA 2O92A 9XIAA 2OB3A 2A3LA 1WXYA 4NNAA 5TD4A 2OYLA 3HQOA 1ESWA 2WOQA 1O5XA 5PTDA 1CNVA 2Z6JA 1Z69A 1ZSXA 5EFDA 3ABXA 1H7NA 1ONWA 4EXBA 8A3HA 1U30A 3HMJG 1BYBA 4NF7A 1TJ2A 2UY2A 4JKLA 1BWLA 4O1BA 4GFSA 2A3CA 1R3WA 2DVTA 4PCPA 1BGGA 3INPA 1ISXA 4CLMA 1XLKA 4B4HA 1CYGA 1KM2A 3UU0A 4FP1A 2RGLA 3ABRA 1FCVA 3G1FA 1XSJA 3NQ6A 3M43A 2OLSA 3DAQA 4ICCX 5BRBA 1ZZMA 3NQGA 1VFSA 4HB7A 4GX9A 2DJLA 3H2EA 4HA4A 1YW1A 4UTTC 5ECVA 4OBTA 1GQNA 3VZYA 3E0FA 3VNDA 3KTXA 1VCVA 3NQVA 3BLIA 3W22A 3WLNA 2REQB 2OVLA 2OT0A 3I3BA 1WAUA 3DYMA 2W62A 1PAMA 2BVYA 4H6QA 2UZ9A 3TN4A 2QXWA 1VR6A 4EF8A 1TWSA 3HPZA 4O19A 2G8ZA 4U2ZA 4M0XA 3STPA 3M64A 4JN8A 5AHMA 4LX4A 4EPKA 4DM1A 4IP5A 4A4AA 1P6BA 1G94A 1VRXA 2Z1WA 4IIFA 5EL1A 4FLSA 1IEQA 5DCBA 3IUDA 2V82A 4RE2A 5C2XA 1PSCA 1XLEA 4Q8TA 2CZVA 5IHRA 3W27A 1ISWA 1W6TA 4CEXC 1MRQA 3QHOA 4F9JA 3QLDA 4AC1X 4YTRA 3PBWA 2YXXA 2X7VA 3QSTA 4FXFA 5AHNA 1YDVA 4QR6A 3GVVA 2Y61A 2GZXA 3LI1A 3TK7A 4XZNX 1VEMA 4WDTA 5J5RA 1C3FA 1QOQA 3L23A 3POCA 2DT0A 3PPGA 1FHLA 4XKYA 1ZP4A 1A5AA 1JJKA 4EF9A 2XZ7A 3AMDA 1K8CA 3M4HA 4J3SA 4O1EA 5A6KA 1SGJA 2QV4A 2Y63A 3PZQA 3CIWA 1CGWA 3PG8A 1BLIA 4GC4A 1I6NA 2JKEA 5G5IA 4WIWA 3SR7A 1JF6A 3WQPA 3OQEA 1EJXC 1XW8A 3T44A 1DV7A 2VELA 3PUEA 3NZPA 1UR1A 4IIDA 4KCTA 3A5VA 1XKYA 1OCQA 1W56A 3ZR6A 2ZUMA 5EMKA 5D4YA 1VCGA 1OWQA 3PANA 6TAAA 3UR7A 3BANA 3NZQA 2EPKX 1PZ0A 1OGBA 4MDOA 4LFYA 6CGTA 4RZ5A 4LV4A 4J40A 1BFNA 3TNOA 4CNUA 3OG2A 4W87A 3CS2A 4XD4A 3GWQA 5XIMA 1QNSA 3FW6A 3NZGA 1YEYA 3S2JA 2WHMA 3LTPA 2PSNA 2I57A 2ZFAA 3ZR4A 3GFZA 5DF0A 3BURA 3E0IA 3GAYA 5E6YA 4EX4A 3NPUA 4PRWA 5A94A 3VOJA 4N42A 4F4RA 4FHAA 3N13A 3N9SA 4KRUA 3SUWA 4EANA 4C90A 4MG4A 1X7IA 1YBQA 2ZRWA 2G4FA 4NAFB 2A3BA 2CXGA 3W7RA 4GCAA 1EIBA 1I2PA 3BSHA 5BZAA 1P6CA 3W6LA 1NF7A 4UTLA 3E12A 1JXKA 3SUTA 1JD9A 1NP0A 3QZ6A 3NO3A 4UR7A 3DFOA 3TC7A 4GA8A 2DSUA 2D2GA 1C9WA 2W61A 1DJYA 1TTQA 1Z44A 3WLTA 1E40A 1GQKA 4UTIA 5E9XA 3WMLA 3NL2A 3CLWA 2YW3A 3AXMA 3TAOA 3KWSA 3QV7A 2VX5A 4JTDA 1EYWA 3ME3A 3W7QA 1W32A 3IGXA 4HPHA 1UWUA 4I90A 1IYXA 4IGSA 2WZTA 4UFHA 1S2CA 3ZJKA 4TMCA 4AWSA 2GUBA 5A6LA 4NHVA 3WH7A 1IGWA 2FPVA 3M44A 2PWUA 4MZYA 4C60A 3BTNA 4Q33A 1G4PA 1F05A 1UD6A 4JN6A 5CZTA 4PCFA 3IJ9A 2NX1A 2V3EA 1PV8A 3HF3A 4FNTA 3VVGA 1W5MA 4UFIA 3VZXA 3KVJA 1GVSA 1QUMA 3B03A 4P8XA 2ZC1A 3DERA 3NDYA 3VNLA 4GQBA 4DAIA 5AHIA 2FDSA 1WA3A 1EP1A 4AY8A 4PL1A 3EA2A 2CLOA 3N4EA 2F9RA 3LHVA 3W84A 1OCNA 3KVMA 3WEZA 3DFYA 2OX4A 4LBSA 3KTCA 4AXNA 4FZIA 4WY0B 5BU6A 2GK1B 3MPGA 5GJNA 2P5NA 3VFLA 3AISA 3G3DA 2Q3RA 6PTDA 5FJPA 2VR5A 1Z3NA 3OA3A 1B3YA 1XIBA 1NDZA 3LG3A 3MO4A 1K6WA 3S42A 4REQA 2Q8LA 4KQNA 2NVAA 1JUKA 3QGKC 4F0MA 1T6MA 1R9XA 1E9YB 4Z1DA 4QQ3A 3TE9A 5LNWA 3LPOA 3A4AA 5AY7A 3LY0A 3BZGA 2INZA 5C2CA 2WSPA 3W6YA 4NUWA 1IEWA 1LTDA 4MNLA 5I6SA 1WKEA 4BF5A 2J25A 3GVQA 4JKMA 1IZJA 3UZZA 2QJMA 2B7OA 1F61A 2OZ0A 4JD4A 3WEOA 2H90A 1JD7A 2PC8A 1LWJA 8XIMA 5A6BD 2A3EA 3HGRA 1A5MC 3H6OA 2HNEA 3QYSA 3MCNA 5KMYA 1IHIA 2Y8UA 5FCZA 4XAPA 3TJIA 3RAOA 3U9IA 3AXHA 2VEPA 4DJDD 2YL8A 1EWDA 3AWNA 2HVMA 1HW6A 1SR9A 3OGRA 1US0A 1JUBA 3DC8A 3TDFA 2OR2A 4D6CA 3VKDA 4IPJA 1UP2A 3OIXA 4JFTA 5G4EA 2V3DA 1XGEA 4HBKA 2ZUTA 1IT7A 4W86A 1H5YA 4B16A 3B0XA 3VD9A 5HINA 4A2RA 5BXSA 1F8IA 2VX6A 1NOFA 2PDLA 2QPUA 1DE5A 1XSIA 3WLMA 2X1UA 1S2VA 1DQXA 5M3WA 2ZXBA 3HN3A 3PZ9A 4O12A 2VQUA 2GGEA 4X9YA 4ZR8A 3VKKA 2GSHA 1W1PA 1YTKA 1HKWA 2PDCA 4E8GA 1FWIC 1XCXA 3GY1A 3TROA 2V2CA 3LCHA 1UUQA 3CMFA 3UXKA 2R8WA 4KWWA 2NT0A 4HZ6A 4KGLA 1U22A 2X1IA 4GBDA 3B05A 1CT5A 3AICA 3B0VC 3M0HA 1NELA 4MUPA 3B0PA 6ENLA 2V5CA 2TPSA 2F8QA 4NZ3A 5FF3A 3A9BA 3F4DA 3GNNA 3TQ0A 1NWTA 3NQEA 1JULA 1V8EA 1JDDA 2ZVIA 2NQ9A 2NLYA 1J6PA 3O06A 1XIHA 5E6ZA 4LBRA 1KLYA 1WUEA 3N73A 3T2PA 1ZCCA 1GK8A 1CGUA 2V2HA 4HPJA 2QT3A 3QKZA 3MKCA 3TC6A 4HN4A 1VFUA 4NI3A 1FH9A 1H63A 3FHQA 5G1YA 1L9WA 3E1F1 3FDKA 1NARA 4BWLA 1Y7VA 3G1SA 3THQA 4XKMA 3U8GA 2J7HA 3T7VA 4IH3A 3E2VA 3UG8A 2CZEA 1FRBA 1QXLA 1JXJA 3AIWA 3N2MA 3L2MA 1FWWA 1DWHM 1E6RA 4FXJA 1WDSA 4V33A 3DFQA 1E0VA 5AC4A 1UWAA 1UKSA 4IJBA 1OG6A 3Q45A 2EHHA 2E9BA 2Y7GA 3LXAA 1AW2A 3R0UA 4QDPA 1F3TA 3KM8A 3KDNA 2WZHA 1OX5A 3DCPA 3AC0A 7TIMA 1VFLA 3UBPC 4U3CA 4WHBA 1VGAA 4TX8A 3MP4A 1V3KA 4C7DA 3EWYA 1TCDA 3WJWA 1KFKA 1AMYA 3GIPA 3P93A 4R9OA 4UXDA 3T4WA 4NJHA 5AOUA 3KXQA 3TN5A 1PWMA 1FP9A 3UG4A 1XLJA 1VPQA 2QGYA 4S38A 4DWDA 1TV5A 2VENA 3LCGA 4ZO8A 2HRWA 1TIMA 2OWXA 3TWBA 1JCJA 2FGLA 4PMOA 1DIKA 2HZGA 3PF3A 4NJJA 2FTYA 1BG9A 5LIKX 1OIFA 2HWGA 3EPOA 1U2YA 4WSKA 3NWRA 1H7XA 1KBBA 3KVKA 1UOKA 2OGJA 4TTGA 1BYDA 4CQBA 1TYGA 2PZ0A 4I5RA 1WDPA 4C91A 1VRDA 3WDRA 3ZM8A 1VFTA 4DPQA 3LENA 4KF1A 3E2QA 4U3AA 4FF7A 1YHTA 3JVAA 2Q71A 3M0MA 1GJPA 4PCSA 5FKYA 1V3IA 7ENLA 4E3TA 1PBGA 1YDNA 5LXXA 1J79A 4UFJA 3LCXA 4OV4A 3CGTA 1K9TA 1TO3A 2PDNA 3UW6A 2XFFA 2PEVA 1LG1A 4UTUA 2I1OA 1SU5A 2VO5A 3A4XA 2QAPA 1K7EA 3B8IA 3WH5A 3H7VA 3N3TA 2BG5A 1YXYA 1JCYA 1HQTA 1SSGA 3VOCA 3ARQA 1GVRA 5AYZA 4K1GA 3WSUA 3QTPA 3W1PA 3AFBA 4O8AA 1E43A 1WCGA 1KO0A 3K1GA 3VMNA 3WMBA 4AG0A 1AH3A 3WQWA 3OGVA 5CSRA 1XINA 2FZMA 4IF2A 4C5ZA 4RDZA 3PZNA 4LT9A 1XIJA 5CSSA 2PGRA 1KTCA 3IVSA 4IPPA 2CBJA 3NSXA 3VNZA 2ZX7A 2BLEA 3KUMA 1R3RA 4ACYA 2JF6A 5I2UA 5J04A 3SN0A 2XIIA 1EFZA 3SCWA 3ZFHA 2WJFA 1LOSA 1E1EA 1S2TA 2VFDA 2WNNA 2V0TA 1VBRA 2Z6IA 1DWJM 3H23A 1VZWA 2DVUA 2FPYA 3WL0A 4Y9AA 4KWSA 3ES7A 4FK9A 4UOQA 4CCCA 1SO3A 5A1AA 2YDRA 1UR4A 3WJXA 4IIGA 3UGVA 2OZ8A 2DGAA 3FSUA 5GJMA 1DWGM 1E4MM 1V5XA 3NPVA 2ZXAA 1DP0A 1I8JA 1R0MA 3EXSA 4MB1A 5G1TA 2FZBA 1OSEA 3KL0A 3MU7A 1H7RA 4Y8EA 3DX5A 5AHFA 3IIPA 3BSMA 1YE4A 2AL1A 3QC3A 3E38A 3LU2A 2WHJA 5D2XA 4ZZ9A 3FJNA 4WJ8A 1A5LC 1KBLA 2Z2AA 4LAKA 3BE7A 1UOZA 3USZA 3VDCA 2QNEA 3GAKA 5DY3A 2DEPA 4WLCA 3C2OA 4BA0A 3UJ2A 2PTZA 2J7DA 4D6EA 1QI3A 2QCFA 4JHOA 2CBIA 3L4VA 4GACA 2ZRZA 3VUPA 3H54A 4POCA 1ZP3A 4DJED 2QV5A 1IT0A 3ITXA 3BQ5A 3SRDA 5T9BG 4N9DA 3VGEA 3SUUA 5A6MA 2YCJA 2X0HA 2QDGA 1TVLA 3MANA 2D23A 3EDDA 3TJ4A 3RRXA 4UQDA 4QQUA 2DW7A 2Y5EA 2NQHA 2W67A 3C4UA 2FMNA 1YX1A 5EMMA 4WDUA 3CAVA 1QOPA 2VT0A 3VCRA 3AAMA 4JFUA 4MYXA 4BJHA 3HPAA 1A4LA 4ATDA 4EPDC 5TAOA 5CZ0A 5A6AA 4C6DA 1B4KA 3GX9A 5K4XA 4KEVA 3WLPA 3ATYA 4H2CA 1IWPA 3Q65A 1W1A1 2WWCA 3W2LA 2J24A 3VIKA 4NASA 1K1DA 4HNVA 1GVQA 3C6CA 4AX7A 1UB3A 2ZDRA 3MUIA 4Y96A 2VDGA 4JN7A 5D02A 4AZIA 4O50A 5CKSA 3I6TA 1ZAHA 1NFGA 4GYPC 3U4FA 5EY5A 4C6EA 5TF0A 4OWGA 1GVEA 1KNWA 2JEQA 3NL6A 3ZO9A 3STEA 3R7MA 4RV8A 3GNDA 5CCZA 4DBWA 3CBWA 3C2RA 1FWAC 2OELA 1GVOA 1DHPA 5AC7A 3M0ZA 3W9ZA 5B7ZA 1X8CA 3BCDA 1MYRA 2YFNA 3S9IA 1ECQA 1PKNA 2NZLA 3E0LA 3I10A 3M0IA 3SCTA 3EYPA 4PTXA 1HX0A 1CLVA 1PUDA 1HL2A 2EEXA 2D0HA 2OLAA 3MMUA 1SO6A 4LSBA 1FDYA 1W5QA 4GO9A 1HKMA 2PP3A 3EX3A 4PTMA 2XVKA 2Y8VA 4WOZA 1PO9A 5C54A 2FGBA 3N6QA 1XIEA 5IOBA 1OABA 3RPMA 3PZIA 4XUGA 3SDOA 4I5XA 4BS0A 2VFEA 1JVNA 3MBFA 3OIHA 5JVLA 3T81A 3G1VA 2NSOA 1KBJA 1OX6A 5EMLA 2ZKMX 2VOMA 4AVNA 1R3SA 1ZJBA 4AIBA 1W9PA 1T7LA 1ZBKA 4NT0A 1S5VA 5D09A 4KKXA 4QS6A 3UG3A 1GEHA 3PNZA 3FA5A 1R46A 3DOPA 4ONVA 3P7YA 3GVRA 1BF6A 1H60A 1THFD 1X39A 1NU5A 5JH1A 1ZPTA 1MEWA 1X38A 1R38A 3H53A 1S39A 4S3FA 2BOFX 4W8LA 5I3DA 2XJ7A 4LU0A 1I45A 3MO7A 4C7GA 5MKGB 3NOYA 3TFXA 3W1TA 5G2IA 3OTRA 3PUGA 4MB4A 2HV5A 5C0QA 3HPFA 1CI1A 4CUCA 2O7QA 1FCQA 1KGWA 2L5HA 2YLLA 1ZENA 1B5TA 2CZ5A 2B4GA 3W7DA 3GBDA 4LEFA 3NQFA 4Z0JA 3AS2A 2PB1A 3VE9A 5H8MA 3AYTA 4W88A 1VYPX 3CYVA 4ATWA 3BO9A 1XH1A 2C18A 4KFPA 1EA9C 1LBFA 2CC0A 1ZLPA 4ZB5A 3QPEA 4N02A 1KXQA 4HCLA 4FI4A 1C7SA 3N14A 3GS6A 4XVEA 4D2JA 3OB8A 4YTSA 4JTIA 2XM2A 3VD5A 2J47A 2G97A 5IXEA 5HAOA 1E6XM 1XKJA 4U33A 4ATLA 1B2YA 3NSNA 1FWEC 3BXWA 3ATZA 1AJ0A 1ONEA 4TX9A 3WY1A 1H49A 1QPRA 3AIUA 1D3HA 1GHSA 1NQKA 2XZ9A 4ALDA 3PPFA 2V5LA 1AG1O 3IEBA 4BEQA 3F4VA 1NOWA 1XR2A 3QBUA 1H3GA 2PDKA 4S3KA 3TTQA 1EUNA 2QCEA 5HQEA 4S3JA 3JZEA 1D8WA 3GG8A 3TN6A 3LRKA 3CV6A 4O0KA 3LPFA 3A3WA 2PU1A 1QWGA 1Z9AA 1JPKA 4H2HA 3FHAA 4YNGA 4C1NB 3GKFA 4C6BA 2VGIA 4IP7A 3MJMA 4U5IA 4AZHA 3B8WA 5FSEC 3LCIA 1YIXA 3PTKA 3TH6A 2E1WA 4H00A 3Q67A 3FGCB 4PGLA 4GX8A 1KFJA 1EGZA 4LVGA 4GIAA 2XGIA 3AXKA 3R79A 1OD0A 4KCUA 1RJRA 3S0CA 4B2DA 3FDGA 3A21A 1UROA 4D6HA 4Y2WA 4WSHA 4XZMX 1TWDA 4KWUA 2IPGA 3HG2A 3S9ZA 3H24A 5D9MA 1XBYA 4XO7A 2FHBA 2OQLA 1OADA 3EDKA 1LOLA 4ADUA 3PFRA 3RCNA 3PZOA 2F38A 2J13A 5EB8A 4OUIA 4ZOEA 5BU9A 3CK5A 2C79A 3ONBA 4Q3MA 5DCDA 3T07A 1F6YA 1GOKA 4B3LA 3TOPA 3AHTA 5CPQA 4H6EA 5CLTA 1J5SA 3KOYA 2H9AA 1VFHA 4DQWA 1TR1A 3O6YX 1JR1A 4QE4A 2QW5A 5TBOA 1I2NA 5D32A 4IXXA 3DGRA 5HANA 4CQ8A 2ISFA 4QHRA 4OQVA 2ZX5A 1Y5WA 3P0WA 4I8YA 3WLLA 1DJXA 4HU3A 1N2VA 2Y2WA 2E3ZA 3CMGA 4UOZA 2WCSA 4NZ5A 4ZODA 1Y0EA 2C8NA 3SUSA 1AODA 3H26A 1E6ZA 1R30A 1TV7A 2C91A 4Q7BA 2Z25A 2VEKA 1CCWB 1LCOA 1BWVA 1JNEA 1F07A 4OUEA 1XUUA 3HZ3A 4ZFMA 5BXPA 3CV2A 1PIIA 4ZCWA 5C8BB 1BKSA 3W1QA 6TIMA 4F0HA 4HNCA 4TX6A 3MSRA 4L80A 2ZRYA 3V5CA 3DDMA 2UY5A 2WC4A 3V0TA 3H2AA 1ADDA 2QPXA 4KS0A 1ISZA 2G3JA 2PWVA 2AAAA 1CTNA 4FSAA 4QROA 1WDQA 3M9YA 1K3UA 1AQ0A 1QFEA 3V75A 3N6HA 5F2IA 3VYLA 5I77A 4ZA0A 4AF0A 3QKEA 3ARSA 3AZSA 3SCSA 4WZHA 4GE8A 1WZMA 1QU4A 3TIMA 3IIVA 2AL2B 4JHMA 2A2IA 1J6OA 1XLAA 4V2XA 2WSRA 5C7HA 4GUIA 4RW3A 3LBOA 4O1DA 3KS5A 1FWSA 4IMEA 4YVPA 3SY1A 2GJPA 4GCXA 1TREA 4S2BA 1GQLA 2H3BA 1LRQA 2H9AB 2O9PA 1J96A 1Q7QA 5TNVA 4LF2A 1XLIA 4I6KA 3P67A 4RNIA 1UR3M 4L65A 2P3ZA 1U5HA 3BAKA 4JQAA 2EPLX 4GZIA 1BXNA 3M5ZA 1IR2A 5CAKA 2ZZ3A 4WQ6A 3DIPA 3BAYA 3WIJA 3SB0A 2XH7A 1LL4A 3G24A 1TG7A 4XBKA 4G6CA 5A6JA 4UNLA 3SCNA 4HPNA 4W5UA 3GQYA 1VEPA 3TSBA 1B3XA 1ZBVA 2J4GA 3QHNA 1GJWA 5AVNA 1UUMA