3TMQA

Crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei in complex with d-arabinose-5-phosphate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
280
structure length
280
Chain Sequence
b'MNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 94
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tmqA00
4CCEA 5AB3A 4YCOA 1IXPA 3KVKA 3PULA 1JCXA 1YTEA 3UY7A 5E93A 2ZTKA 5CZJA 3P74A 1ZAJA 4A21A 4M19A 1C8VA 2CZEA 4GUFA 3S9YA 3O8AA 1KM4A 2CLOA 1A5AA 1DVJA 2Y6ZA 4FHAA 3P80A 6TIMA 2J9ZA 4K38A 4GBUA 4O8RA 3N9SA 1GYNA 1T99A 1IGSA 4JTTA 3CIXA 4LC8A 4JDBA 1S5TA 1G4PA 2HSAA 2B4GA 2CLHA 2H8ZA 4TIMA 1SZEA 4HPXA 5FEWA 1KLYA 2YDAA 3IIOA 3W70A 3ELFA 5DY3A 1MO0A 3W2JA 2GJNA 2KZHA 3GDMA 5D2XA 1MXSA 1W5QA 5K3VA 2G95A 3TXVA 1B3OA 3DBPA 2CLEA 3N2MA 1ALDA 4JTGA 3GNNA 1H50A 3THAA 4NT0A 2ZRUA 3NR0A 4CNOA 1H62A 3S1UA 4B5NA 2VEMA 3G18A 1H7OA 1LZOA 4DBDA 2CLKA 3QM3A 4RXGA 1T0OA 3BLIA 2GUUA 3GDRA 1MEWA 1VS1A 1U83A 3UD6A 3LOTA 2PRLA 5EL1A 3CC1A 3M41A 5EA9A 2QJGA 1L9WA 4DBEA 1GG0A 1Q45A 1JCLA 3FJ6A 1RD5A 2H90A 4P2VA 4EF8A 3EX1A 5LGXA 4ZQMA 3OVQA 4XTIA 1H1YA 3LHTA 1W31A 4LVDA 1L6SA 5AHIA 2P1FA 3GB6A 3I7QA 2QCMA 4ORMA 3CU2A 3B04A 1O60A 1Z42A 2QDGA 4DEFA 1QNVA 4JTIA 1D9EA 1DJNA 1A5BA 4BK9A 3M1ZA 2Y88A 4MIMA 3PBYA 5F4WA 3EKZA 2EGZA 4NNCA 4UTUA 1EA0A 1R47A 3BG9A 4O4WA 3QC3A 1J2WA 3FYPA 3GX9A 5K9CA 3B05A 1P1XA 2ZZ4A 4PODA 4MFEA 3TJXA 3IVTA 3RMJA 4Y90A 2Y62A 2Y61A 4MYXA 4RCXA 1X8FA 1ZFJA 2YZRA 4NX5A 3N9RA 3DFNA 5E1QA 1N8FA 1ZNNA 3UWWA 4LS2A 3F1QA 3A5FA 3QW3A 2QUUA 3PAJA 4MJMA 1C29A 3NZRA 1SO3A 5DY2A 1EP3A 1Z41A 3NQEA 4XBSA 2C3ZA 3W3OA 5LGZA 3KXQA 3PG9A 4LWWA 1TV7A 1YPFA 3TC6A 2VFIA 4FXSA 3ABOA 1TO3A 3MP3A 1G4EA 4ZQRA 1QPRA 3TW7A 3MWAA 2YCEA 3TV8A 3OBKA 3OA3A 3GKFA 1KW1A 5LKYA 1HTIA 3ABRA 3U6WA 3W7DA 1SSDA 2XN0A 3UWQA 2BXVA 1YXCA 4BR1A 1FWRA 4AVFA 4IMEA 2ZFAA 3G22A 1LLWA 4AH7A 4HNTA 2VFHA 2YSWA 2YW3A 3Q94A 3TK7A 4Q32A 4O0ZA 4EWND 1THFD 4WD0A 2TMDA 4A2RA 1WYIA 5FF4A 3G0XA 5DCDA 4WY0F 1DORA 2DJXA 4DO5A 2WSRA 2V2CA 3B06A 1TTIA 1VZWA 4O28A 2C16A 1CX9A 5L9FA 1DQWA 4FNUA 2WJZA 2ZCGA 3MMTA 2ZRWA 4UTKA 3S6DA 4AWUA 3GNDA 1J5TA 3C3NA 3W2NA 2CFFA 5LNUA 1PV8A 4O1DA 4NJKA 3HF3A 4XKYA 1KM0A 4WY0B 1GEQA 1VLWA 2WV8A 3W7LA 1A53A 4AF0B 1JUKA 2E77A 3NO5A 2EF9A 3GDTA 3QW4B 3QRHA 3NQVA 3QSRA 3FEMA 1P4CA 3UZ5A 3TA6A 3WJXA 3EXTA 1SR9A 1KLZA 1EPXA 1ZY9A 3FOKA 3PG8A 1TSIA 4H3DA 3C4UA 4Z1DA 1BWLA 2B7OA 3OVRA 3LV6A 3UZJA 1VJIA 1K03A 2VC6A 1KTBA 2FPVA 3HG2A 3PBWA 1BWKA 3KFTA 1QAPA 1RQEA 3NL2A 3PB2A 3UWVA 1TPUA 2RDUA 1QO2A 3NOEA 1VRDA 5CZTA 2Q8ZA 1A50A 2FB2A 4L4MA 1JRCA 3NYZA 4IJBA 3DXIA 3TROA 1S5VA 4Z1CA 3ZWSA 1IXOA 1O5XA 4WUIA 1TQJA 2NLIA 2ISVA 2X1SA 3PB0A 5IBXA 4ZMGA 1I4NA 5K2ZA 2ZZ3A 3C8FA 4MLRA 1OFDA 1FCVA 2ZRXA 4CCCA 4UCGA 3G0UA 3ABQA 1KM3A 3DKLA 4LUJA 1UUMA 3BW2A 3HGSA 3O06A 5EPDA 5BRBA 4HHPA 2A5HA 3FIGA 2I1OA 3RLUA 3W2KA 2YR1A 3MW7A 1UJPA 1LORA 5FF3A 4K39A 1ZJIA 3NQDA 1TB3A 1RV8A 2VELA 2DZPA 1TREA 4HSNA 2P10A 4MFDA 5K9XA 2VENA 3ATZA 1BKSA 1WOAA 2FIQA 3G1FA 5D02A 3TSMA 1OFEA 1RQBA 3ZS4A 5F2LA 2UV8G 3MHFA 4UXDA 3A21A 1W5NA 4IXXA 3HOJA 4UTMA 1F5ZA 1VR6A 3LERA 4MY1A 3RU6A 1K7XA 1T8XA 1VHCA 4Y6GA 2CLFA 3W88A 4UTLA 3C52A 4JXCA 3BVJA 3MI3A 4O12A 1EEPA 1KFBA 2DORA 2YW4A 1EWEA 3INPA 1S5WA 4JIQA 5AHEA 4DF2A 3UPWA 1PHQA 2DJLA 3MUXA 3GR7A 3SY5A 2CWNA 1DQXA 2HS8A 4FX6M 4LUIA 3DGRA 5HQEA 4KWVA 5BW6A 2QCFA 4PEKA 4DXVA 2TSYA 5GVJA 3THQA 5IBXC 3O6CA 1W3TA 4LNYA 1KBJA 1QWGA 5F2IA 3C2RA 5HUPA 3MYOA 3R13A 4JIPA 4MY9A 2V82A 5KTLA 5CPNA 4X3ZA 4ICNA 3M16A 2C13A 1KV8A 1TCDA 1KFCA 4ADUA 4UTHA 1I2NA 1BEUA 1AMKA 1Q6LA 2WNZA 3E9AA 5HR6A 2YFNA 4NVTA 4EIVA 3EEGA 1G4TA 1AW2A 3G1HA 3LBCA 2OT0A 4XQ6A 4LVFA 2VEIA 3W7OA 1QPOA 4R33A 3W7QA 3VFLA 1YADA 4E38A 4IX0A 1GVOA 3TQVA 1TMHA 4LY8A 2OZ0A 4MZ1A 4GC4A 2VXNA 1ME9A 1MEIA 1GTHA 4K8HA 4N02A 4LVAA 3DENA 3FKKA 4GXMA 2E09A 3LHZA 2QCLA 5LNSA 3W7RA 3L65A 1EP1A 1SFLA 4WQ6A 2W6RA 1DKWA 5C55A 1EWDA 2WNNA 1PIIA 2Z6JA 1J4EA 1ONRA 1TRIA 4OU1A 3W71A 1JQVA 2WKJA 3HGOA 4DPQA 2RH9A 3ATYA 3RNDA 3HQ1A 2NWSA 3C56A 1KM6A 1I8JA 3NZ1A 3H55A 3NQ6A 3TUUA 3LCIA 5AYYA 3OVPA 1XL9A 3W7JA 4TU1A 5K4XA 2ZRYA 1FWSA 1MEHA 2GQ9A 3O1NA 5F2GA 3TXZA 2HMCA 1K7FA 3EXRA 4O54A 4U28A 3QJAA 3EB2A 4GUIA 4BI5A 3TW6A 1JCJA 4BF9A 5HWNA 1ME8A 4XBKA 3IIZA 1H61A 4LRTA 4OT7A 1OFBA 1TIMA 1LOQA 3ANYA 1Z48A 2CLMA 3DHDA 3NPVA 3L0NA 4JDYA 4KFOA 4LU0A 3TDFA 2E1DA 2B0MA 2C14A 4JEQA 1N55A 4CQAA 1WBJA 3BARA 4DPPA 3VE7A 3EWZA 1IXNA 2GPTA 3W1QA 2QCCA 2O7SA 1TPWA 2H8XA 1VQTA 1YDVA 3LHUA 3L68A 4ONVA 1GVSA 2A4AA 3NQAA 3PUDA 3IGXA 3K30A 3LCXA 2QR6A 4S2BA 5EMUA 3TSBA 3LXCA 5HUOA 1OFQA 1LYXA 5CKSA 4HIBA 1FWNA 4POCA 2NWRA 3L21A 1TPFA 4K6AA 3STCA 3TMQA 1LBLA 1L6YA 4UMAA 3EWXA 4TO8A 1H7PA 4O50A 4JGDA 2PRHA 4UMCA 3W76A 3FKRA 1VCGA 4UMBA 1Y0EA 1D3HA 1Q6QA 1UUOA 5FF0A 1SU5A 1LOSA 4CCDA 1KM5A 2ZYFA 1DL3A 3G1DA 5F4SA 2GQ8A 3M5XA 3GIYA 3IEBA 1TTPA 2RHGA 4NZFA 2Y7FA 3PM6A 3QMRA 2W79A 4PFMA 4YCPA 1LOLA 1AW5A 1SW3A 5AFDA 1R2RA 3CHVA 1RQHA 1JVNA 1SFJA 4JTHA 4O14A 4EVZA 3NM1A 5G2IA 2JGYA 3I7SA 1SPQA 4JX6A 3N2XA 3PR2A 1SO6A 4WOQA 4UFLA 5D03A 1KTNA 1IXQA 3VE9A 1EX5A 4LRSA 1YXDA 1Z44A 2B7PA 5T26A 2YYTA 2PRMA 3LRKA 3P5YA 1YDOA 1LBFA 2QCDA 3C61A 1QOQA 1VYRA 3W1NA 3W1XA 1M7OA 4GRSA 3OG3A 1ZCOA 3T40A 5HWMA 2TPSA 5C5YA 1AL7A 3KRZA 3W7NA 1FY6A 3GYEA 5CSRA 2IQTA 4E2DA 3DZ1A 1GG1A 3LBMA 4S2CA 1LROA 1TYGA 2NX1A 4N6EA 3GXNA 6ALDA 4OV9A 2YX0A 1UASA 2FB3A 1FCUA 3DI0A 4IMCA 4WX2A 4AEOA 3WJZA 3O16A 2RDWA 1OK4A 3SGZA 2DU2A 2JKAA 3OEXA 1TTJA 5D32A 4NJJA 1TPDA 3VCRA 1AG1O 5DELA 5KMYA 4OWGA 4PH6A 4IOTA 1YTDA 5HR7A 2ZZ7A 5H2ZA 4O19A 5CPMA 3NGJA 1XFBA 2W0UA 1EB3A 4GNJA 1JCNA 1TRDA 4UNLA 4WXZA 3SI9A 5CG7A 3G24A 1P0KA 3VKJA 3SJ3A 1X6UA 4FIQA 1OG0A 5KITA 2VOMA 2JGQA 3OHIA 2A6LA 3M5YA 1TV8A 2BX7A 2R14A 4KFPA 1XXXA 2NV1A 3T7VA 3GDKA 4PA8A 1A5CA 4IQLA 5F1UA 1DJQA 2GVLA 1KFEA 2CLLA 3W7MA 2ATSA 3BLEA 3QMSA 5BNKA 3W7GA 1IF2A 3VNDA 3GZ3A 1FWWA 1O94A 3AJXA 3BPWA 4BI7A 1DHPA 3B0PA 4NJHA 1MZHA 4RKAA 3HMJG 1BTMA 3NEVA 1ZALA 2ABBA 2GVJA 3GK0A 3W85A 1YTKA 5DCBA 5LSMA 1LTDA 4UTWA 1NF7A 3C0JA 1GPWA 3BGJA 5I3HA 4ZZ9A 1OJXA 3S42A 1WV2A 4K37A 3C2FA 1PE1A 1S3HA 3L0GA 3QSTA 3B8DA 3EWUA 3W1RA 2V2HA 1XC4A 1PHWA 1HO4A 1W37A 2H6RA 4Y96A 2C0AA 3UWZA 3F4WA 3YPIA 2ZA3A 1JCYA 4AMAA 3KHJA 1OYAA 5CPOA 2E6AA 1XDMA 4C1KA 3FYOA 3P84A 3KAOA 1GZGA 4GWEA 2HTMA 2P0OA 3MBFA 3LRMA 2TRSA 4A29A 3GAYA 4DO6A 4RLIA 1SZNA 1SW7A 1R2SA 4K8EA 2WPBA 2Y85A 5G2HA 2EPHA 3GXPA 3TU9A 4N2YA 3CB8A 5LNWA 1K7EA 1I2OA 3M7WA 2WSYA 4YWIA 3MYPA 4QNWA 1JUEA 4CLMA 3G0SA 3WJYA 3PY2A 4UC5A 1FXPA 3M6YA 4UTWC 4WXYA 5IM51 4UNKA 2NXIA 1FDYA 1H7WA 1X7FA 2DZWA 1XCFA 3NQ8A 1H5YA 3G1SA 4QJ1A 4LOCA 1KBIA 2DZUA 2HS6A 1XKYA 3R2GA 3LCGA 5LHEA 3O6DA 5I3JA 4UFJA 3WK0A 4JN6A 5AC6A 2XN1A 4R34A 1PCKA 3L66A 3NAVA 2BLEA 1SZGA 1ZAIA 3T44A 4EF9A 2DZVA 2QAPA 3RK8A 3JR2A 4DQWA 2PC4A 3U2OA 1XBXA 3EX3A 1TPH1 1UBSA 3TR2A 3B0VC 3EWWA 3HG5A 4I7WA 1WAUA 3P81A 4WZHA 5BMWA 3G1AA 3KX6A 1XBVA 1KFJA 4MZYA 4CQ8A 3DFOA 3M5VA 2YXGA 4LVGA 3RFAA 4BI6A 5U7SA 3I6RA 4O10A 1WDWA 3QPZA 4JS3A 4Z1BA 3S1VA 1P0NA 5ABTA 3DFTA 1L2UA 3TX9A 2J27A 2H3DA 3LB0A 4MLJA 2NUXA 1V5XA 2TYSA 4PL1A 1G7VA 1IIGA 1I45A 1EUNA 5AHMA 3B0UX 1YDNA 4GE8A 2AQWA 1QOPA 4RJEA 4HT3A 4O4VA 2Z6IA 2ZA1A 4JY8A 4NNBA 4WOZA 1RZMA 4AXKA 2RDTA 4QAIA 3NG3A 1GQNA 3EX6A 3TFCA 2FLIA 1F05A 1QDSA 1TQXA 1XDLA 1SSGA 4NNAA 2CZFA 3S8HA 4O17A 4JR5A 4ADTA 4AHQA 5CZSA 4MZ8A 1EIXA 1SW0A 1FCQA 1XUZA 3C2OA 3W2MA 1VCVA 2NV2A 1LP6A 2XN2A 4Q4KA 4WY0A 3D0CA 5E0KA 1VHNA 4FNSA 3W1UA 1LLZA 4AF0A 4FNRA 5HINA 2C19A 2V30A 3N14A 1U5JA 4H4IA 3FJLA 3L5MA 3GAKA 3SECA 3LTPA 3HBLA 4J9JA 4YLWA 1LRNA 3NQ2A 1GVQA 3ABSA 3GR8A 4UTJA 3M5ZA 1NF0A 3MP5A 2YPIA 1G69A 3C6CA 4AHPA 1OABA 3G8RA 3HPSA 4KWWA 5D2VA 1W8SA 3JS3A 2A6NA 3MO7A 4LW7A 4TR9A 2A7RA 4O53A 5BMXA 3HGJA 3W74A 4RX0A 2QKFA 2ISWA 1FCBA 1OFPA 1Q6RA 3A23A 2QJHA 3R8RA 3TCEA 5G1YA 3MI6A 3TNOA 4R53A 1M5WA 3CWOX 1H63A 1TJPA 3T55A 2J88A 3WJSA 3SZ8A 5I3IA 2C1HA 5TIMA 2NXHA 3H53A 4O11A 4JX5A 4M6QA 2OX1A 4IPJA 1TTQA 4JYDA 1FUYA 4N9DA 5L6UA 4W9TA 5C6MA 5EYWA 4QIUA 3S5NA 4JTEA 2VEKA 4YL2A 5DBTA 5C2XA 2DZXA 3L5AA 3W83A 2JKPA 1OX4B 2ABAA 3W22A 1B4KA 3PSWA 2E68A 3SGUA 3N19B 3WK2A 3S5OA 1WOBA 4NUWA 5F1VA 2PCQA 3GKAA 4BWLA 1R30A 4ZVJA 1OK6A 3W7PA 2A7NA 2G96A 2WQPA 5D2YA 4UUIA 1F76A 3R5EA 3DKJA 4QISA 1QPNA 2E5DA 3NNTA 1OYBA 5AC8A 4K36A 2GOUA 2VFDA 3FFSA 5I3GA 1M6JA 3BK0A 3UY8A 3BV4A 4IMFA 2DP3A 2A21A 1NEYA 3PUOA 2Z0IA 3SR7A 3CEUA 3L67A 3NM3A 4K7YA 1K8XA 3RLVA 1JULA 4ZQCA 3CPRA 2ZDRA 1OF6A 2C15A 1FXQA 5EKYA 1GTEA 4QQ3A 3C2EA 4LC6A 1W5MA 2I9EA 2Q3OA 1KM1A 3HIJA 1GT8A 4I7UA 1VH7A 5D30A 4N6FA 3HPXA 3UNDA 4LS1A 1TPC1 4CNNA 2CLIA 3W07A 3W73A 3QQ1A 3TAKA 3TJLA 4FF7A 4N9EA 1LRQA 3IGUA 3HB9A 3IIVA 1O5KA 1L6WA 2FJKA 4BWLC 4YXGA 1HG3A 1NSJA 2Y63A 2VFGA 3BGGA 3DU0A 2OMAA 2B7NA 3F03K 5AHNA 3UYCA 4IUOA 3ZR4A 4FX8A 4A2SA 1OX4A 3LCWA 4O15A 1JCMP 1DBTA 1JQXA 3W2LA 3CLMA 3TAOA 1T96A 3PBUA 4QITA 1OFRA 2NUYA 5LNRA 3KRSA 2VKZG 3T78A 3DHFA 2DZTA 3HGRA 5FEPA 1VLIA 2NZLA 3EWYA 3Q2DA 1OX5A 1WA3A 3M44A 2BWGA 1QO5A 5AN7A 1SO4A 2ZBTA 3E0IA 4OE7A 3FLUA 2XFWA 1QFEA 1OFOA 2OT1A 5D04C 1G7UA 1PS9A 3NXFA 3F4NA 3LI1A 4Q33A 1KV5A 2JBMA 5KSWA 3KRUA 3LHWA 3N3MA 5LZLA 3PS7A 1W54A 2X30A 3GVGA 3PBVA 3QZEA 1LDCA 1SZFA 3CEPA 1XI3A 4OHQA 5AYXA 4RV8A 3W1PA 1H1ZA 4ORIA 3WJWA 2JKEA 2X1RA 3S0CA 2FPTA 3U8GA 2QUTA 2ZA2A 4RXFA 3EWBX 4RZ5A 2CW6A 2NX3A 4O1AA 2V8ZA 3LRLA 1HO1A 1SO5A 3WK3A 3M0ZA 1W5PA 4QNEA 3M9YA 3O15A 5AYZA 2X1UA 5DXXA 5G5IA 3UWYA 3GDLA 1W1ZA 4OV4A 1SUXA 3HJZA 2J6XA 4FNQA 3TSDA 3P67A 1QCWA 1I2RA 3LCFA 1Q3NA 3M47A 4UTTA 3MI2A 1C9DA 4MOZA 5D2WA 4GUJA 1LBMA 3NQMA 4NJIA 3USBA 1GWJA 3LXBA 5MHBA 1XUUA 2Q3RA 3L5LA 1O4UA 1EUAA 4KFNA 2A2IA 5I3KA 4DF0A 4IMDA 1F73A 2R8WA 4NZJA 2J9XA 3B03A 3FS2A 3DI1A 4MUZA 4JD4A 1H60A 4O52A 1ICPA 3O63A 2QUVA 4FXRA 2V9DA 3LHYA 2V5BA 5U4NA 2V0TA 3PVFA 1KM2A 3W1MA 5FI8A 3ZWTA 1W0MA 4RR4A 3TFXA 3NQGA 1GYLA 1OF8A 2PURA 4OBTA 1M7PA 4JTSA 2J9YA 4LS0A 3LGEA 1KTCA 3L2IA 2QCHA 3W7CA 3TKFA 2YYUA 5KZMA 2C6QA 4MJZA 4OQVA 4ML9A 2A85A 4MYAA 2QDHA 3BG5A 4TMCA 3LTYA 1H7NA 1NVMA 5CGQA 3LLDA 5DXYA 2EAWA 4UFHA 1F2JA 3NPUA 1GOXA 5G4EA 1K8ZA 1V7YA 4UTTC 2JK2A 4ZQPA 2Q8LA 3STFA 3W7EA 3I68A 5CPLA 4N9BA 3DAQA 2QEZA 4AAJA 2E6FA 3SSJA 4LTSA 4LV4A 3TIMA 2NXGA 3DFSA 4O1CA 3KVMA 3O05A 2FQIA 1ML1A 1XM3A 1YXYA 2Y70A 1G67A 3W72A 1AL8A 1OX6A 3P8IA 1FDZA 3AO0A 5K9DA 3G1YA 4XKYB 2OJPA 2BSLA 4CQ9A 1WBHA 5HNRA 1B4EA 2FTPA 1FX6A 4AWSA 4E2BA 5K4ZA 3W75A 1YLVA 3SIZA 1R2TA 3S5ZA 2R94A 2QCNA 3MHGA 5D33A 5FF7A 4A3UA 4QM1A 1W3NA 5CZ0A 5HULA 5D09A 2ZZ6A 1AW1A 1XBZA 5F4XA 3S1XA 1DOSA 1HFBA 3NPWA 1OHLA 3EX2A 4O18A 2O7QA 4N4PA 1LCOA 4M5PA 4JTKA 2V5LA 4ZQOA 3P7YA 1UCWA 5CSSA 2DZSA 1NAL1 2E6YA 2Y7EA 3W9ZA 4JYEA 3EXSA 5AHLA 4M6PA 5G4WA 3UQNA 5H91A 1I2PA 2X2GA 2ATMA 5DCEA 4N4QA 4UR7A 3IVSA 5J5DA 4MVAA 5G1TA 2AGKA 2FDSA 3CWNA 3P5ZA 2V81A 2ZZ2A 1JR1A 4HNVA 4RK8A 3QYQA 4FIRA 3R89A 1F74A 1IIHA 3P8JA 1K3UA 4GJ1A 2ISSA 3BW4A 5D05A 1G4SA 3TQKA 2BZNA 4X22A 2VFEA 5G2WA 3W1AA 1MSSA 3NL5A 2Y7DA 2VFFA 1KFLA 2A0NA 2CU0A 4ADSA 5I3FA 2ZRZA 3G3DA 3LX9A 5TQLA 4WJEA 2GJLA 4XTDA 1PVNA 4QSHA 3W7HA 5F2MA 3SFKA 1HUVA 4RZ6A 4Z08A 2CZDA 3CTLA 4S1FA 1H7RA 5D2TA 1X1OA 2ZQ0A 3PUEA 1H51A 1VYPX 1FDJA 3HG4A 4NXKA 3W86A 2I14A 4XUGA 3L9CA 3LLFA 4NJGA 4UR8A 3W7KA 3PWAA 3ZFHA 4PL2A 3A5VA 1QR7A 1AK5A 1F6PA 1H7XA 1G6CA 1TPEA 3DFPA 3NQ7A 2VEPA 3LCHA 1VPXA 2E6DA 1YYAA 3BLFA 4UFKA 5AOUA 4DF1A 3V1PA 3G3MA 3OIXA 4TX9A 4Z1AA 2A7PA 4H6KA 1QMLA 1ADOA 3W2UA 2ZZ5A 3CIWA 3BO9A 1CI1A 4JTLA 4PTNA 4NXSA 3WFAA 1FBAA 3A22A 4EOUA 4IX2A 4P61A 4X9SA 3NDOA 4O13A 4I7VA 2QJIA 3BW3A 3TMLA 4KKXA 3MHUA 3QFEA 2ZRVA 1VC4A 3BG3A 2NX9A 4LV9A 3QH2A 4HPJA 2YGYA 5K7JA 2WNQA 4YMZA 4AHOA 3G1VA 1F6KA 2OCZA 1K8YA 3STEA 3W84A 3LHVA 3W1LA 4FX7A 5TBOA 3UXDA 4M7TA 5HMSA 2EKCA 4G1KA 1W5OA 3GLCA 3HO8A 4NU7A 3IGSA 4HNNA 2Y89A 4IWWA 1OFAA 2GVGA 4M6VA 4O57A 4M7SA 3NL3A 1GVFA 1ICQA 1X1ZA 4LT9A 2NUWA 1E51A 5AHFA 5A8GA 3HPZA 4IXHA 2B7QA 4UIOA 3V75A 4ZL1A 5DN1A 3S5YA 3IRDA 3MP4A 1FWTA 2YFOA 2E5CA 4DO4A 3EX4A 5D37A 4FNPA 1PCWA 2EHHA 5C54A 1PL9A 1UB3A 3W7IA 1OYCA 4X2RA 3IVUA 2FFCA 3IIXA 3S1WA 3NPXA 1ICSA 1JUBA 3P62A 2Z2UA 2RFGA 3LV5A 4GUHA 4XZ9A 4ZQNA 4N9CA 2Z1BA 5HJLA 1F7BA 3LCLA 5BOOA 1LRTA 5D38A 2X16A 4L4LA 1XBYA 4GUGA 2BTMA 4FB7A 3QQ0A 3TC7A 3VI2A 3LXAA 4BFAA 7TIMA 3CT7A 4U4MA 3L0KA 1ME7A 2QCEA 2RKXA 2WOQA 1B9BA 4NX0A 1TPB1 3E02A 1CW2A 2G97A 5KZDA 2GQAA 3W87A 1D3GA 4JYFA 4RZ4A 2ZTJA 4JNMA 3Q37A 4HSOA 3UPBA 3STGA 1GJPA 5EBUA 1ZENA 4OGZA 4JICA 3P61A 5KINA 2F7FA 4HNUA 1ZHAA 1WQ5A 4MY8A 3UXAA 1VCFA 4JX4A 3UWUA 3W1TA 3QEZA 4HKPA 4MKNA 4IGHA 5FESA 3WK1A 2LLEA 3FA5A 3NA8A 2X1TA 4FNTA 4O1BA 3TQ0A 4JTFA 4JTUA 3KVLA 4Z0JA 3O6YX 4JY9A 1P5BA 2G5WA 1GVRA 3I65A 1VGAA 1WXJA 2Y7GA 2FPYA 5EY5A 3N73A 3PF3A 2H3BA 2V2DA 1Q6OA 1OVDA 1TPVA 4DELA 2QAFA 4AB4A 2QCGA 3A24A 4C1LA 1VYSX 2WSQA 5J5RA 3CM4A 3W6YA 5FEXA 1KA9F 3KVJA 1EP2A 2A1YA 4UFMA 4XWUA 1DV7A 1RPXA 4LVBA 3QMTA 3W23A 3C2VA 3JRKA 4GFSA 4Z0SA 3RF9A 1B57A 2PE4A 1YPIA 3N34A 3LM7A 4AWTA 1JJKA 4A22A 1R46A 2QCDB 4O0KA 5LNVA 1KFKA 4K7VA 4Y9AA 2F84A 1ZAHA 3SW6A 4I9AA 1LM1A 3NQCA 4Y8FA 3MJYA 1TJRA 2QF7A 3P60A 4UTIA 3EKLA 3LTSA 3DFQA 4IPIA 3IIPA 3E12A 2E5BA 3PC0A 3LDVA 8TIMA 3QF0A 3DH7A 2R91A 1JRBA 4ALDA 1W3IA 1W56A 4O16A 1SQ7A 3GXTA 3CQ0A 3NQFA 3TH6A 4FO4A 5SWUA 4JTJA 4D2JA 1TV5A 3LI0A 2ALDA 1WX0A 1K02A 5HWJA 5AC7A 3HG3A 3A9IA 1FQ0A 5FF2A 3H54A 3NVTA 5KZEA 5FEZA 2D73A 5DLCA 1NFBA 4FEZA 3R12A 3KOFA 3PSVA 3O07A 3QPYA 4CNPA 4NQ1A 4MPQA 1QPQA 3IV3A 1N7KA 5DBUA 3E96A 2C18A 3NL6A 2J24A 4R7JA 4PCFA 4UFIA 2CZ5A 2ZZ1A 5LHFA 1HL2A 1I2QA 3B4UA 2WO5A 3E49A 3MBDA 4TMBA 3I7RA 3P82A 3T4CA 3Q58A 1RVGA 4HN4A 3G1XA 4IMGA 1O95A 3TE9A 1A5SA 4PC8A 3G8EA 5A5WA 2AAMA 4E0CA 1RR2A 3M43A
chains in the Genus database with same CATH superfamily
2WVSA 5AB3A 5A6BA 1HL9A 4YCOA 1E73M 1YTEA 4KIEA 3NDZA 5KZ6A 3CL8A 4XAPA 5CZJA 2P53A 4GUFA 3VKCA 3DIPA 2OB3A 2CLOA 3SRHA 4OECA 3TYAA 6TIMA 4GBUA 3RX4A 4O8RA 2OYMA 1T99A 1IGSA 3CIXA 3DYOA 4JDBA 1S5TA 3WNKA 2B4GA 1SZEA 8XIMA 2GSEA 2YDAA 3N11A 4W7UA 5DY3A 1Q2SA 2GWNA 2KZHA 4X0VA 3VDHA 5K3VA 3IUHA 4HMCA 1DIKA 1JL8A 2CLEA 3N2MA 4IPLA 3T81A 5H8UA 3VIHA 4NT0A 4NILA 4C6PA 3OZYA 1MXDA 3S1UA 1FWIC 3DYPA 3CBWA 3ITXA 3DG6A 2OG9A 2REQB 2CLKA 3VZZA 3QM3A 4NZ1A 4LUSB 2W61A 1OZQA 3S2LA 1FP9A 3D3AA 1U83A 5J04A 3BL3A 2BG5A 3M41A 4MJ2A 2QJGA 4R7OA 4DWSB 3UGVA 4P2VA 2CETA 1Y7VA 4ZQMA 4XTIA 1QU4A 3QC0A 1A5NC 5AHIA 4HMDA 1E1EA 1QHOA 3B04A 4QQUA 5A6BD 3B8WA 1A0CA 1QNVA 1LQAA 3B4YA 5DF0A 4LYQA 4AIUA 4C6BA 4Q7IA 3SQSA 7TAAA 1R47A 1W1B1 1QI2A 5BXPA 3GC2A 4PODA 4JKMA 4HZ7A 2NQZA 3IVTA 4S3BA 2EPOA 4RCXA 1P6BA 1V02A 3SRKA 2YZRA 4NX5A 1LG1A 3DFNA 2QPUA 2QVHA 4CKQA 4UQEA 3UR8A 4PMRA 3VOCA 3NTYA 3VK5A 1NY1A 1QI4A 1SO3A 2OQHA 1EP3A 4J3VA 3K8MA 4IIDA 5DANA 2C3ZA 2E9MA 3WDIA 4M81A 2ACSA 1EQPA 2EO7A 1DWHM 2PF8A 4RDZA 3CPUA 4LWWA 2J47A 1NM9A 1YPFA 3KCLA 4LUSA 3TN3A 4DLMA 3MP3A 4U5IA 1YW1A 4ZQRA 3MQTA 3MWAA 1VFHA 1S2AA 5LKYA 1FWGC 3U6WA 1SSDA 3GU9A 3UWQA 1PDZA 3C0QA 3MVTA 2PTZA 4C6NA 4AH7A 4HNTA 2E8YA 1EYEA 4Q32A 3OVGA 2NLYA 2TMDA 5FAJA 3TCSA 2DJXA 2WSRA 3B06A 1TTIA 4O28A 3VAVA 3RAOA 4PSPA 2GGGA 5L9FA 4KCTA 3MMTA 4UTKA 3SCVA 3GNDA 1J10A 1J5TA 1PV8A 4O1DA 2WCAA 4NJKA 4RE2A 4KEZA 2IMRA 4RDYA 4DIAA 3ITVA 3W7LA 1A53A 1Q6FA 2E77A 3VILA 1TJ0A 4WGXA 2DW7A 1NOUA 4YNGA 3I3EA 3R8GA 3TA6A 3WJXA 3T2PA 4Z2HA 3EWDA 4HJFA 3R25A 3GR4A 1WUFA 3CZ8A 4TXEA 3OVRA 3LV6A 2HPMA 1E9YB 1KTBA 2FPVA 4S3KA 3VC6A 1QAPA 3ARTA 4PMDA 2AAAA 3NOEA 5M17A 3A12A 1U1HA 5CZTA 3LENA 1A50A 3T05A 3H4XA 2Z2BA 1K8CA 3BAKA 4L1GA 4IJBA 4Q6JA 5I6SA 5CC6A 4CGTA 3DXIA 4L9ZA 1W1PA 1E3XA 2VEGA 4WUIA 2W62A 4Q22A 4GINA 2VX6A 1ODUA 2X1SA 3WN6A 5K2ZA 3PNZA 4JN7A 4FLRA 3C8FA 1MQRA 4MLRA 1OFDA 4AZIA 1FCVA 4CCCA 4UCGA 1XSJA 1U2YA 3O06A 4HHPA 4EE9A 4JTQA 2I1OA 3W2KA 5BOEA 3IRSA 4KETA 2CWXA 3MW7A 5T91A 5FF3A 4GHRA 2XG9A 3NQDA 5ECUA 3I3DA 1J18A 1UROA 2ACUA 2VELA 1FP8A 1TREA 1ITCA 2ZWZA 4GVIA 2ANUA 5D02A 3KHDA 2UV8G 3MHFA 2DH3A 3KL3A 4UTMA 3HOJA 1TV3A 1F5ZA 3SY1A 3L4WA 4GIEA 4MY1A 2OGJA 2HK1A 1FHLA 4CD7A 3BCFA 2GWGA 2XVLA 1R87A 5BCAA 3BVJA 4O12A 2Z25A 2HCVA 2ZC1A 1EWEA 3SCQA 4BY3A 2R82A 2PDHA 4DF2A 3UPWA 5DRCA 3GR7A 3SY5A 3SDOA 2HS8A 1C7TA 4LUIA 1Q6GA 4KWVA 1XLKA 5BW6A 1DJIA 1ZJBA 4P7QA 1QHPA 2TSYA 3ITGA 3H21A 4LNYA 4HA0A 3E6EA 5F2IA 3H7VA 3K13A 3R13A 4JIPA 1QI0A 4MY9A 5A8NA 1OCBA 2C13A 3VABA 1KV8A 1TCDA 1POKA 1BEUA 1W9VA 1BHGA 1WKYA 5HPOA 1TV4A 1O68A 4B5TA 4NVTA 1G4TA 4FA3A 1BKHA 1O7AA 5I09A 4LVFA 1QPOA 1UR2A 4R33A 3VFLA 1EF3A 1EOMA 1GVOA 2VCCA 3ZR6A 1TMHA 3A6OA 2VXNA 4K8HA 4CQBA 5REQB 3W0KA 3LHZA 4E8DA 3HA1A 1RJRA 2OZTA 5LNSA 4IMAA 4QLKA 3L65A 1SJAA 1QI5A 1A4MA 3RPMA 1RY8A 2WNNA 2V68A 4EXBA 2WKJA 4DI8A 2XVGA 2RH9A 2NWSA 4AD0A 1KM6A 3NZ1A 1NJJA 3WQVA 1A0DA 3T6CA 3TUUA 3W7JA 4TU1A 5K4XA 1HJQA 1EDQA 2GQ9A 3UP8A 3BZJA 4PRRA 3EYPA 4O54A 4B3KA 2WZEA 3WIJA 1OEPA 1XRSA 4GUIA 4Q7NA 4HZ6A 5T8GA 4F0KA 1ME8A 3IIZA 1H61A 4OT7A 3M64A 3VGEA 3WLJA 3N18A 1Z48A 2XINA 3L0NA 2FTWA 3AJ7A 2E1DA 2VUYA 4CQAA 6PTDA 4RL3A 3W1QA 2ISFA 1A5KC 1TPWA 1I6NA 3LHUA 3L68A 2A4AA 3NQAA 3PUDA 3K30A 3LCXA 3R8HA 3UNTA 1L8NA 1P43A 2NV9A 1OFQA 3OZPA 5E0CA 4K6AA 3N4EA 3RGTA 2J8GA 4GG9A 3IJIA 2MUCA 5A6LA 4JGDA 1JZ2A 2X05A 5CGTA 1F8IA 3ZO9A 3S47A 1VCGA 2DUAA 3OTRA 3WNOA 5FF0A 3GZAA 5CSYA 1SU5A 4CCDA 1DL3A 5BZAA 2W63A 3M5XA 2ZX6A 4ERAA 4GCAA 4HK6A 3PM6A 3QMRA 2W79A 4IG2A 3IJQA 3T0AA 1KRAC 4QX4A 4BJHA 5BWFA 4YCPA 1KBLA 2F38A 4XVEA 1SFJA 5G2IA 2KX9A 3U0HA 1SO6A 5D03A 4OOUA 3VE9A 4LRSA 3UJFA 3UA3A 2PRMA 5T9CE 3FVDA 2ZUWA 3V5CA 2QCDA 1QNSA 1QOQA 2W67A 1WKFA 3W1XA 4XIMA 3ES7A 1E0XA 4GRSA 3OU8A 1WDPA 5HWMA 3CL6A 5C5YA 1AL7A 1W8GA 4QGCA 1U1JA 5CSRA 2XSAA 4I6VA 3DZ1A 1XLGA 5JH2A 1X39A 3LBMA 4S2CA 3WUGA 1C8QA 1SR0A 4UZSA 4KEUA 3QR3A 1UZDA 1MUCA 4RPQA 3TTSA 3EOSA 3BWWA 1XGEA 2HVOA 1DE6A 1FCUA 4GX8A 4H6RA 4PBGA 4Y8EA 1HXJA 3CQKA 2CPUA 4PUNA 2XYLA 2VOTA 3QFWA 3OGSA 1XIJA 1AG1O 2CXGA 4WDXA 2QDEA 5AECA 1HKVA 2GGEA 3VUSA 5ABFA 5CPMA 5A3HA 2DY3A 1SZRA 1CLXA 2MNRA 3MZ2A 1XFBA 1TRDA 3VKJA 3MUIA 3VYLA 2V5DA 4PMOA 3M5YA 4E3VA 3TOYA 4RV3A 3F4DA 3VNLA 4PUJA 4K1GA 1RA0A 3T7VA 1NWTA 4IQLA 3GRIA 2E9LA 4IHCA 4B4HA 4YYCA 3BLEA 3CGTA 1NOFA 3CTTA 2I7GA 3GZ3A 4AZCB 1O94A 3AQUA 4UQAA 1EL3A 3H70A 4DNMA 2GLKA 2DW6A 3AJXA 3B0PA 4NJHA 3LPOA 2G3IA 4AMCA 5D8ZA 3NEVA 5I79A 2ABBA 3W85A 4AZ5A 1LTDA 3FAWA 3WEZA 5I3HA 1OJXA 4DXKA 4K37A 3C2FA 3VOGA 3QSTA 2PS2A 1M01A 3W1RA 3QZAA 1PHWA 1W37A 1D2KA 4HK5A 2AKZA 4IFKA 4XAGA 3YPIA 1TWIA 3ARPA 2ZA3A 4ZODA 2PTDA 1CGTA 1XLDA 4C1KA 4RE4A 3UCCA 1Z3NA 2HTMA 4QXIA 3WDHA 4I5XA 2RUSA 4WSHA 3R1ZA 4FR6A 2R24A 2WMFA 1W2PA 1R2SA 1GOWA 1Q6DA 2WPBA 2Y85A 2EPHA 4QJ5B 4N2YA 5LNWA 4M82A 1S5NA 1MXGA 2OLHA 3BC9A 4QNWA 3G0SA 3WJYA 4WXYA 2NXIA 3XISA 4AVOA 4HYWA 3NQ8A 3ZQ9A 2XUCA 3WD4A 3H2AA 2PP1A 4LOCA 1GHRA 5LHEA 3O6DA 4AZCA 3QLLA 2UY3A 4UFJA 4JN6A 4U2ZA 4AYGA 2XN1A 4OVXA 2BLEA 1CXKA 1ZAIA 2ZX5A 4EF9A 2BODX 3N2CA 2QAPA 4BQ2A 3EX3A 1TPH1 2BGNE 3NSMA 4Q4RA 3EWWA 3HG5A 4I7WA 3KWXA 2VC7A 3LQLA 4OJYA 3GNPA 4DWSC 4WZHA 3SQLA 1KFJA 4CEUC 2O9PA 1KO0A 3M5VA 2WMHA 3PZUA 4LVGA 2BXZA 3I6RA 5I24A 3OO2A 4JS3A 4Z1BA 2R6OA 4GVGA 4US6A 1L2UA 1LT7A 4ML4A 2VGIA 4ATLA 1F3EA 2H3DA 4NL1A 1HJSA 5B7ZA 2PZ0A 4JZ5A 2TYSA 3FX4A 4PL1A 1EUNA 3OHMB 4GE8A 2AQWA 2AMXA 1S1RA 1V08A 4JY8A 2G50A 4NNBA 1EF2A 1WKDA 4HPNA 2XZ9A 1JAKA 4WOZA 1RZMA 1JDAA 1PX4A 3EX6A 1BVWA 2FLIA 1E4MM 4F40A 2WLYA 4ZOAA 1K9DA 4ADTA 4YYFA 1OG6A 2WCSA 3MKCA 3W2MA 1YNPA 3KBVA 4PTDA 3BDKA 1HGWA 1UJQA 3CAKA 3D0CA 5E0KA 1VHNA 4BCEA 4FNSA 4FNRA 3PWGA 3L5MA 3VZYA 3GAKA 4GI4A 2UZ9A 4YLWA 3HN3A 1LRNA 2CHOA 1GVQA 1GOKA 5E6YA 3M5ZA 1NF0A 3MP5A 1G69A 2IQ0A 5C9RA 3C6CA 4MWAB 1ZSXA 3HPSA 4KWWA 2CIPA 4S38A 1AH4A 3JS3A 4LW7A 1V3HA 2A7RA 4O53A 5HQLA 2C79A 3WDRA 1REQB 1VIZA 3N15A 3GVQA 1Q63A 1DP0A 3LBOA 3MI6A 5G1YA 3TCEA 3AHYA 3JUGA 4W5UA 1M5WA 1DTUA 2GFTA 4A05A 3H4GA 2WC3A 4O11A 1UKTA 3DX5A 2OX1A 3G5EA 1TTQA 4J5NA 3C2YA 5L6UA 5C6MA 1GVIA 4GY0A 3S5NA 4YL2A 3GNRA 3IWPA 2NQ5A 2JKPA 3W83A 3GNOA 5HNTA 3RJYA 4DHGA 3N19B 1WOBA 5F1VA 7PTDA 2PCQA 4BWLA 1R30A 4C65A 1Z69A 3W7PA 2A7NA 3H2EA 2QT3A 2FJUB 2BY0A 1XH1A 3GUGA 5CG0A 3MUZ1 1OYBA 2WZHA 3MJMA 4ZE5A 3GTIA 3BV4A 5FJTA 1O1HA 3GFXA 2DP3A 1PB0A 3U2CA 4DJFA 3MTWA 5CGMA 3PUOA 1E5JA 2WWDA 1XD1A 2VNCA 3NM3A 3H4WA 1K8XA 2YOCA 1VFTA 1XR2A 3VDAA 2OFJA 3U5YA 4MWAA 3W6LA 2Q3OA 1GT8A 1UP3A 3DUGA 1VH7A 1REQA 1F61A 4N6FA 1AQFA 1U1UA 4GQ0A 3UNDA 4KESA 1TPC1 2Q8XA 2NVAA 3GE7A 2XVPA 5M5DA 3W73A 3QQ1A 3TAKA 4ZBCA 4QEHA 3IGUA 4AUBA 2FJKA 1HG3A 1QBBA 1UWRA 2VFGA 2XU2A 1DWFM 4B2DA 2VX5A 2PA6A 4Q8UA 4F2BA 3ZR4A 5AHNA 4DXXA 2W3ZA 1JPIA 1UA3A 4M56A 2J75A 1JCMP 3CLMA 3TAOA 1HVQA 4XZHA 5G1MA 3K2GA 4D6JA 3PBUA 2NUYA 2WC7A 2QS8A 1XW8A 1LWIA 4LEQA 4EANA 3O7UA 4AISA 3F4CA 1W1VA 3Q2DA 2DIKA 1OX5A 3GHRA 3VVGA 4HU3A 1P1MA 1NDYA 1ZBWA 4OE7A 2OT1A 2EG8A 1KV5A 5A2BA 4DJFD 4A35A 2PWEA 1EZ2A 2JBMA 2ZXDA 4MB1A 4PUKA 1GORA 3N3MA 1I75A 2XIJA 1T41A 2JALA 5LZLA 4QHRA 2L5HA 2PDQA 5ABHA 1SZFA 1XI3A 1NQKA 4MWAD 4OHQA 3ZZ1A 4RV8A 4BF5A 3EBVA 4DM2A 1H1ZA 1JZ7A 2X1RA 1ZJHA 3PWIA 1QVBA 2I9UA 5HOSA 3U8GA 2QUTA 4RZ5A 4O1AA 2ISDA 3W6MA 1HO1A 1SO5A 1PAMA 4QLLA 3O15A 2X1UA 5H8PA 4EPDC 3MC5A 3GDLA 1W1ZA 3ORWA 2A3HA 4V33A 4B2DD 3TSDA 4GGHA 2PLMA 3MI2A 1C9DA 2WNWA 4E8GA 2VZUA 5HPCA 4MOZA 5D2WA 4D6DA 4QE5A 1LBMA 4WDUA 3MCOA 2OQLA 5MHBA 2D22A 4DLFA 5MKGB 4KFNA 4CD8A 1XS2A 2OWWA 3BJFA 2D23A 1F73A 3VD7A 2R8WA 3R43A 1BVZA 3LSCA 2J9XA 2DEPA 4O52A 4ATDA 2Z2AA 3O63A 2QUVA 2V9DA 1B54A 4J28A 2DVTA 1V3LA 1BYAA 1W0MA 3NQGA 3M0XA 1OF8A 4OBTA 1GONA 3CLWA 3AAMA 2EPNA 3D6NA 1MDRA 3LGEA 4I5RA 3L2IA 1PZ0A 4MJZA 1IEWA 4OQVA 1UD2A 2A85A 1AJ0A 4YTQA 3BG5A 3LTYA 3V0SA 1CB2A 1FFRA 1PX8A 4UQCA 1EXBA 4UFHA 3NPUA 2ZX7A 1GOXA 1EOKA 1UWAA 4DWDA 4RE0A 3UJSA 3NO3A 3EDFA 5CPLA 4N9BA 1N8IA 4LTSA 2O4MA 2ICSA 4IF2A 1GW9A 3WBEA 3IJ8A 3ITTA 3ZSTA 2AOSA 5DMNA 3W72A 2PBOA 1AL8A 1CXEA 2G3FA 3CYVA 3P8IA 5BROA 3AS1A 3AZSA 4XKYB 4AX7A 1B4EA 4Q4MA 3EOOA 4AWSA 2FZBA 4DBSA 2VYOA 1SFTA 3MHGA 5D33A 5MKGA 4QM1A 3VNMA 5HULA 3Q4DA 4GPNA 2QUMA 3NZQA 5F4XA 3S1XA 1VFUA 2FVLA 1OHLA 3EX2A 1IZKA 2PDMA 4M5PA 4JTKA 4KRTA 2V5LA 4ZQOA 1CNVA 1NAL1 1J5SA 2E6YA 2Y7EA 3UR5A 3GG8A 4NKCA 4ZXLA 3GQYA 1FWFC 1XYFA 1UZHA 4A6GA 1S3TC 1I2PA 2CESA 1V93A 5DCEA 4QAWA 2VC9A 2ZXAA 4DY1A 3TLQA 5G1TA 4Y7EA 2FDSA 3KDOA 1NFPA 2ZC8A 2DH2A 3FDKA 3NFUA 4GJ1A 3TQKA 2BZNA 4WIWA 4BQ4A 3WQFA 2D0HA 5G2WA 1W1IE 2Y7DA 2A0NA 3UR7A 3VOHA 1KXTA 1V6VA 2YB4A 3LX9A 4WDTA 3GM8A 1JGIA 1R3QA 4Q8VA 1FHVA 4NYYA 2WSKA 3SFKA 3POHA 3OQEA 2CZDA 3CTLA 5LIXX 1NWUA 1VYPX 4GVFA 1Z89A 4L61A 1V0MA 3HURA 1GHSA 4U33A 4C6MA 1WO2A 3E3HA 3AIRA 5KEZA 1QR7A 1PX3A 3MKKA 4RNJA 4H04A 2CHNA 3UBPC 4W88A 3DFPA 1UP0A 4NZ3A 3S4TA 2PWUA 3WNMA 2VEPA 3LU2A 2E6DA 1JI2A 4GCXA 3RCNA 3V1PA 4B90A 1OM0A 1XSKA 4H6KA 1NP0A 3A3XA 3W2UA 4DAIA 4L9XA 4HU0A 2Z7KA 1CI1A 1K4HA 5TD4A 3WQEA 4JTLA 5LYRA 4JKLA 2O9TA 3WCZA 4IL2A 3VGFA 3LYEA 1Q6EA 4O13A 4M3PA 4I7VA 1BG9A 1BVNP 3OBEA 3VUPA 3BW3A 5GJNA 1T6MA 3QFEA 3BG3A 2NX9A 4QDMA 1MNZA 1GW1A 4GZEA 2YGYA 5J8LA 1BSIA 4AHOA 3G1VA 2OCZA 3W84A 2EG7A 1UA7A 4PMUA 4ZOCA 4PMVA 1ZCCA 5HMSA 2D0GA 2XH0A 3FW6A 3GLCA 1G1YA 3HO8A 1EKOA 2DZBA 4NU7A 4QG6A 1MDLA 5I00A 3IGSA 1M41A 4HNNA 3PJWA 2Y89A 3LMZA 2GVGA 4O57A 3ZT7A 5FD0A 3ZM8A 2B7QA 3V35A 2WVUA 3SADA 4J3TA 2QW5A 3WENA 1FWTA 2E5CA 3AWNA 3EX4A 1PCWA 1OT2A 3II1A 4JIEA 1PL9A 2DFAA 3IVUA 2FFCA 3IIXA 3S1WA 1DWGM 5AYIA 2RFGA 3LV5A 3QHNA 2Z1BA 2YDQA 5AZ1A 4PMQA 1J12A 1AQHA 4CUCA 4BHYA 4NF7A 4FXFA 4C6FA 1JZ8A 3LXAA 2DDXA 1VPQA 2HEJA 4LXFA 2HV5A 1XPGA 2J7BA 3DFYA 1W91A 2D0FA 1E1FA 3WLRA 2E67A 3TONA 4WSKA 4LB4A 3E02A 4KIRA 2G97A 2BY1A 2GQAA 3QKZA 4GZJA 1N82A 2CITA 3M7SA 3EPNA 4S3FA 3FA4A 4HSOA 4OUEA 3F5LA 4GABA 1YEYA 1VP5A 4JICA 3S2JA 1ZLPA 1YBQB 4HNUA 1ZHAA 2CXEA 1E55A 2INFA 5DMMA 5PTDA 3MO4A 4LH8A 3R94A 5CPSA 2LLEA 3WO8A 1DIOA 3GG0A 3TQ0A 3ARUA 1EJTC 4JTFA 4GVHA 3EB4A 5HJYA 2VQTA 3W4RA 2HJPA 1XV8A 4PRWA 4JY9A 3A4XA 4W8BA 4GJIA 1OB0A 2GVEA 3I65A 1E0WA 4AY8A 1DQUA 5EY5A 1E56A 1H2JA 4AB4A 1EEXA 3VD5A 4C1LA 3RX2A 1VYSX 5J5RA 3CM4A 3W6YA 1KA9F 4DUVA 3PTKA 4HHLA 1KFWA 1R9XA 1UHVA 4RNIA 2ZVIA 1BWVA 1JGMA 2GK1B 1RCOB 3WZ0E 3C2VA 3JRKA 4GFSA 4Z0SA 1Q65A 3WFZA 1YPIA 3KP1A 4Z2LA 4XZBA 1R46A 3IJDA 4K7VA 3EA1A 2F84A 1ZAHA 1XQLA 4GNKB 4LANA 3TEVA 1XH0A 4C91A 4IFOA 2GSJA 3MJYA 2PLKA 5IOBA 1QW7A 2QF7A 3P60A 4UTIA 4R7WA 3DFQA 3E12A 2E5BA 3PC0A 2HXUA 3DHUA 4KS0A 3N3TA 4UB9A 1JRBA 3IAPA 4IIEA 4UZUA 4MNLA 3TH6A 3V1HA 3LI0A 2ALDA 3WL1A 3WLTA 1XICA 2PDKA 5FF2A 3PTMA 4IGMA 4PUDA 2XIMA 2AKMA 3H2OA 3WQ5A 2F2HA 2D73A 5A94A 3VNKA 3L4YA 4PULA 3O07A 1HX0A 3UGRA 3CUXA 5A6SA 1E0VA 1HKJA 4GJJA 4Q8PA 2P50A 4UFIA 2ZZ1A 2WO5A 3MBDA 4GQQA 3I7RA 3GDBA 1RVGA 4HN4A 4YHGA 3V5OA 2PD5A 3WF0A 1ELSA 1U33A 4QFUA 2IS7A 5A5WA 2AAMA 3CAWA 1K70A 5ENLA 3WLMA 2GK1A 4CCEA 1JPMA 4W8LA 2O92A 4JHMA 4L6DA 5E93A 2ZTKA 2BVTA 4LAOA 3JZUA 1L0PA 1ZAJA 4A21A 4M19A 2CZEA 1BXNA 1KM4A 2AL2A 2D2JA 2Y6ZA 2J9ZA 1GYNA 1E9LA 2BS9A 4ZENA 8XIAA 4LC8A 3QHOA 4KMQA 2CLHA 2H8ZA 4HPXA 1DXIA 1KLYA 3IIOA 3W70A 3AIUA 3ELFA 1MO0A 3ZR5A 3S6TA 2GJNA 5D2XA 1MXSA 2G95A 3KCJA 3FJNA 3XIMA 4JTGA 1H50A 3HQNA 3THAA 3NR0A 1EJWC 1NH6A 4CNOA 3LG3A 1H62A 4Q8WA 3VNIA 1JPHA 4B5NA 2VEMA 4TVCA 3UWEA 2G0WA 2PDNA 4YU1A 3EEZA 3N9KA 2PZNA 1A3XA 3BAXA 2OPJA 3U5UA 4ECLA 3R7MA 4QDPA 3GDRA 4ZO8A 3WF3A 4G6CA 3WMSA 1SJCA 3CC1A 5EA9A 5FJOA 3PK7A 1L9WA 3KBSA 4R88A 1UBPC 1Q45A 4JHOA 3FJ6A 1RD5A 3EX1A 2BGQA 1H1YA 3LHTA 4HCLA 5HDRA 2UBPC 3I7QA 2QCMA 2AQVA 2NQ9A 1JXKA 5B80A 2WW5A 1LWJA 2WMJA 1D9EA 4PCSA 3W37A 4AZ6A 4H2CA 4QTGA 4BK9A 3M1ZA 4MIMA 3EKZA 3M07A 4IUGA 2EGZA 3KCOA 4NNCA 1R3RA 1EA0A 3BG9A 3RMEA 3UG3A 3QC3A 3M0VA 3HQPA 2QV4A 1YDYA 3ZJ6A 3TJXA 4Y90A 2Y62A 2Y61A 3CQJA 3ARRA 2VUNA 7REQA 1FH8A 3N9RA 4A3QA 5E1QA 5D9MA 3WUEA 2OZ3A 4F9DA 2J78A 3F1QA 4LS2A 3A5FA 3OYXA 2P3EA 1C29A 4MJMA 3ONBA 3RDKA 1V0NA 1M3UA 3Q45A 1Z41A 4I9TA 2NSOA 4X60A 3PG9A 4GC3A 3TC6A 3ABOA 1TO3A 4CD5A 3TV8A 3BSMA 4GKLA 2ZKMX 4LY4A 4BQ5A 3GKFA 2VWSA 1KW1A 1E6PA 3SUWA 2XN0A 3O6AA 3GXIA 1JEZA 2ZFAA 5HATA 1LLWA 3EGJA 2VFHA 2YW3A 3AMCA 4O0ZA 2EPMX 4CN6A 1THFD 1XHGA 4WD0A 3T1GA 1WYIA 3R0UA 1FWAC 3G0XA 4WY0F 4M8UA 1IWPA 4DO5A 5B7YA 3C8NA 1ADDA 4KWSA 1DQWA 1POJA 3BGAA 2WJZA 2ZCGA 5BXTA 3S6DA 3W28A 3AXMA 4AWUA 3CUIA 3VKBA 1OADA 3C3NA 3W2NA 1ZGDA 2RJGA 5C0QA 1KM0A 4WY0B 1VLWA 4LYPA 3K8KA 3PJUA 1L2QA 2NQJA 1FKXA 4FSAA 1UC5A 2PGWA 3T4WA 3S5SA 2EF9A 4ZEPA 3GIPA 4IISA 2XDFA 1WNOA 1R5YA 1YPXA 1QNPA 3QW4B 3QSRA 3RJXA 3UZ5A 1P4CA 1Z8AA 2YL8A 4TX6A 3WLIA 1Y8BA 3UZJA 3WUBA 5I0DA 4KPLA 4IQJA 2XGBA 1BWKA 1A5MC 5DT7A 2JIEA 3ZT6A 1H5VA 1RQEA 3VKKA 3NL2A 3PB2A 1TPUA 1VRDA 3PN8A 1UUQA 2Q8ZA 2FB2A 4XZMX 4R85A 4OKDA 1JRCA 3NYZA 3BLLA 1EC8A 2ON3A 4Z1CA 4Y9PA 1IXOA 3PHAA 1U30A 1TQJA 3B9OA 3KBWA 1I4NA 4AIOA 4FPSA 2BNJA 3G0UA 1JPKA 4TOQA 1VIWA 2VZSA 1UUMA 4GIRA 3BW2A 3UZZA 3HGSA 3FIGA 4W84A 2PTXA 1RLCL 1UJPA 2IPWA 3LSBA 1LORA 4K39A 1XYCA 2YBTA 2OOGA 2DZPA 5FSEC 1NFGA 4A8LA 2P10A 3UXKA 2V5CA 4MFDA 3ITLA 5K9XA 2XSXA 2J77A 4AZBA 1HJXA 3ZS4A 3TYCA 3BJTA 5F2LA 3H7UA 4CNTA 1CECA 3OOQA 1QOXA 1Z9AA 2CLFA 2IUZA 2E7FA 4WJXA 4AY1A 3W88A 4ZGYA 4S39A 4JXCA 2DT2A 1HKKA 1K77A 3MB9A 3MSGA 4J1OA 4JIQA 5AHEA 4I6KA 4QDWA 3M0JA 4JFUA 2CWNA 4FX6M 5HQEA 2QCFA 4DXVA 4C6JA 3C86A 5IBXC 3O6CA 4ZA0A 1JDDA 3B8SA 1UKSA 1V3IA 4KW2A 1ZRQA 3M0IA 3AIEA 3C2RA 3MYOA 3FCPA 3MS8A 5KTLA 4X3ZA 4RW5A 3APYA 4L6HA 1KFCA 1I2NA 1AMKA 2JFEX 1WB0A 4C6EA 2DV0A 1S1PA 4EIVA 4AZGA 1IEVA 3G1HA 4AD3A 5KETA 1QT1A 3S2MA 1WXYA 2VD8A 2YJQA 2BDQA 2XM1A 4IX0A 3C0SA 2Z00A 3VD4A 4LNCA 2D2GA 2OZ0A 5EU9A 1T40A 1GKQA 3N04A 2XTKA 1MEIA 2BGSA 2WM1A 3IANA 4XVDA 4H7CA 3B0XA 2GDUA 4DUXA 3HJEA 1DJGA 4DZAA 2ESCA 1CDGA 1EP1A 1K6WA 4WQ6A 1DKWA 3N4AA 1EWDA 1RPKA 3EDEA 3WD2A 1JQVA 3S3GA 5E09A 3GTXA 3HQ1A 2XIQA 1XG4A 3C56A 5D8WA 1JF6A 1I8JA 3NQ6A 3VIIA 5AYYA 4PMYA 3ARWA 4DBUA 1CGVA 3VPLA 3UFYA 1MEHA 6TAAA 5CZKA 1EJRC 2JQXA 5F2GA 3TXZA 3NSXA 2A3AA 2HMCA 4GQGA 1VKFA 4A3RA 1AQ0A 1JCJA 4BF9A 4XBKA 2WHMA 4DJEC 3ANYA 2OEMA 9CGTA 2CLMA 3VIKA 3BOFA 2GGIA 1K6AA 2BFGA 3BARA 3VE7A 1B9ZA 2CBVA 3A47A 1IXNA 4FS9A 4ONVA 1GVSA 3D3FA 3IGXA 4WF7A 3TSBA 4PUMA 4HIBA 1FWNA 1VB9A 3WLOA 3K46A 3STCA 1LBLA 3WD1A 1L6YA 1QI3A 5EFFA 3CHDA 3EWXA 4MB4A 3VO0A 3OODA 2PRHA 4CVUA 4N42A 2DQWA 4ERIA 2IKHA 4LX4A 3FKRA 3TYDA 3FSTA 1UUOA 3DEQA 3IJ9A 1LOSA 3G1DA 4Z1YA 1PPIA 3GIYA 2FGZA 2CBIA 3NURA 1PZ1A 4NZFA 1DXEA 1KQZA 3MMWA 3BSGA 3N12A 4CD6A 4DJDC 4P7OA 2X0SA 3RRXA 1UH3A 5A8OA 1JVNA 3UEQA 4MG4A 4S3AA 3PR2A 1EX5A 2QPSA 4PN2A 1MVYA 1Z44A 4G56A 4RNFA 2YYTA 3LRKA 3P5YA 3ZJ8A 3SN1A 3GH4A 3C61A 4C1NA 2X7WA 2EPLX 2W9MA 5GNZA 1KR0A 4NAEA 3FHAA 3KRZA 4D6EA 1FY6A 3GYEA 4GI6A 5CCZA 3WMLA 5DRIA 4E2DA 3ENLA 1GG1A 4MKSA 3OPSA 3WBWA 1PIFA 1OGBA 3OJGA 4OV9A 3VCCA 3USZA 3DI0A 4IMCA 3AIWA 1QRQA 4XKMA 3FHQA 3SGZA 1MQPA 3NEHA 3AXXA 3T42A 3VM7A 1KXHA 1TTJA 2IPJA 1BGAA 3VCRA 4IT1A 4UQDA 5A2AA 3FAXA 4I8YA 3DYMA 1DXFA 4X0NA 4DYKA 3WLPA 2Z1KA 5IXEA 1JNEA 1PKYA 1EB3A 1SMDA 3I4EA 2ZUTA 3VMOA 4IGNA 4AVNA 4FALA 3ICJA 4J3UA 3SJ3A 4GYPC 1X6UA 5RUBA 3T09A 1ITUA 2JGQA 1WAWA 4WHBA 3OHIA 5HJXA 3UZWA 1RSCA 2WANA 2BX7A 1VFOA 4KFPA 2XIBA 5C9ZA 2ZX9A 1A5CA 4JBRA 1R6WA 5F1UA 5C7HA 3LD5A 1DJQA 2WZMA 1KFEA 4P8VA 4L4OA 2EEXA 3E2SA 3W7GA 3VNDA 3NUKA 4D8ZA 1GGOA 2FKPA 1JYXA 3BPWA 4BI7A 1DHPA 1PWMA 3H2MA 4F66A 3WQ4A 3HMJG 4Z2KA 5LSMA 2BHZA 2VX4A 4UTWA 1NF7A 3C0JA 1GPWA 4ZZ9A 3E0WA 5JBDA 3VNZA 2HZGA 2PLCA 1HIZA 1PE1A 2GDVA 1S3HA 1VBGA 3B8DA 1RBAA 4HNOA 2V2HA 3RXZA 1BRLB 1B3ZA 4JPGA 3QLDA 3SURA 2Z1VA 3LY0A 3AMDA 2CBUA 4LUTB 4UQ9A 1M1BA 4D8AA 1XD0A 3KHJA 3DDMA 1P7TB 3LLXA 2E6AA 4KGJA 4A3HA 3FYOA 4C6IA 1GZGA 4GWEA 3MBFA 3LRMA 1D8CA 2EG6A 1SZNA 4RLIA 4H9XA 3MA8A 1SW7A 4WGHA 4C6CA 4XSMA 2ZUMA 3TU9A 2EKGA 3ZLGA 3DN5A 3CB8A 1K7EA 1VJZA 4MGGA 1RD6A 1OC7A 2WSYA 3QY6A 3ZJ7A 1O66A 2ZXQA 2ASHA 4YN5A 1TA3B 3J7HA 4OBSA 3DECA 5IM51 1UMLA 4AU0A 2DSWA 4DAFA 4QJ1A 1KBIA 2HS6A 4FK9A 3LCGA 2J74A 3IK2A 4US5A 5H8MA 3NAVA 1SZGA 2C1GA 4QEEA 2J7HA 1ZZMA 2DZVA 2Y8VA 1TWZA 4CU8A 2NT0A 3U2OA 1UBSA 1H09A 3A3WA 1WAUA 4LALA 3W24A 3F5JA 1BRLA 4UR9A 4PUUA 1MZRA 1XX1A 2J79A 1AVAA 4DBWA 4C90A 1ZS2A 4LUTA 1E1CA 2EQDA 3RFAA 4BI6A 1P7TA 4GIYA 1B3XA 5ABTA 1ZB5A 3EOEA 3TX9A 2J27A 1K4GA 3K4DA 5C7VA 1J01A 4MLJA 4KGLA 4QG8A 4N7QA 3UVAA 3BLDA 2Z29A 4EPKA 3B0UX 1XRFA 4XD5A 3WEMA 3FVMA 4IJCA 1OD0A 2WJEA 5H1WA 4O4VA 2I5QA 1E9ZB 7A3HA 3O0FA 3SCWA 4AXKA 4QAIA 3NG3A 1GQNA 2G3MA 3TFCA 1F05A 3IS4A 3LA4A 1QDSA 1JZ3A 1XDLA 2OXNA 3S8HA 4AHQA 4NRRA 1EIXA 1H0IA 3Q67A 2IKGA 1FCQA 3WUFA 1XUZA 3ZIZA 2NV2A 1LP6A 3WELA 3CNYA 4AD4A 4US5D 3E2QA 3W1UA 4AF0A 2WQDA 4H4IA 1PO9A 3SECA 3LTPA 2VDGA 4GY1A 4FOUA 3ID7A 4XO6A 3NQ2A 5CAHA 3ABSA 2PGRA 3MANA 2OX4A 2YPIA 3F7JA 1OABA 4XK2A 3DG7A 3RO6A 4GZ7A 1W8SA 3MPGA 1JFHA 3MO7A 4TR9A 1JFXA 3HGJA 3BOLA 3CV6A 1FCBA 3SEPA 1OFPA 3B8UA 2QJHA 4HNCA 2X2YA 1XLIA 1TCMA 3TNOA 3REQA 1C7SA 3ZVHB 4UTFA 5CAKA 2J88A 1V6WA 2YA2A 3EB3A 2QLYA 4Q4SA 2NXHA 4EACA 4DB7A 1F3WA 2YCIX 3H53A 4JX5A 3G6LA 1UZ4A 3GFZA 4ZOEA 1AJZA 4IPJA 2BOGX 4JYDA 1FUYA 3GH7A 5DBTA 3N2BA 1LUCB 2CYGA 2ABAA 1B4KA 1Q6CA 1UR0A 2E68A 3SGUA 1K1DA 2F8QA 3SCRA 3S1GA 1ZUAX 3ZMRA 6CGTA 3K4WA 5FL0A 4KBXA 4ZVJA 5D2YA 4UUIA 1X6LA 4L1XA 2WHKA 4E4UA 1KGWA 1TVPA 3SB0A 1AODA 3NNTA 1AMYA 3DG3A 2ZOXA 5I3GA 1CGUA 1M6JA 3UY8A 1HF6A 1GQKA 2AMGA 2A21A 4AD2A 3TJIA 1B90A 3SR7A 2YCKX 1IT8A 1XINA 3SFWA 1JULA 1HP4A 3N6HA 1OF6A 3CUFA 2VVSA 5EKYA 4QQ3A 3C2EA 4NRSA 1W5MA 2I9EA 1KM1A 4I7UA 4LS1A 1EJVC 3W07A 3TJLA 4DZ5A 1B5TA 7ODCA 2WMIA 3HB9A 4U10A 3ZYZA 4DM1A 4GMEA 1ECQA 2Y63A 4LBRA 3BGGA 3PFMA 1TELA 2B7NA 3UYCA 2FZ9A 5GJMA 1LUCA 1KWKA 2XVNA 3WMCA 5E9AA 4O15A 1DBTA 1JQXA 2VR5A 1GNXA 3G2GA 3ABZA 1T96A 1E4NA 3GWQA 3T2OA 1T8QA 3EDKA 1KD0A 4P7RA 5FEPA 3CMFA 4U3AA 4A8RA 1VLIA 4F0RA 2NZLA 4LAKA 3AC0A 3WSUA 4XG1A 1SO4A 3E0IA 4DUOA 1J96A 1QFEA 5FCZA 1G7UA 1S38A 2XFRA 3HV8A 1XCWA 4WSJA 1RLDA 2UY2A 3KRUA 3LHWA 2UY4A 4OFCA 2E28A 1CEOA 1MFUA 2E8ZA 1TE1A 1J0YA 2J7EA 4NHVA 5AYXA 3BQ6A 1R3WA 4DNHA 2JKEA 3S0CA 1X1NA 3S9IA 2ZA2A 4RXFA 1RK6A 4MDOA 1W5PA 4QNEA 4H6EA 5DXXA 5G5IA 3UWYA 3TQPA 2GUYA 4OV4A 2JIWA 4QS5A 1SUXA 5CBBA 4FZIA 3L2LA 1QCWA 1QK2A 5I06A 3LCFA 4YWSA 2WJFA 1Q3NA 3TVAA 3M47A 4NAFA 1IE7C 4J7RA 3LXBA 1XGDA 5I77A 3L5LA 1ONXA 1O4UA 4DF0A 4CD4A 5CSUA 2RGLA 3DI1A 4MUZA 4JD4A 1H60A 1ICPA 3VMPA 1LWHA 4FXRA 3LHYA 4XBJA 3PVFA 1KM2A 2ZX8A 5FI8A 1ISWA 3MVIA 5C9UA 1M7PA 4JTSA 5G4HC 3W7CA 3AU2A 2YYUA 2C6QA 2X09A 2BMBA 1BSLA 2FH8A 5CJMA 4TMCA 1H7NA 1QHZA 5CGQA 5DXYA 1I1WA 4UTTC 2JK2A 2Z1WA 3UXIA 1E43A 3W7EA 3R58A 2OEJA 5C9XA 4AAJA 3LZ3A 3EMZA 4PB5A 3WBXA 4KWOA 4S3GA 1XM3A 1YXYA 1UC4A 1G67A 3SJNA 4IZGA 4CQCA 4IM4A 3PZQA 3CQHA 1T5AA 3WH5A 3AHZA 1B2YA 1YLVA 3SIZA 1CXHA 5EFDA 4JQAA 3UPMA 2R94A 4LAMA 1DJXA 1W3NA 5CZ0A 4E8CA 5D09A 3SN0A 2ZZ6A 1F8MA 1HKIA 2D2OA 1DOSA 4JIRA 3URBA 1HFBA 2QQ6A 3R0DA 1IWAA 4N4PA 1LCOA 2BVDA 2DVUA 3EPMA 1GJWA 4RUBA 2DZSA 4MSSA 4JYEA 5AC5A 3M0MA 2WB5A 3UQNA 3WY1A 4U3CA 2X2GA 5C9WA 1TUXA 3GU2A 3IVSA 2IPFA 3BLPX 4HJWA 5GJPA 2AGKA 2J62A 3P5ZA 4PUWA 1F74A 4BEUA 1ITXA 4CN4A 5LIWX 3P8JA 5D05A 1JPDX 4QE1A 5ECVA 3W53A 1C93A 4X22A 2BY3A 2VFEA 3N6JA 1MSSA 3NL5A 2VFFA 1KFLA 3H8AA 3POCA 2PP0A 5EB8A 4PTMA 5I3FA 2C71A 8RUCA 5TQLA 4O1FA 2ZUSA 4URIA 1CTNA 2ACRA 4WJEA 5CC7A 1KC7A 4KERA 3QXBA 1PVNA 4QSHA 3S2CA 3VDCA 1HUVA 3AYVA 2GYIA 3BOXA 4M0XA 1H7RA 3BAYA 1X1OA 3PUEA 3VOJA 1H51A 1CCWB 3ANVA 4NXKA 4H19A 3MU7A 4XUGA 3EPOA 3W7KA 3ARQA 3TN4A 1G6CA 4HQVA 1SYTA 1PYFA 1FTXA 4PGLA 4P8UA 4XUYA 4MNMA 1E4LA 2A7PA 4PCTA 1QMLA 3CIWA 1WKEA 4J40A 1KCLA 1TX0A 3GXDA 4EAYA 1KCXA 3WFAA 1F3TA 4ZO6A 2Y8UA 3QBUA 1A47A 4EOUA 1UWTA 1I1XA 4ROQA 4KKXA 2HNHA 4WLCA 1VC4A 3BAWA 4JEJA 1E6ZA 4HPJA 1FWBC 1KXVA 5K7JA 1F6KA 1PTAA 1K8YA 3STEA 3WH9A 3MCNA 1J8VA 4K68A 3UXDA 4M7TA 2EKCA 1W32A 2F61A 1BYBA 3CHEA 1IHIA 3BICA 3DFHA 3MUCA 1OFAA 4M6VA 3NL3A 1GVFA 4GGBA 2PBGA 5E5CA 1CB7B 1E51A 5A8GA 3N13A 4IXHA 1M65A 2WJDA 4UIOA 3FA3A 5DN1A 4EPBC 3THUA 3S5YA 4X2PA 3IJ6A 1VBHA 5D37A 4FNPA 5C54A 4XAZA 3BQ5A 1UB3A 3W7IA 1M04A 4N0RA 3HTWA 3NPXA 4PCNA 4JIIX 3S9ZA 3CT2A 2Z2UA 1ISVA 4YHEA 2X1IA 2XHYA 4HHHA 1NARA 3LCLA 1G5AA 3GS6A 2WMGA 1IYXA 4XAYA 2X16A 4L4LA 1M68A 4HU4A 3CQIA 3RIKA 2H9AA 3VI2A 4GACA 4BFAA 7TIMA 3CT7A 1DIDA 1EIBA 1ME7A 1UQZA 2PDPA 4MMWA 4JQ2A 1W9XA 2Z4GA 4F9JA 3EMQA 1B9BA 1MW2A 1FWJC 4H7ZA 5IDZA 1X7IA 1TG7A 1CW2A 1IQ8A 4P5UA 5KZDA 3FV9A 3RLHA 3W87A 1D3GA 4JYFA 4HVXA 5FJUA 1MUWA 2ZTJA 2J8TA 2GGJA 4M80A 3Q37A 3UPBA 3STGA 1GJPA 1ZENA 2PDUA 4MNKA 3LGDA 1WQ5A 1TWDA 2BY2A 3UWUA 3CHCA 1NWRA 4WKFA 1ISZA 1RP9A 3L23A 4HKPA 3QGKC 3VGGA 3WK1A 3ERPA 1V03A 5A8PA 4TV6A 1X97A 3MSYA 1GCYA 4JTUA 3KVLA 4HSHA 4Z0JA 3O6YX 4PMXA 3OIHA 2PUZA 1R9YA 4GXPA 4TUFA 4A8NA 2G5WA 4JL1A 4MPKA 3BZGA 2VGGA 1WXJA 2Y7GA 3PF3A 2H3BA 2V2DA 3KWSA 4IG2B 1VPYA 3SRFA 4KF1A 2Z1SA 1TJ2A 4IJRA 2F6UA 3KVJA 1EP2A 1IV8A 2A1YA 1UIOA 2YXXA 1BLIA 4ROPA 1N2VA 4UFMA 1R3SA 6ENLA 1DV7A 3KEHA 3W23A 3RF9A 1B57A 2PE4A 3JVAA 3GTHA 4M29A 3VNYA 4MJ4A 1NTHA 3W00A 3LM7A 2KAUC 1S2UA 2I17A 1VFSA 2QCDB 2QGHA 3NZGA 3GTNA 4Y9AA 2V5JA 3RPTA 3NQCA 1TJRA 3LTSA 2RJHA 4IPIA 3BLOA 4I5UA 3QF0A 3DH7A 2R91A 1L6FA 1W56A 1SQ7A 1XIGA 3GXTA 2VMFA 1XH2A 7XIMA 4MNJA 1TX2A 1GOQA 2OU4A 1WX0A 5HWJA 1PDYA 3A9IA 3H54A 5EMJA 3A64A 1XRVA 4B5UA 3R12A 3GBEA 3KOFA 3PSVA 1A4LA 3QPYA 2V38A 4MPQA 1UR9A 1VAHA 2V3FA 5DBUA 1PTGA 4H83A 3GD6A 2POZA 4XZNX 4PCFA 4QBXA 4S3JA 4EWJA 3I6EA 1I2QA 3B4UA 3E49A 5ABFB 4Y2WA 4TMBA 2I16A 4WEVX 1P0DA 4IIFA 4C6OA 2CNCA 3NVDA 3G1XA 1F4AA 1GQLA 1QW9A 5FOOA 2FMNA 2I56A 4ACYA 1O95A 3TE9A 3HM7A 1A5SA 3DC0A 4PC8A 3G8EA 3E1F1 4H8UA 1K9EA 1TWWA 2YBUA 5FSDC 3KVKA 1FH9A 4BEQA 3AU6A 3UY7A 1C90A 1ESWA 3KDNA 3ME3A 4ZTYA 1C8VA 2OOFA 3S9YA 3CYJA 2D69A 1DVJA 3KZSA 4H9UA 4FHAA 1W1A1 4K38A 1AH3A 4IFRA 3TYBA 3N9SA 1J0IA 4JTTA 4D8LA 5LXEA 3U57A 4HNLA 4HZ8A 3VOFA 2HSAA 1C9WA 2A79A 2ZXBA 5FEWA 3KOZA 3H6OA 5C2CA 1DWIM 3W2JA 5CXPA 4W5ZA 1QNQA 1CGWA 2X42A 3BAIA 4WKHA 1MMFA 4LEFA 5AVHA 3DBPA 1V6XA 1IT0A 3GIQA 4GY7A 5E0FA 5EMLA 6REQA 4V27A 1NELA 1WDSA 3EAUA 2J13A 3GYCA 3H12A 1H7OA 4DBDA 4J3ZA 1TWSA 2R1NA 4IFKB 3CUHA 3SCSA 1ECEA 1EFZA 4YVVA 1T0OA 3IV8A 2GUUA 1MEWA 3LOTA 2PRLA 1AD1A 2C91A 2JEQA 4RPPA 1GKPA 4DBEA 3VC5A 1JCLA 3QPEA 2H90A 3U7BA 2IW0A 3OVQA 9XIAA 2VGFA 1TVLA 4NASA 1L6SA 3GB6A 4ORMA 3SRDA 2P0IA 1PKNA 1QNRA 1S39A 2V3EA 3VFCA 3AMKA 1O60A 1OWQA 1Z42A 3H22A 4DVOA 3TOPA 1C8XA 4JTIA 1YHTA 1KGXA 1DJNA 5JBFA 1A5BA 4Q3MA 2WBGA 2Y88A 3TR9A 1J11A 3V3WA 4UTUA 4YVXA 2OKOA 4W8AA 4O4WA 3GTFA 1J2WA 3FYYA 3W29A 1P1XA 1J6PA 2ZZ4A 3WEOA 4K3ZA 5HMFA 1JG9A 4GZIA 1MW1A 4B16A 2R1MA 5I7GA 2WBKA 3UWWA 1VFFA 1OGSA 1UR1A 3GW3A 2YBVA 4DUWA 3D46A 4AEFA 3NQEA 4W85A 3EA3A 2G3NA 3FGCA 3LEPA 2VWTA 3VTRA 1OZMA 2XH2A 2WM0A 5LGZA 1XLMA 1WPCA 2VI0A 3MDWA 4L5ZA 1J0ZA 2HWGA 3LUTA 1TUFA 1UP2A 2E0PA 1QPRA 3TW7A 2HXTA 2YCEA 1QW8A 4BQ3A 3OBKA 3GXFA 3OA3A 2WWCA 2GJPA 3BSHA 3GVRA 1ZP4A 1W9PA 1UW9A 3GC4A 1YXCA 4IMEA 4XAFA 3H2CA 4ZB0A 2RAGA 4EWND 3KZPA 3GHSA 3ZLHA 3NZPA 5FF4A 4IICA 4W7WA 5DCDA 2XPKA 1VZWA 1CX9A 1BYDA 1TFVA 2D20A 4FNUA 4B15A 1XLHA 1XYAA 2EPKX 3GW0A 1PKMA 2BVYA 2TODA 1F9CA 5LNUA 2Y5JA 2CFFA 4ERGA 4XB3A 4J3XA 3LNMA 2I57A 2FZ8A 3QV7A 3AICA 3KOXA 3RN6A 3HF3A 4HA1A 4HA3A 1E6RA 3W02A 3F5KA 4TTGA 4H9VA 1CXLA 4AC1X 1VEMA 3UJ2A 4NI8A 3FN9A 3GDTA 4IPNB 4KQNA 1H41A 3QRHA 3NQVA 3EXTA 1KLZA 3QTGA 2WZIA 4DX3A 3FOKA 1KBBA 4H3DA 4EKJA 3C4UA 3KLLA 1H0GA 4JFVA 2B7OA 1VJIA 1K03A 2VC6A 3PBWA 3V16A 3QR1A 1YRRA 3PZVA 3NYDA 4AZ7A 4D6IA 3GSMA 5HQMA 4R3UA 4L4MA 1FRBA 4L64A 2QUNA 1B3WA 2GUBA 3TROA 3PAOA 1S5VA 2OSXA 3ZWSA 2FZDA 1O5XA 2QIWA 2CERA 2NLIA 2ISVA 1XC6A 3PB0A 2VDHA 1H4PA 2ZRXA 5ABGA 2ACQA 1KM3A 2WPGA 3DKLA 4U5KA 5EPDA 1XFCA 2A5HA 5EMYA 3QGAC 2HQAA 3RLUA 2YR1A 4PMJA 1ZJIA 3RM8A 3THDA 3EDJA 1B30A 1TB3A 2I5GA 2WMKA 5I78A 1RV8A 4HSNA 3OGRA 4QG9A 1SMAA 2X0HA 3O0KA 3PNUA 3M0YA 2FIQA 2WVTA 3G1FA 4F8XA 1RQBA 4Q8TA 3A21A 1W5NA 4IXXA 2CKRA 1VR6A 1GVYA 3LMYA 1DE5A 3RU6A 1K7XA 3B9AA 4J4KA 4UTLA 2BASA 5BU6A 3MI3A 1IR1A 1EEPA 1KFBA 1X98A 2YW4A 3ALGA 3INPA 3WX7A 1PHQA 4AXNA 8A3HA 1QK0A 1DQXA 2J4GA 1J0KA 3RPDA 4PEKA 5GVJA 3THQA 1ZJAA 1V7AA 2HVMA 1QWGA 4G7EA 2OO0A 3U4FA 2VRKA 3KTCA 1RJQA 2OKTA 3MMDA 3M16A 1S2WA 3GNXA 3UJEA 3W26A 2J7GA 3VNJA 4UTHA 5C71A 1XYZA 3AS3A 2WNZA 1C3FA 1WUEA 3SGGA 2Q6ZA 3TYUA 5HR6A 2YFNA 3A4JA 4J27A 4YVPA 3DHPA 2OT0A 3CXOA 4XQ6A 3WQDA 4AZHA 3WLKX 3W7OA 2HE5A 3W7QA 1YADA 3TQVA 1UZ1A 3HMCA 5FACA 4LY8A 4PFHA 2P88A 4MZ1A 3TTEA 1ME9A 1GTHA 2FHCA 2CHRA 2GQ3A 3WBYA 4LVAA 1P0EA 4S3EA 3FKKA 4GXMA 4GH3A 3W7RA 4Z2GA 2YIHA 5C55A 5IHSA 1UKOA 1PIIA 5FKYA 1EHNA 1TRIA 3W71A 3OBAA 3ATYA 1NP2A 2V3GA 1EYWA 3H55A 2IQDA 1XG3A 1XIDA 3OVPA 1XL9A 2ZRYA 1FWSA 1BXCA 2OYLA 3EXRA 3QJAA 3TW6A 1WCGA 4ZR8A 1OFBA 1LOQA 3HFYA 4KFOA 2JF7A 4JDYA 1W9UA 4GQRA 3RG6A 3WDPP 2C14A 1OSEA 1N55A 3FNDA 1W9BM 1WBJA 5D4YA 3OG2A 2D3NA 3EWZA 2PTYA 2IXVA 2GPTA 2QCCA 2V63A 1YDVA 4S2BA 5EMUA 2QR6A 3RX3A 1TMQA 3LXCA 1MFVA 5HUOA 5CKSA 1L6GA 4POCA 1BTCA 2NWRA 3L21A 4UOQA 1TPFA 5BRPA 2CZVA 3S83A 3ZVIA 1QJWA 2X41A 4O50A 4JNYA 1H1NA 2EXOA 3VMNA 1Y0EA 1D3HA 1Q6QA 3B0YA 5AVNA 4OTKA 4GK8A 3EZ4A 1M9HA 1KM5A 3TYEA 2PDBA 3KBJA 3MV01 3IEBA 4Y9NA 1TTPA 2RHGA 1CGXA 3VIFA 2Y7FA 3CS2A 3NIYA 3DCPA 4PFMA 2R9RA 1BF2A 1SVDA 4M1RA 2A3LA 2Z1XA 4YTUA 1AW5A 1G01A 3BMVA 5AFDA 2ZADA 1XRTA 2XISA 1R2RA 3CHVA 1RQHA 1Y5XA 3S46A 4O14A 3CZLA 3NM1A 3I7SA 3QKEA 1SPQA 2GGHA 3DGBA 4JX6A 3N2XA 1LG2A 5H6HA 4X63A 3QV8A 3RR1A 4H8VA 1KTNA 1V79A 1VFLA 4FLQA 1YXDA 5T26A 1LBFA 5I3DA 2J8FA 2B31A 2VTFA 3ITYA 1VYRA 4WKAA 2FYMA 2XH4A 3WKZA 4CEXC 1XYMA 2TPSA 1OIFA 3I6TA 4JCLA 3W7NA 2ODOA 3AYRA 5A95A 2IQTA 3W01A 3OB8A 1PTDA 1TKKA 3GFYA 4AFYA 2Q01A 2VCAA 3U48A 4N6EA 2BV9A 3GXNA 2VRQA 3U2ZA 6ALDA 3N6QA 2YX0A 1UASA 5D9PA 2FB3A 4AEOA 3WJZA 3B9NA 3O16A 1OK4A 2DIEA 2XIOA 4QE4A 2DU2A 4QCEA 2JKAA 3OZOA 4JAWA 4NJJA 1TPDA 1WXZA 1JAEA 1XP3A 5LA2A 3QQWA 5DELA 3W27A 4OWGA 1RH9A 5GNYA 4PH6A 4IOTA 1R86A 2OSYA 3P14A 3CV7A 2ZZ7A 4O19A 2G4FA 5FJPA 1RAKA 3NGJA 1OCQA 5FA5A 3AUJA 5CG7A 3SI9A 3G24A 2VRJA 2VM8A 3ES8A 4FIQA 4ACZA 5KITA 1J79A 4GO9A 2VOMA 1M7XA 4L9YA 2A6LA 2OO6A 1TV8A 2YZ5A 1HGYA 1XXXA 3FSUA 3GDKA 4PA8A 1J9YA 3UR2A 2GVLA 3VKAA 4BKNA 3RCYA 2ATSA 1U5HA 2QNEA 1FWWA 4RNHA 3TTQA 1RA5A 2ZUVA 3KM8A 1BTMA 2GVJA 5IFPA 4C5YA 3U7VA 1SJBA 3K1DA 1MUMA 3IAQA 3S42A 1WV2A 1WZMA 3IUIA 2PGFA 3L2MA 4E3TA 2VR4A 3L0GA 3OLDA 3EWUA 3BE7A 2QYGA 4UBPC 2Y24A 3R11A 2H6RA 4C6KA 2FVMA 1GZJA 2C0AA 1SGJA 3UWZA 3RLGA 3WL0A 2EJ1A 5HMDA 2WLZA 2REQA 3F4WA 4JL2A 3GY1A 5CJ5A 1JCYA 2HISA 5CPOA 3VGBA 1XDMA 5CH9A