3TMQA

Crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei in complex with d-arabinose-5-phosphate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
280
structure length
280
Chain Sequence
MNVAISPGVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLDEGLKIFAEVKARFGVPVITDVHEAEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSPTQLKHVVSKCGEVGNDRVMLCERGSSFGYDNLVVDMLGFRQMAETTGGCPVIFDVTHSLQCRDPLGDASGGRRRQVLDLARAGIAVGIAGLFLEAHPDPDRARCDGPSALPLHQLEGLLSQMKAIDDLVKRMPALEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase 2
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 94
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tmqA00
4UMAA 2TMDA 4MYAA 1VYPX 3M5YA 3NDOA 1XDLA 5G2WA 4LVDA 1A5CA 4K8HA 1SU5A 3PF3A 2VELA 3TW7A 4O1BA 1ICQA 3UPWA 3N3MA 5EL1A 3F4NA 3AJXA 3CQ0A 5AC7A 5DBTA 3DI1A 2QUVA 1B4EA 3NPXA 2YSWA 5SWUA 3OVPA 1G4PA 1QAPA 1GG1A 2Z6JA 3LTYA 3ZWSA 1OVDA 1OFDA 2NXHA 3HO8A 5FESA 2HSAA 1KLYA 3DKJA 1J2WA 4JTEA 1H5YA 1PCWA 3FLUA 2X2GA 3GNDA 5D09A 5CKSA 3BG3A 4I9AA 2A6LA 4ADUA 1ONRA 3PSWA 1WX0A 4I7UA 1KM6A 4S1FA 3C6CA 1YXDA 2QUTA 4DELA 4JTLA 5HNRA 5AHIA 2QUUA 4GC4A 4GFSA 4FNUA 4AWUA 2V5LA 2B0MA 1TCDA 4UIOA 3B4UA 3R89A 4ICNA 1ML1A 5D32A 4DO6A 2H8ZA 4Y9AA 2QCEA 2B4GA 3KOFA 4NUWA 5I3IA 2CLFA 2QR6A 4HSNA 2Z1BA 4K7VA 1TIMA 2XFWA 3W7OA 5FEPA 1HUVA 1WBJA 3BW3A 4HIBA 3STEA 4X2RA 3W7EA 3OEXA 4C1LA 2AQWA 4DF1A 5IM51 2JGYA 3DFPA 1ME7A 1LBLA 3INPA 3ATYA 4O15A 5LKYA 5BOOA 1FCUA 3LHVA 3EB2A 2C1HA 4HNNA 5AFDA 4K7YA 1GWJA 5K7JA 2E6DA 2FPYA 3TR2A 2C16A 3F03K 4K6AA 1PV8A 4WY0F 2EF9A 1KM3A 2VEIA 2QEZA 4QISA 1RZMA 6ALDA 1ICSA 1F5ZA 3OA3A 1OYCA 1TPFA 3PUEA 4JX5A 2E09A 3CM4A 4HPXA 2AGKA 4KFNA 4MY8A 1W5PA 3RF9A 3GZ3A 3L5AA 3SR7A 2WKJA 4GUIA 4QJ1A 3EX6A 3O6DA 3TFCA 5HULA 2BLEA 3M5ZA 3OBKA 4UR8A 3STCA 1TREA 5AHNA 4IOTA 4XBSA 3TX9A 3LHUA 5G1TA 5HMSA 2J9YA 3PB2A 2E6YA 4Z1CA 4RLIA 4EWND 3BG5A 1FXPA 2CWNA 1VZWA 3EX1A 1JUBA 3G1SA 2B7NA 1EB3A 1DKWA 2HS6A 3CIWA 1RQBA 1LM1A 4POCA 2QCMA 3USBA 1JQVA 3GR8A 1R2RA 3LCGA 1ALDA 2E5DA 1L6WA 3W1NA 5DELA 4FX8A 2YDAA 3S5ZA 3MI2A 1LRNA 3C2EA 4IPJA 2C6QA 3RFAA 1I2OA 1KTNA 5CPMA 1TO3A 3BLIA 4N6EA 4M6PA 4NQ1A 1HO4A 3HG2A 3TJXA 3GXTA 3HMJG 3W2UA 3RNDA 2HS8A 3ELFA 3NQCA 4AB4A 4ADTA 3P5ZA 1X7FA 1SO4A 3LHWA 5G2HA 3QF0A 2ZBTA 3BGGA 5KITA 1UUMA 1HL2A 4UFJA 4MOZA 2CLMA 1XM3A 2P0OA 3HOJA 4JTSA 3W73A 1J4EA 1LTDA 3S5YA 1XDMA 3KFTA 2V2HA 3UWQA 3S9YA 3W83A 2QCFA 5BNKA 2Y7FA 3VKJA 4O57A 4ZQOA 2VEKA 3LCLA 3O6CA 3ABQA 2KZHA 3PC0A 4NU7A 5AHFA 3LRLA 3P61A 4JTTA 4UTWA 3B8DA 3RU6A 1OFPA 1XBZA 2E6FA 4AF0B 2ZRUA 2RFGA 1GTEA 4AHQA 5CZ0A 4IMGA 2X1SA 4QM1A 4RXFA 2ZRZA 1GPWA 1O95A 4PL1A 3H54A 1VYSX 3C2FA 1QOQA 3SI9A 4KWVA 2XN2A 3UWUA 4OBTA 4ONVA 2C19A 1LLZA 1K3UA 1XL9A 4IXHA 4K8EA 5F4SA 1YDOA 4PCFA 2FLIA 3G24A 4JEQA 3BLEA 4NNCA 1DVJA 4DPQA 4Y8FA 1AW1A 4LT9A 2RDUA 5K4ZA 1H7RA 3MI6A 2J88A 4BI5A 3W7NA 3O05A 3IIOA 4NNBA 4YL2A 1PHQA 3MO7A 4MZYA 3M7WA 2FB3A 4GUFA 4ZQNA 4ML9A 2C18A 3W74A 3S1WA 1I8JA 1I2PA 3BLFA 1GJPA 1QPOA 1VPXA 4EF9A 1FDZA 2G5WA 1A50A 1IGSA 2ALDA 5DCEA 1W3NA 3M5XA 3LTPA 4IWWA 4JGDA 2NV1A 1ZNNA 1W5NA 3TE9A 1K8XA 5E1QA 3LV5A 4ZVJA 2W0UA 1JCXA 1XC4A 2V81A 1ZAJA 3LV6A 3PBYA 4R53A 4FX7A 5HR7A 1LOSA 2TYSA 3BVJA 5DY3A 1O5KA 1S3HA 2BXVA 1YPFA 4LC8A 4RR4A 4A29A 2E68A 3SSJA 4MLRA 1G6CA 2YW3A 3TAOA 2CZDA 5F2IA 1QR7A 1W1ZA 1JULA 2Y62A 3LM7A 3KHJA 3CC1A 1MEHA 3N19B 4JYDA 3TIMA 4ZZ9A 3W2KA 5ABTA 4FHAA 2ABAA 1KFKA 4Q33A 1DV7A 4C1KA 4HNUA 1WOBA 3Q58A 3FYPA 1MSSA 2WSQA 4XZ9A 1MXSA 2DU2A 5K3VA 1VHCA 1DBTA 3TW6A 1QO2A 4S2BA 2Y6ZA 5EY5A 1OYBA 4O13A 4HNVA 4HT3A 5AYZA 1OK4A 1YXYA 1WBHA 3N2MA 3W72A 1H7NA 1VCGA 3DAQA 2Z2UA 3HG5A 1GVOA 1Z42A 4AXKA 4W9TA 3M41A 2G95A 4IX2A 4K38A 4PL2A 5IBXA 3HQ1A 3IIVA 5LHEA 1H51A 4JTHA 2BWGA 1IXQA 1EWDA 3QZEA 3MP3A 5D03A 3L67A 2VENA 2V2CA 4JYEA 4XBKA 3T55A 1VCFA 1SSGA 3R12A 4HHPA 5BRBA 3IGSA 1UJPA 4LS2A 3NZ1A 4CCCA 4AF0A 1F6PA 1K7EA 4Y90A 1UASA 2DZUA 3UWVA 3M43A 4NJKA 3W7MA 4JICA 1FWWA 3L0NA 3HG4A 1JCYA 3QSTA 4A2RA 2X30A 4JDBA 4YCOA 2Z0IA 4UXDA 3WK3A 1KTBA 1TTIA 3N9SA 2FIQA 2Q3OA 2Q8ZA 4O10A 1W8SA 3TC7A 4X9SA 3PM6A 3DKLA 1H7OA 2JKEA 4UTIA 2QCGA 3CPRA 4RJEA 1GG0A 4O1CA 4CLMA 3QPYA 4FIRA 1XFBA 2DZWA 1DORA 2ISVA 2GUUA 2YYTA 3NQMA 4PTNA 1LROA 3P8IA 4FNRA 3VCRA 3LOTA 1ZAIA 3GAKA 3NPVA 2WSRA 4JY8A 1JUKA 4NJHA 1KV5A 2EPHA 4UMBA 1F76A 1VLWA 1TTPA 3QMTA 4MY9A 3W1UA 4MLJA 3T40A 3BARA 6TIMA 4OT7A 1Q6RA 3NVTA 1LBFA 1OX6A 4UFKA 3DI0A 1H60A 3O15A 5LNVA 1JRCA 1K7FA 2V82A 1PE1A 4M6VA 2WNZA 3LTSA 3G1YA 5CZSA 3DH7A 4KFOA 3W2MA 5DCBA 3KX6A 2OMAA 4IMDA 2A7NA 1K03A 5KZEA 3NL3A 3NQVA 4WXYA 3IIZA 3B04A 5FF4A 4BWLA 3MBFA 1VLIA 5DLCA 4RCXA 2ZZ3A 3LI1A 1VJIA 2WSYA 3EKZA 4B5NA 1L9WA 2P1FA 1TYGA 2FQIA 1OFBA 1XCFA 4NJJA 5EPDA 3DFNA 4IPIA 2ZRWA 1W5MA 3N9RA 1IXPA 3GXPA 5K4XA 3C4UA 4WXZA 5F2LA 1TB3A 3TH6A 3G1VA 5TQLA 2CZFA 3GIYA 2GVGA 1Q6QA 3A23A 4LY8A 3P67A 1F73A 2ZZ1A 2ZRXA 1OX5A 1OF6A 4NXKA 5CPNA 4X22A 3IVUA 3PBUA 4DF0A 1YYAA 3L68A 2JKAA 3W71A 3OG3A 4O4WA 5E93A 5D02A 1A5BA 4JYFA 2TRSA 4AWTA 4R34A 3I65A 3B06A 4LV4A 2QJIA 4ORIA 4A21A 1NSJA 3T44A 1LCOA 3O07A 3GDTA 4NJGA 1FWRA 1G4SA 3A5VA 1C29A 4LU0A 3W88A 2R91A 5C55A 1OYAA 4O53A 3NO5A 2J24A 3LHTA 2C13A 3JRKA 3QW3A 4IQLA 3GKAA 1WA3A 2ZA2A 5A5WA 3C61A 1GTHA 3L2IA 1C8VA 4FNPA 4UTLA 5DY2A 1FDYA 4RK8A 4TU1A 4NJIA 4QIUA 3T4CA 4DBEA 4NXSA 3E9AA 4LNYA 3B0UX 2R14A 1G69A 4GE8A 2NXGA 3FYOA 3PB0A 4K36A 4QQ3A 1J5TA 1M5WA 3UY7A 3W7PA 1QOPA 5F2GA 3R13A 4GNJA 4JTUA 4MZ1A 1TJRA 2QJGA 3DXIA 4DXVA 3QJAA 3TQ0A 1LP6A 5T26A 4DO5A 1YTKA 2PE4A 3VI2A 5AHLA 3NM3A 1SFLA 5AC6A 1G4TA 4RKAA 3IRDA 4DBDA 3C0JA 2ZZ6A 2X1UA 3EX4A 3UWWA 1H63A 1OFRA 4LS0A 1LZOA 2F7FA 4OQVA 3LDVA 3KXQA 3ATZA 2QDGA 4JS3A 4LW7A 1JQXA 3DHFA 1OF8A 3OVQA 4FNQA 3TKFA 4DO4A 3UQNA 3JS3A 4LOCA 1DJNA 1X8FA 1GVRA 4KWWA 3NQDA 4BWLC 2VFDA 4MYXA 2IQTA 4NT0A 2C14A 2H3DA 3NXFA 1KFEA 4YMZA 4O0KA 4PH6A 2ZZ5A 1KM5A 3KRUA 3KVKA 2ZRVA 2YPIA 5G4WA 3LLFA 3Q94A 1K8YA 2YX0A 2VXNA 1QO5A 2PCQA 1KM4A 1SZFA 3MYPA 3L65A 1LOQA 4M6QA 3HGSA 3IVSA 4ZQCA 4LV9A 1W37A 3W87A 2DZTA 1TJPA 3EXRA 5I3FA 4M7TA 1GQNA 3LRMA 4EVZA 3NZRA 4MFDA 2W79A 2V5BA 4O8RA 5LZLA 1VQTA 4WOQA 3FFSA 4IXXA 3G8EA 3EX2A 3TMQA 3RLUA 5CSRA 4ALDA 1KW1A 3ZFHA 1E51A 1FBAA 4JN6A 4Q4KA 3P5YA 2OX1A 4ZMGA 1IIHA 1FQ0A 2NX9A 4XTIA 3L5MA 1S5WA 1CW2A 2WPBA 2X16A 2GVJA 1JCLA 2BSLA 3L9CA 3NOEA 1P0NA 5D33A 1TQXA 2ZA3A 4DQWA 1LRTA 3TA6A 2VKZG 2V0TA 3G0UA 5FF7A 4WOZA 2V9DA 2VC6A 3W7DA 1ZFJA 5CZJA 5U7SA 2AAMA 5D2WA 3PR2A 7TIMA 3QEZA 2RHGA 4O17A 3THQA 4A2SA 2X1RA 1SZEA 2I1OA 1OABA 1LOLA 1DQWA 2DZXA 2YFNA 3BK0A 2NXIA 1SW0A 2W6RA 4I7VA 4H3DA 1AK5A 4RZ5A 3HGRA 3M9YA 1G7VA 3MI3A 5AN7A 3ZR4A 2NWSA 2R8WA 1UB3A 3UXDA 1PS9A 3SECA 3TMLA 4O18A 3L5LA 4AEOA 4FX6M 2WNQA 1THFD 1JUEA 4N6FA 4UFMA 4PEKA 2B7PA 5C2XA 4AVFA 4ORMA 1VC4A 4EIVA 3RLVA 3S42A 3KRSA 1Z41A 3NEVA 3W9ZA 4RXGA 3QQ1A 3M47A 1X6UA 2A1YA 3QC3A 3G1AA 2BX7A 1NF7A 4O4VA 3SFKA 1KBJA 1FWNA 4TO8A 2NUYA 3QYQA 4XUGA 3E12A 1FCBA 3TUUA 5CSSA 3PULA 3H55A 3M6YA 3OIXA 2CZEA 2YFOA 4XWUA 4FNSA 2ISWA 1L6SA 3EWYA 1L2UA 4J9JA 1SSDA 2CLEA 4JIQA 2E5BA 5K9XA 3NG3A 4A3UA 1EUAA 1O60A 1BEUA 1TPB1 1EP2A 5L9FA 4UNLA 1D3GA 4MVAA 1H1ZA 1YTDA 1FY6A 1OK6A 4BK9A 4EF8A 3S1XA 5K9DA 4JXCA 2ZA1A 3NQ2A 1H61A 4JTKA 4NX5A 2OCZA 4D2JA 2V8ZA 4YXGA 1QPRA 2YCEA 3C3NA 1AL7A 2Y89A 4UFHA 3FEMA 2QCHA 2DZVA 3GR7A 4DPPA 2JK2A 4UNKA 3W07A 3UPBA 4GJ1A 2YGYA 3DFQA 3O16A 1OX4A 2O7SA 3W3OA 5EA9A 5CPLA 3A24A 1DJQA 1I2RA 3T7VA 4E0CA 5EKYA 1FWSA 3B03A 3IIXA 1VRDA 3MBDA 1JCNA 3FS2A 1RQHA 2YW4A 4O1DA 4JY9A 1VS1A 4O14A 4O11A 3VE9A 2WO5A 3DBPA 3PUDA 3FKKA 3NL5A 3SJ3A 5KTLA 1H50A 4XQ6A 3B05A 3VNDA 4LWWA 5BMWA 3UXAA 5G4EA 3NM1A 1SW3A 3DGRA 3PG9A 1AMKA 2Y63A 3VFLA 2NUXA 4KFPA 2P10A 3CU2A 3KAOA 1HFBA 1VH7A 5AB3A 3EX3A 1KFCA 1OFOA 1ADOA 3QM3A 1R2SA 4UTTA 3P82A 4GBUA 2RDWA 2V2DA 3STFA 3TJLA 5F4WA 3HPSA 5KSWA 5K9CA 1EA0A 3FA5A 4MIMA 1QPQA 4N4QA 4JD4A 3P7YA 5D04C 4Q32A 4N9CA 3U6WA 2ZTJA 4MY1A 3R2GA 4AH7A 3W7QA 4P61A 1R30A 2EAWA 2CLOA 3UY8A 3HPZA 1ZCOA 2H8XA 3GNNA 3EWWA 4XKYB 3TSBA 2GJNA 3MWAA 2QJHA 5G5IA 3GYEA 1PVNA 3FIGA 3LXBA 3WJYA 3H53A 3MMTA 3HJZA 1RQEA 1W5QA 5HUOA 4Z1BA 4PFMA 1EWEA 2RDTA 1IXOA 2JGQA 4CNOA 1SW7A 2QDHA 4FXRA 1CX9A 2OT0A 3DHDA 4CQ8A 1IIGA 1D3HA 3EXSA 2GPTA 3GDLA 3W7CA 2ATSA 2QCNA 1EP3A 1W3IA 1V5XA 5K2ZA 1XKYA 1KBIA 3UZ5A 3P80A 3U8GA 1TV7A 3E96A 3QRHA 4UC5A 3WK0A 2Y88A 1ZY9A 3HIJA 4TIMA 1W31A 3PBVA 3C56A 3B0VC 5CG7A 4FXSA 3FKRA 1TV5A 3CEPA 3V75A 4UTHA 2J9ZA 1DL3A 4L4MA 1OG0A 3G3MA 2J9XA 3STGA 2QAPA 1MZHA 2A0NA 5CPOA 2B7QA 3E02A 1IXNA 2HMCA 1W54A 2Y7GA 3BPWA 1QDSA 3DU0A 1XBVA 3LRKA 5FF3A 1WAUA 1SO5A 1OFAA 1H7PA 3S5OA 5FF2A 3S0CA 1QNVA 2E1DA 3E0IA 4UTJA 3LHYA 2A2IA 3MHFA 2ZCGA 1YDVA 3TFXA 4GXMA 2LLEA 4E2BA 1MEWA 5LNUA 1WV2A 3LCHA 1G7UA 3P81A 4MUZA 4R7JA 5HWJA 4TR9A 1O5XA 1YLVA 3CT7A 3KVJA 4LRSA 4UTTC 2NV2A 3NR0A 2TPSA 1ICPA 4IMEA 4FNTA 3CIXA 3M1ZA 1DQXA 1FCQA 2RH9A 2OT1A 5I3HA 3A5FA 5J5DA 1ZAHA 4FB7A 3L21A 3SW6A 1Y0EA 4MJZA 2Y7DA 4WQ6A 4AHPA 1O94A 3N2XA 3M0ZA 1SFJA 3NYZA 4Z08A 3SIZA 1AG1O 5LGXA 3C52A 5KMYA 2VOMA 5J5RA 1P0KA 3W85A 1BTMA 2A6NA 4N2YA 4O19A 3W1XA 4AHOA 2NX1A 1TRIA 4E2DA 3KVMA 3MP4A 4ZQPA 3TAKA 1BKSA 3GKFA 3HGJA 3LCIA 1S5VA 4LTSA 3PG8A 3IV3A 3THAA 5GVJA 3EWUA 3GAYA 2GQAA 1TPDA 3G0XA 3KVLA 1JCJA 5E0KA 3TQKA 3W75A 3QFEA 4JTJA 2E5CA 1W3TA 4O0ZA 4QAIA 3QQ0A 1YDNA 4LVBA 1KFJA 1GVFA 4XKYA 1SQ7A 3LB0A 4N9EA 2DP3A 4O12A 2YZRA 3LI0A 3CHVA 3NGJA 4JX6A 1JJKA 3L0GA 4MPQA 3TK7A 4DF2A 4UFLA 4N9BA 3M44A 4UMCA 1EUNA 1BWLA 1F6KA 3N14A 5HUPA 3TXZA 3W6YA 1PCKA 3N34A 1F74A 4JTFA 4LUJA 4RZ4A 3G1HA 3TDFA 3MHUA 4WZHA 1ME9A 3DENA 3LCXA 4OHQA 3PSVA 4NVTA 3L0KA 4TMCA 1JCMP 1FXQA 2CZ5A 3YPIA 1R2TA 4OV4A 4O54A 3W7LA 3TROA 1VHNA 1EEPA 3I7SA 4YCPA 1F2JA 4LC6A 5AHEA 2RKXA 2Y7EA 3UYCA 1A5SA 4UUIA 1VCVA 1FDJA 2B7OA 3HF3A 1W0MA 4YWIA 3G0SA 1SO3A 3O6YX 2QF7A 2XN1A 5DXYA 4ZQRA 4H6KA 1T0OA 4CNNA 4WJEA 1YADA 1BWKA 2PRLA 4O52A 4OU1A 4OGZA 3E49A 1TQJA 1OJXA 2YXGA 1XUUA 2VFGA 4UCGA 4X3ZA 3LX9A 3M16A 1UBSA 3O06A 1MEIA 2ZQ0A 3WJZA 4IGHA 1W56A 1TSIA 3LXAA 5D30A 4JIPA 1H7XA 3W76A 1XI3A 2J27A 5F4XA 3UZJA 4K39A 3IEBA 1Q3NA 3LLDA 1KM1A 2Y70A 3W7KA 2A7PA 3QMRA 2F84A 5AC8A 3F4WA 1TTQA 1JVNA 4M7SA 4U4MA 1HTIA 3P8JA 1PHWA 3A22A 1LLWA 3WFAA 2CLIA 4I7WA 4QNEA 1NFBA 3CWNA 3ABSA 2ZTKA 3BO9A 1HO1A 2ZDRA 1T96A 3NQ8A 1T99A 5HINA 3W1QA 4GUHA 3P84A 5LNSA 1OX4B 3WJWA 3QSRA 1XBXA 4MFEA 1MO0A 3MW7A 3O63A 4Y6GA 1U83A 2G96A 4N9DA 4WUIA 3LHZA 4M19A 3PS7A 3CLMA 4H4IA 4EOUA 1FX6A 2WV8A 1HG3A 1LDCA 2DORA 3LCWA 5FEXA 2CFFA 1U5JA 4JDYA 1B4KA 4WX2A 3W1AA 4O28A 4CQ9A 1WXJA 5KZMA 3MP5A 2WJZA 3F1QA 1B3OA 1KM2A 1CI1A 4GWEA 4DEFA 2GOUA 3GDKA 3W7RA 5DXXA 3T78A 1DHPA 1NAL1 3DFTA 1H62A 3G22A 3WK2A 1K7XA 1SO6A 3OHIA 1C9DA 3PY2A 1ZENA 4Z0SA 3C8FA 1RVGA 2ZYFA 3TXVA 2EHHA 3O1NA 2C3ZA 2DZPA 2YYUA 5D2TA 3W7GA 3GB6A 4N02A 1Q6LA 2QCLA 1T8XA 4GUGA 3ABOA 3PBWA 3C2RA 3NQGA 1I2QA 1G67A 3A21A 2QKFA 4JR5A 2ZRYA 3ABRA 4WY0B 1GVQA 1A53A 3P60A 5LHFA 1W5OA 2CW6A 4LS1A 4OWGA 4XTDA 3GVGA 3V1PA 5I3JA 3TSDA 3W86A 4NNAA 4U28A 3O8AA 5DBUA 5HJLA 3LERA 1SZNA 1B9BA 3NQFA 4UTUA 4NZFA 3PWAA 3W7HA 1K02A 1F05A 5EYWA 3BW4A 5C5YA 5HR6A 2OJPA 4ZL1A 1I2NA 1LBMA 2Z6IA 1KFLA 1N7KA 1AL8A 1RD5A 2VFHA 5AYXA 1QPNA 3MUXA 5U4NA 4BFAA 4AWSA 3P74A 4UR7A 2NLIA 3QMSA 2R94A 1SUXA 4HKPA 2FPVA 5KINA 1S5TA 2FPTA 1OFQA 3HPXA 3W1PA 4O16A 5F1UA 1P1XA 2UV8G 3ANYA 4MZ8A 3I68A 1F7BA 3HG3A 4PODA 1EX5A 3PUOA 1RPXA 1UUOA 1NEYA 2H3BA 5H2ZA 2Q3RA 2E6AA 1GYNA 5CGQA 5LSMA 2FFCA 3UWZA 3NL6A 1TPUA 5FEWA 3GX9A 5G2IA 1Q45A 3W1MA 4QITA 3W2LA 1M6JA 3DFOA 5AYYA 5D05A 3UD6A 5FI8A 2TSYA 1TPEA 5EMUA 1JR1A 1KFBA 2VEMA 1EP1A 2G97A 2GVLA 2VFEA 3NPWA 4RV8A 2A85A 5AOUA 2GJLA 2WOQA 1X1ZA 3TSMA 2GQ9A 3NQEA 4NX0A 2A7RA 3UWYA 3EWXA 2E77A 3DZ1A 4CCEA 2NZLA 4CNPA 2VFFA 1I4NA 4Z1DA 2Q8LA 3TC6A 2QAFA 5KZDA 1KTCA 1TRDA 3CWOX 1NF0A 1R46A 1V7YA 4Z1AA 2A4AA 1X1OA 1QFEA 1FWTA 2BZNA 4QSHA 1A5AA 2DZSA 4MJMA 1TV8A 3G8RA 5G1YA 2ATMA 1VYRA 4O50A 1YXCA 1B57A 2VEPA 1WDWA 1ZALA 1SR9A 3Q2DA 2OZ0A 1LORA 3CEUA 3BGJA 3TU9A 3EXTA 4MKNA 4WD0A 2QCDB 3L66A 4E38A 1RR2A 3HB9A 1JRBA 1GVSA 3HBLA 3SY5A 2A5HA 4LVFA 2YR1A 1WYIA 4JTIA 3NPUA 2JKPA 4AAJA 2CLLA 2WNNA 3Q37A 2HTMA 1KLZA 5LGZA 2ZZ7A 2V30A 2I14A 2JBMA 2XN0A 4Y96A 3BW2A 3JR2A 1L6YA 1FCVA 4AMAA 2DJLA 2FTPA 3WJSA 3SGZA 3G1FA 1XXXA 3S5NA 3ZS4A 4G1KA 4IX0A 5A8GA 5BW6A 4NZJA 1GT8A 1DOSA 2Y85A 5DN1A 5LNRA 3NNTA 2ISSA 2QCCA 3CTLA 1I45A 1EIXA 3NL2A 5BMXA 1GOXA 3RK8A 4WY0A 4IMCA 4Z0JA 3W7JA 3HGOA 1M7OA 2ZZ4A 2CU0A 2FDSA 5F2MA 1RV8A 3P62A 1D9EA 4M5PA 4LRTA 3G1DA 1N55A 1GZGA 3WJXA 3GK0A 1TTJA 5DCDA 4CQAA 1LYXA 3FOKA 3NAVA 5I3KA 3EWBX 2H90A 1YPIA 2A21A 2PRHA 4KKXA 3S1UA 3TV8A 4JNMA 3C2OA 3D0CA 3LBMA 4BI7A 1TPVA 2FB2A 4FO4A 1KM0A 4HN4A 2WQPA 3W84A 5F1VA 4UTKA 1ZHAA 4UTWC 3VE7A 8TIMA 4BR1A 3W1RA 4QNWA 4TMBA 4JX4A 1LRQA 4N4PA 3FJLA 3TNOA 3BV4A 2J6XA 2O7QA 2ABBA 1OFEA 4CCDA 4PC8A 1M7PA 3W1LA 1TMHA 3EKLA 3TQVA 5C6MA 4HSOA 5D37A 5D38A 1AW5A 4O1AA 1VGAA 3QPZA 4OV9A 5L6UA 4BI6A 1Z44A 3PVFA 3NQ7A 3R8RA 1NVMA 2CLHA 1TPC1 2FJKA 5D2XA 1TPH1 1WOAA 4IUOA 1PL9A 5TIMA 4UFIA 1EPXA 5EBUA 3LXCA 2H6RA 2DJXA 4LUIA 1K8ZA 5HQEA 3S6DA 3B0PA 3AO0A 2X1TA 3W7IA 3I6RA 2PRMA 4IJBA 5D2VA 3W2NA 2C15A 4LVGA 1XBYA 4FF7A 5CZTA 2PC4A 3S1VA 4JTGA 3K30A 4A22A 4R33A 4GUJA 2GQ8A 3R5EA 3W23A 1VR6A 3GDMA 4GRSA 1QCWA 2D73A 3G3DA 5C54A 4ADSA 4IMFA 4S2CA 2I9EA 5FF0A 3IIPA 3QW4B 5HWMA 3M5VA 5LNWA 1GEQA 3SZ8A 3A9IA 3MJYA 1GYLA 3DFSA 4HNTA 3NQ6A 3LBCA 2VFIA 4K37A 3SGUA 1ME8A 4L4LA 3OVRA 4UTMA 3S8HA 1N8FA 1QWGA 3PAJA 3W2JA 1ZJIA 3UNDA 3MYOA 5H91A 3NQAA 5D2YA 2QCDA 1OHLA 1XUZA 1SZGA 2PURA 2NX3A 4OE7A 4YLWA 2ZFAA 4P2VA 4LVAA 4ZQMA 3G18A 1H7WA 5TBOA 3KRZA 3W22A 3N73A 3NA8A 3LCFA 1O4UA 3GDRA 4FIQA 2NWRA 5AHMA 3G1XA 1Z48A 1SPQA 1YTEA 3IGUA 5MHBA 3CB8A 3IVTA 4RX0A 1QMLA 3EWZA 2C0AA 1AW2A 4HPJA 5HWNA 3GXNA 3IGXA 3MHGA 3QH2A 4BF9A 1KA9F 3I7RA 2CLKA 3U2OA 1Q6OA 3TCEA 3BG9A 3GLCA 2ZZ2A 1KV8A 1FUYA 3WK1A 1G4EA 3W70A 3RMJA 4FEZA 3FJ6A 1UCWA 3LGEA 4PA8A 2BTMA 1WQ5A 2Y61A 1TPWA 5FEZA 3ZWTA 1P5BA 2NUWA 1P4CA 4TX9A 1PIIA 2EKCA 3C2VA 3W1TA 1R47A 3EEGA 4RZ6A 5IBXC 1H1YA 5I3GA 3I7QA 1IF2A 2EGZA
chains in the Genus database with same CATH superfamily
4AZBA 3UU0A 1B31A 4O1BA 4LYQA 3MCMA 4XV0A 2OZ8A 2ICSA 1P1MA 3CQ0A 3HA1A 1GJWA 4DUWA 2RJGA 4DJED 1QJWA 3SCQA 2O55A 2F6KA 2CBUA 2QUVA 4I6KA 2JQXA 5CBBA 2AL1A 1KQYA 3A6OA 3ARXA 2OZ3A 2BNJA 3LTYA 2INZA 3HQPA 2D24A 1GOKA 3UP8A 2X2GA 3GNDA 3R1ZA 5D09A 4R9XA 3WG6A 2GGGA 3BG3A 1IEVA 1YXDA 3RMEA 4DELA 4QJ3B 5HNRA 1OWQA 2UWFA 2QUUA 3TA9A 3OW1A 2WJDA 4FNUA 3CL7A 2B0MA 2PDKA 4DBWA 3BOXA 3B4UA 3WDQA 5XIMA 3KBJA 1XSKA 2B4GA 4DBSA 4W89A 1UD2A 2F2KA 2Z1BA 1XYZA 3S2NA 4K7VA 3W7OA 2HE8A 4JFWA 3TOPA 3AXKA 2OOGA 3CHCA 2YB4A 4RL3A 4JEJA 3W7EA 8A3HA 4C1LA 1Q6CA 2X7VA 2JGYA 1LBLA 3BLKA 2GOKA 2Z29A 3DEQA 1FCUA 3LHVA 3EB2A 1KCZA 2C1HA 1GWJA 3WD3A 4HVXA 5K7JA 3TR2A 5CSUA 2FKPA 4GVIA 4WLCA 2QEZA 1A3XA 1RZMA 1ICSA 1OYCA 4JX5A 3WQFA 5HBFA 4MY8A 4OOZA 3VZXA 1W5PA 5DRIA 3RF9A 2W66A 4CKQA 1OCBA 1TZ7A 4GUIA 3BAIA 4HA3A 4AZ6A 2G41A 2BP1A 3ZVIA 3O6DA 2BLEA 4J3VA 1C3FA 2D0GA 1FWJC 4LPCA 4WGXA 3BSHA 3LNMA 3PB2A 2Y5JA 5HAOA 4Q8PA 3MA8A 4WSHA 3BG5A 2W27A 4LBSA 5HOSA 1TV4A 5M5DA 3DYOA 1JD7A 3CIWA 2G3IA 3USBA 4PMJA 3LCGA 1ALDA 3M0MA 3CUHA 3W1NA 7REQB 3HTWA 3CL8A 3UT0A 2QPXA 4IPJA 2VX4A 3WLHA 2C6QA 3RCMA 4N6EA 5C9RA 3ALGA 3TJXA 3HMJG 3W2UA 1FH8A 4EXBA 5HNTA 3RNDA 3P5ZA 2NVCA 5D8ZA 3UG8A 4A8NA 2CHRA 1OADA 4GFIA 3AOFA 1DJIA 3PP7A 2P0OA 1GKRA 4JTSA 1J4EA 1W2VA 4GINA 2DT2A 2O0TA 4MB4A 3H6OA 3WFZA 1C90A 2VX7A 4FOUA 3VOGA 3KDOA 5BNKA 2ISDA 4HMEA 3O6CA 1P7TB 1Q4WA 4WR3A 3SAZA 1SJCA 4JTTA 3AROA 4GPNA 4JTRA 1UKOA 1S2AA 4KEVA 2E6FA 3JVAA 4OECA 4AHQA 4IMGA 3F2BA 1K9DA 2BGSA 3H54A 1VYSX 5I07A 1QOQA 3SI9A 4KRZA 1BD0A 4QAWA 5HXMA 1PZ0A 2I9UA 1AZ2A 4K8EA 4ENLA 4TTUA 1OC5A 3A3HA 2GDUA 3BLEA 4NNCA 2RDUA 4JQ4A 3UFYA 4BI5A 3W7NA 3IIOA 3EA2A 4NNBA 3AMGA 3CJPA 4HTBA 3MO7A 3QOKA 2FB3A 4ML9A 2C18A 3CS2A 3W74A 3WLIA 1I2PA 3BLFA 3B9NA 1GJPA 1VPXA 3WMCA 5FAGA 2FGLA 1XGDA 2ALDA 3M5XA 3LTPA 4JGDA 2BY0A 2VURA 1E6RA 2NQLA 4G6CA 3LU2A 3D5HA 4W7UA 1TV3A 1DE6A 3CQJA 1K8XA 3LV5A 1ELSA 4ZVJA 4GYJA 4L64A 5PTDA 3F7JA 3RLHA 1LOSA 1MUWA 3BMVA 4GACA 1YPFA 3WBEA 4FSAA 2E68A 2HXTA 4D72A 2DPEA 1P0BA 5F2IA 2ZXDA 1PKLA 3KHJA 4JYDA 3TIMA 5ABTA 3QV8A 4XUYA 1W1PA 1X7IA 4Q33A 1SMDA 1UPPA 4HNUA 3VMNA 2V3DA 3IK4A 1NM9A 1ITUA 1WOBA 4YTQA 1MSSA 3FDGA 3G6LA 5HJXA 3CAQA 2IXUA 4S2BA 2Y6ZA 4O13A 5E5CA 1KNWA 3GXDA 1JZ3A 1OK4A 1WBHA 4RDYA 2WMIA 1H7NA 4GH3A 1R9XA 4AXKA 4QBXA 3BAKA 2ZDSA 4JQ2A 1B5TA 2G95A 4QCEA 3QY7A 3UESA 3HQ1A 3IIVA 4JTHA 1HP5A 2BOEX 1EWDA 3ABXA 5CCZA 1VCFA 3FDKA 1UROA 1SSGA 4H6EA 2E0PA 1XHGA 4W86A 4LS2A 2E7FA 1DWFM 2GLKA 1F6PA 1UASA 4UZSA 3M43A 4NJKA 3CL6A 3A3WA 4JICA 1WKEA 4CVUA 4YCOA 2Z0IA 4ERIA 4EE9A 4HPGA 2R1LA 1KTBA 1TTIA 2DGAA 1P48A 2FIQA 2Q3OA 3FAXA 2WSPA 3TC7A 3PM6A 3QTPA 4YYFA 3K13A 2QCGA 3O6AA 4J3SA 4JIRA 4DJFA 1XFBA 1XLFA 4DNHA 3PAOA 1EL3A 4X61A 2GUUA 4YS1A 1BWVA 5EMKA 5DEZA 4FNRA 3PTDA 2WSRA 4CNUA 4Y9MA 1A0EA 4GZJA 4MY9A 1F6YA 3ID7A 3T40A 3BARA 3M0JA 3DI0A 1HT6A 1FHUA 1LL4A 1R9YA 4D9PA 4PMDA 3G1YA 1E9IA 3VNKA 3DH7A 1MQQA 4IIDA 4KFOA 4MADA 3W2MA 1HJWA 3ARWA 3KX6A 4AWEA 1K03A 3NQVA 1E1CA 3SURA 1RBLA 4RCXA 2HXUA 2WSYA 3LI1A 4C6NA 4B5NA 1DWHM 2INEA 2VGBA 9RUBA 1AMYA 1OFBA 3TTQA 5EPDA 2BMBA 3DFNA 4E2OA 4KF1A 1W5MA 1IXPA 3GXPA 4I90A 1TJ2A 3C4UA 1KCXA 3V0TA 3CV7A 4CQBA 5TQLA 1Q6QA 3ZJKA 2VGFA 1SFTA 4NAEB 4NKCA 2I16A 2J8GA 5M17A 2QHAA 5T9BG 3IVUA 1EJXC 2D2OA 1LT7A 2FVKA 4WEVX 2Y24A 3AIBA 1EC9A 3RX4A 4O4WA 2UY2A 5E93A 1A5BA 5D02A 4JYFA 4LSBA 4F9JA 4HQVA 3T44A 2CC0A 3P6LA 4FOJA 4NJGA 1G4SA 1L8NA 3A5VA 5AYBA 5CC5A 3SY1A 1DPMA 5C55A 3NO5A 3LHTA 1XRSA 5EFDA 3WD2A 3JRKA 1CENA 3QW3A 1WA3A 5EGRA 3VNZA 3C61A 4AZGA 3L2IA 1QHPA 4FNPA 4AZCA 3ITYA 3C0SA 3W28A 1U2YA 2REQB 1ZB5A 2DUZA 3AYRA 3E9AA 4LNYA 2R14A 4GE8A 4DJFC 1KKOA 4CU7A 4QQ3A 4AYGA 1VPYA 3R13A 4GI6A 3QJAA 1E0XA 4LAUA 5I2UA 1SFLA 1S2CA 1WB0A 1G4TA 2Q09A 2XVLA 5AC6A 4FF5A 2VR4A 4DBDA 2YXXA 4AUBA 3K4DA 4NYUA 4LS0A 4ZA0A 5DMMA 3LDVA 3KXQA 2QDGA 4GI4A 4WSKA 4IL0A 1JI1A 1JQXA 1G9HA 3OQEA 3TKFA 1GK8A 2I56A 3JS3A 1YX1A 4AZ5A 1H2JA 2Z7KA 3R10A 1X8FA 1GVRA 3NURA 4H9VA 2G0WA 5DO8A 3TLLA 3EDJA 1GPFA 1TUXA 4HCHA 4F0SA 2GJRA 1PKMA 2ZZ5A 2GSEA 2ZRVA 2YPIA 4AD1A 2G3NA 3LLFA 3T8QA 3Q94A 2YX0A 3BTNA 1H11A 1KM4A 1SZFA 2O9RA 3VVGA 2DZTA 4ZXOA 4GISA 3EXRA 4EVZA 3EA3A 4MFDA 1BTCA 2V5BA 3DUGA 3URAA 5TD4A 1UQZA 2AKZA 4L6DA 1R8LA 4L7ZA 4WOQA 1S5MA 4S3AA 2EKGA 3EX2A 3TMQA 5CSRA 1JXJA 1LWIA 1E6XM 1QNQA 1EJWC 3RPDA 2VRQA 4ALDA 3W24A 1BXBA 3P5YA 5DANA 4QEHA 4ZMGA 1FQ0A 4QSFA 5CC7A 4PTXA 2GVJA 1V3LA 2BSLA 4HPHA 1V8EA 5D33A 4DQWA 1WCGA 1DHKA 1JXKA 4DUVA 1E4IA 4NRRA 1EHNA 2XGZA 1A47A 3C8NA 3PR2A 3QGVA 1W1B1 4MJ4A 4A2SA 4QE1A 1E0VA 2BBFA 1OABA 1DQWA 3BK0A 5T9CE 1SW0A 3SBFA 2ZUSA 4I7VA 4H3DA 1AK5A 3HJEA 3HGRA 3TN3A 5AN7A 3ZR4A 1RXOB 4QDWA 5LA0A 1RCXB 3CXOA 2BODX 2V6AA 4AEOA 2WNQA 4UFMA 2DZAA 3MCOA 2VNCA 3CB3A 4EIVA 1B3ZA 3VKKA 3TJ4A 3RLVA 4U2ZA 1KXTA 5HJYA 1B3XA 2ZX7A 2FZ9A 2W63A 3QQ1A 3AI0A 4TVCA 5I03A 4W84A 3G1AA 1FWNA 2PGEA 2NUYA 3QYQA 1R7OA 1TE1A 5E70A 3LSCA 3RM9A 1TVLA 4XWUA 4CN4A 3I4EA 4GX9A 5K9XA 1TVNA 1AQ0A 4PSPA 1IE7C 1BEUA 1R3VA 3VK5A 4AX7A 1VJZA 1OBAA 1ECQA 1JCTA 1U5HA 4BK9A 3DHPA 4PMUA 4D2JA 4HN8A 1BG4A 2VC7A 2PGWA 4I9MA 1AL7A 4XIMA 6TAAA 2QCHA 2C1IA 3GR7A 4DPPA 4UNKA 4KCVA 3V36A 3EOSA 3FXGA 2HE5A 3GQYA 3XINA 2E9BA 5EA9A 5CPLA 1MRQA 3TTEA 1I2RA 1ZSXA 5FCZA 3IJIA 5EKYA 1W91A 3B03A 3IIXA 1QNPA 2CZVA 1VRDA 3MBDA 4JY9A 1UYQA 4O14A 1R3QA 3TNBA 3WL0A 4P8XA 3B05A 1M7JA 1AMKA 1Q2SA 3VDBA 1YRRA 2NUXA 1H09A 3CU2A 1HFBA 1K77A 3OPSA 1UWIA 2OGJA 4UTTA 3P82A 1S46A 4GBUA 3BH4A 4HYVA 3GHUA 3TJLA 1C92A 1YKWA 4MMWA 4MIMA 4JTCA 4REQB 2XTKA 2PP1A 4NP7A 4P8WA 2WJFA 3FJ4A 3GNNA 3F4DA 1QW7A 2GJNA 3MWAA 2QJHA 4GO8A 3GYEA 1XG4A 3FIGA 2Z00A 4D8LA 1IXOA 1H41A 1EKOA 2YDSA 2FHCA 2P3EA 3VNIA 3UF9A 4P7LA 3V0UA 1CX9A 1MW0A 4GY0A 2IW0A 3T8LA 2WYSA 2GPTA 4C6QA 1UPMB 2QCNA 4HHLA 4PTWA 1W3IA 3IWPA 1XLJA 8XIMA 3GVQA 1M1BA 3UZ5A 1XINA 3WK0A 4W93A 1ZY9A 3LZ5A 4RV3A 4FXSA 4UTHA 2CBJA 4UNIA 1FWIC 2P0IA 3ITTA 3WQ6A 1M53A 4S3DA 2J9XA 3APTA 4F2BA 2QAPA 3GE7A 3OLIA 1PX4A 3M07A 1RJPA 3BAXA 3CMFA 4GVFA 4B2DA 4ES4A 2CXGA 4C5ZA 3BPWA 1LUCB 1J0YA 3REQA 3N17A 1XBVA 2IPGA 1WAUA 1H4PA 2OEJA 3S5OA 3FEQA 4PZVA 1W8GA 1YDVA 1J8VA 1CLKA 2LLEA 5LA1A 1MEWA 2GZXA 4PTVA 3EB3A 1YE4A 4R7JA 5D4YA 4ZE5A 1EZWA 1YLVA 4UTTC 1PSCA 3TQPA 2NV2A 3T08A 2HWGA 3N25A 3BC9A 4M8UA 3W0KA 1FCQA 5CAKA 2RH9A 1ZAHA 3UCQA 2NSOA 1PEZA 2PPGA 4AHPA 1QNOA 3NYZA 3OVGA 3VIHA 2ZUUA 3PWGA 1UIOA 2Q8XA 2WC3A 1BTMA 4N2YA 4O19A 1VAHA 2NX1A 1OC6A 3MP4A 1BKSA 3R43A 3GKFA 1S5VA 5JU6A 3GFZA 3WH5A 1KQZA 2QNEA 3G0XA 3IUHA 3KVLA 1CXFA 2PFHA 4UQAA 1BVWA 4PMQA 4O0ZA 3QQ0A 2DIKA 1XPYA 1YDNA 3KM8A 1UZDA 4JAWA 2ANUA 4XKYA 4H9ZA 2YZRA 3WQVA 3CHVA 3NGJA 2D20A 2Z1XA 4Z2LA 4MPQA 4DF2A 3H23A 3IK2A 4LJ3A 1NFGA 2PBGA 2YIHA 1F6KA 2VTFA 2WCAA 4JTFA 4FMVA 2CEQA 2OO0A 3DENA 3LCXA 3CO8A 5IDZA 3CH9A 4TMCA 4YTRA 4GA8A 1PTDA 1LG1A 3B40A 2ZXBA 4D6IA 1OGGA 3ECQA 1EEPA 1R87A 2XVNA 2RKXA 3UYCA 4FR1A 1AH3A 4PUNA 1VCVA 2WKGA 1FDJA 1P6CA 1IWBA 2AL2A 2QIWA 4R5EA 4ZXLA 5DXYA 2EG6A 3VC5A 4FI4A 4LUYA 2PDLA 4H6KA 4WJEA 3UJEA 1W3KA 4AZ7A 4O52A 2PRLA 4OGZA 3E49A 4GIAA 2Z1SA 1B54A 3GC2A 3SN4A 1UBSA 1ISYA 3BXWA 3DC0A 1E40A 3GY1A 3AHZA 5HA7A 2XSAA 4JIPA 3W76A 4QE5A 1GORA 1LLOA 3ARQA 4QG8A 3W7KA 5AC8A 2WZEA 1L2QA 4U4MA 3LG3A 4L61A 4EPBC 3ABSA 3F4VA 4AY7A 3W1QA 2PTYA 5JIWA 2OX4A 3AS0A 1XBXA 3AZSA 3MW7A 4RW3A 1UKTA 4Y6GA 1U83A 2VC9A 3ZSSA 4LUSA 2D69A 5BXSA 1Z8AA 3PS7A 1UW9A 1FX6A 3URQA 1HG3A 2DY3A 1OIFA 2YL6A 3WQDA 1IEXA 4WX2A 2JALA 4M80A 1HX0A 2WB5A 4Z42C 1W9VA 2WJZA 1E72M 4JN7A 1W6TA 2VWTA 4K68A 1Q13A 5DXXA 1DHPA 2W61A 1EH9A 1RJQA 3OB8A 2WVUA 1ZENA 4ICMA 5CH9A 1V6XA 2HK1A 4KBXA 2ZE3A 3TXVA 3O1NA 3W7GA 4Q3MA 4F0LA 4N02A 1T6MA 2WHJA 4C6LA 1T8XA 1J11A 4AEEA 4MM1A 2FHBA 1VFHA 2BB0A 1G67A 2V67A 3OZPA 2XUCA 5JIPA 2QKFA 4ACZB 2ZRYA 2B31A 3SB0A 2WVTA 1PZ3A 3GVGA 3RRXA 4GCAA 3VGDA 1B9BA 1BXNA 4ZOEA 1F05A 5EYWA 7ODCA 3NTYA 5C5YA 4GCXA 5HR6A 3AU2A 1QATA 1KFLA 1IR1A 1AL8A 1QPNA 3MUXA 4F0KA 1E4MM 4L9YA 1EOMA 2NLIA 3V7PA 4TX6A 3IANA 1DP0A 4HKPA 2FPVA 2FPTA 3GH7A 5I79A 4O16A 5F1UA 1S2TA 2XFYA 1LL7A 4WGHA 5MF5A 1WZLA 4MZ8A 4GYKA 3H2OA 1Q65A 3CYJA 3GW3A 4B5SA 1TE6A 2ZE0A 3FW6A 4ACYA 1UUOA 2H3BA 2FMNA 1GYNA 3L4YA 2FFCA 5FEWA 3RITA 3GX9A 5G2IA 1BGGA 2FGBA 3W2LA 1JAEA 4QEEA 3GG7A 3UD6A 1XYBA 5FI8A 5EMMA 2ODOA 1XF0A 4IJRA 2VC5A 2G97A 3TYEA 4IGSA 4LNCA 1VENA 2A3EA 3CZEA 1PJ9A 4C7GA 1ITQA 5LYRA 3TSMA 2OSWA 2A7RA 1NWRA 3PZMA 2E77A 4LEQA 2NZLA 2FVLA 1I4NA 4IIBA 5G1MA 5KZDA 1KTCA 1XYAA 2CWXA 5C9ZA 1QWKA 1TRDA 3CWOX 1NF0A 3PJUA 3ALFA 2A4AA 5I78A 2PDYA 1ZPTA 1FWTA 4QSHA 1A5AA 2EPLX 3WUGA 1E55A 5G1YA 4O50A 2NT0A 2WZHA 3BLOA 1B57A 2VEPA 1SR9A 3Q2DA 5FACA 3TU9A 4XZMX 1LWJA 4X60A 2NQ9A 4WD0A 3WBAA 1GW1A 3L66A 3Q45A 2GYIA 1RR2A 1JRBA 3HBLA 3WO8A 4AVOA 3BLLA 3CQHA 1VFSA 2QDEA 4AAJA 3RGTA 1ZJAA 2WNNA 4D6GA 2I14A 2Z2AA 2JBMA 4D8AA 3D47A 4AMAA 1OD8A 2XU2A 2FTPA 4W8AA 2Y8VA 3QC0A 1CGYA 3S5NA 4PUJA 3ANUA 4G1KA 4IX0A 2C79A 5A8GA 4NZJA 2Y85A 3WDHA 4FALA 5DN1A 3CGTA 1I45A 1EIXA 1P43A 1MUMA 4PMOA 2O4MA 2ZZ4A 3SUUA 1TG7A 3HV8A 2FDSA 5B7YA 4DUXA 1OZMA 3BGAA 3KBMA 2PZ0A 1TTJA 1YNQA 3L4WA 4CQAA 1LYXA 3FOKA 4KH2A 4L65A 3C2YA 5DF0A 2H90A 2PRHA 1KD0A 3TV8A 3C2OA 3D0CA 3LZ3A 1QW9A 2WQPA 3U4FA 4US5A 3A4WA 2QGYA 5F1VA 4ECLA 5CLTA 4DN1A 4LUTA 4OIFA 3VE7A 8TIMA 4TUFA 4QNWA 4AY1A 2GJXA 3KCLA 4MAVA 4N4PA 5FJTA 3DHUA 3G5EA 3TNOA 3BV4A 3KDNA 6CGTA 2MUCA 4DM1A 2ABBA 1OFEA 4CCDA 2PDQA 1M7PA 3VIKA 3EKLA 4QLLA 1XISA 4HSOA 1GOOA 3E2QA 3F2DA 3QPZA 3PVFA 4GGHA 3R8RA 1NVMA 2IPFA 4LAKA 2OVLA 3ITOA 1EOKA 3EDFA 4R3UA 2IUZA 5TIMA 4UFIA 1I75A 5A2AA 2H6RA 4J4KA 2DJXA 1FH7A 4HPNA 4G7FA 3S6DA 3AO0A 3WEOA 2X1TA 4IJBA 5A95A 3S1VA 2PC4A 2VUNA 3R0DA 3PPGA 3POCA 3BMXA 4GUJA 1UR1A 1ZBWA 1J0ZA 3W23A 3LPGA 1QCWA 1A5OC 5C54A 1JPMA 4GIEA 4ZOBA 3AISA 3IIPA 3HM7A 1GEQA 4I5XA 2VO5A 3A9IA 1AA1B 3BQ5A 5JH2A 1JDDA 3QKZA 4HNTA 4L5ZA 4K37A 2PCEA 2IS7A 4HZ7A 3KTCA 3W2JA 4NASA 4W8LA 1U30A 3UNDA 1ZJBA 1GQKA 3NQAA 1X38A 2BGQA 3K46A 1NDZA 4ATWA 4YLWA 4P2VA 4LVAA 1UMYA 1J2BA 1LWHA 4G1NA 4ZSTA 3N73A 4R9OA 3WMSA 1TR1A 3RJYA 4FIQA 1Z48A 3NVDA 1X98A 3IGUA 3CB8A 4TVUA 1AH0A 2H9AB 4HPJA 3N2BA 1KGXA 2G37A 3L4XA 1VBHA 3SN1A 3GTHA 5DFAA 2OODA 1EQPA 3B8IA 3WK1A 4FEZA 1UCWA 1GQLA 2W92A 4PA8A 2ONEA 2BTMA 1WQ5A 2V69A 4AD3A 4B4FA 5EMJA 2NUWA 3C2VA 3PZQA 4MB1A 2P53A 3RUBL 3I7QA 1XC6A 2PD5A 2EGZA 1KCLA 2TMDA 1PKYA 3M5YA 2OLHA 1FP8A 4GI9A 4LVDA 2QJNA 1SU5A 3UVIA 2FZMA 5BU6A 3F4NA 4WF7A 1GKQA 3IRSA 5DBTA 3MANA 3CZ8A 4NYYA 1B4EA 5HPOA 4UQCA 1GVEA 3NPXA 1CPUA 4GVHA 3RPMA 2Z6JA 3ZWSA 1OVDA 1OFDA 2IKHA 5FESA 2I5IA 1U1UA 1SZRA 1JD9A 1EJUC 3AMKA 4JTEA 1UR0A 1H5YA 2W91A 3FLUA 1K6WA 1TJ0A 1WX0A 3HU7A 1KM6A 5AC5A 1FH9A 3K1GA 3TTYA 5AHIA 2HV5A 4GC4A 4XZLX 1T5AA 3POHA 4S23A 4GFSA 4V28A 2WAGA 4J3WA 4UIOA 3IGHX 3R89A 1LT8A 4MWAE 4ICNA 4D6DA 2UY4A 3NO1A 5D32A 3H2MA 4DO6A 3QV9A 2JIWA 1E0WA 4Y9AA 2QCEA 3J7HA 2XIBA 3CPUA 4CEUC 1TIMA 1HIZA 2XFWA 4RE4A 5FEPA 3VOJA 4NHVA 1DEDA 3STEA 4DJDC 4X2RA 1A3WA 3V5CA 3VOIA 2IQDA 1ME7A 1ITXA 3SCVA 1K4GA 3ATYA 4O15A 5LKYA 5BOOA 3VIFA 4DYJA 2E6DA 2FPYA 1PB0A 1PV8A 4WY0F 3IUDA 2BGNE 1KM3A 1HKVA 2VEIA 4HMNA 4OUIA 1A49A 1IEQA 1F5ZA 2GQ3A 1IGWA 4C91A 1TPFA 3AIWA 4HU0A 2AGKA 1RVKA 4DNMA 1YBQA 3L5AA 3T2QA 1EF3A 3SR7A 1QI4A 5BOFA 4LY4A 3N4EA 4WKHA 3AWNA 3EX6A 4IIEA 5C9WA 3AS3A 3TFCA 5HULA 3M5ZA 4UR8A 1TREA 3AXIA 3GHTA 1GQJA 3LHUA 5HMSA 1DTUA 3H26A 2E6YA 5TAOA 3B3DA 3PHAA 4Z1CA 4EWND 3A4JA 1FXPA 2CWNA 2P8CA 1WKFA 2B7NA 1EB3A 1GOIA 1DKWA 2HS6A 5E6YA 4ZFCA 1C8YA 3VX1A 1B9ZA 1HN1A 3BJFA 3QKEA 4C90A 3B8WA 3R79A 1ZP3A 2E5DA 1L6WA 3CBWA 3VOHA 2PDJA 2CNCA 2YDAA 4E4UA 4YYCA 2YCKX 1XSJA 3T1GA 3ZLGA 4DJDD 1LRNA 4ZO9A 3W37A 5G4HC 3PZ9A 3BLIA 4NQ1A 4EXQA 5A6MA 4CD6A 3HG2A 1V6YA 3NSMA 2GWNA 2V5JA 3ELFA 4ADTA 4L4PA 4HU3A 1MRAA 3WLOA 5G2HA 3H4GA 2NT1A 4GX8A 4RNHA 5IHRA 2OWCA 1UUMA 4UFJA 3SUSA 3GU2A 5HATA 2YZ5A 1BFNA 1FKWA 2CLMA 1XM3A 1DYSA 3OOQA 1YW1A 1O1ZA 3S5YA 3V1HA 1ZBKA 2YA1A 2V2HA 3GZAA 2O9PA 3MVIA 1H0GA 2FH6A 3GHRA 4Q8WA 2IXVA 3OYZA 2O9OA 3LCLA 1QVBA 4NU7A 3WFLA 1DE5A 4GG9A 3U9IA 1KR1A 4UTWA 2VWSA 4C6PA 1OFPA 1XBZA 4AF0B 2Z28A 3R7MA 2ZRUA 1GTEA 1ODZA 2XGIA 2X1SA 4RDVA 2ZRZA 4PTDA 2QV5A 3C2FA 3OTRA 3L2MA 2XN2A 5FAJA 4ONVA 4H00A 3IAQA 1K3UA 1RBAA 3FNDA 1NP2A 4BS0A 1DXIA 2PSNA 3OJGA 3OZMA 3W25A 1M65A 1EQCA 1PYFA 4Y8FA 5K4ZA 2GVYA 2QVNA 3UG4A 2WANA 2OZTA 2VR5A 1D2KA 4GUFA 4XAPA 3M0VA 1QK2A 3CTTA 1QPOA 1FDZA 3CQKA 2G5WA 3BUVA 1A5NC 3UCDA 3BDKA 4IWWA 5B7ZA 2CIPA 2NV1A 4H7ZA 3TWAA 1W5NA 4S3KA 4XB3A 3TE9A 1OCQA 3NDZA 4GZ7A 2CXEA 3K8LA 2XGBA 2V81A 2DQWA 1US0A 3ITVA 3BCDA 3LPFA 1ZAJA 3LV6A 3PBYA 3C0LA 4NAFB 2XSXA 5HR7A 1TIWA 3WX7A 1O12A 1S3HA 3DDMA 2HNEA 4A29A 5E9XA 3SSJA 3WQPA 3TW9A 2WC7A 2YW3A 2BVWA 2OKOA 2CZDA 6REQB 2QS8A 2XIJA 4WK9A 3GUGA 1MEHA 3N19B 5FOOA 4IICA 5EMYA 4G56A 3W2KA 3T0CA 2KAUC 1PUDA 4IG2A 2WSKA 4PUMA 3ZSTA 1KFKA 1VFOA 1DV7A 2G4FA 1H0IA 3Q58A 2WSQA 4XZ9A 3GG8A 3TW6A 4JTAA 2D0FA 1V6VA 4QCFA 3UZZA 5AYZA 2F38A 1GHSA 1R86A 1VCGA 3MSYA 1GVOA 4W9TA 4JTQA 4L1XA 2HBVA 3L4UA 3V0SA 4IX2A 5LHEA 2BWGA 1E6PA 3EGJA 2WCSA 4GXPA 2V3GA 3MP3A 5D03A 4UOZA 2VENA 2V2CA 4JYEA 4XBKA 3BE7A 2E8ZA 2OSYA 1MXDA 3R12A 4QS5A 3GDBA 4KWUA 5BRBA 1QXLA 3USZA 1UJPA 3VIGA 1GVIA 3QBUA 3WQCA 1U33A 1TA3B 3W7MA 1FWWA 3L0NA 1ENUA 3HG4A 2RUSA 1B2YA 1E4NA 4A2RA 3PZVA 1XIGA 2X30A 4Q4OA 2WKLA 4TTGA 3UG3A 2ON3A 2XH2A 3N9SA 4DX3A 4O10A 1W8SA 2E28A 2CBVA 3S47A 1H7OA 1C7SA 4KMQA 1RCOB 2O92A 4MWAD 4JFSA 3WMBA 4GJJA 3DERA 4DI8A 3BJSA 1DXFA 3VFCA 2QUNA 4AXNA 4PTNA 3ZQ9A 3FK4A 3GAKA 4RNFA 3NPVA 2I17A 4UMBA 4HNCA 4MKVA 2VCAA 3FGCA 1TTPA 4KETA 1OT1A 1E3XA 1LF1A 4GIYA 6TIMA 1LBFA 3PTKA 1SFSA 2NV9A 4GJIA 2PDIA 3NUKA 4F40A 2PWGA 3NEHA 3LTSA 5CZSA 3WF4A 4IMDA 4WXYA 1GEHA 1A5LC 5ABEA 5LXXA 5FF4A 1VJSA 3TYUA 4H04A 1KRMA 1XLIA 3HQNA 3EKZA 3CK5A 2P1FA 1TYGA 2WMGA 1XCFA 2A3BA 1PX3A 3VINA 3I3BA 2VVNA 3CZKA 1V08A 4WXZA 2XG9A 5F2LA 2GGJA 3I6TA 1TB3A 4XAGA 4HHMA 3B8TA 5CPSA 3GIYA 2GVGA 4LY8A 4JHMA 4BF5A 1OX5A 3P93A 1KC7A 4A6GA 5CGMA 4NXKA 3P2VA 5CPNA 1W1YA 3PUGA 2FZDA 1BQCA 1YYAA 3L68A 3NDYA 3WDIA 3CYVA 4AWTA 1PX8A 3QFWA 2OLSA 3I65A 3KOZA 2QJIA 3LPOA 5LIXX 1LCOA 3CUZA 3LK6A 1FWRA 1NOWA 3ARUA 3WN6A 4PR4A 1C29A 2PLMA 3DG3A 4LU0A 1TWSA 3W88A 1OYAA 4O53A 2J24A 2WHMA 1ZZMA 1Y7VA 3FY1A 3MMUA 4PFHA 1CNVA 1AQHA 4YNGA 1TKKA 2YBUA 4HNOA 1X6LA 4TU1A 1W2PA 4MWAB 4NJIA 2BDQA 1DWAM 1G69A 3MMWA 2FDMA 3PB0A 1J5TA 2Y8KA 3UY7A 1QOPA 5F2GA 4JTUA 4JFTA 1TJRA 5T26A 3ZIZA 1YTKA 3H4WA 3R58A 2A3AA 3VI2A 5AHLA 1C91A 1JFHA 1XSIA 4AIUA 4RKAA 3GBEA 1US2A 3FHQA 1OC7A 4H9TA 4X63A 1DJYA 4CN6A 1E1EA 4C1NA 3HFYA 1HGWA 4OZOA 4FXFA 4LW7A 4LYPA 2PDXA 1GOQA 1TUFA 1OF8A 5A94A 4B5UA 4FNQA 3QHMA 4M29A 4DO4A 3UQNA 4IQEA 1DJNA 2ADAA 1W32A 2QZRA 3TJIA 1D3CA 3OODA 4J35A 2DVTA 3UGRA 2POZA 2FMOA 2C14A 2H3DA 2V38A 1KFEA 3NXFA 4YMZA 4PH6A 5ABFA 3KVKA 5JH1A 3MMDA 2IKIA 1MNZA 2IPJA 3MYPA 4AD4A 1LOQA 5EFFA 1KRCC 4MPKA 2HPMA 1W37A 3W87A 1LQAA 1TJPA 1GQNA 2BV9A 3VNYA 3VYLA 3MDWA 2W79A 4HA1A 1SGJA 4O1EA 5LZLA 4L4OA 1AH4A 3MQTA 5E0FA 3RLUA 1NELA 1VBGA 4QE4A 1ZRQA 1KW1A 3KCOA 4XVEA 1C93A 4JN6A 4FAMA 1OB0A 2VZSA 2NX9A 3OU8A 4XTIA 3CPGA 3KE0A 3L5MA 5IFTA 1HKMA 2QGHA 2YLAA 3R8GA 2X16A 4ZTXA 3MUCA 3T0TA 5C71A 2ZA3A 1LRTA 2VKZG 2V0TA 3G0UA 4YHGA 2V9DA 5LIUX 3BCJA 2J7GA 2VGGA 2PWHA 2WXDM 4DUOA 1W9BM 4I8DA 5CZJA 5U7SA 5GNZA 4V33A 4H83A 3SJNA 1PZ2A 2QPUA 3THQA 1JGMA 1SZEA 2I1OA 2QIIA 3IARA 4K2SA 4HOXA 3PFMA 3WLJA 4RZ5A 2RGLA 3MI3A 1EIBA 2NWSA 4FXJA 3HMCA 1CXIA 1UB3A 3UXDA 3TMLA 4O18A 3L5LA 4N6FA 2PEVA 1BVNP 5KZ6A 3SCWA 1RK5A 1DWIM 4ORMA 4GMEA 2L5HA 3WD1A 4PCTA 1FP9A 3M47A 1Q8JA 1XG3A 2A1YA 3QC3A 1BRLA 4S3JA 4DZ5A 1OCJA 1U1JA 2BX7A 3SFKA 1ZQ5A 4TO8A 2E3ZA 4NZ1A 4XUGA 4XAYA 1ITCA 1FCBA 1CB2A 3LA4A 4MAZA 3PULA 3M6YA 3AIRA 4G2DA 2CZEA 2YFOA 4FNSA 5A6KA 3SCSA 1L2UA 1GKPA 4PMVA 1SSDA 4AIBA 5BXPA 3HZ3A 1EP2A 4J2PA 1D3GA 4MVAA 1W1VA 4YN5A 5K9DA 4W8BA 3NQ2A 3I4KA 1RBOB 1H61A 5JBFA 3VGHA 2OCZA 4IFKB 4PUUA 1WUEA 2PD9A 3GC5A 2J7HA 3C3NA 5DMYA 4D8ZA 1W9UA 2Y89A 4UFHA 3FEMA 3B9DA 2DZVA 2JK2A 1XGEA 3W07A 3AFBA 4LB4A 1F3TA 2YGYA 4H7VA 4H19A 4I9JA 1OX4A 4QX4A 4L6OA 2PWEA 3A24A 2F8QA 1DJQA 3CUXA 1HJXA 3WNPA 3CWHA 4IF2A 2ESCA 1KWGA 1VS1A 1R38A 2VL4A 3PUDA 2G8ZA 3FKKA 4F9DA 5C70A 1H50A 4XQ6A 1TMQA 4LWWA 5BMWA 1YE6A 3WUEA 3U48A 1KGUA 4GHRA 3N3TA 3GM8A 5MKGB 1B0IA 2BY2A 3BCFA 3KAOA 1M68A 3N13A 4UR9A 3TP4A 2ACRA 4C7FA 2E40A 3EX3A 3NIYA 1KFCA 1OFOA 4HU8A 1ADOA 3QM3A 1R2SA 4U5IA 2WJEA 4LAOA 3R25A 2RDWA 5FJUA 3DBNA 3STFA 5F4WA 3HPSA 5KSWA 3NQBA 4GQRA 4CVWA 3FA5A 1EA0A 2FZBA 3QR1A 1QPQA 3MS8A 3BAJA 1BPLB 3W7QA 3Q4DA 3UY8A 1JNEA 1ZCOA 2H8XA 3EWWA 4XD6A 5AZ1A 1TWIA 4M0XA 1V93A 4UCFA 3WJYA 4YPJA 4C6EA 3H53A 3HJZA 3TN4A 1RQEA 4Z1BA 4PFMA 1EWEA 2RDTA 1JAKA 3F5KA 2QDHA 2GGIA 1CT5A 1IT0A 1N8IA 2OT0A 3DHDA 1IIGA 4KQNA 2CYGA 2P76A 3GDLA 4TX8A 2DT1A 1V5XA 2RGMA 1W1IE 2EG8A 2FGZA 4RUBA 3U8GA 4DWDA 1TV7A 2RJHA 1XLBA 4TIMA 3EKGA 4KT2A 4LYRA 4QDMA 1TV5A 4H9UA 2J9ZA 4AZIA 3G6MA 4JKKA 1OG0A 1MWOA 3U57A 3M6DA 5CPOA 1F07A 1IXNA 1W54A 2Y7GA 3AXHA 1G1YA 3QZAA 5FSDC 2OTDA 2YCLB 2DDXA 3DG7A 1Z69A 1OFAA 3A3XA 1H7PA 3E6EA 1HVQA 2R1MA 3LHYA 1CGXA 2A2IA 3MHFA 3KBNA 4S3FA 5LNUA 3KBWA 5I02A 3E5BA 4YTTA 5HWJA 5I24A 4TR9A 5CJ5A 2XISA 1O5XA 3CT7A 4LRSA 1B3VA 4ZE4A 2TPSA 4XIAA 2HBXA 2PBOA 2QMJA 1TJ1A 2DH3A 3U2CA 4J7RA 5A6BD 3OGRA 5I3HA 4DO7A 4AC1X 4FB7A 3TTOA 4IJCA 4G8TA 4MJZA 3E2RA 2DFAA 2Y7DA 1AG1O 5LGXA 1OIMA 4PN2A 1UR9A 1XLEA 3PWIA 4EACA 3W1XA 4ZQPA 1V03A 1UR8A 3LCIA 4DVOA 1BG9A 5JUVA 3TZNA 3VNMA 3VOFA 3LGGA 5E0KA 3SRFA 4IMAA 1W3TA 3WD4A 5A6SA 5HANA 3II1A 4LVBA 1KFJA 2C7FA 1GVFA 3PFRA 4BZYA 1J10A 1SQ7A 2DP3A 3NCOA 2NVDA 4JX6A 1JJKA 1E6ZA 3VKCA 1CDGA 1JPDX 1AVAA 5H8UA 3TK7A 4N9BA 4JCMA 4C65A 1TELA 2FJUB 1XLGA 1EUNA 3W6YA 2PWDA 4RZ4A 1F74A 3MHUA 1ME9A 2VDIA 3WNLA 2PGRA 2QDDA 4C6OA 3L0KA 1JCMP 1XJBA 2Z1KA 1R2TA 1EGZA 3VNLA 3AYSA 4GZIA 3W7LA 3TVAA 5FL1A 1PYMA 4IFRA 3I7SA 4F0RA 5AHEA 3EAUA 4K1GA 2DQXA 2W4XA 3PTMA 4UUIA 3G0SA 1SO3A 1UH2A 2QF7A 4XKMA 1UC5A 3HPFA 3WF2A 5XINA 1BRLB 4ZQRA 4GQGA 5GPRA 1L8PA 2FHFA 3UXKA 2HDJA 4BCEA 3VDCA 4M82A 1TQJA 3EB4A 4E4FA 2EEXA 2XZ9A 2YCJA 4JTDA 4UCGA 1HKKA 4GBDA 3RPTA 3LX9A 3O06A 2VDHA 2PP0A 3WJZA 4L1GA 1W56A 1NQKA 4JQ3A 4CD4A 2ZOXA 2OOFA 4AQLA 3EBVA 1J0KA 1AFSA 1XI3A 3COTA 3SCTA 2NQ5A 3GTIA 3IEBA 1Q3NA 3PJXA 1SJAA 1X8CA 4OOUA 4G7EB 1QBBA 3B8UA 3F4WA 1NH6A 2XIIA 3UJFA 1JIBA 4M1RA 1JVNA 3O3RA 3A22A 3WFAA 2CLIA 1NFBA 2V68A 3UNTA 1HO1A 1V3MA 3AWOA 5IHSA 1JPHA 4JOMA 5LNSA 1OX4B 1WDPA 3WJWA 5CSYA 1MO0A 4BY3A 1RH9A 4N9DA 2NSXA 4WUIA 2OO6A 2G3JA 2BY3A 3AC0A 3QR3A 1U5JA 4JDYA 3W1AA 2PZNA 5M3WA 4O28A 1DJHA 2PDFA 4JPGA 4Q6XA 3AAMA 1UKSA 3MP5A 1B3OA 1KM2A 2P5NA 4DI9A 1K4HA 1CI1A 1I6NA 4GWEA 3W7RA 3T78A 3S2LA 4MJ2A 3DFTA 1H62A 2W62A 1SO6A 3OHIA 1C9DA 3RYSA 1OZQA 4Z0SA 3PZGA 1RVGA 2ZYFA 3IUIA 3N2OA 2INFA 4MNLA 1OGBA 1F3XA 3UR5A 1Q66A 2KX9A 3OIHA 3R8HA 1YNYA 3KBSA 2QCLA 2PDPA 4CD8A 3C2RA 2BHYA 4LX4A 2OYMA 3NSXA 2EPOA 4GQBA 4HSHA 4S3BA 2ZC8A 1AQFA 3GFYA 3ABRA 4WY0B 1WO2A 2CW6A 4XTDA 1I9CB 3H2FA 3V1PA 3TYBA 4NNAA 2AMXA 5HJLA 2WHKA 3GRIA 3PWAA 3U7BA 2DH2A 1P0EA 5A8MA 4ZO6A 1UKPA 4ZL1A 1LBMA 2Z6IA 1N7KA 5AYXA 2VDGA 2PA6A 1GCYA 4WHBA 5FSEC 3XISA 3GFXA 4EPEC 1ECEA 1OFQA 1JDCA 3CAKA 3AYVA 1UQYA 1P1XA 2UV8G 1BKHA 1F8MA 2QV4A 1V3HA 3HG3A 2J13A 4A05A 1C8XA 3R4IA 3VCNA 4A4AA 2NQJA 4DWSA 1NEYA 5DMLA 2Q3RA 3ZVHA 5CGQA 4Q4SA 1REQA 2VZVA 1Q45A 1RK6A 5REQA 2ZX9A 2PDWA 4QITA 4B9ZA 5LIKX 2BVYA 3OBEA 3QN3A 1EDGA 1R3RA 5LIYX 3VIOA 4MNJA 5EMUA 1JR1A 4XK2A 2Z25A 2WM0A 5FJRA 4RV8A 3AHVA 5AOUA 2GJLA 1IWPA 4H9XA 4HP5A 4NX0A 3THCA 1TZ9A 3VUSA 4F0MA 2D2GA 1VEOA 1JZ5A 2HRWA 2Z2BA 3DZ1A 5HQMA 3MKVA 2VFFA 4Z1DA 3TC6A 4TQTA 3UEQA 3D3FA 3O0FA 2JIEA 3O0KA 2GDVA 4Z1AA 3AIEA 4XO7A 3HURA 1P0DA 2X41A 4M3PA 2ATMA 1O66A 4NZ4A 4GXWA 1ZALA 4MG4A 3BGJA 2GK1B 1KGWA 4Q8TA 6A3HA 2QCDB 3S2CA 4IPLA 4E38A 2HZGA 2EJ1A 1ZCCA 2A5HA 3SY5A 2XWEA 4R88A 4WIWA 4PEEA 4DB7A 2CLLA 4WKAA 3Q37A 2HTMA 4TV6A 2W9MA 9XIMA 2WZMA 4BQ5A 4BKNA 4C7DA 2E8YA 2V30A 5GNXA 5H8PA 3SY8A 3JR2A 3VIIA 3IPWA 2A3HA 1FCVA 2C71A 4E2VA 5BW6A 1G01A 3E0WA 3ZOAA 2ISSA 3CTLA 4GIRA 2HVOA 2OFJA 4Z0JA 4LB3A 3K4AA 1NJJA 4B9YA 2WWDA 3GK0A 3NAVA 3EWBX 5HMEA 2X09A 4PRRA 1YPIA 2HEJA 5C8BB 3UJRA 4JNMA 4BI7A 3LBMA 2VI0A 5IXEA 1R3YA 3IAPA 1EX1A 3V18A 1JZ8A 1ZHAA 4CQDA 1RJRA 1E1FA 3AALA 4JX4A 3QLLA 2XVGA 1LRQA 4LALA 3D46A 1A0DA 5H1WA 2YL8A 4LCRA 1GUVA 3QOMA 3OLEA 1PTGA 4D6HA 2O7QA 4GO9A 4JHOA 1R9ZA 4PC8A 3PK7A 3W1LA 3PJTA 1TMHA 5C6MA 5D37A 4AFYA 4Y2WA 5D38A 2Z1VA 4F2TA 4IZGA 4O1AA 4BI6A 4AIEA 1HQTA 1Z44A 1WDQA 2FJKA 3CUGA 1TPH1 4QROA 1WOAA 4JIIX 1V4YA 4A3QA 5CG0A 2J66A 2Z26A 2DIEA 1DJGA 3N29A 3GH5A 3RILA 3B0PA 3W7IA 5D2VA 3AZRA 3W2NA 2C15A 3KHDA 1V0MA 5GJMA 4LVGA 1XBYA 3OP2A 4FF7A 2WNWA 3K30A 1UD4A 2HPIA 1JF6A 3AHTA 1I60A 4U2YA 3ZXWA 1MUCA 3GDMA 5DT7A 1ONWA 2XH4A 3G3DA 4ADSA 4IMFA 1S5NA 5FF0A 5HWMA 4KIEA 1IWAA 3MJYA 4PRWA 3AZTA 2BOGX 4NI8A 3U7VA 4HMCA 3UG5A 1IEWA 1ME8A 3OVRA 3S8HA 3S4TA 3PAJA 1Q63A 2TODA 4DZIA 4NZCA 3NZGA 5H91A 5D2YA 2PURA 3N04A 2NX3A 3QZ6A 5BCAA 4OE7A 2ZFAA 1SMAA 3DFYA 1H7WA 5TBOA 3GS6A 1XKJA 2WW5A 5BWFA 4V1YA 4GQ0A 4MF4A 5A6LA 1HJVA 2PWUA 2NWRA 2OSXA 2Z1WA 4V1XA 1IZKA 1YTEA 5MHBA 1A80A 1NWUA 3IVTA 1QMLA 1AW2A 5HWNA 1LL6A 2EG7A 1XR2A 4Q8OA 3S3GA 2GSJA 4AMCA 2ZZ2A 1YIXA 1Z89A 3RIKA 2Y61A 2BXZA 1TPWA 4N7QA 3ZWTA 1P4CA 1PIIA 4QS6A 3W29A 4RZ6A 4B91A 3SQMA 5I3GA 1PDYA 4OFCA 4PCSA 3TWBA 3D3AA 4MYAA 4P7NA 1VYPX 3NDOA 1YPXA 3VMOA 1XDLA 3V4BA 5G2WA 3UA4A 4WJ8A 1A5CA 2SFPA 4K8HA 5IDIA 3HPAA 3PF3A 4AC7C 1IYXA 2PDMA 1ICQA 3VKAA 3UPWA 3N3MA 2JE8A 1JYWA 3AJXA 4MDOA 5AC7A 4ROQA 3DI1A 4YVPA 3WNKA 2R1PA 1ONXA 2YJQA 1XIMA 4DYKA 1G4PA 1QAPA 1GG1A 3DKJA 4C5YA 3CT2A 4I9AA 4ADUA 4S1FA 3OA5A 3C6CA 7XIMA 3UVAA 4HCLA 2DSZA 3JZEA 5CZKA 2YBVA 4AWUA 4NG3A 1ODUA 1XIBA 4D1IA 1GJUA 1TCDA 1RLCL 4ROPA 3RR1A 3I6EA 1O5QA 1M7XA 3KOFA 4NUWA 5I3IA 2CLFA 2QR6A 2XM1A 4ILSA 3SCOA 4PUEA 3T05A 1HUVA 1WBJA 4NZ5A 3R6IA 4HIBA 3OEXA 3WF0A 4A3HA 2AQWA 5IM51 5EB8A 3DFPA 3T0AA 1ZGDA 1QOXA 1Y5XA 3ERPA 3SDOA 4CGTA 3WQGA 4PUWA 5AFDA 4K7YA 2C16A 3F03K 4K6AA 3DCPA 4Q8MA 2EF9A 1GOMA 2DW6A 3MKKA 4XD5A 2XIOA 1HZYA 4QISA 6ALDA 2WVVA 4IP7A 3VGEA 2BFGA 3ME3A 3CM4A 4KFNA 4PCNA 4IFOA 1XLAA 4CU8A 3GZ3A 4K8GA 4A8RA 5A2BA 2TAAA 4ERAA 4QJ1A 3WELA 1J5SA 1FHVA 3OBKA 3LSBA 5C7VA 3STCA 1XRVA 1UIPA 5AHNA 4IOTA 1TWDA 3TX9A 1JDAA 4DJFD 2J9YA 1G94A 1TR9A 3W01A 1YEYA 5D9MA 4RLIA 3EPNA 4KEUA 1IR2A 1VZWA 3EX1A 1JUBA 3G1SA 4W7WA 4Z2IA 4J28A 5ECVA 4D6FA 1BGAA 1F61A 2X7WA 3R0KA 1RQBA 3Q67A 1JZ2A 4BJHA 4POCA 2QCMA 1EC7A 3PBGA 5FKYA 4J3XA 3C3UA 1AJ2A 1FWFC 1Q6DA 5DELA 4DAFA 4FX8A 4GY1A 3MI2A 2QJJA 3GU9A 4Z2KA 1E9ZB 4LXFA 3CHEA 1GW9A 3K5XA 1NY1A 1I2OA 3CUJA 5CPMA 4ZOCA 3DIPA 4OVXA 4ZO7A 3HN3A 3LNPA 3GXTA 3NQCA 4AB4A 4I8YA 3LHWA 1Z3NA 2ZBTA 5D8WA 1GQIA 3AXMA 1TMLA 2JF7A 1HL2A 5FJIA 1VPQA 4MOZA 2WMIB 1XH1A 3CAVA 2VGIA 3HOJA 3SCNA 2CPUA 1LTDA 1DJXA 1VB9A 1RALA 3UWQA 3S9YA 2YA2A 3GTNA 2QCFA 5A6BA 4Y9OA 2Y7FA 5A6AA 4O57A 1O5RA 3ABQA 5AHFA 1A5UA 4YU1A 1B3YA 4GC3A 1FFQA 3B8DA 4JQ1A 4IM4A 3G77A 1E15A 3B9AA 1OM0A 5CZ0A 1V02A 1Q5MA 4QM1A 3DECA 1Q7ZA 1O95A 4PL1A 2ZUWA 3W02A 1MW3A 4L6HA 2J62A 3MSDA 4DM2A 2C19A 2VRKA 1XL9A 4UWMA 1UZ1A 1ADSA 1YDOA 1S3TC 4HYWA 3G24A 3CZGA 4JEQA 3WNMA 7A3HA 3WLLA 3GC4A 1JYNA 5HK4A 1VBRA 2GGEA 3CIVA 1XW8A 2QVHA 3VKDA 1PHQA 3GIPA 4E3VA 2F9RA 2OQLA 5CXPA 3E3HA 1XX1A 5E6ZA 3S1WA 1DIEA 3UJSA 1FHLA 4CCZA 4ZENA 4EF9A 3BZJA 4M51A 1A50A 2VEGA 1N82A 4D6EA 1IHIA 3T0BA 1W3NA 1BSLA 1VFMA 1S1RA 2GWGA 3AIVA 3VGGA 3SSZA 4WDUA 2OQYA 4MSSA 4DJEA 1EXPA 1OD0A 2W0UA 4QRNA 4GI8A 3EMQA 1XC4A 1E1CB 4R53A 1M03A 4FX7A 3BVJA 5DY3A 4QG9A 3V35A 2BS9A 2BXVA 5CPTA 4RZBA 1AJ0A 4MLRA 1G6CA 1XWYA 5J8LA 3QXBA 1D8WA 1QR7A 1JULA 1W1ZA 2Y62A 4ZZ9A 1XIDA 4B5XA 4FHAA 5BXTA 3ANVA 2ABAA 4NY2A 1V3JA 1EPVA 3EOOA 3FYPA 5K3VA 3GVVA 3RRAA 3FJNA 2XZ7A 3LQLA 3WNOA 1DBTA 4AVNA 4HT3A 4A8IA 2X05A 1YXYA 3N2MA 2FVMA 3PZUA 1EBGA 4B3LA 2R1NA 3HG5A 4YWSA 3RO6A 3UR2A 3OGSA 3K8KA 4EK7A 1UWSA 3KZSA 3EYPA 4PL2A 5IBXA 3RN6A 4QGCA 4BQ2A 4D6CA 5AVHA 3H2CA 1IXQA 3L67A 1FFRA 3T55A 1P7TA 2QW5A 4AZCB 4K1WA 3MO4A 2V5DA 5ENLA 3GXMA 1K7EA 3FX4A 4KERA 1BAGA 3GHSA 3FA3A 1Z9AA 3RO8A 3VIJA 4JDBA 1E5NA 3CHDA 3VMPA 2D2HA 3R0UA 1UG6A 3QLDA 2Q8ZA 1EBHA 2VHLA 4E8CA 5FIPA 3BOFA 4DYEA 4UTIA 5JMUA 4RJEA 2PLJA 1E9YB 1M3UA 2WCGA 1GG0A 4A8LA 2DZWA 2PP3A 3T0DA 4DJEC 1DORA 2ISVA 2YYTA 1RP9A 3WD0A 3LOTA 2W3ZA 2MNRA 4JY8A 1TV2A 2ZIDA 3L23A 2DSVA 2EPHA 2V3FA 1F76A 3QMTA 3H24A 3VX0A 1JDFA 3DX5A 1Q6RA 3AMDA 1QK0A 3NVTA 1OX6A 3VGFA 4UFKA 3WKZA 2BVDA 3RHGA 3O15A 5LNVA 3VD9A 1XIJA 4AISA 4H6RA 1PE1A 2BHZA 1QHOA 1E3ZA 4U3AA 3QVQA 4IQDA 4ZB0A 4XISA 3P14A 3F5LA 1EJVC 3IIZA 3LQGA 3B04A 2ZX8A 3MBFA 3NOYA 1VLIA 5DLCA 2C91A 3ZR6A 3ZO9A 3K4WA 3PZIA 2ZRWA 1L6GA 3M4HA 3BMWA 3QQWA 1RY8A 3PNZA 4HTYA 4HZ6A 5K4XA 1MQRA 3BLDA 1FVPA 3VIMA 1T40A 4HJFA 3TH6A 5DT5A 3G1VA 1B3WA 4KCUA 3A23A 3P67A 1F73A 4RE3A 2ZRXA 4I5RA 2ZKMX 5JQ9A 3PNUA 1RAKA 2XFRA 1QTWA 3B8VA 3PBUA 4DF0A 1UKQA 2JKAA 3W71A 4JZ5A 3IJ6A 1RD6A 3E5PA 4R34A 1CBGA 2J79A 3B06A 4ORIA 1MDLA 4A21A 1NSJA 3O07A 4B5TA 3GDTA 3M0IA 4BEQA 3KP1A 3THUA 3LMZA 2VT0A 5A1AA 2C13A 3WBWA 3GKAA 2ZA2A 1JGIA 1GTHA 1C8VA 4UTLA 4MNMA 2WWCA 4UOJA 4DBEA 3P0XA 4NXSA 3NWRA 2C8NA 2NLYA 2NXGA 1VIWA 3FYOA 4K36A 1M5WA 3PJWA 4MZ1A 3DXIA 4DXVA 5HNNA 1LP6A 3CASA 4XD3A 2YOCA 4JNYA 3IRDA 1A5KC 1SR0A 2X1UA 3CMJA 3EX4A 3WBXA 1XYMA 3S2JA 3VILA 4OQVA 2G4JA 4JS3A 3UGVA 2J6VA 3DHFA 2J8FA 5GQBA 5HNUA 3Q65A 1RCQA 4LOCA 3OYXA 2QYGA 2OB3A 3QY8A 4GQQA 4KWWA 3DOPA 1XYLA 3NQDA 2GL5A 2VM8A 1V0LA 4MYXA 3BWWA 4O0KA 4ZCWA 1KM5A 3CUFA 3KRUA 1MMFA 1F8IA 3PN8A 3LENA 4H2HA 2ZUMA 3SN0A 1R3TA 2VXNA 3FXYA 4YIWA 1QO5A 1D7KA 2Y1HA 4M6QA 3IVSA 1JPKA 4LV9A 4XZWA 1GHRA 2VP8A 2HVNA 2YKKA 2X0SA 1AZ1A 1MZRA 5I3FA 3H12A 4B2DD 3KEHA 3NZRA 3APYA 3S5SA 3G8EA 3MTWA 3BANA 3ZFHA 4Q4KA 3HQOA 3WQOA 1IIHA 1MQPA 4B16A 4NIRA 1S5WA 1EO5A 2WPBA 3UYIA 3L9CA 5RUBA 5AKQA 4NAEA 4KWOA 5TF0A 4HBKA 1XIFA 5FF7A 2BOFX 4WOZA 1XQLA 4MTVA 1ZFJA 2WLZA 3TZFA 2A3LA 2BXYA 2YXOA 4O17A 4AEFA 2X1RA 3VGBA 4LF1A 1LOLA 3KTSA 2PAJA 2W6RA 4KGLA 2AGTA 5CJMA 3NO3A 2OKTA 4H41A 4ZTYA 3S9ZA 3IJ8A 1PS9A 3EA1A 2GUBA 4PEKA 1UWQA 2B7PA 5C2XA 4GOAA 2Z27A 2REQA 1VC4A 3E0LA 3G1RA 1UP3A 3MUZ1 3S42A 3KRSA 1Z41A 1Y8BA 4FK9A 3PTQA 3W9ZA 1Q85A 4RXGA 3S83A 3GTXA 2J7FA 1YMYA 1FWBC 4QHRA 1NF7A 4R27A 4F4RA 3EMCA 1W3LA 4MB3A 4EP8C 3TUUA 3A47A 5CSSA 2D0HA 3H55A 3OIXA 3WLMA 4B92A 4QLJA 1L6SA 1EO7A 1AODA 5H8MA 3KUMA 4A3RA 4J9JA 3W82A 3DGBA 2Z24A 4AY8A 3WL1A 4A3UA 1EUAA 4HCDA 2ZWZA 4L56A 4UNLA 1XLCA 5FD0A 1H1ZA 4EF8A 3S1XA 4JXCA 2ZA1A 4GVGA 3CV2A 1VFLA 3SO7A 4HZ8A 3C86A 3URNA 3REQB 2V8ZA 4YXGA 2YCEA 1H49A 5I00A 1VD6A 3UPBA 4GJ1A 4P7QA 2J8TA