3NSMA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 from ostrinia furnacalis
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords N-acetylglucosaminidase
publication title Structural Determinants of an Insect {beta}-N-Acetyl-D-hexosaminidase Specialized as a Chitinolytic Enzyme
pubmed doi rcsb
source organism Ostrinia furnacalis
total genus 185
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nsmA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3nsmA01
5D9NA 3SCVA 1UA3A 3I3BA 4J28A 3AMLA 4RE4A 3WQWA 3OZPA 4MNJA 2FDMA 4MDPA 1CXLA 2W91A 1QNQA 1UD5A 2E4TA 2DT0A 2XVNA 1JF6A 3BH4A 2ZX8A 3UR7A 1DTUA 2CBUA 4X9YA 1UR9A 2VX5A 4PMVA 1V02E 2FHFA 3ARSA 1W32A 4UOQA 2A3CA 1QVBA 3CMJA 5GQBA 2V5DA 2DSWA 2HVMA 4PMRA 3T08A 1V0MA 4MB3A 1B9ZA 4BCEA 3ZQ9A 2OLHA 4W5UA 3VTRA 3U7BA 3WFZA 4JFUA 1UQYA 2G3MA 3RO8A 4GI9A 2VCAA 2JE8A 2YA1A 1GQJA 1Q6DA 4QP0A 3WQ4A 4MTVA 1JDDA 5A6LA 1ODZA 1RH9A 2ZX5A 3AHXA 3AXHA 1V6WA 2YIHA 1B3WA 4W86A 3BAJA 1GONA 1CGXA 3LMYA 2CEQA 1H1NA 3UG4A 5GNZA 4V27A 1GQLA 3JUGA 1KXQA 4WJXA 4U33A 2CESA 1UD8A 1ITXA 1QBBA 1QI3A 2VZVA 2VRJA 2BVTA 1H11A 2WHJA 4P7NA 2WCSA 4JAWA 1JIBA 2ZX7A 1W3KA 4CU8A 6A3HA 3WDPP 4AZGA 4B16A 4HOXA 1CXIA 3GNRA 5E0CA 3F4VA 2XWEA 3OIHA 1PBGA 4M8UA 3PZNA 3GXMA 1V0LA 5E0FA 3WNPA 4TX6A 1ODUA 2X0HA 5AY7A 4AZ7A 2YDQA 4M56A 4X0VA 1LWHA 3TA9A 4B9YA 3VGFA 4NF7A 1LL4A 1OBAA 1HJUA 3MMDA 1GZJA 4BQ3A 3AOFA 5BWFA 4ZENA 3AQUA 1B90A 2XJ7A 1K9EA 4C90A 1H4PA 4U5KA 2J47A 2WMFA 2XGBA 1JZ7A 2XYLA 3N17A 3A4XA 3WF0A 4U31A 1UD6A 4D1IA 3VMNA 1FFQA 5AYIA 4JFSA 2WMIB 4BS0A 3GBDA 3B9EA 4D6FA 2W61A 3GXIA 1DWHM 2GJXA 1E4NA 3M07A 1KR0A 3IJ7A 4EKJA 1LL7A 1E70M 3EDEA 1VEPA 2DEPA 4RE2A 3T0AA 3W26A 1MQRA 4UCFA 2BVYA 4Z2IA 2DDXA 3MV01 1TA3B 3OGVA 4V28A 1GNXA 4WKHA 1AVAA 5IHRA 2D2OA 2WVUA 4KH2A 2OYKA 1LL6A 4JKKA 4S3JA 4WKFA 1WZLA 4DWSB 1UKQA 4D6GA 2PBOA 2W62A 1JXKA 1MWOA 3IAQA 3K8LA 3CO4A 3K8KA 5A6BA 3W81A 4CGTA 1GORA 1GVIA 2E40A 4ACZA 5CGMA 4AYSA 2ZUTA 1EO5A 4OOZA 4NSBA 4QAWA 1V3MA 3UETA 4CD8A 1GQKA 2VVSA 2DH2A 1V08A 2O9PA 2WHMA 3SCSA 2XFYA 2YL5A 4KGLA 4AY1A 1FH7A 3OGSA 1BVZA 4LXFA 2J7FA 2J62A 3AIUA 4LGXA 2CITA 4L4OA 2WM0A 4M24A 4HA1A 1MW3A 4F9JA 1BPLB 3PZIA 1XV8A 2Y2WA 4OUEA 4A3HA 2XIBA 4KGJA 2D3NA 1Q6GA 2GJPA 1DP0A 2EQDA 1QHPA 2G8ZA 3PZQA 3A4WA 1R85A 5AC4A 1HJSA 1KQYA 4FK9A 4AZBA 1E3ZA 1HF6A 2V38A 1HVQA 1M53A 2XSBA 3WMSA 3UEQA 2PBGA 2YL8A 4CN1A 4UFKA 2CETA 2JF7A 5FL1A 2WB5A 4E8CA 4QFUA 1W9DM 4PCSA 1QNSA 3UR8A 4GI8A 2WWCA 1AQMA 1SYTA 5FCZA 2YBTA 1JZ8A 4H2CA 2O9RA 4PTXA 1LG2A 4V2XA 1RD6A 1IZJA 4H8VA 3DC0A 1CXHA 5DEZA 3AMDA 4KRUA 4RL3A 4PCTA 3CZEA 4AD2A 6TAAA 1CIUA 3NSNA 4H04A 2X8RA 3BAWA 1G94A 3E1F1 3AXXA 3WF1A 2DT3A 3S6TA 4HOZA 1PJ9A 1FHDA 4TVDA 2DQXA 1S46A 4J3SA 3RDKA 1LLOA 1GUVA 1VFOA 3WNMA 5BXSA 1IT0A 5LA0A 4U2YA 1JYXA 3T0BA 1FH9A 3AICA 3AROA 4W8LA 2BXZA 3AZSA 1EXPA 1NOUA 3OZOA 2WWDA 1WDSA 5ABFB 1VFFA 4W5ZA 3WNOA 1ITCA 1UYQA 4GZIA 2GSJA 1M7XA 3W24A 4CCCA 1C8YA 4PSRA 1UWRA 2E9LA 1NWTA 3WENA 3ZSSA 3BSHA 1UR0A 4HTYA 2E8YA 2WVVA 2ZICA 4J7RA 1ZBCA 1H09A 4GPNA 4W7VA 2OWCA 3ZIZA 2WBKA 3CUIA 2X09A 3F5LA 3VIPA 3AHZA 4JKLA 1XGZA 2QMKA 3WQ6A 3TTOA 3FAWA 3WD3A 4CKQA 1B3ZA 1QI4A 1US2A 1JGIA 4AW7A 4BZYA 1E72M 1W2VA 1VFMA 3HJEA 4IPNB 1J10A 4FLSA 4YPJA 1B30A 4UZUA 1B0IA 4JL1A 4NI3A 4QDMA 4JCMA 3RILA 2WBGA 4CVUA 4PN2A 3KEHA 3VIGA 2CHNA 4GQRA 2JEPA 5EFDA 3RM9A 4RE3A 4YHGA 1E4MM 4TXEA 1BGGA 1XH0A 3EDJA 1NOFA 3ZJ8A 4W87A 1J9YA 2VT0A 1CXEA 1MW0A 2W4XA 3RM8A 5JIWA 1U33A 3BAXA 2FHBA 3W38A 1TFVA 1VJSA 3SCOA 3WMBA 3W25A 1CENA 3EMCA 4L4PA 5E70A 3WEOA 1ZS2A 3N04A 1CTNA 1JDCA 2Z1KA 4QLLA 4UQEA 3L4VA 1BLIA 1HJXA 2AOSA 2ZXQA 2V3EA 4F79A 3FNDA 4KWUA 1UWUA 4XB3A 2A3BA 1GOIA 3VD9A 2VR5A 5A8MA 3TONA 3G6MA 4OIFA 1BYCA 1KXTA 5I79A 3W0KA 1JD9A 1UH2A 1VJZA 3GH4A 5A1AA 3SCPA 1QNPA 1ISVA 1RP8A 2FH8A 3GH5A 3WDIA 1V3LA 1HKKA 3T2QA 5IHSA 1W9XA 4PTWA 2YA0A 3M46A 1G1YA 5GPRA 1OIFA 4PYSA 4WK9A 3O2LA 2WZIA 3UCQA 3ZR5A 5A6AA 1QW8A 2BY1A 3W6MA 3AXIA 4MB1A 3CHDA 2CKRA 2G3JA 3GBEA 5M03A 4JFWA 1E5JA 4HMCA 3OBAA 1HP4A 3SCNA 4Q7NA 3ARUA 3WY1A 1XYFA 2J7CA 1W1YA 5E9AA 7A3HA 1XD0A 3WD0A 4F8XA 4UZSA 1EO7A 2XVKA 1KFWA 5DT7A 3PZ9A 1BG4A 2C8NA 1F4HA 4PMQA 3VUPA 5A2AA 1EH9A 3ZOAA 3GM8A 2XG9A 4A3YA 1E4LA 3WFLA 3EDKA 2HISA 1E0VA 1WCGA 3AIEA 2Q8XA 2XGIA 2J4GA 3CZ8A 2IUZA 4HA4A 2QPUA 2VZTA 3VKKA 2VJXA 1XH1A 1KGXA 4GKLA 8CGTA 3GXDA 2ZX6A 2YDRA 1R7AA 1W9UA 3MUAA 2WC3A 4UQCA 2WMIA 5I2UA 2DSKA 2PWEA 4TTUA 3ARVA 3QR3A 2NT0A 1PPIA 1H5VA 4HPGA 4E4PA 1UR4A 1XSKA 4M82A 3BLPX 1JXJA 3DYMA 1OWQA 1FOBA 1H2JA 1V3HA 3WUEA 2BHUA 2DGAA 5E09A 4DWSD 2PB1A 1JZ5A 1JF5A 4UTFA 3WD1A 4QLKA 3PZOA 1XSIA 1C8QA 1C91A 1TA3A 3WD2A 3F5KA 3SCQA 3RIKA 3VX0A 3O9NA 3CZGA 1JZ3A 4JCLA 4AD4A 1J12A 3CTTA 1BTCA 1XRVA 3FY1A 1TE1A 2DPEA 5A8OA 1V3JA 4DWSA 3W37A 2DIEA 4GZEA 1MYRA 1PAMA 1GJUA 2E8ZA 1ISWA 3L2LA 1WDPA 2OWXA 1V6XA 5A2BA 3L4TA 4ZXOA 1KXVA 3AHTA 1CGYA 3APGA 3GNPA 3L4ZA 3A6OA 4W84A 3CMGA 4TX8A 4D71A 5I78A 1WPCA 3CLWA 2CHOA 1HVXA 2CPUA 1WKYA 1J0HA 1NP2A 1VBRA 3N12A 1CGWA 4J27A 2G3IA 5A69A 3DYOA 1Q6EA 2WKLA 1VRXA 1UWQA 4S3KA 3OB8A 5A94A 5I0DA 1W2PA 4H8UA 1ZBKA 4JFTA 2VTFA 3VD4A 4BA0A 3CBWA 1C7SA 3B9DA 2VZUA 2J79A 4AD1A 3CZLA 1QI0A 3VPLA 5BYWA 1HL8A 2X2YA 5JBEA 4PTVA 1C90A 3N11A 2CBVA 4P8UA 4AIUA 4D6EA 4M29A 3WN6A 4CD7A 1JG9A 2DSVA 5CPTA 3BCFA 1E6PA 3BC9A 5BXRA 5D8ZA 3PZTA 3VVGA 5ABGA 1R8LA 5D9OA 3KZSA 4MDOA 1US3A 3BGAA 3RJYA 5I5RA 3PZVA 4JL2A 5JIPA 2VRQA 1UH3A 5M17A 4IUGA 3ARYA 1WZAA 2BXYA 1DWAM 3TTSA 4UOJA 1HT6A 3AMCA 1VIWA 5D4YA 3UERA 3WDJA 3UESA 5BXTA 3A3HA 3CUFA 2F2HA 1QW9A 5HOSA 3QHNA 1KWKA 1DHKA 4HMDA 3WNNA 1UKOA 2D0FA 5ABFA 3ZJKA 3J7HA 3CPUA 5KEZA 1W3JA 4F9DA 1GJWA 1WZMA 3KE0A 2ZUMA 2J77A 3WH7A 3MO4A 1EA9C 9CGTA 1NP0A 3WEZA 1G9HA 3ZJ6A 1CXFA 2YLLA 3WDQA 2DSZA 3OLDA 1VFUA 3NSMA 3RJXA 2YJQA 2VUYA 1UUQA 5IFPA 1I75A 4QLJA 3GYCA 1UWTA 1B1YA 3HMCA 1EDQA 2E0PA 1QI2A 1MXDA 3WIJA 5EBAA 2E9BA 4J3XA 1E6NA 3GNOA 2XUCA 5A6BD 1DWGM 2D22A 1JI2A 4UFMA 1AQHA 1EDTA 2W63A 3BXWA 4J3TA 1FP8A 3WL1A 2W66A 3SUWA 3UG5A 4FLRA 3QOMA 4WKAA 4U3AA 4W88A 3QHMA 3W6LA 3W27A 1FA2A 3ZT6A 1R7OA 5BROA 4BQ4A 1PIGA 1XSJA 1BYBA 3VNZA 3CZKA 3BMWA 4W7WA 2BY3A 2WPGA 2WNWA 2GK1B 2XVGA 4P8VA 1TZ7A 3SCRA 1FHLA 1QHZA 1C8XA 3AZTA 3WQ5A 1X6NA 1MW2A 1E9LA 1EHAA 2XHYA 1E56A 2D0GA 5I24A 3CUGA 3ZJ7A 1XYZA 1TVPA 1E6QM 2CBIA 1GHSA 3WNKA 3T0DA 2EJ1A 4JFVA 1Q4NX 3NIYA 3I3DA 1XHGA 3VGDA 4W7UA 4GI6A 1TMQA 4TUFA 1J0JA 2FHCA 2WMGA 5I77A 4PMNA 5FIPA 4PMUA 4DUWA 1KQZA 4UFLA 2XVLA 4BQ5A 3AIVA 3OGRA 3M7SA 3CZJA 1JZ6A 3TTQA 1Y7VA 5A3HA 1PX8A 2JF6A 1GCYA 1SFSA 2WC7A 4ZEPA 3OA5A 1BFNA 5CXPA 1PEZA 1A3HA 4TOQA 5E6ZA 4PMYA 3GDBA 1H49A 1W9VA 7TAAA 2QMJA 2WMKA 4K68A 5HDRA 1VAHA 4CD4A 2UY4A 3THCA 4NZCA 3WUFA 2E9MA 4UOZA 4B3KA 1FFRA 1B3VA 2GUYA 1E1EA 4U3CA 3RM4A 3SURA 1WE5A 2ESCA 1E5NA 4CN6A 1VB9A 1C93A 4JKMA 5HNNA 3PTQA 1OM0A 2VI0A 5CLTA 2WXDM 3O6AA 3ARXA 2JIWA 1SMDA 2CCRA 2VQUA 1HJQA 2DH3A 4GO9A 5HBFA 1TUXA 1HKJA 1NWRA 3K1DA 4AISA 1M01A 1HJWA 2PWGA 4B9ZA 1KXHA 4H7VA 4UFIA 1E3XA 4DM1A 1UWSA 1WO2A 2ZOXA 1MVYA 1BSIA 3SUVA 3AIRA 4MNLA 1HL9A 5FL0A 4CCDA 1JZ4A 5ABEA 4PUDA 2V3GA 5D8WA 3PBGA 2PWFA 4C7GA 5M3WA 2VOTA 2GDUA 3SCTA 2EEXA 3VD3A 2J75A 2J7DA 3VILA 1HIZA 1NQ6A 5IDIA 1NWUA 2J7HA 2OSXA 1X1NA 3BSGA 2QF8A 3NCOA 3ZT5A 3LPFA 3MANA 4IM4A 1V6VA 2D23A 1ZJAA 3IAPA 2A3AA 4QCEA 3LPOA 4JHZA 1SR0A 3ZM8A 3POCA 4Z2LA 5A6KA 4ZFMA 1W9PA 1J0KA 1ZB5A 2CIPA 2J8GA 3VD7A 1UG6A 4GQQA 3M6DA 2BV9A 3D3AA 5EMYA 4M80A 2MANA 4LPCA 1E40A 3VO0A 1O7AA 2WZHA 2C0HA 4E2OA 3W28A 1IZKA 3FAXA 2WHKA 1Z32X 3U5YA 4PMZA 4HMEA 3W82A 5DMYA 1CNVA 4CU6A 1O6IA 4UR9A 3ZR6A 4UFHA 4D72A 3ALGA 1KCKA 1VEOA 1B3XA 4C7DA 2J7EA 1K6AA 1KGWA 1XC6A 1E6XM 4WSJA 1KGUA 4AIEA 2BVDA 2XVPA 3MUIA 4Z2KA 2DT2A 3ECQA 2J78A 2A3EA 3EMQA 4XUYA 2V5CA 1H41A 2OSWA 2CBJA 3WH9A 1QOXA 3VNYA 4AZCB 1V0NA 1ISZA 3K4DA 1QNRA 2PWHA 3ALFA 3FXYA 4UNIA 1E6RA 4HU0A 2VO5A 1PZ3A 2ZWYA 4IPLA 3CHEA 4ZXLA 1MXGA 1WP6A 2YLAA 2ZXDA 1E55A 1BGAA 3WMCA 1VF8A 2J74A 4LQ1A 1JYVA 4B3LA 1UA7A 4WF7A 4OJYA 3T2OA 2NSXA 2WZEA 1ZU8A 1TR1A 3EMZA 1GOOA 1P6WA 2FGZA 4P7RA 4HZ6A 4JZ5A 4GINA 3L4UA 1J18A 1BVNP 2IXUA 1DWJM 1KBBA 2PC8A 3L4YA 4UQAA 1CGUA 4OOUA 3VOCA 1RPKA 4CU7A 1G0CA 2BS9A 2ZUSA 2FH6A 2VC9A 2ZUNA 3BAIA 3NJ3A 5HXMA 4E8DA 3SUSA 3EDDA 5A6SA 1GQIA 1EQCA 1HX0A 4AZHA 2UY3A 4CVWA 4J3WA 2BY2A 4MJ2A 4W85A 4CD6A 4OBSA 2BHZA 5I6SA 4ZE4A 1PIFA 1I1XA 4ML4A 3SUTA 4TVUA 5E6YA 2XTKA 5FOOA 4MAVA 2XIIA 4P8XA 3KWXA 2O92A 1BQCA 4MB4A 3AISA 1JYWA 1W9BM 5LA1A 4N0RA 1FP9A 1JFXA 2WVSA 3NDZA 4H8HA 1GW1A 4HOWA 5JUVA 1HXJA 4EK7A 1QBAA 2J8FA 4AZ6A 1RP9A 2O9OA 2VZSA 2X05A 3S2CA 1ESWA 1Q6CA 4PBGA 4JIEA 5A8QA 1CXKA 1UQZA 3FN9A 2ZWZA 1WNOA 3MMWA 2E3ZA 4OBRA 1ECEA 4ZE5A 2PI6A 2ZUUA 3ARTA 2OSYA 2D1ZA 2EPOA 3K46A 3ARPA 3DECA 4U2ZA 3II1A 1MQPA 1XCXA 4FF5A 3PTKA 4AIOA 5EFFA 1BYDA 3POHA 1D7FA 2JIEA 4UQBA 1NWSA 1E1FA 2YL6A 1LJYA 3VM7A 3MSDA 5JBDA 3U7VA 1W1PA 3VX1A 7CGTA 1W1VA 1W3LA 3VIMA 1HKMA 3N13A 2GK1A 1YQ2A 2QLYA 3VIIA 2VURA 3FW6A 4OKDA 1OGBA 4Y7EA 2WLYA 2Y8KA 2XM2A 3SUUA 2CERA 4ATDA 1UR1A 5BXPA 3AS2A 1V6YA 5HPOA 3RPMA 1AQ0A 4NRSA 5CPQA 1UR2A 3CIVA 2WSKA 3IANA 1OIMA 3B8SA 2EPMX 2TAAA 2WANA 4PSPA 1CZ1A 3AYSA 1PX3A 3GXFA 3IJ9A 3SIMA 1CGVA 3VD5A 4HZ8A 1CDGA 3GTNA 2WW5A 4X0NA 1VBUA 3N18A 3LPGA 3QGVA 2W5FA 4FLQA 1JZ2A 1V03A 4PMXA 4N42A 2ZE0A 3QOKA 1B2YA 1BAGA 3LPPA 4GIAA 4LYRA 5ABHA 1OSEA 3VDCA 2VVNA 4PTMA 1EOKA 3MS8A 4PUEA 3AHVA 1JD7A 4AEEA 5A8PA 2XPKA 3SCUA 1MW1A 3GZAA 2WCGA 4MJ4A 1BYAA 1K9TA 3KL0A 1JNEA 2V3FA 4MB5A 3VDAA 3WD4A 4EE9A 4JHOA 4LYPA 2Z1SA 1KB3A 1OT2A 1NOWA 1Q6FA 4GXPA 1UD2A 1U2YA 1H0GA 4UQ9A 4HU8A 4FLOA 1L8NA 3AS3A 4F66A 2AAAA 1YHTA 1UD3A 3DHUA 2BY0A 2EBNA 3VGGA 2W92A 3CUJA 3U5UA 2RGLA 1EHNA 1UKSA 5GNXA 1J0IA 1LF1A 2WMJA 4HA3A 4WLCA 3DHPA 1W1TA 2VRKA 2GDVA 4OZOA 5KZ6A 4UFJA 1UH4A 1C92A 1JYNA 3WQ8A 3WBAA 1V6UA 5HPCA 2D20A 2IXVA 1TVNA 1EGZA 3EDFA 5DFAA 1NM9A 3T2PA 3TTYA 1JAEA 1CEOA 3TP4A 1QPKA 3L4XA 2W67A 1B31A 1GOKA 4R5EA 1GHRA 2D0HA 3AIQA 2UWFA 2X1IA 3AMGA 5A8NA 3VGHA 4P7QA 1J0YA 3A4AA 3VINA 5FD0A 1HP5A 4J3VA 3RCNA 4ATLA 2NT1A 1CLXA 3D5HA 3VGBA 1G01A 4BQ2A 1WAWA 1E6ZA 4TTGA 1PX4A 2OWWA 2J7BA 2VQTA 1UKPA 3WH6A 2D3LA 2UY2A 1BG9A 1M03A 5CSUA 2EPLX 4LX4A 2G41A 1OINA 3T09A 4D6HA 1CYGA 2VX7A 1UZ1A 3EYPA 1ZBWA 2WKGA 1XCWA 1GPFA 3ARQA 1V3IA 2XFFA 4HZ7A 3F5JA 2Y5EA 4AD3A 1ISXA 2YDSA 3VDBA 4AC1X 1XD1A 3VMOA 1B3YA 3CUHA 2WHLA 3HU7A 1JI1A 1V02A 3IJ8A 2V3DA 4MAZA 4PMDA 2Y8VA 3AS1A 2XFRA 2F61A 1GOWA 2QV4A 4MNMA 2BNJA 4AZCA 1HNYA 3AJ7A 3N1AA 3NSXA 5C8BB 3CHCA 1ZL1A 5TD4A 5A95A 1V3KA 2XWDA 4PRWA 4AXNA 5A6JA 1VEMA 3ARRA 5CQ1A 8A3HA 5F7UA 1U30A 1UR8A 2YOCA 4D6DA 4DM2A 1MFUA 3AHYA 1X6LA 3AIWA 5D9PA 2WCAA 5CPSA 3VGEA 1K9FA 4B15A 2DSUA 1ZJBA 1J0ZA 3CGTA 4YN5A 5A2CA 3WQVA 3AS0A 1ISYA 3VM5A 1OGGA 3A47A 3WUGA 3THDA 2GFTA 2C7FA 3WH5A 3GH7A 3PZGA 1LG1A 1JDAA 2VL4A 3MSGA 3VDHA 1UKTA 1MFVA 1H0IA 2WLZA 3W29A 3ZSTA 1TG7A 2EPNA 1UOKA 3TOPA 1WDRA 2FGLA 2J7GA 4C7FA 5DO8A 3VIFA 4Z2JA 5IXEA 2JFEX 3SEPA 4QCFA 2ZXBA 1CLVA 4PEEA 2QHAA 1M04A 1A47A 4H41A 1CWYA 5BCAA 5CGTA 5I23A 2AMGA 1KCLA 2ZIDA 1UD4A 5C71A 1XH2A 2CNCA 1OCQA 2ZXAA 3AMKA 3BMVA 4KMQA 4DUVA 4TVCA 2G3NA 4D1JA 2XSAA 3VIOA 4KRTA 1WB0A 5D9MA 4AD0A 4CCEA 3BAKA 1GOMA 5CJ5A 1WZKA 5LA2A 2VNCA 5BRQA 1E15A 1N82A 3WUBA 3AYRA 1DEDA 1CPUA 4XV0A 2Y4SA 4Z2HA 1EQPA 3ZMRA 3L4WA 1BHGA 4D6CA 1W91A 3BCDA 2JALA 3WNLA 3QHOA 1F4AA 2VZOA 1J11A 3MKKA 1OGSA 1EIBA 1K9DA 3VIKA 3AFBA 3IK2A 4WIWA 4D6IA 1L0PA 1WDQA 3MUZ1 5CLWA 1HKIA 4WSKA 3CHFA 1AMYA 1V0KA 1E4IA 3OLIA 4W8AA 1HJVA 3OLGA 5C70A 1E6SM 2GJXB 3K4AA 1ZBVA 4R27A 2PWDA 2VCCA 3VIJA 3VMPA 4CN4A 4GZJA 2WC4A 2BHYA 4MADA 4GO8A 5GNYA 1CGTA 2YA2A 1E43A 2QPSA 2JEQA 6CGTA 2ZUWA 1IV8A 2WYSA 5DF0A 3VIHA 3MUY1 2G4FA 4W93A 4M1RA 4AWEA 2YL9A 3MU7A 3WF3A 4Q22A 4BF7A 2D24A 4FMVA 3WELA 1C7TA 2O9TA 4XX6A 4EANA 1D2KA 4P7LA 5FKYA 2OYLA 2F8QA 5IFTA 1JNDA 4EAMA 5ECUA 1KWGA 3U57A 2B31A 3I3EA 2WSPA 4ACZB 2GJRA 1J01A 1SMAA 2EO7A 2VX6A 1CECA 4MPKA 4URIA 3WF2A 5AC5A 5BRPA 2BFGA 1GOQA 3B9AA 3W4RA 1R86A 3DYPA 3ZO9A 4D6JA 3G6LA 3AZRA 4NRRA 1OB0A 4AEFA 1R87A 2EPKX 1HN1A 3W53A 1G5AA 2RGMA 3KL3A 2UY5A 5LYRA 1JL8A 4A4AA 4CD5A 3WL0A 1DWIM 3MV11 2XM1A 3MMUA 3NUKA 4PMOA 4AD5A 3BLKA 3PN8A 2WMHA 3OG2A 1E0WA 1VENA 4U5IA 1JFHA 5CZKA 1LQ0A 3AIBA 2A3HA 3AI0A 2DIJA 1BF2A 1KBKA 3ARWA 1OD0A 2WK2A 1EOMA 4IISA 3ARZA 2OYMA 4W89A 3CH9A 3WEMA 3NYDA 4DUXA 1GVYA 2GVYA 4XZBA 4AMCA 3WDRA 2Y24A 3WH8A 2WVTA 3PZUA 3N15A 3PZMA 4DWSC 2ZUVA 3WDHA 3NDYA 1D3CA 3WSUA 4YHEA 3RMEA 5DT5A 1UZ4A 1C3FA 2VX4A 5A6MA 3WKZA 4HPHA 5EB8A 4M81A 5M5DA 1NH6A 4W8BA 3HN3A 4HP5A 1OD8A 4C91A 3VU2A 2X0YA 1OT1A 2J25A 4P7OA 5I3DA 3WF4A 5JBFA 1PZ2A 1MQQA 3KL5A 3K8MA 1JAKA 1TCMA 4J3UA 3WBEA 2VR4A 2CXGA 5AYBA 2WAGA 3L2MA 4CUCA 4LYQA 3UG3A 1QHOA 1FH8A 2CKSA 3FHAA 1KR1A 4MNKA 2DT1A 3PTMA 3FHQA 1DWFM 2PF0A 3EBVA 3ZT7A 4XZWA 1UHVA 1UWIA 1E73M 3N9KA 1I1WA 2CYGA 1E0XA 4UQDA 1QI5A 2WVVB 2ZX9A 2EXOA 1E71M 1NARA 1EDGA 5CSYA 2NW0A 4Z2GA 2YBUA 4AZIA 1QNOA 3BAYA 5CG0A 4ATWA 3SCWA 3PHAA 2YKKA 4ACYA 4AZ5A 3OLEA 1CBGA 1LWJA 1W3HA 2VCBA 4P8WA 2VMFA 1H3GA
chains in the Genus database with same CATH superfamily
3SCVA 3HGJA 4J28A 1SM9A 1K4HA 1QAPA 3JR2A 2E4TA 1TX2A 2DT0A 2XVNA 3P7YA 5SWUA 1DTUA 1TTJA 1O1ZA 4ZB5A 1W32A 2QULA 2J6XA 1LP6A 3CMJA 1VFSA 4O1EA 2DSWA 1UUOA 4R7WA 3T08A 4ZCWA 1OF6A 2RUSA 3DBNA 4JFUA 4KBXA 1UQYA 5KZMA 4GI9A 3SRFA 2JE8A 3P3BA 4QP0A 1P0DA 3LCIA 4UTUA 1TPFA 2X2GA 1JDDA 5A6LA 3QJAA 1ODZA 4L9ZA 2OX1A 4FX8A 1V6WA 2YIHA 3RITA 1FQ0A 1XINA 3BAJA 4HNNA 1XYLA 1GONA 1QT1A 3ITYA 2W9MA 1GQLA 4AVOA 1KXQA 3EWUA 1UD8A 1XLKA 3OA3A 3LCHA 4UTWC 3SRDA 1O5KA 2QCCA 3LBMA 3MCNA 2QEZA 1A5UA 2HEJA 1KFBA 1Q6RA 2BTMA 2C15A 3IPWA 1L2UA 7TIMA 6A3HA 3WDPP 1W5PA 1GPWA 4B2DD 5BU9A 3QTPA 5E0CA 1I2NA 1ZGDA 4M8UA 3HGRA 4GCAA 3GXMA 2OX4A 4XZLX 3CU2A 4G7EA 3B8DA 5E0FA 3LQLA 3TMLA 4TX6A 4AZ7A 2VDIA 2R1PA 3VGFA 1N8WA 2VEPA 1OBAA 1GZJA 4BQ3A 4GD0A 3AQUA 1DJHA 4R7OA 5I7GA 1K9EA 5J04A 3GNDA 1H4PA 5GVJA 1J79A 2WMFA 1VBHA 2XGBA 2XYLA 2Y85A 1EX1A 4EACA 3I6RA 2DJLA 1RR2A 4JFSA 2VHLA 3SGUA 3OP2A 1XIMA 3KOZA 3E02A 1PUDA 2W61A 2PTZA 1DWHM 4F0SA 3M07A 3NWRA 3W22A 4FNUA 1LL7A 1O5RA 3KTXA 3EDEA 2BOGX 2P0OA 3SECA 2YCEA 1DVJA 4QR6A 3CUZA 1Z69A 1NY1A 3TIMA 3GK0A 2BOFX 2EKCA 4A35A 4DBEA 4V28A 1Z9AA 1GNXA 5FF0A 1TZZA 1AVAA 2PPGA 4UC5A 5FSDC 1A5MC 3KCOA 3CIWA 3DENA 4PUWA 4EPDC 4QJ5B 2OR2A 1M1BA 4NAEB 5C7VA 1UKQA 4O19A 4QM1A 2EJAA 3KP0A 1XIJA 5A6BA 1UR3M 3XINA 5CGMA 3WLIA 2QS8A 4CNSA 5BZAA 2ZUTA 1FWSA 1MUWA 4CD8A 8TIMA 4JIIX 2O9PA 4KW2A 4OV4A 2X1RA 4KGLA 2GJLA 4H7CA 2PODA 4ROQA 2J62A 2WM0A 1BPLB 4XAZA 2Z1XA 4MUPA 3CPRA 5AC8A 2Y70A 2Y2WA 3WCZA 4OUEA 2Z1VA 2XIBA 3DFTA 3UD6A 2D3NA 3LERA 2OB3A 2EQDA 3PZQA 3TYDA 5AC4A 3S9ZA 1HJSA 1JPHA 4FK9A 5AC7A 2WM1A 2VGFA 1HVQA 1M53A 4UCGA 3UEQA 4YTRA 2PBGA 2ACRA 1R9ZA 4UFKA 2CETA 2CLLA 2WB5A 4Z08A 4QFUA 2GLKA 1HW6A 3NVDA 4ENLA 1SYTA 5FCZA 3R8RA 1JZ8A 4H2CA 4PTXA 2IPJA 1MDLA 1RD6A 5FA5A 4RL3A 4EIVA 1UJQA 4EPEC 1S2WA 5AB3A 2ZDSA 3TR9A 3E1F1 3BANA 4JN6A 3S5SA 4HOZA 1WUEA 4WY0F 3R2GA 4J3SA 3QKEA 1UP3A 4P2VA 3USZA 4Y9MA 5DANA 2Y0FA 1V5XA 5B80A 4ZOCA 1GKQA 2GUBA 4LSBA 3TYZA 5ABFB 3M47A 3VZYA 1TTIA 4GZIA 2O4QA 3W24A 4RUBA 4MZYA 1C8YA 1KFKA 1R3VA 4NZ1A 1PYFA 2Y6ZA 4FNQA 2E9LA 4DXXA 3WENA 3BSHA 1UR0A 3F03K 4HTYA 5TAOA 2V2HA 3W71A 1FWDC 3ZIZA 2VR2A 2WBKA 4ZO6A 4GC3A 3CUIA 3NQMA 2X09A 1C8VA 3PG9A 2QMKA 1PVNA 3O15A 1US2A 3QV6A 2P1FA 4J9JA 5D09A 3CNYA 1W2VA 3IWPA 3SZ8A 4JPGA 4IPNB 4RNHA 1AZ2A 4UZUA 1SFJA 2WBGA 3KEHA 3VIGA 3QM3A 2IW0A 1FDJA 1E4MM 1XH0A 3R4IA 3ZJ8A 4W87A 1J9YA 3L68A 1CXEA 2W4XA 1M7OA 3RHGA 1TPB1 4A8NA 1JUBA 3EMCA 4L4PA 5E70A 3N04A 1JDCA 1A80A 3L4VA 1A4MA 2VC5A 4GYFA 1EF2A 5T8GA 4IT1A 2V3EA 4F79A 3I4EA 5U4NA 1T0OA 4XB3A 2YXOA 4O1DA 3G6MA 1MEIA 5XIAA 2I17A 3Q4DA 2FJKA 3GFYA 5A1AA 3V35A 1QK0A 2E67A 2DV0A 3GH5A 3WDIA 4WDUA 3C4UA 3MUCA 3T2QA 5I3HA 4FXSA 4K7VA 3D6NA 3FIGA 4UR8A 1OIFA 4PYSA 4WK9A 3O2LA 2DP3A 2WZIA 4TV5A 3LNMA 3W6MA 4WJEA 1IWBA 5LGXA 3CHDA 3GBEA 4JFWA 2BGSA 1E5JA 1HP4A 5G4EA 2E1DA 3ARUA 3WY1A 3QC3A 1W1YA 1XQLA 1IT8A 5E9AA 4E4FA 4UTTC 1EC7A 4UZSA 1BXCA 2XVKA 5EMKA 3R8HA 1F4HA 2PP1A 5HWMA 4GI4A 1WKFA 4PMQA 5A2AA 2XG9A 3URAA 3R6IA 4F3HA 1WCGA 2Q8XA 2XGIA 1BTMA 1P0EA 3LU2A 1JQVA 3CZ8A 5LKYA 4ILSA 2VZTA 4O52A 8CGTA 1XUZA 2ZX6A 2V68A 1W9UA 3MUAA 3UWYA 3N9SA 3VNKA 2HS6A 2PWEA 2VOMA 3NL2A 4NHVA 3OYZA 4JY9A 3TSMA 1PPIA 1H5VA 4HPGA 4LU0A 1XSKA 3BLPX 2DZPA 1Z3NA 4OVXA 3BW4A 1JPMA 1H2JA 3ANVA 3WUEA 4MZ1A 4RX0A 1OX5A 4LNCA 3PZOA 1LT8A 1KLYA 2Z28A 2WZMA 4NAFB 2J6VA 1JRBA 4C5YA 1P1MA 1MUCA 4RE0A 3CZGA 3EOSA 4JCLA 4ZB0A 1J12A 3TYUA 4AD4A 3C86A 4XKYA 3FY1A 3M5XA 3N29A 3W37A 2DIEA 1MYRA 2FTPA 3DOPA 1ISWA 4DJDA 1WDPA 1RLCL 1Q63A 4XK2A 4N9DA 1V6XA 2BASA 3GYEA 4LVBA 4NNAA 3APGA 3WK2A 4YU1A 3GTXA 3A6OA 4W84A 3CMGA 4D71A 4LV9A 3T1GA 2CPUA 2POZA 5HWJA 1ML1A 3QY7A 5A69A 3WBWA 3DYOA 3WQPA 1Q6EA 4XAGA 4IQDA 3DKJA 3KM8A 4S3AA 3S42A 4BJHA 1W2PA 1ZBKA 1TIWA 4H00A 2VTFA 3CBWA 1C7SA 4HSHA 2OZTA 3KRUA 4WY0B 1RK6A 1H7OA 3B9DA 4Q33A 1UCWA 3N2CA 2V81A 2QDGA 2J79A 3N19B 3CZLA 4B4FA 3CV1A 3JZEA 4ADTA 3O16A 3BG5A 1R9YA 4V1YA 4PTVA 4FNSA 5HWNA 3N11A 4I5RA 2XN0A 4D6EA 1J5TA 2XH7A 3BCFA 3L21A 5D03A 3W7NA 3BC9A 1H7XA 1LBLA 1W8SA 3PZTA 4Q8OA 3DU0A 3BUVA 4GWEA 5D9OA 3W1NA 4MDOA 1WV2A 4A2RA 4MKNA 4K8HA 4IX0A 2A0NA 5M17A 2MUCA 3MMTA 1L9WA 1SJBA 3FKRA 2DZXA 3WDJA 3G8RA 1A5SA 3MI3A 3MJYA 4O11A 3B0UX 1UPPA 1QW9A 3B8WA 2BZNA 2GOKA 1DHKA 4HMDA 3WNNA 1KW1A 1G4TA 3NQGA 3HOJA 3BE7A 3GRIA 2VEMA 1H60A 3GFXA 4F9DA 4LC8A 4GH1A 1E1CA 1RBLA 1CXFA 5ECVA 3APTA 2V2DA 3HGOA 3WDQA 2DSZA 1VFUA 2YJQA 4AFYA 4ICNA 4G56A 3ZLGA 1TQXA 4JX5A 2QGHA 4O0KA 3ITLA 3W7LA 1Y65A 5PTDA 2ZRXA 2E9BA 1E6NA 3GNOA 1DWGM 2D22A 1YX1A 3P6LA 2W63A 5C55A 1GGOA 3WL1A 1RD5A 1IR2A 4FLRA 3QOMA 4NX0A 4TU1A 3G2GA 4YS1A 5BROA 2ISVA 1PIGA 2NLIA 1ONWA 4F0LA 4P5UA 3SJ3A 3VNZA 1ZFJA 1XIBA 2PGWA 3BMWA 2GWNA 3MZ2A 1GW9A 3UPWA 4MLRA 1YXDA 3UJSA 3KRBA 1NDZA 1TZ7A 4PTNA 3E12A 1C8XA 2ZC1A 3AZTA 4OUIA 3REQA 3M0ZA 1EHAA 4DLMA 4FOJA 3T8QA 4KCVA 4O18A 5I24A 4ZMGA 1F6KA 3CQ0A 4B3ZA 2QJHA 4LUYA 5HQMA 3K13A 1W37A 1Z48A 3NIYA 3DI1A 3I3DA 1TMQA 5I77A 2QDEA 2A1YA 2XVLA 4FIQA 3OGRA 3TWBA 3CQKA 5A3HA 2JF6A 3L66A 1GCYA 1UMLA 1SFSA 3W87A 5I02A 3V5OA 4DJFC 2AL1A 1KTNA 4PMYA 4ASTA 1S5NA 2A85A 3RLHA 2RAGA 3VE9A 3LTSA 3C2EA 3ABSA 4Q4QA 2WMKA 2FFCA 2WNQA 1OFRA 1XDJA 2GQ8A 4MM1A 4LW7A 4NZCA 3UJFA 1BSLA 1NQKA 4B3KA 4Q8QA 2E68A 1WE5A 2NSOA 1HFBA 5LHFA 2G0WA 4JKMA 5HNNA 3B05A 4HJFA 4DO5A 4HIBA 4KKXA 2RKXA 1V7YA 1F8MA 2DH3A 4RZ5A 4GO9A 3ZZ1A 2DUAA 3ONCA 4X2RA 1CI1A 3NTYA 3WJZA 3MDWA 1VP5A 6ENLA 1XLFA 1DJNA 1DIKA 1I0DA 4AU0A 2V3GA 4QDWA 5ABEA 3THAA 4F48A 1P0KA 2E7FA 3XIMA 5M3WA 3NURA 2EEXA 2J75A 3GNXA 3WLSA 1AK5A 3BQ5A 3VNDA 1S3TC 1X97A 1U5VA 5CC5A 1T7LA 2PRHA 1M3UA 3CT7A 4L61A 3LPOA 4AVNA 3QXBA 1SR0A 4RR4A 3WLMA 1GEQA 3PNUA 3BICA 4GQQA 3N2MA 3D3AA 2MANA 1RALA 1E40A 4GVFA 1XISA 2RDWA 5LIXX 2C0HA 5CCZA 3SR7A 1GEHA 2WHKA 1Z32X 1XRSA 2QJNA 1T6MA 2FMNA 3A9IA 4CQ9A 5DMYA 4CU6A 2GZXA 1W1IE 4XKMA 1EZ2A 1KCKA 3T0TA 3STFA 3HPFA 4H9UA 2XVPA 3MUIA 1AH4A 3JVAA 3ECQA 5FJUA 2J9YA 4M6VA 3EMQA 2V5CA 2ZZ6A 1V0NA 4GRSA 1HO1A 1A0EA 1VYRA 4DXVA 3VCNA 4N6EA 2Z27A 4HU0A 1XIFA 3BJFA 1YTDA 5G2HA 2ZWYA 2C19A 4LBSA 3CHEA 4Z1DA 4HT3A 1I9CB 3BLFA 2YLAA 3B4YA 3MC5A 3P61A 3WMCA 3QKZA 3U4FA 4MYAA 4QNEA 2J74A 2NQHA 3NNTA 3Q67A 3BJSA 4B3LA 1UA7A 3IJ6A 5AN7A 1VGAA 4WF7A 4JIHA 2NSXA 1H50A 2HE5A 3FX4A 1TR1A 5JMUA 1P7TB 1DBTA 1EWEA 5CC6A 3QVQA 2IXUA 1DWJM 1CGUA 2GVGA 3VOCA 2D69A 4CU7A 3NQ2A 1G0CA 1UMYA 2ZUSA 3T44A 5KZDA 4XD5A 3K5XA 1R47A 4S1FA 3PULA 4E8DA 1EYWA 3V0TA 1Q2RA 4CD6A 4OBSA 3EPNA 3HJZA 2X16A 3PFRA 1TRIA 4ML4A 4S2BA 5E6YA 2Y7DA 2OZ8A 2Y89A 4JTKA 5C9WA 2BVWA 4P8XA 1I8JA 1NFPA 2G50A 1BQCA 3AISA 5DRCA 1SUXA 1JFXA 2WVSA 1WKDA 4QSFA 3CO8A 1GW1A 2ANUA 3G1DA 5FJOA 1KBLA 2J8FA 3BMXA 2O9OA 2VZSA 3SQSA 3S2CA 1ESWA 1Q6CA 1CXKA 3IJIA 4IXXA 2OQHA 3INPA 3IIPA 2ZWZA 3V1PA 1G4EA 4NILA 2PI6A 2PTXA 2ZUUA 3ARTA 2VP8A 3GO2A 2D1ZA 2A3LA 2ZRVA 4RV8A 4M0XA 3UJ2A 1ZHAA 4E5TA 2HTMA 3CAVA 5G4WA 1KM2A 5EFFA 2QCMA 5F4SA 4GUIA 3BDKA 4UQBA 3QGAC 1NWSA 1LJYA 3MSDA 1IWAA 5JBDA 3MI6A 4WD0A 7CGTA 1W3LA 3VIMA 3LX9A 4E4UA 1OZMA 2QLYA 1Q66A 1OGBA 2CXEA 2E77A 2TPSA 1XQKA 3TJXA 4Y7EA 2VDHA 5DXXA 3SUUA 5LSMA 5BXPA 4KEUA 1V6YA 2P53A 5CPQA 3UZWA 3MP3A 3QSRA 3OG3A 1NFGA 2QJMA 2EPMX 2TAAA 2WANA 3ABZA 2G5WA 4XUGA 4HNVA 3W7CA 1FDZA 1FWAC 1OVDA 1ALDA 4HYWA 5B7YA 3W00A 3LGEA 4G2DA 4UBPC 2ZRWA 2QV5A 2HK0A 2OQYA 1YTEA 3JU2A 4CNOA 1OADA 3UU0A 2O55A 3W1QA 3W2KA 4LYRA 5I03A 1OSEA 3VDCA 2VVNA 3S47A 1FWBC 1EOKA 4PULA 4PL2A 3AHVA 2WJDA 1XYBA 1MW1A 2WCGA 2B7QA 3LN3A 4NNBA 1BYAA 1K9TA 1JNEA 1T41A 2V3FA 4XBKA 4LYPA 2Z1SA 2VELA 3B0YA 3W01A 4AX6A 5TQLA 4POCA 1UD2A 3K4WA 3OU8A 4GMEA 4TR9A 3EA1A 3TAOA 1E9ZB 2AAAA 1UD3A 3FGCA 4JX4A 3UY7A 4N6FA 3U5UA 3L5MA 1UKSA 1LF1A 3G3DA 1TPDA 4RNJA 1D7KA 3P0WA 2GDVA 4OZOA 4DN1A 2W27A 1C92A 2YCLB 4H9XA 1GYLA 1P1XA 1TVNA 6REQB 1NM9A 3T2PA 1JAEA 1O60A 4JTEA 2LLEA 3KDNA 1B31A 7REQA 3AIQA 2D0HA 5IBXA 2UWFA 2X1IA 3AMGA 5A8NA 2BGNE 1XJBA 1ME9A 3TQVA 4RLIA 1KTBA 2AL2A 3SIZA 3UNTA 2NT1A 1CLXA 3QPZA 1G01A 4DNMA 3LDVA 3MQTA 1E6ZA 1EGVA 2VQTA 4H6EA 1VFLA 3WH6A 3DFPA 3IIVA 3CS2A 4LX4A 3KX6A 3UA3A 5D2VA 3ISIX 3T09A 1CYGA 4C6CA 3EYPA 1H7PA 2J8TA 4GUJA 1XX1A 3ARQA 1SZGA 4JS3A 4O4WA 3H2OA 1AUSL 1DJYA 1ISXA 4UUIA 3VDBA 3VMOA 2IKIA 3CV7A 2WHLA 1T8XA 5DX7A 4DYEA 4ZVJA 3O0FA 3RK8A 2Y8VA 1MNSA 3WLLA 3AS1A 2OT1A 3U9IA 4HYVA 2F6UA 4AZCA 4N2YA 4OBTA 3IRDA 4A8RA 1NF0A 1D8CA 4LANA 1QPQA 3ENLA 1NDWA 3RXZA 3CPGA 3USBA 3ARRA 5F7UA 4ORMA 2WQPA 3MYOA 4D6DA 4HU3A 3AHYA 1X6LA 2ZCGA 5ABTA 1OCBA 5LZLA 1IR1A 3N4AA 1K9FA 3TWAA 3G1HA 4XIAA 2DSUA 3T0CA 4R9XA 1OFDA 4C6IA 1ISYA 4LTSA 2GGGA 2VFGA 2C7FA 3GH7A 3LRMA 1EJTC 4QJ4B 4U28A 1UKTA 2WSYA 3LRLA 5HATA 1ELSA 3QC0A 3MW7A 4J1OA 2YSWA 1ICPA 3BW3A 3RU8X 2Z2AA 2I5IA 1CLVA 4PEEA 5CGTA 1CT5A 1ZP3A 2ZIDA 4HVXA 1XH2A 2PDHA 3LXAA 3B9NA 1R3TA 3W7GA 3W2JA 4JTRA 4NZFA 1YIXA 3B8TA 4AY8A 4DUVA 3W2LA 4G7EB 1MUMA 3VIOA 2HPIA 1FCBA 4KRTA 1U5JA 1WB0A 3UZXA 4GYPA 4NIRA 4RDYA 2VNCA 2INEA 4DJEC 2PDNA 3E3HA 2IS7A 2RDXA 1EUAA 4Z2HA 1EQPA 4IP7A 3L4WA 3ZMRA 3EA3A 1W91A 4DJFD 3EX2A 4MGGA 4S23A 1F4AA 1X38A 1OGSA 1S5VA 4LYKA 4I9MA 3AFBA 4IP4A 2E09A 3NEHA 3PUOA 2WJEA 2Z29A 1WDQA 2PZNA 4O0QA 5C2CA 1DOSA 4LUTA 1AMYA 3QYQA 3NAVA 1HJVA 3OLGA 5ENLA 2WSQA 4L1XA 3M4HA 5BMWA 5CAKA 3LLFA 3E9AA 2B4GA 2DUZA 4QIUA 3VNMA 2YA2A 3M0IA 4WRHA 3WBXA 1P4CA 1PYMA 1Q7ZA 3N25A 2JEQA 3M0KA 1H1YA 1JCXA 2ZUWA 2WYSA 5DF0A 1PWLA 3VIHA 3A64A 4LAUA 5AVHA 3SBFA 5F4WA 2DZBA 2E28A 5HNUA 3KVJA 1LRNA 4XX6A 5E0KA 4EANA 2HDJA 1D2KA 4L9XA 1S5MA 4LNYA 2FDSA 1IF2A 1T5AA 4P02B 4ZA0A 5EYWA 2W79A 3I3EA 3H4GA 3PSVA 4GISA 1OYCA 3W7PA 4JYFA 1YPFA 4NNCA 5HANA 1J01A 5CPLA 4I8YA 2Z26A 2BFGA 1GOQA 4BI6A 3DYPA 3ZO9A 4C6LA 5DY2A 3CEUA 1BD0A 4HPJA 3RAOA 4CD5A 1DWIM 4N9BA 1PB0A 2XM1A 2PWVA 1RQHA 3I68A 3LBOA 4RW3A 2C14A 2WMHA 1E0WA 3HQ1A 3W1RA 3UWWA 5CZKA 3ATYA 3GHTA 4CLMA 1KM1A 4O50A 3G1SA 2PWUA 2WK2A 1XC4A 2OYMA 4W89A 1S2VA 4DUXA 1TJPA 4L65A 1KM4A 1TV7A 4NL1A 2Y24A 3PZUA 4DWSC 2ZUVA 3NPUA 2Z25A 4YTUA 3WDHA 3NDYA 4Q8NA 4KEVA 4UNLA 1UZ4A 4MLJA 3WKZA 1OG6A 2RJGA 3LEPA 4GXMA 3SGZA 3FDKA 2DZWA 4M81A 4Q4KA 5HMSA 1NH6A 2EHHA 1R2SA 3CASA 1AQFA 4LCQA 4X2PA 5AYZA 1J4EA 5I3KA 2E6DA 3C3NA 4J3UA 2JK2A 4GC4A 2V5KA 2WAGA 3KZPA 3TCSA 1YE4A 1FH8A 2CKSA 2XGZA 2BX7A 3BOFA 2C16A 2ZVIA 4MNKA 2WKJA 3M1ZA 1KRAC 3C0QA 2PF0A 3EBVA 3ZT7A 2XDFA 1J5SA 5HNTA 3XISA 3S1XA 3RUBL 5I3FA 3CQIA 3IUHA 1LZOA 3RU6A 4I9AA 5CKSA 2YBUA 3T40A 4LUIA 1QNOA 3BAYA 2OJPA 1ADOA 4ATWA 3SCWA 1LYXA 2YKKA 3OLEA 1CBGA 4LBRA 4PC8A 1TJ0A 3EWZA 4NYUA 5FAJA 3Q37A 1NDVA 3AMLA 1PCWA 2H90A 4LJ3A 3WQWA 1W0MA 4W4QA 1A5KC 1QNQA 2HNEA 3BH4A 2PS2A 2POTA 2ZTKA 1V02E 1OX4A 2AKZA 3M9YA 2GL5A 1TCDA 2A3CA 2V9DA 3QH2A 1QVBA 7XIMA 3W83A 3GW0A 2HMCA 4PMRA 3RLGA 7ODCA 3LLXA 1H62A 3H12A 1V0MA 3VOIA 5HR7A 1X1ZA 3ZQ9A 2REQA 3WFZA 1PO9A 4O54A 2G3MA 2H6RA 3VFCA 2VCAA 5BNKA 1KNWA 4ES4A 2IPFA 4LF1A 1GG1A 1RK5A 3H6OA 1IXQA 3UA4A 2CLOA 4IMFA 2Y7FA 3UR5A 1D3GA 4ECLA 3NPWA 4S3DA 5LGZA 1B3WA 3SJNA 1QFEA 3WK0A 1CGXA 4KCUA 2CEQA 1H1NA 3UG4A 5GNZA 3JUGA 5HUOA 3IVUA 4WJXA 1V6TA 2CESA 2YYUA 3BZJA 3LLDA 3O0KA 3UGVA 5JH2A 2VEIA 4QQUA 3VABA 5K7JA 4AY7A 2VZVA 5DBUA 2VRJA 2Z1BA 3DXIA 2PD5A 4P7NA 4R3UA 3VOGA 4IJRA 1JIBA 3HV9A 3LD5A 5F2GA 1VCVA 2ZX7A 4CU8A 4Q4MA 2GSEA 3C8NA 1MEHA 3ES8A 3MKCA 4ZSTA 4P61A 4MF4A 2XWEA 3BW2A 1ZP4A 1A0CA 3QR0A 4E2DA 4H9TA 2X1SA 2ABAA 3WNPA 2VYOA 2X0HA 3O3RA 4M56A 4X0VA 1LWHA 2Z7KA 1KCZA 4Q32A 1UASA 3AC0A 3V7PA 1ZY9A 3F4CA 4B2DA 3MMDA 3AOFA 3VCRA 2HE8A 5BWFA 4I6VA 2Z6IA 1B90A 2XJ7A 2V8ZA 5CJNA 3P84A 3EB2A 1JZ7A 5FF4A 4K37A 3JS3A 2J13A 1VYPX 3A4XA 3WF0A 4D1IA 3KLKA 2RDUA 5AYIA 3MWCA 4BS0A 3MO7A 4R7JA 3S5ZA 3GBDA 3B9EA 3GXIA 5DXYA 1E4NA 4EKJA 1KR0A 3IJ7A 1DIEA 4GIYA 3GKFA 1R46A 4ORIA 2FQIA 1QK2A 4RE2A 3TW7A 1YPIA 1KM5A 1MQRA 4Z2IA 3GIPA 2WQDA 3TN3A 1POJA 4A8LA 3UYIA 4WKHA 2WV8A 1X96A 2D2OA 2QUVA 2HPMA 4XKYB 3EX4A 4JNYA 4CQDA 4JKKA 1W8GA 3CTLA 3QYSA 4XO6A 4D6GA 2DZTA 3T05A 3D0CA 3TMQA 3IAQA 1W5OA 3K8LA 1WYIA 5AHLA 4C1NA 3TJ4A 2JKPA 3W81A 4ACZA 1OYBA 1QW7A 3TUUA 1W5NA 1EO5A 5J5RA 4QAWA 3SI9A 1XDLA 1K03A 1V08A 3SCSA 2WHMA 1TSIA 3NO5A 1D9EA 2YL5A 2KX9A 3EXTA 1VBGA 5EA9A 4O1FA 1FH7A 3OGSA 1BVZA 2DW7A 4J3ZA 4L4OA 1RJPA 4XTDA 3PZIA 2YDAA 5HJYA 2YZ5A 1I45A 4FF7A 4BEQA 1GG0A 4NASA 1X98A 3H2EA 1Q6GA 1OCJA 1DP0A 1QHPA 3VKDA 3AWNA 3A4WA 4GACA 1MMFA 4HJWA 4AZBA 4RCXA 1DJQA 1GTEA 4XSMA 1ICQA 4CQCA 1ZCOA 1TV2A 3UXKA 2YL8A 2JF7A 3UWEA 3PBYA 4E8CA 4HCHA 4S3FA 4PCSA 3Q65A 3IS4A 1AQMA 3E38A 1M7JA 2EG6A 4V2XA 2QJGA 3TH6A 1PSCA 3TNBA 3DH7A 4H8VA 1CXHA 5E5CA 4FXJA 3FYYA 5DEZA 2BBFA 1F76A 4Y8FA 1I60A 6TAAA 1XLHA 4JEJA 4DVOA 3GTIA 3AXXA 3WF1A 3W07A 2DT3A 2DUXA 3LUTA 3U3HA 1PJ9A 1FHDA 1G6CA 3VKCA 5CJMA 1LBFA 1A4LA 1VFOA 3WNMA 5BXSA 1JEZA 3TCEA 3T0BA 3KHDA 1FH9A 3AICA 1MDRA 2DZUA 3UVIA 3UF9A 5AYXA 4Z1BA 1NOUA 4NJJA 3WO8A 4L6OA 1XYAA 4W5ZA 1UYQA 1M7XA 3PTDA 3WLNA 4CCCA 4IGNA 1ZENA 1UWRA 3ZSSA 1E1CB 5CG7A 3VKAA 2VUNA 5D2TA 1WBHA 2WVVA 2ZICA 3VOHA 4J7RA 4W7VA 4GPNA 2X41A 4B92A 3VIPA 5FEPA 3W7JA 3WQ6A 1RBAA 4QRNA 1ME8A 3BARA 3GVQA 4BR1A 2ACQA 1VFMA 4YWSA 2Y88A 1T40A 1B30A 2CHRA 3LCFA 1FXQA 4JCMA 3PJUA 5DY3A 3RILA 2DY3A 2PTDA 2OZ0A 3QV8A 2CHNA 1TWDA 5EFDA 1I0BA 2FZ8A 4GFIA 3FDGA 2XIOA 1OHLA 2YB4A 4DJED 3ZVHA 1NOFA 3PPCA 1PIIA 3STCA 5HINA 2A21A 3BOLA 2ZA1A 2FJUB 2ZKMX 3W2UA 5DCEA 3BAXA 3RLUA 2FHBA 1YKWA 3W38A 3REQB 1VJSA 3CXOA 3VC5A 1CENA 3WEOA 1ZS2A 1CTNA 3GWQA 1HKVA 2IPWA 8XIAA 4QLLA 1RCQA 1QXLA 1GQNA 2AOSA 3G8EA 5C9UA 1REQA 3FNDA 4MG4A 2ADAA 1WAUA 3ITGA 2A3BA 2VR5A 3THQA 3IIOA 4OIFA 5CSSA 4H8NA 3LG3A 1KXTA 4NX5A 5I79A 3W0KA 3C0JA 1UH2A 1Z42A 3GH4A 3JZUA 4F2TA 3PAJA 3SCPA 1QNPA 1Z44A 1ISVA 1VH7A 1S2AA 1RP8A 2FH8A 1PTGA 2C91A 3BO9A 4HD5A 1W31A 4PTWA 3M46A 4YTTA 1XRFA 3LTPA 5GPRA 2OZ3A 5L9FA 4HTBA 3S1WA 3ZR5A 3TJLA 4C6BA 1QW8A 2BY1A 1LOLA 4B4HA 3OQ8A 1NVMA 5DBTA 2CKRA 2XN1A 5M03A 5DMLA 3IVTA 4HMCA 1GVQA 3OBAA 4E3TA 4YVPA 4DJDC 4Q7NA 2I5GA 1XYFA 2J7CA 3LM3A 3M0YA 4F8XA 4KQNA 2WZTA 4KWWA 3ABQA 3EWXA 1EO7A 2PE4A 4XBJA 3BSMA 3PZ9A 2C8NA 1AJZA 3KTCA 3VUPA 2NXGA 4ICCX 1ZLPA 4A3YA 3WFLA 3TTEA 2YYTA 4QG9A 3GE7A 3LA4A 4UMBA 3AIEA 2ALDA 2IUZA 2QPUA 3VKKA 2VJXA 2ISSA 3GXDA 3B8UA 3VK5A 2YDRA 3MP5A 5KMYA 1PHQA 3V4BA 1V7AA 2R8WA 1NJJA 4UQCA 2WMIA 2QCFA 4GK8A 2DSKA 3FKKA 3PPGA 2GSHA 4XZIA 3UY8A 4E3VA 1GWJA 2QCGA 3U2OA 4M82A 3WBYA 1PL9A 2Y7EA 3QLLA 3AU6A 2BHUA 4DWSD 2BOEX 2R82A 4K3ZA 3IGHX 1C91A 2A7RA 5EMJA 2E5CA 3F5KA 4J35A 3PUGA 4QE5A 3VX0A 1JZ3A 1X8FA 3LGGA 4A3UA 1XRVA 1QCWA 3W7RA 1O4UA 1GJUA 2QZRA 5D04C 2E8ZA 2ZRYA 4GZ7A 3EPOA 4DELA 3TA6A 4GUFA 1FWWA 4LB4A 3AHTA 2PDBA 1A0DA 3GNPA 3L4ZA 1RHCA 4UTIA 3CLWA 3E0LA 1J0HA 1NP2A 1VBRA 1CGWA 5RUBA 1KD0A 1JUKA 2BDQA 1RLDA 2WKLA 2QVNA 1LT7A 3W84A 1UWQA 5F2IA 4DX3A 3OB8A 3PWIA 3N2OA 5K9DA 3OVRA 4LWWA 2QF7A 4ZOAA 3TX9A 1RCXB 2JQXA 4E2BA 1UJPA 4Q6XA 4ZL1A 1EJXC 2ZRUA 1YPXA 2NWRA 2ODOA 3NQDA 4BWLA 2EPHA 4O4VA 3RRXA 4JTUA 4AMAA 2X2YA 2VEKA 2INFA 4P8UA 4RKAA 4LS1A 4C6DA 4M29A 3WJYA 4Y9NA 1JG9A 3BWWA 2DZVA 1MSSA 1A5OC 4WGHA 3OOQA 1QU4A 1K8YA 5ABGA 4B5NA 5TF0A 1PKYA 1EJSC 3OBKA 1RJQA 3CEPA 1LRTA 3RJYA 4AIBA 3PZVA 4JL2A 4LUSA 5JIPA 3E5BA 3E74A 2PTYA 1JCNA 3TTSA 4QSHA 3AMCA 3S5NA 3A3HA 3CUFA 4UNKA 4H1ZA 5HNRA 3QHNA 1KWKA 1OFOA 3G18A 1KKRA 3LS9A 2UV8G 4Y96A 1UKOA 1XYMA 1EF3A 3V36A 3CPUA 2NUXA 5C0QA 4HKPA 3T81A 2CLIA 1VYSX 2WJFA 2J9ZA 1ENUA 1TELA 1RBOB 2Q02A 3SFKA 4MMWA 3ZJ6A 2YLLA 3W7EA 4RJEA 4PCFA 1G7UA 2VFIA 2VUYA 1A5BA 1UUQA 3FK4A 1TYGA 4M51A 1DJZA 4QLJA 2P3ZA 3PNZA 1CX9A 1UWTA 3ITCA 3U8GA 1B1YA 3IARA 4FI4A 4QDPA 1AH3A 1EDQA 3AO0A 4KEMA 4R85A 1QI2A 5FESA 1Y5VA 4J3XA 1UZHA 1QPRA 5A6BD 3MZNA 4UFMA 1TPH1 1AL7A 1R0MA 3BXWA 4J3TA 1PDZA 1FP8A 4L1WA 2W66A 1Y8BA 3R43A 4V33A 4WKAA 4AG0A 4U3AA 1DL3A 1GYNA 3QHMA 3UPBA 3IGSA 1LM1A 5HQEA 3HFTA 4O0ZA 1NEYA 2XSXA 4AXKA 2P5NA 1KFEA 4S39A 4W7WA 4FA3A 3KVMA 2WPGA 4D8AA 4AB4A 3NA8A 1ZCCA 3SCRA 1FHLA 1QHZA 3P80A 2IKJA 3WJSA 3WQ5A 5EJ1B 3P5YA 2AQWA 2EF9A 1DXEA 4JTLA 1BWVA 4OECA 4S3BA 4WQ6A 2D0GA 3RCYA 3FJLA 1F6PA 2NV2A 4OWGA 3FYOA 4B5WA 2Z1WA 3A9BA 1GHSA 4JFVA 1Q4NX 4GI6A 3GC2A 3GG8A 5LHEA 3WQFA 4PMUA 4O1CA 5K2ZA 4UFLA 1GVRA 3BLEA 3AIVA 3M7SA 3CZJA 1GZGA 1JZ6A 3TTQA 1F3XA 3S6DA 4DBWA 3K1GA 2CU0A 1RXOB 3G77A 2DORA 1BFNA 1PEZA 4IX2A 1TTPA 1VLIA 5AHEA 7TAAA 3O6CA 2QMJA 5HDRA 4JGDA 3U48A 1VAHA 4OHQA 2UY4A 3SSJA 4NJKA 3THCA 4GJ1A 3WUFA 3B0PA 3W6YA 2E9MA 4BY3A 3A22A 3EOLA 3EKGA 3UW6A 4GVGA 1T8QA 2QVHA 2YBVA 3SURA 1VB9A 2QUNA 2HK1A 3LNPA 3GAKA 3IJDA 3O63A 2G4JA 3FSUA 5DQPA 3BV7A 3O6AA 3FGCB 3NQCA 2CCRA 2VQUA 1LDCA 1RSCA 1TUXA 1YE6A 1X6UA 4ERGA 1NWRA 3D47A 3K1DA 4AISA 4HPNA 1XP3A 1HJWA 4EF9A 4S3GA 1KV5A 4H7VA 3EWWA 5BOOA 4MVAA 1UWSA 4JEQA 4WHBA 1O5XA 3SUVA 3MP4A 5FL0A 2OELA 3TXZA 4CCDA 7REQB 5AZ1A 5D8WA 3E0WA 2PWFA 4C7GA 1ZJIA 4MKVA 1EPVA 2GDUA 3VD3A 2AL2B 1NWUA 2OSXA 1X1NA 3MANA 4HN8A 1V6VA 2D23A 5FACA 2ZDRA 3IAPA 1C9DA 2A3AA 3D46A 4QCEA 4A29A 1GOXA 3SRKA 3ZR4A 5LIYX 4Z2LA 3LSBA 4ZFMA 1ZB5A 1J0KA 3F7JA 4H9VA 1UG6A 3M6DA 4C5ZA 4NYYA 2BV9A 1XBXA 4M80A 4JTFA 3V0SA 1KFJA 3OJGA 2WZHA 1XXXA 2J66A 4E2OA 2PLCA 3UWQA 1A53A 4M7SA 2D2JA 3FAXA 1AFSA 1MXSA 2PF8A 1O6IA 4IIHA 4D72A 3ALGA 1B3XA 1XRTA 1FCVA 4C7DA 2J7EA 1K6AA 4UMAA 1KGWA 4WSJA 1OK4A 4AIEA 4Z1CA 4XO7A 2DT2A 3RX2A 3F2DA 4REQA 1H41A 1WQ5A 1QOXA 3VNYA 4AZCB 2FPVA 3R12A 1KRCC 4NQ1A 6ALDA 3ALFA 3FXYA 2PGEA 3B04A 3PPFA 4PB3A 2VO5A 3UNDA 1TKKA 2CZFA 3IEBA 2AMXA 5EIYB 4ICMA 4ZXLA 1T96A 3B0XA 1BQGA 1JR1A 3GZ3A 3JW7A 4O8RA 5I3IA 4HK5A 2O56A 1JYVA 4HG6B 4XBSA 1U5HA 3VZXA 2HXUA 3EMZA 1WXJA 1DHPA 4HZ6A 4QROA 2H8ZA 4I3GA 1H7NA 3W75A 3L4YA 1KBBA 2PC8A 4X61A 4OFCA 4OOUA 3LHZA 1RPKA 3TJIA 4D9PA 2BS9A 2G37A 2FH6A 2ZUNA 2O7QA 3EDDA 3KBVA 2RHGA 1EQCA 3IACA 2UY3A 3HPAA 3S9YA 5EY5A 2A4AA 4LF2A 1VCGA 2NUYA 1X8CA 1FWIC 1YNYA 3LYEA 2BLEA 3CWNA 4IQJA 4MAVA 2O92A 1UW9A 4MB4A 1DJXA 1W9BM 4FZIA 1NU5A 1DXIA 1A50A 3NDZA 1O68A 4MWAA 3EA2A 4JTHA 1P43A 2HXTA 4GYKA 1RP9A 4JXCA 4AUBA 4IXHA 2X05A 5A8QA 3LCLA 3MYPA 4K38A 4Z1AA 1TPVA 2ICSA 5EMLA 3MMWA 2E3ZA 3T78A 3TC3A 1ECEA 3G0XA 1FXPA 2OSYA 4S3EA 2G3FA 2X0SA 3ARPA 3QV9A 3II1A 4LVDA 4DJDD 1MI3A 1MQPA 3GD6A 3MT1A 4LUTB 4AIOA 1BYDA 1D7FA 3DG6A 5HR6A 2YL6A 1VHCA 3VM7A 3A21A 1Q65A 1A3WA 1W1PA 1POKA 1YW1A 1I2OA 4I7VA 3U6WA 4ZQMA 2VM8A 4FP1A 1HKMA 3GR4A 1TPUA 3FW6A 2WOQA 4KRZA 4OKDA 3TYBA 3TW6A 2Y8KA 3V5CA 3H2FA 2CERA 4ATDA 1YTKA 1D8WA 3RPMA 1UR2A 3CH0A 3CIVA 1OIMA 4IQEA 2H8XA 1L6SA 1SO4A 4B90A 3AYSA 4RXGA 4DY1A 1PX3A 3C0LA 1O94A 4A21A 3CV2A 3PJWA 3IJ9A 1XLLA 5LNSA 1XLGA 3WLOA 3R10A 3VD5A 4HZ8A 2CLEA 2IQDA 1XR2A 3GTNA 4X0NA 3LPGA 4LBUA 2W5FA 5C5YA 1EGMA 4FLQA 3GDRA 5FAGA 4JTQA 3QOKA 1XIEA 3DG7A 5C7HA 3TC7A 1KLZA 4IH3A 4GIAA 1W1ZA 1XWYA 1RY8A 3RX3A 5ABHA 4RDZA 2TMDA 1FWGC 3HPZA 1TPWA 4PTMA 3A12A 1KCXA 1S2CA 5I00A 4RZ4A 1XBVA 1SFTA 3SCUA 4JDBA 4Q8UA 4MJ4A 3GLCA 3GIQA 1TJ1A 4R34A 3KL0A 3ABXA 1W1B1 1KA9F 3VDAA 4YLWA 4AAJA 3CQHA 3S2LA 2PDLA 4GXPA 1U2YA 5F1UA 3QZEA 3VOJA 1H0GA 3KWSA 3EB4A 4HU8A 4L6DA 3HPXA 3ANUA 3OVGA 4JTAA 5CAHA 4CEUC 4U4MA 2BY0A 4KESA 1ZAHA 2VFFA 4Y8EA 3VGGA 2W92A 3QQ0A 1J0IA 3DHPA 2VRKA 1PCKA 3WQ8A 1W56A 3GC4A 2GPTA 5EL1A 5DFAA 3TTYA 3UZZA 1N2VA 2R24A 1HKWA 2BWGA 1XUUA 3GVGA 1PZ1A 3DHFA 4XD4A 3VGHA 1J0YA 3VINA 1SFLA 5FD0A 3THUA 3B40A 4KETA 4YVXA 3EWYA 4ZO8A 2HROA 5C2XA 3HG5A 3L9CA 3B3DA 3PM6A 4DYJA 3N2XA 1PX4A 1H5YA 3UZYA 1S5WA 3S4TA 4DQWA 1QATA 2UY2A 3VI2A 2HVNA 1ONEA 3WK1A 1M03A 3EOEA 1OY0A 4QS6A 2G41A 4KEZA 2PCQA 1OINA 3PAOA 3TW9A 4JQ1A 4D6HA 4C65A 2P0IA 4HZMA 4JTGA 3ATZA 1UZ1A 3O1NA 1ZBWA 1XCWA 1GPFA 3NPXA 2XZ7A 1EYEA 3F5JA 2Y5EA 1D3HA 4PE8A 4AC1X 1F3TA 3MCMA 4GIEA 3PFMA 1SSDA 1YXYA 4I8DA 2OTDA 3IJ8A 1OABA 3MSYA 3BGGA 2F61A 1GOWA 4MNMA 2WPBA 2BNJA 3CWHA 1OX4B 3UCCA 4B5SA 5C8BB 3ELFA 2CWXA 3CHCA 2OEKA 3QGKC 3EEZA 4LALA 5TD4A 1V3KA 3O6YX 5D02A 2ISDA 8A3HA 1UR8A 2B7NA 4A2SA 2REQB 4V1XA 1P0BA 3H4XA 5D9PA 2W3ZA 3HQNA 5CPSA 3LHTA 3R1ZA 3TZFA 3PG8A 4B15A 4NVTA 3LCWA 1J0ZA 3DUGA 3SO7A 5A2CA 1OC7A 2VGGA 3WYZA 3V18A 4I7UA 3WH5A 2P8BA 3RR1A 2VL4A 5EMUA 1RQEA 3W29A 3KRZA 1Q6LA 1TG7A 1F5ZA 2EPNA 2J7GA 4C7FA 2R1LA 3VIFA 2O4MA 1ZPTA 5F2LA 5IXEA 5GJNA 1F05A 3WQEA 4H41A 1B9BA 2FVLA 3C0SA 1KCLA 3CAKA 4C6PA 5C71A 2O0TA 2CNCA 1OCQA 4BI7A 2YX0A 2ZXAA 3AMKA 3L0KA 3I6EA 2X30A 3BMVA 1TQJA 4KMQA 1P6BA 3VCCA 3R58A 4TVCA 4XVDA 2G3NA 4D1JA 3HGSA 1VRDA 4HA0A 5E93A 5CBJA 2ZZ5A 1Q2SA 2XSAA 1JCYA 2I9UA 2ZADA 4CCEA 1FVPA 1TZ9A 1WZKA 1IEXA 1K77A 5BRQA 3O06A 3N73A 1N82A 3WUBA 3TE9A 1DEDA 4M6UA 3BCDA 3NQEA 2JALA 1RVKA 1L8PA 4DO7A 2VZOA 5DMMA 1ADDA 4N9CA 3VIKA 2G97A 1L6FA 1XPYA 1DQWA 2R94A 3IJLA 3PVFA 3MUZ1 1HKIA 2Z4GA 1OC5A 3CHFA 4FHAA 1V0KA 1E6SM 1PHWA 5CBIA 4DJFA 3UYCA 4UTLA 3TK7A 3G5EA 4MADA 5GNYA 2QPSA 1XI3A 3A13A 3B9OA 4L4LA 2YW4A 3OPSA 3TAKA 5KETA 1IV8A 5G1MA 4KCTA 3MUY1 4ADSA 4AWEA 4Q6JA 2C1IA 3LOTA 4BF7A 2AQVA 3KBJA 1L6WA 4FMVA 3FJ4A 1C7TA 1PXGA 3FJNA 3TU9A 3GY1A 4O28A 5IFTA 1JNDA 3DEQA 5CEWA 1KWGA 1XFCA 3U57A 4PUMA 1TWSA 4MUZA 5T9BG 3T55A 4C1NB 5MF5A 3M16A 4ACZB 1XIGA 2R9RA 2Z0IA 4WOZA 1Z8AA 3ABRA 1DIDA 4KIRA 3W4RA 1R86A 4D6JA 3G6LA 4AEFA 4F0MA 1JDFA 2EPKX 3RN6A 2UY5A 3WL0A 2DIKA 3UR2A 1VC4A 2NX1A 3MMUA 4PMOA 1LORA 4WZHA 4L64A 7PTDA 1PDYA 2IMRA 3OG2A 3LGDA 4U5IA 1SW7A 4A8IA 3UWUA 1DJGA 1C29A 3AIBA 2A3HA 3AI0A 3B8IA 5HUPA 1OF8A 3ARWA 1OD0A 1EOMA 5H6HA 3WEMA 3NYDA 4FEZA 1GVYA 2ASHA 3KHJA 1VR6A 5AHFA 5D30A 4HCDA 3N15A 2BB0A 3PZMA 5LNUA 4AWSA 4LV4A 2HBXA 5D33A 3EGJA 4F40A 3F4NA 4HPHA 1Y5XA 4GUHA 1IEQA 3G24A 1HG3A 1TJRA 5M5DA 2OO0A 4HP5A 1OD8A 2DQWA 4C91A 3BG9A 1OG0A 5CPMA 2I57A 3HG3A 1OFQA 1PZ2A 3GHSA 3KL5A 1NELA 3IGXA 5HMDA 1TCMA 3WBEA 5LXXA 1FDYA 4PBEA 4PCNA 4GY0A 2NZLA 1P48A 1DWFM 2XU2A 2Q71A 3VA8A 3MUXA 1E73M 3N9KA 2OLAA 5AHMA 1ZTVA 1E0XA 4PTDA 3N3TA 5K4XA 2PDCA 1QI5A 1XBZA 2WVVB 2ZX9A 2DFAA 3NPVA 2EXOA 4GLEA 1NARA 4NUWA 1RUSA 3QN3A 5KTLA 5BWAA 2NW0A 4Z2GA 3UFYA 2OPJA 2XISA 4JR5A 2WSRA 2EG8A 4IG2A 3W7OA 4GGHA 1XLDA 2VMFA 5DN1A 4JD4A 1UIOA 4I7WA 4X63A 1UA3A 3I3BA 3VNIA 4RE4A 4NKCA 2FPTA 3OZPA 2FDMA 4MDPA 3OVPA 1CXLA 2PC4A 1A5CA 3Q94A 2W91A 1SQ7A 1OJXA 4YWIA 2ZX8A 2CBUA 4X9YA 1FWTA 4PMVA 2FZNA 3ARSA 2V5LA 1RQBA 3SQMA 3T9PA 5C9XA 3ZVHB 1IXNA 5CZTA 4C6JA 3MVIA 3LM7A 2V5DA 2ZQ0A 2HVMA 3T8LA 3QSTA 1PKLA 3WLKX 1ICSA 1LOSA 3LBCA 5LXEA 1R3SA 3STPA 2YA1A 1BXBA 1Q6DA 1REQB 3WQ4A 4JN8A 4H19A 1XLMA 2VWTA 3VZZA 1RH9A 3NQ6A 2ZX5A 3AXHA 1J6OA 3VOFA 4IMCA 3RPDA 3LMYA 3ME3A 2BG5A 2ZZ3A 4U33A 1W6TA 1OFEA 5AFDA 1J8VA 3VAVA 2BVTA 2WHJA 4AEOA 2WCSA 3PK7A 1K6WA 3CWOX 2VEGA 2ZZ2A 3W1AA 1PWMA 1W3KA 3OTRA 4B16A 1CXIA 3GNRA 3LRKA 1N7KA 1UBPC 3PZNA 5GJMA 4LUJA 3UJRA 2HNHA 1Q8JA 1OFPA 1ODUA 3PBVA 2C18A 3LHVA 3DERA 4O13A 9RUBA 1LL4A 4MJMA 1HJUA 3TNOA 4Q8PA 5H1WA 1O1HA 4A05A 2NQ5A 3LHUA 3VMNA 1FFQA 2WMIB 2I1OA 4EXAA 2GJXA 2FZMA 1E70M 3KFTA 2DEPA 3W26A 1OK6A 3R79A 1QRQA 2BVYA 3FXGA 2DDXA 3VXGA 3LMZA 2Y5SA 5KINA 1L2QA 3RX4A 3C52A 2PLMA 5IHRA 1YXCA 2WVUA 4YNGA 1R5YA 5H8UA 4DWDA 4S3JA 3GVRA 1KV8A 3GHRA 4DXKA 3S9IA 4X22A 1MWOA 4CGTA 3GIYA 2E40A 3EKZA 3O6DA 2V82A 3TOYA 3ZLHA 4H3DA 4OOZA 3KCLA 1V3MA 3UETA 3LQGA 2PLJA 1GQKA 4GA8A 2VVSA 3BLIA 1S5TA 2V69A 2C6QA 2ZA3A 1XLAA 2XFYA 2J7FA 1TWWA 2BSLA 4WCJA 3UZ5A 3AIUA 1X7IA 2CITA 4M24A 4F9JA 1E9YB 1P6CA 3WX7A 1MZRA 2VKZG 3EPMA 3UVAA 5CC7A 1XV8A 2HV5A 1LQ2A 5I06A 3DG3A 2OODA 4KGJA 5C6MA 3V0UA 2G8ZA 2IQTA 4E38A 1YBQA 3SDOA 5DLCA 4MKSA 1HF6A 1HZYA 3W7HA 3CL8A 3FYPA 4FNTA 4QE1A 5LIUX 2HWGA 4ZOEA 5MKGA 1IHIA 3GXPA 1AL8A 1QNSA 3UR8A 4GI8A 2WWCA 3C5QA 3LV6A 4TIMA 5H2ZA 4PODA 3DC0A 4M6QA 3AMDA 4KRUA 4RDWA 1OQFA 1EC8A 5H91A 4H04A 4MFEA 3BAWA 4LUSB 3MPGA 4IF2A 2D2HA 1MO0A 3BK0A 2DQXA 4ZQNA 1S46A 4ZQRA 3RDKA 3DDMA 1GUVA 5LA0A 2QJIA 4O1BA 2PP3A 3H22A 2OOGA 1KTCA 4LY4A 4LEFA 3AROA 1TV3A 3MTWA 3STGA 2BXZA 3AZSA 1EXPA 3UXDA 3HV8A 2NV1A 3HA1A 3UZJA 1VFFA 1KRMA 4Q4RA 5AZ0A 3S3GA 1ME7A 2OGJA 3W2MA 4PSRA 5K3VA 3GS6A 4KT2A 4XIMA 2J27A 1H09A 2AGKA 1HGWA 3I4KA 3NZRA 2FKPA 4PRRA 3AXKA 1FY6A 3F5LA 3AHZA 1JVNA 4JKLA 1P0NA 2ZZ1A 3TTOA 3FAWA 1B3ZA 3H7RA 5CGQA 1QI4A 3TQ0A 3S0CA 1JGIA 4AW7A 5DMNA 2Q8LA 4BZYA 3FA5A 2F9RA 3HJEA 4IPIA 1Z7AA 4UMCA 1J10A 3APYA 4FLSA 4YPJA 4PMJA 4NJIA 4GHRA 4K36A 4CNUA 4PB5A 4JL1A 2L5HA 4PUJA 4NI3A 4XWUA 5M2FX 1TUFA 4CVUA 1EP1A 4PN2A 1K7XA 1P5BA 2JEPA 2OMAA 5E9XA 4YHGA 1BGGA 4F4RA 4US5A 4CNTA 4DB7A 2FVKA 2VT0A 1SJAA 4GQ0A 5KITA 2H9AA 3R13A 3WMBA 3W25A 3VKBA 4B5TA 2WNZA 3I7RA 2ZXQA 3W7QA 4U10A 1WDWA 1GOIA 4DPQA 5F4XA 1BKHA 2VDGA 5CZ0A 3F2BA 3HF3A 2IKGA 3ORWA 1AJ0A 1O12A 5D05A 2PCEA 3HQPA 5D37A 3B0VC 5AYYA 1V3LA 4CNNA 4J2MA 4H4IA 1G1YA 2QCNA 3RLVA 1K8ZA 4D2JA 2NVAA 2E5DA 3DN5A 3UCQA 5A6AA 2D2GA 5C2GA 4KFOA 1K8XA 3AXIA 3B97A 4MB1A 4EXBA 2G3JA 3M0JA 4EWJA 1UOZA 3FFSA 1Z89A 1BKSA 3N4FA 3CUXA 4IIBA 4JTJA 7A3HA 3C3UA 3WD0A 3TC6A 4D8LA 4UXDA 5AVNA 2INZA 4HPXA 1L6YA 3GC5A 3ZOAA 2YB1A 3GM8A 4YCOA 3NL6A 4GQBA 4MY1A 3SADA 3QQ1A 3CYVA 4H01A 2J4GA 3GKAA 2FTYA 1XH1A 4XD3A 1KGXA 5EJZB 3QZAA 2FMOA 1VPYA 3FVMA 1K1DA 2ISFA 1OX6A 1R7AA 2E6AA 3BCJA 3IIXA 2VGIA 4LVFA 1X7FA 3NEVA 4TTUA 4BWLC 5AHNA 3ARVA 4PH6A 3QR3A 2NT0A 4QGCA 2VD9A 4N02A 2PDXA 4LC6A 4E4PA 3H2MA 5EGRA 3W7KA 1UR4A 3VDGA 1TE6A 2YR1A 3PF3A 3CIXA 3DYMA 1OWQA 1V3HA 2PB1A 4TQTA 1JZ5A 1JF5A 4QLKA 5G4HC 4MY9A 1XSIA 4C60A 1IGWA 4RV3A 1VFHA 1TA3A 3FOKA 1VZWA 3WD2A 2GQ9A 1HTIA 3SCQA 4RDVA 3O9NA 1SO5A 4P00B 5EPDA 3BV4A 1BTCA 1V93A 2A6NA 3RCMA 4X3ZA 2DPEA 3FLUA 1V3JA 4DWSA 1MZHA 3W72A 3L2LA 2Z2UA 4HSOA 1FBAA 3N34A 5A2BA 3L4TA 4ZXOA 1CGYA 4JTCA 3PJXA 2FYMA 1XGDA 4TX8A 1WPCA 1OYAA 2G3IA 4LCSA 4Y6GA 2I14A 4REQB 1VRXA 3VD4A 5AECA 1AA1B 4I5XA 2GGHA 4LS2A 1QO5A 2P50A 4WX2A 1TMHA 1QI0A 3IIZA 2FGBA 2CLMA 1HL8A 5JBEA 2FZBA 1EL3A 1C90A 3CMFA 4JNZA 2CBVA 4AIUA 3MHGA 4OGZA 2I16A 3S5OA 4CD7A 4TO8A 2ACUA 3SGGA 4YL2A 5CPTA 1C9WA 1E6PA 3RMJA 1EA0A 1QOQA 3FEMA 3BL3A 1R8LA 3SRHA 2GJNA 3KZSA 2A7NA 4NT0A 4TMBA 1Q8AA 4Y9PA 1ITQA 4IUGA 3ARYA 2P88A 1HT6A 3DFOA 3HPSA 3UERA 2QCEA 3NZ1A 1G7VA 3UESA 5BXTA 2CLFA 2E5BA 4NU7A 2E1WA 1ONXA 5HOSA 1EEXA 4X9SA 3KW3A 3ZXWA 1IWPA 1M6JA 1XLIA 2PUZA 1SZFA 2F6KA 2Q3RA 3KOYA 2QNEA 2F38A 1TMLA 2FLIA 4GVIA 5KEZA 1GJWA 4XD6A 1IEVA 1WZMA 1YNPA 4C6KA 2ZUMA 4MWAB 3WH7A 2BP1A 3MO4A 1EA9C 4K2SA 1NP0A 1G9HA 3TVAA 3KXQA 2X1TA 3HIJA 3NSMA 3RJXA 4GABA 1RA0A 3P67A 4IQLA 3EX6A 3GG0A 5FEZA 4PFHA 2NUWA 3HMCA 4AHOA 4PB4A 3UXIA 1MXDA 5EBAA 1F73A 1N8FA 2XUCA 3VYLA 3RRAA 4L80A 1JI2A 4S38A 2HRWA 2RFGA 3W88A 3O8AA 3GB6A 3UG5A 2Q01A 1F8IA 1Q6OA 4EWND 3V1HA 3ZT6A 1R7OA 2P3EA 4BQ4A 2ZC8A 1XSJA 5C9ZA 3HURA 3PPHA 5JQ9A 4XAYA 1HGYA 4IFRA 4E6MA 4E8GA 4PZVA 1X6NA 1MW2A 3KCJA 1E9LA 1VLWA 2XHYA 3QLDA 3H54A 4W9TA 5HJLA 1E56A 1M68A 3VC6A 2VC6A 3KBNA 3PY2A 4JICA 3ZJ7A 1MNZA 1RY0A 1XYZA 1ZALA 1TVPA 4FALA 1E6QM 4IFKA 5DCBA 2XIQA 2CBIA 3WLPA 4X60A 4YYCA 1Q3NA 1XHGA 4W7UA 4TUFA 2WMGA 2CW6A 4PMNA 5FIPA 3KP1A 4WR3A 1Q6QA 4BQ5A 1ZZMA 1PX8A 2WC7A 3TZNA 5FEWA 3M0XA 2CFFA 3MJMA 4GY7A 3FVDA 1AW5A 5CXPA 3PUDA 1B54A 5E6ZA 3W1LA 4GIRA 3GDBA 2GDQA 1UP0A 1W9VA 3CJPA 4K68A 3SSZA 2HQAA 2NX3A 3CM4A 3HTWA 2OQLA 1JCLA 4QG6A 4UOZA 4L1GA 3CB3A 1JRCA 1B3VA 3V3WA 1E1EA 4RNIA 4LRSA 2OLSA 3R0KA 2ESCA 4WUIA 1EIXA 3E2SA 1C93A 2B0MA 3PTQA 2VI0A 3ITXA 3HMJG 2R14A 5BOFA 2ZZ7A 2ZA2A 3ARXA 4JTTA 4RPQA 1SMDA 2C79A 1DE6A 3AU2A 4ERAA 4IPPA 5HBFA 4FB7A 3NFUA 4H83A 3EB3A 4ZO7A 1M01A 3NOEA 3NM1A 3CL7A 1QPOA 4UFIA 1VPXA 1WO2A 2OU4A 1YDYA 1A5NC 3AIRA 4L5ZA 4MNLA 1ECQA 3GR7A 5A8GA 3PBGA 5FEXA 2VOTA 3MCOA 4QITA 3SCTA 2J7DA 3VILA 4IICA 4M3PA 3NCOA 2QF8A 4PR4A 4IM4A 3LK6A 2F84A 3MHFA 3QF0A 1JPKA 3DESA 2ABBA 1RZMA 3POCA 3ZYZA 4I9JA 5A6KA 1V77A 2J8GA 3W1UA 3AWOA 1EP2A 1O7AA 4XQ6A 4NZJA 3EWBX 3NQVA 4XTIA 3T42A 2Q3OA 3QZ6A 4PMZA 4HMEA 4ZB2A 3HBLA 2X7WA 3UCDA 1KFLA 3ZR6A 4H9ZA 4UFHA 2YZRA 1F9CA 2V5JA