3NSMA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 from ostrinia furnacalis
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of an Insect {beta}-N-Acetyl-D-hexosaminidase Specialized as a Chitinolytic Enzyme
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
molecule keywords N-acetylglucosaminidase
total genus 185
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nsmA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3nsmA01
1IT0A 4CD7A 1ESWA 5CGTA 3WIJA 5CSYA 5CLTA 2J77A 1AMYA 2C0HA 3NSNA 4HA1A 5CSUA 2WLYA 1JDCA 3KL0A 1O6IA 2AOSA 5I77A 1TR1A 5BYWA 1PPIA 1PX8A 3HU7A 4GI6A 1JF5A 3UEQA 3WQ6A 3QHOA 1KGWA 5CQ1A 3QOMA 5HBFA 4M8UA 3AYRA 4HU0A 3UERA 1GZJA 2Y5EA 2VX7A 4M29A 1WDRA 3GDBA 2CXGA 5ECUA 3VIFA 2QHAA 4DWSC 3MU7A 4RL3A 1ISXA 1J10A 1UA3A 3FXYA 4B3LA 5LA2A 1JFXA 5A8MA 4XV0A 3WQWA 3PZNA 1BF2A 4MADA 3AHTA 5M3WA 2BNJA 3GNPA 1XYZA 1JAKA 4JHOA 2GUYA 3PZVA 3WSUA 1NWTA 2X1IA 1W1VA 1K9FA 1B1YA 5EFDA 2Y24A 2VQTA 3WDIA 1R7OA 5I78A 4LX4A 1ZBVA 3AI0A 3OIHA 1AQMA 2YA2A 1SR0A 4AD3A 3M7SA 5A69A 1HVQA 1C93A 3ALFA 4UQDA 1TMQA 4HZ7A 4YHEA 2E9LA 2GSJA 2X0HA 3WH9A 5A2BA 3PZMA 2HISA 5BWFA 2NSXA 2DQXA 1PBGA 3SCSA 3B9DA 3TTOA 4BQ2A 1D3CA 5DT7A 2CBVA 3ARUA 3ZJ6A 2EPOA 3W24A 3RJYA 3WBEA 1DWIM 2A3AA 1B0IA 1ITCA 2DT1A 3WF0A 5A8OA 3WNPA 2XM1A 3BSHA 3RPMA 2CEQA 2YIHA 4DWSB 2CNCA 3BAYA 2PBOA 5AC4A 5EFFA 1QI5A 3PTKA 1HVXA 3WL1A 2DGAA 5FCZA 1V08A 4AC1X 2C7FA 2DSZA 2VR5A 3MUZ1 4PTWA 1R86A 1UWSA 2D1ZA 3OBAA 2RGMA 1HP4A 5A2CA 1QI3A 1CLVA 1C3FA 3MANA 1CXFA 1LF1A 1LJYA 1UKPA 3IJ7A 4B9ZA 4LYRA 1VRXA 4W7WA 3WD1A 2RGLA 4FLOA 1GOMA 3SCOA 5A6LA 3S6TA 4CKQA 2VVNA 3GBDA 3ZJKA 4KWUA 2J7DA 2NT0A 1E15A 2QPSA 2VT0A 1UZ1A 5D9NA 2WKGA 9CGTA 4OKDA 2CHOA 3VGHA 1H4PA 4GIAA 1UH4A 1UWUA 5TD4A 4UFHA 3FNDA 1QBBA 3ZT6A 2WPGA 1L0PA 3ARXA 2Y8KA 4K68A 2YL5A 3IJ8A 3W6LA 2WMKA 2CETA 5HPCA 5HPOA 1WZKA 3F5KA 3MV11 1CGTA 1V0KA 3SCTA 1UKTA 3L4ZA 4CU6A 1KGUA 1B9ZA 3EDKA 4JFWA 4PUDA 5BCAA 2VL4A 4Y7EA 2WWDA 1ZS2A 2GFTA 5E09A 3WL0A 3SEPA 3VGDA 1CXIA 3MMWA 2BVYA 4DUVA 3VNYA 1BYAA 1XV8A 1XH1A 3VILA 2OYMA 4UFMA 2EBNA 3SCWA 2WBGA 3ZQ9A 1PZ2A 3WDQA 1VEOA 2AAAA 2IUZA 5CGMA 3M46A 1CGXA 3AMKA 4KRUA 3OLGA 4H04A 1UQZA 4PEEA 1FH9A 1VEPA 3CUJA 3AHZA 4P7LA 3WELA 1WPCA 2BS9A 1DEDA 2ZE0A 4OBSA 4J3WA 1YHTA 4PRWA 5E6YA 3AMDA 4KRTA 1W3JA 5IHRA 3IAPA 2YDRA 5A2AA 1DWAM 3BH4A 3K4AA 5GNZA 3WD2A 4U2ZA 4HTYA 2EQDA 1UD8A 1TCMA 1EDTA 1HJUA 1U30A 3ZO9A 2PWGA 2ZXAA 3WH5A 1KQZA 1CNVA 2ZWYA 3APGA 4JFTA 5M17A 4UFIA 4ZEPA 4CN6A 2CKSA 3RCNA 1OBAA 1KBBA 1GOOA 3ARRA 3VMOA 1E4IA 1Q6DA 2VZSA 2ZUTA 3PBGA 3OGSA 5M03A 3W6MA 2Y8VA 2UY3A 1MW1A 1OGBA 3CH9A 4J3VA 4P7RA 2VOTA 3VINA 4D1IA 1JGIA 2A3CA 2VX6A 2WKLA 4GZEA 1ECEA 2WC4A 4A3HA 3AMGA 5CZKA 1JNDA 3SCNA 4WKAA 4L4PA 1GOQA 3KWXA 3T2OA 1V02A 1DHKA 1UKOA 1KB3A 1BGAA 1HJWA 1LWJA 3NYDA 2A3HA 4U5KA 1OWQA 1J11A 1R87A 1G1YA 4UNIA 4XZWA 3AS0A 2PBGA 3OA5A 3MUY1 4TX6A 3II1A 4AMCA 3MMDA 3OZOA 1J9YA 4MTVA 1JL8A 2V38A 3WFLA 3WFZA 4D6GA 2G3MA 4PCTA 2NW0A 2CYGA 4AWEA 5E0CA 4QDMA 2J7CA 3TTSA 4CU8A 1JYWA 1NH6A 1ZL1A 1NOUA 1XCXA 2CCRA 4URIA 4CCCA 2WVUA 3CZJA 1W9UA 2PI6A 1FP9A 2F8QA 5I23A 2DT0A 3VD5A 3WQ8A 1QNSA 2WMGA 3KE0A 3VDCA 5D9PA 5JBEA 4HP5A 2FGZA 3VNZA 4J7RA 4AEFA 1TA3B 1UR4A 1WKYA 4ATWA 3U7VA 5E9AA 1CPUA 3PZQA 3LPOA 1GHRA 3CZLA 2JFEX 3L4TA 3UESA 4BQ3A 1QVBA 2WCSA 4X0VA 1KXHA 4GQQA 4AIEA 1DWFM 5GNYA 3WN6A 2JF7A 3FN9A 1MXDA 1NOFA 2BY2A 4ACYA 5CG0A 4AD5A 4P7OA 1UD4A 3VD3A 1NWUA 4H2CA 3WY1A 2G41A 1OM0A 2EPLX 1W3KA 1PJ9A 7CGTA 3KEHA 2JEQA 4U31A 4B16A 2A3BA 2W91A 1VJZA 1Q6FA 2A3EA 3WF1A 1C7SA 1BFNA 4M82A 1HKKA 3O9NA 4NRSA 4AZCA 5I0DA 1CXLA 1PZ3A 1E6RA 1MFVA 2OWWA 1KWKA 1UWQA 3W53A 1E6SM 4LPCA 5A8QA 4JIEA 3N11A 3SUWA 1FA2A 1MW0A 3ZM8A 3BCFA 4JHZA 2XJ7A 2Z1SA 4ZXOA 1NARA 1RP9A 4AZ6A 1XC6A 3DYPA 1CWYA 2B31A 3GM8A 3ECQA 2OLHA 2VCBA 2GJXA 1P6WA 3SURA 1M7XA 2XTKA 1EIBA 3U57A 3N12A 4JL1A 1E1EA 4J3UA 4CVWA 2VRQA 3MUIA 3AIRA 1X6NA 3FAXA 4PYSA 3W25A 3GH7A 1BYCA 2OYLA 3A4XA 1UQYA 3UG3A 2XFFA 5I79A 4JAWA 2PB1A 4TOQA 4NSBA 1NP0A 1E6QM 4PTMA 1WZLA 2XVPA 3GXMA 2WAGA 2YBUA 3MSGA 3TOPA 2OWXA 1J0HA 1W9PA 2WC7A 1JZ8A 1C8QA 3NIYA 3A4AA 3GTNA 3L4XA 4KGLA 1FH8A 2GDUA 3GBEA 3WDRA 1E5NA 2BY3A 2WHLA 4FLSA 1G94A 4AD4A 1VBRA 1SFSA 1NOWA 4J3TA 1H2JA 1WAWA 2WLZA 2OWCA 3ARTA 5D8WA 1W3HA 2PWDA 3EDDA 5D9OA 1F4HA 3VKKA 3POCA 3VTRA 3AQUA 3IJ9A 1FFQA 4HMEA 3RMEA 1DWHM 4AZHA 2J8FA 2DT3A 1CXEA 4E4PA 5GPRA 1XD1A 1EGZA 4AZBA 1CXHA 2VC9A 1H5VA 1V3JA 3CUFA 2GDVA 1E55A 1O7AA 2W67A 3SCUA 3BMWA 4MPKA 2VJXA 5C8BB 5CLWA 4P7QA 1JDAA 1CTNA 2EO7A 4D6DA 1M03A 3BAIA 1XCWA 4GKLA 3HN3A 2EXOA 4JFUA 1CENA 1VJSA 4RE4A 2XWEA 2BHUA 1UH3A 3VDBA 1V0NA 3J7HA 3WUBA 3VIJA 1ISVA 1UYQA 2ZX9A 5JIWA 6TAAA 1WB0A 4LYPA 4XB3A 1CZ1A 5DO8A 2F61A 4U5IA 3EYPA 3ZSTA 1NWSA 3T2PA 1BVNP 5ABFA 2YDQA 4ZENA 1ZB5A 1UOKA 1EQPA 2UWFA 5FIPA 1QNPA 1G01A 3NSMA 1BLIA 3EBVA 4GI8A 3ZT5A 3IANA 1V6VA 1W1TA 3VVGA 4U33A 4A3YA 1MW3A 5EBAA 4ZE5A 2E0PA 4HA3A 4ML4A 2WK2A 3CHDA 2ZUWA 2VR4A 2CIPA 2WVVA 4ZFMA 6A3HA 3WDHA 4JKMA 1FP8A 2XIIA 1OD0A 3NSXA 4PSPA 2GJRA 1VIWA 4PMVA 4AEEA 4EKJA 1HKMA 1W2PA 4UFKA 5CJ5A 3VGGA 1KWGA 3W29A 2CKRA 1XGZA 3PZOA 3SCQA 5I3DA 3EDFA 1PIFA 3NUKA 1Q6EA 2UY5A 1FOBA 4WSJA 1QNOA 3A4WA 4Q22A 3VO0A 2E40A 1EHNA 3N9KA 2OSYA 5A6BA 3VPLA 3WF2A 2XPKA 1GQKA 3PTMA 1BGGA 4Z2LA 3WF4A 4CD8A 2J75A 4FLRA 4QCFA 2J25A 3VUPA 2VURA 2ZICA 1V0MA 4QLKA 3AXHA 3POHA 4PMNA 5BXPA 1IZJA 1S46A 4XX6A 4EANA 4UR9A 2EJ1A 4MNKA 4OZOA 4QFUA 3ARZA 1IV8A 2G3NA 3SUTA 3BC9A 3RM4A 2O9PA 5E70A 2CITA 3VGFA 5ABFB 2YJQA 4CD4A 2WC3A 3PZUA 3AIWA 1CGWA 3AIBA 1JNEA 1MXGA 2D3LA 2FH6A 3O2LA 2E3ZA 1RH9A 3SCVA 2F2HA 3WMBA 1HJSA 3ZSSA 3F4VA 5HOSA 4JCLA 1G9HA 4D6HA 1R7AA 4C91A 1ISZA 1V3MA 4W8BA 2WYSA 4H8HA 1QI4A 3CZKA 2ZXQA 3OB8A 3D5HA 1GOIA 1X1NA 4OBRA 5D9MA 4P8VA 2QF8A 1BG4A 3SUSA 7TAAA 2VO5A 3N13A 2J8GA 2WVSA 1E73M 5A6MA 3CUHA 1KFWA 3CZEA 1BQCA 3CBWA 3WNLA 3EMCA 3OLDA 3RDKA 2W5FA 4LYQA 3G6LA 2XWDA 5CPTA 2DDXA 1Q6GA 1JD7A 4IPNB 4F9JA 5BRPA 1GPFA 2VI0A 4U3AA 1DWJM 4AY1A 4OUEA 3AHYA 5DF0A 4GZJA 2XVLA 3WMCA 4W93A 2YKKA 3ZJ7A 1QW8A 3WDJA 1EH9A 4IISA 1W32A 3AIUA 3WNMA 4HMDA 4F79A 3KZSA 1PIGA 5A8NA 4IUGA 1Q4NX 1A3HA 2BHZA 2WWCA 4LQ1A 2VCCA 4GXPA 3AZRA 2XG9A 3K8LA 3WBAA 4BF7A 1DTUA 1CDGA 1XSKA 2YA0A 3M07A 3BLKA 1J0YA 3N1AA 1JZ4A 2XGIA 4AD1A 4WF7A 2CPUA 1KCLA 4P8XA 5KEZA 4PMYA 2X2YA 2FHCA 1JIBA 2W4XA 5EB8A 4X0NA 2UY2A 4XUYA 3GXFA 3GXDA 2CBIA 1EXPA 2J7BA 4W87A 1WZMA 4CN4A 1NM9A 1JYXA 3VDHA 2E9MA 3AHXA 3RILA 4CCEA 4E8CA 4JL2A 2GJPA 1PEZA 2W62A 2WMFA 4OIFA 1UWRA 3RM8A 8A3HA 1UR9A 1VFFA 1B30A 4J28A 2JALA 3RO8A 1TUXA 1HNYA 1MWOA 3GH5A 2E9BA 4N42A 4BZYA 1GVIA 4Q7NA 1UUQA 2ZIDA 1E4LA 2WBKA 4R27A 3THDA 3DC0A 3WF3A 2DT2A 3W82A 4KGJA 2VRJA 3WNKA 2JF6A 1OB0A 4ATLA 4CU7A 1SMDA 1JD9A 1BPLB 1LL6A 3OGVA 4IM4A 3T0DA 5A1AA 1TVNA 1QOXA 1B31A 4L4OA 1LQ0A 2YOCA 1UWTA 1UD6A 1E4MM 3AHVA 2ZUUA 1MQQA 1U2YA 4CD5A 3BSGA 1EOKA 2ZX5A 5DT5A 5A6JA 1CIUA 1OT2A 3F5LA 1UD3A 4WIWA 3GZAA 4UFJA 1AQHA 1E3XA 3UG5A 1HT6A 1CGYA 1E3ZA 3DHUA 1OIMA 4IPLA 1KBKA 4D6JA 4C90A 2J4GA 3L2MA 1E56A 2WMHA 4BA0A 4BQ5A 4D6FA 4J27A 1Q6CA 4PMQA 4W7UA 1JZ3A 3BMVA 1XD0A 1J0KA 4YHGA 2D0FA 2X09A 5DMYA 1W9XA 1JZ6A 4H41A 5E0FA 1QNRA 3RM9A 5JBDA 3AIEA 3S2CA 5FD0A 4UQ9A 3FAWA 2EPMX 4WJXA 3L2LA 1FFRA 1PX4A 1X6LA 1W1YA 4PTXA 2YL8A 1M53A 1E70M 5D8ZA 5A3HA 4WK9A 2Y4SA 2C8NA 4H8VA 3VIGA 1UA7A 4OJYA 2UY4A 1V3IA 2WSPA 1HL9A 1UD2A 1MQPA 2VMFA 1UD5A 3QOKA 4NZCA 3AOFA 4AZCB 3UETA 1JZ5A 2Q8XA 2J7GA 1MFUA 3A3HA 1GOWA 1BAGA 5HDRA 4W85A 4TX8A 3SUVA 2XVKA 4AZGA 2X0YA 5CPQA 1EO7A 1CGVA 4QCEA 3DECA 2XFRA 3L4YA 2WCGA 1M04A 1MYRA 1V6XA 1JDDA 1V6UA 2VZVA 3I3BA 4CUCA 1V03A 3CLWA 4JKKA 3WH8A 2HVMA 1MVYA 2XM2A 4DWSA 3K4DA 3FHQA 1JI2A 2D20A 1EA9C 3MS8A 4N0RA 1GQJA 2D22A 1K9TA 2DH3A 4F8XA 2VNCA 4PBGA 1EDQA 1E0WA 1E5JA 1TFVA 4W86A 1K9DA 5AYIA 1B3VA 3MMUA 1E43A 4XZBA 3NDZA 1XYFA 1W9BM 1C90A 3AZSA 1WDPA 1UWIA 3T08A 1TE1A 1VAHA 1BTCA 1UKQA 1W1PA 5I5RA 2VUYA 3QGVA 1NQ6A 2QMKA 1VFOA 4H8UA 2ZX8A 1YQ2A 5JIPA 5A6AA 3VDAA 2FH8A 5IFTA 1I1XA 3LPPA 3BAWA 1HIZA 1G5AA 1VFMA 3WUEA 2O9RA 5C71A 3AXXA 3SCRA 1UR2A 3ARSA 4AZIA 3K46A 3GXIA 2YDSA 5GQBA 2X05A 3VIKA 3WEOA 2DSWA 1E71M 4HA4A 3W0KA 2OSXA 4QP0A 4W8LA 2CHNA 3D3AA 2BY0A 4BS0A 1HP5A 1BSIA 1RD6A 1JZ2A 4UQBA 3WH7A 1QI0A 3AISA 2VZUA 3KL3A 1TA3A 1XRVA 2XVNA 3U5YA 2YA1A 3VOCA 2GK1B 4MB3A 3EMQA 3WH6A 3VIIA 2ZX7A 4WSKA 4UQEA 3AFBA 2J74A 2WMJA 5LA0A 3QHNA 1K9EA 2BFGA 3PZTA 1ZJAA 4M56A 3VGBA 1WP6A 1KR1A 1E40A 3T0BA 3AS1A 1UR1A 1VB9A 4GI9A 2JE8A 2WMIB 3VIHA 4ZXLA 5I6SA 3B9AA 1W9VA 2J7FA 2XYLA 1UR0A 5LYRA 1ITXA 4Z2JA 1B3ZA 5FOOA 4YPJA 1A47A 1AVAA 1B2YA 1US2A 5CPSA 3TONA 4HOWA 2V3GA 3VD7A 2WHKA 5ABHA 1OGGA 5IFPA 3WUGA 4C7GA 4AXNA 1C8XA 1TVPA 3PZ9A 1CXKA 1QBAA 1KXVA 4DM2A 4PMXA 3ARVA 1HN1A 2XFYA 5LA1A 5I24A 2W66A 4D6IA 1BHGA 2XSAA 3ARPA 2BV9A 2W92A 2WXDM 2Z1KA 1E0XA 2BY1A 2V3DA 2J47A 4OOZA 3WQVA 3AROA 1HJXA 4C7FA 3PN8A 3AIQA 2X8RA 1UH2A 4EK7A 1L8NA 4HOZA 3OG2A 4HU8A 2WCAA 4U3CA 2V3FA 2G3JA 3K8MA 4PMOA 1XH0A 1J01A 2IXVA 2DIJA 4TTUA 2ZXDA 2JIWA 3T0AA 3ZR5A 1H11A 3CO4A 3CPUA 2BVTA 1ZU8A 5I2UA 4DM1A 2WANA 3ZIZA 2YL6A 4LGXA 2J62A 4MAVA 1OD8A 1LL4A 1UG6A 3CZGA 3MV01 4D6CA 1V3HA 4UZSA 5JBFA 4W5UA 3VGEA 3AIVA 2O9OA 4WKHA 2EPNA 3BGAA 2O9TA 3B9EA 2OYKA 4HOXA 2YBTA 1W3LA 1U33A 1EOMA 4YN5A 1E9LA 3HJEA 4W88A 1WO2A 3O6AA 3QHMA 3GNOA 2DPEA 4QLLA 4GO8A 2VQUA 3CIVA 2WHMA 1C8YA 4AD0A 2BVDA 1BYBA 3DYOA 2WNWA 3IK2A 1SYTA 2ZOXA 1B3YA 4FLQA 1ODZA 4D72A 4TVUA 3VM7A 2ZUNA 3VIPA 4DUXA 2PF0A 5F7UA 2W63A 3GYCA 1HF6A 1ZJBA 1XHGA 4HPHA 1ZBKA 4WLCA 3WD0A 1PX3A 3CHFA 4P7NA 5FKYA 1GW1A 3WENA 1QW9A 4M80A 3LPGA 4MB1A 4B15A 3CTTA 4UFLA 3RJXA 3AMCA 4R5EA 1H49A 3VM5A 3VMPA 2D3NA 2ESCA 4D71A 2QLYA 5A8PA 1JXJA 4UZUA 1LWHA 1LG1A 1Y7VA 5AC5A 5BXTA 3WEMA 4TXEA 5ABEA 3E1F1 4CD6A 4HMCA 3CHCA 3GH4A 5FL0A 4ZE4A 4U2YA 4M81A 1V6WA 3I3DA 5M5DA 2PWEA 1HL8A 3NJ3A 3RIKA 1WCGA 3CZ8A 1VENA 3K8KA 3N17A 1J0JA 1QHZA 4S3KA 4UTFA 1GJUA 1ISWA 1M01A 2GK1A 1V0LA 4TUFA 5AY7A 2WHJA 3VIMA 4AIUA 3WNOA 1KGXA 2PC8A 4UOJA 3OLIA 3T09A 3ZR6A 3LMYA 1J0IA 2WZEA 4W7VA 1HKIA 4UQAA 3PTQA 4MDPA 4LXFA 5JUVA 3SIMA 3IAQA 4MB4A 1KXTA 2WB5A 4WKFA 4PMZA 1XSIA 1FH7A 1JYNA 4JFVA 1PAMA 3JUGA 2J78A 2G4FA 4NF7A 1W9DM 1CGUA 3WEZA 1HX0A 1H3GA 1CYGA 4EE9A 2WM0A 5A95A 4W5ZA 4C7DA 1W2VA 1H0GA 2XIBA 4Z2GA 4P8UA 3MUAA 1H41A 3NCOA 4P8WA 3ARYA 1WNOA 1BYDA 2JIEA 3ARQA 4MDOA 5E6ZA 1HXJA 1H0IA 1NP2A 3BAKA 3L4VA 4GQRA 2VTFA 3VMNA 3SCPA 4D1JA 4QLJA 4TVCA 1E1FA 4H7VA 1VFUA 1K6AA 2D0GA 4B9YA 2WMIA 1LG2A 2BHYA 4Z2HA 1F4AA 2FHFA 1OGSA 1WDQA 5D4YA 3WDPP 4CCDA 3UCQA 4E2OA 1IZKA 3AS2A 2XHYA 3AICA 4UOZA 3M6DA 4GINA 3WNNA 4CGTA 3N18A 3ZT7A 2YL9A 1GORA 5EMYA 2WSKA 4GZIA 2V5DA 1I75A 1VEMA 2D0HA 1BG9A 2E8YA 4MJ4A 2ZUVA 2WW5A 4MJ2A 3QR3A 3THCA 2XVGA 1CEOA 1ZBWA 3DHPA 2FGLA 2J7HA 3CMJA 4MNLA 2D23A 2QMJA 4HZ8A 2DIEA 1OCQA 4PMUA 2E8ZA 4D6EA 2YLAA 5CXPA 2E4TA 1GONA 2ZUSA 1UKSA 3VD9A 4DWSD 1MW2A 4JFSA 2V3EA 4CVUA 2DSKA 5AYBA 4PUEA 2ZWZA 1V3LA 3FHAA 3U5UA 4S3JA 2DEPA 4JZ5A 3W26A 2EEXA 1B3XA 1NWRA 1UHVA 2D24A 5GNXA 4AYSA 1H1NA 3W38A 4ACZA 2VRKA 3UR8A 1E6NA 3CGTA 4MNJA 3SUUA 1N82A 4OOUA 1JAEA 2EPKX 3TP4A 1ISYA 4NI3A 4PMDA 1EHAA 1US3A 1C92A 4V28A 3WD4A 3BXWA 7A3HA 3ARWA 3PZIA 3VX1A 1OINA 2GJXB 1GNXA 4M1RA 1WDSA 1KQYA 2VX4A 2Y2WA 1RP8A 2VX5A 1J0ZA 1V3KA 4E8DA 5C70A 3B8SA 1V02E 1J18A 1HJVA 1UR8A 2WVTA 3LPFA 8CGTA 1AQ0A 3FY1A 4FMVA 3VU2A 2ZX6A 2GVYA 1OSEA 2CBJA 3OZPA 3TTYA 2YLLA 1SMAA 1RPKA 3VD4A 1JI1A 3G6MA 4AD2A 3N15A 4J3SA 2VZTA 1D2KA 2DSUA 1XH2A 3ZOAA 1KCKA 5DEZA 4PN2A 2J79A 3OGRA 1XSJA 3OLEA 5DFAA 1EQCA 4JCMA 5IHSA 2DSVA 4X9YA 5HNNA 4UCFA 1CBGA 4AW7A 1GVYA 2CESA 1HJQA 3W37A 2WVVB 3GNRA 2W61A 4UQCA 1WE5A 3UR7A 3WMSA 1JZ7A 4AISA 4BQ4A 5HXMA 1V6YA 2CBUA 1EDGA 2O92A 2CERA 1Z32X 1TZ7A 1R8LA 4A4AA 2JEPA 3T2QA 5IDIA 3HMCA 1LL7A 3ALGA 1VF8A 3L4WA 4MB5A 1LLOA 2ZUMA 3MO4A 4CN1A 4W8AA 2D2OA 4KH2A 1OIFA 1B3WA 1GOKA 2BXYA 3F5JA 1GCYA 3EDEA 1JFHA 5A6KA 4PCSA 4UOQA 1DWGM 3CMGA 2WZIA 3PHAA 2FDMA 4TTGA 1MQRA 2PWFA 1D7FA 1KR0A 1C7TA 2PWHA 1VBUA 4HZ6A 2IXUA 4JKLA 5BROA 1HKJA 2V5CA 4RE2A 2XUCA 3ZMRA 3UG4A 3W28A 1FHDA 4W84A 1C91A 4MNMA 3EDJA 4MAZA 3AJ7A 4B3KA 1FHLA 5A6SA 4ATDA 2BXZA 2TAAA 1JF6A 4W89A 2ZXBA 5A94A 1CLXA 1TG7A 2XGBA 3L4UA 3PZGA 4TVDA 3VX0A 5KZ6A 3CHEA 4FF5A 3AYSA 4PSRA 3DYMA 1JG9A 1JXKA 1QNQA 1B90A 1ODUA 2QPUA 1E0VA 3U7BA 1QPKA 3NDYA 1ZBCA 3W81A 3WUFA 3TTQA 1GJWA 4HPGA 1E6PA 1G0CA 4Z2IA 1UZ4A 4ACZB 1GQIA 1JYVA 3ZJ8A 5ABGA 5FL1A 2AMGA 1BVZA 4AZ5A 1I1WA 2G3IA 4AIOA 1QHOA 3BLPX 1QI2A 3AS3A 3BCDA 4F9DA 1GHSA 2G8ZA 1EO5A 1W91A 3WKZA 4FK9A 3EMZA 2VCAA 4GPNA 3TA9A 3BAXA 3KL5A 3CUIA 2FHBA 1E6ZA 3WD3A 1R85A 3K1DA 2WZHA 4QAWA 2VZOA 1H09A 4J3XA 1QHPA 2MANA 5BXSA 4PMRA 3MSDA 2OSWA 1GQLA 2QV4A 1CECA 3W27A 4RE3A 4EAMA 1OT1A 4M24A 2J7EA 4V2XA 4F66A 3A47A 4V27A 4PTVA 5BXRA 5IXEA 2XSBA 4DUWA 4GO9A 3BAJA 1KXQA 3FW6A 2NT1A 4NRRA 3AMLA 4BCEA 1J12A 3CUGA 1E72M 5BRQA 2VVSA 3AXIA 1GUVA 1WZAA 1E6XM 3VIOA 3A6OA 3N04A 3WQ4A 6CGTA 4Z2KA 3AZTA 3W4RA 3I3EA 2DH2A 3MKKA 5A6BD 3WQ5A 4AZ7A 1E4NA 4KMQA 1DP0A
chains in the Genus database with same CATH superfamily
3SRDA 1IT0A 2PURA 3LNPA 1JEZA 4CD7A 1LBLA 3NZQA 1W56A 3WIJA 1EJWC 3S5YA 2X40A 2C0HA 3NSNA 2H3BA 3TDFA 2WLYA 1JDCA 3KL0A 2OOGA 1UROA 4LBSA 4Q4OA 1T40A 2GVGA 1LM1A 3HU7A 2DZVA 1RCXB 1GYNA 3UEQA 1TPEA 2YCLA 1XC4A 3EAUA 1XLAA 5HBFA 4M8UA 1OX6A 2Y5EA 4CEUC 5ECUA 1V5XA 4Y9PA 3VIFA 3RX2A 4DWSC 2YXXA 3MU7A 4RL3A 1XFCA 3FXYA 1OX4A 4B3LA 5LA2A 2IKIA 5A8MA 5AHFA 5G1MA 3AHTA 3BOFA 3NAVA 4GUHA 3TZNA 4IUOA 4US5A 3BQ6A 3PZVA 2I14A 1NWTA 1Q8AA 5AB3A 1GOXA 3EB3A 1EYEA 2VQTA 4DO5A 1EZ2A 3I6EA 3M7SA 3KLKA 5KZMA 1HVQA 1C93A 2VC6A 3ALFA 4GRSA 2QUVA 2ZADA 1R9YA 4ILSA 3WMLA 2NSXA 1ADDA 3CXOA 3H12A 1KKRA 4NP7A 5DT7A 4LEFA 3ARUA 4JTSA 2NQJA 4O12A 2EPOA 3JR2A 2A3AA 3N4AA 2INFA 3E6EA 3WF0A 5A8OA 1I0BA 2CEQA 3MW7A 2CNCA 4LS1A 1RY0A 5EFFA 4KS0A 4D8ZA 5DN1A 1HVXA 4QXIA 1ZP3A 3WL1A 3IRSA 1PTDA 5FCZA 1IXNA 4Q4RA 2C7FA 2VR5A 2Z27A 4LNCA 1R86A 2J9ZA 1UWSA 5DCEA 3QY7A 3NZPA 5AVHA 1QI3A 4G7EA 1CLVA 5EBUA 1LF1A 5CG7A 5B7ZA 3W1NA 1VRXA 5I7GA 4G2DA 2RGLA 4DQWA 5L6UA 3CJPA 5FJPA 5AYZA 4KW2A 4EVZA 3I10A 1TVLA 1KTCA 4Q8PA 4ZL1A 2CHOA 3V4BA 4GIAA 1UWUA 2PU0A 5JQ9A 2GJNA 4YVXA 4AY7A 1Q7MA 1L0PA 1OYCA 7XIMA 3EX6A 5REQA 1DJWA 5K7JA 3E0IA 2WMKA 3W7PA 3MV11 3SCTA 4NASA 1ONRA 1M41A 2AQVA 1XDMA 1KGUA 1B9ZA 4DAFA 5BCAA 2VL4A 2QDEA 3CUXA 4XAGA 1G4SA 2Q71A 4DUOA 4YU1A 1I9CB 8TIMA 5EL1A 1TPDA 2BVYA 3TAOA 3U0HA 2RUSA 5AZ0A 1HL2A 1BYAA 3VILA 4E4UA 2WBGA 1NIUA 1F7BA 4JYEA 1WQ5A 2IUZA 1U5JA 4XTIA 4GG9A 3N4EA 3AMKA 4ZSUA 3ITTA 3OLGA 1RQEA 4Q4KA 3NZRA 4PEEA 4C6JA 1FH9A 5D04C 5H91A 5I07A 4P7LA 1R30A 1WPCA 4ORIA 1RUSA 2I5GA 2BDQA 2NZLA 1YHTA 4JTHA 3L5AA 2C13A 3V35A 1VYRA 3LHVA 2YDRA 1XBVA 3CWOX 1UBSA 4KFPA 3QYQA 6REQB 1OYBA 3H4XA 2GWGA 1HJUA 4GJ1A 1R3SA 4QSHA 1UCWA 2BBFA 2PC4A 4M3PA 3RCNA 2V81A 1ZSXA 2FJKA 3VMOA 3T05A 1E4IA 2VZSA 3OGSA 4JQ4A 3UJFA 4N9EA 3WK1A 2VOTA 4D1IA 1JGIA 3CC1A 4GZEA 1Z3NA 2WC4A 2I1OA 1FWWA 4A3HA 5GJPA 3SCNA 2CHRA 4L4PA 4B3ZA 1GOQA 5G1TA 3T2OA 1DHKA 1UKOA 1BGAA 4XD6A 1NVMA 1IE7C 4OVXA 3LXCA 1NJJA 1UOZA 2DQWA 4DZHA 3GHRA 4WJEA 1RY8A 3EGJA 1R87A 3ITGA 2PBGA 2HMCA 4E2VA 4TX6A 3II1A 3OZOA 1J9YA 5CBBA 2CYGA 4AWEA 3URNA 3TTSA 4DXVA 4XAYA 2ALRA 3TNBA 1F5ZA 4WDXA 1XCXA 4JHMA 3EA3A 4NI8A 4CCCA 2WVUA 3AYVA 2QAFA 1V7YA 5HNUA 5K9CA 4FB7A 2WMGA 3VDCA 5D9PA 4ZB5A 1MUMA 5BU6A 4ROPA 3TC7A 4HVXA 4B92A 1IXQA 4AEFA 1TA3B 1WKYA 1FWDC 3TK7A 3RPTA 2HV5A 3WBWA 5E9AA 3PZQA 3LPOA 1GHRA 3CZLA 4AF0A 2OLSA 4HPNA 3UESA 4BQ3A 1YDYA 2WCSA 4X0VA 1WKFA 1XXXA 5H1WA 1OCBA 3ATZA 2REQA 1MXDA 2O55A 4ACYA 1WKDA 3R79A 3CIXA 3C8NA 1SZFA 3B4YA 4H2CA 7CGTA 3KEHA 1LWIA 4NYYA 2JEQA 2Y7DA 4B16A 2W91A 3MKVA 3WF1A 3O9NA 4NRSA 4AZCA 1PKLA 1PZ3A 1E6RA 4JIRA 1KWKA 3QW3A 5LZLA 4LPCA 2VOMA 4JIEA 5D03A 1MW0A 3AYTA 2PDXA 4NX5A 3S3GA 2HQAA 4AZ6A 1XC6A 1CWYA 5RUBA 3GM8A 2YZRA 4K8GA 1QPQA 3IUDA 1P6WA 3L23A 5CEWA 3P7YA 1W1IE 2E5BA 4Q3MA 1XLEA 4H3DA 4HTBA 3B8TA 3TUUA 2GLKA 4JL1A 1E1EA 4J3UA 1GVSA 4ERIA 1X6NA 3W25A 1NELA 1CB7B 2OYLA 1GEHA 3FJNA 1XLGA 4JAWA 1NP0A 3QRHA 4PTMA 2WAGA 3M0IA 3BWWA 3TOPA 3UZWA 1J0HA 1SJBA 3T42A 2WC7A 3NIYA 3A4AA 3GVVA 1I2NA 3QY8A 1Q6RA 3VCCA 1D7KA 1SSGA 2WHLA 1YXCA 1SFSA 4IJCA 5M1TA 4Q4MA 3FV9A 3LTSA 4ZQRA 4IG2B 2B7QA 5D8WA 5CAKA 1B9BA 4Q7IA 2Z2UA 3VKKA 2FFCA 3POCA 3G1RA 3RMEA 3TOYA 1YKWA 4AZHA 1X97A 1RJPA 2Y0FA 1TJ0A 1CXEA 3H53A 2EF9A 4TV6A 4IF2A 1XD1A 1UC5A 1DORA 3OYXA 2R8WA 3HPZA 5D32A 1O7AA 2W67A 4L6OA 3GQYA 4EF8A 3SB0A 3URQA 4FR1A 2GVJA 3W84A 3C3NA 2CLLA 2NXIA 5JXQA 3UD6A 3DGBA 1XCWA 4DJEA 4GKLA 1XGDA 2EKCA 1KBLA 2XWEA 4BY3A 2OQLA 3M47A 3SIZA 4DF2A 1UW9A 2D69A 3OZMA 2PDNA 4JTKA 6TAAA 1WB0A 3EKLA 3N2XA 3GDRA 4H83A 3R11A 2YBVA 1XCFA 2WKJA 1XYAA 3ZSTA 3UGVA 3QVQA 3T2PA 5ABFA 4ZENA 1ONEA 1UOKA 2QCDA 1GTHA 1KLYA 1G01A 4IZGA 1ZP4A 3EBVA 1L6GA 1GVRA 3VVGA 1W1TA 5EBAA 2GGGA 2E0PA 3XISA 4YXGA 2HEJA 2WK2A 1UUMA 2CIPA 1DL3A 4JKMA 2DZPA 1PZ0A 3PM6A 1KLZA 3NQFA 1KFKA 1QWKA 4PSPA 3WLLA 1TRDA 4DIAA 3LZ3A 3TU9A 1TV2A 4M7SA 4UFKA 4FPSA 5H6HA 3WLJA 5I06A 2CKRA 3PZOA 4PUUA 3NOYA 3EDFA 3NUKA 4WSJA 1G7VA 4B91A 4QTGA 4Q22A 4IH3A 4L1XA 3VO0A 2E40A 3N9KA 1UWAA 4DBWA 3REQB 5C5YA 2V5BA 3PB2A 3PTMA 4GKTA 2A85A 2J75A 2Z24A 1PIIA 2C14A 1V0MA 3W7KA 1L6WA 4PMNA 4LVBA 5I3JA 1S46A 3H55A 3D46A 4XBSA 3GSMA 2R6OA 1J8VA 4XG1A 5K4ZA 4OZOA 1IV8A 2G3NA 3UWUA 1S5WA 3EX2A 3GUWA 2A2IA 4KWSA 3AIWA 2ON3A 3WQPA 3UBPC 1IWBA 2J6XA 4ZO7A 2GUBA 2V30A 3WMBA 5DX7A 2CLKA 2FTYA 2ZZ2A 5CPMA 1O4UA 5HOSA 3W83A 1EJTC 1VBHA 3DESA 1UMLA 4JCLA 3MO7A 1R7AA 1GPWA 4B2DA 1EJVC 1MEIA 2E6AA 3UNTA 3F2DA 4OBRA 3H7UA 4C6LA 2WVSA 4XO7A 3CZEA 4WDUA 3CBWA 3E0VA 2OTDA 3RDKA 2W5FA 4LYQA 5CPTA 1S39A 4L56A 3S1UA 4J40A 3AIUA 4N02A 1K77A 4HMDA 3KZSA 1BWVA 3IV8A 2OZTA 4JQAA 3NPVA 4ZQOA 1CDGA 1VFTA 3TROA 5LIXX 1JZ4A 3L21A 5KEZA 2W4XA 1A5AA 4X0NA 3KHJA 3GXFA 2HROA 1NTHA 3P0XA 1XLBA 4IGMA 3WQDA 4W87A 1EXPA 1JYXA 2I56A 3LLXA 4UTJA 4Y9OA 3T8QA 3RILA 4IJRA 1GK8A 2HCVA 4E8CA 2AAMA 2WMFA 4OIFA 3NPWA 1UR9A 4K8HA 1Z7AA 3TYZA 1TUXA 4KFNA 1MWOA 1T8XA 3W00A 3GH5A 5D09A 2CZVA 3VCRA 2VFDA 4ZSTA 1W17A 3LMZA 1VD6A 3NYZA 4JY8A 4H9UA 4Z1BA 3W82A 1SU5A 4JNZA 3PTDA 3MQTA 2X30A 2GOUA 4LF1A 3WNKA 4Z0SA 4G5DA 1JD9A 2ACUA 3STCA 4S38A 1FQ0A 3TYCA 2VEKA 2VD8A 3CK5A 5HMEA 4WEVX 1LQ0A 1ZTVA 1UWTA 1UD6A 2YOCA 5G5IA 2ZUUA 2F84A 5IBXC 3TVAA 1EOKA 3BLDA 4MVAA 3I7QA 4DEFA 1EL3A 1F3XA 1OT2A 4UTTC 1UD3A 1AQHA 4YWSA 1W3IA 1R0MA 1ZGDA 3W1XA 1R3RA 5FA5A 1TQJA 2PTYA 4C90A 1VCVA 3L2MA 1Z89A 4IWWA 3BV7A 4BA0A 1VPYA 3R8HA 2HPIA 4JTUA 1Q6CA 3QQ0A 4PMQA 3EPNA 5LKYA 3BMVA 1VP5A 4XBJA 2H8XA 3UZZA 2RDWA 4J35A 1Q6QA 2D0FA 1W9XA 1IT8A 3RM9A 4O0ZA 3AIEA 3S2CA 4PL2A 5HWNA 5FD0A 3PSWA 3KDOA 3UXLA 4M1BA 1TWWA 4B4FA 1PX4A 3CASA 1M53A 1E70M 5D8ZA 4WK9A 1S38A 4H8VA 4DPQA 3O05A 2IQTA 3O6YX 3VIGA 2UY4A 4LUSA 3G22A 4Z1YA 1ZAJA 3WJZA 2VEIA 2VMFA 5G4WA 1W6TA 3IIVA 1TJPA 3AOFA 3ZLGA 4LS2A 4ADUA 1LCOA 3EXRA 1L8PA 4W85A 1EUNA 3SUVA 1O5KA 5DCBA 3GR4A 2X0YA 4AZGA 5FAGA 5CPQA 4OUIA 4REQA 2PA6A 3L4YA 3P61A 4Q8TA 5ECVA 1IXOA 3B06A 4WY0F 1YADA 3I3BA 1PV8A 5HWMA 1PL9A 1V03A 1XIDA 3HV8A 5CPOA 4JKKA 3WH8A 1A5MC 2HVMA 3UG8A 1GGOA 3QM3A 1VFSA 2DH3A 2XIJA 2QUNA 1PWLA 3IJQA 1XIIA 3ES8A 4AMAA 2XN0A 3P6LA 1XW8A 3BJFA 3NDZA 3STPA 1W1B1 1A3XA 1I4NA 4QS6A 1WDPA 2H3DA 4AEOA 1TE1A 5HINA 1BTCA 3SN4A 1GQNA 1UMYA 1W1PA 1RLCL 3QGVA 1FDYA 1RPXA 5C54A 4H8UA 5A6AA 4YVVA 4DYKA 2CLFA 1Y8BA 4EXBA 3OEXA 4DZIA 1G5AA 3UPWA 2DZWA 3BG9A 4EPKA 1UR2A 4AQLA 4EPEC 2QGYA 3ARSA 3L7RA 3ENLA 4K7VA 3RCYA 1E71M 2OSXA 3LEPA 4BS0A 1HP5A 1S1PA 1JZ2A 3HURA 1QI0A 1W1ZA 2FFIA 3AISA 1E9IA 3TXVA 3R2GA 3U5YA 2GK1B 1M5WA 2E6YA 3Q67A 3E0FA 4MB3A 3EMQA 1SVDA 2FVMA 2ZX7A 3OQ8A 4UQEA 1EA0A 1LP6A 3DGRA 3LD5A 4K3ZA 5I3GA 2WMJA 1JPIA 4XBKA 1H7XA 1XWYA 1K9EA 3EWYA 4M56A 5K3VA 3KVLA 1W0MA 3W76A 3B9OA 1C8VA 4O11A 3MCNA 2ISFA 4NX0A 3SFKA 3I6RA 2P10A 3GTIA 4LANA 2XYLA 5AZ1A 5LYRA 2HNHA 2AKMA 2E28A 5FOOA 2QUUA 3LV6A 1B2YA 2PTXA 3VYLA 2CLPA 4HOWA 3QFEA 1AL7A 4CQAA 3PZ9A 2P0IA 1CXKA 2W9MA 4NU7A 3T6CA 3LM7A 1IWPA 3ARVA 1I6NA 1HN1A 3B40A 3LDVA 4S3FA 4R7WA 4ZCWA 1EP3A 3UJSA 2FMNA 2OOFA 2XSAA 3HPSA 1E51A 2H9AB 3FK4A 2DP3A 1E0XA 4GIRA 2V3DA 2NUXA 4C7FA 1YMYA 1DJGA 2X8RA 3DIPA 4XKYB 2ZZ6A 4EK7A 1JUKA 4HOZA 2QEZA 2O7QA 1SJCA 1OABA 3T0AA 2D2HA 3ZR5A 3ABOA 1TV3A 3CPUA 3M44A 3V0TA 4KBXA 3ZIZA 1F61A 4ZO6A 4V15A 1GJPA 2XZ7A 3CZGA 4HGXA 5LNRA 4W5UA 3QZ6A 4YTSA 5MF5A 2D73A 4ZOEA 4JTFA 2QVNA 4HOXA 1K8CA 4MZ1A 4H9MA 3HA1A 4DJDC 4ZGYA 1PYMA 1F73A 4NZ5A 3QHMA 5DY3A 1PHWA 3ZVIA 4OE7A 1J6OA 1TPFA 2ZC8A 3HGOA 3MUXA 3WLKX 1B4KA 3FDKA 2QAPA 3WLMA 4N9BA 3NL2A 4GXMA 4TVUA 5BOOA 5I3HA 4DUXA 4IPPA 4GFIA 2W63A 2FDSA 3GYCA 1XHGA 1ZBKA 3UXDA 3CHFA 3R6IA 3FA4A 2WOQA 1XRTA 2GQAA 2DY3A 3CO8A 4D71A 3TQPA 4BKNA 4UZUA 2WJFA 2PMQA 3WEMA 4TXEA 1K1DA 3PFRA 5DCDA 1X1OA 2IKJA 1UIPA 3MVTA 5SWUA 2Q3RA 3RIKA 3UY8A 1Q7ZA 2DZTA 4ZBCA 3DFQA 4PR4A 1PO9A 4C1NB 1GJUA 3QV9A 2CZEA 1AD1A 1V0LA 4TUFA 2I17A 4WQ6A 1ZENA 3QLDA 3VIMA 3W7RA 3SI9A 2NVAA 2NXHA 4JXCA 3T09A 1OF6A 2HXTA 2ZZ7A 3PTQA 3CL6A 1R3TA 2C3ZA 2I57A 1UPMB 2VYOA 3SIMA 4C6CA 5HMDA 3PUGA 1W3TA 1KXTA 3PWGA 1SQ7A 4WKFA 4IX0A 4PULA 3G5EA 1FH7A 4O16A 3JU2A 3LLDA 3JUGA 2G4FA 1CGUA 1R9ZA 4LEQA 4LC8A 2WZMA 4W5ZA 4C7DA 4FXSA 1W2VA 2I9EA 2WV8A 4P8UA 1EJ7L 1KM2A 5T8GA 1P48A 3KBJA 4GYJA 1P5BA 3NNTA 2FYMA 4BJHA 4XD4A 5TNVA 4C6BA 1HXJA 1A53A 1NP2A 3SY8A 2GDQA 2PWUA 5DANA 4HD5A 4GQRA 2VTFA 1CW2A 2D0GA 4FOKA 2BHYA 1F4AA 1OGSA 3G3DA 1AZ1A 3WDPP 1EX5A 1S2UA 4E2OA 3GG8A 3MVIA 3AS2A 2XHYA 4GINA 2NUYA 5F4WA 1RD5A 5J04A 2ZKMX 1P1XA 3DOPA 1YDNA 4Q4QA 3C2YA 4HHHA 1VEMA 5AFDA 2WW5A 4FXJA 1F2JA 4RW5A 1CEOA 1LRQA 4Q32A 3CYVA 3TA6A 2J7HA 3PUDA 4MNLA 7REQA 4PMUA 4D6EA 3MHFA 3T7VA 5IDZA 3D47A 3KZPA 2OX1A 2ZUSA 3IV3A 3UPBA 2DSKA 2E68A 4Q8MA 1TPVA 3QN3A 3QMSA 1WBHA 2VFHA 1R2TA 1RQBA 4K7YA 3W26A 3B0VC 1S2TA 5D2XA 2EEXA 1B3XA 2D24A 2PCEA 2ATSA 4XKMA 3C52A 4AYSA 4BWLC 3MI2A 1E6NA 5FEPA 3QZEA 3MBFA 5CJMA 2EPKX 3UXIA 3STFA 3LS9A 3TP4A 1TWSA 1AFSA 2ZA1A 2ZRVA 4FOJA 2X7VA 2UV8G 1EHAA 3SGUA 4V28A 2HE5A 3NTYA 3GDKA 3PZIA 4GY0A 3VX1A 5CSRA 3VOFA 3EOSA 4NIRA 3RNDA 4ZODA 3BW4A 4KEVA 2IQDA 1JUEA 3I68A 2VWSA 1J0ZA 4EXQA 1W5QA 1UR8A 1HJVA 3FSTA 1AQ0A 2ZX6A 3GIPA 3ANYA 3G6MA 1TPUA 3GWQA 1UC4A 3P2VA 5FAJA 5HJYA 2J79A 3OGRA 4WDWA 4NT0A 2B7OA 5IHSA 4X9YA 4UCFA 1CBGA 2E6FA 4J9JA 4AW7A 4K1GA 2QCCA 2VFFA 1HJQA 4U10A 1ICSA 1DYSA 4A2RA 3HG5A 1XKJA 3MJYA 3L12A 3LLFA 5KZEA 4HN8A 1RBOB 1H1ZA 1JZ7A 4EOUA 5HXMA 2GSHA 1EDGA 1Z32X 4ADSA 5HQLA 3HMCA 1LL7A 3ALGA 4PUNA 1P6BA 1OIFA 3O8AA 1GOKA 3F5JA 2ZVRA 1JFHA 4GK8A 1P7TB 3C8FA 1NFGA 3ME3A 2FDMA 3S1WA 3OYZA 1VFLA 1E9YB 2Y89A 4A22A 4RPPA 1RSCA 3KFTA 3Q4DA 4O14A 1X8CA 3N3TA 4HZ6A 4FZIA 3B8WA 4JTAA 2XUCA 3ABQA 3ZMRA 3O07A 3W28A 1FHDA 4MNMA 4TU1A 4B3KA 3B0PA 3P81A 3CIWA 2TAAA 1JF6A 3ZLHA 2QKFA 1CLXA 1TG7A 3L4UA 4E38A 3IIOA 4PUMA 4TVDA 2BGSA 3MMTA 4FF5A 2G37A 5F4SA 4XK2A 1QNQA 1Z8AA 1B90A 2OJPA 3S47A 3U7BA 1ZBCA 1X6UA 4EACA 4HPGA 4KWWA 3E5PA 1UZ4A 1YX1A 8XIMA 4TV5A 1JYVA 2OLAA 3ZJ8A 4WX2A 1H1YA 2IKGA 3EOUA 5FESA 2P50A 1GHSA 1RQHA 1CT5A 4H1ZA 4IGSA 1C9WA 4FK9A 4FXRA 1FWSA 4O0KA 3EMZA 2VCAA 5J5RA 4LCSA 3BAXA 3O3RA 1H5YA 2BMBA 4Y2WA 5FEXA 4UTKA 1E6ZA 5K9XA 2HWGA 2VZOA 4Y9NA 3BGJA 1H09A 3M0JA 1LLWA 4LB3A 2J88A 3W7EA 2ZRZA 2OSWA 3OVPA 3DAQA 1GQLA 3K1GA 3U9IA 1OT1A 4M24A 1XBXA 3DBPA 4LBUA 5PTDA 3SQSA 1R2SA 2XSBA 4DUWA 3NQBA 4B90A 3BAJA 1KXQA 1PYFA 3FW6A 3W1AA 2HBXA 3AMLA 4H4IA 2YW3A 1J12A 4KIEA 3VNMA 4MM1A 1WZAA 4LF2A 5G2HA 2J9XA 2YCIX 4IL2A 3FA3A 3FEQA 5AYYA 4W4QA 1WAUA 4AZ7A 1E4NA 2PE4A 4WR3A 3SSJA 2QT3A 4QG9A 4O4WA 5DLCA 1ESWA 5CGTA 3EB2A 5CLTA 2J77A 2PZNA 3MJMA 4HA1A 1OF8A 1RZMA 3W1PA 2AOSA 5I77A 4DB7A 1TV7A 3TYUA 2FPTA 2XZ9A 4YYCA 2QJNA 3FS2A 4L9YA 2NQHA 4HIBA 3BO9A 1XM3A 5CQ1A 3RLUA 2PLCA 5C55A 4HU0A 3NEVA 1GZJA 1WDRA 1OEPA 3KCLA 2NUWA 3BCJA 3IUIA 3DEQA 4PUJA 4B2DD 2QDDA 1PZ1A 4XV0A 4MADA 3OZYA 1UB3A 3GNPA 4IMGA 2GUYA 4Z42C 2AMXA 2ZCGA 4LU0A 1W1VA 4O54A 5EFDA 1R7OA 1AD4A 1TE6A 2VUNA 3A4JA 3P84A 2E77A 1ZBVA 3AI0A 2R14A 2YA2A 1XX1A 4DJDA 2V2CA 4AD3A 3SRHA 3SSZA 1TMQA 2E9LA 1O1HA 2GSJA 3BGGA 2X0HA 3VDGA 1EJRC 5A2BA 3PZMA 2HISA 4CQBA 1R5YA 4KT2A 1YDVA 4RZBA 1IEIA 2DQXA 3DFSA 1PBGA 5AHIA 2FQIA 1RCOB 4CQDA 4BQ2A 1F9CA 3Q37A 4GACA 1FDZA 4FIQA 1ENUA 5D38A 3H26A 3ZJ6A 2Y5SA 3G1AA 3RJYA 1GVOA 1TJRA 1ITCA 4XTDA 2RJGA 3CAQA 3PANA 1AH4A 2XM1A 3WNPA 3BSHA 3HF3A 1SZRA 2HRWA 4US6A 1IXPA 3S4TA 4JTLA 4UTUA 1WOBA 4AHQA 3GDLA 4AC1X 5FJJA 4I9AA 1M1BA 3MUZ1 3CEUA 2OZ0A 2D1ZA 3UWZA 5A2CA 2QCLA 3HQ1A 2BODX 3GLCA 2QYGA 3WD1A 4FLOA 4KERA 3SCOA 2VVNA 4DBDA 4NILA 2OZ8A 3I7RA 4K8EA 3TC6A 3F03K 1WKEA 4AWTA 1VIZA 3N2MA 3VGHA 2CLHA 4LAOA 3VZZA 1KTBA 3ZT6A 4UXDA 3BZGA 3ARXA 4IMFA 3RN6A 4K68A 3GB6A 2YL5A 3NWRA 5HPOA 1WZKA 1CGTA 1L2UA 4C6EA 1UKTA 2X16A 4H9ZA 4ZQNA 2TRSA 4WHBA 3ABRA 4JFWA 3A24A 4P5UA 4YWIA 4A3RA 1EX1A 3N34A 1H63A 3GHSA 1Z42A 3VGDA 1CXIA 1KM4A 4TIMA 5KSWA 3AO0A 1XH1A 3IACA 3ZQ9A 1PZ2A 3M0HA 4J2MA 4MUPA 3A22A 3IPWA 4ES4A 4G1NA 3CLMA 4YS1A 4DZAA 4DNHA 5D2TA 2HVOA 3LX9A 4WCJA 2PDLA 4PMJA 3CUJA 3ONBA 1NU5A 2GOKA 3S46A 3P80A 1HFBA 1OADA 4M19A 2YZ5A 2XIMA 3AMDA 3BUVA 5IHRA 2O7SA 3IAPA 3VOIA 1KV8A 2J66A 5A2AA 1DWAM 3O0FA 1RVGA 3BH4A 3K4AA 4KESA 1SZNA 5EMJA 1ICPA 1EDTA 3ZO9A 1A80A 1UBPC 2V5KA 4MLJA 3MCMA 1LUCA 2OX4A 4PE8A 1CNVA 4KFOA 1KM1A 3FGCB 2GUUA 3DN5A 3TV8A 2CKSA 3S6DA 2A7PA 1GOOA 3ARRA 3PBGA 4Q8QA 3W6MA 2UY3A 1MW1A 3PPGA 1I45A 4P7RA 4I7WA 2GQ9A 3NQCA 2IW0A 4Q8OA 1ECEA 3QV8A 4N4PA 4GCAA 2Y85A 4JTCA 3DKJA 1U83A 3NYDA 5BWAA 4IOTA 2A3HA 4U5KA 2XH7A 1UP0A 1TV5A 1EYWA 2F9RA 4O10A 4DJED 3AS0A 3KXQA 1DQUA 3LB0A 3LY0A 1JL8A 2HZGA 2ISSA 2V38A 2BWGA 4PCTA 1TX2A 1H7PA 1TWZA 5CSSA 1NH6A 1ZL1A 3V5OA 2CCRA 4H9XA 4JTJA 1B5TA 3ITLA 2DT0A 4H6EA 4Z1DA 1XLMA 2FIQA 4TMBA 2FGZA 3NVDA 4J7RA 2V2DA 1VHNA 5AYXA 4BHYA 3AUOA 3C56A 3VAVA 1QVBA 3MY9A 5HWJA 2Q09A 3O06A 4GQQA 4ASTA 4FNUA 2EG6A 3CPGA 3D0CA 3B03A 4O4VA 3VD3A 1NWUA 3GXTA 3SN0A 3F2CA 3G1DA 1OM0A 2EPLX 4C65A 1W3KA 3GVRA 2YX0A 4MIMA 1ZZMA 3R12A 3GTHA 2A3BA 1Q6FA 2A3EA 4E6MA 2ONEA 1HKKA 4A8RA 3ABZA 5I0DA 2FLIA 3WJSA 5L9FA 4H7ZA 4UNLA 2PD5A 4Y6GA 5A8QA 4LVAA 2B4GA 2REQB 3CT7A 5CPNA 3LNMA 2EGZA 3BCFA 4XVDA 4JHZA 2FZBA 1ZJHA 3W07A 2XGZA 2B31A 2J24A 7TIMA 3ECQA 9XIMA 1LZOA 3SURA 2XTKA 1EIBA 3OIXA 3LRMA 2VR2A 4L61A 2R1MA 3DX5A 4N9DA 3MUIA 3AIRA 1VJIA 4NY2A 3ZXWA 1OQFA 4UTWC 5IM51 3FAXA 3GH7A 1BYCA 1DE6A 2CLOA 3UG3A 1QOPA 4TOQA 1K7FA 3WG6A 1E6QM 3VFLA 4Y8EA 2XVPA 3GXMA 5JMUA 5HQEA 3MSGA 1MNZA 4NHVA 1W9PA 3M41A 1JZ8A 1C8QA 3L4XA 5EU9A 3HV9A 3R7MA 1TUFA 2ISDA 2QCFA 2BY3A 4FLSA 1AL8A 4HYRA 2P88A 1LTDA 4IQLA 1NOWA 4MKSA 1EC8A 1WAWA 3OW1A 4MWAA 1XR2A 1MUCA 3KCOA 3ARTA 3NXLA 3S9IA 1W3HA 1SUXA 1BVWA 1FFQA 4HMEA 3W2LA 1Y5XA 4L5ZA 1JPHA 4XSLA 1G7UA 4RV3A 2J8FA 1J4EA 4YCPA 4AC7C 4FEZA 4D2JA 4AZBA 4MJZA 2FVLA 2NQ5A 4H8NA 2OMAA 2OODA 3GC5A 2GDVA 1A5NC 3B0UX 2FPYA 4GCXA 4DPPA 4S3DA 5HR7A 1EPXA 3UJEA 3ZYZA 3QXBA 2EO7A 1FCVA 1RA5A 4NUWA 3BAIA 3FXGA 4MSSA 4XZNX 2EXOA 4JFUA 3BQ5A 3KOWA 3VDBA 7ENLA 1KRBC 4N6FA 1ME7A 3VIJA 3ZWSA 3SQMA 2J27A 1XUZA 1CZ1A 4Y90A 5DO8A 4KIRA 5EMMA 3EYPA 3UWVA 1ZB5A 3P8JA 3EOOA 5FIPA 4I7VA 3NSMA 3LCWA 4DJFD 1I2OA 4GI8A 1J2WA 3TQ0A 1V6VA 4AVNA 3TN3A 3E0WA 3ID7A 4ML4A 3H2OA 3UZXA 1JPMA 4ZFMA 6A3HA 1EBGA 1OD0A 3NSXA 4RX0A 4GVHA 1QATA 4Q4SA 3CTLA 3LXAA 5C9UA 4KEMA 4PMVA 2BASA 1HG3A 3GY1A 4AEEA 1ADOA 4Q8UA 1XIEA 1YTDA 1IYXA 2X41A 1JJKA 3WK3A 3W29A 2GL5A 1EBHA 4IFKA 1XGZA 3TYDA 3SCQA 4GISA 1V8EA 1PIFA 3DUGA 1Q6EA 2UY5A 4ONVA 3BLLA 1S3TC 3W7JA 3OOQA 5A6BA 1DIDA 1PDZA 3VPLA 1IIHA 3IGXA 2XPKA 1GQKA 1IT7A 4AF0B 4HK7A 3PUEA 4FLRA 2RDTA 1FUYA 1CB2A 3VUPA 2VURA 1TYGA 2ZICA 4NVTA 3USZA 1Q13A 3HPFA 3POHA 1JVNA 1IZJA 1RCQA 3IJIA 1QJWA 1F8MA 2EJ1A 1MZRA 4QFUA 4P00B 4CNUA 2FZ9A 3HZ3A 3SUTA 3WQFA 2GWNA 3B05A 4CNSA 2CITA 3OBEA 1A50A 3FLUA 4H9VA 1JNEA 1MXGA 2MNRA 1RH9A 4UC5A 1TTIA 3ZSSA 3RU8X 1G9HA 4IGNA 4C91A 1BRLB 2DZSA 4W8BA 4H8HA 5HAOA 5HMFA 3CZKA 2Z1VA 3OB8A 5C2XA 2PRLA 1KFLA 1X1NA 1ME8A 1A0DA 2QF8A 1BG4A 2FB3A 7TAAA 3WX7A 4HJWA 2J8GA 2VEGA 3GVWA 1GZGA 3B8DA 3EX3A 1E73M 5A6MA 3CUHA 1XDJA 2XWDA 1Q6GA 5BRPA 4IPNB 2QW5A 4U3AA 2I16A 5CAHA 5J5DA 3TW9A 5CZJA 2EG7A 5DF0A 1YPFA 5AN7A 4GZJA 3KOXA 3O7UA 2XVLA 3E2QA 3WMCA 1K8ZA 1XLCA 5C0QA 1QW8A 4GH1A 5HUPA 5LNSA 3EWCA 1UPPA 1Q4NX 1RBAA 2BHZA 4RNIA 2XG9A 3WBAA 4BF7A 4BK9A 4F40A 1C29A 4M6QA 4XD3A 3M07A 1HO1A 1VCFA 4Q7BA 4AVOA 4I3GA 1JIBA 3GU2A 2BX7A 2UY2A 3ITCA 3A21A 2CBIA 2J7BA 2R1LA 4JS3A 2QJHA 4CN4A 4ERAA 3IJLA 3VOHA 4M5PA 4ENLA 4HYWA 3AHXA 1SFLA 4WVXA 1O66A 1XDLA 4EIVA 3CEPA 5TQLA 8A3HA 4PGLA 1B30A 1ZCCA 2C1HA 2JALA 1Q85A 1ME9A 2HK0A 5D2VA 2E9BA 2C16A 4BZYA 3DI1A 4Q7NA 1UUQA 2ZIDA 1SO3A 3QV6A 4R27A 1WXJA 1P0EA 4KGJA 1OCJA 3TIMA 4L1GA 3QR1A 1X7IA 2VRJA 2W6RA 1OB0A 4UTLA 4ATLA 3RRAA 4PUKA 1BPLB 3T0DA 1QAPA 1QOXA 1B31A 3QR0A 4TO8A 3SY1A 4L4OA 3NZ1A 4L4LA 3UPMA 1E4MM 5AC7A 3S5OA 3FVMA 4CD5A 1OVDA 3W7NA 3BSGA 4NJIA 3O0KA 4UMCA 2ZX5A 4AXKA 5DT5A 4N9CA 1G4PA 1GEQA 3HGJA 1CIUA 4YIWA 1K6WA 3L5MA 4UFJA 3WJWA 4KCWA 3Q2DA 2Q3OA 5K2ZA 3SW6A 3FYOA 4S3GA 5EY5A 1OIMA 1FHUA 2VENA 4HSNA 1MEHA 3BJTA 4C6DA 1Z48A 1T41A 2ZZ3A 1POJA 3TX9A 3JRKA 4J27A 3UJ2A 5EMKA 2A7NA 3NGJA 1F3TA 3HB9A 3A5FA 4ERGA 1REQB 3EWWA 2C79A 3W2UA 2AL1A 3S9ZA 1IIGA 1ONXA 4JIPA 2Y7EA 2X09A 5FSDC 3QMRA 4H41A 3RX3A 5C9ZA 1CI1A 4HHMA 3LHUA 3QKEA 2GQ8A 4UQ9A 3W1UA 3PPCA 3AWOA 3GFYA 4WRHA 1W5OA 3GRIA 3KX6A 1JCLA 4DLMA 5BZAA 4OU1A 2YL8A 3A5VA 5A3HA 1VKFA 2BVWA 1OCNA 3WJYA 5FF2A 2WSPA 4RNHA 2ZE3A 4GLEA 1VZWA 3W2JA 3VFCA 3EB4A 1POKA 2EKGA 4OT7A 3T0TA 4NZCA 3TW6A 4AWSA 2PLMA 1JZ5A 2Q8XA 3A3HA 1GOWA 1BAGA 1SJAA 2X42A 3VNKA 4JD4A 4TX8A 1XLFA 1O5QA 2B81A 3BE7A 1CGVA 3DECA 2WCGA 1V6UA 4AAJA 1R47A 3KRUA 2YPIA 4O1AA 4FAMA 3CLWA 3INPA 2YCEA 2C18A 3KVJA 1OZQA 2XM2A 4GVGA 3LOTA 2DV0A 4DWSA 3UFYA 3K4DA 2WM1A 3FHQA 1RAKA 3LUTA 3NO1A 4IQEA 3PULA 1EA9C 1XIBA 5AHEA 2HSAA 1GQJA 2D22A 3R0UA 1YBQA 1F8IA 2YCLB 4FX8A 1P4CA 1QUMA 2V82A 1B3VA 4XZBA 1XYFA 3AZSA 4RDYA 3UY7A 1UWIA 3P5YA 3NO5A 3MCOA 1NQ6A 2YDAA 3KHDA 2V67A 1QK0A 5JIPA 3BSMA 3QC0A 4K2SA 3FCPA 3KOYA 1EP2A 4R88A 1B4EA 2WNNA 3R43A 3S2JA 1VFMA 3WUEA 3TSDA 4F0HA 1KO0A 2YDSA 5GQBA 1VRDA 4HA4A 1OK6A 4KKXA 3U6WA 1S5MA 3D3AA 3BICA 1PE1A 4UQBA 3EX4A 4H6RA 3KL3A 1QPRA 4BI6A 3R94A 2YA1A 3IJDA 3APYA 4F2TA 3XIMA 4UMAA 3TJXA 3AFBA 1K7EA 1XBZA 3QHNA 3BARA 4MY9A 2GJLA 4L6HA 3PZTA 4I5RA 1HGYA 4BFAA 1CX9A 3VGBA 1WP6A 1WA3A 3T0BA 3AS1A 1UR1A 2VC5A 2AL2B 5CC7A 2JE8A 1VH7A 1YEYA 2WMIB 3HM7A 3VIHA 5EKYA 2NSOA 1W9VA 3O1NA 1XRSA 2NVDA 2R91A 5A6TC 1ITXA 3UWYA 4IPJA 4BR1A 5TF0A 3HQNA 1A47A 1DIKA 2QCHA 1US2A 4ALDA 5FJRA 3C2EA 1B54A 2V3GA 1OGGA 5IFPA 1C8XA 1TVPA 4KEUA 1QBAA 4DM2A 1LYXA 1VFHA 3M64A 1LOQA 5ENLA 3LV5A 1T8QA 5LA1A 5I24A 4PH6A 3W86A 1AH3A 4D6IA 6XIMA 1BHGA 2W92A 2Y62A 3IS4A 4KQNA 1DJYA 4RNJA 2P5NA 4MG4A 3EWDA 1KNWA 2G3JA 1XLLA 2DIJA 2ZXDA 4RZ6A 6ENLA 3QV7A 3OVGA 1H11A 3CO4A 2OR2A 4S2BA 4IPIA 1IF2A 3B8VA 2BVTA 3GFXA 4GQBA 5I2UA 4DM1A 4R7JA 4LGXA 3DU0A 4KPLA 2NLYA 2J62A 4PC8A 3W85A 1OD8A 1LL4A 4AIBA 3MV01 4D6CA 1V3HA 4UZSA 1PXGA 1MUWA 4PFMA 3HG2A 4LOCA 2OEJA 5C7HA 1NAL1 2O9TA 2C6QA 4ORMA 1PCKA 1W3LA 4A8IA 1U33A 2Z2BA 4LB4A 3IJ6A 5LIKX 1WO2A 3SGZA 3GNOA 2DPEA 4QLLA 3W23A 4XIAA 3VNIA 3PK7A 2VQUA 3CIVA 4MZYA 4AD0A 2VXNA 3FJLA 3DYOA 3IK2A 3G8RA 1JDEA 2C15A 3C2VA 3Q58A 1H7NA 4CNPA 4LAUA 4D72A 5K9DA 3AUJA 3VM7A 2PU1A 2ZUNA 3VIPA 3U3HA 1H50A 2PF0A 2RKXA 4PRRA 3W2KA 3GG0A 4WLCA 1QPNA 3WD0A 3WYZA 4P7NA 3EWUA 1QW9A 4Q6JA 4M80A 2YW4A 3CTTA 1Q5MA 5LGXA 2QJJA 3AMCA 4UCGA 1H49A 3VM5A 2D3NA 2ESCA 1PUDA 3WQOA 2VKZG 1LWHA 1IEQA 3FYPA 4C5YA 5ABEA 4JIHA 4NQ1A 4HMCA 1NDWA 1LRNA 5FL0A 4ZE4A 1RLDA 4M81A 5B80A 4XD5A 2QDHA 4QE1A 1HL8A 2VGFA 4B5UA 3RXZA 1KW1A 2NQZA 1E0TA 4NZJA 3CZ8A 3H2EA 3N6JA 4GBUA 3ZVHA 3PC0A 3N17A 3R13A 1J0JA 4O18A 3N25A 4DWDA 1QHZA 3KTXA 1ISWA 3CV7A 2PC8A 4UOJA 3OLIA 3ZR6A 3QF0A 1NQKA 1HKIA 4FNSA 4B5SA 3K5XA 4LXFA 5JUVA 1TZ9A 1AMKA 3IAQA 4HNTA 3EPOA 3KBWA 3W01A 4PMZA 3CV1A 3PR2A 4X22A 5C9RA 4NZ1A 3CUZA 1JCNA 3GDMA 4M6PA 4NF7A 2NQLA 4M51A 3WEZA 1HX0A 3BZJA 1S3HA 1ITQA 4HNNA 1W54A 4IMAA 5DBTA 3Q45A 1DBTA 3NCOA 1VLIA 1PSCA 4P8WA 3ARYA 3SJNA 2Z00A 2JIEA 5E6ZA 1JRBA 3VNLA 5E0KA 4G7FA 3BAKA 2HJPA 2TPSA 4O1DA 3L4VA 3VMNA 3SCPA 4QLJA 1E1FA 3B97A 4B9YA 4NZFA 1LG2A 2A6NA 4LUSB 3EPMA 1OFRA 4UOZA 3MP3A 3WQEA 3M6DA 1TCDA 3CNYA 2YYUA 3GTXA 1SZGA 3F1QA 3ZT7A 2YL9A 5EMYA 2AKZA 2V5DA 3NQAA 1HUVA 2D0HA 1BG9A 4AG0A 2ZUVA 4R33A 4JTTA 1SPQA 4GNKB 3QQWA 2XVGA 6REQA 2ISVA 1VR6A 2JQXA 3DHPA 3U2EA 1TQXA 4QG6A 2P8BA 1VYSX 4ZB2A 4HZ8A 4HBKA 3FOKA 2INZA 2VC7A 4ZB0A 2BZNA 5IRPA 3APTA 2BB0A 2HBVA 4DWSD 1S1RA 2V3EA 4CVUA 3CQHA 5LNUA 1MDRA 1T6MA 3U5UA 4V33A 1O60A 4F48A 3MP5A 4JZ5A 3FA5A 3HMJG 1FCQA 1QK2A 1SZEA 4C6KA 1H1NA 3WLQA 2VRKA 3CGTA 3RMJA 1TWDA 4MNJA 3ANVA 1F3EA 4IICA 2F6XA 1E1CB 2O4QA 1A5LC 2IPJA 1V51A 2POZA 1US3A 3WD4A 1Q63A 3SAZA 2QVHA 3VKJA 1AJZA 2GJXB 2QS8A 4H2HA 2WQDA 2GGIA 1KQYA 2Y2WA 4FNPA 2XU2A 1K3UA 1RP8A 1V3KA 4MUZA 4E8DA 4XWUA 3B8SA 1V02E 3FY1A 1XS2A 4JEJA 5JH1A 4FMVA 3VU2A 2ATMA 2PFHA 1YRRA 2GVYA 2CBJA 2Q02A 3OZPA 3TN5A 5DRIA 3TTYA 3UR5A 4FXFA 3HPAA 3WBXA 1JI1A 3L65A 4HYVA 3TSBA 2PRHA 3P0WA 4NXKA 2VZTA 4HJFA 1KCKA 4E3VA 1PHQA 4QQUA 2YYTA 3OTRA 3EKZA 3WBYA 2AQWA 2DSVA 3Q94A 2QZRA 1GVYA 3FIGA 1F05A 1PKNA 4TR9A 1M9HA 3UQNA 1OX4B 3VOJA 1DV7A 4QR6A 2QJMA 4CNOA 1FX6A 3WMSA 3I4KA 4XUGA 1SM9A 1L6FA 2HXUA 1AQFA 2CBUA 2O92A 1ECQA 4O19A 4GA8A 1TZ7A 4A4AA 2JEPA 3M9YA 5IDIA 3H4WA 3KTSA 3SDOA 3L4WA 4S1FA 3ORWA 3S5SA 3MO4A 4CN1A 4W8AA 3TN4A 5AHMA 4KH2A 4GGBA 3LSBA 2UZ9A 3MI6A 3KLLA 1K4GA 4K36A 4PCSA 4UOQA 3QJAA 3PHAA 2H8ZA 1SW0A 4GX8A 1VBUA 1RBLA 1XINA 4GBDA 4EWND 1T5AA 1BWKA 1HKJA 2V5CA 3OJGA 3OA3A 3SECA 1EZWA 2VGGA 5DMMA 1A0CA 4RE0A 4W84A 1XYCA 3EDJA 1DJXA 3MZNA 4Y9AA 5A6SA 2XH4A 3UVAA 3CB8A 2Y6ZA 3EEZA 4DNMA 3CHEA 1U1UA 2VEPA 4PUWA 3DYMA 1JG9A 3S83A 5LNWA 5C9XA 3VABA 1FVPA 1QRQA 7PTDA 1QPKA 4QX4A 3TTQA 1BWLA 1NEYA 2OO0A 2VD9A 1ZY9A 1GQIA 5ABGA 1AW5A 4AZ5A 2DJXA 4RK8A 1GKRA 1U1HA 1KKOA 3GR8A 3BCDA 1EO5A 1XLKA 3WLSA 3KP1A 1Q45A 6ALDA 1N55A 1AW2A 2ABBA 4H6KA 4UTMA 4GPNA 3NO3A 3KL5A 4H9YA 2FHBA 4HNOA 4O17A 3QTGA 3K1DA 2WZHA 2PGWA 3W7CA 3E38A 2IS7A 4L80A 4F3HA 2Z6IA 4R34A 5ABTA 2MANA 3H8AA 4RR4A 4BEUA 2I5IA 3MSDA 3H22A 1YPXA 1R38A 3W1RA 1PKYA 5TAOA 5XIAA 5HQMA 4JDYA 4RE3A 2ZRUA 7ODCA 4Y96A 4UTHA 4F66A 2G97A 5IXEA 4I7UA 1UZHA 3N2CA 3S1VA 2CWNA 1VS1A 1YBQB 1GUVA 3G1SA 3IK4A 2E7FA 4ZZ9A 3EWXA 1S5VA 3DG7A 4C1NA 3W7HA 6CGTA 1OHLA 2WJZA 4Z2KA 3KM8A 2OT1A 4B4HA 5A6BD 3MKKA 4KMQA 4WGXA 1DP0A 5HMSA 3UZJA 5BNKA 3HFYA 5CSUA 3GVGA 1O6IA 5XIMA 1TR1A 5BYWA 1PPIA 3DXIA 1JF5A 3V75A 1XLIA 4MGGA 4F4RA 1IEXA 3LQGA 1KGWA 4J3ZA 3AYRA 3TYBA 3YPIA 2H9AA 3R5EA 4M29A 4MYAA 4NNCA 2CXGA 1LORA 3LM3A 4LVFA 2QHAA 4DY1A 4RDZA 3FX4A 1J10A 1UA3A 4LW7A 3ELFA 1JFXA 3HIJA 1BF2A 1SR9A 4C5ZA 5M3WA 2BNJA 1JAKA 1GZ1A 3WSUA 4F0KA 2OGYA 3G1XA 1K9FA 4R7OA 5I78A 4LX4A 5LHFA 3OIHA 5A69A 4UQDA 4FX6M 3HQOA 4HZ7A 2PTDA 1R46A 3WH9A 5BWFA 2Y61A 3SCSA 3TTOA 1D3CA 4WXZA 4ZFCA 3CMFA 4M6UA 1KFCA 3KRSA 3GU9A 3VOGA 2C0AA 3GAYA 3L68A 3NM1A 3KS5A 4E3TA 2DT1A 4XKYA 5C2CA 4DWSB 3BAYA 5AC4A 1R9XA 3PTKA 3NQVA 3O6CA 3M0KA 1Q66A 1W37A 3C2RA 4PTWA 4ROQA 3GDTA 2P0OA 3OBAA 2VFIA 2RGMA 1L6YA 1UKPA 3IJ7A 2CLIA 4GMEA 4W7WA 2PDIA 2VWTA 4CKQA 3GBDA 4KWUA 1H62A 2QPSA 2VT0A 1UZ1A 4O8AA 2WKGA 4GHRA 9CGTA 1SSDA 4OKDA 1Q2SA 1UH4A 2HS8A 3SBFA 3P5ZA 3B0XA 4UFHA 3FNDA 2WPGA 1TB3A 3FVDA 4JTIA 3PB0A 4S3BA 1MDLA 3DG6A 3SFWA 3W6LA 2Z28A 3DHDA 5HUOA 3RF9A 1OK4A 2C71A 5CH9A 5GVJA 3F5KA 1V0KA 5LGZA 4P61A 4CU6A 3CS2A 3AJXA 3O63A 2PDHA 1EJSC 3PWIA 1OFPA 3TQVA 3KDNA 1FKWA 5E1QA 1ALDA 1QMLA 3L2IA 3KBVA 2WWDA 4DBUA 1ZS2A 5E09A 3WL0A 3SEPA 4GC3A 4XZIA 4QDWA 1TRIA 1V77A 3V7PA 3W1QA 1E0UA 3VNYA 1WUEA 2OYMA 3DI0A 1FXPA 1GKQA 2HVNA 2YCJA 1PKMA 1VEOA 4CLMA 2DJLA 3PBVA 1QXLA 1O68A 4QISA 3M0MA 3P67A 3M46A 2AL2A 4KRUA 4NAFB 4H01A 4H04A 5C6MA 3LXBA 4IT1A 1TO3A 4DHGA 1DJIA 3AHZA 3WELA 1GVQA 2OB3A 1XI3A 2BS9A 1DEDA 1ONWA 1J5SA 2P8CA 2OEKA 4J3WA 4DBSA 2IPWA 4KRTA 1EIXA 4MFDA 2RDXA 1JULA 3MWCA 1N8WA 1IZCA 2IPGA 4MPQA 4U28A 4U2ZA 1EWDA 2EQDA 1UD8A 4GIYA 1TCMA 1U30A 2DVTA 2HNEA 2PWGA 2ZWYA 4GZ7A 3BPWA 3APGA 5M17A 1PVNA 3MSRA 4ZEPA 1TKKA 1OBAA 5FEWA 4NYUA 3LCFA 1OGBA 1GKPA 1DIEA 2VX6A 2A3CA 2WKLA 4WZHA 1WV2A 5CZKA 1JNDA 1V02A 4BEQA 3CL7A 1HJWA 2GYIA 1LWJA 1R6WA 1KFBA 4XZMX 2PF8A 1KRAC 3UCDA 1FDJA 1TPB1 4UNIA 2LLEA 4CQ9A 1JCJA 4BF9A 3MUY1 1BKHA 3N4FA 4AMCA 4O15A 2ZC1A 5I02A 4MTVA 1TJ1A 3WFLA 2Z29A 3WFZA 1PDYA 4K39A 1O94A 4ICCX 1KV5A 4QROA 2NW0A 1S2AA 5E0CA 2J7CA 4CU8A 4FA3A 1V4YA 3PBUA 3DDMA 2XFWA 4URIA 4LV4A 3CZJA 1J2BA 5I23A 1XPGA 2BOGX 1SW7A 3BG5A 3W7QA 2J8TA 4HP5A 5FEZA 1TV4A 2QCGA 5U4NA 1UR4A 1A5CA 4ATWA 4GYPC 2WQPA 3HOJA 3L4TA 1AJ2A 3W3OA 1KCXA 2VELA 1KXHA 2VFEA 4AIEA 1NOFA 3HG3A 4NJHA 4P7OA 1TTQA 3W7MA 4GY7A 2OQHA 2PAJA 3MSYA 3WY1A 1EEXA 3RGTA 4V1YA 4ZA0A 4IMDA 1VJZA 2DZXA 1P0DA 1C7SA 3THQA 2ADAA 3KVMA 2FGBA 3GHUA 1CXLA 3QC3A 4IQDA 4JNMA 3OVRA 3TW7A 1GTEA 4MOZA 2OPJA 2Y5JA 4RZ4A 3V5CA 3N11A 3SUWA 1FA2A 1TMLA 4AU0A 3ZM8A 1MEWA 3TR2A 4QGCA 4GJJA 2XJ7A 4WXYA 2Z1SA 1NARA 1RP9A 4S3AA 3DYPA 4ZOAA 1ZFJA 2KZHA 2OLHA 2VCBA 4LTSA 2GJXA 4MF4A 1M7XA 4KETA 5BMXA 2ZTJA 4HPJA 2BTMA 3U57A 1TTJA 3A12A 3UVIA 3N12A 4CVWA 1RHCA 2VRQA 5AKQA 1BEUA 3LA4A 4Q33A 4PYSA 1OYAA 3P82A 1DOSA 1LRTA 3A4XA 3WO8A 5TIMA 1WDWA 2XFFA 5BU9A 1F6PA 2PB1A 4NSBA 1YTEA 1WZLA 2YBUA 3V18A 1QU4A 2OWXA 1UJQA 4K6AA 1QWGA 4EXAA 2F2KA 3NQ2A 3GTNA 3M5VA 4KGLA 3RCMA 1FH8A 2GDUA 3GBEA 4DAIA 3WDRA 1E5NA 4AD4A 3IGHX 3S9YA 5LXEA 3LI1A 3PS7A 4R9XA 2WLZA 3FFSA 2OWCA 4NXSA 3VNJA 5EYWA 3EDDA 5DRCA 4LY8A 3VTRA 4NL1A 3T1GA 1DHPA 1DWHM 3QGAC 2V5LA 2A5HA 4B5TA 2P53A 3F4CA 4E4PA 2VHLA 5GPRA 2JBMA 1EGZA 5HNRA 4WDTA 1CXHA 4KWOA 3SO7A 1V3JA 1OZMA 2QGHA 1E55A 3BMWA 4MPKA 5C8BB 1KBIA 3KRZA 5G2IA 2DZBA 3GR7A 3N6HA 3NG3A 3PJUA 3G24A 4QJ5B 4L4MA 1JDAA 1CTNA 1EC7A 4ZR8A 1EKOA 4DO7A 3W7LA 3ZLFA 4G8TA 2CLMA 1M03A 4HG6B 1HZYA 2QULA 3GAKA 3HN3A 4I5XA 4CNNA 3PBMA 3BANA 4RE4A 2BHUA 2W27A 4DF0A 1V0NA 3WUBA 1ISVA 1UYQA 3PNZA 4NZ3A 2X1TA 4XB3A 3E3HA 2WJEA 2F61A 4U5IA 3QPYA 3LRLA 4C6IA 1NWSA 5U7SA 1BVNP 2YDQA 1EQPA 2UWFA 4AB4A 1QNPA 4K1WA 4V1XA 4RCXA 3T07A 1BLIA 3ZT5A 4MY8A 3WLIA 3LGEA 4A3YA 4ZE5A 2E5CA 1FWRA 4HA3A 1Q3NA 4YVPA 4QIUA 3CHDA 1DJHA 2PP1A 2VR4A 2WVVA 3U2CA 4IG2A 4O1EA 3MWAA 3LCXA 1FP8A 3EXSA 2XIIA 3K30A 2GGHA 3RFAA 1TSIA 4RDVA 1YYAA 1VIWA 2XDFA 4EKJA 4PBEA 4K38A 4S3CA 4UB9A 5CJ5A 2QCDB 2X2GA 2RFGA 2PDUA 4WOQA 4O8RA 2HDJA 2F6KA 2WSRA 5I3DA 2C19A 1QNOA 1S2VA 5EJ1B 5HJLA 4DI9A 4X2PA 2OSYA 3W88A 5FI8A 2XIOA 4MWAC 2NV9A 2Z7GA 4GUJA 4CD8A 5CBJA 3LCHA 3M0VA 4QHRA 1JCTA 3EA1A 4Q4PA 5BXPA 4IX2A 2ODOA 4I90A 2O9PA 5E70A 4HHLA 2HTMA 2L5HA 3VGFA 5ABFB 4CD4A 2WC3A 3PZUA 1H60A 1X98A 1CGWA 3AIBA 3PUOA 2D3LA 2FH6A 3O2LA 3C6CA 2E3ZA 4QRNA 3NL6A 3SCVA 5FF3A 3T55A 1EWEA 2ZVIA 1OC5A 4TQTA 4NAEA 4D6HA 3M0ZA 1ISZA 2P3EA 4C1KA 1K8XA 4XZLX 1Q4WA 1QI4A 2ZXQA 3B3DA 3C5QA 2V69A 1KBJA 1GOIA 5D9MA 4N4QA 4P8VA 4HQVA 4UUIA 2VO5A 3N13A 5A5WA 4F0RA 4YMZA 3E74A 4Z0JA 4FALA 1VYPX 1LLZA 3WNLA 1A49A 4L6DA 3EMCA 3OLDA 3KOFA 3UJRA 1IGWA 1YW1A 4F9JA 4LBRA 5FJOA 2VI0A 4DLFA 4RLIA 4AY1A 3M0LA 3NURA 4OUEA 3AHYA 5CC3A 2YKKA 3L67A 2PRMA 1EH9A 2PDGA 1W32A 4WJ8A 4F79A 1PIGA 5A8NA 4IUGA 1A3HA 4GQ0A 4LQ1A 4JN7A 1DTUA 2INEA 2XN1A 3RO6A 3QH2A 3ABSA 1XSKA 4MWAB 2YA0A 3BLKA 4ICMA 2XGIA 4AD1A 4WF7A 1KCLA 2J6VA 3M0YA 4P8XA 4HK5A 5C9WA 2X2YA 5DXXA 2FHCA 2X0SA 3B0YA 1ZPTA 3GXDA 4JBRA 1WZMA 3MDUA 3VDHA 5C2GA 1LROA 4CCEA 1WOAA 4BI5A 3T4WA 4JL2A 1PEZA 1QNVA 3KBNA 2P3ZA 1UWRA 3RM8A 5MHBA 3GHTA 3V36A 4MYXA 1V7AA 3PJWA 3RO8A 1HNYA 1H7WA 4OV4A 3ZS4A 1RK6A 4D8AA 1AH0A 1E4LA 3WF3A 2DT2A 4E2BA 2JKAA 4FNQA 2V63A 4QEHA 3N29A 2JF6A 2PDFA 1SMDA 1SW3A 3GW3A 5A1AA 1TVNA 1A5OC 4C6FA 1EXBA 3S2MA 1NSJA 3C3UA 2I9UA 2G95A 4L9ZA 4YJ5A 1HO4A 1ZNNA 4JTDA 4O1BA 4X2RA 2YCKX 1P0NA 4DJEC 5REQB 4PRTA 1MXSA 2OQYA 1OY0A 5FJTA 3TSMA 3W72A 2P76A 3UG5A 1HT6A 1E3ZA 3O15A 5F4XA 1KBKA 4D6JA 2J4GA 2QXWA 1QOQA 4PCPA 3W71A 3WK2A 3L0GA 4HK6A 4W7UA 4YLWA 5FF7A 4YHGA 5H8MA 1I0DA 4FI4A 4LAZA 1JZ6A 3PBYA 2HK1A 4IIGA 5E0FA 1QNRA 3NGFA 4IL0A 5JBDA 4EWJA 1M7JA 4LNYA 3FAWA 1UJPA 2BGNE 4AX7A 2AGKA 4ICNA 4QNEA 3L2LA 5LXXA 1X6LA 4PTXA 1P0BA 4L65A 4JN8A 2Y4SA 2C8NA 2ZBTA 4OTKA 2V2HA 3AXMA 1XQKA 4XZHA 1L6SA 1HL9A 1UD2A 1MQPA 5EPDA 1UD5A 4XVEA 4HKPA 4DN1A 3QOKA 4JOMA 3T4CA 1W5NA 1P0KA 2O56A 1LOLA 4AZCB 2PGFA 3W7DA 5F2GA 2KX9A 2J7GA 4HMNA 2ACQA 1FKXA 5HDRA 3VA8A 4GYKA 2PS2A 3WLHA 4D9PA 1ZALA 1EO7A 4O13A 4EP8C 4ML9A 4PEKA 4QCEA 2XFRA 4PCNA 4A05A 1M04A 1MYRA 1V6XA 2RH9A 1JDDA 2VZVA 1DXFA 4LJ3A 3W73A 1M65A 3PAOA 1JI2A 2D20A 3MS8A 3QFWA 4MY1A 4HU4A 2KAUC 4F8XA 4RKAA 1Z41A 4PBGA 1E5JA 1RJQA 1TFVA 1VPQA