3NSMA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 from ostrinia furnacalis
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-acetylglucosaminidase
publication title Structural Determinants of an Insect {beta}-N-Acetyl-D-hexosaminidase Specialized as a Chitinolytic Enzyme
pubmed doi rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase
total genus 185
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nsmA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3nsmA01
3AHXA 1JF5A 3WNPA 4GQQA 5BRPA 4QDMA 4UFIA 4AW7A 1SMDA 1R8LA 3AIBA 4QLLA 2YL9A 3VDCA 4ZE5A 1E6RA 3QOKA 2A3HA 3NJ3A 1QPKA 5CJ5A 2EPOA 3AXXA 5HDRA 1BVZA 3W6MA 4J3XA 2ZXBA 3BH4A 3KL3A 3MSDA 1TE1A 5HPOA 1I1XA 2XUCA 3SURA 1WZKA 3BCFA 1TCMA 2NW0A 2J7CA 3RIKA 4BA0A 4FF5A 1C93A 1Q6EA 2X2YA 4CD6A 3VIGA 5C71A 3WD1A 2YOCA 2XGBA 1BSIA 3GXMA 3WUBA 2G3JA 4AZIA 1IZJA 1MW3A 4F9JA 1HKIA 2BV9A 3RPMA 4MAVA 2NT1A 4KGJA 4IISA 3VMNA 3AIRA 4C7GA 3LPPA 5HNNA 3II1A 1V02E 4X0NA 5I2UA 1WZLA 2VZOA 1JG9A 1K6AA 1TMQA 1NM9A 1DEDA 3WNKA 3PHAA 1JAEA 1R87A 4PMVA 1TUXA 4P7OA 1HXJA 1Q6DA 4J3SA 1UKPA 2VT0A 5A3HA 3K1DA 4WKAA 3SCNA 1LQ0A 1W9DM 1MQRA 4U3AA 3N12A 3WY1A 4D71A 4U31A 3VDAA 1J0HA 1UQYA 3AISA 2VRKA 2IUZA 4F8XA 3WMCA 1BYCA 2PWGA 2DSWA 1JD7A 2BNJA 3ARRA 4MB1A 3EDFA 4AC1X 2WHLA 2BVTA 2AOSA 1YQ2A 4UFKA 1C3FA 5A6BD 4NRRA 1W3KA 3GXIA 5E9AA 4WSKA 3MO4A 3WNNA 4W8AA 4P7QA 4PTXA 2BY1A 1R86A 4HP5A 4AEFA 4PBGA 2V3EA 5D9MA 1UD3A 2J7GA 4R5EA 1JYVA 4J27A 4GXPA 2XFRA 2WLYA 1HJSA 2J4GA 3SCPA 4CU8A 2XIIA 5FL0A 1ZS2A 1EA9C 4QLJA 4WSJA 3TA9A 4AZ7A 2VRQA 4AISA 3KL0A 1ZBVA 2W92A 1JZ4A 1E15A 2WHKA 2JF6A 3PTQA 5JBDA 1HT6A 5A6LA 1XC6A 3AIWA 3PZUA 1GUVA 3UR8A 1KFWA 2X0HA 3AYSA 4UQBA 1Q4NX 3WBEA 3F4VA 2E4TA 3VIPA 4YPJA 5I23A 3GH4A 1DWIM 5C8BB 1NQ6A 2CBIA 2ZUUA 4M29A 2A3AA 4BQ3A 3NYDA 3AHYA 3G6LA 2UY4A 1JYXA 2G41A 3WD2A 3ARYA 4JCLA 5A6KA 1QNOA 1KGWA 1HJUA 3IAQA 1EO7A 1GQJA 4E8DA 2HISA 2E9MA 2OYKA 4AD0A 1XCXA 4U2YA 1ITCA 3O2LA 1KWGA 5BCAA 2VCAA 2XG9A 3EMZA 4JL2A 1ESWA 3AIVA 3WMSA 2VVNA 5DO8A 4MAZA 1HVQA 1ZB5A 4OJYA 1EHAA 2G3NA 5LYRA 2VRJA 3CUGA 5HBFA 4OBRA 5HPCA 3ZQ9A 4U33A 4UR9A 1BYBA 3AIQA 3WQ5A 1ODZA 3AZRA 2Y24A 3W4RA 1W3JA 1G0CA 3U7BA 4RE3A 2PWFA 2D2OA 4AXNA 4WLCA 2J78A 3SUUA 3WH7A 2A3CA 1CXLA 2CETA 3AYRA 3WD4A 1HIZA 1V3LA 3A3HA 4AD3A 1NWTA 1UHVA 3I3EA 5CG0A 5CXPA 1US2A 2J8GA 3ARPA 1E43A 2D20A 1JXJA 2ZOXA 1JAKA 4YHEA 2YBTA 1HX0A 4ZXLA 3OZOA 2G8ZA 4M8UA 3F5KA 3VIKA 4UQCA 4XZBA 4HA1A 1E3XA 2XFYA 3AI0A 1HKKA 2J7DA 1X6LA 2ZXAA 1CZ1A 1HJWA 3VGDA 1EQCA 3AZTA 2JEQA 1RP8A 3FNDA 4PEEA 2ZUWA 3RCNA 3OLIA 5D8ZA 2GSJA 3UG3A 3VD9A 2OSXA 3WDPP 4B3KA 3BMWA 4W86A 1XGZA 4M24A 1LJYA 1H49A 3CMJA 3E1F1 1H4PA 4W89A 1UA7A 3W6LA 1S46A 4D72A 3LPOA 3VD5A 4DWSB 1MVYA 4D1IA 4UFLA 1H1NA 1BG9A 1FH9A 2YLAA 5DEZA 1BLIA 1JDAA 1HF6A 2VNCA 4HPGA 2J79A 4J3TA 4PMOA 4E8CA 3VGFA 2ZX5A 3RM9A 1CXEA 2YJQA 3WL1A 2F8QA 1UD6A 1GNXA 1I1WA 2BHZA 4UFMA 3AS2A 1VB9A 3WL0A 1JFXA 5CPTA 4AMCA 5A69A 4HMEA 2E9BA 3VKKA 1V3KA 4NZCA 3CHCA 1B3WA 2GK1A 2XM1A 4EANA 3W28A 3SUWA 2ZWYA 3W25A 3WELA 1OGSA 2BVDA 4B3LA 3MUIA 4ZEPA 1QNRA 1UD5A 2EPLX 1V03A 2WMJA 5AC5A 1HVXA 2Y4SA 1UKSA 2PI6A 5I79A 3FAXA 4JFVA 3EDEA 2CCRA 1M53A 4MJ4A 4WF7A 1ZBCA 3THDA 4PYSA 3KWXA 2ZX8A 4JAWA 2WZEA 2ZX6A 1C8YA 1FFQA 2YA1A 4D6DA 1E6NA 1D3CA 1C8XA 1UR8A 5CGMA 5A6AA 1BAGA 1U33A 4GZJA 1GOKA 4QAWA 4HA4A 3VIOA 3DHUA 5ABGA 2VZUA 1RP9A 3OGVA 4DWSA 3EDJA 4PTVA 3L4WA 3ZSTA 2VI0A 2NSXA 1EDGA 1JL8A 2JFEX 1IZKA 3CUHA 2WYSA 3THCA 3N04A 2XVGA 5GNZA 3N17A 1E56A 3K46A 1V0KA 3WDJA 4CD4A 1VFUA 3WEMA 2WMHA 3PTKA 3WF3A 2DT0A 4TTGA 3WDRA 4PSPA 1CGTA 4JKLA 1LL4A 3MANA 1G01A 2QLYA 4MB5A 5CZKA 2XFFA 3AFBA 3OA5A 2O9PA 4TUFA 1G9HA 2DSVA 2AMGA 4PMZA 5JIPA 3KE0A 1CGWA 4ML4A 5IFTA 2QPSA 2VR5A 5GNYA 5ABHA 1K9FA 5EFDA 3L4XA 2BFGA 1QNPA 1XH2A 3RDKA 1VEPA 4MNJA 1EQPA 1JDDA 3AMDA 1EOKA 1UR9A 2GJXA 3PZ9A 3WDQA 4LYRA 3U5YA 1JFHA 1V02A 5JBEA 4IPLA 1B1YA 3CHEA 4W7VA 3O9NA 3SCUA 4HOXA 2XIBA 1UD2A 2GJPA 1TA3B 1FH7A 1WDQA 3AQUA 3W24A 2PF0A 1V08A 3IJ9A 2DIJA 5I3DA 3B9EA 1V6VA 1QHZA 3OZPA 4P8VA 4AZGA 1SYTA 5A95A 1CLVA 2XM2A 1E71M 5A94A 2DT2A 3NDYA 4TXEA 2HVMA 3APGA 3RILA 1ZBWA 1V6UA 5CLTA 3I3BA 3D5HA 3M6DA 4C7FA 4Z2GA 2E40A 5ABFB 3WD3A 4MADA 4J7RA 2VTFA 3HJEA 1E5NA 4ATLA 4E2OA 2UY3A 3IJ7A 2DPEA 3SCVA 3UCQA 1HNYA 1C91A 1W9BM 2QMKA 1HL9A 2EXOA 3WUEA 5M03A 2W91A 3VD4A 3DECA 3M46A 5GNXA 1QHPA 4RL3A 2WVVB 3MSGA 4URIA 4UZUA 1B3VA 1OGBA 4ZFMA 1QI4A 1E0WA 1AQMA 1KCLA 4XZWA 2Y8VA 2WCSA 4JFWA 1MYRA 2WW5A 4HMCA 1HL8A 2XJ7A 1WE5A 4DM1A 5F7UA 3VD3A 4PMNA 1FOBA 4DUVA 2DDXA 3U57A 1OD8A 3A6OA 1WDPA 1D7FA 3KL5A 1ZJAA 4K68A 3ARWA 2ZUVA 3WNOA 4P8WA 1UWSA 4M56A 1E1FA 2WBGA 3POCA 3EDKA 3BAWA 4GO9A 1C7TA 4W8LA 1QNSA 2VX5A 3RM8A 2WVUA 1J12A 2PWHA 3ZSSA 1TA3A 1VRXA 1V3HA 2UWFA 4MTVA 1W1TA 2GJRA 4AD5A 2ZWZA 1J0ZA 4BS0A 2YA2A 3QGVA 4DUXA 3UG5A 4J3UA 4TX8A 2VMFA 2Y8KA 2Y2WA 4JIEA 3AS1A 4TX6A 4AD1A 3N1AA 1WB0A 2J7EA 4FLQA 1U30A 3BGAA 4CU6A 3GTNA 2WCAA 1PX3A 2VVSA 3OBAA 3EDDA 1H2JA 1BG4A 4PMRA 1PAMA 3WDIA 4H41A 3AXHA 1L8NA 3UG4A 1BGAA 1CNVA 2F61A 4E4PA 3W81A 1EO5A 2VO5A 3VMOA 2VZSA 2VX4A 1CWYA 3BMVA 3IAPA 1OGGA 3BAJA 4V27A 2RGMA 4M82A 1G1YA 2G4FA 3FAWA 8A3HA 1GJUA 2GDUA 1KXQA 3LMYA 3O6AA 3T08A 1XSJA 3SUVA 2CBUA 3HN3A 1VJSA 1E6ZA 1UR4A 2V5DA 3ZJ8A 5BWFA 2GUYA 2WWDA 2RGLA 5D9NA 3BAXA 5AY7A 1E4IA 1OSEA 1JD9A 3AZSA 4W84A 2FH8A 1Y7VA 1H41A 6A3HA 1C90A 3VOCA 5FKYA 3BCDA 3NSXA 5FL1A 1L0PA 1F4AA 2OYLA 3B8SA 5GQBA 1CYGA 3GNRA 1BTCA 1BHGA 2ZX9A 4EKJA 1W9XA 1BYAA 4A3YA 3WN6A 1GZJA 1W1YA 2E0PA 1VFMA 3GYCA 4KWUA 3TTYA 1V3MA 3W27A 4JFUA 1B90A 3ARQA 2CITA 3OB8A 5EBAA 1F4HA 5I0DA 4PCTA 2DT3A 4H8HA 1B0IA 4X9YA 4CD8A 1ISVA 2NT0A 2J75A 1ITXA 1HJXA 3FW6A 2C7FA 2GVYA 2FHFA 3FY1A 3F5LA 3VGBA 1ZU8A 2WKGA 2WSPA 5A8NA 4PRWA 3T2OA 4H7VA 4OBSA 2D0GA 2GDVA 1UR1A 3MV11 1LG1A 4CCCA 2EO7A 1JXKA 3VGEA 4AZCB 4AZHA 1CXIA 2JALA 1UA3A 4F66A 4GQRA 4LX4A 1BGGA 3J7HA 1KBKA 2BXYA 4UQAA 5D8WA 1US3A 1A3HA 3L4YA 1WDRA 1HP4A 1UH3A 3W26A 4NF7A 1FH8A 1OM0A 1FA2A 2A3EA 2CEQA 5HOSA 3BAKA 2D0FA 4B16A 1LWJA 4AD4A 3ECQA 4XX6A 5A6SA 3OLGA 1MW2A 2YBUA 3QOMA 1FHLA 4J3WA 3ARXA 3RMEA 3N13A 4ACZB 2VQUA 6CGTA 2PC8A 4CGTA 5LA2A 1Q6CA 4F9DA 3WFLA 3VILA 4D6IA 2WXDM 1UR0A 3GNPA 4CVWA 1LG2A 2X8RA 1JZ8A 1K9EA 2IXUA 4UQEA 1MXGA 4IM4A 1EHNA 4A3HA 4DWSC 6TAAA 1UZ4A 5CPQA 5JUVA 2Z1KA 4CN1A 4KRTA 2CESA 1DWHM 3ZJKA 1CGYA 2XTKA 3UERA 3EMCA 1VFOA 2QV4A 2EQDA 4EE9A 5IFPA 3GH7A 1QNQA 2XVLA 5DT7A 1IT0A 1K9DA 4CCEA 3BAIA 1CGUA 1JF6A 4UOJA 1B31A 1JDCA 4FLRA 1LF1A 2DSZA 1PIFA 4TOQA 1W2VA 3GDBA 4D6GA 1J0IA 2W66A 1A47A 2WMKA 5E70A 3OLDA 4UZSA 1UWUA 1OINA 3TP4A 3ZT5A 2O92A 1UQZA 3L4TA 3HMCA 4M81A 1CTNA 2VZVA 3W37A 2D1ZA 3ZMRA 4YHGA 1EOMA 1H3GA 2OWWA 3TONA 1W9PA 3NDZA 2BY0A 2FHBA 5D4YA 4UNIA 3CZEA 3OGSA 4GI8A 2YLLA 2ZXQA 3AIEA 4JCMA 5BXTA 3CUIA 2WSKA 1UZ1A 3L2MA 1E73M 1E9LA 4PSRA 1EXPA 7TAAA 2BY2A 5E0FA 2X05A 5A6MA 1VIWA 3WEOA 3BSHA 4CUCA 1FP8A 4MDPA 1UD4A 4L4OA 1GOMA 1R7OA 1W9UA 4XV0A 1E4NA 1O7AA 3RO8A 1VEOA 1GONA 3PZQA 1JZ3A 3VIIA 3WEZA 2CXGA 2VJXA 4ZENA 3RJXA 1XCWA 3CO4A 4W88A 2UY2A 4MJ2A 1WCGA 3EMQA 5I5RA 1JIBA 1AQ0A 1WO2A 1KQYA 2YA0A 4D6CA 5M17A 5A2CA 4PMUA 5FOOA 5D9OA 2WHJA 1J01A 2FHCA 4NRSA 3VPLA 2DH3A 3PZVA 2D23A 1KWKA 1BYDA 4V2XA 4Z2IA 4GI6A 4F79A 4GKLA 4P8UA 3D3AA 3CZLA 4AZBA 2E8YA 5GPRA 4ZXOA 1UWRA 4BQ4A 4JHOA 1ODUA 1E4MM 3LPGA 3SUSA 3TOPA 2G3IA 2J47A 5JIWA 1QI2A 2WVTA 1NH6A 2A3BA 2CERA 1UWQA 2D3NA 1LL7A 3VO0A 1E6QM 2WLZA 1JI1A 1UKOA 1OWQA 5CGTA 3CHDA 1CGXA 2FGZA 2WAGA 2CPUA 1SFSA 5CPSA 5KZ6A 3CIVA 4OUEA 1QBBA 1CBGA 3G6MA 2XVKA 1GW1A 3PZGA 4PTWA 5A8PA 1EDTA 4CU7A 1C7SA 3WQ8A 2Y5EA 3A4XA 2O9OA 1W1PA 3WH5A 2YIHA 3MUZ1 4W93A 4AWEA 4LYQA 4KH2A 4B9YA 2XWDA 4UQDA 1MWOA 2QPUA 2VX7A 1NARA 1UD8A 1KB3A 1LL6A 3AMLA 4AZ5A 4BZYA 1UUQA 4OIFA 4UOQA 5A1AA 3VINA 2W63A 2ESCA 1UWTA 4U2ZA 3NCOA 3WENA 2VC9A 8CGTA 3ZIZA 2BS9A 2PBOA 4PMDA 1UWIA 4HZ6A 5DMYA 1HP5A 1BFNA 4JKKA 3GZAA 1H09A 3AMCA 1CECA 4CD5A 5AYIA 3CTTA 3UESA 3VX0A 4DM2A 2XGIA 2JIWA 2PBGA 5BYWA 1VAHA 3FXYA 3ARTA 2WPGA 1H0GA 4Z2KA 4DWSD 4UFJA 2Q8XA 4D6FA 1R85A 3WF1A 1KQZA 1ZJBA 2XVNA 1UOKA 4RE4A 3SCQA 3VD7A 4FLOA 3W29A 2OLHA 3AJ7A 2XVPA 2WM0A 1WZMA 4JKMA 3CH9A 4C91A 1TVPA 1PJ9A 2WZHA 2B31A 4AIUA 1HN1A 1JI2A 1CGVA 2ZE0A 2X0YA 4PTMA 5D9PA 3N9KA 3CUJA 1JNEA 1XYZA 5CQ1A 2FH6A 3ARVA 1UKTA 2DSUA 1BQCA 4A4AA 1XSKA 4GIAA 3WUGA 4JZ5A 1PZ3A 4N0RA 2PWDA 3DYOA 3ZR6A 5EMYA 1E3ZA 3QHNA 2VR4A 3MMDA 4AY1A 5EFFA 5LA1A 1JZ2A 2VOTA 2F2HA 5LA0A 4U5IA 3KZSA 1UKQA 1W3HA 4OOZA 1XRVA 1W91A 3POHA 3CZKA 4UTFA 1XH0A 4H8UA 4P7LA 3U7VA 1PPIA 4RE2A 5DFAA 3M07A 1VF8A 3M7SA 1LLOA 1NWSA 2V3DA 2ZIDA 1NP2A 2VUYA 4P8XA 4J28A 4NI3A 3ZOAA 1MQPA 1D2KA 3PZMA 5ABEA 4GPNA 4EAMA 2E8ZA 3VIHA 3B9DA 4TTUA 1KGXA 2E3ZA 4AEEA 4GINA 7CGTA 2ZUTA 3VDBA 1B2YA 4FMVA 3A47A 1B30A 2VURA 4WJXA 3WF0A 4Z2HA 3GBEA 2DQXA 3VNYA 2WHMA 3AS0A 1NOUA 1QW9A 3S6TA 1E72M 1J0YA 3ARZA 3WSUA 1CXHA 1OCQA 1E6XM 3PZIA 2WCGA 1B3YA 1E0VA 1KBBA 3CGTA 3N18A 4WK9A 5ABFA 3WH6A 4S3KA 3BLPX 1AVAA 1BPLB 3ALFA 3QR3A 2J7HA 3W38A 1DWJM 3VVGA 1UH2A 2ZUSA 1UG6A 4IPNB 1B3XA 1YHTA 2YL8A 1FHDA 1QI3A 4PMYA 3CHFA 2GFTA 2WVVA 4EK7A 2DSKA 5A6BA 5M5DA 3F5JA 3WQ4A 3N11A 3AXIA 1KR0A 1KGUA 4M1RA 2CKSA 1HJVA 5IHRA 4HU8A 3UEQA 2FGLA 3AOFA 3MUY1 3WBAA 4QCEA 2WVSA 2J74A 1WZAA 2XYLA 1M01A 2YL5A 4WIWA 1MFUA 4CVUA 4TVUA 1W1VA 1K9TA 4B9ZA 3FN9A 2OSWA 1EGZA 1VFFA 3WH8A 3K4AA 2QMJA 1KR1A 2E9LA 1W2PA 3GH5A 1TG7A 3VM5A 3WKZA 2D24A 5IHSA 2EEXA 2O9RA 1KCKA 3N15A 1V0MA 3AHZA 4W87A 5BXPA 3PZNA 4PMQA 4YN5A 4IUGA 3LPFA 4KRUA 3HU7A 1E40A 5I78A 3SUTA 4U5KA 5I24A 3TTQA 1OIFA 4HTYA 1HKMA 4LYPA 1GCYA 5IDIA 3FHAA 3FHQA 4H2CA 4NSBA 3MS8A 3OIHA 1M03A 5JBFA 3UR7A 3VTRA 3T2QA 1JZ5A 2CYGA 4HPHA 5I77A 1V3JA 1MQQA 5FIPA 3NIYA 1AQHA 3VIJA 5IXEA 1WKYA 1GQIA 4PMXA 4BQ2A 1NP0A 4D6HA 4FK9A 4P7RA 5FD0A 5A6JA 2G3MA 1OBAA 4D6JA 3MUAA 3ZO9A 1GHSA 4W85A 2W67A 3WFZA 5CSUA 1ISWA 3QHOA 2BHUA 2YKKA 3OG2A 2CHNA 1I75A 2EJ1A 3WNMA 1Z32X 3CZGA 2PB1A 1OIMA 2WMFA 1VBRA 2J8FA 5E6YA 4DUWA 4QLKA 3PZTA 4AIOA 2DH2A 3PZOA 1CDGA 3T09A 4KGLA 3GNOA 4C90A 2ZICA 1AMYA 1WDSA 2V3GA 3VUPA 3T2PA 2WWCA 3MMWA 3GBDA 1CXFA 2BHYA 3NSNA 3AMGA 1X1NA 4AYSA 1WAWA 3EYPA 1NWRA 1J18A 4CD7A 1EDQA 1XD0A 5BRQA 4BCEA 3WNLA 2WMIB 1DHKA 1GOWA 1VEMA 4LGXA 2WB5A 1TVNA 2ZUMA 3NSMA 1RD6A 2XSBA 4PN2A 5E6ZA 1RPKA 4HOZA 4CKQA 1XYFA 1OT1A 3ZM8A 2J62A 4ATWA 1ISZA 2D0HA 1IV8A 4W7WA 1QI0A 3WF2A 1CPUA 4PUEA 3T0AA 2ZX7A 4XB3A 3GXDA 1XD1A 1Q6FA 2EPKX 4BF7A 2BVYA 3AROA 5AC4A 2DT1A 3SCTA 4XUYA 3WF4A 1V0NA 1C92A 3WMBA 2VX6A 2GK1B 2VCCA 1ZL1A 1V6WA 4AZCA 3CZJA 1R7AA 1SR0A 1UR2A 2ZUNA 3L4UA 3RJYA 2WC3A 1MW1A 3L4VA 4WKFA 1J10A 1E0XA 1J0KA 2V38A 3ZR5A 3WH9A 4TVCA 1E70M 4LQ1A 5ECUA 1QVBA 4MPKA 1MFVA 1Q6GA 4QFUA 1W32A 3VGHA 4LPCA 1DWGM 1HJQA 4GZIA 3SCSA 2YDRA 1C8QA 1GHRA 2XSAA 2JEPA 1XSIA 2O9TA 3CMGA 4Q7NA 2J7BA 5C70A 1JZ7A 3CLWA 2X09A 5A8QA 4ACZA 3KEHA 3ZJ7A 4ATDA 2AAAA 3W82A 1GOQA 4B15A 2OWXA 3MU7A 2WZIA 2XHYA 4U3CA 3W53A 1JYWA 3PBGA 3WQVA 3ZT7A 2J25A 2YL6A 3DYMA 4AD2A 2X1IA 4WKHA 1FFRA 1NOWA 1QHOA 1M7XA 2IXVA 3DC0A 2WMIA 4HZ8A 5M3WA 1CEOA 1E55A 1WNOA 1J9YA 1V6YA 2W61A 3CPUA 3VM7A 2CHOA 2JIEA 2OSYA 3VDHA 4BQ5A 1O6IA 1J11A 4R27A 4JFSA 2FDMA 4MB4A 4QCFA 3SCRA 3K4DA 1PIGA 2C0HA 1G5AA 5E0CA 4Y7EA 1MXDA 3VMPA 2CBJA 3K8MA 3ZT6A 2YDSA 2TAAA 3GM8A 4AZ6A 2BXZA 3GXFA 2Z1SA 5A2AA 3SCOA 2OYMA 3IJ8A 2W4XA 3TTOA 5CSYA 4D1JA 1OD0A 3WQ6A 5FCZA 4PCSA 2D22A 3DHPA 5I6SA 2PWEA 2GJXB 3ALGA 1TR1A 4X0VA 1QOXA 4D6EA 1CENA 1DWFM 2V3FA 2VCBA 2C8NA 4W8BA 3W0KA 3VU2A 4H04A 1TFVA 1V0LA 4QP0A 4S3JA 5EB8A 4HOWA 3ZJ6A 1GPFA 2W62A 2YDQA 4V28A 2WANA 3U5UA 3WQWA 3BC9A 1H5VA 1JYNA 1E1EA 4KMQA 2JE8A 3L2LA 1PX4A 5E09A 5TD4A 3WD0A 3BSGA 1BVNP 3OGRA 2QHAA 1ISYA 3MKKA 4UFHA 3AIUA 1WPCA 4W7UA 1H0IA 4ACYA 4CN6A 3AHVA 1EH9A 1W9VA 4UCFA 3K8KA 1H11A 1GJWA 3ARUA 1BF2A 3SEPA 3AMKA 4CCDA 2WNWA 1E6SM 5DT5A 1DP0A 3ARSA 3A4WA 3VIMA 3S2CA 1B9ZA 5HXMA 1CIUA 2UY5A 2D3LA 4M80A 2CIPA 2WC4A 3QHMA 2BY3A 2WC7A 3CZ8A 1N82A 2OWCA 3K8LA 4FLSA 1JZ6A 1QI5A 1KXVA 3VX1A 4J3VA 1CLXA 2EPMX 4GZEA 5A8MA 4OOUA 1HKJA 1J0JA 3BLKA 1QW8A 3PTMA 1GVYA 1V6XA 2MANA 3T0BA 1GOIA 1WP6A 4OKDA 3EBVA 1ZBKA 1UH4A 3IANA 3VNZA 1U2YA 5A8OA 1EIBA 1ISXA 4ZE4A 1DTUA 5A2BA 1W3LA 2VL4A 4Z2LA 2ZXDA 2DIEA 3BXWA 2QF8A 7A3HA 3T0DA 3AS3A 5DF0A 1E5JA 5BROA 5BXRA 1QBAA 1RH9A 1PZ2A 3WUFA 3OLEA 3WIJA 1VBUA 3SCWA 4PUDA 4MNLA 1GORA 4CN4A 1X6NA 4LXFA 3PN8A 3AICA 4UQ9A 2DGAA 2CBVA 4Z2JA 4GO8A 4JHZA 4OZOA 4H8VA 3IK2A 2XPKA 1VJZA 1M04A 3SIMA 4L4PA 3UETA 2JF7A 1CXKA 1V3IA 1GQKA 1XV8A 1JNDA 3WDHA 1KXTA 5KEZA 1P6WA 1SMAA 2DEPA 4HA3A 1VENA 1NOFA 3MMUA 1E4LA 2CKRA 4HU0A 1UYQA 4AIEA 3DYPA 1PBGA 2EBNA 4MNMA 1LWHA 4JL1A 1XHGA 2W5FA 1XH1A 4C7DA 3TTSA 3RM4A 4HZ7A 3B9AA 2WKLA 1KXHA 1OT2A 4N42A 2VQTA 2J7FA 4W5UA 4P7NA 1GVIA 1PEZA 4MB3A 5AYBA 1DWAM 2EPNA 4UOZA 1PX8A 3L4ZA 1E6PA 3I3DA 3A4AA 1GQLA 1MW0A 3VIFA 9CGTA 2WMGA 1GOOA 3CBWA 2CNCA 4W5ZA 1OB0A 4JFTA 2VZTA 3VGGA 2WBKA 3BAYA 3AHTA 1JGIA 4GI9A 2WK2A 1FP9A 3NUKA 4MDOA 2XWEA 3MV01 1NWUA 1G94A 4HMDA 4Q22A 4MNKA 1B3ZA 1ECEA 1TZ7A 3JUGA 3CUFA 4TVDA 2J77A 5CLWA 2V5CA 5BXSA
chains in the Genus database with same CATH superfamily
4US6A 5EA9A 1OG0A 1XS2A 3O07A 2PPGA 4QDMA 2A7NA 4AW7A 1VRDA 4DJEC 1AH3A 5A6TC 1YYAA 4HA0A 3QR0A 4M6PA 2EPOA 4TV5A 1R0MA 4J3XA 3UR2A 3MSDA 3SGUA 1XM3A 1I1XA 4LF2A 1LUCB 3SURA 3LSCA 2NW0A 2J7CA 3RIKA 2DY3A 2PDCA 1R9YA 5C71A 4FB7A 3UP8A 2OQHA 3GVWA 2PDJA 3WUBA 4M3PA 1CCWB 5F2IA 4DZ5A 3LA4A 1Z48A 1C9DA 1HKIA 2BV9A 4YTRA 4WDXA 1WDDA 1J5TA 4A3QA 5HJXA 3UYIA 4C7GA 2P8CA 3II1A 1V02E 2AQVA 2HNHA 1ITQA 3E0LA 1K6AA 4N9BA 1AL7A 1AD1A 3BK0A 5FSEC 3DESA 1TUXA 4JX6A 4PMVA 3MYPA 4PUWA 1HXJA 1Q6DA 1ML1A 4HTBA 3FSUA 2HCVA 3WLQA 1LQ0A 1P0KA 1MQRA 3VDAA 1J0HA 3ZVHA 1K8CA 2ZRXA 5DRIA 4F8XA 3HB9A 3WMCA 2X1TA 1QPRA 1JD7A 3GW0A 3UFYA 3AUOA 4AC1X 4UFKA 2AOSA 1YQ2A 1C3FA 3V0TA 4UR7A 1NVMA 5FJJA 3GXIA 1OK4A 4P7QA 5I3GA 2Z1BA 3G1HA 3E6EA 5IRPA 3T0TA 4HCLA 5D9MA 3C2YA 5FA5A 3FGCA 2J4GA 3JRKA 5FL0A 5HAOA 1EA9C 1KLYA 2VP8A 4I8DA 2VRQA 3JS3A 4AISA 3KL0A 5K4ZA 4Z0SA 4ZQNA 1JZ4A 1KKRA 2WHKA 2JF6A 5JBDA 3LBCA 1XC6A 5A6LA 1U1JA 3AIWA 2Q3RA 1GUVA 1F3WA 1Q4NX 2CLKA 4K6AA 3M0JA 4Q4MA 2CBIA 1TIWA 3TYBA 1W5PA 4PH6A 3ARYA 3UW6A 4MYXA 3IS4A 3KOXA 3TYCA 2CC0A 1EO7A 3PG9A 4H1ZA 3W7EA 4GY7A 4E8DA 3TFCA 5D2VA 6REQB 4XD6A 4JTFA 1PCWA 3O2LA 1RD5A 2VCAA 3EMZA 3N2OA 4JL2A 5HNUA 3S5NA 5DO8A 1HVQA 3N9SA 2FJKA 3CK5A 4OJYA 2ZZ5A 3QQ1A 1VIZA 4ASTA 3R0UA 3EA2A 3WQ5A 4X2PA 1ODZA 3QLLA 3FX4A 4RE3A 3NGFA 3QV9A 1TB3A 2D2OA 4KEMA 1ENUA 4MWAC 4L64A 4UC5A 1QPQA 3WH7A 1GYNA 2A3CA 3AYRA 1WX0A 3PF3A 1V3LA 3A3HA 1UHVA 3ITTA 3MVTA 4QG6A 3DFHA 2NX1A 1E43A 2D20A 1A0EA 1O12A 3CAQA 1HX0A 4QNEA 4ZXLA 1K02A 3MTWA 3F5KA 4YXGA 3PY2A 3S1VA 4UQCA 3NFUA 4HA1A 2XFYA 2UV8G 2R1NA 1Q85A 5J5DA 4C6CA 3BZGA 4O50A 4RDYA 3PS7A 4EVZA 2QF7A 2CZ5A 2OSXA 3LHVA 3WDPP 4F2BA 3GTIA 4P2VA 3OYZA 4O19A 1SZEA 3E1F1 3OTRA 5AVHA 3VD5A 4DWSB 5F2GA 3T1GA 3V4BA 3E5PA 4JX5A 1YKWA 1ZJIA 4KF1A 5DEZA 1BLIA 3W7GA 1P1XA 2VNCA 3LM3A 4HPGA 1SSGA 4PMOA 2PDWA 2I9EA 3VGFA 4PFMA 1EZWA 1BXCA 3P84A 1F7BA 1JFXA 4AMCA 4G6CA 4HMEA 2E9BA 5T8GA 4N2YA 2GK1A 1JULA 4EANA 3I7RA 2AAMA 2I16A 1MNSA 4O0KA 3W25A 4UNLA 3LN3A 9XIMA 3UWUA 3CWOX 2QKFA 2BVDA 3TN3A 4XVDA 5I03A 3E3HA 2ONEA 2ZA2A 1XX1A 2P0IA 1UIOA 1UD5A 1A5OC 4QRNA 2DJXA 5BOFA 3PBMA 4GGHA 3CQ0A 1HVXA 1GVSA 1W1IE 3OW1A 4PR4A 1THFD 5G2HA 4GVGA 3DU0A 4NIRA 2CCRA 4QJ3B 4MJ4A 1FWEC 9XIAA 3BO9A 3CQHA 2FJUB 1UUOA 3JVAA 3QW3A 2DW6A 4EXQA 2ZX6A 1C8YA 2A79A 4D6DA 1ONXA 3NL6A 5A6AA 5CGMA 4BF5A 1BAGA 3WLJA 1U33A 5U4NA 4QAWA 4IF2A 2X1SA 2GVLA 2VZUA 1W37A 1RP9A 4C6DA 2X2GA 4LOCA 3MA8A 4PTVA 4XK2A 3CTLA 3ZSTA 1XGEA 1EDGA 2JFEX 1NIUA 3WK1A 3CUHA 3GY1A 2XVGA 3N17A 4Z1AA 3K46A 3O0FA 3HQNA 4HBKA 2ALDA 4GX9A 1TIMA 2VDGA 3SN0A 1PSCA 2DU2A 2V82A 5G1TA 1VFUA 4R33A 3NZPA 4TTGA 1CGTA 4JIRA 4MB5A 4JTLA 3EXRA 4TUFA 2DSVA 2H9AA 4ML4A 4JQ1A 2LLEA 1WUEA 2QPSA 4IIEA 2PDIA 3NPUA 3KZPA 5ABHA 4JTCA 3L4XA 2YCIX 3AMDA 3DIPA 3LCHA 4FXSA 2HE5A 3WDQA 3U5YA 2GUUA 3FKKA 3CHEA 4B91A 4ORIA 3F4CA 4X61A 3SCUA 3W87A 2DIJA 3K30A 4JQ3A 3OZPA 1QASA 4P8VA 3T7VA 1SYTA 2GZXA 5A94A 3NNTA 1I2PA 1GKRA 1SU5A 3APGA 1EL3A 3KOWA 3BOXA 4JGDA 4GCAA 3GR7A 2GWNA 3DAQA 2F2KA 4NT0A 4J7RA 1CB2A 1EJ7L 1D9EA 2VTFA 1HGYA 3MDUA 1Y5WA 2P1FA 3OHMB 4E2OA 2XDFA 2PTWA 2QS8A 1H63A 1G7UA 1C91A 4KBXA 2NV9A 2OTDA 1OC7A 4WDUA 1K3UA 3MSGA 4UZUA 1OGBA 1YBQB 1GVEA 4ZFMA 1BVWA 2WCSA 1MYRA 4J3ZA 3E0FA 3QKZA 3VZXA 5F7UA 2QCMA 2E68A 2DDXA 1IQ8A 1UB3A 2V5JA 1ZJAA 4K68A 2C19A 2ZUVA 3WNOA 1UWSA 3MJYA 1E1FA 3OBEA 2WZTA 3BAWA 3KVKA 2DUZA 4NKCA 3BCJA 4W8LA 4LAOA 3RM8A 2WVUA 5H6HA 5LNSA 3ZSSA 4CEXC 2UWFA 2I5GA 1VBHA 3NL5A 1BWVA 3CV6A 2Z29A 1U22A 3KLLA 3O7UA 3QGVA 1Q2SA 2OOFA 4HNNA 4TX8A 1A5NC 1DQXA 4K2SA 2Y2WA 3AS1A 5BMXA 2B7OA 4B5VA 1U30A 2HSAA 4ICCX 3OBAA 3EDDA 5HJYA 1BG4A 3W1MA 1P6BA 1IGSA 3AXHA 1L8NA 3UG4A 5BOOA 1XLFA 1ZQ5A 4DBWA 4MY9A 1WOAA 3VMOA 2VZSA 4QEHA 4HJFA 2OPJA 4V27A 4HZMA 1SFJA 1O95A 3KX6A 3TOYA 4EWJA 1X96A 1F74A 3MY9A 1RQEA 3LMYA 4OU1A 3O6AA 3GW3A 3SIZA 3EXTA 3W7RA 3UWEA 4ZOBA 1OCNA 4ZBCA 4KEUA 1QMLA 3H12A 3UNDA 1E4IA 2FH8A 1H41A 4GXWA 6A3HA 1OFQA 7REQB 2V5LA 3Q37A 3BCDA 4XTIA 5FL1A 1U5HA 3M7WA 3PJUA 2JK2A 1W1ZA 4A3YA 1GZJA 3S6OA 1VFMA 4KWUA 3UY8A 3BGGA 1V3MA 3W27A 1IIGA 1KO0A 3KWSA 3LYEA 3SRFA 3GHTA 3MSYA 5FAGA 4PRTA 1B0IA 2INEA 2WPBA 2J75A 1RY0A 3UT0A 2GVYA 3V35A 4QEEA 3F5LA 2OT0A 3UD6A 1ZU8A 2WKGA 2WSPA 4PRWA 1J2WA 4DBEA 2GDVA 3CM4A 5HNTA 2EO7A 4JTDA 3IARA 1ZPTA 2CLPA 3NPXA 1HFBA 3ZFHA 4AZCB 4AHOA 4M6VA 5C0QA 1AK5A 3NGJA 4HMNA 3DC8A 2BXYA 3FCPA 4EF8A 3TJ4A 3KLKA 4ZOAA 3BDKA 3TEVA 4O53A 3C6CA 1L2UA 2ODOA 4KKXA 3B0VC 3L4YA 3W26A 4NF7A 3MKVA 5D2XA 5REQB 4UXDA 2I57A 3QRHA 4A3UA 3LXAA 5HOSA 4DO4A 4ILSA 5CAKA 4H6QA 4NY2A 4XX6A 1C8VA 4QJ1A 4DZIA 4O0QA 3B4YA 5CPNA 1PKNA 1PYMA 2Q8ZA 2WXDM 4O10A 1UR0A 4C6NA 3GNPA 3I6TA 4PB4A 4G5DA 4C6MA 1JZ8A 3MHUA 3H7UA 3FXGA 1MXGA 4IM4A 4OVXA 4CNUA 1DORA 1EHNA 3WMLA 4LUSB 4DNHA 2VGFA 1M7PA 3PAOA 4CN1A 4Q4PA 2J9YA 1CGYA 4WRHA 1GEHA 2HQAA 2QV4A 4EE9A 2V63A 1L9WA 5IFPA 1NJJA 1EX5A 1RLDA 4XG1A 5DT7A 1K9DA 2PRHA 1JF6A 1Y5VA 4J40A 3PP7A 1B31A 3NO1A 1LF1A 4ZMGA 4GNKB 1TRIA 1KCXA 3OLDA 1VFTA 3L67A 1FWGC 4KCVA 1XLDA 3L4TA 4QSFA 4IQDA 4EIVA 3TA6A 1EPVA 2D1ZA 2W27A 3ZMRA 1F3TA 1EOMA 2ZRYA 2OWWA 1W9PA 3TONA 3FJNA 5D4YA 3W1RA 3M5YA 4JN7A 4L5ZA 1LQAA 4LRTA 2QDDA 1S2TA 3AIEA 4JCMA 1UZ1A 2PAJA 3LGEA 3CL8A 4FNPA 4A21A 1E73M 1FWDC 4FNTA 1SZRA 2BY2A 3LHUA 4WUIA 5C9WA 3WEOA 4M7SA 4C1KA 4PULA 2P3ZA 4AY7A 2C16A 1FP8A 4I9TA 1UD4A 4LNYA 3TROA 3STEA 2GVEA 1E4NA 1VEOA 3EX3A 3PZQA 4DXVA 3VIIA 3ABZA 4ORMA 2Q8LA 2CXGA 1XCWA 3C2VA 3S1UA 2UY2A 4MJ2A 5I5RA 3QZEA 1JIBA 1AQ0A 1WO2A 1KQYA 3ONCA 1DJWA 4PMUA 5FOOA 1YE6A 5D9OA 1J01A 4O1EA 2DH3A 1XW8A 2D23A 4V2XA 4F79A 3P81A 2ISVA 4P8UA 5TBOA 3EWXA 1TVLA 1P0NA 4AZBA 4AG0A 2IS7A 4ZXOA 1SJDA 3A5VA 4Q33A 4LYKA 3WJZA 2I9UA 3SUSA 2J9XA 4C1NB 3Q4DA 5JIWA 3DFQA 1QI2A 3S5ZA 2CERA 4GACA 2FLIA 2D3NA 5M1TA 1LL7A 1M7OA 1E6QM 2G37A 4NQ1A 3EWBX 4GMEA 4Q8NA 4C6LA 1J2BA 1KBIA 5G4EA 3W7MA 3NL2A 1OF6A 1QBBA 4RZ4A 4NAFB 1ZY9A 4DJFD 2QUVA 1YTDA 2CZFA 3A3XA 3VZYA 4LBSA 1TMHA 1Y5XA 4PTWA 5CG7A 1I2QA 2G0WA 4LAZA 1UPMB 1TX2A 1Q65A 2YIHA 1Y0EA 4W93A 3N2MA 1MUMA 3L9CA 3IGSA 3V5FA 1XLGA 4UQDA 2VX7A 3TZFA 3AXKA 3HPAA 1LL6A 4DHGA 4NYYA 1ICPA 4YTSA 4OIFA 2QGYA 2VDHA 3CU2A 4ZQMA 4JTQA 3WJWA 4MWAA 4GHRA 2XIMA 4RNFA 2V6AA 4U2ZA 5HK4A 5AHFA 3F2CA 3ZIZA 2BS9A 1UWIA 4HZ6A 3C56A 3LM7A 1BFNA 2PDGA 1NDVA 5G5IA 3CTTA 2XGIA 3DBPA 3M0XA 3FXYA 3ARTA 1EP2A 4DB7A 4DWSD 3U2CA 3W2UA 1Q2RA 1JUEA 1ZP4A 1ZJBA 4RE4A 1IWAA 4BWLA 1LBMA 3HGRA 3KHJA 5CZTA 2WM0A 2QAFA 4JKMA 3GO2A 3CH9A 2QCCA 2QIWA 2Z28A 1CGVA 1OX5A 2ZE0A 5D9PA 1W6TA 4MKSA 4FXFA 4DN1A 1CT5A 5EMLA 5A5WA 1PZ3A 4N0RA 1SFTA 2PWDA 3N6HA 3QHNA 2VR4A 4KCTA 5LA1A 3GFYA 4U5IA 1Q13A 1FUYA 4AWSA 1F3XA 1W3HA 2FZMA 2QVNA 3LQGA 4OOZA 4JTEA 1W91A 4Q8MA 1Q45A 2NUWA 2REQA 3NEHA 1TWZA 3IVTA 3W2NA 4OTKA 4RE2A 2HNEA 5JH1A 5F4WA 1VF8A 3A4JA 3RG6A 1DL3A 1QOQA 1H1YA 1NP2A 4P8XA 2X16A 4NI3A 3LG3A 1EC8A 3BMXA 1D2KA 3PZMA 3W72A 4QE1A 1Z69A 3APTA 2QCDA 1YPFA 1GQNA 3H7VA 3VIHA 3B9DA 2G95A 3B8TA 7ODCA 3RU8X 3USBA 1B2YA 3A47A 4IL0A 1R38A 3WF0A 1EWDA 4Z2HA 3IJLA 4S2BA 3LZ3A 1MNZA 1QW9A 3VFCA 1YNPA 4A8LA 3FEMA 4OV9A 3WSUA 1CXHA 4NZJA 1OCQA 3PZIA 2WCGA 3JW7A 4BI5A 1E0VA 1R3QA 2AMXA 4WK9A 1XIGA 5FEXA 3LI1A 4S3KA 3BLPX 4WCJA 3QR3A 4CQBA 4XKYB 4JICA 1FWIC 3UR5A 4NU7A 3QY8A 1UG6A 1IEXA 3QZAA 1BEUA 1YHTA 3TJLA 3MHFA 5F1UA 1H7XA 2A1YA 1R3RA 4LANA 1S5VA 4PMYA 2GFTA 3AXMA 3GLCA 4MWAE 2DSKA 3QW4B 3UZXA 3TCSA 1XLBA 3WQ4A 1V51A 3GC5A 3PBUA 3PUOA 3VNDA 2GPTA 3B05A 3HURA 4Q8UA 2ZZ6A 4Q32A 3H22A 3AOFA 3CL6A 4N4PA 4QCEA 2FB3A 2WVSA 1WZAA 1MFUA 1TV4A 2OLAA 3ME3A 4CVUA 3WBWA 5LKYA 2OSWA 3JZUA 5H1WA 1YDVA 1MDLA 3WH8A 3N3MA 5HQEA 1KRCC 2Y7FA 3VM5A 5IHSA 1XUZA 3H24A 4LAMA 4Z08A 1XYMA 1V0MA 3AHZA 2WSQA 3S6DA 3PZNA 3LPFA 2ATMA 3HU7A 3DCPA 1R30A 5I24A 3PB0A 1HKMA 4LYPA 2AKZA 4F40A 3B0YA 5IDIA 3LCIA 1XBYA 4E0CA 4NSBA 5CPLA 3THUA 5EBUA 4R7WA 3TE9A 4GA8A 1XG4A 4DYEA 1AQHA 3VIJA 2GJNA 1NP0A 4RE0A 2IQTA 1Z7AA 1FWSA 4HD5A 2G3MA 1PO9A 5J8LA 1W5OA 2W6RA 3MUAA 1YXCA 3B06A 3BOLA 5D37A 1ISWA 2CHNA 1I75A 2EJ1A 3LCGA 4YIWA 4YYCA 5SWUA 1Q3NA 3LENA 1JRCA 4QS5A 4ZTXA 3W9ZA 2Y8UA 2DH2A 3P74A 3W74A 5HR6A 3NDOA 4KGLA 7REQA 3GXPA 3UY7A 4C90A 2V3GA 3VUPA 3H4XA 5KMYA 2G5WA 1CXFA 2BHYA 3O8AA 3AMGA 3R11A 4DNMA 3ITXA 4G7EB 1J18A 4JTJA 2OZ3A 4CD7A 4BCEA 3KOYA 4X9SA 1VCGA 1NDZA 1VLWA 1TVNA 3WBXA 1MEHA 3MUCA 4GFSA 5L6UA 3HG4A 4PN2A 4K8HA 5E6ZA 4IHCA 4WY0B 3S4TA 7ENLA 1IXOA 1TPC1 2OO0A 4E8GA 3OJGA 3L66A 2Y88A 3ZLFA 4PUEA 3T0AA 2OG9A 4EXBA 1B9BA 2EPKX 4HNTA 3AROA 1BRLB 4LALA 5AC4A 2DT1A 3T8LA 3V0SA 1L6GA 4HB7A 1V77A 7PTDA 4EPDC 3E9AA 1EJXC 4AZCA 1R7AA 4I8YA 1UR2A 3RJYA 1LOQA 2QJGA 2WC3A 4RUBA 3ES8A 3L4VA 1TWDA 4XZHA 5D02A 3ID7A 4LEFA 1J10A 3NZGA 1XPGA 4GK8A 4TVCA 1BSLA 3S83A 2A7RA 2B7PA 1QVBA 2ZTKA 4MPKA 4HN8A 4KEVA 3BW4A 3H55A 3VGHA 1HJQA 3C61A 4Q4RA 1C8QA 2BODX 2AKMA 2XSAA 1DIOA 5REQA 4XVEA 3NQFA 1R2SA 1QRQA 3CMGA 4Q7NA 4Z1DA 5I02A 2V2DA 1XLAA 4H9ZA 2F9RA 1BXNA 3G77A 1V4YA 2X09A 4GYPA 2BB0A 3KEHA 4MHBA 2RH9A 3ZJ7A 4ATDA 3F2BA 1FKWA 3CIWA 3MU7A 3VNLA 1E51A 1OFOA 2ALRA 2YL6A 2YYTA 3HPZA 4WKHA 1NOWA 1NY1A 5M3WA 5G1MA 4MUZA 4LUSA 4US5D 3IJ6A 1XIFA 3C8FA 2ZYFA 3CPUA 2OO6A 3QM3A 1KV8A 3P6LA 4LH8A 5I00A 3EGJA 1J11A 3ZZ1A 3GC2A 1OCJA 5E0CA 4Y7EA 2C1GA 1MXDA 2I5QA 2E1DA 1GYMA 5HJLA 2NX9A 1XF0A 4HNUA 3K8MA 3EX2A 2TAAA 3GM8A 2BXVA 4MFEA 4EOUA 4QDPA 1R46A 1P7TB 2RKXA 2W9MA 2OYMA 4L7ZA 4A2SA 2NVAA 3TTOA 4UTWA 3PTDA 3UXIA 3QMSA 3E2RA 3EX1A 3WQ6A 5AFDA 5I6SA 1TR1A 3B8IA 4UTIA 2V3FA 2VCBA 3SQMA 1SSDA 1HO4A 3VZZA 1V0LA 2ACSA 4S3JA 5EB8A 2W62A 4A8RA 3C0LA 1RA0A 3GVQA 1QWGA 2PSNA 2Y61A 3BC9A 1RXOB 5TAOA 4KMQA 3NM3A 5E09A 4NJIA 3DHDA 1XUUA 3AIUA 4W7UA 2IPWA 4GE8A 1EH9A 4NILA 2Y1HA 3LNMA 3TV8A 4GIEA 1RAKA 3C2FA 4CCDA 5DT5A 1DP0A 1VHNA 3ARSA 3E0VA 2P10A 2PTDA 1I9CB 4D8LA 3IUHA 1JPKA 3E0WA 3THAA 3C3UA 3CV1A 2BY3A 2BOGX 1T0OA 1XG3A 3G0SA 1Q5MA 2FIQA 2OWCA 2ICSA 1O1HA 1QI5A 3VX1A 3GX9A 4ZOCA 2EPMX 1FWTA 2G50A 1V79A 5F4SA 4AYGA 4C1NA 1GVYA 2VEGA 2QAPA 2PLKA 1WP6A 3SY8A 3EWUA 1ZBKA 6ALDA 4Y90A 4KWWA 2TYSA 4WJEA 1EIBA 4ZE4A 1M65A 4HSNA 4XBKA 5A2BA 3ZVIA 1W3LA 2VL4A 1JQVA 4Z2LA 3KOZA 2GQAA 2OX1A 3T0DA 4YYFA 3AS3A 3G18A 4FALA 5HWMA 3OLEA 5D30A 3WIJA 4N9DA 4NAFA 3IV8A 4PUDA 1GORA 4UQ9A 2FFCA 2CBVA 3IK2A 1M04A 3TYAA 4G8TA 4GQGA 4O15A 1VYPX 1O5KA 2Q71A 4GX8A 1V3IA 3RGTA 2VUNA 3QN3A 1S1RA 2ACQA 5LIXX 4IQLA 2YB4A 1JJKA 1NOFA 1EB3A 3XISA 1OC5A 4KIRA 4HG6B 5HR7A 2ZVIA 1JPDX 5DMNA 4OBTA 3MPGA 4S1FA 3TMQA 3TYZA 4JIIX 2W5FA 4UTUA 3O1NA 1XH1A 1ZP3A 1NDWA 1D7KA 3ITYA 4ENLA 3IJQA 5IBXC 4WXYA 3RM4A 1ZTVA 1EF3A 2DORA 3W07A 1PEZA 3P60A 3HV8A 3VKCA 2NXGA 4E38A 3A4AA 4IQEA 5AZ1A 3GZ3A 3VIFA 3TDFA 1P0DA 2C15A 3HO8A 4FXJA 4C60A 2WNQA 2ZC1A 3GTXA 2VZTA 2WK2A 3KS5A 4MDOA 3P14A 4JTKA 2DZAA 3A9BA 3NO3A 1B3ZA 2I7GA 4Q4KA 3M0KA 4NNAA 5BXSA 5F1VA 3WNPA 4GQQA 3KRSA 3P61A 1SMDA 3ZR4A 4QLLA 1E6RA 3QOKA 2A3HA 4IG2B 3K1GA 3NJ3A 4ZB0A 1QPKA 3M47A 3QFWA 4MZ1A 4XKMA 3W6MA 3H4WA 3MBDA 5CZ0A 1EP1A 1WZKA 3PBVA 4H19A 3VC5A 3TQKA 4LUIA 4CNPA 1G4EA 1ZLPA 3M6YA 1VKFA 1C93A 1Q6EA 2VELA 3VIGA 2TODA 3WD1A 1PKMA 2ASHA 3IIXA 2YOCA 1BSIA 4R9XA 4Y9AA 3NZ1A 2RDWA 1R9XA 5HWJA 3RPMA 1FWFC 3WYZA 1X1ZA 4KGJA 4IISA 3VMNA 3AIRA 1VR6A 4U28A 3M0MA 5FF2A 2DZXA 3CWHA 4HGXA 4X0NA 3MI3A 2VZOA 1JG9A 2GOKA 2NQZA 5JVLA 2C71A 1NM9A 2XN2A 2BP1A 1JAEA 2QUUA 2X41A 4P7OA 3A5FA 3WLHA 1UKPA 2VT0A 3K1DA 4WKAA 3SCNA 4GUFA 1W9DM 4YVPA 3WY1A 1UQYA 3BUVA 1CX9A 4IOTA 4XZNX 5T9CE 1YTKA 2C13A 4XKYA 2BNJA 1FWHC 2QCEA 3WQCA 3TCEA 1OFEA 4NL1A 1F61A 2GGGA 5A6BD 4LWWA 4NRRA 4WDTA 3WNNA 4R88A 4W8AA 3O6YX 4PTXA 2BY1A 3R12A 1YIXA 1C9WA 4NVTA 1P6CA 2J7GA 1JYVA 4LCQA 4GXPA 2XFRA 5EPDA 3NVDA 2WLYA 1HJSA 1LM1A 3PJXA 1A5MC 2NLYA 2FZDA 2CZEA 3U4AA 3GDKA 1DJNA 4IJCA 4QLJA 4WSJA 3TA9A 3BSMA 2VEKA 3SI9A 2ZZ2A 2RJGA 1D3HA 2W92A 3SRKA 4Z17A 1E15A 2Z1VA 3PTQA 2ADAA 4QR6A 1DVJA 2PC4A 4O13A 4MGGA 1WV2A 1QPNA 4IZGA 1KFWA 3UR8A 4KWVA 4UQBA 2ZCGA 3WBEA 3F4VA 3BANA 5I23A 5C8BB 1J96A 2ZUUA 2V5KA 4M29A 3SW6A 3FYOA 3B0UX 1JYXA 3D6NA 3NAVA 1FDYA 4FOUA 1KTBA 1K8XA 3CYJA 1DJIA 3IAQA 1GQJA 4JNMA 4GIRA 3KAOA 3QXBA 2GGIA 1XCXA 2PGEA 4WVXA 2QZRA 4Z42C 4JBRA 3UWVA 2PFHA 3W1AA 3XINA 3W2JA 3AIVA 4N4QA 3WMSA 1YE4A 3W7PA 2ANUA 2VVNA 1UC5A 4MAZA 1ZB5A 4M0XA 2FTYA 2G3NA 4TMCA 5LYRA 3RXZA 2VRJA 3GUGA 3L12A 4OBRA 2GQ8A 5HPCA 4U33A 4UR9A 1BYBA 5GJNA 2Y24A 3TR2A 1G0CA 5KITA 4YWIA 4AXNA 4WLCA 2IW0A 2J78A 3SUUA 4NNBA 1CXLA 4GOAA 2CETA 1HIZA 4FOJA 4YLWA 3IGHX 4AD3A 1Q66A 5CG0A 1U5VA 3LMZA 5DBTA 1MZHA 4JIHA 2J8GA 1UP3A 1JXJA 2ZOXA 1JAKA 4YHEA 2YBTA 2C6QA 4HKPA 4DUOA 1PIIA 4LJ3A 1OYCA 2XGZA 4IP4A 3RPTA 3UNTA 3RLVA 5HULA 2HMCA 4XBJA 1X6LA 2ZXAA 3UCCA 1SQ7A 1WKDA 1F6PA 1CZ1A 2AL2B 1EQCA 5DBUA 4C5ZA 3AZTA 1RP8A 1SO3A 2QULA 3RCNA 8RUCA 4XO7A 1XRTA 2GSJA 3UG3A 4DJDC 4B3KA 4W86A 1H5YA 4WDWA 2FVLA 4HQVA 4W89A 5D38A 4D72A 4YCOA 3LPOA 1MVYA 1XP3A 4D1IA 1WDWA 4IX2A 4UFLA 1BG9A 1FH9A 1KM6A 4ZB5A 3BG9A 4WY0A 5EMUA 1JDAA 1HF6A 4AWTA 1Z6KA 5E9XA 2ZX5A 3RM9A 4D8ZA 1CXEA 3WL1A 1F2JA 1SR9A 2F8QA 1I1WA 2BHZA 2Z0IA 3AS2A 4AFYA 1A4LA 4UTTC 3SDOA 3F2DA 3RPDA 2VC6A 1K70A 2QUNA 4JTRA 2PDUA 3S5YA 4AX7A 3CHCA 2OVLA 2GGJA 4FX7A 3WQOA 4FX8A 1PZ0A 4K38A 2ZWYA 4RZ6A 2HEJA 3GNNA 4K1GA 1D8CA 1XCFA 3MZNA 2DV0A 1QNRA 4ZEPA 3G1SA 4HCHA 2V0TA 4JEJA 3G22A 3NL3A 4BK9A 3WFAA 2ZADA 1UKSA 2GLKA 2PI6A 3MWAA 3FAXA 3RAOA 4X2RA 3EDEA 3FA3A 4WF7A 5BRBA 4PYSA 1XIMA 1XLJA 2ZX8A 3GXNA 2YA1A 5EIYB 1NFPA 3DI0A 4HA4A 3C3NA 5ABGA 3QPYA 3O15A 1VP5A 1EC9A 4WZHA 1LP6A 2D69A 3QY6A 3QFEA 3OGVA 3EDJA 3CXOA 2L5HA 3L4WA 2VFDA 5DMMA 2VI0A 1AD4A 3KBNA 2WYSA 4ZQPA 4G1NA 3WDJA 3HG3A 4MYAA 3WEMA 3WF3A 1K6WA 2DT0A 4L6DA 2TMDA 1IYXA 4JKLA 5E0KA 4DY1A 3W7HA 3OA5A 2AL1A 1G9HA 1RLCL 3KE0A 2YYUA 5G4WA 4N7QA 5IFTA 2R14A 2VR5A 4HHPA 5GJMA 1K9FA 2P76A 4V1XA 1QNPA 1FDZA 5FEZA 1VEPA 4MNJA 1EQPA 4H9XA 3G2GA 3HA1A 4F0LA 1EOKA 1UR9A 1IIHA 1GVOA 3PZ9A 3L0NA 5JBEA 4DQWA 4W7VA 4HOXA 2GJPA 1TA3B 3AQUA 2XH7A 3EA3A 3H2CA 3M1ZA 3LOTA 3W24A 1KBLA 1C29A 1ELSA 4Q6XA 3TX9A 4EAYA 3ABSA 2F6UA 1RCXB 1QHZA 3GHSA 2OOGA 3VAVA 4CQ8A 5KINA 5A95A 1CLVA 1E71M 4PBEA 3IIZA 4MPQA 4S3CA 3RILA 2E67A 1ZBWA 1V6UA 2WSYA 4C7FA 4O4VA 3M0HA 4O1FA 4MADA 4MWAD 5C9ZA 4DZAA 1UBSA 1E5NA 2QR6A 1F6YA 4CNTA 3SCVA 5LSMA 3WCZA 3QGKC 1B5TA 1XL9A 2EG8A 2QMKA 4S3FA 3FJLA 3QYSA 4OECA 3IK4A 3M46A 5GNXA 2A5HA 4DRSA 4O0ZA 4RL3A 4OGZA 3R94A 1B3VA 3URBA 1E0WA 1AQMA 4XZWA 4JFWA 2E5DA 1HL8A 1PE1A 2XJ7A 1WE5A 3WLOA 4JTGA 1F9CA 1FOBA 1UROA 4DUVA 1J6OA 1KLZA 1TR9A 3VE9A 1OD8A 3A6OA 4YVVA 4RNJA 3VKJA 4P8WA 4M56A 2WBGA 3BJFA 4DBDA 3D46A 4FIQA 1UCWA 4MLRA 1C7TA 2NX3A 2VX5A 1AMKA 2EHHA 1V3HA 5D03A 1SO5A 1JCLA 3HF3A 4AD5A 4IIHA 1TJPA 3NVTA 2CWNA 1TTIA 2R1KA 2JGYA 4DUXA 1IF2A 2DVXA 3KRZA 1JCXA 2VMFA 3CQKA 1GZGA 2Z1WA 2WCAA 1PX3A 3F1QA 1H2JA 3T42A 1FHVA 3DKLA 2W0UA 2F61A 3GSMA 2VO5A 1ZNNA 2VX4A 1KTCA 5I3KA 3OZMA 1OGGA 4IGSA 4M82A 3VK5A 2J13A 1G1YA 2G4FA 1Q6LA 1KXQA 4DAFA 2FTWA 2RFGA 4JOMA 3SUVA 4PB5A 4TIMA 4XQ6A 1UR4A 4KESA 4BKNA 4IPPA 1VLIA 4GC4A 3GS6A 3ISIX 2RGLA 3LERA 3BAXA 1H60A 3N6QA 3LTYA 3AZSA 3E02A 2OLSA 1U1HA 4B3ZA 3S9ZA 2FB2A 2Z6JA 1L0PA 1TJRA 3B8SA 5GQBA 3UJSA 1XFCA 3HPFA 2ZX9A 1W9XA 1BYAA 3WN6A 1ME8A 1JPHA 2AGTA 3IRSA 2H6RA 3P62A 1SGJA 3KRBA 5FF0A 2CITA 5CC3A 1F4HA 3TIMA 1IWBA 1LRQA 2DT3A 1G4PA 4KEZA 2ZC8A 4QX4A 1ZFJA 2NT0A 1HJXA 2C7FA 4IG2A 3ANVA 1SW0A 1XPYA 5A8NA 3T2OA 4E3VA 2X30A 2EG7A 3DUGA 2IKJA 4H7VA 2D0GA 1ZGDA 3AAMA 3MV11 4LC8A 4ROPA 4GISA 4B5NA 2E6YA 3UZWA 4EF9A 4PTDA 4QXIA 4GQRA 2E5CA 1X7IA 2ZRUA 1ZJHA 4LB3A 4QQ3A 1YW1A 3DG3A 3TNBA 4AHPA 3TN5A 5D8WA 3RRAA 2NXIA 2Y0FA 1HTIA 4ADUA 1HP4A 4FAMA 4KRZA 3VOFA 1OM0A 3U3HA 3ZLGA 5HATA 5BMWA 3HQ1A 3BAKA 1ZALA 2D0FA 4LUTB 1LWJA 3MUXA 2R9RA 3QH2A 1VJIA 1SPQA 3QOMA 3MYOA 5RUBA 4JN8A 4ACZB 3V7PA 2VQUA 4CGTA 4F9DA 3W7IA 1T8QA 1DPMA 1UP2A 4GWEA 3FIGA 2J6VA 4C6PA 2IXUA 1DJGA 1KFJA 1BKHA 1UZ4A 3L5LA 2GL5A 3T4WA 1DJXA 2CESA 1DWHM 3P8IA 3ZJKA 5EYWA 4XISA 3EMCA 4XIMA 2EQDA 3PNUA 4QISA 3LV6A 1O4UA 3GH7A 3VNMA 2NZLA 1QNQA 4CCEA 2RDUA 1CGUA 4UOJA 1JDCA 1PIFA 4Y9NA 4TOQA 3KRUA 3GDBA 3S8HA 1J0IA 1A47A 2WMKA 3KVLA 1KRBC 2PDBA 1RJRA 1TYGA 4I6KA 5CGQA 3ZT5A 1IXQA 4YWSA 1NEYA 3VNKA 1K4GA 2VZVA 4PCPA 1VS1A 3T0CA 3M0YA 1H3GA 3NDZA 4IMGA 2FYMA 3CIXA 3SAZA 3GB6A 5F4XA 3OGSA 2V2CA 4GI8A 3A23A 2YLLA 1VYRA 4O57A 2WSKA 1JEZA 1W17A 3SN1A 3LCXA 1V8EA 1BF6A 1K7FA 5I3HA 5E0FA 4XD5A 3RRXA 5A6MA 7TAAA 3W83A 3GIPA 4C5YA 4RDZA 1TCDA 1RUSA 4CUCA 2ZFAA 4L4OA 1GPWA 1MRAA 3GXTA 1GOMA 1MUCA 3KBMA 4M6UA 4P00B 3BLOA 4XV0A 5DN1A 1O7AA 1JZ3A 3KBVA 5FESA 3TAOA 2VJXA 4W88A 5K9XA 1HO1A 1WCGA 3EMQA 4L61A 2XH0A 1ICSA 3DGRA 2IKGA 5M17A 5A2CA 3NG3A 3VPLA 2FHCA 3PZVA 2OEMA 1JDEA 3IEBA 3UPMA 2OB3A 2QDGA 4Z2IA 1W8SA 3EPMA 3D3AA 1RPXA 3MKCA 1X38A 2YGYA 1RK6A 4XZ9A 4E2DA 4BQ4A 4JHOA 4F2TA 2G3IA 5FEPA 2J47A 4RNHA 2IPGA 3DFSA 4IH3A 4QTGA 4C6EA 4RXGA 1DQWA 1JI1A 4YMZA 2AL2A 2BTMA 5TF0A 1OWQA 3M44A 5CGTA 2J8TA 4ZO6A 3MBFA 2WAGA 1SFSA 4A05A 3UXKA 4Z1BA 3CUZA 3GFXA 3OVGA 2QEZA 4O52A 2D73A 4IWWA 1FXQA 3SM0A 1E1CB 1C7SA 3W73A 3BLDA 1NDYA 3MUZ1 3H21A 2XWDA 4O16A 2FZ8A 2QPUA 2C91A 3TK7A 1NARA 1KB3A 5I07A 4LF1A 2RUSA 1WA3A 3STGA 3WBYA 3KXQA 3P0WA 4JY8A 4B5SA 3B97A 1ADOA 4Y8FA 4UWMA 3AUJA 1SJBA 2W63A 3HPXA 3HPSA 3XIMA 2J27A 3PPFA 1T99A 3WENA 1EUAA 3NCOA 4H9UA 1P0BA 2PBOA 1IWPA 2V2HA 2E1WA 1O68A 2V5BA 1HP5A 3G8RA 5HMEA 4TV6A 4WGHA 1H09A 3W2MA 4IPIA 5AYIA 4O54A 3QTPA 1IEWA 3VX0A 4DM2A 4TR9A 3VKBA 3CT7A 3V0UA 1OX6A 4GUGA 5BYWA 2PBGA 1KM2A 1B54A 2GSEA 2Q02A 5H8PA 1KQZA 3W1PA 3VD7A 3AJ7A 1UIPA 3THQA 4C91A 3T4CA 2WZHA 1JI2A 1MXSA 3P7YA 3CUJA 4JHMA 3N2XA 1XYZA 1RJQA 1Q8AA 1UKTA 4XO6A 3O6CA 3MP3A 2PD9A 2YDAA 1F3EA 1KM1A 4JZ5A 1RCQA 3OBKA 5EMYA 3MMDA 3EPOA 3U4FA 1JZ2A 2EAWA 4C6JA 3S2MA 2CW6A 3UZJA 1IHIA 4KCWA 3PFMA 3BJSA 1XH0A 3PG8A 2XISA 3DERA 3KS6A 1TZZA 1XIJA 2FDSA 5DFAA 4QJ4B 3RMJA 4H9TA 3VE7A 1EEPA 3NXFA 1XIBA 1OZMA 1NWSA 2ZIDA 4J28A 2CLMA 5ABEA 4ZSUA 4B5XA 3MW7A 3NQBA 1KGXA 2VOMA 4IIDA 4JQAA 4K1WA 4AEEA 4NI8A 3SR7A 1GEQA 2VURA 4B5WA 2NWSA 3VNYA 2WHMA 3S6TA 4JNYA 4Q8VA 3W7JA 4PODA 4XWUA 3H6OA 4G56A 1KBBA 3N18A 1KM0A 2PP3A 4OUIA 1AVAA 3ALFA 3PNZA 4NZ1A 4O8AA 2XH2A 1ADDA 4B4HA 6XIAA 2ZUSA 2PCEA 4QSHA 3MCNA 5TQLA 2YL8A 2TPSA 3TXVA 4GVHA 3URAA 4DF1A 1FHDA 3URQA 4K7VA 2E7FA 3VFLA 4DO5A 1FDJA 2WQPA 3OODA 3BURA 3N73A 1SZFA 1UJPA 1D3GA 3SY1A 1P48A 4QQUA 2JQXA 2CKSA 4LVDA 4GLEA 1TQXA 1M01A 3WK2A 1IZCA 3V1PA 1W1VA 1K9TA 5AC7A 1KR1A 2E9LA 1W2PA 5JQ9A 4KFOA 3B0PA 2EEXA 3CAWA 2BMBA 1HZYA 4PE8A 4DAIA 5JH2A 2B7QA 4TMBA 3S9IA 4JX4A 4HTYA 4QAIA 1GCYA 3EKLA 3FHQA 4H2CA 3A13A 3AALA 2WQDA 3UYCA 4JR5A 2V69A 3UWYA 4PEKA 2Z6IA 5F2LA 4GY1A 1Y65A 4AF0B 2Y7EA 4DYKA 1MQQA 3D0CA 4DIAA 3NIYA 3ITOA 2DVUA 2VXNA 1TV2A 1HUVA 4FNRA 1OBAA 4LRSA 4D6JA 2YW3A 1GHSA 1ZZMA 3R10A 2QUMA 4ZO9A 3WFZA 2DUXA 2ABBA 3REQB 2BHUA 3QPEA 5DCDA 3RX3A 1PUDA 3WNMA 1LBFA 1Z32X 3N2CA 1FWRA 3V5OA 4LY4A 2J8FA 3NZRA 2XH4A 3S42A 4QLKA 2F6KA 4LAUA 4O1DA 1TV3A 3ZYZA 3UVAA 3IUIA 4IP5A 2ZICA 3B03A 2OZ0A 5G1YA 3GBDA 2DW7A 2YFOA 3NSNA 1FKXA 3I4KA 2IMRA 3K13A 1MZRA 3RLHA 1FWWA 2FMNA 1I6NA 4IFRA 2QCFA 3IWPA 3WLNA 1BTMA 2HBVA 3P0XA 4LGXA 5LXEA 2DUAA 1QXLA 5LIUX 3NSMA 2XSBA 4BI7A 4F0MA 4LCRA 2ZVRA 4LSBA 5CPMA 1LDCA 2E77A 4ZCWA 3MB9A 3TWAA 1QI0A 4EX4A 3M0LA 1CPUA 4F0HA 2PLJA 1XD1A 3QV6A 1Q6FA 1UJQA 1L6FA 4BF7A 2BVYA 1EJUC 3SCTA 4GCXA 3TAKA 3WQDA 3NQ7A 2CLHA 1V0NA 4XAZA 3KBSA 2VX6A 1ZL1A 4O1BA 1V6WA 3CZJA 4B5UA 3FYYA 1T40A 1XQKA 5T91A 1MW1A 3TYUA 3K5XA 3QEZA 3GNDA 3TYDA 2EKCA 1KM3A 4NG3A 3ZR5A 3KTXA 3I6EA 4L9ZA 1MFVA 1Q6GA 3PSVA 1M6JA 4QNWA 4LS1A 4M19A 2OZTA 4GY0A 2IPJA 1GG0A 1I2NA 2PRLA 4LUTA 4I9AA 1FCBA 2O9TA 3T05A 1SJCA 5DLCA 3SQSA 4JTHA 3KFTA 1O1ZA 5FJRA 1LRNA 4S3EA 1JZ7A 2Z2BA 5EY5A 4ACZA 3MVIA 3NOYA 5IM51 4ICMA 4B15A 4U3CA 3PBGA 2J25A 4BWLC 1DE6A 2JKPA 4QROA 3W1QA 1N8WA 2WMIA 4QM1A 2Z2UA 3RX4A 2JIEA 2OSYA 3VDHA 4BQ5A 1WUFA 1O6IA 2Y6ZA 1M5WA 5A8GA 2MUCA 3LS9A 5FI8A 4LY8A 3S9YA 4PC8A 4PUMA 2ISWA 2ZA3A 1G5AA 3NTYA 2Z7KA 4UMBA 4CNNA 4L4MA 1AQFA 3C2OA 4FF7A 1UW9A 5TNVA 1K7EA 1AFSA 1XDJA 3SCOA 1DE5A 3MJMA 3HFTA 4EXAA 5CSYA 3IPWA 1OD0A 5D32A 2D22A 2GOUA 3QPZA 1REQA 2GJXB 3EWYA 2P8BA 1CENA 4DI9A 4W8BA 1KBJA 2W79A 3VU2A 4HYWA 3E96A 4QP0A 3I7QA 1IT8A 1TZ9A 4HOWA 2YDQA 4V28A 4PGLA 4DO6A 1H5VA 1FWJC 2VENA 1TREA 1E1EA 3L2LA 3FLUA 2BDQA 3KCOA 2ZE3A 1X7FA 1BVNP 3QLDA 2QHAA 4JD4A 1H0IA 1P4CA 3C2EA 4ACYA 4CN6A 1W3TA 4WEVX 5I09A 3T78A 5G4HC 3BL3A 3LXBA 3RR4A 3V16A 3SEPA 3H7RA 3FYPA 5HXMA 1Z89A 3CPRA 2D3LA 1FBAA 4M80A 2WC4A 3O06A 3QHMA 3SY5A 3B3DA 4K7YA 1QNVA 1JZ6A 4NJKA 4F0KA 5A8MA 5C55A 3CAVA 1J0JA 3V75A 3PJTA 2PDHA 1GOIA 3M5ZA 4R3UA 3EBVA 1UH4A 1PDYA 1U2YA 3I6RA 2QQ6A 5A8OA 2CFFA 1ISXA 2NQ5A 4UMAA 4PUNA 2C1HA 1DTUA 1OVDA 4MUPA 4AMAA 1JCJA 2P50A 2ZZ3A 1EWEA 3BXWA 4GJ1A 1PTGA 4WX2A 3G1DA 3VNIA 1UC4A 3WLPA 4Q7BA 5I06A 5K4XA 1PZ2A 2C18A 3HG5A 2XSXA 5LXXA 5LZLA 3DDMA 3BE7A 4MNLA 3AICA 2R8WA 4Z2JA 4GO8A 4H8VA 2WJEA 4IQJA 3UETA 3P5ZA 2JF7A 4E6MA 1CXKA 4R53A 1GQKA 1SFLA 3LI0A 1KXTA 4LUYA 1XIDA 1SMAA 2DEPA 4U10A 2XN1A 1RZMA 3BTNA 4HU0A 5EMMA 1R3YA 4BEUA 1X97A 3G24A 2EBNA 4AXKA 2BG5A 2ACRA 2VR2A 1LWHA 3DEQA 9RUBA 3LB0A 4C7DA 3NM1A 4O17A 4DF0A 3IVUA 4HZ7A 1A5AA 3B9AA 2WKLA 1TMLA 5LGXA 1WQ5A 3ZXWA 2VQTA 1M68A 4PTNA 3TLQA 5AYBA 4H6RA 3LCWA 4GH3A 4R9OA 1EBGA 3NO5A 1PX8A 1AG1O 1EUNA 2WZMA 1EPXA 3KHDA 2BGNE 3UBPC 4BHYA 3YPIA 9CGTA 3GRIA 3BZJA 3S5OA 3W70A 2A6NA 3CBWA 4W5ZA 3AHTA 1JGIA 3NUKA 3N6JA 1LWIA 2A85A 1AODA 2OJPA 3MV01 4WOQA 4I7UA 1G94A 4HMDA 4IPJA 3LXCA 2DIKA 3ZVHB 1ECEA 1W1B1 5CLWA 3ZWSA 3AHXA 3DI1A 2PDFA 2PGWA 3HTWA 5BRPA 2PCQA 1TTQA 1VFLA 3AIBA 4I3GA 4ZE5A 5J5RA 1KNWA 5CJ5A 3LTSA 4REQA 5HDRA 1SO6A 4HK7A 1M3UA 4YL2A 2ZXBA 4HU3A 5EKYA 4AX6A 2PRMA 5HPOA 4IFKA 4XZLX 3BCFA 1FWCC 1PHWA 4KERA 3FGCB 2AQWA 4BA0A 5B80A 4FF5A 2X2YA 4HVXA 1LT7A 4NHVA 2DP3A 4LBUA 1S5NA 2A3LA 2CLLA 2XGBA 1B3OA 4AZIA 1IZJA 4S3BA 2R24A 2QCGA 4ZA0A 4IIGA 2NT1A 4NJJA 1IR1A 3LPPA 3UJEA 3N34A 3ANYA 3HQPA 3GKAA 4GD0A 2Q6ZA 1F5ZA 1Z42A 3B8UA 3PUGA 1ONWA 3C86A 5C7HA 1V6TA 1DEDA 2QYGA 4HHLA 4GYPC 3WNKA 1I4NA 2V9DA 3PHAA 1E0UA 4X60A 3LZ5A 5A3HA 2WV8A 3CEPA 4D71A 4U31A 2P3EA 4K36A 2CLEA 1S2AA 5AHLA 3LHZA 2P5NA 3GTFA 2PWGA 4DPQA 2DSWA 2Y89A 4MB1A 3EDFA 3PB2A 5B7ZA 2BVTA 3TSMA 3GDMA 1UWAA 1W3KA 4ERGA 3WJSA 3WLRA 4WSKA 3MO4A 4YTQA 1S3TC 3STFA 3TTEA 4HP5A 5T26A 5BU6A 3W3OA 3OP2A 1S2UA 2OXNA 1LUCA 4J27A 3GG8A 3SCPA 4L4LA 2PTYA 4UCGA 2HTMA 4N9CA 5LNVA 4XAFA 5HNRA 2QCHA 2GGEA 4DEFA 3UWWA 1ZBVA 4UTWC 4P02B 3TYEA 4H9YA 5AHNA 2D2HA 3BG5A 7TIMA 3OG3A 2WM1A 3PVFA 2E4TA 3NQVA 3L21A 1DWIM 1NQ6A 1Q6QA 2A3AA 3A21A 4RV8A 3G6LA 1QWKA 3PBWA 3PK7A 3WD2A 1TE6A 1J5SA 4JCLA 5A6KA 3MDWA 1KGWA 4EP8C 3OQ8A 4INFA 4AU0A 1HJUA 2O55A 3CQJA 4S38A 3H4GA 4QJ5B 2HISA 2E9MA 2OYKA 5D33A 1LLWA 1ITCA 3EB2A 1DTNA 2DZWA 4IP7A 1J8VA 2HZGA 1MUWA 3MP4A 1H7WA 1EC7A 1EHAA 5JMUA 3Q67A 3QGAC 2GUBA 3CUGA 5HBFA 4H00A 4JEQA 2OKOA 3HGSA 1W3JA 4O14A 3U7BA 2GQ9A 2Y7GA 1KFBA 1RV8A 3ABXA 4DPPA 4IJBA 3CJPA 2ZZ4A 3WD4A 3REQA 2KZHA 4B92A 1NWTA 4Q6JA 3I3EA 2NV1A 2HE8A 4O1CA 5CXPA 1US2A 4LVAA 3ARPA 4PBFA 4LVFA 3FA5A 2G8ZA 4M8UA 3NQCA 3L0GA 3VIKA 2O7QA 2H3BA 1LOSA 3T40A 4BF9A 2FFIA 1E3XA 3AI0A 1WOBA 1HJWA 1R2RA 4G2DA 2JEQA 3FNDA 4PEEA 1T8XA 2ZUWA 3OLIA 5D8ZA 3VCNA 2NQHA 4WQ6A 3R43A 3PANA 3M0IA 3BMWA 1XGZA 4HPJA 4M24A 1H49A 4MM1A 3H8AA 3TFXA 1H4PA 1UA7A 1O94A 2HK1A 2BWGA 4BJHA 3QZ6A 3W23A 2PZ0A 3N9RA 3N29A 6REQA 2YLAA 1A5UA 1XLKA 4LS2A 4J3TA 4H7CA 2J79A 4M51A 3WK0A 4DJFA 4BR1A 2Q3OA 1UD6A 3M41A 3FV9A 4YS1A 5BW6A 3WL0A 4H01A 4F0RA 1H50A 3U2ZA 1R5YA 4B2DD 1O5RA 3HOJA 2AGKA 1VCFA 3N2TA 3WELA 1ONEA 3VOJA 5D09A 1KM4A 3EWDA 1OGSA 4AC7C 3O63A 1VPXA 4XIAA 4CCZA 2PODA 4B3LA 3MUIA 4A29A 4AH7A 4GH1A 2ATSA 2EPLX 1V03A 3PPCA 1EBHA 5KSWA 2WMJA 5AC5A 4K3ZA 4H7ZA 2RDXA 2NQ9A 5I79A 1A50A 3E12A 4IMCA 4MJZA 3THDA 5AHEA 3QC0A 3BICA 1W3NA 4JAWA 2WZEA 2OGJA 1FFQA 5KETA 1AH4A 3G0UA 1E6NA 3QMTA 5DY3A 3Q45A 1XJBA 4TX9A 1QK2A 4E2BA 2FMOA 3LHWA 3VIOA 3DHUA 5AB3A 4ICNA 1OFBA 1EJWC 4OHQA 2O4QA 3LLFA 5K9DA 2GSHA 4DWSA 4HU4A 5EJ1B 2H8ZA 3N04A 1EYWA 3PWAA 3GFZA 3JR2A 3T81A 3T8QA 2WMHA 1OEPA 4PSPA 1R3TA 4GFIA 8XIMA 1XICA 3MANA 1G01A 2QLYA 2YZ5A 5CZKA 2EF9A 2XFFA 3VCCA 4PMZA 1CGWA 3BOFA 4IMFA 1N55A 5C54A 4JYFA 3CV2A 2J88A 2YXOA 2FTPA 3BQ5A 4V33A 2BFGA 2P53A 1EKOA 3GHUA 1XIEA 1XH2A 4Y2WA 3RDKA 2GQ3A 2HV5A 2GJXA 2GVGA 3FSTA 1JFHA 3PPGA 1V02A 4IPLA 1TWSA 7XIMA 2C79A 2XIBA 1UD2A 2QJJA 5H2ZA 1WDQA 2PF0A 1V08A 3W1TA 3TR9A 3B9EA 4Y8EA 1YADA 1V6VA 2NXHA 3H2EA 1Q63A 3OOQA 3UWQA 3C0JA 1EEXA 4AZGA 2RAGA 3UJ2A 1H7OA 1CLKA 5DCEA 3NDYA 5BOEA 4TXEA 2HVMA 4MVAA 4X3ZA 3WLKX 4AEOA 3D5HA 5ABFB 3H2NA 1TSIA 3WD3A 3ITVA 4DF2A 1A0DA 3MQTA 4XD4A 3AWNA 2OEJA 1FX6A 5DX7A 3F4NA 1W9BM 2NLIA 3WUEA 2HK0A 2VD8A 3VD4A 3DECA 1QHPA 5G2WA 4C65A 1L6WA 2CLIA 4URIA 2ZDRA 3ORWA 1KCLA 2Y63A 3E2QA 4JPGA 4I5XA 2YW4A 2WW5A 1J6PA 2IKHA 4DM1A 3GU1A 3VD3A 1O66A 2ON3A 3U57A 3VOHA 5C6MA 3GU9A 3UA3A 1M1BA 3ARWA 4DJDD 1LLZA 3EDKA 1QFEA 4ZZ9A 3DG7A 1W3IA 1QNSA 1SZNA 1J12A 1ZSXA 2PWHA 3R89A 1W1TA 2GJRA 1FWAC 2ZWZA 3UWZA 4GVIA 4BS0A 1TPH1 2YA2A 1XR2A 2R6OA 4GUIA 3IIVA 3GDRA 1KV5A 3WQGA 4J3UA 1YNYA 2DZPA 3C52A 1TWWA 3UJRA 4JIEA 4TX6A 3N1AA 2J7EA 4FR1A 4FLQA 4Y96A 2VVSA 2QDEA 3K2GA 1PAMA 3NPVA 1BGAA 1AA1B 3MCOA 4DXXA 1EO5A 1CWYA 3BMVA 3ITGA 2ZZ7A 2CHRA 2WOQA 3BAJA 3TC3A 2RGMA 1UPPA 1GJUA 3QSRA 3VYLA 2QUTA 3T08A 1XSJA 4HYVA 3L68A 2CBUA 2P88A 3MI6A 4FSAA 1YBQA 4R7JA 2V68A 3ZJ8A 5BWFA 1TO3A 4FIRA 1G4SA 1RBOB 2I1OA 5D9NA 5AY7A 1ZENA 3NYZA 1OSEA 1JD9A 1FXPA 4W84A 1VCVA 1Y7VA 1XYBA 4IMEA 3VOCA 4A6GA 1A53A 1KA9F 1F4AA 3GNRA 1BTCA 1BHGA 4NASA 4RZBA 4EKJA 1A49A 2VWTA 3ZWTA 3VKDA 2E0PA 1AJZA 3KCJA 4JS3A 1GZ1A 4CNSA 1O5QA 2OELA 4J4KA 4JFUA 3RCMA 3OB8A 1K77A 2E6FA 5EBAA 1KFEA 3CH0A 5I0DA 4PCTA 6XIMA 4H8HA 3AJXA 1DXEA 4CD8A 1ISVA 1IT7A 3R6IA 4WGXA 2FHFA 3VGBA 2O0TA 1IXPA 1K8YA 1S5WA 1SW7A 3Q2DA 3NQ6A 4OBSA 3ITCA 3M0VA 2XU2A 2NQLA 1UR1A 3SZ8A 2OKTA 1LG1A 2HROA 4CCCA 1AZ1A 1SW3A 1PS9A 4MY8A 3RNDA 3H2MA 1PYFA 1CXIA 1X98A 2JALA 2E09A 2PE4A 4LX4A 1FVPA 1XIIA 1EFZA 3J7HA 3IV3A 4KT2A 3PFRA 3BW3A 4DXKA 4UQAA 5AN7A 4CQCA 4L6HA 2BASA 3DXIA 4YVXA 3G1AA 2DZTA 2UBPC 1DJQA 4X22A 1FA2A 4QDWA 2ZDSA 1EF2A 4I7WA 4B16A 4UUIA 5DXXA 3ECQA 3V5CA 4GUJA 3OLGA 1MW2A 3PUEA 1FHLA 1Q7ZA 3RK8A 4H9MA 3B40A 4J3WA 4KCUA 3ARXA 2NQJA 6CGTA 2PC8A 2OZ8A 5LA2A 2WNNA 3WFLA 2WO5A 4IIFA 1OY0A 1TJ2A 2E6DA 4CVWA 4RR4A 1K9EA 3QY7A 5K9CA 2Z25A 2EPHA 4JY9A 3MP5A 3NQ8A 4UQEA 1A0CA 3H2OA 4YNGA 6TAAA 5CPQA 2Z1KA 3UGRA 1YPXA 3HIJA 4AAJA 4WHBA 1UUMA 1VFOA 3MI2A 4GUHA 3SGZA 3IACA 3GUWA 3FFSA 2XVLA 4US5A 2X42A 3BAIA 4FZIA 4CQ9A 3E38A 1KC7A 2DSZA 2B0MA 1FTXA 2X7WA 1W2VA 2W66A 4MG4A 1FCUA 3TQPA 3WQEA 3DKJA 3OO2A 3KVJA 3S1WA 3TP4A 3EEGA 1OINA 3B8WA 1M41A 2R82A 4WY0F 3KBJA 1NQKA 1W0MA 4QS6A 4M81A 2FVMA 1CTNA 1X39A 1ALDA 4D9PA 3C0QA 4YHGA 3M43A 1IXNA 1OK6A 3BW2A 3I68A 3SGGA 3P2VA 2HBXA 3BLIA 4AQLA 3HMJG 2DZUA 1JR1A 2ZXQA 3CUIA 5H8UA 3L2MA 4RCXA 3S0CA 3CWNA 5FJTA 3W7NA 2EJAA 3PC0A 2VGGA 4J35A 1LYXA 4MDPA 3CHVA 4CNOA 2Z7GA 3R58A 4GBDA 1GONA 3FVMA 2CLOA 3EWCA 2Y5SA 4JIQA 1U5JA 2V30A 3U8GA 3CT2A 4I6VA 4DWDA 4YU1A 1S2VA 3HJZA 2QDHA 3ABRA 3PSWA 5CC5A 2YA0A 5C2GA 3EOUA 2WHJA 1T6MA 2OODA 3DFOA 1XRFA 3ANUA 3NEVA 4MWAB 2RDTA 1KWKA 1BYDA 3QF0A 1E9IA 3DGBA 2GJLA 3ENLA 1IEIA 3WZ0E 1G7VA 4ADSA 1FCQA 1UWRA 1R47A 4IGNA 1ODUA 2PURA 3TOPA 3KDNA 1PZ1A 4IIBA 4FR6A 4HCDA 1FWNA 2WVTA 2A3BA 3QQ0A 1JPIA 2NUYA 2G96A 4FNQA 3TQVA 2DZVA 4Q8QA 5KZEA 3VO0A 2WLZA 2PDLA 3E5BA 1IE7C 3CASA 2XZ9A 1VBGA 3ATYA 1ZUAX 2OFJA 1CBGA 4H2HA 4RNIA 2PDNA 2XVKA 2YCLB 1X6UA 5FAJA 4Z1YA 1H61A 3H26A 1PCKA 5A8PA 1EDTA 3A4XA 3WH5A 1OJXA 3A24A 3S46A 4B9YA 1GVQA 1WXJA 3INPA 1TPEA