3I7QA

Dihydrodipicolinate synthase mutant - k161a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7qA00
1NSJA 1A53A 2GVJA 4KKXA 3STGA 4BWLA 4CCEA 1F5ZA 2BX7A 2YR1A 3TSBA 4HPJA 2B7NA 1QO5A 1RQEA 1D3GA 2HS6A 3ATZA 3LV5A 5G2HA 4WX2A 5HUPA 4I7WA 3C3NA 1G4SA 4ADTA 1H61A 3DBPA 2UV8G 5AHEA 1VC4A 3O16A 3ZS4A 3LRLA 4WOZA 5D09A 2QCNA 3TAOA 1FBAA 3FYOA 3B0VC 1LORA 1KBIA 1F2JA 5U7SA 3W7IA 3KHJA 1Q6RA 1ICQA 2B7PA 3R13A 4YCPA 3U8GA 2ZRZA 2VFIA 5AFDA 4OHQA 1UASA 2VENA 3G8RA 1Z44A 1KFLA 3SGUA 1F73A 4PC8A 5L6UA 3GXPA 5D05A 3QH2A 3W7CA 2ZQ0A 1TPB1 2C18A 1I2NA 3NL2A 2Y61A 5F2GA 1UB3A 1JR1A 4YMZA 2VFDA 3W2KA 4ZVJA 4FX7A 4CNOA 2G97A 3DFTA 1E51A 2VEMA 1DORA 2ZBTA 4BFAA 1L6YA 2I1OA 2CLFA 3QMSA 4HIBA 2YW3A 3NQ6A 5DCDA 3NQMA 2QUTA 3TQ0A 3NL5A 5AB3A 1O5XA 2ZZ2A 4XWUA 5CPOA 3RNDA 2DU2A 3T4CA 4ZZ9A 4YL2A 2HS8A 5CSSA 4ZMGA 4QAIA 3E02A 1GWJA 1DVJA 1VYPX 3CTLA 1R30A 2QDGA 5C6MA 4Z1BA 2YXGA 4FNTA 4Y8FA 3PBUA 2JBMA 3RFAA 2OCZA 3RF9A 3NZ1A 4CCDA 1G69A 4MY8A 1QPNA 1VYRA 3N2MA 3CHVA 4Z0JA 3IIPA 4N2YA 4BF9A 5J5DA 3RLUA 3WFAA 1W5QA 3P5YA 5K9CA 4A22A 4AVFA 4LC8A 4IUOA 2V8ZA 1JRCA 2CZFA 3DFSA 4JICA 3B8DA 1TPEA 1JUKA 2ZCGA 5LGZA 3QFEA 5GVJA 2QUVA 2H8ZA 3GDMA 2X1RA 2V5LA 1ADOA 3LB0A 1M7OA 2W0UA 3TA6A 4ZQNA 1L9WA 3EWXA 5G4WA 2J9ZA 1GJPA 4ZQPA 4CQAA 3T7VA 3G1VA 1PHWA 3T78A 3LHWA 4UXDA 4JTFA 3TXVA 1NF0A 3S5NA 3FOKA 4HKPA 4PA8A 4AWSA 1AW1A 1Q3NA 3DGRA 2V82A 2ZA2A 4UFIA 2QJIA 1Y0EA 4MIMA 3W2MA 2RDUA 3BARA 3MI2A 2A7NA 2ATMA 2CW6A 4LUIA 1QMLA 3NEVA 1LM1A 5LKYA 1SO3A 2NXIA 4OV9A 3KVJA 3H54A 1W5MA 5D02A 2V81A 1KTNA 2Z1BA 3MP3A 1GYLA 4LS2A 3G0UA 4GUIA 3S8HA 3ZFHA 4RKAA 3ABOA 2G95A 4ML9A 4LS1A 3RU6A 1QFEA 6ALDA 4NZJA 3L9CA 3FJ6A 2P0OA 1GVFA 2YPIA 4UTKA 4RZ5A 2ZFAA 1I2OA 1DV7A 3NQEA 3B05A 2CFFA 1G7VA 1QPRA 1V5XA 3NO5A 1FWWA 4LTSA 4JTSA 3GAKA 1QPQA 4H3DA 5LZLA 1VYSX 1AK5A 3IVUA 4ZQOA 1OX5A 3HIJA 1VZWA 2VXNA 3OBKA 4TX9A 3MP5A 4RXFA 4A2RA 1M5WA 4JTKA 1G4TA 2A85A 5K2ZA 4AEOA 1XBYA 5LNRA 1H50A 2Z6JA 2E6DA 1NEYA 1KFCA 4JY8A 3FEMA 3PM6A 4WXZA 3NQ7A 2OT1A 4Z08A 5I3IA 4LWWA 1R2TA 2GJLA 4NJGA 1ICPA 4LV4A 3STEA 5BNKA 5FF2A 3W9ZA 3BO9A 3GDKA 4QNWA 2PURA 4XTIA 4LVGA 1X8FA 1IXQA 1H63A 3B03A 1VCFA 4JTGA 3W87A 4UIOA 3IGXA 3TC6A 1KV5A 2ABAA 1EB3A 3W7DA 1SW7A 1LZOA 2VFHA 3GX9A 4IXHA 3EXTA 5J5RA 5L9FA 1SSGA 3KXQA 1GYNA 3IVSA 2JKAA 1RZMA 4IXXA 3GK0A 3M5YA 3CWOX 3C8FA 3HG5A 2AQWA 5T26A 3BVJA 3P81A 3P8IA 3EB2A 5CKSA 3WJZA 3FFSA 1Q6QA 1KLYA 1A50A 3P8JA 2F7FA 3AJXA 1UBSA 3C61A 3TCEA 2H8XA 4MOZA 3TW6A 1Z48A 4K38A 4K8HA 1MSSA 2VEIA 1TMHA 2PE4A 5TIMA 3JRKA 4NXKA 4IMFA 4CLMA 3HPXA 4Y90A 5AHFA 5K3VA 1H7WA 1R2RA 1XFBA 3NPWA 4UNLA 1TPUA 1GQNA 4FNQA 2C13A 2AAMA 5KZMA 4R53A 5FF4A 4ONVA 3GNDA 4P2VA 1XXXA 1B57A 3ZR4A 3TAKA 3NQVA 2WNNA 1XDMA 3MHUA 3EX1A 2VOMA 4HNUA 3QZEA 4IX2A 2F84A 4IX0A 1NF7A 3I7QA 3GB6A 4TU1A 2B7OA 2QCGA 3OG3A 5DCBA 1LTDA 1GT8A 1DL3A 4WY0A 4RZ6A 3BK0A 5K9XA 1M7PA 3EEGA 3B0PA 2EAWA 3W2JA 1EWEA 3TFCA 3S5YA 2AGKA 3N9RA 2R91A 3SGZA 2P10A 3QSRA 1IF2A 1SZEA 3HPSA 5AC6A 1EUAA 3G1HA 4O52A 3EX6A 4IMGA 1N7KA 5LHFA 1OX4A 1H62A 1VCGA 4HPXA 3PB2A 1JQXA 3Q2DA 2BLEA 4AF0A 1GOXA 4AWUA 4UTWC 3LHTA 3PF3A 1B3OA 3NQCA 3LI1A 3SZ8A 4UTLA 2TRSA 1GPWA 3O07A 1F7BA 1KFJA 2OMAA 5U4NA 4AF0B 3M6YA 5DXYA 1OVDA 4O1CA 3W1AA 1BEUA 2WO5A 4IMCA 2YFNA 3V1PA 3MYPA 4S2CA 3NL6A 3I7RA 1KM0A 3NPXA 3S5OA 4O53A 3NYZA 2A6LA 3LCHA 4XBKA 2C16A 1VLIA 1TPVA 4DO5A 1VR6A 3UWZA 1YPIA 4A21A 5I3HA 4QITA 4MPQA 2VEKA 5HULA 3TJXA 3DZ1A 1XBXA 1K7XA 1WOBA 2E6FA 5D03A 4TMCA 3W7NA 3CU2A 3DKLA 3EWZA 2FLIA 3IIZA 4RX0A 2ZRWA 4RJEA 2C15A 2WJZA 3TW7A 4MJMA 1OF6A 3DAQA 3TC7A 4LU0A 2B0MA 4HNVA 1OFQA 1I45A 4X3ZA 3DFOA 2V5BA 4UFJA 3O15A 3P80A 2E5DA 3INPA 3N3MA 1VLWA 3TU9A 5CGQA 5I3KA 4N4PA 1TTJA 3FS2A 1EP1A 4NJHA 3UZJA 3W2NA 1OHLA 5DY3A 3JR2A 1HO1A 1LROA 3NXFA 4HSNA 3L67A 4ALDA 4NJKA 1W31A 3Q37A 3LERA 2EPHA 3W7PA 4JIPA 3HBLA 4K39A 3S1XA 3TIMA 1VH7A 3TQKA 2QR6A 4WUIA 3MHGA 3W7LA 3PBVA 4LVDA 4RV8A 1IGSA 1HFBA 4PCFA 3IRDA 4LVBA 4O1BA 2FQIA 4JTHA 1DHPA 2WNZA 5EL1A 1JVNA 3M1ZA 3LHUA 4O11A 4CNPA 4O15A 4MFDA 5FF3A 3DH7A 3UWQA 1TV8A 2A7RA 2I14A 2QUUA 4YCOA 4N9BA 3LCGA 4O18A 3HJZA 4Y96A 1FCUA 3LGEA 3UWVA 1IXOA 4OBTA 4OV4A 1O94A 1T8XA 2NUWA 4O4WA 4CQ8A 1MO0A 3QW4B 3N19B 3N34A 4LRTA 2YCEA 1R47A 1BWLA 4K7YA 1JQVA 2YDAA 2B4GA 2G5WA 1ZENA 3P74A 1AL7A 4FO4A 5D2VA 5AC8A 3ATYA 3L0GA 3DI0A 4KFNA 4O1AA 4LV9A 3LHVA 1KM2A 4D2JA 3W3OA 1YDNA 2VELA 2RKXA 4LNYA 5AN7A 2A0NA 1N55A 3CB8A 2NXGA 1ZNNA 4RCXA 4O28A 4IJBA 3HF3A 3NQ8A 5AHMA 3L5MA 4U4MA 3PBWA 1RR2A 1J2WA 2E1DA 1ZHAA 3CIWA 4M7TA 2C1HA 2BZNA 3CLMA 1RQBA 2QCMA 3MJYA 2WQPA 1QDSA 2NWSA 3PB0A 3PBYA 4O50A 4RR4A 3VNDA 1F05A 1FWRA 3DFNA 4EIVA 2GPTA 3QF0A 3IV3A 1TREA 3QW3A 1WX0A 3A22A 3LLFA 3G0XA 3ANYA 3W07A 3L65A 1QPOA 4WQ6A 2JGYA 3KVLA 4ICNA 4YLWA 1JRBA 2P1FA 2NV2A 5LSMA 5FF7A 2WNQA 3A9IA 2Y7GA 4JD4A 3W7QA 3HMJG 2PRHA 4M19A 2A5HA 1EA0A 1G67A 2QCHA 4LS0A 1LBMA 4AB4A 2W79A 4FHAA 1QR7A 3C56A 3G0SA 4MY1A 1YTKA 1D9EA 4JXCA 3GR8A 1G4EA 1SZFA 4NZFA 1VJIA 3TK7A 2GQ8A 1W3TA 1TPC1 5K4ZA 1H7XA 4DPQA 4NNBA 4JIQA 5TQLA 2CU0A 3W1UA 1A5SA 4IPIA 3NQGA 3GNNA 5E93A 3C2OA 1KTBA 4GBUA 5EA9A 4MZYA 5I3JA 3PWAA 3P84A 3DENA 1BWKA 3SW6A 2WOQA 3TQVA 1DKWA 5BRBA 4DEFA 1U5JA 2NX9A 3DI1A 2FJKA 1LLZA 5IBXC 4FXSA 3W1XA 3SI9A 3W1LA 3P5ZA 1YDVA 1YDOA 1HG3A 3W7RA 5H2ZA 4JTLA 5C55A 4UFKA 3GDRA 1PVNA 1KFBA 2QCDA 1H7OA 4CCCA 3P67A 3UY8A 4MJZA 1W0MA 1J4EA 4E0CA 1TJRA 3FA5A 4TO8A 4K6AA 3NG3A 4XZ9A 1JCLA 2ZZ6A 4Q33A 1YXYA 3WJYA 3L68A 1LOSA 3BW2A 2Z2UA 4O54A 2QCDB 1FCBA 1W37A 3EWWA 5DLCA 2YSWA 3TSMA 1FWSA 2V0TA 3LDVA 5HWMA 5LNUA 4GUJA 3OIXA 4Z1AA 3OA3A 1FY6A 3PSVA 4X22A 4MKNA 3LI0A 3NA8A 5DBUA 3CT7A 8TIMA 3G1FA 1C8VA 4QSHA 4GUGA 2QDHA 2X30A 1LRNA 5F4WA 4AMAA 2OZ0A 1SR9A 4UFLA 5FESA 2X1TA 3QJAA 3EX2A 3IIXA 4NX5A 3W74A 3GYEA 2WSQA 3L66A 2ZZ3A 1BKSA 1PIIA 5D32A 4I9AA 4K8EA 2Y6ZA 5DN1A 3F4NA 5AC7A 1SSDA 2CLMA 3G1AA 3LHZA 3W70A 1FDYA 2V9DA 1RD5A 1TPWA 2E5BA 4UTJA 1VCVA 4JTUA 1XM3A 1M6JA 2XFWA 3KVMA 3LXAA 2WV8A 3W2UA 3P7YA 3EX4A 3ZWTA 4ADUA 2BXVA 5AHLA 4EWND 2DJLA 3GKFA 3MUXA 4MLRA 4E38A 3CEPA 3NQFA 4S2BA 2FIQA 2DZTA 3IVTA 4FF7A 3DXIA 4MY9A 1OYBA 1VS1A 4NNCA 5KZDA 2ZRXA 3G22A 3OVPA 2GVLA 3EXSA 2FPVA 1R46A 4DO4A 3NQDA 3PVFA 1VGAA 3USBA 1I4NA 5A8GA 4ORIA 3C2EA 4JX6A 3KOFA 4Q4KA 1MEIA 4XUGA 1TQXA 2A2IA 2X16A 3RK8A 1YTEA 1TB3A 2XN0A 3OVRA 4NUWA 3KRUA 1H51A 3O1NA 1WV2A 2ZA1A 1JCYA 1JCMP 2NUXA 4DPPA 4JTTA 3THAA 3W7MA 4XTDA 1FXQA 3M5ZA 3PAJA 4N6FA 1KFKA 3GDLA 1LYXA 1A5AA 4UTTC 1P1XA 1G4PA 3CM4A 2DZSA 1LLWA 1UJPA 4UTWA 5IM51 3L5LA 3G1YA 1WAUA 5F4SA 1H60A 2QJGA 4AXKA 1FDZA 4DXVA 3FJLA 4O12A 2Y88A 2KZHA 2NUYA 1IIHA 5K7JA 3LM7A 1LBFA 4JN6A 4JTIA 3KRSA 3RMJA 2GOUA 5D38A 1WQ5A 1DOSA 3MI6A 3LTSA 4A29A 1K7EA 2H3BA 1DQXA 3TV8A 4WY0F 1TJPA 5CZ0A 1TV7A 3DHDA 4H4IA 1MEWA 1SPQA 1KW1A 4HSOA 3O05A 1X6UA 1SQ7A 3IGSA 2FTPA 3W72A 2YW4A 5KTLA 5FEWA 3WK2A 4MZ8A 4FIQA 1YXCA 1I2QA 3M44A 4M7SA 3QEZA 2ZRYA 2BWGA 5LHEA 2ZZ7A 5G1YA 2DORA 2C19A 2YYUA 3W88A 4EF9A 3QPYA 3GAYA 2VC6A 4ZQMA 3L0KA 2H90A 4ORMA 3S1VA 3W1TA 4E2DA 1EUNA 1THFD 1JUEA 2V2CA 5F4XA 1OFAA 4MUZA 2R14A 4OE7A 3A21A 2O7QA 3C52A 4K7VA 5LGXA 1W5OA 5FI8A 1KTCA 1T0OA 1T96A 3NM3A 3MO7A 3A24A 4NQ1A 3LXCA 2DZPA 1H7NA 4AHQA 4DBDA 5EPDA 4KWVA 3GKAA 2TYSA 3W7KA 3W1PA 1BTMA 1OJXA 1TTQA 2A21A 5FF0A 4Z1DA 1TIMA 5HUOA 3M5VA 4MLJA 3B0UX 1W8SA 3D0CA 3R5EA 4BK9A 4RZ4A 1IIGA 1J5TA 3NPUA 1I8JA 5DBTA 5EKYA 3BGJA 3H53A 3S1UA 4BR1A 2RDTA 4WY0B 3R2GA 1OFPA 1DBTA 4O17A 3V75A 3UQNA 1PHQA 1EX5A 1P4CA 2Y7FA 2OT0A 1KM1A 2Q8LA 1SO4A 1OX4B 1XI3A 2X1SA 2B7QA 3O6DA 2ISWA 3GZ3A 2Y63A 4R33A 4Y9AA 5K4XA 4LOCA 3B06A 2RHGA 1GEQA 1S3HA 3IGUA 5D33A 3O6CA 3LCLA 4HHPA 2V2HA 1OX6A 5HWJA 4OU1A 1B4KA 3UXAA 2E09A 2QAFA 4L4LA 2E68A 2YX0A 5CPNA 1KV8A 3BGGA 1X1OA 4O1DA 4CQ9A 1UUMA 1W5PA 3C4UA 2ZA3A 4UTHA 3C2FA 1AL8A 1KM3A 3DFQA 2WSRA 4ADSA 1SUXA 3O8AA 1QO2A 3M9YA 1VQTA 4GRSA 3UPWA 2ZRVA 4I7VA 2TSYA 2C14A 1ZAJA 3HGJA 3LXBA 4JS3A 3BLFA 2FPYA 3W6YA 1YADA 3P60A 4GXMA 3TE9A 3ZWSA 5AOUA 1DQWA 2DZXA 1G6CA 3I65A 2DZUA 2NLIA 1P0NA 2C0AA 3N2XA 3TR2A 2RDWA 4YWIA 5C54A 3R8RA 5AYXA 4BI6A 5LNWA 3NQ2A 3S1WA 2OJPA 4G1KA 3T55A 5HQEA 4N6EA 3KRZA 2TMDA 1OABA 5D2WA 3I6RA 4UC5A 4KFOA 4H6KA 1SU5A 3U6WA 3K30A 1A5BA 2ZZ5A 5F2IA 3W7HA 3S0CA 1QWGA 5KSWA 4LY8A 2QEZA 4C1KA 2CLOA 4GUFA 4MFEA 2GQAA 3GXNA 4HT3A 2NV1A 3N14A 5K9DA 3NPVA 4XBSA 4AWTA 1ME9A 3VCRA 3I7SA 2E5CA 3KFTA 3BG3A 1PL9A 2V2DA 3HGRA 4XQ6A 3W1RA 2J88A 2ZDRA 2FPTA 3TFXA 3S6DA 1V7YA 1OFRA 2X2GA 4L4MA 4GUHA 3LCIA 2Y70A 1OK6A 2QF7A 3KVKA 3CC1A 4JX5A 3LLDA 5DXXA 5BOOA 1JCNA 1DJQA 3TJLA 1OFDA 4FNRA 1CX9A 1TRIA 3EKZA 3LBCA 2Z0IA 2CZEA 1XDLA 1OF8A 2A4AA 1YPFA 2JGQA 3TMQA 1RVGA 1YTDA 1TPH1 3G1XA 3PSWA 2NX1A 2EGZA 1HL2A 6TIMA 4O8RA 4NX0A 3HQ1A 2LLEA 3W23A 3N9SA 3G24A 1O4UA 3A5VA 1ZAIA 3NQAA 4JYEA 3EKLA 1OG0A 2FDSA 3Q94A 2QCFA 5IBXA 2W6RA 5AYZA 4M6VA 3OEXA 3QQ0A 1LRQA 4QISA 1H1YA 4O4VA 4Z1CA 4W9TA 4N9EA 5A5WA 3PG8A 3W75A 5LNSA 5G5IA 4NT0A 2XN2A 2NX3A 2QKFA 1ICSA 1S5TA 2GQ9A 2GVGA 3VKJA 3O06A 2G96A 3OVQA 1GG1A 1SZNA 1ZCOA 2CZ5A 3LCFA 5G4EA 2ABBA 2OX1A 2RH9A 2E6YA 2ZRUA 3EX3A 1O95A 1ZAHA 3LTYA 4JY9A 4E2BA 3P61A 3R12A 3BLIA 3NDOA 4AHOA 2WPBA 2I9EA 3EWUA 1LCOA 2YFOA 2H6RA 3LOTA 1EEPA 4JTJA 3GDTA 1I2RA 5D2XA 1MXSA 1XC4A 1F6KA 3NL3A 1KM6A 1C29A 1KM5A 5FEPA 5D2YA 4OT7A 4QQ3A 4DELA 1NAL1 1TYGA 2PCQA 1N8FA 2BTMA 2ZTKA 3STFA 5CSRA 4IMDA 5BW6A 2VKZG 3M41A 3LV6A 3PC0A 4N9CA 3R89A 4OWGA 4AH7A 1H5YA 2HMCA 1T99A 2CZDA 4UTIA 3MBFA 2PRMA 3UXDA 4DF0A 1EP3A 1LP6A 3C2RA 2X1UA 3A5FA 1Q6OA 3MHFA 5EY5A 4EOUA 1K8YA 4JNMA 3BG9A 3LTPA 3THQA 5AHNA 4FNPA 1TTIA 1ALDA 4JYDA 3NR0A 1D3HA 3GLCA 3UPBA 4BI5A 1WXJA 3M16A 3HPZA 2WSYA 3P62A 3W85A 3HG2A 4PFMA 4KFPA 1I2PA 1XBZA 5DCEA 2ZZ1A 3M7WA 3M0ZA 4QNEA 2CLHA 2YGYA 1K8XA 2Y7EA 1FWNA 3QYQA 4TIMA 1K02A 3E12A 3T44A 3W83A 4WD0A 2NXHA 2H3DA 4O10A 2E6AA 4NJJA 4JDBA 3S9YA 2CLLA 4OGZA 1S5VA 4PODA 3TXZA 1FWTA 3ABSA 4EVZA 2J24A 3B04A 1B9BA 4PEKA 1PS9A 3TDFA 3SR7A 1EWDA 4LRSA 5CZSA 1W1ZA 4AHPA 2ZYFA 3MWAA 4JDYA 2A7PA 3VI2A 4UTTA 4N4QA 1S5WA 4KWWA 3SJ3A 3E96A 3RLVA 1X1ZA 4IOTA 4MYXA 4JTEA 4N9DA 1EIXA 4NNAA 4BWLC 2C3ZA 4BI7A 4XKYA 4FB7A 4O0KA 3TMLA 4NU7A 1VHCA 1P0KA 1SW3A 3EWYA 4U28A 2EHHA 4RK8A 1KA9F 3FIGA 2J6XA 1O60A 3QMRA 1FUYA 3MP4A 1ME8A 4HN4A 3TUUA 2QJHA 4Q32A 4XKYB 5HWNA 3FYPA 3C2VA 3OHIA 3F03K 4IMEA 3LRKA 5HINA 1AMKA 2FFCA 1ZJIA 2YZRA 3BW3A 1LBLA 3QMTA 1L6WA 3A23A 1EP2A 4MVAA 1K7FA 2DJXA 4GE8A 4MYAA 5H91A 4K36A 1Q6LA 1QOPA 3WJXA 1RQHA 3N73A 4HNNA 2TPSA 3ABQA 3HGOA 4LW7A 4UNKA 1SFJA 2EF9A 4UTMA 2ALDA 3QM3A 3UWUA 1NVMA 3IIOA 1YLVA 2ZZ4A 3BV4A 1KFEA 4M5PA 2C6QA 5D37A 3F1QA 3NAVA 1TRDA 1HO4A 5E0KA 4UTUA 3UWWA 1LRTA 2Y85A 5HMSA 2ISSA 3VE9A 2Y62A 1X7FA 3DFPA 4FEZA 4RXGA 4IPJA 1Z42A 5KZEA 3CIXA 2VFGA 3EWBX 1PE1A 3W2LA 1GVOA 1W3NA 5BMXA 3LCWA 4MZ1A 3CPRA 3PG9A 1GVRA 4M6QA 4LT9A 5KITA 1XUZA 3WK1A 1CW2A 1R2SA 2Y7DA 3BW4A 3PY2A 1OFBA 5C5YA 3ELFA 5AHIA 4PL1A 1FQ0A 4OQVA 4GC4A 5D2TA 1FDJA 3KAOA 3IIVA 3KX6A 5MHBA 3STCA 5LNVA 3W22A 5C2XA 1FXPA 3W1QA 3HO8A 5KINA 1CI1A 3CEUA 3ABRA 4DQWA 2JKPA 4WJEA 2JK2A 1B4EA 4DF1A 2DZVA 3NOEA 3TNOA 4LUJA 4FX6M 1F76A 2FB3A 5CZTA 3DU0A 1K3UA 3BG5A 2YYTA 3CWNA 3M47A 5KMYA 3WJSA 4A3UA 2E77A 5D04C 4QIUA 3W7EA 4YXGA 3NM1A 3SY5A 2CLKA 3SFKA 1ML1A 4JEQA 4WXYA 3PULA 1K03A 2QCEA 4O13A 4UFHA 3GIYA 2ISVA 3L21A 1ZY9A 4FNUA 1XKYA 2RFGA 1FCQA 3Q58A 1KLZA 5CPLA 2PC4A 3HG4A 1GVQA 4NVTA 3PS7A 5CZJA 4ZL1A 4ZQCA 1W54A 3UY7A 2V30A 1SW0A 4NXSA 5EBUA 3W7GA 2Q3RA 2CLIA 1FCVA 2ATSA 5BMWA 3NNTA 1JUBA 3UZ5A 4PL2A 3VFLA 4IQLA 2DZWA 1YXDA 3BPWA 1F74A 3I68A 2IQTA 3NVTA 1WYIA 2DP3A 3VE7A 3W1NA 5SWUA 1F6PA 1VHNA 3JS3A 5DY2A 1ONRA 1AW5A 2R8WA 2VEPA 1JCJA 2BSLA 1UUOA 1LDCA 1QAPA 2VFEA 3O63A 4QJ1A 1LOLA 5AYYA 3W71A 2CWNA 1HUVA 3W1MA 4S1FA 4TR9A 2QCCA 4UMCA 3E49A 4HNTA 1VRDA 4RLIA 2QAPA 1XCFA 5DELA 4O14A 4O57A 1SFLA 2QCLA 3WJWA 3B4UA 4UMBA 1HTIA 4A2SA 1XBVA 5EMUA 5FEZA 3MYOA 1GG0A 1L6SA 1L2UA 1PV8A 3UNDA 2O7SA 1MEHA 3PR2A 3T40A 4R7JA 4FNSA 1TCDA 1C9DA 3EXRA 1LOQA 5TBOA 1H1ZA 1VPXA 4NJIA 3GVGA 1P5BA 4J9JA 2CLEA 3IEBA 3E0IA 3FLUA 4QM1A 5CPMA 1XUUA 5I3FA 3LHYA 3HB9A 4Y6GA 5F2LA 1TPDA 1YYAA 3M43A 1WDWA 3G8EA 4O19A 1SZGA 3MBDA 4ZQRA 3HOJA 1AW2A 2Q8ZA 1OK4A 4GWEA 3S42A 5G2WA 1W3IA 3LBMA 1WOAA 1TQJA 3MMTA 4EF8A 3W7JA 5EYWA 1H7PA 2HTMA 1SO5A 3SSJA 4DBEA 3W76A 1OFEA 3L5AA 2Q3OA 2XN1A 1Q45A 1GTEA 1ZALA 3LRMA 3DKJA 4TMBA 4UFMA 4POCA 1ZFJA 3HG3A 4WZHA 2A6NA 2J9XA 4R34A 3H55A 1NFBA 1A5CA 4P61A 4M6PA 3TSDA 3LX9A 1FX6A 3QC3A 4O0ZA 3NZRA 4GNJA 3G1DA 3AO0A 4PTNA 1EPXA 4IGHA 2GUUA 1KBJA 2J9YA 2NZLA 4Z0SA 1TO3A 1H7RA 1W5NA 5ABTA 3S5ZA 4UR7A 1QOQA 3G3DA 5D30A 4N02A 3W7OA 3W86A 1JCXA 3WK3A 1WA3A 4AAJA 1MZHA 3WK0A 2R94A 3G3MA 3YPIA 1SO6A 3F4WA 3CQ0A 4K37A 4C1LA 1IXNA 3PUOA 4JX4A 4DF2A 4GFSA 3PUEA 1Z41A 3M5XA 4UMAA 4FX8A 1JJKA 5CG7A 3MI3A 4IWWA 3GR7A 3FKRA 4LC6A 1PCKA 2A1YA 5G2IA 1TPFA 3BLEA 1RV8A 2ZTJA 3UD6A 3TH6A 3W84A 3QQ1A 3FKKA 5HR6A 4JR5A 4PH6A 1OYCA 1GZGA 4X2RA 2GJNA 1QNVA 4UUIA 3P82A 4GJ1A 4FIRA 1K8ZA 1PCWA 4UCGA 3TKFA 1QCWA 1JULA 4O16A 3UWYA 5FEXA 1O5KA 1G7UA 1WBJA 4X9SA 5F1UA 5E1QA 3SIZA 3C0JA 1OYAA 1TSIA 3QPZA 1U83A 4JYFA 4WOQA 2FB2A 3PUDA 1IXPA 4LVAA 5HJLA 3W73A 3U2OA 2EKCA 1GVSA 3TX9A 2D73A 1TV5A 4DO6A 2NWRA 2PRLA 5HNRA 1ME7A 3G1SA 5F2MA 4UR8A 3C6CA 5HR7A 1DJNA 1W56A 1GTHA 1WBHA 5G1TA 1RPXA 1KM4A 2Z6IA 3QSTA 4B5NA 3DHFA 3L0NA 4I7UA 2JKEA 7TIMA 1UCWA 3L2IA 5F1VA 1TTPA 4JGDA 3NGJA 2J27A 3GXTA 3UYCA 1OFOA 1XL9A 3SECA 2HSAA 4CNNA 3MW7A 2Y89A 2WKJA 3QRHA 4LVFA 5I3GA 4FXRA 3LCXA 2VFFA 3HGSA 3E9AA 3TROA 3O6YX 1AG1O 3G18A
chains in the Genus database with same CATH superfamily
4MWAC 3SUWA 3WQFA 3STGA 4BWLA 1F5ZA 4NAFA 1XHGA 2PLCA 3TSBA 1Y5VA 2B7NA 4NKCA 3SCUA 3UWEA 2HS6A 4H6RA 3ATZA 3LV5A 4OUEA 1PZ1A 4WEVX 4I7WA 3OP2A 3C3NA 4ADTA 3FVDA 1XF0A 4C90A 4E4PA 5AHEA 4Q3MA 4NAFB 1A3WA 1HN1A 1ISWA 4PMZA 5D09A 2VGBA 4LAMA 3WH7A 3FYOA 1KBIA 1P0BA 4DZIA 3FJNA 3KHJA 2PF8A 2B7PA 3WX7A 5AFDA 1Z44A 3URAA 4DHGA 3SGUA 1OM0A 3OU8A 3WBEA 5D05A 3W7CA 5HMFA 2C18A 5HATA 1YPXA 4RNFA 4XD4A 4PFHA 4CNOA 1PTDA 1J2BA 2QJMA 2IKIA 1L6YA 2CLFA 3WZ0E 4KGLA 4Q4OA 2YW3A 3VOIA 4H19A 2QDDA 3TQ0A 4NY2A 1JYVA 4WSKA 3V18A 2V38A 4XWUA 5CPOA 2B81A 2DU2A 5FL1A 1JFXA 3T4CA 4S3EA 3ZOAA 4FALA 3E2QA 4CD5A 5CBIA 1DVJA 2XFRA 2WMJA 3CTLA 4WJ8A 2QDGA 2WMIA 2YXGA 2PGRA 4M51A 3H24A 3IJLA 4F9JA 3MMWA 2JBMA 4ZO9A 2GJRA 3CUZA 4X9YA 1EC7A 1G69A 4WDWA 1EHNA 2WMIB 3AJ7A 2A3EA 1QPNA 3OW1A 3KDOA 3CHVA 4QAWA 3IIPA 1LQ2A 4A22A 1OG6A 5FA5A 4IUOA 3CUFA 5JIPA 3N2OA 4JICA 3CMGA 4F0KA 4KRTA 1JUKA 2VVSA 3DERA 2YXXA 4W7WA 5LGZA 1TWIA 2QUVA 4F0HA 3W02A 1ADOA 1M7OA 4ZO6A 3GR4A 1CGUA 1CXEA 3WUGA 4IQDA 3VDCA 4JTFA 3TXVA 4H9YA 3S5NA 1AW1A 3B9NA 2V82A 5ENLA 2VO5A 1Y0EA 4GVFA 3W2MA 2RDUA 4NILA 3BARA 1S5MA 2ATMA 1LJYA 3NEVA 1ZUAX 5LKYA 1MW1A 1BF6A 2WJDA 1WKEA 3H54A 4HHHA 5D02A 2V81A 3GFZA 2Z1BA 1C8YA 1MQPA 4U33A 3MT1A 3ZFHA 3ABOA 4QGCA 3V0TA 3ISIX 4OJYA 4LS1A 3RU6A 3FGCA 5M1TA 3L9CA 3FJ6A 2YPIA 5REQA 4RZ5A 3THCA 1I2OA 1BKHA 1DV7A 3B05A 3GZAA 3N1AA 2QGHA 2J7BA 1Q4WA 1V5XA 5EU9A 4JTSA 4GH3A 1Q66A 3LYEA 4QROA 4MNJA 4PCNA 3UCQA 1VYSX 2WLZA 4F0MA 3MV01 3HIJA 4CEXC 1OCJA 3RCNA 1X8CA 1M5WA 1BYAA 4JTKA 4C6QA 1TX0A 3VKCA 2DSUA 4GX8A 1O1ZA 1J9YA 3PN8A 1GGOA 4NZCA 4MAZA 2PTZA 4R85A 1GOMA 5C71A 2G8ZA 4RE2A 2PURA 1RA0A 7REQA 1RP8A 5CPQA 2CBUA 3GWQA 1R5YA 4GXPA 1H4PA 1EB3A 5AECA 3C0LA 1CB7B 4AD0A 1LZOA 3M7SA 1QATA 5FKYA 4IXHA 3WH6A 5J5RA 5L9FA 3OGVA 4X63A 1GYNA 4C7FA 3GK0A 2HZGA 1A5KC 3OZPA 3ITTA 5T26A 4GG9A 3BVJA 1CTNA 1QTWA 3P8IA 3EB2A 5CKSA 4GIEA 1Y8BA 1UP0A 1A50A 3P8JA 2F7FA 3TCEA 3TW6A 5T91A 2DZAA 4XAPA 3NEHA 4K8HA 1DXEA 1MSSA 4ZOEA 1LWHA 3GC2A 3VGBA 1LL6A 2G3FA 1K77A 2XSAA 2QV4A 4L1XA 3EDKA 1T6MA 1R3RA 4P2VA 2O9TA 4KEUA 1FVPA 4WSJA 1XDMA 2FZNA 2VOMA 4HNUA 3TZFA 1EXPA 1JPKA 3QY7A 4NIRA 2O9RA 3V5OA 1X96A 4GCXA 1K6WA 4DRSA 3GB6A 4TU1A 2QCGA 1Q7ZA 5DCBA 1EA9C 3MY9A 5A6AA 5CXPA 3B0PA 2VX7A 4CVWA 4H01A 9RUBA 5I23A 1X97A 3N9RA 2GJPA 4F8XA 4XSLA 1EJVC 2PP1A 2WANA 3PB2A 3Q2DA 1B3XA 1VFHA 2BLEA 4U3AA 1RUSA 2VYOA 1WO2A 3OLGA 4MHBA 1E4IA 3SZ8A 3ZJKA 3TTSA 2D24A 1JZ8A 3EYPA 4PTXA 2OMAA 4X2PA 1OVDA 2WO5A 4IMCA 4G56A 9CGTA 2ZKMX 3NL6A 3KCOA 1A4MA 3CZ8A 4O53A 3NYZA 7TAAA 2C16A 2VDHA 4XZBA 3IPWA 5JBDA 4QITA 1V0MA 1S2WA 4OOZA 4AIBA 3EMCA 2VEKA 5HULA 3BJTA 3HJEA 3W7NA 1GPFA 4MWAA 1NWTA 3CU2A 4C6BA 2DT1A 1QRQA 3NURA 1OBAA 1OF6A 3DAQA 3TC7A 5FL0A 2Y2WA 1OFQA 1MW3A 4MWAB 3DFOA 2V5BA 1V0LA 1VFLA 1RSCA 3O15A 4LYRA 3DEQA 3N3MA 3TU9A 4P7LA 4N4PA 3FS2A 2DUZA 1DXFA 1TE6A 3WLRA 2B31A 3H2FA 1K9TA 1HO1A 1LROA 4CNSA 3JW7A 4E4FA 3L67A 1VRXA 1GORA 4HD5A 4WVXA 3S1XA 1BWVA 1PDYA 5FJUA 3CIVA 3B9OA 4RPPA 5CZKA 1FH8A 1IGSA 2ICSA 4JZ5A 4QP0A 4NG3A 4JTHA 1DHPA 2WNZA 5EL1A 1XICA 2G3NA 3QY8A 4RE3A 1Z3NA 3RX2A 3AMCA 2PDMA 3WG6A 1B3WA 3KM8A 2XM1A 2HVNA 2QUUA 3W6LA 3LCGA 4ZB2A 1M04A 3R6IA 1EGVA 2PP3A 3OQEA 4QG6A 4YHEA 3UA3A 4PBFA 1IXOA 1ITUA 1O94A 3N17A 3U2CA 2D1ZA 3U7VA 3WDJA 3GHRA 1ZENA 3P74A 2VTFA 4QS6A 1AL7A 1S1PA 4AZ7A 3L0GA 5BROA 5EBAA 2CIPA 4CD4A 5GJNA 4LV9A 1V6YA 2XFFA 2OLAA 2RKXA 2VMFA 1FWGC 4XIAA 2J7DA 2XH4A 4FXJA 1RR2A 1CXHA 1ZHAA 1JPDX 3CLMA 1RQBA 2QCMA 4FSAA 4QTGA 1YBQA 2DIJA 4RR4A 1Q5MA 2GPTA 3QF0A 1JD7A 1PPIA 1W1PA 3A22A 2Q09A 1XYAA 3W07A 3L65A 1E55A 4YLWA 3AXIA 2VJXA 1YBQB 1H49A 4IFRA 3ZVHA 3KTSA 1TV4A 2VD8A 4JD4A 1RJPA 2VZOA 3W7QA 4M19A 2A5HA 3UG4A 3SGGA 4XISA 4AB4A 2W79A 4FHAA 1M03A 1LWIA 1QR7A 1NP0A 4AFYA 5I78A 1U5HA 4NZFA 3WDIA 1VJIA 3QV9A 3I4KA 3B9DA 3PANA 4B5XA 1TPC1 1H7XA 4E2VA 3B8WA 4JIQA 5TQLA 3KE0A 1OSEA 2J8FA 1PTGA 5A8QA 5C9XA 3PWAA 4IHCA 1BWKA 3T0TA 3RO8A 3TQVA 5BRBA 1QASA 1YNYA 3DI1A 2V3EA 2FJKA 3W1LA 5A94A 2PD9A 3GIPA 1HG3A 5H2ZA 2UY4A 4GPNA 5GQBA 3N4EA 1H7OA 4JNZA 3P67A 3FDKA 4ASTA 5EMMA 1J4EA 2FZDA 3AMDA 5EFFA 3NG3A 1UUQA 2WCAA 4Q33A 4HNCA 1YXYA 3L68A 1J12A 4JN8A 3BW2A 2O55A 2BOGX 2V3FA 1GKRA 1E6QM 3PSVA 3CUHA 3NA8A 3CT7A 2E9MA 8TIMA 1XIJA 3ANVA 2VEFA 4NAEA 4GUGA 2X30A 5F4WA 5ABEA 1SR9A 4UFLA 5FESA 3ARUA 4H41A 3JVAA 2W67A 3IARA 4YWSA 4PMDA 3ZO9A 3GYEA 3OYZA 2WSQA 3AYVA 2Q01A 1PIIA 4D72A 2FH8A 4I9AA 4K8EA 4Q4SA 1KGUA 2DSWA 2EQDA 2W92A 3UXKA 4JNYA 3KL0A 3LHZA 5DMYA 1UZ4A 2QW5A 4UTJA 3GM8A 1YW1A 3LXAA 3M0IA 5DQPA 3UGRA 4BF5A 3KL5A 3PPGA 1KR0A 2CXGA 3ZWTA 3J7HA 2GSJA 4EWND 4MLRA 3VD4A 4E38A 4AYGA 2DZTA 3FSUA 3KWXA 2PI6A 5KZDA 2ZRXA 3OVPA 3LMZA 5AKQA 1I4NA 2DZBA 3KOFA 3CHDA 4GY0A 4H8VA 2GGGA 2V3DA 1TB3A 3OVRA 3A6OA 3GVQA 2DIKA 3O1NA 2Y1HA 3VCNA 4XD6A 1JDCA 2EJ1A 2NUXA 2WBGA 4GD0A 4C6IA 4JTTA 4DXKA 3THAA 1XPGA 1KFKA 1P1XA 2DZSA 1UJPA 1S2TA 3L5LA 1H60A 4J3ZA 2D0GA 1XG4A 3H2AA 4DXVA 2Y88A 1FRBA 4LBRA 4LAZA 4PMVA 1IIHA 4MNKA 1OD0A 2Z1KA 1XLFA 4JN6A 1LBFA 1W8GA 3AHTA 4H6QA 3CT2A 1OZMA 1VJZA 2R24A 1UD5A 1ADSA 1DQXA 3TV8A 4M1RA 2XYLA 3CUJA 3SB0A 3UVIA 3URQA 3W81A 3HM7A 2ONEA 2ZUWA 3URBA 1N8IA 2ZVIA 4JBRA 4HCHA 1EJWC 1H0IA 4OECA 2O4MA 1V79A 4XB3A 1S2CA 1Q13A 2P3EA 4PUUA 1OADA 3L4YA 4ZQMA 3L0KA 4HYRA 3F5KA 1JUEA 5F4XA 1OFAA 4MUZA 1JYXA 1HKWA 4FOJA 2O7QA 1KTCA 1T96A 3MO7A 1RK6A 3WSUA 3L4WA 4AHQA 4NYUA 3SJNA 3GKAA 3K4AA 1TTQA 5FF0A 4RPQA 2Z1WA 1BG4A 1NFPA 1PO9A 2V63A 4MLJA 3B0UX 4BK9A 4L1WA 5IRPA 2PWEA 1IIGA 3RCYA 5E5CA 5CJ5A 4JTAA 4IGNA 3AYTA 3WQEA 3CB3A 1DHKA 3C2YA 2KX9A 4BR1A 2V5JA 3M0LA 1U30A 1AH4A 1JPMA 1KXHA 3HMCA 3V75A 1PHQA 3GY1A 1P4CA 4KETA 2OT0A 2BHUA 1KM1A 2Q8LA 3VGDA 1CXKA 3A64A 5GNXA 4Y7EA 1XI3A 4LNCA 1E5JA 2D22A 2ISWA 1PB0A 1ONWA 4YYCA 4HHMA 3S2NA 1UR9A 4L4LA 1RLDA 4M1BA 4U10A 2ZWYA 2WLYA 4M29A 4TOQA 1MVYA 5H8MA 1X1OA 4Q6XA 2BGQA 2QQ6A 4QDPA 2WMFA 2C0HA 1IWAA 1AL8A 3GG7A 3T8QA 3O8AA 3POCA 1Z89A 4YNGA 1GUVA 1QO2A 3CGTA 2ZRVA 3HGJA 3LXBA 4X0VA 1TZ7A 2FPYA 3W6YA 5A8PA 1YADA 5D8ZA 3TE9A 3ZWSA 2HRWA 2GGEA 1DEDA 1UIOA 2Z1SA 1A49A 3I65A 1P0NA 1JIBA 3DX5A 3SCRA 2RDWA 3FVMA 2XFYA 5AYXA 4BI6A 5LNWA 3NQ2A 3S1WA 4AIOA 5HQEA 4LYKA 1GZJA 2E4TA 5DMNA 4N6EA 1WZKA 3VVGA 3L4XA 2OYKA 3WDQA 3BOLA 4H6KA 5PTDA 3K30A 1H09A 3CZJA 3NXLA 1QWGA 1SZRA 3S0CA 4PTVA 3CUXA 2QEZA 3VGEA 1EOKA 1IGWA 5FJRA 4GUFA 1NIUA 3GXNA 4PMYA 4A8RA 2NV1A 1ME9A 5E0FA 3KFTA 2FFIA 4QLJA 1PL9A 2FPTA 3U3HA 2X2GA 1TVNA 2KAUC 1OK6A 2QF7A 5BOOA 1DJQA 4YU1A 2NVCA 3EKZA 2CZEA 4ACYA 2J7CA 1YPFA 3ARTA 4ZXLA 1KD0A 1RVGA 3G1XA 2NX1A 4O8RA 3HQ1A 3C0QA 1UZDA 2BMBA 3W23A 3N9SA 3A5VA 1RJQA 1ZAIA 3LNPA 4WSHA 3AQUA 3Q94A 1YIXA 2QCFA 4EE9A 3MDUA 1PYMA 8XIMA 5T8GA 4JHZA 4Z1CA 4O4VA 3LPPA 4W9TA 1NDVA 1EQPA 4HK7A 1S5TA 4QRNA 3OVQA 1SZNA 3RRAA 1TVPA 5MF5A 4S3AA 5G4EA 2OX1A 3W25A 2ZRUA 4RDZA 4W5ZA 3EX3A 1O95A 4DM2A 4FK9A 1ZAHA 3S1GA 2YL8A 2DY3A 1PWMA 2WPBA 1XSKA 3EWUA 3SCTA 1F3XA 1EEPA 3GDTA 5D2XA 4FP1A 1UD3A 1MXSA 1JG9A 3DYPA 4JQ4A 2X40A 1KM5A 1QU4A 4KWUA 1LUCA 3Q45A 3M0MA 4QQ3A 1TZZA 2X0SA 1NAL1 2PCQA 2BTMA 5CSRA 5CAHA 3STFA 2OYLA 1MUWA 4IMDA 3PC0A 5IFTA 4N9CA 2GVYA 4C6JA 2HMCA 1NH6A 3W38A 2NV9A 3MBFA 1XPYA 4LYQA 5GNZA 1W32A 3CLWA 3UT0A 2VQUA 1WCGA 3A5FA 1FTXA 4TTUA 3MHFA 1CNVA 3BG9A 3BOXA 1Q7MA 5AHNA 4FNPA 3SY8A 3VIFA 4W93A 2PDYA 2XIBA 3JUGA 4PFMA 3BXWA 4KFPA 1FWHC 3VAVA 3M7WA 1E5NA 4RW5A 4K1WA 3LD5A 3T2PA 4MM1A 1KWGA 4I90A 2QJJA 4TIMA 3FDGA 2OO6A 1XGDA 4KESA 4WD0A 1RVKA 3QKZA 4YN5A 3A3WA 3FCPA 4NJJA 3H2MA 4I5XA 1FWTA 3B04A 3WN6A 2E0PA 3B0XA 3TDFA 3VX0A 1PX4A 2Z29A 2ZADA 5CZSA 1W1ZA 1WKDA 3MWAA 3VZZA 3U2EA 1J0IA 3KP1A 2A7PA 3VM5A 3DYOA 3N18A 4EXAA 1RY8A 1XYBA 3UR5A 3PTDA 2FMNA 1VEOA 3AXHA 4ACZB 3E96A 2QYGA 3GFXA 4HPGA 1X1ZA 1EEXA 4IOTA 4MYXA 1XLMA 2D69A 4JTEA 2C1IA 4UBPC 5A6MA 2X1IA 3RX4A 3KBNA 2FGLA 4FB7A 4QR6A 1C90A 2WBKA 4B91A 4RUBA 4GA8A 5CJNA 4U28A 2EHHA 1G5AA 3FXGA 4RNJA 4B90A 1O60A 1ME8A 2YKKA 4HN4A 2QJHA 3QGVA 5HWNA 1WDDA 1ZJIA 5CPTA 1HT6A 2VRKA 3A23A 1EP2A 2A3AA 1V3JA 1X38A 1KXTA 3IUIA 1TWDA 2YCJA 1Q6LA 3WJXA 4H9XA 1W6TA 1US3A 3N73A 2AOSA 3ABQA 3HGOA 2PDFA 1ITCA 1V02E 1IR1A 2ALDA 3QM3A 3IIOA 2C7FA 3B8SA 2I5IA 3LSBA 2WB5A 1HO4A 5FAGA 2DGAA 2ISSA 5C9UA 4KH2A 1OQFA 2CKSA 1FOBA 6PTDA 4ML4A 3PTQA 1X7FA 1P6WA 2WW5A 5KZEA 4Q8UA 1PE1A 1GVOA 1W3NA 2V68A 5TNVA 4MZ1A 3AU6A 3VDBA 1GVRA 4GKLA 3HPFA 1P7TA 4XZIA 3CXOA 1CZ1A 1XUZA 3WK1A 3R4IA 5C5YA 4PL1A 4OQVA 2O56A 3T42A 1ECQA 1WUEA 4EAYA 3W22A 1GCYA 3VNJA 4US5D 1Y7VA 2QULA 3ABRA 4DQWA 3CL6A 2JKPA 3QYSA 1PYFA 1HX0A 4DF1A 2E8ZA 2L5HA 3F5LA 1LT7A 3BCDA 5A2BA 1T5AA 3DU0A 1K3UA 4DO7A 3CWNA 4IGMA 2E77A 2ZC8A 3SO7A 4YXGA 3NM1A 1H41A 1MUCA 3UZYA 3ALGA 1K03A 4PMXA 1VEMA 2QCEA 4XV0A 4CNUA 2ISVA 2R1PA 1IZJA 1FCQA 5CPLA 5LA1A 4NVTA 1UR2A 3S9ZA 3WH9A 1RA5A 1SW0A 3H7VA 4HVXA 3OB8A 2A3BA 3DYMA 1P0EA 1JUBA 3GHTA 3VFLA 4IQLA 2IQTA 3WMBA 3UZZA 1TUFA 2ACUA 3W1NA 1VHNA 5I02A 1AW5A 1K9DA 4LY4A 2VFEA 1LDCA 3ID7A 4JKLA 4QJ1A 1LOLA 4DB7A 3AIWA 2ALRA 3GVRA 4GI9A 1VRDA 4WKFA 3RO6A 2QAPA 1GOKA 4PTMA 5DELA 3IS4A 1SFLA 2QCLA 1B2YA 4Q8VA 1REQB 1CXLA 1XBVA 3ZZ1A 3MYOA 1PV8A 1MEHA 4D1JA 3T40A 3QVQA 4YIWA 3T0BA 2GUBA 4E8CA 5I7GA 3W0KA 1H1ZA 3BLPX 3AALA 2CLEA 2OWWA 1JYNA 4QM1A 2PSNA 3F4VA 5I3FA 1DWFM 1XD0A 1YYAA 3HTWA 1R7AA 5LIUX 5I2UA 2NQ9A 3NDZA 1AW2A 1C93A 2Q8ZA 3GHSA 4GWEA 3S42A 1W3IA 2AL1A 1HVXA 1TQJA 1H7PA 2X7WA 2VCCA 4A05A 4DBEA 3AUOA 3S3GA 3R58A 3NCOA 2TODA 3CHEA 3P93A 2Y5EA 2PDIA 3GC4A 5AYBA 2XJ7A 1BXBA 4UQ9A 3HG3A 3ZIZA 1NDZA 1TWZA 2J9XA 3LY0A 5G4HC 3TSDA 1Y5XA 7PTDA 2CHRA 1FX6A 4PMQA 1H3GA 1EPXA 2GUUA 1A0CA 1UP3A 2XVGA 4ZE4A 3S5ZA 2VGIA 1WB0A 4EPBC 2PA6A 3HPAA 1QOQA 3HURA 4C6OA 1MZHA 1J01A 5I0DA 3VMPA 1SO6A 3F4WA 4C1LA 3PZ9A 5HJXA 4JX4A 2ZC1A 1Z41A 4MAVA 4UMAA 4C6EA 1JJKA 3GU1A 4IWWA 4FLQA 2PDKA 2OELA 1XISA 1PCKA 4R3UA 4UQBA 1RV8A 2AMGA 4DZHA 5FJJA 3TLQA 1EYEA 3CS2A 1X98A 5HR6A 1OYCA 2DQWA 1GZGA 2IW0A 4GGHA 4X2RA 3ICJA 4H8NA 3WKZA 1ZBCA 4FIRA 1E6RA 1K8ZA 4UCGA 3VOHA 3PZVA 1JULA 4O16A 1G7UA 1WBJA 4X9SA 1HQTA 5E1QA 4ZTYA 1XLHA 4AG0A 3MVIA 1U83A 3H12A 4WOQA 4AISA 2FB2A 3PUDA 1GW9A 5BU9A 4LVAA 3VD3A 5HJLA 3W73A 3WFZA 3U2OA 1R38A 1HVQA 3ZR6A 2EKCA 5ABHA 1SJCA 1SYTA 3IUDA 1V3IA 1GHRA 4UR9A 3R25A 2J79A 3FX4A 4H9VA 5HNRA 4EPKA 3ME3A 4R9XA 1DJNA 1W56A 2OQHA 1GTHA 1WBHA 4W8BA 5G1TA 3T6CA 2OB3A 3CO8A 2I5GA 3H6OA 1DIDA 3L0NA 3AXKA 7ENLA 4W88A 3L2IA 4JGDA 2J27A 3SEPA 3SECA 2CERA 4LVFA 2YBTA 4FXRA 3DHPA 3E9AA 4IJCA 4MADA 1FA2A 2BX7A 2YR1A 3SCPA 1NOUA 3N6QA 1CT5A 1CCWB 1RQEA 2NW0A 5G2HA 4WX2A 1UWTA 4D6CA 1AMYA 4YHGA 3CZLA 1H61A 3DBPA 2E9LA 3O16A 2UY5A 3VILA 1CGYA 1IZKA 4WOZA 2YLLA 3TAOA 4HSHA 1FBAA 4HOWA 3B0VC 4GZEA 5FSDC 4H6EA 1BD0A 3UJRA 4DLMA 1HP4A 3W7IA 3MSGA 2Z7KA 5A3HA 1BHGA 3C3UA 1F73A 4PC8A 1EZWA 3IANA 3GXPA 4OOUA 2X41A 3GTIA 2HBVA 4HTYA 1KBBA 4L4OA 4Z17A 1TPB1 3NL2A 3RIKA 2JEQA 2Y61A 2J25A 5F2GA 2VFDA 3ORWA 2G97A 4GI8A 3AIRA 4RL3A 5CC6A 3GU2A 1DORA 2ADAA 3N4AA 2ZUSA 3HU7A 4GKTA 3QMSA 4GQBA 4F4RA 5DCDA 1G9HA 3IJIA 3NQMA 1KR1A 1MYRA 3NL5A 1U1HA 1AJZA 3RNDA 4ZZ9A 3WF0A 4ZMGA 3T81A 3KRBA 2ZWZA 5A8MA 1UWQA 5CSUA 1R30A 1KGWA 2FZMA 4KS0A 4Z1BA 2F8QA 2GDQA 1M3UA 1TVLA 4Y8FA 1E4MM 3PBUA 3VGHA 2HROA 2PFHA 1Z32X 3L4VA 2F6KA 3GD6A 2D0HA 1VYRA 4JKKA 5AZ1A 2GUYA 4N2YA 4BF9A 3BAKA 4GBDA 5J5DA 5DT7A 5K9CA 2YBVA 1KXVA 1Y65A 3B8DA 4IJRA 4XZNX 4ICCX 4DAIA 2C8NA 1LQAA 2QPUA 5H8PA 1KBKA 2V5LA 2OQYA 2W0UA 3TA6A 3LMYA 5J04A 4MPKA 3T7VA 4BY3A 1YMYA 2HJPA 4PB5A 2VP8A 2E25A 4AWSA 1P48A 1BLIA 3IAPA 1Q3NA 4LPCA 3DGRA 3PPFA 3ZLFA 4UFIA 1J93A 1GJWA 1JZ3A 1DP0A 2BP1A 3H7UA 3O0FA 1JEZA 2A7NA 3E5PA 4LUIA 2NSOA 2V69A 1UMLA 1E1CA 3RPDA 3UYIA 1LM1A 1SO3A 1XIIA 3F4DA 3RU8X 1R3SA 1L6FA 1W5MA 3UEQA 2D0FA 3OA5A 3F4CA 4A3YA 4BQ5A 4GUIA 3WY1A 4U2YA 2AKZA 3OZMA 3QQWA 1J79A 1GVFA 2OSWA 2QS8A 3NQEA 2ZXQA 2CFFA 1XLCA 2GGHA 3UJFA 1G7VA 3NO5A 4C6KA 2AKMA 3ENLA 3GAKA 2XGBA 1DJZA 4H3DA 3G1RA 1E73M 2POTA 1ONEA 1KRCC 3OBKA 4O0QA 3WENA 3QGAC 3RCMA 4H00A 2W62A 1G4TA 4V2XA 1XIHA 3WQVA 3AWOA 2WVTA 2Z6JA 2E6DA 1NEYA 3BZGA 3CV7A 4WXZA 3ZYZA 2OT1A 4Z08A 1E70M 5XIMA 1R2TA 1RCXB 4GYPC 1ICPA 5BNKA 3W9ZA 3O3RA 3GDKA 1NDWA 3FY1A 2PWUA 4XTIA 4LVGA 1PZ3A 1X8FA 1KO0A 1H63A 5HPCA 3B03A 3PZTA 4JTGA 3W87A 3QLDA 3CYVA 4UIOA 3VOJA 2ABAA 1JF5A 2WHJA 3W7DA 1SW7A 2VFHA 3R0KA 1HNYA 3RG6A 3KXQA 4K3ZA 3SQLA 3M5YA 3PZNA 2V6AA 1F9CA 3WQGA 4BQ2A 3P81A 3WJZA 3FA3A 2Y8KA 3AAMA 3SCSA 1EC9A 3SUTA 3AJXA 1OIFA 3BSMA 2H8XA 4JAWA 4AD5A 4CVUA 1Z48A 1LF1A 3R0DA 5TIMA 1MMFA 2JALA 3D3FA 1V3MA 3E2VA 3GE7A 1ZU8A 4Y90A 5K3VA 1R7OA 3NPWA 1Q6FA 4UNLA 1TPUA 4TX6A 4ATDA 4FNQA 2C13A 2AAMA 1UBPC 5FJOA 4F0RA 3VD7A 3BICA 4IIGA 1B57A 3TAKA 3NQVA 5IFPA 3MHUA 4GYFA 4LH8A 3QZEA 3TTOA 2YA1A 4IX2A 3ONBA 3W4RA 3PZUA 1NF7A 3I7QA 4MWAD 2GK1B 4TUFA 2A3CA 4HA1A 4DYEA 4RZ6A 3EEGA 1CYGA 3W2JA 1EWEA 2QVHA 3S5YA 3MUCA 1GKPA 2R91A 1FHLA 3GW3A 3PFMA 1SZEA 1UR4A 3QTPA 1EUAA 3G1HA 4D6HA 2CBIA 4JFTA 4IMGA 3KP0A 5LHFA 1NWUA 1PXGA 3DG3A 2R6OA 1GOQA 3P14A 4Z1YA 4UTWC 3LHTA 3KEHA 5BXPA 4C1NA 3VM7A 4P7RA 3KTCA 3OO2A 3G2GA 4CD8A 5U4NA 3M6YA 5DXYA 3KZPA 4O1CA 1BEUA 1I0DA 3MYPA 4V1XA 3GUGA 3U48A 1KM0A 2Z2AA 3NPXA 4L61A 4XBKA 2VR2A 1VR6A 1LQ0A 1PX3A 1IEIA 3NGFA 1PJ9A 1FWJC 4FI4A 1KKRA 3DKLA 1XYMA 4RX0A 2ZRWA 4RNHA 3ARYA 4LAKA 3DOPA 3UJ2A 4DWSB 3M0XA 3RXZA 4GYJA 2B0MA 4HNOA 3M64A 1GW1A 3V3WA 2G3JA 4X3ZA 3BGAA 3MZNA 2E5DA 1OGBA 1VLWA 5CGQA 3HN3A 4J3TA 5FAJA 4NJHA 2GZXA 5DY3A 3JR2A 4PR4A 3NXFA 3PP7A 6A3HA 4DNHA 4HSNA 2EXOA 4IFKA 2REQB 3W7PA 2XVPA 1R9XA 5C7VA 3QC0A 4DYKA 1VH7A 4LCSA 3TQKA 3M4HA 3PBVA 4KIEA 3O9NA 2OR2A 3IRDA 4LVBA 4O1BA 5AVHA 3QV6A 1C92A 3EPNA 2FQIA 3I4EA 4GIAA 1EYWA 4E8DA 1L8NA 2PAJA 4O15A 4MFDA 1J11A 3DH7A 4ZGYA 2A7RA 2I14A 3WYZA 4O1FA 4CU7A 3HJZA 4Y96A 1PDZA 1FCUA 2FHFA 3G6MA 2DVXA 2CZVA 4HU4A 1AUSL 1WZMA 2YL9A 1GYMA 2DH2A 4H1ZA 3GXMA 4OBTA 4OV4A 5XINA 2ZOXA 4AVNA 3CQKA 4YTTA 4CQ8A 3QW4B 2PCEA 4V27A 2YCEA 1R47A 1AFSA 4JN7A 1BWLA 4K7YA 2YDAA 3DG6A 3QGKC 4F66A 3WF2A 2V5DA 5AC8A 1X6LA 1O66A 3DI0A 3LHVA 3V0UA 1JFHA 4LNYA 2A0NA 1N55A 1XSJA 2H9AB 4RCXA 2NQLA 4IJBA 3HF3A 3B4YA 4PUJA 4X0NA 1BVWA 1J2WA 4K8GA 3UNTA 1VIWA 3CIWA 1AH0A 2VOTA 2OEMA 2VUYA 7A3HA 1QDSA 1XP3A 2DUAA 4ICMA 2NWSA 1XYCA 1RD6A 4IP7A 1F05A 1FWRA 4EIVA 3IV3A 1WX0A 3LLFA 4ZCWA 2C71A 3ANYA 2DQXA 4WQ6A 2JGYA 1XS2A 5C9ZA 1F8IA 4ZOCA 4DJFD 2D2JA 2UY3A 4BZYA 4Y9OA 3RUBL 4XSMA 1MFUA 4XZMX 4A3QA 2QCHA 1K8CA 1VFOA 4DUWA 4ERIA 4AXNA 3STPA 2NQHA 5B80A 1G4EA 4RW3A 3TK7A 2EPLX 1W3TA 2VDIA 5K4ZA 1UR0A 3WNPA 3TN6A 2CU0A 5E93A 3C2OA 1KTBA 4MZYA 3P84A 1N82A 5A6BA 3UR2A 2CYGA 3SW6A 4QJ4B 1G1YA 2NX9A 3I3EA 2WQDA 3L4TA 2DEPA 1LLZA 4I5UA 5IBXC 4FXSA 4GI4A 4V33A 4CUCA 3H2EA 1YDOA 3W7RA 2JE8A 4JTLA 5C55A 1PKLA 4UFKA 1GVIA 2DFAA 4ZTXA 2J74A 1UP2A 4H9UA 3UY8A 4AU0A 5DANA 2FVMA 3IJ7A 4L6DA 4GYPA 3WLHA 1R0MA 1EC8A 3QBUA 4TO8A 5LXXA 1MWOA 4XZ9A 3VIIA 5CEWA 1RLCL 2Q6ZA 4LCRA 2Z2UA 4BEQA 1FCBA 3EWWA 2W66A 3LDVA 2Z7GA 3N15A 4GUJA 3W24A 4Z1AA 1FY6A 4MKNA 3GO2A 5DBUA 3S2LA 1VBRA 4QSHA 3PPCA 2XIMA 3F2BA 3PNUA 1LRNA 4AMAA 4XUYA 3CTTA 2X1TA 3EX2A 2PB1A 1Q6GA 3IJ6A 3JU2A 1F07A 2PGEA 4W85A 1CPUA 1TR1A 4F3HA 5DN1A 3F4NA 1SSDA 2CLMA 3Q65A 2PDBA 1FDYA 2WZMA 3KBJA 1TPWA 2YDQA 1UZ1A 4JTUA 4JOMA 3KVMA 3TW9A 4ADUA 1OT1A 1XRFA 3GKFA 4I9TA 3NQFA 4Q8PA 2CCRA 1B31A 3KBSA 4A35A 2OG9A 1SGJA 2YCIX 1VS1A 3G22A 3EXSA 2FPVA 3LBOA 6REQB 5A8GA 3ABXA 3C2EA 4JX6A 3PK7A 2EO7A 1E9LA 4Q8WA 3XINA 4UQDA 2A2IA 2EEXA 2BVTA 2X16A 1MXDA 4WJXA 3RK8A 3WUFA 4J27A 2PDNA 3FHAA 1E0XA 3B8IA 3VNKA 1ODUA 4NUWA 4D6GA 1H51A 4PYSA 2ZXBA 4M8UA 2GL5A 4DPPA 1AQHA 3BURA 3L12A 3PAJA 2P0IA 4PGLA 3M5ZA 4N6FA 3GDLA 1LYXA 4S3BA 1LLWA 4UTWA 5IM51 2RGLA 3V36A 1WAUA 4J35A 2XWDA 1FDZA 5I06A 2CESA 3T0DA 1E15A 3TJ4A 4XD3A 1QVBA 1TZ9A 4W8LA 1NOWA 3MCMA 1W1TA 3GTNA 1J6OA 5K7JA 4LEFA 1G01A 4JTIA 3PJXA 2HXTA 2GOUA 3RHGA 1LL4A 3LTSA 3AICA 3MI6A 1PKNA 4A29A 3GXFA 1FWAC 4PMRA 2CITA 1MEWA 1SPQA 3ITCA 1KW1A 1P6BA 1HGWA 4B4HA 3NZPA 2HBXA 2FTPA 4TQTA 2XU2A 4S38A 4KBXA 4C5YA 3VD5A 1S2UA 5E6YA 1OC7A 4M7SA 3M44A 3QEZA 3EEZA 2BDQA 5G1YA 1QHZA 4ZODA 3PUGA 5HK4A 5AC5A 2C19A 3W88A 3QPYA 3TCSA 3W1TA 2X8RA 4E2DA 1EUNA 1YEYA 3U9IA 2V2CA 4K2SA 3SUSA 3A4AA 3QR0A 3C52A 4K7VA 1W5OA 5CC7A 4I9JA 1J8VA 3NM3A 3A24A 4ZFCA 3L7RA 5EPDA 3FN9A 2TYSA 2A21A 1D7FA 1KQYA 1XH0A 5HUOA 5CH9A 3R5EA 5HBFA 3GVVA 5DBTA 1ITXA 4G7EA 4LANA 3VTRA 1JDAA 1KXQA 3S1UA 1MDLA 5ABFA 1PBGA 4WY0B 3GNXA 1I6NA 3R2GA 1OFPA 4UOZA 1VPYA 1EX5A 2Y7FA 2INZA 2BXYA 3ARXA 2VC5A 1SO4A 1QNRA 1OX4B 3AZTA 1A3XA 4H04A 2ZX7A 3D47A 3GZ3A 1RK5A 3QY6A 4Y9AA 5K4XA 2HEJA 4LOCA 3B06A 4KRZA 1GEQA 1S3HA 3IGUA 5D33A 4DUVA 3LCLA 1W9XA 1OX6A 4OU1A 1XLIA 3AI0A 2QHAA 3UXAA 1VENA 1UH4A 2FZBA 1EF3A 2O0TA 4HJFA 1IEQA 4GQQA 2YX0A 3O2LA 1MUMA 2RJHA 1EOMA 4UTHA 1DWJM 4AZHA 1B3ZA 1QBAA 1KM3A 2VRQA 2WSRA 5D9OA 4QJ5B 1R86A 1VQTA 3UPWA 2DSZA 2TSYA 3I3BA 1DWIM 1YRRA 4JQ2A 4GXMA 4RZBA 4LUTA 1G6CA 2DZUA 3N2XA 1E72M 3SIMA 2V67A 3SRHA 2C91A 4C65A 1FH9A 2ODOA 1TIWA 3KRZA 3QHOA 3LGGA 3WEMA 4F48A 1CGVA 5D2WA 2XGIA 1NOFA 5C9WA 5T9BG 3S2MA 3KBVA 2G41A 5F2IA 4D6DA 3W7HA 4PMOA 4GQGA 5HA7A 4I9MA 5KSWA 4HTBA 4LY8A 2CLOA 3BLLA 3G6LA 3GXDA 4HT3A 4NI8A 3N14A 4XBSA 3QTGA 2Y0FA 4E3VA 3VCRA 3I7SA 1WP6A 1TFVA 4LUSA 3W1RA 2J88A 3M0YA 1OFRA 4FF5A 4GUHA 3R8HA 2Y70A 1QBBA 1GZ1A 3MKCA 3OIHA 3HQOA 1S2VA 3CC1A 2PP0A 1GVYA 3TJLA 1ZSXA 2FHBA 1OFDA 1XH2A 3VMNA 1HL9A 3K8MA 4LUSB 4Q8TA 3DIPA 1OF8A 5EB8A 1YTDA 1TPH1 1HL2A 6TIMA 3EWCA 2LLEA 3N2CA 2JF6A 1GQKA 3EKLA 5IBXA 2W6RA 5AY7A 4M6VA 3OEXA 3QQ0A 2QVNA 1LRQA 3VNMA 1RH9A 4QISA 4ATWA 4REQA 2J7FA 2WJFA 2ACQA 3T0AA 3NIYA 3W29A 5AYIA 4UOQA 4NT0A 1JAKA 1RBLA 2QKFA 4PCSA 1HKJA 2GQ9A 3FAWA 3HFTA 4G8TA 3O06A 2Y5SA 2G96A 1Q6EA 4W7UA 3LCFA 1V3KA 1YKWA 2RH9A 2I9UA 1ZP4A 2AMXA 4Y8EA 3AOFA 4DN1A 4Z2IA 3LTYA 2PMQA 3BC9A 3P61A 3R12A 1TV3A 4NHVA 2I9EA 1E6ZA 4JTJA 3WNKA 1I2RA 3LQLA 1M68A 1VFSA 1OY0A 1EJRC 1XC4A 3AMKA 2W3ZA 3NL3A 4IG2B 1AJ2A 4LQ1A 3GNRA 4WHBA 3NUKA 3WD0A 1H0GA 1EO7A 1DYSA 3DBNA 1VFFA 4H9TA 2ZTKA 3WEZA 3M41A 4AD1A 1TMQA 3UG3A 4R27A 4AH7A 5KETA 1T99A 2OZ3A 2PRMA 3BSGA 1HL8A 1UH3A 1HJQA 3C2RA 1C9WA 2VWSA 2X1UA 1XCXA 4F9DA 4EOUA 4GLEA 3LTPA 3THQA 3UBPC 1ALDA 4JYDA 3UPBA 3W28A 2I57A 3IK2A 4BI5A 3AUJA 3M16A 4IPNB 2WSYA 5BWAA 3BWWA 4HP5A 2DT3A 1ZP3A 3PZMA 3M0ZA 4QNEA 2CLHA 4GXWA 1DJYA 2YGYA 1US2A 3WD3A 2Y7EA 2Z27A 2UWFA 5EGRA 3GG0A 3EDFA 3CQIA 3DFHA 1D3CA 3AIEA 1QI4A 3GW0A 4IL2A 3TXZA 5BWFA 2F6UA 4WGXA 4EVZA 4HCLA 5T9CE 3KHDA 1PS9A 4OKDA 4QJ3B 4NL1A 4W4QA 5MKGB 1XSIA 3ZM8A 4JDYA 1FWFC 3VI2A 3T08A 4CEUC 2WPGA 2PDCA 4S3KA 3SJ3A 2HV5A 2OU4A 4FR1A 1EIXA 4GC3A 3WD1A 3VA8A 1HJUA 3TMLA 5BXTA 4MNMA 4NU7A 1SW3A 3GH4A 4NRSA 3UFYA 4RK8A 3AHZA 1KA9F 3WBYA 2J6XA 1FUYA 4W7VA 1P43A 3C2VA 1TELA 4IMEA 4XK2A 3SSZA 3N3TA 5HINA 1AMKA 2YZRA 3VK5A 4BQ3A 4GE8A 3SUVA 4MYAA 3REQB 2W27A 4XKMA 2FVKA 3ITXA 1O5RA 2OZTA 3WO8A 5CG0A 4J40A 1BGGA 4F79A 4DX3A 2UZ9A 1W17A 1NVMA 3EA2A 3BMVA 3UPMA 4A4AA 5D37A 4XAYA 3CAQA 3F1QA 4CQDA 1TRDA 2BVYA 2Y85A 3VABA 4UZUA 4F2TA 3MZ2A 3RJYA 1A5MC 3DFPA 3ITVA 4FEZA 1TJ2A 3F2DA 2VFGA 3EWBX 2ZX8A 1CB2A 5DX7A 3KTXA 4PRRA 4WDUA 1EJXC 1LL7A 3BW4A 1R2SA 4IM4A 4EACA 1S38A 3ELFA 4L56A 3BOFA 1MW2A 5AHIA 3R94A 2BS9A 1FQ0A 5D2TA 5HMDA 1FDJA 4KW2A 1HKIA 3RILA 3ARPA 4L80A 5LNVA 4NRRA 1RBAA 2BGSA 1FXPA 3W1QA 3SQSA 1CI1A 4J28A 3PJTA 4WJEA 3H4GA 2JK2A 3ECQA 1UIPA 3TNOA 2WC4A 1PKMA 5CZTA 1XYLA 2QF8A 3BG5A 3M47A 4P7OA 4DJFC 2WYSA 1B90A 3AXXA 2CLKA 4WXYA 4O13A 4UOJA 1CXFA 4GVGA 3GIYA 3QFWA 1DTNA 4FNUA 3Q58A 1KLZA 4D6FA 3C8NA 3ARRA 3PS7A 4U2ZA 4JFWA 3N11A 5FACA 4PRTA 5TAOA 4NXSA 1KRAC 3W7GA 1PX8A 2O92A 4US6A 1JF6A 2OGYA 4C7DA 3IV8A 3UZ5A 4C91A 1ISVA 4JFUA 3LQGA 2DZWA 3I68A 4LB3A 1WYIA 2DP3A 5SWUA 1F6PA 1TE1A 1GNXA 4KRUA 2G50A 5BCAA 2CBVA 4HB7A 1ONRA 4IQEA 2R8WA 1U33A 2VEPA 5C0QA 1X7IA 1JCJA 3QZAA 3BUVA 1UUOA 3O63A 1QAPA 4GJIA 2QMJA 1WPCA 1AODA 5AYYA 3KDNA 4N7QA 3W71A 4H2CA 3W1MA 4HHLA 2RGMA 3E49A 1VBJA 1QI5A 3CZGA 3KWSA 1YNPA 2WK2A 1R3YA 3WJWA 3B4UA 5A6LA 4UMBA 1I75A 4A2SA 1W9BM 5FEZA 4QS5A 1GG0A 1RCQA 4R7JA 2XINA 4FNSA 4IPLA 1C9DA 4J3XA 5TBOA 1OINA 6ENLA 1P5BA 3IEBA 2PLJA 1GQLA 3LHYA 3VNLA 2C1GA 1TPDA 2XIOA 3M43A 2YXOA 2XVLA 3HOJA 2FVLA 4XG1A 1B9ZA 4WF7A 3WF1A 3MMTA 3SSJA 3C0SA 1K4GA 1M65A 4G5DA 3LRMA 1AZ2A 4TMBA 2HISA 5ABGA 5DRIA 2HNEA 3H55A 4P61A 4M6PA 3G1DA 3AO0A 4PTNA 4IGHA 4QE1A 2NZLA 4Z0SA 1H5VA 2EKGA 3CZKA 3T05A 4ILSA 1D8CA 2PWVA 3WK0A 3AS3A 1KRBC 4K37A 3AROA 3WQ5A 2DIEA 5IHSA 3PUOA 4HYVA 4DF2A 1ZS2A 2J62A 1D2KA 3ZT7A 1EH9A 2Y4SA 1VPQA 2PTYA 1C91A 4Y2WA 4LC6A 5G2IA 1TPFA 4EPDC 3W84A 3QQ1A 4TX8A 5LA0A 4PH6A 5HMEA 2GJNA 1C7TA 1QNVA 1LG2A 5HXMA 3P82A 4GJ1A 3A9BA 2WKLA 1PCWA 1QCWA 4XVDA 3WD4A 4QXIA 3FAXA 4ECLA 4GJJA 4JYFA 3SCQA 3SRFA 2INFA 3MMDA 4IL0A 4IIHA 1JDFA 1GVSA 3TX9A 2D73A 4QHRA 1UD4A 3RRXA 2VDGA 4JIEA 2PRLA 2WZIA 4QX4A 4DJDD 5LA2A 1ME7A 3C5QA 2PC8A 3NZGA 3EOLA 4R88A 4GZJA 5F2MA 4X60A 3F7JA 3VYLA 2VT0A 3NSXA 1T8QA 1RBOB 4MB5A 1CWYA 3WD2A 1RPXA 4V1YA 1Y5WA 2Q02A 3QSTA 4B5NA 3C86A 3VIGA 4I7UA 4MF4A 4KPLA 3EAUA 1TTPA 3GXTA 1OFOA 2BHZA 1XL9A 2HSAA 4CNNA 2YL6A 2ACRA 2WVVB 5A69A 2VFFA 3O6YX 3O6AA 1J96A 1NSJA 4MSSA 4KKXA 4A8LA 1TA3B 1D3GA 5HUPA 5DMMA 1F3WA 3MA8A 2NQ5A 3MJMA 1G4SA 5JBEA 4J7RA 2XPKA 2UV8G 4WK9A 3APYA 4HPNA 2QIWA 1B0IA 1QW9A 3LRLA 3R79A 2QCNA 1LORA 3T0CA 4FOKA 1F2JA 5U7SA 2Z2BA 4HZMA 1GOIA 3TONA 1ICQA 2RJGA 2WZTA 4QEHA 2OO0A 3R13A 3WLLA 3U8GA 2ZRZA 2VFIA 3LPFA 4OHQA 1UASA 2VENA 3G8RA 4BS0A 4JTCA 4QBXA 2XVKA 3QH2A 5JH1A 2ZQ0A 2I56A 3NZQA 1Q8JA 1YE4A 2CHOA 3U5UA 1HZYA 3MO4A 3HZ3A 4ZVJA 4FX7A 4W87A 3DFTA 1UWSA 3WLPA 2ZBTA 2OEJA 4IIBA 2P76A 1QUMA 2I1OA 3BLDA 4HIBA 1QI3A 2J47A 2O9PA 1NTHA 2XUCA 3B40A 2QUTA 4IISA 3WLJA 3B9EA 2VX4A 4M24A 1OC6A 4QLKA 5AB3A 4A3HA 2ZZ2A 3VIOA 4GCAA 1V03A 2HS8A 5CSSA 2BXZA 2HK1A 2BODX 3E02A 2HE5A 4JTDA 1GWJA 3BL3A 1VYPX 1E4NA 5C6MA 1ENUA 3BSHA 3MU7A 4FNTA 2ZVRA 3PZOA 4O1EA 3B8UA 3E5BA 4DXXA 3RFAA 2OCZA 2WNWA 3NZ1A 3MUIA 3RR1A 4CCDA 1Q2SA 1RALA 4K68A 3ARVA 2BGNE 4Z0JA 5I3DA 4C60A 1W5QA 3S83A 3P5YA 4FLSA 1Z7AA 2V8ZA 2CZFA 3DFSA 4DJFA 1XJBA 3WELA 4C6NA 1R3WA 1RHCA 1ZGDA 4S23A 2ZCGA 3QV7A 2H8ZA 3FXYA 1XG3A 5JMUA 2VZUA 2X1RA 2GVEA 1EKOA 4ZQNA 1JNEA 1M7JA 3EWXA 3WH8A 3AC0A 3QLLA 2PWFA 1DJGA 1GJPA 1BF2A 4FPSA 4S3JA 3AIUA 3G1VA 1PHWA 3T78A 3LHWA 4UXDA 3A3XA 2HCVA 1NF0A 1UA3A 5BZAA 3WQCA 4HKPA 2ZXDA 3CMJA 2BVWA 2VCBA 3CO4A 2ZA2A 2DH3A 2QJIA 3NO1A 4MIMA 4HA4A 1Q6CA 2FGZA 2BVDA 2CPUA 3MI2A 2FJUB 2OXNA 2CW6A 4L4PA 4TVUA 3AHVA 2Y8UA 3UW6A 5FCZA 4YTUA 1JZ5A 4AZCA 3VIKA 4H9MA 1KTNA 3VNYA 3F2CA 1E6SM 4J3WA 4LS2A 1BAGA 5TF0A 1POKA 2QJNA 1FHDA 4RKAA 1IT7A 2G95A 1BRLA 1DQUA 1QFEA 6ALDA 4IIDA 4AZCB 2ZFAA 5H1WA 4S3DA 3TWBA 1VBHA 1AVAA 1R87A 1BYDA 1LT8A 4BEUA 4XO7A 1BRLB 3B8TA 3IVUA 1UYQA 1OX5A 1TJ1A 4TX9A 3MP5A 1NWRA 1HGYA 5G1MA 4A2RA 2HQAA 2WC7A 3D46A 5K2ZA 4AEOA 1XBYA 5LNRA 1H50A 1ZJBA 2W91A 5CC3A 1KFCA 4JY8A 3FEMA 1UROA 3NQ7A 4V15A 3LUTA 2GJLA 4LV4A 1CEOA 3STEA 1HKKA 5FF2A 4M6UA 3DECA 2PODA 4QNWA 5D9MA 1PAMA 4NYYA 1IXQA 3OJGA 1XFCA 2A79A 1CBGA 3ES8A 3ARZA 3AFBA 2I5QA 2IKJA 1KV5A 4GZIA 3FYYA 3T2OA 5BOEA 3GX9A 5KZ6A 1R3TA 4AVOA 1E6PA 1L8PA 2W5FA 3ES7A 2JKAA 1RZMA 2NLYA 3EOEA 1E43A 5DO8A 3HG5A 2AQWA 1GOWA 3DC0A 3FFSA 1Q6QA 4ZSUA 1EBGA 1KLYA 3LA4A 1OC5A 1UBSA 4MOZA 3OPSA 4CCZA 4K38A 1PUDA 2DW6A 2MUCA 1JGIA 4PB4A 4HMNA 3VX1A 1TMHA 4PUKA 2R1MA 3B9AA 3WCZA 4U5KA 4IMFA 5JVLA 3KBWA 4IQJA 1B5TA 3BCJA 1V6UA 4IZGA 3DCPA 1XLLA 1YDYA 1K1DA 4R53A 4WR3A 5FF4A 4ONVA 1YE6A 2OKOA 4J3UA 4ZFMA 4MMWA 4DWSD 2V3GA 3EX1A 4FR6A 3TNBA 1MQQA 3MPGA 4IX0A 4OZOA 4AZ5A 3OG3A 1LTDA 5XIAA 1GT8A 4B5WA 1FWBC 4GQRA 2E1WA 3EDJA 2VURA 1SMAA 2ESCA 3TFCA 5JH2A 2P10A 1YX1A 1IF2A 3HPSA 4B5UA 1HIZA 3EX6A 5E6ZA 4ZO7A 1N7KA 2G4FA 1C8QA 5HNNA 4WKHA 1JQXA 4AF0A 4GIRA 1GOXA 4AWUA 4B3ZA 4BA0A 4PMNA 4Q7NA 1B3OA 2J7GA 3NQCA 4PRWA 1I1XA 4HN8A 4L9YA 3IJ9A 4UTLA 2TRSA 4PCTA 1J0YA 3H23A 4AF0B 3LU2A 2VX6A 3GHUA 3CASA 5E9XA 3PWIA 1OCBA 3V1PA 3ZSTA 3TN3A 3A13A 3S5OA 2A6LA 1PEZA 3TVAA 1T40A 4CKQA 1AQ0A 1XW8A 1TPVA 3UWZA 2BV9A 1YPIA 1J5SA 2VR5A 4A21A 1ZCCA 5CCZA 3WNLA 1V3LA 4MPQA 3CL8A 1E3ZA 3DZ1A 2GQ3A 4Z42C 1N8WA 1WOBA 3KOWA 1S3TC 4L64A 1J10A 3JZUA 3NSNA 4PCPA 1D7KA 3EWZA 2FLIA 3IIZA 4J4KA 4P7QA 2WJZA 3TW7A 4NSBA 3TQPA 2F38A 4MJMA 1W1VA 4LU0A 3MWCA 3WMSA 4DVOA 4HNVA 2PF0A 1UA7A 4HZ8A 8XIAA 5EMJA 4UFJA 2G3IA 5CGMA 4WDTA 3P80A 3U7BA 2ISFA 2G37A 2FMOA 5HJYA 3DFYA 1TTJA 3P3BA 4AZIA 1EP1A 5I07A 5M5DA 3W2NA 4GO9A 3CL7A 4ATLA 4ALDA 1W31A 3Q37A 2EPHA 5FJPA 3HBLA 3RAOA 3TIMA 2D2GA 2QR6A 4LXFA 2PPGA 3MHGA 5BRPA 2WJEA 3W7LA 4RV8A 1HFBA 1IT0A 2AL2B 1UD6A 3QKEA 4H7ZA 4AZGA 2HK0A 1NQ6A 4W8AA 3LHUA 4R7OA 4O11A 3E0WA 1KKOA 2VWTA 3EOSA 5AZ0A 1X39A 4DJED 3GTXA 4NP7A 1WUFA 3UWQA 1TV8A 3VPLA 4YCOA 3E2SA 4N9BA 4UB9A 4O18A 3IK4A 1ZRQA 3MKVA 1UW9A 2OKTA 3LGEA 1B30A 3IGHX 4J2PA 3CV2A 2NUWA 4MTVA 3PZGA 9XIMA 1ZJHA 2QUNA 4NZ1A 1JQVA 2B4GA 2W63A 3KCJA 4FO4A 4CGTA 3ATYA 4WRHA 4KFNA 4O1AA 5C8BB 4D2JA 3W3OA 1YDNA 2VELA 5A6BD 4C6FA 1O12A 2NXGA 4AY8A 1ELSA 1ZNNA 3RLHA 1K6AA 4Q4RA 1HXJA 4JTQA 5AHMA 3L5MA 4U4MA 3PBWA 2E1DA 3VZYA 1NWSA 4PEEA 2C1HA 2BZNA 1QW8A 3PTMA 1HJVA 2WQPA 3EPMA 4QCFA 3SADA 5BRQA 4B4FA 3PB0A 3PBYA 3AMGA 4O50A 4AEEA 3DFNA 1TREA 1MQRA 1TWWA 4KEVA 4RNIA 4UQCA 2CHNA 2F9RA 4ERGA 1UH2A 2YLAA 1GQJA 3KVLA 1JL8A 3V16A 4HGXA 1JRBA 4MUPA 2ZUUA 2P1FA 4L7ZA 2NV2A 1KCLA 3D3AA 4HJWA 1Z6KA 2IPJA 3GSMA 2Y7GA 3N04A 1BXNA 2ZICA 3DUGA 2PRHA 1A47A 2BY1A 3VC5A 1G67A 1LBMA 2J75A 3QHNA 4MY1A 3B3DA 3UU0A 3GR8A 1SZFA 2E67A 4CNTA 3EDEA 3EB3A 4Y9PA 3WUBA 5DRCA 3H70A 2WKGA 1Q65A 8CGTA 1A5SA 4IPIA 3NQGA 3GNNA 3OLIA 4KMQA 5I3JA 4L9ZA 3UP8A 2WOQA 2DUXA 3SN4A 2DVUA 1DKWA 4KCUA 4DEFA 3PNZA 3RITA 3NDYA 3D6NA 5FD0A 1H2JA 1OWQA 2J66A 5JBFA 3W1XA 3SI9A 4PULA 1YDVA 3S47A 3GS6A 2IXUA 4AD3A 1E0VA 4ACZA 1KFBA 4JCMA 4E0CA 1TJRA 4K6AA 3H2CA 4M56A 2PDPA 4IPPA 3WJYA 1LOSA 4FOUA 5DLCA 2VZVA 3VZXA 1R3QA 2FH6A 4HK5A 3EDDA 4CN4A 5HWMA 3WMLA 3IACA 1LWJA 3LI0A 2R1NA 4Q6JA 1ITQA 1YHTA 3VD9A 3WDHA 2OZ0A 2NSXA 3HA1A 3QJAA 1MDRA 3IIXA 5H8UA 4LJ3A 3W74A 4QSFA 3K4DA 1BKSA 3FNDA 1BVNP 1I1WA 1E0UA 5AC7A 2PDQA 3G1AA 4DJDC 4LB4A 3W70A 3WLOA 2WMGA 3VKAA 2E5BA 2WM0A 1M6JA 1A0EA 2XFWA 3VDHA 2WV8A 4OVXA 3P7YA 3OZOA 1J0JA 4ZA0A 3AYSA 1A80A 4PN2A 3PZQA 2VQTA 4S2BA 5F7UA 1CENA 4TTGA 3IVTA 4FF7A 2FDMA 3DXIA 4MY9A 1GK8A 3IAQA 3A3HA 2GVLA 2CC0A 3PVFA 1VGAA 3FGCB 3TYZA 1JZ6A 4ORIA 1EGMA 5REQB 4XUGA 1TQXA 3TEVA 4C5ZA 3WLMA 1QNPA 1K9EA 2PLKA 1NJJA 1YTEA 4M80A 3S2JA 2FZ8A 4EPEC 2FZ9A 1JCYA 3GDBA 2QNEA 1XRTA 4D9PA 4XTDA 1FXQA 1HJXA 1BXCA 1XLKA 2CNCA 1A5AA 4UTTC 2D23A 5M17A 1NELA 3P0XA 4MB3A 4GISA 2QJGA 1HF6A 4AXKA 4PUEA 1R85A 1FH7A 4O12A 2J7HA 2KZHA 1W1IE 3TYBA 2NUYA 3ZSSA 2EJAA 4YJ5A 3ITGA 3LM7A 7REQB 2Q71A 3TTQA 3KRSA 3RMJA 3RMEA 4G7FA 2GSEA 5I00A 4GIYA</