3I7QA

Dihydrodipicolinate synthase mutant - k161a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 109
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7qA00
2E6YA 4N02A 1P1XA 4JIQA 3MBDA 1RV8A 1H63A 4WQ6A 4YMZA 3D0CA 4ZL1A 4UTHA 2CZEA 3UZ5A 2E77A 4RXFA 1FQ0A 2A7RA 4O12A 5FEPA 2YDAA 2B7PA 4HNUA 3B0UX 4TU1A 2DZXA 2QAPA 4UFMA 4O19A 3W84A 2EHHA 4FXSA 5EPDA 2B7NA 1YPFA 4HPXA 2NX1A 3UWYA 3C2RA 3L2IA 1ZAJA 3NQ6A 2A6NA 5SWUA 5L9FA 1ME8A 3E12A 2YFNA 4LC8A 4FX6M 1ZHAA 1JCLA 3RF9A 2VEIA 3DHDA 3LRLA 3TQKA 3E96A 4UTJA 3LLDA 3ANYA 4IX0A 4E38A 1WYIA 2CLIA 1SW3A 2Y6ZA 3BLEA 4JY9A 1IIGA 5EBUA 3SIZA 4DO5A 3RFAA 5DBTA 4O16A 3DFSA 3NQEA 2DZUA 1OFOA 1VCFA 4E2BA 3STCA 5BOOA 1DOSA 1SW7A 2V2CA 4Z1BA 1EIXA 3IGUA 4QQ3A 3MI3A 1IIHA 4B5NA 1JUBA 2OCZA 4GC4A 3W7OA 1L9WA 5G5IA 2C15A 4ORIA 2FJKA 4U28A 1AL8A 2QKFA 4K7VA 4JD4A 4DO6A 3CPRA 3MYPA 4JTEA 1XUZA 3GKFA 1ZENA 4LU0A 3P62A 4LUIA 4XTDA 5CPMA 4Q33A 4O53A 5DCBA 2W0UA 3W1MA 1TPH1 1HG3A 3G3MA 3PBVA 2C19A 3O6CA 4JGDA 3UXDA 3C3NA 3S5YA 3NQCA 2ZCGA 1H5YA 3G0SA 5HULA 4O1BA 4PCFA 3CQ0A 4HNTA 2GVGA 3PBWA 4JX6A 4CNOA 1MO0A 3B04A 2OMAA 3LCGA 4UUIA 3P60A 3EWZA 3V75A 5D2YA 3ABRA 2DZSA 3S0CA 1QPNA 1EUNA 1JCYA 5AYXA 4JTTA 5LNUA 4GXMA 3NVTA 3PC0A 4AHPA 3DHFA 1FDYA 1TJPA 1G7UA 1OK4A 1TTJA 2ZRWA 5K9CA 2QJHA 1AL7A 4N9EA 3IVUA 3LLFA 2Q3OA 1LBMA 5BRBA 4DQWA 1OABA 4XUGA 4QNWA 3TJLA 3N14A 2J9XA 1H7OA 2AGKA 3USBA 1TPDA 1QOPA 1F5ZA 2NZLA 3C8FA 4L4MA 3JRKA 4MY1A 4RV8A 3C6CA 1W37A 3HF3A 4N9CA 1PVNA 2NV2A 2ATSA 4BF9A 4O4VA 4NUWA 3PB0A 2QCFA 3H53A 3NM3A 3BGGA 2AAMA 2WQPA 2ISWA 3SI9A 4KFOA 1TRIA 3GR7A 2I9EA 1ZAIA 3A22A 3B0PA 3STEA 3KVMA 3KAOA 5F1VA 5IBXC 2ZDRA 4K39A 2DU2A 1V5XA 4LUJA 2CWNA 3EKZA 4O1AA 3T4CA 3R89A 3W2NA 3NDOA 5AC7A 3UPBA 4LS2A 1R47A 2W79A 2NV1A 4A21A 5D37A 1G7VA 4NX0A 2WV8A 3EWXA 2XFWA 3W7DA 1CW2A 1WXJA 1OX6A 1HUVA 5J5DA 4FB7A 2NX3A 5FEXA 2DJLA 1LBLA 5KZDA 3N2XA 1VQTA 1DJQA 2DZVA 3FEMA 1I2QA 1WA3A 1Z42A 1JR1A 3KRZA 2EGZA 1BEUA 5F2GA 2FB2A 2DZTA 4QNEA 3KOFA 5C5YA 4HNNA 1R2SA 1LOSA 2ZTKA 1A5AA 1K8YA 3QW4B 1UUMA 3GDKA 3RU6A 3C2VA 2W6RA 1LM1A 3ATZA 2JGQA 4BI6A 1Z44A 5I3IA 3EX6A 4TMBA 2Y7EA 4JIPA 1Q3NA 3W71A 3G1XA 1TPUA 3LHYA 1IGSA 2CW6A 1YXCA 1LROA 3W72A 3NL3A 2QCMA 2WO5A 3E0IA 2H3BA 4O52A 1BTMA 4FNPA 4E2DA 4UFLA 1OFRA 1O5XA 1VPXA 4UFIA 3PM6A 5K4XA 2G5WA 5BNKA 2QF7A 4A3UA 2GJNA 3FOKA 1FXPA 1I2OA 1OX5A 5C6MA 4QIUA 4UCGA 1JCJA 3OG3A 4M6QA 3UD6A 5FF7A 3BVJA 3W7EA 5EA9A 4CNNA 4O54A 3R12A 4C1LA 1KFBA 4UMAA 5LGXA 1ZFJA 4LV9A 3W1LA 4CQ9A 3NG3A 3LTYA 1KM6A 4JYEA 2E68A 3CIWA 3H54A 5KTLA 2OZ0A 3O05A 3TV8A 4FNQA 1OFQA 1JJKA 1KV5A 5IM51 4ML9A 3W83A 4Z0JA 2Y63A 4AWSA 2XN2A 2YYTA 4K38A 4WZHA 3O15A 1IF2A 2HSAA 4O1DA 1IXNA 3W1PA 4ADTA 3TUUA 3W07A 3G1FA 1QDSA 2Y88A 3G22A 4UXDA 3SJ3A 4ZQRA 4O28A 3UPWA 1TTPA 4RX0A 4I7UA 4M7SA 4JR5A 3G0UA 1NFBA 3BGJA 2VEMA 3NXFA 3NAVA 4OBTA 1XC4A 1AMKA 3FJ6A 2JKPA 3W2JA 2X16A 2ZZ1A 5AHEA 5HUPA 4WUIA 1F76A 5AHMA 3CC1A 2C3ZA 1A5CA 1MXSA 2OT1A 4PA8A 3LTPA 1KA9F 2I14A 3L5AA 5EY5A 3STGA 4DBDA 1LRNA 5KITA 1QAPA 3LI1A 1FX6A 1Q6QA 4YLWA 4IMEA 4FNSA 2H90A 4JXCA 4ADSA 2B4GA 1YTKA 3SW6A 1W3IA 4MLJA 2FDSA 4PH6A 1W5QA 4WY0B 4FX7A 4K7YA 1SW0A 1KTBA 1I2PA 3M5XA 3M9YA 1GYNA 3GYEA 3BO9A 2QUUA 3NZRA 1X7FA 3WJYA 1I45A 1YDVA 3TFCA 3L66A 4PEKA 5H2ZA 5AOUA 3NA8A 1TPWA 3TW6A 3R2GA 1XBXA 1OF8A 3IIVA 1G4TA 1M7OA 2A7NA 5AHLA 2ZZ2A 1LOQA 3FS2A 1TPFA 3S8HA 2F7FA 1G67A 2ZRZA 2NXGA 3P74A 2Y7DA 2BX7A 3W1QA 1QR7A 1VR6A 3NQ7A 5G2WA 4Y96A 1ADOA 3PBUA 5U7SA 3VI2A 1VS1A 2E5BA 2DZPA 1BKSA 1J4EA 3N73A 5K3VA 3GIYA 4NXSA 4IWWA 3UZJA 3EB2A 3I65A 2VXNA 3P5YA 5LZLA 3W7IA 1TPEA 1VC4A 3CEPA 4IQLA 1HFBA 2JK2A 1DKWA 1TTIA 5A8GA 1BWLA 5D05A 3GNDA 1XBZA 1PS9A 4FIRA 1D3GA 2FPVA 3G1SA 3DFTA 3MWAA 4EF8A 5D2WA 1WOAA 4AHQA 5LHFA 3GB6A 1DQWA 1FXQA 4PTNA 2CLEA 3TA6A 2BTMA 3G1DA 5D30A 1ML1A 3P61A 1CI1A 2NXHA 3P7YA 1H1YA 1ONRA 2B0MA 1WDWA 4JDBA 5K9DA 5FI8A 5CGQA 5I3HA 3P5ZA 4O11A 4P2VA 1L6WA 5BMWA 3DGRA 1C29A 4RKAA 4JY8A 4XQ6A 2NUWA 3JR2A 5KZMA 4UIOA 3MP5A 3QFEA 3CWOX 1DVJA 1H62A 5D09A 4K8EA 3TQ0A 1KTNA 5G2IA 1OVDA 3UXAA 1T8XA 3DKJA 1EX5A 1QNVA 4XKYB 5E1QA 1FWRA 1KBJA 1OYBA 4G1KA 3LCWA 3W76A 5FF2A 3W2MA 1XXXA 1A5SA 2Z0IA 4Q32A 1MEIA 1EB3A 2GQAA 1T99A 3G1YA 4O15A 3A21A 3PUDA 4RZ6A 3LBMA 4DPPA 4HNVA 3HBLA 3M1ZA 4X9SA 3IRDA 3EWUA 3W7KA 1I4NA 1EUAA 2LLEA 2J9ZA 3MI6A 1VYSX 3G1VA 4UNKA 4EIVA 3G8RA 1PIIA 1LRQA 3QQ1A 4O14A 5DY3A 1HL2A 4NJJA 2WJZA 3WJZA 1GQNA 1UUOA 1VLWA 2YX0A 1YXYA 1ZCOA 3DXIA 3GDMA 5LNRA 2QDGA 3MHGA 2PCQA 2ZRVA 1Q45A 5LKYA 1AW2A 1LLZA 3IEBA 4D2JA 5I3FA 4DO4A 2NUXA 2Z6IA 2PURA 2QJGA 1ZJIA 3EXRA 5CZTA 4MIMA 2QUVA 4YCOA 2ZZ6A 1GVRA 4FX8A 5LNSA 4MLRA 4WD0A 1QPRA 1X1OA 4GUIA 3Q94A 1JULA 3SECA 3UWZA 3I7RA 2X30A 4WX2A 1RPXA 4BFAA 2A1YA 2BXVA 3EX1A 4DF1A 3W1TA 3S1XA 1TTQA 1JRCA 3Q58A 3TFXA 1DHPA 2VEPA 2KZHA 3M7WA 3U8GA 1KM4A 2A5HA 1LDCA 1XI3A 3S1WA 2P1FA 1P4CA 1KLYA 3W7JA 5G1YA 1W8SA 2ZZ3A 4FNRA 1P0KA 5HINA 1FCVA 3GDRA 2DJXA 1LCOA 4GJ1A 1KFLA 3QQ0A 1QCWA 3BLFA 2V2HA 3TNOA 4OV9A 3PVFA 5D32A 3LCHA 4DF0A 1T96A 5FEZA 2HMCA 3DKLA 2E6AA 5EL1A 3H55A 3GKAA 2VOMA 4I7WA 3WJWA 1QFEA 4DF2A 2XN0A 1RD5A 3QZEA 5D38A 6ALDA 1L6YA 1RQHA 4NT0A 1G4EA 2QJIA 2ZFAA 5FF3A 3OIXA 5D02A 2CU0A 2NWSA 5CG7A 2RH9A 2OJPA 3L0NA 4AAJA 5K4ZA 1JUKA 1GPWA 1H7NA 1KM2A 4R53A 1JVNA 3UWVA 2A6LA 1HO1A 3PB2A 3O06A 4BWLA 4K6AA 1J5TA 2RFGA 3NL5A 2FQIA 4WXYA 2Y89A 4OWGA 1SR9A 2A0NA 2RDWA 4TMCA 1NVMA 4NJHA 4LVGA 3I68A 1XCFA 3WK2A 2Y7FA 4JN6A 2V2DA 1VCGA 2V5BA 2QCEA 3N9RA 3BLIA 4FNUA 2J27A 3LCXA 4EWND 1VH7A 3E49A 4Z1AA 3HB9A 2DZWA 5CZJA 1SPQA 4HPJA 4N9BA 1VYPX 2BLEA 3FFSA 4JEQA 4PL1A 1ICSA 2Y62A 3MBFA 4QSHA 4YCPA 1VGAA 1WOBA 1YLVA 5J5RA 1G6CA 4FEZA 1SSGA 1EP3A 3CLMA 4A29A 3RMJA 3P82A 1WV2A 2P10A 1R30A 4MY9A 3DAQA 5GVJA 5KZEA 5K2ZA 3T55A 3W6YA 1SO3A 2A2IA 3HG3A 2EKCA 2GVJA 3IV3A 5BW6A 1F6KA 1WAUA 2QCCA 1RZMA 2BZNA 1L2UA 1A53A 1MSSA 4EVZA 3ZFHA 2ZZ4A 1QPQA 2ATMA 3AJXA 3PWAA 1RVGA 4XWUA 4AH7A 4ALDA 3TQVA 4R34A 3QPZA 2G97A 3TU9A 1BWKA 3FLUA 5E93A 3W70A 3F4NA 4IX2A 3TIMA 3NQFA 1A50A 3W1AA 3LRKA 2GQ8A 4TIMA 3IVSA 4M6VA 5EKYA 1GVFA 4TR9A 1G4SA 5LNWA 4JYFA 2EF9A 3DZ1A 1HTIA 3GAYA 3NQ2A 3UY7A 3EWBX 4LTSA 3IGSA 2UV8G 3O07A 1XL9A 3PBYA 4PL2A 3W7QA 3T44A 5K9XA 1PV8A 3T7VA 1FWSA 4LT9A 5F2IA 2VELA 3PULA 3FYOA 2NXIA 4UTKA 4K37A 2ZRXA 1TMHA 5LGZA 3KRUA 4L4LA 2Y70A 3LRMA 5F2MA 4X22A 1TYGA 4IOTA 4NZJA 3FKKA 1LP6A 1TV5A 2E5CA 4NNBA 1NSJA 1E51A 3Q2DA 1ICQA 4OQVA 1ALDA 1W5NA 3MYOA 1YXDA 1ZAHA 2E6DA 4R7JA 1ZNNA 3TAKA 1VLIA 1W3NA 3ZWTA 1V7YA 1FWNA 2QDHA 2VFGA 3FKRA 3W3OA 1HO4A 1TCDA 3MHFA 3NM1A 1XKYA 3TKFA 1AG1O 2CZDA 3OVQA 4ORMA 7TIMA 1XBVA 2O7QA 4MOZA 4GRSA 3C61A 1PE1A 4MYAA 3O6DA 4CLMA 4UR7A 1JQVA 3NR0A 3TJXA 4H6KA 1GTEA 3EWYA 5AHFA 1KM0A 3W73A 5CSRA 4MFDA 5HMSA 3TSDA 3LXBA 2O7SA 1VRDA 2R14A 3HGSA 4FF7A 3WK1A 4Y9AA 4KWWA 3HGJA 2AQWA 1KV8A 2CFFA 3R13A 2VENA 3BW4A 3LDVA 3P81A 3QMRA 4AF0A 4Q4KA 4GFSA 4OV4A 1GOXA 1YPIA 4UMBA 1YADA 1M6JA 2A4AA 3QYQA 4N2YA 1VZWA 2A21A 3NQAA 3A9IA 2C13A 1YDNA 4MKNA 1K7FA 2C0AA 2H6RA 3UNDA 5AYZA 5F4WA 1KLZA 4LNYA 1SZNA 2JKAA 5AB3A 3FA5A 3ABSA 2OT0A 3EXTA 4UTWA 1T0OA 4LRTA 5DCEA 4Y8FA 5D03A 3MI2A 2H8ZA 3BW2A 1TSIA 5MHBA 4OU1A 2Y85A 3NL6A 5TQLA 4QISA 1D3HA 5CPLA 4POCA 4UR8A 3HG5A 3S5NA 1KM1A 2V5LA 2ZQ0A 1FWWA 3UY8A 1SZEA 2R91A 3DFNA 3GXNA 3B05A 1SO4A 4S1FA 2ZA3A 3W7HA 3B4UA 2GJLA 4WY0F 3LTSA 1P0NA 1FDZA 4A2RA 4LS0A 5C2XA 1XUUA 1M5WA 1B9BA 1LOLA 3PS7A 2GVLA 5FESA 1DL3A 4ZVJA 1S5WA 5G4EA 3NOEA 3CWNA 4H3DA 2Z1BA 1SFLA 4UTIA 3WFAA 3QPYA 4JTFA 4UTWC 5HWMA 3OHIA 4JTLA 1O95A 1Q6RA 4K8HA 4ZQCA 3CHVA 5G4WA 3MP4A 4TO8A 3I7SA 3PUEA 4X3ZA 2FB3A 1TREA 3IIPA 2E5DA 2Y7GA 2YZRA 2RKXA 3W7CA 3FJLA 3EEGA 5D33A 3U6WA 2X1TA 4LC6A 3C56A 3WJXA 3UWWA 4HIBA 2V0TA 3NQVA 2VFHA 4LRSA 2H8XA 2A7PA 4ADUA 2G95A 2ZRUA 1VHNA 4N4QA 1OFBA 4WJEA 1B4EA 1KTCA 2YXGA 2OX1A 3CEUA 3LHTA 1X1ZA 3QMSA 4GBUA 3NL2A 2ZA2A 3QM3A 1S5TA 4XBSA 2DORA 1RQBA 2CLLA 2ISSA 4M6PA 5F4XA 3STFA 1EEPA 2CLKA 5HNRA 1X6UA 3EX4A 5TBOA 1GYLA 2CLOA 5IBXA 2B7QA 2ZZ5A 4I7VA 3E9AA 1AK5A 3KVJA 2FPTA 2QCDA 3KXQA 2WNZA 3DFQA 3N2MA 3L0GA 4GUFA 5FEWA 1NF0A 2EAWA 2Y61A 4GUJA 1QOQA 4M5PA 3W7RA 4NZFA 4JNMA 1THFD 2PRLA 2CZFA 3HQ1A 3OEXA 1VHCA 4BR1A 4JICA 3L0KA 3LHZA 3HGOA 4IMCA 4WY0A 4IJBA 1NEYA 1ME9A 3PG9A 3M5VA 1J2WA 1G69A 4O8RA 1GEQA 4LVFA 1QO5A 4MVAA 2CLMA 3HO8A 3LX9A 4YWIA 2ZBTA 2QR6A 2YYUA 4S2CA 4ZQPA 2CLHA 3LHWA 4QJ1A 4RXGA 3DI1A 5CPNA 3S1VA 1FY6A 4N9DA 4NVTA 3G18A 2C14A 4NX5A 3OBKA 3L9CA 3WJSA 4RZ5A 4A22A 5DCDA 1TQXA 4FIQA 2E1DA 1OFPA 1Y0EA 3QH2A 1KM5A 1NAL1 4S2BA 4RCXA 3O16A 1GT8A 3W22A 1JRBA 5D2VA 2GUUA 2BSLA 3C2EA 4LVDA 1F7BA 1OG0A 3TCEA 4O17A 3S5ZA 3DU0A 4GUGA 1B4KA 2E09A 3VE9A 1OYAA 3EXSA 1DV7A 4NNCA 3W23A 4EF9A 3DH7A 3GLCA 1K02A 4RZ4A 3LCLA 4UTUA 3T40A 2G96A 4Z1CA 3KRSA 4DXVA 1TRDA 2ZYFA 3TROA 3GVGA 5LSMA 4HSOA 3A23A 4DBEA 2YSWA 3GR8A 3O1NA 4NXKA 3L21A 1ZALA 4CCEA 1M7PA 3KFTA 3KVKA 1DBTA 3PAJA 3TAOA 5DLCA 5CKSA 1LYXA 3B0VC 4A2SA 4BK9A 3MMTA 4O13A 3Q37A 3F03K 3DFPA 1MZHA 1JQXA 1ZY9A 3W75A 4PC8A 5C55A 3NQGA 4LW7A 1OJXA 3THAA 4JTIA 4AMAA 2TSYA 3G0XA 4E0CA 2ABAA 3BW3A 4MY8A 1JCXA 3G8EA 1SO5A 2F84A 3LHVA 5AFDA 3M5YA 1GTHA 1Z48A 3FYPA 3N34A 1FCQA 3WK0A 3T78A 4W9TA 4RR4A 5G1TA 4GE8A 5HWNA 2J6XA 1KFEA 1OHLA 1QO2A 1L6SA 4AWUA 2JBMA 1H60A 3BK0A 3M0ZA 3NYZA 2R8WA 5F1UA 1UCWA 4ZZ9A 1FDJA 3EKLA 3W86A 4MJMA 3U2OA 1H7RA 1DJNA 1FCUA 1KFCA 3C0JA 3BG9A 3RK8A 1GG0A 5F2LA 1SSDA 3VCRA 5KSWA 1F05A 4LS1A 3GXTA 1W5MA 2C6QA 3NGJA 4MPQA 1AW1A 3GXPA 4AEOA 5A5WA 1O60A 3NPUA 2WSRA 3M44A 3O63A 3RLVA 2A85A 4WOZA 4GUHA 3PF3A 4K36A 4YXGA 4JTHA 1O5KA 3UWQA 2Z6JA 3BV4A 4O0KA 3JS3A 3LHUA 2VC6A 4Z1DA 3P8JA 4IPIA 4XZ9A 2P0OA 4XKYA 1P5BA 1UJPA 3HIJA 1YDOA 4IMFA 1PCKA 3ZWSA 4LY8A 1OYCA 4OHQA 2FTPA 1FWTA 2QCHA 1TJRA 3I6RA 2QCDB 3S5OA 3RNDA 3LV6A 2NUYA 3VNDA 2JGYA 3HPXA 3W7NA 3K30A 1X8FA 3L68A 1S3HA 3HOJA 2RDUA 4WXZA 5DY2A 3TMQA 2ZRYA 1K8ZA 1KM3A 1W3TA 3F1QA 2PRHA 1OX4B 4AB4A 1GG1A 1IXPA 4H4IA 2CLFA 5K7JA 2R94A 2X1SA 3HJZA 3NQ8A 1FUYA 4O50A 3MJYA 3CB8A 1JCMP 3HPZA 2Q8LA 3M47A 3P8IA 4BWLC 3A24A 1W0MA 4XBKA 2PC4A 3INPA 3PR2A 4R33A 4IMGA 2VFFA 5AC6A 3UWUA 2YW3A 1Z41A 1D9EA 4ICNA 3DENA 4X2RA 3VKJA 4RLIA 3E02A 4JTJA 4MZYA 3NEVA 4QM1A 4LOCA 3P84A 2FIQA 3NQDA 1WX0A 1OF6A 5I3GA 4NJGA 3UQNA 4JTGA 1A5BA 3I7QA 4UTTA 3TDFA 4MFEA 1PCWA 3L65A 3QF0A 3LB0A 3W7GA 3NO5A 3S1UA 3W1UA 5F4SA 4UC5A 4O1CA 2ZA1A 1H50A 3G1HA 1XFBA 3SGUA 2V81A 8TIMA 3DFOA 1XDMA 1K3UA 1WQ5A 2C16A 1XDLA 4ZQNA 3V1PA 3BG5A 1RQEA 1SFJA 3G24A 4OE7A 4JTUA 2WOQA 1GZGA 5H91A 3B06A 3ELFA 1O94A 2NX9A 2VFIA 4ZQMA 3PSVA 4JS3A 2FFCA 3IIOA 3EX2A 1GVSA 3HG2A 1I8JA 4O57A 4JTSA 3UYCA 2H3DA 4ONVA 4HKPA 4WOQA 1IXOA 5C54A 3OVPA 4EOUA 1XM3A 2QEZA 1CX9A 3ABQA 3LGEA 5G2HA 4PFMA 4KKXA 1QMLA 4I9AA 4J9JA 3L5LA 4YL2A 3NNTA 3C2OA 1LZOA 2NWRA 4NQ1A 3SSJA 4AVFA 3QW3A 1RR2A 1YTEA 3NPWA 2YPIA 4IXHA 2YFOA 1LBFA 3PG8A 4LV4A 3N9SA 1EPXA 1AW5A 5AHIA 3A5FA 5KINA 2PRMA 3W7PA 3LM7A 1F74A 1U5JA 4AHOA 2WNQA 4HT3A 1R46A 2C18A 2TYSA 4ZQOA 3NPXA 3W88A 3QSTA 1SUXA 3GDLA 3O6YX 2ZTJA 3MP3A 2V82A 3TW7A 1TV7A 3PSWA 4Z08A 4P61A 3CIXA 1H7WA 2I1OA 3TXVA 3KX6A 4QITA 4CCCA 5T26A 3IIXA 1U83A 4BI7A 4HN4A 5L6UA 5BMXA 2WNNA 1F6PA 4HSNA 1ICPA 1W5OA 1WBJA 4OT7A 1EWEA 3MHUA 3CU2A 2GOUA 3BPWA 1G4PA 5E0KA 1EWDA 4UTLA 4CNPA 3TK7A 3KHJA 1FCBA 2J24A 1K7EA 2QAFA 2Q3RA 1WBHA 4Z0SA 3GX9A 3LBCA 5ABTA 2QCLA 1TPVA 3M5ZA 2J9YA 5HJLA 3HGRA 6TIMA 1GVQA 1W31A 1XBYA 2YCEA 5CPOA 3CT7A 3W1RA 5D04C 3QJAA 5CSSA 1YTDA 5CZ0A 1EP1A 5FF0A 3W1XA 1S5VA 4IPJA 2V9DA 2X1UA 3IGXA 4UTTC 1K8XA 3RLUA 3M6YA 1LRTA 2VEKA 3ZR4A 4JTKA 1VJIA 5DBUA 1VCVA 3O8AA 3IIZA 1R2RA 4FHAA 1LORA 1W1ZA 1H51A 3QSRA 1Q6LA 1UASA 1KW1A 3C4UA 1QWGA 2GPTA 4FXRA 1N8FA 5HWJA 1EP2A 5U4NA 3NPVA 1OFEA 3KVLA 4Y90A 1I2RA 3TXZA 2ZZ7A 3W2KA 3W74A 4XTIA 2VFDA 1K7XA 1OK6A 3HPSA 1KBIA 2C1HA 3QC3A 3BG3A 1NF7A 4U4MA 4QAIA 3VE7A 2NLIA 4TX9A 2FLIA 1Q6OA 3B03A 4UFJA 3VFLA 4MYXA 1GJPA 3TR2A 5I3JA 4JX5A 1SZFA 3EX3A 1FBAA 3EWWA 3P80A 1H61A 5HR6A 1H1ZA 1UB3A 4DEFA 3QEZA 5AN7A 2ABBA 5TIMA 3MUXA 3TH6A 4O0ZA 3LERA 4N6FA 4IGHA 4DELA 4MUZA 1TV8A 5FF4A 4N6EA 5I3KA 4LVAA 3C52A 4O10A 4Y6GA 3IVTA 3THQA 1H7PA 3LOTA 3S9YA 2WPBA 3CM4A 3M41A 3A5VA 4AWTA 5D2TA 1C8VA 2BWGA 1IXQA 4MJZA 4JDYA 4JX4A 1W5PA 1VYRA 2VFEA 3NZ1A 4KFPA 2WKJA 3GAKA 1DQXA 3W2UA 1O4UA 1C9DA 3G1AA 2WSQA 4M19A 3FIGA 4UMCA 2ALDA 4IXXA 1TQJA 4GWEA 5AYYA 4IMDA 3NQMA 2X2GA 1PHWA 5EMUA 3MO7A 3BARA 4CQ8A 2VKZG 3TC6A 1EA0A 3TSBA 2RHGA 1PL9A 4LWWA 1H7XA 1SU5A 2TMDA 2ISVA 1SO6A 3LV5A 2PE4A 1JCNA 2D73A 2X1RA 3W87A 1KFJA 1DORA 3PY2A 3TMLA 5HR7A 4LVBA 3AO0A 1N7KA 3M43A 4FNTA 4JYDA 3WK3A 5AHNA 3DBPA 3MW7A 3L67A 3N3MA 5HQEA 3SFKA 3R5EA 3W2LA 3GZ3A 4MZ1A 3CTLA 1TO3A 3SGZA 1MEHA 1I2NA 5LHEA 3TC7A 3P67A 2QUTA 5DXXA 5AC8A 2FPYA 2DP3A 4MZ8A 3QRHA 5DXYA 1GWJA 2J88A 3ABOA 3SZ8A 1KFKA 2E6FA 1K03A 1N55A 2Q8ZA 3S42A 4O18A 4UFKA 3PUOA 2Z2UA 4O4WA 5DELA 4UTMA 2RDTA 3C2FA 4AF0B 3OA3A 1PHQA 1B57A 4ZMGA 2QCNA 1OFAA 1ME7A 3W85A 3SY5A 2HS6A 4CQAA 2HS8A 3W7LA 1SQ7A 2QCGA 4NJIA 3M16A 3HMJG 2B7OA 4KWVA 2IQTA 4M7TA 5CZSA 2WSYA 4N4PA 2TRSA 1OX4A 3OVRA 3G3DA 4OGZA 3TSMA 2JKEA 3LCFA 5EYWA 1GVOA 2CZ5A 3W1NA 4GNJA 5HUOA 4CCDA 2V8ZA 1TPB1 1B3OA 2GQ9A 3GDTA 3W9ZA 3GK0A 3R8RA 4RK8A 4AXKA 1MEWA 4BI5A 3TE9A 3B8DA 1TB3A 4C1KA 1F73A 4IUOA 1F2JA 4NJKA 1QPOA 1TPC1 4RJEA 2XN1A 4PODA 3TX9A 1R2TA 5LNVA 3LXCA 2YGYA 1TIMA 3LCIA 3ATYA 3HG4A 3DI0A 3S6DA 4FO4A 1SZGA 1UBSA 2YR1A 1LLWA 4NNAA 3QMTA 5D2XA 3LI0A 3LXAA 3F4WA 1JUEA 4UNLA 1YYAA 3YPIA 2V30A 3N19B 4UFHA 2YW4A 2HTMA 1LTDA 3GNNA 4NU7A 5DN1A 3W7MA 4HHPA 3ZS4A 2EPHA 3SR7A 5KMYA 1W54A 4KFNA 3L5MA 1OFDA 1W56A 2TPSA 4DPQA
chains in the Genus database with same CATH superfamily
4N02A 1P1XA 4JIQA 3OZMA 3D0CA 3FV9A 3UERA 3WF1A 2CZEA 3UZ5A 3NQBA 4RXFA 1FQ0A 3QYSA 4H00A 1Y7VA 4P7RA 2PU0A 1NELA 1AQMA 4C6BA 3B0UX 4N0RA 2DZXA 2BGNE 1GYMA 1DPMA 3H21A 4XO6A 2DGAA 2PDUA 1PIGA 1HKJA 2BGSA 2IPJA 5L9FA 1ME8A 4DI9A 4FX6M 1ZHAA 3RF9A 4A6GA 1OQFA 5LA0A 1IV8A 3ANYA 4IX0A 1QI3A 3REQB 4HPHA 1NDZA 3GW0A 4XIMA 5BCAA 1IIGA 1RA0A 3H2AA 3WH7A 4DY1A 4O16A 1NOFA 4HHHA 4WSKA 3STCA 2NQZA 1PTAA 4GC4A 2PDYA 3GFXA 1XWYA 5G5IA 3AZSA 2C15A 4U28A 1DQUA 1W2VA 2DUXA 4JTEA 4LU0A 3GKFA 3DG7A 4LUIA 5CPMA 5I06A 4Q33A 3AXMA 1HN1A 4EKJA 3RAOA 2W0UA 3E0WA 2VYOA 4QXIA 3OB8A 3G3MA 4L4PA 2C19A 4JGDA 3U3HA 3S2NA 1LQ0A 3S5YA 2QDDA 1H5YA 2Z24A 3LD5A 1I60A 4PCFA 3VKBA 3TOPA 3CUFA 4FLQA 3P60A 3S2MA 3ABRA 4D6IA 1CIUA 2DZSA 4JTRA 1XDJA 1XRFA 2WHLA 4GXMA 3NVTA 2D3LA 1REQA 4LEQA 3PPHA 1OK4A 3LPPA 2WQDA 2QJHA 4ZB2A 1T6MA 1AL7A 4YS1A 3LLFA 2Q3OA 3BLKA 5BRBA 2HQAA 4DQWA 1RY0A 3TJLA 3N14A 2Q71A 2AGKA 3TWBA 5EMYA 3WY1A 1IR1A 3JRKA 4MY1A 4RV8A 1KR0A 3C6CA 1W37A 3HF3A 6CGTA 4LB4A 1MVYA 5HQMA 2CPUA 2XVKA 5LA1A 5HMDA 2NV2A 2ZDSA 1E9LA 3JZEA 1L0PA 3H53A 1DWAM 4DUWA 2E9LA 3KVMA 5F1VA 3PZUA 2FH6A 4K39A 1LUCA 2CWNA 3T4CA 1UZHA 4YTUA 2FDMA 3S2CA 4P8VA 5IFPA 3IGHX 2GFTA 2PBOA 4H9YA 4A21A 1M9HA 2WV8A 1E1CB 2ONEA 1CCWB 1GEHA 4PMDA 1JF6A 3CQHA 2HVNA 4DZIA 4PFHA 1LBLA 2J79A 3RJXA 1DJQA 4ILSA 1O66A 1NWSA 1WA3A 3PZIA 3TEVA 2EGZA 3SUUA 4H6QA 2DZTA 5BROA 2VX7A 1LOSA 1K8YA 3QW4B 1UUMA 2PD5A 2ZUMA 2Z7KA 2PDMA 2JGQA 4MADA 1B3ZA 2WVTA 3EX6A 1D2KA 2Y5SA 2Y7EA 1Q3NA 1BKHA 4E3TA 3SRFA 4UB9A 1AZ1A 3AHYA 3OHMB 2QCMA 4FS9A 3AWOA 3E0IA 2P3EA 4R27A 4AG0A 4GI4A 1PIFA 3WMCA 3TTOA 1O5XA 1VPXA 4P7QA 1PB0A 1UP2A 4Q4SA 1UHVA 4RDWA 2QF7A 5E6ZA 2VQUA 2HNHA 1ZZMA 1FXPA 1EX1A 1S2VA 2Y8KA 3WLPA 1CDGA 1YNQA 2XFFA 4HGXA 5EA9A 4CNNA 2DH3A 3A64A 1KFBA 1VBGA 5LGXA 1ZFJA 1MUCA 1W1PA 3W1LA 4I3GA 4CQ9A 2OX4A 1OGGA 4JYEA 5KTLA 3H54A 2V3EA 2QS8A 3O05A 1EF3A 3AHTA 4FNQA 2QPXA 1SMAA 3PN8A 1ZPTA 5A6AA 3W83A 4DUOA 1C92A 4AWSA 2ACRA 1UC4A 1UROA 4WF7A 2I5GA 4O1DA 1IXNA 1FWDC 2VURA 4HJWA 4JIRA 1XP3A 3RPTA 4OFCA 3TUUA 3W07A 2W67A 3OBAA 4C6QA 4M7SA 4ATDA 3G0UA 1V0LA 1XPYA 3O0FA 1ZU8A 3BSHA 1AMKA 2YBVA 1E55A 3FJ6A 3K1GA 2XWEA 4HZ7A 2X16A 5HUPA 1ECQA 4F0SA 1F76A 3CC1A 4PA8A 3AS0A 3LTPA 1KA9F 2I14A 3BCDA 4GI8A 1Q8AA 3E0LA 4C90A 3PFMA 1W2PA 3LI1A 1Q6QA 3L2LA 3OGSA 4IMEA 2VGGA 2BODX 2DEPA 2OEMA 4ADSA 2B4GA 3SW6A 4MLJA 4WY0B 4CU7A 4K7YA 5XIMA 1A3XA 2GJRA 1UJQA 3M9YA 4F9JA 4QE1A 3GYEA 4M81A 2QUUA 3DX5A 3WJYA 1I45A 2CBIA 3TFCA 3W00A 3L66A 3MB9A 4PEKA 3WD4A 1TPWA 3R2GA 1XBXA 2DSKA 1G4TA 3WKZA 3FS2A 1TPFA 3S8HA 1XKJA 1BTCA 2VI0A 4BY3A 2NXGA 4DI8A 3W1QA 3TZFA 3ZT6A 2ZKMX 2R82A 1BG4A 1JPDX 1HKIA 5G2WA 1PKYA 5U7SA 3PBUA 1G01A 4Z1YA 1XH2A 3KWSA 4NXSA 4US5A 5XINA 2A3LA 3I65A 3GVWA 3A47A 4QJ4B 3ZR5A 1HFBA 4NZ5A 2PLKA 1DKWA 5A8GA 3JU2A 5DT7A 1V3LA 2VDHA 1PS9A 2PLMA 4FIRA 1D3GA 3KM8A 1GOOA 1XISA 2VT0A 4BQ3A 3DFTA 1WOAA 2WMIA 2NQ9A 1AH0A 5LHFA 2ZC8A 3EDFA 5RUBA 3SCOA 2HNEA 2CLEA 2OR2A 1ML1A 2NXHA 4ZFMA 2B0MA 2E67A 4JDBA 3RYSA 2PTDA 5FI8A 3O3RA 5CGQA 5EB8A 2P76A 4KRUA 3KL3A 4O11A 4P2VA 3KTXA 3CV6A 1C29A 5A8MA 1S3TC 3JR2A 3R0KA 1DVJA 3P0XA 5D09A 3PTDA 4YNGA 4EPEC 2OO0A 1T5AA 3IK4A 4UQDA 1GQLA 3DKJA 1EX5A 1QNVA 4XKYB 2ZWZA 1KBJA 4W86A 3QV8A 5FF2A 4REQB 1A5SA 1A5MC 3MV11 1MEIA 1T99A 4RZ6A 2J78A 3AMLA 2ZUTA 4W84A 1PX3A 3HBLA 1A80A 2OGYA 1W9PA 3KDNA 3G1VA 5A8NA 1ITXA 3A3HA 4L1WA 3QHMA 1XD0A 4ZO6A 5T8GA 2NQJA 3OVGA 4NJJA 3DCPA 2WJZA 1VLWA 3GDMA 3SFWA 2A3EA 2D20A 2PCQA 1TVPA 1LLZA 4D2JA 4E8DA 1GUVA 2FTYA 2NUXA 3S9ZA 4XX6A 2QJGA 1TV3A 4IQJA 2WC7A 2Z29A 4Y9PA 3M7SA 2QUVA 4EE9A 4YCOA 1GVRA 2PGRA 2CNCA 5FJOA 4MLRA 1UH3A 4QDWA 4M29A 1X1OA 3Q94A 2J7CA 4LAOA 4KGLA 1RPXA 2BXVA 1TVNA 3EOUA 1GOIA 3GH4A 3VKKA 1FHUA 3R0DA 1DHPA 4QSFA 3WLHA 1KM4A 2A5HA 3G6LA 3EPOA 1FVPA 3S1WA 1QW8A 3O7UA 2G8ZA 1X38A 3UA3A 2PEVA 4MB5A 3W7JA 1OZMA 1W8SA 1NIUA 3BZGA 4RV3A 1FCVA 3VD3A 3QQ0A 4GA8A 3TNOA 1KCLA 3GG0A 1HVQA 3SBFA 4OV9A 4F48A 4XD4A 3WQ8A 4B15A 2QW5A 1T96A 2HMCA 3GC5A 2E6AA 2Z00A 2VOMA 1MUWA 2DVUA 4IGNA 4C7DA 2O92A 4GVGA 3N9KA 2PDBA 2QJIA 5H8PA 1C8QA 1B3XA 1V4YA 1W3KA 3FYYA 3L0NA 2EQDA 5ECUA 3BURA 3N13A 1MDRA 2A6LA 1HO1A 4TX8A 4BWLA 4K6AA 4A8LA 4DJED 2I57A 1J5TA 2RFGA 2FQIA 4JFWA 1GORA 2A0NA 4TMCA 1I75A 4W93A 1IT0A 1UKPA 4BHYA 4GQRA 3I68A 2VDIA 1XCFA 2Y7FA 4KPLA 4YTSA 2QDEA 4XO7A 1K8CA 2F6XA 4IT1A 4U2ZA 2J27A 1VFFA 3E49A 4US5D 1OC7A 4N9BA 3U4FA 2ZXDA 2YKKA 2POZA 3GHTA 3EB3A 3CLWA 3WMBA 3WDHA 4QSHA 1G6CA 3GVRA 1HJWA 4AD1A 3SSZA 1J11A 3LS9A 1V3JA 4ZO9A 2P10A 4CKQA 2WHKA 3DAQA 1W9UA 3ARUA 1WDRA 4CCZA 3W6YA 5JUVA 1SO3A 3IV3A 5BW6A 2GVJA 1YW1A 3GD6A 1D8WA 4D8ZA 1K9DA 5JIWA 4IP4A 2OOFA 4WEVX 1MSSA 2OOGA 3PWAA 2GZXA 3TQVA 1E1EA 3QPZA 1BWKA 1EQPA 1HGWA 3W70A 1HKKA 3F4NA 4I90A 2ASHA 4B91A 1DEDA 1A50A 2WYSA 2GQ8A 4YJ5A 1MNSA 4TIMA 3UG5A 4RNIA 4JTAA 4OVXA 4TR9A 1G4SA 1LT7A 2EF9A 1US3A 1HTIA 3NQ2A 1NTHA 3UY7A 4HJFA 2IPWA 2CKSA 2OTDA 2UV8G 1LQAA 3O07A 3PBYA 3T44A 5DFAA 4AW7A 3T7VA 4GQ0A 2VELA 3PULA 5C2GA 1J0YA 4GY1A 5LGZA 1EGMA 1PDYA 2XISA 3UW6A 2Y70A 4UQEA 4IOTA 3VIKA 2Y8VA 1M53A 4NZJA 2Z7GA 1LP6A 4NNBA 3BLLA 4CEUC 2FZMA 1UQYA 4OQVA 1NY1A 1M41A 3MYOA 1W1B1 2E6DA 1ZNNA 3TAKA 1VLIA 4KEMA 3ZWTA 3I3DA 1XFCA 4WGXA 1FWNA 2INEA 1TCDA 2VEFA 4LAUA 1XKYA 4DN1A 5GJMA 1AG1O 1XBVA 3WO8A 3ITOA 3C61A 1PE1A 4MYAA 1WPCA 3O6DA 4CLMA 4GKLA 5AHFA 1KM0A 2YL9A 3HJEA 1VRDA 1E9YB 4KWWA 5CJNA 3HGJA 4WGHA 5MF5A 1KV8A 2CFFA 3N29A 4JL1A 4JFSA 3SY1A 2VENA 3BW4A 3VIJA 1A3WA 1BXBA 3P81A 4YPJA 3BLOA 4AF0A 3VOHA 3WG6A 4G8TA 2ZUVA 4GBDA 4GFSA 3ZO9A 5H8UA 4XD3A 1YPIA 2J47A 4UMBA 1XC6A 4XIAA 2BV9A 1K70A 4N2YA 1VZWA 3A9IA 1TWIA 3W6LA 1XW8A 4F0LA 1K7FA 5F4WA 4LBSA 4CD4A 2QVHA 5AB3A 3CGTA 1BQCA 3VUPA 3UU0A 1ZS2A 2XIJA 3EXTA 3EMZA 2HWGA 5EMKA 1T0OA 5DCEA 4Y8FA 4U5KA 1KCXA 3MI2A 1TSIA 3GY1A 5MHBA 4OU1A 2Y85A 4DYEA 3DFYA 2Z25A 5CPLA 1PXGA 3HG5A 1KM1A 4DJFC 4UQCA 1FWWA 1TFVA 3GXNA 3UJEA 3U2ZA 1VBRA 3B05A 1SO4A 4S1FA 4AZHA 1RJPA 1FDZA 2BVTA 3H22A 1R9ZA 4HHLA 4I9JA 1XIFA 5FESA 3UCQA 4ZVJA 5KETA 5IXEA 3RRAA 3CWNA 4RDYA 4H3DA 4ROQA 3N2OA 3MKKA 3OHIA 5CLTA 4JTLA 1Q6RA 1GJWA 3U0HA 3EA2A 5CC7A 3MP4A 4TO8A 3AYRA 1LT8A 3I7SA 1XQKA 2Y7GA 2YZRA 3A12A 3GNRA 3U6WA 4G5DA 3UR2A 2VFHA 4LRSA 4ADUA 2A7PA 3IJQA 3RM4A 3E2RA 4A3HA 1B4EA 3POCA 4DWSB 1KTCA 2YXGA 3GTHA 3QMSA 3BE7A 3QM3A 4XBSA 5F4XA 1ZRQA 1E9ZB 2IKGA 4ERIA 3FVDA 3EX4A 2HCVA 3L4ZA 1GYLA 1CXEA 1YEYA 5HQLA 3SCTA 2AKMA 2VUYA 2WC4A 2QCDA 2O55A 3KOWA 2BHUA 1POKA 2BY1A 5FEWA 1NF0A 4D6GA 4NZCA 1QOQA 4NZFA 4Y9OA 3GNPA 1VHCA 1XJBA 1TJ1A 4BR1A 2HXUA 2WANA 3OYZA 4DAIA 1UOZA 1HP5A 1W9DM 3LQGA 1ME9A 4KW2A 2JE8A 1J2WA 1QO5A 1Y5WA 4MVAA 1A0CA 3HO8A 2ZBTA 3VZXA 4ZO7A 2CLHA 3LHWA 3QLDA 4RXGA 4FOUA 5CPNA 3S1VA 1JDFA 1UKOA 2VCBA 4AX6A 1FY6A 1VPQA 1YRRA 5HPCA 5HANA 3DESA 3GXIA 2FMOA 1BSIA 1P0EA 4Q7BA 4RCXA 2C8NA 3O16A 3APYA 4H9MA 2XH7A 4ZO8A 1QK2A 1HXJA 1VD6A 3GYCA 5C7HA 1F7BA 3SQSA 3VIGA 2ACSA 2BBFA 3OQEA 3GH5A 3RR1A 2I7GA 4XBJA 3QZAA 1Q2RA 4MWAD 1KQZA 4AFYA 3PPFA 3K46A 3T0CA 1DV7A 1EKOA 3PZVA 1XRTA 4IP7A 4C6JA 1JFHA 3MUZ1 3GLCA 4GD0A 3LCLA 4L9YA 4Z1CA 2FZDA 4HMCA 4DXVA 3LPOA 1EHNA 2ZYFA 4DBEA 1KXTA 3L12A 2YSWA 3BICA 1ISWA 3DUGA 3GR8A 4TTUA 3WQVA 1RBOB 3KVKA 4J1OA 4ICMA 3MZ2A 3VVGA 4TQTA 4BK9A 1GOQA 3II1A 1P0DA 3H4WA 2WHMA 4B5XA 1JQXA 1ZY9A 3W75A 4HYWA 5C55A 1R3QA 2X0SA 4WDXA 2RDXA 4J3WA 4AMAA 4JTIA 4XK2A 3BW3A 2F38A 3G8EA 3LHVA 3N34A 3SQMA 3WK0A 4IPLA 3T78A 4RR4A 3QGAC 4OOUA 1HW6A 5HWNA 2W27A 1ODUA 4UR9A 1OHLA 4IPPA 1V3HA 1GKQA 2ZUNA 2X41A 1H60A 1SM9A 3BQ5A 4NI8A 4ZZ9A 4AD5A 1FDJA 3W86A 3U2OA 1FCUA 1Z3NA 1E6QM 4HYVA 3BG9A 3VCRA 1DHKA 1NWRA 2BVYA 4NILA 3VGGA 1XSIA 3GXTA 2V38A 4AD2A 5EMLA 5JBFA 1W3JA 3WEMA 1O60A 2DQWA 2J4GA 1CTNA 3O63A 3RLVA 1CNVA 4K36A 3AU6A 4JTHA 4J5NA 2CESA 1O5KA 1JAEA 2YB1A 4MWAB 2Z6JA 3ARZA 3JS3A 1XLEA 3LHUA 3MCOA 3QR0A 4IPIA 4XZ9A 4HCHA 2P0OA 2GJXA 4XAYA 3WNLA 2FTPA 1FWTA 1M7XA 3E2QA 3IANA 2PA6A 2QCDB 3S5OA 1BVZA 4ZEPA 1QVBA 2NUYA 4R9OA 1ZB5A 1FA2A 1MXGA 3CZGA 2GVYA 4PZVA 1J0KA 1H2JA 3L68A 4RW3A 1UPPA 1BXCA 4QX4A 4S38A 5B80A 3OODA 2ZRYA 1K8ZA 1KM3A 1V6TA 3F1QA 4D6DA 1OX4B 4HK7A 1GG1A 3W02A 4F0KA 3VDCA 1NDWA 1IGWA 2R94A 1RHCA 4MKVA 2F6UA 1E56A 2QJNA 3M47A 4PTMA 1MDLA 3A24A 3PR2A 3U9IA 1HJQA 1DWGM 2VFFA 4IMGA 5AC6A 2YB4A 5DF0A 2NSXA 2EBNA 4O8AA 1D9EA 3DENA 4NF7A 3E02A 4JTJA 3WF3A 3M46A 1KGUA 1CXFA 3NEVA 3UYIA 1WUFA 4GABA 4NJGA 3WL1A 4H2CA 4JTGA 3ARPA 1A5BA 4UTTA 4BJHA 3L65A 3K4AA 3LB0A 4QCFA 3NO5A 2D0FA 4WJXA 3SRDA 3NWRA 3BAJA 4HK5A 4FAMA 1XFBA 8TIMA 1XDMA 1WQ5A 4JIHA 4ZBCA 1RQEA 3G24A 4JTUA 1GZGA 3RPMA 3M64A 4OUIA 3TJ4A 3ZXWA 4J2MA 2D22A 3L4VA 4Q8VA 1CGVA 1GVSA 4G2DA 1CGWA 3D47A 2PDJA 4C7FA 1MQPA 3I3BA 5ABHA 4QDMA 1ZQ5A 3CO4A 3ZJ7A 3OVPA 5C9XA 4CEXC 1YX1A 3DDMA 3TYDA 4KKXA 5A8PA 4I9AA 4YL2A 1KD0A 4HNCA 4RNFA 3SSJA 4AVFA 5CBJA 3LPFA 4WHBA 4QEHA 3WX7A 1BYAA 1YTEA 2YPIA 4IXHA 3EDDA 3M0MA 2V68A 1M7JA 4LF2A 3A4WA 1EPXA 1AW5A 1QHPA 1YDYA 2J7DA 1QJWA 2PRMA 2NV9A 3LM7A 1UMLA 8RUCA 4AHOA 4JOMA 1ODZA 1R46A 3BXWA 4ZQOA 2J77A 3O6YX 2A3HA 2GDUA 3TW7A 1TV7A 3EGJA 2V3DA 1H7WA 3CH0A 4NRSA 3KX6A 3LQLA 3LSCA 5EMMA 4F2BA 4C1NA 3WUBA 4S3KA 3V5OA 1U83A 4BI7A 4JKMA 2VC5A 3ECQA 2WNNA 4HSNA 5MKGA 4NHVA 4OT7A 3H6OA 1DWIM 2WSKA 4CNPA 5AC4A 4L65A 4QS6A 1SJAA 4GXWA 3GX9A 3W25A 5HJLA 3FXGA 3SJNA 3KTCA 1MFUA 5CZ0A 1VKFA 2GGGA 1JEZA 4IIBA 4WDTA 3W1XA 1S5VA 4EXBA 4IPJA 4Q8TA 1VBHA 3ANUA 2GWNA 2Z28A 3RLUA 4QCEA 3R4IA 1GPFA 2R1KA 3SN0A 1WNOA 1JPKA 3FEQA 1WP6A 4NY2A 2QYGA 3IIZA 1QNQA 4XG1A 4IISA 1AQ0A 3RGTA 2ACUA 4FALA 1UASA 3ISIX 3C4UA 2J6VA 3SRKA 1RP8A 4FXRA 3GC4A 5HWJA 1I1XA 3RM8A 4PSRA 1X97A 1GQJA 3NPVA 3OTRA 1I2RA 3TXZA 5HA7A 2VFDA 2O9RA 3GHUA 3HPSA 2C1HA 2GQ3A 5DMYA 3VE7A 5M1TA 4TX9A 3AJ7A 3ENLA 1G9HA 4K8GA 2FLIA 3B03A 1EF2A 4FLRA 1B90A 5HR6A 3DYPA 1W1TA 2BVDA 1H1ZA 4DEFA 5AN7A 4PCPA 4PUDA 4W5ZA 4QG6A 4IIHA 2ZVRA 1XLJA 2EPNA 4IFOA 3MSGA 5FF4A 4N6EA 1CXKA 1JZ4A 3THQA 4IGMA 1H7PA 1E70M 2ESCA 4ACZB 1RD6A 1RJQA 3CM4A 2PTYA 2QT3A 1AJ0A 4Q8UA 3S47A 1YBQA 2BWGA 1IXQA 3BTNA 4C6MA 1V3KA 4KFPA 2WKJA 3GAKA 1ISYA 3WD1A 1O68A 3TTSA 2ALDA 2XPKA 2JEQA 2Y24A 3SCNA 2X2GA 3KS6A 3MO7A 4HZ8A 5IDZA 2G3JA 3UNTA 2VKZG 3TC6A 1H4PA 5I03A 4WDUA 2GUYA 2ISVA 4BEQA 5B7YA 1ZJBA 2X1RA 4HMNA 5GNYA 3N4FA 3PY2A 4FNTA 3DBPA 1NOWA 2L5HA 4E4PA 3PPGA 1K9EA 3QXBA 3FSTA 2AKZA 3SGZA 1TV4A 1I2NA 4CUCA 3DGBA 2QUTA 1J2BA 2J25A 2DP3A 3FSUA 1GWJA 2YXXA 3T05A 2UZ9A 4F8XA 4D6FA 3T9PA 1D8CA 1NQKA 2DSVA 4QAWA 4UFKA 5ABFB 1JPMA 3UJ2A 3SN4A 4AF0B 4BA0A 3WUEA 5HJYA 1B57A 4ZMGA 5LIYX 3NFUA 1PAMA 2A3CA 3SY5A 2HS6A 3GIQA 5EBAA 3FHAA 1ISZA 1KRBC 2XZ7A 2Z1VA 3M16A 1DIEA 3CL7A 4QBXA 4M7TA 5CZSA 4LAMA 1OX4A 3G3DA 4PR4A 1EJWC 3TSMA 2H9AB 4PB5A 4L1XA 4RPPA 3P2VA 1CXIA 8CGTA 1TPB1 4J3TA 1B3OA 2GQ9A 3OOQA 4LEFA 1JD9A 3R8RA 4BI5A 3TE9A 5AECA 3F2DA 3B8DA 4FZIA 4ZENA 5TNVA 1CECA 1F2JA 3DC8A 2WZTA 2ZADA 5DMNA 3W27A 2XN1A 4PODA 2ADAA 3EPMA 3LXCA 3SQLA 3ATYA 1JDDA 2E0PA 2VTFA 4FO4A 4XZWA 1SZGA 2AOSA 2W63A 5GNXA 3LNPA 1C7TA 5GQBA 1W6TA 3QMTA 2DZBA 5JXQA 2IQDA 1YYAA 3YPIA 3N19B 1EXPA 3VFCA 4NU7A 4IG2A 4HHPA 2EPHA 3NVDA 2ON3A 3L5MA 2WMGA 3EB4A 4L6DA 1RV8A 1H63A 1OINA 5FJUA 3G5EA 1VEMA 4ZL1A 4V33A 3N4EA 2E77A 4EXAA 2A7RA 4O12A 1BLIA 2YDAA 2B7PA 4HNUA 1E43A 2QAPA 3H70A 4DHGA 3QY6A 5EPDA 2YDQA 3CUHA 3C2RA 1B3VA 1TMLA 1EDGA 3VM5A 3F4DA 5SWUA 1J18A 2YFNA 4LC8A 1C90A 3N25A 2JQXA 3EAUA 1Q4NX 3I10A 3TQKA 3E96A 4UTJA 3FN9A 3LLDA 4MNMA 4C6DA 1F8IA 4RDZA 3I6TA 1SW3A 4G9PA 3R6IA 4UOZA 3RFAA 3V16A 4DJDD 3TN4A 2V3FA 3NQEA 4GVHA 1KNWA 4BKNA 4M6UA 4E2BA 3CJPA 3CUGA 1POJA 1FFQA 1E4LA 1SW7A 4HYRA 2V2CA 3WENA 3MI3A 3KUMA 1U22A 1JUBA 2OCZA 1S2AA 1Q2SA 1EJVC 4L6HA 3WQPA 3WLSA 1AL8A 2QKFA 4GK8A 4K7VA 3MYPA 2BY3A 4XTDA 4PMVA 3SCPA 4O53A 4ZSUA 1C7SA 1ZTVA 2OKTA 1HG3A 2YZ5A 4CN1A 5BOEA 5AZ0A 3O6CA 3KP0A 1EZWA 3VOIA 3G0SA 3ZZ1A 4BS0A 2G4FA 3MS8A 3GTFA 1W9XA 3G77A 3W37A 2GVGA 2DVTA 4GZJA 4LANA 3MMWA 3B04A 4IGSA 2I56A 2DT2A 3V75A 3BDKA 5I0DA 1WCGA 3S0CA 1EUNA 4NASA 1VENA 4DBUA 5XIAA 3PC0A 4AHPA 4DYKA 1I9CB 1TJPA 1JCTA 1TTJA 1K1DA 1OBAA 2WZIA 4TUFA 1LBMA 5LA2A 5CJMA 1GKPA 2D23A 4QNWA 3RITA 3UVIA 3OLEA 1XLFA 3DYMA 5CAKA 3USBA 4GY7A 3DOPA 1QOPA 1E6RA 1WB0A 2J74A 3ITCA 3V0SA 3CYJA 2R1MA 3NM3A 3BGGA 2WQPA 2ISWA 4HBKA 4KFOA 1TRIA 3GR7A 3ZLGA 3A22A 3STEA 3KAOA 3RJYA 3UG4A 4QTGA 2ZDRA 2DU2A 1V5XA 5LIUX 3WH6A 3EKZA 3R89A 1QASA 4XUYA 3NDOA 3UPBA 3N15A 1XICA 3B8UA 1OWQA 3MUAA 1UBPC 3CL6A 1U5HA 2J13A 5J5DA 1P48A 4PMOA 3MANA 5I23A 4M1BA 2QMKA 5FEXA 4G7EB 3N2XA 3M4HA 1AUSL 1DWJM 1GCYA 2BOGX 4L4OA 2FB2A 3R1ZA 5C5YA 1BFNA 4PRTA 2RAGA 2XFRA 3C2VA 3CK5A 3WBEA 1LM1A 3ATZA 4UNIA 2PDWA 2PP0A 3UR5A 5I3IA 4GI6A 4JIPA 2PDQA 3W71A 1TPUA 3LHYA 3AIUA 2YCIX 1ONXA 4CU6A 3RMEA 1BTMA 3AHXA 3AMGA 4B16A 9CGTA 2DT1A 4UFIA 1PEZA 5BNKA 3L2MA 4NAFA 1DTUA 3PFRA 1I2OA 1OX5A 2Z2BA 2A3BA 3S3GA 2W92A 3OG3A 1GOWA 1J79A 4GYJA 3W7EA 2XUCA 3VD9A 4WSHA 3R12A 4UMAA 3ZQ9A 4ZOEA 3H2MA 4LV9A 3NG3A 3CV1A 3PWGA 3CIWA 2HE5A 2OZ0A 3TV8A 1OFQA 2IPFA 1KV5A 1YE4A 5I3DA 5IM51 1W1IE 1MMFA 1TWWA 1X39A 3W82A 2VX4A 5A6LA 4WZHA 1UQZA 2ICSA 1AQFA 7CGTA 5C8BB 1H49A 3L7RA 1AFSA 3BANA 4GIRA 3U5UA 4JR5A 3BGJA 4OBTA 3CO8A 3FXYA 3RDKA 3BGAA 3W2JA 2ZZ1A 5AHEA 2QGHA 3AIQA 5I79A 3FDKA 2C3ZA 3L5AA 4JFVA 5EY5A 5CEWA 1CEOA 2J62A 5HNNA 4GPNA 3STGA 4DBDA 1LRNA 1QAPA 4PTXA 4AZIA 2DUZA 3N04A 4Q8WA 2JIEA 3AMKA 4PH6A 1E9IA 5CXPA 4R7WA 3ZT7A 1I2PA 3IUDA 1S5NA 1VEOA 2HK1A 4KWUA 4UWMA 4BF7A 1UKQA 4PMZA 1YDVA 4LAZA 2WCSA 1XG3A 5AOUA 2DSZA 4L61A 3P14A 3TW6A 3IIVA 5AHLA 3I4KA 1ZBCA 1LOQA 4ZGYA 5FSEC 1IEXA 2F7FA 1G67A 6PTDA 3BSGA 1QR7A 1VR6A 3NQ7A 1JZ6A 4Y96A 4QLLA 3MUIA 4ATLA 1ADOA 1LLOA 1PKMA 3CQJA 1VS1A 1J4EA 3N73A 3GIYA 4IWWA 2VGIA 2VXNA 1BRLB 1VC4A 1V79A 1TE1A 1R7AA 1V0MA 1V6VA 2JK2A 4HB7A 3VGBA 3GNDA 4U2YA 2QJJA 4UCFA 1E0UA 4JQ1A 2FPVA 1E6SM 3M0KA 1J5SA 4HZ6A 1DJIA 1DWHM 4FLSA 1ONWA 3KOYA 1JYXA 4AHQA 5AZ1A 2R24A 3V18A 3KZPA 4H01A 1DQWA 3GU1A 4PTNA 2BTMA 3G1DA 4PMYA 3P61A 3P7YA 5K9DA 4JN8A 3P5ZA 5I3HA 1OADA 4JCLA 3E5BA 4GIEA 5AYIA 2CEQA 2PDPA 3H2NA 3K13A 3VCNA 1EJSC 3CWOX 1RSCA 1KTNA 5G2IA 1OVDA 4MB3A 3NCOA 4U3AA 3C0LA 1UR1A 1OYBA 2XJ7A 4G1KA 4AZCA 3U48A 2AL1A 1EJRC 3DECA 2XGBA 3LCWA 1JYNA 3APGA 4Q32A 1GW9A 2GQAA 4ML4A 2OZTA 4O15A 3A21A 3LBMA 3HM7A 1XYCA 3V1HA 4HNVA 4D8AA 4AEEA 3TCSA 1I4NA 1V3MA 3W7KA 2J9ZA 2PD9A 1E6NA 3ONCA 1XCWA 4EP8C 1W32A 2C1IA 4EIVA 1XIGA 3VNKA 1LRQA 3FGCB 4LYRA 2VP8A 4O14A 4HMDA 5DY3A 3K8MA 2XZ9A 1BVWA 4LPCA 3WJZA 4A35A 2YX0A 3DXIA 1YXYA 1ZCOA 1E3ZA 1A5OC 3A3WA 1Q45A 3VXGA 3H7UA 1OY0A 3TYEA 1UH4A 2G3FA 4LYQA 1ZJIA 1A47A 4Z2HA 3EXRA 3HPFA 5CZTA 4MIMA 2ZZ6A 2O0TA 2VVNA 2XM1A 4JEJA 3S1GA 2XSAA 5T9CE 1J93A 4B5VA 4WD0A 4MMWA 4GUIA 5EFFA 1X6NA 1JULA 3I7RA 2EPMX 1TJ0A 2A1YA 2G37A 3S1XA 1VFHA 1TTQA 1JRCA 4W8BA 1DTNA 1WKEA 3M7WA 2I16A 3VC5A 3AQUA 3NSNA 3R10A 4ENLA 1LDCA 1XI3A 1ZCCA 3W26A 3CZJA 4U5IA 3SB0A 4HA4A 1P0KA 3GDRA 2DJXA 1LCOA 1QCWA 2V5JA 1R3TA 5ABGA 1TVLA 2BHZA 2WLZA 5FEZA 3ZJKA 3DKLA 1GOKA 5FOOA 4RE4A 1WZAA 1X6LA 1CGUA 2HPIA 4XZMX 3WJWA 3HQOA 1JDCA 4DF2A 1TE6A 1Q65A 1RD5A 1ZL1A 3WNOA 3QZEA 4OZOA 1G4EA 2ZFAA 2XGIA 1JYVA 2NVDA 5CG7A 1XSJA 2RH9A 1E5NA 4B3LA 5K4ZA 1GPWA 4B4HA 2BY2A 3PB2A 3O06A 4AQLA 2PGEA 1CB7B 5E0FA 2GJPA 1ZLPA 2VVSA 4WXYA 2Y89A 2W61A 3BOFA 1J9YA 3WFLA 4NG3A 1Q5MA 1GQKA 3AS1A 4MWAA 2X1IA 4JQAA 2FGBA 3N9RA 1ENUA 1VH7A 2YL6A 1VBJA 2DZWA 5CZJA 1SPQA 3AIVA 3FCPA 3FHQA 4P7LA 3TYAA 3FFSA 2VD8A 1QHZA 4JEQA 1FOBA 4PL1A 2P53A 1PYFA 4YCPA 1VGAA 4PCNA 2VHLA 2ZX6A 1ZP4A 1SSGA 4LGXA 3CLMA 3LGDA 4ZB5A 2DIEA 4PBEA 1A5KC 3ANVA 3RMJA 1HL8A 5M03A 3UETA 3B8IA 3VINA 2CBVA 3IUIA 4QG9A 2A2IA 1F6KA 3SCUA 3HTWA 2QCCA 1RZMA 2B81A 1L2UA 4P8XA 4GX9A 2G3MA 2ZZ4A 1QPQA 2WAGA 4Q4OA 1SR0A 1XYBA 1R38A 4TVDA 3AISA 4XWUA 4AH7A 4ALDA 5D8WA 3TU9A 1VIZA 1KBBA 1TWSA 1XLKA 4IX2A 4BF5A 4GO8A 3W1AA 1Q85A 3MDWA 3FA4A 2OU4A 3S5SA 5BRPA 4JYFA 3LG3A 4PUUA 4KERA 4M8UA 3IGSA 1XL9A 1E3XA 5K9XA 3WBAA 4AZ6A 3MVIA 2GOKA 3ES7A 4UTKA 2ZRXA 1TMHA 4A8NA 2WBKA 3LRMA 1EO5A 4X22A 3EYPA 1G94A 1XIHA 3FKKA 4AX7A 4C91A 5AKQA 1ICQA 4R7JA 1ALDA 1YXDA 1ZAHA 1QATA 2E1WA 1W3NA 2J7EA 2QDHA 3FKRA 1ADDA 2FVMA 3TKFA 5I07A 3OVQA 5CH9A 1H0IA 1P43A 2OWXA 4UR7A 1JQVA 3BL3A 3EWYA 1XGZA 1EJ7L 4MFDA 1X7IA 3TSDA 2R14A 4FF7A 3GTIA 4BQ2A 3ZJ6A 3UBPC 1RUSA 2NQ5A 5CQ1A 3LDVA 5G1MA 3QMRA 4Q4KA 1NP2A 1EJUC 2OLSA 2W3ZA 5FIPA 4WVXA 1YADA 1XS2A 3TOYA 3B40A 3GW3A 4P8WA 3K2GA 1YDNA 5BZAA 4E2VA 1AJ2A 3COTA 2WVUA 4ASTA 3AYSA 1KLZA 1MW1A 4LNYA 1SZNA 4JIIX 3T07A 1BYDA 3M0HA 3ABSA 2OT0A 1NFGA 1RK6A 4DM1A 4LRTA 2PPGA 3UGVA 1GZ1A 3ITXA 3SUVA 4EANA 5D03A 4J3UA 4QISA 4M1RA 4JKKA 3ZSSA 2V5LA 1CXHA 2R91A 4HN8A 2ZA3A 3K1DA 5LXEA 2V6AA 1R5YA 4DB7A 4AIOA 5T91A 4LS0A 3A9BA 5AC5A 1UOKA 3P0WA 1TWDA 4LUSA 3CIVA 4MAVA 1QNSA 3NOEA 2Q8XA 2Z1BA 3NZQA 2PLCA 1VRXA 2HE8A 1GW1A 4JTFA 1ISXA 4AIEA 5HWMA 3KEHA 3E0VA 3QY8A 5E0CA 4ZQCA 4P7NA 3EDEA 2NT1A 5G4WA 2WM0A 4K1WA 5A2AA 3PUEA 4TX6A 1JNDA 4B92A 4PN2A 2RKXA 3W7CA 3AWNA 3FJLA 3EEGA 2CIPA 2X1TA 3UWWA 3TVAA 4PTDA 3M6DA 3AIEA 3UP8A 1VHNA 2Y4SA 4YIWA 3PUGA 1OFBA 2QPUA 4JBRA 2E9MA 4ZR8A 3CPGA 3CEUA 4KCWA 2F6KA 4GBUA 2PTZA 1E6ZA 3NL2A 1RQBA 2CLLA 4M6PA 3STFA 3NSXA 1TV2A 3H7VA 3CV7A 5HNRA 5IBXA 1UD2A 3WLIA 5JBDA 4FMVA 1AK5A 2QZRA 2VMFA 3UG8A 6REQA 1PZ0A 3N2MA 3KRBA 1UP0A 4NAEA 1FH7A 1H09A 1QT1A 5ENLA 3W53A 2WM1A 2I9UA 1KRAC 2EAWA 3NDYA 3W7RA 4S3EA 1JZ3A 2CZFA 3HQ1A 3OEXA 2EO7A 4JICA 2VZSA 2PWHA 1RLDA 4DWSD 4WY0A 3XISA 1NEYA 3GU2A 3PG9A 3NZGA 1G69A 4C5YA 4A8RA 4G7EA 1QU4A 4Q6XA 3LX9A 3CUIA 2QR6A 4ATWA 4QJ1A 4N9DA 1XLMA 2C14A 4MGGA 4LAKA 2PDGA 4A22A 2NQHA 1W8GA 5HNTA 2E1DA 3V4BA 1N2VA 1UR9A 3QH2A 1KM5A 1NAL1 2UY4A 4YTQA 1Q6EA 1DJYA 2ZE0A 4DLMA 2FHBA 4O17A 2OGJA 2VWTA 3S5ZA 1K6AA 3DU0A 2XH4A 4QEEA 4NNCA 4G56A 4IQDA 3K8KA 4RZ4A 5FSDC 3PANA 4HMEA 1TRDA 3GVGA 5LSMA 2VGBA 3VC6A 2OSYA 4J27A 3O1NA 5ABFA 4ZOBA 2GL5A 4GH3A 1SJBA 3DHPA 3GWQA 2R6OA 4PUWA 4X63A 4O13A 3WNKA 4Q4MA 1KR1A 2OFJA 4B9ZA 3Q37A 3F03K 2P8CA 1MZHA 3NDZA 3ITLA 3NQGA 4LBRA 2A3AA 4HU4A 4E0CA 2GYIA 1VFLA 3SN1A 5AFDA 3KBWA 2KX9A 4AZ5A 3NOYA 1VFMA 4HZMA 1NWTA 3MKVA 3ARYA 4W9TA 3W6MA 4GE8A 3PNZA 2J6XA 4R9XA 3CTTA 1KFEA 1XHGA 4PE8A 3SRHA 4AWUA 3NYZA 4K1GA 1HP4A 3EBVA 1XRVA 4C6KA 2BG5A 2WZMA 3QV9A 4W89A 5ABEA 1KCZA 3WLOA 1GG0A 3FA3A 5F2LA 3U57A 3H2OA 4F2UA 1F05A 2YLAA 2SFPA 1WKYA 4MPQA 4GNKB 3S4TA 2PWGA 1F8MA 1OB0A 4E4FA 7PTDA 3ZVIA 3ARXA 1LL7A 2A85A 4WOZA 4MNLA 2Q09A 2HISA 3UWQA 1PWMA 3PZ9A 1V6YA 2VC6A 4Z1DA 1R85A 1JZ8A 3LPGA 2PZNA 3SCVA 1P5BA 3HIJA 2J7HA 1A0DA 3ZWSA 1OYCA 1FKXA 2QCHA 4ROPA 1C93A 3W24A 3J7HA 2XVLA 3CAVA 1Q63A 1HT6A 3W7NA 4BQ5A 3K30A 4P8UA 4W8LA 1X8FA 4GJIA 3HOJA 1AMYA 2FVLA 4QR6A 3TMQA 3VX1A 2QIIA 2PRHA 2DH2A 5K7JA 5C9ZA 3HJZA 3NQ8A 2OODA 3MJYA 1EHAA 3HPZA 2Q8LA 5EMJA 3P8IA 4NIRA 4XBKA 2PC4A 3INPA 5A69A 4HNOA 4CVUA 3EOEA 1X1NA 1NWUA 2QUNA 2EPKX 3SEPA 3UWUA 1UR0A 3WH9A 5FL0A 1Z41A 3L23A 4AU0A 1LWJA 4LOCA 5HOSA 2FIQA 2QJMA 1JGIA 4FR6A 1WX0A 1OF6A 1U33A 1TCMA 4H6RA 3TDFA 4MFEA 4IUGA 1QOXA 3S1UA 1DJHA 4Q4QA 4MJ4A 1BYCA 5F4SA 4UC5A 1QNPA 3G1HA 4IP5A 3MY9A 2YIHA 4HOZA 3UCCA 4ZQNA 2C16A 3V1PA 4WKFA 3BG5A 3OJGA 5H91A 1F61A 1FWFC 2X40A 2NX9A 4ZQMA 4UQBA 3TJIA 2FFCA 1KKOA 5T9BG 4DZ5A 1B31A 3GVVA 1UC5A 2PUZA 4OTKA 3LBOA 3UYCA 1YIXA 3CPUA 3E5PA 2X0HA 3O9NA 4WOQA 3WLQA 4NL1A 5EFDA 1DJXA 1K4GA 1XM3A 1CX9A 3ABQA 1QW7A 5DO8A 1R9YA 4JHZA 4J9JA 1VPYA 3L5LA 6REQB 1QXLA 2QQ6A 4NQ1A 3QW3A 3GR4A 3PBMA 4LUSB 1J10A 3KL5A 2WJFA 1LBFA 3PG8A 4CD6A 2PF8A 5AHIA 2XH2A 1JD7A 2JFEX 2J7FA 3W7PA 1F74A 3ZR6A 4HT3A 4C65A 4OKDA 2WNWA 3N6QA 3NPXA 3IJ8A 1SUXA 3QSTA 2ZTJA 1RCXB 4AWEA 3IWPA 1E1CA 4Z08A 4P61A 1IEIA 2I1OA 4J2PA 3TXVA 4QITA 4X9YA 2D69A 1HJUA 4KGJA 2REQB 4HN4A 3V35A 1I0BA 2DT3A 5BMXA 1Y5VA 1SGJA 1W5OA 3B0XA 3MHUA 1HJXA 4D8LA 2GOUA 3BPWA 2MANA 3HPAA 2FZBA 1G4PA 1EWDA 3QR1A 1IWPA 4IMAA 1JGMA 1WBHA 3U2CA 4Z0SA 3EDJA 2DQXA 5CPOA 5CPTA 3IJ9A 3KBMA 3W1RA 5D04C 3QJAA 3E74A 3CZ8A 4GCAA 1EP1A 3T0BA 4INFA 3HV8A 2X1UA 1BRLA 2GGIA 1UR3M 1UH2A 1K8XA 3BMWA 3ZR4A 1VJIA 4PGLA 1MQRA 2XVPA 3O8AA 3H2EA 2EG7A 1W1ZA 7XIMA 3QSRA 3IAPA 3JZUA 1KRCC 3GHRA 2NVAA 2EPLX 3BWWA 4NZ4A 4EK7A 3R0UA 4H04A 3V3WA 4LQ1A 2GPTA 1XIEA 5U4NA 7REQA 2XVGA 2VZOA 3WH8A 3KVLA 4Y90A 3W74A 1KQYA 4XTIA 1UPMB 3B9AA 1HKMA 3QV6A 4QAIA 4AEFA 2GSHA 3D3AA 5A94A 4KEUA 1RPKA 5BWAA 3VFLA 4ZTXA 2PI6A 3TR2A 5I3JA 1UR8A 2HV5A 4DXKA 3P80A 1H61A 1HVXA 2YJQA 4E8CA 1UB3A 2G0WA 1V6WA 5TIMA 4PULA 4H2HA 3MUXA 4W88A 2PTXA 3ZJ8A 4IGHA 2PODA 4AVNA 3WMLA 5I3KA 2Z4GA 1WUEA 4O10A 1XD1A 3IVTA 4Y6GA 3RCNA 1P0BA 2YCJA 3LOTA 3M41A 2PS2A 3G2GA 1C8VA 3ZIZA 2JF6A 5CC6A 2HDJA 4JQ3A 3T81A 3T1GA 4JX4A 2FKPA 4Y8EA 4RNJA 1O4UA 2BP1A 4LJ3A 1C9DA 4HCDA 3G1AA 3QV7A 4M19A 3FIGA 4R3UA 3POHA 4GWEA 1J0HA 1ELSA 4IMDA 2VQTA 2X2YA 4KEVA 4CQ8A 1EOMA 3IJLA 4LYPA 1EA0A 3TSBA 2RHGA 5HXMA 2TMDA 4QDPA 2VGFA 2PE4A 3OO2A 1JCNA 1VFUA 3TN6A 3W87A 1K6WA 1OT2A 2VX5A 3AO0A 4DX3A 3M43A 3WK3A 1XQLA 1X96A 3N3MA 5HQEA 3ZM8A 1PBGA 3ARQA 4H8UA 1MEHA 3EWDA 1TELA 5LHEA 2XFYA 1A5NC 1W17A 5AC8A 1UWRA 3F4CA 4S3JA 3QRHA 5DXYA 3T2OA 3L4UA 4GY0A 3PP7A 1QW9A 3ABOA 4GFIA 3A13A 2OB3A 1T41A 2Q8ZA 3S42A 1IQ8A 2CHNA 4L7ZA 3PUOA 4UTMA 2RDTA 2REQA 1UIPA 3C2FA 4GXPA 2WVSA 3VDGA 3CZEA 3HU7A 1VAHA 5HBFA 4E4UA 1OFAA 1XPGA 4TVUA 4HU3A 1ME7A 4RE0A 4CQAA 1CPUA 1SQ7A 1UYQA 2QCGA 1TUFA 2B7OA 4KWVA 3R94A 1V7AA 2IQTA 1Y8BA 4YTTA 1ZBVA 3KCJA 3VMPA 5EYWA 4M82A 1Z6KA 7TAAA 2EJ1A 3GDTA 2Y5JA 4RK8A 4AXKA 3DFHA 1TB3A 4UQ9A 2UY5A 4C1KA 1FKWA 1RBLA 5BOFA 1F73A 3EWCA 5C9UA 1QPOA 1QI2A 2J8GA 3TYUA 3H24A 4RJEA 1EC8A 1XGEA 1O7AA 1TIMA 4GG9A 1V3IA 3DI0A 4HTYA 4AYSA 1UWSA 1UBSA 2WMHA 4KH2A 3AIRA 1H5VA 4A3RA 4NNAA 2FFIA 3VOCA 3UJRA 1RP9A 3G6MA 3LI0A 1GJUA 4IIFA 5LXXA 1V6XA 1JUEA 4UNLA 2HZGA 5BXTA 1R87A 4Q4PA 2V30A 4GOAA 4LFYA 3QZ6A 1DXEA 3F5KA 2VC9A 1XG4A 4UZUA 3LZ5A 3SR7A 3HV9A 4KFNA 2GDVA 2YCKX 1A4MA 2PLJA 4ZOCA 4QE5A 4DPQA 2IMRA 2V5KA 3TONA 2CLPA 4WQ6A 2WK2A 1NH6A 3WDQA 4DVOA 5C9RA 2ZUUA 2NVCA 3THCA 2HVMA 2PDNA 1S2WA 4UFMA 4O19A 3W84A 2B7NA 1FFRA 4HPXA 3MTWA 1ZAJA 4EX4A 4J7RA 1JPHA 2A6NA 4R7OA 2OLAA 4MNKA 2PAJA 2YCLA 4M24A 5CLWA 2AQOA 2YDRA 5FJRA 1CGXA 3DHDA 3FJ4A 5LYRA 4E38A 3ARTA 2NSOA 2YBUA 2CLIA 2Y6ZA 1L8PA 3BLEA 4GGHA 3ALFA 4DO5A 5DBTA 3T6CA 1XIIA 2DZUA 1OFOA 2KAUC 5PTDA 3AHVA 5BOOA 4Z2LA 3L4XA 1DOSA 3WQFA 1GVYA 3AAMA 3GNXA 3B0YA 1WKFA 1EIXA 4V27A 4Q22A 3OLDA 2PBGA 4B5NA 1L9WA 2AQVA 1ITCA 3WUFA 2FJKA 1B2YA 4AD0A 3BCFA 3AALA 4JD4A 4DO6A 5M17A 1XUZA 3P62A 3K5XA 1LWHA 1OIFA 3BUVA 2C71A 2D2JA 3PBVA 3UXDA 2DPEA 3IJ7A 1XH1A 4H19A 4PTWA 1WDSA 2XIOA 3CQ0A 5HDRA 4XZNX 2PB1A 4UUIA 8A3HA 3EWZA 2NT0A 1J0JA 5A1AA 3V5CA 1TZ7A 5AYXA 3DC0A 4JTTA 2DVXA 2OZ8A 3F7JA 1FDYA 4ZODA 2VZVA 1G7UA 5K9CA 1MW3A 3PHAA 3RIKA 1VB9A 3A4AA 4N9EA 3IVUA 1DIOA 1KGXA 3PAOA 3MA8A 3H23A 4XUGA 2J9XA 1H7OA 4C6NA 1TPDA 3WQDA 3PZTA 1F5ZA 3C8FA 4L4MA 2XSXA 2DZAA 2E40A 5JVLA 3UWEA 1PVNA 4W7VA 3VMOA 2ATSA 4BF9A 3FJNA 2BDQA 2AAMA 2ACQA 2XVNA 3JVAA 3SI9A 4REQA 1ZAIA 1Z7AA 1QHOA 2CC0A 4LUJA 4O1AA 5AC7A 2CZVA 4LS2A 1R47A 2W79A 3GTXA 2E7FA 5D37A 1G7VA 3WEZA 2POTA 2XFWA 3EWXA 3W7DA 2C1GA 4Z2GA 1CW2A 1WXJA 1OX6A 2PMQA 3GSMA 1HUVA 3DBNA 5JIPA 1EH9A 3WLRA 4HD5A 4FB7A 2NX3A 5I00A 4JTDA 4MWAE 5KZDA 3UT0A 2GWGA 4JFTA 1J12A 1U30A 2DZVA 3B9DA 4M80A 2OYKA 1I2QA 1VIWA 4CD5A 3KRZA 1VJZA 4MNJA 5F2GA 4EACA 2I5QA 4HNNA 2VR5A 1LL6A 3BCJA 3QLLA 2ZTKA 4AC7C 2YDSA 3GDKA 3OLIA 3RU6A 2ZWYA 2WC3A 3HA1A 3CL8A 3SCWA 4BI6A 1PYMA 1Z44A 5D4YA 2W66A 4TMBA 2E25A 3EA1A 5J04A 2CW6A 1YXCA 3VTRA 2D24A 1KKRA 4B5WA 2V3GA 2H3BA 4O52A 4FNPA 1PO9A 5E9AA 4Q8OA 1OFRA 1E4IA 1TUXA 1WZLA 5K4XA 4R5EA 2WB5A 2G5WA 4MKSA 4A3UA 3FOKA 3CNYA 5CJ5A 3VDAA 5FAJA 3QHNA 3BVJA 4DWSC 1Q6CA 1QNOA 1KM6A 1BGGA 2W9MA 2DT0A 1JJKA 2ZX7A 2VX6A 4C6LA 1FWAC 1IEVA 4YTRA 5A6BD 4GHRA 4Z0JA 3KTSA 4EAMA 4K38A 2NQLA 3PZGA 5C71A 5CPQA 5E6YA 1IF2A 3N6JA 1C8XA 2QLYA 3W1PA 3B9NA 3T2QA 2V67A 1UD4A 1QDSA 4CN4A 2ISFA 3G22A 2XGZA 4UXDA 1HJSA 3SJ3A 4ZQRA 4O28A 3UPWA 4MDOA 3S6OA 5DT5A 4RX0A 4GI9A 4GQGA 3B8VA 1XR2A 3FAXA 2VEMA 3NAVA 2BHYA 1YBQB 2X42A 1XC4A 2IKHA 1E73M 1XLGA 4MG4A 4ZSTA 5CGTA 2JKPA 3S2JA 3ONBA 2OT1A 1JYWA 3BC9A 4QHRA 1AA1B 3TYBA 2PDHA 5A6JA 1FX6A 4YLWA 4FNSA 1EXBA 4GH1A 1PZ2A 4JXCA 5C70A 5CG0A 1YTKA 4L9ZA 2FDSA 4LCSA 2QPSA 4GGBA 1SW0A 5F7UA 4F40A 4BQ4A 4KCTA 5D9MA 1E6PA 3NZRA 1X7FA 3ARWA 5H2ZA 1PTDA 3NA8A 3VGFA 1JAKA 4ZA0A 1Y65A 1Z8AA 2JIWA 3MMUA 2ZZ2A 1B1YA 1PPIA 2E28A 1HNYA 4M51A 5A8OA 3ORWA 3BOLA 2BX7A 3M0VA 2FZ8A 1UZ4A 3HZ3A 3MCMA 3SGGA 1BKSA 4Q8MA 2BOFX 2Y2WA 3IUHA 2PFHA 3U2EA 3GRIA 2R1LA 3W7IA 1TPEA 4IQLA 3CEPA 1UD8A 1TTIA 4WR3A 1W9BM 1XBZA 3MWCA 2CXGA 3G1SA 3GXFA 4YHGA 5IFTA 4JTQA 4EF8A 1MFVA 4A3QA 5D2WA 3IJDA 2J7BA 1REQB 4RZBA 3VGHA 3GB6A 1FXQA 4PTVA 1VP5A 3TA6A 1TX0A 5D30A 4H9VA 5CPSA 3GNOA 3WBXA 1WDWA 3WSUA 3WLLA 1L6WA 3REQA 1A0EA 4RKAA 4JY8A 2IKJA 4XQ6A 4Q7IA 1QNRA 2NUWA 3LY0A 1ZJAA 2VUNA 3H4GA 3QFEA 4H7VA 1TKKA 4K8EA 3Q67A 1GZJA 1T8XA 2IPGA 4B2DA 4IG2B 1DXIA 1E72M 1R9XA 4EPBC 1JF5A 5BYWA 3W76A 1GHRA 4O1FA 1UIOA 4IICA 1XXXA 5IOBA 2Z0IA 1LUCB 3GM8A 3G1YA 4KRTA 1OT1A 2IS7A 4DPPA 1OEPA 3WQOA 3OW1A 1VFOA 3ZVHB 3T0DA 3EWUA 5HATA 1CXLA 1DXFA 1O1HA 1E40A 3N12A 3ITYA 3QTGA 4YVPA 1XLLA 3WQWA 4FF5A 3VIMA 1OCNA 1GQNA 1UUOA 5LNRA 1CENA 2QDGA 3MHGA 4I8YA 5LKYA 3MCNA 5I3FA 4DO4A 5A6KA 1ZSXA 2PURA 1M01A 1S1PA 3FK4A 3ZMRA 2GK1A 5JH1A 1KXQA 5LNSA 3OIHA 2X7VA 3RO6A 1QPRA 4JCMA 2ANUA 3SECA 1E0XA 1L6FA 1E0WA 3UWZA 3W29A 2PZ0A 1DJGA 4BFAA 1AJZA 3EX1A 3F2BA 4DF1A 2QVNA 3Q58A 3EZ4A 4MUPA 3AXKA 2OG9A 3U8GA 3URQA 2FJUB 2XU2A 4WLCA 3BJFA 4AY1A 2P1FA 2J7GA 2VR4A 1NARA 3MUCA 5G1YA 2AMGA 4MHBA 5GPRA 4FNRA 1IT8A 1F6YA 4IFKB 3TN3A 4RL3A 1KFLA 2ZUWA 4CQBA 3BLFA 1EL3A 1EZ2A 2V2HA 4FSAA 2P3ZA 5M5DA 1UA3A 3PVFA 3LCHA 4DF0A 5EL1A 3GKAA 1QFEA 3EOOA 4NSBA 1RXOB 1PX4A 5D38A 3GUGA 2ZIDA 2O56A 1K4HA 1TR1A 4H83A 1F4HA 3FAWA 3OIXA 2CBUA 1HKWA 2OO6A 2NWSA 1CLVA 4S3CA 4F79A 1AQHA 3SUWA 2OJPA 1XIJA 4D6CA 1X98A 1JUKA 3GVQA 3W28A 1J0IA 4H8NA 1KM2A 1EDTA 4R53A 1JVNA 2GDQA 3XIMA 1F3TA 2DDXA 4WJ8A 4AUBA 3A6OA 1B9ZA 2YL8A 1NDYA 1WZKA 2HBXA 2RDWA 1KFWA 3B9EA 1NVMA 2BVWA 1V0KA 2Y1HA 4GQBA 4NJHA 3QGVA 4LCQA 3QHOA 3M0XA 5CZKA 2V2DA 1VCGA 2HXTA 2CERA 2VR2A 3KLKA 3RM9A 3GHSA 3BLIA 4FNUA 3RG6A 3LCXA 1DIDA 2UWFA 1US2A 4WRHA 4Z1AA 3HB9A 4HPJA 3SUTA 1VYPX 2QF8A 4IF2A 1R6WA 2Y62A 1MNZA 3OLGA 3ME3A 1HIZA 1VFTA 1WOBA 1YLVA 5J5RA 1K77A 4FEZA 3KS5A 1R0MA 2NLYA 5IRPA 1W3LA 2BMBA 3P82A 4MY9A 1EBGA 5K2ZA 4MSSA 4YU1A 4KMQA 4XB3A 1P1MA 2EKCA 4X0VA 3U4AA 2QMJA 1RJRA 3NO3A 2BZNA 3HQNA 1A53A 1NU5A 3WDRA 2ATMA 3AJXA 5IDIA 4ACZA 4W85A 4HPNA 3WZ0E 5C2CA 2D1ZA 1HQTA 1UW9A 4C6IA 5BXPA 4M6VA 5EKYA 1W3HA 2B31A 3FDGA 2VL4A 3DZ1A 3GG8A 4Z2KA 4B2DD 3GAYA 5BXSA 2RGLA 3EWBX 1KXHA 4PMUA 5EU9A 2O4QA 3W7QA 5D9PA 1CBGA 1PV8A 1MQQA 3VOJA 4Z2IA 5AVNA