3I7QA

Dihydrodipicolinate synthase mutant - k161a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 109
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7qA00
4CNOA 4O1DA 1FDZA 1VQTA 3C2FA 2X1SA 3M16A 3W2UA 1M7OA 3MP3A 3PG9A 1NAL1 1RVGA 2YFNA 4K37A 3G3MA 2ZZ4A 2V81A 3M6YA 2PURA 3PBUA 3LV6A 4ZQMA 2EPHA 4UTJA 3GDMA 2CFFA 1GVFA 3NPWA 4EF9A 2CLMA 5BRBA 4JTGA 3W1UA 4Z08A 3MO7A 4FNQA 2NZLA 4FIRA 3T40A 1SO5A 3IIOA 1P5BA 3DAQA 2PRLA 3LB0A 1KFJA 3DFNA 1PHQA 4O0ZA 1KFKA 1SUXA 2CLOA 1OFBA 1IF2A 4UC5A 4PFMA 2A85A 4IOTA 4D2JA 3PB0A 2NX1A 2VENA 2HS6A 5F1UA 5AYXA 3IVTA 1TJPA 1G4TA 1KFEA 2ZRWA 3HGSA 4L4MA 5E0KA 1DQXA 4JY8A 4O57A 5E1QA 4XTDA 3QRHA 3NQVA 5HR6A 1W3TA 3LCWA 3QPZA 1XBVA 2YXGA 5I3KA 4IUOA 4NZFA 3LTYA 3P67A 1AW2A 3W73A 3M5YA 5H91A 5DXXA 3IGUA 2YYTA 4N9BA 4K8EA 3ABOA 1TPDA 3S1XA 3YPIA 1Q6LA 5AHMA 3VCRA 2WQPA 1M6JA 4BWLC 1VYPX 1SR9A 5LNRA 5K4XA 3LXAA 3QEZA 2P0OA 1PE1A 2Y61A 3DENA 1FCUA 3W76A 1NFBA 4MZYA 5EPDA 4LVDA 4EF8A 3H54A 1Z42A 1KV5A 2BSLA 4ALDA 2X1UA 4M7TA 2RDTA 3GYEA 4UTWC 3FFSA 4Y6GA 4IGHA 3HG2A 1EUAA 3Q37A 5SWUA 1TREA 5AFDA 4W9TA 3E12A 3W1TA 1DJQA 4NXSA 3Q2DA 4O14A 3I7SA 1OABA 3DKLA 2PE4A 1R47A 1PCKA 5AHEA 3DFOA 3STFA 4ADTA 3LHWA 4WZHA 3WJWA 2JGYA 2YW3A 3W72A 3FLUA 1MXSA 4GXMA 4YMZA 1EIXA 3LCGA 3KVJA 4Z1CA 3TC7A 2QCFA 2ZZ6A 1MZHA 2BX7A 3FKKA 1TPH1 2ZFAA 3GR8A 1ZY9A 5HWMA 4OU1A 3A5VA 2CU0A 1YXYA 5GVJA 3UYCA 3ZS4A 2WSYA 3G1VA 1TTPA 1HO4A 3VFLA 3EX2A 3P62A 2QJIA 4GRSA 1VCVA 4IWWA 2C0AA 1ZAHA 4LS2A 2Q8LA 2A7RA 2NWSA 3T7VA 4WJEA 3CT7A 5D2XA 2H3BA 1IXPA 1DVJA 3SGZA 4MIMA 3HIJA 3TW6A 1K03A 3PG8A 4N02A 4FNUA 4RXFA 4E2DA 3A5FA 2ZRYA 1ALDA 3NQFA 3KVLA 4UTWA 1BEUA 1SSGA 1XBXA 1P0NA 1XUUA 1N7KA 2YCEA 3FYOA 3CC1A 1H51A 5LSMA 2YPIA 1MEIA 2QUUA 1L9WA 5U4NA 3KAOA 3M5VA 4XKYA 1JUEA 1ZNNA 3RLUA 3KRSA 3KXQA 1NSJA 5AOUA 4C1KA 3C8FA 3PS7A 1KV8A 1U83A 1TMHA 3OEXA 3R89A 2CLKA 4N9CA 1SO3A 3TR2A 4UFJA 4HT3A 2JKEA 4BI6A 2EF9A 3OA3A 2VKZG 4YL2A 2P10A 2Z1BA 2OJPA 2YGYA 2DZTA 1QPQA 2F84A 4PA8A 3UPWA 2WKJA 3DXIA 4NNAA 4RXGA 1GVRA 3L68A 4UFLA 1TPUA 5F2MA 1WDWA 1SZFA 1EX5A 1FWSA 3THQA 4AHOA 3HGJA 6TIMA 1KW1A 5C54A 3MI6A 3NR0A 1B9BA 1W54A 4AHPA 3DFSA 3EWXA 1G4SA 2NUXA 1Q3NA 5FF0A 1XCFA 1PV8A 4JGDA 4IX0A 4LS1A 5ABTA 3VE7A 3CEPA 1L6SA 1JCJA 4LC6A 3SW6A 5U7SA 1TTIA 4ONVA 1OF8A 1YDVA 3EKZA 5BOOA 3EWUA 4Q4KA 1RPXA 1ZHAA 2XN2A 2TYSA 2HS8A 3RNDA 2NX3A 1QPNA 4EWND 4M19A 1TTQA 1KTNA 2CLFA 2DU2A 4QITA 2ZZ1A 3CIXA 3L66A 3LM7A 1GYNA 3C0JA 3W75A 4JNMA 1WBJA 4LY8A 3GAKA 1EWDA 4FNRA 3PF3A 5I3IA 2E1DA 4UCGA 5HNRA 4JDYA 5D32A 1TCDA 4QM1A 3G0XA 3SECA 3TAOA 3GKAA 1W5NA 2E5BA 3AO0A 4PL2A 4UNLA 3N34A 4H3DA 4N6FA 5CSRA 1ZFJA 4GUHA 3CWNA 4MJZA 1PVNA 3CHVA 1JQXA 5HWNA 1LDCA 3EX4A 3O05A 5AYZA 1Z48A 4MKNA 3W7LA 1IXNA 1VCGA 2Y89A 5CZJA 5EBUA 4A2SA 3P5ZA 3WK3A 2DJLA 1VLWA 1ADOA 1HFBA 4MLJA 1JCNA 3CB8A 4JX4A 4DO6A 1W5MA 2G96A 2VFHA 4O16A 2V2HA 4IMDA 1D3HA 2J24A 2ZRZA 3PBWA 4Y8FA 3T4CA 1AW5A 4FHAA 1ICPA 3L9CA 1XC4A 3LI0A 3P80A 3LV5A 4WXZA 4O54A 3PBVA 3DFPA 4TX9A 5CPLA 2W79A 2EHHA 1UB3A 2ABBA 3W7EA 3SJ3A 1H1ZA 1RZMA 4JYEA 1XDLA 1OYCA 1XI3A 1DHPA 4KKXA 4JTTA 4JICA 2Z2UA 3DHDA 1UASA 3ANYA 2VFGA 3PAJA 2RDUA 2J9YA 1FWWA 3MBFA 2WNZA 2Y70A 4M6QA 3M43A 4OE7A 4BK9A 3QMRA 1C29A 1IXQA 1ZALA 4HPJA 3QQ0A 2JGQA 3R5EA 3R2GA 3LCFA 5D05A 4IMGA 2FLIA 3TSDA 3C56A 1PIIA 5KZEA 2CWNA 4TO8A 1DBTA 2FB3A 3G1SA 3ZR4A 3PVFA 1ICSA 1G7UA 4FIQA 3NPUA 1XL9A 1F6KA 4K7YA 4NX0A 2YX0A 1GVSA 3KVMA 3H53A 1VS1A 2DZSA 4JXCA 3MI2A 1GYLA 4NT0A 2WV8A 4HNNA 3V75A 4NZJA 3S5ZA 2DJXA 3LXCA 1F76A 1O60A 1X6UA 3C2RA 3QYQA 1MEHA 4NQ1A 2RKXA 3DBPA 3OBKA 1A5BA 2ISSA 3R8RA 3B03A 3EKLA 1RR2A 1GTHA 4TR9A 4BF9A 4UFMA 1I2RA 3QFEA 3B06A 4ZMGA 1HL2A 3W74A 2GQAA 3ATYA 3PUEA 2E68A 4ZZ9A 3PUOA 2H90A 4O17A 4H6KA 1LOSA 2V30A 4MPQA 1QAPA 1Q6OA 2CZEA 4I7UA 3P81A 2BZNA 3M47A 3W2LA 3CQ0A 3NXFA 4LU0A 4K38A 4WY0B 3M44A 3C2EA 2R14A 4HSOA 4AHQA 3N14A 3NQ2A 2UV8G 1J2WA 4RX0A 1B4EA 3W7GA 1SZNA 1F73A 3S9YA 1H5YA 3VI2A 3TXVA 2H3DA 5A5WA 3W7MA 2CW6A 3E9AA 1FDJA 3PSVA 4ZQRA 2Q3OA 3ABQA 1I2OA 1LRNA 4QAIA 3S1UA 1GVQA 2QKFA 2VFIA 2A7PA 2GPTA 4DXVA 1VGAA 2QJHA 3RMJA 3MW7A 5IBXC 3BGGA 4O15A 1AL8A 2NLIA 1IXOA 1JCLA 1H7XA 5AC6A 1R2TA 3NYZA 2ZA3A 3TJLA 4Z0SA 3HBLA 4MY9A 2VFFA 3T55A 3FS2A 4NVTA 3HGOA 2GJLA 1FXQA 4LVBA 3HO8A 2JKAA 2ABAA 5LGZA 4K36A 1O95A 4UMAA 1JUBA 2FB2A 3P84A 2QR6A 2X1TA 2WSQA 2X16A 3C2VA 1L2UA 3TV8A 2E5DA 3G0SA 1VC4A 3TQ0A 4I9AA 4JTJA 4OGZA 2E6YA 3KVKA 4AMAA 3UXAA 4LUJA 3I7RA 1AG1O 3LCXA 4JTEA 3WFAA 3QC3A 4E38A 1DORA 2VEPA 3EWYA 2Q3RA 5K7JA 2VOMA 3W2NA 1OYBA 3C6CA 4ADSA 3W1LA 2ZCGA 2PC4A 3IVUA 4IMEA 1VHNA 3SGUA 5J5DA 1OJXA 4KFNA 7TIMA 5LNVA 2A6LA 4JTLA 4O52A 3LHZA 4U4MA 3MHGA 3NQDA 5F2GA 3R13A 4QNWA 5F2IA 5IBXA 5I3FA 3PB2A 2ALDA 2GJNA 2GVGA 4GE8A 4WOQA 5LZLA 2ZZ5A 1VHCA 4ZQPA 3T44A 5K9DA 1SFLA 2YFOA 4N4QA 3W1PA 2X1RA 1LOLA 5C55A 3SIZA 1LP6A 3TA6A 3O07A 2C1HA 1TRIA 4U28A 3G0UA 3TQKA 3L5MA 5D2TA 5EYWA 4KWWA 4BFAA 2RHGA 4FX6M 3W2MA 3L0KA 4LW7A 1YPIA 2Y7FA 1Z44A 3E49A 4AF0B 3PR2A 4UMBA 5I3JA 2J6XA 3M5ZA 3TNOA 5H2ZA 3LDVA 5KMYA 1BWKA 1G69A 1R2RA 3S5OA 3BLFA 3FJLA 3LXBA 3G1FA 3W07A 1OX6A 1OFQA 5FEWA 3U6WA 2WJZA 4IJBA 2NXHA 3L67A 3EB2A 2PCQA 1OFRA 3K30A 4XWUA 4RK8A 4ZL1A 3BK0A 4O10A 3TJXA 3W2JA 1FY6A 4MLRA 4PEKA 4FO4A 4GFSA 2VELA 1SU5A 4ZQNA 1YDNA 3MJYA 4CNNA 1SW0A 4PTNA 5TBOA 2BLEA 2CLEA 2GQ9A 4X2RA 3A23A 3NPVA 4E2BA 3NQAA 3UWWA 4JTKA 2ZQ0A 4R53A 4NNCA 2GVJA 2ZZ3A 2VEKA 4TMBA 1K7EA 2TPSA 1OX4B 1GPWA 2Y62A 3G3DA 5DCEA 5TIMA 1HO1A 3JR2A 4WY0A 1G4PA 5G2IA 3BV4A 3B0VC 1F05A 4NX5A 4RJEA 1QOPA 1S3HA 2C18A 1W5OA 2WOQA 4N6EA 3TMQA 1Q45A 3MUXA 2W0UA 2JBMA 3UY7A 3R12A 1KM1A 2V9DA 3W86A 8TIMA 2W6RA 4GUIA 3CU2A 3W7JA 1J5TA 4DPQA 4UXDA 3LERA 1G7VA 3G24A 3MP5A 4M6VA 3F4NA 4IMFA 2YW4A 2V82A 1KLYA 1LLWA 3U2OA 1OFAA 4JIPA 1UJPA 3NOEA 2NXIA 5D33A 4NJJA 4WD0A 2RFGA 4O11A 5LNUA 4NJGA 2IQTA 3EX6A 2GQ8A 1OG0A 1QFEA 4IPIA 1K8YA 3S6DA 4MVAA 3UWQA 2ISVA 2I14A 1PL9A 4JYFA 2E6DA 1DL3A 1T96A 3TROA 2HTMA 3O6DA 2A0NA 4PC8A 4UFKA 4C1LA 4B5NA 3L2IA 1H62A 2C19A 2VC6A 4ORMA 3BLIA 1EP1A 4GUJA 3W22A 1WXJA 4LT9A 1M5WA 4WY0F 3IIXA 4YXGA 3BPWA 3W7HA 5K3VA 3Q94A 5D04C 5KINA 4JDBA 1P1XA 1NF7A 5DBTA 4X22A 3W85A 3M1ZA 3WJSA 1F7BA 3GXNA 4LVFA 3NQCA 3PC0A 2DZUA 4JD4A 1IGSA 3N9SA 3BARA 5CGQA 3O1NA 2JK2A 1WV2A 3B0PA 1D9EA 5C6MA 5I3GA 5D38A 4I7WA 3TCEA 1TSIA 1FCQA 1H61A 5LKYA 1GG0A 4K8HA 4XZ9A 3M9YA 1UUMA 3HMJG 3ZWSA 1KFBA 1O94A 1FWNA 5D03A 2GVLA 4FXRA 4RZ6A 1S5WA 2CZFA 3W7PA 3P8JA 4IQLA 3SI9A 1JR1A 3S1VA 4G1KA 3IEBA 4L4LA 4FF7A 3KRUA 4K6AA 4AF0A 1GZGA 1YXCA 1TIMA 2C15A 3NNTA 2J88A 1OFOA 4J9JA 3E0IA 3B05A 2DZPA 5BMWA 4YWIA 3M41A 2TSYA 1F6PA 3TK7A 2GOUA 1QNVA 2NUYA 1KM6A 1PCWA 4UTMA 2C6QA 3W23A 3EWWA 1JULA 4JTSA 1AW1A 3QM3A 4CQAA 4AH7A 1WX0A 3IGXA 3IIPA 4HHPA 1O5KA 1SW7A 1UCWA 1FDYA 5AHLA 5CG7A 4M5PA 5D2VA 4OV4A 3G1YA 1BKSA 2CLHA 1XKYA 2B7QA 3QSRA 1XFBA 1NEYA 1X1OA 3LHYA 1GJPA 3L0NA 4JX6A 4X3ZA 4MYAA 5TQLA 1OVDA 3IIZA 1VCFA 4WX2A 6ALDA 2I1OA 4TMCA 3MBDA 4IXXA 1OX4A 4HKPA 4UTHA 1ME7A 5HUPA 1DQWA 2OMAA 1ME8A 4LV4A 4UR8A 1YTEA 1A53A 4A21A 4QSHA 4GNJA 3NL5A 1J4EA 4Z1BA 2QDGA 4LWWA 3IRDA 3N19B 1T8XA 3THAA 1ZENA 4MY1A 3P60A 5FESA 1TV5A 2J9ZA 1OF6A 3W1QA 3TXZA 2RH9A 4AB4A 1LZOA 4FNPA 3M0ZA 1L6WA 4MFDA 3DZ1A 2Z6JA 1DV7A 1JVNA 1W0MA 3DU0A 5G4EA 1FX6A 1GTEA 3LCHA 1MEWA 3G22A 5DY3A 3TC6A 1QCWA 3W6YA 3L0GA 3QMTA 4XBKA 5DBUA 3NVTA 4MYXA 3W3OA 1T0OA 2R8WA 5HWJA 1TRDA 4DF2A 3TAKA 5CKSA 3G1AA 5E93A 1G67A 4UTKA 5HULA 1CI1A 5LNSA 3TUUA 3B8DA 3N3MA 4O19A 1JRBA 4OWGA 3S8HA 2XN0A 2ZRVA 5LGXA 1H7OA 2ZZ2A 5F1VA 4YLWA 3NQ6A 2QCHA 1I4NA 3SFKA 2ZZ7A 1TYGA 3LCLA 4UTLA 1DJNA 4QNEA 1QDSA 4GC4A 4DF0A 1PS9A 3UZ5A 2Y6ZA 1HG3A 4BI7A 4KWVA 3ABRA 4QQ3A 5KITA 4POCA 1HUVA 2OT0A 3I68A 4PODA 3QW3A 2BXVA 4ORIA 2NUWA 1VRDA 4FX8A 3IV3A 4CCDA 3TU9A 3DI1A 3EXRA 3CEUA 4O13A 4IPJA 3GKFA 1EPXA 2R91A 1JCMP 1W3IA 1P0KA 2YDAA 4UTTA 3NL6A 4RZ5A 2A7NA 4MZ8A 3S5NA 4GUGA 5F4SA 1F74A 4JR5A 1LOQA 1EB3A 5EMUA 4HIBA 2CZDA 1H1YA 4UIOA 3S5YA 1V5XA 3LI1A 5CPNA 3KRZA 4MY8A 2QEZA 5G4WA 2E6AA 3KOFA 4GJ1A 1XXXA 2AAMA 3STCA 1MSSA 3NQ8A 3W7OA 4JX5A 1I2QA 3M7WA 3EX3A 5F4WA 1BTMA 3W87A 5C5YA 3VNDA 2DP3A 3SY5A 3UWZA 3UWVA 2X30A 3CLMA 1I8JA 4O4WA 2CZ5A 1LBLA 5KZMA 4UUIA 5D2WA 1XUZA 5G5IA 1CX9A 3A22A 3SR7A 1TJRA 2QJGA 4DBEA 3RLVA 4RLIA 1KBIA 3DHFA 3LTSA 1YTDA 1ZAJA 3DI0A 3LTPA 2HMCA 1I45A 2HSAA 4UTUA 2QCLA 3E02A 3MP4A 2EKCA 4O1AA 2J27A 4A3UA 1KLZA 3P8IA 2G97A 3N2MA 1I2PA 4S1FA 1ZCOA 1MO0A 2A1YA 4JEQA 1QOQA 5AYYA 2V2CA 3GAYA 4LRTA 3INPA 5HMSA 3FIGA 3W7NA 1OYAA 5D02A 3PSWA 4AXKA 1H7PA 1IIGA 2WSRA 2QUVA 3V1PA 4MFEA 3OG3A 5K4ZA 4XUGA 2E77A 2WNNA 4M7SA 1QR7A 3NQEA 3OVQA 3QSTA 3QW4B 3A9IA 3HPZA 3EX1A 3JRKA 3NG3A 1U5JA 1GQNA 1SFJA 3DGRA 4N9DA 2G95A 1O5XA 1QO5A 1RQEA 4R7JA 2VXNA 4QJ1A 1RQHA 3PBYA 4XTIA 1YLVA 5K9XA 2B7NA 4AVFA 4O4VA 3EWZA 5G2WA 1YTKA 1K7FA 2CLLA 3NAVA 3TKFA 3UPBA 3W70A 3GZ3A 1B4KA 2Q8ZA 3UZJA 1H7WA 3FEMA 3FJ6A 4WXYA 3LRKA 4YCOA 4WQ6A 5FF7A 2JKPA 5D09A 1L6YA 4UR7A 4P2VA 1JUKA 1PHWA 1SO6A 4NXKA 3IVSA 1TPVA 3QF0A 2TRSA 2WPBA 3B04A 3NM1A 5D30A 3W7IA 1W56A 5DY2A 3RFAA 1KM3A 2NX9A 1VLIA 3ZWTA 2KZHA 4O1BA 5K2ZA 4OBTA 2VEMA 4RR4A 4DO5A 4CNPA 3SZ8A 1TO3A 3TE9A 3UWUA 4GUFA 4LNYA 3TMLA 1N8FA 1CW2A 4LV9A 4O53A 1RQBA 1B3OA 3O16A 1K8XA 5DELA 3O63A 4PH6A 4AWUA 2B4GA 3C4UA 4WUIA 1R46A 3LBCA 5HQEA 4XKYB 2FFCA 5CZTA 3STEA 1VJIA 1X1ZA 3O6YX 4Q32A 3LLDA 4DF1A 3RK8A 1GOXA 2EAWA 1A5CA 1WYIA 3TIMA 1S5VA 5DLCA 3TQVA 4JIQA 3P61A 5D2YA 3LHUA 3BG3A 4JTIA 3HOJA 1W1ZA 2TMDA 2BWGA 2X2GA 3OHIA 4AEOA 4Z1AA 3NGJA 1P4CA 2R94A 3U8GA 2A21A 4EOUA 3MHUA 3DFQA 2C16A 4O8RA 3KFTA 2ZDRA 2FDSA 1TV7A 1KM5A 3UXDA 1WBHA 3O6CA 1QWGA 2FPVA 2QF7A 3W7DA 3ZFHA 1KA9F 2Y88A 3G1XA 4HSNA 5CZ0A 4IXHA 2C13A 2E09A 2LLEA 1WQ5A 1E51A 1TPFA 3QQ1A 4CCCA 4GWEA 1OFEA 3QPYA 2ZRXA 3CWOX 4Q33A 1KBJA 3T78A 5EL1A 1LYXA 3L5LA 2Y7EA 4HNVA 2QUTA 1TPWA 1LM1A 1DOSA 3LOTA 4ZVJA 5L6UA 4E0CA 2E6FA 2P1FA 3DKJA 1JCYA 4EVZA 3O06A 2QCNA 1FBAA 5DCBA 3W84A 1ZAIA 1TQJA 3LLFA 1GVOA 4O50A 3GDTA 4Y9AA 3OIXA 3GB6A 3USBA 2H8ZA 1THFD 4XBSA 3BG5A 3NDOA 4BI5A 1H7NA 5I3HA 2E5CA 1H63A 4FNTA 2ZYFA 4UFHA 5KTLA 3HPSA 3HF3A 1R2SA 3W88A 3F4WA 3GDLA 2Y7DA 1VYSX 3WK1A 2C3ZA 3LBMA 3P5YA 5BW6A 1W8SA 4MJMA 4JYDA 5G1YA 1X7FA 1A5AA 1H50A 3HGRA 1JCXA 3S1WA 3L5AA 1K3UA 3IGSA 3NL2A 1YPFA 1GEQA 2QCCA 5A8GA 2XN1A 1DKWA 2DZVA 4I7VA 3A24A 1EP3A 3PUDA 4ZQOA 5KSWA 3HG4A 3N9RA 5AHIA 3WK0A 4X9SA 1XBZA 2VEIA 4YCPA 3DFTA 5T26A 1K02A 1EA0A 2YZRA 3C52A 1Q6QA 5MHBA 1H7RA 2V2DA 2B7PA 1NVMA 3STGA 1JQVA 2A5HA 3NM3A 4Y90A 3GIYA 4BWLA 4Z0JA 3NO5A 1OX5A 3P82A 4NJHA 3ATZA 1QPRA 3TX9A 5LHFA 4FEZA 3KHJA 3CPRA 1SZGA 3LX9A 3LGEA 3BW4A 5CPOA 3GR7A 3W1XA 3MYPA 5L9FA 5DCDA 4O12A 3QZEA 5FI8A 3SSJA 3FYPA 4R34A 5AHFA 1S5TA 3G1DA 1C9DA 4HNUA 5HJLA 2OT1A 1KFLA 1G6CA 3GXPA 2YR1A 2I9EA 1YYAA 3MHFA 3I6RA 5G1TA 1XDMA 4N4PA 5FF2A 2Z6IA 3QMSA 5FF4A 2EGZA 2NXGA 4EIVA 1TPC1 3C2OA 1OFPA 1SQ7A 4MUZA 3UWYA 2ATSA 2Y7GA 1O4UA 2ZBTA 2A4AA 3GLCA 2QCEA 2FPTA 1EEPA 2V8ZA 2ATMA 3IIVA 3LHTA 5DXYA 1KTBA 1C8VA 2VFEA 1KM2A 2FJKA 4JY9A 4LOCA 1OK4A 1I2NA 4LVGA 5F2LA 5FF3A 4OT7A 1TTJA 4JTHA 4O0KA 4O28A 4Z1DA 3B0UX 1Y0EA 5LNWA 1RV8A 1F2JA 2XFWA 3TW7A 4AAJA 2QDHA 4H4IA 1LROA 3O15A 3OVPA 3LCIA 3S0CA 4LS0A 1IIHA 2NV2A 2FQIA 1LLZA 1FCVA 5K9CA 4JTFA 4P61A 2OCZA 2FIQA 1ICQA 1GG1A 4DELA 3P7YA 4PCFA 4MOZA 1BWLA 5HR7A 1EUNA 2OZ0A 3WK2A 2H6RA 2GUUA 2A6NA 4TU1A 2V0TA 4AWTA 3PM6A 1QO2A 2DORA 3M5XA 3UY8A 3HG5A 3JS3A 4NNBA 1FCBA 5FEPA 1ML1A 2CLIA 5C2XA 2PRMA 2B0MA 2QCDB 3BGJA 3I7QA 3BLEA 1YDOA 4K39A 1UUOA 3ELFA 2QCGA 4DO4A 3RF9A 4LC8A 1GT8A 3TSMA 4A22A 1FQ0A 3CM4A 1K8ZA 3C61A 4UNKA 3TDFA 3VKJA 4UTTC 2J9XA 4JTUA 4FNSA 1TB3A 3EXTA 1KM0A 4HN4A 1FWRA 3TFXA 2Z0IA 3W2KA 1TQXA 1OK6A 5AC8A 3W7RA 3RU6A 1TV8A 1UBSA 2WO5A 3F1QA 1WAUA 1V7YA 3KX6A 3O8AA 1LTDA 3N2XA 3EEGA 3QJAA 4DPPA 4UMCA 4AWSA 1QPOA 4N2YA 4ZQCA 1LBFA 1XM3A 1WOBA 3B4UA 3N73A 1LBMA 2PRHA 4RCXA 3MMTA 1KTCA 2OX1A 4A29A 3GX9A 5D37A 1W31A 2C14A 2QAFA 1D3GA 3NZRA 4KFPA 4MZ1A 4UFIA 3HJZA 5EKYA 2WNQA 1F5ZA 3CTLA 3NQ7A 4RZ4A 3LRMA 3GNNA 3TFCA 4LUIA 1SW3A 3MI3A 4QISA 2D73A 3MYOA 4IX2A 1ONRA 3BW3A 3GXTA 3PY2A 4CCEA 3I65A 1T99A 3F03K 1RD5A 3W1MA 2ZA1A 3WJYA 3GDRA 4NU7A 5J5RA 5BMXA 3FKRA 1SZEA 4S2CA 3PWAA 3L21A 3NQMA 1NF0A 4QIUA 1WA3A 3W1NA 4OQVA 4N9EA 3CIWA 4OV9A 2ZRUA 2V5BA 4NJIA 3NEVA 2YSWA 1N55A 3Q58A 2Y63A 2FTPA 3G8RA 3UD6A 1XBYA 1VZWA 1H60A 1KFCA 3LHVA 1W37A 4Y96A 1LCOA 2ISWA 3MWAA 4CLMA 5DN1A 1M7PA 1EP2A 3FOKA 5AN7A 2O7QA 3HG3A 3BW2A 4FB7A 3NZ1A 3VE9A 1VR6A 4O18A 2O7SA 3HQ1A 4K7VA 4IMCA 1ZJIA 4WOZA 2AQWA 3A21A 2B7OA 1ME9A 4DBDA 3GNDA 2ZTKA 3PULA 3NQGA 4LVAA 4M6PA 5FEXA 4A2RA 3WJXA 1FWTA 1W5PA 3HPXA 3TH6A 1JRCA 5HINA 5F4XA 2AGKA 4TIMA 2A2IA 1B57A 1SO4A 3C3NA 5CZSA 4RV8A 3W71A 2DZXA 5AHNA 1FUYA 1Z41A 4OHQA 5FEZA 5AB3A 1AMKA 1HTIA 3BVJA 3E96A 1W5QA 5G2HA 4ADUA 4CQ8A 1VYRA 4XQ6A 1K7XA 1SPQA 3NL3A 5LHEA 3W1RA 3UQNA 3S42A 3L65A 1A5SA 4JS3A 1EWEA 3NPXA 2YYUA 3W83A 2RDWA 1LRTA 2V5LA 4BR1A 1LRQA 3EXSA 1TPB1 3HB9A 5HUOA 3QH2A 4NJKA 3AJXA 1A50A 5AC7A 1JJKA 4O1CA 1W3NA 4KFOA 1KM4A 4NUWA 2ZA2A 4DQWA 4ICNA 2NV1A 4FX7A 1Q6RA 1VPXA 2F7FA 4LRSA 3W9ZA 5EA9A 1YADA 1X8FA 2Y85A 3H55A 4ML9A 1OHLA 3DH7A 4RKAA 3EWBX 1QMLA 3TSBA 1AL7A 3ABSA 3W1AA 4UTIA 2QCDA 2H8XA 2DZWA 3OVRA 5CSSA 5KZDA 3GK0A 4HNTA 2QCMA 5EY5A 3UNDA 2NWRA 2G5WA 1FXPA 3BG9A 5BNKA 3WJZA 3G18A 4HPXA 1LORA 1SSDA 1YXDA 1TPEA 3LRLA 1OFDA 2BTMA 4CQ9A 5IM51 3GDKA 4DEFA 2VFDA 3FA5A 1G4EA 3P74A 4R33A 3W7KA 4S2BA 1WOAA 3W7QA 3D0CA 3G8EA 2FPYA 4FXSA 5CPMA 1GWJA 1VH7A 3NA8A 2QAPA 4PL1A 3W7CA 1AK5A 3G1HA 4JN6A 3GVGA 4LTSA 1R30A 2ZTJA 4GBUA 3BO9A
chains in the Genus database with same CATH superfamily
4O1DA 1FDZA 1VQTA 6XIMA 3B40A 3M16A 3VC5A 3W2UA 3PG9A 3AHTA 1ODUA 1EF3A 1O12A 4K37A 1BYAA 1B3XA 3HU7A 3FDGA 2EPHA 5AC4A 2FHBA 4R7OA 4UTJA 4JNYA 6XIAA 5H8PA 2CFFA 1EZ2A 3UGRA 2CLMA 3IJ7A 3UA4A 3SCUA 4Z08A 3ABZA 3IACA 2XGZA 3BCJA 3F4VA 2BB0A 3LB0A 5AZ0A 3DFNA 2D1ZA 2Z2BA 2O56A 3RM4A 1P6WA 4UC5A 3PB0A 2NX1A 4UQ9A 2OQHA 1SMAA 3IVTA 1HJUA 1G4TA 4JNZA 3N18A 4QE5A 4L4MA 2W5FA 2PLJA 4TV6A 4XTDA 1PTAA 4E3VA 3NQVA 3Q67A 1YQ2A 4EK7A 3ES7A 4JCMA 1XBVA 5I3KA 3REQA 4IUOA 4NZFA 4YVVA 3P67A 3WL0A 2EJ1A 4R5EA 2YYTA 4N9BA 4G9PA 4K8EA 3IJDA 1EO7A 5AHMA 1XYMA 3VCRA 2WQPA 2EG6A 3PK7A 2DT2A 2XIJA 1VYPX 2XSBA 3L12A 3LXAA 2P0OA 3F2CA 4BCEA 5A94A 3W76A 4CCZA 2ZX9A 1VFUA 5E0FA 5E9XA 1E6SM 4LVDA 1ZUAX 1Z42A 4GH3A 3WLJA 3FFSA 4BQ5A 3S2JA 4IGHA 3VDBA 2YJQA 1EUAA 1GZ1A 2V5KA 4W9TA 1DJQA 3TZNA 3C0LA 3URNA 3WBXA 4Q4OA 1PCKA 3DFOA 3GFXA 4Q22A 4C60A 3WJWA 5BZAA 1EL3A 5G1MA 1OIFA 1CWYA 3LSCA 1MXSA 4C7GA 3BE7A 2G4FA 3OODA 4GXMA 3GIPA 5FIPA 1BRLB 4OU1A 3A5VA 5T9CE 3ZS4A 2WSYA 3G1VA 3I6TA 3FK4A 1TTPA 4HK6A 3P62A 4GYPA 2NLYA 3IJ6A 2C0AA 1NDWA 4L5ZA 2P76A 2Q8LA 2P3ZA 3O2LA 5HQLA 4K2SA 4YS1A 3CT7A 4IIBA 3NOYA 1DVJA 3SGZA 4MIMA 4N02A 4FNUA 4Q7BA 2UY3A 4FPSA 2ZRYA 4DRSA 4MG4A 3KVLA 1XBXA 4C6EA 2X09A 3AZSA 2YCEA 4HCHA 1C7SA 1H51A 2ZUVA 2YPIA 1YNPA 3M5VA 1ZNNA 3KXQA 1NSJA 4UR9A 4RNHA 5AOUA 3PS7A 4K1WA 1XPGA 3OEXA 5EMJA 1U5VA 3TR2A 1NP2A 4HT3A 3AJ7A 4WSHA 2EF9A 3PJTA 4YL2A 1DJGA 2YGYA 4QJ3B 1Z6KA 3H23A 3VIFA 1EGMA 1NOWA 4NNAA 3U57A 4DJFD 1AH4A 3UXKA 1TPUA 1MW0A 4FOJA 1BLIA 4GO8A 3OOQA 5C54A 4LYQA 3THUA 2VCBA 2IUZA 5I03A 4D6JA 4AHPA 3EWXA 1G4SA 1XCFA 3UG3A 1K9EA 5I77A 1L6SA 1E3XA 2G3NA 2O9OA 5BCAA 2ZUTA 5U7SA 4UTFA 1CGYA 1TTIA 3EKZA 5BOOA 3EWUA 1ZHAA 2BDQA 3WQVA 2XN2A 2TYSA 1V4YA 2AQVA 4DBUA 4MWAA 4M19A 4QITA 4PMYA 2J74A 3L66A 3CIXA 5T9BG 4AZ5A 1TFVA 2Z4GA 3C0JA 3QQWA 1WBJA 1UA3A 4LY8A 5XIMA 2CBUA 5CJNA 5I3IA 4E8CA 1GYMA 2E1DA 4UCGA 5D32A 1TCDA 3SY8A 1W5NA 3AO0A 4KERA 4W4QA 5CSRA 1ZFJA 5J04A 4GUHA 3MUZ1 2BHYA 2CC0A 4KRUA 4AVOA 5GPRA 3E3HA 1G0CA 4O1EA 3O7UA 5EBUA 3M0IA 3AIVA 3CUHA 5AZ1A 5C9RA 1JCNA 1JZ3A 1XS2A 4LUTB 4DO6A 2G96A 2VFHA 2V2HA 3PBGA 4IMDA 2J24A 4LJ3A 1AW5A 2XGBA 1Z32X 3RR1A 3M4HA 2XH7A 5D9NA 4L7ZA 1XC4A 3LI0A 3ZJ8A 1F3XA 3P80A 3PJUA 1GVIA 3WUGA 2IPJA 1B5TA 5JBDA 4Z2KA 2EHHA 4Q8MA 1R85A 1WKDA 4HA1A 3SJ3A 4DXKA 4UOJA 4GIEA 1OYCA 4KCWA 3NQBA 3RCNA 3VNZA 4JICA 3POHA 1EQPA 2Z2UA 4ROPA 3PAJA 3PN8A 3FVDA 1FWWA 4DJED 5HNUA 3MBFA 4M6QA 4TUFA 1QNSA 4BK9A 1C29A 1ZALA 1Q7ZA 1RUSA 2OSXA 6A3HA 1HX0A 1E1EA 4KH2A 1C7TA 1XIJA 3AWOA 3G1SA 3ZR4A 1VJSA 1UMYA 2CESA 1ICSA 4FIQA 3NPUA 4NX0A 2YX0A 5KZ6A 2ZADA 2BMBA 4F0SA 1VS1A 2O0TA 1OQFA 2SFPA 1AD1A 4ZOBA 2V67A 4HNNA 3V75A 3S5ZA 1IT7A 3WLHA 2CKRA 1F76A 1X6UA 1MEHA 3R7MA 3LPGA 3GNOA 1A5BA 2A3AA 2ISSA 5BXTA 4UFMA 3LUTA 1V0MA 3MVIA 2GQAA 2YXXA 3ATYA 4C6LA 4HMNA 4M24A 2HNEA 2E68A 3EMQA 4B9YA 4ZZ9A 4GA8A 4I7UA 3LNPA 2BZNA 2FZNA 3W2LA 2YBTA 3NXFA 4DO7A 1ZS2A 1AODA 4H9VA 4WY0B 4B16A 4C6CA 4NY2A 4AHQA 8XIAA 1E6QM 3NQ2A 2UV8G 3BMWA 3EGJA 1XGEA 3BAJA 1QATA 1K9FA 1ISXA 4EANA 1SZNA 1H5YA 3TXVA 2Z1WA 4HU4A 2CW6A 4GIAA 4IQEA 3AXXA 3PSVA 2WHKA 1I2OA 3GDBA 1GVQA 2QKFA 4U5KA 2A7PA 2GPTA 4IF2A 1VGAA 2QJHA 3MW7A 3BGGA 2NLIA 1IXOA 2PF8A 1JCLA 1R7OA 1H7XA 1W1YA 3ME3A 2QYGA 3WH6A 2J8TA 2QHAA 5HOSA 3T55A 1VBHA 3SQLA 1RJQA 1QNOA 2FB2A 2YL8A 2F6KA 4LALA 2QR6A 3KOYA 1EXBA 1HL9A 2VUNA 2X16A 4R27A 1VC4A 4OGZA 3UXAA 3S5SA 1KGWA 3I7RA 3WF1A 3AZTA 3MUY1 1DORA 5K7JA 1OYBA 3W24A 2PI6A 5RUBA 2G41A 2ZCGA 2PC4A 3IVUA 1VHNA 1DWGM 1IR2A 2A79A 2Z24A 2WHJA 4JTLA 3L4ZA 5FL0A 3OA5A 4CEUC 2BGSA 5F2GA 3GHTA 3KL0A 3R13A 4GI9A 1LL6A 4QNWA 3WUFA 5IBXA 1F3WA 1WP6A 2GVGA 2WZMA 1V6XA 1CIUA 2E9MA 5K9DA 2YFOA 2WANA 4N4QA 2PDYA 3CPUA 3EYPA 1POKA 1LOLA 1LP6A 1U22A 3LGGA 4DN1A 2C1HA 1S5NA 3QY7A 3L5MA 3L4VA 1TVNA 5EYWA 3E6EA 4KWWA 4V2XA 4LGXA 3E49A 4AF0B 1A5OC 2PBOA 3PR2A 3K4AA 1NWSA 3VKCA 3AISA 1R2RA 3S5OA 2ZX6A 3W07A 3G1FA 1TZZA 3G77A 2XINA 3U6WA 4H7ZA 2NSXA 3EB2A 1OFRA 1VBRA 2D20A 3K30A 3UBPC 2WW5A 3CHFA 3CQIA 3K4DA 4F48A 4FO4A 4GFSA 1V3KA 1SU5A 4ZQNA 4TV5A 4PMXA 1SW0A 3CHDA 4UBPC 5TBOA 3IANA 2WZEA 4E2BA 4XAYA 4URIA 3UWWA 1R86A 1B3VA 4GYPC 5CJ5A 2GVJA 2ZZ3A 2VEKA 5I24A 4BEQA 4TMBA 3UEQA 1WDRA 1W6TA 2HCVA 1HO1A 1TA3B 2WQDA 1Q6FA 1G4PA 3UJFA 3VM7A 3R6IA 2Y1HA 4YNGA 4PMJA 1UC5A 3TMQA 4N6EA 1MFVA 2VC9A 3P3BA 1KM1A 1ZP3A 4PBEA 2W6RA 1A3HA 3BC9A 3QY6A 1XRTA 2UY5A 1WCGA 4L6DA 4QE1A 3HPFA 5BRPA 1TX2A 3DFYA 1LQ0A 3MP5A 1RXOB 4M6VA 4PUJA 3FHAA 1JYVA 4IMFA 2V5DA 2V82A 1ITXA 3U2OA 4H19A 4JIPA 4PN2A 5IFTA 3NOEA 4JHMA 2GYIA 5D33A 4YN5A 2OYKA 5LNUA 2GK1A 3H7UA 3IS4A 3P93A 4PBGA 3H2EA 4PTXA 2B31A 4IPIA 2DUAA 4GK8A 4LB4A 4MVAA 2I14A 4UB9A 5GJNA 1UKSA 3ARXA 3SRHA 2E6DA 4DY1A 2A0NA 4PC8A 5D9MA 1H62A 1EP1A 3RMEA 3ARPA 4RPPA 2NQ5A 3IIXA 4UOZA 4PTDA 5H1WA 3A3WA 5KINA 1GOOA 4JDBA 5T91A 2CITA 3W85A 3LU2A 3WJSA 3WD3A 3RX2A 4LVFA 3FVMA 1WNOA 4GISA 1OD0A 4AXNA 1GOMA 3A4XA 4P7RA 3B0PA 1XISA 4GC3A 5C6MA 4NAFA 3IJQA 3OLEA 3GW0A 4PEEA 3S2LA 3IGHX 1FCQA 3GH7A 4D9PA 1CXHA 3KTXA 1GG0A 4MWAC 3SBFA 4K8HA 3B8SA 3H70A 4J40A 1UUMA 1QASA 1KFBA 4DUVA 3H24A 4XAFA 2GVYA 2WJEA 2GVLA 4CN1A 3A13A 3W7PA 1UKPA 2NW0A 1LG1A 1PPIA 2JIWA 1B90A 4G1KA 4AZHA 3KRUA 4FALA 3I3DA 2DH3A 2E9LA 4K6AA 1GZGA 2XWDA 1TIMA 3AXHA 1OFOA 1A5UA 1BYCA 3FN9A 1XHGA 5BMWA 3M41A 2Q6ZA 2G50A 3Q65A 2NUYA 4DVOA 2BHZA 1DWAM 3W23A 2HQAA 5AECA 3ZVHB 3QM3A 1P7TB 1XCXA 1ENUA 3CJPA 4JAWA 3IIPA 1KCLA 1FDYA 4LYRA 5D2VA 3G1YA 2CLHA 2J7GA 1XFBA 2WZIA 1NEYA 1X1OA 4S3FA 2FHFA 1X98A 1NELA 2D2GA 4IIDA 4D72A 1Z8AA 3GBDA 1J79A 4TMCA 4IXXA 1AH3A 3UXLA 1RJPA 4UTHA 3QPEA 2ZICA 2CLPA 1ME8A 1HKVA 1KD0A 1A53A 4A21A 2AGTA 3QR1A 4LWWA 1T8XA 6REQB 1ZENA 5FESA 1TV5A 2J9ZA 2BY3A 7REQA 1QUMA 2RH9A 4FNPA 3M0ZA 4RZBA 2PDFA 1JGIA 1TE1A 3NSNA 3N4EA 2HXTA 2IQ0A 3BCDA 1QI5A 1MEWA 3ALFA 3EDKA 1E4NA 1LT8A 3QMTA 3KLKA 1KRCC 4GX9A 4ZOAA 3KDNA 3NVTA 3W3OA 1T0OA 2JF7A 4DF2A 1KWKA 3WNKA 3TAKA 1HJVA 3TVAA 3G1AA 5EB8A 3KBNA 4JHOA 4UTKA 2IMRA 5BRQA 5LNSA 3IV8A 3B8DA 3S8HA 2BVTA 3R94A 3WLOA 3CZGA 4GLEA 3CV7A 4LBSA 5F1VA 2IXUA 4AY7A 1J18A 2ZXDA 1IE7C 1I4NA 1DWJM 4EE9A 1VJZA 3LCLA 4UTLA 3GVRA 2VJXA 1OWQA 3RILA 1QDSA 1FRBA 4GC4A 1HG3A 1XYZA 3C2YA 3K2GA 4KWVA 6CGTA 1GVYA 4QQ3A 2OT0A 4MGGA 2NUWA 4FX8A 3GXIA 5ECUA 1H4PA 2Y2WA 1U1UA 1I60A 3EXRA 4O1FA 4O13A 1EPXA 2R91A 1W3IA 2QPUA 2A7NA 1JAEA 3M6DA 3S5NA 2OOGA 3BSMA 4JKLA 5XINA 3Q45A 1DWFM 1V5XA 4DNHA 5CPNA 1XLAA 3KRZA 4NI3A 1X1NA 3E0VA 4GJ1A 1XXXA 1KBLA 4GYFA 1M04A 1POJA 3NQ8A 1VENA 2OXNA 1I2QA 3M7WA 4C1NA 1MWOA 3OPSA 3EX3A 2JFEX 4QDWA 3MKCA 1PWMA 3W87A 2C1IA 4O4WA 1XUZA 4G1NA 3VOCA 3SFWA 3REQB 3AIWA 3SQMA 4DBEA 2HISA 3QVQA 3QTGA 3ZJKA 3DESA 3S4TA 1RBOB 3ID7A 5ABHA 1BAGA 3SCSA 3MSGA 3MP4A 4ICCX 4O1AA 1GK8A 3NO1A 3VD7A 4AX6A 1NOUA 4ATWA 3ITYA 2VMFA 3APTA 4NZ5A 2OWXA 1J11A 1WZMA 5HMSA 1GZJA 4AXKA 1H49A 1IIGA 4DZIA 1BQGA 4XUGA 2WNNA 3FHQA 1QR7A 4WEVX 1KKOA 3VIJA 3OVQA 5A8OA 3A9IA 4I8DA 3E0LA 3T0DA 1ITUA 1GQNA 1DWHM 4H8NA 1O5XA 1QO5A 4JBRA 4R7JA 3W6MA 1SJBA 4GGBA 8A3HA 1UOZA 3RRXA 2VXNA 3G6MA 5DF0A 1EX1A 3PBYA 2WC7A 4HCLA 4QCFA 1YLVA 2B7NA 4O4VA 2CLLA 3NAVA 2GJPA 2ZX5A 2DVUA 2GSJA 5BXPA 3VUPA 1W9VA 1V0LA 2EQDA 3UZJA 1H7WA 3FJ6A 4I6VA 2R1LA 4KT2A 2WK2A 1XIGA 4WXYA 5HPCA 4WQ6A 4AX7A 1ADDA 2JKPA 3R11A 3MZNA 2WPBA 3OVGA 3SDOA 3B04A 1Y5XA 1W1VA 1S2CA 1W56A 4MKVA 2KZHA 4O1BA 1U1HA 1ZBCA 2Y0FA 2OOFA 3UWUA 1Y5VA 4RV3A 5H8UA 4F9DA 1CW2A 3TR9A 4L4PA 3K4WA 5HQEA 1J93A 3GFZA 1EA9C 5CPTA 2YCKX 3SRKA 1MNZA 4ROQA 3R79A 4TXEA 1VJIA 1X1ZA 3O6YX 1TV4A 1GOXA 3QHMA 1AQMA 1NFPA 3BJFA 1O5QA 3TIMA 5IHRA 3TQVA 3P61A 4ZENA 4XV0A 4HYVA 4G5DA 1W1ZA 2BWGA 1CXEA 2PWEA 3MUCA 3OHIA 2IPFA 3OHMB 2D2JA 4E3TA 2R94A 4EPKA 4D6GA 1NP0A 2A21A 3VM5A 3ANUA 2C16A 3KFTA 4NL1A 2ZDRA 3C8NA 2FDSA 3KUMA 3I10A 1R87A 4XK2A 1J0IA 1M68A 1FHVA 7TAAA 1REQB 1NY1A 4HSNA 2XUCA 3AICA 3BTNA 4IXHA 1GOQA 2GDQA 1FWEC 3AXKA 3BOLA 1WQ5A 2QJMA 1XGZA 1I75A 3DG3A 3CWOX 4Q33A 1Q2SA 4LCSA 4R85A 1JFXA 1LYXA 3L5LA 2CBJA 2F38A 4GI4A 4Q4SA 2XJ7A 4I8YA 3LOTA 4E0CA 3B9EA 4MWAB 5HJXA 2GUBA 1QNPA 2QCNA 5DT5A 3W84A 2W3ZA 3NDOA 2X0HA 5HMFA 3W88A 4ECLA 3GDLA 1VYSX 4JKMA 2C3ZA 5A6BA 5BW6A 4MJMA 4GY1A 3K8MA 3QKZA 1EOKA 1X7FA 4AISA 1XH0A 3S1WA 3PZUA 2DZVA 1EP3A 3PUDA 1Q4NX 4F0HA 2DFAA 1RA5A 4X9SA 4F8XA 1K02A 4OIFA 2YZRA 2AQOA 4XAGA 1H7RA 1ZU8A 2WB5A 3STGA 1JQVA 3S9IA 3ZXWA 1H0IA 4CU7A 4Y90A 2ZDSA 3NO5A 3P82A 1Q7QA 2WSPA 3FSTA 4H9UA 4UOQA 3C3UA 1V6TA 5LHFA 1DJYA 3BJSA 3T8QA 3UF9A 4EXQA 3ARSA 4WKFA 1SZGA 2WCGA 3LX9A 3LGEA 1PJ9A 3S47A 5B7YA 3W0KA 1JYWA 4O12A 5FI8A 4QRNA 2PGEA 4AYGA 5AHFA 4WIWA 3S83A 3N4AA 3C0SA 4E5TA 3GXPA 4PFHA 2YR1A 1ISVA 5AYIA 3SCNA 2YA1A 3AC0A 1YYAA 2XISA 7CGTA 4N4PA 5BU6A 1OZQA 4GJIA 4J28A 5C2CA 4ZA0A 4EIVA 2GWNA 2PD5A 1VP5A 4IICA 1TPC1 1JPDX 3C2OA 1SQ7A 4MUZA 3QLLA 2Y7GA 4B5SA 1E1CA 4MKSA 5CSUA 1XLJA 1EEPA 2V8ZA 5EMMA 2QLYA 4YYFA 4R7WA 3SM0A 1KTBA 1XC6A 2VFEA 4YTSA 3QV8A 4OZOA 4LOCA 2HV5A 3BGAA 4LVGA 2AKZA 5FF3A 4OT7A 4Z1DA 7ENLA 2ESCA 3R58A 4UQAA 5A6LA 1F2JA 3P0WA 3FAWA 1UD8A 4AAJA 4H4IA 1JPHA 3GNXA 1M03A 4WGHA 1IIHA 5MF5A 4QG6A 4ATLA 1LL7A 3G2GA 1XSJA 3W26A 1KXHA 2OCZA 3GZAA 1GG1A 3P7YA 1EO5A 4QLKA 4Q6JA 4WDWA 5HR7A 5HPOA 2OZ0A 4HB7A 3WK2A 1XH1A 2V0TA 3SQSA 3GG8A 4NAEA 2EG7A 3PM6A 5I0DA 1UQYA 3GC5A 3HQNA 5FEPA 2J8GA 4EWJA 1G01A 2PRMA 3I7QA 2X1IA 3GRIA 1CXIA 3AUJA 4GQ0A 1VKFA 4MTVA 5CCZA 4LC8A 1GT8A 2O9RA 2PWVA 4A3HA 3WF4A 3KEHA 4UNKA 4ZOEA 2IXVA 1XD0A 4D6IA 2FH8A 1R6WA 1OY0A 3MTWA 2XFFA 1NWUA 4FNSA 4QGCA 1TB3A 4F79A 4HN4A 2BODX 2Z0IA 3W2KA 1TQXA 1OK6A 1RCXB 3VC6A 1GQLA 1UBSA 4IT1A 3PZGA 3KX6A 1B30A 1PTGA 4A3YA 4ZQCA 4ACYA 1LBFA 1WOBA 4RCXA 1KTCA 1WO2A 8CGTA 1W31A 2C14A 5I6SA 3NZRA 3OQ8A 1WXYA 3HJZA 3VNMA 2REQB 5EKYA 6ENLA 2VD8A 4LAKA 3CTLA 3ZQ9A 4UQDA 3DG7A 3NQ7A 2EO7A 3WENA 1J0HA 1DIKA 3O0KA 3L4XA 3MYOA 4A8RA 1BVNP 4NZ3A 1T99A 3F03K 2V3GA 1B3ZA 3LNMA 3T2OA 3JW7A 4OTKA 3OYXA 2ZVRA 1SGJA 3GNPA 1NDZA 4DJFA 2OLAA 1TIWA 3PFRA 2E8ZA 1WA3A 2VGFA 3N6JA 3BICA 1CECA 1KXQA 1KFCA 1EJXC 4Y96A 3DYMA 3E1F1 4CLMA 3H26A 1M7PA 2HPIA 5AN7A 3RX4A 2O7QA 2X7VA 3UCCA 3B8TA 3KOZA 4FB7A 4HCDA 4O18A 5E09A 1PX8A 2XG9A 2MNRA 4IMCA 2AQWA 3PTKA 3E38A 1ME9A 1MW2A 2ZTKA 1HGWA 1OBAA 3NGFA 1FWTA 1WKEA 4Q7NA 3HPXA 2IKHA 3TTSA 5F4XA 4ZTXA 3MQTA 3W71A 2DZXA 1L6FA 2HWGA 2MANA 3ALGA 1HTIA 3BVJA 3E96A 4ADUA 5A6MA 1K7XA 1SPQA 3VAVA 3UQNA 1Q2RA 3L65A 1EJ7L 3NPXA 2PWHA 4IFOA 4BR1A 4EPBC 4NJKA 1YHTA 2DPEA 2XH2A 5AC7A 5A8QA 4W86A 1JJKA 1W3NA 1KM4A 4REQB 3AXMA 2ZA2A 4DQWA 4XAPA 1J0KA 4HPNA 3VD5A 2E67A 4FX7A 4WK9A 3V1HA 2RDXA 3EEZA 1M7XA 1OHLA 2PTDA 1QMLA 1AL7A 3RJXA 2NT1A 3E5PA 2PU0A 2YOCA 2QCMA 5EY5A 3MS8A 3H21A 3UNDA 3BG9A 1V3HA 1WXZA 5D8ZA 3WLSA 3NZQA 1K6AA 3ES8A 4B92A 3VX1A 3H2FA 3KTCA 4DJEA 3QLDA 4I5UA 2BTMA 1BXBA 3AZRA 5IM51 2VFDA 4HK5A 1KGUA 1F8IA 4TVCA 1G4EA 4ACZB 2PTWA 1L0PA 4FOKA 3R8GA 4YHGA 4GIRA 2JE8A 5CPMA 4H9MA 2WMKA 1AK5A 2QDEA 4JN6A 1HVXA 2FHCA 4C6OA 4DUWA 4Z2LA 4L56A 3BO9A 4W7VA 4OKDA 2DY3A 4C7FA 2E1WA 4NG3A 4G8TA 2BGNE 3G3MA 3HQPA 3WNMA 4PUWA 4P5UA 1OIMA 3PBUA 3LV6A 4ZQMA 1S1PA 3LZ3A 3PZ9A 2A3CA 3VUSA 2NVAA 2CETA 2WLYA 3GHUA 1DJZA 4EF9A 2FTYA 5FSDC 3WBWA 2P8BA 3MO7A 4JFWA 2ACSA 1XLMA 1SO5A 2VR4A 3IIOA 4HSHA 3VNIA 1CPUA 1MQRA 1XRFA 1SUXA 4HYRA 1EF2A 1UW9A 2A85A 4D2JA 2Z1VA 3B8WA 1S2UA 4PCTA 4XZLX 1HJXA 5F1UA 3CMGA 3BLLA 4D1JA 2F8QA 4Q4RA 5FSEC 2X0YA 3HGSA 4JY8A 2QV5A 2PDGA 4AIUA 3SB0A 4LYKA 1EQCA 1FWFC 3LCWA 3QPZA 2YXGA 2XVKA 1VFMA 4LBUA 3LTYA 3WBYA 2VD9A 3K46A 3M5YA 2V68A 3A12A 1PX4A 3IGUA 1MRQA 3SCWA 4NZ4A 1F07A 1M6JA 5E6YA 5B7ZA 4M1BA 1PE1A 4NI8A 4MZYA 1QTWA 5EPDA 4EF8A 3H54A 3LPPA 3MO4A 4QR6A 1JEZA 3D3AA 1UZ1A 3GYEA 3W28A 4Y6GA 4IL2A 3M07A 4GZ7A 4KETA 2OX4A 1NDVA 1T8QA 4RNJA 5SWUA 4MSSA 5AFDA 7REQB 2Z1KA 3VFCA 3KRBA 3Q2DA 5D4YA 4QJ5B 3MJMA 3DKLA 4MM1A 1UWRA 3ITCA 1GCYA 4Y2WA 4H00A 1NM9A 1X97A 2HE8A 1N2VA 1DTUA 1A80A 3RM9A 3DUGA 2YLLA 1WUEA 1QW8A 3FLUA 4H2CA 4J3WA 1RP9A 1EIXA 3LCGA 3KVJA 4LAMA 3KDOA 3TC7A 1TPH1 2ZFAA 1EYWA 5GVJA 3UYCA 4IP5A 3CV1A 1XFCA 1NFGA 1HO4A 3EX2A 4GINA 4X60A 2BHUA 2QJIA 4MNMA 4GRSA 3ZZ1A 1VCVA 4GQBA 4IWWA 4B5XA 1ZAHA 2D23A 4LS2A 4ZO6A 3BLDA 2A7RA 3OZYA 1J0JA 5CBBA 3TWBA 4ZO7A 1UG6A 3PG8A 2IS7A 3KWSA 4QBXA 2WMGA 1ALDA 4UTWA 4XB3A 3DHUA 2R1KA 1N7KA 3ITGA 2FZMA 5LSMA 1MDLA 1BWVA 5U4NA 3UCDA 3KAOA 3JUGA 4Y7EA 4BF7A 3RLUA 3WLMA 5I09A 3UR7A 4C1KA 1U83A 1OCJA 1TMHA 4G7EA 2EPOA 4B4HA 1WE5A 3P6LA 3OGRA 2JKEA 5IHSA 4L9YA 4BI6A 3MV01 4GNKB 4PCPA 4S39A 2IPWA 3VDHA 3UPWA 1CXLA 3DXIA 2HK0A 2KX9A 1GVRA 3L68A 4L80A 4C1NB 3OBEA 4J1OA 5F2MA 1WDWA 5ABGA 3W00A 5DQPA 1R3WA 3HGJA 3BSHA 2Y5JA 3UNTA 1HP4A 5C9ZA 1KW1A 4WDTA 4HU0A 5EFDA 3KS5A 2UWFA 3GU2A 3IJ9A 3IK4A 1Q3NA 1PV8A 2XSAA 4DZAA 4LS1A 3VE7A 3AU6A 1KNWA 1BPLB 3LS9A 4QG9A 5A6AA 2QIIA 4MNKA 2FMOA 2QXWA 2OO0A 2YBVA 5I78A 3KOWA 1RPXA 2HS8A 3U2ZA 4GMEA 3UETA 4EWND 1I1WA 5EU9A 4DM2A 2DU2A 1OGSA 1H2JA 2EEXA 4JNMA 2O4QA 1BVZA 1EWDA 1EC9A 4FNRA 1XICA 3W25A 5A2BA 5HNRA 4JDYA 1DTNA 3TJ4A 4DJFC 2Q01A 4C6JA 3EPNA 1JD9A 3WG6A 3TAOA 3TW9A 4XVDA 3GTIA 3W6LA 4N6FA 1JD7A 2D3LA 4Y8EA 4MJZA 1PVNA 4E4UA 3E2RA 3W29A 1JQXA 1LDCA 3O05A 5AYZA 1ZP4A 2VZUA 2J78A 4H8UA 2PBGA 1VCGA 3GXDA 5GQBA 4B90A 2J25A 1M01A 1Z9AA 3T2PA 1Y65A 1EJVC 3B0XA 4QE4A 1FH8A 4C6PA 4JX4A 1KB3A 1W5MA 4O16A 2UBPC 1D3HA 3T4CA 3PBWA 3V0TA 3HN3A 1VFSA 3TONA 2V3EA 1PIFA 2BFGA 1ICPA 1EDQA 4DJDD 4GYKA 1IR1A 1UC4A 3F5KA 3PBVA 3DFPA 1KRBC 5CPLA 1AJZA 4LCQA 2W79A 1H1ZA 1RZMA 1DHPA 2PDWA 4JTTA 3K1GA 2HZGA 1SJCA 1VF8A 1NWRA 2J9YA 9RUBA 2OFJA 2WNZA 4BS0A 4OVXA 3QMRA 1IXQA 1VFFA 4HPJA 1CENA 3GU9A 2I5QA 4C7DA 3BAXA 3R2GA 5D05A 4BQ3A 1JG9A 3AIQA 5KZEA 2CWNA 1DBTA 2FB3A 3PVFA 2RUSA 3I4KA 1XL9A 2ZUMA 3ITVA 3KVMA 3WIJA 1Q4WA 4NT0A 1LQAA 1IEQA 2DJXA 3LXCA 1IZJA 2RGMA 1O60A 1Y7VA 4J5NA 1XX1A 2EPMX 3OBKA 3R8RA 4A3RA 3B03A 2FZBA 4TR9A 2P53A 4ZMGA 3W74A 2E0PA 4DX3A 1YNQA 4OUIA 4DJEC 1A0DA 3F2DA 1L8NA 1TCMA 3QC0A 2H90A 3B0YA 4H6KA 5FJOA 3WQ8A 2VX5A 4INFA 1EBGA 5CXPA 1FHDA 1R3SA 3AYVA 3C2EA 4HSOA 1OD8A 3N14A 1BVWA 1A5LC 4YTUA 1W9XA 1QPKA 2ODOA 3GTFA 2F61A 1JZ8A 3H7VA 1F73A 3MMUA 1YE6A 4CU6A 3S9YA 3VI2A 2H3DA 1FWBC 5IDIA 1Z3NA 3ABQA 4QAIA 3S1UA 1UZHA 3EMZA 2RJGA 3RMJA 3PJWA 1J0ZA 1C9WA 1R2TA 1JDEA 3S6OA 5I2UA 2DZBA 2Z2AA 4S3BA 1XYFA 3FS2A 4NILA 4I9MA 2G3FA 2BY1A 2JKAA 5LGZA 1O95A 3B8VA 1JUBA 2X1TA 4AIOA 2DT1A 3TV8A 1UWSA 3TQ0A 3TYEA 4AMAA 4J2PA 4LUJA 1UMLA 4LUTA 3MU7A 2FGLA 1KBKA 2C71A 4TTUA 2Q3RA 1WDSA 3W2NA 3KL5A 1SFSA 3GW3A 4MNJA 3BZGA 3SN1A 2WC3A 3WDHA 4ZGYA 5J5DA 1OJXA 4IMAA 4PMVA 4KFNA 5E0CA 2ZUSA 4H7CA 2A6LA 4LF1A 5E6ZA 3O6AA 4X0NA 3MHGA 1SFTA 3PTMA 2YCJA 1I0BA 5REQA 4HOWA 4L4OA 5DX7A 4WOQA 4KWOA 4ZQPA 2XIMA 1R9XA 1SFLA 3VGEA 1A3XA 3R0DA 5HMEA 2X1RA 2IKGA 1W1PA 5C55A 3SIZA 2ZOXA 4AFYA 2PGRA 2VO5A 1TRIA 4OBSA 4PTMA 3U5UA 1SJDA 3VU2A 5EMYA 3V3WA 3W2MA 3L0KA 2WLZA 2BOFX 2Y7FA 1E1CB 4UMBA 3M5ZA 3WDPP 3MMDA 1O68A 3F2BA 2VCAA 1G69A 4L65A 2DT3A 3QZAA 4Q3MA 4Z2HA 3LXBA 4RW3A 1RCOB 4PB4A 1OFQA 1W9DM 3HZ3A 5FEWA 2WJZA 2NXHA 3WLPA 2PCQA 4XWUA 1WB0A 4RK8A 4ZL1A 4HP5A 1WZLA 1FY6A 3IAQA 2VTFA 2PS2A 1XQLA 3VIPA 4CNNA 4PTNA 2BLEA 4X2RA 4RE0A 3NQAA 3MB9A 3U2EA 4BJHA 2YA2A 4XZHA 2ZKMX 4WJXA 3SAZA 1K7EA 2TPSA 2WSKA 3O9NA 4YJ5A 4H01A 3MC5A 1PKMA 3VD3A 2POZA 1NTHA 2WWDA 3JR2A 3AMLA 4WY0A 2VP8A 4NX5A 3K1DA 4BHYA 3TOYA 1A47A 1OC7A 1W5OA 2WOQA 4RNFA 3MUXA 3MANA 2WZTA 4GYJA 2FJUB 2JBMA 4DLFA 5JBFA 2WBGA 3R12A 3WSUA 1DXEA 4GX8A 4HOXA 3CU2A 1QOXA 1XG4A 4DPQA 1HKJA 3JZEA 4K68A 4A8LA 1G7VA 3G24A 3CK5A 4H7VA 1V3JA 1MUWA 4A8NA 3EOEA 4MB4A 2NXIA 1Q6EA 3B8UA 2ACRA 4B9ZA 4NJGA 2IQTA 3MKKA 2GQ8A 4JTRA 3RLHA 1QFEA 3IRSA 1K8YA 3S6DA 3VGDA 3KE0A 4KCUA 4JYFA 1DL3A 1IV8A 3O6DA 3LPFA 2A3EA 1OC5A 1ZB5A 3BLIA 3W22A 4HMCA 4WY0F 4DB7A 1ONXA 3Q94A 1BTCA 5D04C 1SVDA 1GQJA 3U3HA 1XYCA 4D1IA 4HPHA 4JTQA 3PZMA 1ECEA 4ZBCA 1TMQA 3GXNA 1OZMA 3ARUA 4JD4A 1IGSA 4AUBA 3EOOA 5CZKA 1S5MA 3WNPA 1WV2A 1D9EA 5D38A 4GQQA 4C6FA 4YIWA 1UWIA 1EGVA 1V08A 3MMWA 4BKNA 3EA2A 3GC2A 2OO6A 2WJFA 4XZ9A 2Z28A 3CAVA 3ZWSA 1O94A 4H9YA 4XZBA 5TF0A 5D03A 1XLGA 4RZ6A 3H2NA 1S5WA 1UP0A 4B4FA 1T41A 1XSKA 4L4LA 1LWJA 1ZGDA 1SM9A 3MCMA 3OG2A 4AF0A 3AUOA 1JXJA 4J9JA 2PODA 4MUPA 3B05A 1ZLPA 1CLVA 4LB3A 4P7NA 2QPXA 1F6PA 4W5ZA 2GOUA 3RLGA 1OSEA 1QNVA 4HTYA 4NKCA 1PCWA 1UWUA 3NDYA 1EC8A 2C6QA 4UTMA 2D69A 4U10A 4JTSA 1AW1A 4CQAA 4AH7A 3AMKA 2EJAA 1O5KA 1B1YA 1SW7A 4NASA 4K1GA 3E0WA 4OV4A 1BKSA 1RP8A 1V02E 1L6GA 3ISIX 1GJPA 3L0NA 4JX6A 2W62A 3IIZA 4KESA 2PP1A 2I1OA 3MBDA 1XRSA 1TA3A 1VEMA 1FWDC 2GSEA 3L4YA 1ME7A 2OMAA 4M56A 1TR1A 4YYCA 1VD6A 5M3WA 3MUIA 1UIOA 1JDAA 2QDGA 3DG6A 3FA3A 3IRDA 3P60A 4I3GA 3SN0A 5HA7A 3EDEA 4GY0A 4AB4A 1LZOA 2GGHA 4Q8VA 2PC8A 1DV7A 3ARRA 1W0MA 1UR1A 3DU0A 5G4EA 1FX6A 2VCCA 3LCHA 1S39A 7A3HA 3WLRA 3TC6A 1QCWA 1H11A 5CAKA 4Q8PA 4EX4A 1QHPA 4XBKA 4L9XA 5DBUA 5M5DA 4MYXA 2QIWA 5I3DA 5HWJA 1TRDA 3ZSTA 2INEA 5E93A 4S3AA 4H9ZA 1YBQA 1KBBA 1Q63A 3AMGA 1R5YA 2XN0A 2ZRVA 4IJCA 4DM1A 5AYBA 4AZ6A 2Y8VA 4P8VA 1GNXA 2QCHA 1JXKA 4Q4PA 3AFBA 4X61A 1ESWA 4A3QA 1DJNA 3ARZA 3VCNA 1E0WA 3VOJA 4DF0A 4I90A 1PS9A 4V15A 3UZ5A 1MVYA 1HUVA 3QW3A 4BA0A 3PZOA 2BY2A 4CCDA 3WQWA 3DI1A 4QS6A 4KRZA 4C6DA 3GKFA 5A6TC 1JCMP 1RLCL 2YDAA 2GVEA 4J3SA 3B9OA 1F74A 3CB3A 4GABA 4HIBA 2CZDA 1H1YA 1NQKA 3LI1A 1DJIA 5LYRA 2QEZA 5G4WA 1GGOA 4CQBA 2PDKA 3STCA 3PNZA 2W66A 1XLLA 4C6IA 5F4WA 1BTMA 3BXWA 3VNDA 5C5YA 3EB4A 5DMMA 3CLMA 2FVKA 1W1IE 2CZ5A 2L5HA 2Z26A 1H41A 1WZKA 3H4XA 2QJGA 1S2AA 3DHFA 4PBFA 3DI0A 4GVHA 3LTPA 2HMCA 3LG3A 5E70A 3THCA 6PTDA 3ZO9A 2GGEA 3ZYZA 4HZ8A 4NSBA 1P7TA 2QCLA 3WN6A 2OODA 1RSCA 2G97A 3PANA 3WQDA 4Q6XA 3DEQA 1ZSXA 1MO0A 1KCKA 4LRTA 3L2MA 3W7NA 2DGAA 1R3RA 1OYAA 3PPCA 3WF0A 3PSWA 5D02A 4H6EA 1FWJC 3V1PA 3HPAA 5K4ZA 4PSRA 2ZUUA 2DSKA 3PNUA 4ZXOA 2PLCA 3WLLA 1EDTA 1HVQA 2PUZA 1U5JA 4C65A 4Z1YA 3TN5A 3KM8A 1RQHA 4XTIA 1TR9A 4D71A 4AVFA 1YTKA 4F3HA 4ZR8A 1B4KA 3FEMA 4GZIA 1R9ZA 5FF7A 1E0TA 4F9JA 1JUKA 3XISA 4NXKA 5HMDA 3QF0A 4G56A 2D2OA 1RA0A 3IAPA 4XUYA 1KM3A 2NX9A 1VLIA 3QTPA 5DO8A 4RL3A 3U4FA 3ZWTA 2ZE0A 4OBTA 5A6BD 3CAWA 3TE9A 1CYGA 4LNYA 3TMLA 1N8FA 1ZJAA 4ZE4A 3VKDA 4FR1A 3O63A 4PH6A 1AQHA 1PZ2A 4B3ZA 2QZRA 4WLCA 5CZTA 1QI2A 4HHHA 3EMCA 5CG0A 4G7EB 2WVUA 4V1XA 5BOFA 3LLDA 3RK8A 1DXIA 1HJQA 1S5VA 2VWTA 5CQ1A 1GQKA 3LHUA 4FR6A 3UR2A 2TMDA 1XIFA 4DI8A 4IGNA 4LPCA 3S46A 4ILSA 4AEOA 4LBRA 4C6QA 4B3KA 1QW7A 1FKXA 3F5LA 3F7JA 3DFQA 4F0KA 1DPMA 3EZ4A 3BJTA 4S3JA 3GYCA 1QWGA 2FPVA 2QF7A 3W7DA 2DQWA 1HZYA 4H8VA 4V28A 3RIKA 3KBWA 4CCCA 2TODA 1E4LA 2QULA 1RD6A 1BSLA 5LXXA 5CLWA 1JF6A 3EOUA 4L1GA 1KBJA 2AOSA 2DVTA 2VGGA 3T78A 1GOKA 3DFHA 2HXUA 3QHOA 3SCPA 4NZCA 1DOSA 3B8IA 2P1FA 3DKJA 1MI3A 5CPSA 3GVWA 3T4WA 2ON3A 3MKVA 3WQEA 1CLXA 1R9YA 3CQKA 3U2CA 1ZAIA 5EBAA 4O50A 4F40A 3OIXA 2Y5EA 5MKGB 3USBA 4XBSA 3BG5A 3VNLA 5DMYA 4BI5A 2E5CA 4FNTA 2OKOA 4RE2A 3HPSA 4MNLA 3WELA 2VQUA 3F4WA 3WK1A 3LBMA 4IIEA 2HK1A 4HD5A 3IARA 2OVLA 9XIAA 1H50A 3HGRA 1JCXA 4W8LA 1K3UA 5FAJA 3OW1A 5H6HA 3TNBA 3A24A 4ZQOA 3N17A 3ARTA 3N9RA 3WK0A 4YCPA 2VEIA 3DFTA 2NQHA 3VPLA 1V6WA 1Q6QA 3DC0A 4Q7IA 3SGGA 1H09A 1XGDA 4Q8QA 1VRXA 1R3TA 3EPOA 3NM3A 3GIYA 4BWLA 2VDGA 1QRQA 4JFSA 3BCFA 2BVYA 5DFAA 3LENA 1DWIM 4WJ8A 3TN4A 4IP7A 1ZJHA 4F0LA 3TX9A 2PGFA 3VOFA 3U0HA 1M41A 3CPRA 3W1XA 5DCDA 3UFYA 3QZEA 2FVLA 3FYPA 4US5A 2HNHA 4HNUA 2VRQA 5HJLA 2OT1A 1KFLA 2DSVA 5A69A 2I9EA 1ITQA 3I6RA 1RBLA 1XDMA 4XD4A 4ZE5A 5FF2A 1BXCA 4IFRA 3M0HA 2EGZA 2NXGA 4I5XA 2Q09A 1F8MA 4CNSA 1OFPA 4K3ZA 1E4IA 3UWYA 2ATSA 5GJMA 2ZBTA 3GLCA 2QCEA 2FPTA 3T07A 3VIHA 1MUCA 4XVEA 2EG8A 2ATMA 3IIVA 5DXYA 2R82A 1TV3A 1JZ7A 3RN6A 2FJKA 4JY9A 1OK4A 1EEXA 4MWAE 2ZWYA 5C2GA 2INFA 2XFWA 3TW7A 1E4MM 2GUYA 1R38A 1P0BA 3OLDA 5LA1A 4IPLA 3GG0A 1REQA 2WKLA 2NV2A 3H4WA 5K9CA 3TJIA 4JTFA 1Q6GA 2R9RA 2FIQA 4DELA 1HN1A 1FKWA 2GUUA 5CLTA 2A6NA 3VZXA 4DLMA 5DRCA 1E6PA 1QO2A 3M5XA 2FFIA 3HG5A 2QUMA 4EXAA 3ZT6A 3HJEA 1V6VA 1RK5A 2QVHA 3MCOA 1ML1A 2CLIA 5C2XA 2QCDB 2PD9A 3BMVA 3BLEA 1A5MC 1E6XM 4K39A 4AIEA 1U2YA 1UUOA 3ELFA 4DO4A 3CM4A 3TDFA 3C61A 3VKJA 1O1ZA 4JTUA 3V0UA 3T0AA 1KM0A 1FWRA 4HTBA 3W27A 1NARA 5AC8A 1TV8A 3R1ZA 1WAUA 1O6IA 2PZ0A 5TD4A 1Q7MA 5AY7A 1E70M 4DPPA 3G5EA 4UMCA 4X63A 1IEVA 3B4UA 3N73A 2PRHA 2PLKA 3QV9A 2OX1A 3CQHA 3SCTA 4HA0A 4UFIA 4FXFA 1KRAC 3ONBA 1F5ZA 2X41A 3LRMA 3GNNA 3TFCA 1SW3A 1WZAA 1UHVA 2D73A 4HMEA 3BW3A 1J0YA 5DRIA 3PY2A 2J62A 5REQB 3W1MA 4NU7A 5J5RA 1UQZA 5BMXA 4A05A 3FKRA 1SZEA 3ONCA 1CXFA 1UKTA 3CL6A 1PXGA 4PMZA 3W1NA 3T0TA 4LQ1A 3LN3A 2V5BA 4NJIA 1T7LA 3J7HA 3EDJA 3G6LA 2OYMA 3UD6A 5F7UA 5CC7A 1ZQ5A 2IQDA 1W37A 4KMQA 2ISWA 1TZ7A 1TWIA 3MWAA 3WZ0E 1P6BA 1EP2A 1V0KA 1W9BM 3HG3A 2J7EA 1V93A 5GNYA 2ZWZA 2DIEA 1DIEA 1VR6A 1SYTA 5LIUX 4TVUA 5BXSA 3A21A 3GTNA 4FI4A 4XKMA 4M6PA 5FD0A 1EHNA 4WSKA 4U5IA 2YKKA 2PDHA 3SRFA 5A8NA 3QGVA 1Z41A 4OHQA 4RE4A 5AB3A 4WKHA 1W5QA 1PTDA 1VPYA 4CQ8A 4XQ6A 4J3UA 3WQCA 5LHEA 1A5SA 1EWEA 1R8LA 5JIWA 3W83A 2RDWA 1VAHA 1LRQA 3EXSA 3I3BA 1XLFA 2CPUA 4IGMA 3AJXA 1A50A 1DP0A 1PYFA 4JFUA 4WHBA 3BDKA 2AMGA 1XRVA 4NUWA 4N0RA 4ICNA 4GQRA 3H22A 1Q6RA 3SUWA 2F7FA 1YADA 2X7WA 1X8FA 3H55A 4ML9A 1TWZA 3W82A 2QUNA 3AS2A 3DH7A 4GXPA 4RKAA 1WDDA 3EWBX 3ABXA 4DJDA 1RH9A 1E0UA 4GFIA 3L2LA 4PMNA 4UTIA 2R1NA 3VIGA 2H8XA 4PMRA 4H1ZA 5CSSA 5LIYX 1CNVA 5IRPA 5KZDA 4HNTA 2YL5A 2X40A 4RNIA 2NWRA 3TTEA 2G5WA 4F0RA 5HXMA 1WKFA 1S1RA 3CBWA 4KEUA 1GW1A 4PTVA 3B9DA 4DEFA 3FA5A 5FAGA 3P74A 5CJMA 3W7KA 3STPA 1M1BA 3NEHA 1WOAA 1XF0A 3W7QA 1US3A 3G8EA 3F4CA 3AU2A 3CH0A 4IH3A 2GGJA 4W88A 3UYIA 1GPFA 1P43A 1GWJA 1TV2A 2QAPA 4M29A 3BAWA 2OG9A 3G1HA 2FTWA 1D8WA 1TVLA 2REQA 1NJJA 1R30A 4FF5A 3KZSA 4GBUA 3P84A 4S3EA 4HVXA 1IT8A 2X1SA 2ZXQA 1NAL1 1GVEA 1RVGA 4AWEA 1ZCCA 2YFNA 2ZZ4A 2CIPA 2V81A 2XFYA 3PWIA 2HDJA 2PURA 3RX3A 4GH1A 1ITCA 3GDMA 1R0MA 1EJWC 3NPWA 4LEQA 4EP8C 4MDPA 3ZVIA 5BRBA 1ECQA 3W1UA 4PSPA 3UG5A 2GDUA 4AEFA 1F4HA 3Q4DA 4FNQA 1RVKA 2NZLA 4FIRA 1DIOA 1P5BA 3WQ4A 3GNRA 2WHMA 1XSIA 1OG6A 3VYLA 4N42A 4RDYA 4JHZA 1IF2A 3VIIA 1QT1A 4IIGA 5CH9A 3WY1A 2NV9A 2HS6A 1D7FA 5AYXA 4YWSA 1TUFA 2WWCA 1XLDA 3W38A 3VK5A 1KQZA 2ZRWA 3TP4A 5E0KA 1DQXA 3ZOAA 3V18A 5E1QA 1W3LA 4WCJA 1W3TA 2ZX7A 3AHZA 3VX0A 4XZMX 3ZR5A 3KZPA 3W73A 1PDZA 5H91A 1TPDA 4DYKA 3YPIA 1Q6LA 1S46A 3VNKA 1TZ9A 3RGTA 4H41A 4ZB5A 4BWLC 1SR9A 3GWQA 3VZZA 3NUKA 3BAIA 1OC6A 1MDRA 1J5SA 3PZVA 3OB8A 3WL1A 1NFBA 1T40A 1UIPA 3V0SA 1SMDA 1EHAA 4REQA 2BSLA 4ALDA 2X1UA 2WYSA 2RDTA 4IPPA 3UVIA 4OBRA 4PRRA 3HG2A 1ISYA 4ZFCA 3E12A 3W1TA 4NXSA 1U33A 3TLQA 3I7SA 1VFOA 2PE4A 2PDQA 1R47A 4WRHA 4ADTA 4J35A 3LHWA 4WZHA 4GVGA 2C8NA 1CB2A 4HNOA 1XYAA 1C90A 1F9CA 4U3CA 4Z1CA 2YCLA 1AZ2A 4DI9A 1MZHA 2BX7A 4Z2IA 1ZY9A 4ENLA 2CU0A 1UR2A 2XH0A 3KP0A 3POCA 1J01A 3SRDA 3WQ5A 2PDUA 1B9ZA 1YBQB 2VZSA 1EOMA 3WD1A 4ACZA 1B0IA 3AIRA 4XG1A 2NWSA 4WJEA 2H3BA 1UD6A 3HIJA 3ZR6A 4HGXA 3BLOA 1KO0A 4DWDA 2YB1A 1I9CB 1BQCA 2EKGA 3NQFA 1BEUA 1SSGA 1P0NA 1XUUA 3IJLA 3FYOA 3CC1A 3VGBA 1MEIA 2QUUA 4XKYA 1JUEA 5A8MA 1E0VA 4NF7A 1B3WA 3C8FA 3S9ZA 1KV8A 2D24A 2GGIA 3WF2A 4HYWA 3R89A 2CLKA 4N9CA 4AU0A 4UFJA 3TC3A 5JU6A 3VNYA 4HNCA 3GBEA 5JMUA 1GOIA 2OJPA 1DIDA 4MB1A 4BEUA 1QPQA 3JVAA 3S2CA 2F84A 2WM0A 2WKJA 3I6EA 4RXGA 1OCNA 1CTNA 4UCFA 4L6OA 3UP8A 3RDKA 4PMUA 3VOHA 1EX5A 1FWSA 3TYCA 6TIMA 1XIDA 4FLSA 3NR0A 1B9BA 4AD4A 3W81A 5JH2A 2NUXA 3UZXA 5A1AA 2V5JA 4ZFMA 1Y5WA 3ITXA 3CNYA 3RHGA 5ABTA 3CEPA 2IKJA 1NOFA 4LC6A 1QBBA 5JIPA 3E74A 3OBAA 4JKKA 4E2OA 3FV9A 2V63A 1I1XA 3G1RA 3RNDA 4OOZA 1QPNA 1K1DA 1TTQA 2CLFA 4F4RA 4CD5A 3LM7A 3U5YA 1GYNA 3W75A 2R24A 2W4XA 3GAKA 2A3HA 3M0MA 2FKPA 3PF3A 4D8ZA 1LT7A 3K13A 4A4AA 4DAFA 3L4TA 3LLXA 3N29A 4PL2A 4H3DA 4S3GA 1C8QA 3CWNA 1VIZA 4WDXA 3S2NA 3CHVA 1MQQA 1W2PA 2FZ8A 4HZ6A 3EX4A 3AIUA 4FK9A 1Z48A 3T42A 4PR4A 9XIMA 3W7LA 1IXNA 4Z2GA 4A2SA 3P5ZA 3WK3A 2AL2B 1E56A 2VYOA 5LIWX 1XJBA 2ADAA 1VLWA 1HFBA 4MLJA 1TG7A 2OELA 3CB8A 3UJRA 1YDYA 3HV8A 3NCOA 3A9BA 2ZRZA 1ZBVA 3VINA 1X7IA 2ASHA 4FHAA 3L9CA 1JPMA 3CAKA 4R9XA 1UR4A 3WD2A 4WXZA 3L4UA 4TX9A 4HK7A 4IHCA 1XLIA 2ABBA 3W7EA 3BURA 1ISZA 1XDLA 1PDYA 4XO7A 1XI3A 4KKXA 2WMIB 4KWUA 4KRTA 4FZIA 3DHDA 3WCZA 1UASA 2VFGA 3HM7A 5G4HC 2G37A 4HA3A 3M43A 2BOEX 6TAAA 3KCLA 3QQ0A 1L2QA 1CCWB 1XH2A 4KWSA 3R5EA 1MZRA 2WVVA 3WBEA 3NYDA 4IMGA 2QW5A 3PTQA 1I0DA 3DC8A 3K8KA 3C56A 3EDDA 1PIIA 4U31A 1UZ4A 4RDZA 4K7YA 4D8AA 1GVSA 1ZBKA 2J7HA 1PYMA 2DZSA 4JXCA 3MI2A 1GYLA 3ZLGA 1X39A 3W4RA 4DJDC 2WV8A 5GNZA 4PUNA 3KBMA 4NZJA 3QBUA 2I57A 2J66A 3QYQA 4NQ1A 4NZ1A 2RKXA 5JH1A 3DBPA 1FWIC 1P6CA 3EKLA 1RR2A 1GTHA 1S2TA 1W17A 3FX4A 1I2RA 3CZEA 3B06A 1HL2A 1QI4A 1P0EA 1HNYA 3PUEA 1LOSA 2V30A 1Q6OA 3MY9A 2CCRA 3M47A 3P81A 3CQ0A 4LU0A 1MMFA 2XZ7A 3A47A 3VOIA 4J27A 3SURA 3ZT7A 4K38A 4JEJA 2I9UA 1YE4A 2PDNA 4QSFA 1J2WA 5XIAA 1B4EA 4Q8UA 2HROA 3W7GA 4ATDA 4RDVA 4LXFA 4KGLA 3E9AA 1FDJA 4E8GA 3MCNA 4PMQA 1FP8A 4KPLA 5BWFA 5IBXC 4O15A 4HZ7A 1AL8A 3KBVA 5AC6A 2QGYA 3NYZA 3TJLA 3TLLA 3LGDA 4MY9A 4NVTA 5E5CA 4LVBA 3HO8A 4K36A 4UMAA 3SEPA 4CUCA 2HPMA 1H3GA 3M7SA 3NSMA 2WSQA 5JQ9A 3G0SA 4CN6A 3AMDA 3WH8A 1AG1O 4QROA 3ZLFA 4NIRA 3QC3A 4E38A 2XIOA 3EWYA 4XZNX 4GOAA 2XVLA 4U3AA 1L8PA 7TIMA 5LNVA 3SUSA 1TJ1A 3IUIA 4O52A 2R6OA 3E2SA 5BOEA 2JF6A 3EA1A 3NQDA 3PZTA 1JF5A 3RM8A 5F2IA 1BF6A 3KTSA 4GE8A 3N13A 2ZZ5A 1VHCA 3R43A 3T44A 2VT0A 4LAUA 5GNXA 2J77A 3W1PA 3BANA 3A4AA 3PZNA 3TTQA 3O07A 4XZIA 3FXGA 3M0VA 3TQKA 3FCPA 4BFAA 2VR5A 1GORA 1AA1B 4IQDA 4LW7A 1YPIA 4JIHA 2J6XA 3TNOA 5H2ZA 4A35A 3LBOA 1DQUA 3VABA 1BWKA 1VEPA 1TELA 2O4MA 4J3ZA 3FJLA 1DEDA 1OX6A 4IJBA 1J9YA 4QX4A 3ARVA 4YVPA 1C3FA 4O10A 4CD7A 2V3DA 3TJXA 3W2JA 1IGWA 5HDRA 2NQLA 3AXIA 5C7HA 4EKJA 1YDNA 3V16A 3ECQA 1E9LA 4MMWA 2CLEA 2GQ9A 3IK2A 3NPVA 1V79A 3H2MA 5CPQA 4NNCA 4HHMA 4JIIX 2YBUA 3WMLA 1FA2A 1CDGA 4D8LA 2Q02A 1OX4B 2Y62A 3G3DA 2PTZA 3CASA 5G2IA 1H5VA 3B0VC 1LUCA 1UA7A 4E8DA 1HJSA 5LXEA 1QOPA 1Y8BA 2G3IA 1WPCA 2D22A 3HV9A 2XSXA 3W86A 8TIMA 3OU8A 5EFFA 5D8WA 4GUIA 1W3JA 1TVPA 1J5TA 1IEIA 1OCBA 3LERA 2Z1SA 3VIOA 7PTDA 3APYA 2YW4A 1KLYA 1LLWA 3LD5A 2WAGA 1GJUA 1J12A 1OFAA 3SCRA 4YTRA 3NO3A 4WD0A 1V3LA 2RFGA 1Q5MA 3EX6A 4GI6A 1AQ0A 1UH2A 2W27A 2XPKA 3RJYA 3I3EA 4IISA 4OECA 2ISVA 4PYSA 4RDWA 1T96A 2ISDA 2EPNA 2HBVA 4B5NA 3L2IA 3V5CA 4ORMA 4GUJA 1WXJA 2VM8A 4LT9A 1M5WA 4YXGA 3BPWA 1UUQA 4S3KA 5K3VA 4Q8OA 1NF7A 5IFPA 4X22A 1AUSL 4M80A 1W3KA 2RJHA 3NQCA 3PC0A 3NZPA 2DZUA 2DEPA 4W89A 3WH9A 5CGQA 2JK2A 5I3GA 3CIVA 2FVMA 2BOGX 2BVWA 3TCEA 3GUGA 5LA2A 1RCQA 3DHPA 3QFWA 3DN5A 5DT7A 3CUIA 1H61A 4PB3A 5LKYA 3WYZA 4AD3A 1JAKA 1M53A 1K4GA 1X38A 4Q8WA 3M9YA 3VKAA 3HMJG 1Q8JA 1G1YA 1FWNA 1KKRA 4JCLA 2P8CA 3KW3A 4AMCA 4I9TA 2OZTA 1ZRQA 3P8JA 4IQLA 3SI9A 4P8WA 3S1VA 2PP3A 3IEBA 3EPMA 4FF7A 3URQA 4S23A 1BKHA 2J88A 2G0WA 1BGGA 3E0IA 4E4FA 2DZPA 3VMPA 3N9KA 2TSYA 3PTDA