3ZFHA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
467
structure length
299
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
publication title Structure of Pseudomonas Aeruginosa Inosine 5'-Monophosphate Dehydrogenase
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 101
structure length 299
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zfhA00
1RV8A 1AL7A 3IIXA 4Z08A 4PC8A 2CLEA 3ZFHA 4GFSA 3LLFA 1XBXA 4DXVA 4M5PA 4GUGA 5G5IA 1K7FA 2E68A 4UMCA 1DV7A 2A4AA 1K8YA 3TW7A 1FWTA 3O15A 3EKZA 2FDSA 2BZNA 3PM6A 5BOOA 2BTMA 3G18A 4HKPA 5EA9A 1QAPA 3NQCA 1MO0A 1XI3A 3W2LA 1FWNA 1IGSA 1UJPA 3CHVA 3WK0A 3STCA 4GXMA 1IIHA 3STFA 5DELA 4ADSA 4MUZA 2G96A 4MZ8A 4O1AA 1OYCA 5DCEA 4O1CA 4PL1A 1KTCA 3KX6A 4I7VA 2NWRA 3LCLA 3NQFA 5LGXA 3VCRA 4HNUA 4NVTA 4DQWA 1LROA 4JYDA 4XZ9A 4EF9A 2FLIA 3GDMA 1RPXA 2A7NA 3B03A 2QUUA 2NX9A 2OZ0A 3DFPA 1O60A 4N4QA 4LVAA 5AYZA 3I68A 5CSRA 3GR7A 4IX0A 5LNVA 1LM1A 3VNDA 1VH7A 3N73A 4NZFA 1QCWA 1FDZA 1TREA 3B4UA 1R47A 1N7KA 1JUEA 4N9DA 3LRMA 2R94A 5BNKA 4X9SA 4E2DA 4K7VA 2VELA 2FB2A 3MBDA 1WDWA 3L0NA 3N2XA 3NR0A 3LBCA 4JTUA 3BW3A 1W3IA 3G8EA 5LHFA 3OIXA 1FXQA 3FOKA 2WV8A 5KSWA 3PWAA 5I3FA 1K02A 3NYZA 5G2HA 3SGUA 6TIMA 2FPVA 4YLWA 1W5QA 3Q94A 1K03A 2GJLA 1LBFA 4WD0A 3TV8A 1W54A 3TUUA 2B7OA 2Y88A 5C5YA 5DCBA 4NZJA 1XC4A 2FPYA 4FIRA 4BWLC 3QF0A 1I2QA 2V82A 3LCGA 3RFAA 3TDFA 1EWDA 4AF0A 1ZAJA 4FX8A 1MEWA 3QW3A 3R5EA 3P80A 1SSGA 1YXDA 1OYBA 1GYLA 1OX4B 4C1LA 4DPPA 2DZSA 5IM51 3SSJA 2JK2A 1VYSX 3W85A 4MKNA 5CGQA 1WV2A 2J27A 1Q6RA 2V2HA 3AJXA 4JX6A 1N8FA 4LOCA 1X6UA 3L68A 2A7PA 1OK4A 5AC6A 3S5ZA 4FHAA 1YADA 2YFNA 5F1UA 3L67A 1DBTA 2CLHA 4MLJA 1TRIA 5HJLA 3MI3A 5AB3A 2J9ZA 3IV3A 1KLZA 2Z1BA 7TIMA 1KBIA 2X30A 3TC6A 3HIJA 4WUIA 2ZZ1A 4Y6GA 4LVBA 5HINA 3LTPA 2UV8G 4O53A 1CX9A 5HUPA 5H2ZA 1IIGA 4JY8A 2YCEA 2R91A 3UY7A 3I7QA 3P62A 2CLMA 2ISVA 1FDJA 3GKFA 1HTIA 5AOUA 3C56A 1PE1A 3JS3A 3MMTA 1VYRA 4JTSA 3PAJA 1LRTA 1OFBA 1TB3A 4NNAA 4MZYA 2F84A 3E49A 3SI9A 2ZRVA 4JTKA 4QSHA 1KA9F 1VC4A 5F2GA 1IXNA 2YXGA 2ZZ3A 1A5BA 3PUDA 3LV5A 3BGJA 1SW0A 4K37A 1BTMA 5AHLA 1H7RA 3BG5A 1VQTA 3S5NA 3T44A 1UB3A 4MFEA 3L0GA 4Z1BA 1RQHA 1EPXA 5CZSA 3EXRA 4O4VA 3EWBX 1E51A 4FIQA 1H7PA 1W3TA 4U4MA 1ADOA 2C14A 1ZAIA 3T40A 5MHBA 2JGYA 4LUJA 1G4TA 2Q8LA 3PY2A 2CZDA 5F2LA 4BR1A 5HR6A 1SO3A 1I2NA 1TCDA 3MUXA 3C2RA 3AO0A 3NXFA 1H63A 3S0CA 3E12A 4MPQA 3THQA 3G3MA 3BO9A 3TW6A 1K8XA 3DKJA 2Q3RA 1TQJA 4J9JA 4LVGA 3UWUA 5AFDA 5AC8A 2TSYA 3QMRA 2DZTA 4JR5A 2EGZA 3HG2A 1W31A 5HWNA 4O15A 2NV1A 1YPIA 3W6YA 3QSRA 5HWJA 1TIMA 2OMAA 3FLUA 3DI1A 3G1YA 2NZLA 1QNVA 3S1WA 1AL8A 1ML1A 2NUWA 3OVRA 4OV9A 4Y96A 2DORA 3TJLA 3DFSA 1EX5A 3GKAA 5HUOA 4JTEA 3NEVA 3GAYA 3QEZA 5FF2A 1TQXA 5HR7A 3LXBA 1AW2A 1W8SA 5AYYA 3GX9A 4WY0B 4DF1A 3RLUA 3CEUA 2VFGA 1KFCA 1P1XA 3S9YA 1LBMA 1P0NA 2VC6A 5K9CA 2QF7A 4OT7A 1U83A 4R34A 5AHIA 1V7YA 2WNQA 1LRQA 2X1SA 3NZRA 4K8EA 3EWXA 4PFMA 3BLIA 2WKJA 3A9IA 3KXQA 3INPA 3TQVA 2WNNA 1EWEA 1I45A 1W5OA 3HOJA 4HNNA 5F2MA 2A7RA 4HPXA 4C1KA 3G1SA 3MJYA 3IEBA 3UQNA 4MVAA 2A6LA 3FFSA 1M7OA 4NNCA 4FX7A 2JKAA 1U5JA 5G2WA 1R2SA 2B7NA 4KFPA 1ZJIA 1OFAA 1PHQA 2QUTA 2R8WA 3TQ0A 4L4LA 3I6RA 3UNDA 2Y7DA 3T78A 3S1XA 3FIGA 1F73A 3GAKA 4K38A 4S2CA 2DZXA 4QJ1A 5EBUA 2X1TA 3FKRA 3HGRA 4KWWA 2NXHA 2ATMA 4UTKA 1NVMA 4OQVA 2Y63A 4ADUA 3O6DA 4OGZA 5TIMA 1VCVA 3G22A 1YXYA 2QDGA 4A21A 3LRLA 3IIZA 4IUOA 3LCWA 1KM2A 3C61A 1OFQA 4CQ8A 1A50A 3CWNA 5EPDA 3UWVA 1BWKA 3NQ6A 5KZMA 3NQGA 3NQDA 2CFFA 2VEPA 3EWZA 1VCFA 3NL5A 3P82A 5G4WA 3Q58A 1XUZA 1YTDA 4IWWA 4S2BA 2GUUA 1WOAA 2JBMA 3UZ5A 5D2WA 1MEHA 4CCEA 1B9BA 2Z0IA 2W79A 4UTTA 1DQWA 1L6YA 3W7OA 1DVJA 4LY8A 1VHCA 1NF7A 2Z6JA 3CU2A 3W2UA 1P5BA 1SO4A 3F03K 3RF9A 4TMBA 1TTJA 3DFTA 3G1VA 3W22A 4MJMA 3NGJA 4O54A 4N9CA 2RFGA 3ZR4A 5L9FA 4RZ6A 3RU6A 1GT8A 5AN7A 4HT3A 1JR1A 4O10A 2X1RA 3TROA 3MP4A 3QRHA 2C15A 1SZNA 1KW1A 3TQKA 1LTDA 1F6KA 3DKLA 3IGSA 1O94A 1FQ0A 3PBWA 4A3UA 1R2TA 5C6MA 1XDLA 2CLOA 1VZWA 3U6WA 3S5YA 2I9EA 4TO8A 1SQ7A 1TV8A 4OWGA 4AF0B 5AC7A 3A5VA 1BEUA 3PC0A 1EP3A 4QNWA 2ZRXA 4O12A 5U7SA 3NQEA 1F05A 1L9WA 1Q6LA 3ABQA 3B8DA 2O7SA 3LM7A 3QPYA 3PSWA 5G4EA 3BPWA 3EX3A 3PUOA 4JYFA 2B7QA 1G4SA 2V5LA 4DO4A 2PRMA 3I7RA 4MFDA 1H5YA 4BFAA 3S1UA 3W76A 3H54A 2G95A 2YPIA 4FNRA 3IVUA 4IMDA 2RKXA 3TSBA 4RLIA 4LW7A 1W3NA 2F7FA 4PCFA 2Y6ZA 5L6UA 1YTKA 4ZQMA 2YW3A 4NX5A 3TNOA 4B5NA 4MY9A 4I7UA 3M5ZA 3DZ1A 1GVSA 4O1DA 2FQIA 3PB2A 1EP2A 3O6YX 3QZEA 2QAFA 1W1ZA 3L21A 1SSDA 3QC3A 2J88A 4FF7A 5DXXA 2CLFA 3W2KA 1O4UA 3A22A 4O0KA 2TRSA 1KM6A 1SPQA 3LERA 2DZWA 3NM3A 4AEOA 1JUKA 2X2GA 1HO1A 1GYNA 1O5XA 1EB3A 3VE7A 1ICSA 2LLEA 3DHDA 3QQ1A 4LS0A 5LZLA 1KTNA 1R2RA 3PVFA 1YDNA 2GVLA 4TX9A 3TXVA 4JS3A 3OVQA 2NUYA 4QITA 2VEMA 2V81A 1PV8A 1GTHA 4NJJA 3SZ8A 5D05A 5CPNA 5D38A 1H1ZA 1J2WA 1FXPA 4MY8A 4LRSA 2Y7GA 2A85A 1I2OA 3F4WA 1JVNA 4N02A 4UTIA 1W37A 4UMBA 1RQEA 3GB6A 1QO2A 1TRDA 3BLEA 2WJZA 3TSDA 1PL9A 4DBEA 1KM1A 4PA8A 2YSWA 2QCCA 2XFWA 3UWYA 3IIOA 4UFHA 1FCUA 3TFCA 1RZMA 1SW3A 1HG3A 3STGA 3S6DA 2QCEA 2J24A 5HULA 3DAQA 3NQ8A 4O0ZA 1F6PA 1JRCA 3LXAA 4HNTA 1IXQA 3G0UA 1KLYA 3R89A 4RXGA 1JCYA 2ISWA 1HUVA 2AGKA 3BW4A 1ICQA 4JD4A 3VI2A 3MHUA 3LOTA 4M6PA 3HO8A 2GQ8A 2HS6A 3HG5A 4QISA 5KTLA 5K4XA 1F2JA 3A24A 8TIMA 2QDHA 1VYPX 4FO4A 3EX4A 5FF4A 1AMKA 1T99A 4XKYA 5F4WA 1VJIA 1FUYA 4UTLA 4IPIA 5HNRA 4QNEA 3NL3A 4CNOA 4CCCA 2P0OA 3W7JA 1OF8A 4FXSA 4GWEA 3W1TA 4RK8A 3ABOA 3MHFA 3W1RA 2EKCA 4OBTA 3GXPA 4LT9A 1IXOA 4RXFA 5AHMA 5AYXA 1UUMA 1WQ5A 2G5WA 3NQ2A 3K30A 1JRBA 3LX9A 4O28A 3W7HA 1Z42A 4UUIA 3QJAA 3LV6A 2P1FA 3C4UA 3W7LA 3SGZA 4QM1A 4UTUA 4HNVA 5AHNA 1M7PA 1MSSA 3W7IA 1YLVA 3KVJA 3M41A 3ATZA 5GVJA 5G2IA 4EOUA 2QJHA 3GIYA 1Q45A 3HGJA 3SR7A 2I14A 4E0CA 4WJEA 3PBUA 3SIZA 1SZGA 3CLMA 3DU0A 3WJWA 3W87A 1X1OA 1FCBA 5DLCA 4EIVA 5CG7A 4HHPA 4E2BA 2OT0A 1FBAA 1FCQA 2ZA3A 5D33A 3MYPA 1DQXA 1SUXA 1Z44A 4FNUA 1F7BA 1G7VA 4ZQCA 3W1NA 3HJZA 3ZS4A 2ABBA 1WYIA 3DGRA 4IMGA 1NEYA 2EPHA 1SO6A 2I1OA 3GZ3A 3ABRA 4ZQRA 3PSVA 2HMCA 2ZDRA 4OE7A 1OFRA 4HN4A 2J9XA 4D2JA 3ZWSA 1PCWA 1Z41A 4U28A 1JCNA 1EUAA 1X1ZA 3STEA 3NOEA 5DCDA 3GVGA 3C2OA 4O4WA 5D02A 1TPUA 1KV5A 4ADTA 3G1DA 1W5PA 3KFTA 3U8GA 2QEZA 3EXTA 1AW1A 1W5NA 3LTYA 4UNKA 1JCMP 1FWRA 4JIPA 2XN0A 3LCIA 3N14A 4O13A 3G0SA 2ABAA 1OFDA 2EAWA 4AHOA 3NL2A 2QCHA 2DJXA 3TKFA 4NQ1A 3RNDA 5G1TA 5FEZA 3OG3A 3VKJA 3NPXA 1ICPA 2G97A 4K6AA 3W1QA 3KAOA 4NX0A 2CU0A 2QCFA 1XL9A 1CI1A 3C2FA 3TAKA 3W07A 2Y85A 5FI8A 1VRDA 3P61A 3PBYA 4CCDA 1KV8A 3RK8A 1TPFA 4S1FA 2DZPA 4UMAA 1JCJA 1TPB1 2H8XA 1JQVA 1WBJA 3KVKA 2A5HA 3SJ3A 2C13A 2Y61A 2YGYA 4GBUA 5DXYA 3TFXA 5DY2A 2GQ9A 4O57A 5I3JA 4UR8A 3DENA 3KHJA 2CLKA 4IX2A 5F4SA 4XTIA 4H3DA 2Q8ZA 5BMWA 1MZHA 4IMFA 3LB0A 3N9SA 2PRHA 3LCHA 2WSRA 3P81A 2OJPA 3IIPA 1P0KA 3W7NA 1QFEA 3P7YA 1TV5A 2WSQA 3HB9A 4O50A 3QW4B 3QPZA 4X22A 3QM3A 1ZFJA 3CIWA 2KZHA 5LKYA 3BK0A 2VFDA 4BWLA 1QPOA 4UNLA 1H51A 1ZAHA 1LRNA 1TPWA 2NLIA 3M5VA 3GR8A 1DORA 3BGGA 3UXDA 3MO7A 1I8JA 1O5KA 2HSAA 3EKLA 1J4EA 1L2UA 1SFLA 1H50A 4Y90A 5EKYA 2OCZA 4AVFA 4EWND 4M6VA 2PRLA 4AWUA 3C3NA 1UASA 1ZCOA 3UY8A 4AWSA 2E6FA 2CZFA 3W83A 3G0XA 3P8JA 4Q33A 1J5TA 2X16A 3DFQA 4LWWA 3O63A 1ALDA 3M9YA 4GC4A 4A29A 3OA3A 4TU1A 1JCXA 1EP1A 2EF9A 2Y89A 2PCQA 1GVFA 2RDTA 3KRUA 2E6AA 1TTQA 2ZZ7A 4ALDA 1S5TA 1C9DA 2P10A 1DJNA 1LBLA 1NAL1 4W9TA 5BRBA 3C6CA 1UBSA 3HPSA 3KVLA 2GVGA 3UPWA 4UFLA 1LLZA 5DBUA 4DELA 5F2IA 3A21A 4JTIA 3LHVA 3W72A 1M6JA 4Q32A 2E1DA 1NSJA 1VHNA 4K7YA 4K39A 4PODA 1EEPA 2V9DA 2Y62A 4IGHA 1TPVA 2ZA1A 2V2DA 2YYUA 3BG3A 5K9DA 5J5RA 4WZHA 5CSSA 1LDCA 3N2MA 1ZHAA 4N4PA 3NQAA 2C1HA 4JDBA 2AAMA 4JTJA 3W70A 4PEKA 1I2PA 2NWSA 1WAUA 3WJSA 3C2VA 6ALDA 4LVDA 2C6QA 1VS1A 5I3GA 3NL6A 3SW6A 3CT7A 4UFIA 4IMEA 3W7DA 1THFD 3IRDA 4WQ6A 3W7CA 2ZYFA 3LCXA 4JGDA 3WK1A 1QOQA 1X7FA 2A6NA 2WNZA 3EWWA 5AHFA 1PHWA 3WJZA 5LNSA 1SR9A 3KVMA 1D3GA 3CM4A 4YCPA 4RKAA 3E9AA 3B06A 5K2ZA 2V8ZA 3NQVA 1H61A 1NFBA 3FJLA 3FJ6A 4O14A 1K7XA 3ATYA 1XM3A 1B4EA 4O1BA 2RH9A 2GQAA 5LNWA 2QCDA 3FKKA 2CW6A 3F4NA 5HMSA 3R2GA 4JIQA 5IBXC 3DFOA 4UFMA 3LLDA 2QCLA 3TJXA 2C18A 3M43A 3QQ0A 4L4MA 3HGOA 3VFLA 3UWZA 2NUXA 4ML9A 3B0PA 3BG9A 5KITA 1OFPA 5FF7A 2ISSA 3M47A 1SZFA 5K7JA 3E0IA 1PVNA 2A2IA 1GJPA 1ME9A 4XKYB 5DY3A 1AK5A 5I3IA 4NU7A 1A5AA 4N9BA 3Q2DA 3NAVA 3R8RA 3GK0A 3MBFA 4E38A 4I9AA 4P2VA 3CWOX 3T4CA 5FEWA 1G7UA 3NZ1A 3C52A 1KFEA 3W71A 5D2XA 1H60A 3G1XA 4RZ4A 5CZTA 2VFFA 4TIMA 3TE9A 4EF8A 4X2RA 3O1NA 1KFBA 3L9CA 3G3DA 3F1QA 3W2JA 1L6SA 2HS8A 2IQTA 2YDAA 4LV9A 2HTMA 1VLIA 5C54A 3I65A 4ZVJA 5C2XA 4RX0A 2CZEA 3BW2A 4JEQA 2ALDA 1GVRA 5E0KA 2QCGA 2ZZ5A 3W9ZA 4GUJA 2GJNA 4M6QA 2BXVA 3S8HA 1A53A 4GRSA 1MEIA 3W7KA 2TYSA 1OFEA 4POCA 1SU5A 4WOQA 3BLFA 3W1UA 3MHGA 5FEXA 4DBDA 4HPJA 2ZRZA 2ZZ6A 4GUIA 3I7SA 1JCLA 1K7EA 1TPH1 2YR1A 4NJIA 5ABTA 3W7PA 4ONVA 1T8XA 2V0TA 3PB0A 3FYPA 5D03A 2FIQA 2ZZ4A 3TX9A 3D0CA 4LV4A 4WXYA 5E93A 3UD6A 3M6YA 4JICA 2DU2A 2WQPA 2ZRWA 3M1ZA 2CZ5A 2VFHA 2A1YA 3B0UX 2D73A 1QDSA 1TJPA 4Z0JA 3QYQA 1GWJA 4BF9A 3EEGA 3P60A 2WPBA 3E02A 1TV7A 5CPLA 4YL2A 1D3HA 3B0VC 2FFCA 2GVJA 4JN6A 1QPQA 3P8IA 4RJEA 1FWWA 1XCFA 1Q3NA 1ONRA 4DPQA 4YXGA 4ICNA 3G8RA 1OG0A 5E1QA 4K8HA 1OHLA 3W1AA 1TO3A 3LHZA 3S1VA 1GEQA 3EWYA 4PL2A 4DF2A 4Q4KA 1RD5A 2VENA 3DH7A 5KMYA 4LNYA 2E5BA 2JKEA 1ZY9A 1FDYA 3O6CA 3M44A 4M7SA 3LHUA 3HG3A 4O16A 1KFJA 3LRKA 3W86A 5H91A 1WA3A 3GNNA 5KZEA 5F4XA 3W75A 3R13A 3BVJA 4AWTA 4QIUA 3PBVA 3S5OA 3B04A 4UR7A 2BWGA 1BKSA 5EYWA 4LU0A 4N2YA 1GQNA 3W1MA 3NPUA 3LBMA 3C8FA 4QAIA 5D04C 4CNNA 4AAJA 2E5DA 1S3HA 1FCVA 2H3DA 4NJHA 1S5WA 4XQ6A 5CKSA 3CB8A 1V5XA 3P5ZA 3L0KA 3QFEA 3LI1A 1OF6A 3P84A 3TXZA 4M7TA 4ORIA 3WFAA 4BI7A 4JTHA 4UTMA 3NDOA 4FEZA 1ME8A 2WOQA 1P4CA 3BARA 3W23A 3MW7A 1TPDA 3C0JA 3W2NA 3W2MA 3LGEA 3MP3A 2VEIA 3PR2A 4NXKA 5TBOA 3LCFA 4NT0A 3QSTA 3W7EA 1QR7A 2QUVA 4MLRA 3GDKA 4K36A 2W0UA 2ZBTA 3THAA 4DO5A 1GVQA 3N3MA 3NVTA 4DF0A 4O17A 1A5CA 1VR6A 2C0AA 1TTIA 1DKWA 4HIBA 4JTGA 1W5MA 2PE4A 3USBA 3PG8A 3IGUA 3W84A 3HMJG 1LZOA 1KFKA 1ZNNA 4UC5A 1QPRA 5HQEA 2QAPA 1NF0A 4R7JA 3UZJA 3LHWA 3U2OA 1OX5A 2CLLA 3HGSA 2J6XA 4H4IA 4NUWA 1TSIA 3PF3A 1OVDA 2VFIA 4LC6A 4XBKA 3H55A 2VXNA 4ZQOA 4KFNA 1W56A 4Z1CA 4GUHA 2VFEA 3FS2A 3W1XA 1WBHA 4FNQA 1M5WA 3GDRA 1H7XA 2OX1A 1DHPA 4CLMA 2QCMA 4O19A 5KZDA 2E6DA 3PG9A 3GYEA 3A5FA 3TCEA 4WOZA 1IXPA 5BMXA 1K3UA 3G1FA 1GVOA 4AHQA 2C16A 4ZL1A 2V30A 3H53A 3GXTA 2E5CA 4A2RA 3DHFA 3R12A 4MYAA 1K8ZA 1LORA 5C55A 3W7RA 4LVFA 1G4EA 3QMTA 1XFBA 4I7WA 1H7WA 3TMQA 5CPMA 5A8GA 4AXKA 3W73A 2NX3A 5D2VA 4OHQA 1YDOA 3O06A 3L66A 4UXDA 5I3HA 1C29A 4BI6A 1I2RA 3TSMA 1R30A 3G24A 3P74A 3KRSA 3LDVA 3LXCA 2ZZ2A 3N9RA 3DXIA 2DJLA 2QCDB 3ANYA 5CZJA 1XBVA 1LOQA 3SY5A 3FEMA 1XBYA 3NQMA 1RQBA 4LRTA 2ZFAA 5FF3A 1X8FA 3EWUA 3N19B 1DOSA 1WXJA 2Y7FA 4GE8A 4JX5A 4LTSA 2NXGA 2ATSA 2B4GA 4YWIA 4PH6A 1OYAA 1BWLA 1G69A 3OEXA 3PULA 4JX4A 4AMAA 4KWVA 2RDUA 3WK2A 3NNTA 4JDYA 4AH7A 3QH2A 1QPNA 4BI5A 4KKXA 3FYOA 1T96A 4MOZA 3ELFA 2XN1A 3CPRA 1B4KA 4LS2A 5DN1A 3UYCA 3GLCA 4O18A 3CEPA 1XUUA 4ZQNA 2FTPA 3HBLA 1XBZA 3LTSA 4O8RA 1ZENA 1KM4A 3A23A 3CC1A 2VEKA 2WSYA 1F5ZA 3NA8A 4FNTA 4JXCA 2V5BA 4LS1A 1GZGA 4JY9A 2H6RA 4Y9AA 4UTHA 5I3KA 3GNDA 3ZWTA 2H90A 3QMSA 4IXXA 4XTDA 2QKFA 4ZQPA 1KFLA 3M5YA 2W6RA 5BW6A 1LOLA 1TYGA 3BV4A 3MI6A 4XWUA 1TPEA 4JTFA 3EXSA 4LC8A 4R53A 4JTTA 3M0ZA 5LGZA 3IIVA 1XDMA 2DZVA 3W7GA 2E77A 1VGAA 2YZRA 3CQ0A 4UIOA 4PTNA 1KM3A 3W7MA 4YCOA 4Y8FA 3W74A 1GOXA 5K4ZA 3CIXA 4MZ1A 3YPIA 5D2YA 3HQ1A 2ZRYA 2E09A 5KINA 2TPSA 3MP5A 4P61A 2ZTKA 3VE9A 3HPZA 2DZUA 3NM1A 4DO6A 1HL2A 4RCXA 3L5MA 2BLEA 4NXSA 2AQWA 2B7PA 2DP3A 1VPXA 2QCNA 3TK7A 4O11A 3KOFA 5D32A 3N34A 4O52A 4JNMA 4N9EA 4UTJA 3WK3A 1HO4A 1N55A 4UTTC 3T55A 4TMCA 3NG3A 2ZRUA 4IPJA 1FY6A 4BK9A 3M16A 3OBKA 2FJKA 3JR2A 3GXNA 4Z1AA 2V2CA 1D9EA 2ZCGA 3V75A 3B05A 1TJRA 3OHIA 4WXZA 3L5LA 5K3VA 3MYOA 1GG0A 1PCKA 3T7VA 1EIXA 3O16A 3O07A 2B0MA 3NPVA 4JYEA 2PC4A 4MYXA 2NXIA 1QO5A 1LCOA 1QMLA 2YYTA 2ZQ0A 1KM5A 4CQAA 3OVPA 4KFOA 5U4NA 3UWWA 4ZZ9A 2PURA 4AHPA 5T26A 5D30A 3JRKA 2QJIA 3RMJA 2Z2UA 1H1YA 2R14A 1VLWA 2C3ZA 2CWNA 1CW2A 3M5XA 5AHEA 4R33A 1YPFA 4UTWC 2ZTJA 3SFKA 2FB3A 5D2TA 3WJXA 1T0OA 2QJGA 3O05A 2CLIA 1OX4A 1YTEA 1OABA 1LOSA 3HG4A 1F74A 4UCGA 2OT1A 4GJ1A 2TMDA 4FNSA 5LSMA 3DI0A 5D09A 3E96A 4N6FA 5CZ0A 2JKPA 3SECA 3MWAA 1JULA 5FEPA 2BSLA 5TQLA 5FF0A 5LNRA 2EHHA 1LLWA 2A0NA 2XN2A 5CPOA 2Z6IA 4A2SA 1Y0EA 3WJYA 3Q37A 3EX6A 4YMZA 3TA6A 3PUEA 1DJQA 2O7QA 1UUOA 3EX2A 3NPWA 1TMHA 1SW7A 4IXHA 4GUFA 5DBTA 4ZMGA 1DL3A 2YW4A 2GOUA 1YYAA 1C8VA 1F76A 1QOPA 1OX6A 5D37A 3DBPA 4NJKA 1VCGA 4IOTA 3TH6A 4CNPA 5J5DA 3W7QA 1TTPA 4A22A 3TAOA 4DEFA 1G67A 3IVSA 4FXRA 4HSNA 4MY1A 5F1VA 4UFJA 3P67A 1OJXA 1GG1A 5EY5A 4GNJA 4FB7A 2A21A 3FA5A 1WOBA 1PIIA 1Z48A 1OFOA 3O8AA 4QQ3A 4Z0SA 1Q6OA 5LNUA 5EMUA 1JJKA 1RR2A 1EA0A 3GDLA 3W3OA 2FPTA 3G1AA 2H3BA 3C2EA 4FNPA 1ZALA 4G1KA 3UXAA 4ORMA 1WX0A 4XBSA 4FX6M 1HFBA 4CQ9A 2E6YA 2YX0A 1G4PA 1SFJA 4M19A 2X1UA 3RLVA 1AG1O 4OU1A 4TR9A 4UFKA 3W1PA 1LP6A 3V1PA 3HPXA 3DFNA 4X3ZA 5EL1A 3LHYA 4N6EA 1MXSA 3IVTA 2NV2A 1JQXA 3L2IA 1KM0A 3EB2A 1RVGA 5G1YA 1H7OA 1YDVA 1GPWA 1GTEA 5SWUA 2RHGA 3HF3A 2NX1A 4Z1DA 1O95A 1AW5A 1R46A 2J9YA 4HSOA 4RR4A 1UCWA 4IQLA 2QR6A 4NNBA 3TU9A 3W88A 1B3OA 2BX7A 3KRZA 1I4NA 2ZA2A 1H7NA 4IMCA 1KTBA 2RDWA 3W1LA 2JGQA 3MI2A 1H62A 3TR2A 4UTWA 3LI0A 4H6KA 1JUBA 3M7WA 4MIMA 2C19A 3NQ7A 2VOMA 1B57A 1TPC1 3UWQA 2Y7EA 5FESA 3EX1A 3ABSA 3NO5A 1OK6A 1A5SA 1FX6A 1XXXA 3TC7A 1FWSA 1YXCA 4IJBA 3G1HA 1S5VA 3L5AA 1XKYA 2VKZG 3TMLA 1KBJA 1QWGA 3P5YA 3UPBA 4WX2A 1PS9A 5IBXA 3LHTA 3S42A 2GPTA 3TIMA 4RZ5A 5K9XA 4WY0F 1L6WA 4JTLA 4MJZA 4EVZA 1EUNA 4XUGA 1SZEA 1IF2A 4LUIA 4OV4A 1SO5A 4RV8A 5A5WA 1G6CA 4WY0A 5LHEA 1W0MA 2YFOA 2H8ZA 1Q6QA 2Q3OA 3CTLA 4NJGA 5HWMA 1LYXA 2Y70A 1ME7A 2WO5A 3GDTA 3L65A 4AB4A 3IGXA 3PS7A
chains in the Genus database with same CATH superfamily
2D0HA 3FX4A 1RV8A 1AL7A 2W63A 3QZ6A 1VFHA 1XIEA 4V2XA 3OPSA 4G5DA 1NFGA 3ZSSA 3REQB 1H2JA 4G9PA 2QW5A 3TW7A 3PJTA 3I10A 3EKZA 2FDSA 3DGBA 2EPNA 2G3JA 4BY3A 2V3FA 3UCCA 1MRAA 5JVLA 3ZZ1A 5BXRA 3N4FA 2J4GA 3PM6A 5BOOA 1V0MA 5EA9A 2YCLB 1RLDA 3CS2A 3W2LA 2QJMA 4G56A 3WK0A 3STCA 4JL1A 4GXMA 1IIHA 3O3RA 3KOXA 3STFA 4MUZA 2G96A 4MZ8A 1TX0A 4O1AA 4YU1A 1OYCA 3VGEA 4NAEA 5CC5A 1GYMA 1A3WA 5T91A 2WCAA 3LCLA 1DHKA 3GVWA 4RDVA 2A79A 2PDBA 4EF9A 1XYBA 2XFRA 5LA2A 3GDMA 4ZEPA 5EMYA 1SJBA 3T6CA 1H1NA 2WCSA 5J8LA 3CHFA 3DFPA 2EPKX 3EDJA 1MYRA 4ZO8A 1EHAA 3TCSA 4KRTA 5ABEA 1RP9A 2GUBA 1JZ4A 1VH7A 4QS6A 3K4WA 1VFLA 5BOFA 1N7KA 2I5QA 4JN7A 1XLJA 2R94A 3H4XA 4G2DA 2Y24A 4K7VA 3A3XA 1EQPA 3AHYA 3MBDA 1WDWA 2VD8A 3L0NA 1HIZA 3N2XA 1XLFA 2PGFA 4DX3A 3G8EA 2BODX 2GZXA 1FXQA 3FOKA 1MVYA 5HQMA 5KSWA 3PWAA 3S3GA 1NP2A 3N2CA 1CGTA 1K02A 2VD9A 5G2HA 1DWHM 2BHYA 3WUBA 4BZYA 1IWAA 1T8QA 1K03A 2GJLA 1WZKA 3IJ6A 3AZSA 5B80A 4NZJA 3KEHA 4BWLC 3QF0A 4H9TA 2V82A 3RFAA 3WH8A 4HHHA 4AF0A 1ZAJA 1DEDA 3GHSA 1SSGA 1OGSA 1YXDA 5HQLA 1OX4B 2QV4A 5D8ZA 2WLYA 1RBAA 2XFYA 3GG0A 3P14A 4U2ZA 4DLFA 1Z69A 4JX6A 1KXHA 4E4FA 4PMYA 1N8FA 1XCXA 2VMFA 1X6UA 2DZBA 2GFTA 5BYWA 2W92A 4HA3A 5F1UA 1DBTA 2CLHA 4ZTXA 3MSYA 1X1NA 1ZTVA 4MLJA 1V4YA 3PN8A 5HJLA 3MI3A 2PDLA 1KLZA 3PZTA 3POCA 4GIRA 7TIMA 3U5YA 5C9ZA 4WUIA 3G6MA 4Y6GA 5E9AA 4LF2A 2G37A 7A3HA 4CD8A 2PLCA 3VIGA 3UF9A 3LTPA 4HZ7A 5H2ZA 1CX9A 1IIGA 4H9ZA 3UY7A 2CLMA 2ISVA 1FDJA 4UQAA 2PU1A 2F2KA 5AOUA 3JS3A 3PAJA 2DH2A 4JQ1A 1M9HA 1LRTA 2XIBA 1OFBA 3E6EA 2HBVA 1J2BA 3E49A 3SI9A 1NY1A 1KA9F 1VC4A 1IXNA 4WLCA 1ELSA 2ZZ3A 1GKQA 3HURA 3OB8A 1E9ZB 4BQ3A 1GQJA 1O66A 2R82A 1XIJA 2G4JA 3E3HA 5AVHA 3NJ3A 2WB5A 4JHZA 4BHYA 4HU8A 3N18A 1VQTA 3T44A 2VX5A 3L0GA 6PTDA 1RQHA 3UZXA 4FIQA 4AVNA 5HMDA 1ZAIA 3T40A 3UGVA 4LUJA 3P2VA 2I57A 4ERGA 2CZDA 1TCDA 1GKRA 2WZIA 3AO0A 4RPQA 1TUXA 4PB3A 3NUKA 1NOUA 4LUSB 5CH9A 4EACA 1DJWA 4GG9A 2Q3RA 4P7OA 1QNQA 4BJHA 2DZTA 4JR5A 2EGZA 3QLLA 4O15A 4FLSA 2J75A 2JALA 1EJ7L 2BHZA 1TIMA 2OMAA 1DXIA 3FLUA 1E9LA 3PZMA 2NZLA 3ARXA 1QNVA 4W8AA 1HKJA 4JQ3A 3OVRA 3ITYA 4KCUA 5IHRA 3B3DA 4B2DD 4YNGA 3GKAA 4JTEA 3H7UA 3QEZA 1Q6EA 4CKQA 1AJ0A 3AMGA 4GO8A 3BICA 1AW2A 2V68A 3B0XA 4DF1A 2VFGA 1KFCA 1FH8A 1OC5A 3CUJA 4C6PA 2XM1A 3S9YA 2VC6A 2V3GA 4H00A 3AXXA 3APGA 1U83A 4R34A 3WELA 3S6OA 3FHAA 2WVVA 2ALRA 4PFMA 2BY2A 3KRBA 2WKJA 1TR1A 5CZKA 2GWGA 1CXEA 1AQFA 2ZWZA 3AALA 1I45A 3HOJA 5F2MA 3NWRA 2A7RA 1Q6DA 3G1SA 4JTRA 6REQB 1CECA 4KRZA 4NNCA 1JZ2A 3EA2A 1U5JA 4AD1A 4M82A 4KFPA 3VOHA 5I2UA 2DSVA 1ZJIA 3IAPA 2R8WA 2XISA 5CJMA 3TQ0A 3KTSA 4L4LA 3UNDA 3GU9A 1TJ2A 2HVMA 3Q67A 3S1XA 4Q8UA 4WSKA 4AIOA 4K38A 2WZMA 2PP1A 4DAIA 3QYSA 1OEPA 2NXHA 3DC0A 3SN0A 2Y63A 4ADUA 3O6DA 1KQYA 4OTKA 3WD0A 4A21A 3LRLA 1KGXA 3LCWA 1JI2A 3U4AA 1X98A 3BAWA 1OFQA 4EAMA 3UWVA 3TN3A 1O5QA 4C7GA 2CFFA 2VEPA 3WBWA 3TN4A 3P82A 5G4WA 7XIMA 3Q58A 3K4DA 2CEQA 4GH1A 4WF7A 1WOAA 3CPUA 4HK6A 1PIGA 1QI5A 4PSRA 2AOSA 1B9BA 3M0JA 3N2TA 2W79A 4J3SA 1WKDA 3W7OA 1TVPA 3NDZA 1VHCA 4KWOA 3CU2A 1P5BA 2YCKX 2D3LA 3G1VA 3AXHA 4MJMA 4RE0A 5EMKA 1IV8A 2ZKMX 3ZR4A 1GT8A 1JR1A 4Q8NA 2HDJA 1GHSA 3RLHA 3WLQA 2NLYA 1DJZA 3TROA 3QRHA 2C15A 3NVDA 2QULA 1SJAA 1B3WA 1LTDA 1F6KA 5HNNA 3CMGA 3IGSA 4MWAB 1XRVA 4GY1A 2PMQA 3A64A 3CYJA 2E28A 1UKSA 5G4HC 2XIJA 4MWAD 1SMDA 3A5VA 4O12A 3L2LA 4CQDA 3NQEA 1F05A 4GI6A 1REQB 3ABQA 2O7SA 3QPYA 4HZMA 2PD5A 4JYFA 1R7AA 2INFA 1G4SA 4HMDA 4HN8A 2J7HA 5E70A 4MFDA 4B2DA 3IGHX 2G95A 4GX8A 1R9ZA 1UW9A 3UZWA 3QHOA 4FNRA 3IVUA 3VIFA 3PZUA 1XKJA 2EJ1A 2Y6ZA 3WX7A 3T0DA 1YTKA 5D4YA 5BWFA 4CUCA 4NX5A 3TNOA 1A4MA 2XINA 5AZ1A 1FWHC 4MY9A 4JTDA 4HHLA 2GGHA 1XGEA 2D23A 1P0DA 4TXEA 3S9ZA 2FH8A 3TYDA 3IV8A 3PB2A 1EP2A 3O6YX 4W8LA 2Y5JA 3SRHA 3QC3A 3A12A 3MMUA 3WF2A 3W2KA 2P50A 2TRSA 3WO8A 3LERA 4AEOA 3NM3A 1JUKA 3RJYA 5FAJA 1O5XA 3VE7A 2LLEA 1TZ9A 2IKGA 4WDWA 1KTNA 2P0IA 5EB8A 3PVFA 3B8IA 4OOZA 1DJXA 4TX9A 3QR0A 3BSHA 3OVQA 2RGMA 3CO8A 2CZVA 2YA1A 2NUYA 4QITA 4NJJA 2CLPA 1TG7A 1H1ZA 2D0GA 5ABFA 4FI4A 3HJEA 1BYAA 1QK2A 2A85A 3UJRA 2ACRA 2F6KA 2C71A 1W37A 3PK7A 1U1HA 3CAKA 5HMEA 4DZ5A 3A3WA 1QO2A 2WJZA 2EJAA 3HFTA 1KM1A 2BDQA 3HQNA 3VA8A 2IKHA 3UWYA 4UFHA 5DT7A 1RA5A 2QCEA 5HULA 3DAQA 3A13A 5CLTA 1F6PA 1JRCA 3DN5A 4HNTA 3VNLA 4NZ3A 3G0UA 2ISWA 4J1OA 4C65A 4JD4A 4YTQA 2O4QA 3MHUA 4YHEA 1PTAA 3HO8A 2HS6A 4S3FA 1TR9A 3FA3A 8TIMA 5FF4A 4QEEA 5F4WA 3TYBA 4QJ3B 3ES7A 5LXXA 4MDPA 1UG6A 4RUBA 3G1RA 2J6VA 2KX9A 4CU6A 5HNRA 1Z89A 3U2CA 3NL3A 4CCCA 5LIUX 3W7JA 4FXJA 3GC4A 3OLEA 4DJDD 4LJ3A 2DVTA 2ZC1A 3MHFA 2EKCA 1RCOB 4OBTA 4RXFA 2B31A 3GH4A 3LNMA 5AHMA 4BKNA 3LX9A 3OGVA 1W2VA 4QM1A 4KIRA 3Q45A 4HTBA 4UTUA 3D47A 1DIDA 4WJ8A 1XIHA 1WDSA 2OQHA 2QJHA 3OZPA 2I14A 3PBUA 4Z42C 4Q7BA 1SZGA 1HP4A 3SIZA 3DU0A 3WJWA 1ODUA 1X1OA 2WVSA 1FBAA 3UFYA 3FY1A 4BS0A 5D33A 2ON3A 4AIBA 1SUXA 1YMYA 3EA1A 2R9RA 3U48A 3ZS4A 1XD1A 4IMGA 3WDQA 1SO6A 3H4WA 3H2EA 2I1OA 2MNRA 3ABRA 3GZ3A 3AS2A 4LXFA 4HNOA 3PSVA 5IDZA 2E9MA 2EBNA 3QR3A 5I23A 3WFLA 1X1ZA 4W84A 5DCDA 1UZ4A 3GVGA 4O4WA 1UROA 4K8GA 2VOTA 1W5PA 3G1DA 4OFCA 2QEZA 2KAUC 3TWAA 3EXTA 5FJRA 2Z2BA 3C2YA 1J93A 1XIMA 4LBSA 4DLMA 4NQ1A 5M2FX 5CCZA 1PBGA 1XFCA 4GNKB 2G97A 2ZUMA 1IGWA 4XKMA 3R11A 1EC8A 2CU0A 2QCFA 4TV6A 1XL9A 3W07A 2Y85A 1D8CA 5FI8A 4CCDA 1KBBA 4UMAA 1TPB1 2H8XA 1HKMA 4NF7A 1JQVA 1WBJA 3GH7A 1RA0A 3AIVA 4O57A 5I3JA 4RE4A 3KHJA 1PWLA 2Q8ZA 5BMWA 4IMFA 9XIAA 1OY0A 1E15A 2WSRA 3VIMA 3IIPA 3VNYA 1Z3NA 1VIZA 4ICMA 2WSQA 3AYVA 3QPZA 4MGGA 1QK0A 1ZFJA 4ZXOA 1GCYA 4UNLA 4XG1A 3EDDA 4EK7A 5A6KA 1JF5A 1TPWA 2NLIA 3GR8A 3BGGA 1BSIA 3MO7A 4PUEA 1J4EA 4Y90A 4AVFA 2WMIA 3H24A 1AZ1A 4YYCA 4AWSA 5AYBA 1NOFA 4O8AA 1CXKA 4Q33A 3W02A 4LWWA 3O63A 4PB5A 3OZYA 4AC1X 3OA3A 3WLNA 1LWJA 1A5MC 2EF9A 3W0KA 4OBRA 2CYGA 3H2NA 1C9DA 1DJNA 1LBLA 4TV5A 2H9AB 3HPSA 3M0KA 1WKEA 3H70A 4N42A 5F2IA 3LHVA 2O9TA 3MZNA 2OQLA 3LK6A 5T9BG 1TKKA 4D71A 3PBGA 4URIA 3QTGA 5FJJA 3T2PA 1FWEC 4MNLA 4DWSC 3S2MA 1UWTA 4UCFA 4F9DA 5CSSA 3U3HA 3N2MA 5M3WA 4N4PA 1TA3B 2EG8A 3WDRA 3CHDA 1ZJAA 2J13A 4KS0A 4IH3A 2C6QA 2FJUB 3LCXA 1ZJHA 4EXBA 1X7IA 3MU7A 5GPRA 1JI1A 4TVUA 3H22A 4H1ZA 1SR9A 2OGYA 4NYUA 2A3BA 3IS4A 5EBAA 4RKAA 3B06A 4ZB2A 1ISZA 4Y2WA 6ENLA 4OZOA 4O14A 1XM3A 3QV9A 4O1BA 4GINA 3BLDA 2GQAA 1Q6GA 3FKKA 3GO2A 1QI4A 5IBXC 4UFMA 1CGVA 2R24A 4LUYA 4MMWA 2C18A 3UWZA 5I6SA 2HNHA 5KITA 1JPDX 2HNEA 3SAZA 1PPIA 4PR4A 3AMLA 4Y8EA 4XAYA 3Q2DA 1P0EA 1TWDA 4MNJA 3BZJA 4GNVA 4XAGA 4I9AA 1FWCC 1K6WA 3C52A 4RL3A 1UIOA 1G01A 5FJOA 3G1XA 4KEMA 3TNBA 3HA1A 4EF8A 4Q8TA 4NIRA 4J3WA 1ESWA 2IQTA 2YDAA 3NIYA 4XAZA 2NSOA 1VLIA 2POZA 3GU1A 4H2CA 4ZFCA 3EOLA 1EJUC 4HZ8A 2FVLA 2CZEA 4KRUA 4O0QA 3VGBA 4GUJA 3S8HA 4J7RA 4IGSA 3LA4A 2Z4GA 4MNMA 3RX2A 4POCA 4BEUA 1KB3A 1UR3M 1VF8A 1Q13A 3MHGA 4GUIA 1K7EA 4FR1A 4P8XA 2XIQA 2YR1A 2VDGA 4G7EB 5GJMA 4NKCA 3I3DA 3PB0A 2CXEA 4WCJA 4V33A 1N8WA 5C2CA 4JICA 2VX4A 1E3ZA 2ZRWA 3U9IA 2D73A 4RW5A 2GYIA 3R6IA 4BF9A 3EEGA 3KDOA 2BY3A 2WPBA 1TV7A 3RPMA 2TODA 3U5UA 2GVJA 2Y8VA 1UBPC 4XIMA 2FGLA 3M0VA 3VNJA 2QHAA 1A49A 1XH1A 3RHGA 3BAJA 1ONRA 3URNA 3AHXA 1M04A 5C9WA 3IK4A 1TZ7A 5E6YA 4A3HA 1L0PA 1CT5A 1TO3A 3DFYA 3EWYA 4PL2A 3WBYA 3DH7A 5KMYA 1E1CA 2E5BA 2JKEA 1AZ2A 1KWKA 4AZ6A 2I7GA 3LHUA 3PWGA 1MQQA 2CETA 1WA3A 4GZIA 4LH8A 3W75A 4A3RA 4AWTA 2BOEX 1DYSA 3PBVA 3EDEA 3CAWA 1E6SM 4UR7A 3T0AA 1LF1A 1BKSA 1Z9AA 2PUZA 2ESCA 3NPUA 4N7QA 2Z1XA 2FZDA 3VNIA 3ARVA 1XQKA 2IPWA 1S3HA 1S5WA 1JPHA 3CB8A 2OSXA 4C6OA 1B1YA 1W1YA 3L0KA 4R85A 4GXWA 3MC5A 1FP9A 1EBGA 4UTMA 5EGRA 2REQA 2DPEA 3AXIA 3SCOA 2VRJA 3BARA 3W23A 3W2NA 3C0JA 1SVDA 2OLSA 3QSTA 3GTHA 1PJ9A 3TLQA 3MQTA 2V63A 4K36A 2D2OA 2ZBTA 1GVQA 4O17A 1A5CA 1VJZA 4UNIA 4HNCA 1VIWA 1DKWA 3EOUA 3WLLA 3HMJG 3BQ5A 2WHMA 3SCRA 5HPOA 5HQEA 3ZVHA 2VO5A 3C0LA 2J7FA 3OBEA 3UZJA 3U2OA 2VGIA 1V03A 4IQDA 4AD2A 2CLLA 2J6XA 4H4IA 3GVQA 4WRHA 4AISA 3UA3A 1ONWA 4XBKA 3RR4A 3H55A 4ZQOA 4C6FA 2GDVA 2OYKA 4GUHA 1FA2A 3NZGA 4AUBA 5DF0A 1VBRA 1QVBA 3AWNA 2I17A 3RILA 3WL0A 4CLMA 1G94A 1M01A 3PG9A 3GYEA 1AD1A 3TW9A 4AD4A 5C9RA 1D2KA 3PHAA 4ZL1A 3CV2A 3DHFA 4IGNA 4MYAA 3CL6A 4H6EA 3MSGA 2XSAA 4C6KA 4E6MA 4LVFA 3WH7A 1W3KA 3TMQA 4I7WA 3WMSA 4F2BA 3DYOA 2NX3A 3CMJA 3AU2A 1AJ2A 2D2GA 3CQJA 1H5VA 1MI3A 4LEQA 4CEXC 3PBMA 2J74A 2PZ0A 3UGRA 2NT1A 2GWNA 1DJHA 3T4WA 3N9RA 3K8LA 1FWAC 1QUMA 4ZR8A 3FEMA 2E25A 1PAMA 4E2OA 4FF5A 3GNRA 1RQBA 4LRTA 2EG7A 1M1BA 2ZFAA 3VIJA 4EAYA 3CYVA 5FF3A 4GD0A 1ISVA 1DOSA 4JX5A 1V3IA 4K2SA 1GVIA 2HROA 4JX4A 1EC9A 1U1JA 3RPDA 4CD7A 2WWCA 1XYMA 5TAOA 4EWJA 2FTYA 3GD6A 3QH2A 1OQFA 5E5CA 4JIHA 2GVEA 2OZ3A 1B90A 3UYCA 1EDTA 3GLCA 2XHYA 1C7TA 2ZWYA 2PP3A 2J62A 3IJDA 4O8RA 1CXFA 4LEFA 1F5ZA 1MNZA 3R0UA 3CZ8A 4FPSA 4MWAE 1GZGA 3WD3A 1B5TA 2H6RA 5I3KA 3GNDA 1ISXA 2W66A 4XTDA 3VNMA 3ARYA 1KFLA 3ECQA 1XP3A 5BW6A 3GXDA 4L9ZA 4LC8A 4R53A 1UC4A 2CERA 2WHJA 1RBLA 3IIVA 3MKCA 2ZVIA 2XPKA 4F0MA 1U30A 1VGAA 1WPCA 3ITOA 3NYDA 4UIOA 4PTNA 1A3XA 4MJ4A 4L6HA 3GW3A 1V6YA 4L1WA 3W74A 1XLLA 3TYEA 5K4ZA 3UXIA 3YPIA 5D2YA 4Q4SA 2E09A 5KINA 2D24A 2Z7GA 4P61A 3KUMA 2DZUA 2ZUVA 4P8UA 3NM1A 4P5UA 1LJYA 9RUBA 2DP3A 2QCNA 1FKWA 4C91A 1S2WA 3VUPA 5D32A 3MT1A 1A0EA 4O52A 1W9UA 1VBJA 1HO4A 3MMDA 1N55A 4PMOA 3CJPA 2WBKA 4KBXA 3NG3A 2VEFA 1EOMA 1U5HA 1WXYA 4IPJA 2ICSA 2VDIA 3KLKA 3VOFA 3PZGA 5D9PA 4NSBA 1P0BA 3ZVIA 1S2VA 2J79A 1GG0A 3M4HA 3GRIA 1W9VA 3IJIA 2PC4A 2IXUA 1QMLA 1GZJA 1TFVA 4K1WA 3OVPA 1E9YB 5IXEA 1CB7B 5D30A 1JG9A 4XZLX 1JZ3A 4MB3A 1ZP3A 3AOFA 3N29A 1CW2A 1JPKA 4GFIA 5CGMA 4L7ZA 4R33A 4UTWC 5D2TA 1T0OA 1EYEA 3L4VA 4B3KA 2Y5EA 3N13A 2CLIA 7REQB 2QDEA 1XRTA 1F74A 4UCGA 2OT1A 3ZLFA 4CD4A 1XLAA 2TMDA 3SM0A 3DI0A 1VKFA 1VFSA 1HN1A 3LN3A 1JFHA 4C7FA 3MWAA 5TQLA 1V3MA 2BSLA 5LNRA 2EHHA 2YCIX 1LLWA 3VIPA 2BASA 2RGLA 3WJYA 3Q37A 3TA6A 1N8IA 4H8VA 4C1NA 4JQAA 2VR2A 1SW7A 5HBFA 5DBTA 2IKJA 2VGGA 4PUNA 1BHGA 4EPKA 1FHUA 1J0YA 3DBPA 4IOTA 3TH6A 5J5DA 2XWDA 3LGGA 1TTPA 3BLPX 2QUMA 4MY1A 5F1VA 3GUWA 1A5UA 1OJXA 2ZUNA 4ATWA 1UH2A 1JF6A 4WSHA 4X60A 4QQ3A 1OFOA 5LNUA 4PB4A 1WZLA 1JCTA 3ZM8A 2UY2A 4G1KA 3PZIA 4LAKA 2X1UA 1AG1O 3BAXA 4UFKA 3N2OA 1LP6A 3DFNA 3RLGA 4TTUA 2V5DA 3IVTA 2NV2A 3L2IA 1GOQA 1EGMA 1YDVA 1E6QM 4TVCA 3HF3A 2NX1A 2XGZA 2WZHA 3TTEA 4IHCA 3ONCA 4D8AA 3ZT7A 4HU4A 4HSOA 4RR4A 4GOAA 3DYPA 2QR6A 4NNBA 5LXEA 3RAOA 3TU9A 1B3OA 3DEQA 4LYRA 1K9DA 1DWIM 3TONA 1JGMA 2F38A 1RAKA 2ZA2A 1H7NA 2RDWA 3PUGA 3CWHA 3W1LA 3W4RA 1XLBA 4HGXA 4EPEC 1TUFA 1H62A 3RO6A 1Q65A 3TR2A 1JUBA 1M03A 1M41A 3M7WA 4MIMA 3EDKA 4YJ5A 5IOBA 1F3XA 3CPGA 1OIMA 3VGFA 3OHMB 2EPLX 3VTRA 3AUOA 4AZ7A 1OT1A 2WAGA 1GJUA 1E0WA 1YXCA 4LAOA 3G1HA 1V6TA 4US6A 2WHKA 1QWGA 3SUTA 3CUHA 1PS9A 3S42A 3MCNA 3TIMA 4RZ5A 3ALFA 3F4CA 5DQPA 2XU2A 1SZEA 4LUIA 3GUGA 1V3JA 1B30A 4WY0A 3WQ8A 5HJYA 4QTGA 3W6LA 1W0MA 2H8ZA 1Q6QA 4NAFB 4JOMA 1A0DA 4E3TA 5FSEC 6XIAA 1ME7A 5FAGA 3IGXA 4S3GA 5IFPA 4XBJA 3VYLA 3IIXA 4WKAA 4PC8A 2CLEA 3ZFHA 3DFHA 3LENA 2QLYA 3BLKA 2I9UA 2VEGA 4DAFA 4M5PA 4GA8A 5G5IA 5C0QA 3S6TA 2ZX6A 5M1TA 1DV7A 2VZOA 1FWTA 1TCMA 4HMNA 4XZBA 5D9NA 2DSKA 3F2BA 1ZBWA 4GKTA 2BTMA 1PYMA 1MO0A 1XI3A 1HJWA 1IGSA 3CHVA 4NI3A 1S5MA 3VIHA 4GY7A 4ADSA 1BXCA 1UD3A 1E4LA 2WMIB 4O1CA 1J0JA 4W7VA 4S3CA 3GIQA 5AY7A 3NQFA 5LGXA 3N1AA 2A3LA 4DQWA 1OCNA 3SRFA 4C6EA 4YTRA 1JZ5A 3NZQA 5I3DA 5REQB 2PAJA 2VVSA 3NZPA 4AQLA 1FRBA 2A7NA 2QUUA 1O60A 2VZTA 5AYZA 1JZ8A 4F0HA 4IX0A 1EKOA 1GZ1A 2PF0A 3AZTA 3ME3A 3N73A 4H7VA 1QCWA 1TREA 2Q8XA 3VMOA 4X9SA 2VQUA 2Z1SA 3NQBA 4W85A 4JHMA 1ECQA 4JTUA 3BW3A 1W3IA 4DUVA 2QXWA 5I0DA 3NYZA 2FPVA 1EF3A 1NFPA 3Q94A 1LBFA 2P3EA 4WD0A 2OOGA 1W54A 1QOXA 3JW7A 3TWBA 3TUUA 2B7OA 2Y88A 5C5YA 3VMPA 5DCBA 3NDYA 2FPYA 4FIRA 4B4FA 4PMJA 3WF0A 1EBHA 2PTWA 4IIDA 2BFGA 4GYJA 4FX8A 1MEWA 3QW3A 3R5EA 3CZLA 4IIFA 1XRSA 3UG4A 1GYLA 4O1FA 4L61A 1ZGDA 3VZYA 3SSJA 2JK2A 3WNPA 1R85A 1P6BA 1FWDC 2PBOA 2VWTA 4DN1A 1PWMA 1J5SA 1JZ7A 4A05A 2V2HA 1GJWA 3AJXA 3FSUA 3TN5A 1EJVC 4E4UA 3TZNA 2R1PA 5HMFA 1OK4A 3S5ZA 1BQCA 2YFNA 2V6AA 1EJSC 1Y65A 2PDWA 1PKLA 4DJDC 2PPGA 3VXGA 3GNPA 4M3PA 3ZIZA 3B8VA 1QPKA 2Z1BA 3WEZA 3EOOA 1AQMA 2X30A 1HW6A 2ACUA 1E71M 3TC6A 2ZZ1A 4F79A 4HK5A 4LVBA 4W7WA 3TOPA 8RUCA 5DRIA 3KWXA 1Q2RA 4O53A 4S38A 4JY8A 2R91A 3P62A 1YPXA 3DIPA 1OGBA 3GKFA 3C56A 1PE1A 1F8MA 1QWKA 2G3NA 4JTSA 4YHGA 3PZOA 3E2SA 4JFTA 4NNAA 4A6GA 5ENLA 4ZSUA 3GWQA 4UOJA 4TUFA 2ZRVA 4JTKA 4QSHA 3H2OA 5F2GA 2R1KA 4A8LA 3LEPA 2VR5A 1XX1A 3I6TA 1SJDA 2WC4A 4IPPA 5ABHA 1ECEA 3LV5A 4PTVA 1AQHA 4W4QA 1L8NA 2YIHA 1H7RA 4DM2A 5FA5A 1UD5A 3EXRA 4O4VA 1H7PA 5B7YA 1W3TA 3L4WA 3AAMA 2IPGA 1R3YA 3F5KA 2E3ZA 3GVRA 2PD9A 4B91A 1VP5A 2ACQA 4V1XA 5F2LA 4B9ZA 5CAHA 4X9YA 2VX6A 1AD4A 2PA6A 2OU4A 1V6UA 4MPQA 3THQA 1HJVA 3G3MA 3CQKA 4UWMA 4L4OA 4Q3MA 1IT8A 1KBKA 1TQJA 4J9JA 4PMUA 4CN6A 5AC8A 2TSYA 3QMRA 3HG2A 1AFSA 1W31A 3E38A 5HWNA 3ORWA 4PUWA 1JEZA 2IPJA 1YPIA 3K8MA 2CXGA 3QSRA 1UMLA 5DT5A 3ZJKA 1E6ZA 5HWJA 3SCNA 1BKHA 2P53A 4ZSTA 2NQJA 3S1WA 1AL8A 3HMCA 1X97A 4Y96A 4ZO9A 1Q7MA 3KBNA 5JU6A 1XDJA 3ZYZA 2GSHA 3NEVA 1LWIA 1F61A 4IISA 3AMCA 2FDMA 3CNYA 3VD7A 2P76A 1P1XA 3PZ9A 4DI8A 1W1TA 5K9CA 3BSMA 4BF5A 3QVQA 1JFXA 3CHEA 4OT7A 5AHIA 3O0FA 2X1SA 1CWYA 2WM1A 3NZRA 4K8EA 1TWWA 1E40A 1T5AA 1IZCA 5EFDA 3CV6A 3INPA 3TQVA 4ML4A 4NASA 4W86A 2WNNA 1EWEA 1A5NC 3UU0A 4GYKA 3MJYA 2ZX7A 4C5ZA 4QE5A 2YKKA 1RCXB 4MVAA 1QHOA 1XJBA 2A6LA 3B9EA 3FFSA 1M7OA 3IAQA 4FX7A 5G2WA 3MCOA 3IJ9A 2B7NA 4MB5A 5I77A 1MQPA 2XIOA 3KBMA 4UQBA 2HPIA 2A3EA 3I6RA 4B5UA 1CEOA 4LQ1A 3GC5A 3FHQA 2NQHA 3VAVA 4QRNA 4MKVA 1F73A 3GAKA 5EBUA 2X1TA 3HGRA 2CKSA 5H6HA 4UTKA 1NVMA 4RNJA 4OGZA 1DE6A 3G22A 3A4JA 2VX7A 1W3LA 4ZB0A 2QDGA 4F2UA 4IUOA 2FHCA 1DTUA 1KM2A 3C61A 1A50A 3CWNA 1BWKA 1QT1A 1ZBVA 1VCFA 1R87A 3PFRA 3ZQ9A 3EPOA 2OLAA 2WPGA 5D2WA 1FWJC 4GCXA 1MEHA 4QX4A 3OQEA 2Z0IA 1G5AA 1EL3A 1L6YA 5C7HA 4US5D 1DVJA 3AQUA 2Q02A 3B9DA 2BS9A 3W2UA 4I8YA 4L56A 4QFUA 1G1YA 3SCSA 4O54A 1ZL1A 2UY3A 1IEVA 1WO2A 4RZ6A 3NSMA 1EZWA 3RU6A 3IARA 3O7UA 1OGGA 4GJIA 1OINA 3MP4A 3B9OA 1NELA 2IW0A 4QCFA 3DKLA 1FQ0A 2WLZA 4A3UA 2ZE0A 3T8QA 1CZ1A 1XDLA 1R3VA 4EXAA 4KEZA 4MADA 1VZWA 3S5YA 3W27A 2I9EA 1SQ7A 1TV8A 1YNYA 4OWGA 1WXZA 4DJEA 3LZ5A 1BEUA 4R27A 2JFEX 4I3GA 3M6DA 1JYNA 5FIPA 3PSWA 1KCZA 1WE5A 4GVFA 1XG3A 3EX3A 2Q71A 4RE2A 1I9CB 1ZBKA 3UXKA 1E0XA 2QJNA 1X39A 3I7RA 4PBEA 3W76A 5XIAA 4JIRA 1V77A 2YPIA 3I3BA 4AFYA 4IMDA 2RKXA 3K4AA 3VX0A 3WUFA 2VM8A 4PCFA 1EF2A 5AC5A 3GBDA 4OOUA 4B5NA 4F66A 2ZVRA 3M5ZA 1GVSA 4OKDA 4O1DA 1LL6A 3DDMA 3MJMA 2DIJA 3QQWA 4U5KA 4XAFA 1J0IA 3QZEA 2QAFA 4KGJA 1W1ZA 2ZXBA 3L21A 4KWSA 2ANUA 2J88A 5DXXA 1RXOB 1US3A 3A22A 1RHCA 1D3CA 3HV8A 4KCWA 4N0RA 1EB3A 3GG1A 4F2TA 1YNPA 3CUXA 3DHDA 2PTYA 1XISA 2GVLA 4HCHA 1MUWA 4FOKA 3TXVA 3A6OA 4I5UA 2A3AA 4J3VA 2VEMA 2V81A 2Z00A 3SZ8A 3RYSA 3WG6A 1E55A 1OC6A 5CPNA 5D38A 1J2WA 3WD4A 4LCSA 4LUTA 2Y7GA 1JVNA 3BMVA 1UYQA 2WSKA 1RQEA 1TRDA 3BLEA 3NO3A 2BY1A 1CTNA 2X7WA 1MXGA 3XINA 3S83A 4DBEA 4HK7A 1UZ1A 3WF1A 2YDSA 3ARRA 3SRDA 1RZMA 3BAYA 1SW3A 2PEVA 4CNTA 3N11A 2ISDA 3FYYA 2QPUA 2PWFA 4LBRA 3R89A 4RXGA 3CT2A 1HUVA 3OLIA 4JN8A 3BW4A 4XVEA 4AZIA 1ICQA 3EYPA 4M6PA 4US5A 5BZAA 4AZCA 4QISA 1F2JA 4OUIA 1AMKA 1T99A 3H21A 4Q4MA 1VJIA 1WZAA 2DZAA 4PMRA 1FUYA 1R38A 3IJQA 4J2MA 4D6IA 1DJYA 4IPIA 1C92A 1PUDA 4L9YA 1JDCA 3UP8A 1DJGA 1TJ1A 1CPUA 2Q01A 4FXSA 4GWEA 4RK8A 2NW0A 2ZIDA 4QLKA 3GXPA 1BD0A 4FLQA 4U33A 4AIEA 1IXOA 2RJGA 1UUMA 1WQ5A 2G5WA 3NQ2A 3K30A 3GHRA 1Z42A 3OBAA 4UUIA 3QJAA 4GJJA 4OJYA 4HNVA 4A8RA 5BXTA 4S23A 1JXKA 2O55A 2QPXA 5GVJA 3WL1A 1QASA 1GVYA 1Q45A 4E0CA 1V02E 4WJEA 1NH6A 2DQXA 3BTNA 1P7TA 3HTWA 3CLMA 4LY4A 2PGRA 2VT0A 3AMKA 2MANA 3CUIA 3ITTA 5CG7A 1XYAA 2OT0A 4IG2A 2VWSA 2INZA 1FFRA 4C6JA 1F7BA 4Z17A 3W1NA 2ABBA 1K9TA 2EPHA 4JKKA 1OD8A 2ZUWA 4ZQRA 2HMCA 3DBNA 2VQTA 4H8HA 1KRAC 4HN4A 4D2JA 3ZWSA 1J6OA 4U28A 1JCNA 3WQ5A 4AEEA 4ROPA 3C2OA 4IT1A 1C8QA 5D02A 1TPUA 4ADTA 5DX7A 4W87A 3T42A 4UNKA 1JCMP 1HJXA 3LCIA 1UKQA 3G0SA 2BBFA 3BAKA 3ZLHA 1OFDA 2XFFA 3NL2A 3BOFA 4XAPA 2WXDM 3RNDA 5G1TA 1K9FA 1VEMA 3VKJA 3OTRA 1VFFA 4L1GA 3R10A 4WVXA 1ICPA 3GG7A 5CC3A 2HXTA 3C2FA 3F2CA 2WMJA 1VRDA 2VJXA 2D22A 1TPFA 4S1FA 3RK8A 2DZPA 2WC3A 2JF7A 2POTA 4QS5A 3SJ3A 2C13A 4FMVA 5DXYA 1BXNA 3TFXA 5DY2A 4PMNA 1TMQA 2CLKA 2CKRA 4IX2A 2FVKA 3MDUA 5FSDC 5CBBA 3P81A 3AZRA 3QKEA 2OJPA 1P0KA 3W24A 1OC7A 3HV9A 3HB9A 4HOWA 4X22A 2YLLA 3E0FA 2KZHA 3KZPA 3BK0A 1QPOA 2Z27A 1S39A 4D6GA 3M5VA 1DORA 2PDYA 4L5ZA 3PTDA 3CBWA 5CAKA 2SFPA 1L2UA 4HTYA 1ZJBA 1KO0A 5EKYA 3ZSTA 4M6VA 4MG4A 4AWUA 3C3NA 4B5XA 1WUEA 1X6NA 4Y9OA 3BE7A 3G0XA 3P8JA 5GQBA 2X16A 4GIYA 4DZHA 4RNFA 1AA1B 2OSYA 1ALDA 2HK1A 4IIBA 2DIKA 3OIHA 1FH7A 4R88A 3WQOA 1PIFA 2WJDA 3KRUA 1S5TA 4DY1A 5C2GA 4LAMA 1EJWC 3GTIA 1UBSA 4GQ0A 3S2JA 4DXXA 3CASA 2QUNA 3KTCA 1XRFA 2WKLA 5DBUA 3A21A 4JTIA 1M65A 3SN4A 4U10A 4K7YA 1S2UA 5FKYA 2V9DA 3UERA 1J11A 1O5RA 1TPVA 2X7VA 4Q6JA 2VDHA 2ZA1A 1F4HA 4JNZA 4P7NA 2V2DA 1UZDA 2XSXA 3WQEA 4WZHA 4YIWA 1LDCA 3KLLA 3C86A 4A8NA 1DXEA 3NTYA 1O6IA 1OCQA 2C1HA 4ERAA 2DSZA 3IRSA 2AAMA 4LANA 4JTJA 3RG6A 4PEKA 1A0CA 3SJNA 2NWSA 6ALDA 3C2VA 4LVDA 3PPFA 1B0IA 3NL6A 3CT7A 1THFD 3RCNA 3IRDA 4WQ6A 3NCOA 2DT0A 3EWWA 3TYUA 1UR8A 4NZ1A 3KVMA 3N2BA 3AFBA 1HZYA 5HDRA 3PJUA 4DJFD 4PMDA 1K6AA 2QIWA 6XIMA 3R0DA 3AUJA 1K7XA 3ATYA 4HSHA 1UP0A 2RH9A 4FS9A 3F4NA 5HMSA 3R2GA 4J3XA 3IPWA 4JFUA 8A3HA 2QCLA 1B3VA 3M43A 2EO7A 3I4EA 4ML9A 4S3DA 1X8CA 3B0PA 3BG9A 1OFPA 3NSXA 5FF7A 5JH2A 1ISWA 1SZFA 3E0IA 2A2IA 1ME9A 2PS2A 4IIEA 4XKYB 5DY3A 3K2GA 1AK5A 2J7BA 2ZE3A 3UJ2A 2GQ3A 1A5AA 2DV0A 4N9BA 4CEUC 5E0CA 1JZ6A 3NAVA 3R8RA 3WQ6A 3V18A 3ABZA 5FEWA 3NZ1A 1XSKA 1GPFA 3SUSA 3TC3A 4A35A 4C6CA 1KFEA 4LSBA 4FA3A 1IR1A 4CU7A 5CZTA 4TIMA 3THDA 4X2RA 3O1NA 1BYCA 1E5NA 3G3DA 2E40A 3LLXA 3W2JA 1K4GA 3E0LA 5J04A 3T09A 1POKA 3V5CA 4NP7A 1D7KA 3I65A 4ZVJA 4AG0A 5C2XA 2HCVA 4ERIA 4PULA 2QMJA 2GSEA 3URAA 2QCGA 2YLAA 1CGUA 4E4PA 2PDGA 4IUGA 1A47A 3VM5A 1A53A 2BV9A 4RDYA 1KXQA 4FR6A 4KW2A 1SU5A 5CBIA 5FEXA 4IL0A 1HGYA 4NG3A 2ZOXA 4M1RA 5I24A 1TPH1 1NU5A 4PUUA 4ONVA 2XYLA 1CNVA 4IFKA 2V0TA 5D03A 4Z2JA 1EX1A 1W3HA 5E93A 3PPHA 1MUMA 2X09A 4Z1YA 1RBOB 2CZ5A 3B0UX 3EMZA 2GJPA 3WDJA 2PWDA 3SQMA 1QDSA 3WZ0E 4L64A 4XK2A 4AY8A 1WDPA 1TMLA 4DM1A 4GGHA 3P60A 1BG9A 1A4LA 1JAEA 5KETA 1J0KA 3B0VC 1GOWA 4WKFA 3P8IA 2Y4SA 3OLGA 1K70A 1MUCA 2YBVA 2PDKA 1XCFA 2INEA 4ICNA 2OO0A 3P0XA 4G8TA 2QVHA 5E1QA 1LL7A 3T2QA 1OHLA 1ZPTA 3GQYA 2X40A 3AROA 1R86A 3LBOA 1OWQA 1M7JA 5I03A 3O6CA 3M44A 1J01A 3WF3A 3R58A 3AYTA 4F4RA 2R6OA 3LRKA 5H91A 5KZEA 3DOPA 5F4XA 2DW7A 2VR4A 3EWDA 4DJFA 3B04A 3L7RA 1Y5WA 2VC7A 2BWGA 4LU0A 3W53A 1UR1A 1GQNA 2CESA 3LBMA 4Z2KA 4QAIA 5D04C 4CNNA 4AAJA 2XVKA 4FAMA 1FCVA 4OECA 1PX3A 3MA8A 3QFEA 3TXZA 3FSTA 3FEQA 4M7TA 4ORIA 3WFAA 4Q8PA 3LQLA 1S2CA 2F61A 1DE5A 1O1ZA 3RCMA 3PR2A 5TBOA 3LCFA 4NT0A 3W7EA 2YB4A 2QUVA 3EB3A 2OTDA 1IWPA 4BQ2A 4DF0A 5CPTA 3LU2A 1ZP4A 2AMXA 4ZTYA 1WP6A 4HIBA 1XIIA 3HZ3A 3JZUA 1U2YA 2FH6A 3PG8A 4GIAA 3W84A 4F40A 2PDCA 3VIOA 1YHTA 1DIEA 1ZNNA 4UC5A 3FGCB 3NO1A 4R7JA 4HA4A 1OT2A 2AMGA 1TV4A 1MFUA 1JDEA 3VIIA 5HATA 5MKGB 4NUWA 1TSIA 3PF3A 1OVDA 2VFIA 3V0SA 3WMLA 4HYWA 4KFNA 2VFEA 3FS2A 4XUYA 1FHLA 3SQSA 1H7XA 2OX1A 3FVDA 2QCMA 5KZDA 1ZBCA 4ACZA 2E6DA 2IS7A 1FVPA 3SEPA 5IRPA 3BANA 1IE7C 1GVOA 4AHQA 2X8RA 4LFYA 1K8ZA 1XF0A 5C55A 3CTTA 5F7UA 2J78A 3QMTA 1DWJM 1QU4A 4AXKA 1EJTC 4OUEA 2AL2B 3L66A 4CCZA 4CQBA 3TTQA 1C29A 3VKAA 4JZ5A 3QPEA 4BI6A 1I2RA 2Y0FA 1R30A 2E8YA 1EDQA 3LXCA 3GE7A 4PFHA 3DXIA 2DJLA 2QCDB 4QSFA 1XBYA 2E1WA 3NQMA 4CU8A 5PTDA 1IWBA 3MO4A 4PBFA 4GXPA 3LZ3A 4BQ4A 2FTWA 2XVPA 3EWUA 3CUGA 3N19B 1XIGA 3WQGA 4FP1A 2Y7FA 4B4HA 3EA3A 2NXGA 4WIWA 4GGBA 4YWIA 2E4TA 4PH6A 1BWLA 1G69A 1LL4A 4UOQA 3PULA 3VUSA 4AMAA 4NY2A 1FOBA 2RDUA 3WK2A 4B92A 1HKIA 1Z8AA 4JDYA 4AH7A 5IFTA 3FYOA 1T96A 3FVMA 3LD5A 1GHRA 2XN1A 3AHVA 5DN1A 3CEPA 3VOJA 3GTFA 1KM4A 3A23A 3CC1A 3R0KA 3S5SA 2W62A 2VEKA 3O2LA 3REQA 2DFAA 1UQZA 4LS1A 1E5JA 1I75A 4Y9AA 1VPYA 2H90A 3QMSA 4J3ZA 3USZA 2WZEA 3R94A 5E6ZA 3WDHA 2CIPA 3BV4A 4XWUA 4JTFA 2YCLA 1IT7A 2R1NA 5LGZA 2PWHA 1K4HA 1KM3A 4B5WA 3W7MA 3PZVA 3KOYA 3KHDA 1UP3A 1P6WA 4J35A 4V27A 2HVOA 4Y9PA 1KXTA 3VE9A 1JD7A 4DO6A 1HL2A 3L5MA 2BLEA 1XLCA 3ITLA 4KGLA 3RPTA 2P8BA 1W17A 1VPXA 2W3ZA 2HPMA 1J0ZA 1EOKA 4O11A 3KOFA 4JNMA 4N9EA 5A6BD 4UTJA 2NQLA 3WK3A 1B3XA 3ARZA 4WGHA 4H7ZA 4JQ2A 2ZRUA 2X0HA 1E4IA 1FY6A 3UCQA 3OBKA 1T7LA 3JR2A 4Z1AA 2V2CA 5BRQA 3V75A 4LAZA 1TJRA 3QLDA 4WXZA 2BOGX 5T9CE 1NQKA 3L5LA 3QBUA 5K3VA 3MYOA 3S2CA 3O07A 4WKHA 1YIXA 1V08A 3SCPA 1LCOA 2ZQ0A 4UTFA 1KM5A 4CQAA 5U4NA 3UWWA 4PBGA 2XVLA 2PDUA 3L12A 3OW1A 1Z7AA 2PODA 3WEMA 1ADDA 4E3VA 2PP0A 4I5XA 2CCRA 4DJEC 4LUTB 4RDZA 3O05A 1OX4A 1UWUA 2G8ZA 3HG4A 3TVAA 4GJ1A 3N6HA 3K8KA 3NURA 3UR8A 3VZZA 4MF4A 3E96A 3VABA 2JKPA 3FCPA 3ANVA 2FFIA 4S3AA 2A0NA 4WHBA 2BXYA 1JDAA 2G41A 3PPGA 1XHGA 4DZIA 3EX2A 3NPWA 2ZXAA 1VJSA 2BGNE 2GOUA 5XIMA 2DUXA 4P7LA 1OX6A 1DWFM 5D37A 3UXLA 4NJKA 5A8OA 1K77A 3UA4A 1EIBA 3AIRA 4A22A 1G67A 1CB2A 5EY5A 4FB7A 4GY0A 3HQOA 1K9EA 2JE8A 3WLIA 1WOBA 1VFMA 1RR2A 3GDLA 2VRQA 1ZALA 3WY1A 3UXAA 4ORMA 1QNRA 3ARSA 4XBSA 4FX6M 2NQ5A 2E6YA 2YX0A 4AX7A 1SFJA 4AD5A 3W1PA 3T81A 3V1PA 4LALA 5FD0A 3Q65A 2IXVA 4HOXA 1KM0A 1RVGA 4AZGA 1H7OA 5M03A 1GPWA 3URBA 2RHGA 1R46A 2C79A 1B9ZA 2J9YA 3WKZA 3VD3A 4IQLA 2ZUTA 1V7AA 3DG7A 2BX7A 5AKQA 3JZEA 1BXBA 3U7VA 2FMOA 2OEJA 4M6UA 2XGBA 2GJRA 1UWSA 4H6RA 4LUSA 1CLXA 1CENA 4UTWA 4H6KA 1VB9A 2NVDA 3V16A 4I8DA 3ITVA 1DWAM 4J27A 4KPLA 2XM2A 1W1PA 2HBXA 1XPYA 1OK6A 1A5SA 1XXXA 1FWGC 1FWSA 3CH0A 2D1ZA 4TQTA 3BJSA 4W5ZA 1JAKA 1TX2A 3TN6A 3VFCA 2VKZG 4F3HA 1KBJA 4HOZA 1EJRC 4AXNA 3H2FA 2GLKA 3LUTA 3BGAA 4L65A 4C6MA 4WY0F 2WHLA 1Q63A 1L6WA 2CBJA 3CV1A 4EVZA 1EC7A 1FHDA 2W27A 1A5LC 1XYZA 1G6CA 1W8GA 5LHEA 2YFOA 2Q3OA 5LIKX 1LYXA 3CLWA 3OJGA 3WIJA 2GK1B 1UOKA 4AX6A 2ZXQA 3B4YA 1NM9A 1XS2A 1YBQB 4GFSA 1XBXA 4KCTA 2I56A 2PI6A 1Q85A 6REQA 1UH4A 1R5YA 4GVHA 2E68A 4UMCA 2JQXA 5TF0A 1K8YA 1J0HA 4ZXLA 3ZJ7A 3BUVA 3RXZA 3EMQA 3K1DA 2XVGA 4HCDA 2NSXA 4HKPA 1VENA 2J7GA 4DYEA 2WMHA 2ONEA 3IUHA 4B16A 3V3WA 3BCJA 5DCEA 4ATDA 1GUVA 2O56A 4PL1A 3TJ4A 1KTCA 1E6XM 3GDBA 1Q6CA 4WDUA 5JIPA 3P3BA 2NWRA 3VCRA 4HNUA 1D7FA 1LROA 4JYDA 5DMMA 2PLJA 3SRKA 2V67A 3M0IA 3OODA 3QY8A 4KESA 1RPXA 3B03A 2NX9A 4LVAA 3II1A 2QMKA 4QP0A 1POJA 3I68A 5CSRA 3F5JA 4Q7IA 3VIKA 5LNVA 5M17A 3APYA 5G1MA 3VNDA 3G5EA 4I9JA 1BVZA 2OELA 1S2TA 2RUSA 2O4MA 4N9DA 5BNKA 1ONXA 4E2DA 3KZSA 3B8TA 4FZIA 2VELA 3WLMA 2GJXA 2DEPA 3PTMA 2FHBA 3AIQA 4C60A 1V93A 5LHFA 2QPSA 4D1JA 3SCVA 3T07A 5I3FA 1TV2A 4GZEA 1KC7A 3AI0A 4YLWA 3C8NA 1I0DA 4PN2A 1O1HA 3VC5A 3TV8A 3PFMA 4MWAA 1XLKA 1XC4A 1I2QA 2VP8A 2O9PA 3LCGA 3NEHA 2ZICA 4RNIA 3TDFA 5BU9A 2HJPA 1EWDA 2BMBA 2BXZA 2YA2A 3P80A 2PFHA 2FZBA 4LF1A 1REQA 4ES4A 5IM51 5A6AA 3TZFA 1VYSX 1ITXA 5EMJA 3L4XA 3T0TA 1I0BA 4MKNA 2J27A 5DEZA 4LOCA 2A7PA 1B31A 4FHAA 1FTXA 3F4DA 3AYSA 4DXKA 9CGTA 1RPKA 1V6VA 3M0XA 1KBIA 4FOUA 4HD5A 1CCWB 1CDGA 4JQ4A 3HIJA 1XD0A 3UG8A 4YS1A 3ALGA 5AZ0A 4D6EA 1XPGA 4H9MA 4GVIA 3CUFA 3E5BA 4QJ5B 1GEHA 3QHNA 5HUPA 3BJFA 2YCEA 2YDQA 3I7QA 2ZDSA 3CZGA 5EMMA 5FJIA 1HTIA 4CVUA 3RDKA 3MDWA 3MMTA 1VYRA 2C8NA 4MZYA 2F2HA 1B3YA 5I07A 3PZQA 2F84A 3ARUA 3ZT5A 3WNKA 4JEJA 1JYVA 4K3ZA 4DHGA 3CAVA 1V0LA 4DWSB 4YPJA 1UR0A 1SW0A 4YTSA 2GDQA 4GKLA 2BVDA 1E72M 5AHLA 3A4XA 3BG5A 3KL0A 2NT0A 4Z1BA 5I78A 3EWBX 1E51A 2YXOA 1GW1A 1JGIA 1F07A 4U4MA 1Y5VA 1EZ2A 1JDFA 3PY2A 3WUEA 3IACA 3MUXA 3C2RA 1YEYA 5HNUA 4QG9A 3S0CA 1BF6A 3TTYA 4TVDA 3C0SA 1JPIA 3TW6A 1K8XA 4LVGA 3UWUA 1EYWA 4X63A 3GNOA 3VDCA 2O9OA 1AJZA 4HQVA 2NV1A 3KW3A 4MB4A 1R3WA 3VD5A 4XD5A 2BGSA 1HKWA 5A2AA 4BA0A 3DI1A 3G1YA 3S1GA 2NUWA 1ML1A 4OV9A 2DORA 3GVVA 3HPFA 1EX5A 1YE4A 3BMWA 4DJDA 3GAYA 1TQXA 1FWIC 5H8UA 1SMAA 1W8SA 4ILSA 3WDPP 4YTTA 5AYYA 3GX9A 1UKOA 3RLUA 3CEUA 1S46A 1HGWA 3ITCA 2E0PA 1LBMA 1G9HA 4JKMA 4J2PA 2CC0A 1C9WA 2QF7A 3M0MA 2Y8UA 3VNZA 2EKGA 4M0XA 2BY0A 3EWXA 2OX4A 3IK2A 3A9IA 3UG3A 3E2VA 1W5OA 3DG3A 3IJLA 1M68A 4C1KA 4HPXA 2CWXA 3IEBA 2NQZA 3UQNA 1ITUA 3GH5A 3N17A 1E56A 3BLLA 1UWIA 2L5HA 3ABXA 2OPJA 5FOOA 3O0KA 4OIFA 3VCCA 1UR4A 2Y7DA 3T78A 1DXFA 3P93A 4D6JA 1QTWA 1JD9A 4QE1A 1HQTA 2DZXA 4QJ1A 3FKRA 5TD4A 1XYCA 4NAEB 1VFUA 1UMYA 1VCVA 4XISA 3MV11 4EE9A 4GZ7A 3ZLGA 4JBRA 1YXYA 1KCXA 4D6FA 4GCAA 4GH3A 4CQ8A 3H23A 5EPDA 1OSEA 4QHRA 1GW9A 2A3HA 3NL5A 4D8LA 2OGJA 1NDZA 1YTDA 4RNHA 4S2BA 2JBMA 4CCEA 1C91A 5CGTA 2IPFA 4LY8A 2ZX5A 4MNKA 4Q8OA 2Z6JA 3BQ6A 4HPGA 3F03K 3RF9A 1OZQA 4TMBA 3DFTA 1C7SA 3NGJA 2Q6ZA 3VK5A 4DJFC 2J77A 1JYWA 4O10A 1W1B1 2X1RA 3H2AA 4PEEA 2VVNA 4Q4OA 4DIAA 3HQPA 3WDIA 1BWVA 3CL7A 1O94A 2J8TA 5C6MA 2WMKA 2CLOA 2WBGA 3U6WA 1HF6A 2VCBA 5MF5A 4XD4A 4AF0B 4MJ2A 5A95A 5AC7A 1FWBC 4PCSA 4QNWA 2RDXA 5U7SA 3WYZA 3W29A 3VGHA 4UZUA 4DBUA 3LM7A 4I6KA 4PRTA 1MDRA 2HRWA 1W91A 3VINA 3LNPA 2B7QA 4DO4A 2PRMA 6CGTA 4IMAA 4AZBA 2PC8A 5A8QA 3H54A 2OZTA 1KCKA 3VDAA 4M29A 2GGIA 4LNCA 4LW7A 1W3NA 5JH1A 2F7FA 3OZMA 5DO8A 3KOWA 2H9AA 1UWAA 3KOZA 4LGXA 3FAXA 4PMXA 3DZ1A 4DYJA 4MAVA 2FQIA 4QEHA 1O7AA 3GHTA 2QGYA 4QG6A 3MUZ1 3MKKA 2PU0A 4FF7A 2CLFA 1MZRA 1SPQA 1TA3A 1GYNA 1PX4A 3QQ1A 1SFTA 4KEUA 4HU0A 3HPAA 5CC7A 1CXIA 4ECLA 1QHZA 4REQA 2YBUA 1DP0A 4GQRA 4TTGA 4X61A 4FSAA 5D05A 7ENLA 2R1MA 3LM3A 3BSGA 1V6WA 3VPLA 3PNUA 1KKOA 1I2OA 3F4WA 3WLRA 4UMBA 3TA9A 1PKYA 4BCEA 3TSDA 4X2PA 2X42A 2W4XA 2GUYA 4PA8A 2YSWA 2QCCA 3GXMA 4LX4A 2Y1HA 4H6QA 1FCUA 4LYQA 1HG3A 2HE5A 4GMEA 3S6DA 3SBFA 1PKMA 2VI0A 1RK6A 2J24A 4O0ZA 3KBJA 5HXMA 4H7CA 3ONBA 2GOKA 1KLYA 2F6XA 1NQ6A 3CAQA 2OODA 1P1MA 4B90A 3KBSA 2IQDA 2GQ8A 3CK5A 4ZOCA 3GHUA 3HG5A 1DPMA 5K4XA 3AS0A 2QDHA 5HA7A 3EX4A 1H4PA 2VHLA 3B9NA 3GFZA 1Y7VA 1WKYA 2UY5A 3BAIA 2G50A 3ISIX 4QNEA 2DDXA 2WCGA 2P0OA 5D9OA 3W1TA 2NQ9A 1QNPA 3ABOA 2DIEA 3UJEA 1JL8A 1UKTA 1KRMA 4LT9A 2V3EA 4ZA0A 5AYXA 3PTKA 5A2BA 3WNNA 3W7HA 2WW5A 1PB0A 4QROA 4IPNB 2GVYA 3LV6A 3BH4A 3RX3A 2WVVB 3C4UA 3SGZA 2XUCA 3VCNA 1CLKA 5AHNA 1MSSA 3W7IA 1YLVA 1BSLA 3G77A 5G2IA 3SUUA 3GIYA 4XZNX 3G6LA 3HGJA 1K1DA 1A3HA 1E1FA 2JEPA 5A6MA 3W87A 2E67A 1FCBA 4EIVA 3TEVA 3UZYA 4MPKA 1BPLB 1FCQA 2ZA3A 5DMNA 4G7EA 1G7VA 3HJZA 1WYIA 3WCZA 1HVQA 1NIUA 4DI9A 2ZDRA 1OFRA 2BB0A 5LYRA 1EO5A 2WVUA 3STEA 3NOEA 1GQKA 1UOZA 1YRRA 1KV5A 4JAWA 3U8GA 1W5NA 3LTYA 4AIUA 3AXKA 3QKZA 4JIPA 2Z29A 4NILA 2XH4A 2QCHA 4HPNA 2DJXA 1UR9A 1TIWA 3TKFA 1ZZMA 2BG5A 1XH2A 4IIHA 1BRLA 3DUGA 4PMVA 4NX0A 1H49A 3EB4A 3MSRA 4IPLA 1CI1A 3BZGA 3V5FA 5FL0A 4QG8A 5I09A 5CXPA 3P61A 3PBYA 3M0HA 4S39A 3CQIA 3SFWA 3HN3A 3BLOA 1JCJA 3N4AA 1W32A 3QZAA 2FZ9A 3KVKA 2A5HA 3BCDA 2Y61A 2YGYA 2VC5A 4GBUA 3VDBA 2GQ9A 4UR8A 1NWSA 1ZB5A 3DENA 3ZR5A 3VOIA 5F4SA 4XTIA 4CN1A 3OYXA 1G0CA 4DUWA 3QGVA 3TYZA 1FWFC 4Y7EA 4ZBCA 4EXQA