3ZFHA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
467
structure length
299
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas Aeruginosa Inosine 5'-Monophosphate Dehydrogenase
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
total genus 101
structure length 299
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zfhA00
4PODA 2NWSA 4DO6A 1C8VA 3A22A 5AYXA 4MOZA 3EWUA 1SFLA 4JGDA 4K7YA 4K39A 4OWGA 4CQ9A 1WOBA 1EA0A 1PCKA 4JTLA 3QFEA 3QPZA 4K37A 5DXYA 1W5NA 4O1BA 1ME8A 4Y90A 5FEWA 4WUIA 1H1ZA 4AMAA 1WQ5A 3PB2A 4TX9A 1OX5A 2Z0IA 2PURA 1A5AA 4M7SA 4A29A 2TSYA 3TR2A 5E93A 3W7GA 5E1QA 2PRHA 3W2LA 3TXVA 2EHHA 1ME9A 3BARA 3S1XA 1IIHA 3CB8A 3TDFA 3HIJA 2DZSA 2WNQA 1TV7A 3I7QA 5I3GA 1H5YA 1ZJIA 4MFEA 2QCGA 4JYEA 1EP3A 3R2GA 1RZMA 1EB3A 1VLWA 2V8ZA 4IXHA 2Z1BA 3P67A 2Z6JA 3M44A 2B0MA 3W71A 1JULA 2X2GA 3FJLA 4LS1A 3S5YA 2FJKA 1TPUA 5DXXA 2ALDA 5AC7A 5D09A 5C2XA 4JEQA 3G1XA 3KOFA 1R2SA 2ABBA 2A6LA 2A5HA 1VS1A 2BWGA 1G4PA 3O06A 1K7FA 2W0UA 1SW3A 1Q6LA 3TXZA 3SSJA 3DGRA 3OVPA 3B0UX 3TC6A 2ZZ1A 5F2IA 2ATMA 2RHGA 3T7VA 3P84A 5DCDA 4MLJA 2E5DA 4Z1DA 3HQ1A 1AK5A 3TFCA 3BGGA 3CWOX 3SW6A 3BPWA 2QUTA 4XKYA 3TW6A 3LTYA 4IPIA 3TFXA 4Z1BA 3A23A 2WNNA 3HJZA 3NGJA 1Q45A 3CC1A 2VFIA 4HNNA 1XUUA 4JICA 5HINA 4JTJA 2YPIA 1AMKA 3LTSA 1QO2A 1TTJA 5I3FA 1DJQA 4UMCA 4Q32A 4A3UA 3BK0A 3MI6A 2GVLA 1KFBA 1QDSA 4NXKA 3CLMA 5DCEA 2WSYA 3WK1A 3UPWA 4CCEA 1I2NA 2EAWA 3MHFA 1H50A 4M19A 1YDVA 2ZRUA 1T8XA 5HR7A 2R8WA 3NQFA 3DHFA 4QSHA 1UB3A 1ZNNA 3G0UA 2VEKA 4JTGA 2YGYA 3HGSA 3KXQA 1ZENA 4XUGA 1JCMP 4UTWC 3GXTA 1JRBA 1NF7A 5EKYA 5EBUA 3M5XA 1OJXA 2BXVA 3HPSA 4DPQA 2BTMA 3L5LA 2C14A 1OF6A 4N4QA 5D05A 1B4KA 3HMJG 3M7WA 4QISA 1W5OA 2AAMA 1SSDA 2CLIA 4O17A 1GZGA 1FXQA 3STEA 4N6FA 2E6FA 3P62A 3SI9A 3N9RA 4Z1AA 1AG1O 3HF3A 1F2JA 2ZRWA 3N2XA 5F2LA 4JTUA 1Q6OA 3E0IA 3QRHA 1S3HA 1QAPA 4AHPA 1TIMA 2NUYA 1OF8A 4DXVA 1OFQA 4O50A 3WK0A 3T55A 3FLUA 3L65A 3I65A 2V81A 1M7PA 1FDJA 3DFPA 2X16A 4FNPA 4UTTC 1JCYA 1GPWA 1WAUA 2ZBTA 3PR2A 1FWWA 2NXIA 1L2UA 1IXQA 3UWZA 1GYLA 4LVFA 3B8DA 1D9EA 3G1DA 4NU7A 1SW0A 4BI5A 2VFDA 1G7VA 1GVSA 4PC8A 3O63A 2YXGA 2H8ZA 1NEYA 1OG0A 4FHAA 5EYWA 1LDCA 3EXSA 4KFNA 3CQ0A 3STFA 4WX2A 4NUWA 3QPYA 2WJZA 5H91A 3WK2A 1MEIA 3TX9A 3CU2A 5CZTA 4C1KA 3IIZA 1GVOA 1IF2A 3AO0A 3NQAA 1H61A 3G1YA 4BR1A 3W6YA 3G0SA 4MUZA 1R47A 5BNKA 4IX2A 4ALDA 2ZCGA 1G69A 5HR6A 1LP6A 1YTDA 4NJIA 1ME7A 3W1QA 5D2VA 3HGOA 4JTEA 3W7DA 3I7SA 3PB0A 2EPHA 1FDZA 3W75A 1VLIA 3LCFA 1SPQA 3D0CA 3M16A 5DY2A 1HL2A 3TQ0A 2A7PA 4H4IA 1SZEA 2VEMA 3OG3A 3L68A 1PCWA 1KFCA 3W1MA 4TMCA 3NQDA 1R30A 3ZS4A 1CX9A 5DELA 2NUWA 2NZLA 4U4MA 1OYCA 5LKYA 1RQEA 4OBTA 3P5ZA 3TK7A 3L0NA 3STCA 1KTCA 3U6WA 2NLIA 5DLCA 2Y7GA 1KLZA 1WX0A 3V75A 3ZFHA 3R13A 1SU5A 3LCXA 4JDYA 2Y88A 4O1AA 2A6NA 3P8IA 3HBLA 4LW7A 4GUIA 4IMDA 5D2YA 2CLOA 5CPOA 2A0NA 4WD0A 2V30A 5DY3A 3UWQA 1F6KA 3P5YA 4QNWA 5EPDA 2V2CA 3KVLA 1OABA 3IGUA 1TTPA 1HTIA 1TTIA 1THFD 4UTMA 5TQLA 4JX4A 3M47A 4DF0A 3I7RA 5HUOA 2NX1A 2VKZG 3O07A 2H8XA 1JJKA 4ORIA 4JDBA 3ANYA 2HTMA 3QZEA 2DZVA 3TAOA 3NVTA 4RZ4A 4QAIA 4IQLA 3WJYA 4FEZA 1G7UA 3STGA 3W7RA 3PF3A 4NZFA 2OJPA 3DI1A 3BO9A 3A5VA 4O12A 2P0OA 1E51A 1XXXA 3UNDA 3NPWA 1A5SA 2KZHA 2QAPA 4Y9AA 3TU9A 3PBWA 4O19A 4UR7A 5EA9A 5G4EA 4J9JA 4LY8A 4LVAA 4GUGA 4LUIA 1QPOA 3NDOA 3QMTA 3W07A 5CPLA 3TC7A 4K7VA 1YLVA 3S1WA 5CSSA 2H90A 3N14A 5KZMA 3PWAA 1DHPA 2B4GA 4ADSA 5K3VA 5FF3A 4O4VA 1ZALA 4NT0A 1XC4A 3MYOA 1F05A 4JTIA 3MP5A 4CQ8A 4HT3A 2W79A 3B0PA 5AC6A 2QCFA 5CPNA 2EKCA 2PRMA 5G1YA 3BG3A 4PEKA 4BF9A 2DP3A 2QCHA 2QR6A 2C0AA 4HN4A 4L4LA 1EP2A 2NUXA 4JTFA 4R53A 1TYGA 3NL6A 1FWRA 4O15A 1PV8A 1OVDA 2QEZA 1QO5A 1XFBA 4UFHA 1LROA 4HNTA 4M5PA 1HFBA 4WOQA 3C2OA 2CZDA 2NX3A 1O4UA 3R5EA 5KSWA 3L66A 2QDHA 1BEUA 2QJIA 2CZEA 4ZQMA 1KV8A 4ORMA 1JQXA 1YXYA 1FY6A 4OQVA 1TPH1 1JCJA 2ZA3A 3P7YA 1PVNA 1LTDA 1WOAA 5L6UA 5FESA 2GQAA 4XZ9A 3ABRA 2YCEA 4LOCA 5I3HA 1RVGA 4I7WA 1UUOA 3LGEA 2VELA 3H54A 4MPQA 3THQA 4GJ1A 3C6CA 4O53A 4DF1A 2JGQA 3Q94A 1SZGA 4XTDA 1ZCOA 2ZA1A 4IMGA 3QC3A 1O5KA 4HPJA 5F1VA 1KM0A 4AEOA 4ZZ9A 5D02A 5DBTA 3T4CA 1J4EA 4Y8FA 2ZRVA 1F7BA 3DFSA 2NWRA 3C56A 1PS9A 3C61A 2W6RA 3NQVA 3CEPA 3LRLA 1L9WA 1Z42A 3GXNA 5K9XA 3W1NA 3VNDA 2FDSA 4N9DA 2ZA2A 3W1AA 4UNKA 3EXTA 3LHYA 4HKPA 4UTLA 4UTHA 3NNTA 1PHQA 2ISWA 3NL2A 4RKAA 4MLRA 4N2YA 3LERA 1DBTA 4LRSA 3W74A 5IBXC 3VFLA 1IXOA 4MYAA 5AOUA 1DL3A 2Y6ZA 1KM4A 1VQTA 4O28A 1G6CA 4IPJA 1G4EA 3NR0A 3W1XA 3NA8A 3NL5A 3W7OA 5A5WA 2ZDRA 5G2IA 2B7NA 5I3JA 1LRNA 4JXCA 3CIXA 3PBUA 1TJRA 4UC5A 5G2HA 1ZHAA 5D2WA 1Q6RA 1LORA 3GB6A 4TO8A 4FNQA 4KWWA 4JYDA 1Z44A 1PL9A 3FIGA 1K3UA 4TU1A 2RDUA 3EEGA 3ZWSA 1S5WA 3TV8A 4MZYA 4KKXA 4DELA 3O1NA 3W1UA 1RD5A 3DENA 4OGZA 3NAVA 3PBYA 2GOUA 3N34A 4UR8A 1OFBA 3BGJA 5HULA 4NXSA 1TRIA 4LVDA 2X1UA 3G1AA 3GDKA 2GJNA 1SZNA 1TJPA 5LNVA 4YWIA 3R89A 3GXPA 3IGSA 4POCA 2V2HA 4QQ3A 5LHEA 2C15A 4RX0A 2I14A 2OCZA 3MI3A 4R33A 1GQNA 2GQ9A 3DH7A 3HGRA 3W1PA 4UTTA 1D3GA 2VC6A 1JVNA 1X6UA 1U5JA 4FX7A 1AL8A 3GIYA 1V7YA 2G97A 3NQMA 3UWWA 4TMBA 2X1SA 5LNRA 1LBMA 1ICPA 3S8HA 2YYTA 2R14A 3UY8A 3NQ6A 3W72A 3TJXA 2J9ZA 3W7EA 1JRCA 1QPRA 4O0KA 5BMWA 3Q37A 2D73A 3UZJA 1VCGA 3OVRA 5HQEA 4MJZA 5BOOA 4AHQA 1P1XA 1TPB1 1W31A 2C1HA 3QMRA 4LT9A 2DU2A 3EX4A 1X1OA 5LHFA 3LHTA 2J27A 3R8RA 1G4SA 4E2BA 3HB9A 1VC4A 4RXGA 4O8RA 4UFMA 5D38A 2RKXA 3G22A 2X1TA 4ZQRA 3TE9A 3UD6A 3LTPA 4Z08A 4NJKA 3C2EA 1SSGA 1GVRA 1K7EA 2QAFA 2ZZ6A 1U83A 1R2RA 1A5CA 3EX3A 4I7VA 1ML1A 4DEFA 1JUBA 4FNSA 3P8JA 1AW5A 3W1RA 4FO4A 3SGZA 2WSQA 1K8XA 1T0OA 3L0KA 3I6RA 4GUJA 4GC4A 4CCDA 1LOSA 4JD4A 3G8EA 5A8GA 4O18A 5BW6A 1ALDA 3G0XA 3GK0A 2FTPA 2C18A 4O13A 2B7QA 5EY5A 1H1YA 3NG3A 5D30A 3TJLA 2CZ5A 4FNTA 4AWUA 4N6EA 5CPMA 5F4WA 4A21A 2QCDB 1N55A 2ZTJA 2JKAA 4JX5A 4UFJA 2YFOA 5G5IA 2Y61A 1PIIA 4HIBA 3BW4A 2DZPA 4CNOA 1T96A 4EIVA 1YPFA 2DJLA 5C55A 3W7IA 5MHBA 3JR2A 1YXDA 4GWEA 1SQ7A 4UMBA 1TPVA 1JUEA 5G4WA 5CZ0A 1X7FA 3TAKA 4AHOA 4P2VA 3TQVA 1YADA 3DBPA 1N7KA 3UPBA 3L21A 3N73A 1GJPA 3G1SA 2R94A 3LXAA 3PULA 5KITA 2QCNA 4AF0A 2CLKA 4O0ZA 3RMJA 1R46A 1PE1A 4E0CA 4O52A 3W7PA 4FX6M 4NNAA 3LHZA 5GVJA 1FDYA 3GAKA 1C9DA 4OU1A 3T44A 1KM6A 1AL7A 2BLEA 5F4XA 2ATSA 3FYPA 4FXRA 4LNYA 5LNSA 3MHGA 1OFAA 3F4WA 2H6RA 2R91A 3W87A 2J9XA 1H7RA 4A22A 2V82A 2V5LA 3CPRA 4MZ1A 5LNWA 1VPXA 4PL1A 3UZ5A 4HNVA 3MJYA 1NF0A 1P5BA 3KVJA 8TIMA 3V1PA 2QKFA 1MO0A 3G3DA 1LZOA 2CLFA 1CW2A 3GX9A 2WV8A 3WJWA 1B9BA 1TPFA 1TV5A 4OV9A 1BKSA 3S42A 1ZFJA 2RDWA 2E5CA 1O60A 2YYUA 2E6DA 2E09A 2QUUA 4HHPA 4WZHA 4N4PA 3MW7A 1F74A 4GE8A 3LM7A 4K38A 3PBVA 2YW4A 1TTQA 1H7XA 5AB3A 2B7PA 1BWKA 1OX4A 4HSNA 4MZ8A 2NX9A 4H6KA 3F1QA 1F5ZA 1B4EA 2FB2A 3M41A 1H51A 5I3IA 3EXRA 1W8SA 1VYSX 4MVAA 1NSJA 3FOKA 3NQEA 1N8FA 3GR8A 3ZR4A 1LM1A 3CM4A 3W84A 3M0ZA 1EUAA 4MY1A 2DZXA 3QMSA 4IOTA 2E1DA 5C54A 1YPIA 4JS3A 5FEPA 2NV1A 3DFNA 4GXMA 4GRSA 2Y7EA 4O54A 4Y96A 1WXJA 3O15A 1NVMA 5HWMA 3ABQA 4R34A 4DO4A 4DPPA 3UY7A 3QM3A 2O7SA 1UASA 1LCOA 2WOQA 3DFOA 4JX6A 4M6QA 4NX5A 4NZJA 4KFOA 2VEPA 4IMCA 3CHVA 2C13A 4JY9A 1T99A 1TCDA 1QNVA 3WJSA 1WBJA 3IIOA 3TSMA 4E38A 3DI0A 1DJNA 1YDOA 4QM1A 4X22A 3NPVA 1HUVA 1X1ZA 4Z0JA 1VRDA 3BG9A 3A21A 1D3HA 3QSTA 1QR7A 1WV2A 2J9YA 5KMYA 3LRKA 4LRTA 5AHNA 4ZQOA 2DZTA 2G96A 3IEBA 4AAJA 2ZZ2A 3PUEA 1TB3A 4P61A 3NPXA 3M6YA 3C8FA 3MBFA 3LLFA 4NNBA 1O95A 1EWEA 4Q33A 3O16A 2NXGA 5AFDA 3L0GA 1H7OA 5F2GA 1ICQA 3O6YX 4S2CA 4L4MA 1GT8A 4XWUA 1FWSA 3LX9A 2ZRXA 3M1ZA 3FJ6A 1MXSA 3NYZA 4N9BA 3TMQA 2IQTA 1YDNA 1W3NA 3W3OA 1ZAJA 4O16A 3W76A 4QIUA 4PTNA 4K8HA 1ONRA 4RZ6A 5HWJA 5KZEA 1QPNA 2YW3A 4K6AA 4R7JA 1OK4A 1XL9A 1SR9A 1TQXA 4JTTA 2V5BA 5EMUA 4O10A 2TRSA 4GUFA 3M43A 2X1RA 3IIVA 4DBDA 3LCGA 1EUNA 4N9CA 2WO5A 3F03K 4A2SA 3L2IA 2QUVA 3W7CA 5J5RA 4ADUA 3W23A 3O6CA 1V5XA 2CLEA 4LTSA 2GVGA 1XKYA 4YXGA 1MEWA 3T40A 1FUYA 3NZ1A 3UWVA 3LV6A 3OHIA 2ZZ7A 2CWNA 5HJLA 1RV8A 3TSDA 3LI0A 4BI6A 4IWWA 3W7JA 2CLHA 2UV8G 3TW7A 3DXIA 2GVJA 2A4AA 3NQ7A 4HPXA 3PSVA 3S5NA 1GOXA 1LOQA 2XN2A 3TKFA 1A53A 1W3IA 3GVGA 5LNUA 1QWGA 3TSBA 3UQNA 1W1ZA 3HG2A 3W2NA 3GR7A 1TQJA 3LBMA 2I1OA 1ZAIA 4UMAA 5DN1A 4GUHA 1PHWA 4IMEA 4JTHA 3ABSA 3LHWA 3B4UA 3M5ZA 4JR5A 3GYEA 3MMTA 5CKSA 3B05A 2FIQA 3GNNA 1KM1A 3IV3A 1LRQA 2QCEA 2C19A 2GUUA 3TQKA 2HS6A 3IIXA 3RU6A 3RLUA 1VCFA 2AGKA 4M7TA 4ZL1A 1ADOA 2JGYA 5FF4A 3C2RA 4Z0SA 3PUDA 3SY5A 5LZLA 3GDLA 3LXBA 2FB3A 4I9AA 2F84A 5K4ZA 3C4UA 1F73A 3JS3A 3CWNA 5HMSA 5EL1A 2TPSA 5FI8A 3DFQA 3LCIA 3EB2A 3DKLA 1KFJA 4XTIA 4XBSA 3W7KA 3EX1A 4YCPA 4K36A 2JKEA 3F4NA 3Q2DA 5U7SA 1UBSA 4XKYB 3RLVA 1H7WA 3KHJA 5AN7A 3MI2A 1FCQA 1KA9F 4RXFA 6ALDA 1I4NA 3QW4B 2CU0A 4AXKA 3LHVA 2O7QA 1SO3A 3NQCA 3MHUA 1QCWA 2DJXA 2QJGA 4WJEA 5TIMA 2PRLA 1GVQA 1HO1A 1XUZA 1ZY9A 2ZZ5A 2H3DA 3W9ZA 3TH6A 1L6SA 3W7NA 4HSOA 5IM51 2RH9A 3EWZA 5TBOA 5KTLA 5F1UA 2P10A 4RZ5A 1S5TA 3Q58A 1Y0EA 3EX6A 2A7NA 1I8JA 3W2UA 4DQWA 5LGZA 3C0JA 4IJBA 4U28A 3WK3A 4RR4A 2RFGA 1S5VA 3KFTA 3IVSA 4MYXA 3HPXA 4W9TA 4WOZA 4MY9A 1G4TA 3UWUA 4JN6A 5DCBA 4BWLC 5SWUA 5LSMA 1VYRA 4BFAA 1I2RA 2GJLA 3FEMA 3YPIA 3P61A 2CW6A 1BWLA 1MSSA 3EWYA 1EIXA 1H7PA 2VOMA 3W70A 1Q6QA 1JUKA 1ZAHA 4JTKA 4UNLA 1DQXA 3QQ1A 4MIMA 2Y7DA 2PE4A 4PH6A 5G2WA 4UXDA 2WPBA 3B04A 3LCHA 2DZWA 2E5BA 3P82A 3MO7A 5IBXA 3N19B 1K03A 3TCEA 2BSLA 6TIMA 3OIXA 3QEZA 3VE9A 5K9CA 1EWDA 3MWAA 4QITA 2JK2A 4K8EA 1AW2A 2ZQ0A 3N2MA 4Q4KA 5FF7A 1G67A 4JTSA 3A5FA 1FWTA 1UCWA 2E6AA 1KM5A 4JNMA 1TMHA 2OT0A 3W2MA 1WDWA 3H55A 3L9CA 3BLFA 3LLDA 4JIQA 2VFGA 1QFEA 3W73A 4ONVA 3MP3A 3H53A 4JY8A 3FFSA 1SW7A 3NL3A 4FNRA 2E68A 2QCCA 1KLYA 5D03A 3W7QA 3LXCA 1OHLA 2V2DA 3DU0A 1OX6A 4O57A 2J88A 1JQVA 1TPEA 2BX7A 2XFWA 4M6VA 1VGAA 3U2OA 3VE7A 1OYBA 3GZ3A 5AHFA 5AHLA 3SR7A 2Y89A 3NEVA 4DF2A 1OFEA 3S5OA 1GG1A 2A2IA 2V9DA 3QW3A 2G95A 5D2TA 1FBAA 2NV2A 3BV4A 4A2RA 4GNJA 4O1CA 3VI2A 4G1KA 2WNZA 5KZDA 2FFCA 2XN0A 7TIMA 2BZNA 2E6YA 2Y85A 1OFDA 3VCRA 4D2JA 3EWXA 5FEZA 1TV8A 3W2KA 5LGXA 2WSRA 2JKPA 4FIQA 4O14A 1OYAA 3NM3A 3JRKA 5E0KA 4DO5A 4AVFA 1F6PA 3BVJA 2LLEA 3W22A 1KW1A 3PG8A 3M5YA 4DBEA 1GWJA 3OVQA 3SFKA 2CLLA 3PY2A 2I9EA 3B06A 1WBHA 3G3MA 5D04C 5K7JA 1VJIA 5D37A 4S1FA 2CFFA 1VHNA 4NJGA 4FXSA 5FF0A 2A1YA 3QQ0A 3P60A 3GKAA 4YLWA 3B0VC 3O6DA 3ATYA 3CTLA 1XBYA 2C6QA 1Z48A 5AC8A 3DKJA 4MKNA 3L5AA 1FWNA 2F7FA 1VYPX 4TR9A 4MFDA 3K30A 1I2OA 4RLIA 1QOQA 2ISVA 3M9YA 1JCLA 4FNUA 5I3KA 1YYAA 1MZHA 4M6PA 3LB0A 2ZZ4A 3ATZA 4Y6GA 3IRDA 4UFLA 3TNOA 3W85A 3W2JA 3WJZA 1EX5A 1O94A 1W5QA 5CZSA 2Y62A 3PG9A 3C2FA 4X2RA 1XBXA 1DKWA 1A50A 4LV9A 2QCLA 3IGXA 3M5VA 4ML9A 4N02A 5D2XA 3OEXA 1I2QA 1TSIA 3PUOA 5AHMA 2YX0A 4AB4A 3RNDA 3CIWA 3AJXA 3W1LA 4EF8A 1NAL1 1XBVA 5CGQA 1WYIA 1FCUA 3IVUA 1K8YA 2RDTA 3FA5A 2YFNA 3TROA 4WXYA 2Z2UA 3N9SA 3WJXA 2FPYA 4E2DA 2YZRA 1K7XA 1XI3A 2TYSA 2Q3OA 1VCVA 4X9SA 3GDTA 1UJPA 3LDVA 4YCOA 3L5MA 3G18A 4WQ6A 1RR2A 4LVGA 2QJHA 3BG5A 1DV7A 1H62A 3B03A 3PAJA 3W7HA 3CT7A 4BK9A 4O1DA 3G1FA 1L6YA 3QF0A 2Z6IA 4HNUA 5K2ZA 3LHUA 1CI1A 3EX2A 4WY0B 3RF9A 4EWND 5BMXA 4ZMGA 3W83A 5FF2A 5HUPA 3TIMA 1LBFA 4LC6A 4TIMA 2VFFA 1MEHA 4WY0F 3THAA 4UTWA 4QNEA 3EKLA 1TPC1 3GKFA 3HG4A 4NJHA 3MUXA 4RJEA 1H7NA 2QF7A 4H3DA 5BRBA 2A7RA 5FEXA 1K02A 4ICNA 1LLZA 4RV8A 1RQHA 1TREA 2OMAA 1GTEA 3IIPA 3NPUA 4I7UA 5ABTA 2ZYFA 1W5PA 2YSWA 1IGSA 4BI7A 1HO4A 1R2TA 3G1HA 3GNDA 2J6XA 4NQ1A 5CZJA 4OT7A 1P4CA 3A24A 1TO3A 1XDLA 3DFTA 3LI1A 2VXNA 2Q3RA 2Y7FA 1WA3A 1GEQA 1F76A 1IIGA 1W56A 1GG0A 5AHEA 1LYXA 2C16A 3GDRA 3NXFA 1KM2A 3W7LA 1W3TA 4PCFA 4PA8A 4PFMA 1KFKA 1M6JA 5T26A 4IUOA 1KFLA 3NQ8A 5CSRA 4FB7A 4B5NA 1JCNA 3FKRA 3GAYA 4YMZA 2A85A 3MP4A 1EEPA 2PC4A 4RCXA 5F4SA 2WQPA 2A21A 3R12A 4UUIA 1L6WA 3C2VA 3TUUA 1VH7A 5U4NA 3G8RA 3P80A 3SGUA 1W37A 1EPXA 3RK8A 1X8FA 2DORA 1FCBA 2H3BA 1SO6A 3HG5A 1H63A 1C29A 3EKZA 2GQ8A 2P1FA 3HG3A 3LBCA 2ZTKA 4LU0A 5AYYA 3KVMA 3DAQA 3RFAA 2PCQA 3A9IA 3S0CA 4GFSA 2J24A 4UTKA 5G1TA 5AHIA 2WKJA 3KRUA 2X30A 4UTIA 3L67A 3LRMA 1DQWA 4UIOA 4UFIA 3INPA 5D33A 1VHCA 4O11A 1W5MA 3O8AA 1BTMA 5C6MA 1JR1A 2HSAA 4NJJA 3E49A 2NXHA 5KINA 1FX6A 1TPWA 3PM6A 1QOPA 1IXPA 5C5YA 2ZRZA 4O4WA 4BWLA 1H60A 1NFBA 1OK6A 4FIRA 1SO4A 1J5TA 4ZQNA 4JYFA 1M7OA 4FX8A 3ABOA 4IX0A 1SFJA 2EGZA 3UWYA 4UCGA 1I2PA 1UUMA 2FQIA 4UTJA 2XN1A 1FXPA 3SECA 2G5WA 2CZFA 1W0MA 2Q8ZA 4ZQCA 1TRDA 3IVTA 4X3ZA 1VR6A 4MY8A 4XQ6A 4IMFA 1QMLA 3HO8A 2Q8LA 3W88A 1HG3A 4AWTA 3QYQA 4N9EA 3GDMA 4CNNA 1RQBA 1OFPA 1EP1A 3ELFA 1LLWA 4Z1CA 3W1TA 3W86A 1FQ0A 3PS7A 2OT1A 3E9AA 1YXCA 4QJ1A 3QH2A 2ZFAA 3E96A 4CQAA 2CLMA 3MYPA 3LOTA 4GBUA 1W54A 2VFHA 4ADTA 1RPXA 2ISSA 3BW3A 4RK8A 3NO5A 1DOSA 3E12A 1A5BA 5H2ZA 3USBA 1K8ZA 3FYOA 1JCXA 2HS8A 3EWWA 2EF9A 1KM3A 2JBMA 3TMLA 3CEUA 2DZUA 4IXXA 3ZWTA 2VFEA 1AW1A 4LC8A 3SJ3A 2FPVA 2Y70A 1SO5A 4KWVA 2AQWA 1OX4B 3T78A 5HNRA 3NZRA 3BLEA 1O5XA 4CNPA 1ICSA 1FCVA 3S5ZA 4YL2A 5CG7A 3S6DA 2QDGA 1KBIA 2Y63A 3S1VA 4OHQA 4EOUA 4KFPA 4OE7A 3G1VA 1B3OA 2ZRYA 3N3MA 1KTBA 1P0KA 3UXDA 1XM3A 3S9YA 3PSWA 4EVZA 1GVFA 2C3ZA 1DVJA 3GLCA 5K4XA 5AYZA 4LV4A 4WXZA 1Z41A 5DBUA 5F2MA 4LWWA 1M5WA 1B57A 2FPTA 3HPZA 4CCCA 3HOJA 5HWNA 3FS2A 3EWBX 4OV4A 2YDAA 3C3NA 1DORA 1SZFA 3KVKA 1KTNA 2FLIA 3C52A 4LS2A 3P81A 3QJAA 4PL2A 2HMCA 3NQGA 4ZVJA 3PVFA 3HGJA 4CLMA 3NOEA 4UFKA 1YTEA 2YR1A 3OBKA 3QSRA 1IXNA 1J2WA 3SZ8A 2E77A 4JIPA 4MJMA 2OZ0A 4FF7A 3UYCA 3KRZA 4XBKA 3G24A 1LRTA 2VENA 1LOLA 3I68A 5J5DA 3WFAA 1XBZA 1GYNA 3DZ1A 1XDMA 2B7OA 4AF0B 1OFRA 1KFEA 5K9DA 3FKKA 3O05A 4S2BA 4LS0A 4LUJA 1QPQA 3UXAA 3BLIA 5L9FA 1KBJA 3S1UA 4AH7A 2VEIA 4ZQPA 1VZWA 4NX0A 2V0TA 2TMDA 3OA3A 3MBDA 3PC0A 1SUXA 1I45A 3LCLA 1XCFA 3KAOA 1Q3NA 1TPDA 3TA6A 3VKJA 3SIZA 3E02A 4IGHA 4AWSA 2OX1A 3LCWA 1YTKA 2ABAA 2ZZ3A 4C1LA 1OFOA 1KV5A 2GPTA 2QCDA 4UTUA 3DHDA 3BW2A 4NVTA 4LVBA 3NQ2A 3W7MA 3LV5A 3NM1A 4WY0A 5D32A 3KX6A 3KRSA 4EF9A 3P74A 1LBLA 1P0NA 1GTHA 2QCMA 4NNCA 3U8GA
chains in the Genus database with same CATH superfamily
4KPLA 2DSUA 4ROQA 3PPHA 4MOZA 1G94A 4CQ9A 1JYWA 4TTUA 4JTLA 4Q8PA 4ASTA 1UP2A 2XVLA 3T0AA 3APYA 5DMNA 5A8OA 2PLMA 3A3HA 4WUIA 4HTYA 4Q6XA 3WNKA 1H1ZA 3JVAA 1GW1A 2Z0IA 3EMQA 3PK7A 3TN4A 4M7SA 3OTRA 1D8CA 3TR2A 3C3UA 5E93A 4JNZA 1ECQA 1EGMA 2EHHA 4C6KA 3TWAA 3E6EA 1IIHA 3CB8A 4RDYA 4HOXA 1QI3A 3I7QA 1QJWA 3HV8A 1EP3A 1MW2A 4MGGA 4LAZA 4LF1A 1VLWA 3SB0A 1VJSA 3P67A 4PRWA 4HZ6A 1TG7A 3FSTA 4OIFA 1XH2A 1JULA 4NZ1A 3FJLA 4DZ5A 1PXGA 1TPUA 5DXXA 2FZ8A 2ALDA 3AYTA 2ABBA 4DWSA 2A6LA 1GGOA 2A5HA 3KEHA 3TTEA 4WKFA 3ZLFA 3SSJA 4H8NA 2WKLA 2ZZ1A 2ATMA 1WO2A 5DCDA 3W0KA 1ZJHA 1RCOB 2D3LA 3SEPA 4MJ4A 4Z1DA 2WZTA 3ALGA 4LUTB 3BPWA 4OTKA 3AXIA 3RLHA 3CUZA 1KCLA 4H8UA 3OIHA 6REQB 1RHCA 4MWAB 4D6HA 3HURA 5CEWA 2VFIA 2FMOA 3THUA 1UW9A 3F5JA 5HXMA 3LTSA 1DJQA 4UMCA 4Q32A 3WF1A 3OQEA 3UA3A 3SRFA 1IEWA 3E38A 3KP1A 1PUDA 1XLKA 3I6EA 1QDSA 2QDEA 3CASA 3M0KA 2WSYA 3WK1A 1KXHA 5M5DA 4JIRA 1LWJA 5A69A 1PZ2A 2EAWA 1H50A 1YDVA 5A6KA 1CENA 3BOXA 2RAGA 2A3BA 2PWVA 4PUMA 1UB3A 2PI6A 3KWSA 1OCBA 1ZENA 3SUWA 3C2YA 1G01A 3UR8A 1JRBA 4KWSA 3FAXA 1CXEA 1GOWA 3M5XA 2BXVA 4HU4A 3HPSA 4DPQA 3GNPA 4LYQA 2BTMA 3N15A 1QATA 5D05A 3N2TA 1EQCA 2G8ZA 1W5OA 2AAMA 3A6OA 4PCNA 2PP0A 3EYPA 1U5VA 2DV0A 2E6FA 6XIAA 1OGGA 4FLSA 3QHOA 1AMYA 4Z1AA 2O9TA 3HF3A 1PWLA 3N2XA 5F2LA 4JTUA 1QAPA 2P3ZA 2GFTA 2NUYA 2PS2A 1V77A 4DXVA 4JTAA 3CUHA 4OOZA 2WLZA 3T55A 9CGTA 6PTDA 4FR1A 1E1CA 2V81A 1M7PA 3GXFA 2OVLA 3DFPA 5GNZA 2X16A 4FNPA 3FDKA 4UTTC 1V3IA 2ZBTA 5TNVA 4GJJA 2NXIA 1RLCL 3KUMA 1L2UA 1GYLA 4LVFA 3B8DA 4M3PA 3G1DA 1ZPTA 2WHJA 2VFDA 3NURA 1OG0A 4FHAA 5EYWA 3OZPA 1EA9C 4WX2A 4NUWA 3UGVA 3QPYA 2WJZA 1MEIA 1NDWA 3FXYA 4P7QA 4F0SA 4W7UA 2Z28A 3ALFA 3G0SA 4MNLA 4BCEA 5HA7A 1BKHA 3VPLA 3GG8A 4ALDA 2ZCGA 1K4GA 5HR6A 1K9TA 1YTDA 4QQUA 3W1QA 5B7YA 3HGOA 3G6LA 2QW5A 3W75A 1QXLA 5DY2A 2BBFA 2ISFA 2A7PA 4A35A 3ABXA 1S2UA 3LMZA 2PDMA 4H4IA 1SZEA 2VEMA 3OG3A 3L68A 5EMYA 2C1IA 1XLHA 2WXDM 4PGLA 1JZ5A 1E9IA 2IMRA 1F07A 1UZ4A 4V1YA 4KS0A 4OBTA 3W37A 5EU9A 4GI8A 3PZUA 3WNOA 4HSHA 4XVEA 1KTCA 3RCYA 4O1FA 4L4OA 2NLIA 1WX0A 2VM8A 4RDWA 3R13A 1SU5A 4Q8UA 4JKKA 2A6NA 2CESA 2ADAA 1XLAA 3AU2A 4MDOA 4GFIA 3E0FA 4V33A 4QNWA 4H04A 3KVLA 1BAGA 1OABA 3IGUA 1THFD 3VK5A 2EPNA 4UB9A 4JX4A 3I7RA 4NIRA 5HUOA 2NX1A 3O07A 5LXEA 3VMNA 3NVTA 4RZ4A 4QAIA 5LIWX 3SN4A 1LLOA 4IQLA 1UKSA 5IXEA 2VD9A 5KETA 2GWNA 1QOXA 1V3KA 1A5SA 4CVUA 3L4UA 2KZHA 2QAPA 4Y9AA 2XIJA 3TU9A 5DO8A 5EA9A 1KR0A 4LUIA 1QPOA 2YLLA 2D0HA 4LB3A 1RA5A 2HQAA 2DUAA 4EK7A 4ILSA 3RMEA 4JTIA 3QR3A 3FK4A 2DUXA 1Y5WA 3FY1A 4PEKA 5FIPA 2BY3A 2DP3A 2QR6A 2CHNA 4L1XA 4HN4A 5HJXA 4JTFA 3U4FA 1BVZA 1VPQA 1PV8A 2QEZA 4J2PA 3CZ8A 2PPGA 3WF4A 4A8NA 4L6OA 2CZDA 1D2KA 3R5EA 1JGMA 3L66A 2QDHA 3ARXA 1F3TA 3CAWA 3WQPA 2PC8A 4D8AA 5I77A 1JCJA 1AODA 4PFHA 1R3WA 7REQA 2ZA3A 1PVNA 4OKDA 5FESA 4R5EA 1W3JA 2GQAA 3ABRA 1V6TA 2YCEA 3LGEA 2X0HA 2VELA 3H54A 4NRSA 3THQA 3S46A 1LJYA 2JGQA 4J3XA 1ZCOA 2I5GA 2X7VA 2E0PA 1C7SA 4PCTA 3FA3A 3GIPA 1EJ7L 4Y8FA 4G7FA 1EBGA 3DFSA 3T07A 1XS2A 1PS9A 4CGTA 4U5KA 2W6RA 2Z1WA 3AQUA 4Y8EA 1L9WA 3K8LA 4W93A 3ZOAA 4MF4A 3VNDA 4QBXA 4P8XA 3EXTA 4UTLA 2PDGA 3W6MA 4BQ5A 4UTHA 1H41A 5XINA 1KRCC 4JIIX 4RKAA 3LERA 3W74A 2YA0A 3VFLA 3CJPA 3QR0A 4MYAA 5AOUA 4PMNA 4GI6A 1SMAA 3QGAC 3O3RA 3D3AA 3WENA 4B5XA 1DIEA 3W7OA 5G2IA 1KRAC 2B7NA 4JXCA 3CIXA 1TJRA 1NOUA 3VO0A 1VP5A 2GUBA 3TNBA 1E9LA 2YBVA 1TV4A 3CBWA 2W66A 3QHNA 2ACUA 2C1GA 4FNQA 2QVNA 1Z44A 4PTDA 5HANA 2RDUA 4A3QA 1XLGA 1VFFA 4XZIA 1JNDA 4QEEA 2IXVA 4MZYA 4KKXA 1DWGM 1PKNA 4KBXA 4W7WA 3SADA 3DENA 2HK0A 3MQTA 5CC7A 3PBYA 2GOUA 2PTDA 1EKOA 3ZJKA 3I3DA 4CU7A 1TE6A 3T2PA 1TJ1A 2BXZA 1NU5A 2Y5EA 2PDJA 4RX0A 5HNNA 1E0VA 3CO8A 4DYJA 1GQNA 3A47A 2FTYA 3VOFA 1JVNA 4UZSA 9RUBA 4IH3A 1AL8A 3NVDA 2ESCA 4DIAA 5HMFA 2G97A 2Z1SA 3DHUA 1H2JA 3UWWA 1S3TC 2X1SA 5XIMA 1XX1A 3S8HA 3MDUA 2YYTA 1AJZA 3R25A 4XO6A 3TJXA 3KLLA 4PR4A 4X2PA 1QPRA 2D73A 3UZJA 1VCGA 5T9BG 4MWAC 1P1XA 4R88A 1W31A 3QV7A 3K2GA 5LHFA 2ASHA 3LHTA 2VZOA 2J27A 3BAKA 3MO4A 4A6GA 3APTA 2ZX6A 4RXGA 3MKCA 2OSYA 1T8QA 2XPKA 1FTXA 3EDEA 3NOYA 3IPWA 1NOWA 1OZQA 2PWEA 3WQ4A 4C5YA 4Z08A 4NJKA 1MNZA 2ZZ6A 1KNWA 1U83A 3TJ4A 1JDDA 3MT1A 3E0LA 4AY1A 4DEFA 1DXFA 2VGGA 4FO4A 5ECVA 3SGZA 1T0OA 1UJQA 4GUJA 3H2FA 2H9AB 2FTPA 1EHAA 3TLQA 4HA1A 1H0GA 3MANA 1I60A 5D30A 1EIBA 2CZ5A 4FLOA 3SFWA 4W89A 3XINA 4N6EA 3F4VA 1XFCA 2VX4A 1HNYA 1N55A 1NDYA 1NH6A 2VC5A 5IHSA 4JX5A 4UFJA 3L4WA 2J74A 4HIBA 2DZPA 4YU1A 3N6QA 1JF5A 3WEZA 2X42A 1W9BM 2XVPA 3GNXA 3N9KA 3W7IA 4RE0A 1RK6A 5CJMA 2XYLA 2OX4A 3KTCA 5T9CE 1YX1A 3TCSA 3CTTA 1PB0A 4KEZA 3L21A 3T9PA 1M65A 4GISA 3N73A 4DZAA 3LXAA 3PULA 5KITA 2QCNA 4AF0A 1B3VA 3QHMA 3OHMB 4M81A 4EPBC 1Q6DA 2VC7A 1GHRA 1HGYA 3USZA 1XG3A 2PDLA 1FDYA 3GAKA 2VCAA 4FXRA 1KCZA 3ARYA 3B8VA 4MNMA 2H6RA 5HBFA 3MCMA 2V5LA 4QXIA 3CK5A 4MZ1A 2Z1KA 4JQ3A 3UG3A 3E2SA 4X60A 3NQBA 4X61A 1P5BA 3KVJA 2P5NA 3PHAA 2QKFA 4D72A 1Y5VA 2AQVA 4HYRA 3KW3A 5A8MA 1EDQA 1B9BA 3I4EA 2PDWA 5I0DA 1ZFJA 3I3EA 5JBEA 2E5CA 2YYUA 2NV9A 2E09A 4DWSD 1Q8JA 3JUGA 1NP2A 1OGSA 1V6VA 3IUIA 4K38A 3PBVA 1K6AA 3GG1A 1DP0A 2PLKA 5EBAA 1J2BA 3PZGA 4ML4A 2NX9A 4GO8A 3F1QA 1F5ZA 1B4EA 2VDIA 3M41A 3UEQA 1LWIA 4LUSB 2JIEA 1WE5A 4M51A 3SCPA 1E3XA 4MY1A 1FWEC 4IOTA 2E1DA 1JAEA 1EJSC 4Y9MA 3WQOA 1WXJA 1XIGA 3ABQA 5CC3A 4F0HA 2O7SA 2GGEA 4NX5A 3VNJA 3L12A 3NEHA 1AQFA 2R1PA 3ZVHB 3W28A 3DI0A 1DJNA 1YDOA 4QM1A 1CECA 1FP8A 5I78A 2QJJA 4Z0JA 1VRDA 1X39A 1JIBA 3WD0A 2I17A 2DZTA 3GTHA 3IEBA 4IP5A 1U1JA 3ARTA 1B1YA 1J6OA 4MWAE 1U33A 2XVKA 4FOKA 3KP0A 3UWEA 2WMKA 1BLIA 3AAMA 1EWEA 3AROA 5DRCA 4KWOA 4INFA 5F2GA 4QE1A 4DZIA 3RGTA 1ICQA 1GT8A 4BJHA 1XW8A 2OB3A 1TVPA 3NYZA 3TMQA 2BG5A 3W3OA 4DZHA 9XIMA 1V0LA 4L80A 3LENA 3UCDA 4CEXC 3WQFA 5I09A 5HWJA 3BSMA 2YW3A 1XP3A 3ANVA 1XL9A 2F61A 2V5BA 3Q45A 4J3WA 3ENLA 1UH2A 3M43A 4DM1A 2X1RA 3QLDA 4YHGA 3IIVA 4DBDA 4NI3A 4DNHA 3LCGA 1UR1A 3MVTA 2PLCA 3EDKA 3M07A 3TQPA 2QUVA 2V38A 1FWDC 1V5XA 2PDQA 3CMFA 4MHBA 4YXGA 1MEWA 3PTDA 3WUFA 1GQKA 5FJPA 3GHTA 3WF3A 2CWNA 2D2GA 3GU1A 3DFYA 5HJLA 3SCTA 2BY0A 3K4WA 5J04A 3LI0A 2UV8G 4V1XA 2GVJA 4Y9NA 1VFTA 3RCMA 3QV8A 4Q22A 1WDDA 1TA3A 4PTWA 3WQWA 3MKKA 1A53A 5LIYX 3GVGA 4XAZA 4JZ5A 4PSPA 3TSBA 5EMKA 2Z1XA 1TQJA 3LBMA 2W4XA 3SCNA 4C6IA 1TJ0A 3IARA 1RY8A 3L4VA 1NP0A 3LHWA 2J8TA 3M5ZA 4JR5A 1KD0A 1VF8A 4DYKA 1OGBA 4EE9A 3SQMA 4ECLA 2QCEA 4HGXA 3C0SA 2Y4SA 2WHKA 1OEPA 5IOBA 5FACA 3ZSTA 3PUDA 3B8WA 3GDLA 3LXBA 4UOQA 3WMBA 2F84A 2UY4A 1YMYA 5K4ZA 1F73A 3BGAA 3JS3A 2XJ7A 3NO3A 2TPSA 3ARPA 3SUVA 3EB2A 3DKLA 3O9NA 4L4PA 3MMUA 4XV0A 2VL4A 3JZUA 1FH7A 1PX8A 4GVFA 5LIKX 1W1VA 2Z4GA 4Q4SA 1UBSA 5FJJA 4RXFA 1GORA 4GXPA 4U2ZA 2VDGA 3QW4B 1NDVA 2O92A 3VFCA 2DSWA 2X40A 3LHVA 1RP8A 6XIMA 1QCWA 1JI1A 2PRLA 2HPMA 1GVQA 3AOFA 1DXIA 3TH6A 4DI9A 8CGTA 4LAMA 3W7NA 4YTQA 4CKQA 2Z24A 5F1UA 2P10A 1S5TA 3Q58A 1FWIC 3C0JA 4GG9A 4IJBA 1CT5A 3R0DA 3WMSA 1XV8A 3NIYA 1MQPA 4LYPA 1CLXA 4G56A 3VKCA 3IVSA 4W9TA 2XINA 4RNHA 1XH1A 4BWLC 1NIUA 4QLJA 3QPEA 1VYRA 2GJLA 3EA1A 5AYIA 2ZX7A 4LCQA 3WKZA 1XRSA 3LQGA 2POZA 1UD4A 4NILA 1ELSA 3GXMA 1NOFA 4W86A 3HFTA 1ZAHA 5B7ZA 4IGSA 1PIFA 1XQLA 4UNLA 1DQXA 4MIMA 2Y7DA 5CPTA 4C6NA 4IIGA 4PH6A 2DZWA 2E5BA 1P0EA 3EA3A 1XLCA 1UBPC 2E4TA 3TCEA 6TIMA 1OCNA 2BASA 3RPTA 3VD9A 4QITA 2JK2A 4K8EA 4NAEA 5D9OA 1AW2A 4I5XA 4AEFA 5D8WA 3IJ8A 4KEUA 1TMHA 1XICA 3H55A 2VZUA 1F3WA 4RE3A 3L9CA 9XIAA 1QFEA 4RDZA 3W73A 2V5DA 1J79A 3MP3A 4JY8A 2MANA 3VZZA 1JZ8A 4RL3A 5D9NA 2F9RA 2XGBA 5C2CA 4LNCA 1E73M 4AD3A 4M6VA 1M41A 1SM9A 3BAXA 3VE7A 2PWUA 5AHLA 2Y89A 2E1WA 3N29A 4H9YA 1OFEA 1JGIA 2A2IA 2V9DA 5I24A 2NV2A 4A2RA 3VI2A 4PULA 2VURA 3E5BA 3B97A 5CAKA 3E2RA 2J25A 2OLSA 4IGNA 3WDPP 5A6BD 1HJVA 2HWGA 3PN8A 1OYAA 2CETA 4AYGA 3MB9A 1F6PA 1GYMA 2WVVB 3W22A 1WDQA 4HPHA 5JH1A 3L4TA 4WJ8A 3DECA 2HK1A 4AZ6A 2J7EA 1X8CA 4KCUA 3N17A 2BVWA 4F79A 1VJIA 1RCQA 1ADDA 2YA2A 2CFFA 2AAAA 3OQ8A 1Q6CA 1ZJAA 2J79A 1TX2A 2WVTA 4LF2A 2A1YA 2XVGA 3GKAA 4MB1A 1XBYA 2CWXA 4AEEA 3DKJA 1UH3A 2A3AA 3VKDA 5EGRA 1ITCA 2OEMA 4RLIA 3CH0A 5E5CA 2ISVA 4GJIA 3AU6A 1UR3M 1JCLA 2V67A 2PBOA 2WMFA 2ZZ4A 2PB1A 4X9YA 3CV7A 1R3QA 3MU7A 1MUCA 1EX5A 4V2XA 2YDSA 1SMDA 1A50A 3GTXA 2RJHA 2G3NA 2VCBA 5A6SA 5CAHA 4GKTA 4WR3A 3K8KA 4AB4A 2QUMA 2BFGA 1E5NA 4AZCA 4LSBA 1B5TA 4AIOA 1XBVA 1H1NA 3IVUA 3F2BA 3QVQA 3GVQA 3WQ6A 3C5QA 2FPYA 4B5UA 5A6BA 3T81A 2TYSA 3TP4A 5A94A 2WCAA 3LDVA 3L5MA 1TX0A 4LVGA 1W3LA 1DV7A 3W7HA 1TMLA 5H8UA 1R0MA 2Y8KA 1X1NA 4O1DA 1KKRA 4L64A 2J7FA 2Z6IA 1S5MA 2CHRA 5T8GA 4GH1A 5K2ZA 3BLLA 3EX2A 1NM9A 4EWND 5BMXA 4FR6A 3TIMA 1YW1A 1KGXA 1U30A 3WBEA 3UG5A 4PCSA 1CGWA 4C6BA 3HG4A 3RX3A 3H2AA 4B4FA 3A13A 3G2GA 4RV8A 1QI0A 2W63A 2ZYFA 3ZLGA 2VX6A 4WLCA 1IGSA 3V3WA 5JIWA 1HO4A 2AKZA 1DPMA 1IYXA 3LU2A 4NQ1A 1P4CA 5BXPA 1XDLA 3DFTA 1XYCA 2VXNA 4HN8A 4N42A 1HVXA 1GEQA 1F76A 1IIGA 2BVTA 5AHEA 2C16A 1IEXA 1XJBA 4Q7NA 5HPCA 1KFKA 5T26A 2WB5A 1Z69A 1AH4A 5CSRA 4JEJA 4FB7A 4B5NA 3FKRA 3GAYA 4YMZA 3PFMA 2PC4A 3JZEA 1F8IA 3UZYA 2VR4A 2WQPA 3DESA 3R12A 3SCRA 1FKWA 4GZIA 2PEVA 3C2VA 5FSDC 3TUUA 1VH7A 2PDPA 4RW5A 3AMGA 2DORA 2H3BA 3FCPA 1E1EA 3VDHA 3SCUA 4LU0A 3NSNA 1IZKA 4AX6A 3ZYZA 1OC5A 3S0CA 1V3JA 4AW7A 2VJXA 5CJNA 4I9TA 3KZPA 2OO6A 3L67A 1EH9A 1DQWA 3P93A 3INPA 1MXGA 3O8AA 3CIVA 4D6EA 2HSAA 3GFZA 5ABGA 5C6MA 1S1RA 4NJJA 1UKTA 3PM6A 1CLKA 1AUSL 1O1ZA 2O56A 1NFBA 4FIRA 4GH3A 2PGFA 5J8LA 5E70A 3V5OA 4JYFA 4A3HA 3SURA 2EGZA 1JAKA 1GZJA 4F0KA 1I2PA 1UUMA 2CZFA 2R9RA 3OA5A 4PMXA 2Q8ZA 1ODUA 2YL9A 3N18A 1XINA 1U1UA 2BS9A 2GJXB 3VD3A 2HPIA 3F7JA 3HO8A 4U3CA 3ARRA 1JYVA 2VHLA 3EWDA 4CNNA 1OFPA 2QUNA 4PUUA 1E6RA 3IWPA 5JBDA 1EOKA 1KO0A 4LBUA 3QY8A 3QH2A 3UU0A 1E5JA 2YB4A 4C1NA 2C91A 2VFHA 1EBHA 3BW3A 4RK8A 3U2EA 2WSPA 3A9BA 1UZ1A 1Q63A 5LA2A 4PMZA 1JCXA 3G5EA 1KM3A 3WH5A 1ONWA 2CBVA 3U9IA 2VFEA 1CBGA 1XKJA 3AZTA 3WEOA 2AQWA 2X41A 1LUCA 1VPYA 4C65A 4K8GA 4DUXA 4HD5A 3N1AA 5CG7A 2DEPA 4JHZA 3FV9A 4U2YA 4LX4A 3GW0A 2GDVA 2ALRA 1DJWA 3MKVA 3G1VA 3OW1A 4GQQA 3TZNA 1KTBA 3RRAA 3PPGA 3RR1A 4QDMA 1QRQA 2IQ0A 3BJFA 1M5WA 4CCCA 1VFSA 3FS2A 3EWBX 1DORA 1K6WA 1SZFA 1QPKA 1ONEA 4M1BA 2VUNA 3KVKA 1TWWA 1V7AA 1PX3A 4CU8A 2E8ZA 4LS2A 3QJAA 2HMCA 4ZVJA 3PVFA 3RILA 1W3HA 3QSRA 2E77A 2ZXAA 2OZ0A 4J1OA 4JL1A 4PUJA 3ZIZA 1LRTA 1F9CA 4ENLA 2PCEA 1A5OC 5K9DA 3O05A 3WLSA 4S2BA 1BSLA 4LS0A 1CEOA 1QPQA 1XWYA 5L9FA 3MZNA 4AH7A 2VEIA 1YKWA 2TMDA 1S46A 1VBGA 3WLOA 1JNEA 4ACYA 4AMCA 1XCFA 2ZUNA 2ZUTA 1HKKA 2D20A 3TA6A 3VKJA 3C0LA 3VDAA 1JZ7A 4CQCA 3R11A 1I0BA 3CL8A 2ZZ3A 1OWQA 2QCDA 3DHDA 1ONXA 3MCOA 1ZBVA 4WY0A 3KX6A 3KRSA 4EF9A 5AYBA 1LBLA 2QCMA 2W61A 4DO6A 1C8VA 3A22A 5AYXA 5LYRA 3WO8A 4OWGA 1WOBA 1TFVA 1AQHA 3WNNA 3QPZA 3RCNA 3F4CA 4J3VA 3PPCA 2R24A 3AXKA 3EBVA 4O1BA 4Y90A 3RJXA 4L65A 3FXGA 1DHKA 1B30A 3PB2A 4TX9A 3WLLA 1A5AA 4NG3A 2XFYA 4A29A 1PPIA 4JHMA 1C93A 3BSHA 5DRIA 3VIHA 3R94A 3CAKA 4S3BA 1MFUA 1P1MA 1EDTA 5E1QA 3E0VA 2VRKA 3WELA 3BARA 2WW5A 3S1XA 4B3LA 2XGIA 1JXKA 3HIJA 1P6BA 1XCXA 2DZSA 4KGJA 1TV7A 1R6WA 5C9XA 5I3GA 3PP7A 4JYEA 4CVWA 3A3WA 1EB3A 2V8ZA 4IXHA 2Z1BA 2IQDA 4FI4A 3M44A 2B0MA 3W71A 2I9UA 2GJPA 3S5YA 1EJRC 5C2XA 4JEQA 1L2QA 3W24A 1R2SA 1A80A 1EEXA 3CZKA 3BAIA 4F2BA 3O06A 1K7FA 2W0UA 1SW3A 1Q6LA 5FKYA 3PZVA 3OVPA 2ZKMX 4LEQA 5F2IA 2RHGA 3T7VA 3P84A 3BCFA 3GTNA 3QQWA 4MLJA 2E5DA 3HQ1A 5A2AA 3TFCA 3CWOX 3S2NA 3OP2A 3K4AA 3V1HA 2GGJA 4OFCA 4LBRA 3V5FA 3TW6A 2YJQA 4Z1BA 3A23A 3C8NA 1WPCA 2WNNA 3HJZA 3NGJA 1V93A 1Q45A 4DO7A 1E6QM 3CC1A 4WK9A 3AC0A 1XUUA 4JICA 1TTJA 1HL9A 3AWNA 1J8VA 4US5A 3BK0A 3MI6A 5AC5A 4CEUC 4NXKA 3CLMA 3C0QA 4GVGA 4D8LA 4C6OA 1EQPA 5MF5A 1U1HA 3MHFA 2ZRUA 3SRKA 3N25A 1R87A 3NQFA 5AVHA 3K1GA 3UR7A 1D3CA 4MDPA 4QSHA 3G77A 2XFFA 2JF6A 3AXMA 2NSXA 2FKPA 4FPSA 3TW9A 4ICMA 4EANA 4UTWC 1PAMA 3GXTA 4PBFA 4JN8A 2PLJA 1OJXA 2Z26A 3M0LA 2VZTA 2QDDA 2B81A 1ESWA 1NFGA 4QISA 1SSDA 4MMWA 2O9PA 1RK5A 2CLIA 5T91A 1US3A 1FXQA 1KCKA 4W4QA 2GGHA 1YHTA 1UH4A 1F2JA 4IL2A 1VEPA 4LFYA 3VNKA 3E0IA 2JEQA 1GQLA 4NF7A 3OU8A 4TXEA 2WCSA 3N2CA 3HU7A 1ISWA 3AYVA 3WK0A 2HV5A 2F2HA 4L5ZA 2CXGA 4BKNA 1FDJA 2D1ZA 5CH9A 1E4LA 1E70M 2FYMA 4AC1X 2OPJA 4EACA 4IM4A 1FWWA 4UOZA 4MNKA 5JUVA 1SJBA 3O0KA 2D0GA 4NU7A 2VRQA 1SW0A 1J10A 4GD0A 4BI5A 1BSIA 4XAFA 3LQLA 1A0CA 1G7VA 1PX4A 3O63A 1UOKA 2YXGA 3SCWA 1NEYA 2SFPA 3PWIA 4QJ4B 2BGQA 5HDRA 3OGVA 5D4YA 1QI4A 4JHOA 3WK2A 3TX9A 1UUQA 4Q8OA 1LG1A 2VTFA 3IIZA 1GVOA 1IF2A 2REQA 3THDA 3W02A 1H61A 3G1YA 4FK9A 4I5UA 4ZB5A 4BQ4A 1AH3A 4PSRA 4MUZA 4IX2A 5IFPA 1UWIA 3LPGA 1SJDA 1LP6A 2DY3A 1CTNA 1XYMA 2PSNA 4NJIA 5D2VA 3W7DA 4YYCA 1FDZA 3T8LA 3D0CA 1HL2A 2GL5A 3BV7A 4Y7EA 1VFLA 2QPUA 3LYEA 4GMEA 3R7MA 1PCWA 1KFCA 3W1MA 4TMCA 1MDRA 5I02A 1KB3A 2FDMA 1UWSA 3ISIX 1R30A 1CB7B 4HMEA 1CX9A 2FTWA 5GNYA 3P5ZA 2P0IA 3TK7A 3L0NA 2ZWZA 1EJXC 3STCA 2V5JA 2ZVIA 4Q4MA 3V75A 2D0FA 5GQBA 3T2OA 1B2YA 4I3GA 2J78A 3FAWA 4GUIA 1S2VA 5D2YA 1EDGA 2QV4A 1F6KA 3U5YA 2PF0A 2PDBA 4XAPA 2QF8A 4BEUA 4AD4A 1V08A 1GKPA 4UTMA 3M47A 3BURA 4QLLA 4XSMA 4J2MA 4QP0A 3ZT5A 2JE8A 4ORIA 1UIOA 4JDBA 3ANYA 1ZTVA 4D6GA 2HTMA 5IDZA 1ISYA 2DZVA 3NDYA 3LPFA 3WJYA 4GACA 1G7UA 4IFKB 4NZFA 5A6MA 3DI1A 3A5VA 4PN2A 3OG2A 4I6VA 1XG4A 2OYLA 1XXXA 3UNDA 4G1NA 2NW0A 4YHEA 3NPWA 3EOEA 4GX9A 3CGTA 2WBKA 4QJ3B 1KGWA 4S3CA 7TAAA 4LVAA 4GUGA 2VUYA 3QMTA 4GIEA 4ERGA 3W07A 2G3FA 3ECQA 3S1WA 2H90A 1GOQA 3PWAA 5CGTA 4Q6JA 4D1IA 5K3VA 2GDUA 5FF3A 4O4VA 1RXOB 1ZALA 4NT0A 1F05A 2J7HA 4HT3A 3B0PA 5CPNA 2PODA 2WLYA 4EKJA 2QCHA 3ITXA 2HEJA 2C0AA 1EP2A 4ERIA 1BRLA 4ZBCA 1NJJA 1XSJA 4C6MA 3NDZA 1OVDA 4DN1A 3MUZ1 4Z2IA 3R0KA 4I6KA 2QHAA 1HFBA 4WOQA 4KERA 2PU0A 1CDGA 3FDGA 5FJOA 4IIHA 1JDCA 3SAZA 1HZYA 1KQYA 5KSWA 1OC6A 1TUXA 2WZHA 1UA7A 1BEUA 1HT6A 2OO0A 1FY6A 1GEHA 4OQVA 5BRQA 3P7YA 1WOAA 5L6UA 1JPMA 3VC5A 1V03A 3MUAA 2JALA 4DF1A 1BXNA 1SZGA 3QC3A 4ZZ9A 3BMWA 3MC5A 3K5XA 5D02A 4FF5A 1BVNP 5DBTA 1J4EA 1DTUA 3L7RA 2VZVA 1M7XA 3C61A 3LRLA 3VABA 2BMBA 3UCQA 1Z42A 3XISA 4DAIA 4HKPA 4Z17A 1PHQA 2ISWA 1NY1A 4MLRA 2Z1VA 4LRSA 1LF1A 1EC8A 1IXOA 1E56A 5A6JA 2EPOA 1DL3A 3IJQA 4L9ZA 4AZCB 4O28A 2GSEA 4DY1A 3GBEA 3W1XA 3RU8X 3NA8A 1T5AA 3NL5A 3VIPA 2ZDRA 4GKLA 5I3JA 4HZ8A 4P8VA 2D69A 1H0IA 3O7UA 1UHVA 1XYLA 5G2HA 1ZHAA 2OSXA 1W9DM 4FLRA 4KWWA 3VOJA 1PL9A 3J7HA 1BG4A 2QJMA 4TU1A 3H24A 3RM4A 1HJXA 3QXBA 4DELA 3W1UA 1RD5A 4OGZA 3VIKA 2W27A 4DUVA 2VYOA 3N34A 3BGJA 1F61A 4WCJA 4LVDA 3GDKA 2W5FA 1K77A 1SZNA 1YBQB 4C6QA 3S2LA 5LNVA 3GXPA 3IGSA 4AVNA 3UJFA 4POCA 4QQ3A 5LHEA 4FLQA 4PB5A 4L9XA 2OCZA 5CPQA 3DH7A 2OEJA 3W1PA 3UJSA 3TR9A 1X6UA 1U5JA 5DEZA 4DJEA 3GIYA 3HQNA 3BICA 1V7YA 1UKOA 1UKQA 4KW2A 3T4WA 1UQYA 2OYMA 4GGHA 4TMBA 1LBMA 4HJWA 4QG6A 3NQ6A 5CZKA 3W7EA 1JRCA 5BMWA 4W8LA 5HQEA 3B8IA 4MJZA 2ONEA 4AHQA 1TPB1 3H7VA 4LT9A 2DU2A 5GNXA 2PDCA 4PMJA 3OZMA 1AFSA 1ISVA 3R8RA 3AYRA 2W3ZA 1I1XA 2A3LA 1ZP4A 4QSFA 4UWMA 5CG0A 3V16A 2D24A 1YE6A 3ZXWA 3BQ6A 2RKXA 3M0MA 4ZQRA 1A5KC 3CL6A 3BCDA 3ITOA 3TE9A 3LTPA 5AVNA 3C2EA 3M6DA 3PZTA 1GVRA 1K7EA 2P76A 1R2RA 4FP1A 1ML1A 1K8XA 1W2VA 4GC4A 4CCDA 3MPGA 4JD4A 2NQ9A 3G8EA 3TYCA 5A8GA 3BQ5A 1SFSA 4C5ZA 3G0XA 3M46A 5EY5A 5FJIA 6TAAA 2FHFA 3B9DA 2P88A 4J27A 4FNTA 3KBNA 1VKFA 3QV6A 2CITA 5CPMA 1GHSA 4ICCX 1OCJA 3E0WA 3DEQA 3KTXA 3P14A 3ME3A 1W3KA 3MY9A 4IHCA 1R86A 3JR2A 1P6CA 1YXDA 5HMDA 5G4WA 2X7WA 3KBMA 4ZO7A 3DBPA 1N7KA 3REQB 4PEEA 3CV2A 2ZE0A 4Z2LA 1R46A 1PE1A 3IJ9A 4FX6M 5I5RA 4NNAA 3JW7A 2NQLA 3WNLA 3WQGA 5GVJA 3PZOA 4OU1A 3T44A 4H1ZA 1AL7A 1XISA 2BLEA 2AOSA 3FYPA 2UY3A 5ABHA 1SFTA 2IPGA 5LNSA 3F4WA 2AGTA 1RVKA 4R85A 4HNVA 1EJUC 4NSBA 1B3ZA 5FJTA 4JTQA 4WSHA 1BF6A 2F6XA 4GQBA 3V1PA 2VP8A 3OGRA 3AS1A 4JIEA 3RLGA 1MO0A 3G3DA 3VX1A 3VKAA 4Z1YA 3WJWA 2O55A 2HROA 3DYPA 1TV5A 3QKEA 4MB3A 1BKSA 1EOMA 1AQ0A 1A3WA 1A3HA 5RUBA 2E6DA 2Z7KA 3PBGA 5I3DA 3KOYA 3M7SA 3MW7A 3VIJA 4J3TA 4AIUA 1AH0A 1PYFA 3CHEA 1CGVA 1Z7AA 2YW4A 3SRDA 4X63A 8XIMA 1IR1A 1H7XA 1WDPA 4YPJA 4BS0A 4MZ8A 4H6KA 1E72M 1PKMA 1H51A 1EJVC 1BVWA 3R1ZA 1JYXA 2PGEA 2AL2A 4B5SA 1PDYA 5HNUA 4B9ZA 1VYSX 1NSJA 1N8FA 1LM1A 3CM4A 1Q2RA 1EUAA 4GYJA 3PZNA 2VOTA 3U4AA 3BUVA 4FZIA 2NV1A 4O54A 4GRSA 3FGCA 3O15A 5HWMA 2C79A 4MADA 2PP1A 1UG6A 4KEVA 4DPPA 4TVCA 4JX6A 2OXNA 2J6VA 4IMCA 3CHVA 3A3XA 2C13A 2W92A 3VIIA 1QNVA 3AXXA 4S38A 1EZ2A 2A3CA 3TSMA 4JTDA 4V28A 4NAFB 3QZ6A 4AD5A 2UWFA 8XIAA 1PO9A 3BG9A 1D3HA 3HQOA 5HMEA 1R8LA 1XCWA 3UNTA 1QNQA 3LRKA 3PNZA 4IGMA 5AHNA 4Q8VA 2OTDA 1RCXB 2MUCA 2PP3A 1V8EA 5C70A 4U5IA 3CV6A 3NGFA 3ZO9A 2VVNA 1O95A 2WQDA 4DRSA 4HA0A 3UETA 1PTGA 4AD1A 4IIEA 3W81A 3O6YX 4S2CA 1E71M 2FZDA 5BCAA 1XLEA 2ACSA 3F5KA 3BOLA 5AZ0A 4N9BA 4LPCA 1FA2A 1ZAJA 4O16A 3W76A 4IIFA 1XSIA 3BAWA 1JZ3A 5C7HA 4K6AA 5HATA 3S6OA 1TQXA 1NARA 2QZRA 5EMUA 4O10A 4GUFA 4DLMA 3DFHA 2WO5A 3F03K 4J40A 3VOGA 3L2IA 2W9MA 3A12A 1VEOA 3T0BA 3UXLA 1RBOB 3PWGA 4CCZA 4M6UA 1PWMA 4P7LA 1BQCA 3PBMA 4GO9A 4DBSA 2XSXA 2EPKX 3UWVA 3LV6A 1RV8A 3SRHA 3TSDA 3BMXA 4IWWA 3W7JA 3NQ7A 4HPXA 3H2EA 3S5NA 3A64A 3QN3A 1GOXA 4IUGA 4TQTA 3CQJA 1W3IA 3UYIA 3UR2A 3WBYA 4GPNA 1QWGA 3UQNA 4PBEA 3GR7A 3IGHX 4DWDA 2I1OA 4HU0A 5XIAA 1PHWA 4IMEA 4YWSA 4Z42C 3DDMA 3UCCA 3MMTA 4HOWA 3B05A 1EJTC 1KM1A 1S2WA 2PTYA 7XIMA 3VTRA 3IIXA 3RU6A 3RLUA 1VCFA 1GQIA 1HXJA 2AGKA 4M7TA 4PRTA 2IKIA 5FF4A 2I7GA 4Z0SA 4CD5A 3U0HA 4WGHA 3CHCA 4JFWA 2VDHA 1V4YA 3D47A 2AQOA 5HMSA 5FI8A 1XRFA 5TD4A 1D7FA 4TV6A 1KFJA 2PTXA 4XTIA 3W7KA 1F3XA 3Q2DA 3RAOA 4D8ZA 2WYSA 3AUJA 3S5SA 4G6CA 4UQCA 1RLDA 3R4IA 2E9MA 1VFMA 2NLYA 2WKGA 3KL5A 2YXXA 4JFSA 1TIWA 3NQCA 3KHDA 4JOMA 3P0WA 2QJGA 2IPFA 4WJEA 5TIMA 1XUZA 2UZ9A 2H3DA 3W9ZA 2WMIB 4AC7C 1L6SA 2DT2A 1FFQA 3EWZA 4R3UA 3W4RA 4RZ5A 5BXRA 4ZR8A 2WJEA 4FA3A 1HJWA 1AD4A 1GZ1A 3OLEA 4DQWA 1Z8AA 3H2MA 4PMOA 3OLDA 3B9OA 1FH8A 4RR4A 1DJHA 3BAJA 3BLDA 1P48A 1S5VA 3OLIA 5BYWA 3HPXA 4JN6A 4R9OA 3RPMA 1XSKA 2DZAA 1I2RA 2IW0A 2PAJA 3T42A 1WUFA 3EMZA 3TYZA 3P61A 3U3HA 2Z29A 4DJED 1MSSA 2XH4A 1EIXA 3FX4A 2VOMA 2VT0A 1QTWA 4AZ7A 4AYSA 3THCA 1UA3A 1RJQA 1MRQA 1XLDA 5D9MA 2WSKA 5G2WA 4UXDA 1UR2A 3LCHA 3P82A 2ZWYA 3MO7A 1K03A 4HA4A 3OIXA 4E4UA 1S39A 2HNEA 3VE9A 2FHBA 2INZA 3MMWA 2F8QA 3V5CA 3DUGA 4Q4KA 3VZXA 1X6NA 3II1A 4OOUA 4WVXA 4E8DA 1ZL1A 2QT3A 3W2MA 4XAGA 2XZ9A 3QTGA 3SY8A 1Z32X 4YVXA 3H53A 4KCWA 1SW7A 3NL3A 3AHZA 4H9MA 2VX7A 1KLYA 5D03A 3W7QA 3LXCA 1UYQA 4XZLX 3ITLA 4O57A 1Y8BA 4DUWA 5I03A 5I7GA 2BX7A 4LYRA 1P7TB 4UOJA 1V3LA 3NEVA 2Z7GA 4DF2A 2O4QA 5A8NA 3WY1A 2J13A 3MUY1 2QGYA 2G95A 2R82A 1FBAA 4J4KA 1XYBA 5KZDA 2CBJA 3H7RA 4CD8A 4AZBA 2HE5A 2BHUA 2IPWA 4D2JA 5FEZA 1TV8A 3W2KA 5HPOA 2JKPA 1ZCCA 4O14A 1XGEA 3CAQA 3HJEA 3NM3A 2OWWA 3AISA 1MXDA 5GPRA 1ECEA 3CMJA 4AVFA 3BVJA 3POHA 3GSMA 1J0HA 1OB0A 3M5YA 4DBEA 5A3HA 1GWJA 2I9EA 1WBHA 2VMFA 3H8AA 5K7JA 4S1FA 1HKWA 1GNXA 1VHNA 3FSUA 4NJGA 1FWCC 3KDNA 1MDLA 5EMLA 1NWUA 3QQ0A 3P60A 3ATYA 3KOXA 1E0TA 2C6QA 1Z48A 1FOBA 2YOCA 2W67A 1N82A 3WLNA 3L5AA 5I07A 3B8TA 2BHZA 1AA1B 3E1F1 4TR9A 1EX1A 3K30A 1I2OA 1UWQA 3RX2A 5I3KA 1YYAA 5DFAA 1MZHA 4IMAA 4M6PA 4CN4A 3LB0A 2FZNA 5CGMA 3KCJA 3IRDA 4XVDA 4C90A 2WVUA 2J77A 5A95A 1O94A 2Y62A 2VNCA 3PG9A 1XBXA 4H6EA 4DUOA 2CHOA 4U31A 4ML9A 4N02A 3UFYA 1I2QA 1PBGA 5AHMA 2HJPA 1MQQA 2PDXA 3HN3A 2WZEA 5CGQA 2RDTA 4WXYA 3EA2A 3S47A 3WJXA 1QHZA 4RV3A 3SIMA 1FWJC 1VCVA 5LIXX 1RBAA 1UJPA 4YCOA 4IF2A 4L6HA 2CBUA 4F2UA 3BG5A 2G50A 1JXJA 1L6YA 4ROPA 4ZB2A 1DYSA 4W7VA 4ZODA 2JF7A 3RF9A 4F2TA 1A4LA 5CLWA 4LC6A 4PMQA 1MEHA 3CQHA 3ZVIA 4G7EA 4FXFA 4UTWA 4QNEA 4XZHA 2XVNA 4IFOA 2Q6ZA 4RJEA 3BXWA 4H3DA 3TYDA 1HP5A 5FEXA 3GVRA 1UZHA 3ES7A 4EP8C 2QPXA 1W5PA 2YSWA 5IHRA 3QY6A 4IFRA 1ZGDA 3QOMA 1R2TA 1QI2A 5CZJA 3FN9A 1LL6A 3A24A 3WUGA 4AFYA 3AALA 2X0YA 4DNMA 5I6SA 2Y7FA 1UR4A 1IEQA 1GG0A 3LBOA 4AISA 1LYXA 3NXFA 2FVMA 1W3TA 4PCFA 1C8QA 4IUOA 5CLTA 3NQ8A 1XH0A 3FEQA 3WQ8A 1UZDA 2EG8A 3VCCA 2O9RA 1JCNA 2A85A 3MP4A 1EEPA 1EYWA 2C0HA 5F4SA 2A21A 4YTUA 1L6WA 5E6YA 4IJCA 5U4NA 2V69A 1WNOA 2ZUMA 1X8FA 4PMUA 3HG5A 5JMUA 5G1MA 4LALA 2ZTKA 3DHPA 4DXXA 3RFAA 4XD6A 2PCQA 4UTKA 3SO7A 5G1TA 4ATDA 2WKJA 1FWGC 3H22A 1TJ2A 1BTMA 1JR1A 2Z2AA 3E49A 2P50A 2ZRZA 4BWLA 3VX0A 3KS6A 1OINA 1NWSA 3OYXA 1M7OA 3ABOA 1SFJA 1SJAA 2NQ5A 3UWYA 5E6ZA 1J93A 2UY2A 1FXPA 2G5WA 4ZQCA 1TRDA 3IVTA 1VR6A 4KIRA 4Q4RA 3WIJA 2FHCA 3FW6A 4XQ6A 1UIPA 3W88A 4YN5A 2NVAA 4N9EA 4ZO9A 1EP1A 2OQYA 1LLWA 4K68A 1QNPA 3W1TA 1AD1A 2BOFX 3E9AA 1YRRA 1MWOA 1YXCA 2ZFAA 1TUFA 2IKJA 1GCYA 1W54A 4HK7A 2ISSA 1MW1A 1DOSA 7ENLA 5H2ZA 2NQZA 3FHQA 1K8ZA 1XLMA 3EWWA 2JBMA 3CEUA 4GOAA 1JF6A 4O1EA 1X98A 4W88A 3GTFA 2FPVA 2Y70A 5HQLA 1OADA 2PDIA 4B16A 3E74A 1C90A 1QW7A 3NZRA 1QW9A 3V35A 1K8CA 4GY1A 1BXBA 2J62A 1Q66A 1SZRA 4CNPA 1B31A 1BTCA 2XSAA 3TLLA 3L4XA 3GUWA 1V0NA 2QDGA 4NZCA 1G9HA 2Y63A 2QS8A 3UG8A 3S1VA 4H8HA 1V02A 3QGKC 3W26A 5A1AA 1EL3A 2L5HA 3S9YA 3PSWA 1GUVA 2QMJA 3Q4DA 4WXZA 1Z41A 5FD0A 2OOFA 1E9ZB 2FPTA 3C3NA 3ZT7A 1KTNA 4D1JA 3QGVA 1TWIA 3P81A 3EZ4A 3ARZA 3SY1A 3HGJA 4Q8WA 1M3UA 4WDWA 2YR1A 1IXNA 4S23A 4MJMA 3UYCA 1L0PA 4JQ4A 3GH5A 4XBKA 4UR9A 5AC4A 1SVDA 2VENA 3WFAA 1QWKA 3URBA 2B7OA 2Q09A 4AF0B 1KFEA 3FKKA 1KXQA 1VENA 1X6LA 3UXAA 5F7UA 1R9ZA 1VZWA 3OA3A 4ZA0A 3MBDA 3VINA 4HHHA 2YKKA 3EOOA 1JZ4A 1XIDA 3E02A 3ABZA 3VNYA 2RJGA 1YTKA 4W85A 4C1LA 3PJXA 4C7FA 1KV5A 2GPTA 3WDRA 5ECUA 1QU4A 1XIMA 3BW2A 7A3HA 3NQ2A 3H12A 3U2CA 1GW9A 5D32A 3B9NA 3P74A 2EKGA 4Y9PA 4KF1A 2C7FA 1GJUA 4NP7A 4PODA 1ZU8A 1CNVA 3LSCA 3IS4A 3GFXA 1WXYA 4JGDA 5CXPA 4K7YA 1PCKA 3LUTA 5CSYA 1JPHA 2PTZA 3RUBL 4PUKA 2GGIA 3OBAA 5DXYA 3QZAA 1W5NA 3RITA 1ME8A 5CBIA 5FEWA 8A3HA 2PGWA 4B91A 2NT1A 3BJSA 1OX5A 2PURA 5BRPA 2I57A 4A8RA 2TSYA 4J3UA 2D22A 4QGCA 3W7GA 4P7OA 3AMDA 1EXPA 2Y1HA 3NSXA 4R9XA 2DFAA 3MA8A 3TDFA 2NVCA 4ZO8A 4MM1A 2GWGA 1H5YA 2XU2A 1VEMA 3TN3A 1ZJIA 3A4WA 2RGLA 3R2GA 4IFKA 1RZMA 1JPDX 4IP7A 4QAWA 4LAKA 3EPOA 3UBPC 2V5KA 4WDTA 1TR1A 3TONA 5D09A 1Q7ZA 3G1XA 3BLOA 3T2QA 4D6JA 2V3FA 2OWXA 1VS1A 1WZKA 2BWGA 4F0RA 1QNSA 3BLKA 4AY8A 1HIZA 1DQUA 3T8QA 4GY7A 3TC6A 1SR0A 3LM3A 1AK5A 4GI9A 3RO8A 2WC3A 3HZ3A 2QUTA 4XKYA 4IPIA 3KZSA 3BH4A 2OOGA 1RA0A 1PTDA 4HNNA 5DMYA 4XB3A 4JTJA 3U7VA 2YPIA 4XD4A 1Q5MA 1QO2A 3M0YA 1GPFA 2GVLA 3CHDA 4GCXA 1GKQA 2JQXA 4JL2A 1WKYA 4NL1A 3U57A 2Y8UA 4LGXA 3UPWA 2IPJA 3UP8A 3CQIA 3ANUA 5CQ1A 4QG8A 4W8BA 3W53A 1C91A 1T8XA 5HR7A 2R8WA 1E9YB 1J11A 2P3EA 1J01A 1ZNNA 2VEKA 3IANA 4JTGA 4XD5A 1NF7A 5EKYA 5EBUA 3AIEA 1M04A 1T41A 3WZ0E 1M03A 1TV3A 3L5LA 4D6IA 2C14A 4N4QA 1B4KA 4J3ZA 3M7WA 2HVOA 4G2DA 1YNPA 3ERPA 1KFWA 4O8AA 4Q3MA 3STEA 4N6FA 4MB5A 4ZOEA 3RPDA 3WD3A 2FGBA 3BZGA 1A5NC 4MKVA 1AG1O 1KRBC 3KM8A 4ZTXA 1S3HA 2MNRA 5H8MA 1OF8A 1K9FA 3GVWA 1M01A 4O50A 3DG7A 3TJIA 3XIMA 3L65A 3I65A 3AS2A 2PZNA 5AECA 4F0LA 2PDNA 2E25A 1GPWA 1WAUA 3CUIA 5BU9A 2R6OA 3VA8A 4ZB0A 4GINA 3UWZA 4D6CA 1H09A 3MV11 2EXOA 1KBLA 1H49A 1D9EA 4GYPC 4DHGA 2DQXA 2XG9A 1EPVA 1Z6KA 1EJWC 2DUZA 1HN1A 3WH8A 2XH2A 5B80A 1LDCA 3EXSA 1LT7A 3CQ0A 1XDJA 5H91A 3N4AA 4AQLA 3QC0A 3VNZA 1CPUA 3AO0A 1WZMA 3NQAA 4XZNX 1OT1A 3AHYA 2P8BA 1R47A 2QMKA 5BNKA 3VC6A 1G69A 4AD2A 5FA5A 4IG2B 4GZEA 4JTEA 2ZUWA 3I7SA 1R38A 3PB0A 1IWPA 3EPNA 4GLEA 1M53A 1V0KA 1A5UA 1VLIA 5MKGA 1SPQA 3M16A 3ID7A 4IPNB 1E6ZA 1UD3A 3BJTA 4YVPA 1H5VA 3AFBA 2YCIX 4ZEPA 2ZXDA 1E55A 2R1NA 4GX8A 3V0TA 4U33A 4US6A 1LWHA 3MSYA 4ATLA 5DELA 4D6DA 2NZLA 4U4MA 1L6FA 1RQEA 2AL1A 3QY7A 5REQA 4GZ7A 1KKOA 1UKPA 1TZZA 1E6PA 2CZVA 4DJFC 3WD2A 1WZLA 3U6WA 3TOPA 5DLCA 2Y7GA 5DF0A 1PZ3A 1KLZA 2WBGA 3ZFHA 4D9PA 4W5ZA 4BF5A 4JDYA 3HBLA 4LW7A 4Z2KA 2AKMA 3ORWA 1RBLA 1X96A 4WD0A 2ACQA 2V30A 5DY3A 1PZ0A 3P5YA 4ZOCA 5EPDA 2X2YA 5HNTA 1HTIA 4LY4A 2BNJA 1TTIA 3PFRA 1CGYA 3R58A 4DF0A 4H2HA 2VKZG 1SGJA 2H8XA 3EDFA 2OQHA 1TZ7A 1HQTA 1UR9A 3GBDA 1HVQA 4QR6A 1W1A1 1V0MA 3K8MA 4ZSTA 3ZSSA 3W7RA 2OJPA 1W1B1 4LUSA 5I06A 3BO9A 1OY0A 4WJXA 4O12A 4NZ5A 2P0OA 1E51A 1CGXA 1DWIM 2H9AA 4JFVA 4UR7A 5G4EA 3T0DA 1C9WA 1QNRA 5CPLA 3TC7A 2EPMX 3RJYA 1YLVA 3UJRA 3N14A 5BWAA 4C7DA 4DJDA 1DHPA 1KBKA 2ZUUA 3LA4A 2A3EA 4KRUA 2ON3A 4LUTA 3UPMA 1ISXA 1I9CB 1F4HA 3ARWA 1R9XA 3N4FA 2V3GA 2W79A 5AC6A 3SN0A 2EKCA 2PU1A 5G1YA 4C6CA 3BG3A 4BF9A 2O4MA 1GJWA 1GVYA 2HVMA 4L4LA 2G4FA 1EGVA 3QTPA 2DVTA 2CIPA 3ZMRA 4J35A 4LJ3A 4O15A 1GK8A 4B2DD 2VQUA 3GG7A 1XIIA 3OZYA 1LROA 4HHMA 1PJ9A 1ZBWA 2WVVA 3IJLA 3C2OA 4HP5A 3GXDA 7ODCA 2NX3A 1O4UA 2HBXA 2YL5A 1LQ2A 2CZEA 3PUGA 4ZQMA 4A05A 2PD9A 4ORMA 2PDYA 1JQXA 3WFLA 1TPH1 1XIBA 1Z3NA 2J66A 3GHSA 5TF0A 3CUXA 2DSKA 4B5WA 1MI3A 4LOCA 1UUOA 4I5RA 4MPQA 4H41A 3C6CA 4JFTA 4DWSC 1W1TA 2ZA1A 4HPJA 1Z9AA 4WKHA 1UQZA 4M82A 1KM0A 5DANA 5F1VA 3V7PA 4AEOA 4F0MA 1HJUA 4L1GA 3T4CA 3MSGA 3GXIA 3ICJA 2ZRVA 3AIWA 7CGTA 1F7BA 2NWRA 3C56A 3H4WA 1HJSA 3CEPA 3MCNA 3KL3A 3W1NA 3H4XA 2ZADA 4HMNA 1EYEA 1EF3A 2FDSA 1XIFA 4QS6A 4UNKA 3WBWA 3FYYA 4E8CA 3NUKA 3NL2A 1R7AA 5HK4A 1DBTA 4OECA 5IBXC 3SCVA 3N6JA 4S3AA 5GJMA 1J0YA 2Y6ZA 1VQTA 2NVDA 1G6CA 4IPJA 4ZCWA 1G4EA 3NR0A 4XZMX 4HYWA 4M80A 3H2CA 1IHIA 1QK0A 2WAGA 1LRNA 3PBUA 3GQYA 4UC5A 5D2WA 4H9TA 1Q6RA 3OOQA 4TO8A 1OM0A 3I3BA 1XYZA 3CZGA 3H70A 1KBBA 3BTNA 4IZGA 1K3UA 3TOYA 4UTFA 3EEGA 3H4GA 1S5WA 1G5AA 3TV8A 3CXOA 4FOJA 2ZE3A 3R43A 1W6TA 3U48A 3IK2A 4F66A 1GOIA 1VJZA 3NAVA 1E43A 3GD6A 4UR8A 1OFBA 1TRIA 3G1AA 1J9YA 2GJNA 4IISA 1P0DA 1XD1A 4HK5A 3R0UA 4DJFD 3R89A 3GG0A 2VGIA 2WMJA 2V2HA 1R3TA 1XHGA 1YEYA 1DIDA 3MI3A 2DIJA 2R1KA 3WLMA 3HGRA 1HJQA 1ITXA 4Z2HA 3QOKA 4IIDA 1IT7A 1TKKA 4CN1A 2HISA 3NQMA 3WDQA 2WHLA 4F8XA 1ICPA 4HVXA 4R7OA 3UY8A 3W72A 3MWCA 2J9ZA 3VUSA 3UESA 2QPSA 1XGZA 3Q37A 3OVRA 2DZBA 3TA9A 1O6IA 3QMRA 2J7BA 2C1HA 3COTA 3EX4A 3F2DA 1X1OA 1I6NA 3VIOA 1A5LC 4WGXA 4XISA 3O6AA 4CU6A 4B5VA 3HB9A 1VC4A 3OLGA 4UFMA 5M2FX 2WMGA 3G22A 4J5NA 3RN6A 2GGGA 1SSGA 4RNIA 4C91A 3EX3A 4I7VA 1RAKA 3H6OA 4AG0A 1QASA 1A49A 1EFZA 1JUBA 4FNSA 3P8JA 1TE1A 1HKJA 2WSQA 4PRRA 3L0KA 2NQHA 1J6PA 5KEZA 5C2GA 1J0IA 3S2CA 1R85A 5BW6A 5EB8A 1JD9A 1ALDA 4RUBA 1V3HA 2ACRA 4NRRA 1PYMA 3CZEA 4TVUA 2B7QA 1YQ2A 1H1YA 3NG3A 3T05A 4K3ZA 3AZSA 1FWAC 4AZIA 4AWUA 3DERA 5BOFA 2JEPA 3N12A 5F4WA 3OVGA 4A21A 2QCDB 1HP4A 2XIIA 2YFOA 3DN5A 2CERA 3BW4A 5JU6A 1T96A 4EIVA 1YPFA 2ZXQA 1PKYA 2X05A 5C55A 3WNPA 3G6MA 2FFIA 4HU8A 1SQ7A 3AIVA 1TPVA 1ENUA 4PB3A 4YTTA 2QULA 5CZ0A 1X7FA 2PA6A 3DGBA 4P2VA 3TQVA 2VO5A 2VZSA 3G1SA 4HZ7A 2R94A 3BMVA 2FZBA 2CLKA 5LA1A 2DT3A 4O52A 4UNIA 2GVEA 3ITVA 4UQ9A 1OIFA 3LHZA 3S4TA 4S39A 3AIBA 1KM6A 4Q4PA 2GK1B 2VVSA 5F4XA 2ATSA 3U5UA 1OFAA 1H7RA 2GJXA 4A22A 5JXQA 4PL1A 3DG3A 3MJYA 1Q4NX 1C3FA 1NF0A 4HCDA 1QT1A 1ZSXA 4I8DA 3IAQA 2BOGX 3GX9A 5LIUX 1TPFA 2BY2A 3S42A 3LGDA 2RDWA 4F40A 2Z27A 1O60A 1WDSA 3DC0A 4N4PA 3GE7A 1F74A 3BLPX 4GE8A 1WB0A 3LM7A 3AMLA 3AWOA 2B7PA 1OX4A 3MTWA 3RRXA 1WDRA 8RUCA 5I3IA 1F6YA 6REQA 4GYKA 3FOKA 3ZR4A 4N7QA 3W84A 1W17A 3M0ZA 4KT2A 2E9BA 2X1IA 2DZXA 1K1DA 4FAMA 1YPIA