3ZFHA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
467
structure length
299
Chain Sequence
b'MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
publication title Structure of Pseudomonas Aeruginosa Inosine 5'-Monophosphate Dehydrogenase
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
total genus 101
structure length 299
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zfhA00
3MO7A 3T44A 1MEHA 2OT0A 4DELA 4HNTA 3GK0A 3Q37A 4H3DA 4IMCA 3O1NA 4LV9A 1JUEA 3GR7A 1Z48A 1SO5A 1CX9A 3DI0A 4NX5A 1TPWA 3W85A 2ATMA 3W22A 3KVKA 4AF0B 3EX2A 1W37A 4UFIA 5DN1A 1XBZA 5AB3A 4BF9A 4C1KA 3NZ1A 1W0MA 4GUIA 4UMCA 5D37A 2E1DA 4HT3A 5BRBA 3NA8A 3SR7A 3PG9A 1UJPA 4GXMA 4JTUA 1KFEA 5CZTA 5I3IA 4O0KA 2Y70A 2ZRWA 4AAJA 5LKYA 1OX4A 4R7JA 2NX3A 4FIQA 3F4NA 3TMLA 3BLIA 1TYGA 2QJIA 3MYPA 3MYOA 4A29A 3TJXA 3LCGA 1CW2A 5FEWA 3UD6A 3MWAA 3DFQA 2V5LA 1HFBA 5D2TA 5CKSA 3M47A 3LXCA 1OG0A 1VH7A 4XQ6A 6TIMA 1FUYA 3Q94A 4K37A 3HG4A 3P74A 3W23A 5LNSA 1FDYA 1QFEA 4EIVA 1TQXA 1QMLA 5CPLA 2WOQA 2ABBA 5F2MA 5FF4A 4DXVA 3YPIA 4O11A 1TTIA 4Z1AA 4KFOA 2Y63A 5CGQA 5BW6A 4XTIA 3CLMA 5KITA 4RX0A 3M16A 1OX4B 2XN1A 3S9YA 3M43A 1S3HA 3STEA 4UIOA 1U5JA 1ZAIA 1S5WA 4PEKA 2OMAA 3HGRA 4DBEA 1GZGA 2WJZA 1H7OA 5AHNA 1EA0A 1XM3A 3W83A 2NUXA 5FEXA 4K8EA 5D30A 4QIUA 5J5RA 3W07A 2PRMA 2X16A 4JTTA 3W87A 1KBIA 1MXSA 4IGHA 3VI2A 1DV7A 3KHJA 1YXDA 1WDWA 1SO6A 4WY0A 1XCFA 4WQ6A 1D3HA 1NVMA 2WSRA 3S5YA 2BLEA 5DY2A 3P8JA 1QWGA 3NM1A 2WSYA 1KTCA 1JCJA 3TDFA 2EHHA 1SZFA 3NNTA 2FLIA 2QEZA 4X22A 3LBCA 3MHGA 5MHBA 1KFKA 3L65A 4QISA 2XN2A 3TR2A 3E0IA 3D0CA 1TSIA 5FI8A 3N9SA 3QW3A 3NYZA 3MP3A 1J2WA 1GWJA 3CQ0A 4BI7A 3SGUA 1ONRA 3GR8A 2OCZA 1M7OA 4LU0A 4WY0B 4JY8A 5BMXA 3HIJA 3NQEA 1K8YA 2JKPA 5D03A 3LTPA 3NQ2A 3G1FA 2JK2A 3TA6A 3L67A 3BG9A 4GUFA 1EX5A 1JULA 2TSYA 3JS3A 3UNDA 3FJLA 2JKEA 4N6FA 3MUXA 3R8RA 2XFWA 2VEIA 4M19A 3PBWA 4AWTA 1FWWA 2QJGA 3W1AA 3PSWA 2CLHA 2AAMA 4Z1BA 2QDHA 1C8VA 1GVQA 1TTJA 2I14A 5HWJA 4Y8FA 3TW7A 4UCGA 3NVTA 1OYBA 2Y62A 3W7PA 1D3GA 1GVRA 4HHPA 4HIBA 1TPEA 1TV7A 2RDTA 1TCDA 4O10A 1YDNA 2CFFA 3VKJA 1EIXA 3HGSA 1YTKA 3BLFA 3C61A 2DZXA 4MYXA 3P81A 2ZTJA 1GTHA 4HPXA 3P5ZA 4MJZA 1XBVA 3I6RA 4QAIA 3IGSA 2NX1A 3C2FA 4JS3A 1LRNA 2CW6A 2PRHA 4O28A 1RQHA 4CCEA 1IXPA 4DF2A 1K3UA 4UTUA 2V2DA 2Y7DA 4UMBA 4M7TA 4XTDA 3STFA 3W7CA 1JJKA 1H60A 1KM6A 8TIMA 3TW6A 4A21A 4HKPA 1KV8A 4GJ1A 4AHPA 5F1UA 3MMTA 3NGJA 3HG3A 3DFPA 4IX2A 4DEFA 3LM7A 4IPIA 1AW5A 3HF3A 3TXVA 3NXFA 3NL2A 3BW3A 4JTJA 4UXDA 3T78A 3W2KA 1SPQA 1HTIA 3WK1A 1M7PA 1KBJA 4Z0JA 3P61A 2GVJA 1I2QA 2WV8A 1ZCOA 2UV8G 5F4XA 3OVQA 2E6DA 1OFDA 3I7SA 1QPRA 1KLYA 2QCFA 2ZZ7A 3P60A 4NJKA 3GNDA 1JVNA 3ZS4A 4DF0A 5AYXA 4X9SA 1MEIA 3SZ8A 1G4SA 2WKJA 3C8FA 5AOUA 3RU6A 4GFSA 3DAQA 3UQNA 1O5KA 2VFDA 4N02A 2C15A 3PR2A 3BG5A 3G1SA 3TIMA 3W73A 2NWRA 3BGJA 3CHVA 3TUUA 1R30A 4FX8A 2C13A 2HSAA 3OVRA 4EOUA 2HMCA 3RLVA 3C4UA 4P61A 1JRBA 4RK8A 3LERA 1W5QA 2VFEA 4CCDA 2OT1A 5I3JA 3P84A 2GQAA 3W86A 4ZQNA 1H50A 4LUJA 5FF3A 5E1QA 5LHFA 1FWRA 3W7MA 3C2RA 1KLZA 4FXRA 3PBUA 1JR1A 1O60A 5FEPA 2Q8ZA 3M44A 1XDLA 5LGXA 2E6AA 1D9EA 2V81A 4M5PA 4LC6A 3DHFA 1VCVA 1DVJA 3NPWA 2X1UA 2AQWA 2QJHA 4HN4A 4IXHA 4LS1A 5HQEA 1VLWA 2EGZA 3GIYA 3RK8A 4DO4A 2V82A 2B0MA 4IMFA 1EP3A 1LLWA 4LV4A 3S5ZA 4AHQA 1G4PA 3PB0A 5LNRA 3MI3A 4DO6A 3TQ0A 3M41A 4JTEA 2D73A 1ZAJA 3USBA 1TPB1 4JGDA 1I2NA 4LVAA 2GJNA 2FB2A 3GKAA 4LS2A 1TPDA 1C29A 3I65A 1Q6OA 1TTPA 1T96A 2B7QA 5CSSA 5HUOA 4ALDA 3B04A 3P80A 1ZENA 3L2IA 1UUMA 1MO0A 3W88A 4PL2A 3LBMA 1F6PA 1TTQA 5G4WA 3W75A 4WOQA 4NJJA 3LHVA 2ISWA 3G1YA 4X3ZA 2HS8A 3KRSA 3L5AA 4AB4A 3LHWA 3T7VA 2RFGA 3MBFA 5G5IA 4FX6M 2J88A 3QSTA 3BV4A 4O8RA 4O19A 4UR8A 2J9YA 5K4ZA 1M5WA 3MJYA 5HMSA 2V2CA 3C0JA 3P7YA 3UXDA 2VFHA 2G5WA 1XC4A 2FPVA 1BWLA 1I2PA 3V75A 4PTNA 4UTJA 2E5BA 4I9AA 4JIQA 4TMCA 3GXNA 4LNYA 1T0OA 4QJ1A 4A3UA 3G3MA 2FPYA 2DZSA 2ISVA 2ZA3A 5C54A 3LCWA 4MY1A 3TAOA 4IUOA 1P4CA 1IXQA 1SO3A 4UTWC 2V8ZA 1H1YA 1F05A 1R2SA 3S5OA 3W2MA 3DI1A 2FIQA 3EX1A 4MFEA 4H6KA 1F2JA 1LROA 2Y88A 1XKYA 4FXSA 1L9WA 2NXIA 5EBUA 2X1TA 4DPPA 2E09A 4BR1A 1L2UA 4O50A 2ISSA 3N9RA 1RQEA 3H53A 2QCHA 4YMZA 1YPFA 4FEZA 1FQ0A 5IBXC 1ZALA 4MY8A 1O95A 4FIRA 1C9DA 1W5NA 4GUHA 1QPNA 1TPVA 1ZNNA 1H7NA 3RFAA 3HO8A 3ABRA 3NPUA 3L0GA 2VOMA 3O6YX 5G1TA 3PBVA 1VYSX 3M5XA 3MHUA 5HR7A 1L6SA 1KFBA 3CWNA 3DKJA 5HWMA 1DQWA 1H63A 4MJMA 1IIHA 4PFMA 1VYRA 1EP2A 2J9XA 2YDAA 2X30A 3I7RA 1VPXA 3FIGA 1GVOA 5J5DA 2WQPA 3O07A 3W2UA 3TFCA 1A50A 4JTIA 3A21A 4YCPA 5EY5A 4WY0F 1FWNA 3QSRA 2DP3A 3A9IA 4MLRA 2C14A 2DJXA 1AMKA 3W1LA 1DJQA 5KZDA 4CNNA 1ME9A 5FF2A 1PVNA 3GLCA 2RDWA 3S8HA 2Q3OA 3W2LA 1SUXA 5LNWA 2E6FA 1H5YA 4O53A 5EKYA 1TQJA 3C2VA 3TSMA 2VEMA 4OQVA 4UTLA 3MP4A 4JNMA 3EX4A 5H91A 3LHYA 3TAKA 3LLFA 2ZDRA 1Z42A 2BX7A 4O52A 5EYWA 1TPC1 2Y89A 5I3GA 5U4NA 4OV4A 1H61A 1WX0A 4ZQPA 1WOBA 2CLEA 1WBJA 3Q2DA 2FB3A 3QW4B 3TSBA 2RDUA 3DZ1A 1EB3A 4O1CA 2A0NA 4GBUA 5H2ZA 2QCGA 2ZZ3A 3HGJA 3NOEA 2GOUA 1E51A 3W7GA 2YX0A 4BFAA 4N9BA 3TMQA 1Q45A 3QM3A 3QMTA 2QKFA 1AW2A 1VQTA 2Q8LA 1EPXA 3NAVA 4MYAA 2ZRYA 1DQXA 3PULA 1YXYA 3BVJA 5GVJA 3NQAA 3HBLA 2ALDA 1X8FA 4NQ1A 4LT9A 2YYUA 1EWEA 3GDKA 5KMYA 3HG5A 3M6YA 2JBMA 2VC6A 5D33A 1W54A 4GUGA 3B8DA 1AW1A 5FEZA 1QPOA 1QOQA 2C1HA 3W9ZA 4EF9A 2QDGA 3W6YA 1SR9A 1RQBA 4FNTA 3SFKA 2YPIA 1Q3NA 5FF7A 1ME7A 2DJLA 3FOKA 3TXZA 4BWLC 1B4EA 1H51A 1KTNA 1R2TA 2CZ5A 1NAL1 2ZFAA 5EL1A 4O4WA 1TPFA 2E5DA 2NXGA 3EXSA 4POCA 3B4UA 2YFNA 1OK4A 4JX4A 5ABTA 1F73A 2Q3RA 3IIZA 4NT0A 5SWUA 4JTLA 4MZYA 5U7SA 1SSDA 1QDSA 5AHIA 4I7WA 3W7NA 5TBOA 1OFOA 1BKSA 2VFIA 2WPBA 2C6QA 2RH9A 1A5SA 1LCOA 2YSWA 4M7SA 1NF7A 4RV8A 2H90A 3NO5A 3ABQA 1P1XA 3G0UA 3BW4A 4N4QA 2BTMA 1NSJA 5EA9A 1FX6A 4QSHA 3I68A 1OYAA 4ZQOA 4HNUA 3G0XA 4YL2A 3TNOA 4LRSA 3HJZA 5IM51 4AHOA 5D02A 3EWBX 2YCEA 5K3VA 3ZFHA 5CSRA 1ICQA 3EKZA 3JR2A 4K7VA 4RJEA 5BMWA 5DLCA 3L9CA 4TIMA 5KTLA 4ZQCA 5AYYA 5CG7A 1UCWA 2QCDB 3TC6A 4UFHA 3W1TA 1DHPA 1P5BA 2E77A 2TRSA 1R46A 1FDZA 4YCOA 3NQ6A 3ZWSA 2QUVA 3RLUA 3IVTA 1GEQA 4TR9A 2JGQA 3WJYA 3GDRA 4H4IA 5T26A 4HSOA 4WJEA 4R34A 2X1RA 1UBSA 1TPH1 3LHTA 2YXGA 3ZR4A 3LXAA 4FO4A 4ZQMA 3INPA 1FXQA 2X2GA 1KW1A 5G2HA 3UWZA 2GVGA 2DZUA 1XBXA 3OG3A 5TQLA 3TQKA 2LLEA 3HPSA 1Q6QA 4AXKA 4A2SA 4IMGA 4WOZA 2YW4A 2R94A 2DZPA 3LCFA 2DU2A 3NQ8A 1EEPA 3NR0A 4JDYA 5LZLA 1LBMA 2WNQA 4ORMA 2I1OA 3MBDA 1O4UA 1H7XA 4RZ6A 4JEQA 3STCA 2A7NA 3WK3A 1XUZA 2YYTA 1OFPA 1TJRA 4ONVA 3NQMA 5KZEA 2Z6IA 5F2LA 4LTSA 3S1WA 2NV2A 3VNDA 2P0OA 1W1ZA 1VR6A 3CC1A 3O05A 4IJBA 1J5TA 1JRCA 1AL7A 2YR1A 2GVLA 3LCXA 3G22A 1VLIA 3OHIA 4MLJA 4MIMA 2ZTKA 1TMHA 5D32A 1GYNA 4Q4KA 3LV6A 3LGEA 1VC4A 3QJAA 5FESA 4JN6A 3S1VA 3UY7A 4JICA 3CU2A 3M5VA 4NUWA 4YXGA 3N2MA 1XXXA 1PHQA 3MI6A 1G6CA 1IF2A 3LTYA 3W1NA 5LHEA 1OABA 3S1XA 4EWND 4XBSA 2CU0A 1FDJA 2Z6JA 3FKRA 2NX9A 1FCVA 1KA9F 5CPOA 3SSJA 3HG2A 5HWNA 1SO4A 1G67A 3G1AA 4R53A 4E38A 1HO1A 3HPXA 3N19B 3B03A 1JCLA 2BXVA 3KRZA 2GQ9A 3W1MA 3PM6A 5D2XA 1FCUA 3I7QA 4N6EA 4D2JA 4WX2A 4HNNA 2CZEA 4JDBA 2CZFA 3EX3A 4IX0A 3C2EA 3MW7A 2B7OA 4L4LA 4Z0SA 2A5HA 2C19A 3GDLA 3T4CA 2FFCA 4OV9A 1W5OA 2YGYA 4O18A 4ZVJA 1K8ZA 4O54A 3LHZA 3N3MA 4NZFA 3UZ5A 4TMBA 3TK7A 3G1VA 2PRLA 2GQ8A 1OYCA 4KWWA 5D38A 3UWYA 4FNQA 1L6WA 1IXNA 1XFBA 4PCFA 2A1YA 1V5XA 4KFPA 5CPMA 3DXIA 4ADUA 4DF1A 3G0SA 1YPIA 1GYLA 3L0KA 3UWVA 3W7JA 5BOOA 2FPTA 5C55A 4O4VA 3UZJA 3T55A 1VHCA 2QCEA 4FF7A 3CEUA 1SZNA 3PY2A 3PAJA 3FKKA 3FYPA 3IIOA 1SW0A 4C1LA 3A23A 4RLIA 4GE8A 1VZWA 3W1QA 1RD5A 1EWDA 1J4EA 1VHNA 1TRIA 4K38A 4BI5A 4ZMGA 3M9YA 1T8XA 5D2YA 4OHQA 1RVGA 3LRKA 3TJLA 4WUIA 5L6UA 1FWTA 3L21A 1ZFJA 1OF6A 5D04C 2W0UA 3N73A 2J6XA 3UPWA 3MI2A 3UXAA 3WJWA 4UFLA 3FJ6A 4XWUA 2NUWA 1QAPA 3NM3A 1X1OA 4JY9A 2F7FA 3DENA 5E93A 1WXJA 1UASA 4N4PA 3R5EA 3E96A 4O13A 2V5BA 4RKAA 3B0UX 1THFD 3E9AA 4CQ9A 3O63A 2G97A 1OFQA 4S2BA 4FX7A 3EWUA 4TX9A 5KINA 4ADTA 2A21A 3QF0A 1A5AA 3DU0A 5DCEA 4Q32A 4S1FA 1S5TA 2Y7GA 3G3DA 1I4NA 4KKXA 2AGKA 4NNAA 3W74A 3BG3A 3FFSA 3G8EA 2CLIA 3GAKA 2H3DA 3BPWA 1PCWA 4RCXA 4FB7A 1TV8A 5LNUA 4UTTC 3NQ7A 3P5YA 1B3OA 3GX9A 1TPUA 1SW7A 3STGA 3TQVA 3OIXA 5G2IA 3TSDA 3PB2A 2A2IA 3PWAA 1KM5A 2ZBTA 1WAUA 3WK0A 3IV3A 1YADA 2WNZA 5G2WA 2ZA2A 1RZMA 3IRDA 3W1XA 5E0KA 2WNNA 2HS6A 4JYFA 4NU7A 4ORIA 3HB9A 2E68A 3W7EA 1K8XA 4J9JA 3QQ1A 2CLLA 3PVFA 4KFNA 3TE9A 4LRTA 2Y61A 3G1DA 5HUPA 4A2RA 3RF9A 3E12A 4GRSA 3LOTA 3O6CA 4IPJA 3PBYA 3W7HA 5CZSA 2VELA 1WA3A 2QR6A 4JYEA 1JUBA 1F5ZA 3G1XA 5KZMA 4S2CA 1GPWA 3LB0A 4GNJA 1XL9A 3L0NA 3QYQA 4WXZA 3OEXA 4DO5A 4CNPA 3EKLA 1OF8A 1G7VA 3KVMA 3H54A 2EPHA 1TREA 4AH7A 1WOAA 1YDVA 2EF9A 2YFOA 4JTGA 5AC7A 3QMRA 5F4WA 4B5NA 1FCBA 4PL1A 1X7FA 2DZTA 3WFAA 1AL8A 3W1RA 3NQVA 3BK0A 5HINA 1WYIA 3LDVA 3M1ZA 3QPYA 3LRMA 3LI1A 1F74A 3EWXA 4FNUA 3QFEA 4OT7A 1G4EA 2EKCA 3G8RA 1FXPA 2PC4A 5AYZA 1PHWA 1W5MA 1KFLA 3L5LA 5DY3A 2KZHA 3CTLA 3DFOA 4CNOA 4IMEA 3R13A 2W79A 1Q6LA 1TJPA 4JIPA 1SW3A 2JGYA 2PE4A 5F2GA 1JQVA 2TPSA 4PC8A 2C18A 1KM3A 3NL3A 2NXHA 2OJPA 2C0AA 1KTBA 3B06A 3KXQA 3NEVA 2J9ZA 3P8IA 4ICNA 5D2VA 3KX6A 2GJLA 3GNNA 2VENA 1DL3A 4Q33A 2W6RA 4MKNA 5DCDA 1HO4A 1F7BA 6ALDA 3DBPA 5CZJA 3TH6A 4JTHA 5K9XA 3IVUA 3ATZA 2BWGA 2VXNA 5LSMA 2RKXA 4Y90A 1H7PA 2V30A 2A7RA 3V1PA 1PS9A 2A6NA 2ZA1A 1GJPA 4MZ1A 3W7OA 1K7FA 3F03K 1PL9A 3L66A 3PUEA 1OJXA 4UMAA 2ZZ4A 4NXKA 1VYPX 1HG3A 1EUNA 4N9CA 3LX9A 2NUYA 3L5MA 4G1KA 4LW7A 3NDOA 1YTEA 1OX6A 2B4GA 4NVTA 4O1DA 3HQ1A 4XUGA 4IQLA 1OFRA 4UTKA 5DBTA 4P2VA 3DHDA 4LVBA 1LDCA 3PC0A 3C2OA 3W72A 1OFEA 5A5WA 4AVFA 3GXPA 1LM1A 4PODA 5HULA 1N7KA 5K4XA 3UWQA 1W3IA 4GUJA 1W56A 3P82A 2BZNA 3N34A 4K7YA 3DH7A 2QF7A 4M6QA 3WJSA 3IGUA 3DFSA 3EXRA 3GXTA 4N9DA 3UYCA 5F2IA 4ZL1A 4EVZA 3LCHA 2CLOA 4JD4A 3G1HA 5K2ZA 1ZY9A 2CWNA 3DGRA 1PE1A 1QCWA 3WJZA 1G7UA 1LOQA 3ELFA 4DPQA 1B9BA 2FDSA 1SSGA 4KWVA 2J24A 4MFDA 1N8FA 3CIXA 3THQA 3OA3A 1XBYA 3DFTA 2DORA 4LOCA 4UTWA 4DQWA 2I9EA 2Y6ZA 3A22A 4CQAA 3CT7A 3M5YA 4FHAA 1IIGA 1DOSA 1GG0A 1JUKA 3NL6A 4O1BA 3SY5A 3ATYA 4JYDA 2XN0A 4PH6A 1XI3A 3UPBA 4LVFA 3W7QA 4JTSA 4DBDA 2QCDA 4GWEA 2DZWA 5IBXA 3HPZA 1KM0A 5LGZA 5AFDA 1JCNA 1F6KA 1T99A 3W84A 2CZDA 3M7WA 3U6WA 5AN7A 2R8WA 1H1ZA 4OGZA 5AC8A 4HSNA 3SIZA 4A22A 2VFFA 3GAYA 1I45A 5A8GA 3E49A 4WD0A 1Z41A 2J27A 1Y0EA 4QQ3A 4IXXA 2ZRXA 3EXTA 3M0ZA 1ZHAA 5AHMA 4UFMA 1GT8A 1N55A 5D2WA 5DELA 3IGXA 4E0CA 1I2RA 3H55A 1GVSA 2E5CA 2IQTA 4ZQRA 1QOPA 1W8SA 1WQ5A 1FCQA 3BW2A 3EWWA 4LWWA 5AHFA 2Y85A 2FTPA 4FNPA 5LNVA 1KM1A 4OWGA 5G4EA 1ALDA 4I7UA 1AG1O 1H7RA 3EX6A 3W7KA 1NFBA 1ZJIA 3W7IA 3LLDA 5K7JA 2NLIA 3HGOA 1U83A 2OZ0A 4CLMA 3O15A 3R2GA 3KFTA 4LVDA 3UY8A 1ZAHA 3BLEA 5C6MA 2A4AA 4OU1A 3N14A 4XZ9A 5DBUA 1K03A 3EEGA 2V2HA 3P62A 2B7NA 4UTIA 5C2XA 2P1FA 3UWWA 1W5PA 3WJXA 4QM1A 1SU5A 1QR7A 4K36A 3SJ3A 3B0PA 4UTHA 1X1ZA 3RNDA 4K6AA 4ADSA 4O14A 1Q6RA 3CWOX 1JCYA 2NV1A 2G95A 3QQ0A 3MP5A 3AJXA 5I3FA 1GG1A 5BNKA 4NJHA 3M5ZA 3NZRA 1P0NA 3VE7A 3PUDA 4K39A 1TO3A 4JR5A 5TIMA 4UC5A 1K7EA 3W76A 1HL2A 3E02A 1VRDA 1O94A 3S0CA 3KRUA 3S1UA 3FEMA 4AMAA 1SFJA 4WXYA 3GVGA 2VEKA 2V0TA 3WK2A 3B05A 3TFXA 3IIPA 1FWSA 2V9DA 1SQ7A 1PV8A 2QCCA 2QAFA 4MPQA 2ZYFA 4LY8A 2FQIA 3DFNA 3QZEA 5AC6A 4M6VA 2WSQA 3ZWTA 4TU1A 3SGZA 3PS7A 3GYEA 3G18A 5K9CA 3PF3A 1LP6A 4GC4A 4HNVA 4BWLA 3QPZA 1I2OA 1QO5A 4MZ8A 3BGGA 3W2JA 3LI0A 3GZ3A 1KV5A 1R47A 1AK5A 1ME8A 3SW6A 5I3HA 1WV2A 4NNCA 1ML1A 1JCMP 3TC7A 3W71A 2CLMA 2OX1A 7TIMA 3A24A 2QAPA 1YXCA 3NQFA 2BSLA 1H62A 2Z1BA 2H8XA 2QUTA 3N2XA 3IIVA 3CIWA 4MVAA 4UUIA 5EPDA 2F84A 1YLVA 1L6YA 5DXXA 1YYAA 2TYSA 3ANYA 4M6PA 2CLFA 4AWSA 4W9TA 5AHLA 5DCBA 4LS0A 3EB2A 4O15A 2TMDA 4MY9A 1LRQA 3BARA 2A6LA 1LTDA 1OK6A 3C3NA 3P67A 4Z08A 4ZZ9A 4PA8A 3VFLA 1KM4A 4UNKA 5EMUA 3QMSA 2G96A 4NX0A 3TU9A 3THAA 3IIXA 1EUAA 3QEZA 5CZ0A 2R91A 4Z1CA 4Z1DA 1G69A 1DBTA 3CM4A 1TRDA 2DZVA 5L9FA 1FBAA 4IWWA 2Z0IA 4O17A 3NL5A 4X2RA 1ADOA 3PUOA 1KFJA 4O16A 3KOFA 4N2YA 1SFLA 1VCFA 1PIIA 4XBKA 3S6DA 3TX9A 3MHFA 4K8HA 1YDOA 3GKFA 1LBFA 1M6JA 2CLKA 1TB3A 2B7PA 3PSVA 4U28A 1B57A 1XUUA 1LYXA 2A85A 2ABAA 1EP1A 3QH2A 4O57A 1FY6A 5AHEA 3IVSA 3ABOA 4JX5A 4UFJA 3GDMA 3KVJA 2PURA 2ZCGA 3W7DA 3K30A 4UTTA 4UR7A 3KVLA 4CQ8A 1LORA 4RR4A 3W1UA 3U8GA 3NQCA 2FJKA 1H7WA 4BI6A 1LBLA 4QITA 2H8ZA 3OBKA 1P0KA 3GDTA 2X1SA 3W70A 4MUZA 1MEWA 2NWSA 2WO5A 4UFKA 5G1YA 4JTKA 1VS1A 4U4MA 3C56A 4RXFA 3SECA 1XDMA 1DKWA 2PCQA 1X6UA 3B0VC 3SI9A 2Y7FA 1O5XA 1KM2A 2ZZ1A 4L4MA 4NZJA 3NPXA 3W2NA 2YW3A 3C6CA 1OVDA 2VEPA 2C3ZA 1MSSA 3TKFA 4YWIA 1W3TA 1S5VA 2C16A 4EF8A 3VE9A 1BWKA 3LCLA 1CI1A 1A5BA 3GB6A 1TIMA 5FF0A 1QPQA 4CCCA 2O7SA 2QCMA 2EAWA 5K9DA 4IMDA 1JCXA 2P10A 2QUUA 4QNEA 1SZEA 4RZ5A 1SZGA 3LRLA 1YTDA 2E6YA 2ZRVA 2ZZ2A 5KSWA 4JTFA 4E2BA 1V7YA 1F76A 1W31A 2H6RA 1BEUA 5HNRA 3EWYA 3F4WA 4RZ4A 4ML9A 1LRTA 2NZLA 3A5VA 2GPTA 3O6DA 2Z2UA 4JXCA 1B4KA 4NXSA 1QO2A 3O16A 3FLUA 3FA5A 3AO0A 3NPVA 1VCGA 4O12A 3VCRA 4I7VA 1GOXA 1W3NA 3QC3A 2R14A 3O06A 4Y9AA 1RPXA 3R89A 3T40A 3F1QA 2YZRA 3W7RA 2RHGA 1DORA 4NJGA 3FS2A 3DKLA 1IXOA 1OFAA 2ZZ6A 2ATSA 1A5CA 3S5NA 4JX6A 1LLZA 4AWUA 2Y7EA 1TV5A 1ICSA 5CPNA 3TROA 4Y6GA 1MZHA 2VFGA 5HJLA 4OBTA 1GTEA 3R12A 3CB8A 1RR2A 4TO8A 3LCIA 1LOLA 5I3KA 3LXBA 3W1PA 1NEYA 2ZZ5A 3ABSA 3IEBA 1OFBA 3TV8A 1LZOA 1GVFA 2ZRZA 3JRKA 4BK9A 4AEOA 3NQDA 3LV5A 1R2RA 1OX5A 3FYOA 3BO9A 4YLWA 3NQGA 4QNWA 3U2OA 5DXYA 4XKYA 3KAOA 3Q58A 1Z44A 2A7PA 1DJNA 2QCNA 3LTSA 2VKZG 3CPRA 1VGAA 1HUVA 2ZRUA 1RV8A 4NJIA 5C5YA 2O7QA 4NNBA 4RXGA 1QNVA 2ZQ0A 5F1VA 5F4SA 2GUUA 3LHUA 1A53A 4IOTA 1VJIA 4LUIA 4N9EA 3HOJA 5HR6A 4R33A 1LOSA 4HPJA 1KFCA 2JKAA 3QRHA 4WZHA 1K7XA 2QCLA 3HMJG 3S42A 1GQNA 2HTMA 1G4TA 1UB3A 3C52A 3PG8A 1WBHA 4FNSA 3O8AA 4MOZA 3G24A 3A5FA 1IGSA 4LVGA 3NG3A 3W3OA 4UNLA 4XKYB 3UWUA 4OE7A 1K02A 4O1AA 4FNRA 3OVPA 5D09A 4AF0A 5D05A 1NF0A 1JQXA 4Y96A 3EWZA 3L68A 4LC8A 4E2DA 4O0ZA 3W7LA 3TCEA 2H3BA 1BTMA 1ICPA 1PCKA 1UUOA 1OHLA 3CEPA 4UTMA 1I8JA 3RMJA
chains in the Genus database with same CATH superfamily
3T44A 2WMKA 5BU6A 4DELA 4HNTA 2RGMA 3GK0A 4H3DA 4IMCA 3O1NA 1WKFA 4TVDA 2F2HA 4IISA 1JUEA 1SO5A 1BF6A 3WLIA 2J7HA 5A8PA 3IUDA 4GYJA 2XPKA 1CBGA 3QBUA 1BVZA 2YL6A 4MPKA 3NZ1A 1W0MA 5D37A 4JFUA 4J3ZA 1FHVA 3T08A 5BRBA 8RUCA 4V2XA 3PG9A 1UJPA 5I3IA 6CGTA 1R9YA 2ZRWA 5LKYA 1LQ0A 4PUWA 1CENA 1JDFA 3UD6A 2V5LA 1HFBA 5CKSA 4XQ6A 3TOYA 6TIMA 1HKIA 3Q94A 4K37A 3VUSA 3W23A 1C93A 1TQXA 5BWAA 5CPLA 3LGGA 4DXVA 4O11A 1AZ2A 2DSUA 3NFUA 4LBRA 2Y63A 5CGTA 2J77A 1UMLA 4XTIA 1FH8A 3AJ7A 4RX0A 3M16A 1EZ2A 4CD4A 3DC8A 5FSDC 1YMYA 1U5JA 2Z1KA 4PEKA 1SJCA 2GGGA 1DXIA 2OMAA 4GXPA 3CQIA 4DBEA 1GZGA 1Q66A 5A6LA 2WJZA 1H7OA 3BAJA 3WLHA 1XM3A 5DEZA 3W38A 2VEGA 4H2CA 1KRCC 2NUXA 4K8EA 3T1GA 3W07A 1UJQA 2X16A 2IKHA 1OZQA 1OSEA 1SO6A 4QDMA 2XJ7A 4GI4A 1EJXC 4D8ZA 3KOZA 3EA1A 1NVMA 2WSRA 1DWAM 4GJIA 3S5YA 2BLEA 5DY2A 3P8JA 3NM1A 1KTCA 3W24A 2A79A 3WBWA 2Q02A 2EG6A 3LBCA 3MHGA 3L65A 1S2AA 3IPWA 4D8AA 2V69A 5LIKX 3QW3A 3RCNA 1JPIA 1FFQA 4IP7A 3HQNA 3RLGA 3L4UA 4O0QA 1ONRA 3HV9A 1BVNP 1HKMA 1U33A 3HIJA 3TTYA 1K8YA 5D03A 1LUCA 1A47A 4ACZA 2J4GA 1UOKA 4IJRA 4J3SA 1SMAA 3VA8A 1GOQA 3E0LA 3L67A 4PRWA 2Z4GA 4GUFA 1J0ZA 4CEXC 1MQRA 2Q8XA 1KGWA 2FTYA 2OLSA 2VEIA 1V6TA 2QHAA 3KLLA 1XX1A 1XISA 3VGBA 3GTNA 4Q8PA 2CLHA 2IPFA 2V68A 2QDHA 1A5LC 4YVVA 2I14A 3WMLA 4BF7A 1LUCB 4ACZB 3JU2A 2Y62A 2DUXA 1GVRA 1TPEA 1YDNA 4YTRA 4QLLA 1EBHA 3VOJA 2PB1A 3VMOA 3OBEA 4NL1A 2VD9A 2HROA 1BYAA 3W6MA 8XIMA 2ZTJA 4MJZA 4KRZA 1XBVA 1W9BM 3IGSA 4KEMA 1Z32X 1T5AA 2PRHA 1RQHA 1BQCA 1NOUA 3K1GA 1K3UA 3A3HA 4UMBA 2E25A 1KM6A 2DV0A 8TIMA 1BXCA 2CHNA 4W4QA 3VTRA 3B9NA 4HKPA 4RNHA 3MB9A 1S2UA 1PBGA 5HXMA 5CC7A 3NGJA 3HG3A 6PTDA 4IPIA 1AW5A 2GK1A 3NL2A 1NY1A 4UXDA 1JYXA 4LCSA 3HU7A 3WF1A 1KBJA 4Z0JA 2J8TA 3VZXA 1FFRA 2WV8A 1ZS2A 4ATLA 1ITXA 1V6WA 1B30A 1VBRA 2BS9A 2D2JA 1TV4A 5PTDA 3BAYA 2QCFA 1KLYA 3P60A 1F6YA 3ZS4A 1J6OA 2V3EA 3GVQA 4X9SA 5AOUA 5KEZA 2VT0A 4GFSA 3ALFA 3DAQA 3AMGA 3UXLA 1E6NA 2VFDA 4XAPA 2VM8A 2YBVA 2VZTA 3W73A 3N29A 2GK1B 3BSHA 1QK0A 3GNPA 3CHVA 1CXKA 1R30A 1FWHC 1EXBA 5AC4A 5IOBA 4F48A 4OUEA 4YS1A 1V03A 1UHVA 3CBWA 1XPGA 4IF2A 4CCDA 2FVMA 4NG3A 4ZQNA 1H50A 4LUJA 1B5TA 4DNMA 4NI3A 3DESA 4FXRA 1OC6A 5BOEA 5EB8A 2W62A 3M44A 1XDLA 5LGXA 3CAQA 2BOGX 5HNTA 2E6AA 1E0VA 5FJTA 4LC6A 1VCVA 3NPWA 3WQOA 2AQWA 2OSYA 4LS1A 3MUZ1 3OP2A 3V3WA 4DO4A 5I5RA 2V82A 3ZVHA 3WQVA 1QBBA 4LV4A 2CYGA 3WD4A 2MNRA 4HP5A 5LNRA 1WXYA 3MI3A 1LQAA 3TQ0A 1XCXA 3SCUA 1E5NA 2W67A 3VKCA 2QDEA 1TWSA 2Z2AA 2FZ8A 1H11A 4JFWA 4PMYA 3W25A 1Q6OA 2XSXA 3UU0A 2NW0A 1T96A 3RM8A 3P80A 1ZENA 1EF2A 1Y7VA 3LHVA 2ISWA 4IFKA 2VVNA 3GH5A 2PDKA 4OIFA 5E9AA 4GY0A 2J88A 3VGDA 4J3UA 2J9YA 5K4ZA 1M5WA 1M1BA 5HMSA 1SJDA 2V2CA 1V6UA 3P7YA 4DB7A 2VFHA 2EBNA 3CUFA 2HEJA 1Y8BA 4XIAA 5JMUA 4AIOA 2PDJA 2FPVA 4PTNA 4UTJA 1YE6A 4GKTA 2QGYA 4I9AA 4Q7IA 1X39A 3TLLA 4DWSA 4J5NA 2FPYA 2DZSA 4HHLA 3AUJA 3VGGA 1AQHA 1P4CA 1PDYA 2V8ZA 2SFPA 4S3EA 4S23A 2PZNA 3ABZA 4Z2LA 3WH8A 2WXDM 1LROA 1L9WA 2NXIA 4DPPA 2E09A 1XIBA 3WBYA 3UZXA 1L2UA 4O50A 1IE7C 1JI2A 2QCHA 1BD0A 1YPFA 5IBXC 1POJA 4FIRA 1W5NA 2GL5A 3PFMA 3EDFA 4DWSB 4GUHA 1TPVA 2G41A 1J18A 5CQ1A 2WMIA 3GWQA 4KGLA 3CUZA 1XINA 4GO8A 3B0YA 1XD0A 1BTCA 3NQBA 3SRDA 4PMZA 5AZ1A 3DKJA 2E28A 3C2YA 4MJMA 4Q8TA 2VEFA 1VYRA 2XGBA 3I7RA 1VPXA 3EA3A 3BJTA 3W2UA 3KL3A 1KXHA 4NRRA 4P8WA 4WJ8A 3TFCA 3C0QA 2XFFA 3DYPA 4JTIA 4QJ3B 4YCPA 3N15A 4WY0F 2XVNA 2DP3A 3A9IA 1JAEA 3STPA 5AVNA 3UJEA 1P6BA 3VNMA 1PVNA 3GLCA 4FALA 3S8HA 2Q3OA 4WDXA 3LPGA 1CPUA 5LNWA 3LNPA 4O53A 1GOWA 2TODA 1PAMA 4UZSA 2NSXA 2HNEA 1TQJA 1R9ZA 3T6CA 1TFVA 3WDRA 2VEMA 1UD8A 4MWAC 2VX6A 4OVXA 3LLFA 3EKGA 2O4MA 3TYEA 4UTFA 3K1DA 1TPC1 4V27A 4PTVA 4QAWA 4IIGA 1Q6CA 1XF0A 4ZQPA 1KO0A 1WOBA 3RJXA 3POHA 3QKEA 1EJVC 2FB3A 2WZHA 4NILA 2X8RA 3GTXA 4IP5A 1BXNA 4GH3A 4V33A 1EB3A 4O1CA 3CV2A 5H2ZA 1BGAA 1E51A 1TA3A 3ZT5A 4XZNX 3MJMA 3TTSA 2YX0A 5CC5A 1XIMA 3WIJA 4L6HA 2QKFA 1VQTA 4MYAA 4M6UA 3UYIA 3HV8A 3PULA 1YXYA 3NQAA 1H0GA 4LT9A 2YYUA 3GDKA 4HSHA 3V0SA 1O5RA 2PTDA 2VC6A 4EPDC 1QPOA 4KCVA 4HTBA 3SUUA 1M04A 3EPOA 4EF9A 2QDGA 3W6YA 1TA3B 2YPIA 1JZ8A 1DIKA 2W63A 1B3XA 1DE6A 1V02E 2D0GA 3TXZA 1B4EA 1R2TA 2ZIDA 2BVTA 3AWNA 3AHVA 5FJIA 2YA2A 4O4WA 3R25A 1TPFA 1C8YA 2DPEA 4POCA 2YFNA 4JX4A 3VGHA 1F73A 2Q3RA 3IIZA 3T2OA 2DY3A 3QZAA 5TBOA 1VIZA 1OFOA 4PMQA 1NOWA 1QASA 2VFIA 1A5SA 4OBSA 2H90A 3GUGA 1GNXA 3NO5A 1P1XA 1HW6A 1NSJA 1FX6A 3FAWA 3VUPA 4GK8A 4J1OA 2VC9A 3TC3A 2DSVA 1EGVA 3U5UA 1E71M 3PZQA 3EWBX 1W1PA 2WHJA 3MY9A 5K3VA 3ZFHA 2ZDSA 3EB3A 1ICQA 3EKZA 4J40A 3LK6A 5AYYA 5CG7A 1UCWA 1MXDA 4UFHA 3AFBA 4NAEA 3NVDA 3NSNA 3ZWSA 2GGEA 3RLUA 4LUYA 1GEQA 1AQFA 1IGWA 2J7BA 4JFTA 3WLOA 5XIAA 4W86A 1JZ2A 4HSOA 4QLKA 4IIDA 2FZDA 1UBSA 2JALA 4E3TA 1OT1A 4FO4A 1PWMA 1ISYA 3K46A 5TQLA 1Q6QA 3T2QA 4WOZA 3VX0A 1PZ1A 4ICMA 4FK9A 2DZPA 5A95A 7XIMA 4TOQA 3SRHA 3NR0A 5BOFA 3JUGA 1AH3A 4F0LA 2VURA 3IGHX 2V38A 4ORMA 1H09A 3MBDA 4FOUA 1HP5A 1AJZA 1A5NC 3STCA 2BNJA 1XLGA 1XUZA 3OZMA 1OFPA 2Z6IA 4J3VA 4A35A 5IHSA 4LTSA 3RX3A 3TTQA 4UOJA 3UW6A 2XZ7A 1DJGA 3VD4A 3VNDA 4KCWA 2RDXA 2VRJA 1AL7A 3QV6A 1I75A 2YR1A 2GVLA 3EB4A 3LCXA 4MIMA 1JNEA 5C9UA 1MQPA 3LV6A 3WX7A 1VC4A 1XDJA 2YDSA 2QPSA 3QJAA 4H9VA 2X05A 2R1MA 2Y1HA 3GXIA 2DVTA 3ZO9A 3WDHA 3CU2A 3M5VA 3N2MA 1Z69A 3DG3A 1OABA 2DW7A 3TONA 1OEPA 5M3WA 3TYBA 1NWSA 3HG2A 5HWNA 1DWGM 4C5ZA 4C6MA 5GJNA 4NP7A 3UT0A 1G67A 5CJ5A 1NP0A 4E38A 2FH8A 3TLQA 3B03A 4X63A 3FYYA 3ARZA 2BXVA 1WP6A 4FA3A 1PYMA 4D2JA 4N6EA 2YCJA 4HNNA 5I2UA 3PPCA 1Q2SA 3MW7A 1FWAC 4L4LA 1XRSA 4REQA 2GUBA 3CL8A 3GDLA 1OWQA 4OV9A 3N2OA 2XIIA 4QG8A 2YGYA 1QI2A 3FAXA 3GU2A 3ZJ8A 1GZJA 3TK7A 2PRLA 1OYCA 4KWWA 1LT7A 1VFFA 4PUUA 3V36A 3E6EA 5CPMA 2A3CA 2XTKA 1CXLA 1GYLA 1U2YA 1EJ7L 3W7JA 2PLKA 4BA0A 2FPTA 3TWBA 3E2QA 3PK7A 4OZOA 3T55A 4REQB 3GG1A 1IEIA 4FF7A 1V6XA 3CEUA 1U5HA 4YTTA 3PAJA 1X98A 1EIBA 1SW0A 4QQUA 5A6BD 3LSCA 2P53A 3S6OA 3W37A 3BZGA 4QLJA 5FKYA 1HZYA 4ICCX 1TV3A 4BI5A 3AMCA 3M9YA 4JQ2A 3ZIZA 2L5HA 1RVGA 3GTIA 3L21A 1ZFJA 3UXAA 4UFLA 4XWUA 3KLKA 1QAPA 4W8LA 3AS3A 2OX4A 4W5UA 3ZZ1A 1MNZA 1XPYA 3CYVA 4GYPA 4Q22A 3EWUA 3WELA 4TX9A 3U2EA 4JTCA 4S1FA 1HVXA 1S5NA 1V02A 2XVGA 3GAKA 3L7RA 1PCWA 4FB7A 2Z25A 5LNUA 4UTTC 3GX9A 4RL3A 4C60A 2CHOA 1K70A 4QJ4B 2ZBTA 1H3GA 1WAUA 4BEQA 1RZMA 1TMLA 2PBGA 3W1XA 4EX4A 3H4WA 3ZYZA 3RR4A 2HS6A 1UG6A 2I5GA 4ORIA 1WAWA 2OOFA 3QQ1A 3N6HA 3OLGA 5HUPA 1NQ6A 4CN6A 3DECA 9CGTA 1TUFA 3M0MA 3PBYA 1XWYA 2IPGA 2VELA 3CZEA 1GVIA 1PKYA 4S2CA 4GNJA 1EO7A 1XL9A 3VXGA 3WQ8A 3QR3A 3LUTA 3OEXA 4IPPA 1EHNA 4KT2A 4DO5A 4CNPA 4PB3A 1G7VA 4EWJA 4Q8NA 1TREA 1JNDA 4XAYA 3EDDA 4RPPA 2YFOA 1BLIA 4JTGA 1RBLA 2HISA 5F4WA 4B5NA 3RN6A 4PL1A 4U3CA 3ICJA 3M1ZA 3QPYA 4WSKA 5CPSA 2VWTA 3QFEA 1E43A 3L5LA 5DY3A 2POZA 2OOGA 2I16A 3CUIA 1VFMA 1V79A 4QS6A 3ONBA 1SW3A 1ISWA 2OQLA 4DN1A 5F2GA 1Q7MA 2QZRA 1KM3A 3D46A 4YWSA 3M0VA 3KXQA 1J2BA 1QOXA 5CGMA 1DHKA 2CXGA 2VENA 1I0BA 4MKNA 3DERA 5HNNA 5B80A 2BXZA 1IWPA 1PKNA 1DIDA 2RKXA 5FSEC 1RVKA 3QOKA 1H7PA 2V30A 3V1PA 1BKHA 3GH4A 2BHZA 5F7UA 4A3RA 1AJ2A 1PL9A 3F03K 3L66A 1OJXA 4UMAA 3LQLA 4NXKA 5CJNA 1SZRA 4QR6A 1A0DA 4KETA 2I17A 3EA2A 3SCQA 5I7GA 2BP1A 5D8ZA 7REQB 1QHZA 3HQ1A 4KCTA 4U10A 1OFRA 1LDCA 2E8YA 5A8MA 5A5WA 3GXPA 3SCOA 5K4XA 3RPTA 3CZLA 3UWQA 1W3IA 4GUJA 3AISA 1W3HA 2B31A 4M6QA 4Q7NA 4RNJA 1XLKA 5GNXA 1UKQA 3T07A 4ROQA 3UYCA 5F2IA 3UZZA 4EVZA 2CLOA 3SUWA 4JD4A 3G1HA 5K2ZA 4HNOA 1ZY9A 3ZOAA 3IJ8A 4R9XA 2XVKA 3SAZA 1B9BA 3CL7A 2R6OA 3AIQA 4HHMA 4MFDA 1NWUA 3CIXA 3HFYA 3DFTA 2DORA 2G4FA 3WZ0E 2I9EA 3XINA 3A22A 3M0JA 4H00A 5FOOA 3CT7A 1IIGA 4FF5A 4DWDA 3NL6A 4S3JA 3RM4A 2F9RA 1UKTA 4N42A 3KBMA 2XN0A 3SCTA 3AC0A 1AZ1A 3W7QA 3N9KA 4ZO6A 2NQLA 3S46A 5DMYA 4Q8MA 4AC7C 1OCBA 5AFDA 2ONEA 1JCNA 3LG3A 2IQ0A 4HCDA 3M7WA 2J47A 2R8WA 2VP8A 1H1ZA 4OGZA 4PRRA 5AC8A 1QNPA 4QROA 4HSNA 2VFFA 1G94A 3A12A 3GAYA 1I45A 3IK4A 1Z41A 3PWIA 4IL0A 4GZIA 4QQ3A 4IXXA 4KERA 5AHMA 3ZJ7A 3THDA 1CGVA 4UFMA 4XG1A 1EPVA 1TVLA 1J0HA 1IWBA 1QOPA 4ECLA 1RK6A 1WQ5A 4DHGA 1O1HA 1C7TA 2Y85A 3MPGA 3S2JA 4MB3A 3AAMA 1ALDA 4L9ZA 5HQLA 5D9NA 1NFPA 1UD6A 3LLDA 3BCJA 3N2BA 1UZ1A 3ZLFA 3K4AA 3O15A 3WQ4A 3R2GA 3WENA 4QDWA 4CD6A 2XH4A 1NFGA 4OU1A 3OG2A 1KRBC 2DT0A 3EEGA 2V2HA 3PPHA 5RUBA 2B7NA 1JGMA 4F0KA 1W5PA 3IV8A 3AUOA 4JIIX 2A3AA 2WBGA 4ADSA 4K6AA 4LAKA 4E3VA 5IFPA 4EXAA 3BICA 1M01A 4PCNA 5E9XA 5HDRA 3N4EA 3AJXA 2G8ZA 3V18A 3WF2A 4XAFA 4GQ0A 3NZRA 3KBWA 3PANA 2WHMA 4ACYA 4IMAA 2ASHA 4K39A 1UBPC 4BY3A 4BCEA 4JR5A 4AIBA 1ADDA 1O94A 4FR6A 3VOHA 4AD3A 4AMAA 3PZGA 3S2MA 4WXYA 1D3CA 4G8TA 3UR2A 1J0JA 3B05A 2ZKMX 2A3BA 2ZX7A 4E4PA 1PV8A 4F2UA 2WM1A 4PMJA 1WNOA 2DT2A 2Y2WA 2QDDA 2OKTA 3PS7A 1YQ2A 3G18A 1P7TA 3AXMA 3RLHA 5JBEA 2GYIA 1S1RA 4HNVA 4BWLA 5HA7A 4B4FA 1IR1A 3BGGA 3MUIA 4LCQA 3GXFA 4PUMA 1ML1A 3QR0A 2CLMA 3CK5A 4QHRA 3VYLA 5H8PA 4P5UA 4IIFA 3ZSTA 4DWSC 4DXXA 3T42A 3IIVA 4MVAA 4AD0A 4HPHA 1P7TB 3WLPA 2CITA 4JQAA 4WDUA 1Y5XA 4AWSA 3BLDA 4W9TA 4EAMA 5DCBA 1S2VA 4MY9A 1LRQA 3PZ9A 3C3NA 2PGWA 4UNKA 5IFTA 3TU9A 3N17A 4LAUA 1CCWB 1A80A 2YJQA 2OGYA 4IWWA 4O17A 1OCQA 1RH9A 4X2RA 1D7FA 1GZ1A 4HN8A 5FIPA 2WJFA 4O16A 1X6NA 1VCFA 2GOKA 3IACA 1PIIA 1YRRA 3QY7A 3ZLGA 3A6OA 2QNEA 3WEMA 3UJFA 3ES8A 3RG6A 1B0IA 3KP0A 3SCNA 4GD0A 4JZ5A 1NIUA 4KIRA 3PSVA 4QE1A 2G3IA 1AQ0A 2W61A 1LYXA 3QH2A 3V5FA 3GG7A 2ZVRA 3GR4A 5J8LA 3ABOA 3GDMA 3KVJA 2ZCGA 2CKRA 1YEYA 4IQEA 1GJUA 4MAZA 3U8GA 4IPLA 3CPGA 4XZWA 4C1NB 3QC0A 3WLTA 4ZSTA 1LL7A 3P0WA 1JPHA 1X6LA 2NWSA 1J79A 4AU0A 2PCQA 1Z3NA 1P6WA 3O9NA 3CT2A 2ZUNA 4MM1A 1TE6A 2Y7FA 2E7FA 1QU4A 1O5XA 3URAA 2X42A 4D72A 3TKFA 3S83A 1GW9A 4N0RA 4EF8A 1S5VA 2C16A 3GY1A 4CQDA 3GQYA 4GGBA 1J9YA 1F8IA 4PMXA 4HK5A 1K77A 3CUXA 5K9DA 2P10A 2QUUA 2X7WA 3AOFA 4RZBA 5A3HA 1R3QA 3MC5A 3LRLA 4E2OA 2ZRVA 1EDGA 5KSWA 1ISXA 1V7YA 4RE3A 1POKA 1T41A 3ISIX 3QGAC 2JF7A 2VTFA 3O6DA 3I6TA 3KDOA 3R94A 1SJAA 3L2LA 1B4KA 3DBNA 2ZWYA 3H24A 2VC7A 1GOXA 1W3NA 3QC3A 1RPXA 1V4YA 4ZR8A 1W9PA 3W81A 2CBJA 3VOIA 1ZL1A 4INFA 4NJGA 2X09A 1IXOA 6XIAA 3DGBA 1OFAA 3S5NA 2CBIA 2DFAA 4AWUA 4TX6A 1BSLA 2WWCA 1TV5A 4Y6GA 2VFGA 4IUGA 3R12A 1L0PA 3LCIA 5I3KA 2PTZA 1V3HA 1NEYA 1RALA 3ABSA 5A8NA 4ZFMA 3HPFA 1GVFA 3MKVA 2VUYA 4W93A 4H9MA 1OT2A 1W2PA 2FGBA 1OX5A 3NSXA 3NQGA 4QNWA 4BZYA 4J2PA 3U2OA 1MMFA 3V5CA 3UFYA 3Q58A 2I5QA 2PDXA 3LTSA 1JZ4A 1ONEA 1RV8A 4X9YA 1QNVA 2ZQ0A 1EJUC 4HHHA 1A53A 5GJPA 1A49A 1EDTA 2QUMA 4QFUA 3QRHA 1V6YA 4WZHA 3PZIA 1UB3A 8XIAA 1NDZA 3A5FA 1AH4A 3NG3A 3WNMA 5D09A 2V5KA 3JVAA 4AF0A 5D05A 1XH0A 4PMUA 4AXNA 2YB1A 3K4DA 5AKQA 1S46A 3TJ4A 1AH0A 3E38A 4MDPA 1BHGA 3H4GA 3SB0A 1XYBA 4OTKA 1MEHA 2HE5A 1A5MC 2OT0A 2INEA 1W32A 3MT1A 4XVEA 1BSIA 3Q37A 3T0TA 1QRQA 4Q8WA 4LV9A 1TVNA 3GR7A 3LBOA 1CX9A 3IJ6A 3SRFA 3DI0A 5BXSA 1J10A 3H7RA 3W85A 2ATMA 3W22A 3KVKA 4AF0B 3W53A 3MTWA 1R85A 3M0LA 4WIWA 1VBUA 2E1DA 4HT3A 1RPKA 1HJXA 1NARA 3UCCA 5A6JA 4O0KA 4M80A 3GU9A 1OX4A 3VKAA 1S39A 2NX3A 3BMVA 4DJEA 4DZAA 4OBRA 3T9PA 4A29A 2YOCA 3DFQA 5G4HC 3M47A 4YN5A 3LXCA 4GABA 3O7UA 1FUYA 2WANA 1RCXB 3ARXA 1MXGA 3CQHA 2WOQA 2ABBA 5F2MA 3YPIA 5CCZA 4Z1AA 4DZ5A 5BW6A 4ENLA 3CLMA 3F5KA 3PFRA 1OX4B 2IUZA 3M43A 1S3HA 3STEA 3RXZA 4UIOA 3M07A 1ZAIA 3R4IA 1S5WA 2Y5SA 4C7FA 2Z27A 1E1FA 4PUKA 4C90A 1NQKA 5A6SA 1EA0A 1X38A 4WKFA 4A05A 3APGA 4UQAA 4QX4A 2W4XA 3W83A 4UQEA 5FEXA 5D30A 4CNSA 5J5RA 1MXSA 4IGHA 1WDWA 3DX5A 1AQMA 2PDBA 5M17A 1DEDA 4Q8VA 3VD3A 2WMFA 2J79A 4FLRA 2WSYA 3H2NA 3TDFA 3WNKA 2FLIA 4OFCA 1KFKA 1E0XA 4QISA 2GWNA 1KCZA 4FXFA 3E0IA 2BOEX 1TSIA 4G56A 3NYZA 3MP3A 2PPGA 2XIBA 1OQFA 3GR8A 2OCZA 1US3A 1HVQA 1J93A 2IXVA 1XLDA 3BURA 3COTA 3G1FA 1E6QM 2JK2A 2GZXA 2BDQA 4RDVA 4W7UA 4J3XA 2O55A 3BG9A 1UR1A 2OVLA 1JULA 3UNDA 3A13A 1A3HA 1CGWA 2EXOA 3E5PA 3UR7A 2VYOA 4GYPC 3MUXA 2XFWA 5AYIA 2PTWA 3B9EA 3RPMA 3AIBA 1WKDA 3V35A 3GVVA 1P43A 1TTJA 5HWJA 4HPNA 1TJ2A 4UCGA 2ZVIA 2WNWA 3H2MA 2RDTA 2CFFA 3AHYA 1HGYA 4NYUA 4ZSUA 3OVGA 4B91A 3HGSA 1YTKA 3C61A 2R1NA 1BRLA 1GTHA 1M7XA 4I3GA 3P5ZA 1UIOA 2BY0A 2EO7A 2NX1A 1LRNA 3KL0A 4HZ8A 3AS0A 4UTUA 2V2DA 2NVCA 4M7TA 4ES4A 1JJKA 1H60A 3FV9A 4C6KA 4JBRA 5B7ZA 1R3SA 2WSKA 2W92A 3XIMA 2ZX8A 1KV8A 4AYGA 3A4WA 3P14A 3MMTA 1E6PA 2VDHA 3DFPA 1FWBC 3WF0A 3T78A 1SPQA 3GFZA 1XRTA 3CXOA 1V93A 3P61A 1Z6KA 4Q3MA 1BRLB 2UY2A 4DO7A 2OZ3A 2UV8G 3CL6A 4DZHA 2BV9A 1M03A 4DLMA 1OFDA 3CMGA 4NJKA 2FHCA 4JIRA 1UH3A 3ES7A 1JVNA 3WBXA 3NO1A 2DZAA 5AYXA 1MEIA 2WKJA 3C8FA 4IQDA 2WZEA 4MKSA 1A0CA 3BG5A 1N8WA 3G1SA 1O7AA 3IRSA 4XO7A 4UB9A 4WGHA 1EH9A 2HMCA 1CYGA 2OT1A 3P84A 2GSHA 2GQAA 2UWFA 2Z2BA 3AS2A 3AHZA 5FF3A 5LHFA 1KLZA 5HQMA 5IHRA 1O60A 2FHBA 1V6VA 2Q8ZA 3I6EA 2PI6A 3VCNA 1D9EA 3ZQ9A 1S2CA 1ESWA 1DVJA 4HB7A 3QGVA 4PMNA 2QJHA 1OCJA 2EGZA 3RK8A 5A6BA 2B0MA 1UROA 1PDZA 4YTUA 1UZHA 1K6AA 4L5ZA 1XGEA 5HJXA 3M41A 1UWAA 2D73A 1W17A 5CEWA 1UH2A 1FKXA 4Z2JA 4WR3A 3ABXA 2FB2A 3GKAA 4LS2A 1E6ZA 3MANA 3VU2A 2PBOA 1TTPA 3GNOA 5HUOA 1C3FA 3O0KA 1W1B1 1UUMA 1MO0A 3G77A 4PL2A 5ECUA 4WOQA 3T81A 2G3MA 3L5AA 4AB4A 1ZBWA 1YIXA 3E74A 2PWHA 2RFGA 1E6RA 3UCDA 4AD2A 3USZA 4NZ1A 2PP1A 4O19A 4UR8A 4G7EA 4JCLA 3M4HA 3UXDA 2G5WA 1C91A 6XIMA 5FJRA 1BWLA 3V75A 2E5BA 1MW0A 4JIQA 3GXNA 2VZOA 4LNYA 1TG7A 4A3UA 1QNOA 3G3MA 3LCWA 4MY1A 3TAOA 4IUOA 3HFTA 1R2SA 4GOAA 1JGIA 3DI1A 2FIQA 3EX1A 2D0FA 4FXSA 5EBUA 3UEQA 4G7EB 4BR1A 3N9RA 4HTYA 3FSUA 1RQEA 4AY8A 1BVWA 4FEZA 1FQ0A 1O68A 1KRAC 2BMBA 1ZALA 2DGAA 4MY8A 1O95A 3TN3A 3OZPA 2QGHA 3K5XA 3AXXA 2XIMA 4P7QA 4Q7BA 4L4PA 1QPNA 4MJ2A 3NPUA 3L0GA 1UH4A 4HK7A 2QV5A 4FR1A 3O6YX 5C7HA 1VYSX 3BAXA 2PF0A 1KFBA 5HWMA 3AIEA 1DQWA 1IIHA 4PFMA 1EP2A 3K13A 4F0RA 1Y65A 1I0DA 4BQ3A 3FIGA 3GBDA 1GVOA 5J5DA 4XV0A 3HMCA 3KS5A 1A50A 3M0KA 1PB0A 7A3HA 3QSRA 2C14A 1R7AA 1EA9C 2DJXA 3W1LA 1PXGA 2FGLA 5KZDA 4NZ4A 1Q8JA 3ITYA 3U4FA 5EKYA 5HMEA 4MMWA 4KS0A 2V3DA 4C6DA 3TSMA 2HXTA 1FVPA 2Y8UA 4UTLA 3MP4A 2YIHA 4JNMA 1K8CA 3EX4A 4ZO9A 4KW2A 4O52A 4IT1A 3HN3A 3MKKA 2Y89A 5I3GA 3AALA 5U4NA 4OV4A 2WK2A 2EEXA 1BAGA 4H9XA 2CLEA 3FY1A 4PMDA 2XH0A 4WSJA 2GLKA 3DZ1A 4D6EA 4GBUA 2QCGA 3HGJA 2BY2A 2IKIA 3TMQA 1Q45A 3ORWA 3UG8A 1EPXA 3NAVA 4G9PA 2ZRYA 1FWGC 2OWWA 1QBAA 2OR2A 4NQ1A 2XYLA 3T4WA 3BUVA 3N12A 5KMYA 3M6YA 4I8YA 2JBMA 5D33A 4GUGA 5FEZA 4C6CA 2YCKX 1K9FA 2C1HA 3MVIA 1QW7A 3ZR5A 4Q8OA 1SR9A 2P8BA 2BG5A 4ERIA 1E55A 4FNTA 3SFKA 3RUBL 1E9ZB 1J5SA 1UC5A 1ME7A 3SY8A 3P2VA 1GVYA 3R7MA 2H9AA 1Q85A 4JFVA 3BGAA 2AAAA 4BWLC 4LALA 4X0NA 1V0MA 2XVPA 4H9ZA 4PYSA 4GPNA 3HQOA 2QUNA 1OK4A 2WZMA 3MQTA 5SWUA 3MZ2A 4I7WA 4IG2B 3PTQA 1BKSA 4ZE5A 2C6QA 1TR1A 2INZA 4RV8A 4M7SA 1NF7A 1DWJM 3ABQA 1JPMA 3G0UA 3POCA 5DF0A 3GVRA 5EA9A 3QVQA 3GC5A 2H9AB 3H2OA 4HNUA 5GPRA 4YL2A 3HJZA 1PX8A 5MF5A 1XLFA 2QMJA 2HPMA 2FTWA 2YCEA 3EDEA 3VZZA 1G0CA 4E6MA 3JR2A 4RJEA 2XM2A 4GISA 3L9CA 5KTLA 4PMRA 3HA1A 3SEPA 1P5BA 1R46A 1HN1A 4YCOA 1JPDX 4JKLA 3NQ6A 4JEJA 5BXPA 3BC9A 4PMOA 2CBVA 4R3UA 5MKGB 2JGQA 3GDRA 1MWOA 4H4IA 5T26A 7PTDA 4GFIA 4GI8A 4R34A 2X1RA 3CHEA 3LHTA 4JFSA 4Q4PA 1W3JA 4DYKA 2VHLA 4H7CA 1FXQA 2X2GA 1KW1A 1ZCCA 3UWZA 1XBXA 3OG3A 3TZNA 3HPSA 3RRXA 2ZADA 2YW4A 4LEFA 3KWSA 3NGFA 1KKOA 1R5YA 1XLAA 3WO8A 3NQ8A 4EP8C 4UCFA 4JDYA 4GHRA 3WD1A 4LB3A 3CPUA 1XGDA 1LBMA 4AZHA 4B2DA 2I1OA 3KHDA 2PS2A 4RZ6A 4JEQA 2A7NA 3CZJA 2OLAA 4ONVA 3NQMA 4XBJA 2EPKX 1RCOB 5DX7A 3ARTA 4LFYA 3WQGA 2WLZA 3II1A 3S1WA 3AZRA 1RP8A 4IIEA 4RE4A 1W1ZA 3O05A 2NQHA 2ZTKA 1TMHA 2BY1A 1TR9A 2EPOA 4RPQA 2XGIA 5FESA 1PZ3A 4FP1A 3S1VA 4JICA 1XXXA 1PHQA 1G6CA 1IF2A 3W1NA 5M03A 2NT0A 5LHEA 1JDAA 3S1XA 1E6SM 1UUQA 2AQOA 5HBFA 2CU0A 5HATA 5DT5A 1F9CA 4F4RA 3SSJA 4KEUA 1TWDA 3TJIA 3B9OA 5M1TA 4P8VA 1SO4A 3EDJA 4R53A 3UGRA 2PDUA 1TKKA 1JCLA 1YBQA 3HPXA 4MDOA 3W1MA 2GQ9A 3PM6A 3RGTA 5AVHA 4H9TA 2CZEA 1AUSL 4NY2A 2CZFA 3C2EA 4GQGA 2B7OA 2P5NA 1W9XA 4U5IA 3AYRA 4Z0SA 3BCDA 2HQAA 4L80A 4AC1X 2A5HA 1XYAA 2GWGA 2X41A 3QLLA 1CB2A 3BOFA 1W5OA 4O18A 1K8ZA 4NZFA 3N3MA 3PP7A 4TMBA 1E40A 3KUMA 2GQ8A 2J7DA 4FNQA 1L6WA 3EOOA 1YBQB 1V5XA 1E0UA 1UQZA 3OHMB 5DMNA 3DXIA 1GHSA 2CXEA 4DF1A 3WNNA 1GK8A 3TYCA 3L0KA 1JYWA 1UD3A 4B4HA 5C55A 3RU8X 2WC7A 2ALRA 3UZJA 1E6XM 4CNUA 1BYCA 3EPMA 3PNUA 4E8DA 3IIOA 2V5JA 2PWDA 4KIEA 3UERA 1BG9A 3A23A 4RLIA 5LA0A 1M68A 2E8ZA 1VZWA 2D69A 3W1QA 1RD5A 1TRIA 4ZMGA 1UP0A 4WVXA 5D9OA 3TJLA 4WUIA 3ITOA 3A47A 3AYTA 1E0WA 4KWUA 2J6XA 3MSGA 4A8RA 4XZHA 3U0HA 3BLLA 3TW9A 1PKMA 2OG9A 3OIHA 3GZAA 1Q6EA 1MUWA 5T9CE 4F40A 1UASA 3AMDA 4O13A 2YA0A 1THFD 3KBJA 4A8NA 4CQ9A 1JFXA 3U7VA 4S2BA 4FX7A 3VO0A 5KINA 4R5EA 6TAAA 2XUCA 4ADTA 4N7QA 2EG7A 1M41A 3RHGA 3QF0A 3DU0A 4C6EA 4IGSA 1S5TA 1IT7A 2Y7GA 3G3DA 1I4NA 4KKXA 4AIEA 2AGKA 3BSGA 3QV7A 3RR1A 4NHVA 2CLIA 2ISDA 1UR4A 1VFLA 4JOMA 4US5D 3WQFA 3P5YA 5CAHA 2CKSA 3STGA 1L6GA 5AYBA 4US6A 3PB2A 3TSDA 2A2IA 1NOFA 1KM5A 1ISVA 1D7KA 1HJQA 4HPGA 2OB3A 3URNA 2I7GA 4B9YA 3IV3A 1YADA 3I4EA 5G2WA 2ZX6A 3PZOA 4JKMA 2WNNA 3VK5A 3CHDA 3THUA 2DUZA 2E68A 3VD5A 2HCVA 3S2NA 3W7EA 1K8XA 3IJDA 4J9JA 4KFNA 3TE9A 4LRTA 3PZNA 1J6PA 3E12A 1REQA 5I77A 3LOTA 3D3AA 3VDHA 4IPJA 3OPSA 2WLYA 4PN2A 3M46A 2QR6A 1K4HA 2XG9A 4JYEA 5CC3A 1JUBA 3SM0A 4U3AA 4DJEC 3LB0A 3QYQA 4PBFA 1PEZA 4E2VA 3KTSA 3KVMA 4RNFA 4MHBA 4AH7A 1WOAA 1YDVA 3C5QA 4O1FA 2EF9A 2JIWA 1I9CB 5AC7A 3O0FA 5E6ZA 3W28A 2FFIA 1FTXA 3QR1A 3SIMA 1X7FA 4GVHA 2PDFA 2VO5A 2ZICA 1AL8A 3W1RA 1EJWC 1RXOB 1UMYA 5HINA 1WYIA 1F74A 1REQB 1GOIA 2BVDA 5H8UA 3CAKA 4HNLA 3WDPP 4FNUA 3SRKA 3GUWA 2PC4A 1W5MA 1KFLA 2KZHA 2ZXDA 3WY1A 4K3ZA 1E9YB 4C6QA 3R13A 1XHGA 2Y24A 5CG0A 1EJTC 1UD5A 2PE4A 3OA5A 2TPSA 4Y7EA 3RO8A 3PTMA 1XYMA 2DDXA 2NXHA 4WSHA 3UXIA 3VKDA 1ITQA 2WC4A 5C9XA 3B06A 1XR2A 4QE5A 2J9ZA 3P8IA 3KX6A 3GNNA 1HO4A 1F7BA 3DBPA 3JZEA 5CZJA 3GE7A 3TN5A 4JTHA 1XIJA 1JD7A 3ATZA 2BWGA 2VXNA 4YVPA 1V3JA 2QW5A 1PS9A 2OO0A 2A6NA 2ZA1A 2BVYA 1GJPA 3W7OA 3A64A 3MDUA 2QVHA 3RCYA 4B3ZA 5FAGA 3PUEA 1MQQA 4DM1A 3TA9A 1VYPX 1HG3A 1EUNA 3OZOA 1PSCA 4BQ4A 2NUYA 3VNIA 2ZX9A 5JQ9A 2B4GA 2ZUWA 3B8VA 2DQWA 2HVOA 4P2VA 3DHDA 2GGJA 3PBMA 1GOKA 4LVBA 3UG5A 2ZC1A 3PC0A 2C71A 3VAVA 4AVFA 3W26A 1R7OA 1YX1A 2E9LA 5HULA 1W56A 3AICA 4GX9A 3N13A 5I07A 3EWCA 1PUDA 2YB4A 3DFSA 2HJPA 1RY8A 3R8GA 1J8VA 1YHTA 1RD6A 4ZL1A 4HYRA 4H9UA 3F2BA 4H8HA 3E0FA 3H21A 3DGRA 1VFTA 2AL1A 1PE1A 1QCWA 4QS5A 3KM8A 3QTPA 4DPQA 2FDSA 1SSGA 2J24A 3UETA 1N8FA 2X2YA 3THQA 3OA3A 2PDIA 2W3ZA 2VVSA 4UTWA 4GI9A 2XWEA 3DIPA 4Q4RA 3BWWA 4LF2A 1DOSA 1JUKA 2FZBA 2FKPA 1DYSA 4W84A 4PH6A 1XI3A 3UPBA 3ZT7A 4D1IA 4LVFA 3MDWA 3WLQA 4DBDA 3DDMA 2QCDA 3KS6A 5BROA 3PZTA 1DJXA 2J7FA 4AD1A 3U5YA 2HBVA 5FACA 5AN7A 3LLXA 1RBOB 4A22A 3JZUA 4TQTA 2QXWA 5C9RA 4H6RA 2J27A 5J04A 2ZRXA 3BAWA 1N55A 5D2WA 2ACSA 3VOGA 2Z24A 1GVSA 2E5CA 4ZQRA 3AS1A 4B15A 4DJDC 3EWWA 4LWWA 5AHFA 1UA3A 1FH7A 2UY3A 5G1MA 3DYMA 4I7UA 4BJHA 3W7KA 1J0KA 1EHAA 1ZJIA 3W7IA 4Q4MA 1G5AA 2NLIA 2OZ0A 4D9PA 4RDWA 2VI0A 3MSRA 3VIGA 2YDQA 4KESA 2X1IA 3F5LA 1WO2A 4J28A 3APTA 4XZ9A 4FMVA 3P62A 4L65A 1WZLA 5C2XA 2C1IA 1D8CA 4QM1A 1SU5A 4YHEA 2D1ZA 4K36A 3SJ3A 3B0PA 1E56A 1UWIA 5HAOA 3FDGA 3ZVIA 3KOYA 4O14A 2NV1A 2OWXA 5I3FA 1GG1A 5BNKA 4ZTXA 2QPUA 5JBDA 2WHLA 3PUDA 3NZQA 1WE5A 1F4AA 4L1WA 2O4QA 2OEJA 2ZX5A 2BGNE 3T09A 1MYRA 3S0CA 2BXYA 3FEMA 4W85A 4L4OA 2R1LA 2V0TA 4E4UA 1XH1A 3IIPA 4CCZA 3ANVA 1WDPA 2WM0A 1CGYA 4MPQA 4HMCA 2ZYFA 1R3WA 2FQIA 1UA7A 4AVNA 4J4KA 5AC6A 2WSQA 3S3GA 1PX3A 4TU1A 3SGZA 1LL6A 3GYEA 5JXQA 2PGFA 5K9CA 3GC2A 3GS6A 4LJ3A 2TAAA 1P48A 1XW8A 4GC4A 3SN0A 1F07A 8CGTA 1GYMA 1R8LA 4MZ8A 3RAOA 2PP0A 2YXOA 3F2CA 1DJZA 4FPSA 3T0CA 3VKKA 3SW6A 1WV2A 1VFSA 1VJZA 3SUTA 2OX1A 4I9MA 7TIMA 1DXFA 2QAPA 5C2CA 1YXCA 1KBLA 3NQFA 1W9VA 4ZCWA 5HJYA 2H8XA 1ECEA 4FZIA 2KX9A 3CIWA 4DUOA 4DI9A 4EANA 1DWFM 5EPDA 1YYAA 2GJRA 4LGXA 2CLFA 1GHRA 2WAGA 4RDZA 1DWHM 5AHLA 2UY4A 2ON3A 3EB2A 4O15A 2OPJA 2D23A 3QFWA 1JZ3A 5D9PA 4ZZ9A 1V0LA 4PA8A 4QG6A 5IRPA 1KM4A 1XLJA 4GC3A 3THAA 1T40A 3NUKA 2HPIA 5D8WA 3WMSA 4TV5A 1DBTA 3CM4A 1XP3A 2I56A 1KNWA 3MCMA 2DZVA 2Z0IA 1CLVA 4K8GA 1KFJA 4LYKA 1JDEA 4N2YA 4IFOA 5GNYA 2Q71A 3GNXA 4NKCA 3KBNA 3GKFA 1B31A 3B9AA 5A1AA 2CLKA 2NQZA 1TB3A 2B7PA 3WFLA 3QGKC 4U28A 1GW1A 3ZJKA 3LY0A 4Q8UA 2A85A 2ABAA 4O57A 2DW6A 3TNBA 2DEPA 4JX5A 1B2YA 4WHBA 1RA5A 1BYDA 4GH1A 2PFHA 3K30A 4UR7A 1O1ZA 3ARSA 4ZXOA 4CQ8A 4JTQA 3W1UA 4DJFA 3KRBA 3NQCA 2FJKA 1H7WA 2WC3A 3OGRA 3OBKA 1Q4NX 2NVDA 3OBAA 3W70A 5C8BB 1OGSA 1S2TA 1QI0A 1JAKA 1XSIA 4UFKA 3E3HA 4UQ9A 1IYXA 3C56A 3FW6A 2VGBA 3UA3A 1DKWA 1X6UA 1QJWA 3H2CA 4JPGA 2BOFX 1ITUA 1KM2A 4L4MA 4NZJA 3NPXA 2YW3A 4IICA 4HK6A 1OVDA 2PU0A 2WW5A 1MSSA 3ZVHB 1OCNA 4ATWA 4LUTA 1W3KA 2IS7A 3ITVA 1A5OC 1KXQA 2CIPA 5FF0A 3WN6A 3D3FA 3H7UA 3IAPA 2O7SA 4O8AA 1OZMA 1SZEA 4IIHA 3FXGA 1SZGA 1YTDA 2VDGA 2ZZ2A 3AMKA 1HQTA 4JTFA 2WB5A 4K68A 2C8NA 2HK1A 3FDKA 4C6JA 2IKJA 5A6KA 3EWYA 3VIPA 3F4WA 2MUCA 4RZ4A 4ML9A 1LRTA 4AY1A 3UJRA 4PUJA 4JXCA 3UESA 4L1GA 1ZPTA 2QQ6A 4LUTB 2GDVA 1EGZA 3VCRA 3CJPA 3ITGA 3OJGA 4Y9AA 7TAAA 3W00A 3ITTA 3QHOA 2FZNA 3V0TA 3F1QA 4IFKB 3VIIA 4A3QA 3S2CA 1GORA 2ATSA 1A5CA 5AY7A 4JX6A 2ZUTA 4EPEC 3LN3A 2Y7EA 3H2FA 4QCEA 4EAYA 2VCBA 4ZFCA 5EMJA 5A2BA 1YPXA 4D6GA 3WL1A 3AIUA 3CAWA 1OFBA 3GD6A 3TV8A 4AWEA 2ZRZA 3JRKA 3CZ8A 4CQBA 3NQDA 1P6CA 3FYOA 3UBPC 3REQA 1ENUA 3UG4A 3KAOA 1UZDA 3S2LA 5H6HA 1EQPA 1HL8A 5I09A 3KZSA 1DJNA 3QHNA 2EPMX 3FNDA 1FOBA 3DN5A 1VGAA 3BE7A 2YLAA 1VRXA 2ZUMA 3EOSA 4NJIA 2O7QA 4RXGA 4GVIA 2YL8A 4IOTA 1VJIA 4LB4A 2WBKA 4N9EA 3VGEA 1K7XA 4ZA0A 1H4PA 2WMIB 4MB4A 3REQB 1XSJA 2HTMA 1MRQA 1WBHA 3O8AA 1OB0A 5E5CA 4OE7A 1ZJAA 5CSUA 4RNIA 1K02A 4O1AA 4JIEA 2XGZA 4A3HA 1US0A 3GM8A 1UOZA 1W9UA 1JQXA 5M2FX 1R3VA 1DPMA 3L68A 3W7LA 2H3BA 2PDMA 1M7JA 4AUBA 1WUEA 2OQHA 1IV8A 2GSJA 2QLYA 5KZ6A 1PIGA 3W27A 3EPNA 5A6MA 1MFUA 5CLWA 1I8JA 3RMJA 3MO7A 3THCA 9RUBA 4IQJA 4Q8QA 2V5CA 1RJPA 3J7HA 2W5FA 1VFHA 1W91A 4NX5A 1TPWA 5BXTA 3EX2A 1W37A 1BFNA 4UFIA 3WLLA 5DN1A 1O5QA 3N25A 4MB1A 3K2GA 4BF9A 4C1KA 3PZVA 2I5IA 1GOOA 4GUIA 4UMCA 3SO7A 1KCKA 4HJWA 4DJED 1F3TA 3NA8A 3SR7A 1TWWA 4GXMA 5FAJA 1L2QA 4JTUA 1KFEA 5CZTA 1Y5VA 3CASA 2Y70A 1QI5A 3BH4A 1WDDA 4JTDA 4JAWA 3F4NA 3TMLA 1TYGA 2NSOA 4NF7A 5FL0A 4HU0A 5ECVA 1FWJC 3MYOA 1TX0A 1I1XA 1QVBA 3TJXA 3LCGA 5FEWA 5A8QA 3MWAA 1UR0A 2PDCA 1TUXA 3KE0A 1T8QA 5JBFA 4AEEA 1U1HA 4KCUA 5LNSA 1QFEA 2F2KA 4I9TA 1KBBA 1VEMA 5CXPA 4KFOA 5CGQA 3OYXA 4DUVA 4ZB0A 5KITA 1R3YA 1PO9A 2XN1A 3S9YA 2D0HA 4FLQA 5HPCA 5EMYA 3NTYA 3GDBA 3V4BA 3A4XA 1GKQA 6ENLA 1RLDA 4NIRA 4LANA 4GJJA 4JTTA 3W87A 3KHJA 4HMEA 1XCFA 4WQ6A 1EC8A 1UC4A 3WD2A 1QWGA 1AD1A 1JCJA 5BU9A 2EHHA 1SZFA 3MCNA 3N2CA 3AZSA 1RUSA 2XN2A 4I5RA 1OINA 3WDQA 3D0CA 4B5WA 4HOZA 3P6LA 3WBAA 2D2OA 5FI8A 3TWAA 4AZIA 3MUY1 1JG9A 1J2WA 3CQ0A 3SGUA 1GKPA 4LU0A 7ODCA 5BMXA 3NQEA 1ZBVA 1F4HA 2JKPA 3LTPA 3NQ2A 4NAEB 3D6NA 2D3LA 2D2HA 1JDCA 4JCMA 3S6TA 2Q01A 1DQUA 4JQ3A 3C0SA 1VEOA 3JS3A 3FJLA 4A3YA 4D6JA 2PWVA 4WGXA 4UBPC 2CC0A 5BXRA 1GQLA 3W1AA 3UVAA 2P8CA 3PSWA 4QBXA 2WVVA 5REQA 4W7WA 1GOMA 1Q7ZA 4Z1BA 1C8VA 2PDYA 4MADA 4Y8FA 4KBXA 3TW7A 1X1NA 3BOXA 3NVTA 3FK4A 1OYBA 3EMCA 1E1CA 4WCJA 1D3GA 4HHPA 2YKKA 4HIBA 1TV7A 4O10A 1XLHA 1EL3A 3VKJA 1CXEA 2F61A 1YKWA 4MGGA 3WQ6A 3BLFA 4QDPA 2DZXA 1YNYA 4HPXA 4GCAA 4HA3A 3I6RA 4NYYA 4QAIA 1BWVA 2RAGA 2CW6A 4O28A 1VIWA 1S1PA 2WVVB 5REQB 4XTDA 4LSBA 3W7CA 3WFZA 3MSDA 5ABEA 1SYTA 4LUSA 4ZO7A 1IZJA 3WQPA 4AHPA 3CHFA 2PDQA 4CQCA 4K1GA 1KR1A 2CCRA 3LM7A 1V8EA 2I9UA 1BF2A 3A4AA 3NXFA 3UGVA 3BW3A 2HRWA 1HTIA 5IXEA 5JH2A 1ZCOA 5IDZA 4JHOA 4DJDD 1CTNA 1Q63A 1IT8A 4GGHA 3OVQA 2B81A 1NU5A 3L2MA 2E6DA 3I7SA 5FJUA 5C0QA 3GNDA 3WH5A 4AW7A 1LWJA 1EFZA 1NM9A 3SZ8A 1G4SA 4I5XA 3RU6A 3SCVA 3BZJA 4LUSB 3UQNA 4N02A 3PR2A 1QXLA 3WLKX 1HKJA 1RJQA 4XD6A 1W2VA 2NQ5A 2NWRA 3N1AA 3L4VA 1EGMA 3BGJA 3TUUA 2OYLA 2HSAA 1CGTA 3OVRA 4EOUA 1W6TA 3M0HA 1K1DA 3S9IA 2VFEA 1E4NA 1P0BA 1TIWA 3UZWA 1QI4A 4V1YA 3W86A 5E1QA 1FWRA 3W7MA 3C2RA 1JR1A 1V0KA 4IHCA 3VC5A 3R0KA 4IPNB 1EC9A 1Q8AA 2WJEA 2X1UA 5CPQA 4IXHA 4B5XA 1AVAA 1IZCA 4IMFA 1UKSA 1EP3A 8A3HA 2POTA 2QYGA 3NDZA 4AHQA 4FSAA 2F8QA 1MUMA 4PUEA 4KWOA 2O56A 4F9JA 4DO6A 1HF6A 3BLOA 1VFOA 4J27A 2ZXBA 4ZODA 3R58A 5A8OA 1I2NA 4LVAA 4D1JA 2CNCA 3T0AA 1C29A 1V3LA 2WVUA 1UPPA 4KQNA 1XCWA 4UWMA 2B7QA 5CSSA 4ALDA 3VKBA 1FHLA 1M9HA 4M1RA 3L2IA 2DZBA 3CO4A 2PF8A 1TTQA 1F6PA 5G4WA 4X3ZA 2HS8A 3KRSA 3G2GA 2BGSA 3LHWA 3T7VA 4B5SA 5G5IA 3MBFA 1YNPA 4FX6M 3HM7A 3BV4A 1JFHA 4O8RA 1E5JA 5C9WA 4B5UA 3MJYA 4D6FA 4US5A 3NCOA 3C0JA 1JYVA 4H7VA 1WPCA 1JI1A 1XC4A 2Z7GA 1I2PA 1HKKA 3K8MA 4J3WA 4FS9A 4AVOA 4QJ1A 1GJWA 2ZA3A 4KGJA 5C54A 1QNQA 1VJSA 3E0VA 1NDYA 2YA1A 4UTWC 3GIQA 4MF4A 3MVTA 2XISA 4R27A 3S5OA 1YW1A 3H8AA 4P7NA 4H6KA 4B90A 1JYNA 4IIBA 1VENA 1E72M 4Y8EA 2OSWA 3H53A 1QUMA 2J78A 2FGZA 3WMBA 4C6BA 4P8XA 4WRHA 3DC0A 3MZNA 4JKKA 1ZNNA 1H7NA 3RFAA 3HO8A 3ABRA 4Q4SA 2VOMA 1ADSA 1SFTA 4KF1A 2C7FA 3FHQA 4HU3A 3M5XA 4LX4A 3MHUA 4GIEA 1L6SA 1ELSA 1WZAA 3TVAA 2J9XA 3W29A 2Z28A 3GSMA 2NV9A 4M0XA 4MNMA 4MB5A 4YTQA 4IM4A 1KFWA 2VX5A 3O07A 5I02A 1TZ7A 1QHPA 5A6TC 3T8LA 1FKWA 3IUHA 3A21A 2OLHA 4GVGA 5DRCA 3I3BA 2HXUA 1FWNA 1MNSA 2WMJA 2PMQA 4LXFA 1NJJA 3N3TA 1DJQA 4MUPA 1ME9A 5FF2A 4EK7A 1TJ0A 1Q7QA 4AZCA 3W2LA 1SUXA 4GKLA 1H5YA 1VD6A 3UR8A 3KBVA 3UNTA 4OQVA 5LIYX 4WK9A 2ZDRA 2G0WA 2G3JA 1P0DA 2BX7A 1E4MM 4S3GA 1A4MA 1KWGA 5I23A 3B8IA 1E9IA 1H61A 1WX0A 1WBJA 3Q2DA 3BSMA 3TYZA 1M3UA 4CU7A 3TSBA 4AZCB 2A0NA 2QULA 2ZZ3A 4NAFA 3NOEA 3VILA 2GOUA 4DNHA 1XYZA 3SBFA 2P3ZA 4BFAA 4N9BA 2OYMA 3QM3A 1GPFA 1AW2A 3DFHA 2VGGA 3LPPA 3B8WA 3OQ8A 4QE4A 4LYRA 2DSWA 3FCPA 5GVJA 2ALDA 1X8FA 4KRUA 1O12A 4P7RA 3QZ6A 3DYOA 1PTDA 1QOQA 4ERAA 4Z2HA 1N82A 3GHUA 1K4GA 2FH6A 2OFJA 1RQBA 3AU2A 3KW3A 4NAFB 2J8FA 3BTNA 5FF7A 4IGNA 3FOKA 1B54A 4HZ6A 2W27A 4URIA 3TYAA 4CU8A 2D20A 1H51A 3SJNA 2CZ5A 1XYFA 3PZUA 4PBGA 2E5DA 2NXGA 3EXSA 3B4UA 4YNGA 4NT0A 4JTLA 4MZYA 3P0XA 1SSDA 1QDSA 4H2HA 5AHIA 1NH6A 3GC4A 1DJYA 2Z29A 3MUAA 2RH9A 1LCOA 3B8UA 3ITCA 3VIOA 3KL5A 4Z2IA 1OIMA 4GG9A 1B3ZA 4N4QA 3WCZA 3AIVA 2PAJA 1JDDA 3I68A 1J0IA 1J0YA 4ZQOA 3U9IA 3A3WA 3TNOA 4LRSA 3R8HA 5IM51 4AHOA 5D02A 1KBKA 4MAVA 4H6QA 4F9DA 5BMWA 5DLCA 2QIWA 4TIMA 4H7ZA 4ZQCA 5CC6A 1L8PA 1DHPA 3SUVA 4D8LA 2E77A 3WQDA 2GVEA 3PWGA 5ENLA 4Z2KA 4RE0A 5GQBA 3QHMA 1WKEA 4ZXLA 3VPLA 1IWAA 4WJEA 1TPH1 3W4RA 4JL2A 2YXGA 3ZR4A 5EMLA 2CHRA 3WG6A 1UP3A 4OJYA 1LT8A 1QT1A 3M0YA 2DZUA 3L4TA 4U5KA 3TQKA 2LLEA 3CLWA 4AXKA 5LXXA 4A2SA 2A3LA 3WSUA 4GNKB 4B2DD 3OTRA 4AMCA 2DU2A 2E4TA 1NWRA 4E4FA 1BG4A 1KXVA 1EYWA 1EEPA 2WKLA 4DYJA 3WH9A 5LZLA 4XVDA 2JFEX 1O4UA 3WQ5A 2YYTA 4DJFC 1KR0A 5KZEA 1UKOA 1A3XA 5F2LA 1F8MA 2OODA 4H19A 1UR9A 1KGUA 5E0CA 3CZGA 3E2VA 2GQ3A 3ENLA 2P0OA 1DIEA 1MDRA 3PJXA 1GEHA 3ARVA 1J5TA 1JRCA 4AX7A 2XWDA 3H22A 4F2BA 1VLIA 4PZVA 3ZXWA 2QMKA 5I78A 3VIJA 4Q4KA 2HVMA 4L6OA 3WH6A 3UA4A 3LGEA 2ADAA 5JH1A 2CPUA 4JN6A 2GJXA 2OEMA