3ZFHA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
467
structure length
299
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETTYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas Aeruginosa Inosine 5'-Monophosphate Dehydrogenase
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Oxidoreductase
molecule keywords INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
total genus 101
structure length 299
sequence length 467
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3zfhA00
1KM6A 1XUUA 3PS7A 3W1MA 4UFHA 3MWAA 5AHFA 2WNQA 1F6PA 1Q6RA 3A24A 3TJLA 3S42A 3EWBX 3DZ1A 1HUVA 1DHPA 4FNTA 1DQWA 1H51A 3C2RA 4Y90A 5BMXA 4DELA 3KVLA 1YLVA 3PUOA 1LLWA 1V7YA 3G18A 1AW1A 3TFCA 1XM3A 2X1RA 3IIVA 4S1FA 1OABA 4UTHA 4O1CA 4OV9A 1C29A 5DLCA 1WQ5A 3HJZA 3T7VA 5HWMA 3NM1A 1K3UA 2DZTA 1SQ7A 1GVRA 3VFLA 3G1YA 2A4AA 2HS8A 1XUZA 2W79A 4JY9A 1R2SA 5DBTA 2B7NA 3C2EA 1H7RA 4QNWA 1P1XA 2ZRXA 1N7KA 4FNRA 4YL2A 2Q8LA 4HSNA 3LTYA 4K7VA 4IOTA 2CLIA 1SO3A 4QAIA 4N9BA 1KV5A 3NGJA 2YYTA 3KRZA 1LDCA 3U2OA 4DPPA 4O4VA 2QCHA 2FB3A 4OE7A 5MHBA 2NV2A 2JK2A 4A3UA 4EF8A 4CLMA 1TB3A 1VHNA 3P60A 4K38A 4UFLA 5AOUA 2TYSA 2X16A 1EP2A 3W74A 3TXZA 3CM4A 5LSMA 3F4WA 1EUNA 1OFQA 3PSWA 3UY8A 3C0JA 3PBVA 3G1SA 5LNRA 5IM51 2HSAA 5D04C 1HO4A 3DAQA 1IXPA 1K7FA 3C56A 3TIMA 3O06A 1QDSA 1CX9A 4MY9A 4O1BA 5I3JA 1LYXA 1WDWA 4OGZA 1F6KA 4LS2A 3W7MA 4DF0A 1H7WA 3M5VA 4A22A 1G4SA 1HL2A 4I7VA 4MPQA 1YXYA 1ZFJA 1VYRA 3GR8A 3KVKA 1LBMA 2VENA 4MLJA 1FCBA 3W7KA 3EX2A 1OX5A 2X1UA 3BGJA 3W7QA 1GOXA 5LNSA 4GWEA 4X22A 3DKLA 3W7EA 3HGSA 4GXMA 1YXDA 4WD0A 2C14A 2B0MA 1PCWA 1NAL1 3F1QA 3GXTA 4EVZA 1GVOA 2ALDA 3E49A 4MOZA 2FIQA 3MBFA 3WK3A 1M7PA 1Z48A 4Y6GA 3IVUA 4TO8A 1RV8A 1E51A 2QCDB 4IMCA 2VEPA 4IPJA 1VS1A 1F7BA 4YWIA 3UPWA 4HN4A 1DJNA 3QMRA 3W2KA 3O16A 4A2SA 5E93A 4JD4A 4MJZA 3ZS4A 5HWJA 4HHPA 4S2CA 5I3GA 4IXHA 1ME9A 2C6QA 1BTMA 1AW2A 1GQNA 5SWUA 3T44A 1D3HA 1NEYA 1Z42A 3QH2A 1SO5A 1OYCA 2ISSA 5C6MA 3UNDA 5D2XA 1JCJA 2PCQA 1AMKA 3MYOA 4GUHA 2YYUA 1P4CA 4PL1A 1SW7A 3S5YA 3CT7A 2GOUA 3QRHA 2GPTA 5CSSA 3KRSA 2OJPA 1W5QA 1S5TA 1WV2A 3PG8A 4O1DA 5HQEA 5AN7A 4O8RA 4AF0A 2NX1A 3B0PA 3FEMA 1VYSX 1R2RA 4K8HA 4ADUA 5EBUA 1ZAJA 3G1VA 3PB2A 1TPFA 1SPQA 1SW3A 2FFCA 3N2XA 4UTLA 1OF8A 4WJEA 2R94A 2C13A 5D09A 1JRCA 4WZHA 2V30A 3NEVA 2ISVA 3DFNA 3N3MA 2PRLA 2GVJA 3W7RA 5HINA 3W83A 3QFEA 4Z1DA 1FBAA 3G1AA 2A5HA 1L6WA 3I7SA 3NL3A 4XUGA 3UQNA 1YDOA 3PY2A 1VJIA 1TO3A 5IBXA 1JRBA 4GE8A 4L4LA 1Q45A 2TPSA 4O57A 4TX9A 4IGHA 1AL7A 2YXGA 1F05A 4DXVA 4GFSA 3FKRA 5ABTA 3MP4A 1W1ZA 1OHLA 1TTQA 3BG3A 4FIRA 4IMEA 4FX6M 3N14A 1FXQA 3UD6A 2ZTJA 3NQ2A 2QCDA 3M43A 1KTNA 3W23A 1IGSA 4H4IA 3OBKA 2TRSA 1JULA 3W1AA 2C1HA 3LERA 3W6YA 4D2JA 1DBTA 2DP3A 3WJSA 5FESA 4FX8A 3DFTA 1JQXA 3LHWA 2Q3RA 5D33A 5EPDA 3U8GA 3TQVA 3ABOA 4NJHA 2VXNA 4AAJA 1QO5A 3WK0A 2C16A 1OF6A 1W54A 3A5FA 5TBOA 2GQ8A 3P5YA 3QPZA 3NPVA 3R2GA 2GJNA 4MZ1A 3L21A 5F1UA 3CC1A 1EIXA 1NF0A 1KA9F 4LUJA 3R89A 1GVFA 2XFWA 3ZWTA 2QCGA 1TPB1 4NXSA 3MHUA 1TMHA 3NL6A 3W87A 4O28A 3LCGA 4O18A 3STEA 3IVTA 3IVSA 3O05A 2OT0A 3GDLA 2QUUA 3ANYA 1NFBA 1Q3NA 4UR7A 2TSYA 1YPFA 3DFSA 1C9DA 4IMFA 3PM6A 1OYAA 1DQXA 1JJKA 1TPWA 2I1OA 5FEWA 3BGGA 4PODA 4N4PA 4NJJA 3L65A 1I2RA 2C18A 1I2NA 3NPXA 3TROA 4O13A 4UIOA 3WJXA 5FF4A 1Q6QA 2F84A 2ISWA 1H1YA 5KZMA 1SFJA 3LBCA 1JVNA 3SY5A 4UTUA 1ADOA 5CZSA 4PC8A 4WUIA 3N19B 3L9CA 3L0GA 1KTBA 2I9EA 3HBLA 5E1QA 1QFEA 4LC6A 5U7SA 1XDMA 2GVGA 2QCMA 1OX4B 3TAKA 1T96A 3N73A 3PG9A 1TV8A 3EB2A 4UFKA 1XC4A 4PTNA 3Q94A 2WJZA 1LORA 3NG3A 2H6RA 1G4TA 8TIMA 2R14A 1FCUA 1S5VA 3C8FA 4IJBA 3NVTA 3HPXA 3GDMA 3HG5A 3Q58A 3W1QA 5EA9A 2ZA1A 3FJ6A 3HGOA 5FEPA 2R8WA 1H5YA 4ZQRA 4XBSA 2P1FA 3M0ZA 2E6YA 3IRDA 3LI0A 1PIIA 1U5JA 2Y7GA 1KTCA 3W2LA 5K9CA 2NZLA 2YFOA 4Z0SA 5BW6A 1EP3A 1PCKA 1OFPA 2ZZ1A 2VEMA 2CFFA 1QOPA 5J5DA 1X1OA 1TPC1 5D2WA 4LS0A 4N6EA 5G1TA 3MW7A 4UTKA 2Y7EA 1AG1O 4DBDA 1LBFA 1DVJA 2ZZ7A 4RR4A 3DHDA 1FWWA 3QJAA 3N9SA 1ME7A 1S3HA 2A7PA 1KM4A 2CLEA 4LVDA 1YDVA 5J5RA 1PV8A 3A9IA 3NQVA 2RDWA 5HUOA 3L0NA 2H3BA 4MY8A 5FF7A 5F2GA 1TJPA 3O63A 3OVQA 1LROA 3VE7A 1UUOA 4UC5A 2FLIA 4UFMA 4Z08A 3O6DA 1VCFA 2ABAA 2YCEA 2JKAA 5AHMA 5HWNA 5F4XA 3EX3A 3M7WA 2QF7A 1W5PA 4MYXA 4RV8A 4XKYA 3U6WA 4Y9AA 4KWWA 1QPOA 1SR9A 2EGZA 3EWXA 2CZ5A 1TREA 4NX5A 1W31A 1FWRA 1W5MA 4O14A 5D05A 3S0CA 2E5CA 5D2TA 4C1LA 4LNYA 3M44A 3M16A 4FXSA 3GDKA 5K7JA 2ZYFA 4BWLC 1KFKA 4LVAA 4XBKA 1CI1A 3TC7A 1GZGA 3GNNA 4NQ1A 3CB8A 4LVBA 2ZFAA 4ORMA 2WOQA 3B05A 1B4EA 1K03A 5F2LA 3W7LA 3DHFA 1UCWA 4GC4A 3BARA 1X1ZA 4O53A 1LRNA 3P5ZA 2OZ0A 4NXKA 2D73A 3LRKA 1Q6OA 3TK7A 4BK9A 3NQ6A 5AC7A 1LTDA 3KRUA 1F2JA 5F2MA 2QCLA 1A5SA 3GXNA 3UPBA 4UTWA 3ATZA 3M41A 2RH9A 1JUKA 4M6VA 1RD5A 1XFBA 4HT3A 3GAYA 1SZFA 3LLFA 1M7OA 2Q8ZA 2CLMA 3GKAA 3EWYA 4TR9A 4O12A 3CWNA 1TPH1 3G22A 4JIQA 1O5KA 2QAPA 3G8EA 1EA0A 5DXXA 2H90A 4OBTA 2NV1A 2V2CA 4AWSA 1TPUA 3Q37A 5FEXA 5H2ZA 4M5PA 4LWWA 5DY2A 1X8FA 3MMTA 4DO5A 3C2OA 1K8XA 2V5BA 2LLEA 4FEZA 1FCVA 3TSDA 1OFEA 1M6JA 2JKEA 3LGEA 4MZ8A 4DO4A 3CTLA 5K4XA 5CG7A 2VFHA 5G4WA 3S5NA 3QM3A 1H63A 1PHQA 2A6LA 3THQA 2QAFA 1K02A 3B4UA 1H62A 1O94A 4JGDA 3KXQA 4RJEA 1GT8A 4GJ1A 1OK6A 2Z2UA 4PEKA 4RCXA 2ATSA 3W1NA 3USBA 2Y70A 3LI1A 3QSRA 1EB3A 3C2VA 3N2MA 3W1XA 4AXKA 4LT9A 4FNUA 2ZRVA 3W71A 2Z6IA 3HMJG 2TMDA 3C4UA 1BEUA 3LCWA 1T8XA 2XN2A 3F4NA 4NT0A 2GJLA 4GUIA 4KFOA 3GK0A 4O19A 3TXVA 5AC6A 1QO2A 2AQWA 3NO5A 4OU1A 5F2IA 5G2IA 1TQXA 1WOAA 3NR0A 3NL5A 4ZZ9A 4QNEA 2Z1BA 1W8SA 3B03A 3GX9A 3LHZA 1BWLA 1K8YA 1AW5A 2QCEA 2WSYA 4P2VA 5LGXA 3TSMA 4UUIA 2FPTA 1FX6A 2WQPA 5AB3A 1GEQA 1VQTA 2WO5A 2ZZ6A 1ZAIA 3IIPA 4XTDA 2NXGA 1XL9A 3P7YA 2I14A 2QCNA 4HNUA 3DXIA 3EX1A 1FDZA 3NL2A 2CWNA 1OFBA 2V2DA 2V81A 4FIQA 1OVDA 4BF9A 4MUZA 4GRSA 4E2DA 2BLEA 3I7RA 4HSOA 1O4UA 4OQVA 3QMTA 3C6CA 4BWLA 1F74A 4N9CA 4JYFA 4EF9A 5LHFA 3ZFHA 2WPBA 3NQAA 4POCA 2ABBA 2J9ZA 3TQKA 3C52A 4JY8A 3STGA 1TTJA 3UZJA 2JGYA 3FA5A 3SI9A 4ONVA 5BOOA 1VYPX 3DU0A 3KOFA 4UXDA 1JUBA 2QJGA 3OG3A 1IXNA 3P81A 3W9ZA 5I3KA 3TU9A 1GG1A 2G95A 3NQFA 2J24A 1H60A 4DPQA 3QQ0A 3IGXA 1O95A 3DBPA 3W75A 3PBUA 1RQBA 5HJLA 3BW4A 4RX0A 3TE9A 3BLEA 2DU2A 2BX7A 4JTKA 1W56A 3S9YA 4UFJA 3A22A 3QW3A 2ZZ3A 1QAPA 3HIJA 2X2GA 3UXDA 4DF2A 1L2UA 2H3DA 2Y7DA 1KLZA 2R91A 6ALDA 2XN0A 2W0UA 3EEGA 1UJPA 2CLFA 4HNVA 1NSJA 3O07A 3GB6A 2ZCGA 2FPYA 2NX3A 1ZHAA 5A8GA 4R34A 1I2PA 2Y62A 5EKYA 4I7UA 5AHEA 1G4PA 5AHNA 3TH6A 1H61A 3CEUA 4KFPA 4AF0B 1L9WA 1O5XA 3DFOA 2BXVA 3CWOX 4WXZA 3NQDA 1MO0A 3L5LA 5HUPA 5EL1A 2YR1A 3L66A 4HKPA 1OFOA 4CNPA 3P61A 4CQ8A 2YX0A 4PFMA 3S5OA 2PE4A 2H8XA 3P74A 3EWZA 1KV8A 4AMAA 1QPQA 1GTHA 2CLOA 1ZJIA 4AWTA 2V5LA 5L9FA 2IQTA 2ZA3A 4P61A 4X9SA 1Q6LA 2QDHA 3TC6A 1HTIA 1OFRA 2QUVA 3M5ZA 3FKKA 1I2OA 2DORA 5T26A 4JTFA 3UYCA 2X30A 2DZWA 2YGYA 3PUEA 2NUYA 1WBHA 1H50A 4Z1BA 4Z1CA 3BG9A 4K8EA 3WFAA 1LOLA 5LNWA 3IGUA 3M9YA 3HG4A 3QMSA 3TW7A 2QUTA 5LHEA 5LZLA 2OMAA 5D37A 3OIXA 1VC4A 1EEPA 3MI6A 5HR6A 2F7FA 3MI2A 3SFKA 3G0UA 1JQVA 1FXPA 3MYPA 2C0AA 2DZVA 3FLUA 4BR1A 2FPVA 3TKFA 4LTSA 1TSIA 3NOEA 4ZVJA 5TIMA 4AB4A 4KKXA 1WXJA 2P0OA 4JTJA 1W37A 1A5AA 3C3NA 1I4NA 1SO6A 2YSWA 2QEZA 3G0SA 4FX7A 1L6YA 4CQ9A 3LLDA 3HO8A 1SSGA 3G8RA 2HMCA 4ZQNA 3LX9A 4O54A 1G4EA 1LOSA 3SSJA 2Y88A 4JNMA 3C2FA 1PE1A 1OG0A 3E12A 1QWGA 3UWYA 5DELA 2WSQA 4JICA 2RDTA 1NF7A 4FO4A 4TU1A 3P84A 3TNOA 4O0KA 4HNTA 2C15A 1RR2A 4FF7A 3WK1A 3ELFA 3D0CA 3PBYA 4GUFA 3NPWA 4G1KA 1F76A 3LHTA 1A5CA 1EWEA 4UTIA 2VFIA 1IF2A 3IIZA 4I7WA 4NU7A 5I3FA 1SU5A 2ZTKA 4X2RA 3LXBA 1WAUA 1V5XA 3EX4A 2X1TA 2ZDRA 3LRMA 4B5NA 5L6UA 5C54A 4R7JA 1Z41A 3JRKA 3IGSA 3O15A 2B7OA 3HQ1A 3LCFA 1ZNNA 3SGZA 5U4NA 2ZZ4A 4FNPA 1F5ZA 4NJIA 3NM3A 5CZJA 3S5ZA 3E0IA 5DCEA 2RHGA 3WK2A 4MVAA 4IPIA 1TCDA 5LNUA 3G0XA 3BLFA 3LHVA 4MIMA 4JTLA 2Y89A 3LRLA 3LCLA 3DFQA 3MO7A 3INPA 5EMUA 3HG2A 3W85A 2RDUA 4LVFA 1DJQA 4BI5A 4Y96A 3ABSA 4XKYB 1K8ZA 1GVSA 4N02A 5KTLA 4NZFA 3L0KA 1U83A 3CEPA 4O0ZA 4AHPA 3BW2A 2JGQA 2CZDA 1GWJA 3TV8A 2ATMA 2NUXA 5AYYA 3HOJA 3BK0A 1K7EA 3MP3A 2DZUA 1IIHA 2FDSA 2CW6A 4EOUA 2EAWA 2RFGA 3NA8A 5KINA 3LV6A 3T4CA 4ZQCA 1PL9A 4YXGA 5K3VA 4JR5A 2EPHA 1QOQA 3RMJA 1GYNA 4A2RA 4ICNA 3I65A 3LTSA 4DBEA 1RPXA 4IWWA 1VLIA 2VC6A 3ABRA 4GUJA 2Y7FA 4JX4A 4M6QA 2GQ9A 2G97A 3AO0A 3TW6A 2BWGA 2B4GA 4O50A 3W7HA 4QM1A 3R12A 1K7XA 4U4MA 2ZBTA 1BKSA 1P5BA 1FWNA 3S8HA 1SSDA 2E1DA 2KZHA 3O6YX 1HG3A 1N8FA 3W7NA 2E6AA 4LU0A 2VFEA 2GUUA 1UBSA 3SJ3A 3L5AA 3W1LA 3OA3A 4Y8FA 3UY7A 1YTEA 3KFTA 5G5IA 2ZRUA 4TMCA 2G5WA 3KVMA 3PR2A 4RZ4A 1G6CA 2VFGA 2FTPA 4JDYA 3NAVA 3W07A 3LOTA 5AYZA 3C61A 1A5BA 1EP1A 1W5OA 3BW3A 5KITA 1WBJA 3VI2A 4QITA 2Z6JA 3QPYA 4Q4KA 4AEOA 3GXPA 3M5XA 2VFFA 1FUYA 3HPSA 4ALDA 1JUEA 1ICQA 1G69A 2YFNA 3W2JA 5BNKA 4MYAA 3ATYA 4NVTA 4X3ZA 4UFIA 3LB0A 3W86A 3SR7A 4HPXA 5AHLA 4Q33A 3O8AA 2QCCA 4JTIA 4UTJA 1FY6A 1LRTA 3NQ7A 3PWAA 5D30A 2VKZG 1N55A 4CCDA 3SZ8A 4LS1A 1KLYA 1R47A 1H7OA 5K9XA 4JYDA 5F1VA 2ZQ0A 4YLWA 5HNRA 4OV4A 2GQAA 4HNNA 3GDRA 3RF9A 1SFLA 4ZQPA 1JCMP 1UB3A 3WJWA 1MEHA 3GLCA 3P67A 3DENA 3GNDA 3KHJA 3HF3A 4O4WA 3LTPA 5CPMA 4LC8A 2ZRZA 2AGKA 3B0UX 4W9TA 1VLWA 3MJYA 5EY5A 5G2HA 2YPIA 3I7QA 2PRHA 2PC4A 1KM0A 3PF3A 2CZFA 3H55A 3GR7A 3T78A 1FQ0A 3HGRA 1BWKA 4UTTC 1VRDA 1KFCA 1X7FA 1TV5A 3VCRA 5AHIA 1SZEA 3IIOA 3RLVA 2J9XA 1EUAA 3W2UA 4FB7A 1W3IA 5H91A 2Y6ZA 4JX5A 2A1YA 4N9EA 3M5YA 4FNSA 5KZDA 1YDNA 5D32A 3N34A 3DH7A 3FJLA 3W88A 3BG5A 4M19A 4JXCA 2A7RA 1OK4A 3G3DA 2UV8G 1KFEA 3AJXA 3OHIA 4WXYA 5K9DA 3JS3A 3F03K 1P0NA 1EPXA 1FDJA 3G1DA 3W22A 5HMSA 3WJYA 1YXCA 1QPRA 3EX6A 1FWSA 3FIGA 4A21A 4GNJA 2NWRA 1TV7A 3QW4B 4AHQA 4DQWA 5F4WA 5D2YA 1I45A 3R5EA 3QC3A 3UXAA 1C8VA 1GYLA 3A23A 4WY0A 1P0KA 4PA8A 3W70A 5E0KA 1KFJA 1XCFA 2VELA 3FOKA 3TJXA 3VKJA 4WY0F 3I6RA 5BRBA 1TRDA 4NJKA 3A21A 3B06A 3CQ0A 4UTTA 1R30A 4LRTA 2A6NA 4FNQA 3W84A 5KZEA 3QYQA 2G96A 3W7JA 1KFLA 4JTUA 4NUWA 3M1ZA 1J5TA 3W7IA 5D03A 5DXYA 1VR6A 2DJXA 3E9AA 4CCEA 3PC0A 4M7SA 1VZWA 3HB9A 1HO1A 3DKJA 4E2BA 3W2NA 5LKYA 5TQLA 4K6AA 3LBMA 1KBIA 4LV4A 3P62A 2QKFA 3ZWSA 3S1VA 4AHOA 1VCGA 4Z0JA 4WOZA 3H53A 2GVLA 2YDAA 3FYPA 4U28A 1LRQA 1Y0EA 4IUOA 1L6SA 2FQIA 1A50A 2E68A 5CKSA 3DGRA 4RXFA 3PB0A 1FDYA 5I3HA 1EX5A 1H1ZA 1RQHA 5FF0A 1OYBA 2Z0IA 1IXOA 1M5WA 3PSVA 1XBZA 1XXXA 3T55A 4JTTA 1GVQA 1W3TA 5AFDA 2OX1A 4A29A 2ZZ5A 3MP5A 3B04A 1JR1A 4N6FA 3EXSA 3S6DA 1DKWA 2Y63A 4DO6A 3UWZA 4HPJA 1LBLA 3BV4A 1Z44A 4JEQA 1ZCOA 5AC8A 2V8ZA 1LP6A 2OT1A 2H8ZA 2WV8A 4CNOA 4ZL1A 3NQCA 3B8DA 2QR6A 3NYZA 2V9DA 3DFPA 1SW0A 1FWTA 2QCFA 1XKYA 3GDTA 3NPUA 1QNVA 5F4SA 4MFDA 1RZMA 3TDFA 3DI1A 3QZEA 3P8JA 1OX4A 2DJLA 2O7SA 3HG3A 3K30A 5LGZA 1VH7A 3CHVA 4UTWC 3OVRA 3L68A 4BI6A 2WKJA 1X6UA 2FJKA 3CIXA 2V2HA 1PVNA 1XBYA 5D2VA 3YPIA 5DY3A 7TIMA 1EWDA 3QSTA 3QEZA 5C2XA 1ZALA 4JDBA 4NNAA 4FXRA 4TMBA 2B7QA 3W7GA 3G24A 4E0CA 1T0OA 1R2TA 2DZPA 1H7XA 3L67A 1B57A 3A5VA 1TTIA 3W7DA 4CCCA 6TIMA 2Q3OA 4YCPA 3M47A 4JIPA 1J4EA 4LRSA 1VCVA 1HFBA 3W3OA 1MXSA 3CIWA 2BTMA 4I9AA 5G2WA 2VEIA 3P8IA 4K36A 1ZENA 4UMBA 1JCLA 1XDLA 3JR2A 2DZXA 4N4QA 3V75A 4JTGA 4UNKA 4ML9A 2BZNA 4UTMA 4K7YA 3EWWA 3NZRA 4UR8A 5KMYA 2A7NA 2ZA2A 4RZ5A 1H7PA 5CSRA 3RU6A 1OJXA 4PH6A 4ADTA 5K2ZA 1B9BA 3W7OA 4WX2A 2YW3A 5CZ0A 5BMWA 3OEXA 4FHAA 5HR7A 4O15A 2P10A 5C5YA 1WA3A 3L5MA 3EKLA 1D3GA 3M6YA 3RNDA 4UMAA 3L2IA 3TSBA 4UNLA 4Z1AA 2ZRWA 4WQ6A 3WJZA 2QJIA 1PS9A 1TQJA 2AAMA 2EKCA 1YYAA 3T40A 4IMGA 4QJ1A 4O1AA 3EKZA 4CNNA 4ZMGA 4M7TA 4O52A 3UWQA 5G4EA 3W73A 5FEZA 3RLUA 3EXRA 5FF3A 2HS6A 3SIZA 4IQLA 1DV7A 4JYEA 3G3MA 2J9YA 1G67A 5CZTA 2V0TA 4L4MA 1UASA 4OT7A 3MBDA 1ME8A 3MHGA 3NXFA 1QPNA 3W1PA 3UZ5A 1JCNA 2E5BA 4R53A 1D9EA 3LXCA 2E77A 3HGJA 4N2YA 3LCHA 5C55A 2CLLA 1YTDA 3Q2DA 2C19A 3TMLA 1IIGA 2E6FA 2NXHA 3G1XA 5EYWA 2RKXA 2Y61A 5IBXC 1DORA 1DOSA 1KFBA 3LM7A 1SUXA 4XZ9A 3BO9A 3EWUA 3IIXA 1VHCA 4RLIA 3O6CA 2EF9A 2OCZA 3BVJA 3QQ1A 4Q32A 3GAKA 5GVJA 3HPZA 3O1NA 2NWSA 4KWVA 4JTEA 5D38A 2A85A 4QIUA 2CLHA 1VGAA 3GKFA 3R13A 2QDGA 3LCIA 2YZRA 1KM1A 1NVMA 1TJRA 4EIVA 1JCYA 1LM1A 2WNZA 4LY8A 4XWUA 1GG0A 4DF1A 4HIBA 1T99A 1VPXA 3S1UA 3NDOA 2J27A 5FI8A 5CPLA 5CPNA 4E38A 3TQ0A 4DEFA 3IV3A 3TMQA 3VNDA 2Y85A 3OVPA 2BSLA 3W2MA 3LDVA 3MI3A 1RVGA 4NNBA 3SW6A 2JKPA 4AWUA 4O10A 4J9JA 5HULA 3SGUA 1TRIA 3CLMA 1KBJA 3BPWA 4MFEA 1I8JA 1ZY9A 3W1TA 4GUGA 5LNVA 1J2WA 2E6DA 4RK8A 5AYXA 3B0VC 1IXQA 3NZ1A 1GPWA 3LHYA 1MEIA 3S1XA 4XTIA 3GVGA 3MHFA 1AL8A 4GBUA 5I3IA 3TAOA 4KFNA 1ICSA 5DBUA 1LOQA 1F73A 3PBWA 2ZZ2A 4BI7A 4H3DA 3KX6A 5DCBA 4CQAA 3TFXA 2QJHA 3BLIA 1B4KA 2A0NA 1QR7A 3W76A 2X1SA 1S5WA 1CW2A 1WX0A 4AH7A 4IX0A 5DCDA 1PHWA 2E5DA 4JS3A 1H7NA 1A53A 2XN1A 1ZAHA 3W1UA 4S2BA 3GYEA 4K39A 3FYOA 3E02A 1LLZA 2B7PA 3LHUA 4PCFA 4O16A 1UUMA 1XI3A 4O11A 1FCQA 1MSSA 2WSRA 4QQ3A 4MZYA 1SZGA 3NQEA 3KVJA 2FB2A 1GTEA 1ONRA 2V82A 4ORIA 3NNTA 1RQEA 3W7PA 1LZOA 5A5WA 2C3ZA 1OFDA 5G1YA 4YMZA 4BFAA 4JTHA 3W72A 2PRMA 4OHQA 4RKAA 3DI0A 3P80A 4NX0A 4JTSA 3PULA 4OWGA 3LCXA 2CZEA 2VFDA 2CU0A 3G1FA 1SO4A 1YADA 3GZ3A 4UCGA 3ZR4A 3EXTA 1XBXA 2NLIA 4RZ6A 1ICPA 3TX9A 3RK8A 4O17A 2WNNA 3UWVA 2J88A 2O7QA 1W0MA 4N9DA 1TIMA 2A2IA 3PAJA 2YW4A 2DZSA 4YCOA 1JCXA 1AK5A 4K37A 4ADSA 1TTPA 3TUUA 1KM3A 5CPOA 1G7UA 3CU2A 1DL3A 4M6PA 3TR2A 4JX6A 2CLKA 3THAA 4LVGA 4TIMA 4PL2A 3PUDA 1G7VA 2NX9A 1YTKA 1OX6A 4MY1A 1TYGA 1I2QA 4XQ6A 4C1KA 5KSWA 4QSHA 3H54A 2HTMA 3CPRA 4IXXA 3UWUA 4IX2A 3FS2A 4LV9A 1ML1A 1W3NA 2ZRYA 4H6KA 3G1HA 2NUWA 3TA6A 4ZQOA 1YPIA 4WOQA 4JN6A 1TPVA 3W1RA 4NZJA 3W7CA 3TCEA 2NXIA 3STCA 3NQGA 4NNCA 3UWWA 3MUXA 1XBVA 5FF2A 1TPDA 1ALDA 5D02A 3KAOA 3SECA 4UMCA 2JBMA 1SZNA 3P82A 1QCWA 5CGQA 4MKNA 4R33A 4IMDA 4WY0B 3E96A 3FFSA 1TPEA 4LUIA 2A21A 1THFD 1R46A 3QF0A 4AVFA 3N9RA 4RXGA 3GIYA 1O60A 1GJPA 3IEBA 1LCOA 4MJMA 2VOMA 2PURA 5K4ZA 5DN1A 1KM2A 4LOCA 4MLRA 3LXAA 3S1WA 4LW7A 1KW1A 1MEWA 3NQ8A 2EHHA 1WOBA 1W5NA 3I68A 3LV5A 2VEKA 2W6RA 2J6XA 3PVFA 1QMLA 1OFAA 4ZQMA 3NQMA 3R8RA 3STFA 1B3OA 3VE9A 4NJGA 2E09A 1MZHA 3V1PA 3RFAA 1KM5A 4EWND 1WYIA 3ABQA 4QISA
chains in the Genus database with same CATH superfamily
3PS7A 3MWAA 2XFYA 4BF5A 2WNQA 1IWAA 3IAQA 4CQBA 1Q6RA 1MW0A 2C71A 1KC7A 3IJ6A 1EXBA 3U57A 1H51A 1CECA 1GOWA 4CD6A 1YLVA 2GGHA 4A6GA 1E5JA 2X1RA 3QV9A 3IIVA 3AYTA 4S1FA 4OV9A 1C29A 4GYFA 4KF1A 3IRSA 5HWMA 2Q01A 3VILA 1GOMA 2J8TA 3G1YA 2HS8A 1XUZA 1REQA 2UZ9A 1R2SA 4JY9A 5HANA 1BG4A 4HTBA 5C9XA 1XH1A 2ZRXA 2C91A 4PEEA 3A4XA 4YL2A 5A8OA 1KFWA 4ATLA 4DXXA 3WMSA 4QLJA 1TG7A 4QAIA 3FA4A 4X2PA 4N9BA 1J10A 2ZWZA 3NGJA 4CD7A 3LMYA 4Y7EA 1NY1A 1LDCA 3WNPA 4KRTA 2ZVRA 4A3UA 4KRZA 1IWPA 4RPPA 1TB3A 1YHTA 5A3HA 4LF1A 3TXZA 5LIKX 2D22A 1GYMA 2WM0A 5HPCA 1K4GA 1QOXA 2DT2A 3PZOA 4HCDA 3AU6A 2X2YA 4GKLA 1C92A 1EOMA 1GOQA 5D04C 2HVOA 3FV9A 3K46A 2JE8A 2BB0A 3SCQA 1W2VA 5I3JA 2NQ9A 1F6KA 5IOBA 4H04A 3PWIA 1R3RA 4I7VA 4H2HA 1VYRA 3K1GA 4IJRA 5CXPA 1FCBA 1WE5A 1F3WA 3UR8A 1OX5A 3W7QA 4ILSA 3KDOA 3LA4A 4F3HA 4HA0A 3W7EA 2B0MA 1W1PA 2Z1VA 3PZIA 5E0FA 3VIGA 3F1QA 1GVYA 3JW7A 1GVOA 1DJZA 3MBFA 2OLSA 1M7PA 3V5OA 3QVQA 2OYMA 1VS1A 3I4KA 2PMQA 2PP3A 3SEPA 4JD4A 3ZS4A 4DHGA 1AH4A 1E1FA 1QI0A 3QPEA 5I02A 3QY7A 4DBUA 1PJ9A 1AW2A 2WJEA 5SWUA 2HNEA 3PZVA 3XIMA 3EA2A 1NEYA 1Z42A 2XVLA 1XISA 2AQOA 3ZYZA 1OYCA 1XLGA 3LPFA 1W9UA 2PCQA 3MYOA 4GUHA 2YYUA 1P4CA 1SW7A 3CT7A 3QRHA 2GPTA 4I9TA 5HQEA 1GK8A 4RDWA 1JPKA 1R3VA 1XYZA 1QRQA 1ISZA 3B0PA 4K8HA 1LQ2A 1LWJA 4DM1A 3G1VA 1SW3A 4UTLA 3N2XA 4YTUA 4YYFA 3GNRA 1OF8A 2R94A 2C13A 1ADSA 1RAKA 1HKMA 2V30A 2Y5JA 3H26A 3TN4A 2WWDA 1WKFA 1XF0A 4ZSUA 4S3KA 2GVJA 1NARA 1ZCCA 5I77A 4CD8A 4E4PA 5HINA 3GFYA 1XLDA 2A5HA 3I7SA 5HNUA 1MW3A 4O57A 4TX9A 2J25A 1R9YA 4ZODA 4DXVA 4GFSA 1V0NA 3MP4A 1OHLA 1PXGA 1TTQA 4FX6M 1FXQA 3UD6A 2QT3A 4P7QA 1SGJA 4H4IA 1BWVA 3OBKA 3TC3A 1EEXA 4L6DA 1DWJM 3LERA 4HJFA 3BOLA 5FESA 4FX8A 3P3BA 1OBAA 3ITGA 3SAZA 2GVYA 3U8GA 3ABOA 1GJWA 2YBTA 3UCCA 1OF6A 1W54A 3P5YA 4GQGA 1RALA 2WB5A 1UD3A 3OBAA 3NYDA 4KH2A 2PDPA 3WQ8A 1L8PA 5CZKA 2WCGA 3APGA 4GC3A 3ZWTA 3MCMA 1TPB1 1E1CA 2WC7A 2WZIA 3IVSA 3II1A 2CKRA 3PM6A 1OYAA 4ZTYA 4UTFA 2R1MA 2YA1A 2XIJA 3DHUA 2I1OA 2W91A 4BHYA 2C7FA 1E72M 4PODA 1M9HA 4N4PA 4DZAA 4NJJA 3GHUA 3VNKA 1FFRA 2ACUA 2C18A 1I2NA 2G37A 4PCPA 1W2PA 3WJXA 4UIOA 4IL2A 1Q6QA 4L61A 4NAFA 1WXYA 1ADOA 4WUIA 2FZ8A 1QFEA 1UJQA 2QDEA 5U7SA 3MSRA 2GVGA 2OSWA 2AGTA 5BROA 1OX4B 1T96A 1AVAA 3E2VA 4OUEA 5T9CE 3GBEA 3O7UA 3CL7A 3EB2A 3UA3A 5HOSA 2QJNA 1HNYA 4YIWA 3IJLA 1XC4A 3PJWA 3E0WA 2W61A 1TWIA 4CEXC 2I5IA 1G4TA 3GTXA 3IJQA 1PDZA 1O5QA 3JU2A 3OGVA 2HCVA 1XCWA 3Q58A 3W1QA 5BWAA 3AXMA 2RUSA 5G4HC 3BWWA 2ZA1A 1KGUA 1B54A 1IZCA 3SRKA 3GSMA 3VA8A 3R4IA 4RW3A 4XBSA 3M0ZA 1P48A 4CGTA 1PIIA 2DGAA 2D20A 3ARPA 3UESA 1HL8A 3W2LA 3GG7A 4Z0SA 1OT2A 1EP3A 3VKAA 1ADDA 4NAEB 1KRAC 3CJPA 1QOPA 4AEEA 1X1OA 1TPC1 5D2WA 1POKA 5G1TA 3HV9A 3WDHA 1RY8A 3PZMA 4RR4A 1PX3A 1EJ7L 1IHIA 1H4PA 1JI1A 1E40A 2A7PA 1YDVA 1MMFA 1PV8A 5HNTA 2DUXA 3A9IA 3NQVA 2RDWA 3TCSA 4YYCA 4MY8A 5FF7A 1E1CB 5F2GA 2DIEA 3LGDA 1LROA 4AUBA 3VE7A 4XVEA 1ZBCA 3AIQA 2E9MA 2ABAA 4AVNA 8CGTA 2JKAA 3CQJA 2WKGA 3M7WA 4MB4A 4GXWA 3GHRA 4H9TA 1LUCA 4ACYA 1Q6EA 3CLWA 1K6WA 3U6WA 2EPKX 4XD3A 4XAYA 2EGZA 1RP8A 5FOOA 4PMDA 5EBAA 2GJRA 4BF7A 3AXHA 3VX1A 2XIIA 4NX5A 4AFYA 1W31A 1W5MA 3CUIA 4RDYA 1WDRA 2EEXA 3HTWA 4C1LA 1T5AA 3M44A 3BE7A 3M16A 3RHGA 1KQYA 2XG9A 1REQB 5I6SA 5GJNA 3TC7A 3S46A 4NQ1A 4LVBA 4MTVA 4ORMA 3B05A 3K4WA 1B4EA 2C79A 1TMLA 1UCWA 1ISVA 5FA5A 3U2EA 5ABFA 2D73A 3R0KA 5GJMA 1Q6OA 2PDHA 4KWSA 2JEPA 5AC7A 3Q67A 1D8CA 3KRUA 3L4ZA 1F2JA 1SFTA 1B3VA 2QCLA 2ZWYA 3UFYA 3GW0A 3H6OA 2RH9A 2I7GA 4M6VA 3L4WA 4RW5A 1CYGA 5I5RA 4F0KA 4AYSA 2I17A 4B16A 1AJ2A 2CLMA 1EDTA 3MO4A 3UJRA 1NIUA 2C8NA 4HPHA 3A6OA 3EWYA 4O12A 3USZA 4LBUA 1TPH1 4ES4A 1EJVC 3QTGA 1JGMA 2QUMA 3PK7A 1Z3NA 3D6NA 3RU8X 3T42A 4LY4A 1BYBA 2YCLA 1XHGA 4AWSA 3M6DA 5A6SA 2J8GA 4M5PA 4KGLA 2ACSA 1QI4A 1N8WA 3PZTA 1BVZA 4G2DA 4AD5A 1WAWA 2XFFA 2PEVA 3H21A 3APTA 3EMZA 3LGEA 4MZ8A 2VT0A 4CCZA 5G4WA 1GHRA 5A95A 3CAKA 1MZRA 4IMAA 5J8LA 6PTDA 3CMFA 1R3TA 1BHGA 2D69A 4GD0A 5GNXA 3LYEA 3USBA 2XPKA 4YHGA 3ARTA 4X9YA 2Z1KA 3ZSSA 4L64A 4OOZA 2Z1XA 3C2VA 3N2MA 4ZO8A 1V0KA 3WQ6A 3W1XA 2PDXA 3SQSA 1UR4A 2ZRVA 3HJEA 4HYWA 3HMJG 3LCWA 1E9YB 2DT1A 2XDFA 3UXIA 2XN2A 2J13A 1EBHA 3F4NA 1XIHA 4KFOA 2DY3A 4DXKA 1QO2A 3NO5A 4P8VA 4OU1A 1WOAA 4PUKA 4Q6JA 3NR0A 4QNEA 2PDBA 2Z1BA 3B9AA 1XLLA 3GX9A 1HKKA 2WSYA 4P2VA 2W66A 1J6PA 3KDNA 1GEQA 5AB3A 3BANA 1UC4A 4MB1A 2NXGA 4Q4RA 4KWOA 1XL9A 3P7YA 4DI9A 1ZJBA 3CMGA 3D46A 4ZXOA 1UMYA 4XSLA 3ZT7A 2WHKA 4QP0A 3DXIA 3WUEA 4L4PA 4UBPC 1GKQA 1AMYA 2CWNA 2P3ZA 4CKQA 4TXEA 4IUGA 4BF9A 3WO8A 4MUZA 1VJZA 1FH9A 3HPAA 2VO5A 4GQBA 4OIFA 4HSOA 1O4UA 3TYZA 1JDDA 1GUVA 3QMTA 4WSHA 3TN3A 3EDEA 1F74A 5LHFA 3QZAA 1Q65A 2ABBA 3WEZA 3TQKA 4JY8A 1YMYA 3QKZA 2GJXA 3SI9A 5BOOA 3DU0A 1XIEA 4UXDA 1O66A 4ZOBA 3OG3A 2GK1A 3TU9A 2R6OA 4S23A 1H60A 1MXGA 5XINA 3IGXA 2BASA 2B81A 1V6WA 3MDWA 7ENLA 7PTDA 3BW4A 1JNDA 5HATA 3BLEA 3WCZA 3MKVA 4DZ5A 3QW3A 3MMDA 1QAPA 5LXXA 2X2GA 3UXDA 3CWHA 1L2UA 2H3DA 4L1GA 2Y7DA 4PCNA 2Y2WA 3FXGA 4Z2IA 2R91A 1UJPA 2CLFA 4HNVA 4KMQA 4QRNA 3NJ3A 1ZHAA 5A8GA 2ZE0A 1E70M 4PBEA 2Y62A 5EKYA 4I7UA 5AHEA 3WFZA 3HV8A 2NV9A 4ERIA 2XH0A 4LBRA 4I6VA 3VNJA 2BXVA 4DWSC 3NQDA 3RITA 2H9AB 4MF4A 5EL1A 3VM7A 3WF2A 4CQ8A 3P61A 1L8NA 4PFMA 3CUGA 3S5OA 3UZZA 4M3PA 4X60A 2H8XA 3EWZA 3T8LA 4IG2A 4HU0A 3ARUA 5HBFA 2IQTA 2ZA3A 1UBPC 1YW1A 4BA0A 3M5ZA 1I2OA 3QTPA 5M1TA 2YGYA 4OZOA 2W3ZA 3BG9A 4K8EA 3KOWA 3WFAA 1VFMA 1M3UA 1YNPA 3TJ4A 5LNWA 3QMSA 4M51A 2QUTA 3TN5A 5LHEA 1JF5A 2J7DA 3OIXA 5HR6A 3Q45A 2F7FA 3MI2A 3SFKA 1JQVA 2J7BA 2C0AA 1QT1A 2FPVA 5DO8A 2EPLX 3WY1A 4Y9PA 2HE5A 5CPTA 4JTJA 4NY2A 4GX9A 4ZXLA 1F3EA 1UWAA 1D2KA 3HO8A 4F9DA 2CBVA 3LX9A 2E3ZA 4O54A 2UWFA 4MPKA 1LOSA 1W1IE 1UD2A 2O4MA 2J7EA 3C2FA 4F4RA 1TA3A 4E8GA 4NRSA 4YJ5A 1QWGA 5DELA 5JUVA 2PWVA 1XH0A 2QNEA 2ZDSA 2AL2B 4O0KA 1YPXA 1T40A 2C15A 2WPGA 1RR2A 3OZYA 3PBYA 4US6A 1XIJA 4GUFA 4G1KA 4C90A 1UYQA 1F76A 3LHTA 4UTIA 4C6JA 4QTGA 1UP3A 1W8GA 5EMKA 4NU7A 4X2RA 6REQA 4KEUA 4Q8VA 3P2VA 3SIMA 3TEVA 2X1TA 5C54A 4WDTA 3O15A 2VL4A 2B7OA 5AVNA 5H6HA 3LCFA 1KRBC 3SGZA 1MYRA 3DX5A 1F5ZA 1LG1A 4DLMA 2IQ0A 1H5VA 3MS8A 2RHGA 1Q63A 3PBMA 3VD3A 2PDFA 3TYDA 5LNUA 3GXDA 1TA3B 2Y89A 2QUNA 2VZTA 4XZHA 3RRXA 1G9HA 4WKHA 4LVFA 1DJQA 2VRJA 4GA8A 4CN4A 3ABSA 4PMOA 1BG9A 1GVSA 1DWFM 3B9OA 2XVNA 3OGSA 3AS1A 4GI6A 4QE5A 3GVQA 3TV8A 4PTWA 3SGGA 1I6NA 3BK0A 1K7EA 4JKLA 1A5KC 5KINA 3LV6A 3MDUA 3SCWA 4JR5A 1OT1A 1XPGA 5GPRA 4A2RA 3I65A 4QCFA 1VLIA 3I10A 3ABRA 4GUJA 2Y7FA 4JX4A 4NZ4A 3W7HA 4QM1A 3B9DA 1FFQA 2QF8A 1TWSA 2ZC1A 2FGLA 1BKSA 2ZBTA 1FWNA 3AICA 1RCQA 4JFTA 1KR0A 3MMUA 1SSDA 3U5YA 2QVNA 2WVTA 7XIMA 4I6KA 4JQAA 1UBSA 2AAAA 3W1LA 4Y8FA 2ZRUA 3N2OA 3QHMA 1J9YA 3KVMA 2C0HA 4XZNX 2VR4A 2FTPA 3V7PA 1W3KA 3WLRA 4ML4A 3OYZA 4W5UA 3UJEA 4C6MA 1GKPA 5MKGB 3C61A 3BW3A 4Q8UA 8XIAA 4QITA 4JAWA 4GIRA 1FUYA 3HPSA 4ALDA 1JUEA 3RILA 4E3TA 1ICQA 3SN1A 2YFNA 1CXIA 3ATYA 4NVTA 1XG3A 3W86A 4UNIA 2PBGA 1X38A 4PMYA 4HP5A 3SRDA 5ABEA 4ZOAA 2MNRA 5CC6A 4CCDA 4WSKA 3SZ8A 3EOSA 2VD9A 1H7OA 5F1VA 2ZQ0A 1NWRA 4EPEC 2WMGA 1JDCA 5HNRA 3URNA 1J11A 4MKVA 1SFLA 1UB3A 3RMEA 1V03A 4FLRA 3LPPA 1RJPA 2PDMA 1D8WA 2A3LA 4MADA 1YE6A 3GNDA 2Y0FA 3LTPA 4LC8A 5CPMA 3QGAC 3B0UX 5G2HA 2YPIA 3RG6A 3I7QA 2PRHA 1RJQA 2PC4A 1G5AA 1BKHA 2CZFA 3H55A 4JNYA 1VRDA 1KFCA 3AIEA 4JFWA 3UERA 2GGIA 3GU2A 2Y6ZA 1OD8A 4W86A 2AL2A 2A1YA 4PMJA 4FNSA 3JZEA 1BQGA 1XR2A 2D2HA 4JXCA 2A7RA 3G3DA 3WNLA 2VX6A 4H9UA 3S6OA 5K9DA 2BGQA 1GQLA 3VYLA 1HVQA 1A0DA 1EPXA 4WIWA 5HMSA 5C71A 3PNUA 6XIMA 2D24A 4RE0A 3FIGA 3N6JA 4A21A 5F4WA 5D2YA 1ITXA 1I45A 3R5EA 3TP4A 3AMGA 2GSJA 4IH3A 4WY0A 1DWAM 4DO7A 5C9ZA 1AJZA 1G0CA 3VKJA 4WY0F 2RGMA 5BRBA 1TRDA 3CAVA 2YZ5A 3WBWA 3VPLA 3RR1A 4LRTA 2WJDA 3B8TA 4EACA 1EIBA 3CHFA 2G96A 4C1NA 3AXKA 1JYNA 1XRVA 4XO6A 3WUFA 2INEA 4NZ1A 5M03A 3GIQA 3E9AA 1UD6A 4ICMA 3MA8A 4E2BA 2OQHA 5LKYA 2O9OA 4K6AA 3LBMA 4LV4A 3KBMA 3P62A 3S1VA 3UR5A 4AHOA 4DWDA 4Z0JA 4WOZA 2QPXA 2YDAA 3FYPA 1Y0EA 4XK2A 4PRTA 5CKSA 2CEQA 1GZJA 3PJTA 3QV7A 1JYWA 4FAMA 1FDYA 3AS0A 4PUUA 1RQHA 2GSHA 4PYSA 2HBXA 1IXOA 3BZJA 1XBZA 4E3VA 3T55A 5AFDA 4HNOA 3GNOA 1EYWA 4W7VA 2PLJA 2CETA 2Y63A 3T8QA 4OFCA 1RUSA 3AHTA 3BV4A 4R7OA 4B3KA 2G50A 1LT8A 4ZL1A 1I0DA 2QR6A 2QV5A 3NYZA 3ITOA 2V9DA 3P6LA 1MQQA 2PU1A 1XICA 1CZ1A 3FNDA 1VF8A 2DUAA 4IFRA 2QCFA 1XRTA 1XKYA 3BAIA 3HMCA 2ZUMA 4Q6XA 5F4SA 4MFDA 3WQPA 2O7SA 3HG3A 2AMGA 3K30A 5LGZA 1GORA 4EPDC 1VH7A 2WM1A 3L68A 1X6UA 3CIXA 2V2HA 4JQ2A 1XBYA 5A2CA 3QSTA 1JD7A 3ZZ1A 1NJJA 4HOWA 2VR5A 5BYWA 2WC3A 5C2XA 1U1HA 4TMBA 2CZVA 3THCA 3G24A 1T0OA 2CCRA 3BZGA 1H7XA 2ODOA 3L67A 1TZ7A 1B57A 4WDUA 3AMLA 3VDGA 4AZ6A 4YCPA 2WMHA 1PO9A 1ZP4A 1J4EA 1RXOB 4LRSA 3AYSA 1HFBA 3W3OA 4PTVA 4DUVA 1RBAA 2GL5A 5HMDA 4WKAA 3EDDA 2PB1A 3UG3A 4UMBA 3CAWA 5JBFA 1BSLA 4G1NA 3DECA 3V75A 2WLYA 4ZSTA 3ZLHA 2X42A 2BZNA 1IR1A 3NZRA 5EMMA 3FX4A 1VRXA 4B4HA 4RZ5A 1H7PA 5CSRA 3RU6A 1OJXA 4WJXA 4D6IA 4MNMA 3RPMA 4ADTA 5K2ZA 1B9BA 2HVNA 4UQ9A 2ACQA 4IIEA 2CHNA 4WX2A 4GQQA 1UIPA 3UZYA 3AIBA 2OYLA 4FHAA 5HR7A 3KZPA 3A4WA 2VGIA 1PIGA 4PUDA 3M6YA 4DBWA 1ECEA 2WHJA 2ZXBA 1KXQA 1ZRQA 3LLXA 4H1ZA 1YYAA 3OPSA 3ANUA 3CH0A 2EPNA 3OVGA 3HPFA 4CNNA 3DFYA 3UWQA 3CB3A 2O9TA 5BCAA 3BMWA 4WVXA 4JL1A 3RGTA 2XZ9A 5FF3A 4O1EA 3SM0A 3T0TA 2HS6A 2O0TA 2D0GA 2J9YA 3ALFA 3QKEA 3AIWA 4L4MA 1UH2A 1QPNA 2POZA 1C8YA 1WZLA 3VNMA 3W6LA 5AKQA 1V6VA 1PEZA 2CLLA 3EA3A 2DQXA 4IP7A 2NXHA 1UZ1A 5EYWA 4DLFA 2X41A 3TOPA 2D23A 4AZBA 5IBXC 1SUXA 1EGMA 2Y4SA 3BO9A 2CBIA 3IIXA 3RPTA 4RLIA 1U33A 1C8QA 3IARA 4OOUA 3GAKA 1J0KA 3O1NA 3C0LA 2NWSA 4JTEA 5D38A 1PB0A 4HK5A 2AKMA 2QDGA 2YZRA 4P7OA 1TJRA 4XWUA 1GG0A 3IK4A 1IEQA 1M7XA 2WLZA 2BHZA 3QQWA 2WVVA 3VIJA 1H0IA 3H4WA 4R3UA 4DEFA 3PZNA 4PN2A 1UPPA 6CGTA 3B8UA 2HJPA 2X0SA 3K8KA 4NNBA 2BXYA 3T81A 1V6UA 5DMNA 3OZOA 4XX6A 1MQRA 5HULA 2DZAA 3CLMA 3WMBA 3V3WA 1RY0A 4QHRA 4PB5A 1M01A 3NZ1A 3LHYA 4S3EA 2W63A 2XSXA 3VINA 4XIMA 2VVSA 3O6AA 2VGBA 3M4HA 4P7NA 1ICSA 5CLTA 1KXHA 4BI7A 2QJHA 4C6BA 5A6LA 3WLMA 4L7ZA 1XYFA 1YNQA 1S5WA 3GFZA 1CW2A 1HW6A 1WX0A 2OWXA 4IX0A 4E5TA 3N15A 3E74A 4AZIA 1TJ2A 3VGHA 4H00A 1E6SM 1LLZA 5CC7A 4PCFA 4Q4SA 2GJPA 5HMFA 4BQ3A 4MZYA 2CIPA 3VIOA 3FN9A 3QYSA 3KVJA 2FB2A 4TVCA 2V82A 2IQDA 4ORIA 2PFHA 3N2CA 2RGLA 4DNHA 3RR4A 4ZO7A 4M6UA 4YMZA 1QI2A 4OBSA 3POHA 1E6ZA 1LG2A 2PRMA 1B2YA 3FYYA 3DI0A 2VWTA 3DDMA 1S39A 2CZEA 5C9RA 3F2BA 1SO4A 1YADA 1JGIA 3EXTA 1XBXA 1OSEA 3TX9A 2WNNA 3UWVA 2V69A 4IGSA 3CO8A 4N9DA 2A2IA 3SUVA 1BVNP 4FP1A 3KP0A 3CYVA 4GZIA 1W17A 2DEPA 2EO7A 2YW4A 4YCOA 1PYFA 1R7AA 2WVVB 2OGYA 2HEJA 4ADSA 1MDRA 3VMPA 4N7QA 1KM3A 3P0XA 4C6LA 5A8MA 3CU2A 1F4AA 3T2QA 3U4AA 4WDXA 3MVTA 4JX6A 1FKXA 3A3WA 1QVBA 3E5PA 1RLDA 4PL2A 5CLWA 2IXVA 4J40A 1JZ7A 2XZ7A 3QBUA 4QS6A 3RCYA 4B2DA 1BVWA 3RPDA 3CPRA 2E40A 4IX2A 3FS2A 2GZXA 1VBRA 1ZP3A 4CNTA 2NUWA 3TA6A 5ABHA 3MSGA 1AQHA 1C9WA 3UVIA 1TPVA 4W8AA 4NNCA 3UWWA 5A6AA 4L6HA 1VEPA 1V0LA 2BVYA 3IUIA 2EKGA 5CPSA 3QR0A 1SZNA 4UR9A 5FJIA 4MKNA 1JFHA 3E96A 3VIMA 4C6QA 3QV6A 3QF0A 1W32A 4AVFA 5FD0A 4RXGA 3OA5A 1CPUA 1JIBA 4CEUC 3SADA 2QMKA 1OD0A 4MJMA 4RNFA 2PURA 5I7GA 2I5QA 4LW7A 3RUBL 4I8YA 1KW1A 3NQ8A 5E5CA 1WOBA 1W5NA 3LV5A 3VKKA 3VO0A 2BMBA 5B7YA 3TZFA 4NJGA 3PAOA 4YVXA 2OSXA 1MZHA 3V1PA 3RFAA 3TLQA 3WENA 3AAMA 3EWCA 3ABQA 3L4XA 1KM6A 3AS2A 3VZXA 3W1MA 4Z2JA 4KEMA 3CBWA 1EQCA 3A24A 3TJLA 2OR2A 2WZMA 1HUVA 1J5SA 2DW6A 2HXUA 1DQWA 1KWGA 4LAMA 4AD4A 3KVLA 4QLLA 3WELA 3GG1A 3QHNA 1AW1A 1XM3A 2V3FA 5DLCA 1NDYA 3HJZA 3UG4A 1S2UA 8XIMA 1T7LA 4RV3A 1SQ7A 4N42A 3WLKX 1GVRA 2W79A 5DBTA 1R87A 2O9RA 4Q4MA 2BGNE 2ALRA 1ONEA 5I03A 1EC9A 1H7RA 4QNWA 1P1XA 2JF6A 2FHCA 3LN3A 4B15A 2Q8LA 2DFAA 4HSNA 3LTYA 4K7VA 4XIAA 2CLIA 4JN7A 1W1A1 2D1ZA 2PDJA 3KRZA 3QY8A 3B8SA 4AW7A 4DPPA 2HXTA 2V5CA 5CJ5A 3O3RA 1B3XA 4GYJA 1W1VA 2VNCA 2FB3A 5FJOA 4JNZA 2XVPA 2JK2A 3CUJA 3TONA 1QNQA 3P60A 4K38A 5TAOA 5AOUA 1ZJAA 3UA4A 4DYEA 1I75A 4Y8EA 3F4WA 1EUNA 4IT1A 3UY8A 4DRSA 1OCQA 4MB3A 1H1NA 2HSAA 3C56A 3TIMA 1QDSA 4WR3A 3UZWA 4D8AA 2RDXA 3W7MA 2VX4A 4QEEA 3DG7A 1NH6A 4R9OA 1OB0A 2G8ZA 3U9IA 1YXYA 3GR8A 3KVKA 1LBMA 4ERGA 2F38A 4MLJA 3K8MA 3PPFA 3PUGA 1V3LA 4ZB2A 3J7HA 1EX1A 2XFRA 4YTSA 5CC5A 3BGJA 1GOXA 2FVLA 3ARWA 4X22A 3PPGA 3HGSA 3GE7A 1HJXA 1YXDA 4WD0A 3EOOA 2BVWA 5D8ZA 4U31A 1NAL1 3KBJA 4YVPA 2ALDA 2WBKA 2QJMA 2W9MA 3WK3A 1V93A 1TVLA 1ODZA 4GVFA 4OTKA 3LPGA 1RV8A 1M03A 4IMCA 3ECQA 1F7BA 4HN4A 1OIFA 3QMRA 4U3AA 5E93A 3THUA 1UC5A 2PBOA 4MJZA 2FHBA 5A6JA 1Q7MA 1US2A 5MKGA 1SJCA 4PUJA 1OWQA 3EB3A 1H09A 4X0NA 3R58A 1F3TA 3T44A 1D3HA 1WXZA 3QH2A 3TA9A 2PF0A 3UNDA 2YBVA 4DJDA 1EO7A 3MVIA 3S5YA 5CSSA 1UQZA 1WV2A 3N2TA 4O1DA 3VTRA 4O8RA 3CL6A 4DIAA 1AJ0A 4JHZA 3CV2A 4R7WA 1SPQA 2FFCA 3CHDA 3BL3A 1YRRA 4GK8A 5HPOA 5ECVA 1UWSA 4WZHA 3UG8A 2YCIX 1K77A 1KCXA 3AALA 3LM3A 2XSBA 3W7RA 4J3ZA 3RN6A 3QFEA 4Z1DA 4E4FA 1FBAA 3WH6A 1CBGA 3BC9A 3NL3A 4XUGA 5H8MA 3PY2A 2Y8UA 1VJIA 5REQA 4H41A 5IBXA 1JRBA 4GE8A 2WW5A 1QBBA 3HU7A 1Q45A 2XIOA 1BXNA 1OGGA 2Z29A 2ANUA 3IGHX 3VKDA 2KX9A 2YXGA 3KWSA 3WDIA 4LSBA 4QG9A 3O0KA 1W1ZA 3N14A 2ZTJA 1Q13A 2QCDA 3M43A 2YBUA 8RUCA 1DXFA 3WG6A 2TRSA 4BEQA 1JULA 2I16A 4RDVA 3SSZA 4AQLA 1XJBA 4D2JA 3NIYA 3OGRA 3IK2A 3GG0A 1QTWA 1JQXA 1QK0A 3EDJA 1AH0A 1BGAA 2Q3RA 4IHCA 4J3UA 3SQLA 3PPHA 4NJHA 2VXNA 1QO5A 2I57A 1QNRA 3QPZA 1UD8A 3R2GA 4IFOA 3L21A 2BHUA 4HA3A 1TMQA 2ON3A 1Z9AA 4NZCA 4AMCA 1KA9F 2DH2A 4AZHA 1PDYA 2XFWA 4HMNA 1TMHA 3W87A 1SJBA 3D3FA 3STEA 4JFVA 3VIKA 1NFBA 1RD6A 1YPFA 4B9YA 1MFVA 4G7EB 3MV01 4W7UA 1VFLA 3NO1A 1DTUA 3F2CA 3KTCA 5DRCA 5FEWA 3T4WA 2PTXA 4L5ZA 4GJJA 1S2WA 2WMFA 1CWYA 3OHMB 3GQYA 3VDCA 3P14A 3TROA 4O13A 5FF4A 1H1YA 3IJDA 1LL6A 1SFJA 3TYBA 3N12A 4UTUA 2DSVA 1OY0A 1KTBA 2I9EA 5HQLA 3HBLA 5E1QA 4U2YA 4Y2WA 2QCMA 5I00A 5C0QA 2WCAA 3NEHA 4W8BA 3Q94A 4J4KA 2WJZA 3E2QA 4LALA 3SJNA 4LX4A 8TIMA 1S5VA 2Y5EA 1XDJA 4DJDC 4TUFA 4AISA 3MUY1 5AY7A 5EA9A 3UCQA 1UR0A 2E6YA 3IRDA 4H9ZA 1U5JA 2Y7GA 3O9NA 1CB2A 3V5CA 1PCKA 2PLCA 2ZZ1A 2VEMA 1J18A 2HDJA 3T05A 1JZ8A 4DB7A 1OINA 4LS0A 4U10A 4UTKA 1LBFA 1DVJA 3DHDA 3I3BA 3N9SA 2ISDA 1GPFA 5EB8A 2R9RA 1LQ0A 4G5DA 2GWGA 5J5RA 3H7RA 4LUSB 4DJEA 3L0NA 3AIUA 3O63A 1UUOA 3OO2A 1KCZA 4UFMA 3TN6A 4CNSA 3FDKA 4A4AA 4HHMA 3G5EA 4JIHA 4ASTA 2QF7A 3H2EA 4MYXA 3DC8A 3G77A 1QPOA 1SR9A 3EWXA 4XV0A 1VEMA 1Z7AA 3T2OA 1FWRA 3ITLA 3RCNA 4GYPA 2AL1A 5D05A 3PFRA 3S0CA 4LNYA 4F0HA 1XLIA 4J5NA 3BCFA 3MTWA 1CXFA 3GW3A 4XBKA 1J0HA 4LVAA 3ZJKA 4FMVA 1V4YA 3CB8A 5F2LA 3DHFA 2CITA 1CNVA 4CUCA 1K9TA 1C91A 2ZUVA 4O53A 1LRNA 2OZ0A 2Q09A 3FW6A 4MAZA 3REQA 1IEXA 1QNPA 3KTSA 4NHVA 3KRBA 4H01A 3GXNA 3T0AA 3UPBA 4WLCA 3WF4A 3WNNA 1JAEA 4EE9A 3VNIA 4MWAA 4TVDA 2WZTA 1PTAA 2Q8ZA 1A3HA 3GKAA 3CWNA 1GVIA 3G22A 3CIVA 1EA0A 3BAXA 1GONA 1EJTC 5E9XA 5DXXA 4J3WA 2J8FA 1ESWA 2NV1A 3GS6A 3C2YA 3KCLA 3RYSA 5CGTA 1KXVA 1LUCB 4LWWA 5DY2A 4DO5A 3UPMA 1M7JA 1GKRA 1TE1A 2V5BA 2LLEA 4GZ7A 4GI9A 3TSDA 1OFEA 1H3GA 2JKEA 5K4XA 3WDPP 2YL6A 1DHKA 5C70A 1LJYA 3E2RA 4KPLA 2YL8A 3THQA 4M80A 3W25A 4JGDA 4LPCA 4RJEA 1GT8A 1H41A 4GNVA 3SUTA 3A3HA 3FK4A 4RCXA 4AX7A 3LI1A 3VMNA 4AG0A 1RK6A 2PLMA 3PTMA 5CEWA 3EPOA 4GACA 4Q8WA 1V3HA 3W71A 3S2LA 5CQ1A 1DIDA 4GIYA 2W27A 4PFHA 3WLIA 3C4UA 3RIKA 4C1NB 2ZKMX 3RCMA 4RE4A 2NT1A 4AZCA 4MAVA 3OLEA 2GJLA 3GK0A 1E56A 4RE3A 2AQWA 1DJWA 1TQXA 1UH3A 3KBWA 2X7WA 3FGCB 1W8SA 3LHZA 1BWLA 1E5NA 3L4UA 2J7HA 3BLDA 4NZ5A 1QHPA 3SQMA 1DE6A 1FX6A 2XWDA 1VQTA 2YA2A 2WO5A 4LAOA 1XLMA 1XLJA 3SO7A 1KCKA 1R7OA 5CAHA 3WNOA 2QCNA 4J27A 3UJSA 4JPGA 4CU8A 1HKWA 3M7SA 4AZGA 2GDUA 4D6CA 1WZKA 2YA0A 1OFBA 2R82A 3P0WA 4E8DA 3B9NA 1GOIA 1AZ2A 4S3AA 2OGJA 3IV8A 2PGRA 3M0LA 2QYGA 4HJWA 3T09A 4HPNA 4GRSA 3CTTA 2BLEA 3F7JA 4QJ3B 2BODX 4EXAA 4N9CA 4CD4A 3ZFHA 4JQ3A 2IKHA 3NQAA 4POCA 4C65A 2OSYA 3C52A 3N25A 2JGYA 1UD4A 4Z2GA 1W9XA 1ISYA 4AIOA 5A6BA 3QHOA 3OBEA 3NFUA 4P8XA 1RLCL 3P81A 2BP1A 1JEZA 3WH7A 2OX4A 3N1AA 1GG1A 1VAHA 2J24A 2HRWA 5JIPA 2OZTA 1S1RA 3QQ0A 2EPMX 1O95A 4S3GA 3PBUA 5A6BD 2RAGA 3GO2A 4MWAC 4GY7A 4RX0A 3TE9A 2PDCA 2DU2A 2BX7A 4PSPA 3RDKA 1X97A 1SYTA 9XIMA 3S9YA 4I9MA 4UFJA 4GQ0A 2J74A 2ZZ3A 2DSKA 3RM4A 4CQCA 6ALDA 3EEGA 4A8NA 3VC6A 4JKKA 3GB6A 2ZCGA 1IEWA 3LY0A 4Q22A 1M04A 3U0HA 5AHNA 1TIWA 3CEUA 1E4IA 4KFPA 4AF0B 1L9WA 1EJRC 3DFOA 4ZBCA 1PWLA 2A3CA 2QULA 3R10A 4GOAA 3S6TA 1MO0A 4DX3A 3WD4A 3U4FA 5HUPA 3NZPA 4Q8MA 6TAAA 3L4VA 3DEQA 2A3EA 2PGFA 3QOKA 5FSEC 1CLVA 4NAEA 1HKJA 4D6JA 2CLOA 1ZJIA 5RUBA 2OYKA 3BAWA 1VFTA 2DORA 1P6CA 5T26A 4JTFA 3N4FA 1NP0A 4XZBA 1JL8A 1WBHA 4Z1BA 1MRQA 1LOLA 3IGUA 3M9YA 3TJIA 3W02A 3TW7A 4GVGA 3AFBA 4D6GA 5LZLA 2OMAA 2E8YA 1EEPA 1JPDX 3KUMA 3G0UA 4J1OA 4IF2A 1DIEA 1VIWA 3TKFA 1TSIA 4NSBA 2E9BA 1KBKA 5TIMA 1W37A 3C3NA 1VEOA 3CMJA 1SO6A 2YSWA 1G01A 4XD5A 4PBGA 5A8NA 4FX7A 4LNCA 1H2JA 1PAMA 3LLDA 3NSNA 3H24A 4KESA 1HZYA 2HPIA 4BQ2A 2F2KA 2PA6A 1XYAA 2XWEA 2Y88A 4F79A 3SUSA 3IJIA 2WSQA 4PTDA 2XVGA 4JICA 1Y5VA 2OB3A 2ZXDA 1VFSA 2CESA 4YPJA 3GNPA 1NF7A 4FO4A 4TU1A 3P84A 2WVSA 4HNTA 1XSJA 1S46A 4W5ZA 5C7HA 5KZ6A 1A5CA 2YDRA 4U3CA 3ARXA 1IF2A 3IIZA 4I7WA 1SU5A 3LXBA 1P1MA 1WAUA 1V5XA 3EX4A 2GGGA 4ECLA 2BDQA 4AY7A 5C2GA 1ZNNA 3FSUA 2ZZ4A 3S5ZA 3E0IA 3C5QA 3VX0A 3WK2A 4REQA 4IPIA 3WF1A 3AISA 3BLFA 3LHVA 4CNUA 1OZMA 1OQFA 2GLKA 3WYZA 2CLPA 4JOMA 3DFQA 3W82A 3CHCA 2ISFA 3HG2A 2FH8A 2G3IA 4BI5A 2PGEA 4Y96A 3B0XA 1A5MC 4BS0A 4XKYB 2AKZA 3WN6A 2ZX7A 4B9ZA 4AHPA 4QEHA 2WVUA 3QZ6A 2ATMA 2NUXA 3XINA 4W8LA 1QW8A 1KQZA 2ZXAA 3OYXA 1JZ2A 4EOUA 1Z69A 3N4EA 1QNOA 3MQTA 4HZ7A 1AD4A 2ICSA 2VGGA 1YNYA 4JIEA 2EPHA 1R3QA 3LTSA 1FWAC 4IWWA 2WQDA 1PTGA 2PDLA 3MZNA 3LU2A 2G97A 3H2NA 4J3TA 2XSAA 1L0PA 3WLTA 4F8XA 2WYSA 3EWDA 5HAOA 3DHPA 5KEZA 1V02A 3GXIA 2R1LA 1P5BA 4ACZA 3QGKC 4AIEA 4RDZA 2W62A 3G6LA 3MU7A 2E6AA 3W28A 4LU0A 2GUUA 3L5AA 4DZIA 2QJJA 1EHAA 1YTEA 4ZTXA 3GUGA 4H8NA 2VFGA 4H9VA 3CQIA 1QPKA 3NDYA 5AYZA 2G4FA 3AYRA 1A5BA 1EP1A 1W5OA 5KITA 4TTGA 3P93A 4MG4A 3UVAA 4Q4KA 4PUWA 1DJGA 5AZ1A 4I9JA 4MNKA 4YNGA 2VFFA 4RNIA 3E0VA 4Z1YA 5REQB 3TYCA 2RJHA 4ROPA 4XZIA 3SN0A 1VFHA 4MYAA 2EQDA 3BOXA 4IL0A 4X3ZA 1TVPA 1JI2A 4UFIA 5AHLA 1EPVA 2PSNA 2QCCA 4JTIA 4QROA 4J2MA 3VUSA 1UP0A 1W3JA 1E55A 2XH4A 3LGGA 1R47A 1E71M 3B0YA 1EC8A 3CUFA 4GH3A 4C6IA 2EJ1A 4BKNA 1FWIC 4QX4A 2QLYA 4IQDA 5FJUA 3WJWA 1R38A 3KOXA 2G41A 1OADA 3QR3A 3ENLA 3KHJA 3HF3A 2G0WA 1VLWA 1TV2A 1KM0A 1Q8AA 5D8WA 4WRHA 3T78A 4UTTC 3KW3A 1GQIA 1TV5A 5AHIA 2VD8A 1CXHA 1YKWA 5G1MA 1BF6A 4FB7A 1MRAA 4N9EA 4D1JA 4B90A 5D32A 3W88A 3DH7A 1E73M 4WXYA 3BLOA 1IWBA 4XAPA 3H7VA 1QK2A 1Q2SA 2PGWA 2GSEA 4IP4A 1YXCA 1QPRA 2Q6ZA 4S3CA 3QW4B 4AHQA 3BMVA 3NVDA 1XD1A 1XLKA 1R5YA 1RH9A 1CGUA 2Z28A 1TZZA 3M0HA 1C8VA 4WGHA 4UQAA 2FZ9A 3A23A 3CQKA 1KFJA 1K9EA 3FOKA 4D6HA 3I6RA 1KGXA 1E0UA 3RLGA 2A6NA 2YL9A 4S3JA 2OLHA 4L6OA 3B40A 1XIMA 3M1ZA 5AC4A 5D03A 5DXYA 1J0ZA 3M0KA 3QLDA 2QKFA 3ZWSA 5ECUA 3U2CA 2GVLA 3IAPA 1EBGA 4MSSA 2FQIA 2E68A 1ISXA 4KIEA 2F6KA 5TF0A 3XISA 4W7WA 2HK1A 3H8AA 4DWSD 1RCOB 2VC5A 3ES7A 5M3WA 1B0IA 4ATWA 3S47A 1R3SA 5CBIA 5FF0A 1PZ3A 4QDMA 2Z0IA 3I3DA 1B3ZA 6A3HA 4REQB 3OW1A 4LH8A 3PSVA 1XXXA 4H6QA 4JTTA 2CC0A 3WBEA 1XPYA 2ZZ5A 3B04A 1JR1A 1EXPA 3EXSA 4DO6A 5B7ZA 3B3DA 3H4GA 1EF2A 5I79A 3S4TA 4FXFA 1ZSXA 2H8ZA 2WV8A 4CNOA 2CHOA 3WH8A 3DFPA 4G6CA 1SW0A 3UCDA 3RXZA 3H2CA 2WKLA 3G1RA 2QPSA 4CD5A 1E9IA 1C93A 1ZU8A 1UR9A 3TDFA 1JDAA 2DJLA 2XGIA 5GNYA 2ZUSA 1KBBA 3M0IA 3LD5A 3CT2A 3H12A 2FJKA 1EWDA 4JDBA 4C7DA 4FXRA 2D3LA 4E0CA 3G2GA 1GHSA 1TTIA 6TIMA 3M47A 2G3JA 4JIPA 3GNXA 4FXJA 1FHVA 2BTMA 4I9AA 1GOKA 4F2UA 3P8IA 2WMJA 2ZX5A 1EJXC 4N4QA 4BZYA 1UIOA 4UNKA 2DT0A 4ML9A 4K7YA 1QW7A 3EWWA 3CZGA 3K5XA 1P6BA 2A7NA 2ZA2A 2BHYA 4NYUA 3AI0A 5HJXA 4EK7A 4PH6A 5A6KA 4KCVA 4HOZA 1GNXA 3W7OA 5CZ0A 3OEXA 4XAGA 4DZHA 3EKLA 1F61A 3RNDA 4UMAA 3L2IA 4UNLA 4Z1AA 1VKFA 2ZRWA 1UKQA 1XD0A 1Z32X 4DJFD 3T40A 1S38A 4IMGA 4KERA 3WBAA 3GVVA 4ZMGA 2Z2BA 4O52A 1V7AA 5PTDA 2JQXA 2I9UA 4FLQA 3GZAA 2FMNA 4GLEA 3MJMA 4U33A 1CGVA 4G8TA 3BSHA 1DV7A 4JYEA 1G67A 1JYVA 1R3WA 2V5KA 4JFSA 3SY1A 3NXFA 3W1PA 3CZLA 1GJUA 2VWSA 1DEDA 2ZX9A 5B80A 2ZX6A 1D9EA 2D2OA 3LXCA 2E77A 2P3EA 4N2YA 5A94A 1QWKA 5C55A 2DVXA 1YTDA 3Q2DA 5KETA 1NDVA 2RKXA 2J66A 1S3TC 3AOFA 1R8LA 5EFDA 3LM7A 2JEQA 3DCPA 3S1GA 4C6CA 3O6CA 4PCSA 1Q6FA 3QQ1A 4PSRA 1ZZMA 5GVJA 4BCEA 2INFA 4B2DD 3S3GA 2A85A 1DQUA 3GKFA 3UR2A 2P53A 1NVMA 5EFFA 1LM1A 2X05A 1UA3A 4HIBA 1UWTA 4GH1A 1F8MA 1B30A 5FKYA 4A3QA 5CCZA 3WQDA 5FI8A 4MM1A 5CPLA 5CPNA 1ENUA 2PC8A 2Y85A 3W2MA 4IPLA 3AS3A 3R7MA 1YQ2A 4UOZA 1P7TA 3BSGA 4J9JA 4O10A 3U2ZA 3SGUA 1CCWB 3BPWA 4PMQA 3W6MA 3W1TA 4GUGA 1J2WA 2E6DA 1PWMA 1L2QA 4RK8A 5AYXA 1X39A 3EPMA 3B0VC 3WLJA 1B9ZA 4ZB5A 4L1XA 3RLHA 4AU0A 2P88A 3S1XA 1US3A 2XUCA 3GVGA 3KBSA 3MHFA 5C7VA 2IKGA 1AL8A 5I3IA 3BAYA 5D9NA 5DBUA 1NQKA 3KX6A 4B4FA 5IFTA 1A3XA 1B4KA 1UWIA 1VIZA 2DSZA 3CO4A 3W76A 4JN8A 3WNMA 3KE0A 3BV7A 1GEHA 5AYIA 1Z6KA 5DCDA 4RL3A 2HPMA 4C6KA 1ZAHA 3W1UA 3NDZA 3FYOA 3E02A 2XTKA 1XYBA 5HJYA 4W93A 3WQOA 1FCQA 1SZGA 3NQEA 1SMDA 1GTEA 5LIYX 4H7CA 3NNTA 3AIRA 4NZ3A 3W7PA 3W00A 1LZOA 4MJ2A 3LG3A 1GW9A 4Q8PA 2ZUUA 4OHQA 1KCLA 2BOEX 3P80A 3SCPA 3AHVA 4CU6A 3PULA 3BCJA 3ZJ8A 2VFDA 1FA2A 3OLDA 3G1FA 2XINA 2NLIA 1ICPA 4GABA 3RK8A 4Q7IA 2O7QA 4LYPA 4GI8A 3PAJA 4QG6A 4R27A 5IRPA 3CASA 1G7UA 1DL3A 4M6PA 2CLKA 4JFUA 3THAA 4LVGA 5C8BB 4F66A 1G7VA 1J0JA 2PDNA 4L1WA 1I2QA 4XQ6A 2VURA 4NG3A 4IXXA 1XYMA 1W3NA 3L2MA 2E28A 3ZJ7A 1NOWA 1QASA 4H6KA 2NQ5A 3G1HA 1A4MA 4YTTA 3ALGA 1YPIA 1GCYA 4WOQA 4JN6A 1EOKA 3W1RA 4NZJA 3NQGA 3KCJA 3MUXA 1XBVA 1OIMA 2Z7KA 1S2TA 1TPDA 1XLCA 5D02A 2OKTA 4UMCA 3CV7A 3Q65A 1W9VA 5J04A 4R33A 4IMDA 4HPGA 1TPEA 5DMLA 3MCOA 1DJHA 2A21A 4JQ1A 1R46A 4A8RA 4E2VA 2CBUA 1O60A 1GJPA 3VOGA 3KHDA 1LT7A 2VOTA 1KM2A 3S1WA 3MC5A 2WHMA 1VBHA 9CGTA 2HK0A 3FAWA 1VBGA 3I68A 4D9PA 2VEKA 1A5LC 4F0SA 2ZUTA 3M64A 2W6RA 2Z1SA 2J6XA 1QMLA 1V08A 3EDFA 3BGAA 3E1F1 3BICA 2OEKA 2E09A 4EWND 5XIMA 4L65A 2IPWA 4NIRA 3SBFA 2HWGA 1CGWA 3MY9A 4Q8QA 1HJUA 3UETA 4FNTA 2GVEA 4Y90A 5BMXA 1E1EA 1IYXA 3EKGA 4FOUA 1LLWA 1V7YA 3G18A 4C7GA 3TFCA 1R6WA 1OABA 4UTHA 4O1CA 5TD4A 3T7VA 2G4JA 3NM1A 2ACRA 1K3UA 2DZTA 3VNYA 5DANA 2C1GA 1XH2A 2VVNA 1ONWA 3C0SA 2YXXA 3ID7A 3U5UA 3CUZA 3GDBA 2WMIB 3V18A 3ZVHA 3VDBA 4M8UA 4OUIA 2YYTA 3IUHA 2VQUA 2REQB 2YCKX 4AY8A 3U2OA 4OKDA 4O4VA 2XIBA 3VNLA 2QCHA 5MHBA 4OECA 1X98A 4GO9A 2EJAA 4EF8A 1LF1A 3EEZA 2WXDM 2FZMA 1VHNA 3W38A 4UFLA 4YN5A 1EP2A 3W74A 1JYXA 2TAAA 2OELA 3CM4A 5LSMA 3GH4A 5A69A 3GHSA 1VENA 1UKOA 1VJSA 3B8IA 3UF9A 5JH1A 3DAQA 3NWRA 4GO8A 4F40A 1EF3A 1CX9A 1XGZA 4O1BA 2PCEA 4F0RA 3SCTA 1LYXA 1VFFA 1WDWA 4OGZA 4LS2A 4DF0A 1H7WA 3M5VA 1C90A 3IANA 3MKKA 1Q8JA 1G4SA 1Y7VA 1HL2A 1NDZA 4MPQA 4YU1A 1DTNA 2OU4A 4GPNA 2PWHA 1RP9A 3ERPA 3W7KA 2PP0A 3A12A 3EX2A 2X1UA 3RJXA 2XISA 5A8QA 5LNSA 4GWEA 3DKLA 2QGHA 4ZENA 4GXMA 4EX4A 1PCWA 3GXTA 5DT5A 3WH9A 4EVZA 2A3AA 3E49A 4GIEA 1BSIA 5A6TC 2BY3A 3IVUA 4TO8A 3WF0A 1UR2A 1E51A 2V6AA 2QCDB 3TVAA 2FH6A 2XM1A 1M53A 4YWIA 2WMKA 3CUXA 3NSMA 1W1YA 3W2KA 3O16A 3BJTA 4V28A 1XC6A 2XVKA 4HHPA 4P8WA 1YBQA 5HA7A 4S2CA 2FGBA 4IXHA 1CGTA 4HBKA 1ME9A 2C6QA 1BTMA 1XIFA 1GQNA 4JHMA 3L7RA 4QQUA 3TNBA 2VRQA 1SO5A 3OIHA 1J0IA 5C6MA 3VD7A 5D2XA 1A5NC 1XYLA 1AMKA 4MKSA 4PL1A 3VXGA 3ZJ6A 1CGXA 2BG5A 3ZLFA 3B4YA 2OJPA 1W5QA 3PG8A 3HA1A 5AN7A 1Q6CA 4AF0A 2EXOA 2HNHA 3FEMA 1VYSX 3UW6A 4ADUA 3WMCA 1ZAJA 1E4LA 4O1FA 2HVMA 2X09A 1CT5A 4WJEA 3QOMA 2OOGA 4JTCA 3L12A 4PUMA 1JRCA 4ROQA 1U22A 3WMLA 1Q6GA 3W83A 1L6WA 3UQNA 1TO3A 4L4LA 2OWWA 1JPMA 1D7KA 4MWAB 4O0QA 1ITCA 1F05A 3WH5A 2CKSA 3FKRA 1ECQA 3CYJA 5ABTA 3F5KA 3C0QA 5AECA 3BG3A 1HL9A 3C8NA 2FHFA 3PZQA 4IMEA 3CH9A 3NQ2A 1KTNA 1CGYA 3W23A 3UU0A 2QDDA 1BXBA 1WDSA 1WDPA 3W1AA 1K70A 2C1HA 1R3YA 5TNVA 3FJNA 4AIBA 3WX7A 1DBTA 3TYUA 4BJHA 4L9ZA 4PMZA 3DFTA 2IKIA 4KBXA 3LHWA 5D33A 1B31A 3TQVA 5EU9A 3WK0A 5TBOA 4AWEA 4E2OA 3NPVA 1JAKA 4MZ1A 1Q4WA 5F1UA 1EIXA 1NF0A 2V63A 2J62A 1PX4A 2PLKA 4LUJA 3TQPA 2E9LA 3R0UA 4XB3A 4IIDA 1VP5A 4NXSA 3MHUA 3ZLGA 3NL6A 3LCGA 2JF7A 3IVTA 3ABZA 3O05A 2OT0A 1Q3NA 2TSYA 4IMFA 1C9DA 2Q71A 3NXLA 1DQXA 1QJWA 4US5A 2A79A 1TPWA 2GK1B 2Z00A 3BGGA 3EOUA 4Q7BA 1Y8BA 9RUBA 3IS4A 3L65A 1I2RA 3NPXA 3A9BA 1GOOA 2F84A 2WHLA 3I4EA 3LQLA 1KD0A 4W84A 1XG4A 5CZSA 4PC8A 3L9CA 3L0GA 2ONEA 4XAFA 2PS2A 1C7TA 1XDMA 3MV11 1XINA 4LGXA 3V16A 2YLLA 3FCPA 4M24A 2ZIDA 1TV8A 3BSMA 3WD1A 3DFHA 4PTNA 4Q8OA 2NLYA 3N29A 3NG3A 2H6RA 2R14A 5D9MA 1FH8A 3NVTA 1NWSA 3V5FA 2FTYA 2DDXA 1EGZA 5FEPA 4A3YA 2R8WA 1H5YA 1TV3A 4JCLA 3KLLA 3WLNA 2V3DA 3M46A 2NZLA 2G3MA 1EKOA 1OFPA 4JEJA 1W6TA 2CERA 5J5DA 1P0EA 1XQKA 3MW7A 2Y7EA 3JZUA 1AG1O 4DBDA 1DJXA 1NWTA 1MFUA 2ZZ7A 4K8GA 5CSUA 1ME7A 4D8ZA 3VABA 2CLEA 3HFYA 4FPSA 2IPJA 4JCMA 3F4CA 3EPNA 3R11A 3NUKA 2H3BA 4DNMA 3PJXA 1TJPA 4S3DA 2PZNA 2WZEA 1UQYA 4YTQA 1VCFA 3GM8A 4G7EA 1A47A 2E25A 3EX3A 5HK4A 4XKYA 1UZDA 2F6XA 4GIAA 5MF5A 2NQJA 2YJQA 3L4YA 3ARZA 3BJSA 4RNHA 2XGZA 1XIGA 3H70A 4O14A 3PANA 2E5CA 5D2TA 1BFNA 2WMIA 3ZVHB 1G1YA 4DM2A 4GISA 1EO5A 4GCXA 2FVKA 2YOCA 5K7JA 4BWLC 4DY1A 3E38A 4HSHA 3CGTA 2WOQA 1K03A 3W7LA 3BARA 3VGFA 3K13A 1HQTA 1X1ZA 2WJFA 2YIHA 4DUOA 3NQ6A 1LTDA 3VGBA 5F2MA 3GUWA 1A5SA 1XYCA 3H7UA 4UTWA 2YDQA 3DBNA 3M41A 2DSWA 1JUKA 3ARYA 1RD5A 3DG6A 1FTXA 4KRUA 3TTEA 4LCRA 1SZFA 4EPBC 1ODUA 3GYCA 4RNJA 4DYJA 2QAPA 4G56A 1CB7B 1V3KA 1BF2A 4EAYA 2H90A 4OBTA 3BLKA 3WQFA 3Q37A 4C6EA 5FL0A 5H2ZA 1X8FA 3MMTA 3ITVA 3C2OA 1K8XA 4X63A 4PB3A 5E0CA 1FCVA 3TYAA 1M6JA 4Y9MA 2J77A 1V77A 1A5OC 3QM3A 1PHQA 3OJGA 2P8BA 3B4UA 3E0LA 3GU9A 3PTQA 4GJ1A 2FKPA 3UGVA 1OK6A 1O7AA 4D1IA 4PEKA 2ATSA 3W1NA 1SJAA 4NI8A 1EZWA 4ZGYA 4AXKA 2Z6IA 4FALA 4EXBA 2TMDA 4C6FA 1BEUA 3T07A 5JBEA 1HT6A 5JU6A 2IPGA 1UPMB 4B92A 4NT0A 3N4AA 4GUIA 4O19A 1GQKA 4AYGA 1Q85A 3TXVA 5AC6A 2J79A 4J3SA 3H2FA 4UQEA 5F2IA 3LSBA 4D6FA 2VDIA 3PFMA 3H22A 1H11A 4GYKA 1ELSA 4MMWA 4UUIA 4NF7A 4HHHA 3WFLA 2ZZ6A 3IIPA 3BURA 1EH9A 2Y24A 4V1XA 3FDGA 4CN6A 1I1XA 4ICCX 1JZ6A 4AVOA 3NTYA 1FDZA 1I60A 3NGFA 4O8AA 4PUEA 4PGLA 2V2DA 2V81A 3VU2A 4FIQA 1OVDA 1MWOA 4PB4A 2ZUWA 4H2CA 4LANA 1CTNA 3WL1A 2J6VA 3STPA 4E2DA 2ZC8A 3I7RA 4J3VA 3C6CA 4BWLA 4GVIA 4EF9A 1VBUA 1FP9A 2J9ZA 1UR8A 3STGA 1TTJA 4AIUA 4HOXA 1IEVA 4YWSA 1DXIA 2DUZA 1JUBA 1IXNA 1ZB5A 1NELA 3VOHA 4M1BA 1W1TA 1HXJA 4C6OA 4DPQA 4TTUA 3DBPA 2J7CA 1WP6A 1WKEA 2X0YA 2WSPA 4B5WA 4Q3MA 5BZAA 3CV6A 4JTKA 1QW9A 7CGTA 3BAKA 2C1IA 3A22A 4J35A 3U3HA 3ANVA 3HIJA 2ZX8A 4XZMX 2YCJA 1HJVA 3M07A 3AZSA 4DJED 2I5GA 2XN0A 2W0UA 1IEIA 5DT7A 3O07A 1QXLA 4C5YA 4P7LA 1F4HA 1M65A 1TKKA 1WZAA 4R34A 2EG6A 4RZBA 1G4PA 3TH6A 1H61A 3UJ2A 2CYGA 3ES8A 3TTSA 1O5XA 4QSFA 3RO6A 1TWWA 3VIFA 2QPUA 5CPQA 5A1AA 4XKMA 1HKVA 4CNPA 4HKPA 5FAJA 4QJ5B 3FGCA 1ZPTA 2PE4A 4PCTA 1KV8A 4EANA 1J93A 1QPQA 3WNKA 5T8GA 2VCCA 2QDHA