3NGJA

Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
b'MDKATLAKYIDHTLLKADATEEQIRKLCSEAAEYKFASVCVNPTWVPLCAELLKGTGVKVCTVIGFPLGATPSEVKAYETKVAVEQGAEEVDMVINIGMVKAKKYDDVEKDVKAVVDASGKALTKVIIECCYLTNEEKVEVCKRCVAAGAEYVKTSTGFGTHGATPEDVKLMKDTVGDKALVKAAGGIRTFDDAMKMINNGASRIGASAGIAILNGIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Crystal structure of a putative deoxyribose-phosphate aldolase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Lyase
total genus 79
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ngjA00
3PM6A 1VR6A 4UCGA 3PC0A 1FQ0A 1UJPA 3K30A 3KOFA 3G1SA 4WZHA 1GYLA 3L68A 2ZZ2A 4Z1CA 3LV5A 3MYOA 1EB3A 3O07A 4BK9A 4U4MA 1T8XA 3G0XA 2JKAA 3LDVA 4CCCA 4BR1A 3KHJA 4ONVA 2YW3A 5F4SA 3QF0A 3W1AA 5AYYA 3GAYA 5E0KA 3NQCA 3G1VA 1QR7A 4NZFA 5CPMA 2OT1A 3LHWA 5G4EA 4BWLC 1H63A 3A5FA 4DELA 3N3MA 2YR1A 1VQTA 4OGZA 2J24A 2I14A 4YL2A 1BWKA 2WJZA 3FYPA 4ORMA 2CLLA 3TSDA 3UWWA 4LVAA 4Q33A 3W7KA 4JDBA 2ZA3A 4UTMA 3H53A 5KINA 1Q6RA 2NX1A 3OHIA 3C4UA 1X6UA 1ME7A 5CSRA 1VYPX 2YYTA 3TV8A 1IGSA 4GNJA 3QQ0A 3O63A 4JXCA 1OG0A 3L5MA 3P5ZA 1K3UA 4O50A 4JDYA 1TPB1 1O5KA 1LBMA 1VLWA 3W7JA 5C6MA 3INPA 3KVKA 4EF8A 1DJQA 2V30A 4UFIA 2XFWA 4ADTA 1YTEA 4E38A 1XBVA 1HL2A 1F7BA 4GUJA 3QMRA 1TQXA 4N9EA 2ISVA 3KVLA 1TREA 2ZFAA 3RLUA 3ANYA 2DU2A 3O6DA 3KVJA 3ZR4A 2GJLA 2E6AA 4NNAA 2QCLA 1L6YA 2EF9A 2AAMA 1SQ7A 4QQ3A 1Z44A 4UMAA 1KFKA 1Z42A 1J2WA 5D37A 4MJMA 4C1LA 2O7QA 3P81A 3CWNA 2QJGA 1Y0EA 1M6JA 4JIQA 4OV9A 1JUKA 4CNNA 5CZJA 2Q8ZA 3BK0A 2E77A 4O53A 5G2WA 4IJBA 1FWSA 3PS7A 2BSLA 5AC6A 2VFHA 1K7EA 1FY6A 4FNQA 5LNVA 5HWMA 3GVGA 4DQWA 1W54A 1PCKA 3L0NA 3L67A 4NUWA 4RXFA 4EWND 3PB2A 1VCVA 4UTTA 1DHPA 2YYUA 4MJZA 4ZZ9A 3B0VC 3OVQA 3W7GA 3LHUA 3JR2A 1FXPA 1KM3A 1IF2A 4IMGA 4ZQPA 1B4EA 2VKZG 2A2IA 4XBSA 1YLVA 2CU0A 2JBMA 3DHDA 4IGHA 5HQEA 3CWOX 1IIHA 5EL1A 3TQVA 4ZMGA 3PVFA 4FB7A 4RLIA 5I3GA 3KFTA 2QAFA 2X2GA 1OYBA 3M41A 4DXVA 2UV8G 3HG2A 4GFSA 1PS9A 2QEZA 3LHYA 3NPXA 3G1YA 4NNCA 4DPPA 1GWJA 1NSJA 1T96A 4WY0A 5F2IA 1Q6QA 5F4WA 2E5BA 4O0ZA 1ZY9A 2YDAA 3PSVA 5CZ0A 4N6FA 3M1ZA 2DZWA 3CC1A 4BWLA 1OFAA 3NQEA 2E6FA 2ABAA 1YTKA 2ZA2A 5EKYA 3VI2A 1ZALA 3BLFA 4MOZA 4A2RA 1QAPA 4K7YA 4DF2A 2XN0A 4AH7A 1XBYA 4H3DA 2ZQ0A 3L0GA 4WY0F 4XUGA 2FPYA 2AGKA 4O15A 1FDJA 1FX6A 4ORIA 3QEZA 4YCPA 5BOOA 3WK1A 1SZNA 2Q3OA 2CLHA 3IV3A 1H7PA 5DCBA 5DY2A 3PBUA 1VYRA 4ZQOA 1NEYA 1P0NA 2R91A 3G3MA 3HGOA 4GJ1A 5AHMA 4UFHA 4UR7A 1DQWA 3TSMA 1DOSA 3HIJA 1EUAA 2CLOA 4HSNA 1JR1A 1OF8A 2GVGA 1WOAA 3SI9A 1MZHA 3DENA 3EXRA 2QDGA 3UWVA 2BX7A 4GUFA 1UCWA 3DZ1A 5DY3A 1KFJA 3NL6A 4HN4A 1RQBA 4R53A 1ONRA 1B57A 3IGXA 4N4QA 3O06A 4XZ9A 1YXYA 2RHGA 1X7FA 4RJEA 1YDVA 1SO6A 1T0OA 1F05A 1FCBA 3TAOA 4AVFA 2V82A 3I65A 3L5LA 4PC8A 3SGZA 4CLMA 3NQ7A 3A9IA 5EBUA 3STFA 1H7NA 4WXYA 5FEPA 5MHBA 1GVQA 2V5BA 2RH9A 5AYXA 4IX0A 1OF6A 3NQAA 2P10A 4LVFA 3NZ1A 4BI5A 4P61A 3HQ1A 4GXMA 2PRHA 1IXOA 1LLZA 3W23A 2BXVA 4OU1A 3I6RA 4FX8A 4MY8A 2V0TA 4QIUA 4JD4A 4PL2A 3TR2A 2ZRUA 4OHQA 2C1HA 1TPWA 2NUXA 5LNRA 4YMZA 2GQ9A 1LOQA 4FHAA 3LI1A 5D03A 1NF7A 3G0SA 1Q6LA 4UUIA 5BW6A 1NVMA 2DZVA 2B7NA 1GZGA 3DU0A 4QNWA 3GAKA 2GVLA 3R13A 3F4WA 2E09A 2VEMA 2FPTA 3C2FA 2VFDA 1YXCA 1FDZA 3HJZA 3F03K 1TPFA 1FXQA 3G1FA 1I2OA 3QJAA 4W9TA 2ISSA 3NXFA 2A7NA 4Y9AA 3GXPA 5AHLA 3M16A 4LRTA 4FIRA 2RDUA 5TQLA 3WJWA 4EIVA 4LVBA 1F73A 3P82A 1TJRA 5AHFA 3UY8A 2HTMA 3DKLA 1FWTA 2CLIA 1LDCA 1DJNA 4R34A 3SW6A 4JX5A 2J9XA 1SR9A 1ZJIA 3TK7A 3R12A 4LW7A 3E0IA 1ICQA 1KV5A 3GLCA 3W1MA 4NX5A 3W2NA 2ZZ3A 5KSWA 5TBOA 1A5SA 2E68A 2TPSA 3EKZA 1UBSA 1VLIA 4GUHA 1Q6OA 4IPIA 3N14A 3L5AA 1O4UA 5DCDA 3W88A 4WOZA 5FF7A 2W79A 1W5NA 2B7PA 4DF1A 1TPUA 4O1BA 1FCVA 3MYPA 3M5YA 4CQAA 2QJIA 1KM6A 2V9DA 4C1KA 4CNPA 1WOBA 2FJKA 4K38A 3E49A 1GTHA 4Z0SA 4QNEA 3A21A 1MXSA 3BARA 3EWYA 3TC6A 2WO5A 4XWUA 3SY5A 3W22A 3GR7A 2ZZ6A 2WSYA 1AW1A 1VHCA 3GB6A 3GX9A 3I7QA 4HNTA 1K8ZA 3R5EA 3TFCA 2CZ5A 4DO4A 3MHGA 1TPH1 3UNDA 1WV2A 4FF7A 4UTHA 1D3GA 4YCOA 1DV7A 1H61A 2YPIA 3I68A 1AW5A 3LLFA 4IMFA 5AYZA 1M7OA 1QPRA 3NAVA 3L65A 1AW2A 5LNWA 3PUDA 1H1YA 2ZZ1A 5CZSA 5ABTA 3S1UA 2ZZ5A 5G4WA 4ZQCA 1KV8A 1G4SA 1K8XA 3O16A 1KLYA 3W1UA 1FCUA 4R33A 4ALDA 2DORA 5IM51 2X16A 1I2PA 3NPUA 3O6CA 4IMCA 4UR8A 4JTIA 3IEBA 3PUEA 4IMDA 4N4PA 5I3JA 2PCQA 4AHOA 4JS3A 4WUIA 1L6SA 5U7SA 5K4XA 4FXRA 5F2LA 4N9DA 4FO4A 4WD0A 3M47A 3A22A 4GUIA 5G1TA 1JCNA 5HULA 1T99A 2C13A 4N9CA 3BLIA 5IBXC 3TW7A 2ZZ4A 1DORA 1HO4A 1LRNA 4JX6A 3HPSA 1G4EA 3G22A 3DFQA 3GNDA 2DP3A 4FIQA 4O13A 1F76A 4DF0A 2OT0A 4OE7A 2PE4A 1K02A 3KRUA 1DQXA 4Z0JA 2WOQA 2WNNA 4DO6A 3PBYA 4AMAA 4JYDA 5CPOA 3OEXA 1JCXA 4O19A 4UTLA 2QCFA 4HPXA 1VJIA 1TRIA 3LRMA 4KWWA 1ICSA 3W87A 2NZLA 3TMLA 1SZFA 3UPBA 5K3VA 1KBIA 3Q58A 3U2OA 2YZRA 2P1FA 3JRKA 4XKYB 2Y7GA 4LY8A 1TRDA 5DELA 1KM0A 3RNDA 1OX5A 4OT7A 1TPVA 4A22A 3TUUA 4K37A 2DJLA 3OVPA 1G4PA 4G1KA 4MYAA 4NJJA 3T40A 1YPFA 2CZEA 4M6PA 2JGQA 4Z1DA 1GVOA 4HHPA 1XL9A 7TIMA 4NXKA 1H7WA 1A53A 3P60A 2H8XA 3C8FA 3QW3A 4OV4A 3W74A 1ICPA 4JYFA 5A8GA 3TROA 2A6NA 1KM4A 1KTBA 3T7VA 3QH2A 3N19B 1JCYA 3EWXA 5LHFA 3GDKA 2QCCA 5C5YA 4MLJA 1VH7A 2R14A 4MFDA 1SW7A 4O4VA 1P5BA 2I9EA 1W3NA 1JRCA 2B0MA 1N8FA 2X30A 2CWNA 3NG3A 4FNRA 4GUGA 2WV8A 5EYWA 2JKPA 1RQHA 3UZ5A 2B7QA 4UNKA 3NA8A 1QPQA 3DFTA 3RU6A 1FWNA 1BWLA 2R8WA 4GBUA 5D09A 3ZWTA 4JN6A 1ZAIA 5HINA 5FEWA 1IXPA 1ZCOA 1WAUA 4A2SA 3W73A 3W7RA 2VOMA 5HUOA 4CQ8A 3QPYA 1L6WA 4QM1A 5KTLA 3NM3A 2KZHA 1TO3A 1XM3A 3CM4A 2W6RA 3ZFHA 3W7CA 1GTEA 5I3HA 3CU2A 5K2ZA 4LVGA 4IOTA 5AHIA 3HPZA 4KWVA 3LCIA 4NNBA 1LRTA 3OBKA 1SW0A 3SGUA 4YLWA 4MVAA 4UXDA 2ATMA 4NJKA 1OX4B 1Z48A 3SZ8A 4X2RA 3NYZA 1ZAJA 4RKAA 1KFLA 3WFAA 3P61A 4Z1BA 3HOJA 1XUUA 3LRKA 5IBXA 1BKSA 4Y6GA 1EWDA 2H6RA 5AFDA 3HG3A 3DBPA 2GPTA 1QPOA 3N34A 3S0CA 2Z0IA 4K7VA 1SSDA 3PBVA 2V2DA 1KW1A 1HO1A 3MBFA 1J4EA 2A6LA 2Y7FA 4UFMA 3QYQA 4ZL1A 1QMLA 5FF0A 1KLZA 2E6YA 4JTEA 4MZ8A 3KRSA 4LS0A 5K4ZA 5D2VA 3EXTA 4ZQNA 1OVDA 1VRDA 2BLEA 4O18A 3BG9A 4UFJA 1GG1A 3HG4A 4NJHA 3A5VA 5FEZA 2DZSA 1TIMA 4ZQMA 3G3DA 1TPEA 2XN2A 4M7TA 3VCRA 1CX9A 4UNLA 1KTNA 2QUUA 3NQFA 1A5CA 2ZBTA 3LCXA 1I2NA 2G5WA 2NWRA 2EAWA 3BGJA 4JTUA 3GDTA 1W31A 5HWNA 5HWJA 1RQEA 3NPVA 4PTNA 2WKJA 2A7RA 5LNSA 3S5YA 2NXGA 3PUOA 4O28A 4X22A 4UMBA 2Z6IA 3S5NA 1HG3A 3ABQA 3KVMA 4JY8A 3NEVA 1I4NA 4FNTA 1F74A 4FEZA 2CLKA 3U8GA 4N6EA 3G18A 2ZTJA 3GKAA 3NO5A 3TX9A 1TTJA 3DXIA 2V81A 2QCDB 2GOUA 3C2OA 1A50A 3CLMA 4L4MA 3Q94A 3AO0A 1R47A 3IIZA 3SFKA 3NL3A 3NOEA 3E12A 2C3ZA 3LB0A 1VS1A 1YYAA 1O94A 3NL2A 1CW2A 3EX2A 5K9DA 5E1QA 1WYIA 3NQ8A 4JY9A 3MI2A 4LS2A 2CZFA 2EKCA 2Y85A 1F6KA 3EX3A 5LZLA 1KM1A 3KX6A 3N73A 3C2EA 3DAQA 3HF3A 3QMSA 4XQ6A 2WPBA 4LRSA 3M5VA 5HUPA 2Y88A 1JULA 3W1QA 1TPDA 2Y61A 2A85A 4GE8A 4S1FA 3TXZA 1U83A 1H50A 2HS8A 1JCMP 2ATSA 2QAPA 4UC5A 3LCGA 1JUEA 2VFIA 4MPQA 3PG8A 1XXXA 3E02A 3W83A 4BFAA 5H2ZA 4CCEA 5I3IA 3CTLA 4O10A 4CNOA 3QPZA 4JYEA 3THQA 1XKYA 3TIMA 2OCZA 6TIMA 2VFGA 2Y7EA 3GIYA 5AC7A 3DH7A 4O52A 4O0KA 3HB9A 3VNDA 4Y96A 5L6UA 2VFFA 3W3OA 2Y89A 4MUZA 3S5ZA 3FOKA 4YXGA 2HMCA 5H91A 3W1XA 3M7WA 3LERA 2V8ZA 5CKSA 2QKFA 2HS6A 1OFQA 1EP1A 1W0MA 3QQ1A 1LBFA 4ADUA 5G2HA 3EX6A 2J9ZA 1VHNA 1ZFJA 2QCNA 5D2WA 1ML1A 3GDMA 3NQ6A 1JQVA 5L9FA 3HGSA 1FBAA 5DBUA 5LKYA 4NJGA 3CIXA 1TB3A 3TJXA 1X1OA 2FLIA 3C61A 4M19A 2WSRA 1QO2A 2ZRWA 2ZZ7A 1S5TA 1PCWA 4NZJA 3DGRA 3YPIA 1DKWA 5AC8A 4UTKA 3PY2A 1HFBA 3DKJA 3T78A 3LBCA 3NZRA 5CG7A 3W7DA 4TIMA 3BV4A 3DHFA 5KMYA 1XUZA 1GOXA 2QR6A 4K8EA 1GVFA 2VENA 4X3ZA 2GUUA 4PEKA 1H60A 1TV5A 3SECA 1YXDA 2YXGA 1UASA 5F1VA 3RLVA 1KM5A 1X1ZA 2NXIA 3WJZA 3LX9A 4ADSA 2I1OA 1Q3NA 2BTMA 1BEUA 3TW6A 3LLDA 2PC4A 4JICA 4AAJA 1K7XA 1MO0A 4FNSA 3THAA 2A21A 1BTMA 4ZQRA 3S5OA 4XBKA 2FB3A 2YX0A 6ALDA 1TPC1 3IVUA 1LLWA 2LLEA 5D33A 4XKYA 4QSHA 3LCLA 3BW3A 1GVRA 3I7SA 4AHPA 3UQNA 1TTQA 1I8JA 1F2JA 3SSJA 4TR9A 1LOSA 1C29A 2G95A 1LRQA 4JTJA 3N2XA 3LOTA 3W7EA 4AF0A 2OX1A 3ELFA 1E51A 5TIMA 1X8FA 5AB3A 3T4CA 3BLEA 3W2JA 5LHEA 3QZEA 3OG3A 3W7NA 3LCHA 3W2LA 1W3IA 3JS3A 1WA3A 3TU9A 1YPIA 4E2BA 3NQGA 2ZRZA 4LNYA 4POCA 3FFSA 1UUOA 2D73A 3IVSA 3IGUA 3T55A 3UYCA 4MZ1A 4O11A 1XDLA 3TAKA 3A24A 4L4LA 5EMUA 3S1XA 3MP4A 3N9SA 1SFLA 4O1CA 3M5XA 2CFFA 3W7OA 4NX0A 2EHHA 2ZDRA 2QDHA 2B7OA 2G97A 3ZS4A 3MI6A 4LTSA 2NUWA 2J9YA 3PSWA 4M5PA 1W5QA 4DBDA 3M43A 2Y63A 1SPQA 4HIBA 3FKKA 3GZ3A 5D30A 4LS1A 4R7JA 1G6CA 4WOQA 5FF4A 2QF7A 3BVJA 3W84A 2E1DA 3P84A 3W85A 2FDSA 4IXXA 2J27A 3W2MA 3MI3A 5AHEA 3NQMA 4OWGA 5HJLA 1WQ5A 3IIOA 5F1UA 1GEQA 1TTIA 5D38A 3W7PA 2QCMA 4P2VA 5D32A 3LTYA 4Y90A 1KTCA 4I7WA 3CEPA 3MO7A 4MLRA 1H7XA 2C14A 3W70A 3N2MA 3WJYA 1S3HA 5DXXA 3NNTA 4UTWA 1AL7A 3C52A 3HGRA 1QO5A 2NX9A 3UWYA 3CIWA 4MZYA 2PRLA 3V1PA 5KZEA 5FF3A 4RX0A 3ZWSA 3DI1A 3H54A 4WQ6A 3EXSA 3NR0A 1MEWA 3GK0A 3W7QA 3BW4A 1MEIA 4J9JA 1P1XA 1G69A 4RCXA 3QRHA 2TRSA 1ADOA 3FKRA 3R2GA 3G1DA 1GYNA 3UWUA 2NXHA 4DEFA 3W1PA 4O12A 3QFEA 3EWUA 3LHVA 1Q45A 3TNOA 1GVSA 4E2DA 3P5YA 1JCLA 1H1ZA 5EPDA 5EY5A 2ZRYA 1DVJA 2C18A 3O1NA 1JRBA 1I45A 3BPWA 2ZA1A 1OFPA 3UD6A 1H5YA 1LORA 4H6KA 5D2YA 1QPNA 1PIIA 4PCFA 3EKLA 1M5WA 1VPXA 3LXCA 1W1ZA 2NWSA 4E0CA 1UB3A 2PRMA 2VEPA 4U28A 1EUNA 3OA3A 3WK3A 1H7OA 3W75A 1OK4A 3DFOA 1R2TA 1ZAHA 3LCWA 2YSWA 3EB2A 3STEA 1RPXA 3RK8A 3PULA 4XTIA 4JR5A 3S8HA 2QCHA 2ABBA 5FI8A 2VFEA 2Y7DA 3TJLA 2H90A 3E9AA 1P4CA 4DO5A 1VCFA 4HT3A 3W2UA 2C16A 5DBTA 4N9BA 1R30A 3S6DA 2F84A 1QDSA 4NT0A 3IIVA 4I7UA 5HR7A 1IXNA 1W56A 1OYCA 5F2GA 1OYAA 5E93A 1B4KA 2FB2A 1SZEA 1QNVA 4S2CA 2Y70A 4OQVA 3QMTA 2VXNA 4PH6A 1C9DA 1J5TA 3FEMA 3PR2A 4JTKA 1LOLA 5SWUA 1TV7A 1GQNA 4RV8A 1W3TA 1G7UA 3EX4A 4O8RA 1OFEA 1H51A 4KFPA 4O4WA 2DZUA 3IIXA 3STGA 1SO3A 1FWRA 2C19A 1SSGA 3GYEA 5FF2A 3UZJA 5D04C 8TIMA 3L2IA 5C2XA 3HBLA 3EWBX 1KFCA 3TA6A 3E96A 4CQ9A 2ZYFA 5FESA 4BF9A 3MBDA 1W37A 1HUVA 5KZDA 2GJNA 5BRBA 1QOQA 3B0PA 1XC4A 1TCDA 3MW7A 3LXBA 3KXQA 3VE7A 4NQ1A 3I7RA 4IWWA 3QSTA 4AHQA 5G5IA 3DFSA 5D02A 4JEQA 2VELA 3TSBA 1ZNNA 3MUXA 1PE1A 1G67A 2QUTA 1THFD 5HMSA 2W0UA 2NV1A 5G2IA 3UXDA 3HPXA 3GR8A 1R2RA 3VE9A 2QUVA 3TDFA 3L0KA 1GG0A 1I2RA 4O14A 4IMEA 2J6XA 4HSOA 5CGQA 3O15A 1GT8A 1B3OA 3ATYA 3B03A 1YADA 4LC8A 3USBA 4QJ1A 1VZWA 4NVTA 1DL3A 4DBEA 3FYOA 4N2YA 3WK0A 4UFLA 2ZTKA 1VYSX 1RZMA 4TX9A 4K8HA 3SIZA 3S1WA 3TH6A 4AEOA 4OBTA 5EA9A 1JCJA 1PVNA 1L9WA 2JKEA 3MP3A 4DPQA 3DFPA 3CT7A 4B5NA 3V75A 1NAL1 3CQ0A 2EGZA 5J5RA 1LP6A 3C56A 3PG9A 2ALDA 3W86A 4IXHA 3MHFA 4JIPA 1I2QA 3O05A 2NUYA 3L21A 3UPWA 2BZNA 4MYXA 2P0OA 2QCEA 2Z2UA 4HNUA 3RFAA 4RZ4A 3TE9A 1A5BA 1ME9A 3LXAA 5C54A 1SU5A 3ABOA 3R8RA 3BG5A 2Z6JA 5I3KA 1JUBA 1EP2A 3KRZA 3SJ3A 4RK8A 5C55A 4O1DA 1O5XA 1PV8A 4JX4A 2E5DA 1LBLA 1WBJA 1ALDA 3BG3A 4MKNA 1W5PA 2WNQA 2F7FA 5D05A 1FCQA 1A5AA 1G7VA 3B8DA 3NQ2A 2OZ0A 4AXKA 2R94A 2H8ZA 5LGZA 2YFNA 4Q32A 4AWSA 1UUMA 3L9CA 5T26A 4RZ6A 1W5MA 3TQKA 3TQ0A 5CPNA 3MJYA 1GJPA 3CEUA 2EPHA 3PAJA 2WQPA 1WX0A 2C15A 3HO8A 2WSQA 3W7HA 4NJIA 2XN1A 1AK5A 4JTSA 4LU0A 2RDWA 5DXYA 1R2SA 4PODA 1TV8A 4AWTA 4RXGA 4IQLA 5BMWA 1SUXA 3W1NA 5KZMA 3BO9A 3NL5A 2H3DA 5LNUA 3CB8A 4LUIA 4EF9A 3Q37A 1K8YA 3TFXA 3FJ6A 3B0UX 4UTUA 3GKFA 4H4IA 2NX3A 2V5LA 2TMDA 2VEIA 1JVNA 1YDNA 3PBWA 3NVTA 1EWEA 4FNPA 1KBJA 2NV2A 1PHQA 1JJKA 1W5OA 1DBTA 4JNMA 4TO8A 3P67A 4RR4A 5F4XA 4D2JA 2VC6A 4O54A 1V5XA 1QWGA 3O6YX 2V2HA 4IUOA 4AWUA 4NXSA 4M6QA 2E5CA 5K9CA 2GQ8A 3MP5A 3LHZA 1AMKA 3BGGA 3HMJG 2QCGA 3W1RA 3W9ZA 4LWWA 1N7KA 3N9RA 1G4TA 3LI0A 3B05A 3U6WA 1NF0A 1OABA 1TSIA 5LGXA 4UMCA 1M7PA 5CSSA 4O1AA 5G1YA 3DFNA 1TJPA 1XDMA 3D0CA 3CHVA 1V7YA 3MWAA 3NM1A 5D2TA 1VCGA 4XTDA 1KA9F 4UTJA 4WXZA 2J88A 2VEKA 1YDOA 3TMQA 1RVGA 4LUJA 3QM3A 4LVDA 3WK2A 1H62A 1XBZA 1K03A 4K6AA 3QW4B 4ML9A 1OX6A 2ZRXA 3M5ZA 3LRLA 4UTWC 3OIXA 1OFDA 3FJLA 3W71A 1SO4A 1C8VA 3RF9A 2C6QA 2CLFA 4A21A 3F1QA 1XI3A 3G24A 3M6YA 4LV9A 4RZ5A 4UFKA 3EWWA 3C0JA 5DN1A 4Q4KA 1IXQA 1S5WA 2CLMA 1O60A 2YW4A 4TMCA 1LZOA 4PFMA 5DLCA 1PHWA 1N55A 3DI0A 3G1XA 3H55A 3IRDA 3LTSA 5CZTA 3G1AA 3ATZA 4KFOA 2G96A 4MY9A 3LBMA 3VFLA 4O17A 1IIGA 2ZCGA 1KFBA 3VKJA 3RMJA 4IPJA 4K39A 4BI7A 5FEXA 5K7JA 3UWZA 4EVZA 1FUYA 1VGAA 4O16A 3EEGA 3W76A 3ABSA 2DZTA 2X1RA 1LM1A 1OJXA 3M9YA 1EX5A 3G1HA 4Z08A 3KAOA 3UWQA 1SFJA 3W7MA 5AN7A 3TC7A 3W1LA 2X1UA 3PWAA 1F6PA 1XBXA 1LCOA 3LGEA 2YFOA 2CLEA 1K7FA 3S1VA 3CPRA 4FX6M 3UXAA 3Q2DA 1OFBA 5A5WA 4JTLA 4X9SA 4LV4A 2RKXA 3NQDA 4FX7A 4HNVA 3R89A 4K36A 3GNNA 2DZXA 4EOUA 3NDOA 3LTPA 2GQAA 3MHUA 2O7SA 1EPXA 3F4NA 5HNRA 3HG5A 3QC3A 3STCA 2YCEA 1ZHAA 1CI1A 2FFCA 4PA8A 3G0UA 4AB4A 2NLIA 3BW2A 2A7PA 2Y6ZA 4WY0B 1FWWA 2OJPA 1PL9A 3FA5A 2E6DA 2HSAA 5I3FA 1XFBA 2FTPA 2PURA 4TU1A 3B06A 1O95A 4GWEA 3S42A 3P74A 4M7SA 1VC4A 5LSMA 1TMHA 3IIPA 4QITA 3TKFA 1LTDA 4JGDA 4KFNA 3A23A 2AQWA 2TSYA 4YWIA 4JTHA 2Q3RA 3C2RA 3L66A 3W07A 2A0NA 2V2CA 1Z41A 4MFEA 1OFOA 1OFRA 3G8RA 3OVRA 1ME8A 2CZDA 1RD5A 4MY1A 4N02A 2H3BA 4LOCA 3P80A 1OK6A 1TQJA 3G8EA 1B9BA 4BI6A 4LT9A 2JK2A 1ZENA 4UTIA 2B4GA 3P8IA 2GVJA 1WBHA 2FQIA 3NPWA 4LC6A 1OX4A 4GRSA 3C3NA 4M6VA 1SZGA 1TTPA 4ICNA 2RDTA 4HKPA 4QISA 4WX2A 1EP3A 2ISWA 1EIXA 5D2XA 4UIOA 1SO5A 4MIMA 4Y8FA 2Y62A 3W2KA 4I7VA 3SR7A 5GVJA 2Z1BA 4FXSA 4JTFA 1H7RA 3WJXA 1P0KA 3EX1A 5HR6A 3NGJA 3LCFA 1SW3A 4JTTA 3B04A 1OHLA 4NU7A 3GDLA 3GXNA 4O57A 1MSSA 2FIQA 3QSRA 5AHNA 3W1TA 4HPJA 3HGJA 2ZRVA 1R46A 1KFEA 1RR2A 1S5VA 5BNKA 4A3UA 2OMAA 1EEPA 3M44A 3S9YA 1WXJA 2Q8LA 2DJXA 3IGSA 4HNNA 3IVTA 1TYGA 2X1SA 5BMXA 1U5JA 2FPVA 4JTGA 2X1TA 3C2VA 1W8SA 1D3HA 1RV8A 5AOUA 1QOPA 4KKXA 3W7LA 3GDRA 2YGYA 5KITA 1YTDA 3M0ZA 1LROA 1L2UA 2A1YA 3AJXA 4QAIA 4I9AA 3WJSA 1AG1O 3FS2A 3O8AA 3P7YA 4TMBA 5DCEA 2DZPA 4FNUA 1QCWA 3P8JA 1GPWA 3LV6A 3B4UA 3TCEA 3T44A 2IQTA 3FLUA 3W6YA 4GC4A 2QCDA 3EWZA 4S2BA 1JQXA 4PL1A 1HTIA 3PB0A 2JGYA 3W7IA 3GXTA 4A29A 5U4NA 2QJHA 3MMTA 1QFEA 3TXVA 1FDYA 3NQVA 2CW6A 4UTTC 5F2MA 3UY7A 5CPLA 3PF3A 3P62A 3FIGA 1AL8A 3LHTA 1KM2A 1LYXA 2A5HA 3LM7A 2BWGA 4IX2A 4Z1AA 2C0AA 1EA0A 3ABRA 2RFGA 3C6CA 5J5DA 1WDWA 4AF0B 1F5ZA 4ZVJA 4CCDA 4WJEA 1XCFA 2A4AA 3W72A 1MEHA 1NFBA 2TYSA 2WNZA 5K9XA 1D9EA
chains in the Genus database with same CATH superfamily
3HFTA 1J0KA 4IICA 3KOFA 3L68A 3LV5A 1DEDA 5C9ZA 2P3ZA 2OWXA 5IXEA 5E5CA 3AHTA 3B8WA 4BR1A 3GG7A 4NYUA 1XYCA 3RMEA 1ISYA 2YW3A 1P7TB 2OTDA 4X2PA 3NQCA 3G1VA 1KKOA 3WH9A 2OSXA 2YBUA 2PODA 5H8PA 3SURA 1JZ4A 3KW3A 3U5UA 3N3MA 2YR1A 2D24A 2QDDA 1SZRA 1XGDA 2WYSA 3FYPA 3K13A 4Q33A 4QE5A 1CENA 1X6UA 2NQ5A 2WWDA 1VYPX 4AISA 4KESA 4XAZA 4DZIA 3QQ0A 4JXCA 1GJWA 1S2AA 1OG0A 1K3UA 2IS7A 2JIWA 4V2XA 2SFPA 1CXFA 4U3CA 1DJQA 2V30A 4MKSA 4QDMA 3STPA 2V63A 4KRUA 4ADTA 1CGVA 4GI6A 5E9XA 1F7BA 3U2EA 3QMRA 4HCDA 1ITUA 5FKYA 3WNOA 4MWAE 4DY1A 2DU2A 1UP0A 3ZR4A 1LWHA 1PTGA 4FOKA 2AAMA 1SQ7A 1Z44A 1D7FA 4CVUA 4MJMA 1W3KA 4C1LA 3P81A 2QJGA 3BGAA 1M6JA 4PMJA 4CNNA 4B5XA 3SUTA 3EMQA 2Q8ZA 2WHLA 1R3SA 3WQFA 3BK0A 4O53A 1BD0A 1NWUA 5JH2A 4MB5A 2DIKA 5AC6A 1Q13A 2VFHA 4UNIA 1K7EA 1FY6A 4FNQA 3WLHA 3WUEA 4DBWA 1QWKA 2F2HA 4DQWA 3DX5A 3W6MA 4H8VA 3PB2A 2HCVA 3FEQA 1XIIA 5EMYA 4MJZA 3RX3A 3W7GA 3PZ9A 1EL3A 3AYSA 4IGMA 4IMGA 1DXIA 4KCUA 4HP5A 1B4EA 4YJ5A 4L61A 4W7VA 1R86A 2A2IA 4IUGA 4F0MA 3U3HA 4R5EA 2A3LA 2VOTA 4JZ5A 3KL0A 1UMYA 2BB0A 4ZMGA 3WD1A 3N4FA 4XAYA 4PUMA 2FYMA 3NSXA 1IV8A 2QAFA 5LIUX 1TWDA 1OYBA 2BFGA 2A3EA 2QEZA 3W0KA 1NSJA 1T96A 1EH9A 5F4WA 3RM8A 5C9WA 2YDAA 3CC1A 3NJ3A 3NDZA 5FCZA 1X97A 1B3YA 1S38A 1QAPA 5G1MA 4DF2A 2XN0A 1VJZA 3BJFA 3LPOA 3L0GA 2HISA 3L4UA 2FPYA 2AGKA 3ITXA 1FDJA 1FX6A 1LUCB 2BY2A 2VUYA 4RNIA 4GQBA 5BOOA 3FN9A 1YE6A 1R85A 3NXLA 1OM0A 3CAVA 5DCBA 3TP4A 4WKHA 2P76A 1Q8AA 1P0NA 1VP5A 1K9DA 1DQWA 3PZVA 4OUEA 5T9BG 4JNZA 4HTYA 1DOSA 2QF8A 1EUAA 1V0KA 5BROA 2CLOA 3TLLA 1JR1A 3DENA 1VFTA 2BX7A 3B3DA 4GUFA 3DZ1A 3WZ0E 2Q09A 4QLLA 4HN4A 1L6GA 4J27A 3ZT7A 4WEVX 1HQTA 1YXYA 2RHGA 4HD5A 2BMBA 4TVCA 4PC8A 3ZXWA 3NQ7A 3BE7A 5JBEA 1K9FA 2NSOA 2XWEA 2RH9A 2X0HA 1OF6A 3KE0A 3MCMA 4US6A 4BI5A 2R82A 1KBLA 3HQ1A 4YVXA 5HQMA 3AYTA 1ZB5A 1VEMA 1LLZA 2BXVA 5IHSA 4OU1A 4WGXA 3I6RA 4MY8A 2XVPA 2V67A 4QIUA 3LYEA 2ZRUA 2X05A 1FKWA 1ZGDA 4HZMA 1TPWA 3OZOA 4AIOA 1IWBA 3LI1A 1T41A 1WXYA 3SFWA 2V5CA 1E73M 1GZGA 3DU0A 4JKMA 2FPTA 1YBQA 4DRSA 1Q85A 1US2A 4YVPA 5BRQA 1I2OA 4C60A 2YDSA 2BGNE 3GXPA 5AHLA 1Y8BA 1WO2A 2Y24A 3S5SA 1UWAA 3T0BA 3CK5A 3M0VA 4GA8A 1F9CA 5AHFA 4WSJA 2CLIA 4QR6A 4I5XA 1BFNA 3GS6A 1LL6A 5BCAA 3SW6A 4ZO6A 4JX5A 2P3EA 4PSRA 1ZJIA 3KL3A 4HNCA 4J3ZA 4AY1A 4IG2A 1MXDA 4MADA 3MWCA 2Z25A 1LG1A 3M6DA 3W1MA 1HGYA 1JZ8A 3OIHA 5TBOA 2E68A 1QNQA 5BRPA 2ONEA 1C92A 1JGMA 5DCDA 3T8LA 2GUBA 3HA1A 5FF7A 3I3DA 5C2GA 4DF1A 3MTWA 1MW2A 1EGVA 1E1EA 5C71A 1E6NA 1E6QM 1MQQA 2V9DA 1A3WA 1WOBA 4KCTA 4EAYA 4JL2A 4AFYA 1GTHA 4QNEA 3A21A 4AYSA 3ITOA 3UVAA 3TC6A 3LLXA 2ZZ6A 3KDOA 1AW1A 3GX9A 1OB0A 1XQKA 4LBRA 3GIPA 4HNTA 3R5EA 4CUCA 1LQ2A 2CZ5A 3WNNA 3TFCA 3BLDA 5IFPA 1Y5XA 1D3GA 3I68A 3LLFA 1M7OA 1UD6A 3ZSTA 2HRWA 3BAJA 3L65A 4KETA 3PUDA 6PTDA 3UNTA 1SMAA 3QXBA 1XPGA 1XLMA 4Q4RA 3W1UA 2JIEA 3W82A 2DORA 3E5PA 3J7HA 2CBUA 4U5KA 2OGJA 4IMCA 3SQLA 4JTIA 3KCOA 3PUEA 4IMDA 3W25A 4GACA 3BJSA 5I3JA 4JS3A 1E40A 5U7SA 4L65A 5F2LA 1FH7A 4N9DA 3UR2A 5CXPA 1JI2A 1XLAA 3LPPA 1E5JA 2WCSA 5HULA 4N9CA 3PK7A 5IBXC 3TW7A 1DORA 2PTWA 1GK8A 2J7FA 3HPSA 1G4EA 3AIWA 4LCRA 2ZIDA 3S1GA 4DF0A 4OE7A 1K4HA 2GGJA 2VTFA 1M03A 1MI3A 2IW0A 4MWAB 4Y7EA 3H22A 2HJPA 4Z0JA 4J4KA 2AMGA 4FPSA 4P8UA 2QV5A 4O19A 1TRIA 4O1FA 1QI3A 3RCYA 1ICSA 1LJYA 2QVHA 2NZLA 2ALRA 1NTHA 2P1FA 1V51A 3BAKA 2Y7GA 1TRDA 1KM0A 3RNDA 4NI3A 4M51A 5CCZA 1V93A 2PFHA 3WQPA 4QXIA 4AD2A 3K4AA 2ANUA 3UR7A 4LYPA 4NJJA 1JYVA 4M6PA 5HMFA 1POKA 3EA1A 3UG5A 3ZJKA 4P7NA 2KAUC 4OJYA 1UR2A 2C8NA 4LAMA 3C8FA 1Z3NA 1ICPA 2Z2AA 3KOWA 5DT7A 2A6NA 1KM4A 1KTBA 4PB3A 2BOFX 3GDKA 3OPSA 5C5YA 1DJZA 2Z1XA 1IEWA 4JNYA 1KFWA 3WMBA 2WAGA 1W3NA 2B0MA 3TTQA 2X30A 1TX0A 3AU6A 1GVEA 4DWSA 3JU2A 5EYWA 4HHMA 1RQHA 2ISFA 3UCQA 1AH0A 3NA8A 3DFTA 4GGHA 4PZVA 1H4PA 1JYXA 1W1YA 2R8WA 4GBUA 3V0TA 1DQUA 1ZAIA 1IXPA 1ZCOA 4CQ8A 4NAEA 3QPYA 2QGHA 2ON3A 2ACRA 2YKKA 3GG1A 5KTLA 2D0HA 1TO3A 4RE3A 2J6VA 3W7CA 1BKHA 3COTA 3CU2A 5AHIA 1O12A 2JEPA 4QDPA 4AX6A 4UXDA 1VRXA 4F0LA 2XFRA 1VFHA 1XISA 4DZ5A 2KX9A 2VGIA 3P61A 4W85A 2PDNA 5A8PA 4ZSUA 3I4KA 3GBEA 4GO9A 3WUBA 3B40A 5AFDA 3HG3A 3CAWA 2GPTA 4FXFA 3N34A 3BL3A 3KBSA 3PBVA 2V2DA 4JHZA 3FCPA 2F6UA 1AQHA 2A6LA 2HZGA 3KHDA 4ZL1A 3HMCA 4B90A 1ZJHA 4HMCA 3M4HA 3NOYA 4XKMA 5K4ZA 5D2VA 3EXTA 4ZQNA 3V4BA 1GKPA 3L4XA 1BSLA 4PMZA 4CD8A 1TV3A 1QI4A 4O18A 3VINA 5FEZA 3CAQA 2GQ3A 3DEQA 1VAHA 3G5EA 4M7TA 4C65A 4UNLA 2POTA 2ZX7A 1EBGA 3H7RA 1CXEA 3LCXA 3VMPA 2NWRA 3NSMA 3BGJA 1AMYA 3GDTA 1UPMB 5HWNA 5HWJA 1H0GA 4X60A 4UQAA 2VX7A 2WKJA 4U10A 1XIEA 2ZVIA 3S5YA 2W61A 2VCCA 1MW1A 3H2NA 2Z1WA 4O28A 4U2YA 4X22A 3S5NA 4S3BA 3KVMA 2MANA 3NEVA 4B2DD 4FEZA 3U8GA 4N6EA 3BWWA 3G18A 3KBNA 2ZTJA 3GYCA 1V03A 3NO5A 2V81A 2GOUA 4YNGA 3CLMA 1QTWA 2A3BA 3WLIA 4XIMA 3IIZA 3NL3A 2YOCA 2C3ZA 2VRKA 1V02A 3NL2A 4GHRA 3VKCA 7XIMA 4ZBCA 2IKIA 2HK1A 3WENA 4JY9A 1H49A 2NSXA 2C1GA 3UU0A 3DESA 5LZLA 1D8WA 4P8VA 3UETA 2Y88A 3ORWA 1SM9A 1V4YA 3Q45A 1PWLA 2Y61A 4OBSA 4QCEA 4XD4A 4HNLA 1J0HA 1ZJAA 1RJRA 2QAPA 4UC5A 3OZMA 3PG8A 1XXXA 3E02A 3SCVA 1WDDA 4BFAA 5H2ZA 4CCEA 3KP1A 4CNOA 4O10A 2Z00A 5T9CE 4N7QA 4NF7A 1XLHA 2QULA 1PO9A 4O52A 4KRZA 2VFFA 1Q6FA 1VD6A 3W3OA 2C7FA 2Y89A 5EGRA 1UWQA 3VDHA 3IS4A 1EQCA 2PLMA 3WDJA 1OEPA 3V35A 5CC7A 1OFQA 1PSCA 3IUHA 4EK7A 4Q4SA 2H9AA 3UG8A 3VGBA 2OG9A 1W0MA 1U5VA 3QKEA 3LQGA 3EX6A 1VHNA 4MPKA 1ZFJA 1CGXA 1FBAA 5DBUA 4NJGA 1TB3A 3BAYA 3GNOA 5LXXA 1X1OA 2CHNA 4Q4PA 1EDQA 1A5KC 3V7PA 3M0MA 1PKMA 1IEQA 3VPLA 1PCWA 3PUGA 1PJ9A 2OR2A 1M9HA 3YPIA 4Q8NA 4AZIA 4BZYA 5A6SA 2WC4A 3LBCA 4YYCA 3BV4A 1XUZA 2J7DA 4K8EA 5EFDA 2GYIA 4X3ZA 1V8EA 4W4QA 3O6AA 4XSLA 3R10A 3MANA 1Z8AA 2NLYA 3VGEA 5FJUA 1Y5VA 2R24A 1KM5A 3BV7A 3WJZA 3LX9A 3GR4A 4PTXA 2VR2A 1BEUA 2QV4A 3LLDA 1FKXA 4NZ1A 4AAJA 3IRSA 3THAA 3U2CA 3QV9A 1ZTVA 4IM4A 4ZQRA 3WQ6A 2FGZA 3VIFA 8RUCA 3WQWA 2Z24A 3F4VA 3TYBA 4XKYA 1US0A 6CGTA 2XFFA 1UR0A 3GTNA 1DWFM 3UQNA 1LLOA 1F2JA 3SSJA 3EB3A 3L4TA 1QW8A 4S3JA 4HZ7A 1UROA 1X8FA 3NSNA 3CZJA 1ZRQA 3BLEA 3W2JA 2D1ZA 3QZEA 1SFTA 3QVQA 3N9KA 3W2LA 1W3IA 3JS3A 1UKPA 3TU9A 2VHLA 2IKGA 3C3UA 3KTSA 4HMDA 3G77A 1NDVA 3PWIA 2VZTA 2Z4GA 2ZRZA 2D73A 3IGUA 4IGNA 3TAKA 3GXFA 2I57A 1P7TA 1SFLA 5HPCA 3R1ZA 1E1CB 3MSDA 2ZDRA 2PWHA 1JZ5A 1H2JA 4LTSA 1NP2A 4DBDA 1EBHA 3R0KA 4HIBA 3XISA 3FKKA 3GZ3A 1KRBC 2E9BA 3M0HA 5LXEA 5FF4A 3KOXA 2E1DA 3B9EA 4S3KA 1I6NA 3W85A 1AD1A 1LQAA 2J27A 5AHEA 3NQMA 3QGVA 1GEHA 5HJLA 5A2CA 1UKOA 1GEQA 5D32A 4FOUA 4DYKA 2VDHA 3WNKA 4MLRA 1J79A 1E0UA 1UZDA 2OZTA 3WJYA 1S3HA 5DXXA 3NNTA 3SUWA 1AL7A 1R9ZA 4KCWA 1QO5A 4MZYA 2WXDM 3ZWSA 3APGA 4M80A 2FDMA 4J35A 2ZOXA 3U5YA 1F3WA 3GHSA 5I06A 1G69A 4RCXA 3T2QA 2TRSA 3OQEA 3OW1A 1NWTA 3RGTA 3R2GA 4D6HA 3G1DA 4A35A 2NXHA 1WDSA 3RM4A 3QFEA 3TONA 3LHVA 1A3XA 2QHAA 3P5YA 1JCLA 1H1ZA 2OWWA 1TA3B 2C18A 3WDQA 4Y8EA 3MSRA 4D8AA 2ZA1A 2IXVA 1SJBA 1KCLA 3JVAA 1W1A1 4M24A 5D2YA 4F66A 3KTXA 3U4FA 4DJFC 3CMFA 1M5WA 2GGEA 1UB3A 2PRMA 4REQA 3S9IA 2PBGA 3RITA 1EZ2A 3H70A 2G41A 2OZ8A 4CU8A 3CPGA 3DCPA 1OK4A 3DFOA 1XYBA 1BTCA 1FWDC 3EB2A 2E9LA 5I2UA 1RUSA 4DO5A 1CGUA 4LCSA 4HT3A 4ERAA 3W2UA 2HBVA 4N9BA 2OSWA 3WNLA 4G7EA 2V68A 1R30A 4I8DA 5KETA 4DJDC 2WKLA 1OYCA 1NQKA 1JZ2A 3CV1A 4BQ5A 4HNOA 1OYAA 1B4KA 2FB2A 3MCNA 1QNVA 3GXIA 3VOFA 3R6IA 1R7AA 2PP3A 3PR2A 3ALFA 1LOLA 3EX4A 3WIJA 1OFEA 1H51A 4KFPA 1SSGA 1PX4A 5HPOA 4C6NA 4V33A 8TIMA 3VM5A 4ZEPA 3MBDA 4BQ2A 4Y9PA 2GJNA 4Q22A 1IEIA 1WCGA 2PGFA 4EKJA 1DYSA 2QIIA 1CECA 3MW7A 3LXBA 2F6XA 2YA2A 3QSTA 2PU1A 4FK9A 4AHQA 1M01A 3FA3A 2VELA 4IGSA 5GNXA 4PULA 3VFCA 1PE1A 2QUTA 5DANA 3T6CA 1UJQA 2W0UA 5G2IA 3HPXA 1K1DA 4W7WA 4W8AA 3GR8A 3L0KA 1I2RA 4DUVA 1DWHM 2B31A 1UWSA 1C93A 5CGQA 4E4UA 3NO1A 3B03A 3USBA 4QJ1A 5C70A 2FHCA 3UFYA 1UC5A 5BWFA 2PS2A 2CYGA 3FYOA 4N2YA 1RZMA 4TX9A 1L8NA 3GVVA 3R11A 4K8HA 3WQDA 3AWOA 3UXIA 1AFSA 3DFHA 5EA9A 1EDTA 3WEMA 2JKEA 4H9MA 3IANA 3I3BA 3ARWA 4ZOCA 4B5NA 1NOWA 3AMLA 3MMDA 3V75A 3TN5A 4S3DA 3EZ4A 1LP6A 2VD8A 4IXHA 3B8TA 1I2QA 3URAA 4CN1A 8XIMA 4BHYA 2QJMA 2WJFA 2WK2A 4DB7A 1TFVA 3WF2A 5C54A 1SU5A 5I3KA 4KWUA 1QHZA 3KRZA 4HK7A 1CGTA 3R8GA 4O1DA 1O5XA 3VZXA 4RPPA 1CDGA 1LBLA 1WBJA 3P0XA 2J62A 2V5JA 1DIOA 4MMWA 3SIMA 1BRLB 2OZ0A 2H8ZA 1WKFA 4HB7A 5BXPA 2PDPA 1VB9A 3CHCA 3L9CA 3TN6A 4RZ6A 1QBAA 1KRCC 3D6NA 4UOZA 3MJYA 2CERA 3CNYA 3NWRA 2C15A 5I00A 1PPIA 1O6IA 1AK5A 4JTSA 1AZ2A 2RDWA 1E0TA 3OOQA 4AWTA 1GJUA 4J2MA 3EGJA 1EF2A 3MUY1 4RNFA 3VD9A 1BGAA 5KZMA 1REQA 1TR1A 4XZNX 3Q37A 3VOIA 1M7XA 3CASA 3N25A 4XZWA 4NZ3A 2HK0A 3APTA 4ZO9A 3N2CA 3RR1A 3B0UX 3GKFA 2V5LA 2ACSA 2YIHA 3AQUA 3WQOA 1ZCCA 3P67A 3B8SA 4NZ4A 4O54A 1QWGA 5DX7A 1Y65A 4AZGA 2V2HA 1VFSA 4INFA 2E5CA 5K9CA 3LHZA 1PKYA 1AMKA 3W1RA 4GINA 3LNMA 3QYSA 5DO8A 3B05A 3U6WA 1OABA 1TSIA 3AXKA 3JZEA 1GPFA 4C6EA 3F7JA 4NAFB 4O1AA 4G5DA 5G1YA 3TA9A 3DFNA 2V3EA 3NM1A 5LA0A 1YDOA 4MWAD 1RVGA 3WYZA 1XYZA 4YN5A 7REQA 4QJ3B 1K03A 4ML9A 2ZRXA 3LRLA 4UTWC 1J11A 3HM7A 1OFDA 3CV2A 1SO4A 1C8VA 4JIHA 3ZM8A 3M6YA 1XI3A 4LV9A 3ZO9A 3EWWA 2G0WA 1MNSA 2PDHA 3DG6A 5DN1A 1W9VA 4PBFA 1IXQA 3DHUA 4YVVA 1O60A 5T8GA 2WMJA 4S38A 1LZOA 4HZ8A 3C0QA 2VMFA 4GPNA 5CZTA 4KFOA 1HP4A 3C0SA 2CKRA 1ADSA 4JFSA 4GZJA 1A80A 4K39A 3EBVA 3R58A 5FEXA 2PDMA 5K7JA 2AOSA 2D2OA 1OC6A 1M53A 1FUYA 4EVZA 3L4YA 1E6PA 2GWGA 3EEGA 3W76A 2HXTA 2DZTA 1JEZA 2X1RA 5TF0A 3KAOA 1SFJA 1V6WA 3NZGA 3RU8X 1HZYA 1HL9A 2PA6A 5B7YA 4FX6M 5A5WA 4JTLA 1FFRA 4O1EA 4OECA 4LV4A 1FRBA 2GJPA 2RKXA 2W5FA 1E0WA 3U48A 3GNNA 4EOUA 3MHUA 3OG2A 2XH4A 3HG5A 2G8ZA 3AS0A 2FFCA 4D6FA 3WF0A 4AB4A 3BW2A 1MZRA 2Y6ZA 3WMCA 5I3FA 2CBIA 4XISA 3CL6A 5MKGA 2CBVA 2J13A 1U1JA 1ENUA 5C8BB 5ABGA 3TKFA 1LTDA 2AQWA 4GVGA 4JTHA 4P8WA 2O56A 4GIEA 2IPWA 3C2RA 1WP6A 2OLSA 4LF1A 2AL2A 4MFEA 1ESWA 4JIEA 3GC5A 1EJRC 3G8RA 3OVRA 3GHTA 3MUIA 2H3BA 4GQ0A 1TIWA 1TQJA 1MFUA 4DNHA 1WZLA 3GNRA 2A79A 4QISA 2ISWA 1EIXA 2PTYA 4UIOA 4MIMA 3RN6A 3T05A 5JBFA 3GO2A 1QASA 3SR7A 1T6MA 4Q7IA 1UD2A 3EOEA 1H7RA 2FFIA 3CZ8A 4JTTA 4NHVA 1OHLA 5D8WA 3QSRA 1W3HA 2E9MA 4JQ3A 5FACA 3FA4A 4J3SA 1H5VA 4QEHA 1S5VA 1XRFA 1FWFC 1GKRA 2O92A 2OMAA 1EEPA 4GIAA 2DJXA 4H8UA 3TW9A 1U5JA 4LUTA 2J78A 3VK5A 3E1F1 4ROQA 1YNPA 1Y7VA 1QOPA 3GDRA 4AY7A 4RE2A 1QT1A 3D5HA 3FX4A 3BLOA 3WJSA 1AG1O 3P7YA 4LAKA 4U3AA 2QXWA 1IGWA 3LPFA 3P8JA 3A9BA 1KB3A 1KO0A 3TCEA 5DMLA 3E6EA 3UXKA 4C6QA 2J74A 1WZMA 1JQXA 3LGGA 3RLHA 4HHHA 2ZC1A 3DGBA 1NP0A 2JGYA 1VJSA 5U4NA 4HA1A 5T91A 1EKOA 3KRBA 3FIGA 5AVNA 1LYXA 4QS5A 3SCWA 4WKFA 4PN2A 1EHAA 1Z9AA 4AF0B 1GONA 3LS9A 5A3HA 3HPFA 1MEHA 1Q6CA 2TYSA 2XM1A 2HQAA 1E0XA 2OLAA 3PC0A 3K30A 5E0CA 2FZDA 1GOOA 3MYOA 1EB3A 3WDRA 3OZPA 2ZUVA 1T8XA 4O0QA 3PTQA 3KHJA 4ONVA 5A2BA 2QLYA 3GHRA 4B3KA 1HJUA 5AYYA 2CIPA 5E0KA 2WVTA 1QR7A 2OT1A 2DPEA 4E8DA 4LCQA 3LHWA 4A3YA 2AQOA 5D9NA 3A5FA 3ARUA 4G6CA 1VQTA 1AODA 5A6TC 4OGZA 2OQHA 4YL2A 1BWKA 2C91A 2WJZA 3KTCA 5JVLA 3GWQA 4ORMA 3TSDA 3UWWA 2J8FA 3W7KA 4ERIA 4TV6A 1PEZA 5KINA 4GI4A 2DUZA 4IIGA 2XSXA 3OHIA 1ME7A 1KXVA 2YYTA 4FLRA 4GIYA 3O63A 4Y9OA 2OYLA 2P8BA 1TZ9A 3L5MA 4H7CA 4O50A 3ANVA 1NWSA 2PLKA 4CN6A 4I5UA 2I16A 3OO2A 4PUDA 3C0LA 3INPA 5LIKX 3EAUA 4EF8A 4UFIA 3K2GA 4E38A 1JF6A 1XBVA 1HL2A 1EF3A 3CB3A 2ISVA 2JFEX 1XIDA 3RLUA 2HV5A 3ANYA 4IL0A 1OG6A 3KVJA 4NNAA 1JF5A 4FZIA 1KFKA 5REQB 4AC7C 5D37A 1OADA 1QNPA 5I0DA 2Y1HA 4OV9A 4W8LA 5CZJA 2G3MA 5BZAA 2E77A 3VZZA 1FWSA 2PDCA 3PS7A 3CJPA 4G7FA 3N6QA 1AVAA 1PDZA 3AFBA 3GVGA 1I1XA 3IJ7A 2PDFA 4NUWA 1C8QA 3PPCA 3L7RA 2YDQA 3W53A 1DHPA 1RBOB 2F9RA 3NIYA 1F8MA 4ZZ9A 5HAOA 1RCOB 3MC5A 1ZJBA 1VFUA 2BHZA 2NVCA 4CD6A 2Z2BA 1YLVA 2JBMA 3T0CA 4IGHA 4ATWA 5HQEA 2HE5A 5EL1A 3TQVA 3KOZA 4M56A 1Z7AA 4RLIA 4A6GA 3AOFA 5I3GA 1TVPA 2X2GA 1BVWA 3LHYA 4GABA 4NNCA 4DPPA 1WKDA 3OYZA 4HU4A 3PPHA 4EPDC 5MF5A 4PGLA 2E5BA 4LYKA 4O0ZA 1E15A 1ZY9A 3FVDA 3PSVA 4N6FA 4TUFA 5AY7A 2DZWA 4N42A 3TR9A 3WF1A 1E1CA 2E6FA 3N2BA 2J66A 2ABAA 4E6MA 2ZA2A 4EXBA 1JCTA 1ZALA 3EOOA 3WD0A 1QNOA 1XLEA 3PZTA 4AH7A 4H3DA 1JPHA 4TVUA 4EPBC 1J9YA 4XUGA 4W84A 3EPOA 4O15A 4W89A 4AD5A 4DLMA 3WK1A 2RGMA 2VP8A 4XAGA 1H7PA 4ZCWA 4A3RA 4MDOA 3PBUA 4HOWA 3RRXA 3M7SA 1DXEA 1W32A 4ZQOA 1XHGA 3VU2A 7ENLA 5C7VA 3G3MA 3PFMA 4GJ1A 2YCIX 5AHMA 4XVDA 4UR7A 3WQGA 1BAGA 3HIJA 4GMEA 5GJPA 3BSGA 2QMKA 4YHEA 1MZHA 2WPGA 1R6WA 3UWVA 1XRSA 4GBDA 1KFJA 3NL6A 1RQBA 2BBFA 1WAWA 3IGXA 4N4QA 4HPGA 1T0OA 3FW6A 1J6PA 2V82A 3I65A 1W6TA 3L5LA 3S4TA 4CLMA 4CU6A 3A9IA 5FEPA 5MHBA 5M03A 4OTKA 1FVPA 2PWEA 1PKNA 3FDKA 4LVFA 1UA3A 3B9DA 4GXMA 4IZGA 3IJLA 4Q6XA 4FX8A 2Q6ZA 3QHOA 4JD4A 4PL2A 1S2WA 1VPQA 4YMZA 1D3CA 2DT2A 2HNEA 4IQDA 1LOQA 3TOPA 5D03A 1NF7A 1Q6LA 5BW6A 1NVMA 1ZS2A 4BEQA 4QNWA 3R13A 2GVLA 2E09A 3UZYA 3C2FA 4IIBA 3E0LA 4P8XA 2VFDA 3HJZA 1PZ2A 4CNSA 4S3EA 1FXQA 3R4IA 3FXYA 3G1FA 2QVNA 4W9TA 1J0JA 3EYPA 3WLOA 3QKZA 4CU7A 4P7LA 1F73A 3VGFA 3G6MA 1TX2A 4LGXA 3UY8A 3DKLA 3GG8A 4D6IA 1DJNA 1V6UA 2J9XA 4QRNA 2HVMA 3VCCA 3E0IA 4H9YA 1KV5A 1J5SA 4ERGA 1PX8A 3GLCA 1QBBA 4NX5A 4MNLA 1GQIA 2ZZ3A 1XLGA 4GYPC 1A5SA 2W4XA 4HA0A 4HCHA 4QE4A 3EKZA 2E25A 1UBSA 1EJ7L 1VLIA 4W86A 3S6OA 4IPIA 3HURA 3L2LA 3GSMA 4LEFA 3WQCA 2W79A 4FR1A 1W5NA 4HCLA 1Z6KA 1FCVA 4YS1A 4C1KA 2VZSA 4K38A 2X0SA 4Z0SA 3FHQA 5DMNA 4ZR8A 3SY5A 1P0DA 2OEMA 1QI0A 2GK1A 4HHLA 2WSYA 1VHCA 3GB6A 3NQBA 3AXMA 3VIIA 1M04A 2IKHA 1ZPTA 1MDLA 4PTVA 3S2LA 3G6LA 4IMFA 5AYZA 2WZTA 1BYDA 1QPRA 3NAVA 3VIHA 1QI5A 2BG5A 2WM1A 5LNWA 2Y8UA 2YL6A 5CZSA 1T5AA 3S1UA 4ZQCA 3WMSA 4ZO7A 3PTDA 1KV8A 1G4SA 1FCUA 4ALDA 4QROA 3NPUA 4HK5A 4LFYA 1XYFA 3VMOA 1PUDA 4UR8A 3IEBA 3O7UA 3PNZA 4N4PA 4ZOEA 4AHOA 4LBSA 4PR4A 1L6SA 5K4XA 3DIPA 3BOXA 2HE8A 1TVNA 4FO4A 4E2OA 1MMFA 3H2EA 3VOGA 3M47A 1HKVA 4JQ1A 3EMCA 1JCNA 1T99A 3GU9A 1LRNA 4JX6A 2VWTA 4ZB5A 4TV5A 1OWQA 3T09A 4JTAA 1XG3A 4ICCX 4EXQA 5FJJA 4ACZB 1DQXA 4WLCA 3RIKA 3ZLGA 4DO6A 1JL8A 4GK8A 1FP9A 4AMAA 4W88A 1TV4A 4M1RA 1FA2A 3OEXA 2D2JA 3TQPA 3CO8A 6ENLA 1UR1A 1BRLA 1PAMA 2OLHA 5BWAA 3TMLA 5HANA 3Q58A 2YZRA 4BF5A 4IP7A 4DYJA 1OX5A 1J96A 2FH8A 1TPVA 4A22A 1ECEA 3TUUA 5LIYX 1QI2A 1YPFA 2CZEA 1CNVA 3WQEA 4CQBA 4Z1DA 3HZ3A 4HHPA 2PB1A 4JCLA 1TCMA 4AUBA 1EPVA 4YWSA 2E4TA 2H8XA 3QW3A 3PHAA 4H2HA 1VIWA 4OV4A 3W74A 1UQZA 1C8YA 3T7VA 1GOKA 1JCYA 1F3EA 3BXWA 1MXGA 2FTYA 2R14A 1UKQA 2I9EA 2WCGA 1JDCA 4MDPA 7A3HA 1N8FA 3A3XA 3NG3A 2BVYA 3VNYA 4IFRA 2WV8A 2X40A 5J8LA 4YU1A 2X42A 1QPQA 3RU6A 5A8NA 1S3TC 4C6CA 5D09A 5FEWA 3HQNA 3VD5A 1WAUA 4A2SA 3N2TA 1YEYA 4QM1A 3RPDA 4H6EA 3NM3A 1NJJA 1GTEA 2OQYA 2Y5SA 4R7OA 1LL4A 3LCIA 1DJHA 3OBKA 3SGUA 4YLWA 4H9VA 3O0KA 3QZAA 1YW1A 4NJKA 2R9RA 3SZ8A 3NYZA 1ZAJA 3WFAA 3HOJA 1XUUA 5IBXA 1BKSA 3O3RA 4AD3A 5CBJA 5JXQA 1QPOA 2Z0IA 1SSDA 4CCZA 3SCSA 4LUSB 2ZX5A 1V6TA 1KW1A 1HO1A 6REQB 4UFMA 2Y7FA 4ZB2A 3EB4A 4C5ZA 2Z26A 1KLZA 2FZ9A 1JFHA 2W3ZA 3CUHA 4RW3A 4KW2A 2EPOA 2WHKA 4Z2JA 1M41A 4C6BA 4FLQA 2WLZA 1VRDA 1VBGA 2BLEA 2RGLA 1TJ2A 3A5VA 1LL7A 4M81A 4QCFA 4DHGA 1SGJA 4ZQMA 3FNDA 3G3DA 1O5QA 1CX9A 4DM2A 4KQNA 1HVXA 2QUUA 3F5LA 1GYMA 5CGMA 2AL1A 2ZBTA 1I0DA 3FK4A 3EMZA 4QG6A 3WNPA 3TYUA 3ZT5A 3A4AA 3U2ZA 1RQEA 3L4WA 2A7RA 4TOQA 1XYMA 4WSHA 5LNSA 5JQ9A 4ZSTA 2PDJA 1HG3A 5AC5A 3ABQA 2FTWA 1TUFA 4JY8A 1I4NA 3GNPA 1F74A 2Z1KA 4MWAC 3ERPA 2WC3A 6XIAA 3QY8A 3SBFA 4HMEA 2CXGA 3F4CA 1V0LA 3EWDA 1V7AA 5A8MA 5A8QA 3Q67A 4C5YA 1R47A 1GQJA 4EXAA 3SFKA 3NOEA 3LB0A 5ABFB 2O0TA 1CW2A 1ITQA 2DH3A 3PZUA 3NQ8A 3MI2A 2EKCA 2Y85A 4E3VA 1F6KA 4M6UA 1KM1A 1IZCA 3KX6A 3N73A 3DAQA 3HF3A 4XQ6A 2DY3A 1ECQA 1SFSA 3IAQA 3R79A 3OBAA 3M5VA 1AJZA 3SCTA 5HUPA 8CGTA 2P50A 3W1QA 3SCOA 2YDRA 4GX8A 5I09A 3A13A 1WNOA 8A3HA 1U83A 4HU0A 4QLKA 2QJNA 1JCMP 2ATSA 3MDWA 1XR2A 2VFIA 3KLLA 4MPQA 4JL1A 4H6QA 3MVTA 4C1NB 3W83A 1W9UA 5I3IA 2VVNA 3QPZA 1R9YA 3TIMA 2OCZA 3AIUA 3MU7A 4S3GA 6TIMA 3FSTA 2VFGA 3GIYA 3D47A 1DXFA 3DYOA 4WGHA 3HB9A 1HKMA 3OVGA 2GSEA 4LAZA 3VNDA 1RJQA 2J7BA 1SJAA 2HXUA 3LY0A 1GOIA 1EOMA 2FZ8A 4I9TA 2YXXA 2PGWA 3LZ5A 5H91A 3W1XA 4J2PA 5CKSA 4DN1A 2DQXA 3E5BA 2OU4A 4ADUA 3LMZA 5G2HA 2J9ZA 5E0FA 1JQVA 5PTDA 4ZE4A 3FYYA 3C61A 3W00A 3BC9A 4H01A 4RL3A 2GDQA 2XH2A 2WSRA 3AIVA 3CHDA 5LA2A 1POJA 3T1GA 3DGRA 3T0DA 4AD1A 4JIIX 5JH1A 4FP1A 2INEA 3NZRA 1VFLA 4L80A 5CG7A 1TVLA 4B4FA 1JI1A 4HU3A 5I6SA 1GCYA 2IQ0A 4MGGA 1GVFA 2VENA 4PEKA 1H60A 3GTIA 1TV5A 1US3A 1XX1A 3GTXA 3KUMA 2G3FA 1K8CA 1X1ZA 4ADSA 2XJ7A 1Q3NA 3SRKA 2JEQA 3TW6A 1RHCA 1MO0A 3DC8A 4NP7A 4CN4A 1BTMA 3S5OA 4XBKA 5ABEA 1TPC1 1QOXA 3ZJ8A 1LLWA 2LLEA 4QSHA 3DUGA 3K46A 3UJFA 3I7SA 1HJWA 3N1AA 1KD0A 1B1YA 1I8JA 1HIZA 3GVRA 1LOSA 4YPJA 2Z29A 3GXDA 1LRQA 3LOTA 1YKWA 3W7EA 4AF0A 1XCXA 1E51A 5TIMA 4Y2WA 5AB3A 2Y5JA 3T4CA 4AQLA 3KDNA 3K1GA 6A3HA 2DT0A 4Q8WA 3P6LA 2DEPA 1GHRA 3E0FA 4LX4A 4QG8A 4PMYA 3VGHA 3LENA 2XM2A 1OCNA 4J3UA 5EMUA 4DX3A 4LQ1A 1IT0A 4NX0A 2EHHA 2J79A 1QW7A 2PAJA 2B7OA 3ZS4A 2GJXB 3M43A 2CEQA 3PBGA 4BA0A 5CLTA 4E8GA 3H2FA 4WOQA 2X8RA 3VC6A 2FGBA 3D3FA 2OB3A 1TKKA 1OT2A 5CZKA 3MI3A 1GW1A 5RUBA 1UPPA 1CXHA 3REQB 4Z1YA 4PMDA 4LAUA 4P2VA 1ZQ5A 2X7VA 3PJTA 1IT7A 1KTCA 3AZTA 4I7WA 1ISVA 4J3VA 2CNCA 3W70A 3HGRA 5JIWA 4QBXA 3CIWA 1OGBA 2PRLA 2WHMA 3V1PA 5KZEA 3S46A 5HBFA 3DI1A 4AIBA 2VC5A 4C6KA 2ACQA 3EEZA 1JZ7A 4FALA 1V0NA 2I56A 2I5GA 3GK0A 3S3GA 2CPUA 3W7QA 1OCQA 2PEVA 2Z27A 4XB3A 3NO3A 5LIWX 3PJWA 4P7OA 1XW8A 3W1PA 2REQA 2FH6A 1Q65A 1TMQA 3GFXA 3JW7A 2ZRYA 1KR1A 3CQJA 3QLDA 1JRBA 3TOYA 1OFPA 1K6WA 3QOMA 5FJOA 1PIIA 2BXZA 4PCFA 2WSKA 3EKLA 2O4MA 1MVYA 1EIBA 2NWSA 4KEMA 2VEPA 4F2UA 3H2CA 1LT8A 2HVNA 1W1IE 1H7OA 1Q4NX 3EOUA 4ASTA 1NY1A 3AJ7A 1IT8A 2Z7KA 4EPKA 1KCZA 3ZLHA 1AZ1A 3UERA 2PI6A 3ARQA 4I6VA 5CSYA 3DYPA 2XIJA 1K6AA 1X38A 1B31A 2ABBA 1S2VA 1Q2RA 2Y0FA 1P4CA 2I5QA 7TAAA 3OB8A 4UQBA 5DBTA 2PLCA 4B5SA 2ZICA 3VIJA 1X96A 1QDSA 2B81A 3VX1A 4I7UA 1IXNA 2WMIB 3ABZA 5XIAA 3KZPA 2IPGA 5JMUA 3QMTA 3UGRA 2VXNA 4QAWA 4W93A 4JTKA 1QRQA 1TV7A 1GQNA 2HNHA 2F8QA 2YCJA 3OQ8A 3WLQA 4IJRA 4O4WA 3STGA 1DJYA 2C19A 5D04C 3CYVA 3L2IA 5C2XA 3WBAA 3SB0A 2WCAA 1ZL1A 3EWBX 2CC0A 2EPKX 3TA6A 3E96A 4DXKA 5FESA 3CH9A 3SRHA 1W37A 1B90A 2R6OA 3WX7A 1QOQA 1CXIA 3B0PA 1XC4A 5E70A 3C8NA 3LD5A 4JKKA 1TCDA 1R0MA 1MFVA 1BQGA 4Q4OA 5G5IA 5D02A 4JEQA 1DJXA 3FAXA 1ZNNA 4L7ZA 3KZSA 1THFD 3LQLA 1CTNA 4BKNA 3P0WA 5ENLA 3MY9A 3GDBA 4RNJA 1IEVA 4JCMA 2ZX6A 3T81A 3TDFA 3ARYA 2WW5A 5BXRA 4R88A 4O14A 1JG9A 2BODX 1O68A 1GT8A 3ATYA 3UW6A 4LC8A 4DJED 1DL3A 4LB3A 1M1BA 4UFLA 1VYSX 3PNUA 3GUWA 3SIZA 4GVFA 1VFOA 4DJFA 2VJXA 2W27A 3THCA 5EFFA 4OBTA 3VIPA 1JCJA 1E3XA 2R1MA 2AAAA 1F3XA 1E71M 4F2BA 2WBGA 2XVNA 2FKPA 3DFPA 4XZMX 1NAL1 1S39A 3BMVA 1QNRA 5CGTA 3VGGA 1HN1A 2ALDA 5FD0A 2VGGA 3O05A 2ZVRA 2BZNA 2POZA 2DIEA 2P0OA 2Z2UA 4WDTA 3RFAA 3TE9A 4E4FA 3GU1A 1ME9A 1QK2A 3WFZA 2Z6JA 1EP2A 4RK8A 3BUVA 3QN3A 2WMGA 4GJJA 2VD9A 1EHNA 3E3HA 3MCOA 4DJDA 2FGLA 2WNQA 3AUOA 1G7VA 3NQ2A 1V3KA 1GZ1A 2R94A 3B97A 5LGZA 3POHA 3QHNA 2YFNA 4Q32A 5A6JA 3VAVA 4XK2A 3TQ0A 5CPNA 3EA3A 1WX0A 5BOEA 4NJIA 2XN1A 1DJGA 1DWIM 1VBRA 4WRHA 1WUEA 3VIKA 4LU0A 1VENA 4RXGA 4IQLA 1W9BM 5BMWA 2EG7A 2QPUA 4JBRA 2WZMA 1SUXA 4AMCA 2ZWYA 3BO9A 4E4PA 1CEOA 3SAZA 4HOZA 1CLVA 3TFXA 2ISDA 5M3WA 4UTUA 5HMDA 3DECA 2OO6A 2NX3A 4LY4A 4AU0A 2J47A 3PBWA 3RM9A 2OGYA 3VIMA 3AHXA 1EWEA 4LB4A 2NV2A 4D1JA 4HMNA 1W5OA 4UOQA 2GSJA 2HROA 5FOOA 2OO0A 4TO8A 5F4XA 2BOGX 1KXTA 2VC6A 1V3LA 4WK9A 3FDGA 3N29A 2G50A 5DMMA 2VI0A 2ZE3A 1X39A 4NXSA 1BXCA 2GQ8A 3MP5A 1DE6A 2QCGA 1JDEA 2XINA 1V79A 4LWWA 1N7KA 3WLKX 1TWIA 2OXNA 1NELA 2DDXA 1NF0A 1F8IA 4UMCA 1UG6A 2DSKA 1M7PA 5A8OA 1U2YA 2ZX9A 2J7HA 2XVLA 4XVEA 3A6OA 3ITVA 1XDMA 5HXMA 3UR5A 1V7YA 3CZGA 5D2TA 4XTDA 1KA9F 2VEKA 1TZZA 3M46A 1F3TA 4LUJA 3FVMA 1UA7A 3QM3A 2XYLA 3WK2A 2PWFA 4K6AA 2YLLA 3QW4B 3SGGA 7CGTA 5I07A 3RYSA 4OFCA 3FJLA 3W71A 1UC4A 4NASA 1KKRA 3RF9A 1JXKA 2GSHA 4A21A 2PUZA 3G24A 3A4JA 3T2OA 1UZ4A 4TMCA 2YW4A 4PFMA 3VD7A 3FHAA 5H8MA 2GWNA 3DI0A 3G1XA 3H55A 1PBGA 4AZ6A 3MB9A 2GGIA 2ZXQA 3LBMA 3S2NA 1Q6EA 3VKJA 3EOLA 3WLMA 3EDKA 3IJDA 4LAOA 3ZQ9A 4F48A 4J3XA 1XRVA 1QPKA 5D8ZA 4O16A 2A3CA 3AC0A 2DUXA 2XSBA 4J1OA 1LM1A 1TELA 1AUSL 1EX5A 3W27A 3PZGA 3LA4A 3UWQA 3W7MA 3W1LA 2OOFA 1LCOA 3TWAA 1UH3A 2YFOA 4LH8A 3S1VA 1QATA 4MKVA 4Q4MA 1W9PA 4HNVA 3R89A 1Q6DA 2UZ9A 4OBRA 3DHPA 3G2GA 4JIRA 3LTPA 2O7SA 1EPXA 3F4NA 1CI1A 4PA8A 3G0UA 3PZMA 2GUYA 2NLIA 3OBEA 2OODA 3E2RA 3W01A 1FWWA 1NQ6A 2E6DA 2HSAA 1XFBA 4ROPA 4E5TA 4AVOA 3B06A 1VFFA 4WKAA 4JQ4A 2PDKA 3WY1A 2EJAA 4GWEA 1HL8A 1F61A 1VC4A 5LSMA 3IIPA 4QITA 4JGDA 3UCDA 3A23A 2TSYA 3CL8A 1YNQA 3W07A 4MNJA 2A0NA 2V2CA 1RPKA 3AISA 1R3TA 2XZ9A 1P48A 1VFMA 4G1NA 3EDEA 2ZUMA 1UKSA 4LOCA 1OK6A 3AHVA 3QZ6A 4U2ZA 4WSKA 5CBBA 4PRWA 2QW5A 4IIHA 4UTIA 2B4GA 2GVJA 4Z2GA 2FQIA 4LC6A 1T7LA 4R3UA 4M6VA 1EP3A 3A3HA 4XZHA 1RA0A 1VBJA 1JD7A 2A3AA 1S5MA 2INFA 4PUNA 4Y8FA 4V1YA 3VKKA 5GVJA 4ECLA 4FXSA 4LUSA 1XQLA 1TG7A 1P0KA 3RJYA 2XH7A 3SDOA 3TTYA 4KEZA 1ADDA 3GXNA 3L2MA 4NSBA 4F8XA 2Y8KA 1A0DA 2QT3A 4ZFMA 4H04A 5BNKA 2HVOA 4A3UA 4L4PA 3M44A 4B92A 2NVAA 3S9YA 1WXJA 3SUSA 2FJUB 4MUPA 2X1SA 5BMXA 3ID7A 3N13A 2FPVA 4JTGA 3C2VA 1W8SA 2J77A 1D3HA 5FJPA 3MQTA 3E2SA 3W7LA 4GKLA 3V0UA 2BDQA 1YTDA 2A1YA 3AJXA 1E9LA 1C7SA 4QAIA 3FS2A 3O8AA 4TMBA 5DCEA 4RNHA 2V38A 3VNZA 1CCWB 3VNKA 1QCWA 1GPWA 1V02E 3LV6A 2WLYA 4C6OA 1XD0A 2NQHA 3B4UA 4G56A 4AEEA 2O9RA 4QP0A 3WL0A 3FLUA 3W6YA 1RCQA 2PDXA 1HTIA 3ARVA 3T2PA 3IJ6A 3W7IA 3GXTA 4MB1A 3PJUA 3H7UA 2QJHA 3N6HA 5ABFA 1QFEA 2PTZA 4UTTC 3WN6A 1VEPA 1J0IA 1U5HA 1V3JA 4GQRA 5E6YA 1XYLA 1KM2A 2BWGA 1EA0A 1EQPA 4IG2B 3ABRA 2RFGA 1WDWA 1JPKA 1F5ZA 3B8VA 1KBBA 3VTRA 3WBYA 2WSPA 1XCFA 2WNZA 1E5NA 1RLDA 1RY0A 4F0SA 1NDZA 2E8ZA 4UCGA 4GJIA 2F38A 1A49A 3G1SA 2OPJA 1GYLA 4Z1CA 3BZJA 1PYFA 4C1NA 4BK9A 1W9XA 1CWYA 4U4MA 3LZ3A 3LN3A 3G0XA 2JKAA 3LDVA 4PUJA 3VOJA 1DIKA 4OOZA 3W1AA 3WBXA 3GAYA 4LF2A 2O9TA 2WMKA 4NZFA 5CPMA 1NU5A 3T4WA 5G4EA 2ZDSA 3CUXA 4B5VA 4BWLC 1H63A 3VKBA 4V28A 4DELA 1V6VA 3ZIZA 1XCWA 2J24A 4R9XA 3VD3A 1XINA 3MO4A 1EYEA 2DW6A 4LVAA 4KT2A 3RJXA 2P8CA 2ZA3A 4UTMA 2QPXA 1ELSA 1BVNP 1DWAM 3H53A 7ODCA 2D0GA 1F6YA 1Q6RA 3C4UA 4PMXA 3TV8A 1IGSA 3CL7A 4Z2IA 3P5ZA 3I10A 3R43A 1TPB1 2Q71A 4RZBA 1LBMA 3GH5A 3E74A 2XIBA 2G4JA 2CCRA 4L9ZA 3KVKA 4I90A 4BY3A 4K1GA 3ZR6A 4GUJA 1TQXA 4J3TA 3KVLA 1TREA 2ZFAA 4RDYA 2GZXA 1JIBA 4WF7A 2FVMA 3O6DA 2GJLA 2QCLA 3E0WA 1Z42A 1LT7A 3V18A 2O7QA 3CWNA 3PZQA 4JIQA 1JUKA 4JFTA 4MHBA 1CXLA 4L56A 1B3ZA 1S46A 2OSYA 1UR9A 4AEFA 1J93A 3AMKA 3AS2A 3MKKA 4PRTA 4FF5A 3L0NA 3L67A 4W8BA 4RXFA 4R9OA 4DXXA 3IGHX 2YYUA 3B0VC 3OVQA 3H8AA 3LHUA 1FXPA 5FSEC 3TNBA 5DRCA 4QEEA 4ICMA 4ZQPA 2VKZG 3W02A 2PWDA 4XZBA 4ZXOA 4XBSA 2CU0A 3DHDA 4JTCA 2QNEA 2C79A 1ITXA 1BYBA 2OFJA 3QY7A 1IIHA 4HPNA 1XIMA 5D9OA 2ESCA 3M41A 4G9PA 2UV8G 3KOYA 3HG2A 4GFSA 4QJ5B 1PS9A 1W17A 9RUBA 4WY0A 5F7UA 1Q6QA 3L4ZA 2QZRA 4B2DA 2HBXA 5CZ0A 5CAHA 3AWNA 2VZUA 3M1ZA 4V15A 5AZ0A 1FFQA 4DZHA 3EKGA 4H7VA 5EKYA 3VI2A 4MOZA 5CPTA 5C2CA 2D22A 1G01A 1TWZA 4ORIA 3QEZA 3KLKA 4NRSA 3UESA 1SZNA 3SQSA 3BH4A 3BAIA 4MAVA 3K8LA 3URBA 5DY2A 4CD4A 1VYRA 1XIJA 2I7GA 4JTDA 2R91A 4HQVA 3REQA 4NAEB 1XSJA 3TLQA 4UFHA 1YRRA 2QGYA 4LALA 3VZYA 3IACA 3FGCA 1RY8A 1OF8A 2R1PA 1WOAA 3SI9A 1GORA 5D9MA 3EXRA 1KGWA 2Z1VA 5DY3A 2VRQA 1TWSA 1DTUA 4A4AA 2XPKA 3O06A 4ZOAA 1SO6A 1F05A 3TAOA 4I8YA 3SGZA 3KP0A 3LBOA 3UR8A 4DAFA 1EGZA 1EXBA 1H7NA 4TQTA 4WXYA 1MDRA 4B3ZA 1GVQA 2V5BA 3KS5A 5AYXA 4GVHA 4C91A 3NQAA 4B91A 3NZ1A 4BQ3A 4P61A 1PZ1A 4GG9A 1JD9A 1IXOA 3W23A 1E9ZB 1R3VA 3PTKA 2V0TA 3TR2A 2C1HA 1D8CA 2VURA 2NUXA 3L4VA 1TUXA 3OLEA 1XLBA 3WMLA 5AZ1A 4FHAA 2X2YA 1N2VA 1DIDA 4UUIA 3KBJA 1HT6A 3NYDA 2DZVA 2B7NA 5BOFA 2YA0A 3F4WA 1E9IA 2VEMA 4D6EA 2YB4A 1XGEA 1KRMA 4M1BA 1BF6A 1BSIA 3QJAA 1BXBA 3IJQA 3CZLA 4Y9AA 2BNJA 4QQUA 3M16A 2PTDA 4LRTA 1SVDA 4FA3A 2RDUA 4RV3A 5TQLA 3WJWA 3P82A 3GZAA 1O7AA 2IXUA 1TJRA 1DE5A 4KMQA 2HTMA 1YE4A 1LDCA 3HQPA 3T07A 3BQ5A 3UZWA 1SR9A 3N11A 4IL2A 4LW7A 3II1A 2WMIA 1VKFA 1P1MA 3HQOA 3W2NA 4WDUA 5KSWA 1EGMA 4US5D 2TPSA 2OX4A 3PFRA 1Q6OA 4I5RA 4CKQA 3P14A 3L5AA 4XO6A 4WVXA 1R38A 4WOZA 4GGBA 2B7PA 1B3XA 4D8ZA 3VNIA 1TPUA 2VX5A 6XIMA 4O1BA 1M68A 2ZXAA 3MYPA 4CQAA 1KM6A 2FJKA 2W92A 3WH6A 4QJ4B 3V36A 3SM0A 4K3ZA 3F2CA 2YA1A 3BARA 2WO5A 3KEHA 4XWUA 3W22A 3WUGA 2P88A 3I7QA 3MDUA 1K8ZA 5H1WA 4DO4A 2OYKA 1WV2A 1XP3A 4FF7A 4UTHA 1DV7A 5IRPA 1EC8A 1TR9A 4OZOA 2NQJA 1V6XA 1H1YA 2PP1A 2ZZ1A 5ABTA 4F0RA 1V3HA 2ZZ5A 2R1LA 1O66A 3O16A 4F0KA 4R33A 1QNSA 1JPDX 4DBUA 5IM51 3C86A 2X16A 3T9PA 4L6OA 1E72M 1I2PA 2H9AB 1HJXA 3KBMA 4Q8VA 1EC9A 3O6CA 3LG3A 1FOBA 1UQYA 2PCEA 4GX9A 1CXKA 1A0EA 3WF4A 4JKLA 1ZBWA 1DJIA 1KCKA 1XV8A 3E2QA 2ODOA 2XIQA 5I23A 2C0HA 3RAOA 1NFGA 5FL0A 4PCPA 1ONXA 4WD0A 4HN8A 3B0YA 5GQBA 4GFIA 5G1TA 2GGGA 3BLIA 2ZZ4A 1F07A 1HO4A 3CQIA 1MUWA 3V16A 4S23A 4WJXA 3BCJA 2ZKMX 1E70M 3IPWA 3CLWA 1ODZA 3CYJA 3R94A 1XGZA 2J7GA 4HA3A 2PE4A 1K02A 3GG0A 1GVIA 1T8QA 2WNNA 2WB5A 3PBYA 4F9DA 5CPOA 5I03A 1JCXA 4EPEC 2QCFA 3IUDA 2EPLX 3LRMA 4KWWA 4ZODA 4R7WA 1E43A 3W87A 1SZFA 3WKZA 3SCQA 4MG4A 3JRKA 3WNMA 4XKYB 1MW3A 4EE9A 3ARTA 4LY8A 4DJEC 5JBDA 4GYPA 2I5IA 3ITYA 1JGIA 1RJPA 3CIVA 2PSNA 2QUNA 4OT7A 3BLLA 3K4WA 2DJLA 4G1KA 3PZOA 5TAOA 4L9YA 4FSAA 4MJ2A 4DI8A 1Q5MA 1GVOA 5CJNA 1H7WA 5GNYA 5JUVA 3VIGA 1A53A 3P60A 2DSUA 1XLDA 5A8GA 3HV8A 3TROA 2EG6A 3QH2A 3GC4A 3N19B 3EWXA 5LHFA 2QCCA 5DEZA 3OGSA 1EXPA 3CMJA 1DHKA 1OD0A 1P5BA 1UWIA 3QTPA 2CWNA 3VDBA 5FIPA 3UYIA 5HJXA 1LUCA 3OZYA 1E55A 1P6BA 2JKPA 4M82A 3UZ5A 1R3QA 1UD5A 1BWLA 4H41A 4FLOA 3ZWTA 4I9MA 3W7RA 2VOMA 5HUOA 3N17A 4C7GA 4GI9A 1F4HA 1L6WA 2KZHA 1UOKA 2WJDA 2W6RA 1NARA 3ZFHA 4DJFD 2DVUA 5HNNA 4FAMA 5K2ZA 1N82A 4LVGA 4IOTA 4MM1A 2WANA 4NNBA 4EAMA 3EWCA 1SW0A 4GIRA 3MZNA 1MRQA 3UPMA 2GLKA 4ZFCA 2BVWA 4J28A 1XC6A 4RKAA 5E6ZA 3SJNA 1JDDA 2VQTA 1WB0A 3LRKA 3WH7A 3C2YA 2QPSA 2WMHA 4AC1X 2H6RA 2F61A 5EMMA 2QYGA 4K7VA 4JFUA 1S2TA 1V77A 2NT0A 3DYMA 5FF0A 2E6YA 5B80A 4HSHA 3K5XA 4DJDD 3TN4A 3U0HA 4LS0A 4KPLA 2HDJA 3ZYZA 1HF6A 1OVDA 4UFJA 1GG1A 2DZSA 1TIMA 1TPEA 2XN2A 3OHMB 3PJXA 3THUA 1QK0A 3VCRA 1KTNA 3WLSA 3UT0A 4EX4A 3MPGA 2G5WA 4PEEA 2DT1A 2FHBA 4JTUA 1W31A 4NRRA 5BYWA 4J5NA 4REQB 2NXGA 2VNCA 3PUOA 2V69A 1S2UA 1Q7ZA 2DQWA 4LUYA 5EMLA 1HJQA 3TX9A 1TTJA 3DXIA 1M3UA 3C2OA 1J12A 3HTWA 2VEFA 1GW9A 3Q94A 4XD6A 3UBPC 3E12A 3EDFA 3DDMA 4C6IA 4B15A 1BHGA 1YYAA 5M1TA 4ZO8A 3WLPA 5E1QA 1WYIA 1V6YA 4G7EB 5A1AA 4LS2A 3VC5A 5A2AA 4I3GA 3IJIA 3QMSA 2XVGA 1Q7MA 3POCA 3FY1A 3G1RA 1NDWA 1JULA 3TYZA 1Q6GA 4GE8A 4S1FA 3TXZA 1H50A 1VEOA 2BY1A 2HS8A 1IYXA 4J3WA 3WLRA 1FWEC 1FWIC 2EG8A 5AYIA 3CTLA 3TCSA 2ZWZA 3UWEA 4JYEA 3THQA 4ENLA 4PTMA 4XBJA 5IFTA 2CITA 1BYAA 2WBKA 3VKDA 3O2LA 1UYQA 1J18A 2YCLB 3FAWA 1WDRA 3MJMA 1PZ0A 4UZSA 1E3ZA 4LANA 3S5ZA 1OBAA 1J10A 3FOKA 2VR5A 3BURA 3WUFA 1W3JA 4GI8A 3M7WA 4CGTA 3LERA 2V8ZA 4HU8A 2HS6A 4BEUA 2UY3A 5FAJA 2PTXA 1GQKA 1XIGA 4KF1A 3QQ1A 4HK6A 1LBFA 5D2WA 5L9FA 1CT5A