3NGJA

Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MDKATLAKYIDHTLLKADATEEQIRKLCSEAAEYKFASVCVNPTWVPLCAELLKGTGVKVCTVIGFPLGATPSEVKAYETKVAVEQGAEEVDMVINIGMVKAKKYDDVEKDVKAVVDASGKALTKVIIECCYLTNEEKVEVCKRCVAAGAEYVKTSTGFGTHGATPEDVKLMKDTVGDKALVKAAGGIRTFDDAMKMINNGASRIGASAGIAILNGIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Crystal structure of a putative deoxyribose-phosphate aldolase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 79
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ngjA00
1TMHA 3USBA 1KLYA 2NUXA 3B0UX 3DFQA 2WNNA 4A2RA 2DZSA 3GDKA 2WJZA 1CI1A 3M5ZA 1JCJA 1ZALA 2Y62A 4MZ8A 4JN6A 2P10A 2V2DA 1ONRA 2QF7A 3CEUA 3P61A 1VH7A 2B4GA 1H1YA 5G2IA 4WY0A 3C2EA 2E5CA 1IIGA 1XI3A 1H7XA 3NQDA 4JY9A 1KTNA 5D38A 2VFHA 3N9RA 1I4NA 2Y70A 2F7FA 4FNSA 4IPIA 3W1NA 3L2IA 4O1BA 4NJGA 3NNTA 5EBUA 1EP2A 5K9DA 1W3NA 3QF0A 3G3DA 1SU5A 3P82A 1ZFJA 2BTMA 1JQXA 4S1FA 4KFPA 3PSWA 5BRBA 1S3HA 3FJ6A 1TPWA 3GKAA 2RDWA 2DZVA 4JNMA 4UTWA 3SW6A 2WNQA 4S2CA 1P5BA 5AOUA 5KZDA 3UWVA 5AB3A 3B0PA 3NQCA 3KVKA 4NX0A 5AN7A 2DZWA 2Z1BA 4HT3A 5DELA 5GVJA 2XN0A 4WQ6A 1JCNA 3I7SA 4HNVA 4Z0JA 2DZUA 5AYXA 4CLMA 2X16A 3G1VA 4QSHA 3DFPA 4UTKA 3G22A 4BI5A 1ZHAA 4TO8A 6TIMA 5G2HA 3IIXA 5HWNA 3S1XA 1I2PA 2A6NA 3MMTA 4JTHA 3WJXA 4DQWA 2WSRA 4MZ1A 3W1LA 1GG0A 4R33A 2QCNA 1E51A 3ELFA 4X22A 1RQBA 5D05A 5F2MA 1SZEA 1VS1A 1AW1A 1TREA 4O14A 1NEYA 3UWYA 5LNVA 3I68A 3NR0A 1AW2A 4GUHA 4RX0A 1NSJA 1R2TA 1CX9A 3M47A 5KZMA 1DKWA 4IQLA 1A5CA 1WA3A 3G0XA 3PUEA 4ZQNA 3M44A 1N7KA 4K39A 3ATYA 3KVMA 1OF8A 2E6FA 1LORA 3SFKA 1MZHA 5KINA 1WDWA 4OBTA 3PB2A 1W5QA 4JS3A 1W56A 3PBWA 5EPDA 2RDTA 5AYZA 4LV9A 3M5VA 4Z1AA 3HG5A 3TMLA 4DPQA 3TW6A 1KFBA 2GVLA 3E96A 2C15A 2ISVA 3MI3A 3GDRA 3LRMA 3G8RA 3EX6A 2GUUA 5G4EA 5DCDA 4MYXA 1F05A 4YMZA 1WQ5A 4XZ9A 3ZS4A 4AWUA 1A5SA 4O54A 4JX5A 5K4XA 1IGSA 5D30A 1F76A 4NJKA 1QPQA 5KZEA 3V75A 3C2VA 4JX4A 3T40A 4FNPA 3QSRA 4R53A 1S5TA 7TIMA 1Q6LA 5DY2A 3HPZA 3CIXA 3VKJA 5C5YA 1S5VA 1SSDA 3O8AA 4K7YA 1X1OA 4BF9A 3TROA 2ZZ6A 1P0NA 3EKLA 2YFOA 5HWJA 5DBUA 3LXCA 2A5HA 1XCFA 2WQPA 5LNRA 3F1QA 4K37A 1NF7A 3EWZA 5CGQA 3ZWSA 1NF0A 3LCWA 3GNNA 3GXTA 1KM4A 1JR1A 4O57A 3PR2A 1OX4A 4LVBA 5AYYA 3BLIA 4XKYA 1BWLA 3S1UA 3HGJA 1O5XA 4O10A 2A6LA 1FCBA 3HG4A 1AK5A 5AHMA 4UMCA 5EMUA 4HHPA 2NWRA 5T26A 3KX6A 2GJLA 2E6YA 4JYDA 1T0OA 3HJZA 3W71A 3UWWA 3WJZA 1XBVA 4OWGA 3W88A 1QOQA 2ABBA 4UTMA 3QPZA 3VE7A 3RLUA 2JGQA 3MO7A 1OFOA 2H8ZA 5KMYA 1UCWA 4UFIA 4BWLC 1W5OA 1OK6A 2QCDA 5CZ0A 5D2TA 4MFEA 2P0OA 3EKZA 1LOSA 1OFRA 3M1ZA 3QSTA 1T8XA 3LM7A 3W86A 2YCEA 3O63A 3L67A 2V2CA 4WOQA 3GXNA 3ABQA 4N02A 2NLIA 3G8EA 3S5NA 4AWTA 4LVDA 5HUOA 3TCEA 3MP3A 1LTDA 3GAKA 1BKSA 5K7JA 4HSOA 3NG3A 4JTEA 2C0AA 2CLIA 4JY8A 3W75A 2RDUA 1LCOA 1O95A 1V5XA 4AXKA 1U5JA 1IIHA 5DXYA 3QPYA 1RQEA 1I2QA 1NVMA 3W7RA 4EVZA 4MFDA 3W7JA 3DU0A 3O15A 4IUOA 5U7SA 2WSQA 1VPXA 3TK7A 5AC6A 1KV8A 4N6FA 2BSLA 3BK0A 2ZZ7A 1WOBA 1JUKA 2P1FA 3NZ1A 1SW3A 3NDOA 1YTEA 3FYPA 1Q6RA 2J24A 5MHBA 4BFAA 5G5IA 3NYZA 3N3MA 3M6YA 1H7NA 5HJLA 1ICQA 1GVFA 5DY3A 1CW2A 4NNAA 2X1TA 2QCCA 3GAYA 2Q8ZA 1K7EA 3CWNA 5CKSA 2DORA 3EXTA 3LRLA 1G4TA 2B7QA 2VFGA 2EPHA 2GVGA 1JRBA 3TKFA 1QPNA 2VEIA 3TUUA 3QZEA 3O16A 2V2HA 5ABTA 2W6RA 5CPLA 1EUNA 3CQ0A 2ALDA 3EX3A 3W76A 3TXZA 1IF2A 1W5NA 3W1TA 3QQ0A 1OFEA 2G5WA 4MPQA 4LS2A 1BTMA 4K38A 4NQ1A 2ZTJA 4X9SA 4OGZA 4UIOA 5TQLA 4WY0F 1FCUA 2C16A 1JJKA 3ATZA 1TPVA 2WKJA 3MHUA 4CQ8A 4YWIA 2DJLA 5BMXA 1FWNA 3R12A 1YADA 3IEBA 1RPXA 1YYAA 4FEZA 1UASA 1OJXA 4Z0SA 3DENA 5F2IA 1Q45A 2ZZ4A 4U28A 2YYUA 1ME7A 2YR1A 1EB3A 1TQJA 4LU0A 2QCMA 3CU2A 3B0VC 4N9EA 2QJHA 3NQMA 3HIJA 1H5YA 4O53A 2NUYA 2O7QA 3QQ1A 3QEZA 4NXSA 1VCGA 5HQEA 1L6YA 3FEMA 4MIMA 3PBUA 1YDOA 1YTDA 4HPXA 5FESA 1V7YA 1O60A 2FLIA 1FDZA 1EA0A 4XBKA 3PG9A 3TSBA 3GR7A 1IXNA 3G1FA 3S9YA 3C2RA 3W1UA 2XN2A 3G0UA 2QJIA 3BO9A 1H7PA 2BZNA 3MHGA 4UMBA 1KV5A 4QQ3A 1KFKA 1THFD 3DXIA 1XBXA 3NL3A 1RQHA 3P67A 1DV7A 3EEGA 4BI7A 2JBMA 5SWUA 3W7QA 1HUVA 3W7LA 3GYEA 3LCXA 1W31A 3EWXA 4U4MA 3LCGA 4M5PA 1M7PA 4TMCA 2E68A 4JEQA 2YDAA 4UFJA 1OX5A 4IMGA 4LOCA 1SQ7A 1KM2A 4IGHA 1F2JA 3G0SA 2BWGA 3CM4A 3SY5A 2CLOA 4Y96A 1GT8A 1B4EA 4IOTA 3TC6A 1JVNA 1R2RA 3P84A 3R5EA 3STGA 4XTIA 3NL5A 3W1QA 1A5AA 1GVQA 4O11A 4FF7A 1OFBA 4LRTA 3MW7A 3E9AA 4Y90A 5C2XA 3NVTA 3NGJA 2FPVA 2YPIA 4O15A 3QMRA 2E09A 4CQAA 1GEQA 4IXHA 5FF0A 1TPC1 8TIMA 3NQGA 3SIZA 3PULA 2PURA 4O0ZA 3SSJA 1EPXA 1Z42A 4BWLA 2OCZA 1PIIA 1RD5A 5E1QA 1DQWA 4LNYA 1TTPA 3OEXA 1JRCA 3QJAA 1SZNA 1AG1O 1AL7A 5I3KA 5D09A 1VGAA 1D3GA 1VZWA 3MP5A 4K8EA 4KFOA 4UC5A 1VLWA 2B0MA 1F6KA 4XKYB 1U83A 1GYLA 3W7NA 3TH6A 1FCVA 5FF4A 4YLWA 3TJXA 3PC0A 4XUGA 3NM1A 4Z08A 3NPXA 2WO5A 5EYWA 1N55A 5HULA 4DF2A 3PY2A 3P8JA 1G4EA 1DBTA 3LCHA 1K7FA 1TJPA 2YXGA 3PUOA 3AJXA 3AO0A 3EWBX 3BG9A 3BG5A 3IIPA 4KKXA 1FXPA 3B04A 4O17A 2ZA2A 3LLDA 2FTPA 1EP3A 3W70A 3G1HA 3GR8A 1OF6A 1KM0A 2R8WA 4CCEA 4JYEA 4YCOA 1WX0A 4WOZA 3A24A 4O28A 5FEWA 5LSMA 4NU7A 5AHIA 3FLUA 2ZRZA 2Y88A 4RZ5A 4LC6A 3NPUA 4CQ9A 3UWQA 3UQNA 1WAUA 3W2KA 2TSYA 3O6YX 1F7BA 5AHLA 3W2LA 3NQ7A 3NQ8A 5CPNA 1JCXA 4L4LA 1GG1A 5CPMA 4OV9A 2E77A 2V0TA 4JYFA 4LWWA 1MEWA 5AC7A 3QH2A 2HS6A 4HKPA 1DJQA 2Y61A 2ZYFA 1G7UA 3W1AA 3QYQA 2R94A 4E2DA 1LDCA 4NVTA 4MYAA 4GRSA 5D2VA 3N14A 2VFEA 3FKKA 2QCHA 3NPWA 1SO6A 2VKZG 3BGGA 2A2IA 1J5TA 5HR7A 1LOLA 2CLLA 1X8FA 3P60A 4PL1A 4WUIA 1XBZA 1T96A 4OQVA 2UV8G 3TV8A 3OG3A 5K4ZA 1TPFA 4FX6M 2VFFA 1TRIA 3TMQA 2ZZ5A 5AC8A 2ZZ3A 4QJ1A 1XDLA 1TJRA 2G96A 4JTGA 3CHVA 2C13A 3MI6A 4M19A 3W07A 1VYPX 3KRUA 1MEIA 3OVPA 5CZTA 3HPSA 4NUWA 3CWOX 3E12A 5TBOA 1QAPA 4FIRA 2YX0A 1YXDA 1VRDA 3SGZA 4GFSA 4OV4A 1G6CA 4GXMA 3W83A 3PVFA 5AFDA 1C29A 5BMWA 2ZRWA 5AHNA 3LI1A 3W7GA 3STEA 5CG7A 5F1VA 3S5YA 4FNUA 2BLEA 1NFBA 3LB0A 4A29A 3KOFA 5CPOA 3LHYA 2DJXA 4A3UA 4GUIA 1I8JA 2Y89A 5U4NA 2NUWA 3W84A 2A1YA 3PBVA 4O1AA 1OFDA 2H8XA 4GUFA 1ADOA 3PG8A 2A85A 3SR7A 1GOXA 2E1DA 3A21A 1FDJA 4WXZA 3W7PA 2QAFA 2J9YA 3MBFA 4GUJA 3TQ0A 1QO5A 1A50A 1WBHA 3DFOA 3LBCA 4ZQCA 4I7UA 4HNNA 3BLFA 2DU2A 3R2GA 1AW5A 4LVAA 4FB7A 2Z2UA 3QW4B 3UD6A 2KZHA 3W7KA 1VCVA 1W37A 2CZEA 1TV7A 1VHNA 1N8FA 3RK8A 3L9CA 3KVJA 3DFSA 1Q3NA 1R2SA 3NZRA 3C0JA 5C6MA 1TPH1 1WV2A 3CPRA 4M6VA 1UJPA 1H1ZA 4YXGA 2WNZA 3G1SA 3Q37A 3ZR4A 4FX8A 2ZRUA 6ALDA 3BW2A 1LYXA 3VI2A 3W7IA 2QCLA 4UTTA 1H62A 2A7RA 3L5AA 2NWSA 3M5YA 1XBYA 4MY1A 2Q3OA 3RNDA 4HNTA 5D2WA 5F4WA 4AWSA 1QDSA 1K8XA 1VYRA 2NX9A 2W79A 2OZ0A 3WK3A 5KSWA 3NQ2A 2DZXA 5LZLA 1EX5A 1VR6A 1XKYA 3I65A 4JTLA 3LLFA 4RK8A 1JQVA 4MY8A 3QC3A 1ICSA 1KM5A 1ZENA 3PS7A 4MJZA 3DGRA 4AHQA 1XUUA 5LHFA 2ZCGA 2C1HA 2JKAA 2AGKA 1YLVA 1OFQA 3MP4A 2ZFAA 4PH6A 1FWTA 4FO4A 3RLVA 3W7DA 4UFKA 3M16A 3UZJA 4JR5A 2ZA3A 2OT1A 2J88A 4EOUA 2YYTA 2JKPA 3C61A 3MWAA 3QMSA 4ML9A 3UXDA 3Q2DA 2J27A 3QRHA 5DLCA 4Y8FA 4CCCA 4EF8A 1SUXA 4QISA 4ZQMA 5K2ZA 4DXVA 3T7VA 1UUOA 4O18A 3SGUA 1VLIA 4CNOA 2Y7DA 1G4SA 2B7PA 4NNCA 3BVJA 4ORMA 2NXGA 1Z48A 2ATSA 2CLEA 3TIMA 1GVRA 3L5MA 4DPPA 4ONVA 3W1MA 4Q4KA 3IIVA 1TTQA 5LNUA 3TW7A 4W9TA 1I45A 5I3HA 5CZJA 5I3JA 1TTIA 1LM1A 2VENA 1OABA 1SFJA 3TX9A 1PL9A 2VFDA 1QWGA 3C3NA 4HPJA 1SW7A 4WXYA 5DCBA 2NV1A 3C4UA 3UYCA 4JTTA 5D2YA 3TXVA 1O5KA 1PVNA 3EWYA 1ZCOA 2JGYA 3KFTA 1SPQA 1VHCA 2G97A 2H3BA 3LBMA 1A53A 4JTIA 3NAVA 4JIPA 3LHWA 4AAJA 1FWWA 4Q33A 1W8SA 4M7SA 4GE8A 4D2JA 1GVOA 2ATMA 1UBSA 5FI8A 2NX3A 3GIYA 3L0GA 3WK1A 3RMJA 1OYBA 3D0CA 3ABRA 1TIMA 5J5DA 1ME9A 2I9EA 3DI1A 1J2WA 3S1VA 3LTSA 2YZRA 3L65A 3WJYA 4MLJA 5AHEA 1K3UA 1IXPA 2X2GA 4PEKA 3TR2A 2V5BA 2EF9A 1EIXA 1VCFA 4JTFA 3IGXA 3W87A 3VCRA 4GJ1A 2J6XA 3EX2A 4IX0A 2WSYA 5TIMA 2GVJA 3QFEA 3TQKA 1TO3A 1XXXA 1P1XA 1SZFA 1LRNA 4RXGA 4UFMA 1TPEA 2Y7EA 3HBLA 3T44A 4N4QA 3O06A 1DQXA 5FEPA 3NQAA 2PRHA 4A21A 3W73A 4P2VA 4CCDA 3PBYA 1ML1A 3IGUA 2AQWA 4JX6A 4UXDA 5I3GA 3T78A 2GOUA 3THAA 4LC8A 4BR1A 4M6QA 4O4VA 4NJJA 1Y0EA 1P4CA 3W7EA 3GB6A 5F4SA 2ZTKA 5BOOA 1W1ZA 3B05A 4ORIA 3I6RA 1GTHA 4LRSA 2Z6IA 3HMJG 1G7VA 4OU1A 2G95A 4TX9A 3VNDA 4UTWC 2D73A 3G18A 3INPA 2C3ZA 2V81A 4IMFA 4O19A 3LCFA 4TMBA 1LOQA 1JCLA 1PHWA 4PC8A 4LS1A 1LRTA 1OVDA 4IMCA 1TPUA 2V9DA 1K02A 2ZRVA 1AMKA 4QNWA 4MKNA 2ZA1A 3FOKA 5CSSA 1KTBA 2H3DA 2E5DA 3F4WA 1HTIA 1UUMA 3PF3A 2QR6A 4MVAA 4MUZA 3BV4A 4UTHA 1W5MA 1K8ZA 1RVGA 3GKFA 3WK0A 2R91A 1LLWA 2X1SA 2FB2A 1WOAA 3JS3A 1ALDA 2GQAA 3LXAA 1I2NA 3LOTA 4I9AA 3UPBA 3UY8A 3YPIA 3RF9A 4FXRA 2FJKA 2E5BA 4NJIA 4QAIA 3MUXA 3W1RA 4RKAA 2VOMA 3N2XA 2Z6JA 1LRQA 1C8VA 1KFJA 4RLIA 3G1YA 4NJHA 4JTUA 5KITA 2TRSA 4IMDA 1TYGA 1SR9A 3GVGA 1QPOA 3A5VA 1TSIA 3MJYA 1TQXA 1J4EA 3IGSA 1QO2A 4AVFA 1IXQA 2IQTA 3IV3A 2CLKA 3DHFA 1KLZA 1UB3A 2QDGA 3HGRA 2VEPA 1GVSA 2H90A 3O05A 3DZ1A 4AH7A 1HO4A 1LBFA 5FF2A 3DH7A 5DN1A 2AAMA 3LCLA 5C54A 3W85A 4G1KA 3W6YA 5IM51 1H61A 3EX4A 1GQNA 2Q8LA 3P74A 3W9ZA 1Q6OA 3UPWA 1ZJIA 2J9XA 2TMDA 2CWNA 4XQ6A 2X1UA 1GJPA 3DFTA 1OG0A 2DP3A 4UTUA 5EKYA 3M9YA 3LV6A 2QDHA 5LNWA 3S6DA 4DELA 3R89A 3SJ3A 4UFLA 4MJMA 1YDNA 4HNUA 3NL2A 3EB2A 1X1ZA 2PE4A 3STFA 3KAOA 3KHJA 2XFWA 3UY7A 2X30A 4O12A 1GYNA 4ZL1A 3E0IA 2RKXA 3FKRA 1ME8A 4X2RA 1MXSA 3C52A 4ICNA 4AF0B 3BLEA 2ZBTA 2A7NA 1OYAA 3ABOA 2VFIA 3A9IA 4IWWA 4YCPA 3ZWTA 4IX2A 1JUBA 3FFSA 1KM3A 3GDLA 1EWDA 2FIQA 4M6PA 1G4PA 4PFMA 5D02A 5IBXC 1QOPA 3LCIA 1HFBA 3UZ5A 1BEUA 3R13A 3QW3A 5CSRA 3P5YA 2OMAA 3QM3A 4N2YA 4N6EA 4C1KA 3HG2A 1XC4A 4O13A 3G1XA 4X3ZA 4ZVJA 1F6PA 4E2BA 1F5ZA 3FYOA 3IVUA 1H7OA 3BW3A 4N9DA 4LV4A 3DI0A 3W2JA 1R30A 2GJNA 4Z1DA 1TTJA 4PA8A 5G4WA 2Y6ZA 3LHUA 5L9FA 1Z41A 1AL8A 3S1WA 3Q94A 3KRSA 1B9BA 3A22A 3HB9A 3P80A 4IPJA 1SFLA 4M7TA 4UTIA 1QNVA 3CLMA 1LBLA 1L6SA 3IVSA 5DBTA 4A22A 2CFFA 3SI9A 5L6UA 4DBDA 3OVQA 2OX1A 3ABSA 5G1YA 3WK2A 4JDBA 4UR8A 2E6AA 5A5WA 4EF9A 1ZNNA 1F74A 3EX1A 3UNDA 3NXFA 4JIQA 1H50A 2NX1A 2CZ5A 4B5NA 4XBSA 3S42A 1H63A 1WXJA 4IMEA 3W3OA 4P61A 3P8IA 3M41A 2V5LA 3N2MA 3MYOA 3STCA 4OE7A 1KFCA 3PB0A 2HSAA 1YDVA 3O07A 2ZZ2A 1DL3A 3ZFHA 2FB3A 3TAKA 4RXFA 5D04C 3LI0A 2GPTA 1OFAA 1QCWA 2NV2A 4NNBA 1G67A 1ZY9A 3LV5A 4LVGA 1BWKA 3H54A 2HTMA 5K9XA 4Q32A 3CC1A 2A7PA 1DHPA 4ZQOA 5I3IA 5LKYA 3ANYA 4RJEA 1LP6A 3W1XA 4RV8A 3UWZA 4QITA 2BXVA 3EXRA 3QMTA 2YGYA 1GWJA 3C2FA 1W0MA 3DKJA 4UNLA 5F2GA 1X6UA 3LXBA 1R46A 1SW0A 4GBUA 2CZDA 3HGSA 5AHFA 2FQIA 4AMAA 1ICPA 5K3VA 4R7JA 3L5LA 2ZDRA 2QUUA 1R47A 5H91A 4UR7A 1TPDA 3N34A 4J9JA 4AHPA 4PODA 2Q3RA 5E93A 2X1RA 4Y9AA 3G1DA 4ZQPA 2WV8A 4H3DA 2WPBA 4GUGA 5H2ZA 1EP1A 4PCFA 2A4AA 4BI6A 3NQFA 1T99A 3CEPA 4E38A 2CW6A 1FCQA 4A2SA 4MLRA 5HR6A 3W23A 2EGZA 5E0KA 3TC7A 2V82A 3LHVA 4FNRA 1RZMA 3U2OA 1LBMA 2E6DA 1DORA 3GDMA 4FXSA 4CNNA 5D03A 4CNPA 3W2MA 3CIWA 2ABAA 3TSDA 4UMAA 1W54A 3MHFA 3C2OA 3PAJA 5F4XA 1FQ0A 2QCGA 3CT7A 3P62A 4LVFA 5EL1A 1PCKA 1H60A 1MEHA 2B7NA 2PC4A 4UCGA 1Z44A 2I14A 4AHOA 3IRDA 4N9BA 5J5RA 3HF3A 1A5BA 3T4CA 4NZJA 1KM1A 1FWRA 2QJGA 1G69A 2W0UA 3IIZA 5HWMA 1OK4A 1W3TA 4UTLA 5CZSA 4DEFA 1QMLA 1KBJA 3NL6A 4ADTA 3I7QA 4UNKA 3FS2A 1SO3A 3A23A 2ZRYA 5I3FA 2FDSA 1M6JA 3E49A 3PM6A 1DJNA 2FPTA 3EWWA 1F73A 1WBJA 5FEZA 4WZHA 4TIMA 1LZOA 1C9DA 1QPRA 4QIUA 2GQ8A 1TV8A 2YW4A 4LW7A 2CLHA 5BW6A 5DXXA 1FUYA 4O8RA 4GC4A 5D37A 1JUEA 3LERA 4HSNA 3TE9A 2YW3A 1NAL1 4QM1A 3U8GA 4KWWA 4O16A 4S2BA 3BGJA 5IBXA 3M43A 4JTJA 4RCXA 3NOEA 1ZAHA 3HO8A 1K8YA 3P7YA 4HIBA 3LGEA 4Y6GA 2OJPA 3W74A 1KM6A 4LY8A 3LTYA 1EUAA 2RHGA 1OYCA 3M0ZA 4L4MA 1L6WA 3A5FA 4JTSA 4ADUA 2ZRXA 2H6RA 1O4UA 2DZPA 4I7WA 1W3IA 1YPFA 3OVRA 5FEXA 3KVLA 2O7SA 3L0NA 5DCEA 3N9SA 5D33A 4DO4A 1QR7A 4AF0A 4LTSA 5F2LA 5LGXA 3FIGA 3LTPA 1KW1A 3BARA 2QAPA 4GNJA 3FA5A 1JCMP 1WYIA 2GQ9A 4K7VA 3MI2A 2VELA 3TFCA 2NZLA 4ZZ9A 2RH9A 2ZQ0A 3NQEA 4O0KA 4WD0A 3WJWA 2PRLA 2Y7GA 4C1LA 1ZAIA 4JDYA 1SO4A 2HS8A 3I7RA 4XWUA 2FFCA 3NQVA 4O52A 4EWND 3HPXA 1XUZA 1TCDA 1B3OA 1MO0A 2PRMA 1ZAJA 1TPB1 1FWSA 4JD4A 4MY9A 2C6QA 3IIOA 1VQTA 4MZYA 3VFLA 4QNEA 4Z1BA 2Y85A 1I2OA 3G24A 5EY5A 3H53A 4N4PA 1VC4A 3DHDA 1FBAA 3TFXA 5BNKA 2Z0IA 3NO5A 4WY0B 4EIVA 2C14A 2VC6A 1YTKA 2LLEA 3S0CA 4LT9A 1MSSA 3DAQA 3GZ3A 2TYSA 4FX7A 3EXSA 1PS9A 4IXXA 3EWUA 3F4NA 1W5PA 4NXKA 1SZGA 1EWEA 3PSVA 1PHQA 3L21A 3NPVA 3W2NA 4DBEA 1SO5A 2QUTA 3TQVA 1HG3A 3MYPA 1TV5A 4FNQA 4WX2A 2QCEA 4TU1A 3W7CA 1O94A 3L68A 3S8HA 4KFNA 4NT0A 3HQ1A 1XM3A 3C6CA 2XN1A 4YL2A 3JR2A 4JXCA 2ISWA 5EA9A 3T55A 1H7RA 3R8RA 4N9CA 5D32A 2I1OA 1GZGA 5C55A 2EHHA 5LGZA 4Z1CA 5FF7A 4DF0A 2CLMA 3RU6A 5G1TA 2QCFA 2JK2A 1YPIA 2Y63A 4ZMGA 1P0KA 3TNOA 4RZ4A 4E0CA 3E02A 3P5ZA 1FDYA 1H7WA 1DOSA 5LNSA 4LUJA 3Q58A 3PUDA 3S5ZA 4NZFA 3W1PA 4MOZA 3B06A 2QUVA 3IVTA 3KRZA 4O50A 1XL9A 1M5WA 1HL2A 4FNTA 1B4KA 3WJSA 1FXQA 4UTJA 3LDVA 2FPYA 1GTEA 1OX6A 5K9CA 4ZQRA 4AB4A 4ADSA 4FHAA 4UUIA 3O6CA 1DVJA 4RZ6A 2J9ZA 4OHQA 3TJLA 4I7VA 4GWEA 3TSMA 3CTLA 1VJIA 2R14A 1JULA 1I2RA 3FJLA 3HOJA 4DO5A 3LHZA 5HNRA 4JTKA 2DZTA 1OFPA 3NQ6A 1L9WA 4K36A 1IXOA 3G3MA 3O1NA 4POCA 3NEVA 3CB8A 1FX6A 4H6KA 3V1PA 3M5XA 1TRDA 2F84A 1S5WA 3GLCA 2CLFA 2TPSA 3W72A 3L0KA 5F1UA 3H55A 3HGOA 3N73A 3JRKA 4IJBA 3S5OA 3TAOA 2VXNA 4ALDA 3BG3A 2V30A 1KTCA 1D3HA 1X7FA 1PV8A 1K03A 3RFAA 3B03A 3GX9A 3C8FA 2A21A 3N19B 4K6AA 4UFHA 4WJEA 3L66A 3NM3A 1L2UA 2JKEA 5G2WA 2RFGA 2ZZ1A 5FF3A 2NXHA 4RR4A 3W7MA 3P81A 1XDMA 3W2UA 1M7OA 2BX7A 3GNDA 1QFEA 1Q6QA 3W7HA 4XTDA 2NXIA 4BK9A 4LUIA 3THQA 3GK0A 1YXYA 4AEOA 1KFEA 3C56A 3NA8A 3DKLA 3G1AA 3KXQA 3PWAA 4PL2A 2PCQA 1D9EA 5HUPA 4O1DA 1H51A 4PTNA 4JICA 1VYSX 2B7OA 3B8DA 5A8GA 1TB3A 3W22A 2C19A 2CZFA 3LRKA 1PE1A 3GXPA 4KWVA 2VEMA 1PCWA 1OX4B 1LLZA 2EAWA 1K7XA 3VE9A 1RV8A 5LHEA 1HO1A 4UTTC 4JGDA 2A0NA 3MBDA 2EKCA 2ISSA 2C18A 3OA3A 3OBKA 1B57A 4NX5A 1XFBA 4K8HA 3LX9A 4TR9A 4O4WA 5KTLA 2V8ZA 4R34A 3UXAA 2CU0A 1GPWA 3F03K 3WFAA 2QEZA 3UWUA 1KA9F 1KFLA 1RR2A 1FY6A 3TA6A 3SECA 2HMCA 4FIQA 1KBIA 1LROA 4LS0A 3OIXA 3GDTA 3DFNA 4DF1A 3O6DA 3TDFA 5HMSA 3BW4A 2WOQA 2QCDB 1OHLA 2OT0A 2YFNA 4O1CA 3K30A 3TU9A 5HINA 3HG3A 1JCYA 1SSGA 2YSWA 4DO6A 1EEPA 3B4UA 4OT7A 2VEKA 3M7WA 2Y7FA 4H4IA 3OHIA 5D2XA 1YXCA 3BPWA 3LHTA 3U6WA 3SZ8A 4HN4A 3DBPA 3W7OA 2QKFA
chains in the Genus database with same CATH superfamily
4QJ3B 5BCAA 3EA3A 4A2RA 4B2DD 1JCJA 1ZALA 4MZ8A 1GJUA 1UC5A 3GQYA 3QY6A 2V2DA 3P61A 1B0IA 1H1YA 1U1JA 5G2IA 3NXLA 4WY0A 2VM8A 1EHNA 2BV9A 1XI3A 4ZSUA 4WIWA 3V18A 1XLLA 3N9RA 4KEVA 4HTYA 2F7FA 4HZ7A 2Y8VA 4UOQA 4B5TA 1V3IA 4UQEA 1OIMA 4IPIA 3OA5A 3CH0A 1V6YA 5DMLA 2E3ZA 3NNTA 1EP2A 4CQBA 1JQXA 2VRJA 1CTNA 2PGWA 2RDWA 2WNQA 3UZYA 3AZSA 2G3FA 3ARQA 4IP4A 3P0WA 1ZJBA 4YTUA 4NX0A 5AN7A 5GVJA 4H6RA 4PSPA 1JCNA 4HNVA 5KETA 3BAWA 1XSKA 1F4AA 3O7UA 4IF2A 3H2CA 1AD1A 1QW7A 2L5HA 2EQDA 4PUMA 3WBEA 4BI5A 3RRXA 3EMZA 4TO8A 3RILA 3P14A 5HWNA 3MMTA 3WJXA 4Y9NA 3Q45A 4R33A 1ZTVA 2VRKA 4X22A 1Y5VA 4PRTA 1Z8AA 1AZ1A 3I68A 1M04A 4IPLA 3NR0A 1B3VA 3LGDA 5AECA 1IZKA 3D6NA 5D8ZA 4PMOA 1A5CA 3G0XA 2V63A 4GQBA 1MXGA 3M44A 1Q66A 3T07A 4K39A 1JEZA 3II1A 3ANVA 2XU2A 4C6BA 5KINA 1UG6A 1M65A 3PB2A 4ZB2A 1W56A 4GINA 5CJMA 4EK7A 2E9MA 1JAKA 4LV9A 2HQAA 5AYZA 3I3EA 4JQ3A 4KCUA 4Z1AA 6REQA 3HG5A 4EX4A 2WWDA 4DPQA 5E0CA 1CYGA 3UGVA 3HPFA 2Y1HA 3S2NA 2EEXA 1Y5XA 1XH0A 3G8RA 3EX6A 5G4EA 4YMZA 3W6LA 1WQ5A 3VZZA 4DYJA 2VWTA 2PDJA 2CHRA 2WVUA 1BYBA 4ZTXA 3PUGA 4ZBCA 4B4FA 4GH1A 4Z1YA 3OLIA 1YMYA 3C2VA 4AD5A 3T40A 4RNHA 5T91A 2PS2A 4GNKB 1AZ2A 2YXXA 1VFHA 3QSRA 3QGAC 3OHMB 3DEQA 2XFFA 1EJUC 4FF5A 7TIMA 1Q6LA 3SRHA 3VX0A 4WHBA 3CIXA 2YDSA 1GZJA 3VKJA 1SSDA 3AIRA 4K7YA 1CXKA 1XLHA 3E2QA 3QV8A 4MSSA 1DEDA 4NZ3A 4W85A 3LXCA 2OWCA 3MSYA 5LNRA 1NF7A 5CGQA 1NF0A 3MANA 3VIGA 2WMJA 4O57A 4R85A 3ZJ8A 1KRBC 4IICA 3GVQA 4LVBA 4Q7IA 5AYYA 3ISIX 3IJQA 3HGJA 4O10A 3TYCA 3HG4A 4RE2A 4GZJA 2Y8KA 2E6YA 4KMQA 1KGXA 1B31A 1RLCL 1T0OA 2XHYA 2AMXA 4UOJA 3GC5A 3FJNA 3WLKX 1GOWA 3BC9A 3UWWA 1QOQA 5TNVA 3WENA 4Q4MA 2H8ZA 2YDRA 2DV0A 4UFIA 4NZ1A 4Q8QA 2FTWA 5CZ0A 1PIGA 5D2TA 4MFEA 3WQFA 4XVDA 1PPIA 2YB4A 3GTXA 2PUZA 5B7ZA 1OFRA 3UA3A 3LM7A 2ISFA 4PRRA 3GXNA 3ABQA 1UR4A 3G8EA 3H4WA 3S5NA 5HUOA 4TVUA 1LTDA 3GAKA 3VNMA 4HSOA 1LCOA 4AXKA 4I9MA 1PBGA 2YL8A 2ALRA 2C79A 4EVZA 4DUVA 3UR8A 4K68A 2WSQA 5H8UA 4LBUA 4US5A 3FN9A 5XIAA 1U1HA 3S1GA 3HQOA 3NZ1A 5JBEA 1Q6RA 5BXPA 5MHBA 4MB4A 5G5IA 3N3MA 5JUVA 1H7NA 4PMJA 4G9PA 4NNAA 1TJ1A 5JBFA 3PTQA 2Q8ZA 3CWNA 1KXHA 4JFWA 4B4HA 2WZTA 1W2PA 1G4TA 3VCNA 1TFVA 1KBLA 4QDWA 2ZOXA 3TUUA 2V2HA 2W6RA 8RUCA 3W76A 1A4MA 1B2YA 3QQ0A 4NQ1A 5BU6A 2WK2A 4OGZA 4UIOA 1JZ6A 1O12A 3ATZA 3G6MA 3VUPA 4CQ8A 1CLKA 2DJLA 6XIMA 5BMXA 1KR0A 2WZIA 3ITYA 4FEZA 3L4UA 1UASA 3ZYZA 5I79A 3CUHA 2Z1VA 2YYUA 1NOWA 3E38A 3B0VC 4N9EA 3GHTA 1KD0A 5I24A 4AZBA 2YBTA 3HIJA 4IIGA 1H5YA 4Z2IA 2PTDA 4O53A 1C3FA 3QQ1A 2OG9A 3K2GA 4KGJA 1L6YA 3FEMA 4PULA 3QOMA 3PBUA 1YDOA 5C7VA 3A3XA 4BJHA 1D7FA 1O60A 1DIDA 4FS9A 3PG9A 3H8AA 4MGGA 3G1FA 2OKOA 3R1ZA 4C6PA 2ZE0A 2A3LA 1XRTA 2V6AA 4I3GA 4WSJA 1THFD 3N9KA 3EDFA 1DV7A 1HUVA 5CBBA 3UJFA 3PFRA 3W7LA 1DJIA 3LCXA 1PWLA 3QHNA 4TMCA 5I09A 5CPSA 4UFJA 2XSBA 3MSDA 2YA1A 1Z6KA 1BYDA 2IPJA 4JHZA 1RK6A 3AHYA 1ZZMA 1B4EA 4IOTA 4YTRA 2HVMA 4CNSA 1MUCA 3V4BA 4FF7A 3M0IA 4FR6A 2YPIA 1WUEA 3QMRA 4IIBA 1B54A 3KOXA 4GYFA 2EJAA 2D1ZA 1TPC1 3NQGA 1TE6A 3UXKA 4H04A 1BSLA 4UBPC 4C7GA 2WCSA 2WVTA 4BWLA 1DQWA 1FHDA 4GABA 1TTPA 3RPDA 4CU6A 1VFLA 2I56A 3N2OA 5A94A 4DJFC 1PJ9A 4XKYB 1GYLA 2OLAA 3WQ6A 3WY1A 1FCVA 5FF4A 3BE7A 3HV9A 2WO5A 4GQ0A 4LYKA 4URIA 3F2CA 3P8JA 1G4EA 1K7FA 1TJPA 2YXGA 3VIMA 1FXPA 1HJWA 1S5NA 2OWWA 3LLDA 2FTPA 4ZOAA 3W70A 1E6QM 3V16A 1EOMA 2VX5A 1KM0A 3MC5A 4CCEA 2IMRA 5AC4A 2D69A 2J7HA 1J6OA 1HGWA 3DHUA 3SEPA 3P6LA 3GFZA 4L80A 3KBNA 3W26A 3GTHA 2AAAA 2KAUC 3O6YX 3UJEA 3LLXA 1F7BA 3W2LA 5CPNA 3GBDA 3CAVA 5CPMA 4OV9A 1XG4A 2FZBA 5AC7A 2UBPC 5T8GA 3QH2A 2HS6A 3WF2A 1WCGA 5GJMA 2ZYFA 2R94A 4NVTA 4H01A 3VGBA 4HZ8A 3FKKA 2QCHA 1OQFA 1GUVA 3NPWA 3VOFA 1IEWA 2A2IA 1ENUA 2CLLA 3ABXA 1Q63A 1X8FA 1DE6A 1NY1A 3TTQA 4WUIA 1AQMA 3MQTA 4U31A 1W6TA 2QDEA 4FX6M 2EG7A 2VFFA 1P1MA 5AC8A 2ZZ3A 4QJ1A 1TR1A 3P3BA 1TJRA 4JTGA 3RIKA 1LQAA 3CHVA 2C13A 3MI6A 5CG0A 2DIEA 4WLCA 3W07A 1H41A 3KRUA 1MEIA 3HPSA 4PMNA 3W00A 5TBOA 1QAPA 4EPEC 3OZMA 3SGZA 2WSKA 4OV4A 1G6CA 5BMWA 1IT7A 3LI1A 1BRLB 3W7GA 1JYNA 3G6LA 5DT7A 1NFBA 1K4GA 4A29A 4NHVA 5IRPA 2D0FA 3LHYA 4LJ3A 3RPMA 4A3UA 3WF0A 1I8JA 4ZXOA 4CU8A 1EGVA 3XISA 3CXOA 2H8XA 1ADOA 3PG8A 2F2HA 2VDIA 1YNPA 1P6WA 2QAFA 2J9YA 3AI0A 3DFOA 4ZQCA 1S2WA 2VT0A 2DU2A 4GYJA 5DQPA 2Q8XA 1AW5A 1XYBA 2KZHA 3W7KA 1VCVA 1DTNA 3DUGA 1UR0A 1UWQA 2FZNA 4XZIA 4AG0A 3A3WA 1PUDA 3RCYA 2XIIA 3QV9A 4HYVA 1EO7A 1R2SA 4IQDA 3FSTA 1XLCA 4LCRA 3AIWA 4UNIA 1TPH1 4M6VA 1UJPA 4D6JA 3MKCA 5CAKA 5FJJA 2PSNA 3VOGA 2XUCA 3BMXA 3Q37A 3ZR4A 3K1DA 1M03A 4P7QA 4UTTA 2FDMA 1H62A 4CD6A 3WBXA 3UERA 4WKAA 3AFBA 3RR4A 4GYPC 4GZ7A 1DE5A 5D2WA 5F4WA 1QDSA 1W32A 1VFFA 3SCTA 3MWCA 2NX9A 2W79A 2Z1XA 4I6KA 4BY3A 1JXKA 3DERA 4E4UA 4S3KA 3VNJA 2EJ1A 4AZGA 2WSPA 3UW6A 1U5HA 1JQVA 4U3AA 3FVDA 3QC3A 1ZENA 3PS7A 4MAZA 3B9DA 4U2ZA 2ZCGA 2C1HA 2JKAA 3KDNA 3MP4A 4PH6A 4OKDA 1E5JA 1RA0A 4FO4A 2ZWZA 3MT1A 3RLVA 3W7DA 4UFKA 2J66A 3GXIA 3SQMA 3CWHA 3APGA 2YYTA 3GU1A 3C61A 3F4VA 1HKJA 1NP0A 3Q2DA 2J27A 3OBEA 1TVNA 3C2YA 1CGWA 3KZPA 4EF8A 1O66A 3K13A 4JTAA 4R9XA 3T7VA 4AZ6A 3HTWA 1VLIA 2Y7DA 1A0DA 1IGWA 1G4SA 4W8BA 4M81A 1GHRA 1PKLA 1UROA 1Z48A 2V69A 4DPPA 4ONVA 4Z2GA 3IIVA 5LNUA 1XIHA 3TW7A 4W9TA 5IHRA 3I6TA 5HQLA 3MY9A 4KESA 1TV4A 2VFDA 1XYZA 3VIPA 4P7RA 4HPJA 4XUYA 5DCBA 2V67A 3ITGA 5CLWA 4PGLA 1AJ2A 3TXVA 1PVNA 4L9XA 1SPQA 1VHCA 3ARRA 2X42A 4EAMA 4GBDA 1F07A 2PD9A 3AROA 3PJXA 4UB9A 1W8SA 4GE8A 3ME3A 2ATMA 1Q2RA 4AD1A 2GDUA 3GIYA 4EP8C 7REQB 2R1LA 2DT3A 3DI1A 3LTSA 4AC1X 1UHVA 5HQMA 4YIWA 4JL1A 1K3UA 1J8VA 4PEKA 6CGTA 2EF9A 2OO0A 3IGXA 3BDKA 4J3WA 3ZR5A 3WUBA 3WNPA 1XV8A 1EC7A 1AJ0A 3PJUA 1SZFA 1BRLA 2KX9A 1TPEA 5H8MA 3BH4A 3VMPA 3T44A 4N4QA 3O06A 5FEPA 1T5AA 4F79A 4HZ6A 4FLQA 2PRHA 3PBYA 3IGUA 2AQWA 3T78A 4O4VA 1TV3A 4NJJA 5EMLA 5BXRA 3GB6A 1AJZA 4BKNA 3UG3A 2ZTKA 3OG2A 3E0VA 1VEMA 4IFRA 2AMGA 3B05A 4ORIA 1TJ2A 1WE5A 3I6RA 2PI6A 5A2AA 2Z6IA 1G7VA 4OU1A 3OLEA 4ILSA 2G95A 3MMDA 1CENA 4PMDA 4R3UA 3INPA 1S38A 1ESWA 1HW6A 4LB3A 1LOQA 1V0KA 1JCLA 4Q8UA 3ALGA 3EB3A 2REQA 1LRTA 2ZXDA 5E9AA 1NWSA 1TPUA 2V9DA 1K02A 1R3VA 4KCTA 2ZRVA 3FDGA 1E5NA 1AMKA 4P5UA 4J2MA 4HMDA 1RBOB 1UQZA 1XLKA 2H3DA 1EJVC 1U30A 1ECEA 3UG5A 4JTQA 1UUMA 4UTHA 2Z1KA 3C8NA 1RVGA 4MAVA 3I10A 2NQ5A 2FB2A 4HB7A 3CAWA 3FAXA 3AHXA 3VZXA 1ALDA 2CCRA 3L4TA 1EQCA 4KCWA 2CLPA 2ZX7A 4I9AA 4FXRA 3WD3A 1W2VA 2FJKA 2Z4GA 2ZC8A 5A2CA 2Z6JA 1LRQA 1KFJA 4RLIA 3GNOA 2FGLA 3G1YA 4J3UA 2BASA 1S1PA 3R10A 3AIVA 4NJHA 2Z27A 3AISA 1SR9A 4REQB 5LIXX 3BOXA 3WLLA 3AUOA 3VCCA 4YVPA 9CGTA 1EZWA 4S38A 4AVFA 1IXQA 2IQTA 3IV3A 4A3YA 1KLZA 2QDGA 2ZADA 4JCLA 4KRZA 4WRHA 5AVHA 1RLDA 1HO4A 2PAJA 4ACYA 3D3AA 2YDQA 4QLLA 4WJ8A 5C54A 6A3HA 2TAAA 4D72A 4Q8TA 1H61A 2Q8LA 1Q6OA 3FXGA 2AKMA 4NIRA 2X1UA 3ZIZA 3H7RA 5EKYA 3M9YA 3LV6A 3H2MA 3R89A 3SJ3A 4B5VA 4UFLA 1X97A 2PDWA 3STFA 3BAIA 3KHJA 3UY7A 4XZNX 2RKXA 3SRKA 4PR4A 3O0FA 1GOKA 1XIMA 1R87A 1HN1A 3NURA 4PTMA 4YCPA 3ZWTA 1JUBA 3FFSA 1EWDA 2OYKA 5LA2A 1QJWA 4DJEA 5TAOA 5IBXC 4OECA 2XIQA 1HFBA 3UZ5A 1BEUA 3U0HA 2OMAA 3QM3A 3JU2A 3FY1A 1PZ2A 3G1XA 4X3ZA 4ZVJA 4A8RA 1F6PA 4Z2KA 3BOLA 1J5SA 2VMFA 4PUUA 3DI0A 3BJTA 4Z1DA 2Y6ZA 3LHUA 1Z41A 1AL8A 3J7HA 1X8CA 7REQA 3RLHA 3HB9A 3P80A 3A4AA 4J40A 4XD6A 3WNOA 4H9XA 1ZP4A 4M7TA 1RPKA 1ISWA 3CLMA 4PMRA 2PF0A 2PFHA 3SI9A 1FP8A 5G1YA 3ABSA 3WK2A 3LGGA 4JDBA 3LENA 3M64A 1V0NA 3EX1A 3UNDA 2BGNE 4DO7A 5BOFA 3SUTA 4B3LA 3WD0A 4CQCA 5A95A 4PRWA 5FJTA 4P61A 2QGHA 1RCXB 3CYVA 3MYOA 4OE7A 3BWWA 3O07A 1XIJA 2ZZ2A 3KL3A 2UWFA 2VD8A 2GPTA 1XRSA 4NI3A 1E0WA 3FAWA 1BWKA 2BXZA 1A47A 4KERA 2WPGA 4PBGA 4Q32A 4ZQOA 1KCXA 5I3IA 4LXFA 2F38A 3C5QA 3QMTA 1GWJA 1Q13A 3BJFA 1XPYA 3M0KA 4GBUA 3MSGA 2FQIA 4AMAA 3E5BA 1UR8A 1ITCA 3WSUA 1XLIA 4GACA 1R47A 5H91A 4LCSA 1R6WA 4XAZA 4EACA 5C9UA 4U5IA 4Y9AA 3C3UA 2WV8A 4H3DA 3NQFA 1T99A 4Q8NA 1FCQA 3OOQA 1MDLA 2C0HA 5HR6A 2FZDA 4PUWA 3W23A 5EGRA 1EC8A 2V82A 1NFGA 1O1ZA 1TV2A 4FNRA 4GZEA 2XGBA 1FWFC 2WVVB 5DRIA 2OR2A 4FXSA 2GSJA 3VNKA 4CNNA 5D03A 2VZVA 4CNPA 3C2OA 2XH2A 1FQ0A 2NT1A 2QCGA 4NAFB 3CT7A 3EDJA 4LVFA 7XIMA 2CHOA 1I60A 3M46A 4UCGA 1Q4WA 4Q4QA 1E6RA 4Q8WA 3HFYA 3HF3A 1A5BA 3T4CA 1FWRA 2W0UA 4LPCA 4HJFA 1W3TA 5CZSA 5I77A 2ZC1A 2PMQA 1R0MA 2QT3A 5J04A 4J3XA 4UNKA 4REQA 1VF8A 4BQ2A 2ZRYA 2ZUSA 2EPLX 4XB3A 3DYPA 2FDSA 4LBSA 1O7AA 2IPFA 3E49A 3EWWA 1F73A 3CV7A 3L23A 4TIMA 2YW4A 2CLHA 3CHCA 5BW6A 2WMIB 3NIYA 2YCIX 5A8NA 1JUEA 2WKLA 3TE9A 2YW3A 1DWHM 1YX1A 4QM1A 3U8GA 3CUJA 4KWWA 4OVXA 4S2BA 3EMQA 3PTDA 3M43A 4L9ZA 2GJXB 2PA6A 4JQ1A 4JTJA 1XYLA 2D2GA 4A35A 3HO8A 4B90A 3P7YA 1IR2A 1VRXA 4LY8A 4GVIA 3ES7A 1EUAA 4RPPA 1L6WA 2ZRXA 4I7WA 3VKCA 1YPFA 4U10A 3GTIA 2VNCA 3KVLA 1F8IA 3L0NA 4MB1A 5ABFB 3UVIA 5DCEA 4DO4A 3PNUA 5LGXA 4GCXA 4PBEA 3FIGA 4NZ5A 4GNJA 3FA5A 1WYIA 4ICCX 2VELA 1V3KA 3GNXA 1XKJA 5JQ9A 4WD0A 1ZAIA 4OUEA 2HS8A 3QQWA 2WXDM 8CGTA 3D3FA 4N7QA 2SFPA 4O52A 4EWND 3AIQA 3HPXA 1TCDA 2TODA 2VGIA 1TPB1 1FWSA 2JE8A 4BCEA 1KQYA 4TQTA 1R3SA 3VFLA 4DXKA 2GOKA 4NI8A 4F0RA 4Z42C 1EO5A 3N17A 1W1B1 2FZ8A 4A3RA 3PBGA 4IGSA 4HHMA 2D3NA 1FBAA 3V0SA 2O4MA 5A6MA 2Z2AA 3SRFA 2VC6A 3SADA 4IJCA 2BVTA 2PTWA 4R7WA 4K1WA 3DAQA 3E2SA 3ARZA 3UJSA 4O1FA 3RN6A 1PS9A 1EWEA 1QPKA 2VEFA 4DBEA 1QI0A 2QUTA 3TQVA 1HG3A 3CMJA 5LIYX 2QCEA 4QCEA 2VI0A 4TTUA 3FK4A 1XCXA 5A69A 3S8HA 3S2CA 4AX6A 4YL2A 3CZJA 3MSRA 4GQGA 4JXCA 2ISWA 2NVDA 4IM4A 3VPLA 1E15A 2I1OA 2PD5A 3N4EA 1H0GA 2EHHA 5LGZA 1W9VA 3RU6A 1GQIA 5GQBA 2G3JA 4QGCA 3AHZA 3VIFA 1P0BA 1H7WA 1TVLA 4RDWA 3MUZ1 1OM0A 3NSXA 2E67A 3IVTA 2J8GA 1E4LA 1XGEA 1GGOA 1BTCA 4O50A 1IWAA 1WPCA 4F0KA 1B4KA 3OVGA 2CBJA 3LDVA 1A5UA 3TZFA 4ADSA 1XF0A 2PDQA 1X98A 4PTWA 1DVJA 5C70A 4OHQA 3UGRA 3VXGA 1JD7A 1JULA 3FJLA 2ODOA 4JTKA 2WVVA 3RCNA 1J01A 5M03A 2DZTA 1L9WA 4K36A 3VKDA 1IXOA 2QXWA 4GQRA 3O1NA 3PZGA 4POCA 1HKWA 3M07A 1FX6A 1S5WA 4NAFA 4JN7A 2CLFA 3KBWA 1BHGA 2TPSA 3H55A 2CWXA 4D9PA 1ZP3A 4H7ZA 1X7FA 1T6MA 3FCPA 3B03A 5GNYA 3C8FA 1X39A 1UW9A 3N19B 4UFHA 2P5NA 4WJEA 3H26A 3THUA 1LG1A 2ZUNA 1CDGA 1CWYA 3R7MA 2XM1A 3A4XA 1M7OA 3GNDA 1W3HA 4KT2A 3QGVA 1Q6EA 4LUIA 1PX3A 3C56A 1B3WA 2HBVA 3NA8A 2PCQA 1VIWA 5HUPA 1YDYA 4DZAA 1H51A 3KTSA 4JICA 2B7OA 3B8DA 5A8GA 5KZ6A 1UH2A 2HE5A 3LRKA 4GY7A 2ZX5A 2PGFA 3WBWA 3WFLA 2ZX8A 2VEMA 4W5ZA 1LLZA 2EAWA 4E6MA 3FA3A 3T0AA 1PXGA 1XISA 4UTTC 3WNLA 2A0NA 4D8AA 3T2QA 3MBDA 2ISSA 3LQLA 3OA3A 3OBKA 4NX5A 4OIFA 5FAGA 4C6DA 4PMVA 4HBKA 4O4WA 4BEQA 4HK5A 1OSEA 5KTLA 2BY1A 4R34A 2CU0A 5ABFA 4GI6A 2CERA 1XIEA 3CL7A 3SECA 3RPTA 2HMCA 2O4QA 3MA8A 4CGTA 3NFUA 4XBJA 4LS0A 3RGTA 4DF1A 1XQKA 2AL2B 2JQXA 5HMSA 4QBXA 4XZLX 4LYRA 5HINA 2BVYA 4DO6A 1EEPA 3B4UA 1HJUA 3M7WA 4AISA 2Y7FA 5A6BD 3OHIA 3NCOA 1SJDA 2QDDA 3BPWA 4PB3A 4E8CA 2QIWA 1EFZA 4RNIA 1WZLA 3CBWA 4FLOA 4C6FA 1XICA 3R79A 4B3KA 3JVAA 2WBKA 2Y62A 1WUFA 2P10A 4DIAA 3HA1A 1ONRA 2QF7A 3CEUA 2B4GA 3TN5A 1NQKA 1ONEA 3B8TA 1UMYA 1CECA 3FSUA 1EZ2A 1H7XA 4JY9A 1PKYA 2CBIA 5D38A 3FXYA 4TV6A 4HOZA 1ZRQA 3VD3A 5CC3A 2FFIA 2Y70A 4FNSA 1RA5A 4AEEA 2OSXA 4O1BA 4DUOA 5K9DA 2GK1B 3QF0A 1SU5A 3P82A 1XLAA 2BTMA 3URBA 4LY4A 5BRBA 5FL0A 4N0RA 1ISXA 1KRCC 4F0SA 3ZQ9A 3WNNA 1P5BA 3KLKA 1F3WA 3GH7A 2D23A 5F7UA 2D0GA 2W4XA 5KZDA 2BB0A 3KVKA 4ERGA 2DZWA 5DELA 2QW5A 3GC4A 3P0XA 2DZUA 4CLMA 3N1AA 3G1VA 4DWDA 4QSHA 1OC5A 1WO2A 4S3CA 3DFPA 3G22A 3QOKA 5DMNA 1ZHAA 3IIXA 3WN6A 3S1XA 2A6NA 2DT0A 4MZ1A 3U5YA 5DMMA 1RQBA 2V38A 5D05A 1SZEA 1EBGA 1TREA 1NEYA 5DRCA 3UWYA 5LNVA 4J3TA 1AW2A 3CIVA 4XO7A 2ZUWA 1R2TA 3LZ5A 5E0FA 4IQLA 4F0HA 3KRBA 4HP5A 3KVMA 4RUBA 1OF8A 2E6FA 1LORA 5I02A 3TNBA 4JTRA 5JMUA 4JS3A 1QI4A 3IUHA 3BSGA 1PIFA 2BNJA 3WQPA 1OC6A 3N29A 1KFBA 2GVLA 1OCQA 2C15A 4JHMA 3UR5A 3GDRA 2ZICA 2Y5EA 4BQ3A 3CHEA 4E5TA 1Q7ZA 1F05A 1A3XA 1XD1A 3ZS4A 3R0UA 4AWUA 1QI3A 3PZTA 1P0DA 4BHYA 3UXLA 1QW8A 1JFXA 2NW0A 4DRSA 2FGBA 4KH2A 4P8UA 4ZB5A 4QG9A 4NF7A 3K1GA 1SVDA 1JFHA 4HD5A 1S5TA 3WQCA 2PB1A 4GH3A 4H8VA 5DY2A 3HPZA 2VL4A 3GU9A 4W86A 2ZZ6A 3EKLA 3W38A 2YFOA 3T6CA 2BVWA 3GVWA 3CQKA 2HNEA 1UKQA 1B3XA 4HA0A 1I0BA 2RGLA 3EWZA 2V5KA 3GNNA 1LUCB 4IQEA 1JR1A 3RUBL 3PR2A 3U5UA 4XAYA 3GHRA 1QBAA 4QR6A 1FCBA 4GKTA 2ZUTA 1AK5A 4BF7A 3KX6A 3HV8A 3V5FA 3WL0A 3DOPA 4JYDA 2DW7A 2PP1A 4B5WA 1Z89A 3WJZA 1XBVA 4OWGA 4BZYA 3W88A 1EJSC 2QPSA 3MO7A 4H2HA 7TAAA 1UCWA 3D5HA 2AL2A 1SYTA 3KCJA 4HU3A 1W5OA 1XDJA 2P0OA 4Q7BA 1Y8BA 3QSTA 3W86A 2YCEA 3N04A 3L67A 4KWSA 4TOQA 2YCJA 4AWTA 4LVDA 3AXHA 1QHZA 1OADA 3IGHX 1L8NA 3NG3A 3WQOA 2CLIA 4JY8A 2BODX 2GGHA 1U5JA 1EJXC 3KTXA 1JPHA 4M6UA 3PZUA 5CPQA 4MADA 2WJEA 2PWEA 4LQ1A 3NEHA 2UY4A 4XD3A 1N82A 4B91A 2ZZ7A 1JUKA 4U2YA 2E8ZA 1VBHA 1SW3A 2EO7A 1FH7A 3M0VA 3CV1A 4BFAA 3NYZA 1FHLA 1AQFA 4NZ4A 2P0IA 3C86A 1GVFA 5DY3A 4IP5A 2GK1A 3GG1A 2QCCA 1REQB 2QUMA 4CKQA 4R9OA 1H5VA 3WUFA 1I9CB 2GVGA 2OB3A 2FHCA 3M0JA 4GX9A 1QPNA 2VEIA 4AD4A 2I9UA 3QZEA 1F6YA 5ABTA 1QTWA 4AUBA 2ALDA 3EX3A 1E4MM 1IF2A 1IZCA 3ARWA 2J7DA 4DM2A 1EEXA 2G5WA 4U5KA 4C6CA 1FH9A 4LS2A 3LA4A 5I78A 3RO8A 3MU7A 4WY0F 1JJKA 4HCDA 1AH3A 1BVNP 3IEBA 5LXEA 1YYAA 1BD0A 3E3HA 4Z0SA 3DENA 5F2IA 1Q45A 4AYGA 1CXHA 4WJXA 2W66A 4PUEA 1TQJA 2ZX9A 4LU0A 4Y9MA 2QCMA 4S3DA 2QJHA 1C7TA 4DI9A 2POZA 2FH8A 2H9AB 1VCGA 4MIMA 1WZKA 4HPXA 4JTCA 5FACA 1FDZA 2PTXA 2YKKA 1KCZA 2I5QA 1IXNA 2R1KA 1BXNA 1WZAA 3W1UA 2HRWA 2QJIA 1KV5A 4QQ3A 1V3MA 2VGGA 3QBUA 1E0TA 4QE4A 3P67A 4E2VA 3WDRA 1TZ7A 2AL1A 1FFRA 1AODA 2AOSA 3GYEA 3I4KA 4HYRA 1OY0A 4U4MA 4GIYA 3LCGA 4L65A 3T8LA 1FTXA 4IMGA 4GPNA 3CM4A 4QDPA 1E9YB 1G94A 2BY2A 2ZXAA 2HNHA 3P84A 3R5EA 4C6EA 3NL5A 1UA7A 1A5AA 1OFBA 3QFWA 3MW7A 5C2XA 3N25A 3MKVA 3NGJA 4HOWA 1VBUA 4AIUA 9RUBA 2VC9A 2YBUA 1GEQA 2OQHA 4G1NA 4PCNA 3T81A 3SIZA 2V5DA 2PURA 4C91A 1RSCA 2QPUA 3OU8A 4KEUA 4KWUA 4DY1A 1EPXA 1LUCA 1Z42A 4QXIA 1O6IA 3U4FA 1GOMA 4RDVA 1AA1B 4B3ZA 2YOCA 5FJPA 1VZWA 4NZCA 4K8EA 4UC5A 3IS4A 1VLWA 3IARA 1F6KA 2RJGA 2QIIA 1JYWA 3GTFA 1VIZA 3PC0A 3NM1A 4Z08A 4L9YA 2GGJA 1V6UA 5EYWA 2DUZA 3PPFA 4DF2A 3MO4A 3PY2A 3VIIA 3CZKA 4KPLA 1UP0A 3PUOA 3EWBX 1ISZA 3G77A 2O9RA 4NYUA 2ZA2A 4TUFA 3GR8A 1EYWA 4Q22A 1OF6A 1XLGA 2DFAA 4JYEA 4F66A 2HJPA 4O28A 3GXFA 2PU1A 2ZRZA 4QQUA 4RZ5A 3NPUA 3UQNA 2WC7A 5ABGA 2A3AA 3BV7A 3W2KA 2TSYA 3W0KA 1SM9A 3NQ8A 1AMYA 4L4LA 1TZZA 3KOZA 4JYFA 1E0XA 1MEWA 1K8CA 4UQ9A 2CNCA 4S3EA 4QS5A 4HKPA 4XK2A 2Y61A 1HIZA 3QYQA 1HJXA 1R3RA 3W37A 5D2VA 2PTZA 1UZHA 3N2TA 1OD8A 4PTDA 3BGGA 4AZIA 2E28A 5ABHA 1S5MA 1E1CA 1O1HA 3N6JA 5A6KA 3RYSA 4GJIA 3ARYA 1LG2A 4NAEB 4PL1A 1XBZA 1REQA 3BTNA 2W67A 2UV8G 3UP8A 2PDFA 3AHTA 5K4ZA 1XDLA 1UYQA 2XH4A 1R85A 4Q4RA 1Q65A 3PZIA 1UKPA 2XYLA 3E5PA 4AIBA 4M19A 1VYPX 2WLYA 2FHBA 4AW7A 3PZOA 3UCDA 4I9JA 3PAOA 1AFSA 2JF7A 1RXOB 1VRDA 1SMDA 4GFSA 5GNZA 1MMFA 3W83A 3PVFA 5AFDA 3TYDA 1C29A 5CZKA 3CYJA 2ZRWA 5AHNA 5FJIA 3RX3A 4HK6A 3S5YA 1QNQA 5F1VA 2ZUUA 4AQLA 2BLEA 4R5EA 1OT2A 3LB0A 4G56A 3W25A 1N8IA 2PTYA 1JGMA 1C92A 1BKHA 2H9AA 5U4NA 2NUWA 3W84A 2QLYA 3PBVA 2A85A 3SR7A 4V27A 1GOXA 2E1DA 4WXZA 3MBFA 4GUJA 3EDEA 1QO5A 5D4YA 3GH5A 1WBHA 1IT0A 4I7UA 3VABA 3BLFA 2PWVA 5D9PA 2QPXA 3QW4B 4K1GA 2YCLB 3VIHA 4X60A 3UVAA 3R25A 1M7JA 1W37A 1VHNA 5EMKA 5M17A 4M56A 3L7RA 4NG3A 3KVJA 4LANA 3DFSA 2BY3A 2C1IA 4B16A 3NZRA 4FP1A 4J7RA 4AD0A 1WV2A 4YXGA 4WDUA 1OCBA 4M3PA 5FSEC 4GI9A 3PANA 3H2NA 5HDRA 4DJFA 6ALDA 3H2EA 3W7IA 3LPOA 4ZO7A 1MFVA 3LN3A 4ZSTA 2A7RA 1A3HA 3WF3A 3FNDA 5LXXA 2WWCA 3U4AA 1VYRA 4HU8A 4C60A 2Q01A 1JYXA 4C7DA 1UA3A 4MUPA 3NQ2A 2DZXA 5LZLA 2VP8A 4L61A 1EX5A 3BICA 1XKYA 3I65A 2XPKA 5FD0A 4RK8A 1IZJA 1V3HA 4JFUA 4GOAA 1CEOA 5DT5A 5LHFA 2BOFX 4JNYA 1YLVA 4Z2LA 3EOEA 3GXDA 2ZFAA 3AXKA 1XP3A 3AYVA 7ODCA 2CBVA 4H7VA 3AWNA 4MG4A 3GIPA 2J88A 5C9ZA 4EOUA 2VX7A 2GFTA 2JKPA 3MWAA 1V0MA 3QMSA 4JIRA 3QRHA 4Y8FA 2FJUB 4EPBC 3FEQA 3BAXA 2YZ5A 1E72M 4ZQMA 3GUWA 3TC3A 3LPFA 3B4YA 1OZQA 1CLVA 1UUOA 3WLMA 2XDFA 3SGUA 2VX6A 3IUDA 2GL5A 4GVGA 4ORMA 2CLEA 3TIMA 5BYWA 2IPWA 1GVRA 3L5MA 3WQGA 4RE4A 1W3LA 2P3EA 3VKAA 4UZSA 2HVOA 1TTIA 1TWDA 1OABA 4OOZA 1PL9A 3C3NA 1PZ1A 3FGCB 4WDWA 4WXYA 4CQDA 1W9DM 3UR7A 2VYOA 1HJSA 2ZXBA 1E1EA 5D2YA 3TZNA 1I1XA 3WLSA 3IWPA 1E73M 4KW2A 4NAEA 3QPEA 4M51A 4HCHA 1AUSL 4J3VA 4GI4A 1IWPA 1NWRA 1DJHA 4M7SA 1TA3B 2J7CA 4I9TA 2FVMA 4A8LA 3ONCA 3WX7A 3GBEA 3D0CA 2VCAA 1NDVA 3SBFA 2D2HA 4XZBA 1EGZA 1TIMA 3ITCA 4OBSA 4JKLA 1CB7B 3S1VA 2BGQA 4MLJA 4FZIA 4R7OA 3RM8A 4GNVA 4G7EB 1POJA 1VCFA 4XVEA 3W87A 1S2TA 1UPMB 2J6XA 4QE5A 2G8ZA 3EX2A 2WSYA 2GVJA 4DWSD 2DUXA 1P1XA 1ITXA 1ODUA 1N8WA 1YNYA 1ZLPA 2YCKX 2Y7EA 3FA4A 2CXEA 3HBLA 1DQXA 4B92A 3SIMA 3W73A 4P2VA 3FVMA 3OBAA 4JX6A 4AXNA 2GOUA 4LC8A 3TYEA 4BR1A 4LEFA 4M6QA 3ZVHB 1C90A 4H9VA 1Y0EA 1J2BA 4K3ZA 3PNZA 5C9WA 2XGIA 4GA8A 5BOOA 1FWCC 1XH1A 2BBFA 1GKRA 2VQTA 3PN8A 1GTHA 3PFMA 4G2DA 4HYWA 3VIJA 3IJDA 3HMJG 3KP1A 2YCLA 1T40A 3VNZA 4TX9A 2Y8UA 3F7JA 3G18A 1UOKA 2GZXA 3OGRA 4IMFA 3LCFA 3IJ7A 3BL3A 4TMBA 1PHWA 1I6NA 2QUNA 4LS1A 2INFA 1OVDA 5JXQA 2PLKA 2PGRA 3K8LA 2FMNA 4H83A 5FA5A 3VC5A 3VK5A 1HKKA 4KWOA 4QNWA 1CB2A 3UZWA 4X2PA 3TEVA 4C6QA 1JNDA 3W4RA 4MNMA 4EANA 1HTIA 3CO4A 1LL6A 4MVAA 5T9CE 2FYMA 4MUZA 1GEHA 3U3HA 3WK0A 1VPQA 3VD7A 4E3VA 3NOYA 3ZVIA 2E1WA 1POKA 3PBMA 1YHTA 3F5JA 2E5BA 4NJIA 4Q6JA 3K4AA 1V7AA 1PDZA 1GQKA 3QTPA 4ZCWA 4DWSB 3DG6A 3MMWA 3VVGA 4JTUA 2X0SA 5A8QA 1DJZA 1TYGA 3ZSTA 1EJ7L 1QPOA 4JAWA 2WM1A 3A5VA 1RP8A 3RMEA 3IGSA 1QO2A 3QKZA 2CLKA 2UY2A 4DHGA 1TUFA 3WELA 3AAMA 2VEPA 3AS3A 2H90A 4AU0A 4KEZA 1E9IA 3O05A 3DZ1A 1LBFA 5D9OA 1UWAA 4XAPA 5FF2A 3RJXA 3DH7A 1NWTA 2AAMA 5DN1A 3W85A 5IM51 1GQNA 3C0QA 3P74A 3UPWA 4ENLA 2I16A 2CWNA 2MANA 5BWFA 4DLFA 2YL6A 4TTGA 3GE7A 5AZ1A 5CXPA 1SR0A 3S6DA 2J62A 2WVSA 3EB2A 4HNUA 1MW1A 4GG9A 2IUZA 3ZLFA 4O12A 2CPUA 2RAGA 4ZL1A 3E0IA 1QK2A 4X2RA 2HK1A 3SUVA 3ITXA 1MXSA 5HMDA 4EKJA 1OYAA 4E4FA 3ABOA 2VFIA 2I5IA 4IX2A 1KM3A 3KDOA 3W29A 3AOFA 3UU0A 4MJ2A 1QBBA 2XGZA 1S2CA 3P5YA 4ASTA 4N6EA 3B97A 4C1KA 3HG2A 4O13A 4LAUA 2Z7GA 3GG0A 4PEEA 1EHAA 2CITA 1H7OA 1E71M 4HK7A 3VDGA 2GJNA 4DBWA 2WJDA 1TTJA 1V6TA 4PA8A 4P7LA 4AWEA 4LH8A 3AWOA 3KRSA 1Q8AA 1B9BA 3A22A 3ZJ6A 1Q6DA 4X63A 2ZWYA 4D6CA 1LBLA 1L6SA 3U7VA 4ERIA 3R4IA 4YNGA 1EXPA 4DBDA 3S2JA 5LA1A 3EA2A 1TELA 3N3TA 3GHSA 3SCPA 1F74A 1QATA 4PMQA 3NSMA 3NXFA 5HXMA 1H50A 2NX1A 4ZODA 2QVNA 4RZBA 4AZCB 1WXJA 3ID7A 3W3OA 4PUNA 3P8IA 4D6EA 3OYZA 1QNPA 3CHFA 3N6HA 3GWQA 1C91A 1MNSA 2VCCA 4DJDA 5DMYA 3ZFHA 1G01A 5D04C 2OSYA 3LI0A 3V35A 4D6DA 1OFAA 1J0IA 4NNBA 3ZVHA 1JIBA 3LV5A 3H54A 2AGTA 2HTMA 4G5DA 2UY3A 1UZDA 3CC1A 1DHPA 1TWZA 1A5LC 4D8ZA 5I07A 4RJEA 4JIHA 2A3BA 4RV8A 3UWZA 4QG8A 5CC5A 3H23A 3DKJA 5E5CA 3M0HA 1UWUA 4ZTYA 2DIJA 2CZDA 4MDOA 4LBRA 3GSMA 5AHFA 4NKCA 1EDQA 1ICPA 1H4PA 1MW0A 2V3FA 5EFDA 1K4HA 3ENLA 5K3VA 3TQPA 3ZT7A 1BVWA 4DBUA 4UR7A 4J9JA 2YXOA 1RH9A 1QRQA 3WO8A 2NT0A 2JIEA 3QYSA 1TVPA 2WPBA 3LMZA 4PCFA 1E6SM 4BI6A 3R0DA 3V0UA 4IPNB 2NSXA 2PWDA 3VKBA 2CW6A 3S3GA 2O9PA 3OB8A 4MLRA 4PBFA 1BAGA 1Q4NX 1RZMA 1M01A 3R0KA 5XIMA 1LBMA 2E6DA 3GDMA 2XVLA 1D8CA 4GXPA 3CIWA 1V3LA 4F2BA 2ABAA 5HANA 1ADSA 1W54A 3MHFA 2XIOA 2HISA 3N11A 5F4XA 3WF4A 1RHCA 4QJ4B 3WH6A 1PCKA 1MEHA 2PC4A 1PB0A 1Z44A 2Q02A 2ZKMX 3PPGA 2OQLA 4N9BA 1Z32X 1ITQA 1KB3A 1IQ8A 4DEFA 1QMLA 3VIKA 1KBJA 3UPMA 2PP3A 3B9OA 1E6NA 1XW8A 4ADTA 6PTDA 3I7QA 5XINA 3FS2A 1SO3A 3QR3A 1M6JA 1R86A 3PM6A 1CCWB 2FPTA 2EG8A 4FI4A 1LZOA 2E7FA 1QPRA 2P88A 2GQ8A 4I5RA 4QSFA 4QE1A 2DW6A 1FUYA 4O8RA 4GC4A 3C0LA 4HSNA 4JNZA 2IXUA 1U5VA 4O16A 1LWIA 3BGJA 3EOUA 3RX4A 3GVRA 5IBXA 3RLGA 4C6IA 3CB3A 2PU0A 3NOEA 1WDDA 5H8PA 1K8YA 2IW0A 4HIBA 2PDPA 4Y6GA 2OJPA 3W74A 2GSEA 2OFJA 1HZYA 3ZXWA 1OYCA 2PBGA 4HU4A 4ADUA 2P3ZA 2H6RA 1O4UA 1W3IA 3OVRA 5FL1A 2J7FA 2O7SA 2MNRA 1K9TA 3N9SA 4FXJA 1JDDA 2W92A 1YBQA 3LTPA 1KW1A 2ONEA 4HPNA 2PC8A 2QAPA 4CN1A 3EZ4A 2OKTA 3MI2A 3OZOA 3QY8A 2NZLA 3CT2A 1FOBA 3ZOAA 3EBVA 2GGIA 4FLSA 1MO0A 1R38A 2C6QA 4MM1A 2Y85A 5EY5A 1E3XA 4W88A 5C71A 4CD7A 3DHDA 1HJQA 3IACA 3TYAA 3TFXA 3M7SA 2GWGA 1JI1A 3WH8A 4P7NA 4A6GA 1TMLA 2C14A 1XCWA 4NYYA 1MSSA 4V2XA 4DNHA 3S6TA 5FOOA 4IGNA 1VJSA 3H12A 1JI2A 1PHQA 5ECUA 3L21A 4NP7A 2P8BA 1R9XA 1SO5A 3MYPA 3CJPA 4FNQA 3XINA 3IANA 1BSIA 4AMCA 1SGJA 4JOMA 1VFSA 3S2LA 4YHGA 4NT0A 4HQVA 3C6CA 2XN1A 4Q8MA 5EA9A 3SO7A 5D32A 1GZGA 1S2AA 1XYAA 5MKGB 4E8GA 1FHVA 2QHAA 4RE3A 1GOOA 3QTGA 1EC9A 1EF3A 4GLEA 2QCFA 4ZMGA 4RZ4A 4DYEA 2ACRA 4E0CA 3E02A 1FDYA 1XIIA 1BXCA 1DOSA 2XG9A 1PKMA 2WZMA 3Q58A 3AMDA 4MOZA 1XLEA 3AMLA 1MYRA 1NOUA 1UD4A 4JBRA 3UF9A 1W91A 2DSZA 1XL9A 3TW9A 1HL2A 4FNTA 4LAOA 1CXLA 4FMVA 2WLZA 2G3MA 1MWOA 1UWSA 3FV9A 2Z1SA 3LEPA 3VOHA 4FHAA 3DX5A 4RZ6A 2J9ZA 3TJLA 4GWEA 2DEPA 3WD4A 2PDIA 1QI5A 4B2DA 1E70M 4WR3A 1I2RA 3WLNA 1RAKA 1NARA 3LNPA 5BOEA 1YE4A 3NZGA 4HMNA 3NQ6A 4NASA 3AZTA 3GG7A 3Q67A 4QS6A 3G3MA 3AIEA 3USZA 1J0JA 1US3A 3CB8A 3NEVA 4H6KA 1A49A 2F84A 3ZT5A 1NU5A 3R8GA 1HNYA 3VDHA 1EYEA 2FZMA 5FJUA 3N73A 4MB5A 3M0YA 3BG3A 1D3HA 5BRQA 3APTA 1FWJC 3GX9A 2J79A 4ZE5A 3GM8A 3SUSA 1K77A 4PUJA 3VAVA 3NM3A 1W3KA 1NJJA 5FF3A 4GC3A 1CXIA 1XDMA 3W2UA 7PTDA 1Q6QA 4AEOA 1YXYA 1KFEA 2JEQA 4AD2A 4BS0A 3G1AA 4HMCA 3N6QA 4KBXA 3F5KA 1DWJM 3BURA 1VFMA 1JZ4A 1C9WA 2IXVA 4MWAD 1EH9A 4O1DA 2FKPA 1UQYA 4PTNA 3ES8A 1PAMA 1PE1A 2QJJA 2OXNA 4KWVA 3S4TA 1PCWA 1OX4B 1K7XA 3VE9A 1RV8A 1DIOA 3OZYA 1L2QA 1XH2A 2C18A 3VYLA 4DAIA 2XWDA 4UTFA 3LX9A 2OEJA 1DJWA 1P7TB 2EPKX 3WFAA 5CC7A 1LQ2A 2QEZA 3JW7A 1ZBWA 3TOPA 1FY6A 4WK9A 3A9BA 1UOZA 3PPCA 2OYLA 1V79A 3UNTA 2YLAA 1ZBKA 2HEJA 3BW4A 1UWIA 2QCDB 4O1CA 2GDQA 3HG3A 1EF2A 4A05A 4TX8A 2PDNA 4GGBA 3QZAA 2PBOA 1OD0A 2J8TA 3LHTA 3SZ8A 4HN4A 1LWJA 1XRVA 3RX2A 3BMVA 3VNIA 2VD9A 2NUXA 1RUSA 3OP2A 3DFQA 3GDKA 1CI1A 1JZ2A 3M5ZA 4LX4A 4JN6A 3WLJA 4LALA 4Q8VA 1VH7A 1MW2A 3TTOA 4IIFA 4J35A 3MUY1 1QWKA 1UIPA 2E5CA 1UZ1A 1S46A 3UXIA 4LF1A 3NQDA 3UYIA 1C8XA 3TONA 1KTNA 2VFHA 4K8GA 2E9BA 4KGLA 3B8VA 4QAWA 2DY3A 3ARTA 3W1NA 3L2IA 3F4DA 4NJGA 1EXBA 4F3HA 5EBUA 4ROQA 1TKKA 3G3DA 1ZFJA 3GUGA 3PP7A 3VOJA 3FJ6A 4ZOBA 5M2FX 2D24A 2DZVA 4UTWA 4S2CA 3KEHA 4U33A 1WXZA 3HZ3A 4PN2A 4M29A 6TAAA 1YIXA 2PODA 5AB3A 3QGKC 3B0PA 5HK4A 5MKGA 1XLBA 3QZ6A 4Z0JA 5AYXA 3GY1A 2X16A 5CEWA 1S39A 4J28A 5C0QA 5G1MA 4XKMA 6TIMA 1EQPA 5G2HA 3TYZA 3EPNA 2INEA 1I2PA 3A64A 4JTHA 4DQWA 4I5XA 2WSRA 3W1LA 5AKQA 1MZRA 4JEJA 5AY7A 5F2MA 2ICSA 4C6JA 1AW1A 4PCTA 2CESA 4R88A 2W9MA 4YJ5A 3BCFA 4OJYA 3S5SA 4GUHA 3CS2A 3KZSA 1F61A 4GX8A 2DT1A 1J96A 2BOEX 1DKWA 1TWSA 4NRRA 3T9PA 1R3WA 4ZQNA 5A8OA 1EDTA 3NO3A 1W5QA 1CBGA 3PBWA 2RDTA 4WF7A 3BXWA 5BU9A 1V03A 3TMLA 2HZGA 1JL8A 5EB8A 4W7UA 3MI3A 3LRMA 2WHKA 1Q6GA 4W93A 2GUUA 4F40A 4LB4A 1RJRA 4XZ9A 5HMFA 4QFUA 1FWGC 5JU6A 4JX5A 3WNKA 3VOIA 1WZMA 3UCQA 1IGSA 2X8RA 4NJKA 4NILA 4JX4A 3GVVA 1OC7A 4PE8A 3KM8A 1BG4A 2WMGA 1R8LA 3O8AA 5IDZA 4BF9A 2PDMA 3AYSA 3CUGA 1WKDA 1P0NA 2E4TA 5CCZA 3VC6A 2NQLA 2WQPA 2R1PA 4K37A 3ZJ7A 1D8WA 3ZWSA 4HNLA 3LCWA 3GXTA 4WGHA 5BROA 1OX4A 3TWBA 3BLIA 4XKYA 1BWLA 3TN3A 3S1UA 2OWXA 3URQA 2A6LA 4GJJA 1R9ZA 3LBOA 4HHPA 3WQ5A 2CZVA 2DIKA 1SFTA 4HTBA 3AXXA 1KRMA 4GKLA 3W71A 4B15A 1P7TA 1PO9A 4FOUA 2ABBA 3VE7A 1V77A 3KBVA 3R94A 1QK0A 4HJWA 1OFOA 3BMWA 2XH0A 5KMYA 2GYIA 5DO8A 1OK6A 1QASA 2QCDA 3JZUA 2Q6ZA 2BDQA 1T41A 1LOSA 3U48A 3PJTA 1E0VA 2V2CA 4H9TA 2NLIA 1FKWA 3TCEA 4BA0A 2INZA 4HVXA 4JTEA 3BANA 2C0AA 1UKTA 1K70A 3OZPA 1V5XA 4HSHA 2RGMA 1JD9A 4G7FA 3MDUA 2VC5A 3LZ3A 1NVMA 3W7RA 4V1YA 1OCJA 3W7JA 3DU0A 5U7SA 1VPXA 3TK7A 2VGFA 5E9XA 5AC6A 1KV8A 4N6FA 5D9MA 4EWJA 2BSLA 3BK0A 2P1FA 4CEUC 4Q8PA 2X05A 1KQZA 4F9DA 3NDOA 3N4FA 1YKWA 3M6YA 3DBNA 4N42A 3M6DA 1CW2A 4GQQA 3ZMRA 5HA7A 3GAYA 5CKSA 2Z7KA 4L1XA 2DORA 3W53A 2VFGA 4KIRA 3T2PA 1LL4A 2EPHA 4AYSA 1O68A 1M68A 3WUEA 3TKFA 2QQ6A 1PX8A 2F6UA 3RCMA 1RD6A 2EXOA 5C2CA 3O16A 1ELSA 3RM4A 5CPLA 3B9EA 3CQ0A 4HN8A 3TCSA 2HXTA 5AC5A 1W5NA 3W1TA 3H7VA 1OFEA 3VDCA 4F2TA 5HNTA 4XZHA 3NYDA 4K38A 4EAYA 2ZTJA 4X9SA 4XX6A 2QJNA 3NVDA 5TQLA 1GQLA 2C16A 2IKHA 3GH4A 2WKJA 2WMFA 4H6EA 1FWNA 3R12A 1YADA 3REQB 4HA3A 3HQPA 1GORA 2JALA 4KIEA 1Q6FA 5D9NA 5H6HA 2ZZ4A 3O9NA 1V0LA 2HBXA 3OW1A 1O5RA 4U28A 1OIFA 3SFWA 1EB3A 1W9UA 2XWEA 3BQ6A 4CN4A 1MQQA 4F48A 3H2AA 4A4AA 5ENLA 2W27A 2XM2A 1J0ZA 1IT8A 1F4HA 2PDKA 3ZLHA 3JZEA 2NUYA 2O7QA 2HV5A 3QEZA 4NXSA 2OEKA 3BLLA 5HQEA 1JF5A 1V6WA 4XZMX 2FLIA 2OELA 4G6CA 3O2LA 3A13A 3GR7A 5IHSA 3C2RA 2YJQA 2F6KA 3V5CA 3BO9A 4NY2A 3MHGA 3VFCA 4M82A 4DJDC 4YTTA 4BI7A 5SWUA 3URAA 1W31A 3EWXA 2J74A 2VZOA 3NWRA 4A3HA 4M5PA 4F8XA 1M7PA 1OEPA 2E68A 2YDAA 3AQUA 1OX5A 1A4LA 4L1GA 4OOUA 1SQ7A 1F2JA 2BWGA 4S3JA 2QVHA 1GONA 2CLOA 5MF5A 1HVQA 2IPGA 1JVNA 3STGA 2Y24A 4US5D 3W1QA 2VR5A 4Y90A 3NVTA 4O15A 4KETA 4RW5A 1NDZA 2VJXA 4CQAA 4PYSA 5FF0A 8TIMA 1A0CA 4X9YA 3TTYA 3ALFA 3PULA 3WEMA 1NOFA 5HJYA 3DG3A 1XIGA 3B0YA 4O0ZA 3SSJA 1CGXA 1L8PA 4DN1A 1PIIA 1RD5A 3B8WA 4LNYA 1Q7QA 1R5YA 3QJAA 1AG1O 1AL7A 5D09A 1VGAA 3L2LA 1D3GA 3MP5A 4KFOA 1L0PA 2VDGA 3AHVA 2XSXA 2D2JA 4HCLA 3R8HA 3ZR6A 3OODA 4YLWA 3TJXA 1K9EA 2J7GA 3QV6A 3QXBA 3KWSA 1H49A 3SCQA 2VUNA 2DGAA 1I75A 1UJQA 1VEPA 4L1WA 3LCHA 3VTRA 3DESA 3AJXA 5E6ZA 4HZMA 4XSLA 4XD4A 1GVEA 3IIPA 4IL0A 1UD3A 4DWSC 1E6PA 1EP3A 4XAGA 3UBPC 3CAKA 2BHZA 3CK5A 3O0KA 2BGSA 2R8WA 4FAMA 4YCOA 1BG9A 3A24A 5LSMA 5AHIA 2Y88A 2Q71A 3S46A 2G41A 5JIPA 3UWQA 1H2JA 1WAUA 1VJZA 2G4JA 3BAKA 3AXIA 1EJWC 4AEFA 2DVTA 3L4YA 2E77A 2V0TA 1KC7A 3LG3A 1UIOA 4JQ4A 1J79A 3EOSA 3W1AA 4FOKA 4Y7EA 2QS8A 1XSIA 4E2DA 4QRNA 2OODA 4MYAA 1XJBA 2WC4A 1MUMA 3N14A 4EPKA 4AVNA 1UD5A 1GVIA 1SO6A 1IR1A 1J5TA 1KRAC 5HR7A 4GO8A 3DG7A 3AYTA 4XSMA 3P60A 2VO5A 1T96A 4OQVA 3GFYA 4Y8EA 4DXXA 1B9ZA 3OG3A 4H9MA 1C93A 1TRIA 5CH9A 4B5XA 1JPMA 4CEXC 1H11A 3VGHA 1ISYA 1DXFA 3SY8A 4M80A 3Q4DA 2D2OA 1EBHA 3NGFA 1YE6A 1V08A 4NUWA 3TYBA 1ZS2A 3CWOX 3E12A 4RW3A 1KCLA 1YXDA 3OGSA 1WDSA 1NH6A 3OO2A 3T05A 3BCJA 3WD1A 2QULA 3REQA 4O1EA 1WKEA 3MUAA 5LIWX 1AQHA 2VTFA 3DYMA 2DSUA 3EGJA 3QY7A 1C8YA 4AY8A 4W4QA 1V6VA 2WJFA 2ZUVA 5CPOA 1EKOA 3N2BA 4C6LA 1D3CA 3WLTA 4GUIA 2J7BA 3VD9A 2Y89A 2CXGA 3TJIA 4O1AA 1OFDA 3RR1A 2O9OA 3A21A 3SUUA 4ZO9A 1W17A 1RJPA 4IFKB 3VIOA 3SGGA 3E2VA 3LBCA 4KEMA 4HNNA 1ECQA 1UP2A 3R2GA 1JG9A 2Z2UA 4W84A 4M1RA 2PDUA 1J0KA 2FGZA 4HHLA 1TV7A 2G0WA 3RK8A 1XD0A 4W5UA 1UUQA 4AVOA 1TJ0A 3L4VA 1FWEC 5C6MA 1CXFA 3SJNA 2C71A 3BJSA 5J8LA 3DIPA 1MRQA 4S3AA 4Z2HA 4MPKA 2GVEA 3WF1A 1CT5A 1E43A 3H6OA 3G1SA 1QNRA 2J77A 4FX8A 4JKKA 3DYOA 2NVAA 4YS1A 2F2KA 3OQ8A 1BPLB 1BFNA 3IV8A 3PZMA 1UZ4A 4X0VA 2NWSA 4D1IA 1JPKA 1IEVA 1SJAA 1XBYA 3DN5A 3JUGA 4AWSA 1K9DA 1DJXA 1KXTA 2OZ0A 3WH7A 4Z2JA 4H9YA 2NQHA 2PDXA 4H8NA 3WK3A 5KSWA 4H2CA 3F2BA 4JTLA 1XG3A 4QCFA 1PX4A 4YYCA 3LLFA 1ZU8A 1ICSA 1KM5A 4MJZA 4I90A 1XUUA 3KLLA 3WDPP 3W01A 1Y5WA 1OFQA 3A3HA 1FWTA 5A8PA 2WANA 3GDBA 4H8HA 3UR2A 1JAEA 4JPGA 3T4WA 3UZJA 2OT1A 3I3DA 2CHNA 1JCTA 1UWRA 4ML9A 1PKNA 3BCDA 2HE8A 2B31A 3AJ7A 2E40A 3KP0A 4QISA 3NTYA 1NQ6A 3OLDA 1WKYA 2VUYA 2ZDSA