1S2WA

Crystal structure of phosphoenolpyruvate mutase in high ionic strength
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
258
Chain Sequence
KVKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
total genus 97
structure length 258
sequence length 275
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2wA00
2WQDA 1PYMA 3FA3A 3KTXA 3GG8A 3T0TA 4IP7A 2HJPA 1S2VA 4RPPA 2V5JA 4L9YA 3H6OA 4IQDA 3EOOA 4IQEA 1AQFA 3I4EA 4QG9A 4HYVA 1MUMA 4FXJA 3LG3A 3N25A 3SRKA 3KHDA 1S2TA 3QLLA 1OY0A 3G2GA 3QV8A 3R4IA 2R82A 3HQOA 4DRSA 2G50A 3EOEA 2V5KA 2VGGA 1U5VA 3VAVA 2VGFA 1O5QA 3GR4A 4ROQA 3SRDA 4B5TA 2DIKA 3IS4A 1O66A 1S2WA 3EZ4A 4B5WA 1KC7A 1JDEA 1VBGA 1F8MA 1M3UA 3T05A 4QGCA 1DXEA 1E0TA 1GGOA 3QV9A 1UJQA 2X0SA 2ZE3A 4L80A 1IGWA 1A3XA 1PKNA 3U2ZA 1ZJHA 3BJFA 3EOLA 2QIWA 4KS0A 4L7ZA 1U5HA 4TV6A 1DXFA 1IZCA 4KCTA 3T07A 1A49A 3LYEA 4MG4A 1DIKA 3QV6A 4QG8A 4JPGA 4B5SA 3PUGA 3SRFA 1PKYA 3ME3A 2XDFA 4YNGA 2VGBA 4MF4A 3M0JA 4KCVA 4WJ8A 3OQ8A 5TAOA 1F8IA 4B2DA 2XZ9A 3QTGA 3P0XA 4B5UA 1ZLPA 4HYWA 2VWTA 1E0UA 2OLSA 3E5BA 4G1NA 2XZ7A 3E0VA 4LSBA 3FA4A 2VGIA 3QZ6A 2L5HA 4TV5A 1M1BA 4B5VA 3HQNA 1F3WA 3M0KA 4KCUA 1S2UA 3HQPA 2HWGA 1PKMA 4QG6A 4B5XA 1DQUA 1F61A 2E28A 1XG3A 1OQFA 1VBHA 3B8IA 3MA8A 3QQWA 5JVLA 3E0WA 2KX9A 4YJ5A 4L9ZA 2HRWA 3OYZA 1A5UA 4B2DD 3OYXA 3PP7A 4IMAA 1O68A 3BJTA 2DUAA 2VWSA 1SGJA 3GQYA 1F3XA 1PKLA 1KBLA 1Z6KA 1XG4A 3SRHA 3QV7A 4KCWA 4KRZA 1A3WA 1T5AA 2BG5A 2HROA 4FXFA
chains in the Genus database with same CATH superfamily
4UNKA 3VOFA 3RYSA 2YCLA 3AWNA 1E70M 3VUSA 2Y70A 5HXMA 5A6SA 3L68A 4AZCA 5HA7A 5HAOA 2J27A 2R1MA 3KHJA 3LNMA 1JDAA 4KEZA 1LWHA 4MZYA 2XWEA 3V7PA 1W9UA 1WUEA 2J6VA 3DXIA 1JVNA 5AHIA 1QNPA 1XX1A 2YBVA 4QLKA 1EP3A 2CZEA 1RUSA 1CW2A 2C91A 4WSJA 4S38A 5B7ZA 2XIIA 3OG3A 1JGIA 2A7PA 4O50A 3Q45A 1UD2A 2WYSA 3A47A 1CYGA 1ZCOA 2PF0A 2EEXA 3F7JA 5HWNA 5EY5A 3A13A 3EB4A 2E3ZA 1E5NA 3W7IA 3IGHX 5TF0A 2A4AA 1PVNA 2B7OA 5T9BG 2DP3A 4J40A 4DELA 3CHDA 1XD1A 3GO2A 4GX8A 2J88A 4AB4A 2D2GA 1WV2A 3WUBA 1ISYA 2HQAA 2X7WA 2I16A 4P7QA 4DZAA 4CN4A 4Q3MA 2PC8A 3ZWSA 2BS9A 2VRQA 2OZ3A 4HA3A 5F4WA 4C7DA 5LGXA 4J7RA 3BCJA 4RE3A 3VK5A 3WQ4A 3W83A 2J9XA 3JZEA 3IVUA 1AJZA 1TYGA 3VGHA 3OW1A 2AQOA 4KRUA 5G1YA 1ADDA 1XDMA 4UR7A 5J8LA 3TH6A 7A3HA 1TQJA 4NI8A 3HQOA 4HOXA 3QW3A 1HJWA 1IV8A 4C6EA 2ZUTA 4QM1A 3KM8A 3DFQA 3NPWA 4LGXA 4CCDA 1JCLA 1C9WA 1OFRA 4LU0A 3U6WA 2CU0A 3SFWA 1EJUC 4M81A 2Y62A 3B4YA 3CAVA 5HQEA 4MNLA 1IF2A 3U3HA 1PB0A 3WF0A 3SSZA 1WXJA 2V3FA 4R27A 4I9AA 4TX8A 1QTWA 3CV7A 4GJIA 2VHLA 1EIXA 1GEHA 1NQKA 1W1B1 3EB3A 3T9PA 3VOGA 1S2UA 3RLVA 3SB0A 2PURA 1SR9A 2IPFA 1VYPX 2OG9A 3KOZA 3HA1A 2J13A 3GY1A 5IFTA 2TSYA 1KFLA 5K2ZA 3H53A 4PEEA 4X22A 4PMUA 5IM51 2J7HA 3CC1A 3S5ZA 4H04A 1C8VA 1QWGA 5TAOA 5C54A 4MAZA 3BURA 4F0MA 3WLRA 4U5KA 2CW6A 3I6EA 2Z00A 3QR0A 3OG2A 4WIWA 2FKPA 2HBVA 2PB1A 1KM0A 3CK5A 2BVDA 3L66A 4W88A 3UJEA 1G6CA 3URAA 1DJWA 2GGHA 6REQB 3O6YX 5ABTA 5BOEA 1LORA 1ZAJA 5CSUA 4JFUA 4JFSA 3W3OA 2WSYA 1V0KA 1UBSA 1EGMA 5I09A 2YA0A 3WBXA 4WHBA 3MUY1 3NA8A 4Q7NA 1FCQA 4FK9A 3TK7A 3KL3A 4WCJA 3H2AA 4Y2WA 3ARYA 1OIMA 3PANA 4YTSA 3DBNA 1R9ZA 1T99A 4E4UA 4JTUA 3S2LA 3M0JA 3SUWA 1AZ2A 3TR2A 3G8RA 1JCMP 2IKJA 3WQGA 3WFZA 1W1A1 2DT1A 3AZRA 3KS5A 4UCFA 4NXSA 4BQ3A 2D1ZA 3IJ9A 3T44A 3TDFA 4MB5A 3RJXA 3EX6A 2VVSA 1TWZA 4UFMA 1BEUA 4UMCA 4PB3A 2CETA 1V02E 3OBKA 3CUXA 3UY7A 2WWDA 2UY3A 4Z17A 4ACZB 3L0KA 4W89A 2E09A 4Q8UA 3N2XA 1SZGA 1TX2A 2XHYA 1BVWA 6ALDA 4MZ1A 1ICQA 1L6FA 3VFLA 4OOZA 3QM3A 4KMQA 1J79A 2DQWA 1H1YA 3GXNA 5DMLA 5C2CA 4P7NA 1GQKA 1IT0A 4CEUC 2TRSA 2VM8A 3N73A 1R7OA 3GUWA 1XF0A 3N2OA 3NPVA 1Q13A 1FFQA 3RNDA 2GGGA 3WO8A 2WVVA 3EMCA 4X60A 3FHAA 4DUWA 3TJLA 1UA7A 2WNQA 5CLWA 3WNNA 1KFKA 1XXXA 3S4TA 2OZ0A 3KOWA 5BRBA 1RHCA 3BPWA 4HNVA 4O1AA 3KVJA 3OTRA 3INPA 4TMBA 2D2HA 1KCKA 1Z42A 4HB7A 2W92A 2FHBA 3G5EA 4HCHA 5PTDA 1VFSA 1YQ2A 5DRCA 3GB6A 3RLGA 1AH4A 2FH8A 5I3FA 2ZWYA 3DHFA 3MUAA 1US2A 5DY3A 3AIBA 4TOQA 1FH9A 4W7VA 3P8JA 3BCFA 4N4QA 3TE9A 2HROA 2WHJA 3F2BA 2UY2A 5AFDA 1B4KA 1BWVA 1N8WA 1NFBA 1KRBC 2Z28A 2PMQA 3W76A 4B9ZA 4JTRA 3W27A 1XSJA 3CHVA 1M01A 3QMSA 3PAJA 3PZUA 4YVVA 1O5QA 2EQDA 3OZMA 4GVGA 2WM1A 1W0MA 1WDQA 3WX7A 3QMRA 4MB1A 3LGGA 3V4BA 1AH0A 5BMWA 3BOXA 5FD0A 2OELA 3URNA 1HGWA 2VEIA 3U2OA 3BCDA 3SCQA 3HURA 3RLHA 1F74A 3EWBX 4S39A 4MDOA 3ITGA 1DJYA 4XD4A 3W7RA 1GG0A 3ERPA 3GR7A 1ZBVA 3E96A 4CD6A 5E93A 1K1DA 3AI0A 3CM4A 3WBAA 1JZ6A 4MYXA 1Q63A 1Z8AA 2VO5A 5I23A 3QY7A 1AG1O 3TQ0A 3R5EA 5T8GA 1GVRA 1W5OA 3EDFA 3PTQA 2AL1A 2R9RA 1QI4A 1GJUA 2VDIA 3QJAA 3N2CA 1AW1A 4Y96A 3K8KA 3SJNA 3E0IA 2C19A 2H3BA 2P5NA 4HNUA 1LM1A 4O1BA 4OUIA 3LLDA 3PM6A 2J7EA 1UPMB 1F6YA 3W38A 3FDGA 2A3AA 3LBMA 3WLPA 2Q09A 2CESA 4WSHA 1G4PA 4REQA 4FLOA 4UUIA 1H1ZA 2DQXA 3W01A 1VHNA 4QJ5B 2GJRA 1OF8A 1MZRA 3STGA 1B3OA 2Y0FA 4DVOA 1DOSA 4ILSA 4IQLA 1B3XA 3LS9A 5HQMA 1LT7A 4Q4SA 4IX0A 4AY8A 3AC0A 1PUDA 4K3ZA 2XGZA 1TMHA 3TA9A 9XIMA 2GK1B 1F5ZA 4DXVA 3W9ZA 1DIKA 2XIQA 1GVOA 2FDSA 1J93A 5AHNA 2ZXAA 5EBUA 3NM1A 1UD4A 1TKKA 3SADA 1HP5A 1KBKA 3S2CA 4H9TA 1EZ2A 3K13A 4C1LA 3SGUA 3HQPA 1F9CA 3L5AA 3ARZA 1KM4A 1TFVA 3ABQA 1XLIA 2XH7A 3G1XA 4MADA 1H7WA 4WK9A 5DANA 3UCDA 1TREA 2HXUA 3LPFA 1F3TA 5LA1A 1E6PA 3W1RA 3M44A 2Y85A 2YW4A 4UTWA 3PB0A 5CJMA 1ME7A 2J7FA 3LCGA 3KE0A 4S3GA 4JN8A 4FEZA 1CGXA 5LNWA 1I75A 2VZSA 5G5IA 3W2UA 1JUEA 3AHZA 5CBBA 4KGJA 2R24A 1AZ1A 3AZSA 1MNSA 4BZYA 1DIOA 2G3FA 1DWFM 1L8NA 5I00A 1EX5A 4ZE4A 2CXEA 5C0QA 4DI9A 4JIQA 4ICNA 4S1FA 1Q65A 1QNVA 3C6CA 3BOLA 3TSDA 1PTAA 3ARSA 2J7BA 1PS9A 3W6LA 3NR0A 4DB7A 3LLXA 3B40A 4QDMA 3TJXA 4DPPA 3PZOA 2XH4A 3SUSA 4TU1A 4B15A 1IR2A 4NX0A 1SMDA 1Q3NA 1SZNA 4PMOA 4Z0SA 4MNJA 3N4FA 4RE2A 3QZ6A 4N02A 1MI3A 4F9DA 1PHWA 2Q3OA 1MDRA 3KX6A 4B5XA 4QS5A 2G4FA 2VEGA 4MHBA 1SW0A 4WUIA 3N2TA 3WQOA 4DWDA 3BAKA 1PAMA 3E1F1 3C86A 2QJIA 3HPZA 4U3CA 4LQ1A 3RUBL 3WKZA 1GKQA 3MMUA 3RR1A 1I9CB 2ZZ7A 1UD8A 3NZGA 3QSRA 5D9PA 4B3ZA 1I0DA 2J7GA 1CGYA 2VD8A 1QUMA 4FNPA 4M82A 3I7RA 2QCHA 2FJKA 1CWYA 3G77A 4C6LA 1KM5A 2C1HA 1D8WA 2CBJA 4HZMA 3EX1A 2UV8G 3E3HA 3N14A 1DWIM 3EMQA 3ECQA 2GQ8A 5F2GA 4NP7A 2DIEA 2BODX 3KBMA 4PODA 2J8GA 3CYVA 4PMDA 3T4WA 1BVZA 4NRSA 2E6FA 1PSCA 3LD5A 4XAFA 3W37A 5KZDA 2QAFA 3WH5A 2XSBA 2J74A 4TIMA 3U48A 3AHYA 4N2YA 3CZLA 4GA8A 2C3ZA 3QPEA 4DYEA 2RJHA 3EPNA 3PNZA 1JAKA 5LGZA 5DO8A 3QYSA 3UGVA 3S83A 1LROA 2E28A 4FNSA 1FUYA 4LOCA 4M3PA 4KH2A 2BVTA 3W7QA 3CPGA 5IRPA 1OIFA 3SQSA 3BUVA 1A5UA 3AQUA 4GRSA 2X42A 4LY4A 1KR1A 1DKWA 1A5AA 3NQMA 3W1AA 5CEWA 3LDVA 4AZGA 2P8CA 4XD5A 4WDUA 1XRSA 1XM3A 3SN0A 2WK2A 3W25A 3GVWA 3P61A 1Q6RA 4NF7A 3OA3A 3H4WA 3GVVA 1NAL1 2VEFA 3W7PA 5GNYA 4Y8EA 2OEKA 2I9EA 3F4WA 3VGGA 2CFFA 3VZYA 3RIKA 1H51A 4MJZA 3TFXA 4IMGA 4PRTA 1JAEA 3CIXA 1R3SA 1KQYA 1XIHA 4MNKA 2GGIA 3UBPC 1GOKA 3HGJA 5GJPA 1E3XA 2A3BA 2BFGA 2GJPA 1A5LC 3ANVA 1A3XA 4LW7A 1W1ZA 5A6TC 2AQWA 2V2DA 3MSYA 1UZ1A 1JCNA 2V63A 3NPXA 1AODA 4H9XA 3H7RA 4EPDC 1UZHA 1S5VA 4UQ9A 4JTFA 3W00A 5IHRA 1E6XM 3EAUA 4QLLA 5A6BD 2GZXA 3KEHA 4UQCA 2YLLA 3VNMA 5C71A 4G1NA 3HJEA 4GBUA 3BOFA 3VCNA 3TTYA 2NT1A 2QGYA 1EJ7L 3LBOA 2H90A 4P8VA 1UD3A 1UQYA 3KWXA 4Q6JA 4XAGA 1KXTA 2GUUA 5CC5A 5J5DA 3IV3A 1KCZA 1DORA 5A3HA 2VD9A 1Q6CA 3APYA 2ZVRA 2EJ1A 1JD9A 1LDCA 2YR1A 3M9YA 3MDWA 2TMDA 1QAPA 1ZQ5A 3M5ZA 2E25A 2UWFA 3TFCA 3CL7A 1V0LA 4PTVA 3QBUA 3R79A 4H41A 2FFIA 3C0SA 4HT3A 4FAMA 4PTNA 4PMQA 1UKTA 2NQ9A 4ALDA 3KVKA 8XIAA 1XLBA 1SW7A 3RRAA 1M6JA 3NQCA 1J0ZA 3RCYA 1EL3A 1R7AA 2O9RA 4AX7A 3M0YA 4WSKA 3R4IA 3GYCA 1CB7B 4NNCA 2YDAA 4JHZA 2YZRA 4X3ZA 3BAJA 4Z1DA 2VRJA 2A85A 3DC0A 1H0GA 2QCDA 1AD1A 4PN2A 2Z1KA 5LXEA 1XIEA 3CO8A 5J04A 4F40A 3N3TA 2ZOXA 2O4MA 2ZRYA 1VFUA 2CLOA 2P0IA 4GACA 4PMRA 3L4TA 3TYZA 3WDJA 1IIHA 3PC0A 4AIOA 1J10A 3VOJA 3EWWA 4B4FA 1I1WA 4IG2A 4ADSA 5JBFA 3T81A 4ZOEA 3WH6A 6PTDA 4M80A 4BA0A 1J96A 5HR6A 4A29A 1FWRA 2X1SA 2QULA 3MZNA 1I2NA 2Z24A 3KZSA 4XZHA 1LT8A 2CERA 1YNPA 3B8WA 4G5DA 5CSSA 3MWAA 1Z89A 3WSUA 1KWGA 3H4XA 3NO5A 4C6DA 3EA3A 4K38A 2R91A 3AMDA 5E9XA 2NX9A 3GTNA 2PDPA 4GJ1A 3H8AA 3SRHA 3VGFA 4P61A 2GPTA 3L0NA 6XIMA 3ZWTA 4IOTA 1I2RA 1V6UA 2FVLA 2ISFA 1KRCC 4ERIA 3UWWA 2CPUA 4MPKA 4L9YA 3PPGA 1A53A 1FQ0A 1AQFA 1ECQA 3L5LA 1LL4A 3N25A 4V27A 1S2TA 1UR9A 4JDBA 1F6PA 3WH7A 3VO0A 3NPUA 5E09A 3K5XA 4PTMA 2AL2B 2YYTA 2JQXA 3CWHA 3KW3A 3WN6A 3GDRA 4W8AA 3N6HA 2EPKX 3T7VA 2ZZ4A 3G1SA 3OA5A 3PG9A 3GW0A 3WDPP 1IHIA 1OFQA 3SCRA 3KAOA 3RN6A 4PL1A 5CGQA 3SQLA 2FDMA 3ANUA 3WJZA 2Y7EA 3H7VA 2Z2BA 5CC3A 4O17A 4ZQMA 1RA0A 1C93A 4LYQA 5CPTA 1N8FA 4H9MA 2CZ5A 2P53A 1Q7MA 3VI2A 1W9PA 2QV4A 3AIWA 4GY1A 3HJZA 4KGLA 2RAGA 1KLZA 2ZUUA 4NAFA 2EKGA 1GYLA 1BQCA 2HRWA 2FJUB 3FLUA 3GXTA 3H21A 3MI6A 3QPYA 2X05A 4OECA 3F5LA 3TN5A 3MO4A 3LLFA 4D6IA 3T0AA 1XFCA 4DF0A 5A5WA 2C18A 1BKHA 4PUNA 1DJIA 1NU5A 1IXNA 4AF0B 3CTLA 5FEXA 1GJWA 3H2CA 4HA1A 1SO3A 3LQGA 3W1LA 3B06A 3W7LA 4O10A 1EYEA 3W86A 2DSUA 2ZC1A 1W9BM 3W82A 4EXBA 4CN6A 1E71M 4LANA 3M0HA 1E0WA 5AC8A 1ZB5A 2QHAA 4RCXA 5HWJA 4LBRA 3W7OA 1G4SA 1FBAA 3U9IA 3S46A 5C6MA 2J25A 3EKLA 3RJYA 1E15A 4BI5A 4XKMA 3T78A 4O1DA 3PZNA 1GQLA 3S1UA 2DSWA 1CGWA 2XU2A 4OHQA 5JIWA 1KFCA 4UTLA 3URQA 3U2EA 1P0EA 2Z26A 2JIWA 2X09A 4D6EA 4XIAA 4XO6A 3CLMA 3RGTA 2RJGA 2Y1HA 2L5HA 3DGBA 5A1AA 1C3FA 1ONEA 3O1NA 1NSJA 3GXIA 3NQ8A 2ZX7A 3EWDA 2GUBA 1J11A 1O5XA 3QEZA 1ZL1A 3ITLA 4PBEA 3O05A 4Y9NA 1VQTA 3AWOA 3PUDA 1IXOA 3P8IA 4XTIA 2Z7KA 2OGJA 1JFXA 3SBFA 3N1AA 1RK6A 4P5UA 3HTWA 2G3JA 2NSXA 1TPVA 3WJWA 4NL1A 3WMLA 3V0UA 1R0MA 3BQ6A 4WDWA 3TTQA 3WF3A 4HK6A 4FA3A 3C5QA 5C9ZA 2C15A 2NUYA 3TZFA 5LYRA 4C65A 5FJIA 2YCJA 1WBJA 3EZ4A 2E40A 2PDBA 2HVMA 2V3EA 5I3GA 3OP2A 4Z1YA 2V69A 4IZGA 3MUXA 1F4HA 4DWSA 1V3HA 3DHUA 1UROA 4W7UA 4HP5A 4G2DA 3E38A 2G8ZA 6XIAA 3RLUA 3KL5A 3H54A 3ZS4A 4JPGA 4B9YA 3DEQA 1K02A 1XLEA 4LY8A 2VR5A 3A23A 2WJZA 4ZENA 1HN1A 4UQDA 4IIBA 4LUIA 2WAGA 3N9RA 4C6IA 1MZHA 9XIAA 4CU6A 4C6CA 5AYBA 5CGMA 3GC4A 1UOZA 1K4GA 4L6OA 5BROA 2VX7A 3EGJA 4GYFA 1TPC1 4C1KA 3ZJ8A 2C1GA 4DUVA 1QOQA 4C5ZA 3WDRA 4HMCA 1AQMA 4HSOA 3G1HA 1RCXB 2QMJA 4AD2A 4CNUA 4IIDA 4NJJA 4ERGA 2V82A 2OSXA 1AH3A 1XIJA 2WQPA 4C7GA 3LNPA 4W86A 2XVPA 4QIUA 1PYFA 2C8NA 3AISA 4HIBA 3BV7A 4TR9A 1SO4A 2AAAA 3SFKA 4BQ2A 5ABFA 4HNCA 3AZTA 1RBOB 1LG2A 5HATA 1X1ZA 4MAVA 1TTIA 2PEVA 2IKHA 7CGTA 4M6VA 4HZ7A 3L4XA 5E1QA 1A47A 4UFJA 2PLCA 3VDAA 1VLIA 3QVQA 3QV9A 2VR4A 3RM8A 1WDSA 1TPEA 5BRPA 5A69A 2WSKA 2YLAA 5AC4A 4XQ6A 5H6HA 3M41A 3ZSTA 3ZJ6A 4ZOCA 2I1OA 3I7QA 1RAKA 4ATDA 1C8XA 3HG3A 3PUGA 4JIPA 1LRQA 3M7WA 4ENLA 1X6LA 5CG7A 3LBCA 1VHCA 1DL3A 3NQ6A 3RHGA 4HPHA 2EGZA 3D46A 3QHNA 2O0TA 1VFMA 3HF3A 1K6WA 1EA0A 1RA5A 3TQVA 2Y88A 2OVLA 1TA3B 1QO2A 4C6KA 4YYFA 2XVLA 3W1TA 4R7OA 1CPUA 1EYWA 2XFYA 4DLFA 3H2NA 3GHSA 2FZ8A 2ATSA 3CUZA 1RJRA 1HL2A 1UR2A 3RILA 2FB2A 5D2YA 4ACYA 3H2MA 3IK2A 4C6QA 4NZCA 3UJRA 4N6EA 1TJRA 3CAQA 3M1ZA 3URBA 1EC9A 3UWEA 3AJ7A 4M6PA 4GUFA 4QR6A 2QGHA 4E8CA 3TYDA 1TE6A 1HG3A 3CT7A 2BB0A 2C14A 4D1IA 4JEQA 4HCDA 3PNUA 3VMPA 2FB3A 1E1EA 1EHNA 3S1WA 5EFDA 4AXKA 2WCAA 3HPAA 3P3BA 1V3LA 1XLFA 2QIWA 5LXXA 1WO2A 3AYSA 1XKYA 3IGUA 3V1HA 2DPEA 4BJHA 3MCMA 3PJUA 5ABGA 3DH7A 4NZ5A 2PDXA 4NYYA 3MKCA 5C8BB 4WDXA 3ZR6A 4F9JA 2YDQA 5C9WA 3W1UA 1Q4NX 4S2BA 3AIQA 3THDA 3UR8A 4PMZA 3PBVA 1I2PA 2D0HA 3GWQA 3MKVA 3ZVIA 4D9PA 4PUWA 1QI0A 3MMDA 4PA8A 3BSMA 4W8LA 4YLWA 1F61A 3MUCA 1OQFA 4JTHA 3FAXA 4R5EA 1LJYA 4I8DA 2XVNA 3ZLHA 1UKOA 1DEDA 1IIGA 3EB2A 1Q85A 2FZ9A 4B90A 4Q7BA 4FHAA 1VR6A 4MJ4A 1NDYA 1R38A 3IJ8A 4HHHA 1KBLA 3T42A 3OGVA 3DZ1A 3P0WA 3SCSA 1OFOA 3FSTA 1AW2A 3JZUA 3MY9A 2F61A 4DJDA 1GQNA 3JVAA 3KL0A 2BOFX 2WVSA 1F05A 2J6XA 2FHCA 4GI4A 4ICMA 1V6WA 1YNYA 4DXXA 4JNMA 3W23A 4GI6A 2EG6A 4H8UA 1WOAA 3KHDA 3N9KA 4Q8NA 2Y7GA 2PDGA 3SY5A 4GOAA 4PTWA 1TB3A 2WNZA 2V30A 3XISA 1MQQA 1A0DA 2Y8UA 2QPXA 1B4EA 3LHZA 2WJDA 2NVCA 3WF4A 3FGCA 3MANA 4ZQPA 4ECLA 2ACRA 1IGWA 1NOWA 3MMTA 1W31A 1TIWA 2G96A 3GU2A 1FTXA 5TNVA 1TJ1A 1L6GA 1OGSA 1R2SA 3G8EA 2NWRA 1FXPA 1MNZA 4YNGA 2BY1A 2F84A 1LL6A 3I3EA 4F2UA 1XIFA 1DHPA 3UQNA 4X9SA 2XH2A 1EEXA 3CH9A 4G8TA 1GT8A 3CBWA 3OBAA 2XWDA 2FTWA 3EX2A 5AYZA 3RM4A 4LVBA 4NJIA 1E6NA 1Q66A 1R87A 2XFWA 3N34A 3ALGA 4L4LA 4H8VA 2Y61A 2VVNA 2QS8A 5FEWA 3STEA 3P62A 1J5SA 2DZUA 3GKFA 3NXLA 4NASA 1W1PA 3DYPA 3UF9A 5JMUA 3GHTA 2YJQA 4JKMA 3W7JA 1TPUA 1H49A 2H9AA 2CBIA 1R2RA 4Z1BA 1GHSA 3VGBA 5LA2A 1VYSX 3B97A 5D30A 2VX6A 2ANUA 1G9HA 5D2TA 1B3YA 5E0KA 3MSRA 3B04A 4F2BA 2PSNA 1Q6EA 2VXNA 3OGSA 5GNZA 1RK5A 3QY6A 1KXVA 1OY0A 4OIFA 5C9XA 1TPH1 1EH9A 4P7LA 4WOQA 4H3DA 1FH8A 4EPBC 3TW9A 1KFJA 1EX1A 1OVDA 1S2WA 4FIRA 1KC7A 3EYPA 1NDWA 1RP9A 4Z0JA 5HANA 1JCTA 5DCBA 4NJGA 2WKGA 3IJIA 4DJFA 1RBLA 2JFEX 5F1UA 1JCJA 3FKKA 2QUMA 2WKJA 3MHGA 3UVIA 3PF3A 4FLSA 1OBAA 3BSGA 2ZKMX 4QE1A 1TUXA 4B5UA 4JBRA 3WBYA 4GD0A 4I7WA 3BDKA 2VL4A 2JF7A 3M4HA 4Z08A 1W9XA 3A22A 4LVAA 3VFCA 3LK6A 4XKYB 1EP2A 3ENLA 4L1WA 3SN1A 2ZUNA 2YCKX 4LJ3A 4GYPA 1AUSL 8RUCA 2QVHA 3ZYZA 1P7TB 2TPSA 4G7EB 2WQDA 3M7SA 3KZPA 3STFA 4H6RA 2AMGA 5TBOA 1A0CA 3GIYA 3LMZA 3A4WA 4KIEA 1JDFA 3CNYA 1EBGA 3UR5A 5KTLA 2XPKA 5E0FA 1BXBA 3AU6A 3B0YA 4FIQA 4AD1A 2IQTA 4FOJA 1E55A 2W4XA 3SQMA 4QJ4B 4NZJA 3TAKA 5C5YA 1HIZA 3VPLA 3BAYA 4C1NA 3R8HA 5CPOA 2OKOA 4AIUA 2VUYA 5EYWA 3GNXA 1V7YA 1W3JA 4QBXA 5DFAA 1T8XA 3TX9A 2V3GA 3S2NA 4O57A 2VQUA 4WRHA 3VVGA 4C6PA 2WSQA 1FWNA 1UMYA 4Q4QA 1VEPA 1CXIA 5IFPA 3WK2A 4NHVA 4Z2IA 1SMAA 4CLMA 5CC6A 4FALA 2GJNA 3AYVA 2Y2WA 1PE1A 4NKCA 3MDUA 3RMEA 3R43A 2Z7GA 4CD4A 4G9PA 2V68A 4ZB2A 2PDIA 3SY8A 1JF6A 1OYAA 1MRAA 2W66A 1GPWA 4QAIA 1KR0A 4ZTXA 4IPNB 4HN8A 3H12A 1Y7VA 5AKQA 2WNNA 3K2GA 2YFNA 4IPJA 5FEZA 1M68A 3TCSA 1P0DA 4GY0A 1QNOA 4XV0A 3L23A 4DO6A 5FJRA 3CL8A 4EIVA 3MHUA 4GIAA 3TC6A 4R53A 3REQA 5KEZA 4GNVA 2Y8KA 3QC0A 1ODZA 1LG1A 3TW6A 1ME9A 4XO7A 4C60A 1I1XA 4RNFA 1C7SA 3CPUA 2QF8A 4U2ZA 1PO9A 2HK0A 1XYAA 2G50A 4XIMA 4F0LA 1UB3A 1ZJAA 1I45A 4LWWA 4PMNA 2A2IA 1H62A 2QUNA 4NZ4A 1WDWA 4LNCA 1Q2RA 4K36A 5AC5A 1XV8A 4UZSA 1GOXA 1DXFA 1UUQA 4INFA 2XGBA 2NLYA 3GNDA 4FNRA 5HNNA 3NVTA 3W26A 4LPCA 1TO3A 3FV9A 1G67A 1SPQA 2WO5A 1GCYA 4HPJA 1DIEA 1IR1A 3QHMA 1UQZA 2ALDA 1M1BA 3L2LA 1GWJA 1P48A 5FI8A 1VYRA 5BXTA 1CX9A 1TG7A 1WKEA 4QLJA 4EPKA 1VBHA 1AQ0A 2R1LA 2ZRXA 4A3HA 3M5YA 3MV11 4KT2A 5HINA 3ZT5A 5A94A 3VD5A 1R2TA 1XDJA 1XLAA 1DQWA 1SFLA 4KKXA 3FEMA 5CZ0A 1OCQA 1UWTA 3ZLGA 4FSAA 4PSPA 1TIMA 4FI4A 4IP7A 3R10A 4GVFA 2YBTA 1NWRA 3PBMA 1HGYA 3P7YA 1VRXA 3H6OA 2G0WA 1UP0A 5FL1A 3NZPA 3UXDA 4O1EA 2WJFA 3UPMA 4FS9A 3ATYA 1GW1A 4NY2A 1POKA 4US5A 2I17A 2ZXBA 1GZJA 1FWAC 3RMJA 1ADSA 3ZJKA 3L9CA 4GINA 4PCSA 4B92A 4O16A 1AK5A 3C0JA 1XCWA 2E68A 3UU0A 1CEOA 2QCFA 1TZZA 4JTJA 1BXNA 5KSWA 5G1TA 4XVDA 1A49A 3NCOA 4J9JA 1TPB1 1G69A 1KRMA 2G3NA 2QJHA 2ZX8A 3IVTA 3NGJA 4NJKA 1VENA 4B2DA 4PUKA 4RV8A 3GZ3A 2YDSA 3SCPA 1OM0A 9CGTA 4I5RA 1D8CA 1XYLA 1E1CA 4J3XA 1D3HA 3VA8A 3OVRA 1DQUA 2Z29A 3CQJA 3L4UA 4BI6A 1RR2A 4P7OA 2VKZG 1QW8A 2D2OA 3W02A 3LZ5A 1TV4A 3QPZA 3IPWA 1O6IA 3SDOA 1I4NA 3T0DA 3QR3A 3N04A 5GJMA 5CJNA 4L6DA 2W0UA 4YYCA 5CZSA 3RXZA 3TXVA 2WBGA 3WQCA 1VFFA 1XIDA 1YADA 2CLEA 1TVPA 2NQHA 1PBGA 3M6DA 2ASHA 4GCXA 2BVWA 5EB8A 3UG4A 1W3HA 1BRLA 5BNKA 1OFDA 3G1RA 5BXSA 4GMEA 1P0NA 4JR5A 2DUXA 1TWDA 1S3HA 3F4DA 3TOPA 3PUOA 3G1DA 4YVPA 1UJPA 1WDPA 3WDQA 1TTPA 2PDKA 1XI3A 5JH2A 1MUCA 4E4FA 3CZ8A 3KLLA 3M46A 2BZNA 1O66A 3VOHA 3WD2A 4KF1A 4MB3A 4AUBA 2VCBA 1FY6A 1L6YA 3O7UA 2ISDA 1CLXA 1WKFA 2REQB 2WWCA 1GVFA 3CV2A 3GBDA 1M04A 1YKWA 2FVKA 3B3DA 2SFPA 1TR9A 2R14A 3NWRA 1FX6A 1CDGA 3RX3A 4LEQA 4EAMA 3NIYA 3CUFA 1JZ8A 3WFAA 3E2RA 5LHEA 1IQ8A 5A95A 1XRFA 4Z2JA 4PBGA 3HQ1A 4HTBA 3QC3A 2Z1BA 3VDHA 4F0RA 3WLJA 1ZZMA 2ESCA 3BG9A 1L0PA 4AYGA 1JDDA 4HOWA 1K70A 1QPRA 4UOJA 4H7VA 3FJ6A 1H7RA 1ZU8A 2WW5A 4D8ZA 1XSKA 4IGMA 1KM6A 2J78A 1QI3A 4O8AA 3K4WA 3VIKA 3CWNA 2WZTA 4W5ZA 1L2UA 1ONRA 3SGZA 2OZ8A 2NZLA 3TVAA 3PJWA 3DBPA 2VRKA 4GJJA 4GPNA 5D33A 4XG1A 4GZEA 4Q8PA 4EWJA 4JTDA 5MF5A 2VC7A 1QI5A 2QUVA 4QSHA 1ZBWA 2EPMX 3B0PA 2OSWA 2FPVA 3ARVA 2DZSA 1O5KA 1A50A 1TWIA 1JDEA 2DZXA 2FGBA 1YBQB 3M07A 4Z2GA 2CKRA 2H8ZA 3HOJA 5I06A 1U5HA 4D71A 4NNAA 4WY0A 5GNXA 5I2UA 4Q4KA 1W5MA 3LY0A 2PU0A 5E70A 3UVAA 4ADTA 3HU7A 1SZEA 4BEQA 3V35A 4FF7A 3R94A 2RHGA 3THUA 4HPGA 2VZUA 5LHFA 2EAWA 4JHOA 1B9BA 2OT0A 2JEPA 1GTEA 4B5NA 2EG8A 3K8LA 4B16A 4V1YA 2ZWZA 5EGRA 3VKKA 1WX0A 4WDTA 4IMEA 4M24A 3ARUA 4IP4A 3GD6A 5FF4A 5JQ9A 5EPDA 4GVIA 3VE9A 3OYXA 1AW5A 3W7DA 1E0XA 3R6IA 4PUJA 3F4NA 3P6LA 4HK5A 2YB4A 1OK6A 3IRDA 3B4UA 5CPQA 1PZ2A 2PGEA 1X98A 4G1KA 1BSIA 3A12A 4UB9A 4LNYA 2NQLA 4IFKA 3ES7A 1XSIA 4A8RA 3UCCA 3ZFHA 2C79A 4NUWA 5E6YA 3L4WA 2WMIB 3DOPA 1HKVA 3O63A 4GIRA 3KDOA 4GXPA 4UTMA 1CI1A 1GYMA 1H11A 1RBAA 3DFOA 2OOFA 4CUCA 1QU4A 2FHFA 4D6CA 3W24A 3CHCA 1QOXA 1RD6A 2PF8A 3HB9A 1M7XA 1IYXA 3AS3A 1PX4A 4DYKA 3ZMRA 4D6GA 2CHNA 1XYBA 2NSOA 3TEVA 5FOOA 3S6OA 3LCFA 4OQVA 4UFKA 2B0MA 3ELFA 3VIGA 2XFRA 3BAXA 2OSYA 1OCBA 4E8DA 1K9FA 2BASA 3KS6A 3P81A 3WK0A 4I7UA 1S1RA 3GG0A 1UCWA 3ZZ1A 4GFIA 5G4WA 3W7MA 4DJEA 5JVLA 2E6DA 4RDYA 1NF7A 1J4EA 4JN7A 1QCWA 2E6YA 1XQKA 1CCWB 5M17A 3P80A 3WUEA 3HG5A 3B8SA 5TD4A 5MHBA 4CQBA 3OODA 1QNQA 4W7WA 1RD5A 1FFRA 3IIOA 1T5AA 4GI8A 3U4FA 4R85A 2DW6A 1OEPA 2DU2A 3IANA 3ABZA 3HZ3A 1QJWA 2WCGA 2D23A 3QFEA 4LBUA 2A6NA 3M47A 2WM0A 5A2CA 1CLVA 3BL3A 1V51A 1TZ7A 3VYLA 4DI8A 4HJFA 1ZNNA 4I9JA 3A24A 1E4IA 1FDYA 4UOZA 3QY8A 1OD0A 3A3WA 2MUCA 5T91A 3PWIA 4MLRA 3WZ0E 2O7SA 1EC7A 1R30A 4A4AA 3DGRA 3GNRA 5FJJA 3U2ZA 3QTPA 5I24A 4XB3A 2D0FA 4DAFA 4CCCA 3PR2A 3AHXA 4P8XA 3R8GA 3BMVA 4KWWA 4DO7A 4LYKA 1U2YA 2QDEA 5G2WA 2OLHA 3HIJA 2R1NA 2Z1XA 1ZPTA 4Q4PA 1G4EA 3OPSA 3DAQA 1SJBA 1C9DA 3FJ4A 4JKLA 4O4WA 1JEZA 2OO0A 4NZ1A 2NVDA 4UTWC 1PWLA 3MPGA 2QF7A 4IT1A 3LGEA 1ICPA 4M29A 1QR7A 2OO6A 3SEPA 5ECUA 1ZSXA 1GUVA 3TTEA 1XGZA 3TUUA 2OWCA 4EK7A 4XZWA 1YMYA 2DZVA 2BP1A 4P7RA 5EBAA 2VUNA 3VC5A 3T55A 3W2MA 2HTMA 1RJQA 3UT0A 1HJQA 1FDZA 2QNEA 2RH9A 4JKKA 2OOGA 2CHOA 3A5FA 2PCEA 4IPIA 1MUMA 3STCA 1DWHM 3VE7A 1OB0A 4JIEA 2BY0A 3W71A 1KTNA 1TUFA 4XUGA 1P1XA 2HVOA 1FDJA 3WENA 3IS4A 2YL6A 4KBXA 5JU6A 4WXZA 3NYDA 3DI0A 3G0UA 3AU2A 1E9IA 4NG3A 4ZOAA 4Q8QA 3TYAA 2PGFA 1LTDA 2VZTA 5F2IA 3VM5A 1H7OA 3ZVHB 2VI0A 3BANA 2WB5A 3SW6A 2PPGA 3HG4A 3SURA 1E6RA 2ONEA 3W7CA 3VIOA 4L56A 3UXAA 3E2VA 1SW3A 3DDMA 3PZGA 1U1UA 4WKAA 2VT0A 4ZB5A 5HNUA 2OT1A 5AYYA 4LB4A 5MKGA 3E2SA 5JIPA 1LOQA 2VEPA 2OX4A 1ZBCA 1Q8AA 3OGRA 3C3NA 1J6OA 4LCSA 3AIVA 4D8AA 4ORIA 3PP7A 2BGSA 2OU4A 2BNJA 3ABSA 4GZ7A 3LZ3A 4H01A 2GOUA 5DX7A 3K46A 3O2LA 4QISA 3F4CA 4IMFA 4MWAA 1OX4A 4JGDA 3NEVA 3UW6A 1GVQA 1UIOA 4LEFA 3WK1A 3O15A 4HMNA 1YDOA 1XISA 1WDRA 5U4NA 1MDLA 1ZBKA 2ACQA 4PR4A 1W5PA 5H8MA 3W2NA 1GTHA 1K9TA 4U10A 3W29A 3GXMA 3GVQA 4HD5A 2Z6JA 4DPQA 1OABA 5K9DA 4K37A 4FX8A 2Y7FA 4CEXC 1B1YA 4ZZ9A 2A3HA 4LXFA 4B5WA 4Q8VA 3NQVA 3FEQA 1H1NA 1UWSA 1BXCA 1V3JA 3AALA 4NRRA 3K4DA 2P0OA 4LTSA 3VIJA 1IEWA 1V3KA 2XYLA 3K4AA 2IPWA 1JZ7A 1FWCC 1G5AA 1SVDA 2PDCA 4MG4A 5DBTA 2X41A 4Q4MA 1E1FA 4I7VA 3XIMA 1UR3M 3GNOA 4ZCWA 1B3WA 1E9YB 3BQ5A 4XBKA 2ZRVA 4W4QA 4DZIA 1GOIA 3VABA 4JY8A 2D24A 3ABXA 2G4JA 2XISA 4Y6GA 3VU2A 1D7KA 1XLHA 3CIVA 2OWWA 4CQAA 2Z27A 4QSFA 2HNHA 4CU7A 2O9PA 2ADAA 3B9DA 4AVFA 1FHDA 1N8IA 5EU9A 4U5IA 4EX4A 1GONA 4BF5A 3QSTA 4TO8A 4DO4A 1XCFA 2NW0A 4DIAA 1HT6A 3UCQA 3S1XA 1AL8A 3PK7A 3KOFA 1K9DA 2QAPA 3W2KA 4LAUA 1S3TC 5F7UA 3U4AA 5DEZA 3N17A 1RXOB 3N11A 1LLZA 4JS3A 2XTKA 3T8QA 3LRLA 3QQ0A 4KFNA 2Y8VA 2R6OA 4FXJA 4JX5A 3UZ5A 3O3RA 3G6LA 4WGXA 2H8XA 2R1KA 4U28A 4IFOA 4GNJA 1R9XA 3MT1A 3CS2A 4GHRA 5CLTA 1IXQA 4N9BA 3T0CA 1ODUA 4PCNA 2GOKA 1W1VA 1ZCCA 2YA1A 1ELSA 5I07A 3R8RA 4XK2A 4Z2HA 3WQDA 3SCNA 1JL8A 4JN6A 2DFAA 2HE8A 2WZMA 4FOKA 3U57A 1V03A 3MHFA 5REQB 1FXQA 2VGBA 1XW8A 3VTRA 1XRVA 4GIYA 3H55A 2H3DA 2WCSA 1E6QM 2OYLA 1ZHAA 2JE8A 3GZAA 4LUSB 5LSMA 4MJMA 2VENA 4B3KA 4DWSD 5BXRA 3C2FA 2AQVA 2QCMA 3SCVA 3TXZA 1ZS2A 2CLMA 1IXPA 2VC6A 4R33A 4JEJA 4UOQA 3MWCA 2GFTA 3VX0A 3WLNA 1P5BA 3V5FA 1QRQA 3H7UA 1EXBA 2GJXB 5M2FX 2P3EA 2QJMA 4DBUA 3FA3A 4TTGA 1CECA 4HNTA 2XSXA 1GW9A 1B9ZA 2EKCA 7REQB 2X40A 4ZSUA 1XH2A 4PZVA 2XIOA 3CQ0A 4C7FA 1T40A 5F2MA 2V5KA 3O9NA 5FEPA 1BFNA 1A80A 1BYAA 3BH4A 4A05A 4YHEA 1JYXA 1RQBA 2WSRA 2A7RA 2RFGA 4GBDA 4TVDA 1ISZA 3PZMA 4RX0A 2PE4A 4GUHA 4ES4A 4M51A 1BAGA 3WLLA 5CSYA 2FIQA 1JF5A 5XIMA 4UR8A 1KW1A 1TMQA 1K8XA 3C2EA 4A8LA 4J3VA 1B90A 3W0KA 3VX1A 3ITXA 5FAJA 4AG0A 1VH7A 4ICCX 1LUCA 4ZFCA 4GIEA 2XUCA 3H26A 4Y8FA 3LTSA 3LCHA 1ZJIA 3AXMA 3KBVA 4GQ0A 3C3UA 1SJCA 5DN1A 4MUPA 2QYGA 2EPLX 4H9UA 2W62A 5I3DA 1KFWA 2TODA 5D9OA 4AMAA 2DW7A 4KQNA 4RZBA 4J3WA 5AVHA 2QCLA 1TSIA 4PEKA 4O8RA 1XG4A 1GOOA 2QLYA 1MUWA 2ZXQA 1IT8A 1HVXA 4QNWA 1X7IA 4JYFA 1JR1A 1WZAA 5HK4A 4LAOA 4O4VA 2VFGA 1JZ4A 4NI3A 4PE8A 4ZFMA 1KD0A 3BLIA 1P6CA 4JHMA 2EPNA 5FJUA 3BSHA 3FS2A 1LLOA 1ISVA 3P5ZA 3BAIA 3G1FA 2GUYA 1R6WA 1OG6A 1V6XA 3S5YA 4XAZA 3KCLA 4QS6A 1ZALA 3TW7A 1XLKA 4LUTA 2PBOA 2ZQ0A 2QQ6A 2CIPA 1R3WA 3JW7A 1KM1A 1SU5A 3BJSA 1E43A 3N3MA 3OBEA 2F6KA 3LTPA 1BVNP 3WMBA 1UBPC 1MFUA 4RNHA 1EOKA 2PLMA 1TJPA 3FN9A 4HYWA 3M64A 1XIGA 2E7FA 1UUOA 4KFPA 3GM8A 2G3MA 4JQAA 2Q3RA 1REQA 2QJJA 2QR6A 1FWWA 4XSMA 5EA9A 4QG6A 1EDTA 3FW6A 3MBDA 5LNRA 4MWAE 4S3DA 3W1NA 3S5NA 3S5OA 4MY1A 3JR2A 1GKPA 1DHKA 4IMCA 3AXIA 1N55A 5AECA 3DKJA 1GOMA 2UY4A 4JFWA 3OYZA 1W6TA 4UTKA 1K4HA 3TC7A 2WV8A 3C61A 1EF2A 3PPFA 1ZGDA 5A6MA 2VEMA 3U7VA 1XGDA 2ZDSA 1KV5A 2EXOA 5CKSA 4KRZA 2PBGA 5D02A 4IUOA 3GRIA 3CV6A 1PZ3A 5A8PA 4IJRA 2VFEA 3K1GA 5BCAA 1T41A 1H63A 1YE4A 3BLOA 3PULA 6TAAA 3SRKA 4W8BA 5BOOA 1E6ZA 4L9XA 1DJGA 2IS7A 3S2MA 3KOXA 3UZJA 4BHYA 4A8IA 3M0IA 3D0CA 1F8MA 3DENA 4DJDD 1CXEA 4WKFA 3DFHA 2YDRA 3N4EA 4IHCA 1V3IA 3G6MA 7PTDA 5G2IA 3ICJA 4LS0A 1GVEA 3DECA 3GTIA 5FACA 1XUZA 4J3SA 2GJLA 3NTYA 4WJ8A 1K8YA 3P0XA 1QXLA 2VFIA 4XBJA 3CAWA 2Y4SA 3LI0A 3F03K 2UZ9A 1YDVA 4DUOA 3RX4A 3G3MA 4AVOA 1BPLB 4FMVA 4WEVX 1XC6A 3CUIA 1H60A 1SZRA 1SSGA 3NURA 3CXOA 1EWEA 3ARXA 3GC5A 3PFMA 3HPFA 4XZIA 2PRMA 4N9CA 1LLWA 1JYWA 3Q65A 1SO6A 2XSAA 1TR1A 1E72M 1KB3A 1Q6GA 4M5PA 3LM3A 1Q6FA 1PIGA 4UQAA 1VFHA 4O0ZA 2FZBA 5AZ1A 3RCMA 1JIBA 2I9UA 2CCRA 2NXGA 2ZYFA 4HK7A 8TIMA 4XZ9A 2PAJA 3W70A 3ZJ7A 1OWQA 3TLLA 3U2CA 3CGTA 4BWLA 2Z2AA 4CQ8A 4DWSC 2EBNA 1LQ0A 3RM9A 1B2YA 3K30A 3TJIA 2JK2A 4V33A 3TP4A 4HA4A 3T05A 4PBFA 4ZQCA 3VC6A 2ZICA 5D9NA 2FFCA 1XRTA 2JKAA 2NLIA 2HSAA 2VELA 4L80A 5TIMA 3HPSA 3DN5A 1EJVC 3M5XA 3WMSA 1MXDA 1NQ6A 3WNKA 3THCA 4CNPA 1KTBA 5CAHA 4YS1A 3HG2A 1YXDA 4ONVA 3GU1A 4I5XA 5AYIA 3TSMA 5D32A 1ISXA 2ZUVA 4AZ5A 4LAMA 2XZ9A 2J7CA 5HUPA 3TYUA 3CPRA 3GFXA 3LEPA 4AW7A 3ARPA 1QWKA 3M0KA 4JQ1A 2VOTA 2QJNA 3SN4A 1RVKA 1TV2A 2ZDRA 3CIWA 4MLJA 4HBKA 3WNLA 4DJFD 2DEPA 1QASA 1S2AA 3H70A 2DSKA 3P60A 1X7FA 1HX0A 1RZMA 2KZHA 3O6CA 4H83A 4EE9A 1A4LA 4C6NA 2QEZA 3LTYA 4BEUA 4E2VA 5DMMA 1KNWA 1T0OA 4IMAA 4IPLA 4N9EA 1HKIA 1WUFA 1UIPA 2ZC8A 4TTUA 2VX4A 1PDYA 4LYRA 4OUEA 1R3TA 4RPPA 2ZVIA 1I2OA 4DAIA 2XVGA 3WLHA 4D6FA 4TMCA 1TCDA 5HJXA 1OF6A 2AGKA 1DPMA 2E8YA 3I3BA 4L4OA 4UTUA 4RPQA 5ENLA 3I6TA 1SFJA 3LXCA 3UJSA 4B5TA 2GL5A 3K1DA 1JCYA 2VC5A 1YE6A 1GGOA 2QIIA 1NFPA 3S42A 4AHQA 4OVXA 1SJDA 2FVMA 4IGHA 4US6A 2YGYA 4KCTA 1ICSA 4MYAA 2WMFA 5RUBA 2Y5SA 3RCNA 1TMLA 3IIXA 1EQPA 5AN7A 2W67A 2PUZA 3V5CA 2PP3A 3WH8A 1E0UA 1Z3NA 3CH0A 4FB7A 5F2LA 3E9AA 4LSBA 4QITA 3W6YA 5HNRA 4IPPA 1GK8A 4XBSA 2W5FA 1OJXA 4O12A 1EJWC 4UTIA 3T2QA 4QJ1A 1EA9C 2V38A 1CGTA 2Y6ZA 3DIPA 4PCFA 2Z25A 4XZBA 3B05A 1XLLA 1Q2SA 4JTTA 1WAWA 3DFTA 4IGSA 1UWUA 1HP4A 5BZAA 1RVGA 1PHQA 2H6RA 2GQ3A 4CNTA 3GAYA 3G0SA 5EMJA 3IJLA 2C6QA 1KQZA 1W3KA 2XVKA 2CXGA 1V6YA 4TQTA 3WLMA 3CQIA 4E2BA 2BBFA 4O54A 4HNNA 1FWTA 3AS0A 2DUZA 3OLGA 4K7YA 3K8MA 5G4EA 3WNMA 3BG3A 6REQA 1B0IA 3CHFA 4IL0A 4C91A 3SUVA 2W27A 3VINA 4QEEA 1I6NA 3LM7A 4MOZA 2VFDA 4CNOA 3V3WA 2FLIA 2RDUA 4O28A 4RV3A 1BG4A 4A6GA 4PCTA 4OV4A 3GH5A 3O16A 4QQUA 1JPIA 4GNKB 2XZ7A 4GE8A 4GO9A 3DERA 2V0TA 1T6MA 3KP0A 3ZT7A 4DNHA 1US3A 2R94A 3CB3A 4RE0A 1UR8A 1LQ2A 3HMJG 1FWJC 1B3VA 2XH0A 4DJDC 1XP3A 2ZA2A 3TU9A 5A6JA 3W72A 1YPXA 2YPIA 4AWUA 4S3EA 4FP1A 1PTGA 2DUAA 4IQJA 1RCOB 4P2VA 3VD7A 4JAWA 1GPFA 1BYCA 3GH7A 5HDRA 2F38A 1A5BA 3MP5A 1OCJA 5BU9A 3OO2A 5DBUA 3MYOA 1XLCA 5IDIA 5LKYA 4ACZA 3AMCA 1OD8A 4DEFA 1G7UA 4ML9A 3D3AA 1LWIA 2NUWA 3TZNA 1KXQA 1T7LA 4IF2A 2PTWA 2OGYA 4NJHA 3WK3A 3FVMA 2PRLA 3TWBA 1AVAA 3WDHA 2X16A 1ADOA 3BLEA 5D09A 1JZ2A 2WNWA 4W85A 5AYXA 1HKMA 1G4TA 3DFPA 4HOZA 4H2CA 4US5D 1W5NA 4DZHA 1AQHA 3WUGA 1LF1A 1BGAA 4QDPA 2ZRUA 3I4KA 4HQVA 2HEJA 4LT9A 2EPOA 1VKFA 3VKDA 3A3HA 3KBNA 1OFAA 1WZLA 3KBWA 4UTTA 2DH2A 3VKJA 4K1GA 1Q45A 3VD4A 1V6VA 3S9IA 3S6DA 4B2DD 1E73M 1BHGA 2C13A 2ISVA 2XM2A 5CPLA 3JUGA 4C6MA 2YCLB 3NSMA 1BYBA 3W75A 1ZY9A 4FNQA 1NWTA 4AZCB 1Y8BA 3AOFA 2QDGA 1M7OA 1KV8A 3OLIA 4DBWA 4QTGA 3EDJA 2ZCGA 1Q4WA 4DJFC 4KW2A 5CXPA 1JRCA 4OGZA 3VAVA 4D6HA 5IXEA 3DG7A 4U3AA 3IIVA 1Z48A 4CQ9A 1GJPA 1L9WA 4GH1A 1XFBA 4TUFA 3M5VA 1JXKA 4ORMA 1EFZA 3IRSA 4QFUA 1AMKA 3MV01 5C9UA 3OVPA 4BF7A 3DC8A 2YXXA 1KXHA 4R7WA 4OJYA 1ZJBA 4X9YA 1KA9F 1ZRQA 2WPGA 3NOEA 4GYPC 4GY7A 3PTMA 4O13A 3FA4A 1XL9A 1IWAA 2NXIA 5CPSA 3QHOA 1M7JA 1WE5A 2ABAA 4PGLA 3O07A 4AD4A 1FRBA 2PS2A 4C6FA 1IEQA 3AMKA 3MI3A 3N13A 3C2RA 3IV8A 1HO4A 2RGMA 4LAKA 3EX4A 3V0SA 3LCIA 2YFOA 3C2OA 1J12A 3E5PA 3I7SA 4C6OA 1E5JA 4AZBA 1W1YA 1VLWA 3EDEA 4PH6A 4R88A 1GVIA 3EKGA 3T0TA 5LNSA 4H6EA 3GG7A 4LALA 3W7KA 2PWDA 3WQ6A 5C7VA 3CZGA 5JUVA 2BXZA 1LBMA 4ASTA 4YTTA 5A8NA 2I7GA 1G01A 4H9ZA 2V5CA 3UD6A 1TX0A 3IEBA 3HV8A 2G97A 2IXUA 1XCXA 4Z2KA 3VD9A 2E6AA 2I14A 3NOYA 4CQDA 4BI7A 2ABBA 1MEWA 3IIZA 1KRAC 1UJQA 4BFAA 4RXGA 4FLRA 2X1UA 2D20A 2HPIA 2W79A 3FY1A 3TIMA 1Q5MA 3QXBA 4N7QA 3TN6A 4UTHA 3FVDA 1R85A 4PMJA 2GK1A 2JKEA 2G37A 3GW3A 4WVXA 3GS6A 4L1XA 1J6PA 3BLDA 3TV8A 4DBDA 4EF9A 1P1MA 1IGSA 3QKEA 1B30A 1UUMA 3WJXA 4YMZA 3TKFA 1GORA 1XJBA 3WCZA 4Q8TA 2BX7A 5CPMA 4YCPA 1TQXA 1NM9A 1D7FA 4XAPA 2F7FA 3KBJA 4J4KA 3BW2A 2KX9A 1X8CA 3GH4A 2B81A 3TMLA 1H41A 1MXGA 1OX5A 2XJ7A 1UYQA 1A5KC 2INEA 3VM7A 1C29A 1EXPA 1SGJA 3WLSA 1TPFA 4F3HA 2JEQA 1HKWA 1ME8A 4OV9A 1CGVA 3HM7A 3GTHA 4HPXA 1PL9A 4IQDA 3GVGA 1YPIA 3G0XA 4QG9A 1A4MA 3LG3A 4AU0A 4IX2A 3M0MA 2QJGA 3TJ4A 3SCUA 4FX7A 3MCOA 4ZO7A 4LVFA 3ATZA 2VGFA 4JTGA 2YZ5A 5I5RA 5HUOA 2E4TA 2WHKA 2X0YA 2BV9A 2FTYA 4GX9A 2O55A 4BR1A 1OT2A 1R3QA 3WFLA 4M19A 1V02A 1LBFA 4ZA0A 3GXDA 4RZ5A 3EBVA 4JFVA 5GPRA 3VNJA 3LGDA 1XD0A 1Q6OA 4JIHA 3ME3A 3VZXA 1R3RA 3G22A 1VIZA 3MC5A 5A8GA 1FWSA 1WP6A 1OADA 1JZ3A 4DUXA 4XZNX 3RU6A 3USZA 4HGXA 2P1FA 4NIRA 3GDBA 5J5RA 3ONCA 1W1TA 2BOEX 2C71A 2RGLA 3B8DA 1HJXA 2ZE0A 4RKAA 1KKOA 5AOUA 1PKMA 4EF8A 1MQPA 1XYZA 2Y24A 2NWSA 3PTKA 4J3ZA 1BYDA 5JBEA 3THQA 4RUBA 2X8RA 3AJXA 3VOIA 1B31A 1GQIA 4E3TA 1DTUA 4B4HA 4H00A 3R2GA 2RUSA 1CIUA 4K68A 4I5UA 1YRRA 1KBIA 1S46A 2VCCA 3AMGA 1W3NA 2YYUA 4DJED 4LF1A 3EA2A 5BWAA 1GEQA 2P10A 3GHRA 4UMBA 4TXEA 3TNOA 1M53A 3BV4A 5KETA 1CZ1A 4NSBA 2VYOA 1HTIA 1GNXA 3CUGA 4EWND 3LUTA 4JTSA 2ZZ6A 2Q6ZA 4M6QA 1YIXA 2WVVB 1AJ0A 3ZM8A 1PKNA 2V9DA 3GYEA 2X1RA 3W87A 4CN1A 3MP3A 3V75A 1YXYA 1RLCL 4LCRA 3ARWA 4Q6XA 1S5NA 3UPBA 2XN1A 3PWAA 6CGTA 4WKHA 2GQAA 3QOKA 3KFTA 1I8JA 2ZTKA 2CYGA 5K7JA 3IJDA 2HK1A 4LVGA 3L5MA 4U2YA 1ITQA 3W6MA 3QYQA 1PPIA 4R7JA 3W7GA 3U8GA 4K39A 4PTDA 2W9MA 1PKLA 3P82A 3FA5A 1GG1A 2XIBA 5GQBA 4IQEA 4AWSA 4WGHA 3NQFA 3FYOA 1MQRA 3GKAA 2D2JA 1WYIA 3F5JA 3GFYA 5A2AA 5I77A 4XSLA 4ZO8A 4H9VA 4WQ6A 1J2WA 4NYUA 3LHUA 4M56A 2OQHA 4S3CA 4GQRA 3FXYA 5BRQA 3SJ3A 3NL5A 2J7DA 3MW7A 2POZA 3O6AA 3BC9A 3SRDA 5HMSA 3PFRA 1U83A 4EKJA 4YWSA 2W6RA 3W7HA 3E74A 3G3DA 1UWIA 3MB9A 2YB1A 1S5TA 1DV7A 4E5TA 2OEMA 3QKZA 3RPDA 3N19B 3NG3A 3RU8X 2PLKA 3R7MA 4A8NA 3QF0A 1O12A 3DI1A 4WZHA 3HPXA 3VXGA 3KCJA 3GFZA 1J0KA 2DJLA 2NV1A 1WA3A 1RQEA 5FSDC 1W2PA 1DWJM 5FIPA 3AYRA 2BOGX 3GK0A 4KERA 4FF5A 3VGEA 1X97A 3H23A 4Q33A 4JQ4A 1J01A 1JG9A 1XIMA 1VEOA 2ZADA 2NT0A 2P3ZA 4J27A 3ZT6A 1GKRA 1XC4A 1VPQA 4GKLA 4YXGA 3BLFA 3OU8A 3UZWA 4A3QA 4QP0A 3DCPA 4UQEA 1VCVA 4REQB 3VNDA 2WMHA 3EXTA 2O9OA 2PP1A 5CBJA 3M16A 2PGRA 2A6LA 4S3FA 1UHVA 3CMJA 3PB2A 4O11A 4JTAA 4GZJA 7ODCA 4MWAD 3PN8A 2V3DA 1FOBA 3CLWA 1MW0A 4CVWA 3EOUA 4E2DA 1P43A 4MTVA 3BJFA 3QGKC 1RJPA 3CMFA 1QK0A 1TV7A 3MUIA 4JX4A 3TYCA 3H2FA 3TN4A 2OLSA 3I6RA 4HMEA 1O4UA 5F1VA 2A7NA 1QDSA 2DVUA 3L2MA 4CNSA 3UWQA 4AFYA 2CHRA 2X2YA 2HWGA 4ADUA 3USBA 2A3CA 1RALA 1DQXA 4Z1AA 4AEFA 1G0CA 2DSZA 4K8EA 1J2BA 5KZMA 3WD1A 3SAZA 2JGQA 1DXIA 3PPHA 1HNYA 2QDHA 2A79A 3OVQA 3C2YA 2E1DA 3Q4DA 4AD0A 5IBXA 2BMBA 1IEVA 3W73A 2RDXA 5D2WA 4MUZA 2V5JA 1VS1A 5FF3A 1FCVA 4LF2A 1WNOA 2GWNA 2IKGA 5D9MA 4IXXA 4PRRA 1NOFA 1UZDA 3QV8A 2PTZA 1R8LA 2YW3A 4RW3A 4GKTA 5FCZA 1PZ0A 2POTA 2PZ0A 1X38A 4CNNA 2PODA 5KINA 3N2MA 2ACSA 4NXKA 4O18A 3VMOA 4GQGA 2AL2A 3HO8A 3G1VA 1EP1A 3LRKA 3GSMA 4WOZA 1XWYA 5JBDA 4FNUA 4DJEC 3S1GA 4MF4A 3BO9A 3GR8A 1GZ1A 1GYNA 3M6YA 3C0QA 5JH1A 3NQAA 2QMKA 2GQ9A 3GG1A 1BLIA 3E12A 3VOCA 2BDQA 3KDNA 1PEZA 3LQLA 1E6SM 4PULA 3S6TA 6TIMA 4LH8A 3J7HA 4N6FA 1B3ZA 1EWDA 4X0NA 3NSXA 4Y9AA 2C0AA 4YJ5A 3W4RA 5A8QA 3OEXA 4W93A 1UKSA 1UG6A 3AIRA 3SY1A 3GTFA 1H3GA 3A64A 5E9AA 1AL7A 4UBPC 4LUYA 1FWIC 4EAYA 4Q8OA 4HA0A 1XYCA 1YTEA 3SCTA 4OU1A 2CC0A 1NELA 4G56A 2PDYA 1FWBC 3LB0A 4HN4A 3TOYA 4EP8C 4AY1A 1YX1A 2F2KA 3MSGA 4O15A 1XPYA 2PWUA 3GAKA 4AF0A 2ICSA 4HNOA 4KEVA 1G94A 2ACUA 3NL3A 2JGYA 1JPHA 2E5DA 1CBGA 4QNEA 1NVMA 4KEUA 3WLTA 5I78A 3EX3A 3ABRA 2J47A 1BTCA 4S2CA 3LCLA 1M3UA 2DIJA 1UW9A 1NWSA 1FWFC 5I3JA 2VMFA 3NQBA 2ISWA 4HZ6A 3UY8A 5GVJA 4AWTA 2ZZ1A 5I6SA 1TTQA 5DT7A 1J8VA 1S2CA 3ITTA 4RLIA 3T07A 1TV3A 3LENA 1O5RA 4H7ZA 1QK2A 1PKYA 3BGGA 2P88A 2G95A 3QTGA 1RP8A 2PDJA 2YKKA 3MVIA 3OHMB 5FL0A 4OZOA 3BZJA 4O52A 3VNIA 4MY9A 2FH6A 3PS7A 1W9DM 5BXPA 3PUEA 1UMLA 4QHRA 1A5OC 3AUOA 4H4IA 1JNDA 3O6DA 4H1ZA 1YDYA 3BLKA 3QOMA 1JPMA 1EOMA 4AXNA 1V6TA 4RDWA 1BF2A 1O68A 3WELA 4CCEA 1EJTC 3KVMA 3CT2A 5D2XA 4UZUA 3ITVA 3SCWA 1YW1A 4RDZA 3SSJA 4IL2A 4LCQA 2PDQA 1JI2A 3WQ8A 2XG9A 4LBSA 4AZ7A 4BKNA 4AC7C 4F0SA 2DY3A 2Z1SA 2INZA 4IIGA 4DO5A 3I68A 4DNMA 3LPGA 1E51A 1X8FA 3CL6A 3LXBA 1H5VA 2F9RA 4YL2A 4ZSTA 3R58A 1NH6A 4AY7A 3TLQA 3CV1A 5T26A 5DELA 4UTFA 4AZIA 3OZYA 2HV5A 2QXWA 4JNYA 2I5IA 4C5YA 3E02A 1NP2A 1R3YA 3QRHA 4D6DA 3NO3A 3EPOA 4LV4A 3O06A 3LMYA 3IAPA 4ZTYA 4PC8A 4HU8A 4EPEC 4KS0A 4DX3A 4S3KA 4UIOA 1HJUA 3LSBA 2OQLA 3XINA 3CUJA 2ON3A 1SYTA 3KRBA 2BVYA 1OC7A 2QT3A 2C0HA 4FOUA 4UFHA 3RPTA 4XWUA 1JRBA 4GO8A 4HVXA 4AX6A 3QN3A 1E56A 4JZ5A 3UFYA 3GXPA 5FJOA 1H2JA 1VRDA 3H4GA 1Y5WA 4MWAC 1POJA 3UR7A 1H50A 3CMGA 4JYEA 3S1VA 4I6KA 4NX5A 3W22A 3WLKX 4G6CA 2Q8XA 3S0CA 2NUXA 4HU3A 4IJBA 3DX5A 4EOUA 5B7YA 3GC2A 3CJPA 2JALA 1DJXA 3QGAC 4W87A 3II1A 1BD0A 1JULA 3SR7A 1QO5A 2X1IA 1UH2A 3BE7A 2B7QA 2Y5JA 5AY7A 4HSHA 4H9YA 2YL5A 1DJHA 1FHVA 3I10A 4YWIA 4AMCA 3RR4A 4Q4OA 4PSRA 4DY1A 1GVSA 4P8WA 4IUGA 4NZFA 1TRDA 1US0A 4Y7EA 3W84A 2QCDB 1F2JA 1QW7A 3WY1A 1W8SA 1OG0A 3MQTA 4GGBA 1LRNA 1A5NC 2PLJA 3KOYA 1K6AA 1NF0A 3SCOA 2P50A 1LOLA 1QT1A 2AAMA 2NX1A 2YXGA 3FKRA 2E1WA 4IG2B 2Y63A 2GVEA 3ZSSA 2GVGA 2DT0A 3T6CA 5B80A 1Z32X 2V2HA 1FH7A 2ZA1A 3N12A 4LC6A 3L4YA 3FXGA 3FJLA 2OQYA 1TA3A 3WJSA 3AMLA 3N29A 2Q8LA 1KLYA 1JDCA 3WMCA 1YXCA 5AZ0A 5A8OA 3EEZA 3F5KA 2PTDA 2WKLA 3RG6A 1XDLA 1FKXA 1ECEA 2ZRWA 5TQLA 4JL1A 5XINA 2BHYA 4OOUA 1QVBA 3WH9A 3S9ZA 1SFTA 3APTA 3UEQA 1XH0A 5G4HC 4HNLA 4U4MA 1HF6A 2DZWA 1Y65A 3R0UA 1N82A 3WQEA 4YPJA 4IMDA 2PD9A 1DE6A 4JYDA 3NGFA 4V15A 4ZXOA 4ZQOA 1VBGA 3E6EA 3B9NA 3AICA 4JTCA 3WJYA 4JIRA 2OWXA 3B03A 3NUKA 3S2JA 1A5CA 2CZFA 6A3HA 3W85A 1J9YA 3ARRA 3UWZA 1T96A 1TVLA 4B5SA 4PYSA 3HGRA 3N18A 4GXMA 4YN5A 1YEYA 3W74A 2F2HA 2BWGA 1ZFJA 4L61A 4ZOBA 1LCOA 4TX9A 3IWPA 3TN3A 3M0XA 4YTQA 2D3NA 1PIFA 4GCAA 5SWUA 4NAFB 1VFOA 4MDPA 2WC4A 4JD4A 2ZX5A 3COTA 4A3YA 2X30A 3E0WA 2QDDA 1FP9A 3KCOA 3D3FA 1K77A 3CHEA 5A6LA 4AHOA 1GVYA 3G24A 3LSCA 4JY9A 1HO1A 2YBUA 4I90A 5LIYX 3FDKA 5IOBA 5FF2A 1NTHA 4A21A 1X39A 1KFEA 4YTRA 1VB9A 1C92A 3QW4B 3LCWA 2FZDA 4OKDA 4UNIA 5AHFA 1R47A 3TNBA 1W1IE 3KVLA 2BLEA 4PTXA 1W2VA 4E4PA 3LV6A 1OZMA 4V2XA 5AVNA 1E4NA 5CCZA 3IGXA 3NEHA 1I2QA 1MVYA 4EXAA 3WQVA 3L4VA 4LRTA 1Q6QA 3W81A 2HBXA 3R12A 5JXQA 4AISA 3CASA 3D6NA 5ABHA 3ARQA 1Q8JA 4KCVA 3OQ8A 4JDYA 1SFSA 4B3LA 1KFBA 1XLDA 2DZBA 2OODA 4ZMGA 4GYJA 3W7NA 1KCLA 2HNEA 3HFTA 2HS8A 2DH3A 1OYCA 3GLCA 1TELA 3RITA 2W91A 3HQNA 5T9CE 3POHA 3QMTA 2ZUWA 3IIPA 3BGAA 1XS2A 2WXDM 3OQEA 3DHPA 3B8UA 5DF0A 5HNTA 2VJXA 1XGEA 2OYKA 2WVUA 4ZEPA 4DF1A 3A3XA 3WD3A 1NOUA 3RRXA 3IJ7A 3QZAA 1SR0A 3SUUA 3CO4A 2XN0A 1XINA 2PGWA 4L6HA 3MSDA 4BS0A 4U33A 4XISA 4DBEA 4UWMA 3C52A 5E0CA 3W1PA 4CD8A 3GG8A 1UD6A 3PHAA 4WXYA 1FA2A 1ITXA 2D73A 1KTCA 3G1YA 2GDUA 4XD6A 2X7VA 3FHQA 4O14A 4B91A 2W63A 2GDQA 1MRQA 2ATMA 3WG6A 4OBRA 2OZTA 2WBKA 2Z4GA 1PJ9A 4XAYA 3GR4A 1R46A 5FKYA 2DIKA 3WBEA 2OB3A 1V8EA 5D04C 4DWSB 4YTUA 3PY2A 8CGTA 2HVNA 3AHTA 3QLDA 3FIGA 1E9LA 4X63A 1IZCA 2QV5A 2HZGA 1P4CA 3PBGA 5AC7A 3OOQA 4IFRA 1A0EA 3NYZA 1HKKA 4ATWA 3MMWA 7TAAA 5F4XA 1ZLPA 3T40A 4PCPA 2AGTA 1Z9AA 5K9XA 1EGVA 2HXTA 5DMNA 2D0GA 1VBUA 2WHMA 1EEPA 3M43A 4KCUA 4N0RA 3LOTA 2V2CA 3UWYA 3DFNA 2IQDA 1QHPA 1TZ9A 3PVFA 3S3GA 1VEMA 4E8GA 4XKYA 1EJRC 1W37A 1W3TA 3SECA 3WDIA 3PJTA 2CBUA 1E4LA 5HMFA 1CTNA 1OFEA 4QROA 3AO0A 3Q58A 7TIMA 2IQ0A 4KWOA 4PUDA 3WQPA 1E40A 1BTMA 1CGUA 3PTDA 2Y7DA 2NQ5A 1P7TA 1UZ4A 1H09A 1WXZA 4XUYA 1UASA 4G7EA 3LV5A 2G41A 1S2VA 3VIHA 3EPMA 5ABFB 2IXVA 4QCEA 1QOPA 5E5CA 1FVPA 5DY2A 3EXRA 2BTMA 4UMAA 5AHMA 1AJ2A 1W5QA 2JF6A 4PB5A 3ZR5A 2R82A 2Q02A 1NIUA 1ZTVA 1V79A 1PX3A 3ZO9A 4MIMA 1DWGM 3BG5A 3L2IA 3M0ZA 5BYWA 2VFHA 3EDKA 4C90A 2QPUA 4NAEB 4KETA 4ZL1A 2OCZA 4ATLA 3OZPA 4LC8A 4MMWA 3GNNA 4QG8A 1D3CA 2R8WA 3N2BA 3RO6A 4AD5A 4QRNA 2WJEA 3A21A 4HHMA 3VUPA 3NM3A 1MEHA 2B4GA 5I3IA 1CXHA 4HU4A 3WLQA 3WEZA 1V77A 2OYMA 4PFHA 1KGUA 2WOQA 4QAWA 2YA2A 1VJSA 3IJQA 4MNMA 1HJSA 2VEKA 3QR1A 2XGIA 3KRZA 2FTPA 3IAQA 2J24A 4ZR8A 2ZZ3A 4NQ1A 3UYIA 1UH3A 3DYOA 3SM0A 5BMXA 5H91A 3R11A 3DKLA 3H22A 1C8YA 1W8GA 1XLJA 2NXHA 1F3XA 4BWLC 3WD4A 3AXKA 3B9OA 1O7AA 2INFA 2BY3A 2MNRA 2GWGA 2J9YA 5LIKX 2QUTA 3PZ9A 1X1NA 1D3GA 3BLPX 3QLLA 1SM9A 2FZNA 1DVJA 3VD3A 1W17A 4EVZA 2CLPA 3ARTA 3WUFA 2DORA 1JUKA 3WF1A 2Z2UA 1UPPA 4H2HA 1IEIA 3GHUA 4OT7A 1S5WA 1E0VA 3WQFA 3L0GA 4LFYA 1PIIA 1Y5XA 1K8CA 1JCXA 3VDBA 1WB0A 1TWWA 3H2OA 4JQ2A 3BARA 5L6UA 4WJEA 1FKWA 4LAZA 4J35A 3W2JA 1Z44A 5C70A 2YL9A 1F8IA 1EPXA 1YLVA 2I5QA 4XTDA 5LIWX 3A9BA 1UR1A 4I3GA 1U1HA 2B31A 4TV5A 1JJKA 1K7XA 2ZX9A 2ZUMA 1HUVA 3WYZA 1DJNA 4AEEA 3IUHA 3MA8A 4GC3A 4D6JA 4IIEA 1CXKA 2Q71A 4JOMA 4OBSA 4AH7A 1KM2A 2XN2A 1W9VA 4A3UA 1UD5A 4V28A 3IUDA 3P5YA 3E0FA 2PFHA 3VIPA 1C7TA 1JFHA 1T8QA 1VGAA 2A3EA 2W61A 4XZMX 4FZIA 3EEGA 1DJQA 1K03A 4CGTA 4IIHA 3KTCA 5AHLA 1LRTA 3OB8A 5H8UA 1W32A 4H6KA 4DLMA 3UYCA 3U7BA 3UWVA 1QNSA 3FGCB 4AWEA 1V7AA 1D9EA 2Q01A 2TYSA 1MWOA 1CLKA 1VPXA 1W3IA 4JTKA 1HL8A 4RXFA 2P8BA 3LU2A 3UWUA 2ODOA 4AVNA 1VCGA 4GVHA 4DN1A 4HYRA 4GC4A 4NILA 1WAUA 4P8UA 1WKDA 2A3LA 2WVTA 2VTFA 2Z6IA 1TJ2A 1XQLA 5FSEC 3L12A 5HWMA 2CLHA 3O8AA 5CQ1A 1DWAM 3AXHA 4A2RA 1EF3A 3AIEA 2WC7A 4X0VA 2EPHA 2F6XA 1P6BA 3E5BA 1UKPA 1OFBA 4AZ6A 3T1GA 4IM4A 1ALDA 1GQJA 2MANA 2GSEA 3NNTA 1H7XA 3MZ2A 1XBYA 4Y90A 5FJTA 3S8HA 4QX4A 5LZLA 1U1JA 1XBXA 4PMVA 3LHWA 1TWSA 4GWEA 1XICA 4RW5A 4WX2A 5D8WA 1HKJA 3A6OA 2VWSA 4IXHA 2H9AB 3EWCA 4BQ4A 1L6WA 1FHLA 3AS2A 1BSLA 5C2XA 1XIBA 1M41A 2C16A 2B7NA 3RAOA 2HISA 3WD0A 4E3VA 1UH4A 1VJZA 3NDOA 4GGHA 3PZTA 1V4YA 2PWHA 4EXQA 4ZO9A 3DG6A 2J62A 2OLAA 3LA4A 1Y5VA 2BY2A 2E0PA 2W3ZA 5CBIA 5LNVA 2GVYA 2A21A 4M1RA 5HBFA 2AKZA 2ZIDA 1PXGA 1LZOA 1BGGA 2ZBTA 1LYXA 3HV9A 1G1YA 3T4CA 1B5TA 5EMMA 5I03A 2V8ZA 1MW2A 3N4AA 3UG3A 5HPCA 3IK4A 2IUZA 2REQA 2V67A 3WEOA 3LERA 4CU8A 4GQQA 4PUUA 4HMDA 3BAWA 4AYSA 4JTQA 4U31A 1G7VA 3ALFA 2YL8A 1XHGA 4JIIX 4CD7A 1VF8A 3E49A 1QPKA 1FP8A 4LX4A 3AXXA 3E0LA 3AROA 4NAEA 1GHRA 2VFFA 1J0IA 1IT7A 4ML4A 3MVTA 1XG3A 4PMYA 4ZB0A 5LA0A 3ANYA 3UPWA 1QFEA 3AS1A 4L9ZA 3GIPA 4M6UA 4JFTA 2PDFA 3APGA 3FOKA 5H2ZA 1HJVA 3NQGA 1FCBA 4F0KA 4MFDA 1PTDA 1EJSC 3PBYA 2PWFA 4LUJA 5CG0A 1PYMA 1QBAA 3HGSA 4WJXA 3KRUA 4WR3A 3ITYA 3R13A 5EMYA 3A5VA 4IISA 1X1OA 2DVTA 2ZUSA 1RPXA 1D2KA 1VJIA 1WBHA 1CT5A 4C1NB 2FMNA 4EACA 3I65A 3TQKA 4FLQA 4L65A 2PU1A 2PDNA 3RX2A 3WLIA 5KITA 2HPMA 1XYMA 2BXYA 3MKKA 2PCQA 4ROQA 1NY1A 3SI9A 1W3LA 5EFFA 4PMXA 1GOWA 1RH9A 1SUXA 2FYMA 2LLEA 4GUIA 3V1PA 1JPDX 1YBQA 4RJEA 3YPIA 4JQ3A 4UTJA 1QPNA 1B57A 4ZGYA 5CAKA 3LHTA 3L21A 3LYEA 3UG5A 1I0BA 2O9TA 4A3RA 1ONXA 4NZ3A 2QCGA 4UTTC 5FESA 3UZXA 1YPFA 2FGZA 1FWGC 3CZJA 4Q7IA 2ZZ5A 1SO5A 3QQ1A 1NP0A 1EBHA 3F1QA 3GVRA 2VGIA 3BICA 2CLLA 5D8ZA 2Y5EA 3GX9A 4Y9OA 1MW1A 4R3UA 3BMWA 2YSWA 1ONWA 1KCXA 3I3DA 3CEUA 4KWSA 3MU7A 2E67A 2PD5A 3VNKA 3R0DA 2F6UA 2WSPA 1ITUA 2EHHA 3BJTA 4K7VA 3OIHA 1EJXC 3PBUA 2AOSA 3REQB 1A3WA 3V5OA 2OEJA 4S3JA 3NQ7A 4PL2A 3OIXA 2WZIA 2J9ZA 3NXFA 3UA3A 3C56A 3PSWA 1EQCA 3POCA 4Q8WA 1F6KA 1PDZA 3CEPA 3HGOA 2KAUC 1F3EA 1DIDA 1PZ1A 4AHPA 1R5YA 3MS8A 3GDMA 2WMIA 3UZYA 1ZENA 3MUZ1 3NVDA 4L4MA 5A2BA 3MTWA 1MXSA 1WPCA 4WD0A 2VQTA 3ONBA 3LN3A 3TWAA 5ECVA 1Q7QA 4Z2LA 8A3HA 2WZEA 4N42A 1U30A 1OFPA 1J0HA 1A5SA 2BHUA 4KRTA 1TTJA 1GZGA 1UWQA 3WQWA 4F4RA 5LIUX 2OKTA 3MP4A 1DP0A 3N6QA 3IGSA 5M5DA 3D47A 1MW3A 1OK4A 1TV5A 4BF9A 2CLKA 5FAGA 2PA6A 2OX1A 1TPDA 1PCWA 2WMGA 3S5SA 4DM1A 4JX6A 3CAKA 1OT1A 1TPWA 3AYTA 4UR9A 3RF9A 4FR1A 3BLLA 3M0VA 3PSVA 4KCWA 2VWTA 3H2EA 4AEOA 4J3UA 1DBTA 3KLKA 1OX6A 1EDQA 4V1XA 3NDZA 2CBVA 3KUMA 4OFCA 1BG9A 3NDYA 3DYMA 2FQIA 3V0TA 3I4EA 3NZ1A 3L4ZA 2GVJA 1NJJA 3T09A 1ITCA 2B7PA 1HXJA 1A3HA 2O4QA 2GSHA 2ZTJA 4LB3A 2QKFA 4F79A 4AAJA 1VAHA 3UXLA 1LL7A 3T8LA 1OGGA 1BF6A 4I9TA 3CTTA 3VZZA 3VNYA 3ID7A 2CZVA 1VCFA 4MKSA 3CU2A 1UWAA 1PWMA 3EWYA 4NVTA 1RY8A 4JCMA 3W07A 1XIIA 2NV9A 3ORWA 1ISWA 3UA4A 1U5JA 3UZZA 4OWGA 3BXWA 2UBPC 1E1CB 5IDZA 1LOSA 4TVUA 4J28A 1KM3A 1TCMA 5DCEA 2CITA 1Y0EA 1DJZA 4MSSA 2YXOA 1UC4A 1I60A 2OJPA 3ZIZA 4HJWA 4E0CA 1EPVA 5FF7A 1JQVA 1R86A 5XIAA 2E8ZA 1IE7C 4URIA 4PB4A 2F8QA 2QW5A 1YNQA 2VOMA 3LX9A 1XLMA 1XBZA 4O0QA 3B0XA 5C2GA 1L8PA 4C6JA 3CZEA 3FJNA 4KESA 4XZLX 3NL6A 1P0KA 1BWKA 3NZQA 3NFUA 4DM2A 2BHZA 4Z42C 1Z6KA 5A6AA 3HN3A 3QV7A 1U22A 1KBBA 2OXNA 1QHZA 1EC8A 2DZTA 1BRLB 4FXSA 4GG9A 2IKIA 3EWZA 2O56A 1RY0A 4ZODA 3VCRA 1M03A 3EOOA 4WLCA 1QBBA 4GABA 1UP2A 3MO7A 3PG8A 1KWKA 2FPTA 1BWLA 1B54A 4ZXLA 4IJCA 1R3VA 3G2GA 4CVUA 4UQBA 7XIMA 2RDTA 2VDGA 3SO7A 4GXWA 2PTXA 4UFLA 4K8HA 3VDGA 5BU6A 3W7EA 2PDHA 3T08A 1RCQA 3OVGA 3WL0A 4UNLA 1VBRA 2NQJA 2DT2A 4LS2A 1AA1B 5HJYA 3W1MA 4M7SA 2PP0A 3BWWA 1SQ7A 4MJ2A 3ZVHA 1MFVA 2YIHA 4ZBCA 3MI2A 3UESA 2Z1VA 4GH3A 3GNPA 3GDTA 2PI6A 1SJAA 1WQ5A 4MGGA 4BK9A 5CPNA 2EF9A 3TYEA 2I57A 3HBLA 4IWWA 3B8IA 1JUBA 4HPNA 3UG8A 2Z0IA 1XLGA 1YYAA 1K3UA 3BVJA 2YCIX 4KPLA 2JKPA 1W54A 4DHGA 2WZHA 1HZYA 3GXFA 2FZMA 4R9XA 1F73A 5KZEA 2PWEA 5AC6A 4MY8A 5FJPA 2D3LA 1K7EA 1V93A 3W1QA 2V81A 5CZKA 1RV8A 3QZEA 4FX6M 4HSNA 3BW3A 3GDLA 3FFSA 2YX0A 2CLFA 1EO7A 1OC5A 1QPQA 3EKZA 1J0YA 4L5ZA 3V36A 2DGAA 4F8XA 4L1GA 3OJGA 2WPBA 2J79A 3PAOA 2DVXA 2CNCA 1QHOA 2QUUA 4QGCA 5KMYA 3FYPA 3MJYA 4E6MA 3NQ2A 1V5XA 2GGJA 1Z41A 2CKSA 3HFYA 4WY0B 3U5YA 3M0LA 4KFOA 2A5HA 3N15A 1MMFA 2RDWA 2V5DA 2VCAA 4MPQA 2XDFA 2V6AA 4X2PA 3BTNA 4HTYA 3UR2A 3VIIA 3B8VA 1KO0A 4QXIA 3O0FA 3VILA 1F07A 1X6NA 4CQCA 1FWDC 1J18A 4AIEA 4UC5A 2WMKA 4YU1A 5FF0A 2CWNA 3W28A 1JPKA 1VFTA 2PZNA 2VP8A 1ENUA 3WBWA 9RUBA 3MYPA 3ISIX 1YHTA 1EGZA 5A6KA 1Q6DA 1H5YA 1TVNA 4IFKB 2C1IA 4LRSA 1MEIA 5EMLA 4JXCA 1O1HA 1CNVA 4BQ5A 3TR9A 3F2DA 4N4PA 3NQDA 2QCEA 3GIQA 1LP6A 4OE7A 3GBEA 2VGGA 3NL2A 5EMUA 3A4XA 1OYBA 5D03A 2E5CA 3BZGA 1DTNA 1LQAA 3C8FA 5HJLA 5C9RA 3AIUA 4Y9PA 2AMXA 1JXJA 4ZQRA 3EOLA 1OC6A 4AIBA 3WF2A 3VKCA 1V0MA 4MM1A 2QPSA 3AHVA 2HMCA 1HW6A 3UERA 3SRFA 3UXIA 1H7NA 3VKBA 3NZRA 2PDLA 4S3BA 5KZ6A 2GLKA 2HDJA 3DFSA 2DZPA 1XR2A 5REQA 4X61A 5ABEA 1VZWA 4Q4RA 4IP5A 3TMQA 4RNIA 5U7SA 3TTSA 3C0LA 4OBTA 5BW6A 1F3WA 4LS1A 1C91A 4LUSA 4R34A 4F48A 2IPGA 3QH2A 3VDCA 5K3VA 5DRIA 1F76A 4CCZA 4I9MA 5CZJA 4F2TA 1FHUA 3B8TA 4I6VA 5GJNA 2IPJA 2D69A 3GQYA 1X6UA 3HMCA 3TC3A 3CUHA 2VNCA 1O1ZA 2D22A 2BG5A 1XKJA 3NAVA 4POCA 4DXKA 2GJXA 1K9EA 4PUMA 3T0BA 4J3TA 3LCXA 1ZP4A 4DZ5A 1HQTA 3KWSA 4A22A 3C2VA 4HHLA 7REQA 1WOBA 2DDXA 5H1WA 1QW9A 1ZAIA 5CJ5A 1VP5A 4DRSA 1Q7ZA 3B0VC 3LI1A 3FSUA 2FGLA 2G5WA 3DESA 5L9FA 2OTDA 1BKSA 4MVAA 1UKQA 5EKYA 2J8TA 4GLEA 5I0DA 3ITCA 4O1FA 2PC4A 4XX6A 1PV8A 4TV6A 5DXXA 1WDDA 3O0KA 5HQLA 4S3AA 3EOSA 1CENA 2G3IA 2X2GA 1S39A 1FWEC 1NDZA 2XIJA 1ZUAX 3V16A 1TE1A 1F4AA 4QEHA 2E9BA 1JNEA 4W9TA 3RDKA 2QZRA 3TONA 4UFIA 1NWUA 1SZFA 3PZIA