1S2WA

Crystal structure of phosphoenolpyruvate mutase in high ionic strength
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
258
Chain Sequence
KVKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
total genus 97
structure length 258
sequence length 275
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2wA00
1JDEA 5TAOA 4QG8A 3QV7A 1S2UA 1E0TA 3BJFA 2R82A 4B5SA 1PKMA 3VAVA 2VWSA 1MUMA 4ROQA 3QV9A 2HWGA 4B2DD 4LSBA 1F3WA 1AQFA 3FA4A 2VWTA 1PKYA 3QTGA 4YJ5A 1F8IA 3N25A 5JVLA 3T0TA 4QG6A 4RPPA 3KTXA 1DQUA 1E0UA 4TV6A 4MG4A 4KCWA 3EOEA 1XG4A 1S2WA 1O66A 3EZ4A 2OLSA 2V5JA 3R4IA 4KS0A 3LG3A 1ZJHA 2E28A 3HQPA 4G1NA 3FA3A 4FXJA 4B5WA 4L7ZA 2QIWA 1A3WA 1PKNA 3QV8A 4B5TA 2HJPA 2HROA 2XZ7A 4HYWA 1F3XA 1A5UA 1KBLA 3SRFA 3EOOA 3I4EA 1S2VA 3E0VA 1PYMA 3E5BA 3PUGA 4QGCA 4KCUA 3M0KA 2V5KA 1XG3A 1DIKA 2BG5A 1U5VA 3OYZA 2L5HA 4L80A 1UJQA 3IS4A 4IQDA 2DIKA 1F61A 2HRWA 3SRHA 3HQOA 4YNGA 3MA8A 3GQYA 3ME3A 2G50A 1GGOA 2KX9A 4B2DA 1IZCA 3OQ8A 1DXEA 4WJ8A 3P0XA 3QV6A 4IQEA 3GR4A 3LYEA 4TV5A 1OY0A 3PP7A 4B5UA 3QQWA 1IGWA 3GG8A 2VGBA 3HQNA 4MF4A 3U2ZA 3KHDA 1M1BA 4KCTA 3QLLA 2X0SA 1ZLPA 2XZ9A 4DRSA 4L9YA 3H6OA 3SRKA 4B5XA 1SGJA 2DUAA 4IP7A 1VBHA 4L9ZA 3T05A 4KCVA 1F8MA 2VGFA 3EOLA 4FXFA 1U5HA 1S2TA 4KRZA 3G2GA 1O68A 1Z6KA 3QZ6A 3SRDA 2WQDA 1PKLA 1VBGA 3M0JA 4HYVA 4IMAA 1OQFA 2VGGA 3E0WA 3B8IA 3T07A 2XDFA 4JPGA 1KC7A 1M3UA 2VGIA 4B5VA 1A3XA 1O5QA 4QG9A 3BJTA 1T5AA 1DXFA 2ZE3A 3OYXA 1A49A
chains in the Genus database with same CATH superfamily
1OSEA 1VKFA 1XDLA 1XH2A 5CC7A 3MY9A 3W0KA 3EWZA 4BF9A 3MUAA 2EPHA 2WW5A 2B7OA 3F4NA 3SIZA 5BU6A 3EA2A 3HB9A 3WN6A 4HHLA 4H01A 1TV5A 5IBXA 3VC5A 5A8PA 3T0DA 3DU0A 1JF6A 1QI0A 1XIIA 3XIMA 4YU1A 1BWKA 3WDRA 1DJNA 3F5LA 3CQJA 1HUVA 4N42A 1WDDA 1Q6QA 4MWAE 2J47A 4PYSA 3LRLA 4R7JA 3WD2A 4MAVA 1XBZA 4L7ZA 4V15A 1SZEA 4RE4A 3ZJ7A 1REQB 2HV5A 4NI8A 1E6RA 1TCDA 4JTCA 5G1TA 1HGYA 2WZIA 2OSYA 2HE8A 5KMYA 3SW6A 3WLPA 4CN6A 4Y8EA 2QMKA 4PGLA 1VD6A 3PZGA 4R88A 3WH7A 3BG9A 4IIGA 3HFYA 4IIDA 2ON3A 1HKMA 3K1GA 4ZGYA 3P93A 3B8UA 3W1TA 4HNTA 4ZODA 1GQKA 3PNUA 2QCMA 3SCVA 4ACYA 4MWAB 1KWGA 5FJJA 4UZSA 3WUFA 2WSRA 1ZLPA 1BWLA 2CXGA 1FFQA 1SGJA 3ARUA 1RPXA 1XLMA 4C6LA 5DF0A 4HZ7A 4A2RA 4LAUA 1YQ2A 4UR8A 5D04C 3THAA 1ITXA 4DXVA 4HA1A 5TD4A 5BROA 3H7VA 3VD3A 1PYFA 3KBJA 3UWVA 3FOKA 2EQDA 2D0FA 3H7RA 4ROQA 1CGYA 4DIAA 3SQMA 5JXQA 4JIIX 2VZUA 4Y8FA 3T0CA 2YSWA 2CWNA 1RXOB 4A35A 5I3JA 3TTYA 4IMFA 1FH8A 1BGAA 2KZHA 3RLGA 1THFD 3RDKA 5HATA 1XLFA 4QITA 2PDMA 4GH1A 1UP2A 1VEMA 3WL1A 2VX5A 4MY1A 1BVNP 1OFEA 4GUGA 3VOFA 1J9YA 1Q7QA 4NX0A 4Q4QA 3IJDA 2Y0FA 5CQ1A 1HL2A 1RA5A 4PFMA 5M17A 3OHIA 2YA0A 1K77A 4QAWA 4W8BA 1JFXA 2BY1A 5D38A 2YL9A 1ZY9A 4A8RA 3WQVA 1XLCA 1XLDA 1GW9A 2CLKA 4HP5A 1DQXA 2FH6A 3EEZA 5D30A 2VCAA 5I77A 1S5VA 3LMYA 3Q65A 4LVAA 2YKKA 3M44A 3W02A 4DXXA 4PMDA 3S46A 3GYEA 2YW4A 4ADSA 5CKSA 3ERPA 4MPKA 1VB9A 1KM0A 3TR2A 4BR1A 2QZRA 3M0MA 1RBAA 2WHJA 1KXHA 1OC6A 4O8AA 1KC7A 5A8OA 2Z6IA 2NLIA 2GK1A 4MAZA 3N29A 2O55A 3MCMA 3PBUA 4QEHA 1CIUA 1JG9A 1LCOA 1AD4A 1E1FA 1EA0A 5FOOA 4FEZA 3SGGA 3NQFA 5ABHA 4PMZA 4H3DA 1G1YA 4LVDA 4C6FA 1Q8AA 3KW3A 1AD1A 2WC4A 1ZJHA 1B4KA 3A21A 4GX9A 2JEPA 4B5TA 3V0TA 4IL2A 1S2AA 1L6FA 4XSLA 1HF6A 1EEXA 2EJAA 4L1XA 4RDVA 3DFNA 2DW7A 9CGTA 3UNTA 1HIZA 3SIMA 3PZ9A 2AKZA 2ZZ1A 1FWIC 4LGXA 3BURA 1TSIA 2VO5A 2R1NA 1FCVA 3E6EA 5DCDA 5L9FA 3LZ3A 1IZCA 4YYFA 1B3XA 4IQEA 3ZR6A 4HKPA 2X05A 1OCJA 1UJPA 5K7JA 3SDOA 2QDDA 4LCRA 1XIFA 1QPOA 3HURA 3B04A 3A6OA 3N4AA 1KCKA 1KGUA 3UCDA 2XN2A 4KFNA 1U1HA 5IFTA 3GU1A 4GUFA 3NPVA 2PB1A 3W24A 1CGUA 4GIAA 4LU0A 3EX6A 1OG0A 1QR7A 4JGDA 1QAPA 4AD4A 1E4NA 1KR1A 1R6WA 1JL8A 5A6MA 1LTDA 3M07A 3UR2A 2A79A 4GA8A 4A05A 3W27A 3KTCA 4UTKA 2UY5A 3FCPA 1V0KA 3KBSA 1QHZA 2J25A 2ZUSA 4RE3A 4Q4RA 2WPGA 2YDQA 4N02A 2ZICA 4MJMA 1DVJA 1NFPA 3TOPA 3OU8A 3NDOA 4Q8NA 5KEZA 1AH4A 2O7SA 1ZP3A 4JY9A 2BVTA 3LTYA 2A6LA 4U3CA 5DN1A 1W0MA 4YHGA 3UWEA 2J9YA 3Q67A 1YPFA 3MWCA 3K8MA 3E0VA 3S9ZA 1IEXA 4Q4PA 3A5VA 2YB1A 2ZRYA 3AXXA 1IXOA 5I07A 3QYQA 4LS1A 4CGTA 3VIOA 2DU2A 2NQ9A 1WX0A 3SZ8A 2E77A 4TVCA 2X1IA 3B8VA 2QJNA 3EMZA 1V7YA 4QDMA 4S3CA 3OG3A 1IEQA 2MANA 3TYBA 1RD6A 3BQ6A 4B4FA 4JTAA 3M47A 2YL8A 1F3TA 2BVWA 3GK0A 2Z29A 4JFVA 3LV6A 1XGZA 3FFSA 1EHNA 3W7NA 2DVUA 1ISZA 4XAYA 3G1XA 3WJZA 3AJ7A 1E6SM 1RR2A 2BZNA 3OQEA 3TJ4A 1Q6GA 4WSJA 1DJGA 1MSSA 1X6NA 4LNCA 1ZP4A 4G2DA 5AHFA 3T44A 2GSEA 2WHLA 4AD5A 1W9UA 1MQQA 3TQKA 4MSSA 4HZ8A 3DESA 5EMJA 3CLMA 3LI0A 2VFDA 2J6VA 5C2GA 3A23A 3E38A 3ZOAA 1VFOA 2Z7KA 3GH5A 2PGEA 5IBXC 3ATYA 5CZ0A 3G0SA 5LNSA 2X09A 1RLDA 3GG1A 2WNQA 5J04A 5D9MA 3EWWA 4TXEA 5A1AA 1XFBA 4PR4A 1F74A 3UWQA 2IQ0A 2OR2A 1ML1A 4NJIA 1HKVA 3UW6A 1E1CB 3JW7A 1XYLA 2F6XA 4LNYA 1NDYA 1GQIA 4W87A 3WQCA 4MZYA 1S5NA 1QBBA 4KH2A 2Q71A 1GONA 4MYXA 4ORIA 3KCJA 4HJFA 3RLUA 4IG2A 1L8PA 3CAVA 3VZZA 1CLKA 3BLKA 5REQB 2VOMA 7A3HA 3LK6A 4LUTB 4XZBA 2YBVA 1C7TA 1XCFA 4NZFA 3NQEA 3PM6A 1RJQA 4LY4A 4UB9A 1KWKA 5CLWA 1RK5A 3JRKA 1R86A 5ECVA 2UBPC 3ES8A 3AZTA 3ITOA 1A5BA 3CYVA 4UCFA 2D3NA 3SY8A 3GHTA 1WP6A 1VYPX 5I5RA 3QRHA 1ZZMA 4GJJA 3LCGA 4DZIA 1W1TA 3IAQA 2J13A 4HMCA 3JS3A 2QDEA 3ARRA 2OEJA 4J1OA 1FUYA 1B3OA 2E9LA 2FHBA 2A3HA 1WZLA 5JVLA 1AVAA 2FJKA 3PJTA 1CXFA 3V36A 5CPOA 3LHWA 3IVUA 2VQTA 3GTXA 3HU7A 1GOQA 1F6YA 3KL5A 3U0HA 2DJXA 2REQA 2GGGA 3QM3A 3PJUA 3ZR5A 3INPA 1YMYA 1JXJA 1PKNA 1O1HA 3H53A 2O4QA 5G1MA 4IZGA 4CQCA 1RJPA 3EA1A 1V08A 4GQQA 4DJDC 3LHVA 3UR5A 2C1HA 4HU3A 2VFHA 3BARA 4A22A 1CX9A 4HOXA 1F7BA 1JCMP 2FVLA 3CB3A 4FLRA 4M6QA 1A50A 5T9BG 2NQLA 3V5CA 1OIFA 2E1DA 2CBUA 1B54A 3BLLA 3QY7A 1GUVA 1I9CB 2DP3A 4TV5A 2OT1A 1K03A 4P8UA 1O5KA 2Z24A 1H49A 2E6DA 4WDXA 2XZ9A 4K2SA 3TC7A 4BEUA 1M7OA 5C9RA 4F8XA 3MKVA 2Y8KA 1B3ZA 1GKQA 1RVGA 1ITQA 4B15A 3EMQA 4AZCA 1M04A 1E4LA 4XX6A 5DX7A 3U7VA 3AMGA 1W9PA 5AKQA 1KRMA 2KAUC 3LPFA 1ONRA 3BTNA 4J7RA 3E9AA 3NQAA 1WAUA 2VP8A 3BE7A 3CIWA 4P5UA 3BCFA 1AK5A 2QAFA 2J7DA 3REQA 1CXKA 3VGHA 2OKTA 1CGWA 4H83A 1CCWB 4AWTA 4B16A 3LCHA 3M5XA 1ICPA 5TIMA 1O6IA 4DM1A 3KL3A 2ZDRA 1YLVA 4S3AA 3O2LA 3GO2A 1Q7ZA 1SUXA 5CGQA 3N2OA 1H51A 2X41A 1QNQA 2GGIA 3IUDA 1XH1A 4GABA 5LXEA 1WCGA 4JIRA 1KM1A 3IWPA 1UUQA 3SR7A 1F61A 4WKHA 1JUBA 4M5PA 4Q4KA 4S3FA 4D2JA 3VINA 4KIEA 5CSSA 2RDXA 1VR6A 4HCDA 2PZNA 2ZUMA 4RV3A 2I16A 1N8WA 3AYSA 1OADA 1K02A 5LIXX 5DANA 1X38A 3ANVA 1UH4A 3ARXA 3KTSA 5I3KA 4PB4A 1DWHM 2EPKX 2FZ8A 2DEPA 2IMRA 2VKZG 2J77A 2PDBA 3PTDA 1N82A 3T2PA 3CQKA 3V75A 1PZ2A 4MUPA 1S2UA 2IUZA 3WQWA 2DUZA 1WZMA 4GO8A 3R11A 3L67A 1ZJAA 4P8XA 4ADUA 2VC9A 2HS8A 2QEZA 2D22A 3LNPA 2WMFA 3T09A 1V6WA 4Q8WA 3DYMA 3TN4A 4ZQNA 2YBUA 4S3KA 4TO8A 1RSCA 2QCEA 3P6LA 4FZIA 2VR5A 4O1FA 4GG9A 2INFA 4O52A 1OFPA 1HO1A 4MFDA 1IT8A 3GDKA 3MI6A 3C2YA 4JKLA 3VM7A 3KFTA 1H7OA 1XC4A 1J6PA 3WZ0E 3NQ2A 3R10A 4JYEA 1UBSA 3G1YA 3PSVA 3NGFA 4K39A 3QYSA 1Z7AA 3QHOA 5DMMA 3KRUA 4Y7EA 3VM5A 2WK2A 1DE5A 1RZMA 3UF9A 1E0VA 4GY0A 2VQUA 3AIBA 1XYBA 2YXXA 1YTEA 4KRTA 5HMEA 3WUBA 4HNVA 4ZQOA 4WRHA 4JFSA 4E4UA 3PVFA 3W71A 1JJKA 1YXYA 4NF7A 4IMEA 4AZCB 3EXSA 4ENLA 1YPIA 1TWZA 2HNHA 3FYPA 5C71A 1EIBA 2W79A 4UMAA 4I6KA 4I7WA 4KEUA 3NL5A 2FPVA 5CCZA 2R1LA 1MXGA 4LBRA 3NURA 3TYUA 4LB4A 1KV8A 4FNSA 1TV2A 3MKCA 2CLLA 2DGAA 2QUTA 1OF8A 2V38A 3CBWA 1M7JA 1OX5A 1QW7A 1UW9A 9XIMA 1CTNA 3QKEA 4Q3MA 3WFLA 3QV8A 1Z41A 4LFYA 2YDSA 4BA0A 1H7XA 2D2HA 1SFJA 4MWAA 1L2QA 2QV4A 1EOKA 5FF0A 2PTZA 2R14A 4O50A 4EANA 2YL6A 1JGIA 3BVJA 5CBJA 4JNYA 2XWDA 3WKZA 1V3IA 4YS1A 5EBAA 4JQ2A 4GYJA 3W2LA 3IVSA 4Z0SA 1G4PA 2QQ6A 3SCWA 4PMVA 3DBNA 1ECEA 2ZZ3A 2BLEA 6TAAA 1CW2A 5LGZA 4W4QA 1HKJA 2I9EA 4C7DA 2VR4A 3OODA 2CETA 2XGBA 1Q66A 3SAZA 1RH9A 3B05A 3W1QA 4LY8A 1AQHA 3M0JA 3L4XA 1A47A 3E0WA 1N55A 3W2JA 1TTQA 3JVAA 1TPB1 1NFGA 1HZYA 3UT0A 2WCSA 4NNCA 3A3XA 3LNMA 3GG7A 1HL8A 3GXPA 1PKMA 4WEVX 1XWYA 4QNWA 3SI9A 2UY4A 2PDLA 1A5SA 5G4WA 1MFUA 1T41A 2PS2A 5U7SA 4J2PA 4LRSA 3S9YA 4U2ZA 3UR7A 3L12A 2VC5A 3O06A 4O0ZA 3OLEA 1YRRA 1MW1A 1NOUA 1XYCA 3RUBL 5CJMA 3FEQA 2PZ0A 1H09A 3C0SA 4J3XA 4AY7A 4XZMX 3HG2A 4C1NA 3PZTA 4K7VA 3TQ0A 2WSKA 2QUMA 1EC8A 3GNDA 2YJQA 3VGGA 1XIBA 3SCNA 5RUBA 1AH3A 3YPIA 1L6WA 4NIRA 4YHEA 3QBUA 4WY0A 3SN4A 1QDSA 4CVUA 1DIDA 4XQ6A 1GQNA 2OQHA 4V28A 1LORA 5HJLA 3MI3A 1H0GA 1W3HA 3NM1A 5FJPA 4MJZA 5DLCA 4F2TA 2XN1A 4JIHA 2QIIA 4LH8A 1MXSA 1OX4A 2AMXA 3WY1A 3W1RA 4CD7A 3WLHA 4WX2A 3GZAA 3MTWA 3LGEA 4M6VA 1KBKA 3B4YA 3RM8A 4JTKA 4ZO6A 4AY8A 3E49A 1BD0A 4TTUA 5JIPA 1BYBA 2OELA 3OVGA 3CIVA 4I7UA 1V0MA 3SBFA 4P7OA 4KFOA 2EEXA 3GU2A 2JKPA 1JCJA 2E6YA 4JPGA 4BWLC 2VZTA 3CC1A 4DX3A 1CXIA 2BOFX 1WXZA 2CERA 1TTPA 2P76A 4AYGA 2UV8G 3VNZA 4PTXA 3VIGA 3M0HA 4QDPA 4MKNA 3AOFA 4B92A 3WD4A 3BANA 1EX1A 3N04A 2JK2A 1EF2A 4Z2IA 3CQ0A 5KITA 4MZ8A 4IX2A 3VNDA 2VNCA 2OLAA 4X2PA 4GFIA 4GXWA 1LDCA 5I6SA 4CEXC 3WEOA 3TXZA 3AHTA 4H6EA 4QHRA 3GXMA 4PMXA 3APGA 5K2ZA 2DIJA 3G0UA 1R2TA 3QSRA 3TMQA 4D72A 1EBGA 1BKSA 1KKRA 5CPMA 1ZBKA 5HWJA 2FGLA 2BG5A 4AWEA 3OYZA 4FIRA 2W66A 3TAKA 5HOSA 3W6YA 1OD0A 3ITYA 6REQA 1JDDA 1E56A 2J4GA 4IMCA 3L4YA 3VOIA 5G2HA 3THCA 4QLJA 3N15A 2Y88A 3THUA 3KBMA 1S1RA 1TWSA 2ZDSA 1QNVA 3TA9A 4R53A 3LU2A 1KCZA 4AIEA 1HJQA 3H2FA 3B8TA 4O1AA 4GO9A 3CLWA 5CPTA 4YIWA 3ZR4A 1NELA 5C2XA 3NA8A 2E3ZA 3GDLA 3PB2A 3BMXA 2TRSA 2QCDA 3EB2A 1LL7A 1BLIA 3DZ1A 4GD0A 2PC4A 1SZNA 1LT8A 1H1YA 2VI0A 2WC3A 4E0CA 4NZ5A 4K38A 1NY1A 3PZVA 2D0HA 1R38A 4N6FA 3W86A 3OLGA 3KBWA 1XH0A 1GVYA 3EWDA 5G4EA 4AWUA 1W9BM 1WUEA 3BOXA 1JZ8A 3U48A 3LM3A 3N2TA 4HTYA 3FN9A 2HNEA 3FIGA 2NQ5A 1V93A 3SUSA 1NF0A 4H6RA 2BGNE 3DECA 5T8GA 1X7FA 1R3YA 5BW6A 4RL3A 2YZ5A 1UHVA 1FWEC 2QVNA 2NQHA 4UFJA 1UWRA 4UQBA 4Y9MA 3UETA 1W37A 2WQPA 1J11A 4YTTA 2P3ZA 1J79A 3RR4A 2RAGA 4ZQRA 2VD8A 2QT3A 4QDWA 1IT0A 4WXYA 4PBGA 3LM7A 1VYRA 3S8HA 1N7KA 1MEHA 3PC0A 3W83A 4YTSA 5FA5A 1DIOA 1PHWA 2FJUB 3VABA 4CQ8A 1DXIA 4RKAA 4UFHA 4U31A 2DQXA 1R85A 2D23A 2REQB 1OCNA 3CH0A 3ZYZA 1RD5A 4V1YA 3WJYA 5C9ZA 2WNWA 3W26A 3LY0A 5D37A 5BRQA 3OLDA 4IPNB 4PMQA 2I5IA 2WPBA 5D32A 1ISWA 4P61A 3TV8A 1CBGA 3D3FA 1E73M 4XZNX 4MKSA 1EX5A 3H22A 3VKBA 1EOMA 3C61A 3QPYA 3D0CA 4ZFMA 4I6VA 4Z0JA 2NWSA 3TSDA 1V3JA 1EJXC 7TIMA 3UWZA 3RJXA 5HMDA 2Z1KA 3KP1A 4DUWA 4GGBA 3OGRA 5K4ZA 2W91A 1HGWA 4GGHA 5JMUA 4V1XA 4DI8A 1QT1A 2G95A 3BV7A 1RALA 2C1GA 3PS7A 1ZCOA 1M41A 2FDSA 4GQBA 4IM4A 3R8GA 3VFCA 3W1MA 1OZQA 3TUUA 2PBGA 5F4WA 4RDWA 4GC4A 3KM8A 3L4ZA 3N12A 3KOZA 4I8YA 3VIJA 1RUSA 3KS5A 3V4BA 3I3BA 1UUOA 2HZGA 3MO4A 4FXFA 3CV6A 2BBFA 3FS2A 1UA3A 3WD3A 4N6EA 3G6MA 2YR1A 3TVAA 1Q3NA 1XIGA 4WD0A 4RXGA 2FIQA 4IMDA 3R8RA 3IIXA 1DHPA 4IUOA 3VC6A 1YTKA 3A9BA 4GYPC 2EO7A 1K3UA 1X8FA 3DHDA 2QPXA 3QSTA 4FNUA 1US3A 5GPRA 5CXPA 3UZXA 4WJXA 3BG3A 2Y7DA 4NQ1A 4U10A 1E72M 4ATDA 1RVKA 2V5JA 2NLYA 3LGGA 3VNMA 2I9UA 3KE0A 1UOKA 3U8GA 1C92A 1IWBA 4I90A 2WZMA 4M6UA 4D6CA 3P61A 3T81A 1GNXA 3O6AA 4Z2KA 4QCEA 3CS2A 3KHJA 3G3MA 3GVRA 2OWXA 3PULA 4MADA 3R5EA 2GUBA 3E2RA 2Y62A 1Q2SA 1MRAA 4JBRA 4MOZA 3LRMA 1C9WA 3QGKC 3PWGA 1I2NA 1Q6RA 2RGMA 4L9ZA 1LQ0A 2CC0A 3H2OA 4IPLA 1H2JA 2VZVA 3A9IA 1QOQA 2C71A 3GY1A 2RDUA 4Q4OA 1KM2A 5BWAA 1GJUA 4CQBA 4J27A 1DJYA 4B5NA 2DZSA 5FL0A 5C7HA 1TMLA 3RPDA 4OV4A 1V3LA 4JD4A 1M03A 4NUWA 4W7WA 3MW7A 5G5IA 1UD3A 1T8XA 4ICNA 2NV1A 2XSXA 3ZM8A 2WWCA 2ZXAA 1K4GA 4FF7A 1E40A 1ME7A 1VLWA 1Q4NX 2PDNA 3G1DA 3P74A 5M1TA 5CJNA 2V3DA 3EZ4A 3CUZA 1QTWA 2OZ8A 2DSVA 4AZ5A 4AH7A 2E28A 5LIYX 1AA1B 4JTHA 4ZZ9A 2MNRA 2JQXA 4JTUA 3LHYA 4MGGA 3DHFA 2GL5A 5AYYA 1L6SA 3RX2A 3F4CA 3GC4A 5BMXA 4MY8A 3ATZA 4CN1A 5EA9A 1GYLA 3M6YA 5CZKA 3VDBA 5BRPA 4AAJA 3F4DA 1KW1A 3QOKA 2B81A 1OVDA 1W5QA 5A6AA 4RNFA 1M9HA 4KWOA 2A85A 5E5CA 3V35A 2ANUA 1UKOA 2E8ZA 4FLOA 4KBXA 1I2RA 5C55A 2FLIA 3TC3A 3E74A 4JHOA 3H2CA 3PHAA 1F2JA 1UPPA 5DEZA 3W2MA 3HN3A 4A3UA 5EY5A 2CLFA 3NYZA 1C91A 3HA1A 5CPLA 1M5WA 3TIMA 1PSCA 2VZOA 4MWAD 1DXFA 2Z1XA 4H9MA 4RZBA 1O4UA 2PODA 3AI0A 3CPUA 4ADTA 2W6RA 1VENA 5MHBA 1XIDA 3GXTA 4NJHA 4DUVA 1P7TA 3M16A 3IRSA 5ENLA 4BWLA 3GUWA 4GUHA 4TIMA 4B9YA 3SECA 4WIWA 4GVHA 3S42A 5DT7A 3GNXA 4AHOA 1VC4A 4S3JA 4FR1A 2R1KA 2WKLA 3N34A 5D02A 4PTMA 5EMUA 4BF5A 2VFEA 2Y8VA 3EAUA 3CO4A 5I78A 4TQTA 1K9TA 1SMDA 4AG0A 4DJED 1R30A 4GC3A 1VGAA 4ZO9A 3L2MA 1WNOA 5CAHA 1EJWC 2IPWA 4YWIA 1HKWA 3W53A 3GG0A 4A3RA 4JY8A 4M51A 5DMNA 4RPQA 2XGIA 2AGKA 3VKJA 4XZ9A 2BHZA 4AZ6A 5C5YA 5EU9A 3WLQA 3VMNA 1KFJA 2QW5A 3NXLA 4U3AA 1XQKA 5FSEC 2X2GA 3UYIA 4O4VA 1W9DM 1TWDA 3GTIA 1EJVC 4O11A 3QH2A 9XIAA 3TW7A 4ZQMA 2CLEA 2OCZA 2VMFA 2X1UA 3OYXA 4CUCA 1FKXA 2V3GA 2PWGA 1WE5A 2XJ7A 3S0CA 1BYAA 4JS3A 2OTDA 4GCXA 5CEWA 3RU6A 1R2RA 1J0HA 3OVPA 2QGYA 3PZQA 1UD5A 4F2BA 4HA3A 1GVOA 3EOUA 3DHUA 2EPLX 1L0PA 3TFCA 2R9RA 2XFYA 2J6XA 2AQOA 4X9YA 1KV5A 1J93A 3MZ2A 2JFEX 2O7QA 1EEPA 3HBLA 3OZYA 2PRHA 1QJWA 2YXOA 3UPWA 2VUYA 2G8ZA 1QUMA 1WOBA 1W1ZA 1TV4A 3RXZA 1GORA 5GJMA 4O8RA 1UP0A 4DPQA 4DXKA 3GNRA 3IIVA 3ME3A 2VVNA 1EPXA 1GJWA 1Z69A 2QCFA 5I23A 3WQ4A 2GJXB 4EWJA 4JN8A 3HJZA 5C9UA 4MUZA 4S38A 1Q45A 4IP4A 4N9BA 1EC7A 1RV8A 4QRNA 5AYZA 2Y89A 1JFHA 3AIQA 1TUXA 4LX4A 3STPA 4LV4A 3EOLA 3HGOA 4ZO7A 3HV8A 2C8NA 3WNNA 1JYXA 2VC7A 1ICSA 3OJGA 1XYZA 2FPYA 2IPJA 2QCNA 3KVKA 2FZDA 5D9OA 5A69A 1V79A 3L4VA 4TTGA 2IQTA 3WEMA 4W84A 4GNJA 3S1VA 3OZPA 2QMJA 2GSHA 3IRDA 1EPVA 1FH7A 1JULA 1X98A 3S1XA 3TR9A 3L66A 2HTMA 4LT9A 5JBFA 1K1DA 3KUMA 1D3GA 3FA3A 3FLUA 3TA6A 3P80A 2W27A 4LB3A 1UH2A 1LBFA 4U2YA 3PG9A 1D3CA 1OYAA 2YCLB 1A5AA 4GZEA 1JR1A 1O5XA 5FJTA 1VHCA 3I4KA 4DBSA 5ABTA 4IWWA 3PZIA 1RPKA 3KZPA 3CMGA 3CMFA 5ABFB 2D2GA 2A3LA 1GVEA 3EOSA 4IGMA 5AYXA 3WBAA 1HJWA 1P48A 1CGXA 3WFAA 1XPGA 4GKLA 5AHMA 4F48A 3EA3A 2PC8A 1TQJA 1KRAC 1H7PA 2OJPA 5JBDA 1A5OC 2PDKA 2ATMA 1JZ2A 4Z2LA 2E6FA 3CAKA 1WQ5A 4I9MA 5K4XA 2X1RA 1H41A 3VA8A 3T55A 1O5QA 3N9KA 3LCIA 5C9WA 4QG8A 1D9EA 5D2VA 2R82A 2IW0A 4B2DD 1N8FA 1QXLA 1TRIA 4FAMA 3AXMA 3U7BA 3W82A 3GBEA 2YLAA 1AODA 2PWEA 1LL6A 3WEZA 4UQCA 5HJXA 1J6OA 1JIBA 4WF7A 3W7PA 2OX1A 1BFNA 1L9WA 2WJDA 3PZUA 3GX9A 4XKYA 3N9SA 1W9VA 3ALFA 4AQLA 3G1FA 4R27A 1VJSA 2V67A 2V2HA 2J66A 1MQRA 5DQPA 4AF0B 3ID7A 2X2YA 1XKJA 3O9NA 4R9OA 3GFZA 3PBWA 4MB1A 2PWDA 4AISA 3MDWA 4MHBA 3SFKA 3BH4A 3SY1A 1FWWA 3U2CA 2G4FA 1XSKA 2VXNA 8CGTA 3TE9A 4XIAA 3UG4A 4O0KA 4YN5A 3QZ6A 4IJRA 4B90A 4KEMA 3EPMA 2QUNA 4AZ7A 1UD2A 3VI2A 4EWND 3U4AA 2ZIDA 5D09A 5AOUA 3EYPA 4JEJA 1V6TA 1HKKA 3WH9A 2XVLA 3M7SA 4CCCA 3EDKA 5F7UA 2DZVA 3VAVA 3QR3A 1MUWA 1ECQA 1GTHA 2JGQA 4KGLA 1X1ZA 3ITVA 4XTIA 4JTSA 1J2BA 4L5ZA 4ZXOA 2P53A 4QE5A 1NDZA 3C86A 2F2HA 4J35A 1ISXA 5J5DA 2OLSA 4JHZA 3PBYA 1YYAA 1KTNA 2LLEA 2BXZA 1Q6FA 2GZXA 3TAOA 5A94A 3GDMA 3ES7A 5LNUA 2HROA 3GNNA 2I7GA 3VK5A 4CEUC 5MKGA 3CWNA 1YEYA 3GNPA 1LWHA 3AIUA 1P5BA 4E2BA 3NQ6A 3OA5A 3BL3A 2DT0A 2WVVB 3LPGA 1EH9A 5CPNA 1UJQA 4WR3A 1J0JA 4QBXA 4ZXLA 3NSNA 2F2KA 2QJIA 3P0XA 1PPIA 4IICA 1GYMA 2DH2A 2GVEA 1K8CA 1KCXA 2R8WA 3U2ZA 3HFTA 4LVGA 3SY5A 1ITUA 1TA3A 3LHUA 3G18A 4W5ZA 3ZZ1A 3BLEA 1VBRA 1EQCA 1U5HA 1HJXA 1MFVA 3A13A 2J79A 3CTLA 1SQ7A 3W74A 1OFRA 2P0OA 4NNBA 1ONWA 1G4EA 1OZMA 3BLIA 4WLCA 4RE2A 2NXIA 2DZXA 3NPXA 1RBLA 2IXUA 4UTFA 1PB0A 1GCYA 2ZC8A 1W3KA 2OOGA 3EGJA 3NCOA 4XB3A 1G7UA 4KEZA 4YJ5A 3FAWA 5A2BA 5CSYA 4I5RA 4URIA 5HQEA 3ZQ9A 2E9MA 4BQ5A 1TIWA 3CWOX 5EYWA 1O66A 2X7VA 5TF0A 3SCTA 2YBTA 3QTPA 4UOQA 2NV2A 1MDRA 3TDFA 1FWFC 3CHVA 1I45A 1CNVA 3CTTA 3BAWA 3MV11 4R33A 3CWHA 3PUGA 3N11A 1K7XA 3POCA 3UPMA 1EFZA 5LNRA 3CK5A 3AXIA 4FP1A 3KWXA 1GOOA 4K36A 2G50A 4PFHA 3WQEA 3VNIA 2RJGA 1TPVA 2FMOA 4O1CA 3CAWA 4G6CA 3SM0A 3EBVA 3A64A 4UFLA 1VH7A 3GW0A 3PWIA 4XUGA 4GVGA 4B5XA 6PTDA 4N4PA 3BCDA 3H4WA 4XAPA 5LYRA 2X40A 3KOFA 3T05A 1Q85A 1PIIA 1UCWA 2OEMA 3CIXA 3H55A 1HJUA 2E25A 7TAAA 1LUCB 3VXGA 1TJ2A 4I5XA 4M24A 4MZ1A 3P62A 3VOHA 1ODZA 3EB4A 1BSLA 3S4TA 1W1A1 1NOWA 3C0LA 1SO6A 5HBFA 4RDYA 2EXOA 4CNTA 4AMCA 3WNLA 1UD8A 1E0WA 2XINA 3QTGA 2V69A 2FYMA 2W5FA 4CNOA 1Y0EA 3A4XA 3KVJA 2PURA 4R3UA 4CD4A 1C90A 3M7WA 4MB5A 1BXBA 2NVAA 1TPUA 2Q8LA 1BG9A 3T40A 1A3WA 2O92A 1QU4A 1VBJA 2GJNA 1WBHA 2OPJA 4L61A 1G4SA 3QMRA 2O9OA 5I3IA 3C3UA 1UKQA 4FOJA 2OLHA 1OABA 3LSCA 4QGCA 5F4SA 2AOSA 3HTWA 2BX7A 4H8NA 4J4KA 4L1WA 5HA7A 1XCWA 1Y5XA 1IEWA 1KXQA 1WDPA 1Y8BA 2QV5A 3E0LA 3CZLA 1BTCA 1SMAA 3S9IA 3CT7A 4XKMA 5G2WA 1GOMA 3SFWA 2CBJA 3DIPA 4HPXA 4GXMA 3GHSA 4NAFB 3WYZA 3U57A 3M0ZA 3AHXA 1FWAC 3P82A 4O15A 2A7RA 5KTLA 2OQYA 4S2BA 4UQ9A 3RX4A 1XIHA 3G6LA 3GHRA 4DF1A 2OKOA 5KZEA 3S6DA 2GDUA 3CQIA 3T9PA 5AYIA 3UD6A 1AJZA 1GPWA 2ONEA 1Z42A 3BGAA 1CECA 2GGJA 1QOPA 2WBKA 4LALA 2W61A 2R6OA 2WANA 5C7VA 1R3QA 5EMKA 1VIWA 3R43A 4NZ4A 4HPJA 5A6BA 4PULA 4HHPA 3M6DA 4MM1A 4ALDA 5ABEA 2OFJA 2FHCA 1O5RA 3VIIA 1KR0A 3WBWA 5IM51 2WOQA 4HHMA 1R8LA 3VDHA 1J8VA 4FIQA 1IE7C 1SR9A 3VDGA 3PUDA 3WQGA 4NI3A 5K9DA 4RZ4A 2DSZA 1A80A 1PDZA 1XFCA 2VC6A 3WJXA 2C91A 2DZUA 3NTYA 5AHNA 3AXHA 1XYAA 3LZ5A 4L4MA 2OU4A 2A1YA 4QS6A 3K1DA 4NJJA 2PEVA 1G9HA 1HJVA 3WQPA 4AIBA 2DT1A 1KFCA 3GNOA 1PTGA 4ACZB 1FWGC 4NXKA 1SM9A 4H1ZA 5CBIA 1IZKA 3BLPX 1F8MA 1ESWA 2NUXA 4KEVA 3TONA 3CL8A 1FX6A 4X61A 3URNA 1V7AA 3RGTA 4REQA 2DSKA 3ORWA 1UROA 2PPGA 2A6NA 1EKOA 3JUGA 3TCSA 3UG8A 4C7GA 1AMKA 1KBJA 4AHPA 2Z28A 3WDHA 4Y9PA 3DC0A 3LLXA 1J12A 3HG3A 2HS6A 2RFGA 5C70A 1NM9A 4YL2A 4LUJA 2QGHA 1GZGA 2NZLA 3CZKA 1IZJA 1DHKA 3WMLA 1R3SA 3NZRA 3C2OA 2GVLA 2GQ8A 3BV4A 4Z1YA 5DMYA 8TIMA 1WUFA 4BQ4A 4AFYA 1OIMA 4ZMGA 1OGSA 3K8LA 1F76A 3OZMA 4LF2A 2R24A 3F2CA 4YTUA 3GHUA 4PCTA 3ZFHA 3UESA 5BYWA 3IJ6A 2ZUVA 1CYGA 4J3ZA 9RUBA 1MWOA 1UC5A 1QK0A 2P5NA 3FDKA 1A53A 5F2IA 4D1JA 1P1XA 1NAL1 5I3FA 4QP0A 1KQZA 5KZ6A 4OE7A 3LS9A 2WBGA 3W7RA 3B9OA 3G24A 4A6GA 1RP9A 2G96A 1EJSC 1DV7A 3RN6A 1C29A 1W5PA 1UP3A 3W6LA 4X22A 4E8CA 1MO0A 4O0QA 5AYBA 1NP0A 5EMMA 1R9XA 2ZVIA 1NOFA 1VFSA 3S2LA 4GI4A 3TJIA 3R13A 4YVXA 4TMBA 3UWUA 1V6XA 1P6BA 3GB6A 4XZWA 4Q8UA 2AQWA 3BJFA 3QFWA 1Y7VA 2C19A 3WLTA 2QUVA 5BXSA 1F3WA 2Z00A 5I2UA 1JXKA 1M6JA 3DG3A 4PB3A 3NVTA 4LUSA 1JZ4A 3BW4A 3SCOA 1MI3A 2ZUWA 2Z26A 2QCGA 3MVIA 4HYRA 4J28A 3BAYA 2Q09A 3GVGA 4PUUA 4FXJA 4BI5A 5I3GA 1WB0A 4GZIA 1MUCA 1ZJIA 5DBTA 4AIUA 7CGTA 1ICQA 3ONBA 4ES4A 1QO2A 1V02A 2RDTA 1WOAA 4GJ1A 2VCBA 3NDYA 4B2DA 1GGOA 3H4XA 2Y7GA 1CB2A 2AKMA 5DCEA 3ABZA 3O3RA 3DN5A 3BCJA 2ZX8A 4DYEA 5IXEA 1CLVA 2XU2A 4ILSA 1IR1A 5A6SA 2V6AA 5I79A 1NF7A 4NU7A 4WSKA 2ZWYA 1VAHA 4P7QA 3FYOA 4ZSUA 3FAXA 2GVGA 4CCDA 1BG4A 2BOGX 1ZB5A 2VGGA 3T07A 1NARA 3VCNA 1DBTA 5A3HA 5D9PA 5A6JA 3H12A 3ZWSA 1F4HA 1Q2RA 4WXZA 4UTTC 4IXXA 2Q02A 4TX8A 1H1NA 2A0NA 5T91A 1UQYA 4D71A 3APYA 1I4NA 1W2PA 1XPYA 2OSWA 1C93A 1NQKA 3M9YA 1EZWA 3VE9A 1YNYA 2J8GA 3B0UX 2FDMA 3CZGA 4P7LA 4BCEA 4AC1X 1LRNA 2YOCA 1A5MC 2HXTA 1OFDA 1UKPA 4OV9A 1XLJA 3CV1A 1NEYA 2ZX7A 3KWSA 4DAFA 3L5AA 4PCNA 2OWCA 3ANUA 1M7PA 3SJ3A 4DZ5A 4F79A 1OYBA 3GS6A 1PDYA 3QW3A 4C6DA 5REQA 3W7KA 3F2BA 2X0YA 4PH6A 1HQTA 1W32A 5CAKA 4LS2A 4L80A 4HMNA 3MYPA 1VCFA 4I9TA 3G1RA 3USBA 2YGYA 4I8DA 4AD3A 2CZ5A 3DENA 4PC8A 4BI6A 3FHQA 1X6LA 2WMIB 5HNRA 1WXJA 3GUGA 4ZEPA 2OG9A 3CV2A 3P3BA 2C79A 2V3FA 1J0KA 2TAAA 1E9IA 2NQZA 3WO8A 5CPQA 1I60A 1R46A 3L68A 4GYPA 1KBBA 1PKLA 4DUOA 3B8IA 1I6NA 1W3JA 4M19A 2H6RA 2VT0A 1EIXA 3N13A 2YL5A 3NWRA 2FZ9A 3N2XA 1AQ0A 3GIQA 3WUEA 4C6QA 3W28A 2XGZA 2E9BA 3TTOA 3MS8A 3R7MA 5GJNA 2CWXA 1LT7A 1UWSA 3ARTA 3ZT7A 2H8ZA 1NTHA 4AZIA 3BLDA 5G2IA 3TX9A 2C13A 2H9AA 4G7EB 1UC4A 4DJDD 1HP5A 2PD5A 5I24A 2DVXA 3ITXA 2GFTA 2PU1A 2TSYA 4KW2A 2BV9A 3ITCA 2ZX5A 2DDXA 1C8YA 3QMTA 1US2A 3SO7A 1H4PA 1JD9A 3TC6A 3WSUA 4XV0A 4IQDA 2Z4GA 6TIMA 2G37A 1U30A 2R1PA 3IV3A 1EB3A 4LEFA 4R85A 1V51A 2QHAA 5IFPA 3LENA 4B5UA 1ME9A 3TZNA 3VCCA 2J8FA 3JZUA 3VKCA 4KCTA 4G7FA 4NILA 1S2CA 1JCXA 1XP3A 1EUAA 3M1ZA 3TJLA 1GVRA 3DXIA 3EDJA 4OGZA 3E5PA 4QJ5B 4QAIA 2E40A 5D03A 5DELA 2B7PA 3PAOA 5DY3A 1AZ1A 5CLTA 5J5RA 3WMBA 1V4YA 1UR4A 3W1LA 6REQB 8A3HA 3EDEA 3MP4A 2V68A 3LLDA 1TR1A 1UZHA 2F84A 5F1VA 1IR2A 2V9DA 4LBSA 3WMSA 4GQGA 4H9XA 1TELA 3W00A 2OGJA 4AEFA 1YXCA 1IHIA 4POCA 4F0LA 5MKGB 1ZRQA 2Y70A 4V27A 2H3DA 2ADAA 2CYGA 3ZT5A 3GXFA 1I1WA 3R25A 1ME8A 4ZB2A 2ZX6A 4UNIA 2PDXA 3CHFA 4Y2WA 4K1WA 3DDMA 3SRFA 3ARZA 4CD6A 3ZLFA 4JTLA 3EKGA 4UNLA 1XI3A 2Y85A 4DWSC 1YHTA 3VNYA 4CU7A 1EC9A 3R12A 1KA9F 3GKFA 2OWWA 2NUYA 2F38A 3NO5A 4A8LA 3MA8A 1EGVA 6CGTA 4HIBA 1SFLA 1RLCL 5FJOA 3GAKA 3QPEA 1RJRA 3GXNA 4Q8MA 3S5NA 3VGFA 3RHGA 4O10A 3AWNA 2MUCA 1B1YA 3DFPA 5CSRA 3WLIA 1VHNA 4OFCA 4R7WA 3BLFA 1JNDA 3F1QA 1XYFA 5GVJA 1XICA 1BQGA 1AJ2A 2BY0A 4E4PA 3MUY1 3IUHA 2PD9A 3UZJA 3U9IA 1T5AA 2DIEA 5MF5A 4BJHA 4ZOBA 3D46A 3WF0A 4E38A 3VKKA 1WV2A 4LPCA 4DZHA 4L65A 1JF5A 3AJXA 2VWTA 4NXSA 3TCEA 4Q32A 2VM8A 2OZ3A 3B8DA 4RPPA 1DQUA 1I75A 4H7CA 4QJ3B 3VIPA 1SJBA 4UZUA 3EMCA 3UJSA 4KCWA 3WIJA 1XG4A 4E8GA 1MEWA 3I3DA 5HINA 2CLHA 5CJ5A 2EPMX 5I0DA 4G1NA 3NZGA 3UERA 3KVLA 2PDIA 3W7DA 3IGUA 4Z2JA 4NAFA 3IJ8A 5BXTA 4FNPA 2VEPA 3NJ3A 2Z2UA 2Q6ZA 2CESA 3DI0A 1MW2A 2A3CA 1JEZA 3I10A 3GAYA 4LRTA 5I03A 1U22A 3ZJKA 1FCBA 3URBA 3I68A 1H0IA 2Y24A 1R9ZA 4E8DA 4WJ8A 1EJ7L 1P0BA 2SFPA 3BPWA 1LROA 4DF2A 3B40A 4UMBA 5GNXA 3URAA 3RF9A 4JQ3A 4B3LA 3A47A 3LCXA 3UFYA 4HN4A 1JD7A 3G1VA 5A6BD 3RCYA 1NDWA 2XH4A 5IOBA 4U33A 2V5DA 4K6AA 3W73A 3HPZA 4HNLA 3B3DA 2FHFA 5GQBA 1XLKA 5FEZA 2XIOA 1AUSL 1UIPA 1IXQA 2GQAA 2VOTA 1NJJA 2ACQA 5FESA 3MQTA 4CCEA 5HANA 4ZFCA 3B9DA 1VP5A 1XV8A 2BFGA 1PEZA 4JNMA 3EWYA 1DJHA 4QEEA 1I1XA 1ZU8A 4ZCWA 1KM4A 4Y9OA 2ZZ2A 1MZHA 3II1A 3GR8A 3NEVA 1LBLA 5AZ0A 3ZT6A 3L5MA 3R2GA 3ZVHA 3MJYA 1MW0A 1W2VA 2V63A 1TB3A 1TMQA 1TX2A 1FWTA 3DG7A 2JF6A 4YCPA 4S39A 1VRDA 3VX1A 4H8HA 4U5IA 3UWYA 3VD9A 1BF6A 3UNDA 2CZEA 4PMUA 1GZ1A 3V0SA 3RAOA 4PBEA 4JIEA 1B3YA 1UMYA 3CUXA 3KEHA 3HPAA 3VMPA 3A3HA 3L65A 1Y5WA 3UZZA 1UWAA 2NV9A 4A3HA 4IOTA 1RQEA 3DYOA 5FIPA 4ROPA 1B0IA 1T99A 5AC8A 4KWSA 3KHDA 2HCVA 3O6YX 4XO6A 4QE1A 1QNPA 3OOQA 3EPNA 3BOLA 1D3HA 1CXLA 4QQ3A 1E3XA 2P3EA 3PTQA 5H2ZA 4LYPA 3N6QA 3P67A 4UBPC 1XW8A 1Z6KA 3CHDA 4C6EA 1VBGA 4IMAA 3G22A 3IVTA 3FJ4A 4I5UA 1ZCCA 3W22A 3NL3A 4JIPA 4NVTA 3OTRA 2OVLA 1CENA 5XIAA 2YCJA 3V18A 4GLEA 2NXGA 4GIYA 2GJLA 3THQA 4CN4A 4FHAA 4GUJA 6A3HA 3KBNA 2QVHA 1G94A 4XSMA 4ZE4A 4Q4MA 1ZTVA 3G1HA 2ABAA 5DMLA 4E3TA 3PFRA 3DFQA 1RHCA 3WD0A 2FFCA 2ACUA 3OGSA 3B0VC 3BDKA 3W9ZA 5I00A 1EDTA 4JN6A 3DYPA 4DEFA 2FZBA 4P7RA 3G1AA 4NKCA 3DKLA 4PUNA 1JI2A 1MQPA 2PDGA 3B0PA 3I6EA 4ICCX 3STCA 1U5VA 1ADSA 3W85A 2QKFA 3SRHA 1DPMA 2P0IA 3OIXA 5HAOA 3OQ8A 1SSGA 2QF7A 2EJ1A 3LYEA 2AL2A 3PK7A 4IXHA 4FSAA 1TPEA 3N19B 5TNVA 1FCUA 2XVPA 3P8IA 4US5A 1HO4A 3UWWA 3LB0A 1V3KA 1IEIA 4AY1A 4IFRA 4JTJA 3H26A 3MANA 3R89A 4XISA 1JPMA 3VNJA 4JX6A 4X60A 4Q6JA 3OG2A 3VTRA 2VRQA 3RCNA 1BYDA 2E5CA 2OZTA 3THDA 1ZS2A 2OQLA 1R9YA 1PKYA 1TJPA 3G8RA 2QNEA 1E1EA 1TMHA 4MJ4A 4HVXA 2ALDA 2FB2A 2I17A 2ICSA 4XD6A 2ISWA 3KBVA 1T7LA 5FEXA 3FGCB 3SCQA 2D1ZA 3WH6A 4W85A 4DWSD 2A2IA 3VNLA 1HTIA 1DKWA 1TV3A 2PTYA 4FMVA 3FJ6A 4JHMA 3CPGA 1XBXA 1ZJBA 2OO6A 5FSDC 1GKRA 1JAKA 1QVBA 1EJUC 2L5HA 2C3ZA 5AVHA 2D0GA 4FO4A 1WZKA 3DFYA 3ZWTA 2W3ZA 3ZVIA 3NEHA 3AUOA 4PTVA 3WQDA 2G97A 2GOKA 2YW3A 3TQVA 2V82A 5EMYA 4ONVA 2E5DA 4S2CA 1ZPTA 3FY1A 2CBIA 3MO7A 3TKFA 1XSJA 3TFXA 2IKJA 3S2JA 3C2VA 3HIJA 2ISVA 2JIEA 2OB3A 4K68A 3NQGA 3PBMA 4AD1A 3OHMB 2CU0A 3RRXA 1TQXA 1JRBA 2VELA 2JE8A 5E70A 1V6VA 1WZAA 3KP0A 1XHGA 3L2IA 2O4MA 1K4HA 1UYQA 1ISYA 4TUFA 1YDYA 2FFIA 3TN5A 3AICA 2G3FA 3WD1A 4GYKA 3T0TA 3BAXA 1IIGA 1GG0A 4JR5A 1VFLA 4PUKA 1S2WA 1SW3A 1XF0A 4EF8A 1DWAM 3UG3A 1UPMB 1W1VA 1DWJM 4K3ZA 1QFEA 2PTXA 3QHMA 5SWUA 1QHPA 1JNEA 3FKKA 1G0CA 3WLRA 1UG6A 1YADA 1Q6DA 3CHCA 2XWEA 4O1BA 1XG3A 1F9CA 2OMAA 3UZWA 1ZENA 4FA3A 3E02A 3RR1A 1O60A 3FW6A 3B03A 2VCCA 3QLDA 1DJIA 1Q63A 3BC9A 5E0FA 4JTDA 1K8XA 2VYOA 2DZWA 4CNNA 5FD0A 4G8TA 1XBYA 1OY0A 1GVIA 3G5EA 1ADOA 1OD8A 1W1YA 3LX9A 3W1UA 3ZIZA 2PDCA 4UOZA 2OEKA 3MCOA 4IGHA 1CZ1A 4EE9A 1J4EA 3NR0A 3VX0A 3QW4B 3OPSA 3O0KA 3QZAA 3RM9A 2C16A 4M0XA 3RYSA 1FP9A 4HNNA 1R7OA 5HPCA 5AN7A 2X42A 1P4CA 2OZ0A 3LSBA 3SGUA 2ZZ4A 1XLIA 1FFRA 2R91A 2WWDA 5D2WA 1TE1A 2ZC1A 1FHUA 3ZS4A 2W9MA 1MMFA 3Q37A 3FV9A 2F61A 3RLHA 1FWSA 2PLCA 2EBNA 4XZIA 3OEXA 1XXXA 3QXBA 4IPJA 4CQ9A 3CUHA 3ARPA 4NT0A 1RA0A 4DBUA 3L7RA 5AVNA 3SQSA 3TH6A 2XZ7A 1FKWA 1RQBA 1KM5A 2DSWA 4GISA 3RRAA 1P0KA 2QPSA 3BWWA 3U4FA 3S6TA 4IQJA 3FSUA 3NOYA 4KF1A 4PA8A 3WF4A 5BOOA 4AD0A 3REQB 1GEHA 4ZL1A 1QWKA 2WM1A 4UWMA 4A8IA 4GACA 4JICA 1TV7A 2CW6A 4UTHA 2PWFA 1RCOB 1ISVA 3VUSA 3AC0A 3TMLA 2WZHA 3LERA 4LXFA 1OM0A 1WO2A 1QRQA 1REQA 4JL1A 3W7CA 2A4AA 2VD9A 3R8HA 3PJWA 1SO4A 4ZENA 3VDAA 1F5ZA 1LG2A 3DFHA 1PZ1A 3MMWA 1CGTA 1TYGA 5HXMA 4YMZA 4LYQA 1GEQA 2C7FA 4Q8VA 5CGTA 2PGRA 4IH3A 4OVXA 1C8QA 1E0XA 2XVKA 2GDQA 2QUUA 2HVMA 1TUFA 3XINA 5LIWX 4Q7BA 2OT0A 1L6GA 4UTLA 3QC0A 3LGDA 4AXKA 1E71M 5AC7A 1TWWA 4Z08A 1PX3A 3K4AA 2E4TA 1OK4A 2EHHA 2BHYA 2G3NA 1KD0A 1PO9A 3TYAA 3M0XA 3N4FA 1GOXA 2WMKA 4LF1A 2XVGA 2HK1A 1DIEA 1XUUA 3CM4A 3MU7A 4UTWA 2FQIA 3SN0A 4PB5A 5FF3A 4H9VA 3N1AA 2KX9A 2PP1A 2VEIA 4Q8OA 3RIKA 3T6CA 1XSIA 2CLPA 4JFWA 3GC2A 4UQAA 4MNMA 4UR9A 1AW1A 4GBUA 4PEEA 4QE4A 5AZ1A 3E96A 1PVNA 1H7WA 3W3OA 4A3YA 3QFEA 2G41A 1R2SA 3CZJA 1FH9A 7ODCA 4GI8A 4O54A 3PSWA 1TIMA 5CC3A 4GWEA 3MUXA 1EF3A 1TA3B 4B3KA 3H2AA 1EJRC 1MW3A 2VRJA 3BJTA 1X8CA 5BRBA 1QBAA 1B9ZA 1VF8A 1P7TB 1E1CA 2XUCA 3MZNA 1P0EA 2J74A 2HVOA 1S5MA 2B4GA 3IK4A 4HA4A 4DJEC 3IIPA 2ABBA 5CZSA 4AUBA 2ACRA 4MNJA 1Q6OA 3AIEA 1UIOA 1MNSA 1V02E 1WDWA 3I4EA 3K4WA 4GIEA 4BS0A 4F66A 1SR0A 2IKHA 5XIMA 4HOZA 4AIOA 1KRCC 4EF9A 2I56A 3SB0A 3ZSTA 2QYGA 3JZEA 3M4HA 1W3IA 3K2GA 1J2WA 1UOZA 2C1IA 3CPRA 4D6IA 3B06A 5LA2A 1B9BA 1P0NA 3AS2A 4JDBA 4GX8A 3A12A 3CNYA 5EBUA 3M43A 4D6JA 3RK8A 1H7RA 3M5YA 2X0SA 3SRKA 3W7JA 4PRTA 2DUAA 4WOZA 4DJDA 3URQA 2Z2BA 1OJXA 3IK2A 5HWNA 4YXGA 1V3HA 3A24A 1K6WA 4PMJA 3OB8A 5G4HC 1RY0A 3FX4A 1YNPA 3T42A 3PUEA 2YCKX 2POTA 1E9LA 1EYEA 2GUYA 1HL9A 2A7PA 5KSWA 3T0BA 2PRLA 4YYCA 1VEPA 1JDAA 3TYEA 1O94A 3RG6A 5K9CA 4DAIA 2PDWA 5LA1A 3PZNA 1UR3M 1UR8A 4O57A 3PUOA 4OT7A 4HSHA 3MDUA 4ZTYA 1F8IA 4MPQA 1HP4A 3AS0A 4PCPA 4KKXA 3KLLA 1DP0A 1LBMA 5D2YA 3RPTA 4D6GA 3SUTA 1LZOA 3R4IA 3UXAA 2O56A 4LC6A 4MNLA 1KM3A 3D47A 1Y65A 3F5KA 3OVRA 3CXOA 1Z9AA 5DBUA 1IT7A 3DGRA 3B0XA 3DERA 1BVZA 3H70A 1I0DA 2WCAA 3M46A 3WELA 1R3WA 4C65A 2OOFA 4MJ2A 4IHCA 1OFAA 3HV9A 1W1IE 3SJNA 4DRSA 4F4RA 1KXVA 2PP0A 3BGJA 4MLJA 3NPWA 4ERAA 4S3GA 4ECLA 4KRZA 1OYCA 2BHUA 3DX5A 4HNCA 4JTTA 1MVYA 3ARWA 4X9SA 2J8TA 4KWVA 4RZ6A 2YIHA 4X2RA 2VX7A 3FXGA 3KOXA 3OBEA 3C0QA 6ENLA 3IACA 3GC5A 3QV9A 2J75A 2PDPA 3OP2A 1X97A 4X0NA 1AQFA 1LRTA 3I7QA 4KQNA 4E2VA 5GJPA 1WKDA 4H4IA 4PUJA 5CBBA 1UWUA 1TPC1 4UTJA 3ITLA 1NU5A 1OT2A 2EKGA 4BQ2A 4Y9AA 3L4WA 5HMFA 3GE7A 4DWSB 4DPPA 2QF8A 3PBVA 5AHEA 2X1SA 3B0YA 5AECA 3D3AA 3N6HA 4GK8A 5BCAA 4D8ZA 1JYNA 2WNZA 2FKPA 1HKIA 5E1QA 1YDNA 4OUIA 3K30A 3COTA 5KZMA 2J88A 3GLCA 2J27A 1DJWA 3I6RA 4HPGA 4WGXA 2WHMA 4L9YA 4IPPA 3B4UA 3ONCA 4C6KA 2IKGA 1SW7A 5JIWA 2VDIA 1FWNA 3CB8A 5LNWA 2ZA3A 5HJYA 2W67A 5D33A 4L4OA 3DH7A 4C1LA 2C6QA 3FGCA 1EZ2A 2H90A 1H62A 4GYFA 3LCFA 4GIRA 4HPNA 2EAWA 4AEOA 4HBKA 2QJHA 3LTPA 5T26A 4XK2A 4XAFA 3D5HA 2CHRA 4EPBC 1LOQA 1OCQA 3ISIX 4PL2A 4L6DA 1EO7A 2CKSA 6XIAA 2PDJA 2G5WA 3UXLA 1RP8A 4WVXA 4A29A 3NQ7A 1HXJA 2BGQA 4H04A 3STEA 2OYKA 1NH6A 1MZRA 4W93A 4FS9A 4XAGA 1IIHA 2V2DA 3KCOA 3C8FA 3EOOA 3QMSA 4EXAA 2J24A 2ZYFA 3TTEA 1XBVA 3M0KA 4ZQCA 4WK9A 4BI7A 1H1ZA 3K8KA 1JUKA 4JTQA 2X8RA 3NFUA 4Q22A 3HQOA 3ABOA 3IGSA 4YVVA 4DLFA 3AU2A 1PX4A 1A3HA 3M0LA 3HGRA 5LHEA 4CU6A 1UWQA 4UXDA 2J62A 1QI3A 3S47A 3BOFA 4EPEC 4XUYA 3VNKA 2VHLA 1FWDC 2UZ9A 3T2QA 1XUZA 1TJRA 4H2CA 4IIFA 5ABGA 1LLOA 1PX8A 4W7UA 1UWIA 1S46A 3UG5A 4W89A 4NZCA 3CUJA 4F0KA 4ZBCA 3BSGA 4O17A 3AMCA 2NT1A 3GVQA 1T8QA 2DV0A 2NX3A 2XIBA 1VPQA 1E6NA 2DPEA 2DORA 3OBKA 1TZ9A 2BODX 3ZLHA 3NIYA 2TODA 1MEIA 2UY2A 2F9RA 2PE4A 3LI1A 4LV9A 1Z8AA 3I65A 2FH8A 4E6MA 4I7VA 1V03A 1KGXA 4GNVA 3IJLA 3L0GA 4F3HA 4FX7A 2PWVA 3W6MA 4H6KA 4EXBA 4PSRA 1JCTA 3LPPA 2FVMA 5FJRA 2RDWA 5F2MA 1ZBCA 1TTIA 4C1NB 4M29A 2PU0A 4HZMA 2Y4SA 3AO0A 3LHZA 3ABXA 5LSMA 4N4QA 3T7VA 1YXDA 4OQVA 3DFOA 1TJ1A 5J8LA 3WQFA 4LJ3A 2XPKA 5LKYA 4IG2B 3TLLA 4AVOA 3CV7A 4RCXA 2EGZA 4L56A 1NFBA 3SQLA 1GVQA 1TRDA 1GQLA 1TX0A 3KRBA 3P2VA 3V1PA 5HUOA 1IGWA 2XM1A 3VPLA 4FX8A 1CLXA 4NJKA 2WC7A 3VGBA 4WZHA 5KZDA 4UTWC 3AZSA 2Z0IA 5HWMA 4M7TA 3XISA 1K9EA 1FWBC 1UR1A 3P81A 3LHTA 4PMOA 4INFA 4BFAA 1POJA 4RW5A 1W3NA 1QW8A 2OGYA 1D2KA 1E6XM 1E70M 1OT1A 4QISA 1LOLA 5GNYA 2CFFA 4ATLA 3EDDA 2DZAA 2HDJA 4WHBA 4MB3A 2HPIA 4CCZA 2I5QA 3UJRA 3KOYA 5H91A 1BAGA 3NQCA 4Q7NA 3FSTA 3KOWA 4C6BA 1DQWA 1QK2A 1U5JA 1XCXA 2JALA 5A6LA 4X3ZA 1CPUA 1AH0A 3W1XA 4PUDA 5HUPA 2YXGA 3NYDA 2NT0A 4IGNA 2GQ9A 5M2FX 5F4XA 2G0WA 1O7AA 2E8YA 1DYSA 3DFSA 3GZ3A 3CASA 4UNKA 3UGRA 3H2NA 2Y2WA 1E9YB 4KT2A 1ZALA 1JPIA 3AHVA 1W5MA 1XLLA 1E6ZA 2AGTA 4MKVA 3AROA 3GRIA 1XC6A 4AB4A 4Y96A 4FK9A 1QNSA 4GPNA 3VIKA 1VIZA 3TW9A 4JL2A 1ZBWA 3C56A 2V5CA 3W07A 3R0UA 1EUNA 3CU2A 3E2VA 4PTWA 4D6FA 3B9EA 2CNCA 2GOUA 5I3DA 5JH2A 1ONEA 4U28A 4DJEA 1G4TA 1YBQB 1B30A 1DORA 5HNUA 3AHYA 1AW2A 4AZHA 3WNOA 5FKYA 5C54A 3GW3A 1JGMA 3BAJA 4RLIA 3SADA 3NZQA 1NP2A 3W38A 1UH3A 5AY7A 2QCDB 4GZ7A 3N6JA 4DYKA 3VZXA 3TSMA 1E0UA 4R34A 4KERA 4XAZA 1TG7A 3LBOA 2HEJA 2PGWA 3GFXA 1CDGA 3I7RA 4GMEA 1PHQA 3C3NA 1OC5A 3E1F1 1QO5A 2I1OA 2V5LA 2QIWA 1PE1A 1TE6A 3MVTA 2Z1WA 1PAMA 2VR2A 3QC3A 1L2UA 2J7HA 1PIGA 3VD4A 1H61A 1OWQA 2Y5JA 3N9RA 2FZNA 1EDQA 4CD8A 2F6KA 1KTCA 3TU9A 2ZQ0A 1WDRA 4TMCA 1WPCA 3T4CA 5ABFA 1WAWA 2QR6A 1J0IA 3LD5A 4JTRA 3JU2A 5LHFA 1FY6A 1OINA 1S3HA 3NQMA 1Q6CA 4D8LA 2OODA 4LYKA 1S5WA 4H9ZA 2X16A 3G8EA 4QTGA 3K5XA 1VFFA 2A3EA 2CLOA 3AS3A 5DRCA 1XDJA 4BY3A 4ZB5A 3A3WA 2Q3OA 3BZGA 4PTDA 3UZYA 4GI6A 3WMCA 3TK7A 3F4WA 3W7QA 3WBEA 3HZ3A 2DT2A 3FHAA 4HK5A 1EXBA 2A5HA 1BRLB 4OBTA 3N2MA 4C6NA 4ZB0A 3M0VA 2PDUA 2PLMA 4EOUA 3U2EA 3GDRA 3U2OA 5A8GA 1GVFA 3DBPA 3A4AA 1JRCA 3O6CA 4QG6A 3BQ5A 3MSGA 1F73A 3Q58A 1VCVA 1JZ3A 1F07A 5PTDA 2CIPA 1J0ZA 4TR9A 4FX6M 2QCLA 5HR6A 2ZCGA 5A8MA 3MMDA 1V77A 4US6A 2QULA 3WK2A 1CI1A 3KVMA 2E5BA 4QJ4B 3TROA 4OKDA 1EDGA 5KETA 3A22A 1KFKA 3LOTA 5BNKA 3LPOA 3BK0A 4NZ1A 2EG8A 4C7FA 4PUMA 4GJIA 2IQDA 1YNQA 3QGVA 5CG0A 3F03K 2V2CA 3NOEA 4JKKA 4O53A 1JQVA 4AVNA 4X0VA 4K7YA 3BUVA 1LL4A 3RMJA 2DW6A 3UCCA 3MI2A 3C0JA 3BLOA 2P50A 4A4AA 1TREA 3FVMA 2XISA 2NX1A 3WK1A 3LXBA 3UVAA 1WDQA 4PMNA 4O19A 4IQLA 1D8CA 4LANA 4CLMA 1VYSX 4HYVA 4P8VA 4H8UA 2HPMA 3TZFA 1G67A 2H3BA 3IARA 1BTMA 4HU4A 4QXIA 2D20A 4IFKB 3DGBA 3SCPA 5TAOA 1TZZA 2BOEX 2DZPA 3MUZ1 1IWPA 3BAIA 4DYJA 5HQLA 4NAEB 2IXVA 2PCEA 2PDFA 4WGHA 1QATA 4KWUA 2GUUA 3U6WA 1Q8JA 3O6DA 5EKYA 5DT5A 2PCQA 1E4MM 2J7FA 3HQ1A 2ZADA 3RO6A 1HFBA 5BZAA 3RILA 3LV5A 2WVTA 5H8PA 3RO8A 1EA9C 1UASA 3B9NA 1J01A 1ZUAX 3P5ZA 2G3MA 2VDHA 4W7VA 3WDIA 1O95A 3AAMA 4DO6A 4HPHA 1S2VA 1ADDA 3S1UA 1C9DA 1XINA 1XYMA 3LTSA 1W1PA 3KX6A 3E5BA 4A3QA 1AG1O 3AQUA 4C90A 3WLJA 1TCMA 4O28A 3QVQA 4D8AA 2JBMA 5AC5A 2ZXQA 4M81A 1BXNA 4NP7A 3KRZA 5LXXA 2YCEA 4Y9NA 4AD2A 3LQLA 4Z42C 2ZRVA 4GFSA 1JAEA 1UB3A 5EB8A 3OVQA 2ZUNA 1VBHA 2XTKA 3T8LA 4NYYA 5HR7A 1GOIA 5D4YA 2J7BA 4GY1A 1V5XA 3DOPA 1AMYA 1JVNA 4KESA 2Y1HA 1TPDA 3CJPA 3WENA 3AWOA 4DNMA 3EKZA 3BW2A 3N3MA 3V7PA 1EBHA 3MBFA 4IMGA 3S3GA 2Y7EA 1XRTA 2PTDA 1ZL1A 2W92A 4OTKA 3RX3A 4RW3A 3AU6A 4IISA 1BQCA 1BHGA 3E2SA 3WDQA 4Z2HA 1XS2A 4K8GA 3CUGA 1UZ4A 4UMCA 2RKXA 3ABQA 2Y6ZA 3PTKA 3WF1A 4L4LA 2CITA 4C60A 1WBJA 1FXPA 1I2QA 4ZOCA 4ACZA 1GOKA 4C6PA 4MMWA 2PSNA 4R5EA 3APTA 3VIFA 4FXRA 4P8WA 1PTDA 2H9AB 7XIMA 4NJGA 3MSDA 2I57A 1Z48A 4M80A 5LZLA 4WUIA 7PTDA 3PAJA 4O12A 2XIJA 5KINA 6XIMA 4QIUA 1M68A 1FDJA 3CO8A 3WFZA 1A0EA 2WO5A 1BEUA 2BVDA 3PNZA 3CEUA 3HG4A 3QV6A 1NWTA 3IIZA 1OK6A 3KCLA 1XR2A 3N73A 2VGBA 1GHRA 5AHIA 4Z1DA 1EP1A 3AUJA 3W88A 4LC8A 5LIUX 4LAMA 4JTIA 2GSJA 3E0FA 2WB5A 4ERGA 3CL6A 1ODUA 3B8SA 3MHFA 3LXCA 5A2CA 1SJDA 2W4XA 1OQFA 4GRSA 1W54A 4HZ6A 1GJPA 1A3XA 4KMQA 2WMIA 3K13A 2YFOA 3OIHA 2AMGA 1KQYA 4JQ4A 3S1GA 2OSXA 4LCQA 3MMTA 1SJAA 3B9AA 3RNDA 1LRQA 3QHNA 1MYRA 4NASA 2Q8XA 2YYUA 1Y5VA 1UZ1A 2ATSA 3ZO9A 4AC7C 3EWCA 1JI1A 3S6OA 4JX4A 4XO7A 1XLAA 3DEQA 4MG4A 2WHKA 3W7EA 3LG3A 4M82A 3HQPA 5JBEA 5FAGA 5HNTA 2BB0A 2ISFA 2X0HA 3QR0A 3UXKA 3WK0A 3OW1A 5FEPA 3P0WA 4RZ5A 4C5ZA 4HNUA 4XWUA 2ZUUA 2WMHA 3MBDA 5I7GA 2O9PA 1UA7A 4H9YA 2HBVA 3AMKA 2BXVA 5EMLA 4DO4A 1SO5A 3QJAA 5A5WA 4DQWA 2NVCA 4AU0A 1TV8A 4Z2GA 3NZ1A 1Z32X 4AMAA 4LBUA 3QLLA 2G4JA 3N2CA 3VU2A 3L0KA 1JZ5A 3VGEA 1AW5A 3TEVA 2CZDA 1IF2A 1LP6A 2YA1A 2B0MA 5I06A 1HG3A 2ZWZA 3CQHA 1BF2A 3FYYA 3ZLGA 4A21A 1JZ7A 3IEBA 4QSHA 1MDLA 3WLOA 4HU8A 4GOAA 5B7ZA 2BP1A 1GK8A 4WDWA 4WQ6A 4H7ZA 4YVPA 1MXDA 1OC7A 1V0NA 2ZTKA 4B3ZA 4H00A 4Q8PA 3I7SA 2QAPA 1G69A 3H24A 3R79A 3SUVA 4FOKA 4HA0A 4HJWA 1YDOA 5CC5A 3L2LA 2ESCA 1JQXA 2ACSA 4UFMA 3TP4A 1IWAA 1TWIA 3T2OA 3GH4A 2ZA1A 3SCRA 3WNMA 2GGHA 2V0TA 4WOQA 2JEQA 2GWNA 4OUEA 3NZPA 2ZRUA 4OBRA 4LVFA 4XBSA 3WX7A 1B3WA 4IF2A 2R1MA 4D6DA 1H3GA 3QEZA 4OU1A 4ML9A 2OX4A 2V5KA 1HT6A 3VMOA 1U2YA 2V81A 3N17A 2NQJA 5LNVA 4JDYA 4EVZA 1KRBC 1EQPA 5A6KA 2WSQA 4PMYA 4D6HA 4JXCA 2PDYA 1G6CA 4FNTA 3QQWA 3TOYA 4XZLX 2FZMA 1O1ZA 5DCBA 1AFSA 5E9XA 3H21A 3C5QA 1W6TA 4HSNA 2OO0A 3EX3A 3NQ8A 4C91A 3TQPA 4BHYA 3UVIA 4S3BA 3F5JA 3W2UA 2CHOA 4P7NA 5EFDA 3POHA 1XLBA 2WCGA 4F9JA 3NXFA 3QR1A 3WJSA 2P10A 4EAYA 4YTQA 3IJ9A 1OX4B 3ZSSA 3O7UA 5A8NA 1E0TA 2XSAA 3LCWA 4QJ1A 2HWGA 3TN3A 3G3DA 1LG1A 1M01A 4FF5A 3TN6A 2VZSA 2W0UA 3IJIA 3ANYA 1X1OA 3S5YA 4EPKA 2XVNA 4Z17A 1VEOA 3AMDA 4G1KA 2PUZA 4LAOA 1E4IA 4AXNA 4HYWA 1SPQA 2FPTA 4F2UA 3R58A 4IGSA 1SO3A 2ZX9A 4YCOA 1JPKA 4GH3A 5DRIA 1KFLA 2WMJA 4C6OA 3N4EA 2DFAA 3PY2A 4FLQA 2E68A 1QI4A 4GI9A 1DXEA 1QNRA 4UTIA 4R7OA 1GW1A 1H63A 1F6PA 4V33A 3VZYA 3DC8A 4CQDA 1V0LA 3HMJG 3T4WA 3SUUA 3NDZA 4PTNA 4AEEA 3FDGA 4J3TA 4REQB 2ZOXA 5M3WA 2HK0A 3KAOA 3LCLA 1LM1A 2E6AA 2IPFA 3LBCA 1BXCA 2QXWA 5D2TA 3VOCA 3AS1A 1VRXA 3CMJA 1FHDA 5H1WA 2ZE3A 4DO7A 4LVBA 1A49A 4KWWA 2UWFA 4N9EA 4OECA 4AWSA 2GJXA 1FWCC 4B5SA 2BASA 5F2LA 2HXUA 1LLWA 2ISSA 4UUIA 4ZTXA 4PZVA 3FVDA 4IIEA 3BICA 4ZSTA 2QS8A 1JUEA 4F0RA 2PP3A 1YPXA 4FOUA 4XTDA 1OFQA 1PUDA 3EOEA 3ZJ8A 4I9JA 2CCRA 3GYCA 4HNOA 2BXYA 3W1NA 3GTHA 1SU5A 1JCNA 3EXTA 1HNYA 2HQAA 3UZ5A 5HDRA 4UFKA 2WSYA 3I3EA 1F4AA 1OGBA 1ALDA 2IKIA 3W01A 1W1B1 4JFUA 3LQGA 3MP3A 4C5YA 1HN1A 2QDHA 2BDQA 1VZWA 3W72A 3TYZA 3Q45A 1SFTA 3AIVA 2Q01A 1EGZA 4IIHA 4WY0B 3TNBA 1W8SA 3GDTA 1PIFA 4A2SA 3W7IA 4O14A 2V8ZA 1AL7A 1OGGA 3UGVA 2J78A 3KDNA 3UXDA 1BPLB 1H5YA 4JYFA 1XIMA 1SZGA 1ONXA 2GQ3A 1E9ZB 2EG7A 1IYXA 3AYTA 3V3WA 1Q5MA 3O63A 3QPZA 2VVSA 4DVOA 1SZRA 4R9XA 3PG8A 1RCQA 2PWUA 1EJTC 1JCYA 4WCJA 2YA2A 3IJ7A 2WVUA 5TQLA 4L64A 3PN8A 4UQEA 1JYWA 3LEPA 1UR0A 1Z44A 1KXTA 4K1GA 2Y8UA 1R3VA 2BGSA 4RXFA 1CWYA 4UIOA 1OFOA 4RNHA 4CKQA 4Y6GA 3GH7A 3HPSA 1I2OA 3MC5A 3ZJ6A 1WDSA 3HJEA 3SSZA 1A5LC 3HOJA 4QNEA 2YYTA 1DL3A 3S2NA 2NVDA 4C1KA 4E2DA 5E93A 4JCMA 1GG1A 4HCHA 3NQVA 4HMEA 3KL0A 3F2DA 1W8GA 3VOJA 4XD5A 5D9NA 1AJ0A 3LDVA 5A6TC 4LUSB 2FVKA 2YDAA 2Z6JA 1AL8A 4Q8QA 3VUPA 1BRLA 3NPUA 1KBIA 2HE5A 3E0IA 2VENA 4CNPA 1EYWA 2UY3A 1DTNA 3H6OA 1KFEA 1GZJA 3AFBA 3ARVA 5CZJA 3W25A 1YW1A 2EKCA 4MLRA 2NXHA 1KB3A 2R94A 3EDFA 3U5YA 4Q6XA 2POZA 2VURA 3W4RA 1SW0A 2W62A 4TX9A 2WJEA 3P5YA 2XM2A 3MUIA 4DJFD 2PLJA 5K3VA 3A4JA 3FA5A 1YE4A 1JCLA 4ORMA 3MSYA 5K9XA 5IRPA 1ITCA 3V16A 1OHLA 4P2VA 4KPLA 5GNZA 4QCFA 4WJEA 3VIHA 2XN0A 2P88A 3BSMA 1XRSA 3W7GA 1W5NA 1WA3A 1PS9A 1S1PA 1HVQA 5IHSA 4HD5A 4O16A 1U1JA 3W75A 1NWRA 1B4EA 1WXYA 1RBOB 5HMSA 1FHVA 1E55A 1W3LA 5BOFA 5M5DA 2CHNA 3SCUA 1UKTA 3HG5A 1OG6A 5TBOA 4JTGA 1TPFA 4QM1A 4LTSA 3EWBX 3MV01 1FDYA 3MJMA 3OZOA 3GQYA 1UWTA 1TFVA 3ALGA 5E0CA 1TJ0A 5CZTA 3GG8A 4NYUA 3MB9A 5EL1A 3UXIA 2WSPA 4UQDA 1KKOA 1E15A 5CH9A 4HB7A 4CNUA 2V3EA 4NY2A 5FACA 3GKAA 1TR9A 5E0KA 3AYRA 3U5UA 4BEQA 5I02A 3CUIA 2XHYA 3R94A 3VE7A 2ZRWA 1QPNA 1DEDA 2P1FA 2XDFA 1Q6LA 5C6MA 3GU9A 4QG9A 1FQ0A 2EG6A 1C7SA 1H50A 3UYCA 1LF1A 3OLIA 3DAQA 2PF0A 4DI9A 2IPGA 3DCPA 1PXGA 3GTFA 4E5TA 1J5TA 3BMWA 1XRFA 1S39A 3RM4A 3M0YA 1JPDX 1K7EA 1DJXA 3DI1A 3WG6A 2P8BA 2WNNA 2HJPA 2AL1A 3V5FA 4DBWA 3T1GA 2XFWA 3S5ZA 2ZRXA 3GD6A 4WSHA 2WZTA 3BW3A 3KS6A 2JKEA 4F0HA 4J3UA 4M7SA 2GVJA 1JDCA 4PSPA 3J7HA 4HQVA 3UY8A 4XZHA 3F4VA 3W76A 2CZVA 3PP7A 3PJXA 4MIMA 3L4UA 3T78A 2VX6A 1HJSA 2ZKMX 4FNRA 4J40A 2XG9A 4QS5A 2CBVA 1R3TA 3GR7A 1GHSA 1OBAA 1Z89A 1EHAA 4WDTA 3TYCA 4XIMA 1E5NA 2PI6A 1E3ZA 4LUTA 7REQA 1R5YA 2O9TA 2GLKA 7REQB 5DY2A 1B57A 1W56A 1XM3A 3EPOA 1FDZA 5HNNA 3WUGA 3VOGA 3UJEA 5IDZA 3VVGA 1TO3A 2J7GA 1GYNA 4JN7A 1UKSA 3ARQA 3FNDA 1QPRA 1XLHA 2XH7A 2WM0A 2ZVRA 3EEGA 5JUVA 3WLNA 3FJNA 4GQRA 1SZFA 5B80A 3EXRA 2AAAA 2GK1B 4AX6A 4Z1BA 2QCHA 1VQTA 3TSBA 2EF9A 2X1TA 2A3BA 4W8AA 1EWEA 2Q3RA 3K46A 3L5LA 1W3TA 3GIPA 1DJQA 1GT8A 2WJZA 1V6YA 3PPCA 1F3XA 1A5UA 4BZYA 3LMZA 4ATWA 4TU1A 4AZGA 3WDPP 1S5TA 4KRUA 4DO5A 1NQ6A 1O12A 2XH2A 4F0SA 4NZ3A 3MHUA 4LEQA 1FA2A 4FNQA 3WNPA 1W31A 3EWXA 4DZAA 1UR2A 2HRWA 4ZA0A 2TPSA 4N9DA 3W7MA 1A4MA 3NL6A 3V5OA 3VKAA 1Q7MA 4NAEA 3WF3A 5H8MA 1LLZA 3LLFA 1W5OA 2WLZA 4E4FA 1KO0A 1LWJA 4RX0A 4J3WA 2PF8A 2I14A 1KM6A 3QQ1A 2GPTA 1UD6A 3STFA 4F9DA 1YX1A 5M03A 3A5FA 3ITTA 3NNTA 1X39A 5D05A 3N2BA 4JYDA 3AALA 4G7EA 7ENLA 1PZ3A 4Z1CA 4O1EA 2BTMA 1LOSA 1SSDA 4Q7IA 2GJRA 3TW6A 4XBJA 3BAKA 3GM8A 1EP3A 2VFGA 1FWRA 4YTRA 1KLZA 4ZR8A 3SURA 3O15A 3ARSA 1F3EA 1PL9A 1US0A 1UQZA 1TPWA 5AC4A 5E09A 5H6HA 1M7XA 3PZOA 2XSBA 3LBMA 4HN8A 1IV8A 3CYJA 4NRSA 5CPSA 4C6JA 2Y7FA 1OX6A 3T0AA 3G0XA 5C2CA 3TWBA 1P43A 2PWHA 3P8JA 1BKHA 5L6UA 5C9XA 4XD4A 4LS0A 2ALRA 3NSXA 3PTMA 1ZSXA 4ZVJA 5BOEA 4Z1AA 4FLSA 4DJFC 2YPIA 4ZQPA 4S3DA 4XVEA 4AZBA 1PJ9A 2ZRZA 1CXHA 3I6TA 1VBUA 2DZBA 4GNKB 2Z1SA 5FEWA 3BGGA 3QY6A 3WH8A 4RJEA 5I3HA 2VEMA 1DTUA 2WKGA 4IFOA 4PODA 4DN1A 4FPSA 2Z7GA 2TYSA 1E43A 4EXQA 3O0FA 3SCSA 2D2OA 1S38A 4A8NA 1FP8A 3K4DA 4TVDA 1GPFA 2D73A 3H2MA 4S3EA 1V8EA 1E6QM 1M53A 4UTMA 3TLQA 2Y61A 3FJLA 4IIBA 3S1WA 2A7NA 3EX2A 1ZAHA 1DWFM 3UQNA 4MDPA 4DY1A 4L9XA 2VFIA 4PRWA 1FHLA 1VPXA 4W88A 5FI8A 5CC6A 4DM2A 5CGMA 3PFMA 4OHQA 4HK6A 2O0TA 5FF4A 4QLKA 4LUYA 3R0KA 5BMWA 4WDUA 4V2XA 4M1RA 1SJCA 5XINA 1EGMA 4L4PA 1RCXB 2YX0A 1H7NA 2YZRA 2RGLA 2VL4A 4B5WA 4LUIA 3C2RA 1TPH1 4F40A 1QHOA 4B4HA 1J5SA 3M64A 2G3IA 4L1GA 4RE0A 3VD7A 1Q6EA 3WLLA 2RJHA 2QJMA 1RAKA 3HF3A 4LCSA 1RY8A 1IXNA 1JDFA 4G9PA 3WNKA 3ZVHB 3HGSA 3IS4A 1J10A 2DIKA 2DQWA 4JNZA 3MT1A 3HPFA 4H2HA 1S3TC 3QN3A 4BKNA 2F7FA 4PE8A 2I5GA 4Q8TA 4DNHA 5CSUA 1VJIA 1POKA 3STGA 4DLMA 4JAWA 5FF7A 1WYIA 4EACA 5FCZA 2J7EA 1QASA 4MNKA 3BZJA 4B9ZA 3JR2A 3B97A 3VILA 1K9DA 4DHGA 5A2AA 1ZHAA 3CZEA 3UR8A 4KFPA 2VGIA 1NDVA 1BYCA 2C18A 5CG7A 1JDEA 1UBPC 3SUWA 1VJZA 4CD5A 4E3VA 1R0MA 4W9TA 3FK4A 1A0CA 3VIMA 3L21A 3ABSA 3WH5A 3BJSA 3DFTA 4PUEA 2WAGA 3CGTA 3AZRA 2DJLA 3KTXA 4IJBA 1UD4A 1H5VA 2YCLA 2FTYA 4IFKA 3ICJA 2ZZ7A 1IGSA 2EPNA 2Y5SA 3VFLA 1BVWA 4RNIA 2H8XA 4JFTA 1ZBVA 2D3LA 3NSMA 1YE6A 1W17A 3NAVA 2GWGA 4FB7A 4DB7A 1A0DA 4BF7A 1B2YA 2ZA2A 3PBGA 3TYDA 1FCQA 1PYMA 2JGYA 4S1FA 5AC6A 1EWDA 2XYLA 4D9PA 3R0DA 2B31A 2BVYA 4CU8A 3KDOA 3NM3A 4ZO8A 3VGDA 2B7QA 4JEQA 4AHQA 3UBPC 5HULA 4JIQA 3NQBA 3V1HA 3GR4A 3W81A 5EFFA 5FJIA 4RR4A 1M1BA 2QCCA 2PGFA 3C2EA 3LRKA 3C52A 3OO2A 3H7UA 3IJQA 4D1IA 1QI5A 2EPOA 3NL2A 2Z1VA 1EXPA 2J7CA 4PL1A 2BS9A 4N0RA 4M1BA 4GCAA 1S2TA 4JTFA 2PDHA 1G01A 4HMDA 4IPIA 2QPUA 1CT5A 2JKAA 1QW9A 2XIMA 3GTNA 1FTXA 3AIRA 1I0BA 2CEQA 3R6IA 3ZXWA 1PCWA 4HGXA 1K8YA 1KFWA 3O05A 1E6PA 1UMLA 2W63A 2WZEA 4HTBA 4OOUA 1GWJA 3C4UA 1PCKA 4ASTA 2ZXDA 1D7FA 1QNOA 4GY7A 4US5D 2PBOA 3IAPA 4GZJA 2YDRA 1B90A 4M8UA 2F8QA 3H54A 3MWAA 1P1MA 4UC5A 1XGEA 1W91A 3UEQA 3RCMA 1T40A 3EWUA 5DFAA 1XLGA 4OZOA 5F2GA 2NWRA 1SFSA 4DJFA 3C2FA 1B31A 1H60A 1C8XA 4PN2A 1ELSA 4BQ3A 4QFUA 2CLMA 2PDQA 4TVUA 2ZTJA 3S5OA 1NWSA 4FXSA 1WKFA 3IPWA 1A5KC 4ML4A 5AHLA 4NRRA 4QSFA 3BG5A 4IL0A 2PLKA 1GTEA 3Q94A 1BWVA 1TTJA 3C6CA 4DWSA 4DELA 3S2CA 4NHVA 4PCSA 1QPKA 2ZE0A 2ZZ6A 1P0DA 1GQJA 3L9CA 2Y63A 4HT3A 1ZGDA 1FXQA 5E9AA 4DF0A 2FB3A 1R3RA 4N7QA 1NIUA 4OWGA 4MB4A 1OCBA 2XH0A 3MHGA 2DH3A 4IP5A 1OFBA 2FTPA 4J5NA 2X7WA 2X30A 5BXPA 1E51A 5LGXA 1X6UA 2E09A 3SN1A 1Q65A 1T96A 1PV8A 4RK8A 2Y5EA 3ZMRA 4U4MA 2XFFA 3DKJA 1ZNNA 1TVLA 4GINA 4XG1A 1L8NA 4C6IA 5T9CE 4G5DA 2VUNA 2AAMA 4LAZA 3UA4A 1YBQA 4IX0A 3KZSA 4MY9A 5D8WA 4KIRA 4ZOEA 1VFMA 1VS1A 3W87A 1JZ6A 3OA3A 2C0HA 3TJXA 4LW7A 4Q33A 4JQAA 3L0NA 2XFRA 3LXAA 1CXEA 4UCGA 4ERIA 5FF2A 1J0YA 2IS7A 3BSHA 2WLYA 1R47A 3GDBA 2V5BA 4AW7A 2C0AA 3QQ0A 1D8WA 1IQ8A 3W1AA 2BWGA 3P14A 4MF4A 2INZA 4QQUA 3HGJA 2F6UA 1F05A 3MKKA 5E6YA 3P60A 1PWLA 2VGFA 3WBYA 3RFAA 3M41A 1JYVA 4WKFA 4E2OA 1VFHA 3DG6A 4I3GA 1RK6A 2P8CA 2ZUTA 3S2MA 3M0IA 4W86A 3WQ6A