1S2WA

Crystal structure of phosphoenolpyruvate mutase in high ionic strength
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
258
Chain Sequence
b'KVKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 97
structure length 258
sequence length 275
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2wA00
3MA8A 4DRSA 3IS4A 3QQWA 5TAOA 3E0VA 1VBGA 2VGBA 1T5AA 4TV5A 1PYMA 3T07A 1M3UA 3M0JA 1S2UA 2V5JA 2VWTA 3ME3A 1PKMA 1O5QA 3E5BA 4JPGA 1Z6KA 1DQUA 3KTXA 1KBLA 3QV7A 1F3WA 3SRHA 4B5VA 2WQDA 3QV9A 1U5VA 3BJTA 3T05A 3T0TA 3SRFA 2HRWA 3EOEA 3QTGA 1DIKA 1F8IA 4KS0A 1DXFA 4B5UA 1U5HA 2X0SA 4TV6A 2VWSA 2L5HA 1XG3A 1IZCA 4MG4A 2DUAA 4HYWA 4B2DA 4KCVA 1M1BA 2XDFA 3EZ4A 1PKLA 1PKNA 1S2TA 3EOLA 4FXFA 1DXEA 1PKYA 4B5SA 2HWGA 2V5KA 2OLSA 4QG9A 3LYEA 3QLLA 3B8IA 4B5XA 3I4EA 3QV6A 1UJQA 3FA4A 2DIKA 3PP7A 3FA3A 1ZLPA 1E0UA 3M0KA 1GGOA 4G1NA 4YNGA 1SGJA 3HQOA 3VAVA 4B2DD 1A5UA 3LG3A 4QGCA 1XG4A 4IP7A 2VGGA 4KCWA 2E28A 1S2VA 3OYZA 1JDEA 3R4IA 2XZ7A 1A49A 2HJPA 2KX9A 4L9YA 3PUGA 2BG5A 4IQEA 4IQDA 1O66A 3QZ6A 1VBHA 3G2GA 4KRZA 4L7ZA 1F8MA 3BJFA 1F3XA 4KCUA 3SRKA 1A3XA 2VGFA 4L9ZA 3EOOA 3P0XA 1OQFA 2ZE3A 3H6OA 2HROA 1F61A 1S2WA 4FXJA 4LSBA 1ZJHA 2VGIA 4KCTA 3GG8A 4IMAA 4YJ5A 2G50A 1AQFA 3HQPA 3HQNA 3KHDA 1E0TA 3GQYA 5JVLA 2QIWA 3OYXA 1IGWA 3QV8A 4RPPA 4MF4A 1A3WA 1KC7A 4WJ8A 4B5WA 1MUMA 3N25A 4B5TA 3SRDA 4QG6A 4HYVA 4ROQA 3OQ8A 4QG8A 3U2ZA 2XZ9A 2R82A 3GR4A 1OY0A 1O68A 4L80A 3E0WA
chains in the Genus database with same CATH superfamily
4PCTA 4X9YA 5FEWA 2YGYA 3PSWA 1A5CA 4TTGA 1ICSA 4MB1A 2W67A 3A9IA 4Y7EA 1Q6QA 3ZYZA 3IJIA 3LPOA 3NGJA 4WGXA 4DUVA 1AZ2A 1OCQA 4O1BA 3WUEA 3C2RA 1KRBC 2ZWYA 4HNTA 1DKWA 4QDWA 4FNSA 2ZRVA 2VYOA 5HINA 5DCBA 3VILA 4DYEA 4GACA 3BUVA 2PWFA 3DHUA 2PLKA 4B2DA 4KCVA 3PZQA 1OFAA 3EXTA 1EDQA 3M0HA 3IRSA 4A4AA 4HBKA 1QBAA 3S2MA 3VNLA 2W9MA 4RDVA 3KOYA 1EYEA 4J3UA 4GOAA 3VCCA 2ZA3A 3LGEA 3RRAA 2OO6A 4IP5A 4FXSA 1IXNA 4Y90A 1OX5A 3N6HA 1CLVA 1QNVA 2J27A 5ECVA 1OK4A 3THUA 4AYGA 3CXOA 3DKJA 2D23A 2YDRA 3QH2A 3LDVA 1V6TA 3TCSA 3GR7A 2X8RA 5LZLA 3V1PA 4EF8A 4XZLX 2IS7A 1EX5A 2WKGA 1BQGA 1GWJA 2A3HA 2XISA 4AMCA 3F4WA 1K02A 5HNRA 4A3HA 2IQ0A 4ZOCA 4D8LA 3KFTA 2P0OA 4O18A 3DFHA 1JAEA 3JVAA 2WBGA 1JQVA 4D6EA 5A95A 1H7PA 4RV8A 1VEOA 3ABXA 4XB3A 5DRIA 3CIVA 3DECA 4ATDA 1EP3A 3LUTA 4DJFA 2O55A 4JTUA 1ZS2A 4GIRA 1TTJA 3L66A 1X1NA 4HMCA 1V0LA 3WN6A 5LSMA 2HSAA 2OEKA 4QIUA 2OLAA 2OZ8A 4PUNA 1YDVA 5LNWA 2BNJA 3O16A 3WDPP 3E0FA 1QK2A 5BMWA 5LHFA 4OIFA 3BW3A 3LQLA 2XPKA 2CU0A 1FDYA 3IJLA 4TQTA 4GBDA 3TYAA 4WUIA 2VFFA 9XIMA 4E4PA 1M53A 1SGJA 1VBRA 2PS2A 1IV8A 3E0IA 1A49A 3UG4A 3G1DA 2R94A 4DWSC 4I6KA 1O66A 2DGAA 1EZ2A 4Y96A 4XK2A 3UFYA 3O6AA 1U2YA 1LLOA 3N2XA 3RPDA 4XV0A 4DJEC 1LWIA 3UYIA 3HA1A 3WJXA 1LT7A 4BK9A 3HQNA 2QDDA 3ES8A 3VOIA 2NX1A 1L6FA 1ONWA 5BU9A 3W29A 4AX6A 3GDLA 3N25A 3WD4A 4GIEA 3T7VA 3QW3A 3BZJA 2F8QA 1GW9A 2J6VA 4WK9A 4LOCA 1YEYA 5K4XA 3IK4A 3GHUA 1OFQA 3CMJA 4F2UA 1EP1A 3CNYA 3MSRA 1KFLA 4WJXA 4K8EA 4PFMA 4MTVA 2ZRUA 3CZ8A 5MHBA 1WZLA 1D8WA 2J88A 2NWSA 1E3XA 3I10A 4FOKA 3I6TA 3WK0A 4WDWA 5EB8A 1C93A 4WDXA 1R2RA 3MMTA 4G56A 1FWDC 1IWAA 5CGQA 5JBDA 2C0HA 3TLLA 3WLMA 4E5TA 4UCFA 5CAKA 3ZVHA 4LS2A 3CUJA 3LYEA 1OYAA 3FXYA 3W7QA 1T7LA 4LVGA 5CJ5A 2ZXQA 3MC5A 5G2IA 3LRKA 1J93A 4HZ6A 3VKAA 2PCEA 1V3JA 2Q01A 4CU6A 4J2MA 2W27A 3LM7A 3GNXA 4O1CA 4Z2GA 1TVNA 1W2PA 2I5QA 4Z1CA 2QJNA 2QF7A 5HMEA 4L7ZA 1F8MA 1DJGA 3LB0A 4EF9A 2DW6A 3TA6A 2QCEA 4EPEC 3TN3A 2GVGA 3M6DA 3MKCA 2BFGA 4AHQA 5CGMA 4UTWC 1XIBA 1RA5A 4ZXOA 2J75A 2JKAA 3QPEA 4MF4A 3HG5A 3W2UA 5E0KA 4HU8A 1ECEA 4JAWA 1JD9A 1HXJA 4MZYA 4LY8A 5F2GA 3BQ5A 3NQVA 4XBKA 3NZPA 5CZTA 3NNTA 4D72A 4FPSA 2C91A 4XKYB 3QYQA 2FZ9A 1I9CB 1VPXA 1ZJIA 2G0WA 5I03A 1WA3A 4CCEA 3P62A 4WOZA 5BXTA 4DQWA 1OYCA 4WDTA 2FGBA 1KBLA 4OT7A 5CZSA 3S5ZA 4G7EA 4NZ5A 4MUPA 3VC6A 1GUVA 2D24A 4MYAA 1HTIA 7TAAA 1XYLA 4DI9A 4LYKA 2YA2A 3E96A 4CVWA 3W1RA 3E6EA 2RAGA 3CC1A 3S6TA 4R88A 1PIFA 1OC6A 5GJMA 3IJDA 4EXBA 3PUEA 1WXZA 1W3TA 4GI9A 2Y61A 3P5YA 1XIHA 1O5KA 4B91A 1XYCA 3TW9A 4NNCA 1F73A 1BF6A 2E9MA 3NFUA 1C7TA 3AALA 2XFRA 1UBSA 1VR6A 1ZENA 3W27A 1JI1A 3TFCA 3T78A 1CPUA 2VEGA 3G8EA 1H5VA 2GJXB 5LNVA 3AI0A 3RHGA 2O7SA 3HG4A 4HHHA 1H1NA 3CAVA 2D2JA 3HJZA 5J5RA 4A8LA 4FR6A 4YTTA 4UFMA 1HQTA 2XH7A 4BFAA 4WHBA 1OF6A 2ONEA 2WSQA 3G18A 3TYCA 5DCDA 4JIHA 1JCJA 4B15A 4QG8A 1R3TA 3FYYA 3RIKA 3C0JA 2JKEA 2Z7GA 1EEPA 1NAL1 1FDJA 3O6CA 1TRIA 4DBWA 5H8PA 4W5ZA 3B3DA 3OA3A 3S5SA 3WMSA 2ISVA 4LS0A 2PDKA 5C9WA 2EF9A 4ZSTA 3G0XA 1XC6A 3SRFA 1TJPA 1BEUA 1V3LA 3SCUA 1R7OA 2ADAA 4A3YA 4IPPA 2PF8A 1POKA 3UWZA 4WKAA 3RGTA 4OJYA 1SW7A 4MAVA 4S3BA 3JW7A 1QXLA 3SY1A 3PANA 3QFEA 5F4SA 4Q3MA 4HOXA 3WZ0E 3OOQA 4Y9OA 2OX1A 5E9XA 2D0GA 2EEXA 4US6A 4JTHA 1CGYA 5AC6A 1P6BA 1SJCA 3DFNA 5FEZA 1KGUA 4IG2A 2ZQ0A 3QPYA 1G5AA 3AXIA 1LBFA 2C1HA 4NXKA 3S1GA 3TX9A 5AC5A 3UERA 3OLEA 4DM1A 2VP8A 2X7WA 4IQJA 4ACZB 4L1WA 4C5YA 4UFHA 1FXPA 4MSSA 2OQHA 3L65A 4O8AA 1E4MM 4H7ZA 3LBMA 1ZAHA 4GC3A 4LUTA 2J7HA 1U30A 2KZHA 4XAYA 2GVJA 4UTLA 5IRPA 1MEIA 1ODUA 1W1YA 5JBFA 3ZT6A 2J9YA 2Z28A 1S46A 3P60A 3PUOA 1JRBA 2VGBA 2ZZ2A 1Q7MA 3NOYA 4XZNX 4UQCA 4GXMA 1CGUA 4D9PA 3B8TA 3KVMA 4N0RA 1PTGA 4Q7BA 1ISYA 1E0VA 2W4XA 3W9ZA 1KM6A 1LCOA 3BLDA 3PZUA 2G4FA 3VGGA 3UXDA 5M17A 4CGTA 4OUIA 1O6IA 5E0FA 3WNNA 1PIIA 2X1IA 1NDYA 1F4AA 2BVYA 2F7FA 2P3EA 1W1IE 5HULA 1JXJA 5HPCA 3TCEA 7A3HA 3HGJA 4RE2A 3BICA 5FJOA 3GW3A 3IIZA 1EC7A 2XH2A 3BLPX 4PTMA 4UMAA 4XAPA 2H3BA 1RSCA 4A2RA 3ARZA 1C8XA 2YJQA 3WBWA 2DJLA 1XSKA 4OHQA 5G4EA 3C2OA 1M7PA 1ISXA 1NY1A 1QI3A 4KCUA 1HGWA 3WF0A 3BMVA 3O1NA 1US2A 4XVDA 1IE7C 3TQPA 1KW1A 1ADOA 4XVEA 1R9ZA 3SY8A 1VCFA 1VFTA 1ONXA 4I9TA 3VGEA 5D03A 3TYEA 1NWRA 4Z1YA 4ROQA 4NP7A 1K1DA 1TR1A 4ENLA 1ZBKA 1PBGA 3BANA 3UEQA 3VKCA 3CYJA 4Q8MA 4YTSA 3W22A 1E9ZB 4MLRA 4GWEA 2OKTA 2GUYA 4RDWA 4WJEA 1G01A 4O0QA 4FLOA 1BHGA 2F6XA 3W6YA 5XINA 3T40A 4AUBA 4IIEA 1XICA 3RU8X 1AODA 2HNEA 4JKLA 3S5NA 2VDIA 4IP4A 2X0SA 3OIXA 4IL2A 2E77A 5BWAA 3WQVA 1K4HA 2X16A 4UFLA 2BVTA 4BR1A 1WKEA 1O7AA 3VIFA 2PMQA 4IIGA 1M68A 3WY1A 4U3CA 2QV4A 3ATYA 4LVDA 3PSVA 3CWNA 2A0NA 5XIMA 1X96A 2R6OA 1IEWA 2QLYA 2C1GA 2AQOA 1XBZA 3MO4A 3TEVA 4IFKB 3EWZA 3NZRA 1Q2RA 1NFBA 2W6RA 4QR6A 3FXGA 3MWAA 4B4FA 1I75A 2ZIDA 3GXMA 4NI8A 4E8DA 3R5EA 4GHRA 1P7TA 5K9XA 4IGNA 1EGMA 1KV8A 1X8CA 1A5LC 1OC5A 3EDFA 3SW6A 1QOXA 3IJQA 1GT8A 2QPUA 4OGZA 1XSJA 4FR1A 2OEJA 3Q65A 2F38A 3W02A 1DVJA 3UWWA 3WNKA 3GK0A 1ZY9A 3ID7A 4HNLA 4JQ1A 5F2IA 3L2MA 1HF6A 3HO8A 3Q45A 2RKXA 1V51A 2ALRA 4QAWA 1GNXA 1EOMA 4K8GA 3ZFHA 5AYZA 5DT5A 4HB7A 3OODA 2VX6A 2QPSA 4PL2A 5REQA 1GW1A 3KL0A 3ZZ1A 2IPGA 2J8FA 1UMLA 1OFRA 4RZ6A 2FZMA 4NASA 4AYSA 3W83A 4JTLA 4LAUA 3KL3A 3C61A 3FA4A 2D3LA 2E68A 3JUGA 2D2OA 2CXGA 1B5TA 2DU2A 4FX7A 4M19A 4DN1A 3WLQA 4WXYA 3AMLA 4GH1A 4L4MA 2ZXAA 2CLPA 1V6XA 4M7TA 3GNNA 1XUZA 5DN1A 2PDIA 4LAZA 2VGFA 1UOKA 1VGAA 4GYPC 3S46A 2Y5JA 1VYRA 4IWWA 3LZ5A 3NVDA 2PFHA 1SZFA 4O28A 4QEEA 2BVDA 1OIMA 1CB2A 4EKJA 4N42A 4HD5A 2YL8A 1W8SA 4LCRA 1JGMA 3TC6A 3R43A 4GX8A 1OCBA 1QDSA 2ZRWA 3S1WA 4DYKA 3QW4B 4DVOA 1WYIA 1QPOA 3IS4A 5LIKX 4C7GA 1EJVC 2V5JA 1Z48A 4LFYA 3W82A 4D8AA 4D6HA 3M44A 2FMNA 3NQ7A 3NYZA 4K39A 1XXXA 1SO6A 3O15A 3KCJA 3U5UA 1P4CA 1D7FA 4MJ4A 1HJVA 5HMFA 4DBDA 1SSDA 3N73A 3GTFA 3ARQA 3VD5A 4DXVA 1M1BA 4NL1A 4GVFA 2G3IA 1L6WA 3TW6A 1S1RA 1QOQA 1WO2A 3DBNA 1TELA 4KWUA 2EHHA 5BRBA 5DY2A 5A6LA 1GJUA 2Z4GA 4HHLA 2EPKX 3GHTA 1W9DM 1U1JA 5LXEA 4NJKA 3STPA 3EOUA 3M5YA 4S3CA 3W07A 1KO0A 3E2VA 4L9YA 1DWHM 1J0IA 3VGDA 4V15A 2WNQA 1U22A 5F4WA 3CAQA 1JF6A 2GQ3A 3SAZA 3W1QA 1G94A 1HGYA 1V5XA 1LYXA 2G97A 4EAMA 2GJRA 1RK5A 4J3SA 4KEVA 4XTDA 3EDJA 1UZ1A 4AD5A 1E0XA 1YLVA 3NL6A 5J5DA 3O6DA 1MUWA 1TPFA 2W3ZA 4WR3A 5K4ZA 3G1YA 1CI1A 1XLAA 4LUYA 3GYEA 5DMYA 3QGAC 4XBJA 1YBQA 4O1FA 5G4WA 2DZPA 4LB3A 4PYSA 4QTGA 2O7QA 2G3JA 4AZHA 2C13A 3MUZ1 4KFNA 3VCNA 3HJEA 3AYTA 3CWOX 5LKYA 3UXIA 3ZT5A 3C0SA 4DHGA 1VIZA 4MNKA 1IEVA 4QSFA 3EDKA 1MDRA 1UH2A 3KBJA 4C6CA 3T4WA 3V36A 1K3UA 5EKYA 1UD3A 4LCQA 1ZLPA 4EXQA 3P14A 1A0CA 3S6DA 4GCAA 3TIMA 1M7OA 1A5UA 1LQ0A 1S1PA 1AJ0A 4GD0A 3AIBA 3MDUA 5AVNA 1PWLA 3MZ2A 1SZRA 2VCCA 3PTQA 4H8VA 4Z17A 2OG9A 3UZYA 3DG6A 2WVVA 3E2SA 2X0HA 1J5TA 2V9DA 2X09A 3RLUA 1UKPA 1Q8AA 1H61A 3KRZA 4P7LA 3P80A 3REQA 3CUGA 3LEPA 2NV9A 1GOQA 1AH4A 3TNBA 3F5KA 3UJ2A 2FPVA 4IPJA 4L9XA 2OQYA 3W7IA 5GNZA 2DT0A 5D4YA 5I0DA 1LQ2A 3UVIA 3EB3A 5I09A 2PPGA 2VD8A 2R8WA 4K36A 1VJZA 3WJSA 1AFSA 1FCUA 1UHVA 4P5UA 3WLOA 2PWGA 2I17A 4HSOA 1OX4A 4ZXLA 1FKWA 1H62A 2NZLA 3DFSA 2B0MA 2W5FA 3C8FA 5BMXA 1O5RA 4C6OA 1O12A 4MY9A 1Q8JA 4LNCA 2PODA 5CZJA 2NXGA 2D0FA 1G9HA 1GVSA 3SN0A 3BAYA 5TD4A 3UZZA 3RM4A 2D73A 4L4LA 1TRDA 5AHNA 1B3ZA 2WLYA 1M03A 3NWRA 4TVUA 1OBAA 3A3XA 3QV6A 1UZ4A 3IJ7A 3WLSA 1EJXC 3ZS4A 1Z42A 1ZGDA 3EGJA 3E9AA 2GVYA 2WMIA 3HURA 1ME9A 5C2GA 1T40A 2XIJA 3NA8A 5I3DA 4V1XA 3QBUA 2P3ZA 8XIAA 1W1VA 1W3KA 2EKGA 4ROPA 3WK1A 4U28A 1F4HA 4MJ2A 1O5XA 3QLDA 1IR2A 5CPSA 2NQLA 1FUYA 1OFOA 1HO4A 3U57A 4D6JA 4AMAA 5F2LA 1EJTC 2ZC8A 5D9PA 3HTWA 3OQ8A 4HTBA 5C70A 3RITA 4L80A 4N9EA 4DUXA 3K1GA 5KITA 2VL4A 3ZMRA 3VCRA 4TV5A 4W85A 1UIPA 1XKJA 1OEPA 1DJIA 2O4MA 3WLTA 2BBFA 4CNSA 4Q6XA 3H7UA 2X0YA 3I65A 3QTPA 4XSMA 2W92A 3LD5A 3TJIA 2YL5A 2O9PA 5FD0A 4QLKA 3B0VC 3QSTA 3OEXA 2Q8ZA 5AB3A 1R0MA 3ALGA 3B06A 4G1KA 3WEZA 3M0IA 4IXXA 1SJAA 2HEJA 2GSHA 1XR2A 3R89A 1P0BA 4RPQA 6ENLA 4CQBA 1XH1A 3CV2A 2Z1WA 3PP7A 3DFQA 3GIYA 3HGSA 4LUJA 3HPAA 1L0PA 4JX4A 3UPMA 1W1ZA 4B16A 1JZ4A 5FEXA 4TXEA 4D71A 3FVMA 2QGHA 1M65A 1X1OA 4PB5A 1TV7A 4HVXA 2D22A 2A5HA 1YPXA 4AVNA 3QR1A 4X22A 4JHMA 2V30A 4AH7A 4UMCA 4LW7A 4C6MA 4DUOA 3QYSA 4E2DA 3VYLA 2YFNA 2Y88A 3BAIA 2EJAA 3A22A 5KEZA 5DMNA 3GBDA 1GKPA 1PYFA 3T42A 1H1YA 3OHMB 4FNTA 5C55A 5K9CA 3C2YA 1TV2A 2VT0A 1GVEA 1SU5A 2GGEA 1XCXA 3HPSA 1KQZA 2PUZA 3FSUA 1W8GA 5K9DA 3S2CA 1C90A 1WDSA 3QGKC 3L4TA 1NOUA 4N2YA 2QUTA 5AZ0A 1WE5A 2QCMA 3PBUA 3V0SA 3UWQA 4AY8A 3T9PA 3QC3A 3VNIA 4HU4A 3IGHX 3PNUA 1NU5A 3T2OA 2J7FA 2WK2A 3O6YX 2F6KA 1OVDA 3VMNA 1UWSA 1UUQA 3SQLA 3PK7A 2Z00A 2ZUSA 5H8MA 4IFRA 1V3HA 5G2HA 2OFJA 3OVGA 5I2UA 1HJQA 3K30A 4PUDA 2XVNA 2PP3A 4E8GA 1UH3A 4C90A 1UWIA 4REQA 2XGIA 3KCOA 5ENLA 2JGQA 2JQXA 3WMCA 1PCWA 5LIWX 1TG7A 1X1ZA 1T8XA 2WM1A 1EGZA 4N9CA 2BZNA 4DXXA 5KMYA 2D2HA 3J7HA 1AW1A 3GH7A 1EJRC 4M81A 4Z1BA 5I3KA 2G4JA 3EWWA 1SO4A 3PAJA 4PMNA 2HVMA 4GABA 3IWPA 1XF0A 3SN4A 3NDZA 1UZDA 5E9AA 1E40A 4U2YA 4DJDC 3GDMA 3G8RA 1OFDA 4K38A 2J8GA 4FO4A 2OCZA 3KHJA 2Z1BA 1KQYA 1HJWA 2J7GA 2BLEA 4X63A 3VNKA 4A2SA 4GVIA 1UWQA 4GGHA 3NIYA 3P8JA 1REQA 3PB2A 1R3SA 3BMXA 3GTIA 4Z2LA 4DBEA 1E71M 3ATZA 5CJNA 4DBUA 1RJRA 2GJNA 3M5VA 4W7VA 1A5MC 1W9BM 3EYPA 4NNBA 4IX2A 4KWSA 2AMGA 4L1GA 3GKAA 3RG6A 3KZSA 3VIGA 4LU0A 1JCTA 3VGHA 4AXKA 4CD7A 1SZGA 1AD1A 1I2RA 5AN7A 3AAMA 4Z2HA 3FX4A 1OX6A 3RILA 2H90A 3GU1A 4DWSD 2JE8A 1UBPC 1JVNA 4KRUA 4IHCA 3LBCA 4X60A 2UBPC 3R79A 4ORIA 3TMLA 4WKHA 1EA9C 2OWWA 2PI6A 3N3MA 1M3UA 3GFXA 3O0FA 4PTWA 4CN4A 4QLJA 2A6LA 1VJSA 4DNMA 1F6PA 1C91A 2E8YA 2OWCA 3BJTA 1WDDA 1I2NA 1SVDA 3WK3A 2YDAA 3DUGA 2VQUA 4LEFA 1F3TA 2VDGA 3VM7A 2ATSA 1XIEA 3W1NA 4CUCA 2VCAA 3VABA 4CU7A 1N8WA 3GYCA 3MSDA 1BYCA 3OG2A 4W87A 4NG3A 1JDDA 3GBEA 1FA2A 3GH4A 4YPJA 1PWMA 5CSYA 4O14A 4IIBA 3U4AA 2ISDA 4UQAA 1JNEA 4Z1AA 2Q09A 1V6WA 3W6MA 2GUBA 1E1CA 2DQXA 4C5ZA 3KDOA 4Z08A 3UPWA 1LRTA 4AWEA 4RE3A 2DPEA 3WX7A 4C6JA 3GFYA 3HQ1A 2G50A 2VOTA 2ZX6A 4H6RA 1TPWA 1FTXA 5CJMA 4BI6A 2GGIA 4GPNA 4X0VA 3WDJA 4X61A 2VFIA 4HU0A 2UV8G 1SO3A 4KF1A 2XIBA 1WZAA 4MDPA 2RDWA 3RCNA 2Z1VA 3GXFA 4H9MA 5E1QA 4MB3A 3BURA 4UNLA 1E3ZA 1NDVA 2BOFX 3RLGA 2PSNA 2XTKA 3PPGA 2CKRA 2A6NA 3SRHA 3N15A 3B4YA 3BG3A 2RGMA 4DI8A 4GUGA 4YHGA 2EKCA 2QUMA 2WJFA 5H6HA 5IBXC 5CLWA 1Y0EA 4ATWA 1PZ2A 4XIAA 3APYA 1VYSX 2OELA 3TTSA 1BGGA 3LPGA 4C6EA 1XJBA 3LSBA 3I3DA 1NOWA 3WFZA 4AZCB 2RJHA 3VE9A 1I0BA 3TONA 3N3TA 3BSMA 1PEZA 1QR7A 3OB8A 3CEPA 1B3VA 1GVRA 3S9YA 4PCFA 4GE8A 4GUJA 5CSUA 4AZ5A 1JZ3A 1N8FA 4FIRA 3WIJA 1OT2A 4PB3A 3WLIA 3DESA 1AK5A 1TKKA 2INZA 3R1ZA 1LZOA 2FVKA 3PZTA 3K8KA 1DPMA 4PULA 3U2EA 3CZKA 3CUXA 1AMKA 5EMUA 4JY9A 3C0QA 2GQAA 2IKIA 3DEQA 1J9YA 3Q58A 1HZYA 2EJ1A 2WNZA 3TAKA 3LRLA 4NT0A 4R5EA 3TJ4A 2NVAA 4BF5A 4L5ZA 2V6AA 3KXQA 3IARA 3M0MA 3TP4A 3LCHA 4OFCA 3GC2A 1GYLA 4JIIX 3ARUA 3MUXA 3S6OA 4UOJA 4E38A 3B9EA 3IJ9A 1CIUA 4PMQA 1JCXA 3WF1A 4W5UA 4GY0A 5LGZA 3LMYA 2B7NA 1ZJAA 2HK0A 1XKYA 1RQEA 3AIQA 4PMYA 3WF4A 3NCOA 3TE9A 2QDHA 1B1YA 1XDJA 4XAFA 3UR2A 3WF2A 2H9AB 3FV9A 1C92A 4G1NA 3S47A 3BLLA 2J79A 2HQAA 3VIPA 4YWIA 3CZJA 2GDUA 1ZFJA 2GWNA 4KRZA 4U5KA 1EO7A 3LXCA 1DE5A 3L4ZA 1NQKA 2HZGA 3VIMA 1JYVA 3PS7A 3EB2A 1PPIA 3DOPA 3CUFA 4GC4A 4IJRA 4H9VA 4XUYA 4A21A 1IZKA 4LVBA 3B0XA 3OBEA 4Q4QA 3LCLA 3LNMA 1KR0A 1BWKA 1R30A 1RD6A 4NXSA 3TTEA 3B8WA 3L67A 2AMXA 5ABHA 2G8ZA 4H8UA 4UZSA 6PTDA 2IPFA 1C7SA 4MWAA 3MA8A 1W1PA 1X6LA 1BKSA 5FJRA 4ZCWA 3LN3A 1NH6A 5D05A 1QT1A 3K4DA 3QRHA 1DTUA 4Q8QA 1XYBA 3SUVA 3UESA 3ZXWA 3DU0A 2Z26A 1KRCC 3AHXA 4HQVA 4M6QA 1UUOA 1NSJA 4GG9A 3TC3A 4YTUA 4HPGA 2DUAA 4HYWA 1VH7A 1PKNA 1DE6A 4NX0A 4HYRA 3FAWA 2Y24A 4Q8UA 4J3WA 4GISA 1UMYA 3DG7A 4GRSA 3A47A 3V5CA 3EA2A 4N6FA 2WNNA 4DF0A 1Y8BA 1KR1A 4OBRA 3VD3A 4S3JA 5A94A 1FH7A 4MUZA 3W85A 4F0MA 5I3HA 5EMMA 3KRBA 4LUIA 3PBWA 1SFSA 2QCGA 3QY7A 3IGUA 3TYBA 2Y5EA 4M0XA 4GCXA 3DYMA 5AC8A 1W1A1 2HROA 1XLMA 4MYXA 4C65A 3W38A 3GZ3A 4U3AA 4TVCA 1NF7A 1XQLA 3AYRA 2ZZ5A 4AWTA 4GVHA 1G67A 2WWCA 2FQIA 5DBTA 3C3NA 3WJZA 3AZRA 1R3YA 4FZIA 3MI6A 2X05A 3OIHA 2VQTA 3F2CA 3VGFA 4NAEA 4RW5A 4H9XA 2UY4A 2YCIX 4IQLA 4C6FA 4G8TA 5EPDA 3GIQA 1W5MA 3GO2A 4YCOA 2WXDM 1IXQA 5U7SA 1RCXB 4XD3A 5FCZA 2G3MA 1FRBA 2Z2AA 2HRWA 1OC7A 4OUEA 1ONEA 3G0UA 5CPQA 4HJWA 3VIJA 4XSLA 3WCZA 2Y4SA 3FLUA 1JZ8A 1DQWA 1Q85A 3VZXA 3WMLA 3L4UA 4GKTA 2H8XA 1RVKA 1PKYA 1GVIA 4B5SA 4O1EA 3SFWA 4ZENA 5IOBA 3CUZA 4F2TA 3GNPA 3MZNA 3AU2A 5CGTA 2OYLA 3AJXA 2V2DA 4HN8A 2WVSA 3RM8A 2QAFA 2QULA 3DZ1A 5M03A 1TUXA 2VMFA 3PBVA 4LQ1A 3CMFA 5C54A 1QW7A 3WD3A 4DY1A 5HPOA 1RBLA 3MKVA 1KFBA 4C7FA 2TAAA 3NEVA 4RE0A 3QZEA 4DWSA 4EE9A 2YA1A 4PBGA 1TJ0A 3WDRA 4KESA 1JGIA 3NQ6A 8XIMA 1KLZA 2E6FA 2JEQA 4DJEA 2J7CA 3ZVHB 4QNEA 3ITTA 5HUPA 2HVOA 1KXTA 5HMSA 1U1HA 1BKHA 4ICMA 1GYMA 3FKRA 1XD0A 1XGZA 3K8LA 2FPTA 2PE4A 2WNWA 1DEDA 3HG3A 1E0WA 1L8NA 3R6IA 1FWAC 4CD8A 1TQJA 3P82A 3KP1A 4LS1A 3P84A 2G95A 1HN1A 3FS2A 2C16A 1WCGA 3ARSA 3AS3A 3L68A 1TPH1 4KEMA 3RAOA 3NQFA 4FX6M 4C6KA 4Y2WA 3G5EA 3FSTA 1MW3A 3S2JA 3A4JA 4MPKA 3UR8A 5I02A 3N2TA 5JIPA 4DM2A 1B2YA 1ADSA 4WSHA 3B8SA 4M3PA 3PJTA 1XIDA 4AXNA 4W7UA 2Y7EA 2NVCA 3DENA 4IJCA 2AKZA 4B5NA 3UXKA 4KFOA 2YB1A 1SZEA 3VOGA 4ZB2A 2DZTA 5GPRA 3L0NA 1RQBA 4WQ6A 4BEQA 4G7EB 3UWUA 4FK9A 1GQKA 4GX9A 5JBEA 4B90A 3IK2A 1LWHA 5C5YA 3AXXA 1W3IA 1XLKA 1YDYA 3KHDA 1E0TA 3BJSA 3MKKA 1XLBA 1K9DA 3QV8A 1HW6A 2WZHA 5FL0A 1WZKA 4K3ZA 3UWYA 1E1FA 2GVEA 1NELA 4B5TA 4ECLA 4UTWA 3WQWA 2YYTA 2W79A 4H6KA 6REQB 3MB9A 1ODZA 4DBSA 4QJ5B 1UKTA 4I7UA 4ATLA 2FH8A 3LA4A 1N82A 4DLMA 1JD7A 4AVFA 5G2WA 4KMQA 4DNHA 3W1UA 4TMBA 3VUPA 3WNMA 1PZ3A 2A4AA 3UY8A 3KDNA 3PTDA 3UYCA 4XZIA 2CLOA 4UXDA 4C6IA 1WDQA 1OFEA 1KM3A 1QPRA 3AIWA 2XUCA 1UR2A 4RL3A 1YPFA 4TR9A 5TQLA 1VYPX 1EOKA 1P0DA 1U1UA 3OHIA 3SDOA 3LM3A 2ZDSA 2CC0A 4LT9A 1V3KA 3E5PA 3BAJA 5C2XA 3AZSA 4V2XA 1Q4WA 5CBJA 3EDDA 3N6QA 3U3HA 1I1XA 3D5HA 4UNKA 3I68A 2WCGA 4WOQA 2B31A 1KCZA 1ITUA 4UTTC 5HATA 4IMAA 4Q8PA 2WPBA 4LYPA 1R6WA 4W93A 3LRMA 3ARXA 2QYGA 3TN4A 3OZPA 1W9UA 1IWPA 2HTMA 4L61A 4M5PA 3KBWA 2WOQA 1BXCA 4LALA 2E6DA 3QY6A 1FHDA 4J3VA 4KGLA 1UR1A 2VD9A 1ELSA 1KNWA 5KINA 3UF9A 4IG2B 1J0HA 1DXIA 2TSYA 3H7RA 5CBBA 2DVTA 2WQDA 4GQGA 3QV9A 1YX1A 2HS8A 3RR4A 1W5PA 4DAFA 2V81A 3EKZA 1MQPA 3NQ2A 3BAKA 2PWEA 3MV01 4BQ3A 2A3AA 2MANA 4WIWA 1FWEC 2Q8LA 1S2TA 1B9BA 3EX2A 4JZ5A 3CL7A 3M6YA 2XM2A 4JD4A 1XC4A 3BARA 4XD5A 1EX1A 3LHYA 4IT1A 2WMGA 4GK8A 3CQIA 3GRIA 4D6GA 4BS0A 4GI4A 3CPRA 4NKCA 3C0LA 4DZIA 1TE1A 4PSPA 3CL8A 4UTKA 1QNRA 2J62A 2IUZA 1GOMA 1H7RA 4L9ZA 1FWIC 4PUJA 3VMPA 2X2YA 3R25A 4FNUA 4YJ5A 4O17A 1XP3A 2C15A 1E1EA 1PX4A 2SFPA 3UNDA 3QKZA 2WJZA 4YVPA 3YPIA 4NZCA 3VO0A 3SRDA 3L4WA 3OGVA 4IMDA 7REQA 3UR5A 4PEKA 3W25A 3AXMA 4DYJA 3PWIA 1W31A 3EEGA 3MY9A 1PYMA 3QC0A 2XWEA 1V03A 1KKOA 4F79A 3AUJA 4JKMA 3FDKA 3HZ3A 1AL7A 2NT0A 4DO5A 3UNTA 4UWMA 4OE7A 4MMWA 3W23A 2I14A 1P43A 4H9ZA 4AD2A 2PD9A 2OU4A 1VC4A 2YFOA 5IFTA 3S8HA 3MPGA 1MQRA 1OGSA 3K4AA 3H4WA 2BHYA 4XZBA 1DXEA 3UR7A 4DB7A 4UTUA 1R2SA 1XYFA 3L9CA 2Z27A 1CT5A 1XH2A 4MVAA 5KZDA 3KM8A 1QUMA 4CQDA 2QUNA 3PAOA 3RDKA 3UPBA 4V1YA 4PC8A 3NQGA 4H8NA 3GKFA 3O63A 3DXIA 1IHIA 3GVQA 3VD7A 5AY7A 3LV6A 4N02A 2Q6ZA 2V5LA 5LXXA 1JRCA 4GUHA 3EWXA 4B9YA 3RJYA 1JG9A 3PR2A 1GQNA 3QN3A 3MUY1 3VKJA 4I9MA 3A64A 3VKDA 1XWYA 4KKXA 3W7RA 2P0IA 3A24A 3G6MA 4M56A 2Y62A 1Q63A 1XQKA 1N2VA 3FHAA 3ANVA 4HMNA 4ZQOA 2WV8A 1W3JA 3QXBA 2C7FA 2PDJA 2PLJA 3T05A 3NQ8A 3EA1A 3IGSA 1DIKA 1LBMA 4MZ8A 5D9MA 4MIMA 4R85A 2BV9A 2VXNA 3B40A 1DTNA 3QHMA 4CNPA 3GD6A 4UTJA 3STCA 4CD5A 3NG3A 3CEUA 3TWBA 2VHLA 2DIKA 4D8ZA 1E6NA 1Q6OA 3WD0A 3HV9A 5AYXA 3W6LA 3GR8A 4GJJA 4GFSA 4YHEA 4KCWA 5AFDA 2ZUMA 4UBPC 3M0YA 4F0HA 2XU2A 3U5YA 4LRTA 2QUVA 1GKRA 2ACSA 1RCOB 1J0KA 5KZMA 1PSCA 4PSRA 3EWDA 4ICNA 2WZMA 4XKYA 4BHYA 3GNRA 1CXLA 2NQ9A 3AS0A 2JBMA 2Z1SA 3FA5A 1TWSA 4CEXC 3OLIA 5DBUA 1DWIM 1VFFA 1TA3B 2CLMA 4ZTYA 1K8ZA 3LHVA 4GO8A 1JUKA 2ZRZA 3UQNA 3ERPA 4HCDA 1LBLA 3N34A 2ISSA 3OLGA 4U33A 4YN5A 2BTMA 4GLEA 4H9TA 4NYYA 3CAKA 4CNOA 1Q6GA 1XLCA 3UJRA 2FYMA 2E4TA 3LI0A 2J66A 2O92A 2WSRA 2J47A 1QU4A 2Y89A 4RCXA 4BWLA 1GVQA 2GLKA 2V67A 1K8XA 5A6AA 2FZ8A 3H12A 1FCQA 4KH2A 3PJUA 4Q8NA 4YVXA 1F8IA 4HK5A 2XGZA 1CGXA 2VO5A 1QHOA 1XG3A 1HKMA 3IVTA 3MUIA 4QFUA 3AXHA 1E43A 4J4KA 1S2AA 1BVWA 3A4AA 3SCSA 3N9SA 1BF2A 3C6CA 2PDLA 3ZR4A 1ITQA 4KPLA 3W2MA 2ZUNA 3PBYA 4J28A 3UETA 3CLMA 3UG3A 3NZ1A 3NSMA 3MW7A 1ZBCA 5CEWA 1VEPA 3THCA 3V1HA 4JTEA 3W2NA 3UG5A 3CH9A 1FWNA 3GAYA 3QZ6A 1NDWA 3DAQA 4AC1X 2ZX5A 4D2JA 4P8WA 4HNCA 2PDWA 3IIPA 4KCTA 2QVHA 1MXGA 1WQ5A 4GYPA 3VZYA 3TZFA 3BLIA 1CENA 1TV8A 3CV6A 3DC0A 3L4VA 4ORMA 3H7VA 1I0DA 3GR4A 1XIMA 2YPIA 3BLKA 4JX5A 1VLWA 4W86A 4WRHA 2PEVA 1CXKA 4UQBA 3VD4A 2V3EA 1PO9A 1FX6A 4R3UA 2VWTA 1VHCA 1Z6KA 3GC5A 3OJGA 4YL2A 1HO1A 1D7KA 1WXYA 3GXTA 1U5VA 3CZGA 4EWJA 4PUEA 1A50A 3AO0A 3PZMA 5FF4A 4W8LA 1XLEA 1VB9A 1JEZA 2IKHA 3CB8A 1HP4A 1WKFA 2I1OA 3EZ4A 2DUXA 1QVBA 2RGLA 4EXAA 5HUOA 1YYAA 4UTFA 3GB6A 3TA9A 5BZAA 1KWKA 3MMDA 4JTAA 5FL1A 4JICA 1WB0A 1EA0A 1D3HA 3SJ3A 4A8NA 2AOSA 4DJDD 1LG1A 1KM1A 5C71A 3CO4A 1J2BA 3MSGA 4Z0JA 1BYBA 4G7FA 5HQMA 1ADDA 4A22A 1PVNA 1JCLA 3W7KA 2Y0FA 5JH2A 3MCMA 4LSBA 1GEQA 4HHPA 3SCNA 3ONCA 3GG1A 2Z2UA 1J10A 5CLTA 4RX0A 1QNQA 2O9OA 2ZZ4A 3K8MA 3WLKX 3TOPA 3CHEA 1MUCA 5D2VA 3BVJA 4FAMA 4JQ4A 1TB3A 3MP4A 1SR0A 2GOKA 3ISIX 4LUSA 1CW2A 3KBMA 4LF2A 1V0MA 3GG0A 2ZBTA 1JZ5A 3QR0A 1V4YA 2CLHA 2WHKA 1RY8A 1EJUC 1B57A 4FX8A 1VBJA 2EPMX 1XRTA 3KTSA 1TIWA 4TX6A 3EA3A 3W0KA 4H8HA 4AVOA 1B9ZA 1UD4A 3MTWA 4QCEA 2PCQA 3BTNA 3VU2A 1OABA 3VNJA 3W7PA 3SGUA 4K68A 3POCA 3Q37A 4DELA 2AL2A 1DQXA 7CGTA 1ISVA 3IV3A 4UR7A 2NUXA 2OPJA 5A8OA 2FZNA 4F0SA 3VD9A 1BD0A 1TTIA 2CWXA 2F84A 3AMKA 4H83A 1GORA 2ZA1A 2DIJA 2RUSA 3ITOA 5HBFA 5AYYA 1Q7QA 5CPLA 4DF1A 4B4HA 4M51A 1XINA 3TNOA 2YYUA 3URNA 2C79A 2OB3A 4JCMA 2D0HA 3N2CA 3N1AA 3MS8A 5GNXA 2Z6IA 4IUGA 1W9VA 3PWGA 3U9IA 2J7BA 4H3DA 5AYBA 3W74A 1LOSA 3GVGA 4S3KA 4F3HA 2BXVA 4ASTA 1OY0A 3S5YA 4YYCA 3O7UA 3WO8A 4GNVA 1T5AA 3HBLA 5MKGA 3K1DA 4AD3A 4BCEA 1W5OA 2OJPA 3HPXA 4LBSA 3F5LA 1YDOA 5BYWA 3EXSA 3TSMA 1P0EA 5A2BA 4GY1A 1MXSA 2WHJA 2PWDA 2X2GA 1NEYA 2QCDB 4K7YA 4R7WA 3SBFA 2A2IA 4B3KA 3UZJA 2V82A 4HNVA 4FEZA 1XI3A 1YPIA 3AHZA 1LL4A 5AHLA 3I4KA 1UWTA 3NURA 3EX4A 3CJPA 4IFKA 1X98A 2B81A 5LHEA 2R1KA 1DJYA 2WWDA 2XVKA 3N04A 2O4QA 1XV8A 1HIZA 3TC7A 4OOUA 4A3UA 1XIIA 3K46A 5AHFA 2C18A 2CLIA 3GNDA 2VKZG 2INEA 3QF0A 1ZP3A 5HJXA 2PTYA 1ZJHA 5C9RA 1NP2A 4DPPA 1SJBA 3B4UA 1VF8A 4UFJA 1RLDA 2DZSA 2E09A 3SUTA 5KZ6A 3UA4A 2GUUA 4AD1A 2AAAA 2R82A 2PAJA 1IGSA 3UJFA 4Q8OA 2ALDA 3AXKA 4DLFA 4JFWA 1RALA 1A80A 1FVPA 4I9JA 1LM1A 3BLEA 3NZGA 4H6EA 5KTLA 4L64A 1WDPA 2A1YA 4TOQA 4GXPA 3S5OA 4CEUC 1WKYA 2P1FA 4JBRA 2PBOA 1DXFA 3G1SA 3CH0A 3BCFA 1BXBA 3HM7A 3TYDA 4GFIA 4LEQA 3MMWA 3NEHA 3WLHA 2Y8VA 1ZAIA 3PWAA 4JKKA 1EHAA 2XWDA 1NM9A 1AW2A 2YSWA 2FDSA 5LNRA 2RDXA 1AJZA 3BOXA 3B0UX 3MUCA 4HKPA 5I3GA 4J3TA 2NSXA 3S4TA 2HCVA 3R4IA 2OYKA 5A6SA 3L5MA 4PMUA 1QW8A 2QKFA 8TIMA 1F3XA 5CSSA 3WEOA 2OZ3A 1P1MA 4FXRA 2GSJA 2WLZA 2Y1HA 3QGVA 2DZVA 3W00A 5D2TA 1GPWA 2G41A 4IJBA 2Q3OA 1ZBVA 2Z7KA 1K8YA 3KW3A 4RR4A 1XFBA 3GUGA 2YCLB 3TH6A 1K8CA 5HA7A 3U8GA 2XN0A 3EB4A 4HIBA 1RUSA 3FN9A 1UA3A 2AGKA 3R0UA 4XO7A 3ZJ7A 1VBGA 4AD4A 1GK8A 4EP8C 2FB2A 1VHNA 2VC6A 4C6LA 1AQHA 2ZUUA 2C0AA 1DQUA 4LAMA 5FSDC 4GI8A 4PTNA 3RYSA 3T0TA 3VNDA 2HISA 2VX4A 1JPKA 3IANA 1QBBA 3UCQA 1O1HA 1TZ9A 5SWUA 4E3TA 4XTIA 4DWDA 3UZ5A 3RUBL 1Q66A 1A4MA 1OYBA 4JIEA 1CWYA 3T55A 5I77A 2VENA 2CHOA 1JNDA 4YNGA 4JDYA 2CZEA 2PB1A 1BRLB 4OZOA 3UJEA 2QDEA 2WZTA 4Q6JA 3VKKA 4L1XA 3VOCA 3SSJA 3KZPA 1ZL1A 2PTXA 2VRQA 2Y6ZA 4YS1A 1VBHA 2W62A 2DZUA 2XVLA 4W84A 4HNOA 4JCLA 4M24A 3BLFA 2PRHA 4CNNA 1YIXA 3OGRA 5I3FA 1B90A 2J6XA 1OZQA 2V68A 3THDA 4I7VA 3GQYA 1QATA 3PTKA 5JMUA 3UWVA 1YE4A 2FJKA 3CU2A 4C6PA 3N9RA 1W54A 1H7WA 3BLOA 3TAOA 4F9JA 2FGZA 3ZWTA 3LGDA 2J8TA 3WQPA 1SR9A 3KOWA 5E70A 1GPFA 3HFTA 4JQAA 3W81A 3CHCA 3EX1A 2NV2A 4Y9NA 4F0KA 2VR5A 3QEZA 1TCDA 1F05A 2I7GA 3SCQA 2HBXA 4LPCA 4E2BA 1EP2A 4MFDA 2VEIA 5T26A 4EPKA 4Y8EA 4NVTA 1JDFA 2CZ5A 2C14A 5HDRA 3SB0A 4FLRA 3AC0A 5HQEA 3I6RA 4DJDA 3MU7A 1XIGA 2HWGA 2V5BA 1E73M 3KWXA 1UP0A 2HS6A 5AZ1A 1HP5A 1GONA 4K6AA 1G7UA 4J9JA 1XIFA 3LERA 1J6PA 4AWSA 1TVLA 2DT2A 4P7QA 3O0KA 1TE6A 4NYUA 4UNIA 4M6PA 3NPWA 4J40A 1S2CA 1U33A 4GGBA 1RCQA 3ITVA 3F4VA 2ZCGA 4IUOA 1I45A 3D47A 2ZXDA 4PRRA 1TJ1A 1RY0A 1QI2A 3L5LA 3SURA 2A85A 2VR4A 5CAHA 3GTHA 3WENA 4P61A 2CYGA 3EKGA 3QHOA 3CV7A 4O16A 2PGRA 3SQMA 2GJLA 1Q6LA 4ZQMA 1LLZA 1NOFA 3RCMA 4B3ZA 4QNWA 1RAKA 5C7VA 3QJAA 4OTKA 1YNYA 1E1CB 5DEZA 3RLHA 3INPA 4XISA 4IMFA 3SR7A 1H60A 3M07A 3WNLA 2P8BA 5CXPA 3IV8A 4GNKB 3NQMA 1R2TA 2D69A 2VWSA 3WQOA 1FH9A 2DT1A 4R9XA 1E70M 1BG4A 2Q8XA 2ZTJA 2INFA 1SM9A 2WSPA 1YNQA 4E8CA 2NSOA 5I78A 3G1AA 3GLCA 1UJQA 2FDMA 3OBAA 2WPGA 1WOBA 1EF2A 3JS3A 1XG4A 2G3NA 3WLLA 3RXZA 4LV4A 1S2VA 2BDQA 1FWJC 4AF0B 3GC4A 1TPB1 1RA0A 2VFDA 2NQ5A 3N18A 3WF3A 4CU8A 2Q02A 2YZRA 4J3ZA 4XAZA 3P0XA 4FLSA 1EDGA 1TO3A 2P5NA 3FK4A 1EQCA 4WF7A 4LRSA 5H1WA 4OECA 1XX1A 2IQTA 3HG2A 3MT1A 3TLQA 3O8AA 2GWGA 1QNSA 1IT0A 1XBXA 3L21A 1C9WA 3EWCA 3ITCA 2YL9A 4JNMA 4JY8A 4HA1A 4L6HA 2WBKA 1TQXA 3AS2A 2B7QA 3RF9A 2OODA 1CGWA 2NXHA 2C3ZA 4PE8A 4HA0A 2WCSA 3N19B 4QE5A 1E6XM 4DIAA 3SQSA 3ARTA 2J7EA 3KTCA 5T91A 1ZZMA 4ZQNA 3QSRA 2H8ZA 4PUKA 4IGHA 4URIA 2QPXA 2ZUWA 1RVGA 4NHVA 1PXGA 3T0DA 2EBNA 4OV4A 4H2HA 1Q7ZA 3LLXA 2I9UA 4HP5A 3NM1A 3IPWA 1GTHA 2GK1B 4F66A 1L2QA 1U5HA 2QMKA 3K5XA 1GVYA 2NXIA 1IZCA 1A5SA 1WDRA 2GGHA 1PX3A 5IBXA 3H70A 3W26A 5C8BB 4I90A 4RUBA 3TK7A 3E2RA 4ZE5A 2ACRA 5LA1A 2CFFA 1WUEA 1WKDA 2J4GA 3R0DA 5E6YA 3S1UA 4WSKA 4CCZA 2I57A 2ZA2A 1CGTA 3H8AA 3QHNA 3MWCA 4CKQA 1JZ6A 1W3NA 4ZO7A 1DWFM 1UWRA 1B54A 1TPEA 4KIEA 1GEHA 4JTRA 2CKSA 4UMBA 1BAGA 3H26A 2E6YA 5I24A 4IX0A 3S9IA 3NR0A 3PPCA 1LUCB 3M9YA 3MHFA 3M7SA 3W7LA 2J9XA 4KWVA 3KLLA 3VVGA 3RPTA 3ABSA 1KTCA 3W71A 5I6SA 1XYZA 3M0JA 3M46A 5HQLA 1KLYA 3T8QA 3DDMA 3LGGA 3H2OA 2VVNA 5HNTA 1IEXA 3GE7A 4PMOA 5AYIA 2GGGA 2OT0A 1UQZA 5FOOA 5EBAA 5FEPA 2CZFA 1QI0A 4ZODA 3URBA 3PVFA 3WYZA 3MP3A 3ALFA 1NP0A 3WLNA 1N7KA 4NZ1A 1BXNA 1TV3A 1YNPA 3RMEA 3KOZA 5U4NA 4ZO9A 4ILSA 1GVFA 1PTAA 4MWAB 3THQA 1QPQA 3IRDA 3PZGA 3O05A 4A8IA 3DYOA 3N13A 1SFTA 4Q33A 3R7MA 4Y9MA 3VE7A 1ZRQA 3L0GA 1KRAC 3CHVA 4PCSA 3BGGA 2NLIA 1TWWA 1ISWA 1XIJA 4ML4A 5EFFA 1XL9A 2QVNA 5BCAA 5BOFA 3TW7A 3ORWA 4BWLC 3AUOA 3C2FA 3AU6A 1R85A 1YRRA 4MHBA 3BV4A 4GIAA 4JGDA 3SECA 1A3WA 4Q4RA 3VKBA 1R86A 2QV5A 1ZP4A 2X1UA 4HSHA 3AIEA 4L4PA 4H7VA 1SYTA 2FFCA 2LLEA 1FHUA 1P48A 1Q6RA 3TR2A 4DRSA 4O53A 3WBAA 1HX0A 1CBGA 2WO5A 3UCDA 1GOOA 4N4QA 2V38A 4MKVA 1Q6CA 4AISA 3P5ZA 2HDJA 2WVUA 3K4WA 2YDSA 5I3IA 1FWBC 1UP3A 1IIHA 1OFBA 1UZHA 3VDHA 3S0CA 1TPUA 4EVZA 1IXPA 2J77A 5CBIA 5HNNA 2X1SA 3MI2A 2VUNA 3CZLA 1H7OA 3IAQA 3WQFA 1M6JA 2BODX 1OB0A 3EX3A 3PULA 4PA8A 4CD6A 3B97A 3ARRA 3PZOA 2DT3A 4D6DA 4LH8A 3RO8A 1PV8A 4UZUA 3KOFA 2O9TA 1I1WA 4B9ZA 3OBKA 3CPGA 4N6EA 2KAUC 2VFEA 3EPOA 3NDOA 1LQAA 1W9PA 3VDGA 1A5BA 2TRSA 5E0CA 1JPMA 1K9FA 4LV9A 3LV5A 3PY2A 1FCBA 4FALA 2YLLA 1UD2A 1UG6A 5L9FA 4GUFA 1XCFA 4Z2KA 2FLIA 1VBUA 3IJ8A 1E4NA 3N4AA 3KP0A 3NPUA 4A3QA 4D6CA 4NZJA 2NWRA 2F9RA 2YR1A 1XUUA 3TZNA 3UXAA 1GZGA 5BWFA 1EQPA 3ZJ8A 1E56A 3BW4A 2CBVA 2DEPA 4JX6A 1OINA 2XN2A 3FIGA 1H63A 5C9ZA 1LJYA 1LL6A 4DWSB 3PZ9A 3ABZA 2CLFA 3H2FA 1TWZA 4H7CA 3VNYA 5A8MA 2YBTA 3CL6A 3RMJA 1AQMA 4MG4A 4GI6A 1V0KA 3C2VA 4HOZA 3P2VA 4E3VA 1PS9A 3W87A 5BXPA 3QLLA 1E6QM 3BG9A 2VUYA 5IXEA 4J35A 3BOFA 3H4GA 1LROA 1LG2A 3LPPA 2FH6A 1CGVA 3CMGA 1VLIA 1MYRA 1EIBA 4QDPA 1OM0A 1RXOB 4IF2A 2VZVA 4IQEA 3QOMA 2YA0A 4WY0B 1J6OA 4JHZA 1QRQA 4EOUA 3TUUA 5AECA 4RW3A 1WAUA 4GXWA 5IDZA 2FHBA 1VAHA 2E67A 5HK4A 3G0SA 1J4EA 5I79A 3R8RA 3EXRA 1SZNA 1S3TC 2PLCA 3VM5A 3RM9A 1W1TA 3APTA 3G1RA 1RD5A 4M80A 3RLVA 2NUWA 2WC7A 3U2ZA 5DFAA 2CEQA 1HFBA 1EUAA 4RZ4A 4JEJA 4E2OA 5FACA 2PZ0A 1H50A 3E0VA 2OEMA 2MUCA 1EL3A 3ME3A 2BY2A 4WEVX 1JUBA 2E5BA 3LBOA 5LNSA 4IIDA 3TN6A 5EYWA 3FKKA 3IVSA 4B5VA 3RK8A 3ZLHA 1VS1A 3WQ5A 4PMZA 3T0BA 1UC4A 2PTDA 4AZCA 1V08A 2PWVA 2DY3A 5LA0A 3DIPA 4UR9A 3WKZA 4LC6A 4L56A 3VDBA 2JGYA 4PTDA 1LP6A 4RDYA 2DDXA 5EA9A 1GZJA 2F6UA 2DZAA 2PP0A 3HOJA 5T8GA 3PBMA 3FJ4A 3LPFA 3M0KA 2OOGA 5FKYA 1VIWA 1Y7VA 1Y5VA 1FWRA 3UGRA 1G4PA 1O95A 2Z24A 1MW2A 5B7YA 4ZGYA 3NXLA 4V33A 3SIZA 1LRQA 3C86A 4IICA 3AMCA 3TJXA 1A3XA 2IW0A 2C6QA 4C1NB 3OVPA 2DP3A 2IKGA 3W53A 3ARPA 4Y9AA 1UPMB 5C2CA 4XX6A 5FJJA 1XS2A 2P8CA 4FOJA 3SM0A 1UKOA 4J7RA 4OOZA 5FI8A 3F1QA 1TZ7A 4AEFA 5LGXA 1BSIA 4AFYA 3CHDA 4IMEA 2FB3A 1LTDA 3P3BA 1OWQA 4C6QA 4IPLA 3U4FA 4EK7A 4P7OA 3IAPA 3S2NA 4EIVA 1OCJA 1P6CA 2JALA 4O19A 3SO7A 2ZTKA 1X7IA 5BXSA 4NJHA 5TAOA 1JI2A 2V0TA 1PDYA 1ITXA 2ZWZA 3BOLA 4JTJA 1R8LA 1D3GA 1BTCA 2VZUA 6XIAA 1ZALA 1OZMA 5HJYA 4KWWA 3E0LA 3WBEA 1ALDA 3H24A 2WANA 3C52A 1R5YA 3FDGA 2E9BA 2AKMA 4YYFA 5FSEC 3G22A 1UR4A 3LNPA 1VPQA 4B5XA 2JIWA 1SQ7A 4JTCA 3NL5A 3EX6A 3ELFA 4C1KA 1MZRA 4CD4A 4O10A 5RUBA 1GQJA 1HJSA 3FGCA 1Z44A 4IMGA 3ICJA 3B8DA 5IFPA 1RH9A 2BGQA 3OYZA 3MHUA 4PTXA 3B0YA 4LVFA 1HVQA 2ZZ7A 1GQIA 1C8QA 4MOZA 2EXOA 3SRKA 5HAOA 3IGXA 1FXQA 3L0KA 1B4KA 1HVXA 1XDLA 5G1TA 1WBHA 3AROA 3TN5A 2OMAA 3I7RA 4ZL1A 3Q67A 3WEMA 2ZADA 1KXHA 3LXAA 5EGRA 1ME8A 1RLCL 4KWOA 2DQWA 4WJ8A 3HGOA 2QT3A 4UTTA 4ALDA 5CG0A 3FAXA 2ACQA 3W1LA 1LOLA 1V0NA 3A6OA 1ICPA 2PU0A 1XISA 3WNPA 1CECA 4XZ9A 2G37A 4K37A 2ZC1A 4A6GA 2GDVA 2WW5A 3ZQ9A 5F1UA 1UASA 4Q7IA 2OYMA 4HJFA 4F40A 2GSEA 4ZQCA 5JU6A 3DBPA 3ITGA 3MBFA 3QR3A 3ZR5A 5F4XA 5EY5A 4NF7A 4H4IA 1IR1A 1KFWA 1ZAJA 4M6UA 4E0CA 3R8GA 2ABAA 3QQ1A 4ZO8A 4QS6A 4AZ7A 3V5FA 4JQ3A 2OWXA 3ANUA 1T6MA 7REQB 1E0UA 1TMHA 4DPQA 1G4SA 4A05A 1L8PA 4ZVJA 4QGCA 4IP7A 3CPUA 3FVDA 2FHFA 3W76A 4UB9A 4QITA 3LHWA 3AHVA 3NO3A 3WLJA 2OSYA 4JOMA 3WSUA 3AIUA 9CGTA 2VCBA 3MDWA 4M82A 4S3FA 1GYNA 1OSEA 4HK6A 4FNRA 4CVUA 3M43A 3OP2A 3GG7A 1EPXA 1XLDA 1HNYA 1BPLB 1BVZA 3V35A 3F2DA 2REQB 1QPKA 2FTPA 3OYXA 3LSCA 1SSGA 4MNMA 3EDEA 1VFLA 3S42A 4GQRA 1K77A 1TR9A 2R91A 3A5FA 2W66A 3H54A 1Z41A 2XH0A 3NPXA 5A6BD 3WQ4A 2PDHA 3E2QA 1DL3A 1EXPA 1XFCA 1Q3NA 4KEZA 4WGHA 1NIUA 3QKEA 4C6NA 4IM4A 3G6LA 2VEMA 1DIDA 2NLYA 1MFUA 2NVDA 4BQ4A 3PM6A 2GDQA 4PBFA 5AOUA 2XDFA 1R38A 5BRPA 3W1PA 3WQCA 3LU2A 4KETA 1KV5A 1XGDA 5ABEA 1AUSL 1OD0A 5FAJA 2FMOA 4JYEA 2Q71A 1E5JA 2QCFA 4NZ3A 3SEPA 3GS6A 1Y5XA 3DFOA 3UWEA 2QAPA 4IQDA 2D3NA 2OOFA 1JZ2A 3GFZA 4GUIA 4W8AA 4GZEA 2Z2BA 1VFOA 1JIBA 3B9NA 3EWUA 3O2LA 3PJWA 1HL2A 2RDUA 4PL1A 4HK7A 3V7PA 4D6FA 4EX4A 2YX0A 4PRWA 2QIWA 3P81A 4HMDA 3HU7A 2X40A 3BH4A 3MVTA 4IL0A 4XZMX 5ABFB 2YW4A 2WMHA 2IPJA 5EMKA 3RFAA 1QPNA 1D2KA 3HGRA 1TPDA 6XIMA 1KA9F 3BWWA 2VNCA 1UKQA 3WQGA 1HJXA 1JAKA 1K70A 1JJKA 2ZZ6A 3W7EA 2FKPA 2PDFA 3VIKA 1QCWA 1FWHC 1O4UA 5C9XA 4PUMA 1IZJA 1LL7A 3RN6A 7TIMA 5CZKA 2R1PA 1Z8AA 3L12A 1B4EA 1IEIA 4TIMA 5M3WA 3T2QA 1S3HA 1Z69A 3AHTA 3TKFA 1L6YA 2CZVA 4TV6A 3R2GA 5TF0A 4NY2A 2UY3A 1F6KA 2VEKA 3R58A 4FS9A 4HGXA 2DSZA 4GQBA 2EPHA 4UFIA 2OSXA 2ZX9A 5C0QA 2E28A 2BXYA 2FZBA 4BKNA 1GJWA 3QZAA 2BX7A 3D0CA 3E12A 3A4WA 3SCTA 3HB9A 3OU8A 3CYVA 4Q8WA 1D8CA 3QMSA 1V93A 4RNFA 2CERA 6REQA 1BVNP 2GQ9A 4S3DA 2VC7A 3BSHA 4NAFA 4IGMA 3XINA 2CITA 4WSJA 5A8QA 1PUDA 1EDTA 1KCLA 5LIXX 4AW7A 5MF5A 2PDUA 1SFLA 2V63A 1EXBA 4NSBA 1UYQA 3WLRA 1VFMA 1DP0A 1YDNA 2VURA 1EYWA 1KFCA 1MW1A 3A23A 1F3WA 1S5MA 2BOEX 2YBUA 4YWSA 4W88A 5HNUA 5CH9A 1XLFA 1QO5A 1KKRA 5BRQA 2Y70A 3RJXA 3WUBA 1TJRA 2H6RA 3T4CA 3TYZA 2VI0A 4JTFA 1C8YA 1UB3A 4NILA 2PGEA 4FP1A 1E15A 2Z1XA 4JN7A 3H22A 2PA6A 3H2AA 4JEQA 1VFUA 4XAGA 1YTEA 3BAXA 3NXFA 1AMYA 5DX7A 2I5GA 1DIOA 2OZ0A 3T44A 1TFVA 2VRKA 2XZ7A 3MYPA 4AY7A 1YXCA 1SFJA 1UPPA 3A13A 1J18A 3KEHA 2HVNA 3KBNA 3P74A 1WPCA 4O1DA 1KM5A 2G3FA 2PD5A 4DXKA 3B04A 4AIOA 2X30A 4MNLA 3L4YA 2CZDA 3AZTA 5BXRA 4F4RA 4W4QA 3NGFA 5G1MA 3CTTA 1AL8A 1M7JA 4S3EA 4TTUA 1YQ2A 1NQ6A 2XH4A 3ZJ6A 3M7WA 4Z0SA 4J1OA 5CPOA 3WELA 3SI9A 3A3HA 5L6UA 4O12A 3CS2A 3R0KA 3V5OA 4JTIA 3U2CA 3WD2A 4NZ4A 4O4WA 2YOCA 1UKSA 3OQEA 3N4FA 1GTEA 1MFVA 3UW6A 2CHNA 3QV7A 4LVAA 1A3HA 3AWOA 3P0WA 3SFKA 2XSAA 2Y7GA 3QM3A 4KERA 4MJZA 4H9YA 1GVOA 4DX3A 1FKXA 1NWUA 4FIQA 1R47A 4PBEA 1MRQA 3IUDA 4RKAA 4ACYA 4RK8A 2PGFA 2AL1A 2DV0A 2EPNA 2CBJA 1H5YA 3AISA 1US0A 3IIVA 2XIMA 3RRXA 3WUGA 3V75A 1EJ7L 3HQOA 3VAVA 1KBIA 2UY2A 3BG5A 4WZHA 1KM2A 3Q4DA 3G3MA 3CUIA 3MCOA 3OLDA 3RX2A 1E6RA 7ODCA 4L4OA 4LUSB 2YLAA 3M5ZA 3TQ0A 1RBOB 2VRJA 3QPZA 3AFBA 3ZR6A 3B8UA 3FYPA 1TREA 2AQWA 3IEBA 4K1GA 3FNDA 3VDAA 1GQLA 3DFTA 3KL5A 3ZSTA 4FXJA 3TTOA 2VGIA 3AMDA 4WDUA 4RNHA 3TQVA 2EAWA 5EU9A 4R7OA 4BQ2A 1J5SA 3H23A 3OA5A 4QBXA 1PX8A 4JHOA 3CIWA 5G4HC 1VQTA 4IIHA 3OZOA 4B92A 3V3WA 4MB5A 4XKMA 1ZTVA 2AL2B 4QEHA 1F3EA 3VPLA 4MFEA 2QJGA 1EH9A 4MJMA 3D6NA 4Z42C 2QZRA 5A6MA 4EANA 1U5JA 3HFYA 4PMRA 1UCWA 3FJ6A 4LBRA 2QDGA 2HXTA 3KS5A 4LB4A 1V6YA 1FP8A 4I5RA 4NUWA 3AIVA 1Q6FA 1QHZA 1QWGA 1VZWA 4AZIA 3EKLA 3K2GA 4UTHA 4G2DA 1RPXA 1UD8A 4P8XA 2ABBA 1T0OA 1DJNA 1DHPA 1PL9A 1V02A 1VENA 3R94A 1H4PA 3S3GA 4JS3A 1L9WA 1R46A 3MQTA 4C6BA 1VEMA 3IIOA 4OVXA 3VMOA 3W4RA 4ZO6A 2OZTA 3G1XA 1LRNA 1HUVA 3T08A 3LG3A 4JL1A 1UJPA 2RHGA 5MKGB 5LIUX 4FOUA 3KCLA 4Q4OA 3KVLA 3OG3A 1JUEA 4JL2A 1UD6A 5FF2A 3W7JA 2PWHA 4DO7A 3KRUA 3R8HA 2FTYA 2AAMA 1TIMA 1T41A 3BPWA 5CZ0A 3MJYA 4HPHA 5AC7A 1JPDX 1VFSA 4CCDA 1OIFA 4MGGA 1DHKA 5A6KA 2VZOA 3QMRA 5EMJA 3WQ8A 2IPWA 5A6BA 3NO1A 4WVXA 2WCAA 3LMZA 2FGLA 1CLKA 3U7VA 2QF8A 4H2CA 4Z2JA 4CCCA 3VOHA 3IJ6A 1M41A 3BSGA 4PMDA 3CB3A 3OO2A 2CBUA 2CLEA 1O94A 3GM8A 4D1JA 3QFWA 4OV9A 3GHRA 3PB0A 1NFGA 2WM0A 3PFMA 5A2AA 4QSHA 3FW6A 2OKOA 2XSBA 1TSIA 5GQBA 3Q94A 2CCRA 1E6PA 2HK1A 2E6AA 4GY7A 4MM1A 4GYJA 1MEHA 4B5UA 3URQA 2PRLA 2NX9A 1DJZA 3L2IA 5FJIA 1BYDA 1XLHA 3DHDA 3L5AA 4O11A 1M9HA 4U2ZA 1QHPA 1XLJA 2E25A 4QXIA 1PIGA 1VFHA 3TMQA 2R9RA 1X6NA 1GGOA 1E5NA 4FNPA 1H7NA 3WJWA 1J8VA 3OZMA 1YXDA 5E6ZA 3MUAA 4MAZA 1JULA 3C56A 5DANA 5I3JA 3TFXA 3PJXA 1PB0A 1FQ0A 4C1LA 1XBVA 5B80A 1DBTA 2PZNA 1TA3A 1TZZA 5C9UA 3PNZA 2PP1A 4ES4A 4JYFA 4K2SA 1AQFA 4PMVA 2GJPA 3G77A 4I8DA 1V02E 3IIXA 4JTDA 2W63A 2ZE0A 4RNIA 4YLWA 3BO9A 1I2OA 2V5CA 4PN2A 3I7SA 3KBVA 1HL8A 3L23A 4PTVA 4US5D 1CX9A 2J25A 3AQUA 4A35A 2QS8A 1AQ0A 2Z29A 3BCJA 1KM0A 4WKFA 3B0PA 7PTDA 1WAWA 1TMLA 2Y63A 4KT2A 4RDZA 2DSKA 2XINA 1ZUAX 2OX4A 1CLXA 3F7JA 2NW0A 4JYDA 2Y7DA 3VK5A 3PZNA 4ZQRA 3UT0A 2J74A 4CLMA 1LORA 1ZHAA 3EMZA 1J01A 2IMRA 4X2PA 1QNOA 2F61A 1EC8A 2VEFA 4QG9A 2QCLA 4PR4A 3PG9A 3GUWA 3VA8A 5BROA 2PLMA 3UZWA 5CSRA 1XD1A 1NTHA 2A7NA 4GIYA 1YW1A 2EGZA 3KOXA 3C4UA 2QUUA 4JTSA 5EMYA 2QGYA 2E0PA 1AG1O 4JTKA 1R9XA 5D9OA 5CKSA 2B4GA 4X3ZA 4XIMA 4IOTA 1JZ7A 5FIPA 2DVXA 1PJ9A 1ZCCA 2Y85A 3MI3A 1JFHA 3VX1A 1SUXA 2FJUB 5FJPA 2XSXA 3SJNA 2G5WA 1EGVA 3JRKA 5JVLA 3CGTA 1V77A 3D3AA 3OW1A 3LOTA 4OBSA 3P8IA 2R24A 2Q3RA 1HT6A 1TPVA 3GDKA 3AWNA 3W70A 1YXYA 3TSBA 1W17A 2CWNA 3E0WA 2BSLA 2PTZA 4ZOBA 3CWHA 4CN6A 2F2KA 3DFYA 3BXWA 4NU7A 1MZHA 3T8LA 1OFPA 5CCZA 3ITYA 4NIRA 1FHLA 1W32A 5E5CA 1ZJBA 4HPJA 1I2QA 4AIEA 2GGJA 3UD6A 3P93A 1KFKA 3HPFA 1DOSA 5JXQA 6TIMA 4YTRA 2ASHA 5I00A 4O52A 1ZBWA 1ZNNA 3Q2DA 2DSWA 3M1ZA 2BOGX 1OG0A 3EAUA 1UROA 2ZDRA 5ECUA 4JFTA 3UG8A 1F74A 4RXGA 5J8LA 6A3HA 3MHGA 3NVTA 1E4LA 4I5UA 3CK5A 2RH9A 5FESA 3T2PA 1MSSA 5DELA 1C29A 2WYSA 2E5CA 2VX7A 2IXUA 3NSNA 4ADUA 3ARVA 3G24A 2PWUA 5A2CA 2XIIA 3LCWA 3L2LA 5HMDA 4WXZA 4UQEA 1YMYA 3DHPA 1JYWA 1NDZA 3PC0A 4HCHA 3VUSA 4OKDA 2XHYA 3TJLA 4I9AA 1W5NA 4GZ7A 1SO5A 3MYOA 4ERAA 3W7OA 4I5XA 3LZ3A 4JDBA 2PDYA 2DIEA 4OU1A 1FCVA 4AB4A 1D3CA 3D3FA 1IWBA 2BWGA 2XVPA 3QOKA 4UOQA 4ZOEA 3GY1A 4F2BA 3TXZA 4Y8FA 1MW0A 1V3IA 1THFD 1VRXA 3UZXA 4TMCA 3JR2A 1ZQ5A 4GH3A 4UFKA 2A3CA 3CT7A 2J9ZA 4YIWA 3M4HA 4MY1A 3IVUA 2CESA 3BGJA 5HWNA 1MNZA 2R14A 3UVAA 3CO8A 2PC4A 4LC8A 3WL0A 2CNCA 3CBWA 9RUBA 1KD0A 4ERIA 3ARWA 2HE5A 4TU1A 3M16A 4R53A 4WD0A 2QCHA 3W2JA 4DUWA 1VKFA 1G7VA 3MCNA 3WL1A 4P2VA 1RV8A 3NAVA 1J12A 3VC5A 4GYFA 2GVLA 4OQVA 4QISA 3ZJKA 5M1TA 3VI2A 1H7XA 2C8NA 2BY0A 3O06A 4JTTA 2YXXA 2VEPA 4YCPA 2CLKA 5TIMA 2NQZA 1FWTA 3C5QA 1OQFA 4HA4A 4K1WA 1SW3A 1EPVA 4ZMGA 1PTDA 1T99A 3EOSA 2AQVA 4QM1A 9XIAA 4JIRA 5ABTA 2ZXBA 1K4GA 4HT3A 2I9EA 1KB3A 2WC4A 1GOIA 2QCDA 4H01A 1X8FA 3UGVA 3ARYA 5EBUA 3GAKA 2XFYA 3SCVA 2ZX8A 3URAA 1S5VA 4S23A 4DJFC 5D02A 4JPGA 4DF2A 1X97A 1CXEA 4LUTB 3EBVA 2QR6A 1XHGA 3LCXA 3BV7A 3KX6A 4JN6A 3FEMA 1KTBA 1RBAA 1CNVA 5D37A 3N2OA 1WX0A 4IGSA 3W3OA 1RJPA 1UW9A 2OTDA 1GG1A 4FLQA 1WP6A 5AHEA 2UWFA 5I7GA 2QXWA 3EMQA 1TMQA 2WZEA 5CC6A 3GW0A 3FA3A 1EJWC 2A79A 3M0ZA 3ABQA 3N17A 3DGBA 5D04C 1I6NA 3DFPA 3V16A 2ESCA 1LOQA 3A5VA 3CQ0A 1MO0A 3WFAA 5HXMA 3DYPA 2HJPA 3G1FA 1H09A 5CC5A 4XQ6A 1XM3A 2OT1A 1X7FA 4ZB5A 3R10A 4W9TA 3B03A 5PTDA 3ZSSA 3AICA 3UCCA 2E1WA 2PDMA 4LTSA 4ZZ9A 3EPNA 1HKKA 5DXXA 2ISFA 2PC8A 5DMMA 2QHAA 1Q45A 4XD4A 4TX9A 4AY1A 1H2JA 2BY3A 4AZBA 1K7XA 3VNZA 4QG6A 4Q4KA 2IXVA 4NRRA 2BVWA 1YE6A 1IXOA 1QI5A 1UWAA 1R9YA 3T07A 4CQ8A 3E5BA 1XRVA 1E6ZA 3GWQA 4QHRA 3RX3A 3W01A 4O57A 1US3A 4L6OA 1W3HA 5GVJA 1QNPA 3PG8A 4QQUA 2JFEX 8A3HA 3CTLA 4LYQA 3G1HA 1UR8A 4HPNA 4LAOA 3DKLA 1K6AA 4KQNA 2O0TA 3SCPA 3WQDA 3ECQA 1F5ZA 4CQ9A 3OVRA 3H2CA 3NQCA 1ISZA 1NWTA 4AG0A 5BOOA 2OLSA 1SMDA 2WMFA 1SJDA 4MWAD 4QRNA 2YCJA 1FFRA 2YZ5A 2P50A 4HSNA 1KBJA 1FY6A 5D32A 3VIIA 1GOXA 3LCGA 5A8GA 2DSUA 5D09A 4ADSA 1UH4A 4LCSA 3P61A 3E38A 1H0GA 3GDRA 3T1GA 3MSYA 2YCLA 2D2GA 2P53A 2ZRXA 2ICSA 1DORA 3DGRA 4GZIA 2DH2A 1FDZA 3SN1A 3W24A 3FJNA 5HR6A 3F4DA 5FF7A 3ZLFA 4US5A 1M04A 1BFNA 4HTYA 3LHTA 1H0IA 2C1IA 1J79A 1ESWA 2XIQA 3C8NA 3IUIA 4CN1A 2ZZ3A 1JCYA 3L7RA 3B9DA 1P7TB 4L65A 1V7YA 3LTSA 3HMJG 4M8UA 4NJGA 3CZEA 5JQ9A 3N14A 1UWUA 1WBJA 3EOEA 4AZGA 5DT7A 1I8JA 1YTDA 3W7DA 3CQJA 3ZO9A 4IPNB 3VGBA 4ZA0A 1Z7AA 3WFLA 1BRLA 4LF1A 2EPLX 4A29A 1FWSA 4I3GA 4F0LA 4IMCA 1JYNA 5AVHA 5D33A 4LAKA 3CQKA 1G6CA 2XFWA 3I4EA 3AJ7A 2A3BA 5D2WA 2DZXA 5AHIA 3KE0A 4UR8A 1EWEA 1IT8A 1ICQA 2FZDA 5REQB 2Y5SA 4PODA 5A6TC 1LLWA 2PURA 4UC5A 1GOWA 3NM3A 2R1MA 5AKQA 1F2JA 1XGEA 1B3YA 2IKJA 3TQKA 3OPSA 3W7MA 2WKJA 5J04A 2B7PA 2EG6A 4RV3A 2DORA 1KGXA 4IPIA 5DLCA 4JTGA 1AZ1A 2OXNA 1S2WA 5DQPA 4DO6A 3STFA 3NO5A 4V27A 3AIRA 3NPVA 3BAWA 1XYAA 1IGWA 3WDIA 5CC3A 1IT7A 2VC5A 4NRSA 4U4MA 4M6VA 4CQCA 1EB3A 2HXUA 4K8HA 4LNYA 3W1AA 1EUNA 2XZ9A 4ZBCA 4O4VA 4O13A 1I60A 2OR2A 6ALDA 2GZXA 3NTYA 4H41A 5FF0A 4UIOA 5KETA 1RP9A 1YKWA 3HN3A 3C3UA 3R11A 2E9LA 1CXHA 1VD6A 2QW5A 4O1AA 1PHWA 1KBBA 2GJXA 3BQ6A 4QQ3A 3NDYA 2YKKA 1XDMA 4JTQA 1XW8A 2RFGA 3ABOA 4BF7A 2OVLA 1K7FA 1XLLA 1TV4A 3GU9A 3GXIA 1EC9A 4DJED 2JEPA 2PDNA 2PDQA 5CPMA 4S3GA 2QJJA 4AHPA 4PGLA 1VCVA 1TYGA 4MDOA 2J24A 3STGA 3WMBA 2QJIA 4CNTA 1WZMA 1BSLA 3LCFA 2EG8A 5D2YA 5DRCA 1QK0A 1OD8A 1MVYA 1QO2A 2WJDA 3MP5A 4HN4A 3WDQA 2DW7A 3FEQA 3A21A 4BQ5A 4PFHA 2BY1A 3I6EA 4WLCA 2ZUVA 3CLWA 4QAIA 3UXLA 1L6SA 2PDBA 1UP2A 5T9CE 4M1BA 2V8ZA 3S1VA 4P7RA 4HA3A 3NOEA 4QE1A 1CEOA 4D6IA 1KWGA 1HKJA 1KC7A 5HOSA 1UA7A 2NQJA 4HNUA 5TBOA 2WMKA 3DCPA 1EBGA 2TODA 1JXKA 4P7NA 4HNNA 3OGSA 4P8VA 5TNVA 4S39A 2Z1KA 4RJEA 3WLPA 1KM4A 1PKMA 1TWDA 3W75A 3APGA 1OJXA 2YBVA 4BZYA 5K2ZA 1DV7A 1GZ1A 4ACZA 1P5BA 1YBQB 3BL3A 1YTKA 4Z1DA 2YCEA 2PTWA 3H2MA 5IHRA 4AX7A 3WH5A 4N7QA 1XRSA 4BJHA 5D38A 4AF0A 3EOLA 3PZIA 5G1YA 1KFJA 3XISA 5GJNA 2EG7A 2A7PA 3W7NA 1A5AA 4O0ZA 3FJLA 4R34A 3PFRA 3GNOA 1DWAM 5AHMA 3FCPA 1EHNA 1TX2A 3USZA 1BGAA 4OBTA 1Z9AA 1J0YA 2VGGA 3F03K 2X7VA 1RHCA 2WMJA 4YVVA 2ATMA 1QFEA 7ENLA 1RK6A 5A8PA 3CAWA 3WQEA 5IHSA 1XH0A 3THAA 4HZ8A 1AVAA 2XM1A 5DY3A 2WSKA 1CTNA 4K7VA 1MRAA 3MO7A 2Y7FA 1FWCC 3ES7A 1MMFA 5EL1A 1VCGA 4GKLA 4ERGA 1D9EA 5A5WA 1HKIA 5JH1A 2D20A 2WVVB 2WC3A 3SUUA 3M64A 4U10A 1AA1B 1J0JA 2DZBA 2ODOA 3W86A 3MANA 2PDGA 4KEUA 3VOJA 3N11A 3ANYA 2GK1A 3W2KA 1E51A 4S2CA 3REQB 3W73A 3H21A 3E02A 1ECQA 2OGYA 2PDCA 1MDLA 3W1MA 2OLHA 1ZB5A 3QTGA 3T09A 3N4EA 1PHQA 3HMCA 3DI1A 2V69A 4QROA 1HKWA 4X0NA 2FIQA 3W1XA 1S5TA 4N4PA 3VFLA 4X9SA 3BE7A 1XYMA 1RPKA 1OX4B 4EAYA 4EWND 1UR9A 1O60A 2ZFAA 4XG1A 1V79A 1HJUA 1XLGA 3WG6A 4RXFA 2WSYA 2YCKX 1ZU8A 3LTPA 4MZ1A 2O56A 4XZWA 1DWGM 2ACUA 3WDHA 1S5WA 2DUZA 3SUWA 3U2OA 4FI4A 1OADA 4ZE4A 5LIYX 2HE8A 1EWDA 1B3WA 3II1A 2Y8UA 2CLLA 5E09A 4LANA 1G4TA 1LUCA 2BGNE 1FOBA 4DZAA 3EOOA 2V3FA 4N9DA 4NX5A 2CETA 4F9DA 1QOPA 3HQPA 4F0RA 4J27A 2WMIB 3N29A 2RDTA 4H00A 1BQCA 3GTNA 3CHFA 1MUMA 4JIQA 1G0CA 1R3WA 4QE4A 1E6SM 4LGXA 3WD1A 1K03A 2VZSA 2O9RA 4ZOAA 3JZUA 4U31A 3NYDA 3FGCB 1C3FA 4M29A 4KFPA 4MB4A 3TU9A 3JU2A 1ITCA 3LHZA 3GIPA 4HU3A 1QI4A 5FAGA 1XSIA 3GXNA 2DFAA 3I7QA 1JPHA 1K7EA 4BEUA 4E4UA 2V5DA 2R1LA 2L5HA 1CCWB 3ZVIA 2HV5A 4W8BA 4BY3A 2P10A 1V6UA 2ZUTA 3WH6A 1TUFA 3NQDA 1RR2A 3RR1A 3LX9A 1AH3A 4AWUA 2ON3A 5FF3A 1MXDA 3H2EA 3AYVA 3H53A 2BXZA 1CZ1A 5I06A 3GX9A 4ICCX 1XBYA 2QJMA 1E72M 1QMLA 2VVSA 1GHSA 2HPIA 1FP9A 1PZ1A 4YMZA 5GNYA 3SZ8A 3ITXA 5ABGA 1JDEA 3AYSA 2A7RA 4JFSA 1L6GA 3RO6A 4FF7A 5DXYA 5C6MA 2GOUA 1JCMP 4C7DA 3G3DA 4W7WA 3TDFA 3VIOA 1R3RA 3H6OA 1A0EA 2GYIA 2OQLA 2BHZA 4QJ3B 3M0VA 3F4CA 4P8UA 2VFHA 1U83A 3PBGA 1BG9A 2V3GA 3PTMA 1F76A 1E4IA 2BGSA 4Y9PA 3SCWA 4CNUA 2CBIA 3V0UA 4JFUA 3AS1A 3MMUA 1BYAA 3CT2A 4HYVA 4G5DA 1G69A 1X38A 2FHCA 3RX4A 1BWLA 1MI3A 3B8VA 5A69A 5A8NA 4QX4A 3FY1A 1V8EA 4GJ1A 3GXPA 3W7CA 1B30A 1R7AA 1G4EA 4TO8A 1K6WA 4G6CA 2VDHA 4JNYA 1R87A 1Q6EA 1EBHA 1F07A 1DJQA 1Q2SA 3SUSA 2ZRYA 5HWJA 3GXDA 4G9PA 4F8XA 3UU0A 3VFCA 2I16A 2HBVA 2V5KA 3BK0A 3PPHA 1BWVA 4JQ2A 1NF0A 5CPTA 3PUDA 1FFQA 1JQXA 1XCWA 5H8UA 3S2LA 1YHTA 1QW9A 4AAJA 1X39A 4MPQA 3RU6A 2WZIA 4WY0F 5HANA 2B7OA 1WNOA 1SMAA 3NQBA 4PH6A 4E4FA 1PCKA 1QAPA 4ZEPA 2QMJA 1H3GA 4MWAE 1TTPA 2BS9A 1FBAA 1H11A 2WHLA 2H3DA 1VJIA 3E3HA 2QIIA 2ZX7A 4KW2A 4J5NA 4Q7NA 4FHAA 1KCXA 3T0AA 3C2EA 4PUWA 4D1IA 1QWKA 2YL6A 3NZQA 3LLDA 3RPMA 1B3OA 5KZEA 2TMDA 1Q65A 2P76A 4REQB 2VZTA 3A4XA 1NFPA 6CGTA 4UTIA 1ZSXA 4RZBA 5LA2A 1W9XA 3GH5A 3F5JA 3TYUA 1MNSA 1UR0A 5XIAA 5G5IA 4PMXA 2DH3A 1J0ZA 3VX0A 4FF5A 2E3ZA 4M1RA 2FTWA 3ZLGA 3B8IA 2EO7A 4AQLA 2E7FA 1UUMA 3MV11 4WY0A 4UUIA 2DSVA 3ONBA 1GG0A 1CYGA 3CIXA 2GQ8A 5AC4A 4TX8A 4ZFCA 1BTMA 2VC9A 3MBDA 1EKOA 2VOMA 3XIMA 4PZVA 1REQB 2ISWA 2TPSA 4Q22A 1EJSC 3M0XA 2I5IA 4NI3A 3VOFA 2XGBA 4R9OA 4RPPA 2A21A 4HMEA 2Z6JA 3BMWA 3W37A 3TXVA 1B0IA 5T9BG 3SGGA 2POZA 3LI1A 4ZR8A 3EEZA 1X6UA 1E55A 1QTWA 3R13A 3U48A 5HWMA 4BA0A 4J2PA 5E93A 5DMLA 2X1TA 2WKLA 3D46A 1O5QA 3KVKA 1TVPA 2V2HA 2ZVIA 5HJLA 2YIHA 5K3VA 1A5NC 2VX5A 2PU1A 3P7YA 3BGAA 4HZ7A 3E49A 3HV8A 4AD0A 4IH3A 3POHA 3AMGA 4GYKA 4HCLA 2F2HA 3KLKA 3WH7A 1L2UA 2CW6A 1VP5A 2V3DA 2GFTA 3M41A 4NAFB 2R1NA 2ANUA 1IIGA 4QJ4B 1RJQA 4C1NA 1DJWA 4Q32A 1DYSA 2HNHA 3DN5A 2VJXA 2PDXA 4F48A 3NQEA 1Q6DA 2KX9A 3PUGA 3W1TA 4GMEA 3G2GA 2FVLA 1HKVA 5DCEA 3TSDA 1B3XA 3BZGA 1NJJA 2BB0A 4XZHA 3N2MA 2TYSA 3B05A 3CQHA 1W5QA 3P67A 4MY8A 4N9BA 4HZMA 1A4LA 1IYXA 4B5WA 2PRMA 3V18A 1AH0A 3FHQA 1UR3M 5FJUA 1ZPTA 1BLIA 1C8VA 4RNJA 3A12A 3KRSA 1KCKA 4A8RA 2MNRA 3F4NA 2QCCA 3QMTA 5BW6A 1Z3NA 3LENA 3N6JA 3TTYA 4BI7A 2YDQA 1F7BA 3U6WA 5CPNA 4C60A 3GSMA 3KTXA 1DJXA 1E9LA 5LNUA 3WJYA 3NJ3A 3TOYA 1WXJA 3GTXA 4U5IA 4H19A 1JDAA 4GQ0A 4ZQPA 1J2WA 2C19A