1S2WA

Crystal structure of phosphoenolpyruvate mutase in high ionic strength
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
258
Chain Sequence
KVKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 97
structure length 258
sequence length 275
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2wA00
3M0JA 3FA3A 3QV7A 3BJFA 1PKLA 2VGGA 1PYMA 1Z6KA 3HQPA 1MUMA 4G1NA 2HRWA 1DXFA 4KCVA 3PUGA 1UJQA 4IQEA 4L7ZA 3SRFA 4MF4A 1JDEA 1AQFA 1U5VA 2HWGA 4KCWA 1IZCA 3QQWA 1F8IA 1S2UA 4QGCA 1ZJHA 2VGBA 2OLSA 1M3UA 4B5TA 4YJ5A 1E0UA 4DRSA 3M0KA 4HYVA 2XZ7A 3H6OA 1KBLA 3HQNA 1A3XA 2V5JA 3T0TA 3QV8A 4IMAA 4L9ZA 1OQFA 2ZE3A 4QG6A 3QTGA 2HROA 3G2GA 4L80A 4KRZA 1OY0A 2V5KA 3GQYA 4ROQA 3LYEA 4IP7A 4TV5A 1S2TA 3IS4A 5JVLA 1F8MA 5TAOA 3U2ZA 4B5VA 4KS0A 4B5UA 3FA4A 3EOOA 3EOEA 3VAVA 3KTXA 3QLLA 1VBGA 2HJPA 1PKYA 3GG8A 1SGJA 4HYWA 3LG3A 4QG9A 3QV6A 1ZLPA 3N25A 4IQDA 2BG5A 3B8IA 4B5XA 1XG3A 4FXFA 3E0VA 1PKMA 1XG4A 3PP7A 3SRKA 2VWSA 1M1BA 2KX9A 3GR4A 3KHDA 3MA8A 3QV9A 1DIKA 2E28A 3EZ4A 1IGWA 3E0WA 4KCUA 2L5HA 4YNGA 4KCTA 4JPGA 2VGIA 3EOLA 3I4EA 1F61A 2R82A 3OYXA 3QZ6A 2VWTA 1GGOA 3BJTA 4WJ8A 2VGFA 4MG4A 4B2DA 1F3WA 1PKNA 3SRDA 1F3XA 4RPPA 1DXEA 3OYZA 4FXJA 4QG8A 1A5UA 1O5QA 4L9YA 2XDFA 3HQOA 4B5SA 1O68A 3R4IA 2DUAA 3T07A 3OQ8A 1DQUA 2QIWA 3E5BA 3P0XA 4B2DD 1VBHA 3SRHA 1A49A 1S2WA 2X0SA 1U5HA 1S2VA 3T05A 1KC7A 4B5WA 1E0TA 4LSBA 4TV6A 1T5AA 3ME3A 1O66A 2DIKA 2G50A 2XZ9A 1A3WA 2WQDA
chains in the Genus database with same CATH superfamily
4TVDA 4CD8A 3NCOA 3PBGA 2VDGA 4DZ5A 4AZ7A 4LH8A 4C1NB 1TPWA 3RJXA 3FEMA 1E5JA 1M9HA 1JIBA 3SGZA 3AZRA 3GRIA 1M7PA 4P7RA 4AAJA 3CAWA 3H6OA 1NIUA 3HF3A 2V5JA 1HL8A 5LHEA 1A50A 4LALA 3BK0A 4D72A 4E4PA 3QQ1A 3TA6A 1XKJA 2HE8A 5EU9A 1RP8A 1QUMA 2WBGA 4X9SA 4JL2A 4J3TA 1XD0A 4DJDC 1JZ3A 4H83A 4GUIA 2QPUA 2CW6A 3LGDA 3TIMA 3V75A 4IPPA 4QE4A 3TC3A 2CZEA 1HJQA 2J7BA 1BTCA 4DWDA 3UA3A 4J2MA 2OQLA 3OA3A 2I5QA 5K4XA 4AEFA 2BXZA 5D8WA 3UXDA 2NX1A 1P0KA 1GVFA 2ZZ6A 3GHRA 5HBFA 3V1HA 1DJZA 2PURA 3VIJA 4MKSA 6TIMA 3AYSA 4YMZA 1QNVA 4O28A 3GDTA 2CWNA 4FEZA 4YXGA 1C90A 1I60A 1UD5A 4U4MA 2J9XA 5GNXA 1S5VA 2J24A 4RCXA 3URAA 2G50A 3D3AA 3DC8A 1OC6A 5AB3A 2Q02A 3SGUA 3QV7A 4TO8A 4XG1A 1Q4NX 2VGGA 2X0YA 1O4UA 1KM1A 2G37A 2HRWA 4XAGA 1B2YA 2CXEA 1WAUA 2HPMA 3LPPA 4L6HA 3UWVA 1LQ0A 1M3UA 2NQ5A 3WDIA 5A3HA 3U0HA 5EMKA 1E56A 1AW5A 3ANUA 3EGJA 2YFOA 3IUIA 3FK4A 3TH6A 1N7KA 3W22A 1LUCB 4WX2A 4DZHA 4FIRA 3LM3A 1CYGA 1R0MA 4F0LA 3KP1A 5I0DA 1KXQA 1Z7AA 2WZEA 3MCOA 4Y9PA 1TCMA 1W5OA 1Q3NA 1TVNA 2R1LA 3U2OA 2GGHA 4GINA 4LUJA 1JCXA 3OBKA 3SCPA 4YYFA 1DWHM 4UQCA 1ZAIA 4M82A 3H53A 1C9DA 3MI2A 3N12A 3A4XA 2VTFA 2V81A 4F48A 4ZL1A 5EPDA 4HHHA 1XIBA 5DN1A 3FXYA 4PTVA 2V2CA 3R2GA 3FAXA 4AZIA 4PUUA 3BPWA 1W3JA 4K7YA 3SM0A 4L6OA 5H8MA 5CQ1A 5AOUA 3WBXA 2F61A 2EKGA 3A23A 2ZVIA 1MRQA 4NASA 1WOAA 1IXNA 4TU1A 4NT0A 3HGRA 2I9UA 3DI0A 2C1HA 4QLLA 2Y7EA 3A3HA 3VDCA 4UQEA 4LYRA 4Z0SA 4LVFA 1OJXA 2WHJA 2NVDA 1EJXC 3R0KA 3B8SA 4IX0A 1XDMA 2GJXB 1EIBA 3BL3A 3BLPX 3O15A 1AL8A 2MANA 3RM9A 2QS8A 2VEIA 2VDIA 3HQNA 3IVUA 4H9ZA 4H8HA 4RZBA 2CLOA 3RRXA 1QI0A 1IEWA 2PDMA 1S3TC 1U1UA 4FX7A 4U3CA 3VIKA 1YADA 3MQTA 3ATYA 5G2IA 1K9TA 3VOJA 1LQAA 2C91A 3JRKA 1LYXA 3FGCB 3RF9A 1F3TA 2WXDM 4MNJA 4DO6A 4KGLA 5I7GA 3IRSA 2B31A 1FDYA 4JYEA 4BF7A 1EYWA 2INEA 1XHGA 3R1ZA 2XFFA 5DCBA 3O2LA 2PDPA 2PDQA 3THUA 2I9EA 1TPUA 1EGZA 2OX4A 3T81A 2YPIA 4EF8A 3TJ4A 1OIMA 4LAOA 2CLMA 4OOUA 3B8VA 1VD6A 3UPBA 2OEJA 1Q6QA 2VC5A 2FFIA 4WDTA 4ZFCA 1UP0A 3R10A 4UQ9A 3ELFA 1NVMA 2VFGA 3UXIA 1T40A 3AJ7A 2OKTA 3WLJA 3TW9A 2GYIA 3UCDA 2EAWA 3CYVA 1UP3A 2HQAA 1VFUA 2HVMA 3L2MA 3MCMA 2PPGA 1JNDA 3TNOA 3T40A 2A7PA 1F9CA 1YTEA 3EWXA 3NO1A 4L64A 1TTQA 1DORA 1UR3M 4ZO8A 1OG0A 4B5UA 1X38A 4GNJA 5HANA 1C8YA 1DIOA 2FJKA 4AD1A 2VZTA 1R9ZA 2HK0A 4HNTA 1K77A 4ZE4A 2C13A 3GY1A 1B9BA 1ICPA 4GNVA 4AY1A 3UVAA 4D6EA 1W6TA 3TROA 4K68A 5D02A 2OZTA 3NWRA 4MUZA 3LS9A 2X09A 1GZGA 3SUWA 2X16A 4FSAA 3ZR6A 4QITA 3N2OA 1XKYA 1FX6A 1RCXB 3C8NA 4OU1A 1KWGA 3N4AA 1U5JA 7ODCA 4HYRA 1S1PA 4IM4A 1GVEA 4HSHA 3CV2A 2PDGA 2Z1VA 3EX3A 4PODA 2FPTA 4H2HA 4CQCA 4UMCA 1NTHA 1QW8A 3IIZA 4JFTA 1TWWA 1OC5A 2H6RA 3ITXA 3DGRA 3PZUA 3WF0A 3QHMA 1AG1O 1US0A 1FWCC 1AQ0A 1JI2A 2PWDA 1RR2A 4Y8EA 2X1SA 1D7KA 1TQJA 3CWNA 1V3JA 4ZBCA 1YPIA 2D24A 3TFCA 4JD4A 3WNOA 2Z26A 1VLWA 5H8PA 3B40A 3I3BA 3TWBA 1D2KA 1SR9A 5G1MA 7TIMA 1RUSA 2FDMA 1WZLA 1YMYA 2XWDA 2G3FA 4HTYA 3W83A 1HKMA 4JTEA 5DT5A 1J5SA 3GDKA 2X30A 5I03A 1JD7A 2BG5A 1CLVA 3VZZA 4HNLA 4AWUA 3QYQA 1HGWA 2P50A 4FLOA 2YSWA 5LYRA 1V79A 3C0JA 2QJHA 3BW4A 4AVNA 1F6YA 4ADUA 2JK2A 5CPMA 1NDWA 3AXXA 3TYUA 3BJTA 4CQDA 1J0HA 4LY8A 3KS5A 1A0EA 2BVYA 3GTHA 2G3NA 5CPSA 1V6WA 3PAOA 1ZUAX 3R58A 1R3YA 2WMGA 4WGXA 1TZ9A 2X7VA 2WZHA 2HEJA 3NSXA 3AISA 4CQBA 1LQ2A 3BQ6A 4GLEA 4M6UA 3W7IA 3PPGA 4GD0A 1WZAA 1XIEA 3WQ4A 3VOGA 3PBWA 4DXKA 3GM8A 1UIOA 3POHA 1XLAA 1QI2A 1EPXA 5JU6A 2AMGA 1PCWA 2OODA 3A4AA 3NEVA 4I8YA 3RR4A 2OCZA 3CLMA 4XSMA 2DEPA 3DHFA 1AA1B 1CWYA 2ASHA 3S1UA 1GOXA 1IR2A 4LVGA 3E2QA 4RZ6A 1F8MA 1K6WA 2A2IA 3INPA 5E1QA 5E93A 3BGGA 4GY0A 4LPCA 1GKPA 3QY8A 3QV6A 3IGHX 3R6IA 3LTYA 2QCGA 3DZ1A 3STCA 1JCLA 5CLWA 3GAKA 9RUBA 1NWTA 1HJWA 4ZO7A 1PWMA 1SM9A 2BY3A 5CC7A 3EZ4A 3VGGA 3A21A 3JUGA 1F4HA 1RSCA 1DXIA 4BQ4A 5C9ZA 3EWWA 1B3ZA 3N15A 2NX3A 4IFOA 2VOTA 2J7GA 1HKKA 1Q5MA 3IPWA 3KTCA 3UG5A 4OT7A 1H0IA 1MXDA 1A5UA 4WY0B 3E96A 3M0XA 1TE1A 2EJ1A 1JGIA 5DRCA 2JE8A 5A1AA 5FAGA 2D2OA 1YE4A 3P0XA 4NZCA 4DWSD 3PK7A 4V1YA 1IXPA 1XPYA 1XV8A 4RZ4A 2CWXA 3W1QA 3OW1A 4RLIA 3WLMA 3TQKA 1EEXA 4CD4A 2VP8A 3EXTA 2WNZA 1AK5A 5JBDA 4O13A 1BRLA 2PDNA 4MWAA 1MUWA 4F0MA 2J77A 4R7WA 2DT0A 1BG9A 2E77A 1JJKA 1SSDA 4FNRA 4IHCA 4NI8A 1OM0A 2PUZA 1L0PA 4R5EA 1GPFA 2J9ZA 3PTKA 5JH1A 1KBJA 3DDMA 3W7MA 1KM4A 3QW4B 3LB0A 5M3WA 5A6TC 2QUTA 1ZB5A 3LLFA 2D73A 5D2VA 3GHTA 3KTXA 4M19A 2P8BA 2FGZA 5IFPA 2IPJA 2WVSA 2ANUA 2DUXA 2W63A 3PPHA 4ZO9A 2W66A 2KX9A 3TTEA 2WB5A 1WDRA 1XWYA 4DY1A 2PTYA 4IX2A 1F6PA 2ZZ4A 5AC7A 3B9AA 3MDUA 1KKRA 4DN1A 3ARQA 4UTWA 3WK1A 1XM3A 3N9KA 4C6DA 4A4AA 1Z48A 5DQPA 3QSRA 4ES4A 4JCLA 3FY1A 4ZQRA 1GNXA 3FSUA 2YIHA 2DUAA 7A3HA 3L12A 3E5BA 4MZYA 3LM7A 4OVXA 4IICA 2C7FA 3F4CA 3N17A 4UCGA 3TW7A 1J8VA 1WBJA 1QPKA 3IK2A 1TX2A 3REQA 3GAYA 4ZENA 1W3NA 4XV0A 4HSNA 4J35A 2DZBA 3BOLA 3T9PA 3O6DA 4I6VA 1Z69A 3MI3A 1XDLA 2HBXA 2DW7A 2OFJA 4YVXA 1MQPA 1QHOA 2VZOA 1OD0A 4NL1A 3FA5A 4IL2A 4S3DA 4BI5A 3W2UA 1A5KC 5DXXA 3W2NA 4NHVA 4LYPA 1K3UA 4X0VA 3I10A 2G0WA 3UR7A 3GTFA 4O52A 5HQEA 3G3DA 1DIEA 3LHYA 3HQ1A 3S9YA 3ZT7A 1T8QA 4D6CA 5HMEA 4LAMA 3MO7A 3L4WA 5HNTA 4U2YA 3R12A 4GBDA 2EPLX 1GK8A 4C6LA 5XIAA 2R1NA 3B0VC 1ME8A 1UD4A 1UKOA 3CL7A 3PWAA 4GX9A 1LJYA 1E51A 3W1TA 4DYEA 4IG2B 5BMXA 2CZVA 3VOHA 5KSWA 5DFAA 3LN3A 4BA0A 2EPKX 1XQLA 5E0CA 1OBAA 1ZS2A 4G2DA 4TVUA 3G5EA 4JY8A 4KIRA 3G8RA 4REQA 1G94A 2DUZA 3ITTA 2Z4GA 3PULA 2CKRA 2WK2A 3AC0A 3F03K 2QCDA 2IKHA 1S46A 1EF3A 1PIIA 1XI3A 1XYMA 4LOCA 1XLIA 3OU8A 4IUOA 3E74A 1OF6A 4HPHA 1JDEA 2YR1A 4KRTA 1GVOA 1TV3A 3F4VA 3RRAA 2QIIA 2WAGA 4PN2A 3DENA 1J0JA 1GPWA 3PR2A 4DUWA 3H22A 2J6VA 2VX6A 1KLZA 3JU2A 3GNNA 2YDQA 4KH2A 2VC9A 5FACA 1N55A 3P84A 1L6SA 1W9DM 2PP3A 3TCEA 4NKCA 4M29A 4JR5A 1UASA 3O6AA 3QZAA 3T0BA 1EDGA 3CEPA 4UR7A 4JAWA 2R14A 3C2EA 3WNKA 1XUZA 3R8RA 2PDIA 3VNLA 3SQSA 4R9XA 2FZDA 4IGHA 4YVVA 2ZWZA 4FOKA 3KOWA 3C2FA 1K8CA 1ZCCA 4HCLA 1JCTA 4CKQA 3WD1A 4Q7BA 5C2CA 3RO8A 5DELA 2H9AB 1DP0A 2ZC8A 4YCPA 2AAMA 5CBIA 2HV5A 5A8PA 1LROA 1A49A 5I06A 2DZWA 2TRSA 4IISA 5IHRA 3ARXA 4D71A 1WOBA 1H1ZA 3PY2A 3NYDA 4MJ2A 3UETA 4PBGA 2UWFA 2VEFA 2I17A 4JZ5A 3GHSA 3NQAA 4QJ4B 2CC0A 3J7HA 4QEEA 1LT8A 3R25A 1DXFA 4L7ZA 3WLOA 3W2JA 3ABRA 2Y7FA 3BMXA 4XZIA 3NGFA 3OJGA 2QDEA 3HIJA 3S9IA 1PBGA 1PHWA 5E6ZA 2XIQA 4IGSA 3DI1A 4BS0A 1SJBA 5LHFA 2HROA 3O6CA 4EPKA 5TBOA 1QU4A 4IGMA 2HS8A 2RGLA 4RW5A 1VBGA 3LHZA 4RNHA 4YTRA 3JW7A 3N04A 4B5XA 1HJSA 3PP7A 3RPMA 3N4FA 4E3VA 2ICSA 3PZ9A 4FZIA 4AIBA 4QS6A 1QTWA 1CEOA 1TZZA 3T0CA 1EHAA 3HPZA 4FHAA 1GW9A 2ZA1A 1KFJA 4NZ3A 3N2BA 2ZWYA 2BFGA 1DOSA 2E8ZA 1QPQA 1R3RA 3HPFA 2WVUA 1RPKA 5CPNA 4WCJA 1F7BA 2Z24A 4L5ZA 2ISSA 1SFTA 3MMUA 4TQTA 3WK3A 1GTHA 4M1RA 3FYOA 1OCJA 3LCXA 4J3XA 5F1UA 5C9UA 3U4FA 4ERAA 5IHSA 3OPSA 4BQ5A 1EWDA 4GYPC 3QQWA 2PDBA 1ZJHA 3KAOA 5H1WA 3DYPA 1BYDA 3CJPA 4XVEA 1UKSA 3TTYA 1E0XA 4W85A 2IUZA 1L2UA 2OOGA 1UWRA 2HCVA 2ZDRA 4EAMA 1YTDA 3W82A 4I5XA 5AFDA 4HN4A 1WDWA 3NIYA 3VAVA 4WSKA 3W76A 4ORIA 4E2DA 4D1IA 3SUUA 1GJWA 3WD0A 4B90A 1X97A 3W7RA 1Q8AA 3KBMA 4JTCA 2YLLA 4GVFA 4MAVA 4FP1A 4Y9MA 2EPHA 2J7HA 4U31A 1A5AA 1UKPA 2QULA 3SRDA 3RYSA 5HK4A 3IGXA 3RPTA 3ONBA 1E9ZB 3W1LA 4LCQA 1JDAA 1OGBA 3M46A 2WVTA 2ZUWA 4V27A 1UYQA 4CQ9A 3M1ZA 1H0GA 4DWSB 4M8UA 3TR2A 5GJPA 3O07A 5HMSA 3C6CA 4NAEA 1ZHAA 2PFHA 3MZNA 1SO3A 3AALA 3WEZA 3GBDA 1XS2A 2Y7GA 3TYAA 2WCGA 2TODA 5CZ0A 4NP7A 3DBNA 5A5WA 4AZ5A 1EDTA 2ACQA 1K7XA 2C8NA 4Z2JA 1NH6A 4A29A 4GABA 3GFXA 3MMWA 1RA0A 3B9DA 4GUFA 5EFDA 2YW3A 1H62A 3MTWA 1BYBA 1CB7B 2PWFA 2WNWA 5F4SA 2GJRA 3CHVA 3ZJKA 2VX4A 4C6JA 2A5HA 2Q71A 4N9BA 4I9TA 4FLRA 4QJ1A 3K1DA 3UJEA 5M03A 2DH3A 1C8XA 4QE1A 5CZKA 1AD1A 2PWVA 3LTSA 3AIEA 1EXBA 2D69A 3IVTA 5D32A 4NNCA 2J25A 3ZZ1A 1H7WA 3ATZA 4ICNA 1TE6A 5KEZA 3NQCA 2B7PA 4J2PA 4YTTA 3QH2A 3IANA 3PG9A 3ITVA 4IXXA 3CHCA 4N2YA 2PGWA 1JF6A 3R4IA 4N9DA 1AH4A 4G5DA 3KL3A 4W8AA 3L2IA 1FDJA 5BOOA 2I14A 3O7UA 2POTA 4A22A 1RHCA 1NDZA 4AEEA 4F0SA 5BU6A 5ABFA 2P3EA 1W9XA 1U5VA 4HU3A 4DLFA 1WCGA 4A3HA 1BWVA 2BHYA 1XSJA 1L8NA 5D9OA 1JUEA 2BXVA 1YYAA 2WLYA 3JVAA 3MUXA 5CPTA 1CTNA 2VEKA 1B57A 4PFHA 4OFCA 1IYXA 2AOSA 3R7MA 4MNKA 1G7VA 4DLMA 3BICA 4XBJA 1EZWA 1WQ5A 3C2OA 4QAWA 5DO8A 4IMGA 3WDHA 1E1CA 3N9RA 4LUSA 3S9ZA 2WWDA 1US2A 2VELA 4QSHA 2WMIB 3L0GA 2GJNA 1M1BA 3TQVA 3CIWA 2OYMA 3IWPA 3QR3A 1I9CB 1FFQA 4RXGA 3QZEA 4FOUA 3T8QA 4YTSA 3MI6A 1RLCL 3NOEA 4LB4A 4D6IA 4N6FA 4P5UA 3MY9A 3MS8A 4DX3A 5FEWA 5C54A 3VXGA 2Y88A 1YHTA 3MVIA 2QXWA 2WVVB 3I3DA 3ARPA 3V0TA 1F3EA 4PCNA 4NI3A 3UZ5A 5JXQA 1DPMA 4Q4SA 3LBMA 3M5ZA 3WK0A 3MKVA 1RJPA 4J27A 2XIMA 3FJLA 1SUXA 4WDWA 5AC8A 2PLKA 3ZSTA 1Z44A 1D9EA 3IK4A 4W7VA 2OWCA 4CVUA 3U7BA 1H11A 1N2VA 1UJQA 3TP4A 3HGOA 1JZ5A 4UFMA 5A6KA 2WNNA 4FLQA 3TVAA 3NGJA 2CHNA 2WMKA 4E38A 1RXOB 2YDAA 2YCIX 4I3GA 2QV4A 3OVQA 1V3LA 1TVPA 1OFPA 2A1YA 3ARSA 4D8ZA 4BZYA 4L80A 1AD4A 1UZDA 5CPLA 3GG7A 1M7XA 2P10A 1GCYA 2V5CA 4UUIA 4GC3A 3DG3A 4FIQA 3OG3A 4GQRA 4JNZA 2DSUA 3UXKA 7TAAA 3EX1A 3MUAA 2GDUA 5D2XA 2XSBA 4MG4A 2V5BA 2ISWA 1PJ9A 2ZXQA 1FHLA 3V18A 3HGJA 1N82A 4AZCA 4MGGA 4Z2IA 5EMMA 3FS2A 3CL8A 2OR2A 3B0XA 1A47A 4IIFA 4EPBC 4TXEA 3ITLA 1JCYA 4AWSA 4I7WA 1UWAA 4H1ZA 4TMBA 1F6KA 1XSKA 3AICA 3Q65A 1XLCA 4OUEA 3WQFA 3AYTA 1SMAA 2DT3A 3LSBA 2OZ8A 1H61A 1W56A 2OB3A 3BAIA 1D3CA 2VX5A 1VYRA 3UGRA 4KCVA 2WSKA 4GIYA 4U10A 4D6JA 1NF7A 4E2BA 3M5YA 4NZ1A 4PL2A 3MT1A 4AFYA 1QAPA 3IJQA 4JFVA 2W3ZA 1HF6A 2ZVRA 1HKWA 2V30A 2FJUB 4HZ7A 4MWAD 3V5FA 2C14A 1US3A 1KR1A 3AROA 4TV5A 4F40A 1WV2A 3WFAA 1SFLA 4KS0A 2ZTKA 1VFOA 1NWUA 1MW1A 1YRRA 4LF2A 4UTTC 2EF9A 4P8UA 5D2WA 3NNTA 4J7RA 1NAL1 1VBRA 3LHTA 1BHGA 4XKYA 3DHDA 5LA2A 1UIPA 3SCOA 2E5BA 3UPMA 1KO0A 4GHRA 2PD5A 4OJYA 3RX3A 3GDMA 4JBRA 3KOZA 2NW0A 1T6MA 3ABOA 3ARWA 2Y89A 3THDA 4MLJA 1S5TA 1EOKA 3GVRA 4FNUA 5HWMA 2PODA 2Z1SA 5REQA 4MMWA 1QATA 3MUIA 3PAJA 4BFAA 1A5NC 4F66A 2TMDA 3T07A 3HG4A 2FMNA 1S5MA 3GH4A 2W6RA 1LTDA 3BLEA 4EX4A 5CZSA 2VFFA 3QPYA 4JKLA 1BGAA 3COTA 1TFVA 1PS9A 3M7SA 1KRCC 4ZFMA 1FWIC 5DT7A 1S2UA 3AS3A 4V2XA 1I4NA 5RUBA 4NYUA 4U33A 5EBUA 4GVHA 2OLAA 3CK5A 2WC4A 3VIOA 3L4XA 3CHFA 1VRDA 4L65A 1H7RA 1MQRA 4IIBA 1W0MA 3NVTA 1U1JA 3MW7A 3W3OA 3SECA 3TMLA 1YKWA 1VENA 3WD4A 3CUHA 3II1A 4W5UA 1BSIA 4BY3A 4IIGA 1XINA 3LTPA 2HXTA 1XLKA 3IRDA 2AGKA 1XLEA 4TX6A 1P0NA 2A3BA 2JF6A 2YCLA 4CU8A 3G6MA 1X6NA 3SY5A 3E0WA 2G3MA 1ONXA 4AZ6A 3G1RA 1QNQA 2VMFA 1UQZA 1HKVA 1HVQA 3XIMA 3S5OA 4O12A 3L5AA 1G4TA 1ICSA 1UUOA 3V7PA 1JULA 2JEQA 2H8XA 1E1EA 1XFBA 2WJEA 3C2RA 2B0MA 4X3ZA 3F5JA 1TTJA 2WHKA 2ZX8A 3CBWA 4PB4A 3NG3A 1Q85A 4LRSA 4MADA 1GG0A 1R7OA 2YXOA 1CXEA 2F2HA 3TSBA 4A3UA 1VKFA 2YBUA 3DHUA 4PTWA 1F73A 4P7LA 1ADOA 2OJPA 4ZODA 3W6YA 2VR4A 1KD0A 5LXEA 4A05A 1GYNA 2FHFA 5KINA 2V3DA 1D3GA 1J11A 2HSAA 1EC7A 2AMXA 3EX4A 4ML4A 3TXZA 4E8DA 5MKGA 3W26A 4RDWA 1CIUA 1LP6A 2DGAA 3TMQA 1XH2A 1KXVA 4OUIA 1OYBA 4Z1DA 4BWLA 1XBVA 3B04A 4F9DA 1OFBA 4G7EA 5LIXX 3TWAA 3OGSA 4E6MA 3H55A 3GQYA 3ARYA 3EPMA 2E0PA 3MJYA 3KRBA 2FPYA 1S39A 1B3OA 3AIRA 1H7NA 3DBPA 3GKAA 2QCLA 3E0VA 4R7OA 3TJIA 4EACA 4UC5A 2QJGA 1GOQA 1Q6FA 5AY7A 2V82A 4IQLA 4O18A 3BAJA 3QYSA 5DBUA 4XO6A 1BYCA 3E0IA 1X39A 1V0KA 3W1UA 3U4AA 2YCKX 4URIA 1GVIA 2WZMA 3QVQA 5AVNA 3F1QA 1EL3A 1BPLB 3CEUA 4ZQCA 1I2NA 3T08A 4MY8A 5CJMA 2DQXA 1ZAJA 5CPOA 1OCBA 4WXYA 1CLXA 3C52A 1XFCA 1XLHA 2XSXA 3AIBA 1WKFA 2Z7KA 3PF3A 1A5MC 5I3HA 3L66A 3UR8A 3CV6A 3KDOA 4O17A 1KXTA 3TFXA 3T8LA 3KBWA 1XISA 4H9UA 4GFSA 3SIZA 3RXZA 4XZNX 2V8ZA 4YPJA 2E6AA 4UMAA 3D0CA 1RJRA 1ADSA 1MEWA 1EGVA 3PUOA 2I56A 3WQEA 1EJVC 4JTUA 4QQUA 3FIGA 5F2MA 1X6UA 2J27A 3QC0A 5C7VA 3G3MA 3P2VA 4F2TA 4UTLA 3DCPA 1V6XA 1W2PA 2ZE3A 4DZIA 2DVUA 4AX7A 2FZBA 1MFVA 2JIWA 1BXCA 3B97A 5BXTA 4NG3A 5D2TA 1CXHA 4UCFA 4QS5A 1LM1A 3E12A 3H7RA 3WQ8A 3LK6A 1QWKA 2VQUA 3UF9A 3UWUA 2ALRA 2XINA 2VYOA 1IGWA 1BD0A 2QYGA 3NQFA 3GVGA 5CJ5A 2CLPA 3L0NA 3W9ZA 3APGA 2BY0A 2Z25A 5LA0A 4FXRA 3C5QA 4CCCA 3K30A 1FXQA 3FKKA 4D6DA 5DMLA 1R30A 3B4UA 1CXLA 3A64A 1T96A 4D8LA 3TXVA 5C9XA 4AEOA 3UJRA 1ZP4A 4XIMA 5E9XA 4ZQOA 3UJFA 1QNOA 4GQ0A 1A5LC 2QJMA 3SO7A 1ICQA 4H19A 3VGFA 3BAKA 4JYFA 3WJZA 3GKFA 4KCWA 3ORWA 4PE8A 1K9FA 1KM2A 3AAMA 3QN3A 3PJWA 3HBLA 3S5YA 5LZLA 1UH2A 5G4WA 1C92A 3V1PA 3LBCA 2WQPA 1JXKA 1TR1A 4IMAA 3W71A 4EIVA 1DJXA 4WSJA 1B9ZA 3H2CA 3W00A 3TN5A 2DZTA 2E25A 3TK7A 3CXOA 1BKSA 4W8BA 5CSRA 1UWQA 4F0HA 4HZ8A 3VIHA 3LU2A 3P5ZA 4QG9A 1VFHA 2Z1XA 3S5SA 3M4HA 1F76A 2YYTA 2EEXA 8CGTA 2XWEA 3VCCA 1UB3A 1P7TA 4W89A 2GJLA 4LVAA 1BXBA 3NZ1A 2BVDA 3PWIA 2EHHA 4HVXA 3OP2A 2VGFA 1QOPA 3AMGA 4UMBA 2ZRXA 4FF7A 2XIIA 3AWOA 4ZOCA 4JNYA 2C71A 3MU7A 4GQQA 3ZSSA 2VHLA 3DFOA 3UNDA 2IKIA 1OCNA 1WE5A 5A8GA 3M16A 1M7JA 1JCMP 4LC6A 3A9IA 1EA0A 1TJ0A 4XTDA 1RCOB 3DESA 4WF7A 4M6VA 5CH9A 4UTIA 3CU2A 1KGXA 2WQDA 3H23A 4M24A 3PC0A 1DJHA 3GUWA 1CGXA 4MPQA 1JPDX 2WSQA 3FVMA 2QUUA 3OIXA 1SZNA 1LORA 1UROA 1HP4A 4KEVA 3I6EA 1VEMA 5LIWX 1KM0A 1B3YA 2V2DA 3K4AA 1EZ2A 4Q8QA 2OELA 3G22A 4FX8A 1BRLB 1UJPA 2PDFA 4MWAB 4QP0A 1XRSA 1O7AA 2D0FA 1ITQA 4EXBA 3MUY1 3SIMA 2PCQA 3NPVA 1XH0A 2VWSA 5XIMA 2DZSA 3NM3A 2NQJA 3UGVA 4DAFA 2YB1A 4KPLA 4JPGA 3CZ8A 3KRUA 1R85A 4IP5A 2OYKA 1GGOA 4EP8C 3GS6A 1A0CA 3WD3A 1P6BA 5FEZA 1WX0A 2CLEA 3C56A 4OBSA 2QV5A 3AXMA 3TQ0A 5FF4A 5I78A 3ZR5A 3PZGA 3VNZA 3VKCA 5K3VA 3FYYA 4HMCA 2F38A 4Q4RA 1PTAA 3U9IA 3FOKA 2E9LA 1NQKA 2C1GA 1KWKA 4K39A 5DRIA 3AO0A 3CPGA 2CEQA 2O0TA 3EKZA 3VIMA 1RY8A 4AF0A 2BV9A 1R9YA 3CB8A 3MHGA 1I2QA 4OHQA 3TAOA 1IZCA 5M2FX 5ABEA 3H2NA 1HJXA 3D46A 1W8SA 5FF0A 5A8OA 1A4LA 2J7FA 3REQB 2Z00A 5CXPA 1C7SA 5LXXA 1RK5A 1OQFA 2VC7A 3WLKX 3AHZA 1EJTC 1HO4A 9XIMA 4C7DA 1MW2A 3U2ZA 3WUGA 3FSTA 4GJIA 1XCFA 3L23A 3NZRA 2VEGA 1XCXA 3LG3A 3WFZA 4C6EA 3HGSA 1YDOA 4AU0A 3UWZA 1TJ1A 2YL5A 4DELA 1EQCA 4JHMA 1IQ8A 1GVSA 3DH7A 2XM2A 1DWGM 3UYIA 4DJDA 3SJ3A 4EPEC 1IWPA 4DI9A 4XUGA 5HMFA 4GFIA 3SY1A 3LHVA 1XIJA 3UWEA 1EJWC 4LAZA 5BYWA 1VPXA 4UBPC 5FJJA 1MMFA 1Q7ZA 4LBRA 2NQLA 3WUEA 1JAEA 1PZ1A 3LEPA 1TRIA 2PSNA 3TYEA 1W1YA 2A4AA 3KCOA 1RQBA 3V3WA 2VC6A 5GPRA 2X2GA 4O16A 3PZMA 3GTIA 3GYCA 3NURA 4NAFA 1WA3A 4E2VA 5DF0A 1N8FA 4B4FA 5EYWA 1QPOA 3W81A 2O4QA 4EWND 2F6UA 3IJ8A 4BI7A 2OG9A 2D0HA 3VIGA 4ZB0A 4TMCA 1FTXA 4E2OA 4IQEA 3K46A 1SYTA 4A2RA 3VM5A 3EKGA 4REQB 3V36A 3WQWA 3WELA 1AH0A 2QCDB 1KTBA 1V3IA 4LU0A 3QFWA 4JCMA 2BTMA 5KZEA 3LX9A 1W3LA 1M65A 4FLSA 4UTMA 1A0DA 2FHBA 1TPC1 3CZLA 3F5KA 1CGYA 3A4WA 3CLWA 3EDEA 2X1RA 2R1PA 2BODX 4JTIA 4OBRA 1A80A 3ALGA 4PL1A 4NJHA 3VZYA 1NJJA 3A4JA 5H6HA 1XLFA 1EO5A 5CGMA 3LCLA 2E7FA 4A2SA 3SR7A 1Y7VA 1J18A 1I75A 4H4IA 2PF0A 3ZR4A 1VP5A 1KRBC 4D6GA 4PMXA 4GH3A 1C91A 2A3HA 2EGZA 3NSMA 3CZGA 1MQQA 2B4GA 2PRLA 2CCRA 1TPVA 1RY0A 4WRHA 3RFAA 3DFSA 3HJZA 3OGVA 3SFKA 4JDBA 3USBA 4C90A 4J3VA 3BC9A 3OGRA 4WJXA 1FA2A 1K7FA 1VZWA 3SQMA 3P74A 2DT1A 2J75A 2HZGA 2PCEA 3HJEA 4ZOEA 2BY2A 4A3RA 4AXNA 4QNEA 3F2DA 4RDYA 3PPFA 4DEFA 5I02A 2FDSA 2Y1HA 2Y70A 1SFJA 1DBTA 2QW5A 1ZQ5A 4J3ZA 3VNDA 5KITA 4WZHA 1HIZA 3WH9A 3N13A 4PBEA 3DHPA 3LRKA 2Y7DA 3KLKA 1B0IA 4ONVA 4GQGA 5A6JA 4U2ZA 4HOZA 4N6EA 4KESA 1KGUA 1SPQA 1LBMA 4UWMA 4XZHA 3RILA 3AIQA 3T0AA 2PDKA 4V15A 1WDQA 1ZJBA 4LYKA 3OYXA 4ADSA 5BU9A 5HQLA 2WZIA 3AMDA 2PTXA 1MXGA 4XAZA 1FXPA 1TRDA 3NVDA 4GGBA 5DEZA 4S23A 4I9AA 4BKNA 4L9XA 1DVJA 2QVNA 5I3FA 4Y90A 4NRSA 4NJJA 4UOQA 1OVDA 1FH7A 3NQ7A 4KEZA 3MUZ1 1O1ZA 1NOFA 3V0UA 2GWNA 3OBAA 3RK8A 5CC3A 3KE0A 3PJXA 3URNA 5C2GA 2OVLA 3DYOA 4RXFA 3Q94A 3VM7A 3W29A 3VNMA 1KFBA 4UTHA 3ZLFA 3CZJA 3KZPA 1SZRA 5I09A 1T7LA 4H9XA 2E5DA 3E3HA 1KFKA 2QQ6A 3KDNA 3CTTA 1RCQA 4N9EA 4DXXA 3IJDA 2VCCA 4JGDA 3B0UX 2PDUA 3Q2DA 5K4ZA 3Q58A 1MEIA 3R79A 1VJZA 4H9MA 3CO4A 5D33A 3CH0A 5JUVA 3IIPA 1VC4A 4ILSA 4GBUA 3UWWA 3N29A 1SQ7A 4X61A 2X41A 5DY3A 1RH9A 2P88A 3HPAA 1KM3A 3CUJA 4Q4QA 1CW2A 2VRKA 4CNPA 2GOUA 3O63A 1UPPA 4HP5A 5EMYA 3O0KA 4QDPA 3W1MA 1CPUA 4MM1A 4LS1A 4X60A 3ES7A 1LLOA 1WBHA 1TREA 2WV8A 4M7TA 4ZB2A 3CQJA 4JDYA 1UG6A 4WD0A 7PTDA 1LRNA 1PX3A 3EOUA 1KFLA 2WO5A 3VX1A 2QCCA 3EWDA 1IR1A 3SFWA 2R6OA 4D6FA 1P6WA 3SN0A 4UFIA 2ZRVA 2ZRYA 4TUFA 1T99A 3UY7A 1H1NA 4NXSA 2Q01A 2J62A 2I7GA 3CB3A 3KL5A 1SJAA 2Q8ZA 4I9MA 4PUWA 3JR2A 2CXGA 4X9YA 3H7UA 1OFEA 3WNLA 4HJFA 2WNQA 3A22A 3LI0A 4DI8A 4NAEB 2J66A 2HK1A 3N6QA 4PTDA 1OY0A 1H7PA 2QKFA 3LI1A 1NQ6A 2C1IA 1ITXA 4CN1A 3W6MA 1OFDA 3WF1A 4Q4MA 1SGJA 4ATLA 2QJNA 3FXGA 8XIMA 1BKHA 1TUXA 2XUCA 2BOGX 1G4EA 5CKSA 2VEMA 3TC7A 1Q13A 3VA8A 3KS6A 4TIMA 5LNWA 3ZQ9A 3WJSA 1QMLA 4H7VA 2J13A 4K6AA 1OIFA 4E8GA 1LL6A 1W54A 4W4QA 2GGGA 3UG8A 1DXEA 1V77A 3IUHA 3G1XA 3DN5A 4H9VA 2E3ZA 3UA4A 2F6KA 1GW1A 3XISA 1JZ2A 3S2NA 2PWHA 4YLWA 3E1F1 2J78A 5BRBA 2EG7A 3KM8A 1SW0A 3KCLA 1ZENA 1S5NA 3QKEA 4JOMA 3M0IA 2ON3A 4YTQA 4HJWA 1EKOA 1OX6A 4HMEA 3FX4A 3BJFA 1A5BA 5E6YA 2QAPA 1PYMA 3LGEA 5I07A 2GJPA 3WUBA 1R3WA 3VO0A 3BOFA 5FJIA 1ISXA 3DECA 3R8HA 3RO6A 4CD7A 4IQJA 4YJ5A 4QLJA 5CSUA 3FV9A 1KCXA 2PMQA 4ATWA 4ENLA 1W1IE 1PX4A 1GJPA 4DNHA 3STEA 1HTIA 4QISA 1A3HA 3O9NA 2CLHA 3N2XA 2VJXA 1FDZA 2BZNA 4PUJA 4PEEA 3BV4A 2GK1A 2QDGA 1IT7A 2Y6ZA 3WBAA 1K9DA 1M68A 1PIGA 1RALA 3WLPA 2Y0FA 3N1AA 2VX7A 1O94A 4G1KA 4B9ZA 4S3KA 3CQHA 3SY8A 2XJ7A 8XIAA 1MRAA 2DP3A 1R6WA 2ACSA 4QHRA 4HMDA 2V0TA 4F3HA 4Z08A 4OV4A 1RVKA 2OXNA 3CUIA 5F2GA 1H5YA 3GU2A 2BHZA 3VGDA 2OWXA 2PTDA 4YHEA 2HE5A 3H70A 4LUSB 2PRHA 3PTMA 4OTKA 1TMLA 4M5PA 3TONA 4CNSA 4IFRA 4AWEA 1OG6A 1QO2A 2DZVA 4D1JA 3NJ3A 4LAUA 3OIHA 1HW6A 5F2LA 2G95A 2A21A 5BOEA 1HGYA 1XIIA 3TW6A 1O66A 2QAFA 1S2CA 3W86A 1QT1A 1EXPA 3GVQA 2NXHA 2VD9A 1MUCA 4F9JA 3MDWA 2NSXA 2HNEA 1R47A 2F84A 1KTNA 3SQLA 4GIAA 2CERA 4L61A 1E3ZA 4A8LA 2UY4A 4HU0A 1P4CA 3AS0A 1YNPA 2Q8LA 4CQ8A 2V5KA 4Q4OA 5JVLA 4GZEA 2WHMA 3BGJA 3MSRA 4B92A 4M0XA 3WQGA 3BO9A 5HJLA 4AUBA 4LVDA 1OINA 3A24A 3N19B 5I2UA 4O57A 4FS9A 2BSLA 1ONEA 1FKXA 1CGUA 1Q45A 3E2SA 3R13A 3VX0A 4Q7IA 1MXSA 1H09A 3TCSA 1C29A 3W28A 4IPLA 5JIWA 3WL0A 1O5QA 4Q6JA 1TTPA 1VYSX 3BDKA 4MYXA 3TQPA 3TR9A 4S3CA 3ONCA 6TAAA 3EA3A 4FALA 4A35A 3WH5A 3DAQA 1C3FA 1MI3A 3NOYA 4AZCB 2Y8KA 2MNRA 4DUXA 3KBNA 4UQAA 2WJDA 1CI1A 2RUSA 1G1YA 1GKRA 3CUFA 2ODOA 2BS9A 1AH3A 3PNZA 5DANA 3SGGA 2XHYA 4H41A 4KKXA 1KBLA 1V03A 4AIUA 4CU6A 3OLDA 3EMCA 5A2BA 3BE7A 4JQ2A 4C6CA 1DJYA 5JQ9A 4O19A 2Q6ZA 3RM8A 3IJ7A 3GU9A 3E49A 3IGUA 1VF8A 3IAPA 5FAJA 3QLLA 1B54A 5GNYA 5CJNA 1H49A 2YXGA 2AQWA 3L4UA 5C9RA 3GR4A 1J2WA 4JIEA 1PVNA 4BEQA 1LG2A 1DJWA 1X8FA 3NL6A 3WX7A 4YS1A 3VDAA 3PJTA 1EP3A 5G1TA 3EXRA 4FNTA 3EDFA 1VPYA 4CUCA 1ZBKA 4Q8VA 3RX2A 2VFDA 4DM1A 4ORMA 1FP9A 4PR4A 3OYZA 1V6VA 1E43A 1C9WA 3RG6A 4C6FA 4XKYB 4S3JA 4GCXA 3USZA 4BJHA 1E72M 4Q4PA 1A5CA 5A6AA 1B3WA 1QASA 4U5IA 1W32A 4EVZA 3IV8A 5IFTA 1GTEA 5HINA 4OIFA 1LL7A 2XZ9A 3WLTA 4DJEC 1KQZA 1THFD 2W67A 4G7FA 3U57A 2FZMA 5REQB 3LERA 1G6CA 2JIEA 1TKKA 4PUDA 4FO4A 3DERA 1AJ2A 3TC6A 4KGJA 2ZZ7A 3B9EA 2ZZ3A 3CPRA 4RZ5A 1UD8A 5D38A 5C70A 5C5YA 2UY5A 3W7DA 2J6XA 4UTJA 3K5XA 3VCNA 3D47A 4HPNA 5CGQA 1QNRA 3MSGA 3W84A 4CCDA 1RBLA 2UY2A 3D5HA 4GI9A 3UZZA 1E0WA 1WB0A 2Z1KA 2QVHA 4IF2A 3VD5A 3UYCA 4KFNA 2J74A 1MZRA 3WYZA 3POCA 1XDJA 4PMYA 5GJMA 1VFTA 5FA5A 1XXXA 3NM1A 4IQDA 4RUBA 4WKFA 4HPXA 2E28A 3VMNA 3VDBA 4WJEA 5FESA 1CGTA 3BSMA 1F61A 3W70A 4JX5A 2WM0A 3ECQA 3CQKA 3WIJA 3S1WA 1LWIA 1U83A 4B9YA 1RK6A 4BEUA 1M41A 5D9MA 1RD6A 5I3DA 2VCAA 2YCLB 2IKGA 4DJDD 3YPIA 4WVXA 1VH7A 3GDLA 1AQMA 5I3GA 2WPGA 4O0ZA 2Z29A 4B5WA 1QRQA 4LGXA 4S3AA 1I1WA 4LYQA 3ME3A 1DV7A 2VL4A 4E8CA 1EBHA 1OCQA 2A0NA 1F5ZA 2JALA 2D3LA 3WNNA 3DU0A 1AFSA 1YNQA 3MV11 5MF5A 3W7GA 4QM1A 2AAAA 1LOLA 4GI4A 2ZCGA 5CZTA 3LD5A 5ECUA 2EG8A 4AWTA 3NQBA 1SFSA 4W86A 2C0AA 4ACZA 2YYUA 5HWJA 3HV8A 3GNOA 4AC7C 4PMZA 3QFEA 3M41A 4V28A 4JXCA 3F2CA 4O0KA 4XAPA 5MKGB 3LMYA 3NXFA 4TX9A 1RA5A 3IV3A 3ABZA 4JY9A 4HQVA 2A3LA 3R0DA 4ZQNA 1FQ0A 1HN1A 5A69A 4QFUA 1R86A 4G7EB 3LA4A 4F2UA 1L6GA 4XIAA 4N42A 5HDRA 3DFYA 5ABTA 2QCEA 4GGHA 2FMOA 3VIPA 1AMYA 1OADA 2Y5SA 4IMFA 3H4GA 4LNYA 1NFBA 2WW5A 3IEBA 3UNTA 2BY1A 4UQBA 3AMKA 3WQVA 2XH0A 2AKZA 2X2YA 3PSWA 2CBUA 1XC6A 1CENA 6CGTA 3VIIA 1W1PA 5JMUA 2FVLA 4ZOAA 1L6FA 4LSBA 3ANYA 3VFCA 4HA1A 1MW3A 4US5A 1G4PA 3EMZA 3VIFA 1XP3A 3W2LA 2BNJA 5FF3A 4JTJA 3HOJA 4HTBA 1JNEA 4DBDA 3GXFA 1VCGA 1UR8A 1TV2A 3CIVA 3B05A 1SW3A 5CSYA 4KF1A 1PEZA 4MY1A 4B5TA 4KWUA 2OPJA 1Z89A 1HVXA 4H9TA 3WMLA 4JTFA 5DMMA 1Q6OA 4JTSA 4S2BA 1TG7A 3PTDA 4NVTA 5H8UA 1TB3A 1YIXA 4TX8A 4GYPA 1E9LA 3FJNA 3UWQA 1LOQA 3LENA 3RIKA 5I23A 1R87A 5D30A 3UVIA 1BAGA 1KRMA 2W79A 1ZLPA 1YLVA 3GO2A 3S4TA 3W7HA 1ZJAA 3NA8A 4PRRA 3KTSA 1FKWA 2WZTA 3VUPA 1TX0A 3W27A 3RPDA 2X40A 5SWUA 1NOUA 3T2OA 3S3GA 2XVKA 4JFSA 4RE0A 4HZ6A 1PKNA 2J9YA 3LSCA 1GKQA 4XZLX 1K8YA 4UZUA 4MSSA 4AHPA 3RAOA 4GNKB 3CAKA 2I1OA 3OQ8A 2PWEA 3FDKA 3WEMA 1GOKA 4ZTYA 1Z9AA 4XKMA 4J3SA 3BANA 3T05A 3GXDA 4IT1A 2H90A 3VGBA 3GTXA 2ADAA 4XISA 2CETA 1TZ7A 4DJFC 4MJ4A 1R3SA 3GX9A 3K1GA 4HA0A 3ZVHA 3QR1A 4QROA 1XQKA 3UFYA 1FWHC 2NV1A 2ZXAA 4JQ1A 3THAA 4PH6A 1EUAA 5LGXA 3QEZA 2J7CA 2CLFA 5I24A 1ZFJA 4J3WA 9CGTA 2QUMA 3TJXA 1JR1A 5E0FA 2ZX5A 3OHIA 5J5DA 4H04A 1QNSA 3A47A 2PA6A 2INZA 5GVJA 4DO4A 1PZ3A 5DMNA 2O9PA 3TV8A 3S46A 1SJDA 3DFTA 4QDMA 2VUNA 1OX5A 3PUDA 3N6JA 3TNBA 2QT3A 3QV9A 3FNDA 5FSDC 3VKDA 1VAHA 2VCBA 2VVSA 3JS3A 1P1XA 4KWWA 4CQAA 3R8GA 1V3HA 3HV9A 3FAWA 3GB6A 1XBYA 1W31A 3EEGA 5FIPA 5DLCA 4FR1A 1F74A 3BLOA 2WCAA 1MW0A 3O16A 2E6FA 3QHNA 4AXKA 1JPMA 1P7TB 2G3JA 5KETA 3FW6A 3EB2A 1GHRA 4Q3MA 2IMRA 4RDVA 2HDJA 4JFWA 2C19A 1J0KA 5K9DA 4JKKA 5FCZA 4MVAA 1KBIA 1YPXA 4M80A 1P0EA 1I6NA 1GOOA 5I6SA 3AHYA 3ZXWA 5ABHA 4W87A 4Q8NA 3AIVA 2WKGA 5HNRA 4WQ6A 3VILA 2DVXA 1OX4B 3W7PA 2XVNA 3W7JA 1TJRA 1VGAA 5AHLA 7REQA 5IBXC 4IIEA 4L6DA 3CAQA 4UNIA 2LLEA 4PMJA 2WJFA 2XFYA 1HKJA 4PMQA 3N4EA 2OEMA 3VI2A 4HIBA 5DMYA 2QR6A 1H63A 2R9RA 5BXSA 1EDQA 1F2JA 1XYBA 3L0KA 3EMQA 1O12A 4PUKA 4I90A 2YZ5A 2ZXBA 1EQPA 3PTQA 3QJAA 4O50A 4S3GA 1K02A 3ID7A 1KW1A 4LV4A 3N34A 1TV8A 1X7IA 1ZY9A 2JF7A 2WC3A 4S38A 4UZSA 3LQGA 5IOBA 4L9YA 1G67A 3M43A 3WQDA 1JGMA 3MYOA 2GPTA 4M81A 2Y2WA 3G1AA 5CBBA 3CT7A 4H3DA 2IPWA 1Q6DA 3C4UA 4K1WA 1P6CA 3QY7A 3UJSA 2V68A 4NJGA 2GDQA 2WM1A 5AHFA 1JF5A 2EG6A 4NUWA 5LIUX 1RLDA 4HOWA 3SCNA 2Q09A 2DSVA 4KW2A 1FWBC 5L9FA 2F7FA 1TWIA 2A6LA 5AN7A 3BSHA 3KOFA 4AF0B 2Y63A 5GNZA 3TTOA 2PD9A 3UXLA 2R1KA 4AY8A 3T1GA 4JQ4A 2POZA 3ENLA 1TV7A 4FF5A 2DT2A 3H2MA 4MB4A 5HR7A 2DW6A 3F4NA 3A5VA 1GQIA 5IRPA 3TA9A 1DWFM 1KM5A 2C16A 3ZS4A 2REQA 4K36A 1TPB1 4GVGA 4QIUA 3GXIA 3N3TA 4X0NA 1SW7A 2VFIA 3SCTA 4ZMGA 3QLDA 4ZO6A 5JH2A 2INFA 1RAKA 2VZVA 1PYFA 1OFQA 3LBOA 3UR2A 1FWAC 1S5WA 1TYGA 1V3KA 3M7WA 4S39A 2JGQA 5LNRA 3UG3A 3NQ8A 5C7HA 2NVAA 2XDFA 3A6OA 3H54A 3M0MA 2ZE0A 4XD6A 2PDLA 3B4YA 3IJ6A 4IXHA 4Z1CA 2P5NA 3GNXA 3MWAA 2X1UA 1KC7A 1MYRA 3C8FA 1UKTA 1WZMA 3M64A 2ZKMX 2GVJA 2ZUMA 3CC1A 1ISVA 1GOMA 4LC8A 2XGBA 3OLEA 4Z17A 1VYPX 1LZOA 3CAVA 2VI0A 2CZ5A 2EBNA 4EXQA 4AVOA 3EOSA 3HG5A 1H1YA 5B7ZA 3DFPA 1JDDA 4IFKA 4MUPA 5FJPA 3SAZA 3HB9A 3QMSA 3HMCA 4NAFB 3QQ0A 4JTTA 4IOTA 1QW9A 4H2CA 4DF1A 4ZTXA 3VKKA 2H3DA 4Q33A 4YU1A 1MDRA 1FWSA 1QNPA 3TUUA 2WBKA 1QI5A 2WANA 1JYNA 2B7OA 3LXBA 3N25A 1P0BA 4HA3A 3LDVA 2GOKA 3Q4DA 4JS3A 1YW1A 3GLCA 2YX0A 4DUOA 3MBFA 3PZIA 1Q6RA 2A3AA 1PDYA 1QVBA 5E5CA 2DV0A 1ZPTA 1BF2A 2H8ZA 1UZHA 1JQVA 2XGIA 4UTTA 2GUYA 3C0QA 3WLNA 5HXMA 1TO3A 3PG8A 4RPPA 1HFBA 3D6NA 2W62A 4AD5A 1E0VA 2RDUA 3R11A 4FX6M 2W0UA 1PHQA 3VOIA 1NOWA 3CS2A 3WLSA 3CV1A 2DIEA 1UWIA 1D3HA 3LXAA 2O9RA 1QCWA 3VMPA 2J8TA 1K70A 1MVYA 2GFTA 3E2VA 2D1ZA 3VVGA 3ZJ8A 3ZWSA 5BOFA 3PWGA 3HG3A 3M0JA 5FSEC 1BSLA 1QO5A 3GIQA 4DYKA 2E6DA 1PKLA 4C6PA 1FWTA 3BXWA 1OF8A 4AMAA 3SDOA 5C6MA 3KXQA 3UZWA 3TU9A 4FA3A 1MDLA 3LOTA 3L4ZA 3ALFA 3LNPA 3ARVA 4KIEA 1Q65A 5HA7A 2A6NA 1A3XA 3S83A 3T78A 6A3HA 1TPH1 3K2GA 1CB2A 3SW6A 4Y2WA 3ZLHA 4GE8A 5D37A 3NTYA 4YTUA 1J6PA 2OO0A 4M3PA 2YGYA 4YIWA 1O95A 2VM8A 1LG1A 1XG3A 2VFEA 4B16A 4HNVA 1PKMA 5AHEA 2FIQA 1EH9A 4FOJA 1MSSA 3S6DA 6REQA 1UWTA 3GW0A 3HTWA 1WUEA 3GDRA 1TA3A 1VBUA 2O9TA 2NLIA 3GH7A 1ELSA 5KMYA 4LB3A 2Z1WA 4MOZA 4WOZA 1P0DA 2YL8A 4ASTA 3CM4A 1Z42A 2EKCA 4JX6A 1V8EA 4O15A 3CTLA 3W7LA 1NFPA 3SB0A 1XBZA 3RR1A 1E73M 3SCUA 2DORA 1LRQA 3WDPP 2XN2A 3OEXA 2GGEA 3DKLA 3SRFA 1R5YA 3OVGA 4W7UA 2IKJA 3P7YA 5CAHA 3I7QA 4GYKA 4ATDA 3P62A 3B0PA 4K37A 5FKYA 5D05A 4RDZA 3T7VA 3L68A 1VR6A 2BGNE 1M01A 5A6BA 3M0LA 1E6NA 4UB9A 1Z3NA 1N8IA 4GVIA 2FKPA 4WDXA 3K4DA 4RK8A 4O11A 2VURA 3G1SA 3GG8A 4C6KA 3I3EA 3TN6A 3BURA 3BUVA 4FXFA 1KFCA 3PBYA 1W91A 2NV9A 2IQ0A 3AFBA 5D04C 1EJ7L 3KW3A 4LY4A 1JFXA 4DF0A 3DIPA 1JAKA 2B7NA 2YFNA 1HUVA 4UFJA 3KFTA 3KBSA 1R9XA 3RMEA 1YEYA 1Z32X 4FR6A 4LF1A 3U2CA 4C6OA 1TR9A 4PYSA 1ZSXA 1OABA 2QDHA 3S2CA 3BLLA 3LQLA 4ZOBA 3M6DA 2QIWA 1VB9A 3UZXA 2FB3A 3M44A 1OT2A 3CPUA 3A9BA 3STFA 2QHAA 4MKNA 4DAIA 4ZQPA 4PCSA 1CX9A 3GR8A 1M03A 3K8KA 2D2GA 5I3IA 1KCZA 4D6HA 2FLIA 1ZTVA 1DIDA 5T91A 4C5YA 5U7SA 4INFA 3SUTA 4PBFA 3H2AA 4CU7A 1JYXA 1ZL1A 4KQNA 3WZ0E 5HQMA 3HG2A 2NUYA 3WDQA 3V16A 1WXJA 2Z2UA 3GFYA 3H12A 1Y8BA 1S2TA 4JKMA 5CC5A 2YB4A 3B3DA 3SN1A 3S0CA 4YCOA 1X6LA 5F2IA 3TOYA 1YE6A 3BAWA 3SBFA 1VIZA 2ZX7A 4FMVA 3RGTA 2F6XA 2ZUUA 2DZAA 2R8WA 1DIKA 5HPCA 4NX0A 3W24A 1T8XA 4Q8WA 3CQIA 4WKHA 4JN6A 4R3UA 1NFGA 2Y5JA 1ODZA 2ISFA 4FXSA 2CITA 1IWAA 1JCNA 3FFSA 1SR0A 4N4QA 4CCZA 4Q6XA 2OT0A 4X2RA 2D2HA 4DIAA 2P0OA 3RLGA 5E70A 1DHPA 3STPA 1DJIA 2GQ8A 2QMJA 3AWNA 4DB7A 3EWUA 1S38A 4HA4A 1QI4A 3VNYA 4JHZA 2V6AA 1W3KA 5D9NA 4NF7A 3W88A 2C79A 1J4EA 4O4VA 1JDFA 2YBVA 4O1FA 1NDYA 1P43A 3F4DA 5EBAA 3MKCA 4PMUA 1R2SA 2BDQA 2CBIA 3WF3A 2AQVA 2BVWA 4EXAA 4O10A 1K8XA 5G4HC 1P1MA 3TAKA 3CO8A 3KX6A 1JPKA 1JYVA 1F8IA 3CUZA 4MIMA 4US5D 3S5ZA 4LUTA 4HD5A 4IMEA 5CSSA 2P76A 1VHNA 2QCFA 3QGVA 1VEOA 2XZ7A 1OFAA 2FTPA 3R43A 2X1TA 4LUIA 5BRQA 2C18A 2PDCA 2VNCA 1H3GA 3FVDA 1DWAM 2BOFX 4NYYA 2F9RA 1GQNA 3EPOA 4HMNA 4IJBA 4AW7A 4MNMA 3LCWA 2GLKA 4EWJA 1B3XA 1NP2A 1W1ZA 3FCPA 3GC5A 1XG4A 3CMJA 3GWQA 3OLIA 1FCQA 3V5OA 3MA8A 4Q8OA 2OZ0A 1O1HA 4KCUA 5EY5A 3RM4A 2W4XA 1GOIA 1H4PA 4KRUA 5C71A 1REQA 3I65A 2QCNA 1M7OA 4YHGA 1UC4A 2GK1B 3OZPA 1SZGA 2WC7A 4V1XA 1X98A 3L65A 3G24A 4XAFA 3WY1A 3S1XA 4W7WA 3DOPA 3NXLA 1Y5XA 5T26A 2XGZA 3BLKA 1E5NA 4Q32A 2XVGA 1YNYA 3PBMA 5FEXA 1ONWA 4TV6A 3KLLA 1CXFA 1Z41A 3P61A 5D4YA 3VC6A 4N0RA 3RMJA 4XZWA 1E6RA 5G1YA 2X8RA 1V5XA 4M6PA 3P6LA 5BCAA 4PRTA 1QK0A 4QGCA 3G8EA 3GG1A 3MP3A 4OV9A 3WBEA 1E15A 2ABAA 3KBVA 5BXRA 1KQYA 3BW3A 3GD6A 1XH1A 4YVPA 4NNBA 3FJ4A 1QXLA 3W72A 4HKPA 1TMQA 2DFAA 4IP7A 3A12A 4C6IA 3DFHA 4XBKA 3C2YA 3DX5A 1OT1A 4MJZA 1EBGA 3L9CA 3BLIA 5BWAA 2A79A 3ZMRA 2BGSA 3GNRA 4EF9A 1NU5A 5HJXA 2GGIA 3AMCA 3NDYA 5TQLA 2E9MA 4L4PA 3HFTA 1RP9A 5FEPA 3ICJA 2GGJA 1BLIA 5M1TA 2GVEA 4MB5A 5EMLA 4TR9A 3U8GA 1W8GA 1K9EA 4RPQA 1K4HA 4MFEA 2PGRA 5FL0A 3AHTA 4JTKA 1CXIA 4OGZA 1B4KA 3LCIA 1ZBCA 1ITUA 4Z2LA 4XK2A 2C6QA 1EX5A 1WP6A 1OD8A 1QFEA 1SO5A 4OECA 2Z2BA 2ZUSA 2HVOA 4ZGYA 1PZ2A 1MZHA 4RX0A 3UCCA 1Z6KA 2ZA2A 3EAUA 1ISYA 3MSYA 1G0CA 4B15A 4CNTA 2OOFA 4IIHA 5BWFA 4H6QA 4S2CA 1XRTA 1Q2SA 5TF0A 4R34A 4C6MA 3DG6A 4HNCA 2X05A 1UBSA 1XGDA 1TIWA 1HL2A 3O06A 3BWWA 4EK7A 3WF2A 3RLVA 3T55A 1GG1A 2ZZ5A 1VHCA 3MWCA 5AHMA 2C15A 1H60A 1DEDA 1HJVA 3O8AA 1EJRC 3TSDA 4ZEPA 1OZMA 5LGZA 4AQLA 2F2KA 4DPQA 3E2RA 2G4FA 3QGKC 2CIPA 4ALDA 5L6UA 3QRHA 1JQXA 5A94A 3UPWA 3UZJA 3I6RA 4JN8A 3I6TA 1EYEA 1W1TA 4MB1A 3S1GA 2E4TA 3VE7A 4R9OA 3MANA 1B30A 1L6YA 4RNJA 1EIXA 2V3EA 3VD9A 1FH8A 1T5AA 2ATMA 1DTUA 3VKAA 1VFMA 4N4PA 1XIFA 4DXVA 4W93A 3URQA 3SCSA 3P81A 3HQPA 4QCEA 4LBUA 3NO3A 1YBQA 4GUJA 2OZ3A 4XTIA 2HVNA 3MJMA 2WPBA 1OB0A 4AC1X 3E0LA 3BAYA 2DSKA 1V6UA 4A8NA 3CWOX 4POCA 5AYYA 2HBVA 3PANA 5AYBA 3E02A 1ME7A 5KTLA 2NV2A 2OQYA 3H26A 1ENUA 3TEVA 3AYRA 2WOQA 4W84A 4GYJA 3W75A 4DWSC 4NJKA 5LNVA 4O1BA 3AZSA 3VD4A 3M6YA 3U48A 2UBPC 5DY2A 3SRKA 4X2PA 1N8WA 2OTDA 3ITYA 1VFLA 1R8LA 3EDDA 3QGAC 1VQTA 4Y6GA 4C65A 1IEQA 4JIIX 5IXEA 2FYMA 2HXUA 2DH2A 4MTVA 2P8CA 1RPXA 4JIHA 2EJAA 3GE7A 4DBEA 1O6IA 3F4WA 1FHDA 3LXCA 1PIFA 4ZZ9A 4E4UA 1M04A 3QOMA 2O4MA 4H8NA 2I5IA 4YWSA 4TVCA 2PWUA 1QW7A 2GVLA 4LANA 4BF5A 4H6KA 2YDRA 4GXMA 3N6HA 1E4IA 2YZRA 4IPJA 3NDOA 2Z1BA 1J12A 1I2RA 2ZX6A 1IGSA 5F4WA 3FA3A 1GEHA 1XF0A 4Z2HA 1UC5A 1KV8A 3V5CA 1YPFA 2GVGA 1LL4A 5A6LA 1V02E 1AODA 4K38A 3E5PA 3W7OA 5B7YA 5CPQA 2FZ9A 5EL1A 3DC0A 3ZWTA 3P93A 1W17A 4PCTA 3SURA 5CCZA 1TWSA 4Y7EA 3T0TA 1FBAA 4HNUA 2HISA 3EX6A 4J28A 1UMYA 1W1A1 1JVNA 3L7RA 1V93A 4CCEA 3U7VA 1PCKA 3LYEA 5K9CA 1KLYA 3KP0A 3NPUA 1TPEA 3ABXA 3GDBA 1H7XA 1UZ4A 3GZAA 4HPJA 2Y24A 2WMJA 3P0WA 1BWLA 1ECQA 3VINA 3EX2A 1JZ7A 4ACZB 4GPNA 1UOZA 4S3FA 1WKDA 2HNHA 3T2PA 3BCJA 2J88A 4UXDA 3SEPA 3GVVA 4CVWA 1Q66A 1AW2A 3ITCA 3L21A 4L1XA 8A3HA 4PC8A 2WKLA 4FXJA 2YOCA 4UFLA 2QLYA 3W1AA 5I77A 3LMZA 4AH7A 2ACUA 4EOUA 2OU4A 2CZDA 4R7JA 2V67A 4RNFA 8RUCA 2QDDA 3G18A 3LCHA 3U5UA 3MMDA 4LCSA 4LEFA 3W01A 4JQ3A 1XLGA 3HO8A 2BB0A 4BCEA 1QK2A 5H2ZA 4IWWA 4JX4A 4RL3A 5AC6A 4YN5A 3U2EA 3FN9A 3R94A 1FH9A 3BOXA 4HOXA 3RJYA 4UR9A 1CGVA 2RFGA 1QWGA 3UG4A 3L4VA 2XFWA 3W07A 3TOPA 4K7VA 3BLDA 4GO8A 1S2AA 1TELA 3S6TA 4AMCA 4MHBA 3G0SA 4KBXA 1DHKA 4B5VA 4NRRA 1ISWA 3NO5A 1PKYA 1DE5A 1L6WA 4RE2A 3AMLA 1O5XA 5A2AA 3RHGA 1JEZA 2XTKA 3BAXA 1MEHA 2EPNA 8TIMA 3BMVA 5XINA 4MY9A 4ICCX 4HB7A 1CXKA 3A3WA 3DGBA 3UESA 1FWNA 2R82A 3OVPA 2XPKA 1IIHA 3Q67A 2YCEA 4P8XA 1TUFA 2FGLA 3GIPA 3VOFA 1MO0A 4K8HA 4HZMA 2RAGA 4Q7NA 4D2JA 1OYCA 1HZYA 3P60A 2W5FA 4AYSA 4PCPA 3HQOA 3HFYA 1GVRA 1IEXA 5BRPA 4UTUA 4O1CA 3UXAA 1IEIA 2DJXA 3S5NA 4GIRA 1OFOA 4PMVA 3VNJA 3O0FA 3B0YA 2RDWA 1UA3A 1C8QA 1YDVA 1EHNA 4J3UA 3LRMA 1SZFA 3LNMA 3DFQA 5MHBA 2PBGA 2Y62A 5HPOA 1UWSA 2CESA 4C6QA 1NY1A 2NXGA 3TKFA 1NEYA 2FB2A 2GUUA 3CT2A 2DSZA 3HURA 1G01A 1J6OA 3ZOAA 3BGAA 1V0NA 3KWXA 1BGGA 2VZSA 1FWRA 1EOMA 3GSMA 3UT0A 2PF8A 2VR5A 2O9OA 3ZVHB 1KBKA 3LCFA 1QPRA 1S3HA 1GORA 4CLMA 2BXYA 1JDCA 3D3FA 1Q6EA 1CNVA 5A6BD 2AL2A 4MKVA 1V7YA 3VD7A 4PTMA 2PGFA 4QX4A 2TPSA 1VLIA 3JZEA 3MSDA 2ZRZA 1D8CA 1TQXA 1UH3A 3CL6A 3PZTA 4JN7A 3FYPA 3OZMA 1WPCA 1TVLA 3DG7A 3NL5A 4MDPA 3FKRA 2J8FA 4M51A 3AYVA 4F79A 4WUIA 1XICA 1E9YB 2A7NA 3F7JA 4Z42C 3WN6A 3W73A 1CLKA 1J2BA 1DWIM 3PZOA 3CMGA 3ZM8A 3W1PA 2XH2A 5HUOA 2IQTA 3VD3A 4DBSA 3SSJA 2NX9A 2EQDA 2J4GA 4P61A 3W2KA 3P82A 4RV8A 4GQBA 4PGLA 4OBTA 4GO9A 1GEQA 1PPIA 2WMHA 4O53A 2ESCA 4KWVA 2DPEA 2ZQ0A 2CHOA 2QJJA 3APYA 1IWBA 3KVLA 4W5ZA 2AL1A 3M9YA 1R3VA 3BVJA 3LPGA 2ZDSA 2NLYA 2RH9A 3W87A 3P8IA 5EA9A 1B5TA 1XR2A 4NSBA 3N11A 2YL9A 1ZALA 2D22A 4ERIA 3ZVIA 1QDSA 3GTNA 1DWJM 5G4EA 3XINA 2HJPA 3W74A 1G4SA 4O4WA 2YJQA 1NWSA 5CZJA 3LHUA 7REQB 3N2TA 1KTCA 5LNSA 1Y0EA 3ZT6A 1P48A 1KM6A 5BNKA 1TJPA 4K8GA 4GJ1A 3PJUA 1OX4A 3OBEA 2PGEA 2NQ9A 4LVBA 3S2MA 1C93A 4C91A 3CV7A 2VXNA 1YXYA 4MAZA 4HK5A 3TE9A 1EJUC 1J93A 3PZNA 3NSNA 1E55A 5DCDA 3AOFA 4FNPA 2ZZ2A 1LRTA 1UMLA 4GYFA 4G6CA 1XSIA 2XIBA 3QPZA 4K2SA 4UIOA 2FPVA 1S2WA 4WXZA 2GQ3A 1VJIA 3OG2A 1KBBA 1RQEA 3RLHA 4I8DA 5EMJA 3FA4A 3FLUA 3UQNA 1ISZA 4XZBA 2FFCA 3EDJA 1B1YA 3ZT5A 4CD6A 5IM51 3ABQA 4UOJA 4H00A 3EWBX 3BG9A 3EXSA 3FJ6A 3AI0A 4O54A 2Z0IA 3W7QA 2QCMA 3A13A 3M0KA 1POJA 1VCFA 4WIWA 1HX0A 4HYVA 4JNMA 5EFFA 4OWGA 3FHAA 2IXVA 1TSIA 3PZQA 3WG6A 2ZUTA 4WR3A 4ROPA 3KOXA 3LV6A 1XLBA 4BQ2A 4NJIA 2NVCA 5T9CE 3LZ3A 3G1YA 2NUWA 4ZE5A 3ZFHA 1JRCA 4KWOA 3H7VA 3W1NA 4JQAA 1Q7MA 3NFUA 4IH3A 3B8UA 2Z6JA 1JUKA 3PUEA 3P5YA 3VKJA 3GNPA 1KXHA 4HU8A 4HHPA 2A7RA 5JBEA 3M0VA 3WF4A 1TV5A 1KGWA 2XVPA 2P3ZA 3F5LA 3RCMA 4L1WA 2I16A 3KCJA 4B2DA 7CGTA 4CEUC 5A8NA 4LTSA 1XC4A 2BLEA 5FL1A 1XLJA 1UKQA 2YW4A 2VENA 2REQB 1XIMA 4OE7A 4Z2GA 2X7WA 2P0IA 3NEHA 5T8GA 1WDPA 1GJUA 3N3MA 2XM1A 3SRHA 4GC4A 1S2VA 1Q6CA 4MZ1A 1DQXA 3FHQA 5AECA 2NWRA 4GKLA 3U5YA 4QCFA 1V7AA 4D8AA 5CC6A 1BEUA 2E6YA 3O3RA 1X1NA 4JTDA 3T44A 2RHGA 3K8MA 4GKTA 1A5OC 3QSTA 4LUYA 4YYCA 1GUVA 1ZBVA 3NQVA 3N73A 1IT8A 6ENLA 2QGHA 3PN8A 2PB1A 3LCGA 3WLIA 2WKJA 1OYAA 4NZFA 2YCJA 3C3NA 4N7QA 2XN1A 4LCRA 4HPGA 3VNKA 1H51A 1JZ4A 2JEPA 1Z8AA 1B3VA 4XD3A 1SU5A 4QG6A 2BGQA 3IS4A 4XQ6A 3LLDA 1ODUA 2G97A 3IJIA 3K13A 3SN4A 4AZGA 2PTWA 1R38A 3NPWA 3QTPA 3RCNA 4IFKB 4O1AA 4NZ5A 1WDSA 4CD5A 5KZMA 3M5XA 4CGTA 4Y8FA 4LNCA 1R2RA 4F8XA 4J1OA 5FJTA 3LHWA 1NDVA 1UBPC 4B3KA 5CAKA 1MNSA 3C3UA 3BG3A 2Y5EA 2Z28A 4FI4A 2Z2AA 3OB8A 1X7FA 4LT9A 1ZZMA 5T9BG 4NQ1A 3G1FA 4GXWA 3HM7A 4P7NA 1EC8A 3WMSA 1MFUA 5C0QA 1OZQA 1E4LA 3MC5A 1A3WA 3UCQA 1TMHA 1WKYA 4A3YA 2CFFA 4UTFA 1XW8A 1QI3A 4FNSA 7XIMA 6XIMA 5LSMA 3AZTA 1OSEA 3WQPA 1TWDA 3LPFA 2QJIA 3VABA 3EBVA 1G9HA 1IZKA 3WLHA 1E0UA 3I68A 3UJ2A 1BG4A 2V38A 4JEQA 4D9PA 1WYIA 4DJEA 5HNNA 3W7CA 3TDFA 3QTGA 1BVZA 3I7RA 5FI8A 1VS1A 3L67A 3JZUA 3GBEA 3TYBA 3OZOA 2CZFA 3TN4A 3UY8A 1LDCA 1UH4A 1YXDA 4PSRA 1LWJA 1HP5A 1A53A 3L5LA 4UOZA 5C8BB 2XSAA 4DNMA 1XCWA 4WEVX 5I3JA 2OGYA 4YNGA 3ZLGA 3EOLA 3GXPA 4HK7A 3QMTA 1BVWA 2PLMA 3MKKA 3APTA 1FY6A 4I7UA 4PMNA 1H50A 1HNYA 1CZ1A 2EO7A 1UW9A 1JI1A 1IXOA 3VDHA 3W4RA 1K1DA 1QR7A 4R27A 3L4TA 3TN3A 3AIUA 3LGGA 2QF8A 1F4AA 4GRSA 2J79A 5HATA 6REQB 1TA3B 1QHZA 3GW3A 3GYEA 1NP0A 1R3QA 3W6LA 4E0CA 4QBXA 1KRAC 4AISA 3SCRA 2OYLA 2NWSA 4NX5A 3G77A 1DTNA 4Z1AA 5CGTA 4HSOA 3ZIZA 1PV8A 3Q37A 3ARRA 1O60A 4GZ7A 1FWJC 1V0LA 4PZVA 2XYLA 3B8WA 5AZ0A 1JYWA 1LBFA 1FCUA 1Y65A 2IXUA 5G2HA 1XBXA 3WO8A 3PSVA 3UW6A 2PI6A 4C1LA 3MCNA 3VU2A 2Q8XA 3SCQA 1E4NA 3OLGA 3PBVA 2PZ0A 3B03A 3ITOA 3P80A 6PTDA 2GL5A 1Q6GA 5K7JA 4PMRA 3NPXA 1SMDA 3AIWA 2ATSA 2G4JA 3R5EA 2PWGA 2OMAA 3C0LA 5PTDA 4RW3A 3B8TA 3EB4A 1PTGA 2ABBA 1TPFA 5E9AA 3W2MA 1QJWA 3RN6A 2ZRUA 1JZ6A 2RDTA 1ONRA 4MB3A 1PXGA 3T09A 5LIKX 3MHFA 2RGMA 3CMFA 1BQCA 1ZU8A 3PFRA 1DE6A 3W38A 1X8CA 5BMWA 3M47A 2E68A 4XVDA 2XH7A 4O0QA 4F4RA 1Q7QA 5E0KA 1EC9A 3M0ZA 4PUMA 4C6NA 2ZUVA 4OQVA 3T42A 3GC4A 3VUSA 3N18A 1E6ZA 3ERPA 1VBHA 4MWAC 4LJ3A 3Q45A 3G6LA 3SCWA 1U22A 2FZ8A 1UR2A 2V69A 3BMWA 4P8VA 2G5WA 2Z7GA 3P3BA 2CU0A 4AD2A 3PUGA 4ZB5A 5CBJA 4QXIA 1HJUA 3GXMA 1QHPA 4GH1A 2ONEA 3F2BA 3BZJA 1CT5A 4PMDA 2CBVA 3VK5A 3MZ2A 3VYLA 4S3BA 3SUVA 2GSHA 3UWYA 4JIQA 2D0GA 4DHGA 4DO7A 1RQHA 2QNEA 3OO2A 4ZSUA 5AYXA 4UTWC 2H3BA 1I2OA 4W88A 4JL1A 4ZQMA 1C8VA 2OGJA 1VEPA 3CASA 4XB3A 3RU8X 1U33A 2AQOA 5CEWA 2ACRA 4AY7A 4GUGA 1LLWA 4O14A 1KKOA 3VMOA 3WQ5A 5TD4A 1M6JA 3SADA 3R89A 3WMCA 4HBKA 1KV5A 1PWLA 4P2VA 4GI6A 1H41A 4Q8MA 1UA7A 4C1NA 2XU2A 2QEZA 2JFEX 4H6EA 1WKEA 1O5RA 3WBWA 1GZJA 4DZAA 1SVDA 2D2JA 4PEKA 4Y9AA 1JZ8A 2WLZA 1UUQA 4GIEA 2I57A 2GSEA 2PU1A 2W92A 3QC3A 3WLLA 2V9DA 2WWCA 2E67A 2XVLA 2OLSA 3O6YX 3WJYA 3CNYA 1EFZA 3GR7A 4DO5A 1W9UA 1TCDA 3S1VA 1K6AA 4DJFA 1KFEA 2IPGA 3P14A 2X1IA 4GY1A 4AIOA 9XIAA 2DY3A 4AZHA 1CDGA 3IARA 3ZJ6A 1EJSC 3W0KA 1W1B1 3K4WA 2PTZA 3UERA 4Z1BA 1XYAA 4LUTB 2PC8A 4I7VA 1LCOA 1OEPA 3WDJA 4NU7A 3LV5A 5HUPA 4DM2A 2KZHA 4IMCA 4KFOA 4IGNA 3AS1A 5EGRA 1XLDA 4JTHA 3G1VA 3T2QA 3N2MA 4GI8A 1I0BA 3VPLA 1M5WA 5I79A 4CN6A 1J9YA 2UZ9A 1OC7A 5A8MA 4UR8A 3RNDA 2ZICA 3S2JA 4IPIA 5HJYA 1W5NA 3UEQA 2QPSA 3NQGA 4LS2A 5BZAA 1HQTA 2DZPA 4LV9A 4OZOA 1V0MA 1REQB 2O7QA 4R85A 4KWSA 1V6TA 4PSPA 1EGMA 3MUCA 3AU6A 1E3XA 3VC5A 3WJWA 1LUCA 3NZGA 3PHAA 4W8LA 1X1ZA 4ML9A 2XN0A 3QY6A 2RKXA 4L4MA 4JFUA 1XLLA 4WY0F 4IPNB 1IHIA 1E40A 5HR6A 3GNDA 4JIPA 5ABGA 3NDZA 2VQTA 4AYGA 4W9TA 3MHUA 1D7FA 4YL2A 4GK8A 3KVJA 2EPMX 3WLRA 2VDHA 4Y96A 1BYAA 4LX4A 2DQWA 2R94A 3NYZA 4LRTA 2E09A 4B3LA 2ZIDA 1X1OA 2GZXA 3UD6A 3C61A 2BP1A 5EB8A 3W02A 4FPSA 5IBXA 2ZC1A 4WLCA 1EF2A 2WJZA 3N9SA 2FVKA 2PLCA 3BZGA 4R88A 1FOBA 4V33A 2YDSA 4NILA 4AD4A 2RJHA 3L4YA 4S3EA 1GYMA 1OFRA 1VCVA 1BQGA 2D23A 1VFFA 4RE3A 4A8RA 2GQAA 3NQ2A 3PB2A 2ZX9A 3S42A 4LS0A 1O68A 4PULA 1SJCA 4EAYA 1BXNA 4ZXLA 3KEHA 4JTLA 3W7NA 2GJXA 3CUGA 2QZRA 3WQOA 1H5VA 2OX1A 3NQEA 4MDOA 2ISDA 4CNOA 3VZXA 3FDGA 1EP1A 2R24A 4O8RA 3CYJA 4AB4A 3UBPC 4U28A 1U1HA 2OT1A 3AXHA 1JFHA 3IIXA 1JXJA 2HS6A 1LOSA 1XPGA 1KCKA 1DJNA 4IZGA 4PMOA 3BCFA 3FGCA 1ESWA 1LLZA 3EWYA 1QOQA 4KFPA 3OOQA 3CQ0A 4P7OA 3DKJA 3H8AA 5AC5A 1WZKA 3B9NA 4ICMA 4IMDA 2PDYA 3AUJA 1VIWA 5HULA 3MVTA 1RZMA 3W37A 3BW2A 4GG9A 1E6SM 5FF7A 4HYWA 3WLQA 4J9JA 3SCVA 2PP1A 2QUNA 1XX1A 2ZA3A 3SUSA 3RCYA 5AHIA 2FZNA 2KAUC 3OA5A 3HN3A 1EA9C 2PP0A 2ZBTA 4LAKA 2L5HA 2YXXA 4QLKA 1WAWA 1UR1A 4UNLA 3PBUA 4L1GA 2V2HA 1VPQA 4PTNA 2BASA 3WH8A 4ERGA 3VKBA 3PM6A 2XG9A 5DX7A 1JPHA 3WNPA 2CLLA 1A5SA 3V0SA 2ISVA 1QBAA 1LF1A 2TAAA 4IJRA 1E6XM 3G0XA 4Q8UA 4FB7A 1HKIA 1IXQA 1G5AA 1W37A 2QGYA 2VZUA 2E5CA 5J5RA 3B06A 2NT1A 2C3ZA 3TTSA 1LWHA 2Y8VA 3TSMA 4DYJA 4G1NA 2RJGA 2HWGA 5U4NA 1OK6A 1AUSL 4K1GA 1F07A 1UUMA 3AUOA 5BW6A 4LQ1A 2VFHA 5FF2A 3OQEA 4AX6A 3DUGA 3QHOA 1E71M 4GCAA 3QV8A 1GHSA 3IUDA 6XIAA 1QPNA 3VNIA 4H7CA 1PTDA 2QCHA 3S8HA 1YBQB 4Y9OA 4JICA 1I2PA 5DBTA 3UZYA 1WDDA 5J8LA 3T4WA 3L5MA 3ABSA 2ALDA 3EA2A 3KZSA 2R1MA 5F1VA 4CNNA 4B4HA 5F4XA 3S47A 2G3IA 2VT0A 3KL0A 3ARZA 4XD4A 3RX4A 3KBJA 1GT8A 4C7FA 1H7OA 1VBJA 4L4OA 1TIMA 3QMRA 3CUXA 3A3XA 1FFRA 1M53A 2A3CA 2DVTA 1GONA 1HL9A 5I3KA 2YA1A 3NQMA 2VRJA 4HCHA 4QG8A 2X0HA 4WGHA 4Q8PA 4Z0JA 3DEQA 3O05A 2DZUA 2CHRA 1OGGA 3KUMA 1R7AA 4KEMA 1UD3A 1XYLA 4FNQA 4B2DD 3ISIX 1Q4WA 2J7DA 1IF2A 3VGHA 2DIJA 4IJCA 2A3EA 3BTNA 2P53A 4M1BA 4A6GA 3M5VA 3NQDA 2VD8A 4EANA 3EPNA 5K9XA 2DU2A 2NXIA 4KETA 4J40A 2OLHA 4E4FA 3C2VA 1YX1A 1SO6A 4HCDA 2ZRWA 1JCJA 1GQJA 1W5QA 2NQZA 3EEZA 3WQCA 4PB3A 3WMBA 2VKZG 2IS7A 5D8ZA 3QKZA 3G2GA 3M07A 3AU2A 3EKLA 4H6RA 4ACYA 2PDHA 1JRBA 2BWGA 5TAOA 4HK6A 3H2OA 3LPOA 3GVWA 5HWNA 3LRLA 3B8IA 1Y5VA 3CIXA 3KRZA 3PS7A 4N9CA 2E1WA 1BWKA 4H9YA 1I45A 1GOWA 5IDZA 1QBBA 1IT0A 1W1VA 3WK2A 3AJXA 1XGEA 3VOCA 1R2TA 3AHVA 3EWCA 3LLXA 2GUBA 3VGEA 2JQXA 2XIJA 1J0ZA 4GX8A 1C7TA 3ARUA 3BCDA 1SZEA 3DFNA 3SSZA 3EB3A 1W3TA 3AS2A 2JGYA 3WD2A 1KNWA 1PB0A 1FCBA 1FHVA 1BTMA 5TIMA 5D9PA 1PZ0A 4GACA 2ZFAA 1V02A 5A95A 2VEPA 1TPDA 2XFRA 3PB0A 4PUNA 1H2JA 3W7KA 1FWDC 4G56A 2O92A 2V3GA 4QJ5B 2OWWA 2OQHA 1ECEA 3WSUA 1VRXA 3BG5A 3O1NA 5IDIA 3HA1A 2W9MA 4JYDA 4WSHA 4C6BA 1IE7C 5AC4A 1ITCA 4ECLA 4MWAE 2OKOA 2WMFA 4US6A 1OHLA 2Y4SA 4ZR8A 1CCWB 4H8UA 2E1DA 4X63A 2IPFA 2HPIA 2J7EA 3P67A 4DJED 5I00A 2I5GA 1FHUA 2FVMA 2PZNA 3WH7A 4WY0A 2PEVA 1PE1A 1PL9A 1V4YA 2A85A 3B9OA 3SJNA 4LEQA 4KCTA 3VCRA 1PO9A 2PE4A 1WNOA 5LA1A 5AYIA 4HN8A 1NF0A 4L56A 1W2VA 2VWTA 4XZMX 5GJNA 1ME9A 2RDXA 3EYPA 1FWFC 3GZ3A 1S1RA 1F3XA 1FWWA 5LNUA 1CECA 1AZ1A 1UQYA 4LW7A 4MJMA 3EDKA 4PB5A 1EP2A 4E3TA 3ZO9A 4O8AA 3LUTA 1IEVA 1XRFA 3WQ6A 3PPCA 2C0HA 4QTGA 5A8QA 1V51A 2D3NA 3ZYZA 3T4CA 1JD9A 4F2BA 3TZNA 1K4GA 1UR9A 4JTRA 1W3IA 5K2ZA 1E70M 1MUMA 4PRWA 1U2YA 1EB3A 1Q63A 4WDUA 1YDNA 4NXKA 1FP8A 1CBGA 1DJQA 3TJLA 2VGBA 4NNAA 2EPOA 4Y9NA 1UZ1A 1W9PA 2R91A 3OTRA 1LBLA 3H2FA 3CHEA 4HNNA 4H01A 1T0OA 2NUXA 4XO7A 3AXIA 3OODA 4K3ZA 2DDXA 2O56A 1XUUA 4IUGA 4L9ZA 2CLKA 1XIHA 4TOQA 1KFWA 2JKAA 1POKA 5EKYA 3IACA 1I8JA 4JTAA 3TYDA 4G9PA 3TYCA 4H7ZA 4HHMA 1PSCA 3QR0A 4XAYA 4AD0A 1Q6LA 4UQDA 3QF0A 1NARA 4EE9A 2PDWA 4HGXA 1FRBA 1GYLA 3BLFA 3QZ6A 5GQBA 2XISA 3DYMA 2GDVA 2B81A 2Y85A 2BBFA 2E8YA 4RE4A 2V3FA 2AL2B 2TYSA 3WNMA 1ZJIA 4A8IA 1FWEC 4PUEA 3IAQA 1EX1A 1R46A 4Z2KA 1A4MA 3H2EA 3RU6A 4JTGA 4MFDA 4WK9A 1UR4A 1UD6A 5AZ1A 3C0SA 1VFSA 5FD0A 4F0KA 1AZ2A 3HMJG 1L9WA 1KB3A 1DL3A 2F8QA 4HHLA 4JEJA 1XL9A 1ZNNA 3OZYA 4I9JA 1XYCA 2WSYA 1OWQA 3OHMB 3S6OA 2PLJA 3IGSA 3AHXA