1EB3A

Yeast 5-aminolaevulinic acid dehydratase 4,7-dioxosebacic acid complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Two Diacid Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
total genus 122
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1eb3A00
1SO6A 2B0MA 3SFKA 3PB2A 3KVKA 4DF2A 2Y85A 5HQEA 4NUWA 5AYXA 1LRQA 4H3DA 4JDBA 2Y61A 3LCLA 2Y88A 2VXNA 3TR2A 1TQJA 4D2JA 5FEPA 3PG8A 1M7PA 1T8XA 3LHTA 3CIXA 4FNTA 3TCEA 3NQ8A 4NJGA 3W85A 3W1NA 3WK1A 2ZZ3A 3THAA 3TK7A 4DPPA 3BW3A 1CI1A 1MEHA 4AHOA 4IXHA 3EWXA 2FB2A 5D30A 4HHPA 3QSTA 3BPWA 3LGEA 2V2DA 2H6RA 4LRTA 4WOZA 4PFMA 5K3VA 4QISA 3M0ZA 1FCUA 1SO4A 3DFSA 4MYXA 1YXCA 4DO6A 3S1WA 1H62A 5D03A 5KINA 2PRMA 1QPQA 4HN4A 4AWUA 3NL6A 3EWYA 1FWNA 1YYAA 3FJ6A 2P1FA 4UTKA 5HULA 3B03A 2DZPA 3U8GA 2RDTA 4GXMA 4NZJA 2J24A 3MHUA 1YDNA 2E09A 1GG1A 3TMQA 4PTNA 3HOJA 2BWGA 4UFJA 3PS7A 2JKEA 2NX1A 2GQAA 2QDGA 4GUHA 1LOQA 1FDJA 4UFLA 3WJYA 1EP3A 2UV8G 4IXXA 5LSMA 1GT8A 1X1OA 4Y9AA 1VYPX 3HG2A 1I2PA 4DQWA 3M6YA 1YTDA 3GVGA 4BR1A 3C4UA 2AQWA 3MI3A 1PCKA 1D9EA 3CWOX 3MBFA 1K7EA 3HPXA 4DBEA 1OYBA 4MZ1A 1W5MA 3L0NA 3LERA 3LLDA 3W74A 4EOUA 3ABQA 5D2YA 1XDLA 3W7GA 3M5XA 5CG7A 2WJZA 3N9RA 2JGQA 1QPRA 3IIOA 1QPNA 1X8FA 4FX8A 3TXZA 4UFHA 1WXJA 4EF9A 3G1DA 2CZEA 3C3NA 1FBAA 1PHQA 3DHFA 1TRIA 1VCVA 3SJ3A 5D2TA 3GDMA 4X22A 3CM4A 3NPVA 3ZFHA 5AC7A 2OT0A 3ABRA 1YPIA 1M6JA 4ADTA 4P61A 1TPVA 5HR7A 1F2JA 4N9EA 2VEPA 1A53A 1PCWA 3DBPA 5DBUA 3L21A 4LRSA 1G67A 4MKNA 1C8VA 3USBA 1FCVA 3S1UA 3OEXA 3W1PA 4UTWC 4Y96A 4AHQA 5IBXC 4GUJA 4FNRA 4GUGA 3E49A 2QUTA 1LM1A 5C2XA 2YW3A 5FEXA 3UD6A 4E2DA 2NUYA 3QMRA 3T40A 1W56A 4RZ6A 3LI1A 4IQLA 1ADOA 1YTEA 4A22A 2VFEA 2VFIA 2GUUA 1LZOA 2DZSA 2J88A 2TMDA 3E9AA 4UTIA 1LBLA 3BG9A 1YTKA 1TPUA 3QEZA 4M5PA 3GXPA 2YW4A 2G96A 1W31A 3HGSA 1HUVA 3TE9A 3UWWA 3LB0A 3LBCA 4N9DA 1S5WA 4OV9A 1WA3A 3W6YA 2QDHA 2CLMA 4HNUA 2YDAA 2QCFA 2YYTA 2ABAA 4MY9A 4RLIA 3W1RA 3HPZA 4Q32A 3UPWA 1DHPA 2ATMA 1G4TA 2ISSA 1OVDA 3CWNA 3P8IA 1KM0A 4DBDA 1SSGA 3O6DA 3WK3A 1I45A 1LLWA 2PRHA 3F03K 1VYRA 3LXAA 2QCMA 2RFGA 3FEMA 4ADSA 3TDFA 3UWYA 3UNDA 2JK2A 3NQEA 2Q8LA 3FFSA 4WOQA 2VC6A 3BLIA 4O50A 4OQVA 4QQ3A 4BK9A 1PE1A 3G3DA 2QAFA 2H3DA 4LVFA 3W70A 4WD0A 1H51A 4A2SA 2CLOA 4M7TA 1AG1O 4O10A 1SW7A 2FIQA 5FESA 5U7SA 1G7VA 5CPOA 2QAPA 5G4EA 5E0KA 1A50A 3M47A 4LW7A 4Y6GA 3TX9A 4M6QA 3HG5A 5DXYA 1HG3A 3BGJA 3G0UA 1JRBA 4MJZA 1R47A 1TO3A 3W7NA 3M1ZA 3CC1A 1UCWA 4FHAA 3FIGA 2GVLA 1EIXA 3GZ3A 4GJ1A 1B4KA 3CQ0A 3RK8A 3M41A 1F73A 1VHCA 3A24A 1XUUA 1I4NA 3HIJA 2X2GA 4JTJA 3S42A 2A85A 3INPA 2J27A 5D33A 1EWEA 3W73A 1ZALA 2ZDRA 1FX6A 1X6UA 3GX9A 1W5OA 5KITA 3MJYA 3GR8A 4IJBA 1LRTA 3NOEA 2Y63A 4UTMA 3W7CA 3NVTA 2ZZ5A 1UBSA 4UMBA 3STEA 5LKYA 3I7SA 1GPWA 5AB3A 2WQPA 4BI7A 2NV1A 5BOOA 5AOUA 3C0JA 1TIMA 2DJXA 4YMZA 2VEKA 2C13A 3STGA 3BLEA 3KOFA 3RU6A 4N4PA 1QWGA 3IGXA 4IGHA 1X7FA 2Q8ZA 2CW6A 3WFAA 3M5YA 3RLVA 1QOPA 3PY2A 4JNMA 2ZYFA 2TYSA 1EWDA 4TX9A 1O60A 4OHQA 5BMWA 1WDWA 2F7FA 5F2GA 2BTMA 4C1KA 4DO4A 3HGRA 1LRNA 3STCA 1OYCA 1K8YA 5FI8A 4ALDA 1S3HA 3EEGA 2CWNA 1K8ZA 1HO4A 4QAIA 4J9JA 5CGQA 2V2HA 4K8HA 3EWUA 3LHYA 3QZEA 4CQ8A 2IQTA 3QW3A 1JRCA 2V0TA 1T99A 3IV3A 4MPQA 3T55A 5G4WA 2X1UA 1ICSA 4JXCA 5G5IA 4G1KA 1DVJA 5AHIA 5HWJA 2DZUA 3NM1A 4MFEA 2I9EA 4LS2A 4LU0A 3IGUA 1J2WA 1YADA 4AF0B 5KZMA 5SWUA 2J9XA 2Z0IA 4WY0B 3N19B 4IOTA 3EX1A 5K4XA 2CZ5A 1GVRA 3KFTA 3KVJA 3N9SA 5FEWA 3EXSA 3HPSA 3TJLA 4MLRA 4E38A 4O4WA 3VCRA 2V2CA 1KTBA 3G8EA 3LRLA 3TFCA 1OFAA 1KM2A 3P62A 3IRDA 2WKJA 2R91A 1F76A 3O05A 4WXYA 4S2CA 1DV7A 5EMUA 1PL9A 4BF9A 3EKLA 2Y6ZA 3C2OA 2V5LA 4EF8A 3DFPA 1H7OA 3DGRA 2W6RA 4TMCA 2Y7FA 1HO1A 3B06A 3U6WA 3PBYA 2B7QA 1B9BA 1JCJA 3C6CA 5AFDA 2A6LA 1RZMA 2B7NA 3W7DA 1K7XA 1RPXA 1H7RA 3M9YA 3SW6A 3N34A 1HFBA 1YLVA 3WJWA 1VZWA 3W76A 3TKFA 4BI6A 1SSDA 1SZEA 5C5YA 1K02A 4ADUA 1XKYA 4NU7A 1R2SA 4AMAA 4M6PA 4RZ5A 4Q33A 5TQLA 2O7SA 1BTMA 1GG0A 4DPQA 4JTKA 4CQAA 3UQNA 2CZFA 4JTLA 4O57A 2C18A 1EPXA 5F4WA 3HBLA 3GKAA 3O15A 2CZDA 5LNWA 2YR1A 4X9SA 2FTPA 5GVJA 2YCEA 4ZQNA 2FB3A 4LV4A 4NJKA 4KFNA 4N2YA 1D3HA 3GNDA 4EIVA 4HKPA 3CEPA 1OFEA 4XKYB 4XTDA 5K9CA 4PODA 5EL1A 4AVFA 4FX6M 3NG3A 3DZ1A 2ZTJA 1G4PA 3P60A 5C6MA 5DLCA 1GVSA 4AAJA 1VPXA 3GDRA 1NAL1 2EHHA 1LOLA 1SUXA 3MHGA 5KMYA 4OU1A 2ZQ0A 3LCHA 4NJHA 3UY8A 4BI5A 2H8XA 3JR2A 3T7VA 4C1LA 3MWAA 2YPIA 1U5JA 1PVNA 3D0CA 4LY8A 4ICNA 2ZA3A 5KSWA 4QM1A 1TPWA 3E96A 5HJLA 1KTCA 3PSWA 4IX2A 3UPBA 2E5CA 2NLIA 1KTNA 4HPXA 5IM51 4MY8A 3BW2A 2FDSA 4JY9A 4DF0A 5F2IA 2HS8A 3A21A 4OBTA 8TIMA 4UTUA 1K7FA 1RQHA 2VKZG 3MYOA 1H7NA 4LV9A 5LNSA 2WNNA 3I6RA 3TV8A 3P7YA 4GE8A 1ICQA 2A6NA 3W7RA 3G8RA 2CLFA 3HF3A 3G3MA 4QJ1A 4UFMA 5DCDA 3TQ0A 1TREA 4IUOA 1XXXA 3S5NA 1P1XA 3LHWA 1G69A 3L5LA 5HINA 1SO3A 1QCWA 4PC8A 3NQVA 5AYYA 2PURA 5I3FA 5HR6A 2VOMA 4JX5A 3L66A 5DN1A 3LCIA 4KFPA 4N4QA 3A5VA 2I1OA 4ZQPA 2GQ9A 1JUBA 2A0NA 1VGAA 1KV5A 2VELA 3JS3A 3QPYA 1W0MA 1GVFA 4JICA 1K8XA 5FF2A 3EX2A 3G18A 1QOQA 4O4VA 1IIGA 4U4MA 5DBTA 2NX3A 4O17A 4CNPA 1VC4A 1TV8A 4O1DA 1EUNA 4AHPA 3NDOA 3PULA 2VFGA 2YFOA 1XBXA 3IIVA 3TQKA 3QQ0A 2NV2A 4HT3A 3W72A 2NUXA 5AHNA 4O11A 1Q6OA 1JQXA 3KHJA 2EAWA 2V5BA 5J5DA 1SO5A 1TQXA 4RCXA 1SR9A 3O6YX 3OVPA 4WZHA 2ZZ6A 3M7WA 3THQA 3F1QA 3M16A 1TPFA 4AEOA 5F4XA 5I3HA 2TRSA 4N9CA 1KLZA 1F7BA 3BARA 3VI2A 4EWND 3UZ5A 1JULA 2NUWA 3IIZA 4XBSA 1IGSA 1DJQA 1C29A 1UUOA 4JD4A 5I3KA 1TPEA 1FWSA 1YXDA 3TXVA 4MFDA 2BSLA 2E6YA 2VFFA 3N3MA 3F4NA 2E77A 4AXKA 2G5WA 2NX9A 1ZNNA 2V30A 5FF0A 3B8DA 4JX6A 3IIXA 3PSVA 4AWTA 1QPOA 2B7PA 3EB2A 4K38A 1NSJA 4LS0A 3LCXA 3TMLA 2HMCA 1OFPA 4UMAA 4JIQA 3W23A 4JYEA 4ZMGA 3BV4A 1AL7A 2EPHA 1QDSA 2Y7EA 3S6DA 4BWLA 1GTHA 2ZRVA 1AW1A 1GEQA 4A29A 3NQCA 3G1XA 1R2RA 1B57A 3FOKA 4JR5A 1EP1A 4YCPA 3FA5A 3G24A 1B3OA 3ATZA 3MO7A 1AMKA 4AWSA 3LHVA 1OX4A 4CCEA 1X1ZA 4Z0JA 4O13A 4K7YA 1W3TA 3EWBX 1RQBA 2RKXA 4UUIA 5I3JA 3PM6A 3HGOA 4ORIA 5F1VA 2ATSA 4RK8A 4NQ1A 2WNQA 1IIHA 1MEWA 1H61A 1DKWA 2CLHA 2TPSA 1G4EA 1TTPA 1Z42A 4GFSA 4GRSA 1OX6A 3W7OA 3ATYA 1XC4A 2QCDA 3MP4A 4UCGA 5C55A 3G22A 1SW3A 1PHWA 3NL3A 1Z48A 1MSSA 4CLMA 1F6KA 4NZFA 1L6YA 2Q3RA 2HS6A 3QMSA 3LTSA 5LNVA 2ZCGA 1IXNA 1WX0A 3NNTA 1TCDA 3TW7A 4NT0A 3TSDA 4DO5A 3NZ1A 3RMJA 2Z1BA 2ISWA 4CCDA 1TPC1 4NX0A 1ZY9A 3HB9A 4R53A 3M43A 4UFIA 3LBMA 1GVOA 1M7OA 3HQ1A 3SIZA 5AC6A 3HJZA 4TO8A 2DU2A 3AJXA 3G0SA 2WSRA 4ML9A 3OVRA 5CSSA 2E5BA 2R8WA 2CLIA 1A5CA 5DXXA 4FNUA 4GNJA 4O16A 4UR8A 4PA8A 2ZRUA 2J9YA 3OBKA 2R14A 1P5BA 5CZJA 5E93A 1AL8A 4LVBA 4JTSA 2C19A 3LV6A 1SZGA 1MZHA 3R5EA 2FQIA 1Q3NA 3E02A 3FYOA 4MYAA 3LHUA 1E51A 4UXDA 1WYIA 3C8FA 3NXFA 3IEBA 5D2XA 4XTIA 4CNNA 1FY6A 1XDMA 4N6EA 1G7UA 4NNCA 3TNOA 4Z1BA 1I2NA 3FKKA 1N7KA 3W22A 1H7XA 1Q45A 2DJLA 4LNYA 3VNDA 2OCZA 1TTQA 4UFKA 3B4UA 2CLKA 4MZ8A 2DORA 5AHLA 5D05A 1VHNA 1ZJIA 2C1HA 2GOUA 2I14A 5LNRA 1N55A 5H91A 1R30A 3DFOA 4O0KA 5F4SA 1JCYA 1QR7A 1VJIA 5CSRA 2WOQA 2FLIA 3O06A 3TROA 2YXGA 3RFAA 1THFD 2G97A 3GB6A 1H7PA 3Q94A 1KA9F 4MVAA 3NQ6A 4IMFA 2E6FA 4LVDA 2DZWA 1OF8A 4LTSA 1W5NA 3LHZA 2GQ8A 3NYZA 1UASA 5D37A 3C2FA 3MP5A 5LNUA 1TV7A 3DU0A 1EB3A 2Y7GA 3CEUA 1A5AA 3W2MA 4O28A 5DCEA 1TMHA 2BLEA 3TAOA 1TB3A 4A2RA 3TU9A 4NJIA 4BFAA 3H54A 2WNZA 5T26A 3M5ZA 2C3ZA 4XUGA 1LORA 3V1PA 1WV2A 1H50A 4Z1DA 4LUJA 3TC7A 1FUYA 2CLEA 1SFJA 2OT1A 2WPBA 4ZVJA 1ME7A 2V81A 2J6XA 3GR7A 4FF7A 5EPDA 3LCFA 1KLYA 4UTWA 1ZENA 3NPXA 1CX9A 3LI0A 2A1YA 5IBXA 2VFHA 4K36A 4O1CA 3ANYA 2ZTKA 3W83A 4WXZA 5A5WA 3IVSA 1XI3A 4LWWA 4Z0SA 4PL1A 1P4CA 1C9DA 3PUEA 4QSHA 5AHEA 3W7HA 3P81A 4N6FA 2WO5A 3ELFA 2NXIA 1QO2A 3UZJA 2FJKA 1BKSA 4RXFA 4OT7A 1T96A 5DCBA 4A3UA 2WSYA 1IF2A 3CIWA 5FEZA 4DXVA 4I7WA 5KZDA 3H53A 3VFLA 1JUEA 1OYAA 1KM4A 2NXHA 1FDYA 3PWAA 4HIBA 3MW7A 1LYXA 2HSAA 1L6WA 2AAMA 4RR4A 3C52A 3TSBA 2V82A 1FXQA 4FB7A 3T78A 3TUUA 1W3IA 4UTTC 3PF3A 2E5DA 1A5SA 1JJKA 3W84A 3SR7A 3W7MA 2XN0A 1W3NA 1LBFA 1ZFJA 4MLJA 4WX2A 3SECA 1H60A 1BWLA 2VEIA 1JCNA 2PE4A 1AW2A 5LGZA 3A23A 3NEVA 4FXRA 2Z6IA 2Y70A 1YDOA 4YLWA 5J5RA 1R46A 5KZEA 4POCA 1D3GA 2W0UA 3UWVA 1O5KA 3UWQA 3NR0A 4WUIA 4KWWA 1I2QA 3LOTA 3IIPA 3IVTA 2YSWA 4ZQMA 3MUXA 4JY8A 3QMTA 2DZXA 1KFLA 3W07A 3KVMA 4O52A 1EX5A 1KFBA 1DJNA 2ZBTA 2A7RA 2KZHA 5K9XA 2ZFAA 2P0OA 3AO0A 3EKZA 1OK6A 3N2MA 1RQEA 3DFNA 1F5ZA 4JIPA 3LV5A 1LP6A 1O94A 3UY7A 3W1QA 2OJPA 2ALDA 4XQ6A 1IXQA 1ZAHA 4N9BA 1J5TA 3KRUA 4TU1A 2QKFA 4IMGA 3LCWA 3OIXA 3GK0A 5G2WA 3SGZA 1GZGA 2F84A 3S5OA 4QNWA 4Y8FA 5FF4A 3A9IA 1LTDA 2QCLA 1H7WA 4JS3A 2G95A 1GTEA 3FLUA 4FX7A 5DY3A 4FO4A 3W7IA 3Q37A 4TR9A 1ME9A 1G4SA 1A5BA 3LRMA 3O07A 3UXDA 5KTLA 5D38A 2JGYA 3MI6A 5EYWA 4FNQA 3C56A 3L67A 3UYCA 3SY5A 4K6AA 4M19A 4YCOA 3VE9A 3DI0A 2J9ZA 4LC6A 3G0XA 4UTHA 1XM3A 2HTMA 3SI9A 4UMCA 1OX5A 2C16A 3B04A 1AW5A 2Y7DA 3LXBA 5HWNA 3W2KA 3OG3A 4O1BA 2RH9A 2YZRA 4FIRA 1DBTA 2B4GA 3PG9A 4JTUA 3PAJA 1RR2A 3KX6A 3L5AA 3B05A 4O8RA 4UNLA 3GKFA 4IPJA 3UXAA 3LRKA 1JVNA 3RLUA 3W9ZA 1VCFA 4JN6A 5L9FA 5D02A 3PBUA 4IWWA 3O16A 1SQ7A 1LCOA 3NPUA 1ZAIA 1IXPA 1Z41A 4MOZA 1FCBA 3W7LA 1KM5A 3FKRA 3MMTA 3O1NA 1OFQA 1MEIA 3FJLA 4NXKA 3W7QA 6ALDA 2FPVA 4MUZA 5G1YA 4XWUA 1EP2A 2P10A 3E12A 3R13A 4O0ZA 4AH7A 1XFBA 4JGDA 1Z44A 5EY5A 3Q58A 4E2BA 3I7RA 1NEYA 1O95A 2QUVA 3EXTA 2NXGA 4U28A 2GVGA 4Q4KA 2A7NA 4RV8A 1HL2A 3TSMA 5K4ZA 3B0UX 3I7QA 2NZLA 3NL2A 2QUUA 5AHFA 2GJNA 2NWSA 4S1FA 2X16A 2A5HA 5K7JA 3PUDA 6TIMA 1WBHA 4I9AA 2EKCA 3S1VA 4NNBA 2Q3OA 1KV8A 3BK0A 5F1UA 4ONVA 1VR6A 5I3IA 5L6UA 1GYLA 3GNNA 3TW6A 5CZTA 1OFBA 1O4UA 3Q2DA 3G1VA 3BG3A 4I7VA 1BEUA 4JYFA 7TIMA 1OJXA 1ZHAA 1G6CA 2RDUA 3TFXA 2ZRYA 4M7SA 4P2VA 2A4AA 1Y0EA 5I3GA 3W7EA 3G1SA 4LT9A 2ZRZA 3NQAA 2EGZA 3NAVA 3WK0A 3HMJG 3U2OA 1B4EA 4JEQA 4GUIA 3QPZA 3DFQA 3ZR4A 4IMCA 1SZFA 5G2HA 1XBVA 4ZL1A 3BW4A 4LOCA 3L2IA 1JCLA 1XBYA 3R89A 3TA6A 4GWEA 3HG3A 3LX9A 1H1YA 3L65A 3MI2A 4NNAA 2W79A 1XBZA 3DKLA 1XCFA 3CLMA 2A2IA 3KRSA 4UC5A 1H5YA 3GAYA 1TPB1 4GUFA 5D2WA 3C2RA 5HUOA 3EXRA 1TJRA 1OHLA 4H6KA 1XL9A 2QCCA 3PVFA 4E0CA 4LC8A 4HNVA 3QFEA 1KM1A 3SZ8A 2FPYA 5F2LA 3SSJA 5D04C 1P0NA 4IMEA 4H4IA 4HSNA 1GVQA 3GDTA 3N73A 1NVMA 3F4WA 1OF6A 3NZRA 3PUOA 1Q6QA 4MY1A 1TJPA 4O19A 2D73A 4WJEA 2OMAA 1J4EA 3LXCA 5BNKA 4UTJA 4PH6A 2ZRWA 1TSIA 3NM3A 5MHBA 4PL2A 1SFLA 4RZ4A 1NF7A 2WSQA 4TMBA 3PR2A 3M44A 3KRZA 3A22A 3PC0A 1AK5A 5D2VA 1SPQA 3CPRA 3STFA 1EA0A 2H3BA 3BO9A 3NA8A 4DEFA 3ABOA 5LGXA 4LUIA 3MBDA 1QFEA 5U4NA 2V8ZA 3W1TA 1FWRA 1R2TA 1NF0A 5BW6A 1SW0A 3CT7A 3P67A 1W37A 5HNRA 2QJGA 3C2EA 2ZA1A 1Q6RA 2YGYA 1L2UA 1K3UA 3W86A 3V75A 4R34A 3I65A 1DOSA 3W1XA 4RXGA 1UUMA 3S5ZA 3GLCA 1DQWA 1YXYA 4IMDA 2ZA2A 3YPIA 2V9DA 5A8GA 1GYNA 3QW4B 1FQ0A 1ICPA 1TV5A 5EKYA 3H55A 3LTPA 5CKSA 3P82A 3N2XA 1OFDA 3LM7A 4O1AA 2QCNA 3GDLA 3W1LA 2QJIA 3W2LA 2EF9A 1TTJA 1YPFA 1WQ5A 3O63A 3TH6A 4X3ZA 3BLFA 5TBOA 2TSYA 1LOSA 1FDZA 2ZZ7A 3P84A 3OVQA 1QMLA 2RDWA 1KW1A 5AYZA 3T4CA 2YX0A 2X1TA 3A5FA 1W54A 4QIUA 3QQ1A 2B7OA 1IXOA 4UIOA 1V7YA 4Y90A 2ZRXA 3EWWA 3NQFA 2E6DA 2Y89A 5AC8A 3RNDA 1OG0A 3VKJA 4O12A 1OFOA 2NWRA 1FWWA 2YFNA 2LLEA 5G1TA 1QNVA 3S1XA 4DELA 1I8JA 3PBVA 3DKJA 3G1FA 2CU0A 3GYEA 4JTGA 4B5NA 1W8SA 1DL3A 3O6CA 3WJSA 5K9DA 3W2JA 1KM3A 4IX0A 4KWVA 3NQMA 1LROA 3JRKA 1UB3A 4UNKA 3BVJA 3MHFA 1VQTA 4JTTA 3QC3A 2C0AA 4R33A 4ZQCA 3P80A 2Z6JA 1KBJA 4ZQRA 3L68A 1OX4B 1VRDA 2QF7A 2QJHA 1JCXA 1H1ZA 4O54A 4DF1A 4JTEA 1DQXA 3GAKA 2C6QA 4CCCA 3GIYA 2BX7A 3W1MA 4Z1AA 1OABA 3QH2A 1YDVA 1I2RA 4GC4A 2DZTA 2QCDB 3QM3A 3CHVA 4JTIA 4JTFA 3DENA 4L4LA 3P5YA 1S5VA 3EX4A 2C15A 1Q6LA 4AF0A 4WY0A 2BZNA 2ZZ4A 1GOXA 2XFWA 3LLFA 2PCQA 1KBIA 3C61A 4A21A 4O15A 3EX3A 3DAQA 2GVJA 4X2RA 1KFKA 1MO0A 3E0IA 4S2BA 2ISVA 3NGJA 3NQ7A 1FWTA 3P61A 2JKAA 3K30A 3P5ZA 1TTIA 1JUKA 1OK4A 3CU2A 4FNPA 5CPNA 1KFJA 2DZVA 1U83A 4AB4A 1S5TA 2DP3A 2H90A 4K39A 2VFDA 4CQ9A 1PIIA 5HWMA 4QNEA 1BWKA 4LVAA 4OGZA 4HPJA 3W7KA 3MP3A 4QITA 4WQ6A 3GXNA 1P0KA 4O53A 4LVGA 3G1YA 2E68A 3VE7A 1MXSA 4R7JA 4ORMA 3CTLA 4FNSA 4HSOA 5FF7A 3HGJA 3HO8A 2Z2UA 3WJZA 1F05A 1VYSX 5LHFA 5EA9A 4MZYA 5D09A 5G2IA 2BXVA 3RF9A 3BGGA 3N14A 4CNOA 3HG4A 1W5QA 1RV8A 3P74A 4WY0F 5CPMA 5AHMA 3NL5A 3QYQA 4N02A 3W88A 4MIMA 2OZ0A 4UTLA 1ZCOA 1SZNA 4RJEA 4YXGA 1L6SA 2JKPA 2GPTA 3EWZA 1F6PA 3TAKA 3NQ2A 1EEPA 1K03A 1LLZA 3C2VA 4XBKA 3TQVA 3QF0A 2FFCA 2GJLA 3DH7A 2QCGA 3LCGA 4K7VA 4UR7A 5DY2A 5HUPA 3L9CA 3O8AA 2AGKA 3IGSA 4XKYA 3W2NA 4NXSA 1NFBA 4L4MA 5D32A 3W87A 1JQVA 3FS2A 2JBMA 2YYUA 3OHIA 3S9YA 1ME8A 5FF3A 2VENA 2XN1A 4OWGA 2OX1A 3S8HA 5AN7A 3NQDA 3QSRA 4TIMA 5LHEA 1L9WA 5F2MA 4O14A 5TIMA 3DHDA 5CZSA 1O5XA 3W7PA 2E6AA 4OE7A 5K2ZA 4W9TA 4HNNA 1ZAJA 1TYGA 3ZWSA 1GJPA 5LZLA 2C14A 4YWIA 1JR1A 4K8EA 3B0VC 1F74A 2QEZA 3FYPA 4LS1A 4HNTA 1W1ZA 3NO5A 4KFOA 5EBUA 4OV4A 3UWUA 1I2OA 1ONRA 1GQNA 3W3OA 5C54A 4JDYA 3G1AA 3I68A 4FEZA 3W1UA 5ABTA 1TPH1 3R2GA 3W1AA 2QCEA 3DXIA 4FIQA 1M5WA 3ZS4A 3PB0A 3P8JA 3LDVA 3S5YA 1VS1A 4RKAA 3CB8A 2R94A 4EVZA 1FXPA 4I7UA 1RD5A 5BRBA 1HTIA 5DELA 3T44A 1WBJA 4NX5A 3R8RA 5H2ZA 3TIMA 2A7PA 3WJXA 5BMXA 1N8FA 1VCGA 3QJAA 1QAPA 2FPTA 2XN2A 1EUAA 4ZZ9A 2CLLA 3EX6A 4JYDA 1OFRA 4MJMA 3TC6A 1H63A 2PC4A 1TPDA 3BG5A 1PS9A 2RHGA 4Z08A 3KAOA 2O7QA 1T0OA 2QCHA 4RX0A 1UJPA 2ZZ1A 4M6VA 3S0CA 2ABBA 1PV8A 3G1HA 3R12A 4JX4A 3W7JA 3WK2A 1QO5A 3L0KA 3M5VA 4XZ9A 4PEKA 1DORA 1SU5A 3MYPA 3ABSA 1VLWA 3ZWTA 2X1SA 1CW2A 3NQGA 3LTYA 2X1RA 3OA3A 2E1DA 1W5PA 3QRHA 1TRDA 1RVGA 2CFFA 4PCFA 3KXQA 3L0GA 1ML1A 1WAUA 4JTHA 5HMSA 3TJXA 1VLIA 4KKXA 2VEMA 2Y62A 1VH7A 1KFCA 5E1QA 1JCMP 1KM6A 4Z1CA 4K37A 4UTTA 4YL2A 1KFEA 1ALDA 4IPIA 4BWLC 3W71A 2H8ZA 3GXTA 3IVUA 5CZ0A 1WOBA 1LBMA 3GDKA 1XUZA 4FXSA 3L5MA 3DFTA 3SGUA 4ZQOA 3UWZA 2QR6A 1LDCA 4NVTA 2WV8A 3NPWA 3DI1A 1WOAA 1GWJA 2PRLA 3W2UA 4O18A 1V5XA 5CPLA 2ZZ2A 3KVLA 3PBWA 4GBUA 4NJJA 2X30A 3B0PA 3W75A 1FCQA 2A21A
chains in the Genus database with same CATH superfamily
1NOFA 3W82A 3SFKA 1M03A 3IS4A 2Y85A 3FAWA 3CMGA 1JDFA 2Q6ZA 2R1NA 4JDBA 2Y61A 1POJA 4XZHA 3SIMA 3TR2A 4Y9MA 4X9YA 1M7PA 3CK5A 1F4HA 4NJGA 4OIFA 4GCAA 3WK1A 4ZA0A 3MB9A 4Q6JA 4DPPA 5PTDA 3MZ2A 2F61A 1KNWA 5HAOA 3B3DA 2FB2A 1TCMA 3UG5A 4OUEA 4AQLA 3RR1A 3LGEA 2V2DA 4FAMA 3MPGA 4GPNA 1EOMA 4D6IA 3IUIA 3ZIZA 3S1WA 1H62A 2E40A 4H9MA 3QOKA 4UTKA 3VPLA 4JN8A 3OG2A 4XISA 4GXMA 4NZJA 3CHDA 3MHUA 1A5NC 1GJWA 3KWSA 3M07A 1VPYA 4PTNA 5LYRA 3PS7A 4GUHA 4UFLA 4IXXA 3OLDA 2VDGA 4Y9AA 1UA7A 4DQWA 4BR1A 2AQWA 3MI3A 1PCKA 2ZXAA 3MBFA 1K7EA 5BROA 1Q4WA 1E9ZB 4DBEA 4MZ1A 4W93A 1W5MA 2ZX6A 4MM1A 3LLDA 3DC0A 3W7GA 1VF8A 3M5XA 3QR1A 3IGHX 3N9RA 4DJDA 5KEZA 4GBDA 4XO6A 1QPNA 3LBOA 3ORWA 4IIFA 2YA2A 3S1GA 3VCCA 4A8LA 2IS7A 3N4EA 2QDDA 1PHQA 1ZBWA 1VCVA 1UC4A 1RK5A 4X22A 3CM4A 4CQDA 4QG6A 1FVPA 2OT0A 1YPIA 1JFHA 3CL8A 3NZPA 1F2JA 4N9EA 4ZEPA 1OEPA 2GDQA 4XIMA 1R3SA 4LRSA 1PSCA 1G67A 4XD3A 5D8WA 1WDRA 4B5VA 3BQ5A 5JQ9A 4MKNA 1C8VA 3USBA 3S1UA 4MNLA 2V67A 4MNMA 4E4UA 4AHQA 4GUJA 3OHMB 5EMYA 1OGBA 2QXWA 5FEXA 1TWDA 3FGCB 4AX7A 3W37A 3QMRA 4GY0A 4WKFA 2GFTA 4UOJA 1YDYA 3VGGA 2GUUA 3V5CA 1W9VA 1BQGA 2J88A 1LBLA 8CGTA 3JZUA 3R4IA 3DYMA 3FJ4A 1TPUA 2XH0A 3GXPA 3V5FA 2YW4A 1W31A 3C0SA 3HGSA 3OW1A 3TE9A 4HTYA 3LB0A 3LBCA 1IZCA 2XM1A 4NZ3A 4MHBA 2PDLA 1S5WA 3GUWA 4IIEA 1TR1A 4OV9A 5E6ZA 4IUGA 4Q8WA 3WF0A 3TW9A 4F40A 2YDAA 2QCFA 4RLIA 3URAA 2WVSA 4Q32A 1DHPA 4KEUA 3S2MA 4CD8A 2ISSA 1QNPA 3DG7A 4US5A 1OVDA 1BVWA 1HJSA 4GK8A 5DMMA 3IJLA 1W1YA 1A3WA 1LLWA 4J3TA 4J3WA 3F03K 1VYRA 4D8ZA 4XVEA 1F3TA 1WP6A 1ZBVA 3C3UA 4L4OA 3MO4A 3OVGA 2W67A 4LNCA 5A69A 4WOQA 3BLIA 5G1MA 3AYRA 4QQ3A 3G3DA 3VCNA 2H3DA 1XSJA 3N6HA 4IL2A 2H9AB 1H0GA 1GVYA 1H51A 3QC0A 1AG1O 3SO7A 3TN3A 3S2CA 3E0WA 5U7SA 4Z2HA 1A50A 5GJPA 4Z42C 4O8AA 4M6QA 1XP3A 9XIMA 3G0UA 4MJZA 3W7NA 3M1ZA 1UCWA 3FIGA 5CPTA 1E6ZA 3GZ3A 3CQ0A 5HMEA 3S46A 1F73A 1ESWA 5I02A 4U10A 2OSXA 3RR4A 4B2DA 1FX6A 1X6UA 4HZ8A 3LPFA 3MJYA 1VEPA 1U1HA 3OGSA 3NOEA 2FHBA 2C1GA 3QKZA 4HCHA 3UP8A 4ZXLA 1RPKA 3BLPX 1XHGA 3AIBA 1UIPA 2L5HA 1UBSA 1DWIM 3V16A 5A6LA 4PMOA 3STEA 2GJXA 3NQBA 4I5RA 1V03A 4BI7A 2FTYA 5E0CA 5BOOA 3DG3A 5DEZA 1MW3A 1TIMA 4Q4MA 2OO6A 2DVUA 4KH2A 1PKLA 3M0MA 4IGHA 2CW6A 3WFAA 3M5YA 2DSKA 2ZYFA 1O60A 4OHQA 1WDWA 4M81A 3WX7A 2BTMA 3HGRA 5FI8A 4AY7A 1S3HA 1POKA 1WCGA 1ISZA 3BJSA 4HK6A 3ZLFA 4K8HA 1QNQA 2X1UA 3UYIA 1ICSA 1DVJA 4HNOA 2DZUA 2R82A 5D9PA 3NM1A 4DXKA 2C91A 2WSPA 3TYAA 1J2WA 4GOAA 4Q7IA 2FVMA 5KZMA 5SWUA 5JUVA 3QVQA 4KEZA 5BZAA 4PCNA 3EX1A 1EBGA 4HYWA 5K4XA 2ZE3A 2NVDA 2CZ5A 2UY3A 1G0CA 4DJEA 1V3IA 3AIRA 5E9AA 1K9DA 4HYVA 4O4WA 3BLOA 3DFHA 1GKPA 4YU1A 3TFCA 3P62A 2IKIA 3L4XA 1XH0A 1PL9A 3AMKA 5CC5A 1OCQA 3DFPA 2ZUTA 1CXFA 4PN2A 4PBFA 2W6RA 4QE5A 4GQGA 5GQBA 1UWQA 1PYMA 4F4RA 3LPOA 4BKNA 1PX8A 3WSUA 2B7NA 2AL2A 3TJIA 3K8MA 2PU0A 1H7RA 3N15A 3E0LA 2VX6A 3CQHA 3WJWA 4GY1A 1R85A 4GXWA 3W76A 2UZ9A 4BI6A 5C5YA 4DWSB 3IJ7A 4NU7A 5IXEA 1JI2A 4JL1A 3TOYA 2D3NA 1XF0A 3CMFA 4AMAA 3F5LA 1OCBA 3E0FA 2W62A 1E43A 5A6JA 2WYSA 3W00A 3BCFA 4TVCA 4HA0A 1AD1A 4O57A 2YCIX 4QLLA 4ZQNA 1UH3A 4KFNA 3GNDA 4HKPA 4XKYB 2INFA 3NG3A 1HN1A 1G4PA 1E0WA 5C6MA 3ZYZA 1GVSA 2CERA 2EHHA 1SUXA 3MHGA 3AXXA 1EJRC 3KLKA 4FPSA 4C1LA 3SY8A 2PDGA 3PJUA 4HU3A 4ZO6A 2XH4A 4WRHA 1TPWA 1LG2A 4E3VA 5EBAA 4CUCA 1TR9A 4NAEA 3BW2A 4H8HA 2I5GA 4AU0A 3KZSA 4L9YA 8TIMA 3UJEA 2YA1A 1BAGA 5LNSA 1BQCA 3EMCA 3MYOA 2WNNA 3I6RA 3DHUA 1R8LA 3MT1A 2NQJA 1ICQA 3W7RA 3PTQA 3KBJA 3EDEA 4HMNA 5EU9A 2YBUA 3ONBA 3NOYA 4UFMA 5DCDA 1GOWA 1I6NA 1P1XA 2BY0A 4S3GA 2CBUA 2AMXA 5HINA 1MFUA 1KKOA 4PC8A 4S3AA 1E56A 5AYYA 3VUSA 1WZMA 1HVXA 4AIOA 5FKYA 3SN0A 2GQ9A 2I17A 1F8MA 2A0NA 4GJJA 4Y9PA 4AVOA 1KV5A 1Y5VA 2B81A 1K8XA 3DCPA 4U5IA 3G77A 3VK5A 2PBGA 3H21A 1IT0A 1QOQA 4O4VA 1V0NA 5DBTA 2NX3A 4DZ5A 3L23A 1VC4A 2GLKA 1DJYA 4AHPA 3IIVA 1BYDA 4PUJA 3W72A 2BNJA 2G0WA 1QASA 1KFWA 4JFSA 5J5DA 1SO5A 4WZHA 3OVPA 2ZZ6A 3M7WA 3THQA 3V0UA 4B9YA 3WZ0E 3F1QA 2IKJA 1ZZMA 5F4XA 5I3HA 3IANA 3ISIX 2HXTA 5B80A 2NQZA 4EWND 3UZ5A 1JULA 3VOIA 1A0DA 4JIEA 1CXEA 1UUOA 3WDHA 2Z4GA 1P48A 2E6YA 2VFFA 4NI8A 4R27A 4LX4A 4H1ZA 2ONEA 3DFYA 3CUIA 4JX6A 1P7TA 1PTGA 1VAHA 5GNYA 4K38A 3CYJA 3LCXA 2VUNA 1QBAA 2HVNA 1FH7A 3BV4A 2EPHA 1W9PA 5H8UA 1QDSA 3I6EA 4HMEA 3SRDA 1GJUA 1GEQA 1B57A 3WLIA 1NIUA 4YCPA 3FA5A 1HJVA 1E40A 3ATZA 5FJJA 1AMKA 4IFRA 1OX4A 1QJWA 3RRXA 3ES7A 1W3TA 1RQBA 3ABXA 2P0IA 3R0UA 4ORIA 5F1VA 5CPSA 3MCNA 1MEWA 4ERGA 2IKGA 2CLHA 4PMJA 4NI3A 1LWIA 4GFSA 3B0YA 3APGA 1XC4A 3FN9A 1M01A 1SW3A 3NL3A 1MSSA 4MB1A 6TAAA 2FHFA 3WUBA 3CQIA 4YN5A 2HS6A 3CXOA 2HK1A 4B5SA 4HQVA 5LNVA 4GIAA 1W1A1 3NNTA 8XIAA 3VU2A 4NT0A 3AZTA 2NQ5A 3AUOA 3E5PA 4V15A 1EX1A 2Z1BA 5AC5A 2ISWA 1TWSA 4CCDA 4NX0A 1ZY9A 1A4LA 1W1B1 5C2CA 1S38A 4UFIA 4BQ3A 1GVOA 1E9YB 1IGWA 1RD6A 4E5TA 5AC6A 4ZOEA 3O2LA 2WSRA 3NYDA 1D8WA 4X63A 3LZ3A 2E5BA 2CLIA 1A5CA 3LPPA 4O16A 1RSCA 4PA8A 2A3EA 4X60A 3WH9A 1P5BA 4J7RA 3IJIA 5FACA 5E93A 4LVBA 2HEJA 3U7VA 1NY1A 2JIWA 3R5EA 2CHRA 2FQIA 1CT5A 3ITGA 2PBOA 3A4WA 4Y9OA 4XTIA 2BY1A 4NNCA 5M3WA 3TNOA 3WH5A 3LG3A 4E8GA 4UFKA 4DRSA 7CGTA 1LQ2A 1R7OA 4FLOA 1YIXA 1N55A 4B5UA 4MKVA 1R30A 4LBSA 1JCYA 1HKIA 3OZOA 4PSRA 1VJIA 3KBWA 2FLIA 3N3TA 3O06A 3M0XA 4LAMA 1FKXA 1B54A 1A3HA 2YXGA 1HJUA 3RFAA 1TFVA 4AZ5A 1AVAA 3WD1A 2DZWA 3PANA 1Q8AA 1W5NA 2WWDA 3LHZA 3NYZA 2A3CA 1A5AA 4O28A 4LYKA 2BLEA 4L1GA 4IQJA 2WVVA 3BAKA 3EOSA 4JN7A 2WNZA 5T26A 2WHKA 1ZP3A 1H50A 4EPKA 4Z1DA 4BZYA 2WPBA 1XYFA 2DZAA 4C91A 4XD4A 3A3WA 1ZENA 3JUGA 3LI0A 2J4GA 4KWUA 4B15A 1XG3A 4LFYA 3THDA 1JF5A 3C0QA 4ROQA 1UPPA 3BE7A 3ZZ1A 4NAFA 4AEEA 3AXIA 1C9DA 3OZMA 2EG7A 2NXIA 1EOKA 5CJNA 4Q8OA 3URBA 1BKSA 3WDQA 3GH4A 4RXFA 4QLKA 3NUKA 2HWGA 3Q45A 3HFTA 4EXAA 2A3AA 4BEUA 4LANA 3WD2A 4KCTA 3MW7A 5J04A 2HSAA 3C52A 1FXQA 1VBHA 3ITCA 3TUUA 3M6DA 1W3IA 2BB0A 4UTTC 2E5DA 1A5SA 1EGZA 3W84A 4B92A 1ZB5A 1K70A 4LUSB 3BZGA 3SECA 3VGEA 4J4KA 1FH8A 3GBEA 1TMQA 3NEVA 1E9IA 2IQDA 5BU9A 1M53A 1IR2A 4EANA 6REQB 1D3GA 4FLQA 3UWQA 4WUIA 5CSYA 1TZ7A 1IEIA 3LOTA 2CXGA 2QLYA 3WY1A 4CNSA 3QMTA 3CO8A 3W07A 1KKRA 4ZO9A 1ONEA 2ZFAA 1OK6A 3DHPA 1OZQA 1ECQA 1LP6A 3CH0A 1AZ1A 1QW8A 3FHAA 1O94A 4W7WA 3MKKA 3W24A 2WJEA 3GIPA 1IXQA 3OZYA 3GS6A 1OG6A 4TU1A 1BSIA 4IMGA 1WDQA 1PBGA 1BRLB 1XPYA 3OIXA 1E6NA 3ZMRA 4YHGA 3KP1A 1GZGA 1US0A 2ESCA 1UD4A 1LTDA 1H7WA 4JS3A 4V33A 4QTGA 2G95A 4UZSA 2FZDA 3IJQA 2E4TA 3H2MA 3W7IA 3E6EA 3MVTA 3Q37A 1X7IA 1TELA 3PFRA 1MUCA 4IPNB 5EYWA 3C56A 3AYVA 3SY5A 4K6AA 4CN4A 3K1DA 2V3EA 4YCOA 4X2PA 2J9ZA 4IQEA 3WQ6A 1E70M 3KCJA 2VCBA 1OX5A 3QFWA 3WLKX 2VRQA 5HWNA 3KBVA 3OZPA 1E1CB 3QBUA 4JIRA 3AISA 1DBTA 2BY3A 3ITYA 4GIRA 2R1PA 1BVZA 3VD4A 4YJ5A 1JPKA 4O8RA 2WKGA 4UNLA 3GKFA 3VIFA 2ZVRA 3UXAA 4ERAA 1UD6A 3AWNA 5L9FA 4DLMA 4S38A 3T2PA 2W4XA 4IHCA 4A8IA 1G94A 4GFIA 3FVDA 4E4PA 2GOKA 3FK4A 1M68A 4ACYA 1Z41A 2PMQA 4DJDC 2PWGA 1XRFA 4HK7A 3SCUA 4M0XA 3MMTA 3U7BA 2FTWA 4YIWA 3W7QA 2TAAA 3T8LA 1XCWA 2X2YA 4JKLA 3O6AA 4LYQA 1BGAA 1EP2A 3E12A 4LB4A 4FLRA 2OLAA 3UG4A 3B8WA 1ADDA 1I75A 3H2AA 5T8GA 3I7RA 3B9AA 4IG2B 2QUVA 2GVGA 4IMAA 1HL2A 5K4ZA 4PCSA 3NL2A 4ML4A 3RJYA 6TIMA 2EKCA 3S1VA 1E1EA 2Q3OA 4L4PA 4WCJA 1VR6A 3AHZA 5I3IA 3CAWA 3GNNA 4I9TA 1YQ2A 2BBFA 1OFBA 1XFCA 4QLJA 2Z7GA 1JZ8A 3AWOA 4LBRA 5JH1A 5TD4A 4M7SA 2VGIA 4Q4SA 5I09A 2WC4A 4LT9A 4NKCA 3APYA 3NQAA 3SUVA 1L8NA 1Z8AA 3U2OA 4GUIA 3DFQA 1KCKA 5G2HA 1HP5A 5ECVA 1CXLA 3UNTA 1FOBA 4ZL1A 3FGCA 3M0JA 4GYFA 4LOCA 3R89A 1Y8BA 4Z2JA 4GWEA 2QVNA 1Q6GA 3LX9A 4HOZA 3L65A 1XIBA 1CPUA 3I3BA 3MI2A 3FA3A 2EJAA 1CNVA 4W4QA 3CLMA 1UUQA 1DXFA 3NWRA 3GAYA 3R58A 1TPB1 4P7NA 1MUMA 2Z26A 1WDSA 4FK9A 4H6KA 1XL9A 2QCCA 3PVFA 5DMNA 2RGLA 4E0CA 3WQCA 5AYIA 4PUWA 4PMDA 1E4LA 2FPYA 1OT1A 4XAZA 3SSJA 2G37A 4IMEA 2D23A 2GUYA 4H4IA 4DAFA 3N73A 1OF6A 5A1AA 2RDXA 3WQFA 3PPHA 1RK6A 2PDHA 2CKRA 5MHBA 1NF7A 2J79A 3P6LA 5GNZA 3PC0A 1ITUA 1SPQA 2ACSA 4G8TA 1EA0A 3WBEA 1QW7A 3E5BA 3BO9A 3EPMA 4UQDA 1ONWA 4LUIA 3MBDA 1V02E 4AFYA 1W6TA 2H9AA 3CZ8A 4GO8A 1NF0A 3QZAA 4H04A 3AALA 1SW0A 2WBKA 3CT7A 3P67A 3MA8A 5BCAA 1CYGA 1Q6RA 2YGYA 1K3UA 3W86A 4CD5A 1XX1A 3RO8A 3I65A 3FDKA 4S3FA 4RXGA 3GLCA 1CB2A 1EJXC 1YXYA 4B16A 3CAKA 1IWBA 2IPFA 2V5KA 5A8GA 3SM0A 3QW4B 1TV5A 1ICPA 1BYCA 1SM9A 3APTA 2UY2A 3N2XA 1OFDA 3LM7A 2QCNA 1XGZA 3W1LA 2QJIA 4ICCX 3KHDA 4P7LA 1YPFA 3O63A 1ZJHA 2DY3A 4X3ZA 2HV5A 5TBOA 2TSYA 1LOSA 1WO2A 2GWNA 2WHJA 2V5JA 1KW1A 4ZO8A 1Z3NA 2E25A 5AYZA 4AD4A 2YDQA 1QBBA 1E73M 1IXOA 3ARZA 2EXOA 4Y90A 1CGXA 1OG0A 3H4XA 1M7JA 3ZR5A 1S5MA 1K9TA 4N42A 3UGRA 2WJFA 3LN3A 5HJYA 3G1FA 3FYYA 3UVAA 1W8SA 1DXEA 4KWVA 2WAGA 4UNKA 3G6MA 5LA2A 3UG8A 3K4DA 4JTTA 3VKAA 3P80A 1Q4NX 2Z6JA 2R1LA 1PZ1A 3HQNA 2WANA 2PPGA 1ITQA 1H1ZA 4O54A 3T0DA 4DJEC 1J79A 4YVXA 2ANUA 2DT1A 3KDNA 4GACA 4BQ5A 3ZR6A 1WUEA 3SUSA 1I2RA 5C7HA 2QV5A 1WB0A 5A6AA 2PD5A 2QCDB 3RIKA 3P0WA 2F6KA 1S5VA 5EMJA 3I3DA 4XSMA 3GUGA 3ES8A 4JEJA 3W6MA 2WK2A 1GOXA 2XFWA 1OBAA 1JPDX 1IWAA 1ZL1A 1F3WA 3EX3A 2DDXA 5HK4A 1XGDA 2GVJA 4X2RA 1MO0A 2BGNE 1FWTA 2OELA 1K9EA 4F0KA 3LNPA 1IWPA 3P5ZA 1GZ1A 3PNUA 4TX6A 1JUKA 5I0DA 1C9WA 5IFTA 1KFJA 5FCZA 1IEQA 2DZVA 1U83A 3SCOA 4AB4A 1S5TA 2XSXA 1A5LC 1T6MA 4JNYA 1R7AA 4CD4A 4G5DA 2X40A 3HJEA 4HPJA 1XIGA 1P0KA 3MU7A 3C2YA 4Y9NA 4C6EA 2GWGA 4TTGA 4GZ7A 3CTLA 5A94A 3SCNA 4P8XA 1JYVA 7REQB 5LHFA 3UCCA 2VUYA 4MZYA 2W63A 2V63A 4DWSA 3N14A 3EMZA 4WY0F 4MIMA 4AW7A 1XLBA 1L6SA 4IP7A 4L7ZA 4CQCA 2GPTA 3EWZA 1F6PA 3L12A 3NQ2A 4XBKA 2ZUWA 4F0SA 4K7VA 4UR7A 4XKYA 4R9XA 4XZNX 3UJRA 1NFBA 4AZGA 1JQVA 1K6AA 2XZ9A 3ZJ8A 1UWUA 2JBMA 2YYUA 2W61A 1QU4A 2C1IA 4PULA 4E2OA 1HJQA 2OX1A 3S8HA 3NQDA 1PZ3A 1E0TA 4TIMA 4C6MA 1L9WA 3S6TA 4WJ8A 1O5XA 3AS2A 5K2ZA 1Q63A 5H8MA 2FHCA 5CBIA 1TYGA 3O0FA 2V38A 2C14A 4P7OA 2QEZA 3AXMA 1UWIA 5M03A 4OBSA 1XPGA 3ZT5A 1EF2A 4HNTA 4J35A 1GPFA 1IYXA 3EZ4A 1GQNA 4HMCA 3PBMA 2E67A 2WB5A 4G6CA 3CB3A 3EOUA 5IHSA 3R2GA 1UZ4A 4FIQA 1ZLPA 1PYFA 3P8JA 3S5YA 1VS1A 1J6OA 4RKAA 3VABA 3CB8A 1FRBA 4I7UA 5BRBA 4NX5A 2PP0A 3TIMA 3WEMA 2V5CA 1BVNP 2OKOA 1RH9A 2ZX9A 1TV4A 3VX0A 3RLHA 1UHVA 3EX6A 1DIOA 3WLTA 1OADA 3WBXA 2RHGA 2X0SA 1YE6A 4LSBA 1AD4A 4ERIA 4B4FA 4LF1A 4Z17A 1VBUA 1EEXA 4MMWA 4ROPA 3NO1A 1TIWA 3TTQA 3S0CA 4JX4A 1QO5A 3L0KA 1SYTA 3H2EA 1DORA 4PCTA 1MUWA 3UCQA 3ZWTA 2X1SA 3NQGA 1OD0A 3OA3A 1RA0A 5C7VA 1W5PA 3QRHA 3KXQA 1ML1A 1VLIA 3H22A 1KFCA 5E1QA 1WZLA 1ALDA 3TWBA 2VX7A 1H2JA 3IVUA 1WOBA 1LBMA 4AC1X 3OP2A 3L5MA 2ZC1A 3VIOA 1V3KA 3RILA 1QRQA 1W32A 2QGYA 1WOAA 3WBAA 1GWJA 3W2UA 3CUGA 4JQ2A 3GU9A 5CPLA 2X30A 4QBXA 3W75A 4QEHA 1SO6A 4GVFA 2QMKA 3KVKA 4DF2A 3VIJA 1ODUA 3LCLA 2FJUB 1XQLA 2V3DA 3CYVA 3N2CA 1WKFA 3PG8A 1T8XA 4FNTA 3CPUA 3CHCA 3NQ8A 2X7WA 4Q7NA 2VQUA 2XPKA 1U22A 1TX0A 1FWDC 4Y8EA 2VOTA 1AH4A 3IV8A 1UR9A 1J0HA 1V77A 3HTWA 3WNLA 1AJ0A 4KQNA 2QZRA 1FFRA 2PEVA 2CNCA 3V3WA 3QSTA 1KXTA 4QG9A 2PGFA 4H9YA 2H6RA 4LRTA 2FZ8A 1QT1A 3PTMA 1FCUA 3BANA 3OQ8A 1F07A 3SCTA 4FSAA 3OU8A 5KINA 2PRMA 1BYAA 4S3CA 3NL6A 1FWNA 1YYAA 2P1FA 3ZLHA 1VFOA 4J40A 2D0FA 5LA0A 2DZPA 3RX4A 2RDTA 5T9BG 1W17A 4JTDA 3NDZA 4PYSA 3WLMA 1U1UA 1LL6A 3AMGA 2BWGA 4UFJA 1KGUA 1ZBCA 2NX1A 1GVEA 2BDQA 2QDGA 4V1XA 1LOQA 1FDJA 4QXIA 4QGCA 1CIUA 1D7FA 2QF8A 1GT8A 4D71A 4F3HA 1VYPX 3BCJA 3HG2A 3AS3A 4DUXA 3A3HA 3GVGA 4K8GA 4WSHA 4ATWA 1FTXA 1BF6A 2ZUMA 3ITOA 2Z1XA 4C7DA 3KBSA 1GCYA 3W74A 5C2GA 1FHLA 3A9BA 4YTUA 1IV8A 5CG7A 1TE6A 2Z27A 3UR8A 1FFQA 1H1NA 1QPRA 2JGQA 3IIOA 4XSLA 1X8FA 3LGGA 1XQKA 2Q8XA 4FX8A 3RJXA 4EF9A 2O0TA 3CT2A 4MG4A 1CLKA 3CJPA 5HJXA 3NPVA 4ADTA 2DUZA 2E9LA 1TPVA 1J10A 1A53A 3GW3A 3DBPA 4K1GA 1R86A 2VZVA 4KEMA 2VCAA 1KD0A 4C6OA 3F5KA 2HBVA 3AMDA 3UZZA 3OEXA 2WC3A 4Y96A 3ZQ9A 3BURA 5M5DA 4FNRA 3E49A 2QUTA 3BJTA 1PWLA 5C2XA 2YW3A 3PZTA 4UQBA 1JZ4A 2VEGA 4E2DA 2NUYA 5EFDA 3LU2A 1Y5XA 3LI1A 3LGDA 1YTEA 1OB0A 4J3ZA 4H2CA 4NZCA 2Z00A 4GI6A 3CUJA 3WENA 2POZA 2AMGA 4O0QA 3ZXWA 4I9JA 3KTCA 3ENLA 3BLLA 2BVWA 2HRWA 1HKMA 1D2KA 1EDTA 1BWVA 2VNCA 4QDPA 3BQ6A 2OOFA 4GKLA 2J78A 3PZGA 3R25A 5BYWA 1MQPA 4GX9A 1WA3A 3W6YA 3MTWA 2FVLA 2YYTA 2ABAA 4MY9A 1A0CA 3R11A 3CWNA 3P8IA 4I8DA 2XSBA 3O6DA 3WK3A 1UOKA 1SJCA 2PRHA 2V3GA 3LXAA 3V5OA 3UNDA 3NQEA 4QG8A 2Q8LA 4O50A 4BK9A 2W27A 1RBOB 2DIJA 3W70A 4H8VA 2D22A 1QNSA 4M7TA 2WZHA 4O10A 3WQ4A 3RITA 4D8AA 4L6DA 5E0KA 3GE7A 3M47A 5EMMA 4Y6GA 4HHLA 1KXQA 1E4NA 2JE8A 3BGJA 4YYFA 3BZJA 4LUSA 1JRBA 1R47A 4PEEA 3UERA 5DRCA 1EIXA 1ZGDA 3QHNA 1XLKA 3LPGA 1B4KA 3ZLGA 3RK8A 3M41A 4ZO7A 1V3MA 1XUUA 3LK6A 3SQSA 1KO0A 2DSVA 2PDBA 6REQA 2J27A 3AIVA 3AQUA 1ZALA 3EOEA 4JQAA 3GR8A 3UZXA 3TLQA 2Y63A 2VP8A 3W7CA 3QY8A 5FJTA 3R43A 3VM5A 3H2FA 3VZYA 2F2KA 3LMZA 5HPOA 3I7SA 1GPWA 4OUIA 1BG4A 5AB3A 4H9TA 5A8QA 4PRWA 3C0JA 1BRLA 2OEJA 2VEKA 3CZKA 4L5ZA 3F4CA 3BLEA 2OSWA 3RU6A 1UPMB 1UQYA 1PTAA 3IGXA 1P0DA 2XGIA 3UA4A 1QOPA 4Q8NA 4JNMA 3QY7A 2PGWA 5BMWA 3ARRA 3N18A 2AQOA 3VIGA 4HZMA 5ABEA 4C1KA 1LRNA 1TUFA 3DECA 4GZIA 1AQHA 5D9NA 4WDWA 2MUCA 1CZ1A 1K8ZA 4P8UA 4L1WA 4J9JA 1WZKA 5CJ5A 1UOZA 3EWUA 3RDKA 3TTSA 3T55A 2D1ZA 3P2VA 1C8QA 1RBLA 3MS8A 3CIVA 5G5IA 4G1KA 3FVMA 4A35A 4PMUA 5AHIA 5HWJA 4MFEA 1QPKA 1E1CA 4B3LA 1Q6DA 4LS2A 3TA9A 4M1RA 2J9XA 1XYMA 4CCZA 4IL0A 2NSXA 1FA2A 4F9JA 2J66A 3N9SA 4ATDA 4I3GA 1JPMA 2B31A 3EXSA 3HPSA 2WM0A 4A05A 4MLRA 1E72M 3VCRA 1O12A 3G8EA 3M0KA 3LRLA 3FEQA 1KM2A 4M56A 4BF7A 4S2CA 2BOEX 5EMUA 4BF9A 3EKLA 4EF8A 4DNHA 2X09A 2Y4SA 3MSGA 2DIEA 3TEVA 1S2AA 4LAOA 4S3KA 2B7QA 1B9BA 5E0FA 3B97A 1RALA 1JCJA 5AFDA 2A6LA 3SUUA 4IG2A 5ABFB 4C6KA 1LUCB 2XM2A 2Y0FA 3KTSA 3N34A 3J7HA 4WDUA 4XG1A 2G3FA 2A79A 4ZOCA 3VFCA 1K02A 4Z2LA 4MB5A 4OOZA 1IZJA 1GVIA 1BTCA 1Q66A 3IUHA 2G3JA 4Q33A 4GY7A 1EZWA 4IIGA 1B3VA 3AZRA 3O15A 2CZDA 5LNWA 1OC7A 3MC5A 4EIVA 3CEPA 1OFEA 4XTDA 5K9CA 1UH2A 4F8XA 5EL1A 3MUAA 3SCWA 4AVFA 1JPIA 5I6SA 3QTPA 2ZTJA 1G01A 2OYKA 1IE7C 4WGXA 4LXFA 3WFLA 4KERA 2EKGA 2D2JA 3UT0A 1OT2A 5KMYA 3EPNA 4OU1A 1LQAA 4NJHA 4BI5A 2H8XA 3MANA 5DMLA 3T7VA 1V6TA 1EKOA 1XIMA 1N8WA 2YPIA 1UR0A 3K1GA 1U5JA 1XGEA 2VGGA 3KL5A 4QM1A 5HJLA 5LIKX 3CGTA 2ZX7A 4DAIA 2Q01A 4CNTA 3UU0A 3II1A 3UPBA 2E5CA 1KTNA 4MY8A 2YDSA 2FDSA 3CUHA 4RNFA 3FXGA 1JXJA 4DF0A 1ZCCA 5F2IA 2HS8A 3GFZA 1B3ZA 4UTUA 1K7FA 1W3KA 4MPKA 3SCVA 1R3TA 4NL1A 3M0VA 4GE8A 2A6NA 3G8RA 4KMQA 1V93A 1TREA 8A3HA 4IUOA 2D0HA 2WCSA 3NCOA 1DTNA 1G69A 1GOKA 5JBFA 1SO3A 4HU4A 1QCWA 1ZP4A 4EWJA 2CIPA 3BAIA 1UR3M 3U0HA 5HR6A 2D20A 2VOMA 2CHOA 3SN1A 2VC7A 4N4QA 4C6FA 3A5VA 2PF0A 3A4AA 4ZQPA 2WLYA 1VFTA 2NQ9A 4QS5A 4BQ2A 3QPYA 3COTA 1YRRA 1GVFA 4KRZA 2QPUA 4D72A 5I2UA 4O17A 4CNPA 2QHAA 3F2BA 3NDOA 3PULA 2VFGA 3VNKA 4JOMA 2FGLA 3TQKA 4C6BA 3QV9A 2NV2A 3V36A 2NUXA 3C0LA 4O11A 4EPEC 2EAWA 3FXYA 1SR9A 2BG5A 1TPFA 1CBGA 2TRSA 3UESA 1KLZA 3RPMA 3BARA 3BLDA 2WMHA 4XBSA 1IGSA 1DJQA 1EO7A 4GNVA 2I9UA 1IR1A 1TPEA 3TXVA 3REQB 2CEQA 4PTMA 4DYKA 1CB7B 3N3MA 1HX0A 4OOUA 3F4NA 3UZWA 1J2BA 1EC7A 2G5WA 5FF0A 1E71M 4V27A 1VJSA 2FGBA 3B8DA 3IIXA 2GGJA 1W1IE 1BLIA 4XV0A 4AWTA 1W91A 2B7PA 1NSJA 2HMCA 1OFPA 3XIMA 4JIQA 2EEXA 2OLSA 1AL7A 1ZS2A 3VD5A 6PTDA 3MWCA 3TZFA 1ONXA 4A29A 3VTRA 3G1XA 1R2RA 3FOKA 1EP1A 1HF6A 4KCWA 1B3OA 2V6AA 3ARPA 1QNRA 4AWSA 3LHVA 4CCEA 4Z0JA 2RUSA 4K7YA 3NTYA 1EDGA 4AZBA 5I3JA 3H24A 3HGOA 2W5FA 2DW6A 3PPCA 3TYBA 1HZYA 1IIHA 1VIWA 1Z42A 2QCDA 4UCGA 4GYKA 4CNUA 3G22A 1R0MA 1EJWC 3D47A 1E3XA 4ZXOA 1Z48A 4XD5A 4KESA 2WZMA 5LIYX 4CLMA 2EPLX 2BHZA 3NSNA 1M65A 3M4HA 3CV2A 3H4GA 2Q3RA 1WX0A 3WF4A 4AD5A 3TSDA 4AY8A 4GQBA 1TPC1 3HB9A 4R53A 2YCLB 4HVXA 1M7OA 1EO5A 3THCA 4DWSC 4TO8A 1W9XA 2DU2A 4AD3A 5A6TC 1XYZA 2AOSA 4TOQA 6A3HA 1X6NA 5DXXA 1J01A 4GNJA 4UR8A 3GTFA 1Z7AA 2Y8KA 2R14A 2BHUA 1R5YA 5CZJA 5DO8A 3OODA 4JTSA 4Q4OA 3LV6A 1MZHA 4HHHA 1Q3NA 3E02A 1X97A 1VD6A 3BMXA 4EAMA 2PZNA 3U5UA 1WYIA 3C8FA 7REQA 3NXFA 1T8QA 2IPGA 4N6EA 1G7UA 4UOQA 1CXKA 1N7KA 3W22A 1H7XA 1Q45A 1Q2RA 4XIAA 3MV01 3B4UA 4PR4A 5AHLA 5D05A 3GSMA 5AVNA 2HNHA 2C1HA 2NT1A 2MANA 3H23A 2OLHA 1XRTA 4H2HA 2PUZA 5CSRA 2Y2WA 1ISXA 4R88A 3WNKA 3GHTA 4NRSA 4WJXA 2G97A 2OX4A 3NQ6A 4LVDA 3OO2A 3UJ2A 1QOXA 3SUWA 4Z1YA 2GQ8A 2XVGA 2VZOA 3PTKA 5LNUA 1TV7A 3WKZA 1EB3A 3W2MA 5DCEA 3GZAA 4MUPA 3TQPA 4C6DA 2VC9A 3TAOA 1TB3A 4A2RA 4JFVA 4U2YA 4BFAA 3LYEA 3H54A 3SRHA 2PWVA 1OQFA 1LORA 3GTNA 1Q5MA 4LUJA 1FUYA 1SFJA 5FA5A 3PP7A 4HJWA 4LUTB 1V51A 1AJZA 4HMDA 1B3YA 4FF7A 3WNPA 5EPDA 2R1KA 3LCFA 4UTWA 2CXEA 1V6UA 5IBXA 1NP2A 3WUFA 4O1CA 1TV3A 4WXZA 5LXXA 4TTUA 2HDJA 7A3HA 4PL1A 5IHRA 3ITLA 5BRPA 3PUEA 3A47A 2YB4A 3ELFA 3EDFA 3KP0A 2VWTA 3PFMA 3KS6A 1VFMA 2G41A 1Q13A 1QO2A 3UZJA 4OT7A 3CIWA 4DXVA 4D8LA 1XW8A 3PWGA 4I7WA 2JFEX 3DGBA 4XAFA 3VFLA 1OYAA 2PSNA 3AU2A 4HK5A 3SQLA 3EYPA 2VX5A 1FDYA 3PWAA 4HIBA 3VIIA 2AAMA 4IICA 4RR4A 3VMNA 2V82A 4EE9A 2ISFA 1XC6A 3V18A 1E5NA 1VKFA 1JZ3A 3GD6A 3SEPA 1REQB 4GX8A 3SR7A 1G5AA 3MUCA 3LY0A 2VEIA 1S46A 1R9XA 5LGZA 2G50A 4XAPA 4WR3A 3QKEA 3LZ5A 3ITVA 1YDOA 5J5RA 3WQ5A 3QPEA 3S9ZA 2GJRA 2YCJA 3IVTA 4QAWA 3RPTA 4GI4A 1IEXA 4ZQMA 5DMYA 1J93A 1TVLA 1KFLA 1JZ2A 3IK2A 1EJUC 1KFBA 2ZBTA 2KZHA 1EIBA 3OLIA 3EMQA 3N2MA 1RQEA 3DFNA 1J96A 4MWAB 2ZDSA 5JU6A 2OJPA 3STPA 4LAUA 4FI4A 3OGRA 2UWFA 1O5QA 1NQ6A 3LCWA 2PTZA 3WLJA 4QNWA 1Z69A 5FF4A 1C8XA 2QCLA 1KBKA 3QR0A 3UW6A 4S3JA 3FLUA 3CLWA 4FO4A 2ICSA 1CGYA 1NARA 3B8UA 3GNPA 4LPCA 3ZSSA 4PRTA 2MNRA 3LRMA 1PUDA 5D38A 2JGYA 4FNQA 2VZUA 4M19A 1R87A 3VE9A 3DI0A 1XM3A 3EA2A 2IKHA 3VGHA 4UMCA 3AXHA 2C16A 1AW5A 3W2KA 1XH2A 2RH9A 5E9XA 1SFSA 1VBRA 2XINA 3KX6A 3B05A 1U33A 5A8MA 4IPJA 2OXNA 3LRKA 1JVNA 2P5NA 3RLUA 1VCFA 4D6EA 1P0BA 4QS6A 3PBUA 1UWAA 3PPGA 4GVGA 4OJYA 1LCOA 3OLEA 2BVTA 2ZICA 1NWRA 3LS9A 1IXPA 4NY2A 1Y5WA 1EJVC 3H70A 4M8UA 3O1NA 5AC4A 1MEIA 3FJLA 4NXKA 1SMDA 3H7RA 4MUZA 5G1YA 4E3TA 2P10A 4AH7A 4JGDA 4AY1A 3ARVA 5EY5A 4E2BA 1ENUA 1JGMA 4W85A 1O95A 3EXTA 3GQYA 1UBPC 4U28A 2A7NA 1JL8A 4MJ4A 1MXDA 4JKKA 4QFUA 2Z1SA 4DJDD 3DDMA 4DI8A 2VCCA 2NWSA 5K7JA 2X16A 2A5HA 5IRPA 1WBHA 4I9AA 2ADAA 1GORA 4C1NB 1EF3A 1UH4A 4C7GA 3DEQA 1VRXA 5FJOA 3OBEA 6XIAA 2YXXA 4XAGA 3Q65A 4W5UA 3GG0A 3G1VA 4IPPA 1BEUA 4JYFA 7TIMA 3TYZA 1KGXA 1OJXA 2PP1A 4D1JA 5I79A 2CWXA 2RDUA 1Q2SA 4GYJA 2ZX5A 3HMJG 5C9ZA 3WF1A 5IDZA 3WL1A 3QYSA 2PGEA 1M7XA 4JIIX 2Q02A 5I7GA 1XBVA 1JCLA 3CTTA 5CAHA 1J0KA 4NNAA 1R9YA 4JKMA 1QUMA 1S2TA 2ZKMX 4JFTA 2A2IA 1US3A 6ENLA 1H5YA 1CEOA 5D2WA 2WVTA 4GI9A 5HUOA 1OHLA 3KBNA 3ZOAA 2ZX8A 4ES4A 3UEQA 3NEHA 2FZNA 4HNVA 3QFEA 2OFJA 2OZ3A 2WMIB 3L7RA 5F2LA 4H6QA 3DX5A 3NZGA 4J3XA 4AWEA 4ZB2A 3SCRA 3GDTA 6XIMA 3F4WA 3NZRA 4QEEA 1Q6QA 2P76A 4MY1A 4US5D 4DZHA 1TJPA 4FLSA 1KQZA 3UWEA 4PZVA 2D73A 5REQB 1VB9A 3GTXA 1J4EA 3LXCA 7ENLA 4PH6A 4XVDA 4DO7A 4RZ4A 1K8CA 1EHAA 5FJIA 3KOZA 1J6PA 1V6YA 5D2VA 2Y5SA 3C86A 4D6DA 2ACRA 4LGXA 3STFA 2ZC8A 2OG9A 4PB4A 3SADA 4XZMX 3ABOA 5LGXA 1MRAA 3BH4A 3N29A 3H26A 1I9CB 2XG9A 3FSUA 2QUMA 2V8ZA 3W1TA 3CQJA 4JHOA 5BW6A 4DM1A 4L61A 2CCRA 5HNRA 3U9IA 1C8YA 2QJGA 3ZSTA 4YTQA 1QK2A 3F4VA 4R34A 2PU1A 2X41A 3SCQA 1I60A 1DQWA 4IMDA 5T9CE 9CGTA 2GL5A 2OR2A 1GYNA 2HISA 2VT0A 1FQ0A 4JFWA 3KOYA 3P82A 1AZ2A 3RG6A 4O1AA 1TVNA 3EBVA 4PUDA 2QIWA 4B2DD 4M3PA 2EF9A 4NG3A 2ACUA 1FDZA 4ASTA 3G1RA 1EJTC 2RDWA 3BICA 3A5FA 1W54A 2PODA 1VEOA 2IQ0A 4UIOA 1DIEA 3NQFA 3VKJA 1OFOA 2NWRA 4KEVA 4R5EA 3S1XA 4DELA 3KWXA 3UR5A 2J7HA 3DKJA 2BOFX 4JTGA 1RJPA 3JVAA 3VIKA 2VR5A 3WJSA 4ZENA 2OZTA 3DERA 2HE8A 1Y7VA 2GSEA 5ABHA 1UR2A 3IAPA 4A3YA 3JRKA 3WDJA 4H9VA 1JYNA 1KBJA 1A80A 4B3KA 2G3MA 5HBFA 1XD0A 1VRDA 2QJHA 3T07A 4H41A 1KCZA 2GGGA 3GY1A 3WLRA 1QI2A 4UTFA 1PKNA 3EB4A 2EPOA 1DQXA 3GAKA 2C6QA 2DSUA 3W1MA 3VNJA 1YDVA 4UQ9A 2EJ1A 4NP7A 5M2FX 1LL4A 2IUZA 2DZTA 2HBXA 3LUTA 3QM3A 3CHVA 2HZGA 3OA5A 3AHYA 3VIMA 3EB3A 3P5YA 3GG8A 1HW6A 4JIHA 2WM1A 1FHVA 4AD2A 3VDBA 3HMCA 4HB7A 3TVAA 4NRRA 3QGVA 4DJED 1JZ5A 2PCQA 1KQYA 3MVIA 3WG6A 3MCOA 3BOFA 3WH8A 3AMLA 5T91A 1HKJA 1X38A 4AZ6A 4PTVA 1YW1A 1F9CA 3E0IA 4S2BA 5TAOA 3P61A 3PK7A 3VGBA 4TV5A 2Y5EA 1OK4A 3DBNA 4FNPA 5HATA 1HNYA 3ZVHB 3KE0A 4KW2A 2JALA 1ZBKA 4PB5A 2A3HA 4PGLA 1IEWA 4FOKA 2P88A 3AJ7A 2ACQA 5HWMA 2DQWA 1PB0A 4QNEA 1BWKA 5FD0A 4OGZA 1NH6A 3MP3A 4QITA 3NZQA 4DYEA 1L0PA 3G1YA 4GQ0A 4DUVA 5ABFA 1MXSA 1LUCA 4JTAA 3XINA 3WO8A 1PXGA 1NFGA 4IF2A 3VD7A 1F05A 4WKHA 4AZCB 2O92A 3RF9A 3BGGA 4L65A 3HG4A 1W5QA 3E3HA 3P74A 3NL5A 2EPMX 4HGXA 4JTRA 4HPNA 1T40A 1YPXA 4UTLA 4CEUC 4YXGA 4X0NA 1JPHA 1EEPA 4OKDA 1PKMA 1FWHC 3C2VA 4DUWA 3TQVA 3QF0A 3B4YA 2O55A 2GJLA 2D3LA 1YNPA 2AGKA 3IGSA 4GA8A 2HPIA 1JDDA 4L4MA 1W9UA 1V6XA 3FS2A 3NVDA 4F79A 3S9YA 1CDGA 1F61A 5EMLA 2HK0A 2QYGA 4R7WA 4O14A 4FZIA 3W7PA 1EXPA 3JW7A 5FL1A 4UOZA 5B7YA 4YWIA 5XIAA 1F74A 3VDHA 3VIHA 2VJXA 4LS1A 2AAAA 1I0DA 1QI4A 1X96A 3GXIA 4KFOA 5EBUA 2WZEA 3UWUA 4Q7BA 1J5SA 3EA1A 4J2MA 3ARUA 2PDJA 4DJFA 4GC3A 1W9DM 2X42A 4V1YA 2XIMA 1A49A 3W1UA 5ABTA 3P93A 3DXIA 1W3HA 5CC6A 5JMUA 4FXJA 4B5WA 3F2DA 3PZVA 1RD5A 1HL9A 3ITTA 2BOGX 3T44A 4KF1A 5H2ZA 2QPSA 3B9DA 5BMXA 1UD2A 2DV0A 2G8ZA 2FPTA 1NP0A 4C6QA 2XN2A 4MJMA 2YB1A 1OFRA 3TC6A 4DY1A 1PS9A 1TJ2A 4KGJA 2X8RA 2XIQA 2C8NA 2ZWZA 4PMQA 3W0KA 3OYXA 1HGYA 1T0OA 2QCHA 2ASHA 1OSEA 5HPCA 3IACA 1HJXA 1PV8A 5A6SA 2PTWA 3M5VA 4OTKA 3RAOA 4PEKA 3T2OA 3ABSA 3N9KA 4EXBA 1MQRA 2BXZA 3KDOA 1E0XA 1TRDA 1CECA 3L0GA 1RUSA 3VA8A 3MUZ1 4AIBA 1SR0A 2V5DA 1UKOA 4KKXA 1TJ1A 1FWEC 2VEMA 1DQUA 2Y62A 1BXNA 2P50A 3K2GA 3TWAA 1JCMP 4Z1CA 3GH5A 3ANUA 4YL2A 1KWGA 3W71A 2H8ZA 5CZ0A 4G7EB 3GDKA 3VDCA 1UKPA 4JHMA 4WLCA 3REQA 4FXSA 8XIMA 4ZQOA 2QR6A 1LDCA 4NVTA 4LB3A 3PBGA 2DT0A 1JNDA 4CD6A 5FL0A 4O18A 4BA0A 4GBUA 4AG0A 1KRBC 3SB0A 5HQEA 3SAZA 2DT3A 4U2ZA 3ZT7A 3S83A 5AYXA 1DWHM 1JEZA 4H3DA 2Y88A 2VXNA 3TC3A 1TQJA 4D2JA 2Z1WA 4ECLA 2DQXA 3TCEA 3MDUA 3W1NA 3S3GA 2YXOA 5A3HA 5AZ0A 3THAA 1B90A 3TK7A 3DC8A 4NZ1A 3E2SA 1Q85A 4IGNA 4JHZA 4AHOA 4KCVA 4MAZA 5IOBA 1ZSXA 3T08A 3PPFA 4HHPA 2I56A 3BPWA 3SCPA 4TXEA 5H8PA 4XUYA 2DH3A 5K3VA 1SO4A 1O5RA 4MYXA 1YXCA 4DO6A 5D03A 1C91A 4AWUA 3EWYA 4I6KA 2XHYA 3FJ6A 3W29A 3U8GA 1V6WA 1PAMA 1ZJAA 3VC5A 4R9OA 2J24A 4LUYA 2E09A 4LYPA 4KIEA 3K8KA 4RE0A 2AKMA 2QIIA 3WJYA 2YCLA 4GO9A 3LSCA 1X1OA 3S2LA 1I2PA 4YWSA 3S2NA 3WQPA 3M6YA 1NFPA 3C4UA 3VINA 1D9EA 3CWOX 3TN5A 5DT5A 2XUCA 3WDIA 1OYBA 3L0NA 3LERA 1K4HA 3ABQA 3F5JA 4EX4A 4MNKA 2DEPA 2F9RA 1E6XM 3BV7A 4XO7A 1VENA 3TXZA 2HNEA 4UFHA 3G1DA 2CZEA 2BV9A 1WXZA 3C3NA 1FBAA 2HVMA 3DHFA 1GW1A 3SJ3A 5D2TA 2QGHA 1W1VA 4QJ5B 2WHLA 1KB3A 3ZFHA 3OB8A 3BCDA 2WZIA 4TVUA 5HR7A 3WMCA 2OYMA 4L6HA 3U48A 1AMYA 4IH3A 4IM4A 3W81A 1FP8A 1FCVA 4UTWC 4DI9A 4GQQA 5IBXC 4O1FA 4GUGA 3WD0A 1XWYA 1LM1A 2FGZA 1A5KC 3U5YA 1PPIA 4JQ3A 1OCNA 2ZADA 4QJ4B 2PDFA 2YCKX 1ADOA 5G4HC 1X6LA 1TZ9A 2VFIA 5C9XA 1C92A 4L9XA 2DZSA 2XH7A 4W8BA 2J13A 2TMDA 3VOCA 4ZE4A 3CH9A 3BG9A 1E1FA 3EGJA 3S6OA 1DPMA 1YTKA 4M5PA 1QHPA 4LUTA 4M80A 3R8HA 3T0BA 1HUVA 3UWWA 4N9DA 4OECA 2PA6A 4WF7A 4IP4A 3RUBL 3WD3A 2QDHA 2CLMA 4HNUA 3E2QA 4RDVA 4R85A 3W1RA 3UPWA 3ARXA 2ATMA 3CL7A 3VZZA 1G4TA 1KM0A 1SSGA 1UMYA 2ALRA 1I45A 4J1OA 5LA1A 3TDFA 4N0RA 1MW1A 1UA3A 5HANA 3FFSA 4OQVA 1PE1A 4QP0A 2GGEA 2QAFA 3D3FA 4BJHA 3TTOA 4AMCA 1JAEA 4PMZA 4A2SA 1V0LA 1QVBA 4LCQA 2FIQA 5FESA 1H09A 5CPOA 5G4EA 1A5UA 4LW7A 3TX9A 1REQA 4EACA 1VBJA 3WQWA 3WLHA 3IJ9A 1TMLA 2EBNA 1TO3A 3CC1A 4FHAA 4AXNA 1CXIA 3VOHA 4GJ1A 4V28A 4DN1A 1VHCA 3A24A 3D46A 1XLGA 1I4NA 4F66A 2FDMA 3BMVA 3CUZA 2A85A 1O6IA 2YA0A 2YIHA 3INPA 4NSBA 3KLLA 2ZDRA 1FWCC 3GX9A 1RLDA 2OKTA 5KITA 4A3HA 4LCSA 1LRTA 4W5ZA 3AROA 5CH9A 4UTMA 4NYUA 3NVTA 5JBDA 2ZXDA 1UYQA 1B3WA 3PNZA 3WQ8A 4MWAA 1OC6A 3HPAA 5D8ZA 4YTSA 4UMBA 3BJFA 1AH0A 1PZ2A 2DJXA 2VO5A 2XH2A 3VILA 2PWFA 1GEHA 3STGA 4KGLA 1XLCA 3KOFA 4N4PA 1X7FA 3RLVA 4GIEA 4E8CA 4DIAA 4TX9A 4UZUA 2F7FA 4DO4A 2PDXA 1K8YA 4P7QA 2CWNA 1JIBA 1HO4A 2PC8A 3HN3A 5CGQA 2V2HA 3QXBA 2PDWA 3QGKC 4CQ8A 1HL8A 4I90A 2V0TA 1T99A 5HQLA 2RJGA 4P7RA 3IJDA 3W38A 5GJMA 2OWXA 1ITXA 2C0HA 2GUBA 4X0VA 5JXQA 1YADA 4WY0B 2IMRA 4UB9A 3SFWA 3SSZA 4IOTA 1LT7A 2GDUA 1GVRA 3KFTA 3KVJA 3ITXA 3B8VA 1KRMA 3TJLA 4NZ5A 4E38A 1E6PA 2KAUC 5CC3A 3TTYA 1OFAA 5CEWA 3IRDA 3B8SA 2WKJA 3WLSA 4WXYA 1F76A 3C8NA 3O05A 3G2GA 4W8AA 4LCRA 1IEVA 3A3XA 2OSYA 2Y6ZA 1F6YA 3GWQA 3N2BA 2DVTA 3ALGA 3DGRA 2J6VA 1CGWA 2Y7FA 1QXLA 3WMLA 3U6WA 3OTRA 1B9ZA 3NXLA 1IHIA 1RZMA 4PUNA 4W86A 1K7XA 5A2AA 4GH3A 3M9YA 3SW6A 1HFBA 3H7VA 2CKSA 1DTUA 1YLVA 1MWOA 1VZWA 2GZXA 4C1NA 5HNTA 3CWHA 1XKYA 4ZFCA 1ITCA 1R2SA 4M6PA 4GQRA 2R24A 4RZ5A 5TQLA 2O7SA 1XYBA 3F2CA 4DPQA 3O9NA 3UQNA 1UP2A 4RNHA 1W1TA 2W92A 2CZFA 3BSHA 1EPXA 1EHNA 3HBLA 4EP8C 5GVJA 3N4FA 3RMEA 2YCEA 2FB3A 4LV4A 4NJKA 2VYOA 4N2YA 1D3HA 4MNJA 3MZNA 4CN6A 4FX6M 3P60A 3AHXA 4RDYA 5DLCA 3L2LA 4R3UA 1VPXA 3GDRA 1LOLA 3LCHA 1V4YA 5ABGA 3WBYA 3MWAA 5A8NA 1PX4A 4F0HA 1DHKA 1GHRA 2J62A 1IT7A 1PVNA 4ICNA 2ZA3A 5KSWA 3OOQA 3VOGA 3GBDA 3LD5A 3PSWA 5MKGB 4IX2A 3ERPA 1F3XA 2DSZA 5IM51 4JY9A 3KL3A 1QI3A 1T41A 2FZMA 3E0VA 2WMIA 2OQYA 2JEQA 3A21A 4OBTA 1JG9A 2QJJA 1QHOA 1FHUA 4LV9A 3L4TA 1H7NA 4WEVX 3GHSA 2R9RA 3GVVA 3P7YA 4GYPA 5REQA 3MMUA 2YBVA 2Q09A 3ZJKA 3EEZA 3TQ0A 1V0KA 3VOJA 4AISA 4CVWA 1DJGA 1B30A 3TJ4A 3LHWA 1Q6EA 3U2EA 2X1IA 5GPRA 1S2CA 1R38A 2NVAA 2PGRA 4GGBA 3WEOA 3VMOA 4PMNA 3TYDA 1DIKA 5D9OA 2WQDA 4JX5A 4DNMA 5DN1A 2OWWA 3LCIA 1RVKA 3EA3A 4KFPA 1RCOB 4AD0A 1AJ2A 1JUBA 3I10A 3KL0A 4WK9A 2J8TA 1VGAA 5A6BA 4JICA 2J77A 5FF2A 5IFPA 5FSDC 3EX2A 3CL6A 1CGTA 1IIGA 4GNKB 4U4MA 1TV8A 4O1DA 1EUNA 4KWOA 2YFOA 3GH7A 3QQ0A 4HT3A 3CQKA 1KR0A 2V5BA 2HXUA 3O6YX 4O1EA 3UPMA 3M16A 4C90A 2BY2A 3QGAC 1F7BA 5DFAA 2NUWA 3EAUA 1C29A 2O4MA 1W3LA 1J0YA 4CU6A 4CN1A 4JD4A 4US6A 3R94A 3AXKA 3SBFA 4F0LA 3H12A 1DJWA 3R1ZA 4MFDA 1GK8A 4AXKA 2NX9A 1ZNNA 2V30A 4HNLA 1XYLA 3R10A 2VMFA 3W01A 4EK7A 4LBUA 4DVOA 2DUAA 3OYZA 3RX2A 5FOOA 3PSVA 1QPOA 3EB2A 3ZJ7A 4LS0A 3TMLA 4UNIA 5JH2A 2WZTA 3O3RA 1O1HA 3W23A 1JYWA 1NQKA 3V0SA 1Q8JA 1R3WA 3S6DA 1NDZA 3WL0A 1J8VA 1EL3A 1GTHA 1UWSA 1AW1A 3NQCA 5I03A 1O68A 4MB3A 3G24A 3CBWA 3MO7A 4M82A 3VNZA 1X1ZA 4C6LA 1HKKA 2ATSA 4BCEA 4HCLA 1CCWB 2PDMA 1DKWA 5CXPA 3W6LA 2TPSA 3W7OA 4GRSA 1W8GA 4HA3A 1TWIA 1MDRA 3ATYA 1Y65A 4ICMA 5C55A 4XZLX 1PHWA 1JYXA 3VD9A 3URQA 5RUBA 1XLJA 3R0DA 1J18A 3L4YA 3VD3A 1L6YA 5EMKA 6CGTA 5D9MA 1TCDA 4GD0A 2AKZA 3QY6A 1UD3A 4GISA 3A4XA 4LY4A 2PWEA 4LYRA 3AFBA 4H00A 3M43A 3LBMA 1R9ZA 3HQ1A 1M1BA 3GTHA 3ZVHA 3AJXA 3G0SA 3CNYA 4OBRA 2R8WA 4PBEA 2VVNA 2ZRUA 2J9YA 3OBKA 2W66A 2XGBA 5I23A 1XLFA 2OEKA 2C19A 4MB4A 1EJSC 2HVOA 4S3BA 3ME3A 3FV9A 4K68A 2CBIA 4ZE5A 2VD9A 4DWSD 1WZAA 3IEBA 4ZTYA 1HQTA 5D2XA 4CNNA 4AZCA 4U3AA 2VVSA 4Z1BA 3FKKA 1WDPA 1QTWA 3VNDA 2OCZA 1CLVA 2VC5A 4J28A 2CLKA 4MZ8A 2XIJA 1RLCL 4LQ1A 1WE5A 2DZBA 1ZJIA 3URNA 2I14A 5H91A 3TONA 3B8IA 1GYMA 3PZMA 2WOQA 3CUXA 3ARYA 4A8RA 3TROA 1EGMA 2WW5A 3GB6A 1H7PA 3Q94A 3PZ9A 3BXWA 2CZVA 4LTSA 1OF8A 3CS2A 1BXBA 1HIZA 2WMGA 4PMRA 4YVPA 4DJFC 3A4JA 1TMHA 1H0IA <