1EB3A

Yeast 5-aminolaevulinic acid dehydratase 4,7-dioxosebacic acid complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dehydratase
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Two Diacid Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 122
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1eb3A00
4LW7A 3R12A 4G1KA 3TR2A 5G4EA 2QCGA 3SECA 1GZGA 3G0UA 5CKSA 1JCYA 1XKYA 2FTPA 3UY7A 2VOMA 2EHHA 5I3FA 3NQVA 5K9DA 4PEKA 1AG1O 1DHPA 2EKCA 4YLWA 3MHUA 5HULA 4CCDA 3NNTA 1ZJIA 3LM7A 3KVKA 4RZ5A 5F2MA 3B0VC 3IV3A 1Q6LA 2DU2A 1IIGA 2A85A 3LXCA 1VYPX 3W2MA 4N6EA 3QW3A 3L65A 3LHUA 3EWWA 2Q8LA 4GRSA 4AMAA 4QIUA 1KFKA 4HKPA 2C19A 4P61A 4JYEA 1DJNA 5FESA 2FFCA 3FEMA 5FF3A 3DKJA 3QPZA 1XBYA 3DGRA 4DPPA 1DVJA 1I8JA 3THQA 3TUUA 1SO6A 3LCFA 3LTSA 1RV8A 5CZSA 1QOPA 1GT8A 1H1ZA 3P61A 2GVLA 2NXGA 1PVNA 4OV4A 2VKZG 2ATMA 3DFTA 1X1OA 4LVDA 1I2NA 4XZ9A 5EYWA 3TV8A 4HPJA 4N6FA 2FJKA 3LTYA 1SFJA 3LCHA 5F2LA 3DFNA 3FOKA 3I68A 5C2XA 2Y88A 2NXHA 4IPJA 4H3DA 4ZQNA 3Q2DA 1H63A 5HWJA 3W70A 1GVSA 4GWEA 4JN6A 3WK1A 2NUYA 3FFSA 5AN7A 3NPXA 1P5BA 3MHGA 1TTPA 3NPWA 5AHNA 4DF1A 2QF7A 4FNSA 3MHFA 3MO7A 2B7QA 3TMLA 1QMLA 3MW7A 1HL2A 5E1QA 4H4IA 3WK0A 4QQ3A 2ZZ4A 5AYYA 2YGYA 5DXYA 5FEXA 2ZA3A 1KFJA 5DY3A 4UFJA 1OF8A 3RNDA 3QRHA 1OK6A 1IXPA 3NGJA 3C2RA 4JTLA 3DH7A 3TC6A 1KM0A 4K8EA 2FLIA 2HMCA 3NL5A 2ZZ7A 1W5PA 2DZUA 2GQ9A 1H7OA 3O07A 4Q4KA 1DJQA 1TPB1 2GQAA 4YWIA 4UTMA 1OX4A 3BK0A 1H62A 2EGZA 1R47A 3N34A 1ONRA 3QC3A 2I9EA 2CU0A 3FLUA 2A6LA 5AHMA 1G67A 3TW7A 5DN1A 1QPQA 3JS3A 4LVAA 2R94A 3L0NA 3DFPA 2X1SA 5L6UA 1FWRA 3BLFA 5LNUA 5LNWA 1P0KA 5F4WA 1YDOA 2P1FA 5D38A 4ZL1A 7TIMA 2B4GA 3M5XA 4NVTA 1ZENA 3CTLA 4KFOA 1I2PA 2H90A 3IIVA 2C6QA 5D2WA 3L66A 3G1AA 3QQ1A 3EEGA 2DZPA 3CIWA 1F2JA 1QPOA 2DORA 1ZALA 3W7MA 2QCDA 3Q37A 2NX3A 1OABA 4NJHA 4CNOA 3Q58A 5D09A 4DELA 1Q3NA 1GWJA 2Y7DA 2X1UA 4DXVA 4JY9A 4DO6A 4DF0A 2WJZA 5D32A 2QJHA 3G1DA 4JX4A 1WOAA 1A5SA 4N9CA 4XWUA 4Y96A 3WJWA 2XN0A 1LLZA 1X1ZA 1W54A 1ME8A 4UTIA 4O18A 2V2DA 3M43A 3HMJG 1XI3A 1B9BA 1OFEA 2H8XA 4BI5A 3PC0A 4UUIA 3VNDA 3WFAA 1PHWA 4YCOA 2J9ZA 4LRTA 2YZRA 1OF6A 4P2VA 3C6CA 1OFOA 3A24A 3MP3A 3KFTA 1Q6OA 1KTBA 3K30A 2VFIA 3V1PA 1L2UA 4QITA 2F84A 5HNRA 4Z08A 1M7PA 3CQ0A 5F4SA 3GXPA 1RQHA 3KAOA 2WSYA 3F1QA 1KBJA 3PY2A 2W6RA 1TPC1 1YXCA 5LGXA 3C8FA 4JX6A 4OT7A 3P74A 3L2IA 2ZRZA 2ISWA 4K36A 3VFLA 1T8XA 1OX6A 2E1DA 2WO5A 3UWWA 3DHFA 3PAJA 3BO9A 3JRKA 3NR0A 4AWTA 1B3OA 1ZHAA 3PB2A 1ADOA 4WOQA 4X22A 4RX0A 1MSSA 4MVAA 1EUNA 3PR2A 2O7SA 4GC4A 3W7LA 1DORA 4BR1A 4JR5A 3MBFA 5G2IA 3HGOA 2ZYFA 4AHQA 4WQ6A 1XDMA 3T40A 4FB7A 5KZDA 2NZLA 3E96A 2A6NA 4LS1A 3S9YA 4UR7A 1TQJA 3BW2A 1LOQA 1DL3A 2PRMA 4FX8A 4PFMA 4Z1CA 3SY5A 5AC6A 2FPTA 1LLWA 2V0TA 3FS2A 4UTLA 3T4CA 3HB9A 1GVRA 2QAPA 3I65A 5D30A 3B05A 3I6RA 4QAIA 2E5DA 3GLCA 4JTFA 4LVFA 1L6WA 1FCBA 2OCZA 4QNWA 1FDJA 1SZGA 2RKXA 3IEBA 3MMTA 4LS2A 1KV5A 3W7NA 1KTNA 4XTDA 3L0KA 3LGEA 1L6YA 2I1OA 3C52A 1ICPA 4K7VA 1TREA 4ADSA 4EWND 3NZ1A 2QDHA 5BNKA 4JIPA 1MEIA 2VFFA 4LRSA 1ZAIA 2H3BA 2JGYA 2YCEA 3KVJA 1JRCA 3TFXA 2E5BA 2E5CA 1I45A 5HINA 4RKAA 3OVPA 3F4WA 2AAMA 1JJKA 1FWSA 3GAKA 3TU9A 3NVTA 5HMSA 1QFEA 5G5IA 2Z1BA 1UBSA 4M6PA 5CPOA 1SW7A 3KXQA 3GNDA 2ZZ3A 3L68A 2X1TA 3F03K 3M44A 1RD5A 2DZSA 2BX7A 4IMCA 5LHFA 1YADA 4MJMA 4KFPA 4YL2A 1QO5A 3C3NA 4NZFA 5C54A 3UPBA 1U5JA 4DBEA 2DZTA 2TPSA 3B4UA 3WK2A 1OHLA 2C3ZA 1OX5A 3DAQA 3GVGA 1EB3A 3H55A 2WNNA 3N3MA 5FEZA 3CIXA 5D03A 3HQ1A 4HNUA 4IGHA 4N9BA 3UZJA 2Q8ZA 5EL1A 5G1YA 3PF3A 4HN4A 4TR9A 3GDMA 4HSOA 1IXQA 5G2WA 5EBUA 4JTHA 3TC7A 5E93A 1KM5A 5I3JA 1GEQA 1UASA 1NSJA 4IMEA 4TIMA 1LM1A 4IMGA 4EF9A 1FCUA 1HG3A 3LHWA 1LYXA 1TPVA 2C13A 1H7RA 4NT0A 3A22A 1XDLA 3C2FA 4E2DA 3UXDA 3W1TA 4RZ6A 2E09A 3W9ZA 2NWSA 3GR8A 4RR4A 4ZQRA 3T78A 4LWWA 1PV8A 1W0MA 3SR7A 5F1UA 3W86A 4FIQA 1ZAHA 4ML9A 3O15A 4O54A 5D2XA 2VEKA 3C2EA 2GQ8A 5C6MA 2CWNA 3NEVA 4GXMA 1XUUA 1OVDA 2C16A 2HS6A 1GJPA 1EIXA 3HGSA 3O6DA 3G18A 1F73A 4WXZA 3N14A 5CG7A 4Z1AA 4UTTA 1LRQA 3QYQA 4MPQA 2H3DA 1JUEA 3BVJA 1KTCA 1JCNA 1M6JA 1LDCA 4HPXA 1KM3A 3R8RA 4JICA 4DBDA 4FNUA 1JQXA 4DO5A 3BARA 3BG5A 4WY0F 3L0GA 4XBKA 2V30A 2D73A 4MOZA 4WUIA 3A5FA 1QO2A 4EOUA 3LV5A 3O1NA 3E9AA 3QSRA 4GFSA 3MP4A 4WX2A 4CCEA 5AHLA 1TTQA 4GUFA 3TNOA 1SSGA 2J6XA 2VEMA 3OIXA 1VJIA 3W74A 1C9DA 3W1RA 3HOJA 4O4WA 3EKZA 3UWQA 1S5WA 5D2TA 2YX0A 3M5ZA 1CX9A 1YXDA 4Q32A 5DCDA 1Q6RA 4OE7A 1SR9A 4ZQMA 5CZ0A 3LBMA 3GX9A 1S5VA 1S5TA 1YTKA 1H1YA 3QMRA 3O05A 3W7IA 3W72A 3NQMA 2GVJA 2E77A 4JYDA 1VCGA 5U4NA 4GJ1A 1BWLA 3THAA 1YYAA 5FI8A 4S1FA 3R2GA 3P84A 3TROA 3C2OA 4X3ZA 4IUOA 1OJXA 3I7QA 1B57A 4JTUA 4C1LA 2A7RA 4EVZA 2V5LA 4JEQA 1W5NA 2J27A 3O63A 2B7PA 4Y6GA 3TE9A 4IPIA 3L9CA 1HO4A 1AW1A 3KVMA 5DBUA 2FB3A 5H91A 5LKYA 3GXNA 5L9FA 3CLMA 2V81A 3C2VA 4LVBA 1JR1A 4K8HA 1O60A 3M6YA 4WY0A 2WOQA 1B4EA 3LXAA 4MLJA 3R5EA 2FB2A 1SZEA 1W3IA 4QJ1A 4MKNA 4MY8A 1TSIA 5KITA 1KW1A 2VELA 4AH7A 2Y63A 1WV2A 1WQ5A 5FF7A 1T99A 1KM2A 3G0SA 3MBDA 2QCEA 1VGAA 1F76A 1LP6A 2ALDA 4FXRA 1MEWA 1ME7A 1RQEA 3QEZA 4FEZA 4O13A 1OK4A 2BSLA 4MY1A 3FKKA 2NXIA 3ELFA 1O94A 2VENA 3N9RA 3BG3A 4AWSA 2Q3OA 5CSRA 3LTPA 1ICQA 1SUXA 3CWNA 3ZR4A 5I3IA 4LU0A 1K3UA 1W56A 1QPRA 2OMAA 5D02A 4TMBA 3PUDA 3M47A 4A2RA 4MFDA 4BI7A 3P5ZA 3B04A 3A21A 1XL9A 4MJZA 1G7UA 1EA0A 1W5MA 1WYIA 3LB0A 5DY2A 1WA3A 5HJLA 4IMFA 1THFD 1GPWA 1DV7A 1FBAA 4YCPA 1NAL1 1D3HA 4M6VA 4IX0A 3CEUA 3UZ5A 1VYSX 1W1ZA 4AF0A 3HO8A 4IXXA 4RXFA 3PSWA 3W1PA 4JD4A 3PM6A 2WSRA 3G1VA 5D37A 2CZDA 1EUAA 1VHCA 3W23A 2E6FA 3STGA 4RLIA 4ICNA 2YFNA 2YPIA 3PUOA 3RLVA 1TPH1 1M7OA 4N4QA 1FXQA 3RK8A 3R89A 4Z0JA 3QM3A 4O10A 1ZNNA 2CLFA 2JKAA 4NJKA 1VS1A 3KVLA 3LI0A 4JNMA 1W8SA 4Z1DA 1DOSA 3U8GA 4B5NA 3TQKA 2G95A 2QCCA 2W79A 1G4TA 1GQNA 3FYOA 3WK3A 2OX1A 5E0KA 4AAJA 2OZ0A 2QDGA 1JQVA 3FYPA 3PWAA 4PL2A 1VPXA 1XC4A 1SW0A 3P82A 3HPZA 3CT7A 5DCBA 2DJLA 2PRLA 3GKFA 2QCLA 4O1BA 1Z42A 3SI9A 3C61A 1SQ7A 1NVMA 1F7BA 3P8IA 1YTDA 4O0KA 5FF0A 4OV9A 3NYZA 5DLCA 4UTUA 1TIMA 4BI6A 3QZEA 2J24A 1BTMA 4R34A 2Z6IA 3VCRA 3NO5A 2Y6ZA 3OBKA 5CZTA 3SIZA 1J5TA 1FX6A 1LRTA 1TYGA 1W37A 3NQAA 4I7WA 4NNBA 4FNTA 3ATYA 2C14A 3PBYA 4O16A 2RDUA 3NM1A 1HO1A 5LZLA 1WAUA 4CNPA 4O4VA 1F74A 2VFDA 4CQ9A 4FNQA 3W7CA 3KHJA 4LVGA 1U83A 3LLDA 5D04C 4GE8A 3EX3A 5DCEA 1H7XA 3IIXA 4ZQCA 5F4XA 3S42A 3G1SA 2Y89A 3T7VA 4K7YA 4R33A 4MFEA 4FX7A 3M1ZA 1HFBA 3BGGA 2DP3A 2J9XA 4MZ1A 4A29A 1H51A 3MYOA 3EX4A 8TIMA 4N2YA 4AF0B 1I2OA 3D0CA 4ZMGA 4Y8FA 2NWRA 3BPWA 1JRBA 4AXKA 2HTMA 2RDTA 1T96A 2ZDRA 2QR6A 3W2NA 1TB3A 5AYXA 3M0ZA 3M5YA 1TPWA 2A5HA 3B8DA 4O28A 3BLEA 1ML1A 1LOSA 2JGQA 3NQGA 1KFCA 4JTKA 5CPNA 1EEPA 4DF2A 4BFAA 1XUZA 5CZJA 5TBOA 5K7JA 3GAYA 4O57A 1G4EA 3JR2A 4UR8A 3UQNA 2ZRYA 2B7NA 2XN1A 3M9YA 1FDZA 1PIIA 5D05A 2X16A 1RR2A 5G2HA 1H7NA 3PBWA 2Y7GA 3IGSA 4TU1A 3PG9A 1F6KA 3Q94A 2NX9A 4LV9A 3NG3A 4XTIA 1OFAA 3W2UA 4NU7A 4I9AA 3N2MA 1TPEA 3RU6A 1C29A 5K9XA 4UTTC 2ISVA 4RJEA 3NOEA 3NQCA 1A5BA 1OX4B 4E0CA 2ISSA 3IRDA 1KM4A 1FY6A 4EIVA 3LCGA 2E6DA 2DJXA 3NA8A 2PRHA 4ADUA 2PURA 1Z44A 4BF9A 3G1XA 5EKYA 5EA9A 2YFOA 2A2IA 1SO5A 2H6RA 1ZCOA 3B03A 1YDVA 1VHNA 2I14A 2UV8G 3IIZA 3ATZA 4O0ZA 4CQ8A 1WBHA 3EB2A 4FO4A 1XFBA 1YXYA 1F5ZA 3TKFA 1W5OA 3LCWA 3TSMA 3NQ2A 2BXVA 3GXTA 1ZY9A 3SGZA 3HG5A 3W3OA 1LORA 4XBSA 5LNSA 3TFCA 1TPDA 4JDYA 3W7QA 2QCDB 3DFQA 1CI1A 4I7UA 2Y70A 2PCQA 3P8JA 2C15A 3O6CA 5D2VA 3S5ZA 3W76A 1Z48A 3W84A 3B0UX 4O1DA 3CU2A 3GDRA 2WPBA 3KRZA 4JY8A 2Z2UA 3UWZA 1RPXA 3IVTA 4LY8A 2QEZA 1GTHA 4U28A 3TSBA 1Y0EA 4HNTA 3I7SA 2Q3RA 4UTWA 2CLEA 1S3HA 1OFBA 1SZNA 2VFHA 5T26A 2CLOA 4LS0A 1OYBA 3W7JA 3G3MA 1AW5A 2C0AA 4MYXA 4ORMA 2QUUA 1XCFA 2P0OA 3NQ6A 4N02A 4NX0A 5C55A 4XKYA 4ADTA 2BLEA 1UCWA 1BKSA 3NL3A 3W87A 4MYAA 5SWUA 3HIJA 3TXVA 2DZXA 4BK9A 4Y9AA 3G22A 1YPIA 2XFWA 4QNEA 1W3TA 1UJPA 2EAWA 2CZFA 3RLUA 3EX2A 1TV8A 4FNPA 4LOCA 1FCVA 2X1RA 2C18A 3NQ7A 4Q33A 3GDLA 2VEIA 1AMKA 1SFLA 3KRUA 2B7OA 3ANYA 3DHDA 3PBUA 1F05A 1WBJA 3H54A 4IQLA 4UMAA 2P10A 1JUBA 1V5XA 3RMJA 3W7RA 3IVUA 3VE9A 1I2QA 1R30A 4ZQPA 1SW3A 2Y7EA 1O4UA 3EWBX 5IM51 1I4NA 5KTLA 1R2RA 1W3NA 1ME9A 2Z6JA 4KWWA 1CW2A 3E49A 3IVSA 2X2GA 3LRMA 3EWUA 4OU1A 4O14A 3IGUA 1Q6QA 3U2OA 3EXSA 1EWDA 1KFEA 3W1MA 4FF7A 2VXNA 1GVOA 1G69A 1ZAJA 4QM1A 5GVJA 4GUHA 1KLYA 3S1UA 5K4ZA 4IOTA 4JTEA 3LCLA 5DBTA 2CFFA 2PC4A 2QJIA 3NAVA 4FXSA 4A21A 4S2CA 5EY5A 5LHEA 2YW4A 5G1TA 1AL8A 1QPNA 2Y7FA 4FHAA 3SGUA 3TXZA 3W75A 5FEPA 1IF2A 1O95A 3B06A 4LUIA 4AEOA 4TMCA 1WX0A 1QNVA 3GNNA 4LTSA 3PG8A 2FQIA 4OGZA 1SSDA 3KOFA 4CNNA 3DENA 3CB8A 1PCWA 4NJIA 1N8FA 5HUPA 5AC7A 1VRDA 4MUZA 3HPXA 4DPQA 5AC8A 4HT3A 3DKLA 3HJZA 2OJPA 3RFAA 3BGJA 4A2SA 1UUOA 3ZWSA 1SPQA 4L4MA 3UWVA 1Z41A 2RH9A 3W1QA 1FWWA 2OT0A 2GOUA 3P62A 3QPYA 4ZVJA 2NX1A 4O1AA 3W07A 3AJXA 1AL7A 3HG3A 1MXSA 1HTIA 3P67A 3O8AA 3HBLA 3N19B 3RF9A 1XXXA 2V2HA 3CEPA 3A9IA 3HPSA 2WNZA 2Y85A 4PL1A 5CSSA 1K7FA 2V82A 3N9SA 4M7TA 4UFKA 2ZFAA 4XQ6A 3M7WA 3LOTA 4DO4A 1FUYA 3F4NA 4FNRA 4JXCA 3UYCA 4FX6M 5A5WA 1VCVA 2A4AA 4BWLC 4A3UA 3QF0A 1AK5A 2DZWA 4OWGA 5AHFA 5C5YA 4PTNA 3CHVA 1WOBA 4ZQOA 2VFGA 3W7DA 2BTMA 2QUVA 1FXPA 3L5AA 3P80A 3N73A 1KV8A 3L21A 1FWNA 2JKEA 3WJYA 2E6AA 4UCGA 3G8RA 4I7VA 1R46A 2TSYA 4IMDA 3NL6A 1IXNA 1QOQA 2LLEA 3W88A 2Y62A 1GG1A 5AOUA 1VLWA 1MZHA 1OG0A 1NF7A 1BEUA 1GTEA 3LHTA 2QUTA 2YXGA 3NM3A 3USBA 4JTTA 3NPUA 5I3HA 2R91A 2GJNA 1ZFJA 1PS9A 2A0NA 4WJEA 4O1CA 4HIBA 2ZQ0A 1R2SA 1M5WA 1GVFA 1NFBA 3L5MA 3LCXA 2KZHA 3TQ0A 2ABBA 1RVGA 1EWEA 3V75A 1GYNA 5IBXA 3BLIA 2ZZ5A 4DQWA 3L5LA 1TPFA 1GG0A 1H5YA 4JX5A 2BWGA 1DBTA 4ONVA 3MI3A 4O17A 3W1LA 5KINA 1GVQA 5CPLA 1JCJA 3S0CA 4E2BA 1TJRA 3C4UA 4M7SA 4D2JA 2JKPA 3W1XA 2XN2A 2VEPA 4KWVA 3W73A 3NQDA 4GBUA 4Z1BA 3W7KA 3ABSA 3G3DA 2CZEA 3EX1A 2A7PA 4JDBA 2CLIA 4UTJA 2DZVA 1VYRA 5F2IA 4NNCA 4KKXA 3DFOA 1K03A 3LX9A 3QMSA 5KZEA 1IIHA 3KRSA 4LC8A 5HQEA 1TQXA 1DQWA 4NX5A 1DQXA 1OFPA 1L9WA 3OHIA 3HGRA 2G97A 1SO4A 1EP1A 3W2KA 3R13A 5TQLA 4O12A 4O19A 1TV5A 5F2GA 4NXKA 5HWNA 4UC5A 3W7PA 3ZFHA 3TW6A 1SO3A 2V9DA 1YLVA 1C8VA 3HG4A 3W7EA 4ZZ9A 1O5KA 5CGQA 3W7GA 5HWMA 3W1NA 2JK2A 1X7FA 1H60A 4IWWA 3E0IA 5D33A 5AYZA 3AO0A 1IXOA 1A5AA 3B0PA 3VKJA 1OFQA 2CLHA 5KMYA 1AW2A 3TK7A 4WY0B 3TX9A 1NEYA 4K39A 4NJJA 4UNLA 3OG3A 5EPDA 1QAPA 1WXJA 3GDKA 4HSNA 1QCWA 3DBPA 4CQAA 3LCIA 5AHEA 3STCA 2V2CA 3DU0A 2ATSA 1NF0A 3O06A 3G1HA 1PCKA 3WJSA 3BG9A 4JGDA 4UFLA 4X9SA 2VFEA 3NQ8A 2RFGA 3GIYA 1LCOA 3LXBA 4O50A 4BWLA 4UFMA 3A23A 4L4LA 2Z0IA 4UFHA 3W1AA 1GOXA 4E38A 2WQPA 3MJYA 3HGJA 3W83A 4UMCA 4JS3A 4UTWC 5LGZA 1A53A 4DEFA 1VQTA 2YR1A 3TJXA 3EKLA 3A5VA 2CLMA 4N4PA 4WXYA 1LBMA 4WZHA 6ALDA 4CCCA 3FJLA 4LUJA 1KLZA 1LRNA 1KFLA 4AWUA 1A5CA 2QKFA 4K37A 4O11A 1LTDA 3UNDA 2ZTKA 3EXRA 3SFKA 1TTIA 5A8GA 2E68A 1E51A 1FWTA 4IXHA 4NJGA 1J2WA 3CPRA 3IGXA 3W22A 4TO8A 1SZFA 3DXIA 5HUOA 1H7PA 3VI2A 4LC6A 2IQTA 1K7EA 1W5QA 1K8ZA 2HS8A 2GPTA 3NQFA 2ZZ1A 4XUGA 4RV8A 1R2TA 3LBCA 4KFNA 3SZ8A 2GVGA 3MP5A 3SSJA 4PODA 2ZZ2A 1G4SA 3ABQA 2E6YA 3E12A 4UTKA 2CZ5A 2R14A 2FPVA 5J5RA 3GKAA 4UIOA 2AGKA 4JYFA 3GR7A 1GYLA 3DFSA 4GUJA 3BV4A 2QJGA 4W9TA 4ALDA 1X6UA 5LNVA 4H6KA 2FIQA 4WD0A 1KM6A 1P1XA 4UMBA 3NDOA 2C1HA 2QCHA 2J88A 2F7FA 1PHQA 1VH7A 4PC8A 1LBLA 3OA3A 4S2BA 1TRIA 2RDWA 4JTJA 1X8FA 3DZ1A 3HF3A 4AHPA 3MUXA 2GJLA 1I2RA 3L67A 3PS7A 1P0NA 4M5PA 3GYEA 4IJBA 4OHQA 3EXTA 5J5DA 2O7QA 4U4MA 5KSWA 3OEXA 4NUWA 3G1FA 3W85A 1EPXA 5HR7A 1W31A 1DKWA 4QISA 3FIGA 4TX9A 3TAOA 2AQWA 5I3KA 4UTHA 4AB4A 1P4CA 2ZCGA 4MIMA 3LHVA 3PB0A 2V5BA 5DXXA 3ZS4A 3M16A 1KA9F 3S5YA 1PE1A 1H50A 4HHPA 3LI1A 5FF4A 2H8ZA 3CC1A 3PVFA 3INPA 2ZA1A 4POCA 2NUXA 1OFRA 4GUGA 1Q45A 3W1UA 3S8HA 4R53A 3TCEA 3U6WA 2YSWA 2Y61A 3VE7A 3TA6A 2QCNA 3W7HA 1EP2A 2YW3A 5I3GA 3LERA 5MHBA 3S1XA 1KFBA 3LRLA 3EWXA 5K9CA 4YMZA 2ZBTA 4PCFA 3ABRA 3BW4A 3P60A 4MZ8A 2ZRVA 3SJ3A 4YXGA 4OBTA 4PA8A 1QR7A 4QSHA 1F6PA 3UWUA 1J4EA 3IIOA 1FCQA 2BZNA 2GUUA 4GUIA 4RZ4A 2R8WA 1ICSA 1TJPA 3S5OA 2CLLA 1MO0A 1N55A 4FIRA 3QW4B 2ZRUA 3G8EA 5CPMA 3MYPA 3TAKA 5K3VA 4UFIA 3LRKA 2RHGA 1TPUA 3TIMA 3TMQA 3GZ3A 3EWZA 2QCFA 3G1YA 4MY9A 5LSMA 1YDNA 1H7WA 4JIQA 1JCLA 1UUMA 1MEHA 5BOOA 5K4XA 3M5VA 4AHOA 1K8YA 3N2XA 5DELA 3OVRA 4Y90A 2PE4A 3TH6A 3TSDA 4JTGA 3TQVA 3W71A 1G4PA 2EF9A 5K2ZA 4NZJA 1K8XA 3EWYA 1JULA 2G5WA 4Z0SA 4HNNA 5ABTA 1YTEA 1G6CA 3T44A 3MWAA 1G7VA 1VCFA 3P81A 3LHYA 1VZWA 4NNAA 4UNKA 4MLRA 2ZTJA 3NXFA 4X2RA 1HUVA 1VR6A 2WNQA 4O53A 1D3GA 2WKJA 3LLFA 4K6AA 1T0OA 3DI0A 2WSQA 3LV6A 2ZA2A 3GK0A 3QH2A 1KBIA 1JVNA 2QAFA 4JTIA 3DI1A 5IBXC 3S1WA 3C0JA 2NUWA 3G0XA 5HR6A 4CLMA 4LV4A 1FDYA 5FF2A 1UB3A 5AB3A 5LNRA 2TYSA 4RXGA 4LNYA 2CLKA 3TDFA 2QCMA 6TIMA 2JBMA 3PSVA 3S6DA 3M41A 1JUKA 1VC4A 2VC6A 1EP3A 4UXDA 2HSAA 3EX6A 4RCXA 3ZWTA 1VLIA 2W0UA 4N9EA 1K02A 3T55A 3QFEA 5AFDA 1KM1A 2TRSA 4ORIA 3NL2A 3IIPA 1PL9A 3STEA 2ABAA 4MZYA 3TJLA 3PUEA 1QWGA 4R7JA 2J9YA 3W2JA 1L6SA 5G4WA 3H53A 4PH6A 1XBZA 5AHIA 1TTJA 2A21A 2X30A 3I7RA 4J9JA 3QQ0A 3CWOX 3S1VA 2NLIA 2ZRXA 1A50A 5BMXA 1V7YA 5D2YA 2WV8A 1JCXA 1LROA 2NV2A 5TIMA 3G24A 2G96A 4XKYB 3CM4A 4HNVA 1B4KA 1H61A 1QDSA 2TMDA 4NQ1A 3UPWA 3NPVA 3NZRA 2YYTA 2OT1A 3P5YA 5FEWA 3MI2A 5H2ZA 3PULA 5BMWA 4O15A 4NXSA 3QSTA 4M6QA 2CW6A 3GB6A 3STFA 4LT9A 2ZRWA 3FKRA 2EPHA 1TO3A 1OYAA 4A22A 2YYUA 3SW6A 3OVQA 1O5XA 4GNJA 3WJZA 4N9DA 3NQEA 3BW3A 1SU5A 1D9EA 3QMTA 5U7SA 1FQ0A 1K7XA 4OQVA 1RZMA 4C1KA 3O6YX 3MI6A 4EF8A 1TRDA 4IX2A 2ZZ6A 2NV1A 2FDSA 2B0MA 3S5NA 1TMHA 3UXAA 3KX6A 4JTSA 3QJAA 1RQBA 4RK8A 2A1YA 3O16A 1N7KA 3W7OA 2YDAA 1IGSA 3P7YA 5BW6A 3UD6A 1XBVA 4K38A 4M19A 3LDVA 1LOLA 3GDTA 5EMUA 1LBFA 1XBXA 5BRBA 3E02A 3FA5A 3WJXA 1BWKA 1XM3A 1YPFA 3UY8A 1WDWA 1OYCA 4WOZA 3UWYA 1JCMP 3W6YA 3YPIA 1LZOA 1TV7A 3HG2A 2FPYA 1TCDA 4O8RA 1EX5A 1OFDA 3C56A 4O52A 3FJ6A 5KZMA 4AVFA 1ALDA 3ABOA 2A7NA 2V8ZA 3PBVA 3W2LA 5F1VA 3LHZA
chains in the Genus database with same CATH superfamily
3GTIA 1MWOA 4G1KA 1OM0A 5G4EA 2QCGA 3I6EA 2NQHA 5CKSA 3S4TA 1BXCA 3UY7A 2VOMA 5HMEA 3NQVA 1MQRA 2Z1KA 4YLWA 4WIWA 1ZP4A 1R7AA 5B7ZA 3KVKA 5F2MA 5GJNA 2PP3A 3IV3A 3N15A 2FMNA 4S3BA 3FVDA 1IIGA 2A85A 4FLQA 5HPCA 3AIEA 4N6EA 1OGSA 2WHJA 3XIMA 4HN8A 2KX9A 3PPCA 3BLOA 4D6CA 4P61A 5CLTA 1JZ4A 4JYEA 2GL5A 2WWDA 2FFCA 1S2UA 3GTHA 4I90A 3DKJA 1XBYA 3DGRA 4I3GA 1XCWA 1WE5A 3VIMA 1X7IA 3THQA 1ISYA 3MDUA 1TX2A 3GNOA 4OV4A 4Q4SA 2PODA 3DFTA 4LVDA 3VDBA 5EYWA 4S23A 4N6FA 2PFHA 3LTYA 3KWXA 5F2LA 2YB1A 5LIUX 3FOKA 3WMBA 3B9OA 3OLGA 4G7EA 5HWJA 3B0XA 4JN6A 3WBXA 1GOMA 1VIWA 2NUYA 3F4CA 3VDAA 3KCJA 5AN7A 4Q4MA 3CH0A 1NDZA 4PBFA 3MHGA 2DW7A 3L4ZA 2QF7A 3MHFA 3MO7A 3GD6A 1AD1A 1R3RA 1NH6A 5AYYA 2PTXA 1KFJA 5DY3A 5ABFA 3QRHA 1IXPA 2D20A 1VFUA 4IQEA 1BHGA 4O1FA 3C2RA 3DH7A 3C0LA 3TC6A 4B2DD 4U3AA 5LXEA 2WMIA 1M53A 1TPB1 3AS3A 2AMXA 3MSDA 3EMZA 1JYWA 1UD2A 4XVDA 4LBSA 2CPUA 3QC3A 4DLFA 3PZQA 2XIQA 2A6LA 1PPIA 4RNIA 1QPQA 2UBPC 4LVAA 4B3KA 1M41A 4D6GA 3SQSA 5L6UA 3EWDA 3LZ3A 3R11A 1E6SM 3F5LA 1UC5A 4LB3A 4MJ4A 5D38A 3M5XA 5JBFA 1ZENA 4A3YA 1I2PA 3UR2A 4HOWA 4DO7A 3EEGA 2J79A 4H9ZA 3MQTA 1QPOA 2DORA 2QCDA 2NX3A 1G0CA 1OABA 1ZRQA 3TZNA 5D09A 1AUSL 4DELA 3U57A 1Q3NA 3CV7A 1GWJA 1W3KA 2WHKA 1XYCA 2OKOA 3N6QA 5GJMA 4C1NB 4TVUA 4N9CA 1DJXA 4ZB5A 2XN0A 3WNMA 1X1ZA 1W54A 4QE1A 4J3XA 2VC5A 1B9BA 1E55A 1U33A 3PPHA 3IRSA 4PMNA 2G8ZA 4HA1A 1HKJA 2O9PA 4UUIA 1OG6A 3AIUA 1PHWA 2C8NA 2J9ZA 3VZXA 3ZVIA 1TX0A 1OFOA 4U31A 3MP3A 5FJJA 4W89A 2Q71A 2W61A 1Y5XA 4QITA 3ZLGA 4IJRA 1PTAA 3VIGA 4LY4A 4DUXA 1M01A 4LH8A 2XWEA 3JU2A 2ESCA 3KAOA 4JL2A 3F1QA 3BLPX 1YXCA 5EGRA 4JX6A 3WF0A 4IIEA 1Q2SA 3FYYA 5G4HC 1R9ZA 1WUFA 3MC5A 2E1DA 2WO5A 1C93A 5HOSA 3QY8A 3BO9A 4JNYA 1B3OA 2EG6A 1HJWA 4C6NA 1AD4A 4WOQA 2V3DA 2QJMA 3IARA 4GC4A 5G2IA 4TTGA 2UY2A 4WQ6A 2PDWA 5KZDA 4UR7A 1TQJA 2P50A 1Q2RA 1C3FA 5GPRA 8RUCA 1BG4A 2ZE0A 5FL0A 1UKOA 4P8XA 1GZJA 3WUBA 1R6WA 3I65A 3KCOA 3BH4A 2JE8A 3GLCA 1KR0A 2X40A 5DEZA 4AX6A 4DLMA 1FDJA 5CGTA 2WM1A 2FH8A 4XTDA 4K68A 3LGEA 3F5KA 4HA3A 4FOJA 2BVTA 2OTDA 2VFFA 4PUJA 4BHYA 3VNZA 1UD3A 2YCEA 5TAOA 2E5BA 3VIPA 1CDGA 1JJKA 2VC7A 3TU9A 1G9HA 5C9WA 3SB0A 1H2JA 2Z1BA 4XAPA 3GHRA 4ZO7A 3PZOA 3GNDA 3LBOA 2ZZ3A 1CENA 1V93A 3AALA 3MVTA 1T6MA 1RD5A 2DZSA 5ENLA 5LHFA 4YL2A 4XISA 1U5JA 3ALGA 1XLHA 3L4UA 4EXBA 1RA5A 3SN4A 3CPGA 1OHLA 2C3ZA 5CZKA 5JIPA 1EB3A 3H55A 5FEZA 4AZBA 1JGIA 1BLIA 3SCNA 3UZJA 2FHCA 3QY6A 3DUGA 2Q8ZA 5EL1A 4JN7A 4MJ2A 5E93A 1KM5A 5I3JA 4IMEA 1LUCA 1EYEA 3S2LA 3ZVHA 4JTDA 1CB2A 4DYKA 4RZ6A 1A4LA 1N82A 2NWSA 2G41A 3TJ4A 3E5PA 4ZQRA 4LWWA 3SR7A 3W86A 1ZAHA 1UD6A 3O15A 4KIRA 2WPGA 3GC2A 2GQ8A 3NJ3A 5C6MA 3NEVA 2WJDA 3M7SA 1XUUA 4AC1X 1ITXA 1F73A 5RUBA 3N14A 2XVNA 4Z1AA 1UKPA 1LRQA 3QYQA 3AIRA 1JUEA 3RR1A 3BVJA 1KTCA 3S1GA 4NAEB 1W1IE 2ZE3A 1JCNA 4NL1A 3UCDA 3RCYA 1JQXA 4DBUA 4NSBA 3BARA 4DO5A 3BG5A 3MU7A 3FA4A 3A5FA 4EOUA 4F2BA 1EDTA 1E40A 5JU6A 3E9AA 3PP7A 3N13A 3MP4A 4GGBA 4GI8A 4EPDC 4GUFA 3HOJA 4O4WA 2QUMA 4XD4A 1S5WA 3WLNA 1E0WA 1YXDA 3ES7A 3NURA 3IV8A 1ONXA 1SR9A 4MUPA 2W3ZA 1US3A 4TXEA 3U4AA 3AC0A 3OZMA 3O05A 3W7IA 2ZXAA 3W72A 1RPKA 2A3EA 4H04A 1JYNA 2WWCA 4HYWA 1FP8A 4AIOA 3N2BA 3B9NA 3LSCA 7TAAA 5C7VA 1XSIA 4H7ZA 5FI8A 3CAVA 4V28A 2OYKA 3R2GA 5EMLA 4XKMA 3P84A 3QV8A 3TROA 1LL4A 3C2OA 4JTUA 5FOOA 1DPMA 4EVZA 2V5LA 1OCJA 3WF1A 4JFVA 3TE9A 4IPIA 4L6OA 3L9CA 2QLYA 4M8UA 3KVMA 5CPTA 5DBUA 2FB3A 5LKYA 3T1GA 3GXNA 4JAWA 2UY4A 2DPEA 3MY9A 5L9FA 2ZICA 3DHUA 5D9OA 1B3YA 3M6YA 4WY0A 4M6UA 1CLKA 1B4EA 1GUVA 2QULA 3AMCA 4MLJA 5CLWA 3GS6A 3R5EA 3GG8A 1W3IA 4QJ1A 3DFYA 3BWWA 1TSIA 4AH7A 3WH5A 3T08A 1QHOA 1V0NA 3MBDA 1QBBA 2QCEA 1F76A 2Z1XA 3VZZA 5I09A 1MEWA 1ME7A 1CT5A 5CJNA 1QU4A 3XINA 4H83A 4H9XA 5CBJA 4ZCWA 1V0KA 3BG3A 3CUXA 3WYZA 1E56A 1ICQA 1SUXA 3CWNA 2PSNA 4LU0A 3WF4A 1K3UA 3KW3A 4H01A 2OMAA 1UP0A 2JIEA 3M47A 1PX4A 2O0TA 2P0IA 3A21A 1CTNA 4KEMA 3S47A 1HKMA 1QI0A 3OP2A 1WYIA 1TZ7A 3LB0A 5DY2A 1THFD 4YCPA 4M24A 4Y9NA 3CEUA 2YLLA 3UZ5A 1VYSX 1W1ZA 1XLEA 2WCAA 3BUVA 4XSLA 3ZMRA 4JD4A 3PM6A 4K3ZA 2BVWA 3KS5A 4PEEA 3ID7A 3H2OA 1A5OC 2YFNA 2XVGA 2VZTA 3R89A 4NJKA 1VS1A 1W8SA 4Z1DA 1RY8A 1DOSA 3AUJA 1BVNP 4DI8A 3TQKA 3UNTA 1K77A 2W79A 3HV8A 3IS4A 4RE3A 1VP5A 2OZ0A 5ECVA 3PWAA 4PL2A 2J7HA 3URNA 3F2DA 4OUEA 2DJLA 3JW7A 3U48A 1S2VA 2PRLA 3GKFA 3CHFA 3AYRA 3SI9A 4E6MA 3CPUA 4UTUA 4BI6A 1WDDA 4E3VA 2J24A 1BTMA 3UG4A 3SAZA 2Y6ZA 4LB4A 3IPWA 1DWFM 1LRTA 2VX6A 1V0MA 3VYLA 4AG0A 3VIHA 3I6TA 3UXKA 3ITXA 1ZUAX 5EU9A 3ATYA 5AC5A 3PBYA 4CNPA 3WENA 4US5A 4QEHA 3KHJA 1DJYA 1MXGA 3LPFA 3MUAA 4LQ1A 1E15A 1H7XA 4ZQCA 3VFCA 1NWSA 1WDSA 4FP1A 2VDGA 4YYFA 3KUMA 3CS2A 5CSUA 3KM8A 2PDHA 3RPMA 3OZOA 1W9UA 2D69A 3EX4A 3GBDA 4N2YA 3NIYA 3IAQA 4ZMGA 3TTYA 1QJWA 2QPXA 4R7WA 2OFJA 3ITLA 1J0KA 1TPWA 3VMNA 3AU6A 2EJ1A 3NQGA 3GVWA 4JTKA 4M1RA 4KS0A 4ZE5A 1EEPA 4BFAA 1XUZA 4QQUA 5CZJA 5TBOA 3UJRA 2VC9A 3M9YA 2O9RA 1W17A 1OD8A 1RR2A 1H7NA 3SCVA 3F4DA 3AS1A 4S3JA 1IE7C 4JCMA 1KXVA 4E5TA 1V3IA 1F6KA 2Z29A 3BOLA 3W2UA 4EKJA 4NU7A 3NGFA 2YL9A 3IACA 4CNSA 1GQJA 1C29A 2XVKA 4UTTC 4FLRA 3KDOA 1JPMA 3NOEA 5AECA 1EO5A 1OX4B 5I0DA 4IISA 3REQA 1FY6A 3M0JA 2FZBA 1OGGA 1E3ZA 4ADUA 4NZ3A 1BQGA 3R10A 2C7FA 1M7JA 4ENLA 1L8PA 1E9ZB 2CBUA 2A2IA 4D8AA 1I9CB 1SO5A 3HFTA 3N18A 4Y9MA 3R8HA 4KERA 1YDVA 1DWJM 3V1HA 3IIZA 4O0ZA 1XIFA 4GJIA 1P7TA 4BQ5A 4CQ8A 2E28A 2E9MA 2F38A 2P3ZA 2AGTA 1ZP3A 4MNKA 2BXVA 4I9JA 3SGZA 4KETA 1ZJHA 2OU4A 4D6EA 2PCQA 3P8JA 3O6CA 3MUIA 3W76A 4HGXA 1Z48A 3GH7A 3W84A 3DN5A 4GQGA 2WPBA 1E1EA 1RCQA 4JY8A 4JFTA 4PTDA 1RPXA 4ACYA 3FXGA 2QEZA 1Y0EA 4RE4A 5CH9A 1S3HA 3T2PA 4KEVA 4AVOA 4IIFA 4L6DA 5T26A 4LS0A 2IKGA 3BSMA 3TC3A 1Y7VA 3PAOA 3W7JA 2Y5EA 3PNUA 2JALA 1BYBA 4C60A 4ADTA 4Z2HA 3APTA 3QLDA 3WD4A 4AVNA 3TXVA 5A6BD 2PDKA 4QDMA 2DZXA 4BK9A 3G22A 4DJDA 4OTKA 1UJPA 3GSMA 4GH1A 1FCVA 4Q33A 3M0MA 1ZU8A 1SFLA 1QNQA 2PAJA 3ANYA 1QI4A 1TWSA 2CKSA 3H54A 1WB0A 2WC7A 1KBKA 4PCTA 1LWIA 4DBSA 5BXTA 3RMJA 4E2OA 3QZAA 3VE9A 3EB3A 3TTSA 3UG8A 2CXEA 1SW3A 1O4UA 1C92A 1I4NA 1F8MA 2XIBA 4GNKB 4J27A 3WQFA 3NZGA 1A5UA 4AZ5A 2X2GA 4HPHA 2YA0A 1PEZA 1SFSA 2HBVA 3U2OA 3VGFA 1MXDA 2HWGA 5PTDA 4DJED 3AWOA 1X97A 1G69A 1CBGA 3RO6A 1ZAJA 5HK4A 1TUXA 3ZLFA 4GUHA 3K2GA 3VGDA 4A21A 3NAVA 4S2CA 5EY5A 1AL8A 1Z89A 3TXZA 1IF2A 2A3HA 5C7HA 4LUIA 2QF8A 4LX4A 4OGZA 3CO4A 4A3RA 1WZKA 1PCWA 5HUPA 4NG3A 2XHYA 2BV9A 4EXQA 5CC5A 2V5CA 4JN8A 3POCA 4LUSB 2V3GA 3UR5A 3BGJA 3PJXA 2RH9A 2WQDA 5HQMA 1FWWA 2XG9A 3EPMA 4GFIA 5B80A 3P62A 4ZVJA 1KB3A 3AJXA 3FEQA 4B5VA 3WLMA 2DT1A 4JNZA 5A94A 3P67A 2ZVRA 3O8AA 3AXKA 1QWKA 2V2HA 4OBSA 4AD1A 3DC8A 1IHIA 4CGTA 2OSXA 4LUTA 3HPSA 3PTQA 4AU0A 3GXMA 3WEZA 4EPBC 1K7FA 3N9SA 4XQ6A 2WCGA 1DWHM 1MRQA 3LOTA 3M7WA 3S46A 3SEPA 1RALA 4FNRA 5JBEA 5I23A 4HYRA 3U9IA 5MKGB 2DSWA 4FX6M 3ICJA 1ZZMA 2O92A 4A3UA 3QF0A 5AHFA 5CC6A 1F61A 3CHVA 1KCXA 4KW2A 4ZEPA 4FLOA 2BTMA 4W8BA 1HGYA 3L5AA 3N73A 4PMJA 1OZQA 3T8LA 3QXBA 2VQTA 2F6UA 2JKEA 4C6QA 4I8YA 1H41A 3TYCA 4IMDA 2YA1A 1XD1A 3NL6A 3TEVA 3R25A 1IXNA 3IJLA 1QOQA 3T07A 3WNKA 5M2FX 1UKTA 3LHTA 4D8LA 1G5AA 4WJ8A 3NPUA 2R91A 1XJBA 2PDGA 5M17A 1PWMA 4HIBA 1M5WA 1EGVA 1HJVA 2VDHA 3T8QA 3VM5A 1KRMA 2PLMA 4DUWA 1GYNA 4CN1A 3N6JA 1R3YA 3OZYA 4HZMA 3DDMA 3W1LA 1JCJA 3S0CA 3C4UA 4M7SA 4HMEA 5FJPA 3W1XA 5BXRA 2WC4A 2BY0A 2VOTA 4AD4A 2Y8UA 1VAHA 3PFMA 4Z1BA 3ABSA 3G3DA 3BC9A 3EX1A 4XD6A 2A7PA 3DOPA 1BXBA 1DIEA 4QROA 3AMGA 1VJSA 4F3HA 5A6SA 2W62A 4RUBA 3URQA 1QTWA 4G2DA 4DNMA 1ADSA 3MSYA 5FL1A 1LL7A 1L9WA 3HGRA 1S2AA 1SO4A 3QZ6A 5DT5A 3R13A 5A6LA 4LALA 1CECA 1TV5A 5EMYA 3CL8A 3JZEA 4JQAA 3V4BA 5F2GA 4NXKA 5E09A 2NQJA 3ALFA 3ZFHA 3PPGA 1DWAM 1DE6A 1YLVA 3HG4A 4ZZ9A 3BICA 1O5KA 4ECLA 5HWMA 1CXLA 4CQDA 1R5YA 4NZ5A 5A6MA 1P0BA 3SGGA 5LIWX 1A5AA 3B0PA 1OFQA 1E1FA 4FF5A 1QAPA 2OSYA 4PB3A 4HSNA 1QCWA 4H1ZA 4CQAA 1P0EA 5C0QA 3STCA 3O06A 2PEVA 1V3HA 4X9SA 4MWAA 4NHVA 5EMJA 2RFGA 3GIYA 5A1AA 3LXBA 3NQBA 2NVCA 1K9EA 4U10A 2Z0IA 3MJYA 3HGJA 4C7DA 1V8EA 5CCZA 2EPOA 3UYIA 4UMCA 3P0XA 4JS3A 2AL2A 4JFWA 5LGZA 4R9OA 1FWIC 1R85A 3IUDA 2CLMA 3C86A 4DJEC 1O68A 1S1PA 4KESA 3ZQ9A 1F4AA 1XD0A 1KFLA 4AWUA 4UZSA 4FK9A 2QKFA 2BGQA 2ZUVA 3HA1A 4K37A 4F2TA 4LAZA 1X6LA 1KR1A 3SFKA 1TTIA 3FCPA 4YWSA 1JZ2A 1MDRA 1E51A 4RNHA 1OQFA 3CPRA 3W22A 4L9YA 4AXNA 1IEXA 3CZGA 1H7PA 3VI2A 3EDKA 1W5QA 1K8ZA 4KRZA 3NQFA 2ZZ1A 4RV8A 3LBCA 1HN1A 1RSCA 1G4SA 3I3DA 2FPVA 3GKAA 4UIOA 1B3ZA 2YBUA 4W93A 1GYLA 2PD9A 4GUJA 1FWEC 3BV4A 4IQDA 4UB9A 3O7UA 4HOXA 4OVXA 2DSZA 3NXLA 1KM6A 2ALRA 5T9BG 2D3NA 5JVLA 2J88A 3PZIA 1MMFA 3SUUA 1UD4A 1O1ZA 2QQ6A 1GOIA 4ZB0A 1LBLA 3OA3A 4P8WA 5BXPA 2WZEA 3IANA 3QTGA 1NWRA 4GY7A 1EGMA 4BA0A 4AHPA 2PMQA 3CZLA 1UWRA 4M5PA 2XFRA 2PGEA 3V18A 4U4MA 3OBEA 2VCBA 2CITA 2P53A 4CU6A 3G6MA 5D8WA 3UESA 4QISA 4TX9A 3TAOA 2AQWA 3GNPA 5CJMA 1AH4A 3CHCA 1KA9F 4LBUA 1OSEA 3LI1A 3CC1A 3PVFA 5JBDA 1YRRA 2NUXA 3W1UA 2GWGA 3U6WA 2BHYA 5E9AA 2YSWA 3TYAA 5C2CA 5MHBA 2FZMA 3S1XA 1KFBA 4CKQA 3SSZA 4IG2A 3U0HA 4DNHA 5IOBA 3KTSA 1FHLA 3SJ3A 4WKAA 1UWUA 4BKNA 5A2BA 3UWUA 2XIIA 3IIOA 4TV6A 1FCQA 2GUUA 4JIIX 2X8RA 2R8WA 1ICSA 1TJPA 5E0CA 1E9IA 1MO0A 4FIRA 2HK1A 2XH4A 2ZRUA 1IT8A 3G8EA 2DIJA 3GG1A 4DAIA 4UFIA 1JPIA 2CETA 3EWZA 2BY3A 5LSMA 5FAJA 2VRKA 1O6IA 4O8AA 1UUMA 3IAPA 3QN3A 2EBNA 4BF5A 5DELA 1GGOA 4OZOA 4PTWA 1RXOB 2PE4A 4WLCA 3DECA 1Q13A 2FHBA 5D8ZA 4PYSA 3TQVA 3W71A 3FHAA 2ZC8A 4TV5A 3EWYA 4D6DA 4RDZA 1JULA 2X41A 4GYPA 4NAFA 1VCFA 3WIJA 1J2BA 3P81A 1HIZA 3LHYA 1QXLA 1REQB 4X2RA 1HUVA 1I6NA 1NDYA 3UGVA 3AISA 4HU3A 3K13A 1W91A 3BJTA 2WKJA 2ISFA 4K6AA 1KQZA 3DI0A 1ECEA 2WSQA 3LV6A 1JPHA 2ZA2A 3AHZA 2NSOA 2GGHA 1DTNA 3E1F1 3SCUA 4GCAA 3S1WA 4F9JA 3T2OA 4DWSD 3G0XA 4LV4A 3T81A 1UB3A 2TYSA 1GONA 1XYMA 2PDJA 4AZHA 2QCMA 3WQDA 6TIMA 4LJ3A 5DT7A 1JUKA 1XLMA 1VC4A 3R6IA 4UXDA 2E8ZA 2RJHA 4RCXA 2RGLA 4QGCA 2QW5A 1GHSA 3QFEA 3ABZA 1KM1A 4ORIA 3AFBA 1W3LA 4XAFA 4DM2A 3NL2A 4W5UA 4ZSTA 3MZ2A 3IIPA 3WG6A 1X98A 5HMDA 4IF2A 3GXDA 4R7JA 4IIBA 3W53A 4PGLA 1PZ0A 1S5MA 5G4WA 3NSXA 1PAMA 3EYPA 2A21A 3UJ2A 4RNFA 3D3AA 3UZWA 3I7RA 1YNQA 2BS9A 3S1VA 1E6RA 3IUIA 4Y9PA 1FP9A 2Q8XA 1JCXA 3O3RA 1PX3A 5TIMA 2G96A 1AQFA 4HNVA 2I7GA 3TYDA 4NQ1A 3CGTA 4F8XA 3PZGA 3PULA 3GM8A 2CXGA 4XZIA 5IHSA 3ZSSA 3GB6A 4JEJA 3STFA 4LT9A 2EPHA 1UPMB 1P6BA 4JQ2A 1O5XA 4XAYA 3WD2A 5CPSA 1XV8A 4FSAA 4GQQA 1FQ0A 3BCFA 1LL6A 4B3ZA 4IFKA 1UZDA 1TRDA 1BGAA 4IX2A 3OLEA 1P1MA 1OT1A 1PBGA 1UH3A 8A3HA 1CB7B 2HRWA 4CU8A 1RQBA 4Q6XA 1N7KA 3W7OA 4AZGA 1IGSA 3P7YA 3UD6A 1TE1A 8CGTA 1HKWA 3GDTA 1JZ8A 1YX1A 4ICMA 1NFPA 3RN6A 3WJXA 1BWKA 1PKYA 4REQB 2IPFA 1YPFA 2DVUA 4GVGA 2R1MA 2Z26A 1B3WA 3UY8A 4WOZA 1JCMP 3TN3A 3W6YA 5I2UA 1IWPA 5DMNA 1TV7A 3QTPA 3AIBA 4Q8QA 4O52A 3FJ6A 4E8GA 5A2CA 1FH7A 2V8ZA 3M0HA 3USZA 1XRTA 5AVHA 4CQCA 3DEQA 1FFQA 1GZGA 3G0UA 4LCSA 1JNEA 1S1RA 2FTPA 5I3FA 3LN3A 1R8LA 4P7LA 2Y1HA 2ISDA 3BAXA 3R0KA 2ZX8A 3LMYA 2EKCA 2VQUA 3KL5A 5HULA 1FTXA 4CCDA 2VDIA 1XYBA 4X0VA 4ZFMA 3ANVA 3WLRA 3B0VC 4C6MA 4PUDA 7XIMA 2DU2A 2PTWA 3E2RA 2B81A 2WMJA 4A8IA 3CB3A 1B2YA 4C6BA 2Q8LA 3CUIA 2FVKA 4L1XA 2D23A 4QIUA 4HKPA 1YMYA 3FEMA 3QPZA 1AH3A 3SUWA 4DPPA 3WN6A 1UHVA 3LCFA 1RV8A 1GT8A 2POTA 3OGRA 1T8QA 3VKAA 2NXGA 1PVNA 1LWJA 4J7RA 1FH9A 2ATMA 4M3PA 2DQWA 1HX0A 4XZ9A 1X6NA 3H2MA 1Z6KA 3T42A 3MUZ1 1DIOA 3SUTA 3CV1A 3S9IA 3W70A 1E6ZA 1JYXA 3GNXA 3VO0A 1Q7MA 4AZCA 1XH0A 4LYKA 3ARQA 1TG7A 4OBRA 4DF1A 1YE4A 4FMVA 1CPUA 1QMLA 4IUGA 2X0HA 4QQ3A 2ZA3A 3B8UA 4DRSA 2F2KA 3BURA 3AXMA 1KM0A 2FLIA 1VEMA 1PDYA 2HMCA 1KWGA 2AKMA 4DWSC 3O07A 4XD5A 3VOIA 4F0MA 3MV11 2VD9A 4Z2GA 4YWIA 3VGHA 1HZYA 3KL0A 4PMQA 3GFYA 1UKSA 3QR3A 3DFPA 3C0SA 1TCMA 1FWRA 5LNUA 4KRUA 1C8YA 2NQZA 1YDOA 2B31A 4ATWA 4JKMA 1CLXA 2P88A 3IIVA 3QQ1A 3FDKA 2DZPA 1F2JA 2RDXA 4BQ2A 1ZALA 1PTGA 3W7MA 3OPSA 2XM2A 3V16A 5C2GA 2W9MA 2Z7KA 3TN5A 3WDIA 4NJHA 5D4YA 3WNOA 4H9YA 3PBMA 1T5AA 6XIMA 4Q4RA 2FTWA 4H6RA 2Y7DA 3UT0A 1LT8A 2IKHA 1VF8A 2WJZA 3UJFA 5D32A 4A35A 1WXYA 4ROPA 1A5SA 1V77A 1NP2A 2VZSA 4XWUA 2CYGA 1R86A 1SMAA 3WJWA 2X1IA 1AFSA 1ME8A 3ARSA 1J0JA 4UTIA 4O18A 3RR4A 1ZGDA 3M43A 2V5JA 4GIAA 1OFEA 4N42A 5HXMA 1H3GA 3UZZA 3VNDA 1H09A 3WFAA 1UR4A 4YCOA 4GQRA 4LRTA 2CESA 3SN1A 4Q7BA 3A24A 7ODCA 3KFTA 3TWAA 3V1PA 4AYGA 3VKKA 5HNRA 1XIBA 3TVAA 1UR1A 4Z08A 1BVWA 5F4SA 3N4AA 3AYSA 4DX3A 3BAWA 1NQ6A 3TOPA 2W6RA 5LGXA 1QHZA 6TAAA 3L2IA 5IXEA 1S2TA 4BF7A 7REQB 3LZ5A 2OG9A 3JRKA 3NR0A 4AWTA 1ZHAA 4ZTYA 5A6KA 1TWIA 4GYFA 1WAWA 1GOOA 3CAWA 3TTOA 4AZ7A 5LXXA 1GNXA 4JR5A 1CXHA 3MBFA 5E9XA 2ZADA 2NZLA 4NRSA 2A6NA 6A3HA 4L4PA 3S9YA 4GO9A 1NU5A 1WDRA 4GHRA 4HU0A 1DL3A 3DBNA 1WP6A 3VNIA 3FXYA 5AC6A 1AMYA 2V0TA 3B9AA 3BAYA 4AZIA 5DX7A 5A6TC 4F4RA 5D30A 1VFTA 2EO7A 1UYQA 2IS7A 4GZ7A 3U2ZA 3WDHA 4IQJA 4QAIA 1EF2A 2E5DA 4Z17A 4JTFA 4LVFA 4QNWA 1HP4A 1MW0A 4XUYA 2RKXA 3W7NA 1KTNA 3A4XA 3U3HA 3L0KA 5DMYA 1KCLA 1ZCCA 2PP0A 1RK5A 1XLBA 1VJZA 4K7VA 2VUNA 1LLOA 1EJTC 4YNGA 2Y24A 4HPNA 1MEIA 2XH0A 2WZHA 2DUXA 3BDKA 4YTQA 1W9PA 1JRCA 2VGIA 3RLGA 4CD7A 2WNWA 2PI6A 2AAMA 4IIHA 1K1DA 2GK1A 4UWMA 1SW7A 3KXQA 2HE5A 4FZIA 3M44A 2WLZA 1SJDA 3THCA 3SRFA 2C0HA 4MJMA 3W4RA 4ICCX 1FFRA 2VWSA 1QO5A 4X9YA 4E2VA 3BZGA 3N17A 3UPBA 3PTMA 3ITGA 3G5EA 2TPSA 1XCXA 3WK2A 2GDQA 2Z1VA 3DAQA 4HSHA 3UF9A 1UD8A 4ZA0A 3CIXA 5D03A 1MNZA 4FALA 4PMOA 1JAKA 5LIKX 2DT0A 3THUA 3MS8A 1IXQA 3NO1A 2J66A 3TC7A 1UPPA 4IMGA 4C6OA 1LYXA 1TPVA 5FJTA 2C13A 4FPSA 3UXDA 1BGGA 2E09A 4OKDA 1LQAA 1B54A 1W0MA 4FIQA 1OCQA 3SURA 4GIEA 4O54A 5D2XA 4QE5A 2VEKA 5CPQA 2CWNA 1BFNA 4L64A 3EOSA 4PRTA 5BU6A 2R1NA 4KEUA 1EGZA 3G18A 3WY1A 2DW6A 4DWSB 5FKYA 5CG7A 3TYUA 2PPGA 2BB0A 2BHZA 3N6HA 1TV3A 4QFUA 2PA6A 3RIKA 2PDXA 1M6JA 3SCQA 1LDCA 4HPXA 3R8RA 4DBDA 1Z9AA 1ZBVA 4OUIA 4J2PA 2HK0A 1TJ0A 3BOFA 2ASHA 3QSRA 4GFSA 1HVQA 2PF8A 4CCEA 4AIUA 1TTQA 3KOYA 3TNOA 2J6XA 2NLYA 5BRPA 3OIXA 3W74A 4BEQA 4UQ9A 3UWQA 3W00A 1PUDA 3GBEA 3AAMA 5D2TA 4PCSA 4F79A 2OPJA 3U5UA 3TTQA 1Q6RA 4OE7A 1VBRA 1P6WA 1TR9A 3T9PA 1RLCL 3U7VA 1H1YA 4AD2A 1RAKA 4LNCA 1J6PA 2GVJA 5E70A 2E77A 4JYDA 3WD0A 3EBVA 3NCOA 1NY1A 1EOMA 1ZTVA 1BWLA 2DVTA 2ODOA 3THAA 3EDJA 6REQB 4P8UA 4ZB2A 4X3ZA 4YJ5A 3GUGA 4Y7EA 2GQ3A 1YNPA 2Y4SA 1W5NA 2VTFA 4NYUA 5J04A 2XVPA 2TAAA 1TZZA 1WUEA 4C7GA 1HO4A 2DZAA 1DIDA 2I5QA 2H9AA 3STPA 1YBQB 3FW6A 3WQVA 3CLMA 3C2VA 3EA2A 1IQ8A 4L6HA 4B5UA 2WOQA 2G37A 3ZM8A 2E0PA 1J0YA 1DIKA 1IV8A 2FB2A 2OEJA 1XG4A 4MKNA 3T0CA 1KW1A 2Y63A 4RDYA 1WQ5A 2ACSA 1T99A 4ZGYA 1S38A 2FFIA 3OYZA 1KRAC 3QKEA 2DEPA 4FEZA 1U5HA 4I5RA 4KCTA 4O13A 4PCNA 1RHCA 4MY1A 3HZ3A 3D6NA 3VIJA 4AWSA 2Q3OA 5CSRA 2ZX5A 1K6WA 3M4HA 4F0LA 4S38A 5I3IA 1FHUA 1W56A 4TMBA 4IJCA 2OQLA 1XP3A 4B2DA 3AXIA 4GPNA 5CQ1A 1W5MA 2FVMA 4WKHA 3GVQA 3K8LA 2OSWA 1FBAA 1XPGA 4GA8A 4RXFA 2EPNA 3LPGA 3TTEA 2PLJA 3OHMB 3SJNA 5D37A 2CZDA 1EUAA 4G9PA 4NP7A 3PN8A 3STGA 3TJIA 2YPIA 3PUOA 3EPOA 3KE0A 3KP1A 4HBKA 3DG3A 4Z0JA 2HVNA 1V03A 2D3LA 3ARUA 5LIYX 1VEPA 3U8GA 3WL1A 2G95A 1G4TA 1GQNA 2OX1A 1HW6A 1BSIA 1U1JA 1JQVA 1R3QA 3U7BA 5IFTA 3H4WA 1X39A 3P82A 3HPZA 5BWFA 2X09A 2EEXA 4E4PA 1SJCA 3WNLA 4Q3MA 3PJTA 3E3HA 4WCJA 4FA3A 1TELA 1YTDA 3NYZA 1IEIA 1TWZA 1ZBKA 1JNDA 1S5NA 4XZLX 3QZEA 2WMGA 4HPGA 3K8MA 2QS8A 3RRXA 4DN1A 2ZUTA 2Z6IA 2V6AA 3OBKA 1UWTA 5CZTA 2WLYA 3MPGA 4LPCA 3NQAA 4I7WA 4NNBA 4FNTA 2C14A 4KCVA 3NM1A 1OC6A 5BOFA 5AKQA 5T8GA 4CQ9A 2F61A 3W7CA 2BOGX 4LVGA 4US6A 4PMDA 4GE8A 1GQKA 2NSXA 5DCEA 5BU9A 4ZXOA 4IL2A 5F4XA 3G1SA 2Y89A 1U22A 4R33A 3MCMA 3BAJA 4AEFA 1UR2A 3M1ZA 1HFBA 1MI3A 4MMWA 1Y8BA 2NVDA 3D0CA 1OB0A 3VMOA 4Y8FA 2HTMA 3NVDA 4QS5A 1VD6A 1TB3A 3I4EA 3M0VA 4HOZA 3M5YA 5FACA 4G7EB 1EH9A 2A5HA 4O28A 3BLEA 1ML1A 2UWFA 4AYSA 1BVZA 2OWCA 2JGQA 1KFCA 3VNLA 1XGDA 2XGZA 1KC7A 1V6YA 1XIMA 4DF2A 5K7JA 1ISWA 1VB9A 1G4EA 3JR2A 3UQNA 4X61A 1ZL1A 4GXPA 1HL9A 4US5D 5ABFB 1M03A 1F8IA 2Y7GA 3WLQA 3N2MA 3RU6A 1UKQA 5K9XA 4RJEA 1Y5WA 2ISSA 2V69A 1KM4A 1EJWC 3EZ4A 3GVVA 1M65A 3MTWA 1BKHA 2E6DA 1KBBA 4QXIA 1J12A 2PURA 4BF9A 3G1XA 5EKYA 1W1B1 4GABA 3AIQA 4B16A 3H24A 4CVUA 3FAWA 2QYGA 2A3LA 3PHAA 2UV8G 4GZJA 2FZ9A 3MB9A 2HNEA 2AMGA 4FO4A 3V5OA 1CLVA 2GGGA 1YXYA 3ZSTA 3IJ7A 1W5OA 3TSMA 3NQ2A 1ZY9A 1E4MM 3W3OA 3GWQA 1RY0A 3TFCA 4JDYA 2QCDB 3DFQA 1KCKA 4KWOA 3VINA 3ZIZA 1XLFA 4OECA 3E74A 3KOWA 1ZS2A 2PWGA 3GTXA 2E25A 3KRZA 1XIHA 3SRKA 3KL3A 3H7UA 1HKKA 3VK5A 1GTHA 4U28A 3TSBA 4WR3A 2CLEA 1SZNA 1ITQA 1UWAA 6XIAA 1W8GA 3APYA 4OFCA 4LUSA 2OOFA 3G3MA 4ORMA 4NY2A 4XKYA 3NZQA 1BRLA 4ZOEA 1UCWA 4F2UA 1BKSA 3NL3A 3W87A 4MYAA 4FS9A 4W4QA 3CZ8A 2GDVA 3HIJA 4ERGA 1E1CA 3LGDA 4Y9AA 1KGXA 1YPIA 2XFWA 4QNEA 2EAWA 2CZFA 1L6FA 4R3UA 1W1YA 3RLUA 3W37A 4XV0A 1TV8A 3WFLA 3AHXA 2OZ3A 4DHGA 1W32A 3GDLA 4FR1A 4O0QA 1AMKA 3DHDA 1E43A 3MT1A 1F05A 1WBJA 2CCRA 3FV9A 1E4NA 4IQLA 5ABHA 4UMAA 2P10A 4KQNA 2XH2A 3R79A 1CWYA 4GNVA 2Y7EA 5BCAA 5BOEA 3GC5A 5IM51 4M51A 1CW2A 4PSRA 3S6TA 4JIRA 3E49A 2EG7A 4W7WA 3IVSA 5JMUA 1VFLA 3ANUA 3LRMA 5DMLA 3WMSA 2AKZA 4C90A 4O14A 1DTUA 3LK6A 4FF7A 4B3LA 2YXXA 3IJ9A 4MDOA 3KLLA 3V7PA 2XINA 1A4MA 5GVJA 4RDWA 1BF6A 5DBTA 5I02A 4K8GA 2CFFA 2ACUA 2PC4A 5AYBA 4DJDD 2YW4A 1QPNA 3H7VA 3SGUA 3E2QA 3T0AA 1FOBA 2QHAA 4M29A 2D0HA 4TMCA 5FAGA 4LTSA 1SSDA 3ME3A 1JDFA 4CNNA 1TJ2A 1JL8A 3RXZA 2MANA 1EL3A 2VCCA 2G50A 4MUZA 3HPXA 5B7YA 5AC8A 2OJPA 4GD0A 2UY5A 1UUOA 1SPQA 2W63A 2FZ8A 2QUNA 4L4MA 3T0TA 1BAGA 3EAUA 1EQCA 1IT0A 1VRXA 4DZIA 2PLCA 3QPYA 3LLXA 3W07A 1QNOA 1AL7A 2VYOA 1JPKA 3VTRA 3N19B 1XXXA 4Q8OA 3DYOA 4EWJA 4GQ0A 3BTNA 2WNZA 3E6EA 4TX6A 1JDEA 2HXTA 4PL1A 4W86A 2XH7A 4MGGA 1JDAA 2WCSA 2V82A 4ACZA 3QPEA 4UFKA 3WD3A 1BPLB 1PJ9A 1OWQA 3UERA 2CKRA 1FWGC 5XIMA 1FUYA 4JQ4A 3ERPA 1LUCB 2A4AA 4BWLC 4I6KA 3H2NA 3ZVHB 5C5YA 2WVUA 2FKPA 4ZQOA 2VFGA 2QUVA 1KV8A 5JUVA 4MNJA 1C7TA 4ZO8A 3VIOA 2TSYA 4M82A 1GCYA 2V5KA 2GSHA 3TWBA 1U2YA 3W88A 5AOUA 1VLWA 1FHDA 1MZHA 4KGJA 4HD5A 1GTEA 2QUTA 1V02E 3EDFA 2QDEA 3USBA 3S2NA 1ZFJA 1PS9A 3KDNA 2FHFA 3GG0A 4O1CA 2GGEA 1J0HA 4M0XA 2YL8A 1GVFA 1NFBA 3L5MA 3TN4A 2ABBA 4RPPA 2PDFA 1QNSA 4R88A 1H1NA 1E6QM 2J4GA 4GZIA 4DQWA 4IZGA 2G4FA 1GG0A 2CHNA 3Q45A 1J0IA 1DBTA 5AY7A 3CUGA 4O17A 5D9MA 1P0DA 1GVQA 4GISA 4F0HA 4E2BA 1IZCA 3GUWA 2XN2A 4XAGA 4GQBA 3P2VA 3L2LA 1A5NC 4GBUA 4G56A 2PWUA 4JDBA 1XLKA 2CLIA 4UTJA 1AJZA 5J8LA 5BWAA 5F2IA 2HQAA 2EPKX 3OO2A 4X2PA 2E67A 5KZEA 1RVKA 1IIHA 4LC8A 3AYVA 2J7EA 5HPOA 1Q6FA 3W2KA 1XLCA 4O12A 4ZOAA 4H8VA 2J75A 4ZOBA 1EKOA 3W7PA 1XW8A 4GX8A 3KBWA 1SO3A 2INEA 4D1IA 4TVCA 1V3MA 1MW2A 2IPGA 4C6JA 3W1NA 5HAOA 1BG9A 3G2GA 4R7OA 3VXGA 1FWBC 1H60A 4GCXA 3S3GA 5D33A 5AYZA 3AO0A 1IXOA 1AW2A 3TK7A 3FGCA 4WY0B 3TX9A 2ZUWA 2PDLA 1WXZA 3OG3A 3HPAA 1WXJA 2PU0A 1TWWA 3F2CA 3DBPA 1EC9A 3DU0A 1NF0A 1NTHA 1ECQA 1XINA 3WJSA 4K2SA 1JIBA 1QATA 4W7UA 4KT2A 4O50A 3WZ0E 4L9ZA 1BWVA 4W84A 4MWAE 4L4LA 4LEFA 4UFHA 3L4WA 2JIWA 3W83A 1KCZA 1IWBA 1AH0A 3SIMA 4DJFD 1A53A 2Q6ZA 4M56A 4IMAA 1TVPA 4B5WA 2A3AA 3H70A 3K4DA 3EKLA 3A5VA 4N4PA 4WXYA 5HJXA 3FJLA 3WLOA 3L4TA 2HNHA 4Z2LA 1EEXA 5JH1A 3GU9A 2OWWA 1Q4WA 1V6XA 1LTDA 2ZTKA 3SCWA 1VIZA 4AX7A 4DJDC 4HNLA 1QI2A 5A8GA 3AZRA 1XQLA 4NJGA 1J2WA 3QV7A 2YBVA 3N4EA 4LC6A 2IQTA 2V63A 4U3CA 4DXXA 4V2XA 3MP5A 2BG5A 2VZVA 3KOXA 3E12A 3LM3A 5TNVA 5KZ6A 1IR2A 2CZ5A 2R14A 3EB4A 4AC7C 4JYFA 2QJGA 1VFMA 4W9TA 2FIQA 3IWPA 4CD6A 4MAZA 2YCIX 4DY1A 2F7FA 4AQLA 1IGWA 1GW1A 1SZRA 3RCMA 3O0FA 1VH7A 4PC8A 2XPKA 5I03A 4S2BA 1X8FA 3HF3A 4NKCA 3IUHA 3VDCA 3PS7A 1P0NA 2ZX6A 4IJBA 4OHQA 4F9DA 3QKZA 3EXTA 4GI4A 2O7QA 4G8TA 3FVMA 1OC5A 4IICA 3FIGA 5I3KA 4UTHA 5A6BA 4AB4A 4MIMA 2EPLX 2VM8A 3LHVA 4Q6JA 3PB0A 3ZS4A 3AZTA 1UZ1A 4GINA 4BQ4A 1H50A 1W1TA 4HHPA 4IT1A 2F6KA 3HURA 4TUFA 2H8ZA 5FF4A 3N2OA 1WDPA 1BYCA 3ZOAA 1A3WA 3VC5A 3W38A 2HXUA 3VE7A 2BBFA 3TA6A 2J8GA 3ZO9A 1EP2A 2VO5A 2DQXA 4IM4A 4NF7A 5I3GA 3KS6A 1V6UA 5K9CA 6ENLA 1ZJBA 3PZTA 2CLPA 4D6IA 4A8RA 5AVNA 3GNRA 4A8LA 5E0FA 4PA8A 1QR7A 4Q7IA 2GZXA 4QSHA 1F6PA 3B8TA 1J4EA 4ZO6A 3VNKA 2BDQA 2CLLA 1XHGA 2HV5A 4E8CA 5K3VA 4DJEA 2RHGA 3TIMA 3GZ3A 4I9TA 3G1YA 4P7QA 2NQ9A 1DJIA 1H7WA 1JCLA 2HZGA 1PIGA 5DO8A 1K8YA 3CK5A 3H8AA 4JTGA 3ISIX 1UH4A 4JTRA 3WQ4A 5K2ZA 1K8XA 1BSLA 2O9OA 4Z0SA 4HNNA 4GZEA 1JZ7A 2OWXA 4KF1A 1VZWA 1N8WA 1BD0A 2VUYA 4N0RA 3B0YA 4UNKA 4MLRA 2ZTJA 3V3WA 1VR6A 2GVEA 1E9YB 2Q09A 1A47A 1TFVA 2Y2WA 1T0OA 3QH2A 1DWIM 3W28A 4LAOA 1ISZA 1M9HA 4JTIA 4EE9A 3WL0A 2EKGA 2NUWA 3N25A 4CLMA 1NOUA 5AB3A 4RZBA 5H8UA 3L2MA 2FVLA 1P7TB 5C9UA 2VC6A 4MB5A 3RM8A 1EP3A 2BGSA 5IDZA 8XIMA 4GIYA 2HSAA 3EMCA 2ACRA 1RA0A 4ZR8A 4WSHA 2PTDA 3ZWTA 4EACA 2W0UA 1K02A 2YDQA 3OLDA 1PL9A 2XJ7A 4J40A 4MZYA 4AY7A 4GJJA 2J9YA 5F7UA 4PH6A 3T0BA 1XBZA 1TTJA 4ZSUA 4DJFC 3B40A 2NLIA 3DESA 1A50A 3U4FA 3AI0A 4L61A 5AZ0A 3I10A 1ZJAA 3G24A 3QLLA 4GKLA 4RPQA 2VNCA 4HYVA 1QW9A 3VIFA 2FJUB 1H61A 5IHRA 4A3QA 4PE8A 3I3BA 1NDVA 1YEYA 1H0IA 3CWHA 1R38A 2DIKA 3W6LA 2HPMA 4IP4A 1L6GA 5FA5A 3Q65A 2REQA 4DUVA 2CW6A 3MKKA 1OYAA 4A22A 3SW6A 4LANA 2D0GA 3VU2A 3CMFA 4GNJA 5JQ9A 1SU5A 2R9RA 1D9EA 3QMTA 1US2A 5ABGA 2PDYA 3WNNA 3MCNA 1RZMA 4C1KA 3PUGA 3WLSA 1P6CA 4PMVA 2F9RA 4OOZA 2NV1A 2B0MA 3GIQA 5GNZA 3S5NA 4JTSA 4RL3A 2WZMA 4PSPA 3DIPA 4K38A 1LBFA 1XBXA 5BRBA 4UTFA 2QJJA 2DT3A 2O55A 5E6ZA 3I4KA 2QPSA 1WDWA 2MUCA 1GOKA 3YPIA 5LYRA 2FPYA 1TCDA 4QLKA 4O8RA 5KZMA 1ALDA 2A7NA 3PBVA 4P5UA 3AXHA 3AHTA 4XG1A 3ITCA 1NOFA 3W2LA 1CZ1A 1V3LA 1OBAA 2ZXDA 4LW7A 3R12A 2CBJA 1H4PA 4INFA 1JCYA 1XKYA 2VP8A 4ZODA 4Y8EA 3H7RA 5K9DA 2V68A 4PEKA 1AG1O 2INFA 1R0MA 3E0VA 4Q4QA 3MHUA 3NNTA 1IYXA 2F8QA 3LM7A 3TCSA 4XX6A 1Q6LA 1E6PA 3GDBA 5A8QA 1VYPX 4Z1YA 4GI6A 3W2MA 1GKRA 3QW3A 1C9WA 5GQBA 3MMDA 1XLIA 1XWYA 4AMAA 1XR2A 1JDDA 1KFKA 3LU2A 1UOKA 2IXUA 1DJNA 5FESA 4YYCA 1EO7A 4IPPA 2NQLA 5EMKA 1I8JA 3AMKA 4IIGA 3MO4A 3VCCA 5CZSA 1QOPA 1H1ZA 1POKA 3ZR5A 2GVLA 4Q8PA 4QX4A 3VIIA 1KGUA 4C6IA 1I2NA 5DRCA 4Q8NA 4HPJA 3ZJ6A 4CU7A 5C2XA 2NXHA 4H3DA 4ZQNA 3Q2DA 2HE8A 3CBWA 1IZKA 4GWEA 1GOWA 5JXQA 3FFSA 3EA3A 3NPXA 1TTPA 3NPWA 5AHNA 4FNSA 4OOUA 5EFFA 1F3EA 3MW7A 4H4IA 3WK0A 4L5ZA 2OO0A 5DXYA 5FEXA 3ES8A 3SUVA 1DP0A 3RX3A 1OF8A 3H2AA 4HCHA 1XYAA 2Q01A 3GH5A 3NGJA 3GRIA 1G1YA 3MCOA 3P6LA 3NL5A 1W5PA 3FX4A 1JEZA 2DZUA 2GQ9A 1DJQA 4K1GA 2GQAA 2XM1A 4B5TA 4V33A 3VKBA 1QUMA 3C0QA 4JTQA 3N34A 3ZJKA 3W26A 1ONRA 4IIDA 2WKLA 3FLUA 3DC0A 1ISXA 1G67A 1XSJA 3A4AA 4I6VA 3S2JA 4JQ3A 4MPKA 3WMLA 2R94A 1OADA 3L0NA 4YTRA 1GZ1A 2X1SA 3DYMA 3V36A 1PKNA 5LNWA 1P0KA 3AYTA 1E70M 3IJ8A 5F4WA 3CO8A 2P1FA 1UJQA 3ENLA 4C6CA 4ZL1A 1LJYA 2PGWA 4PRWA 2ZC1A 3CTLA 5A8MA 1PSCA 3ITVA 3BGAA 5D2WA 3L66A 4IL0A 3CIWA 2GFTA 2C79A 2J78A 1QPKA 1CXFA 3M6DA 4IFRA 3FA3A 4JHMA 1O5RA 3CIVA 2X1UA 2DY3A 4DF0A 4JX4A 1AJ2A 3D46A 4H8UA 4U2YA 4Y96A 1R3TA 4QG9A 3N12A 1MW1A 3V0TA 2Z24A 4KIEA 2H8XA 1ZB5A 2IQDA 4S39A 2YOCA 1OF6A 3CYVA 4P2VA 3VM7A 3C6CA 2QT3A 3OOQA 2DT2A 1XLJA 2F84A 2VRQA 3CQ0A 2ZXBA 1KBJA 2OZTA 2I56A 3C8FA 4OT7A 4NASA 1JF6A 3SCPA 4UOZA 4K36A 1VPQA 1ZLPA 2ISWA 3VFLA 2RUSA 3T6CA 3BOXA 4K1WA 3TZFA 1QI3A 1XRSA 3B8IA 2DSUA 5HQLA 4P7RA 3PB2A 3NYDA 2AL2B 3JVAA 4X22A 4RX0A 1Q85A 3O9NA 3AS2A 3WQ8A 2O7SA 4MM1A 1DORA 1XLGA 3ZZ1A 1AZ1A 3HGOA 3SCTA 4AHQA 1XDMA 2E8YA 2Z1SA 4UQAA 4LS1A 3BW2A 1FWDC 2QGHA 4Z1CA 4ERAA 2XU2A 1GHRA 3FS2A 2OEKA 3T4CA 3QHNA 1GVRA 2QAPA 2D1ZA 3B05A 3BE7A 3I6RA 4C5YA 1VFOA 4LF2A 3IEBA 1SZGA 3MMTA 4GG9A 4LS2A 1GW9A 1KV5A 4YVXA 2DDXA 1W3JA 2QJNA 4DVOA 3C52A 1TREA 3TLLA 2BMBA 4EWND 3NZ1A 5BNKA 1RH9A 1FH8A 2H3BA 1GPFA 2JGYA 2BP1A 3KVJA 3CLWA 4RKAA 3OVPA 4L7ZA 3F4WA 4R85A 1FWSA 3NVTA 2GWNA 3R43A 1QFEA 5G5IA 5JH2A 1UBSA 4M6PA 5C70A 2CERA 3HM7A 4A8NA 2Y5JA 3U2CA 2VGBA 3AMLA 3BLDA 4W7VA 1FHVA 1KXTA 3GTFA 2OZ8A 1V6TA 4XZWA 5GNXA 3S5SA 3RDKA 2TODA 3K46A 3MSGA 4KFPA 3C3NA 1O12A 4NZFA 5C54A 3A4WA 4QS6A 4DBEA 1KXHA 2WK2A 4RW5A 3K8KA 3B4UA 4AFYA 1LG2A 1OX5A 3SFWA 2EXOA 3GVGA 3XISA 5A8PA 2OYMA 2WNNA 3N3MA 1AVAA 4HNUA 4IGHA 4HZ8A 3TOYA 1UG6A 3DG6A 5G1YA 4L80A 3GDMA 2DVXA 1JDCA 1EDGA 2DUAA 4CD5A 5EBUA 3TW9A 4AZ6A 1ODUA 1GEQA 1UASA 4TIMA 4EF9A 1Q6EA 3FJNA 1HG3A 1TA3A 4W8AA 4QLLA 4C65A 2FYMA 3WQEA 1XSKA 2OQHA 2ZKMX 1AA1B 3A22A 1XDLA 3C2FA 4E2DA 4Q4PA 3W1TA 2WMHA 4LAKA 3GR8A 2O4QA 2FH6A 5F1UA 3E2VA 3NEHA 4ML9A 2G3MA 4BCEA 4FOKA 1A49A 4IG2B 3WH9A 8XIAA 3WELA 4IP5A 1WZLA 4MKVA 1EIXA 3HGSA 3V5FA 4WXZA 3URBA 3BMVA 3PWGA 2XUCA 3MUY1 4Q8VA 1S2CA 2C71A 2I57A 2Z25A 5C9XA 4DXKA 3SY8A 4AUBA 1NWTA 1C8QA 3G77A 4FNUA 4JICA 3B8VA 4WY0F 4XBKA 1JXKA 2V30A 1RBAA 4MOZA 4WUIA 4V15A 3O1NA 2XSXA 1BYDA 3R1ZA 2OEMA 4J28A 4QCEA 2Y8KA 1SSGA 2YDRA 1Q8JA 1C9DA 2XISA 2PD5A 3TONA 2YX0A 4PBGA 3M0KA 1EFZA 3M5ZA 2J62A 1CX9A 4MNLA 4Q32A 3VPLA 5IDIA 4A05A 4NAFB 3UCCA 3EEZA 5CZ0A 3LBMA 2WSPA 3GX9A 4UQCA 1S5TA 4XAZA 3UU0A 3ZJ8A 1VPYA 3QMRA 4MSSA 1A0EA 1HXJA 1OT2A 1H0GA 2IKJA 1OD0A 3UA4A 4CD4A 5U4NA 3L7RA 1SYTA 2R1KA 2PWVA 4GJ1A 1MVYA 2DSKA 4U5KA 1EJRC 2XDFA 1YYAA 1UW9A 4S1FA 3RILA 3B9DA 3AZSA 3EGJA 1FKXA 4J5NA 2PCEA 4IUOA 3HN3A 1OJXA 1RP9A 1V3JA 3I7QA 1B57A 2A7RA 1I60A 3PTKA 3D47A 4JEQA 4YTTA 4WDUA 4NRRA 3O63A 2B7PA 2PS2A 1AW1A 3VDHA 1JXJA 2IMRA 3UCQA 5H91A 1DQUA 4C91A 2V81A 2WVTA 4LVBA 4Q4OA 4K8HA 3RX2A 4XK2A 5DF0A 4PCPA 3LXAA 4HJFA 1V02A 3ZR6A 1X96A 2VELA 1WV2A 1UR3M 1E6XM 4N7QA 5FF7A 1KXQA 3IK4A 1VGAA 2ALDA 2ZVIA 3BLLA 3AS0A 1OK4A 1WZMA 3FKKA 2NXIA 2VENA 1MQQA 1B3VA 3QGKC 3N9RA 4E8DA 3LTPA 4WEVX 1TMLA 3FY1A 1ISVA 4W5ZA 3ITTA 1ZPTA 1QASA 4UOJA 5D02A 2W66A 3RG6A 3PUDA 4A2RA 4MFDA 3P5ZA 3WH8A 2FZDA 1E73M 2G3NA 4ATDA 4Q22A 1I1WA 2WW5A 4MJZA 2J7GA 1X1NA 1WA3A 1DXEA 4DZHA 1NAL1 1D3HA 4M6VA 4IX0A 4UCFA 3UJEA 4IFKB 1WO2A 1O66A 3PSWA 3VD9A 4XVEA 3W1PA 3G1VA 3WLTA 3M46A 4XSMA 2E6FA 2INZA 4RLIA 4ICNA 2VHLA 3RLVA 1SMDA 3CAKA 4N4QA 3RK8A 1DJZA 3A64A 3F7JA 4O10A 1ZNNA 2CLFA 2JKAA 5FCZA 3S9ZA 3KVLA 4JNMA 2ZUMA 4JIHA 5FJOA 2GJRA 4JIEA 3QQWA 1RUSA 3GZAA 4B5NA 1JG9A 2QCCA 3D5HA 3FYOA 4PUNA 2ANUA 5E0KA 4ERIA 2J7DA 4AAJA 4QCFA 5C9ZA 1F3WA 3FYPA 1UR8A 1TVNA 5EB8A 1VPXA 3ARPA 1SW0A 1K9TA 4UQDA 5DCBA 1V7AA 2DZBA 4NZ4A 2FMOA 2QCLA 4O1BA 3BQ6A 1B9ZA 1UIPA 3C61A 1NVMA 1F7BA 3WBAA 2I16A 3P8IA 3VOHA 1IZJA 4OV9A 3H4XA 1TIMA 3RGTA 4Q8MA 2CHOA 3LQGA 2GJXA 3FK4A 2EG8A 3BSHA 2NW0A 4LXFA 1Q4NX 4TQTA 4FLSA 4J3SA 1TYGA 3VD3A 5A6JA 2IUZA 4FXFA 2RDUA 2VX5A 5LZLA 1WAUA 4FNQA 1NELA 3LLDA 5D04C 2E9BA 4C5ZA 3EX3A 1WPCA 4E4UA 2HROA 2I9UA 3S42A 3T7VA 4QTGA 4MFEA 4GYKA 3DX5A 3BGGA 2DP3A 3AHYA 2J13A 4MZ1A 2PGRA 4A29A 4Q8WA 1H51A 2VX7A 3MYOA 8TIMA 4AF0B 2FGBA 3APGA 3CXOA 2YBTA 2NWRA 4AXKA 1JRBA 3P14A 1DEDA 2XFYA 3KBNA 3WQGA 1VFFA 1T96A 2QR6A 2D0FA 5AYXA 3NZPA 1QRQA 5CPNA 4ZENA 2X7WA 4QR6A 1M68A 4URIA 4AZCB 4QHRA 2W92A 3UVAA 3WF2A 1I0DA 2V3EA 4C6LA 2E3ZA 3GAYA 4O57A 4AW7A 4UR8A 2ZRYA 1FDZA 1PIIA 2WJEA 5D05A 2X16A 2OX4A 3PBWA 3IGSA 4TU1A 4A3HA 3PG9A 3Q94A 1D8CA 5FSDC 1OFAA 5BROA 3M07A 3BAIA 3LYEA 1TPEA 1A5KC 4QAWA 2ISVA 1UD5A 4J35A 1A5BA 1FWCC 4MF4A 4ZTXA 1E3XA 2ADAA 4B5XA 1UQZA 1M3UA