1EB3A

Yeast 5-aminolaevulinic acid dehydratase 4,7-dioxosebacic acid complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
340
structure length
340
Chain Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title The X-Ray Structure of Yeast 5-Aminolaevulinic Acid Dehydratase Complexed with Two Diacid Inhibitors
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dehydratase
total genus 122
structure length 340
sequence length 340
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2001-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1eb3A00
3G1VA 2VFIA 2YSWA 3FOKA 3HJZA 5C5YA 1JJKA 3LI0A 2B7QA 2Y62A 2QCDA 3HF3A 3W1AA 2EGZA 1G4SA 2E6DA 2GQ9A 1F7BA 2VXNA 4P2VA 4R53A 4HNTA 4GC4A 4BI5A 3LOTA 4XKYA 3TA6A 3N19B 1X7FA 1TV5A 3CEPA 5CPOA 4Z1BA 4N9EA 4DF2A 1YPIA 2V30A 3EWWA 3C2VA 5G2IA 3BV4A 3QZEA 1PVNA 2B7OA 1KBIA 3NPWA 1MO0A 2C18A 1XXXA 3G0XA 2EPHA 3W86A 2V9DA 4UMAA 3C56A 4O4VA 2ZA3A 5LKYA 2X1TA 4MLJA 1YXDA 4GUIA 4ZQMA 1TRIA 1A5SA 4I7VA 1M7OA 1U5JA 1UBSA 3TW6A 1GVSA 4Z1DA 1M6JA 3O6CA 3KVLA 4UMCA 2C0AA 3LLFA 3W87A 3TX9A 1SFLA 2E6FA 4JX4A 3EWUA 4RK8A 4PC8A 1SO6A 5EA9A 5FF4A 3V1PA 3G8RA 5LNSA 1WDWA 3H54A 4GBUA 2O7QA 3D0CA 3LHWA 3CHVA 3LERA 4ADSA 1J2WA 5DN1A 3G1YA 3IRDA 4IMGA 5U7SA 2XFWA 3NM3A 3EEGA 2YGYA 2CWNA 5LSMA 2GVLA 3HMJG 1KM2A 3IIVA 4A29A 1XFBA 4LC6A 5LGZA 3HOJA 5LNVA 1QAPA 3L65A 1NAL1 3L0NA 1BKSA 3M9YA 3T7VA 2FLIA 4IWWA 2QF7A 3PVFA 4O11A 1LRTA 1H7XA 2QJIA 2NUWA 5GVJA 4XBKA 1OABA 3KVJA 3RK8A 3USBA 3TAKA 2WSQA 4S2BA 3P62A 2OCZA 2VOMA 3T4CA 2VC6A 4RLIA 1EIXA 1K8YA 2TPSA 1XBXA 4JIPA 1FCBA 2W79A 3W1QA 1EWEA 2FPTA 1K7FA 3VE9A 2WNQA 3O05A 4JTKA 3ZR4A 3W2MA 3U2OA 4LV9A 1SFJA 2V8ZA 3P60A 3G1SA 3SW6A 3UWZA 5F4SA 3SGUA 5DXYA 2EHHA 3DHDA 3UWQA 2CZEA 4Z0SA 1BTMA 1RV8A 4UFKA 2R94A 1OFOA 1LYXA 2QEZA 2B7PA 1XBVA 2Y88A 3GZ3A 1F6PA 4EWND 3MMTA 5C54A 3KFTA 5FF3A 3LBMA 1TIMA 3SECA 4A21A 3HB9A 3HPZA 1W5OA 3E96A 3T55A 4N6EA 1HG3A 3OA3A 3ZWSA 4DF0A 3LBCA 3JR2A 4NT0A 3L5LA 3C0JA 1KW1A 1QOPA 2ZRUA 1AMKA 1GPWA 1GG0A 1KFLA 4DBDA 3PR2A 2C3ZA 3GDKA 4AWUA 4AH7A 1IGSA 3NZRA 1KM4A 3ANYA 3QPZA 1Q6LA 1UASA 2V81A 4LS0A 4AHPA 2B0MA 3SSJA 3EX4A 2PRHA 1VR6A 2CLIA 2A7RA 2DU2A 5HMSA 3BGJA 1VPXA 1W5NA 4DO4A 1K02A 4X2RA 5I3FA 3W23A 4M7TA 3MI6A 3UZ5A 4BI7A 1H7PA 1WBJA 3C4UA 4O18A 1W5MA 1YTKA 1TCDA 1DBTA 4ZQNA 3PUDA 1W37A 1W54A 2ZRYA 3LHYA 3FJLA 1W3IA 3W1NA 1WQ5A 3F1QA 3IGSA 4JTFA 2J9XA 1Z42A 4YXGA 1N8FA 4OQVA 3E12A 2CFFA 4RXFA 4QAIA 3ELFA 3B06A 5AN7A 3PSWA 4MLRA 1MSSA 2ZRVA 3FIGA 2JBMA 3LLDA 3TDFA 4EVZA 1KFEA 5F2MA 5L6UA 5BMWA 5AYYA 5HUOA 2ZRWA 1TV8A 4MY8A 4YL2A 1GYLA 3G0SA 3W1XA 2YFOA 5EMUA 1TPUA 2Z6IA 4UTJA 4JTIA 4B5NA 3W70A 1B4EA 3EX1A 1OVDA 1FWSA 1KA9F 3TMLA 1ZHAA 3HPSA 4N9DA 1VCFA 3DFOA 1LROA 3NA8A 5CZJA 3W6YA 4NXKA 4RR4A 2ZZ7A 3T44A 5KZMA 4M6PA 1TQJA 1OG0A 3MP4A 3UYCA 1JRCA 1GVRA 4O12A 5H91A 3PBVA 1T99A 3GXTA 3GIYA 1RPXA 3TUUA 3NVTA 1F5ZA 2QJGA 4K37A 4GE8A 3HGJA 1X1ZA 1FX6A 4MUZA 3KVMA 1H7RA 1WAUA 1HUVA 1LRQA 1AW1A 2QKFA 1F05A 1SO5A 2W0UA 2ZTJA 1FCQA 1OJXA 3IEBA 3NZ1A 5G4WA 3W1PA 4JTSA 2Y63A 3QMTA 5A8GA 3FEMA 5C6MA 1G4TA 1QPQA 2ZZ1A 2ZZ6A 1OF6A 3TSBA 3M44A 1EB3A 4LU0A 1V7YA 5D33A 4WY0A 5FI8A 4JTGA 1F73A 2A1YA 3HGOA 3UQNA 3WK2A 3PF3A 4DQWA 1PCWA 4BWLA 4UTUA 1OFEA 4DF1A 5ABTA 2NXGA 2VELA 4HKPA 3QMRA 4HPJA 1Q6QA 4O54A 1GG1A 3E9AA 3M1ZA 1NEYA 3P84A 3LTPA 2CZ5A 4ADTA 3NQCA 2ZA2A 2LLEA 1EP1A 2IQTA 3W2NA 3LCLA 3UD6A 3DFTA 1G7VA 3WJZA 3P8JA 3VFLA 4IXXA 2CZDA 4Y90A 1R2TA 3M0ZA 4O57A 1FWRA 1SUXA 1QPNA 2ABBA 5AHEA 5IBXC 3TU9A 3KRZA 1VYSX 5LNUA 1S5WA 1LLWA 1AW5A 1EWDA 3UWYA 2GJNA 5E93A 3WJWA 2R91A 1MEIA 4UMBA 3IIZA 1AK5A 4N4QA 4AWTA 2RDTA 4CQAA 1DJNA 4JN6A 2VEKA 3EWXA 3NQFA 1KV8A 5D2XA 5D04C 2V0TA 4H4IA 1VH7A 1TPH1 2ALDA 4Z1AA 5D30A 1FXQA 4JTUA 5U4NA 3L66A 3EB2A 1EEPA 1QCWA 2C19A 4GWEA 1ICPA 3RLVA 1A5BA 2HMCA 2J27A 3L68A 1I2OA 3PUOA 1CW2A 3EWBX 3QH2A 3STCA 3U6WA 5HUPA 4PL1A 1J4EA 1W0MA 3NQGA 5EPDA 3W76A 3G3DA 1DORA 4DEFA 2TSYA 3C3NA 4FIRA 4YWIA 4LV4A 4BFAA 3P67A 3OIXA 3DKJA 4UTHA 4FHAA 3M5XA 1N55A 3TFXA 1GWJA 2Z0IA 4EF9A 4ORMA 1DKWA 4TU1A 2AAMA 4UFLA 5F1VA 4DELA 3DXIA 3H55A 1JCMP 1W5PA 2HTMA 4N6FA 1R30A 2RKXA 1G69A 3I6RA 5DBUA 1TREA 4TO8A 4YMZA 2ZRZA 3CT7A 4UFMA 1OFAA 2WO5A 3S6DA 4NNCA 3K30A 1Z44A 2Q8ZA 1F6KA 1ME9A 2A6LA 4UCGA 1B57A 4M6VA 2X2GA 5DLCA 3TIMA 2WPBA 2PRMA 1SR9A 1VQTA 2NWSA 4WJEA 3TV8A 4UNKA 4ZQPA 1W8SA 3GDTA 3WK3A 4M19A 2OZ0A 3NQAA 5DCBA 3OVRA 4LWWA 2JK2A 1LDCA 3DFSA 2WV8A 3LGEA 3BG9A 2WKJA 4N2YA 3W7DA 3OVPA 3QF0A 4I9AA 4O17A 1VGAA 3GDRA 2CLEA 1WOAA 2VFHA 4S1FA 4O50A 4LOCA 4ZVJA 2A21A 3GNDA 4FEZA 5DCDA 4O13A 3W7EA 3W7OA 3L5AA 2F84A 2CLHA 3DFQA 4WX2A 1BWKA 4UTTC 2PURA 4LS2A 3B04A 5CKSA 1GVOA 1Q6OA 4L4LA 2A7NA 2X30A 5CG7A 1HO1A 1TQXA 3PB2A 3DFNA 5HINA 5FEWA 1R2SA 4ZZ9A 4UTWC 4OE7A 1Q45A 1UB3A 1E51A 4FNTA 3I65A 4XBSA 2DZVA 3R5EA 2HS6A 3TK7A 1FWNA 3BW3A 3CIWA 2DP3A 3W22A 3OHIA 1W1ZA 4NJJA 1SO4A 3LHTA 3NQDA 1VCVA 3G18A 5MHBA 3W2LA 2C6QA 4LW7A 3UPWA 3NL5A 4Z1CA 4UXDA 3LXAA 1DOSA 1QO5A 3P74A 3MBDA 3M47A 2FJKA 3NR0A 1PS9A 1ZENA 3NPUA 3QQ1A 4QITA 4A2SA 1HL2A 2QCFA 2XN0A 2WNZA 1PE1A 4NJGA 3N2MA 1IIHA 4MPQA 1B3OA 2NXHA 1O95A 3N73A 5AOUA 3QPYA 1IIGA 3ABQA 3MWAA 4UFHA 5K9CA 2OX1A 3W1MA 3PBWA 4N02A 2DJXA 3GDLA 3ABRA 1SW0A 2A6NA 3NL6A 1IXPA 2ZQ0A 3TW7A 3GAKA 3STFA 1FCUA 2QAPA 5AHIA 2NX9A 3T40A 4JD4A 5CZ0A 4FNSA 2XN2A 1ZAJA 1TJRA 1ONRA 4HPXA 5EKYA 3DGRA 3LXCA 4CNPA 1TV7A 3UXDA 3W7HA 4AMAA 1GEQA 2RFGA 5T26A 4AXKA 3W1UA 1RQEA 3MJYA 3P80A 4IQLA 4FB7A 4WY0B 5AC7A 3FYOA 3F4WA 4RKAA 1RQBA 1MEHA 1L9WA 4JICA 2GQ8A 1NF7A 4NJKA 3MO7A 3VNDA 3A23A 3INPA 3CEUA 5CZTA 1A5CA 2V2DA 3N14A 3B0PA 5CPMA 4HSOA 3W1RA 2VEMA 5AHNA 4RXGA 5C2XA 4AF0A 3BARA 2O7SA 1XI3A 3A5VA 2E77A 4X22A 5D09A 1PHQA 1C9DA 1OF8A 3C61A 2OT1A 4FXSA 5AC8A 3KOFA 3IVSA 1ME7A 5BW6A 1O60A 1WXJA 2G96A 2ZTKA 2CW6A 5AFDA 1TSIA 4PFMA 4AB4A 3LB0A 5TQLA 3NO5A 5D38A 3B4UA 3EXSA 4K8EA 4GNJA 1XBYA 4WXZA 2Y7FA 1I2QA 2C16A 4UIOA 4PODA 4O52A 3HG3A 4JYDA 1WA3A 4JTHA 3VI2A 3BLIA 1Y0EA 2NWRA 4RCXA 1O94A 3S5YA 1W31A 3M7WA 3LX9A 3OG3A 4LVAA 4IJBA 4MZYA 2EKCA 3W9ZA 1DJQA 3NXFA 1HFBA 4NZFA 3SZ8A 1AL7A 1GT8A 4GUGA 4MYAA 3S1WA 4HSNA 4Y8FA 3SJ3A 3N34A 2OMAA 4MJMA 5EBUA 3NPXA 3GKFA 3S5ZA 1FY6A 1KM1A 2ZFAA 3BO9A 4TMBA 1MZHA 4OHQA 3LCFA 1HTIA 1TJPA 4O8RA 4HN4A 4UTWA 3C2EA 3L67A 1L6WA 1KTCA 2BLEA 1H61A 5HWMA 1NSJA 2E6YA 4FX8A 3LM7A 1DL3A 1VC4A 3W7QA 2FPVA 4NVTA 5I3HA 1WX0A 5CPNA 3LI1A 5A5WA 4HNUA 3B0UX 1TPWA 4AAJA 1A50A 3PM6A 3TQ0A 3W73A 1ICSA 4U28A 3KRSA 1SO3A 3TH6A 3MHGA 3TC6A 4AWSA 5KINA 3IIOA 4I7UA 3GXNA 3LV6A 4OV9A 5D2TA 3E02A 5K9DA 3NYZA 4EOUA 1X8FA 3VE7A 2R14A 1UJPA 1F76A 2VFGA 4LNYA 3C6CA 3KAOA 3NQ7A 3LRLA 3UWVA 4W9TA 3PG8A 1ZAIA 1XC4A 1UUMA 2VFDA 2CLMA 3UNDA 4JTEA 3DI0A 3QFEA 1FCVA 2QCMA 2V5LA 4K7YA 4JXCA 1OX4B 3SIZA 1L6SA 2RHGA 3O1NA 2RH9A 2J88A 1I45A 1GTEA 3UZJA 6ALDA 3LDVA 2QCLA 3GK0A 3IV3A 3NGJA 3FS2A 3HO8A 1A53A 5AHMA 1EPXA 1CI1A 2E5DA 5D32A 3G1FA 1ZY9A 1TPDA 3GVGA 5LNRA 2YR1A 1BWLA 2V2CA 5F4WA 4AHQA 3R2GA 3NQ8A 2JGQA 5HWJA 4NJIA 2J9ZA 1SPQA 3W07A 3F03K 3P82A 4UC5A 2CLFA 2I14A 3BG3A 2QCHA 3TSDA 2VEIA 4O1AA 3PB0A 3I7SA 3FYPA 3CU2A 5L9FA 3QW3A 5HQEA 3UWWA 2GVGA 1JULA 4MJZA 1KBJA 3WJSA 1DVJA 4DO5A 1SSGA 5LHEA 2TMDA 1GVQA 4JTLA 1D3HA 3LTYA 2YDAA 2UV8G 1PIIA 1YXYA 1H63A 3A24A 4E2BA 2QCDB 3LHUA 5C55A 2JKEA 4GRSA 1EX5A 3DENA 3LHZA 1KM3A 3B05A 3BG5A 3DH7A 1I4NA 1LOLA 4P61A 4XKYB 4NX5A 3SGZA 1K7XA 1OYAA 3B03A 3TAOA 4NNBA 1VYRA 5F2IA 2DZUA 4UFJA 1QMLA 3RFAA 2GQAA 4MYXA 3M5ZA 4BI6A 1J5TA 3I7RA 3R8RA 3TJXA 2WNNA 1Z48A 1KTBA 2AGKA 3P5ZA 2A2IA 3G1AA 3MP5A 2QCCA 3ZS4A 3PUEA 4KFOA 1EUNA 3W7PA 5G1YA 3L0GA 1IXQA 4OU1A 3O07A 3W7JA 3GX9A 4FXRA 4OWGA 5G4EA 1FDYA 1JQXA 4PH6A 1P4CA 4EIVA 3U8GA 4N9CA 3TXZA 2B4GA 2RDUA 3KX6A 4JIQA 2DZPA 4CLMA 2Y7DA 3TR2A 5CPLA 5DCEA 1ZJIA 1O5XA 2ATMA 3PBYA 4N4PA 4XZ9A 3UY8A 5DY3A 3GDMA 4Y6GA 4AEOA 1W3NA 3H53A 2NV1A 5KMYA 4HNVA 2HSAA 3KRUA 4A22A 4S2CA 3M6YA 4IX2A 2G5WA 3HPXA 1ZALA 2XN1A 1FDZA 5DELA 1OK4A 2ABAA 1S5VA 3GXPA 2QJHA 4HIBA 4K7VA 4KFPA 5FEPA 2YX0A 2J9YA 4UTIA 3Q94A 3L2IA 2OJPA 3N2XA 3N3MA 3A9IA 4JYEA 3SFKA 1H60A 1L2UA 2Z2UA 3W1TA 5K9XA 3THAA 3W1LA 4DXVA 3DAQA 4ZMGA 3WFAA 4NU7A 3GNNA 4E38A 3NEVA 5EYWA 1SZEA 5EL1A 3LCWA 3W7NA 2C1HA 3W7RA 5J5RA 2Y89A 4Y9AA 2ISSA 3O8AA 3NL2A 5K2ZA 2QUTA 3M41A 4JTJA 3PAJA 3NQEA 2ZCGA 5G1TA 3LRKA 4YCOA 1H51A 3C8FA 4MY1A 4GUJA 1GQNA 1K8XA 5FEXA 3DZ1A 1GZGA 3W88A 1I2RA 3LCXA 3HG2A 4OT7A 1G4EA 3KXQA 1UCWA 3TC7A 1R46A 1B9BA 1T8XA 2F7FA 4KWVA 4FNQA 1TPB1 1GOXA 2X16A 3O6YX 3CQ0A 4JX6A 1VLWA 3QMSA 1IF2A 3W84A 5K4ZA 3W2UA 4C1LA 3MI3A 4D2JA 1JCYA 1VYPX 5HR7A 3TXVA 4DO6A 4Q32A 3WK1A 1H1YA 1YTDA 3M5VA 7TIMA 2YCEA 4Y96A 3Q37A 1JUEA 5KSWA 2V2HA 3W85A 4E2DA 3UY7A 2FB2A 4CNOA 1P0NA 1LBLA 1W56A 2ZZ2A 5K7JA 2D73A 1WV2A 4FX6M 2NUXA 1Q3NA 3G3MA 1ML1A 1JQVA 3LTSA 3ZFHA 3MYOA 1JCNA 4RX0A 1R2RA 1SZFA 3NOEA 2BWGA 1XM3A 3P81A 1SSDA 2C15A 2WJZA 4N9BA 1JRBA 4G1KA 1VHNA 5D03A 1IXNA 3BW4A 1ME8A 2YW4A 3V75A 4QIUA 5LNWA 3YPIA 4UTLA 1F74A 2DZSA 1ZAHA 1QO2A 3QM3A 2E5BA 4I7WA 2E68A 3G24A 1WOBA 1NVMA 3NDOA 4BF9A 2CLLA 4HNNA 4GXMA 1EA0A 1FXPA 1PHWA 5BRBA 2VFEA 1TO3A 4IPIA 3WJYA 5KZDA 5D37A 4PTNA 4ADUA 3NG3A 1EP3A 3STEA 3P5YA 4M6QA 1G4PA 5I3KA 5LZLA 3MHUA 2A5HA 3G22A 4YLWA 2QDGA 3PS7A 1JR1A 3F4NA 3MYPA 2J6XA 3Q58A 4HHPA 5G5IA 4UUIA 1JUKA 4WQ6A 5F2GA 3TQKA 3TMQA 4TIMA 4QJ1A 1AW2A 1LOSA 3OBKA 1G7UA 4MY9A 5TBOA 2NLIA 3NQVA 4O19A 3W74A 4AHOA 1O4UA 4FNPA 5IBXA 1TTPA 4JDBA 3RMJA 1CX9A 1BEUA 4WY0F 3CIXA 1H5YA 3WJXA 1TB3A 4UR8A 1ALDA 3S0CA 4PA8A 4O10A 4E0CA 3C52A 1QPOA 2PCQA 2ZYFA 3C2FA 2VFFA 4OBTA 4IXHA 1GJPA 4IPJA 2ZRXA 5EY5A 5H2ZA 4FF7A 5FESA 4ZQRA 1YYAA 2NZLA 3S5OA 1VHCA 5F4XA 1PL9A 4O15A 1QDSA 4LUIA 1YDVA 5D2YA 1X6UA 3CLMA 3DBPA 1DQWA 3BVJA 3NQ2A 1RVGA 3FKKA 1KM6A 4JTTA 1H62A 3QYQA 4R34A 4WOQA 4CCDA 3QJAA 2V82A 4NQ1A 3O63A 3HGRA 2R8WA 3P7YA 4LRTA 2YFNA 4H6KA 2A4AA 4ICNA 4CCCA 3P61A 1ZNNA 3PBUA 1H50A 3O6DA 4O4WA 3TKFA 2YW3A 5DY2A 4CNNA 2C14A 1K7EA 3NQ6A 4ZQCA 3DKLA 4MZ1A 1ZFJA 2CU0A 4O0KA 3AO0A 4JGDA 3I68A 4C1KA 5J5DA 5KZEA 4Q4KA 5E1QA 3HIJA 2CLKA 2VENA 4YCPA 4NZJA 1JCJA 5KITA 4JYFA 1XL9A 4LVFA 2X1SA 1T96A 3W3OA 3W75A 5FEZA 3TFCA 1SZNA 1XCFA 3MP3A 4JX5A 4XTDA 4LVGA 3A21A 1W5QA 2H3DA 5HWNA 1O5KA 1YDNA 3R89A 4XWUA 2ZZ3A 1TTIA 5CSRA 4LVBA 2E09A 4R33A 2BX7A 4WOZA 1YLVA 2PRLA 4CQ8A 2DZTA 4O16A 4IOTA 2ZDRA 5AHLA 1OK6A 1OX5A 1TPC1 3IVUA 4PL2A 4XUGA 4X3ZA 2GPTA 3N9SA 1TPFA 4IUOA 3CTLA 3FJ6A 5HULA 1KV5A 5LGXA 3G0UA 1LCOA 1LP6A 2DJLA 4QNWA 8TIMA 3W2JA 1L6YA 1EUAA 3AJXA 2AQWA 3G1DA 1PCKA 4IMDA 2CLOA 4ZQOA 5AB3A 4UTTA 3NNTA 3KVKA 4NXSA 2J24A 4Z0JA 4WUIA 1VZWA 4JR5A 2FDSA 1LZOA 1SW3A 1YADA 2GJLA 2WOQA 3IIXA 1MEWA 3EWZA 2Y6ZA 4MOZA 4BWLC 2H8ZA 4A3UA 2H3BA 3BPWA 3IGXA 5F1UA 1EP2A 1SW7A 4O14A 1G6CA 1M5WA 4RZ5A 2QR6A 2QUVA 5AYZA 4UTKA 1QFEA 4ALDA 2H6RA 3HGSA 1KFKA 4GUHA 2Y7GA 1SQ7A 2P1FA 2PE4A 4MKNA 2EF9A 4FNUA 4RJEA 3EX6A 4O0ZA 2E1DA 1KTNA 3STGA 3W72A 1OX6A 5BMXA 3TJLA 1WBHA 3E0IA 1XDMA 4MFEA 3TQVA 4JS3A 1SZGA 2DZWA 1B4KA 1WYIA 4UTMA 4DBEA 5K3VA 1FWTA 1NF0A 4Z08A 5AHFA 3S1VA 4GUFA 1IXOA 4POCA 4AVFA 2NX3A 2JGYA 4NNAA 3GYEA 1YXCA 2E5CA 3W7IA 4LT9A 1VLIA 1P0KA 3EXRA 3L5MA 2B7NA 3DU0A 3JS3A 3RU6A 1K3UA 3NPVA 2QCNA 5D02A 1GTHA 4IGHA 3EX3A 1OFBA 4TX9A 3UXAA 3M16A 1LBMA 4MVAA 5AYXA 4IMFA 3QSRA 2OT0A 5D05A 3B8DA 3SR7A 3DI1A 1S5TA 3W7LA 3ATZA 1C29A 3S5NA 3QRHA 3TNOA 5G2WA 1X1OA 3EWYA 3RLUA 1K03A 4KFNA 4GFSA 1JCXA 1JUBA 2BXVA 4LUJA 3W7MA 3RNDA 5CZSA 4K8HA 1I2NA 5G2HA 1C8VA 4LTSA 3TSMA 2ZA1A 1KFCA 5BNKA 3DFPA 1XUZA 4LY8A 2EAWA 3GLCA 2ZZ4A 4FO4A 3A22A 5AC6A 1H7OA 2Z1BA 4J9JA 6TIMA 2TRSA 2G97A 1LBFA 5BOOA 1RR2A 1K8ZA 2G95A 2H8XA 3QEZA 1OHLA 3HG4A 1S3HA 1H1ZA 4JNMA 3LHVA 4XTIA 2NV2A 4O1CA 1KM5A 2Y70A 3I7QA 5F2LA 4MFDA 1G67A 2YXGA 3S1UA 3W2KA 2FB3A 2NXIA 1LRNA 2GVJA 3R12A 1DV7A 1AG1O 5TIMA 3QW4B 4X9SA 5HNRA 4K36A 3LV5A 3VKJA 1LLZA 3PULA 3G1HA 2Q8LA 3MI2A 2W6RA 2DZXA 1TPEA 2Y85A 1F2JA 4PEKA 3Q2DA 4GJ1A 5KTLA 1KFJA 2Z6JA 3MUXA 3CPRA 4RV8A 5HJLA 1DQXA 2ISWA 3S1XA 3UPBA 3G1XA 2NUYA 2VEPA 1Q6RA 4O1DA 4QM1A 4O53A 3RF9A 3L21A 4A2RA 2RDWA 4ONVA 3CB8A 1ZCOA 4QSHA 4OGZA 4LRSA 4IMCA 3TE9A 4H3DA 1TPVA 4LS1A 1VCGA 3VCRA 1SU5A 4FX7A 2KZHA 1KFBA 4NX0A 1KLZA 1QWGA 4TR9A 1TRDA 1D9EA 4DPQA 3ABOA 3S9YA 2A85A 4L4MA 5D2WA 3BLEA 3G8EA 3BW2A 1OFQA 3NM1A 4FIQA 3O06A 2GOUA 4AF0B 3BK0A 3B0VC 1I2PA 1NFBA 2PC4A 1P1XA 3LRMA 1RQHA 3P8IA 3NL3A 4OV4A 1OYCA 3CWOX 3IVTA 3EKZA 2HS8A 3QQ0A 1OFPA 3LXBA 3SY5A 3UWUA 5K4XA 1Z41A 3O15A 1H7NA 2QDHA 3THQA 4NJHA 3LCHA 4IX0A 4ML9A 1FDJA 3PWAA 3GAYA 2TYSA 1GVFA 1N7KA 2P0OA 2C13A 2Y7EA 1QR7A 3KHJA 3GR8A 3CWNA 4NUWA 1OFDA 2ISVA 4BR1A 1D3GA 4UNLA 2WQPA 5DXXA 3JRKA 4QQ3A 1M7PA 1FQ0A 4K39A 4WD0A 3SI9A 2X1UA 4JY8A 3S8HA 5DBTA 3C2OA 5SWUA 2QUUA 2ZBTA 4QISA 2A7PA 3T78A 1XBZA 3NAVA 4XQ6A 2NX1A 2JKAA 1LORA 1OFRA 1T0OA 1U83A 3FA5A 1TTQA 4LC8A 2Q3OA 4O28A 1YPFA 3A5FA 3EKLA 4WZHA 1THFD 4JEQA 3L0KA 4K38A 1FWWA 1AL8A 5I3IA 3PG9A 1OYBA 1XKYA 3PY2A 1GYNA 1HO4A 4BK9A 1YDOA 3TCEA 2YPIA 3MBFA 4LVDA 2E6AA 3BLFA 2A0NA 5IM51 1I8JA 1A5AA 3QSTA 4CCEA 3BGGA 3EX2A 4RZ6A 2VKZG 4EF8A 2Y61A 2FIQA 2ZZ5A 4ORIA 3IGUA 3GKAA 4CQ9A 2BTMA 5HR6A 3QC3A 1QOQA 4MZ8A 4O1BA 1TTJA 2BZNA 2QAFA 5FF7A 3W7GA 1ADOA 2FTPA 2YZRA 2FPYA 1FBAA 3CM4A 3MW7A 3M5YA 1PV8A 3OEXA 1KLYA 2BSLA 4Q33A 3O16A 3PC0A 1TMHA 2FFCA 3L9CA 3EXTA 3DHFA 3PSVA 1TYGA 3M43A 2DORA 3W7CA 4ZL1A 4WXYA 3NQMA 1LOQA 4KKXA 3W71A 3OVQA 3LCIA 5FF2A 5CSSA 1VRDA 3LCGA 5E0KA 3S42A 1UUOA 1P5BA 1V5XA 1W3TA 2WSYA 1OX4A 1LM1A 3HQ1A 4IMEA 3CC1A 4QNEA 2QCGA 2ATSA 1R47A 3FKRA 4KWWA 3IIPA 1MXSA 4M7SA 4U4MA 5CGQA 1JCLA 3GR7A 1JVNA 1YTEA 3ABSA 3ATYA 3HG5A 2CZFA 1RD5A 1RZMA 3W7KA 5FF0A 3MHFA 5I3GA 5LHFA 1XUUA 3ZWTA 4K6AA 4MIMA 1QNVA 3TROA 3HBLA 2H90A 4RZ4A 1H7WA 4M5PA 4UR7A 2JKPA 3WK0A 3R13A 3FFSA 1LTDA 4JDYA 2FQIA 4FNRA 5D2VA 2Q3RA 2WSRA 1QPRA 3FLUA 5I3JA 1VJIA 2YYUA 2GUUA 1VS1A 1DHPA 4DPPA 1ICQA 1FUYA 2QCEA 4PCFA 4HT3A 4TMCA 3GB6A 2I9EA 2I1OA 3N9RA 3W83A 2X1RA 3C2RA 2YYTA 4JY9A 1KM0A 4UFIA 1XDLA 4R7JA 2V5BA 2P10A 3E49A
chains in the Genus database with same CATH superfamily
1IEVA 4PMUA 3ORWA 2V5CA 4JIRA 2E6DA 4YTRA 1IGWA 4LPCA 3B9DA 2VVSA 1M65A 4P2VA 4HNTA 4GC4A 3CEPA 4WIWA 3ITVA 4YU1A 3EWWA 4MB4A 3C2VA 4MAZA 2REQA 2ZOXA 4QAWA 2UBPC 1PSCA 1PVNA 2XM1A 4E3TA 3BOXA 3N15A 1R5YA 3G0XA 1K4HA 3TTSA 4PMVA 2R82A 4UMAA 3KE0A 2W9MA 1AZ1A 1VJSA 2WANA 2PGEA 4LUSB 4KEUA 1A5KC 2C0AA 1WAWA 2O4MA 5FF4A 1PJ9A 4C6MA 2PP0A 4XD5A 4Q6XA 4CGTA 2O7QA 3D0CA 2BVWA 3MB9A 3VDBA 2DSZA 4MPKA 3VMPA 3GU1A 2OYLA 2XFWA 1XYZA 3NM3A 4AZ5A 4E4PA 3EEGA 1TR1A 3VIKA 3F4DA 1KM2A 4PUMA 4HZ6A 3HOJA 1S46A 1NAL1 3L0NA 1BKSA 1XP3A 4ZFMA 2TODA 1H7XA 5MKGB 1HGYA 2NUWA 4GINA 3ALGA 3USBA 4WLCA 1J79A 4S2BA 2YCKX 3EKGA 3T4CA 1UD3A 3S3GA 2TPSA 4PUKA 4JAWA 2F2KA 2QHAA 1EWEA 2FPTA 2HK0A 2ZWZA 2XG9A 1W17A 3O05A 4GY0A 3W2MA 1W6TA 2WPGA 1UC5A 3E2SA 3SW6A 4DUOA 3SGUA 3SADA 2BP1A 2WM1A 4L4OA 3RJXA 3DHDA 3UWQA 1RV8A 2GL5A 1R6WA 2R94A 2B7PA 1QI5A 2HPIA 2XWEA 3GC4A 4EAYA 3KOWA 1XIMA 2IKGA 5BXRA 3LBMA 1DWFM 4HYWA 5E70A 3HB9A 5XIAA 2DUXA 2PUZA 4N6EA 3P6LA 4PUDA 1HG3A 1EDQA 3OA3A 1C9WA 3LBCA 3JR2A 2PDWA 4H6QA 1PKMA 3S5SA 4R7OA 3PR2A 2C3ZA 1XV8A 1QNOA 3NZRA 2J78A 2D3NA 4FK9A 4PEEA 1UASA 3MUAA 4AHPA 4K1WA 1LL7A 1VR6A 2CESA 5HMSA 2DU2A 1T7LA 1K02A 5I3FA 1GUVA 2OEJA 1W9XA 4N7QA 2E9MA 3MUIA 3UZ5A 4QTGA 1H7PA 1WBJA 4GX9A 4BJHA 3C4UA 3NJ3A 1OT1A 1DBTA 5CXPA 4ZQNA 1PYMA 4XK2A 1RA0A 3LHYA 3LN3A 3PJWA 2Z2AA 1JPDX 3PFMA 3E12A 2WCSA 3TDFA 2PTWA 2V5KA 2WQDA 4H9YA 5HUOA 2Z27A 2ZRWA 3FEQA 4YL2A 3W1XA 3D6NA 2YFOA 4ZO9A 4Y8EA 1TPUA 2PDFA 2Z6IA 3BJSA 4JTIA 3UCQA 3A13A 3W70A 1B4EA 1OVDA 1KA9F 3APGA 3SCTA 4J1OA 2PAJA 3NTYA 4JFUA 1ZHAA 4N9DA 4EPKA 3NA8A 2X1IA 5CZJA 2ZZ7A 1PDYA 1JRCA 3AFBA 3AIEA 1VPYA 5H91A 4AD1A 1RSCA 3TUUA 2PZ0A 1F5ZA 2W92A 4GE8A 6ENLA 3HGJA 1FX6A 2OB3A 1HUVA 1SJAA 2QKFA 3NYDA 1GZ1A 2Q6ZA 2W0UA 1GJUA 1C7SA 3IEBA 3PTKA 5G4WA 2ZE3A 4F0LA 1UR4A 4JTSA 3K2GA 1EL3A 3QMTA 4QEHA 3FEMA 5C6MA 1QPQA 2ZZ1A 2YL5A 2ZZ6A 3CV7A 3TSBA 3UCDA 1EB3A 4LU0A 1EH9A 4ES4A 1KWGA 3H4XA 3BJTA 3WK2A 6REQA 4ZEPA 4BWLA 4UTUA 1SJDA 4H8NA 3WDHA 1OCQA 1T8QA 4O54A 2X0SA 4P8XA 3M1ZA 3VM5A 1TWIA 2P8BA 3MS8A 1NEYA 3P84A 3LTPA 4ADTA 2IQTA 3W2NA 7TAAA 3TWBA 1JPMA 3POCA 3LCLA 3CUFA 3TZFA 1G7VA 3WF4A 4DAFA 1XLCA 1P43A 3P8JA 4B3LA 4GQRA 3AXHA 3GBEA 1UR1A 3SUTA 4CVWA 3TU9A 4Z1YA 1S5WA 1ZJBA 3ZLGA 2XIOA 1EWDA 1D8CA 3WJWA 1AK5A 3WLKX 3UZYA 1YMYA 5J04A 3B8WA 4LX4A 2WZHA 4Z2HA 4CQAA 1VKFA 3NQFA 4DI8A 1EDTA 1IEIA 5IFTA 1EEPA 1QCWA 3RLVA 2EG8A 3L68A 3ZJ6A 3STCA 2J4GA 3UERA 4PL1A 1XD0A 1UIPA 3W76A 1CLVA 4PMXA 3H2FA 3S2NA 2TSYA 4M1RA 3QY6A 1VFUA 3P67A 3OIXA 1JZ3A 3GE7A 3QKZA 4UTHA 4FHAA 3FSTA 1F61A 1O1ZA 3TFXA 4EF9A 4B2DD 1DKWA 1Q6FA 3VD7A 3MQTA 3KBNA 3LLXA 2A79A 4DELA 3DXIA 3V5CA 3H55A 1J6OA 2Z1KA 3SFWA 4KW2A 1OIFA 3MC5A 3H2NA 3T1GA 4L64A 5CAHA 4YMZA 1E1FA 5I2UA 4P7NA 3QV8A 4I9JA 3GDBA 3E0LA 2AGTA 2C91A 3GTFA 1Z44A 1F6KA 3T07A 2WPBA 3GNRA 3V5FA 3S46A 3TV8A 4UNKA 1W8SA 2EPLX 2J6VA 3WQ6A 3FNDA 7ENLA 4LYKA 2Y4SA 2GGGA 3ZZ1A 1QT1A 3BG9A 3W7DA 4KETA 1VGAA 4S1FA 1Q63A 3R1ZA 2CERA 3L5AA 2GJXB 4AIEA 1EXPA 2O9TA 2CLHA 3NQBA 4MADA 4QCEA 1LL4A 2G37A 5CG7A 3G6MA 1TQXA 2I57A 1GOWA 1GYMA 2W4XA 3VVGA 5I6SA 4OE7A 2B31A 1E51A 4WEVX 3TK7A 1CB2A 4QE1A 3VZZA 5G4HC 3CIWA 2D23A 3PBGA 4GNVA 3RUBL 1KBBA 3CB3A 4Y7EA 1SO4A 3LHTA 3NQDA 5MHBA 4DX3A 3WFLA 2C6QA 4LW7A 2YA0A 3ZSTA 4MM1A 3WLOA 1DOSA 5AYBA 5T9BG 4JQ2A 3HQPA 1V7AA 3LU2A 4A2SA 1HL2A 2WSKA 1IIHA 5HANA 3UW6A 2NXHA 5AOUA 3ME3A 3QPYA 3ABQA 1J2BA 3APTA 3MWAA 5K9CA 4GG9A 2OX1A 4I8DA 3CAQA 3ES8A 1AQ0A 1JAEA 2F61A 3NL6A 1IXPA 3NSXA 3GAKA 3IWPA 2QAPA 3T40A 1HL9A 1Y5WA 5CZ0A 2XN2A 1P48A 5EKYA 3MY9A 3IJIA 3KTCA 1TV7A 2W66A 2RFGA 1W9PA 4AXKA 1W3LA 4PB4A 2FZBA 4RV3A 3H24A 2G3JA 3KL3A 4KEMA 4JICA 3ONCA 2X0HA 3U4FA 4H8HA 1NF7A 5DMNA 3L4YA 3U4AA 3V0TA 2J79A 4PCTA 4BS0A 4H00A 5CZTA 1A5CA 2J7BA 5CPMA 4WKAA 1E1EA 2VEMA 4RXGA 2WC7A 2NQJA 3SURA 2CETA 3C61A 3AMKA 4Y9OA 1NOUA 1I75A 2AQOA 3SRKA 4R27A 5BW6A 1OCNA 2OSYA 2XSAA 4E2OA 3VGHA 3LEPA 2MUCA 4MWAE 4XZHA 4PFMA 1KR0A 4K8EA 4ZO6A 3O7UA 4D72A 1XBYA 1R9YA 3DHPA 3MMDA 4MJ4A 2C16A 2CHNA 4B5SA 2CWXA 5M1TA 4DVOA 1TE1A 1WA3A 3VI2A 2PPGA 3VIMA 3NIYA 1Y0EA 2NWRA 3AS0A 1O94A 1MW0A 2JFEX 4LAKA 3LX9A 6XIMA 4IJBA 1UKSA 1ZP4A 3L2LA 3SZ8A 1AL7A 3WQPA 3GU9A 3S1WA 2OZ3A 5J8LA 3ANUA 3AUJA 3SJ3A 3N34A 4H9TA 3LBOA 3S5ZA 1UD6A 4W86A 4OHQA 3UEQA 3LCFA 1B1YA 1EOKA 3VIFA 1BF6A 1XCXA 4HA1A 3L67A 1NSJA 2VNCA 4R88A 3LM7A 3QZ6A 1DL3A 1H2JA 3VUPA 4NVTA 1TZ9A 2ZX7A 5A5WA 4AAJA 2EPKX 3M07A 4PMZA 4IQEA 3O0KA 2GYIA 1ZJHA 3UR2A 2XU2A 3TC6A 3SCNA 1FWCC 4AWSA 4I7UA 3K8KA 4F40A 4OV9A 3EEZA 1S2UA 4QSFA 4L6DA 1HXJA 3KP0A 3NYZA 1JDDA 3KOZA 3FAWA 9CGTA 2R14A 3C6CA 3NQ7A 3OA5A 1BRLB 1DTUA 4GVHA 3XINA 4AZHA 1UUMA 2XFRA 3UYIA 3IAPA 2VFDA 1QI2A 3UNDA 3DI0A 1FCVA 2QCMA 4K7YA 4JXCA 1V0KA 2OEKA 2RHGA 3CHCA 3H2AA 1J0JA 4L9XA 2BY0A 2PGWA 1E1CA 2E8ZA 4KGLA 1XG3A 1QUMA 2QCLA 3GFXA 3VMOA 3SQSA 3CYJA 2E28A 5AHMA 3PJXA 2E8YA 1EPXA 1CI1A 2E5DA 1OZMA 5D32A 3G1FA 1TPDA 1IEWA 4U33A 2YR1A 2V2CA 1I0DA 3NQ8A 1XLAA 1P6CA 1BTCA 1FH9A 3V36A 2UY4A 3F03K 3P82A 3TN5A 3AS2A 3GM8A 2G3MA 4FSAA 2I14A 3BAWA 3BG3A 2AL2B 3I7SA 3CU2A 5AVHA 1MMFA 3UWWA 1JULA 4MJZA 3B4YA 2I5QA 1SSGA 3KTXA 1TVNA 5LHEA 1YNPA 1CGVA 1E0TA 4JTRA 3LTYA 2YDAA 2ZUWA 3NWRA 3A24A 3EOLA 2O0TA 4WCJA 3REQA 4J3TA 1BF2A 2WHKA 3DENA 2ZX9A 4JKMA 1HQTA 3B05A 3WQVA 1KQZA 3UF9A 4RE2A 4HCHA 3OG2A 3SGZA 1E55A 3TAOA 3PTDA 5BROA 2DZUA 1K9FA 1QMLA 5IXEA 2PD5A 2REQB 1K6AA 3CAWA 3WX7A 2I5IA 1J5TA 3I7RA 3TJXA 2WNNA 1POJA 1Z48A 1JYWA 1ADSA 2HVOA 4KCWA 4HPNA 3GNXA 5D4YA 2Q01A 1XLGA 4Q8WA 3MP5A 3FK4A 2GFTA 3LD5A 2FMOA 1EUNA 2XISA 4PCSA 4XD3A 1XG4A 5BWFA 1J9YA 1VBUA 2YXXA 4OWGA 3PUGA 3W27A 3EGJA 3P14A 1MDLA 2Y7DA 1E0UA 2ATMA 3NOYA 2V68A 1IQ8A 2GGJA 2WWDA 1JFXA 5DY3A 4H8VA 3RM4A 1U2YA 4Y6GA 1EC9A 3ARYA 3UXLA 3M6YA 5TNVA 3CS2A 2J66A 4W5ZA 4B3ZA 1ZALA 4JPGA 1TWSA 2ABAA 1ZUAX 1ZCCA 2OSWA 4ROPA 2YX0A 4ZO7A 3T0DA 3P93A 1GVIA 3UFYA 4EPEC 4Q4SA 2WLYA 3L2IA 5AECA 3A9IA 1MUCA 2Z2UA 5K9XA 3THAA 4XVDA 1AQMA 4DXVA 3DAQA 4PB3A 4NU7A 4E38A 3NEVA 3WH6A 5EYWA 1SZEA 4M1BA 3W7NA 3W7RA 3VOCA 2Y89A 1GW1A 4TXEA 4Y9AA 1WDSA 3MMWA 2SFPA 2ISSA 5K2ZA 4PSPA 3R4IA 3M41A 3TTYA 3PAJA 4GUJA 1K8XA 1IWBA 1JNEA 1B54A 1GZGA 1SFTA 3HG2A 1XKJA 4OT7A 1UCWA 1JDCA 3H6OA 1B9BA 1T8XA 4KWVA 1AJZA 4L65A 3O6YX 3CQ0A 3PK7A 3SAZA 3AZSA 4KWUA 3JW7A 2QW5A 1FRBA 2G4FA 5K4ZA 2HNEA 1CB7B 2XVGA 3H12A 3WF1A 1U22A 3DYPA 1JYXA 2P3EA 3VGGA 4YTUA 3AU2A 2XIBA 3EB4A 1P7TA 2PDNA 1HKMA 5LIUX 4PMJA 1ML1A 1AMYA 4RX0A 3WH7A 2VC9A 3DHUA 4XKMA 4HGXA 2FHCA 1CIUA 1H0GA 4N9BA 2WJZA 5D03A 4CU6A 1WO2A 2H9AB 3V75A 5LNWA 4TVUA 3BDKA 1JXKA 2BY2A 2UWFA 1MYRA 5A6LA 2OKOA 4G7FA 4I7WA 3CGTA 3G24A 1WOBA 1UH2A 1NVMA 2XGBA 4DLFA 2CLLA 4HNNA 3WUFA 5BU9A 1QHZA 3VKBA 3V4BA 1WZAA 3W37A 3L4TA 1ONEA 3GTHA 4Q8PA 1TMQA 3PPHA 4M6QA 1XWYA 5I3KA 1ITCA 4V27A 1B0IA 3PS7A 2XIJA 3F4NA 2QZRA 3DFHA 1E9IA 2DQWA 1W91A 1CENA 4HYRA 4QJ1A 4DZ5A 1LOSA 3OBKA 1UMYA 2WWCA 4MY9A 1WXZA 3A64A 3OVGA 2XZ7A 4DJED 3NQVA 4AHOA 4S38A 3LM3A 1TCMA 2GVYA 3W00A 2HDJA 1BEUA 4WY0F 3WJXA 2OYKA 1TB3A 5IOBA 4F2TA 4MB3A 4IXHA 4ICCX 4FF7A 4ZQRA 4JL1A 1DJHA 3S5OA 2WMIA 4LAZA 1PTAA 5PTDA 4CEUC 3MVTA 4CKQA 3RR4A 2EJ1A 1MWOA 1M7JA 3F5JA 3WSUA 1KM6A 4JTTA 2UZ9A 1HJWA 3ZO9A 3AYVA 2V82A 3VOJA 4RE0A 3T8LA 3OYXA 2JF6A 4RW3A 4GYPA 1W2PA 2OR2A 4AIUA 3O6DA 4ZR8A 4OIFA 2PWVA 6REQB 2DQXA 1K7EA 3NQ6A 3ZMRA 1J96A 3CXOA 4MZ1A 1ISZA 2CHOA 3AO0A 4JGDA 4QX4A 3R25A 2WJEA 2NQLA 4Q4KA 5E1QA 3TVAA 4UR9A 1JCJA 2BOFX 2V6AA 3NVDA 1OBAA 2V69A 1UKOA 4JYFA 3CASA 3EDJA 2VDHA 5A69A 3M0XA 1FP9A 1XCFA 3MP3A 5E0CA 1R3YA 2UY3A 4XTDA 2H3DA 3T2QA 1UR0A 4V2XA 1TTIA 1HKIA 3RPMA 3GWQA 4QEEA 2P0IA 3OLIA 1E70M 1WUFA 2QV4A 1EDGA 4CQ8A 1LWJA 3AZRA 3FAXA 1GKQA 3N2BA 4IOTA 5HJXA 3D3AA 4X63A 1VFLA 4XUGA 3KOXA 1V6TA 1Z32X 3CTLA 3FJ6A 3DERA 2G8ZA 1LCOA 2DJLA 4HCDA 2VL4A 1FHVA 3HZ3A 5C2CA 3OGRA 1XGEA 1A0EA 3DFYA 3UGRA 3DG6A 2IMRA 2NQ5A 3WYZA 1TG7A 4I5UA 1JG9A 4HK6A 2CLOA 2BB0A 3NNTA 4L80A 3KZSA 1EF3A 2X7WA 3MDWA 3WL0A 4QG6A 1C8YA 1O1HA 4F48A 3EWZA 4MOZA 1E6RA 1S38A 4R9OA 3VIHA 3S6OA 3IGXA 3H7VA 5CJMA 4DNMA 1ITQA 3N29A 2PC8A 3AALA 1JI2A 1BYBA 2VX4A 2CZVA 3V0SA 1QFEA 3IJ6A 3IAQA 4Y9NA 2EJAA 1KFKA 2V3FA 2Y7GA 1SQ7A 2P1FA 2PE4A 3C3UA 2EF9A 4J27A 3EX6A 4O0ZA 4GCAA 3W72A 1OX6A 1MUMA 4B5TA 1A49A 3TJLA 4YWSA 3TQVA 3N6HA 3KBMA 2JIWA 1G94A 1IZKA 1WYIA 4Z08A 4F4RA 4D6FA 3UG5A 5FAGA 1J93A 2EPNA 2NX3A 2JGYA 4MDOA 4MB1A 1W1B1 1K8CA 1R8LA 4A3RA 3BAXA 1K9TA 5D02A 1GTHA 2DVTA 2EO7A 4DXXA 1EJXC 3RRAA 1NIUA 1JYNA 2PU1A 2D2OA 5D05A 3B8DA 3SR7A 3U2EA 1VP5A 3W7LA 1C29A 2XHYA 2Z28A 3QRHA 2VX5A 1GVEA 4GFSA 2C0HA 4HMDA 1OC5A 3KWXA 1IWAA 2QJNA 5G2HA 3AIQA 2J7HA 3PBMA 2ZA1A 5E5CA 4YTQA 3V35A 4I9MA 2QMKA 4NHVA 1S1PA 1J0KA 5HPCA 4RE3A 3F2DA 4FO4A 4FF5A 3A22A 2OO0A 5AC6A 1H7OA 3H4WA 4J2MA 3ZT5A 4J9JA 4K1GA 2TRSA 3KHDA 2G97A 1GCYA 3MCMA 1LBFA 2VWTA 5BOOA 3AYTA 3BV7A 3F4CA 1HVQA 4XZBA 4YS1A 3VNKA 3WBEA 3HG4A 3W25A 3SUVA 1XPGA 1Q66A 2BODX 4BF5A 3R0KA 4B4FA 1G67A 1NTHA 4A3YA 3TN6A 1VENA 3WD1A 4A8NA 4AEEA 4Q22A 4PTVA 2C79A 1O6IA 3R8HA 3QXBA 3Q65A 2W5FA 1UPPA 1HNYA 3VKJA 1PX8A 3U9IA 2INFA 3G1HA 4XISA 4XD4A 2W6RA 1TV4A 2WZTA 3AUOA 4E2VA 2VR5A 2Z6JA 5BRPA 3N12A 5HJLA 1DQXA 3UPBA 1RLCL 1VJZA 4QM1A 1X98A 4WDTA 4O53A 2PDXA 3VD4A 3EDDA 4LS1A 3VCRA 2OGYA 4FX7A 4EP8C 1EYWA 4TQTA 2ZUUA 2Z1VA 4HOWA 4PTWA 2J25A 2FZ9A 1D9EA 4L4MA 2YZ5A 1A3HA 1HJSA 1B2YA 4E5TA 1JZ7A 4DJDC 1XJBA 4DYJA 3ZVHA 5ABEA 1EGMA 2BHZA 3IVTA 2ZX5A 1XRFA 3ITYA 4QLJA 4LF2A 1V03A 1B3WA 3THQA 3AMDA 1CGUA 3I4KA 3W81A 2IPFA 3AC0A 1EF2A 2GGEA 3AIVA 2VQTA 4NUWA 2ISVA 1D3GA 4QJ5B 1KRMA 4MNLA 4J5NA 3GUWA 3S8HA 3C2OA 3MV01 2A7PA 4QGCA 1UR8A 2VRJA 1XBZA 4NL1A 2Z29A 4ILSA 4XQ6A 2C8NA 1LORA 2PDIA 4UQEA 3RLHA 1DXFA 4NZ4A 1PZ2A 4QLKA 1YPFA 3T81A 1AVAA 1UP3A 3QHMA 2X2YA 4D6DA 1M1BA 3PG9A 4F2UA 1BG4A 1YDOA 3A9BA 4Z2IA 4LVDA 3T4WA 4UQBA 5B7YA 2A0NA 1I8JA 1A5AA 4CCEA 3OO2A 1XLIA 3EX2A 3TEVA 4RZ6A 5EBAA 2VKZG 3R79A 3SGGA 4ORIA 3QV9A 4IGNA 1E15A 3IGUA 1MW1A 3T0TA 3QC3A 1QOQA 2BZNA 5FF7A 4DRSA 1HKVA 2BVTA 2FTPA 3A4WA 3NZPA 5FSDC 4GIEA 3OEXA 1KLYA 2BSLA 2DVXA 1RUSA 1U30A 4C7FA 1MQRA 2Q09A 4JFTA 3ZLFA 2DORA 2GJRA 3SN4A 4PUUA 1C91A 3QV7A 5FF2A 1CLKA 4IUGA 5CSSA 3LCGA 4D8ZA 1V5XA 1W3TA 1LM1A 2MANA 3N11A 3CC1A 4A3HA 1OM0A 3IIPA 4I5XA 1MXSA 4U4MA 2E1WA 3GR7A 3HG5A 3VNJA 3WDIA 4Z2KA 3W26A 3MHFA 5I3GA 1X6NA 3K13A 3ZWTA 2BY3A 4MIMA 3WNOA 1E1CB 2FZDA 3HBLA 1YBQA 2H90A 3TA9A 4ZXLA 4E6MA 4UR7A 4YVPA 3KS6A 2JKPA 5CC5A 3FFSA 2NVDA 5A2AA 4IQJA 2HV5A 4LFYA 4HJWA 3TOPA 1MQQA 2G3FA 1QPRA 1NFPA 2WSRA 1E6ZA 4DJEA 1E4IA 4L1GA 5I07A 1FUYA 3GXIA 1Q5MA 2X0YA 4LQ1A 2I1OA 3D3FA 4LY4A 2VI0A 1KM0A 4UFIA 1XDLA 3U5UA 4R7JA 1BXNA 2P10A 2VFIA 1ISXA 1DJGA 3FOKA 4XO6A 1JJKA 4DWDA 4H7CA 2Y62A 3HF3A 4QQUA 1X8CA 4C6EA 3W1AA 1F7BA 1UZ1A 2PLCA 2WCAA 4FI4A 4R53A 3HFTA 4CCZA 4UQAA 1L8PA 1YPIA 4D1IA 3M6DA 3N04A 5I7GA 2EPHA 2YA1A 3AWNA 4GJJA 5EMJA 3VCNA 1QASA 1KWKA 2ZA3A 4TUFA 4MLJA 4P7QA 4GUIA 3T0CA 1A5SA 3DG7A 1TV3A 1NU5A 1XX1A 4EACA 5BCAA 2QT3A 2BDQA 3TYEA 1M6JA 3KVLA 1S2VA 1CXKA 3TX9A 3QR1A 3VNIA 1SFLA 2E6FA 4WSJA 5EA9A 1LWIA 2ZXQA 2Z1XA 1WDWA 3H54A 4GBUA 3LHWA 3LENA 3LERA 1J2WA 4RDWA 1QRQA 2YLLA 1JZ2A 1GVYA 2PDLA 4H8UA 3WN6A 1ZTVA 5FJOA 4Q7BA 4W7WA 2YGYA 3WD0A 3OQ8A 3IIVA 1GOIA 1M01A 3B8UA 2XVPA 4O11A 4BF7A 2QJIA 1OABA 3TYAA 1F9CA 3TAKA 1LJYA 3XIMA 2GK1A 3P62A 4OTKA 3QGVA 3II1A 2VOMA 1EIXA 1K8YA 4YJ5A 3QLLA 5HQMA 1FCBA 3HTWA 2CXEA 3WDQA 2WNQA 3R94A 3KBWA 3VM7A 2WAGA 3ZR4A 1SFJA 1ZLPA 5E9XA 3G1SA 1FWEC 2BGQA 4HHHA 3U2CA 1UUQA 1D7KA 2DEPA 1GKRA 1AA1B 3EWCA 4NASA 5JQ9A 1LYXA 2IS7A 1XBVA 2WK2A 3GZ3A 1F6PA 5C7HA 5C54A 3KFTA 4RDVA 5FF3A 4IGMA 3VO0A 4PUWA 4A21A 3E96A 2A3HA 3K4DA 1WKEA 3T55A 2QDDA 4GK8A 3URBA 1P7TB 4DF0A 4NT0A 3L5LA 3C0JA 1QOPA 4IFOA 3RIKA 2J8TA 1GPWA 3MWCA 3SM0A 3GDKA 1HF6A 3AHTA 4WSKA 5CGTA 3SQMA 3IANA 3KL5A 1K9DA 3GS6A 1OGSA 3SSJA 3EX4A 4NF7A 2CLIA 3MZNA 4RDYA 1HN1A 2BG5A 4M7TA 3MI6A 1JZ6A 4BI7A 2WKGA 4X0NA 1YTKA 2W67A 1N2VA 1W54A 4AUBA 1PKNA 3W1NA 1VRXA 1Y5XA 3A6OA 2NQHA 1OIMA 4YXGA 1BGGA 2BOEX 1N8FA 1DWJM 1L2QA 6CGTA 2PDBA 3B06A 5AN7A 3MO4A 3FIGA 2ZRVA 3Q4DA 3LLDA 3ZIZA 3ICJA 1KFEA 5L6UA 4AISA 1S5MA 4B5XA 3PP7A 2WMFA 3GYCA 3K5XA 4S3KA 1EQCA 5RUBA 5EU9A 3VX0A 2FH6A 4B5NA 4C7DA 4WVXA 2WJDA 5TD4A 2G4JA 4PBGA 1AH3A 3HPSA 4I3GA 3OGVA 1KCKA 3DFOA 2Y5SA 1LROA 4NXKA 1QBAA 5KZMA 3AICA 1OG0A 3L4UA 4W8BA 1W1VA 1IT0A 4O12A 3PBVA 1T99A 3AJ7A 3B8SA 2GGIA 3GIYA 4IFRA 4PMDA 5FJUA 1RBOB 1EBHA 4HOZA 1JDFA 5CPQA 2VHLA 3AIBA 4Q4MA 2O56A 4E4UA 2WVVA 1H7RA 2OODA 4M24A 2J75A 1D3CA 3CUXA 3WH9A 2ZTJA 2J8FA 2Y63A 3RRXA 1GEHA 3SN1A 3M44A 1BVNP 1V7YA 3PAOA 5FI8A 4XZLX 3UQNA 4LYQA 2O9OA 3PWIA 4AYSA 3UR8A 4JQ3A 1Q2RA 4A4AA 1DWAM 2NXGA 4F9DA 3QMRA 5I06A 5H8UA 2V5JA 3E9AA 3RHGA 3CWHA 3RLGA 4RW5A 3WKZA 1XPYA 1EGVA 3ARWA 1D7FA 1XQKA 2CZ5A 2ZA2A 1EP1A 1UWIA 3DBNA 2YL6A 5DFAA 4P8UA 1XLLA 3FA4A 2VO5A 3M0KA 1RCQA 1FOBA 3SY1A 2JIEA 4NP7A 3E1F1 9XIMA 3GSMA 2CZDA 2WM0A 3WLTA 5AHEA 5IBXC 1UP2A 4UZSA 1VYSX 5DRIA 4HHMA 3UWYA 2GJNA 5E93A 1N8IA 2WHLA 1XD1A 2XIIA 1E4NA 1WPCA 5CC6A 1DTNA 1VFOA 1XYCA 4EWJA 3EWXA 1W1IE 2V0TA 4H4IA 5HQLA 4OUEA 3WD4A 3HFYA 2D22A 4OFCA 1UC4A 3EB2A 1VFSA 2C19A 1XIDA 3DESA 3EWBX 2VDIA 3K1GA 1Q8AA 3L7RA 3U6WA 5HUPA 4MWAA 1F3WA 1W0MA 3NQGA 4JCMA 3AIUA 3LPFA 1V4YA 3G3DA 5A8QA 1XYMA 4DEFA 3C3NA 4FIRA 2DGAA 4BFAA 3E0VA 1HKJA 1UROA 5AZ1A 3JUGA 1GWJA 3T9PA 2GZXA 2RJGA 1ADDA 2YDSA 5F1VA 3UT0A 3WBAA 2W3ZA 2O55A 1XIGA 2RKXA 3CQJA 4GI6A 2Z7GA 3JVAA 3R11A 3K8LA 5B7ZA 1WDQA 2INEA 4P8WA 1ME9A 1B90A 4M6VA 5HK4A 3TIMA 3LMYA 1IT7A 1OSEA 2NWSA 4WR3A 4GGHA 3GDTA 3TYDA 4DLMA 2JEPA 4G5DA 3WK3A 3NQAA 2DT0A 5DCBA 2J8GA 3OVRA 4GD0A 3BLPX 1LDCA 3RX4A 4UBPC 1R3WA 3OVPA 4I9AA 4INFA 4O17A 2CLEA 1WOAA 2VFHA 4D6IA 3LZ3A 4FEZA 1MFVA 5A6JA 4MSSA 5DCDA 4FOKA 1TKKA 1XH2A 4ZOEA 2QYGA 2BBFA 1GVOA 4L4LA 2VOTA 2X30A 4EXQA 1HO1A 3VD9A 3MKCA 2ASHA 4DWSA 3RJYA 4XZNX 5FAJA 1PZ0A 5HAOA 4UTWC 1Q45A 1UB3A 3BUVA 1JXJA 1GGOA 1H3GA 2UY5A 3I65A 1GPFA 2DZVA 1UD4A 3BW3A 4DXKA 4Q4RA 2DIEA 1EHAA 2DP3A 3TYZA 4NJJA 4RNFA 1EXBA 3W2LA 3HMCA 2XFFA 4Z1CA 2PDCA 3LXAA 3ZR5A 1QO5A 3MBDA 3M47A 2FJKA 1PS9A 1ZENA 4QITA 2QIIA 3M0HA 3RM8A 1PE1A 1E9ZB 4NJGA 4MPQA 1B3OA 2YCJA 1MRQA 3K1DA 1RP9A 4GBDA 4N02A 4HMEA 2DJXA 3EPOA 1DJWA 1POKA 1XIFA 2WMJA 4HSHA 1W3HA 5A95A 5FD0A 4FA3A 1EC8A 4FNSA 1ZAJA 1TJRA 2FMNA 4PRRA 3DGRA 4QJ3B 3LXCA 1MRAA 1XLFA 3UXDA 1US3A 3IV8A 3W7HA 3H26A 3MJYA 4IQLA 3KEHA 1Z8AA 2JALA 3W4RA 4WY0B 3L4ZA 2WLZA 4YYFA 4W85A 1RQBA 1MEHA 4HQVA 2XPKA 4BZYA 2GQ8A 1KGXA 1U1UA 4F0SA 1UHVA 2O4QA 3B0PA 1REQA 4HSOA 1MFUA 3W1RA 1QHOA 3HPFA 3WF2A 4HU8A 2F8QA 1XI3A 1XH0A 3A5VA 2R1KA 2VR4A 5I24A 5AC8A 3N9KA 2HROA 3IVSA 1R3TA 2ZTKA 3VNLA 5AFDA 4GYFA 4AB4A 3SCPA 3NO5A 5D38A 3B4UA 3EXSA 4GNJA 3MSDA 2CBJA 2JF7A 1X39A 4O52A 3IK2A 1DIOA 2NV9A 3HG3A 2YA2A 2D2JA 2DH3A 4KPLA 1A4LA 4RCXA 3TW9A 3S5YA 5AZ0A 1W31A 3OG3A 4MZYA 1DJQA 3NXFA 3VIJA 1OGGA 3EZ4A 3V1HA 4A35A 3PPGA 1EJRC 4GUGA 5LIXX 4MKSA 4OZOA 1JZ8A 4Y8FA 4FR1A 3GD6A 3NPXA 1PX3A 1I0BA 3UR5A 1PKLA 1P6BA 3BO9A 4TMBA 2FHBA 4CD5A 1VFFA 2DV0A 4US6A 1XRTA 3AIWA 1TJPA 4UTWA 2O9RA 1KTCA 4LAMA 2ANUA 1H61A 2WVSA 3B9OA 1VC4A 2FPVA 1H5VA 2HEJA 3K8MA 5CPNA 4U3CA 3LI1A 4HNUA 1V0NA 1I1WA 3PM6A 1CXHA 3TQ0A 2Q71A 3W73A 3TH6A 3WNLA 3G1RA 7XIMA 1C93A 3PZQA 1TE6A 4PRTA 5KINA 4XO7A 1UWRA 3GXNA 4HA4A 5D2TA 3K4WA 5K9DA 5CQ1A 3W38A 3L4WA 4L9YA 1F76A 4G6CA 4HU0A 3WELA 3UWVA 4IHCA 4W9TA 1LQ2A 2BMBA 2X40A 1ZAIA 1LG1A 2XVNA 2HBXA 3G6LA 4JTCA 3GG7A 2CLMA 2ZUSA 4JTEA 5CPSA 3QFEA 2V5LA 1UZ4A 3S6TA 1DIKA 3O1NA 2RH9A 2Y24A 3RAOA 1XDJA 1SM9A 3VIOA 1GTEA 1IE7C 1XS2A 2XGIA 3IV3A 2VGFA 4ACZA 1A53A 3CUIA 4C6NA 1YBQB 1ZY9A 1BWLA 3GRIA 4AHQA 1YIXA 3GNOA 4EPDC 1FWIC 1OG6A 3PTQA 1GOOA 1YDYA 4NJIA 3GHUA 1GQKA 1SPQA 1BPLB 4AQLA 1GQJA 4O1FA 2CLFA 3LNMA 2QCHA 3WUGA 3TSDA 5L9FA 9RUBA 2VT0A 1KBJA 3WJSA 4DO5A 4HPHA 4Q7IA 1OC7A 4M0XA 4HJFA 2TMDA 4JTLA 4IP7A 4AC7C 1YXYA 4E2BA 3B3DA 4GZEA 1A0CA 4BY3A 1EX5A 2VCCA 3LHZA 2A3AA 4P61A 4NX5A 1VYRA 1DHKA 5F2IA 4H7VA 3C8NA 4UFJA 4MYXA 4HB7A 5DMMA 2AQVA 3R8RA 1KTBA 2AGKA 1VPQA 3P5ZA 3I6EA 1M9HA 2A2IA 3GO2A 4H2HA 3G1AA 3ZYZA 4B5VA 3U5YA 3PUEA 3U2ZA 4GH1A 3W7PA 1UD5A 1IXQA 4F0MA 3N1AA 4WGHA 1DIEA 4OU1A 4FXRA 1V3IA 1JQXA 4PH6A 4C6JA 1P4CA 1GK8A 3NSMA 3QC0A 2GVEA 2J7GA 2NLYA 1BQGA 1QNPA 5CPLA 5DCEA 1XIJA 4N4PA 3QHNA 4XZ9A 1MVYA 3VZYA 3VC6A 1FWGC 2XGZA 3OW1A 4IF2A 2X05A 2QGYA 3DX5A 4HNVA 2F2HA 3KRUA 4S2CA 4A22A 4C6BA 4IX2A 2G5WA 3CLWA 3HPXA 4B15A 4UWMA 2XN1A 1FDZA 2ACUA 3QV6A 3JZEA 3GXPA 4EK7A 4HIBA 4K7VA 5FEPA 3DEQA 1D8WA 2OJPA 4JHZA 3B9NA 3QQWA 1HJXA 3T2OA 3VOHA 2BHYA 1ZBVA 4IIEA 4ZMGA 5CJ5A 4NAEA 4C1NA 5F7UA 1KBLA 1QNQA 2C1HA 5J5RA 3ECQA 4LANA 3LZ5A 1WP6A 3P0XA 1QPKA 2Y2WA 4GXWA 1G0CA 4P5UA 1V51A 4XIAA 3LCXA 4J28A 1G4EA 3KXQA 3TC7A 1EHNA 1NWRA 1E40A 4K3ZA 2P3ZA 3E2RA 3IJDA 1TPB1 4AZCA 2X16A 5TF0A 4IPLA 2DPEA 5FJRA 3QMSA 3USZA 1XICA 4Y2WA 3BLKA 3L2MA 3W84A 2CBVA 2DZAA 2OOGA 3MI3A 2EPMX 1UKTA 5B80A 3M5VA 2YCEA 3MT1A 3Q37A 5CSUA 3W85A 4E2DA 2ISDA 3UY7A 2GSJA 2YBUA 4A8LA 1H41A 3UA3A 1WV2A 4AZ7A 3WCZA 2NVAA 1UQZA 4B90A 3QTGA 5JH2A 4ZOAA 2VX7A 1XM3A 1SSDA 2DH2A 1IXNA 3GTNA 1DIDA 2YW4A 1ZB5A 4QIUA 1QW8A 3YPIA 1VIWA 1AD4A 2P50A 4WKHA 2DZSA 3QM3A 2ADAA 2E68A 4JKKA 4V28A 4FXFA 3NDOA 2IPWA 3S2LA 1C92A 4GXMA 5BRBA 1TV2A 4D9PA 1NP0A 3A12A 4AG0A 1QJWA 4AU0A 3VGFA 3TNBA 2EEXA 3STEA 4IQDA 4ZSTA 4I6KA 3LK6A 3PJTA 1F8MA 4GQ0A 4YLWA 3V16A 2VUYA 2ON3A 3MYPA 3LGDA 3MANA 5G5IA 1L6FA 1JUKA 2HZGA 4WQ6A 3NEHA 1J6PA 4TIMA 1UR3M 4NZ5A 3B9EA 4JFSA 2RGMA 2W27A 4QLLA 3SCOA 3CV6A 4O19A 4GO8A 1O4UA 2QIWA 1TTPA 3RMJA 3GH7A 4LXFA 5LA0A 4XVEA 4YTTA 1EZWA 4W88A 4O10A 2X8RA 3WQWA 3C2FA 3AROA 1HJUA 1E4MM 4Q8MA 4C91A 4WDUA 2HQAA 5FESA 1YYAA 2NZLA 1VHCA 3OLGA 5F4XA 4REQA 1QDSA 3OBEA 4LUIA 3H21A 3CMFA 5LA1A 1X6UA 5A6TC 7A3HA 3HN3A 2WVVB 1WDPA 1DQWA 2D1ZA 3BVJA 1RVGA 4L7ZA 3TCSA 1EZ2A 4YVXA 3LPOA 4QBXA 3HGRA 4I9TA 4H6KA 1QWKA 2A4AA 4CCCA 2E9BA 4OBSA 4IFKA 1H50A 2IXUA 3M0IA 3GQYA 3LA4A 3LPPA 4LUTA 4FALA 5DMLA 2NT1A 4Q4QA 2CU0A 1HJQA 5HMDA 4GVIA 3RDKA 4TX6A 1OADA 2CLKA 2VENA 2E40A 2PODA 3SBFA 3UZWA 3W75A 2HCVA 5FEZA 1T6MA 1SZNA 1NQKA 5AC5A 2J7CA 4JX5A 5HWNA 3ZJKA 1YDNA 2YDRA 3R89A 2YLAA 5CSRA 1KBKA 2BASA 3CYVA 2E09A 4LVBA 2BX7A 2XH2A 1N82A 4AIOA 1Q13A 1WKDA 2QPXA 3BMXA 5D9PA 3SQLA 4MNMA 3WDJA 3L4VA 2DSVA 1XSIA 1QNRA 2DT1A 3G0UA 4QNWA 4A6GA 3W2JA 1L6YA 3AJXA 1FH7A 5BU6A 3G1DA 1PCKA 1V6UA 5AB3A 4WHBA 4UTTA 5JH1A 4NXSA 2J24A 1K1DA 4WUIA 1VZWA 3WLIA 3IJLA 4HZ7A 4TX8A 1LZOA 1XLKA 2F6XA 4DB7A 2WOQA 3VKDA 2IPJA 4PYSA 3ZXWA 3W6LA 2Y6ZA 1QHPA 4BWLC 4U31A 1FH8A 2H8ZA 4J3WA 1VEPA 1W1YA 4A3UA 4XAGA 2Y1HA 3T8QA 3N18A 4GISA 3WG6A 1V79A 1SW7A 4GPNA 1M5WA 5FL1A 1X1NA 5C2GA 5AYZA 3FHQA 2POTA 4WDWA 3WNMA 3HGSA 3WY1A 1XH1A 1JCTA 3A3XA 2XYLA 4ROQA 4MFEA 1EBGA 4JS3A 1KFWA 1ZS2A 3FCPA 3VCCA 3W01A 4DBEA 5K3VA 1FWTA 1X7IA 5AHFA 3CBWA 2OWXA 4QROA 3GVRA 1IXOA 3CV1A 4POCA 3LUTA 4L1WA 4YHGA 4NNAA 3GYEA 3MSYA 3AIRA 2YKKA 1YXCA 2OGJA 3W7IA 3JU2A 4M3PA 1EQPA 3VKAA 1A5UA 5M5DA 1K6WA 1OFBA 1RK5A 2W62A 4MVAA 5AYXA 4IMFA 4S3GA 3PZ9A 1S5TA 5G2WA 4KFNA 1JUBA 1XF0A 3W7MA 2BFGA 1JAKA 5CZSA 3CPUA 4DY1A 3B8IA 2VP8A 1C8VA 5DX7A 4LTSA 4WRHA 3TSMA 3DC0A 5BNKA 3T09A 2VRQA 1XUZA 3GLCA 8A3HA 2ZUTA 3CQHA 1K9EA 1XRVA 2Z1BA 1DQUA 5AC4A 4ZGYA 4U5KA 1UW9A 4S39A 2OQHA 3E0FA 4HA0A 1RR2A 5AVNA 2G95A 3QEZA 1S3HA 4JNMA 1EJSC 3LHVA 3IPWA 4WDXA 2NV2A 1ZZMA 1Z9AA 3I7QA 2ACQA 5FACA 3S1UA 2NXIA 1W9UA 1V0LA 1JYVA 3BOLA 3R12A 4CVUA 1DV7A 5TIMA 3QW4B 1C3FA 5HNRA 1W3KA 4X2PA 3LV5A 3EMQA 3PZMA 4GA8A 2ZUMA 2XH4A 3PULA 5M3WA 1CTNA 2Q8LA 2DZXA 1TPEA 2WMKA 5M03A 3MUXA 1AFSA 4HK7A 3AHZA 2NUYA 2VEPA 1Q6RA 2GDUA 4BQ4A 3HV8A 3E3HA 1IEQA 4A2RA 1H11A 4GY1A 4OGZA 4WSHA 3TE9A 4H3DA 3QGKC 1SU5A 1F8IA 3VC5A 4PRWA 5BOEA 5I09A 2CKSA 5A2BA 4R5EA 4NX0A 2DSWA 1TUFA 1TRDA 1XLJA 3ITGA 4ZSUA 4DPQA 1W9BM 1XCWA 3CK5A 3H7UA 4JEJA 1V0MA 1Q6DA 3O06A 1DXEA 2GOUA 3B0VC 3LRMA 1M03A 1RQHA 4LEQA 3CWOX 1PWMA 3EKZA 3QQ0A 2J47A 3UWUA 1H7NA 2J74A 3LCHA 1C7TA 1EGZA 2J7FA 4ML9A 3GAYA 3IK4A 1N7KA 5FKYA 3KHJA 4GIRA 3GR8A 1PBGA 4N0RA 1OFDA 1UD2A 3LG3A 1UPMB 4QQ3A 2HJPA 3VOGA 2X1UA 4JY8A 3R43A 3VDHA 4NKCA 5SWUA 4QISA 4ERIA 4ZE5A 2QNEA 2F6KA 2YBVA 2JKAA 1OFRA 3EOEA 3WQDA 3DIPA 1T0OA 4F66A 4UOJA 5GJPA 3CUZA 4I90A 3GIQA 5CLTA 4O28A 3A5FA 4AY8A 3EKLA 4WZHA 3VOIA 3ITTA 1PXGA 3L0KA 5CC7A 1FWWA 1AL8A 4NZ1A 1XHGA 3K4AA 3VD5A 1AQHA 1EC7A 1OYBA 1XKYA 3UJRA 1GYNA 1E6QM 4AZIA 3TCEA 2YPIA 5DO8A 3QSTA 1WUEA 4EF8A 2Y61A 2FIQA 2ZZ5A 4ATLA 2EG7A 3ZR6A 1F3XA 2VDGA 4GHRA 5HR6A 2ZXAA 3FHAA 1R0MA 1FFRA 1EFZA 1WZMA 2P76A 4XAZA 1TTJA 1TFVA 2FPYA 3WEOA 3M5YA 4KERA 1JPIA 3PC0A 4IM4A 3GY1A 2V63A 3PSVA 2QVNA 3OGSA 4WXYA 4KKXA 4QP0A 2YCLA 4LAOA 3OVQA 3SEPA 1FWBC 5E0KA 2G41A 1UUOA 3UG3A 1P5BA 2WKLA 2DY3A 3S4TA 1OX4A 3HQ1A 4AVNA 1GZJA 4CN6A 1CXFA 2TAAA 1ZBCA 4M7SA 3E5BA 1JVNA 3ABSA 3ATYA 4MF4A 2CZFA 1UMLA 1RZMA 1UA7A 3MCOA 3EPMA 1QNVA 1XLDA 4NSBA 3TROA 3BZGA 3DGBA 1DYSA 4QS6A 3AMCA 4KMQA 4M81A 1JPHA 2O9PA 3DYOA 3R13A 4HNCA 4ACZB 3R8GA 2GOKA 1LTDA 4JDYA 4FNRA 1J11A 3T0AA 2Q3RA 1PWLA 3FLUA 2PDUA 1QATA 1U1JA 4DPPA 3ID7A 4PCFA 4HT3A 4TMCA 1OB0A 4ZBCA 3PZTA 3W83A 3C2RA 4JY9A 1JI1A 3AXIA 3BJFA 4CQCA 2V5BA 3FKKA 2CNCA 1OZQA 1P1MA 3G1VA 3HJZA 3LI0A 4PUNA 2B7QA 4J35A 2GQ9A 1G4SA 1LF1A 1UYQA 2VXNA 4QG9A 4ZO8A 4BI5A 1UD8A 3GG1A 1DPMA 4XKYA 4DO7A 4Z2GA 5A6MA 1X7FA 4NYUA 2KAUC 1TV5A 4Z1BA 4N9EA 2V30A 5G2IA 3BV4A 1UA3A 3ZJ8A 3QZEA 2B7OA 1XXXA 3N3TA 3ARUA 1X97A 4QHRA 3GVQA 4O4VA 1TMLA 5LKYA 4J3XA 4C6CA 2X1TA 2D2HA 3W28A 2WHJA 1YXDA 2NT0A 2ZIDA 4ZQMA 1M7OA 1U5JA 1A5OC 1VBHA 3TW6A 1GVSA 4Z1DA 3O6CA 4UMCA 3W87A 2Z24A 4GLEA 4K68A 4RK8A 4UB9A 3V1PA 3EWUA 3M4HA 4PC8A 1SO6A 1VF8A 1Z69A 4TV5A 4ADSA 3IRDA 4Q8UA 4FXJA 4KCTA 3FVMA 4XV0A 5FCZA 4ZTXA 5U7SA 2PTYA 2PA6A 2GUYA 1E56A 5LSMA 1UOKA 3HMJG 4A29A 3QOMA 4X9YA 5LNVA 5CGMA 3CPGA 1QAPA 2CYGA 3L65A 8CGTA 4IWWA 1S2WA 4C90A 1LRTA 1YNYA 2YBTA 1VEOA 5GVJA 4XBKA 3VFCA 1Q6EA 1YHTA 3RK8A 1U33A 3ABZA 2ICSA 3M0YA 3MUY1 4NAEB 3FJNA 4C1NB 4HU4A 4GVFA 3SJNA 4JIPA 3E74A 5EMYA 3G77A 2W79A 3T05A 5HMEA 3U2OA 1E72M 1VFTA 3P60A 4BEUA 3UWZA 4ZFCA 4P7OA 5C9ZA 1ODZA 3N4AA 1N8WA 4Z0SA 4AZCB 3IUIA 3FA3A 3IJ9A 3BCDA 3MMTA 2INZA 3MMUA 2PFHA 4S3FA 4HBKA 5CZKA 1TIMA 1YE4A 4RNHA 1NFGA 3SECA 4S3EA 4S3BA 3HPZA 1W5OA 3CZEA 3MJMA 3PJUA 2ACSA 3TP4A 3ZWSA 3RPTA 3FSUA 3KCJA 4YYCA 1MW3A 4CQBA 4NZ3A 1KW1A 2IXVA 3GXFA 4DBDA 4AWUA 3WQ5A 1IGSA 5A8OA 4V1YA 3B8TA 1M41A 1ECEA 2BV9A 1Q6LA 3QPZA 3W6MA 2V81A 5HOSA 4LS0A 1DXIA 1WKFA 2B0MA 1UR2A 4H9ZA 3RILA 3CMGA 2A7RA 4EXAA 1W5NA 4DO4A 4X2RA 1FFQA 2VZOA 3W23A 3QHOA 4LYRA 3FV9A 1OWQA 4IPNB 4L1XA 3L4XA 4O18A 1W5MA 4R3UA 1TCDA 4MTVA 1S39A 1W37A 2ZRYA 4U2YA 3FJLA 2OVLA 4KBXA 2ZE0A 2PLJA 3IGSA 4M51A 1Z42A 3Q67A 2POZA 4OQVA 2CFFA 3OBAA 4RXFA 4UCFA 4ZTYA 4GZJA 4L9ZA 3PSWA 1MSSA 2JBMA 4RNJA 4JQ1A 3N6QA 4ZOBA 4MY8A 1FWFC 1WZLA 1K4GA 3W02A 4MUPA 3CUHA 2WHMA 2E7FA 4L6HA 4OKDA 3EX1A 4M6UA 1Z6KA 3TMLA 3KL0A 3FXYA 4KWSA 1S2CA 1I9CB 4UQDA 5A6KA 1KQYA 3ISIX 4RR4A 3T44A 5FA5A 1TQJA 1ECQA 3CHFA 1UQYA 3MP4A 4M80A 4DIAA 1IWPA 5T8GA 1RPXA 4HCLA 4HD5A 3KP1A 2XWDA 4U2ZA 2QJGA 4K37A 1X1ZA 1V6XA 4MUZA 3KVMA 1WAUA 1TVPA 3AAMA 2QUNA 4REQB 1AW1A 2BGSA 1SO5A 2RAGA 4I5RA 4LYPA 1WZKA 1ENUA 2XM2A 1OJXA 3K46A 1LT8A 2RUSA 5A8GA 3RCMA 1OF6A 3VGDA 1KXHA 3GFZA 4H9XA 4AD2A 4JTGA 1HKKA 1F73A 3HGOA 4DYEA 1NH6A 3CV2A 4IFKB 4XIMA 1OFEA 4K2SA 3F5LA 5CSYA 4DF1A 1HZYA 4HKPA 4Q8OA 4HPJA 4LUTB 2ZXBA 3ANVA 4R9XA 4PUEA 2Y5JA 5C9WA 3NQCA 2LLEA 2P53A 2Z7KA 1A47A 2ZADA 1W2VA 2YDQA 3EA1A 3IUHA 2QJJA 3SUUA 2DUZA 3WJZA 5BXPA 2OZTA 1BYCA 3VFLA 1P0EA 4Y90A 3W29A 5MF5A 3M0ZA 4CEXC 1JD9A 1SUXA 1QPNA 2ABBA 5H8PA 3KDNA 4Y9PA 5LNUA 1AW5A 5CH9A 5I0DA 2R91A 1MEIA 3IIZA 4QDMA 2ZVIA 3KDOA 3VGEA 4N4QA 2VEGA 2WZIA 2PSNA 4UQ9A 4QE4A 4F8XA 4EPBC 3THCA 2VEKA 3CNYA 1KV8A 5D2XA 2QF8A 4ZCWA 1VH7A 4PMYA 2ALDA 4Z1AA 1FXQA 4A8IA 3B0YA 3L66A 4GWEA 3URNA 1ZJAA 4OUIA 1CW2A 5IDZA 3QH2A 1RBLA 3EOSA 1J4EA 4PR4A 4IIBA 3LSCA 4GYJA 1DORA 4GYPC 4HMCA 4ZENA 4YWIA 1XLEA 1XR2A 4LV4A 3GW0A 3NCOA 3UJ2A 4CU7A 2AAMA 4PMRA 3GIPA 4HK5A 1W5PA 2HTMA 4LCQA 2ISFA 1G69A 3AWOA 3I6RA 1TREA 4TO8A 4HYVA 3CT7A 4UFMA 1OFAA 3UR7A 2WC3A 2WW5A 2CHRA 1S3TC 1ODUA 4B9YA 2Q8ZA 2VUNA 3GC2A 5EFDA 4AVOA 1B57A 2X2GA 2PRMA 4IICA 3UVAA 2ZUVA 5HBFA 3EA2A 4GO9A 1E71M 2OZ0A 4JHMA 1IEXA 6XIAA 1TWZA 1V3HA 2EQDA 2OOFA 1NDVA 2WKJA 4N2YA 1US0A 3O3RA 3GDRA 2FH8A 3H23A 4LOCA 4ZVJA 1JD7A 1R38A 3EMZA 4O13A 3W7EA 5M2FX 3W7OA 2CBIA 3H7RA 3SCWA 3TN3A 1EJUC 4AY7A 2NQZA 4WX2A 3VA8A 3F2BA 1BWKA 1IT8A 3H2MA 4W7VA 4W5UA 3B04A 4CN1A 1RBAA 1Q6OA 1G9HA 2A7NA 2DIJA 5XIMA 1B9ZA 3DFNA 5HINA 2ZXDA 1R2SA 1UBPC 3UJEA 1DJZA 1PZ1A 4XAFA 4JTDA 4B92A 4FNTA 2I7GA 1PO9A 4XBSA 1RAKA 2HVNA 4IG2A 4KIEA 2A3EA 4KWOA 2CIPA 2IKIA 5AY7A 3QQ1A 3NR0A 4FLRA 1X96A 4PGLA 4NRSA 5DEZA 5I79A 4AZGA 1AJ0A 3AXMA 1O95A 3N73A 1CBGA 4PBFA 4L6OA 3WMBA 1V02E 2DT2A 3W1MA 1RCOB 3GDLA 5JU6A 2A6NA 1F3EA 3PZGA 4DN1A 2ZQ0A 3TW7A 3STFA 5AHIA 5JVLA 2NX9A 1Q8JA 4ZE4A 4JD4A 3TQPA 3NDYA 1CLXA 1QI0A 4HPXA 4CNPA 1V3KA 1CDGA 1GEQA 5T26A 3IARA 3P80A 1WKYA 2HE8A 4FB7A 5AC7A 1JFHA 3F4WA 2PMQA 4JN7A 1EJ7L 1Q7ZA 4PB5A 5FJIA 1L9WA 4KH2A 2Z26A 1XIHA 1R7AA 3CEUA 2V2DA 3N14A 2FGLA 3IUDA 4DM1A 3P3BA 1QOXA 5AHNA 4AF0A 4JIEA 3BARA 2E77A 3TN4A 5D09A 3HURA 1PHQA 1C9DA 1OF8A 4PZVA 3D47A 2E25A 2OT1A 1U1HA 3KOFA 4H1ZA 3IJQA 3CH9A 2G96A 5TQLA 2GDQA 1F6YA 3ALFA 5I78A 2FTWA 4YNGA 4H9VA 4UIOA 3PZVA 4PODA 3LQLA 1IYXA 4MMWA 1GOMA 3HM7A 4JYDA 3FGCA 1XIBA 4X60A 3BLIA 3M7WA 3PNUA 4LVAA 3TLQA 3WO8A 2VGIA 4NZFA 3BSMA 3ZJ7A 4DJFD 1X6LA 3QZAA 3BH4A 4MYAA 4HSNA 3FX4A 4NG3A 1SFSA 3SRDA 3FY1A 3GKFA 3EDFA 3AHVA 1KM1A 2ZFAA 1MZHA 3CAVA 3TTEA 4HN4A 5HNUA 4WJXA 2BLEA 2IW0A 2E6YA 1DE6A 1LQAA 3W7QA 4Z2LA 2I17A 3AYSA 5GJNA 5I3HA 2D69A 3TONA 1J18A 1TPWA 1A50A 1O5QA 4YIWA 1ICSA 5DMYA 3MHGA 2H9AA 3LV6A 4FLQA 1XYLA 1EJTC 4UQCA 2VURA 1NWUA 4Z17A 4B5UA 3VDAA 4EOUA 3RX2A 4C6OA 2PB1A 4JFWA 2W61A 3GG0A 1SJBA 3ITXA 2VFGA 4LNYA 3MUZ1 4BA0A 1NARA 3PG8A 4KEZA 3ENLA 5CC3A 2VTFA 2YCLB 1H0IA 1EJVC 4P7LA 3ARSA 1OX4B 3SIZA 4QJ4B 5A6BA 2OO6A 3UZJA 3VMNA 2Z1SA 6ALDA 3QY7A 4DZAA 5FJPA 1M53A 3FS2A 3WDPP 4GZIA 4Q6JA 3HO8A 2R6OA 5HDRA 4J2PA 4B5WA 3CJPA 1OCJA 3GVGA 3R2GA 2J9ZA 5JBDA 2PWFA 4LAUA 4UC5A 1MUWA 2WCGA 5XINA 1DWIM 4D8LA 1UIOA 2VEIA 4O1AA 3PB0A 4A05A 3FYPA 4GH3A 3SDOA 5HQEA 4Q8NA 2GVGA 1QXLA 2Z4GA 5I00A 1DVJA 1BWVA 1RALA 3E0WA 3D5HA 5A8MA 2HISA 3WH8A 1U5VA 3PZOA 2UV8G 1PIIA 1HKWA 4Q3MA 3LHUA 3CZJA 5C55A 3WQOA 2JKEA 3SY8A 4ZXOA 4L5ZA 3W53A 1KM3A 3BG5A 4XBJA 5GQBA 2WMGA 4XX6A 1LOLA 2OZ8A 4XKYB 2PCEA 1H09A 1K7XA 1OYAA 2VD8A 4GX8A 4NNBA 4RE4A 5FSEC 2GQAA 4G7EA 4BI6A 5T91A 3CAKA 4R7WA 5JXQA 2ALRA 4ACYA 2PBOA 2QCCA 4KFOA 2ODOA 4U5IA 3L0GA 3SCVA 4LJ3A 4E8DA 3QTPA 1EO7A <