1CB2A

Cellobiohydrolase ii, catalytic domain, mutant y169f
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE II
publication title The active site of Trichoderma reesei cellobiohydrolase II: the role of tyrosine 169.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase (o-glycosyl)
total genus 132
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1995-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1cb2A00
2BODX 1HGWA 4I5UA 1CB2A 1QJWA 4A05A 4AVNA 4B4FA 1UP3A 3VOFA 3VOIA 2BOEX 4AU0A 3VOJA 4B4HA 1GZ1A 1QK2A 1UP0A 1OC7A 3ABXA 1OC5A 2BVWA 1QK0A 4I5RA 1DYSA 1OCJA 1UP2A 2BOFX 2BOGX 1UOZA 3VOGA 3RPTA 3VOHA 1OCBA 1TMLA 4AX6A 1OC6A 1HGYA 1OCNA 3RU8X 3A64A 4AX7A 4AVOA 1BVWA 3A9BA
chains in the Genus database with same CATH superfamily
3P8JA 3WL1A 2J78A 3WUBA 1G1YA 4NZCA 2YB4A 3S9YA 3AXIA 4Q22A 1GK8A 2A7PA 5HATA 4E3TA 3PZUA 3WMBA 2PLJA 1C9DA 5HNTA 3EWZA 4ROQA 5FEXA 3WBEA 5CJMA 1Q6LA 1VPYA 4Y9NA 4KIRA 1RBOB 3I6RA 3RXZA 3W1RA 2AGTA 4MJZA 1IR2A 3PR2A 5I5RA 1KTCA 4DZAA 2Z1BA 3WQEA 1ZL1A 4NIRA 2NQ5A 1BQGA 1TWIA 4G7FA 4WRHA 3T8QA 2Z7KA 4KCVA 4LANA 1GQIA 3SQSA 4JQ4A 3NAVA 4DWSD 1EO5A 1PDYA 1M9HA 1PBGA 3BGGA 3M0HA 3DYMA 4DJED 1DHPA 1TIMA 3MYPA 2ZC1A 5D37A 2XGBA 4GQ0A 3VINA 2GSJA 1XC4A 1NARA 3ZT5A 1QTWA 1Q6QA 3N25A 2J9XA 2A79A 4O4VA 4GH3A 3VNLA 2AL2A 5DY3A 4C5YA 4I9AA 4UMCA 4IISA 3SCUA 5JH2A 1HF6A 1JRBA 3HBLA 1XFBA 3MUZ1 3QMRA 1AH0A 3PPHA 1DIDA 1ONWA 1J10A 1QPOA 4ZFMA 4M8UA 1XICA 4CU6A 2VFEA 2P76A 1W6TA 1O5KA 2D23A 5LA2A 5E93A 2HXUA 3F2DA 1GJPA 2V5DA 2V69A 4Z2IA 4Z2GA 1C8QA 3C2VA 4TU1A 3BCFA 1DQXA 4CD8A 4UTWC 4K68A 5I06A 1T0OA 4IWWA 2PUZA 2ZX6A 3K8LA 4M3PA 2JIWA 3I65A 3PM6A 3IJQA 4R53A 3W88A 4BEUA 3W1UA 3G1VA 2IPFA 3TU9A 3R1ZA 3F03K 3A6OA 1UJQA 1FUYA 4JICA 3MDWA 1YDYA 1W0MA 4HCLA 1EP3A 3L7RA 3ECQA 2FKPA 4UQDA 2PGFA 5C9WA 4LBRA 4UTMA 1XIEA 3K4WA 4K8GA 1LOLA 3H2CA 4P8UA 3DKJA 4UQ9A 3WLRA 3VE9A 3DC8A 3ITXA 1W3HA 2DVXA 4AH7A 2KAUC 1S3HA 5HWMA 4HMCA 3RM4A 2BBFA 5MKGB 1Q6FA 2D0HA 2DH2A 3LA4A 1FWEC 3NA8A 3QRHA 3VOHA 1WDWA 3KLKA 1KBLA 3CL7A 4UR7A 4WD0A 2V81A 3WELA 4WEVX 3NM3A 3VA8A 3O2LA 5CPSA 3S8HA 5F1VA 4KETA 1NU5A 3BC9A 1KRMA 2QJHA 3LSCA 3PBGA 4I90A 4AMAA 1NAL1 1VPXA 1LL4A 2NUXA 5FKYA 3K1DA 1F61A 3GU1A 1UUQA 2OKOA 5A6BD 4F0KA 2EEXA 5HUOA 4UOQA 3R0DA 4L65A 1ESWA 1VCGA 3EB3A 1RK6A 4PMRA 1AODA 1TTPA 2ZZ5A 3TN3A 3V5FA 4BZYA 2QJMA 1EEPA 3PB0A 1SGJA 1XCFA 1HKVA 2XINA 3UZXA 2BOGX 4IIGA 5C70A 1XPYA 2PS2A 3QPYA 3CXOA 2DZTA 1TPVA 4L80A 3I6EA 3WBYA 4LB4A 3CBWA 3KL0A 4JTCA 3GHTA 1JCYA 3BG5A 3I3BA 4H00A 3UPBA 1LWJA 2DH3A 3MMWA 1GJUA 1FWGC 4HK7A 1FTXA 4AY1A 1SO3A 4GJIA 1P7TB 1NDZA 3NQ6A 4FHAA 1KFLA 3PAJA 4HOZA 4QJ1A 4PMOA 3E9AA 2Y89A 4XVEA 3CLWA 2PTZA 5U4NA 3M6YA 1MEWA 4TO8A 3K8KA 3UR7A 4S3JA 5EMKA 4C6NA 3WNKA 2VOTA 3B0XA 3O8AA 2BGNE 3GG0A 2Y70A 4XD5A 8A3HA 3AAMA 4I6VA 3SCNA 1E70M 1CXEA 1SJBA 4ERGA 2VR4A 1H7OA 3PZVA 4ZSUA 4E3VA 4QS6A 1EJXC 4BI6A 1DPMA 2BZNA 2DSKA 4XD3A 1AQMA 3B40A 1M68A 3N73A 3PUDA 2PBGA 3M7SA 4I7VA 3KOFA 4Z1CA 1MW0A 2F2KA 2CLHA 3WQ5A 1TB3A 3W23A 2XSXA 2WQPA 3PBVA 4PA8A 1J6PA 3CWNA 5FEWA 2X8RA 3M0XA 3WUFA 2AQWA 1G6CA 3GU2A 2CWXA 1NDWA 3C8NA 3N2OA 1BXNA 4C6PA 1V0LA 3VNMA 5KEZA 1Q6GA 4RZ5A 1IEVA 3OA5A 1SSGA 4BWLA 4GJ1A 2WKLA 4EVZA 2QCGA 3VTRA 4PEKA 4FLSA 5DRCA 4S3KA 4XKYB 3STFA 1GG1A 4KT2A 1HKIA 4RV3A 1AZ2A 3WNMA 3KTCA 3FJ4A 1TG7A 3TYEA 2VTFA 3NEHA 3P61A 3PS7A 3AXMA 4MKVA 3MKVA 3JS3A 1HNYA 4BHYA 4QGCA 3AWNA 2Y4SA 3GB6A 1R47A 4CQ9A 1UZ1A 3CUXA 3FDKA 2VHLA 3NZGA 2X0HA 4JCLA 3EYPA 3SADA 2BMBA 2Y7FA 5LA1A 3QZEA 3N12A 1UUMA 2OSWA 3MP5A 1QI2A 1IWAA 1TUFA 4MUPA 4LS2A 1UUOA 3E38A 2VWSA 3A64A 5F4WA 4CGTA 4I5UA 3GZ3A 4MG4A 1ZHAA 4PUNA 1EA0A 1AH4A 4WY0A 2D24A 3L0GA 2EJAA 2ATMA 3CL8A 1S2WA 2WCSA 1PYMA 5LNVA 4GBDA 4LTSA 3TYDA 2ON3A 8RUCA 4P8XA 2CIPA 2C0AA 2VQTA 4YIWA 2F6UA 4X2RA 2ZDSA 4QP0A 4WSJA 2FJUB 2GK1B 2OJPA 3EPOA 2WNWA 3FFSA 4ZQCA 4ZE5A 2PWHA 5I07A 3PJWA 4IXHA 1SVDA 3TWAA 1HKJA 4K39A 3WY1A 1VQTA 3GBDA 4B2DA 4N2YA 4PUKA 5REQA 3NM1A 4FNUA 5DCEA 4D6HA 2HZGA 3BLKA 5A69A 2PDNA 1QNRA 3C3UA 3T09A 4JIHA 2YZRA 3GWQA 3CZKA 4HZ6A 4LU0A 1QWGA 1Z7AA 1O68A 2A3EA 4ADUA 1SUXA 4CN4A 3G5EA 3AHYA 2JF7A 4Z1YA 4DJFC 1MFVA 3LTPA 3HF3A 4U31A 4AD5A 4OJYA 4K36A 2P3EA 3S5YA 7ODCA 2WBKA 1ADSA 3M0VA 3CZ8A 2PDBA 1WOBA 1FWSA 1TVPA 3K13A 5HXMA 2HK0A 1LL6A 1TPUA 4NJGA 2PGRA 4U5IA 2ODOA 1WZLA 5DCDA 2DW6A 1K8YA 2VFFA 1QW9A 1BGGA 4Q8VA 5D2VA 1QNSA 2WVVB 1ZRQA 5AHFA 1CXKA 4S3BA 3LEPA 4LWWA 4Q4SA 3LENA 1J9YA 3W2MA 3QVQA 3ZR4A 2FTPA 4WLCA 1JYXA 4GXPA 2XFFA 1FHLA 1GHSA 3L4WA 3G1HA 3PSWA 4MJ2A 4K38A 1Z9AA 1XLGA 1BTMA 4HNOA 2ZOXA 3DESA 1Q85A 3EBVA 1KCXA 4EF9A 3L4ZA 3O05A 3MT1A 4GGBA 3MP4A 1RCOB 3ENLA 3MA8A 3O0KA 3ERPA 3JRKA 5CZJA 3NXFA 4RNHA 4HVXA 3G24A 3M0MA 3GR7A 3RCMA 4JTEA 4B90A 1LG2A 2FHFA 4KH2A 1LWIA 3KVJA 3SFWA 4TVDA 4KF1A 3RG6A 4DX3A 1QR7A 5F1UA 1XUUA 4XZWA 3O3RA 1ECQA 3UG5A 1YTEA 5FCZA 4Z0JA 1EPXA 1IT0A 1MRAA 2EF9A 1I9CB 3E2QA 1FY6A 2QDDA 3GIQA 2AMXA 5IFPA 1US0A 3JZEA 1W9UA 2CW6A 1VZWA 1MEIA 4WX2A 1RBAA 5JMUA 2TODA 3PJXA 3EOOA 1TR9A 2V3DA 5HR6A 1W3LA 3ZLGA 2WNQA 4PUEA 2WC3A 3QPZA 4KRUA 2UY2A 3SJNA 2ESCA 3BK0A 5CG0A 2JGYA 3CZJA 5F4XA 3PTMA 5IFTA 1QUMA 2Q09A 1OSEA 1SU5A 3PANA 3PZ9A 2FGZA 3MCOA 1JZ2A 1GYMA 6XIAA 2XGZA 2Q3RA 2BXYA 7A3HA 1PKLA 4UWMA 1XDMA 2E28A 5I3IA 3CTLA 3ITVA 1RA0A 2OELA 4BCEA 1TFVA 2WSRA 3NDOA 5FJRA 3BOFA 2G3NA 1AW1A 1H1YA 5E1QA 1W3JA 1KWKA 1XP3A 4NAFB 3CZEA 3FKRA 3FLUA 1A5NC 3W1MA 3WQ4A 5HJYA 1KR1A 3A24A 3V5OA 1Z41A 3BLOA 3WLPA 2ZZ4A 3W2UA 4LNCA 1J11A 3NZ1A 1F3WA 2HXTA 4ADTA 2CLEA 1GOKA 4C1NB 2OKTA 6REQA 2J4GA 3LS9A 4AF0B 4DRSA 4Z2LA 4GOAA 3LD5A 2V67A 1PZ1A 2HPMA 3UWUA 2VFDA 2VEGA 3FSUA 1XM3A 3SJ3A 1M6JA 4NZ5A 4JNMA 4ORMA 3APGA 1EF2A 3WEOA 4J2MA 4QCFA 4W87A 2V8ZA 4ADSA 3MI6A 3KBJA 3IS4A 1G4EA 5FSEC 3QZ6A 3FVMA 3C8FA 4JNYA 2XVGA 4XSLA 4F2BA 3UJRA 3AXKA 3GYEA 1SFSA 2VENA 4FX8A 5LNWA 1EC9A 1I45A 2J7BA 1RLCL 3AMKA 3UVAA 2VUNA 3QC0A 4MF4A 3IVSA 1YTDA 4GYPA 2W62A 3W01A 4FAMA 1UKSA 1HJVA 3QHOA 1RCQA 1FOBA 1HJXA 1I1WA 4FALA 5DEZA 2XVNA 3LTSA 3REQA 3I3DA 1OFPA 3N2XA 3M9YA 1QBBA 3OBEA 4LEFA 1YNPA 4AW7A 4D6DA 3NVDA 1MRQA 4GFSA 1J12A 1T41A 3ORWA 1QNQA 5G2HA 5CCZA 4JIQA 4U10A 3POCA 1WBJA 4JTJA 3W83A 4H2CA 3GKFA 1V6TA 1REQA 3R89A 2PTWA 2OB3A 4A8LA 3PY2A 2E1WA 3CB3A 3IAPA 2Z2AA 4GISA 4X60A 1RAKA 2DQWA 2NV1A 2PLMA 3VZZA 5I00A 4MTVA 5LGZA 2CKRA 1KB3A 4UMAA 4AU0A 2VDIA 4P8WA 3MSRA 5RUBA 3H4GA 1X1OA 4PRTA 3BZJA 5I2UA 3PULA 3VGEA 3XINA 3PG9A 4GINA 1EGVA 4PTNA 4O10A 5FF4A 2DUAA 3UYCA 3STEA 3TTEA 3STPA 1ISYA 1SFJA 2CXEA 2O9OA 3MZNA 1IEIA 5C9XA 1XYFA 4ZOEA 1S2CA 5XIAA 4UNLA 4Q4RA 4XTIA 2ISDA 1ZU8A 2BVYA 4PFMA 3AMDA 4W5ZA 5HANA 1SW7A 4PTVA 4L9YA 1VIWA 2OQLA 1B3XA 3PNZA 3RX3A 2LLEA 1FWJC 1OG0A 4B5UA 1A0DA 3AMCA 4S3AA 2G95A 3L65A 4D72A 1UG6A 3HMCA 1LM1A 3LGDA 5TD4A 2FIQA 2EPHA 4M6VA 4QROA 3OQ8A 4FIQA 2VL4A 3CJPA 4IFKB 1KM2A 4XAYA 4TMBA 3IAQA 4P5UA 5LYRA 3VD9A 4X9YA 3W4RA 1XYMA 2Q02A 4UTTC 3N6QA 4C6CA 4JFTA 1FWFC 1LWHA 1CB2A 3TMQA 1IZCA 3KUMA 4P8VA 3BJFA 4TVCA 5LXEA 4XZNX 2Z1KA 3T8LA 2E4TA 5FJUA 2A6NA 5A6LA 1S5MA 3MO4A 3BQ5A 4PUUA 4A3YA 2D1ZA 1KC7A 1EJRC 3M1ZA 3VK5A 3M44A 5KZMA 2VKZG 4H41A 3GC5A 1JPKA 2YOCA 2X09A 4MPQA 4OU1A 5TF0A 1RVKA 3W38A 1DQUA 1LOSA 5HOSA 3S9ZA 3WDQA 3AS1A 2D3NA 3UWEA 3DFOA 4C7FA 3FAWA 1XIGA 3NPVA 1E6SM 4KMQA 4JTTA 1RJQA 3C0QA 2RKXA 4YTUA 3SGGA 4FIRA 1Z44A 5AYXA 3BG3A 3KOWA 3U5UA 3EOUA 4XISA 3VKBA 2RDWA 2C1IA 2FB3A 3ONCA 3TK7A 3OLDA 2XJ7A 1W1A1 3QY7A 1OYAA 4ES4A 3AHZA 4LBUA 4RDVA 3WQGA 2BVWA 3OLIA 3QMSA 1YBQB 3FYOA 1H7WA 2XG9A 2HS8A 1K8XA 4HD5A 4PMYA 2Z1WA 3C56A 3UA3A 1AFSA 3S5SA 1ODZA 5CC6A 3WF4A 4DF1A 3E0VA 2DQXA 1EF3A 3N6JA 4GI6A 3FS2A 4H9ZA 2OO0A 1VYSX 1BEUA 4JTUA 1L2QA 1F07A 3NCOA 3OGSA 3R10A 1RD6A 1LRTA 4MWAA 4GZJA 1VFTA 5A94A 1F8IA 3M0ZA 4WSHA 2OG9A 3TJXA 3GKAA 1AUSL 4L1WA 3BSGA 4QITA 4LRSA 1O1ZA 5JBEA 3IGHX 1HP4A 4FZIA 1E4NA 3LZ5A 1HJWA 4CQ8A 4XVDA 1ICSA 3A47A 3W27A 4MLRA 1E4IA 1PEZA 2NVCA 2D2OA 3TE9A 4FS9A 3B04A 1OB0A 3NOEA 3GX9A 3GNOA 4TMCA 5E9XA 3VYLA 1YKWA 2D69A 2HCVA 3D0CA 1VYPX 4U3CA 3VKCA 4A4AA 2FMNA 2ZUWA 4D2JA 1GKPA 4H6RA 4DUOA 3NGJA 5JH1A 1FA2A 4IUGA 4N42A 1WZMA 3UVIA 1DWAM 2PTDA 3LTYA 4KBXA 4HU8A 1OHLA 1RLDA 1UA7A 2PDXA 1VBGA 1VKFA 2CLPA 1DVJA 4ACZB 2QHAA 2OZ3A 5KZDA 2VUYA 4ZE4A 3WH6A 1UWQA 4FB7A 3USBA 4PUJA 3TCSA 1H7NA 3M7WA 1IXOA 4IQLA 5DF0A 2OGJA 3CUHA 1S2AA 1TPB1 3F4WA 4IFRA 3CT7A 4S3FA 3UWVA 2WZHA 1VS1A 1I2NA 1GVIA 3A3HA 4A35A 4HSNA 3RLGA 2ZXDA 3BANA 4K1WA 5DY2A 2C1GA 1B30A 3O16A 1ISXA 2J7HA 1FQ0A 4A8RA 1JAKA 3G0XA 4EACA 4R7JA 2W3ZA 4JTKA 5I3KA 3NQVA 5EPDA 3TXZA 3CC1A 5MHBA 1QK0A 4HYRA 1A53A 4G9PA 3OEXA 2VJXA 3FHAA 3SN0A 4E38A 1TZ7A 4A05A 5G4EA 4XIMA 4K37A 4W5UA 1UH4A 1UPMB 1K1DA 4Z17A 1ME7A 2ACQA 4S3EA 4QX4A 4REQA 1JUKA 4K3ZA 3VE7A 1JDAA 3BG9A 5TQLA 5H8UA 3W6MA 5LIKX 2WJEA 3QPEA 4QNWA 4PMQA 1EIXA 4N0RA 3S1VA 1QXLA 3RR1A 3WEZA 4ZO6A 1VGAA 1Q6RA 1YDVA 4B3KA 4DZIA 4QFUA 2FVLA 4GVFA 3IJ9A 4JOMA 3UXDA 5D9PA 3ZZ1A 1PKMA 3N34A 3BMXA 3NQ2A 1FDJA 1TJ2A 1GOMA 3SUUA 3GRIA 5HMEA 2RJHA 1TTJA 2ZA1A 1XLEA 2QT3A 4E4FA 4DY1A 1E6QM 1JZ6A 4R5EA 4IIFA 2QDEA 4EP8C 3PPFA 4ZQRA 3TKFA 1LT7A 1IE7C 3CGTA 1OCJA 5TAOA 3RCYA 4JYEA 3EZ4A 3LQLA 4AC1X 1C7SA 1O5RA 3MUXA 4W88A 5CBJA 5JXQA 4JHOA 2E8ZA 3LK6A 3BAWA 3LHWA 1TV5A 5GJNA 4KESA 3MMUA 4NZFA 3SAZA 5LA0A 3SEPA 1PCKA 2B7QA 2DZBA 4H01A 2YW4A 1B4EA 4I8DA 1ODUA 5BRBA 1E5NA 1B54A 4JFWA 1EX1A 3IV8A 4HHMA 1VENA 1XYZA 4W84A 3BXWA 1E72M 1PZ0A 3UW6A 4ZMGA 1UR4A 2PP3A 4LAZA 3FK4A 4HMDA 4QLKA 2HISA 5D8WA 3JUGA 1TQXA 3PZGA 3UF9A 3VO0A 3MZ2A 3LLFA 4JTQA 1XS2A 3AZTA 4WDXA 4QLLA 5CKSA 3O07A 3S1GA 4LVDA 3GIYA 2CLKA 4JN8A 4C6FA 1Q2SA 3N1AA 4F40A 2ZX8A 3TC7A 2YA2A 3THQA 3HG4A 3ZSTA 2OCZA 5HQEA 1YADA 3AS3A 4D71A 2WZMA 5DMMA 3TZFA 4H04A 3B8TA 2ZUTA 2PDHA 1ZGDA 4XUGA 4H6EA 3F7JA 3CV7A 1F3EA 4O1EA 5DN1A 2WKGA 1OFEA 4JX5A 5LHEA 4QLJA 3TOYA 1KLZA 3B9AA 3W3OA 3GUGA 3N3TA 4UTWA 3E74A 3TAKA 2RFGA 1B3WA 1BRLA 4EXQA 1UA3A 5E6YA 1YLVA 4GY0A 1YXDA 4HPGA 3KRBA 4FX7A 2PDIA 1YQ2A 1GZ1A 1DIKA 2I14A 1RPKA 3GZAA 3G1SA 2WNNA 1FVPA 3ABQA 3LMYA 3RLHA 3FEMA 4KEUA 2Z6IA 1AW2A 1KCLA 5CZKA 1YNQA 4YMZA 1GG0A 3H2OA 3NQAA 3VFCA 3SCVA 1V7AA 1KM6A 2A0NA 4IP4A 1TWWA 4C6LA 3RUBL 4J40A 2XIMA 3WKZA 1XIHA 1GEHA 2WW5A 2XFWA 3PVFA 4LVFA 1HP5A 3JR2A 1DE5A 4S3DA 4ZZ9A 2E09A 3GS6A 1CLXA 3MQTA 5I77A 3TTQA 1ZALA 1ZJBA 3CT2A 1M1BA 3LHUA 4O0KA 1OCQA 4Z2KA 3ZS4A 4OHQA 3CO8A 2ZA2A 5D2TA 1HN1A 3B8UA 1QPKA 1JUBA 2EJ1A 3OU8A 2GSHA 3N6HA 4HCHA 3WF0A 4WKFA 3P0WA 3VGDA 3F1QA 2V9DA 2Z28A 4UC5A 4GLEA 3QC3A 1WCGA 1W1PA 3R2GA 3Q37A 2X1UA 4EAYA 5BU9A 4DZ5A 3WNPA 4B9YA 2QPSA 5EMLA 2YCEA 2ZUMA 3QZAA 2I56A 1JZ3A 4DF0A 1SYTA 4UFMA 3USZA 1L0PA 5CAKA 2ISFA 1YMYA 2ZFAA 3CMJA 4WOZA 4R7WA 4DJEC 4O53A 1W9BM 4WXZA 3B0YA 3GE7A 5LNUA 1QFEA 3TFCA 4YVVA 1DWIM 3R11A 2GYIA 5K9XA 2Z1VA 2VCAA 3AYVA 2QDHA 1XHGA 3Q58A 2J6VA 3AXXA 1XKJA 3F5JA 4LVBA 4O8RA 4JTDA 3VM5A 1W3IA 2QCDB 4MKNA 4GJJA 3WLOA 4GQQA 1J5SA 2ZCGA 3ARSA 3U57A 4JL1A 3N9KA 1KV8A 1AMYA 3ALGA 3QW3A 1JYVA 5CH9A 3GY1A 2OYKA 1JCLA 3WDHA 1MW3A 2JEQA 1YTKA 3T6CA 4PB4A 5LIYX 1X7FA 2HPIA 1E1CB 4KRZA 5HMFA 3RMEA 3TYZA 3H8AA 4QHRA 1ENUA 3K8MA 2ZRWA 5GQBA 3UXAA 4XZLX 3SQLA 2NT0A 4UTKA 3UPMA 1TQJA 3MO7A 4QJ3B 1Z8AA 4H4IA 1ZCOA 2ZUNA 4GXMA 2A3HA 4V1YA 2V38A 4GUFA 4WHBA 1XG3A 2R94A 3V5CA 2FQIA 2WK2A 3PWGA 3LCXA 4LC8A 2ZE0A 7ENLA 3QTGA 1B9ZA 3D3AA 1UQZA 2ZRUA 3ARQA 1NFPA 4J9JA 2E5CA 4US5D 3GW3A 3SUWA 1MMFA 2MANA 3WF1A 2RAGA 3LCWA 2R1NA 5DO8A 4W7UA 1UBSA 4WDUA 4LNYA 3ZSSA 2NV9A 4IMCA 1JL8A 4K8HA 1UMLA 4O0ZA 3LCLA 2XIJA 4DBUA 1TJ0A 1HKMA 3THDA 2KZHA 1QW7A 3GVGA 2IQDA 2BOEX 5CPTA 3MV01 2BTMA 2AGKA 4W86A 3GNNA 3S1XA 2XH0A 5G1TA 4D6FA 2O9TA 3CYJA 4PYSA 1HJQA 4M56A 3WLKX 4IF2A 1A3XA 3G8RA 3W1XA 1CENA 3VD3A 5M5DA 1QATA 2PDPA 2FDSA 1ICPA 1GWJA 4EXAA 3KVMA 1NOUA 3TJ4A 3L23A 1LYXA 1J0JA 3I68A 1DWGM 3KRZA 4CCCA 4YTTA 2O55A 4Q7IA 2WHLA 3W7KA 4KWOA 2C16A 4PC8A 1HZYA 2G3JA 1I60A 4LCSA 3APTA 1J0KA 4NUWA 4HU3A 3WH5A 5D02A 2J27A 2DJXA 2A1YA 3IPWA 3TN5A 3MI3A 1FWAC 4WKHA 2VR2A 3SY1A 2Y7GA 1Z42A 3PAOA 4NVTA 1QI5A 1UWTA 1W5PA 1H63A 1KBBA 3DOPA 1GYLA 3CUGA 2HRWA 5AHIA 3VCNA 3LRLA 1V5XA 1Q63A 3BURA 3QBUA 2BOFX 1HKWA 5CZTA 2E9LA 3UR2A 3KL3A 3CV6A 5AHNA 2BP1A 3LUTA 1IIGA 2W67A 3PZQA 1VJIA 2H9AA 3KBWA 4J3ZA 1JDDA 1UQYA 9RUBA 4JYDA 3E6EA 4GXWA 4O16A 4GCXA 3AIBA 1K7FA 4QEEA 2XWEA 1J2BA 2ZRXA 1WV2A 2OEKA 4EX4A 3UPWA 1V79A 4HQVA 3LXCA 2H90A 5EMUA 4KEMA 4J3SA 4MVAA 2VRJA 4MFDA 4BQ5A 3RX2A 3ZLFA 1E6XM 2GQ9A 2ZZ6A 4IQEA 4A8IA 5AZ1A 2X41A 3NSMA 3VX0A 1PKYA 2NSOA 3W87A 3UJEA 1OJXA 3W7CA 4UTHA 4C6KA 2QW5A 1B5TA 2CCRA 1UYQA 1OZMA 3ITOA 4CN6A 2C79A 4DJFA 5CJNA 5A2AA 3BUVA 3KHDA 1PE1A 2VM8A 4PTMA 2AL1A 3ZVIA 4ROPA 3MSDA 1VH7A 3RM8A 2CLFA 4PSPA 1XPGA 1L6WA 3A9IA 3LCHA 4IQJA 1B3YA 1SO4A 3AQUA 1X8FA 2REQB 4M7SA 4V28A 1JDFA 3AICA 4QNEA 1TX2A 3URBA 3BLIA 3BLDA 3VIJA 1VBUA 4RW3A 1Q6EA 3WK3A 2W9MA 4BI7A 1XH2A 4IPNB 4EE9A 5CGTA 5F2MA 1QK2A 2HQAA 3SRHA 3KDNA 1KRAC 1FCBA 1LJYA 2TMDA 2ZWZA 2FVMA 2O9RA 3MVIA 5AYYA 4IT1A 3IANA 5FF7A 1W3NA 1VIZA 3EKLA 2XIBA 2AAMA 1GQLA 4IJCA 3KS5A 1EDGA 5FJJA 1UOKA 1O4UA 3KL5A 1DBTA 1FH8A 3MPGA 7PTDA 2D22A 1TE1A 1ISWA 5CPMA 5FA5A 4A8NA 2JF6A 4W8AA 3GHSA 2Y1HA 3ES7A 4X61A 1T40A 1OCNA 3GFXA 2PLKA 2VRQA 1QI3A 3AFBA 3W26A 4MJMA 4HJWA 4D6EA 3LZ3A 4IICA 3C2FA 3R0KA 3LRKA 3ZR6A 4Z1AA 1FX6A 4C6OA 1WX0A 4ZTYA 3L68A 3GDTA 2HVNA 4O1CA 2YB1A 3FIGA 5I23A 1WUEA 3GG1A 5CXPA 1TJ1A 4H7VA 2PD9A 3WQDA 1JUEA 1U1UA 4ATLA 3HB9A 1I2OA 4LYRA 1G01A 5HNRA 4ZODA 3QM3A 2X7WA 1U22A 3B9EA 2WB5A 2PDFA 1UH3A 4AMCA 4C6BA 2HNEA 4ZO8A 3GQYA 4J1OA 1AL7A 5DBTA 3VNJA 4UTLA 4AIUA 2V5LA 3VPLA 1BYAA 2V2DA 1MXGA 1ITXA 3SCOA 2TAAA 1XGEA 1JQVA 2HBXA 4FEZA 1YX1A 1Y8BA 4PMXA 2J8GA 1M01A 1XYCA 4XZHA 2B81A 3OVQA 2DSWA 4JBRA 2YLLA 3NL2A 4H8HA 3DFNA 3CHDA 3UXIA 1A4MA 5BCAA 3ES8A 2I9UA 4RLIA 2PC4A 2VEFA 5C9UA 2XGIA 2YA0A 5BNKA 1RH9A 3BVJA 1DJZA 2H8ZA 3KTXA 4HSOA 3ZM8A 2QGYA 3GDLA 4RXFA 1SFLA 2VZUA 3PFRA 4FP1A 2J8TA 1FCUA 3I3EA 3SCWA 1H50A 3THCA 3RK8A 4H7ZA 1Y65A 4NNCA 5T26A 3VIIA 3O06A 3UZWA 2C91A 2FH6A 4FXJA 1XSIA 2QCHA 3EA1A 3AIUA 2OOFA 4WGHA 2YBTA 2WMGA 4ENLA 1W3KA 3BZGA 3GHUA 2YCLB 4E6MA 1VLWA 4BJHA 4DWDA 3U2OA 3W2NA 4H3DA 1GVSA 3COTA 3THAA 1N7KA 5FSDC 4DBEA 2NQJA 3W29A 2IKHA 2PWUA 4Q7BA 2X30A 3DU0A 2J7EA 4ML4A 4C7GA 5I6SA 1V3MA 4N7QA 3ME3A 1DJQA 3NVTA 4Z1DA 1DEDA 1LBMA 3CASA 2QUVA 3HV8A 4IP7A 3OOQA 1K77A 3CV1A 1E1FA 4JHZA 4HPNA 3TC3A 3M5XA 4XUYA 3GXPA 3TIMA 5KITA 3OA3A 4WJEA 3EWXA 3HPFA 3GC4A 3T7VA 3MJYA 1L6SA 5AKQA 1E9YB 2CZDA 1MQRA 2Y5EA 4WY0F 5EU9A 3HA1A 4PCFA 1V6XA 2W79A 1LBLA 5FAJA 3P8IA 7CGTA 2BVDA 4GVIA 2YXOA 3TR9A 1LUCB 1LT8A 1ZAJA 2YR1A 3LY0A 3L0NA 2ZC8A 5HQMA 5GVJA 3S5OA 4K8EA 4AB4A 3LHYA 4GH1A 3A4AA 2RGLA 1H3GA 4L4OA 4Q8TA 3J7HA 4B5NA 3MMTA 3GLCA 4IPPA 3M0IA 3S6DA 2PDYA 3UNTA 3DGBA 3NO5A 2DT2A 3WLTA 2UWFA 2P88A 3EKGA 3VILA 3S5NA 2F7FA 2PDQA 3LBMA 2ZYFA 1WAWA 3LGGA 4LS0A 2PWFA 2V82A 1GOWA 1H41A 4PSRA 1R2RA 2NQ9A 3S2MA 3MCMA 5D4YA 3W02A 4C7DA 3V7PA 1X1NA 1I1XA 2XN1A 3U7VA 1MW1A 3EOEA 3GO2A 4MGGA 3NSXA 1KRBC 4IPLA 4PL1A 3SI9A 1TKKA 3STGA 4W89A 3U6WA 5HMSA 1X1ZA 3BMWA 4IIDA 1WXJA 1M3UA 4ZQMA 5AZ0A 3ZVHB 5TIMA 3VC6A 3H26A 1JNDA 2OT1A 1OFBA 3GK0A 3GDKA 1M7PA 3V35A 2E7FA 3WLLA 2G0WA 4V27A 1D8CA 4JX4A 4DJDD 3H70A 2ZQ0A 4IX0A 3TSDA 3DXIA 3LRMA 3ZOAA 2QXWA 1R85A 2IQTA 3R13A 4E8DA 4UTTA 3DC0A 4JNZA 3TW7A 3D3FA 4P7QA 3BTNA 2GDQA 1UWSA 1RSCA 4ZCWA 1V6WA 3EX3A 2YGYA 3VNDA 4PUMA 3QF0A 2R8WA 6CGTA 1W32A 2NWRA 3OG3A 3H4WA 5CG7A 1KBKA 3WQ8A 1QO2A 1WKFA 3HPXA 1CXIA 1LORA 4HTYA 4KGLA 2C1HA 5C2GA 5CSYA 1EZ2A 3OLEA 5J04A 1XKYA 2JALA 1SMDA 1E73M 2PE4A 4P7LA 3CAQA 1DE6A 3PFMA 1EL3A 3E2SA 1A49A 2Y62A 1XCWA 4O11A 2DFAA 4Z0SA 5DT7A 2E77A 2G5WA 4WKAA 1RBLA 3PBUA 4DZHA 3A4XA 3PK7A 3OGVA 4X0VA 3AZSA 3FGCA 2WMHA 3M46A 3LHVA 5DELA 4YLWA 1OF6A 1GW1A 1VFMA 4AEOA 1MW2A 3NPWA 3OIHA 1PPIA 3AOFA 1PX4A 2F6KA 3H24A 3PF3A 1BWLA 2VOMA 4IIBA 3UWZA 4B91A 1F73A 2ZUUA 3AYSA 4GE8A 5CGQA 3DFSA 1XW8A 1Z32X 3FNDA 1MSSA 3LG3A 3W1QA 2PBOA 1VFLA 1O7AA 3DFTA 1WZKA 1UROA 4RCXA 1EX5A 1XBVA 2WXDM 4O1FA 3IUDA 1QASA 4C65A 1HO4A 4L4PA 3WENA 5CGMA 4PRRA 4GUGA 3NPXA 1XLMA 4JFSA 3FDGA 1QNOA 3ELFA 3NQFA 1S5WA 1SJDA 2VCCA 3WH8A 2YLAA 3II1A 1HGWA 4IP5A 5TBOA 3QY8A 1O95A 1VC4A 1EGMA 1XQLA 6TAAA 4K7VA 3KAOA 3VNYA 4A2RA 3T2PA 1XIJA 1Y7VA 3WG6A 3V3WA 2QV4A 4LUTB 3P81A 4C6QA 1ZS2A 4LC6A 2FDMA 3NJ3A 1Q65A 1TMQA 3W70A 3QYSA 3RITA 2CC0A 2YFOA 2R1MA 3DKLA 3OVPA 4FXSA 2DIEA 2YDQA 4I8YA 1RA5A 1VFFA 2BG5A 3R79A 3CK5A 1US2A 1ME9A 2V5KA 5HUPA 4ZENA 3HTWA 4CD7A 3AUJA 3TYAA 3JW7A 3CTTA 1YXCA 4GYJA 4CN1A 3UY8A 5ENLA 4UB9A 2ABAA 2E0PA 1N2VA 1GORA 2I5IA 2RH9A 2C14A 4JHMA 4TTUA 2ZA3A 4HK6A 3N2CA 1EWEA 4HJFA 4P61A 2WPBA 3N17A 1TVLA 1LLZA 2FZBA 4RL3A 4TX6A 3B9OA 4AVOA 4NJJA 3K1GA 2C18A 2VZSA 4Y9AA 5CEWA 1W1YA 2P5NA 3M64A 3W1NA 4MPKA 2J74A 1HKKA 3G3DA 2V5BA 2XIIA 1A5AA 1DWFM 3ANUA 4YCPA 3EKZA 4TIMA 1AVAA 4BA0A 2AQOA 3LV5A 3C86A 3LXBA 4PTWA 1V0MA 2QUNA 1R0MA 2OWWA 2UY3A 1ZFJA 1EJWC 2DZWA 3GNDA 1HVXA 1GOQA 3S2JA 4MUZA 1BSIA 4Q8WA 3KVKA 1C8VA 2CZ5A 2HE5A 5DXYA 2HS6A 2JBMA 4ZGYA 5FF0A 4B5TA 1TA3A 1VBHA 1GZJA 1V6VA 2VD8A 3KXQA 3DHPA 4LW7A 2DUXA 4CNPA 2Z4GA 3SY5A 3UA4A 5D04C 4DM1A 4V33A 3NYDA 4HNLA 4YYCA 3A3WA 3HM7A 3PZMA 3VIGA 2VC9A 1KXTA 4ZB0A 3VUPA 4RDWA 4NX0A 3M0KA 4S3CA 1WBHA 2XZ7A 3CUIA 2E1DA 1TV8A 3NO1A 2VVNA 4IG2A 4PN2A 1IIHA 3LNMA 1PXGA 2YA1A 4GIYA 1RQBA 1YE6A 4J3UA 4OTKA 1DXFA 3MUIA 2VI0A 1UR0A 2BY1A 3R12A 1UD2A 4H19A 1XGDA 1CCWB 2E6DA 2IPGA 3T05A 2VX4A 3CQIA 2J9YA 4LQ1A 1AH3A 2NLIA 1A0CA 3W7RA 4OT7A 4UFJA 1IQ8A 4BR1A 3A13A 2PDKA 2GJRA 3E2RA 4NRRA 5HBFA 2TPSA 4O14A 5G4HC 5HINA 3WLSA 5DQPA 4LYPA 1BD0A 2FGLA 4IGSA 4V15A 3UWWA 3LYEA 4JDBA 1OT2A 2XZ9A 2WANA 1E15A 3RPDA 4UOJA 3SIZA 2A85A 3N13A 1OBAA 4GI4A 3R94A 5D2XA 2DV0A 3RNDA 3LSBA 3PB2A 1OX4A 4LT9A 4WIWA 3FAXA 5A8NA 3PZOA 4IHCA 4PCNA 1HVQA 1IHIA 3MSGA 1XX1A 4CD4A 3OIXA 3BLEA 1ZBVA 4PCSA 1HXJA 3EMCA 1UP0A 1D3GA 1ADOA 3JU2A 3EX4A 1WKYA 4BY3A 3C2EA 3EWWA 3NZPA 1ZP4A 3GTHA 4AD2A 4NJIA 1BF6A 2WC7A 4J7RA 1A5KC 2Z24A 5E0KA 3WDJA 2DEPA 2H6RA 3UBPC 1JQXA 2CBVA 3H12A 4TV5A 2J79A 3QN3A 3DFPA 3FSTA 2V2HA 3U5YA 1PVNA 1VFHA 3TW9A 1E55A 1MUCA 4B5VA 1J96A 2DJLA 1F05A 2GZXA 4LB3A 3VIHA 1GVRA 4N9CA 2HVMA 1LZOA 4HYWA 3H6OA 1D3HA 3VGGA 1IEWA 3WJYA 1KKOA 3MW7A 4HBKA 3CQJA 3JVAA 3S1WA 1C92A 3OP2A 2XWDA 5EBUA 1LRQA 3IARA 3MS8A 3SR7A 3L5MA 1ZUAX 3WQPA 2BY0A 5DX7A 3G8EA 1H0IA 3B8VA 2IS7A 2W92A 3KCOA 1WO2A 3VFLA 3NNTA 1CGWA 3RJXA 4AIOA 1BHGA 1P4CA 3YPIA 4M5PA 4DB7A 3TW6A 4IMFA 2EKGA 2XM1A 3LI1A 4UTUA 1CB7B 2FGBA 4XAPA 4MADA 3AXHA 1Q7MA 2PDCA 1GHRA 2DDXA 4M19A 2OU4A 2Z29A 1OG6A 2GUBA 3VGFA 2ZZ3A 3NQDA 5IHRA 3IACA 4XO7A 1J8VA 3LGEA 4RNIA 1VBJA 4H9XA 4XK2A 4DWSB 4XD6A 4HZ8A 1UD5A 1GUVA 2DORA 1GVQA 4NRSA 4FMVA 1TCDA 4GZ7A 4GMEA 4CEUC 3UP8A 4DJEA 3BQ6A 1EOKA 1NM9A 3T0DA 2QDGA 5CZ0A 4Q4PA 4LH8A 2FPTA 1UC5A 1Q7QA 1QOPA 4JY9A 1KFWA 4F66A 3QH2A 3VZXA 4CVWA 2Q8XA 2DSZA 3K4AA 1U5HA 3SB0A 4PL2A 1M41A 5SWUA 2XIOA 3BARA 3R4IA 3NSNA 4FOKA 3RF9A 4MAVA 1G7UA 2NZLA 4MY9A 3RCNA 4K7YA 3NZQA 3IGSA 3TQ0A 3CUFA 4OGZA 5A8QA 1FWBC 5GNZA 1W3TA 4AXKA 1AD4A 1VCFA 4L56A 1RY0A 2QNEA 4HN8A 4O19A 4AZIA 3TROA 4IFOA 2XTKA 2W6RA 5L6UA 5CC5A 2VFGA 3EA2A 3NUKA 1A5LC 1ZP3A 2CNCA 4HOWA 2VFIA 3KRUA 4JTRA 5DXXA 3IRSA 4O0QA 1P6CA 3PPGA 1W1ZA 3SO7A 3DG7A 1PIGA 2I7GA 1LG1A 2G3IA 2YBUA 5HULA 1B3OA 1A5CA 1AA1B 3NL5A 2JQXA 3CHVA 1KXVA 3ZT7A 2DU2A 4F79A 4L6OA 3SIMA 3WJWA 4CNTA 3N29A 1FWCC 1OZQA 4DLFA 4L4MA 4A3UA 5C9RA 3V1HA 2I17A 1HX0A 1XRTA 1ZENA 3W76A 1DJGA 2Y5SA 4CQCA 5AC4A 1E4LA 4ZVJA 1QW8A 3V16A 4MHBA 3S1UA 1TV3A 5KZEA 1P6WA 1OIFA 4HU4A 1IEQA 4C1KA 5BWAA 4EWND 1O6IA 3NZRA 4GD0A 1ZZMA 1C9WA 3WNLA 3LOTA 1Z6KA 5K9CA 1EKOA 4DN1A 1IXNA 1FDYA 5MKGA 2WBGA 1K7EA 2PP0A 4L6HA 4IGHA 1L6YA 3M41A 2I16A 2NXGA 4KEVA 1R3WA 3F4VA 1V3HA 3S5ZA 4O54A 2BLEA 2PD5A 1UBPC 2VWTA 3HQNA 1E51A 2CBUA 1GONA 2BASA 7REQB 5M1TA 1J93A 2J75A 2P3ZA 1OWQA 1JZ5A 1BWKA 4N6EA 4HZ7A 2Y61A 3EWBX 4YTQA 5E0CA 3CV2A 3SCSA 5A6BA 1ITUA 1R8LA 1UD8A 4LV9A 3GTXA 1XR2A 3W7IA 1R30A 3ZIZA 4JTLA 1VRXA 2ACRA 3E02A 3SRKA 3SCPA 1MZRA 4FOUA 5DBUA 1L6GA 1XLKA 2C19A 5CPOA 3MSYA 4N9DA 3F5KA 4AG0A 1POJA 1Q6CA 1UIPA 3CZGA 3ARPA 6XIMA 4AZ6A 4G7EB 1Z89A 3L4YA 3QOKA 4EPDC 1Q45A 1V3IA 3MB9A 4RV8A 1XJBA 3KX6A 2V0TA 3MBDA 1ICQA 4AAJA 2GGJA 3UXKA 4EPKA 3EDKA 4BF9A 2C15A 4ZB2A 2VDHA 4NAEB 1BQCA 4E2OA 2VGGA 5BROA 5I78A 1DJXA 1TPC1 5FJTA 1TPFA 3GBEA 3GDBA 2FVKA 4JEJA 2Q6ZA 4FLOA 3DX5A 1DTNA 3Q94A 4XAGA 2J24A 3SN4A 1GOIA 3M5VA 4LUIA 1SM9A 1UKOA 3STCA 3ARZA 3CNYA 1P7TA 4U2ZA 1ISZA 1VBRA 3UGVA 3WLQA 1D9EA 2DIJA 3H53A 2VEMA 1BWVA 3QY6A 2V30A 3GXNA 3ATYA 3GC2A 4JTIA 1W9VA 4R7OA 3FOKA 4QJ5B 5B7ZA 4MKSA 5M17A 1LBFA 3U2CA 1EDTA 1QU4A 2OLHA 1BF2A 3M5ZA 1XD0A 1T8QA 4L1XA 1TV7A 2V3GA 1US3A 3E3HA 1TSIA 4E2BA 4I7WA 5K2ZA 3M4HA 4M1BA 5CZSA 3LBOA 5M03A 2ANUA 4HNVA 1XL9A 3IK2A 3B8IA 3UR5A 1ZQ5A 2Z00A 5C5YA 4ORIA 4IL2A 4JPGA 1EPVA 4PCTA 2A2IA 4FR1A 3ZR5A 1RQHA 1GQJA 2WV8A 3KTSA 1ZJAA 2BVTA 1PUDA 1E71M 3MV11 3IVTA 3DHUA 4I9TA 1FWRA 4DXVA 1KM3A 1VEPA 2NUWA 2B7NA 1V02E 4XAFA 4QEHA 5EA9A 3VXGA 1KFJA 4M29A 1F2JA 3GR8A 4W8BA 4UXDA 1X8CA 1TE6A 2QS8A 2VEIA 3WK2A 3C2RA 5KMYA 2IQ0A 2XH2A 2HWGA 4XTDA 1A4LA 4XKYA 1U5JA 4ICMA 1N55A 3RPMA 5DT5A 4U3AA 2O4MA 3UFYA 5EMYA 2G4FA 1M03A 5CPNA 5B80A 3BPWA 2OPJA 1I2RA 3G0UA 2GFTA 1AD1A 3UERA 4RE4A 1VR6A 2OGYA 1JIBA 1QVBA 1R3YA 1CX9A 5A8OA 3F4CA 1R9ZA 4PB3A 3N15A 2I5GA 3CYVA 4DLMA 2EG8A 1BPLB 4JEQA 4O50A 1W8GA 4AEEA 4CEXC 4F48A 3SQMA 3RHGA 3W7NA 3Q45A 3P7YA 5DCBA 2IKIA 2WMIB 4AX6A 4UQCA 3FYYA 1S2VA 3VD5A 3DFQA 5M2FX 3W0KA 1JXJA 4AHOA 2FZ8A 1J0ZA 2O7QA 1RXOB 3WQ6A 3C3NA 2BFGA 4WXYA 1FXQA 4LYKA 5AFDA 5C71A 3FY1A 2JKEA 1C91A 1MWOA 4F0MA 4Q8QA 1P0NA 4IPJA 3SDOA 3NURA 4KWVA 4CD5A 3T08A 1TELA 1GTHA 4GX8A 2Y85A 4G8TA 1BG9A 4G1KA 1JD7A 1E3ZA 3ZLHA 4BF7A 1HIZA 1UR8A 3BAKA 3EDJA 4HNNA 3HG3A 3B9DA 3HGJA 1MFUA 3DH7A 4UIOA 1WDRA 2QVHA 2WSYA 4PMNA 3RMJA 3GNRA 3A9BA 4HPXA 2Z25A 3KZPA 3F2BA 4K1GA 4MZ8A 4LPCA 3B9NA 2P0IA 2GJXB 3ARVA 3CHEA 4JYFA 3BCJA 2ZWYA 4DEFA 1P1MA 6ENLA 3FEQA 2C8NA 4NX5A 4C6IA 2ZX7A 2ISVA 3A5FA 3S46A 5D09A 1GKRA 1KQYA 3ZFHA 3NPUA 2E6AA 5G1MA 1LOQA 2A4AA 4PMDA 4B5WA 1LQ2A 4U33A 3VD4A 1QJWA 9XIAA 2DP3A 3AJ7A 2ZVRA 3ZJKA 5T91A 1DP0A 4AIEA 2VZVA 2HMCA 5A6KA 1EEXA 4AEFA 4RW5A 2OFJA 2VO5A 1J18A 2YXXA 3TCEA 4I7UA 5BXRA 3MC5A 4AZCB 1FFQA 5JBDA 2DZPA 4YCOA 2F9RA 2Y6ZA 1RY8A 2B31A 4IL0A 4RPQA 1D3CA 1Q6OA 3KBSA 1UJPA 3V4BA 3WDPP 4GKLA 3EX2A 1WE5A 5J5DA 4IQDA 2R82A 4AHPA 1ONXA 2XSAA 1QT1A 2NQZA 2QCLA 3DHDA 3QR1A 4JIRA 5I3JA 2ZADA 3WJSA 2TYSA 1R3RA 4QJ4B 1TCMA 2VT0A 9CGTA 1U1HA 1UWUA 2WVVA 3AISA 1W9XA 4GI8A 1DXEA 2X0SA 4N6FA 5D05A 1H7PA 1Q2RA 3QLDA 2CLIA 1V77A 2AKZA 2DZAA 2ZIDA 8TIMA 3ATZA 3C2YA 5J5RA 1CBGA 3ZXWA 4CCDA 3WQCA 2F84A 3D5HA 2ZXQA 2OYLA 3RRAA 4EK7A 2NX3A 1ZBWA 3EPMA 3THUA 2JGQA 4OQVA 4GABA 1LLWA 4LXFA 3WUEA 1A80A 4AWTA 3IUIA 3MHFA 2DY3A 5I02A 4OV9A 2CITA 1S5NA 4A6GA 1OX5A 1QHPA 3BAIA 5D03A 4CVUA 3LPGA 1GT8A 1F3TA 3ZMRA 3T81A 1E4MM 1O12A 3LHZA 1KQZA 1W1TA 4OFCA 5F2GA 3LI0A 1P43A 4HCDA 3A5VA 1EP1A 4UFIA 1XGZA 3WQFA 5ABFB 4XAZA 3GTFA 1OF8A 2IXVA 2DVUA 2R91A 4Z2HA 1EWDA 3LBCA 2FMOA 1QMLA 3H2FA 5AVNA 3N2TA 3GXFA 1UD4A 3TR2A 1SR9A 6A3HA 4IJRA 3OVRA 2QUUA 2WCAA 3TONA 4GC4A 2CLLA 2VC6A 5I3HA 3AUOA 3W7LA 2XVLA 1QDSA 1QNPA 4DM2A 4RE3A 1C90A 3G1YA 3UG4A 4A21A 4QIUA 1V4YA 3W07A 1AJ2A 3DEQA 3O9NA 4PBGA 3VOFA 2YDAA 2YL5A 1GQKA 4LOCA 1GPWA 5D8ZA 4FNPA 4GX9A 3L21A 2GVLA 1J5TA 4I5RA 4NAFA 3WL0A 5HPOA 1XBZA 2O4QA 2QUTA 3MDUA 1IGSA 2CBIA 2OOGA 1JDEA 3LCFA 4AD0A 4KPLA 5D30A 2A3AA 2A7NA 4DBWA 5TNVA 2VGBA 2QIIA 2C3ZA 1U30A 3TQKA 4GIAA 2J7GA 4C1NA 4AF0A 4O12A 4I9JA 1A47A 3P2VA 1ALDA 4NNBA 4UFLA 2PA6A 4AD1A 4XO6A 2R6OA 4M7TA 1V0KA 1E6NA 4Q4MA 4AHQA 4YYFA 5C0QA 2UZ9A 3N11A 3P84A 3O6DA 2GGIA 4PB5A 4GQGA 5BU6A 3C61A 4LEQA 1HGYA 3OODA 3H23A 1XLBA 3TJLA 2GDVA 2GVJA 2O9PA 3O6AA 3VUSA 4NHVA 3EMQA 3EWCA 4HMNA 2PPGA 4FK9A 5EBAA 4FNTA 2PCEA 1FKXA 4W7WA 1JZ7A 1H7XA 4RKAA 4AISA 4YS1A 3ABOA 1YHTA 1H4PA 1U1JA 1NTHA 3T4CA 1BYCA 2RDTA 3NL6A 3S6TA 1ZY9A 3UT0A 2OODA 4US6A 4KWWA 4QM1A 3WD0A 1XH0A 1F4HA 1GJWA 4FLRA 4FNQA 1E0XA 2J7CA 2QYGA 4HOXA 1UR9A 3W7EA 1HL2A 4D6JA 4DHGA 3R7MA 3B8WA 3PJTA 2P10A 3OO2A 1CDGA 2PODA 4QE4A 3W24A 3BJTA 2B7PA 3PJUA 1B90A 2Z6JA 1E5JA 4MM1A 1U2YA 2B7OA 2WMFA 4Q8PA 3VOIA 3FJLA 1X7IA 2EBNA 4TQTA 4Y96A 2INZA 1WP6A 3BGAA 3DBPA 1WPCA 2EG6A 2AMGA 2WAGA 4H9YA 3VVGA 1KGWA 4AZGA 1H5YA 5DANA 4Z1BA 4QG8A 1BYBA 1JEZA 2Z0IA 3IUHA 4LUSB 1K9FA 3BMVA 2OLSA 1RHCA 4Y9OA 3PN8A 1J4EA 4QDWA 1SQ7A 3W74A 4E0CA 2J7DA 4NXSA 4IG2B 3KRSA 2D0GA 3B4UA 1UWRA 3WK0A 1U33A 2CXGA 1VHNA 3W7PA 1JCNA 2J62A 4XX6A 4AWEA 1YPIA 3M16A 3AMGA 4HU0A 1R3QA 4N9BA 4BF5A 3ZWTA 1FDZA 3WQOA 3GW0A 2CLMA 3W2KA 3I4EA 4ILSA 3TX9A 1TJPA 3HURA 2GQ3A 3F5LA 4J3XA 2GDUA 3F2CA 1YNYA 2HVOA 2NV2A 4CQBA 4MLJA 3W6YA 4DJDC 1FHDA 5FI8A 1KGXA 3DG3A 4QQ3A 3BW3A 2EO7A 5CLTA 4C6DA 2P8CA 1E3XA 4IFKA 2VDGA 3L4XA 3V0TA 3R6IA 3ITLA 3O1NA 2NT1A 1WUFA 1B9BA 4DUWA 1YRRA 1TVNA 2YYTA 3N2MA 1ITQA 4FPSA 1XUZA 2J47A 1B3VA 3ARTA 5E0FA 4HA0A 4L1GA 4YPJA 3A3XA 4JN6A 4KFOA 1A3WA 2FYMA 1XD1A 1AQHA 2OEMA 4HB7A 3PTDA 4MNMA 1F76A 1KD0A 2W27A 1NSJA 4PULA 1K03A 1IEXA 1XRVA 4EPEC 2WNZA 5HDRA 1OIMA 3QOMA 2G37A 1BKHA 4Q6XA 5A6TC 3ZO9A 4LUJA 1UHVA 3K5XA 1F6KA 1H11A 1BVNP 2X7VA 1PX8A 1PV8A 1XBXA 3SW6A 2Q01A 1H60A 3T2OA 1NWUA 3AIQA 4PCPA 4B4HA 3CEPA 4ZQNA 1G94A 1VYRA 5BW6A 1GNXA 5CQ1A 3ZJ8A 1OGBA 1V03A 2X1RA 3GD6A 3BV4A 3TQPA 1BYDA 4NQ1A 4M6PA 5FL1A 2XIQA 1WYIA 1WQ5A 3VGBA 4WF7A 4XZ9A 2F2HA 1T7LA 3TNOA 2R1LA 5EL1A 4CNSA 5FAGA 5E5CA 3S6OA 4AY8A 1YBQA 1T99A 4ICNA 5EMJA 1N8WA 2QGHA 4H8UA 2X05A 4MB5A 3F4NA 4PRWA 1V6YA 4ICCX 3LQGA 2ZRYA 1MDRA 5CPQA 1CW2A 4S1FA 5JIWA 3RO8A 4IOTA 3RGTA 4JD4A 2WHKA 3SCTA 1AQ0A 2PTXA 4GKTA 3GVWA 4XG1A 3WQVA 1R3SA 1XRFA 2AAAA 1WDDA 3GVRA 1F8MA 2E25A 1P48A 1OK4A 3NQGA 2DT0A 1H51A 2PZ0A 2QZRA 3RLVA 2J7FA 2E5DA 4DO7A 4U5KA 1A3HA 2WVSA 1OYBA 2Z2UA 4V1XA 1DL3A 1TO3A 1J0IA 1MEHA 3V0SA 5BYWA 1UKPA 1KGUA 1N8FA 4KRTA 2XPKA 1C29A 3VM7A 8XIAA 1OY0A 2E9MA 4IMDA 2VZTA 1YDNA 1XLHA 5ABEA 2FPVA 3PUGA 4XZMX 5XIMA 2ACSA 2VD9A 1UWIA 4MDOA 3TVAA 2L5HA 1P5BA 2WM0A 1WXZA 2VELA 2YDSA 1UOZA 3E0FA 4W7VA 5GPRA 1HW6A 2NX1A 4EF8A 2QVNA 2RGMA 2GGGA 4QS5A 3RO6A 1EQPA 3P62A 2PU1A 4KWSA 3I7SA 2XVPA 3W82A 1J6OA 1XIFA 2PMQA 4ACZA 3IJ8A 4LCQA 1OFQA 2AL2B 1C7TA 4JQ3A 4R33A 3W7DA 2ZVIA 5IXEA 3M0LA 3TA9A 1IWBA 1F74A 3HQPA 1CYGA 3N2BA 2OVLA 4JXCA 2X2GA 3PC0A 3LV6A 3MWCA 2BHZA 1ZNNA 4WJ8A 4MYXA 1MI3A 1UMYA 4QBXA 4LGXA 2FZNA 2X1SA 1IT8A 3TEVA 2RHGA 1S39A 4DAFA 1YEYA 4FA3A 4Q8OA 2ZXAA 4D8AA 1BXCA 1QPQA 4PMVA 2XH4A 5XINA 2ISSA 1NWSA 2OO6A 4XQ6A 3KHJA 4IH3A 2W61A 4D8LA 4BQ2A 4DPQA 3BGJA 3SCQA 2QJGA 5A6JA 4FF7A 4MMWA 1B57A 3HGOA 1X39A 4UNIA 3E49A 5KINA 2ONEA 4BKNA 3P82A 4GZEA 1EJUC 1E9ZB 3QTPA 5E9AA 2OSXA 3S2CA 2Y7EA 3GH5A 3GXTA 1TV4A 3NQ7A 4TXEA 3OG2A 3EB2A 5CSRA 2W91A 3CWOX 3QSTA 4O1AA 4EKJA 4UZUA 1RV8A 1JG9A 2BDQA 2E5BA 3UJ2A 1R2TA 2QUMA 1V0NA 3HGSA 1GPFA 4M1RA 3I4KA 5A6AA 2C13A 1ECEA 2Y0FA 3S2LA 1DJNA 4KEZA 5D2WA 4GWEA 3HV9A 2Q8ZA 3HFYA 1JGIA 3T0AA 4RNFA 4Q33A 5JVLA 4IPIA 1AQFA 2H3BA 1BSLA 3W1LA 5F2IA 5AYIA 1AG1O 3W00A 5CJ5A 3U7BA 1LLOA 2ZTKA 4HNTA 1YPXA 2DZUA 1TX0A 7TAAA 5LSMA 1TWSA 3I7RA 3MY9A 1T5AA 3TN6A 4MNKA 2RDUA 4IIEA 2PAJA 2PTYA 1X98A 2C6QA 4NYYA 1GKQA 4JTHA 3CH0A 3QGKC 5IDZA 3SBFA 2XH7A 1JJKA 3EXSA 2D2GA 4OVXA 1SR0A 2CFFA 2Q71A 3ID7A 4CU7A 3V18A 3EOSA 4FNRA 2DT1A 5I3FA 1QPRA 4S2CA 4LBSA 3TN4A 3BOXA 3WD1A 3PG8A 1R87A 5JQ9A 4OKDA 2QEZA 1L8PA 4P7NA 4E4UA 1PAMA 2HNHA 2QAPA 2YX0A 1C3FA 4GQRA 3CQKA 3W1PA 1OT1A 3SSJA 3WNOA 3GXDA 1DHKA 4XIAA 3HQOA 4UCFA 4F9JA 2YYUA 1EXPA 2RJGA 2VX5A 2WSKA 3KOXA 2E40A 3M47A 4ZL1A 3NEVA 4PGLA 1K9TA 1XBYA 3B06A 4RE2A 3CHCA 1A5SA 4F0LA 4GVGA 3EWYA 2WZEA 3OQEA 3L5AA 3FX4A 4JQ2A 1XFCA 2O56A 3DFHA 5LZLA 1K4GA 3OTRA 3UJSA 4AY7A 3NQCA 2OXNA 2MUCA 1EYWA 1R9XA 2O92A 2QJJA 5H8MA 4Y9PA 2AKMA 3G6LA 4ZOAA 1WDQA 4M0XA 4RJEA 2NW0A 3WLMA 1CLKA 1S2UA 3PBYA 1TPDA 4TOQA 4ATWA 3URQA 4KS0A 3QR3A 1JPHA 4YL2A 1XCXA 2BY2A 1RR2A 1EJ7L 1QWKA 4JIEA 3OGRA 1ME8A 1XC6A 4JCMA 3LX9A 4QAIA 3RYSA 1FBAA 1CECA 3AS0A 4B15A 3PUEA 1IF2A 4FOJA 3NQEA 3VCCA 3HGRA 3WUGA 8CGTA 4JFVA 3OZPA 4HIBA 4RUBA 3M43A 1LRNA 3E0IA 3BICA 5AY7A 2DZSA 3QGAC 2FFCA 3HPZA 1DWJM 4JDYA 1KCKA 1TWZA 2O7SA 2VURA 3P5ZA 5CBBA 3WX7A 1GTEA 3MI2A 1KM1A 1K8ZA 3ARUA 4WVXA 1NVMA 2QKFA 3K4DA 1IWPA 3M5YA 3WIJA 4ZQPA 2WHJA 1VPQA 2Y24A 2GGEA 4OE7A 2A7RA 1AJ0A 1FWDC 1ISVA 1ZJIA 3ITGA 4AIBA 3Q65A 4L9ZA 3WD3A 1AW5A 3VNZA 5JBFA 3VKDA 4DNHA 1JAEA 1K7XA 1UASA 4RDYA 2OX1A 4R27A 2F8QA 4J5NA 1S38A 3CS2A 3TLQA 4GG9A 1MYRA 1CGUA 2CZVA 3DI1A 3ICJA 5AECA 1EUNA 3IJ6A 4ZR8A 1S1PA 3NL3A 1SZFA 4NZ3A 4R3UA 1OADA 2DPEA 4DO6A 4FXRA 4GZIA 3U9IA 4YN5A 3VIFA 3QFEA 3H4XA 1EGZA 5DMNA 3T0CA 1Y5XA 2OWCA 3S4TA 3VNKA 2OT0A 4EAMA 4QR6A 4DWSC 1RP9A 1UD3A 4DF2A 1OGSA 4N4QA 1D7FA 3G1FA 4K2SA 3CPUA 4K6AA 1XIBA 3EOLA 6PTDA 4OBSA 2VVSA 1PIIA 5IHSA 1S5VA 4LS1A 3WH7A 1LQ0A 2EQDA 1AJZA 2Z7GA 3EGJA 2CHRA 3H55A 2V3EA 1BTCA 3BE7A 3OZMA 3GG8A 4MSSA 4DUVA 2ZBTA 3R43A 2QCNA 4WY0B 3WLIA 4D1JA 3QGVA 1XI3A 3NDYA 1ZTVA 1PHWA 4LSBA 4PEEA 3UJFA 3IJIA 4OUEA 4Q6JA 3AHXA 3FA3A 1TTIA 2BB0A 2P50A 2QULA 2QCDA 3G1AA 4HK5A 4WGXA 4AXNA 4MIMA 4URIA 1N8IA 4GYFA 3HJEA 3SURA 1O60A 1V08A 3WN6A 5F2LA 1RQEA 5FD0A 3KOZA 2KX9A 4DPPA 1A5UA 2WZTA 4ZA0A 4ZFCA 4MDPA 3ZJ6A 2EAWA 3BH4A 1JCTA 1E6ZA 2ZRVA 1IT7A 2W66A 5CLWA 3W7MA 3DGRA 4MFEA 2IKJA 2P1FA 4LCRA 3RILA 5REQB 1E1CA 4MY8A 1F3XA 4POCA 1J01A 5BOOA 2GL5A 2CPUA 3MKCA 4HPHA 2YPIA 4B2DD 1CTNA 3IIXA 1RCXB 3Q2DA 1OINA 3AHVA 2VEKA 3FXGA 3G18A 4AC7C 5AB3A 1P0DA 1GZGA 3RDKA 3SUVA 2YIHA 3ONBA 2QJNA 2I9EA 3QSRA 2E8YA 2C0HA 3RRXA 4US5A 1W9DM 1KTBA 3OBKA 3LERA 1H1NA 3CMFA 2G3FA 3UETA 4PR4A 3WF3A 3GXMA 4HMEA 3LNPA 4MOZA 2ZTJA 1J79A 3IJDA 1GVYA 4D6CA 1NJJA 7TIMA 1OD0A 2ATSA 1ZJHA 3RR4A 5EFFA 5FF3A 2ZXBA 3PWAA 1BLIA 1RJPA 1TUXA 2R14A 3MUY1 3P14A 4GY1A 5HWJA 1W5MA 1G4TA 1VRDA 3TQVA 2YSWA 1JF6A 4PH6A 2WVUA 3T44A 2DUZA 4AFYA 2DZVA 5HR7A 3PZNA 2FZMA 1WDSA 3N14A 3WBXA 1XIMA 5G2WA 4KKXA 4E2DA 2DZXA 1WAUA 1NEYA 4C6MA 4CNOA 2OYMA 3R8RA 2BWGA 2NLYA 3CPGA 3LM3A 2R9RA 5AYZA 1HT6A 4PUDA 3UR8A 2E3ZA 5HJXA 1HO1A 4ZBCA 3DN5A 3UWQA 1UR2A 4UMBA 3FJ6A 5CSSA 2XUCA 4S2BA 1W54A 5FJPA 5ABHA 3W6LA 4TV6A 1EOMA 4D6IA 3A23A 2HROA 1XIIA 2YBVA 3ZWSA 4DVOA 3P93A 3VZYA 2YCIX 3LHTA 4ZB5A 2RUSA 4OZOA 3GXIA 2XSBA 3CL6A 2ICSA 1I2QA 1IR1A 4G1NA 3CEUA 2BHYA 2GJNA 5G4WA 4CCZA 4HHHA 3EDEA 3ARXA 1E6RA 3HFTA 4MJ4A 1WA3A 1A5MC 1E43A 1K70A 1SO5A 5A1AA 1Y5WA 2NXIA 4PZVA 3N9RA 4GNJA 5G5IA 3GVVA 2X0YA 3AIVA 3AIRA 2Y8KA 4H2HA 4UTFA 4NXKA 5C7VA 3L66A 3EA3A 3ABZA 1T96A 3CU2A 4NT0A 6ALDA 4NG3A 1L9WA 3EXTA 3AALA 5FJIA 2WVTA 1VFOA 5LNSA 1PS9A 3LN3A 2PLCA 3HO8A 2YFNA 3VMPA 3WMSA 3MU7A 4M24A 4NU7A 5AHEA 3AZRA 1KO0A 3QKZA 3LLXA 4O28A 1IV8A 2BGQA 4D1IA 1K6WA 2BSLA 1D2KA 4F8XA 5K4ZA 3T4WA 1XQKA 2IXUA 3MVTA 5J8LA 4NNAA 3KP0A 1GVOA 3KS6A 4A3RA 5FACA 2E67A 2WHMA 2GUUA 1R46A 4PFHA 5EFDA 3CIXA 1JULA 1TYGA 2PDJA 1PZ3A 2A5HA 1SZEA 4LF2A 3TFXA 2CZFA 4PUWA 3LXAA 2PZNA 3FV9A 2J9ZA 5H1WA 4E4PA 4FXFA 1UCWA 2OZTA 4J3VA 3UG8A 3VI2A 1CPUA 4KCTA 1PX3A 6REQB 3M0JA 1P1XA 1R3VA 4RXGA 3DCPA 4AVNA 2YXGA 1J2WA 2ZUVA 3U3HA 5GNXA 1R5YA 1THFD 4XBJA 3OYZA 3BWWA 2REQA 3TSMA 1RP8A 1F6PA 4AUBA 1I2PA 2BGSA 3W7GA 2ABBA 4BS0A 2OX4A 2J77A 4Q4OA 2JEPA 2PGEA 4W4QA 3AO0A 5JUVA 3S9IA 3H2EA 3GHRA 1H09A 2G50A 2WJDA 3DUGA 2PRHA 3UY7A 4TX8A 1KNWA 2FTWA 3DZ1A 1S1RA 4HP5A 3NR0A 1EDQA 4KW2A 4IX2A 3L67A 3DFYA 2F61A 1TMHA 2EPMX 4WDTA 1BVWA 1UB3A 3L2LA 4S3GA 2JKAA 2QCCA 3HPSA 4X9SA 1PWLA 4UNKA 1OC5A 3REQB 4UCGA 4HHPA 3LB0A 4YTSA 4JS3A 1RVGA 4QCEA 2ZICA 4Q8MA 5AHLA 4MYAA 4PMZA 4Y9MA 3TZNA 4RZ6A 4H6QA 2VXNA 2Q3OA 1BKSA 4LV4A 1E0UA 2WLYA 1REQB 3B03A 2Y2WA 2YCKX 4L4LA 1BFNA 3BO9A 3C2OA 2NXHA 5JU6A 3RU6A 2J25A 5IDIA 1QPNA 3MWAA 1WZAA 1RK5A 1YPFA 5EMMA 1DORA 1ZPTA 2PC8A 3CPRA 4RZBA 1TIWA 2JKPA 3MTWA 3TMLA 3NQMA 5EKYA 1FXPA 2NWSA 4GHRA 1EB3A 4M80A 2A3CA 2VR5A 3CAKA 5AYBA 1NQ6A 1VEMA 1DIOA 3WJZA 3VAVA 2R24A 4DNMA 3OYXA 1TV2A 3L9CA 1F4AA 3GTIA 5AC8A 2GUYA 4AD4A 6TIMA 1OFAA 1UP2A 1UWAA 1RD5A 4Q4KA 2J13A 4ERAA 3UD6A 2BY3A 4TTGA 1CXLA 1EC8A 1XLJA 5K7JA 1X96A 5A3HA 1K02A 1CGYA 2IPJA 1KLYA 1XV8A 2CHOA 3SRFA 1FWIC 4H6KA 3B0PA 2P0OA 5FL0A 2XYLA 5AC6A 3B0UX 3VU2A 4LX4A 1KFEA 2HE8A 1L6FA 2E6YA 4ZO7A 3BOLA 3KWXA 3CWHA 3IIOA 1H0GA 4A3QA 5FJOA 1I0DA 4QE5A 3RX4A 1JFXA 3W7HA 1BXBA 2WWDA 3QMTA 1KM5A 1JFHA 4TVUA 2WOQA 2YCLA 5U7SA 1YW1A 1PIFA 1IXQA 2GLKA 3VDGA 3VOJA 4Y8EA 4NZ4A 3CAWA 3UYIA 5BRQA 3VMOA 4ZTXA 1CWYA 5HK4A 3KEHA 3BCDA 3N3MA 3GM8A 1ITCA 3LCIA 2XN0A 3BV7A 3OHMB 3UEQA 2CERA 4AWSA 1EJSC 1Z48A 4KQNA 5G2IA 3C4UA 4O1BA 4UR8A 5C6MA 2D2HA 4E5TA 1MUMA 1FCQA 5D9NA 2EG7A 4GY7A 1CGVA 1XG4A 1IZJA 3GG7A 2A21A 3A22A 3V0UA 4B3ZA 3VKJA 2XISA 4IJBA 3BLLA 1K6AA 1VFUA 3PSVA 5DFAA 3DIPA 3KOYA 3TLLA 3T0TA 1QNVA 1XDJA 2I57A 1WOAA 3LMZA 3HQ1A 3TYBA 4F0SA 2IW0A 3VDBA 3S3GA 2ZZ7A 3AHTA 4MAZA 3HPAA 3CLMA 1LF1A 3HN3A 2PFHA 3H2MA 2Y88A 3RIKA 3CUJA 3CMGA 4ZOBA 4JTSA 4OWGA 3ANYA 4M51A 4G2DA 3TP4A 3WEMA 5BWFA 4DO4A 1OVDA 1LUCA 2V3FA 3QLLA 1KTNA 3PZTA 2TSYA 1NFBA 2WWCA 1P0EA 3WMLA 1JCXA 1TPWA 2VGFA 3H21A 1JPIA 1F5ZA 4NILA 1JYWA 1AK5A 1Q7ZA 3URAA 3NDZA 3B4YA 3E1F1 2J66A 4MWAB 4JTGA 1O5QA 3N18A 4C5ZA 3EWDA 1E56A 3HJZA 4MY1A 1CGTA 4B3LA 1I4NA 4MWAD 4XSMA 2GJPA 2OWXA 4XB3A 1KXHA 1A50A 2HSAA 1I75A 2B4GA 4X0NA 3LM7A 1MZHA 1H61A 2CU0A 1JYNA 1VFSA 4JIPA 4GGHA 5I24A 1CNVA 1E0VA 5I3GA 2NSXA 4NL1A 4N9EA 5AOUA 1DKWA 2G41A 5G1YA 1A0EA 3DYOA 3PPCA 4DJDA 3BLPX 3ZVHA 3ABSA 3PZIA 3WYZA 3TUUA 1B31A 3UGRA 3CUZA 4LUYA 4UQAA 4J28A 3MKKA 2WM1A 3CHFA 4DI8A 2HTMA 3QV7A 4RDZA 1XLCA 3KE0A 1SFTA 1H49A 1EBHA 1R38A 2CZEA 5C8BB 4F3HA 2PSNA 1EYEA 5D9OA 1T8XA 3DDMA 1QCWA 3E2VA 5I7GA 1HJUA 1V3JA 3T9PA 3G2GA 4R9XA 5I0DA 1ML1A 4A3HA 3ABRA 1EHAA 4MZYA 3L5LA 1HUVA 4INFA 4N02A 1NOFA 2PDGA 1BAGA 4WDWA 4Q7NA 3I6TA 3OW1A 3EMZA 1YYAA 1R9YA 1O94A 5KTLA 3W75A 4ECLA 1G5AA 2JE8A 5HWNA 5EB8A 4QISA 4LALA 5F7UA 1EXBA 4FSAA 1UKQA 1W5OA 1VEOA 1KXQA 1H1ZA 3S2NA 1W1VA 2GQAA 2HDJA 3W7OA 3P74A 1CIUA 3QQ0A 1NQKA 1KFCA 4L5ZA 4WCJA 5KZ6A 1V51A 1O1HA 1YE4A 2OR2A 2DSVA 2PDWA 4REQB 3BW2A 5LGXA 3EB4A 3L4TA 1LQAA 4IZGA 2D2JA 2QAFA 3QV9A 3A4JA 5BOFA 3BLFA 3RJYA 4B92A 4IMAA 1PJ9A 4ZEPA 4OBTA 5K3VA 1X38A 5D9MA 4GUHA 3G77A 5DMYA 5FIPA 4YTRA 4GO8A 4O4WA 2OSYA 4OOUA 3K2GA 2XVKA 5IBXC 2ACUA 1C93A 1OK6A 2BODX 5IOBA 4IMGA 4UTIA 4B5SA 5LHFA 1SW0A 4G56A 2ZRZA 3N4AA 3VDHA 3WBWA 4J2PA 4AYGA 5LIXX 4C6JA 4AZBA 3W73A 3KP1A 3BDKA 5A2BA 1OFRA 1NH6A 3IVUA 3AC0A 5A8MA 1KV5A 1GYNA 1KKRA 4H8VA 3W84A 1SJAA 3G3MA 4UFHA 4C60A 3K30A 2A6LA 4HYVA 4E8CA 2XN2A 5AHMA 3SZ8A 4UBPC 1WKDA 2VGIA 2ZKMX 2XDFA 1PTDA 4LUTA 2VNCA 4W9TA 4HNCA 4AQLA 1MO0A 3WH9A 5LNRA 3TNBA 1JCJA 1LP6A 2WO5A 3TTOA 5D38A 2CWNA 5AVHA 1ZAHA 4H83A 3QHMA 1B2YA 3TTYA 2WCGA 2PI6A 2V68A 4P2VA 1G4SA 5HNUA 3LPOA 4RNJA 2YL8A 4QE1A 3W7JA 3H7UA 3XIMA 3FA4A 4LY4A 3NWRA 4FNSA 3AS2A 1KCZA 1WDPA 1GW9A 1TZ9A 4XKMA 1R2SA 1PL9A 5K4XA 1O66A 1CXHA 1ONRA 3EXRA 4Z42C 3TOPA 4MB1A 1FHUA 2AOSA 1Q6DA 3FW6A 1GVEA 4HSHA 3H7RA 4CNNA 5A6MA 2IMRA 3KLLA 3KDOA 3FA5A 1GOXA 3LCGA 1KA9F 3ITCA 1JI1A 4LAMA 2WMJA 4BQ3A 3WBAA 2YW3A 1O5XA 1AZ1A 1I0BA 2ALRA 3A4WA 1P6BA 5AC5A 2XHYA 4AYSA 1BRLB 2EKCA 3GDRA 1PSCA 4GIRA 4ACYA 4X2PA 2FJKA 2INFA 1FCVA 4F4RA 1VP5A 3UCDA 4GBUA 1EH9A 1V7YA 3QV6A 1DJWA 1LTDA 3W1TA 4AZ5A 1EZWA 5I79A 5L9FA 4LFYA 4I9MA 4A22A 3NTYA 4UR9A 3ZQ9A 3OZOA 2OQHA 2EGZA 3VIPA 4NI3A 3XISA 1GQNA 3UQNA 1WB0A 3VKKA 2BV9A 4J3WA 4BEQA 3APYA 2D3LA 3W2LA 3E96A 3U4FA 4KFNA 4CUCA 3DG6A 2Y7DA 2ALDA 3GNPA 2Z2BA 1FWWA 1IZKA 3H7VA 2POZA 3KBVA 1E9LA 1MQQA 2ZX5A 4YWSA 2W4XA 3B8SA 3UCCA 3GFZA 4H7CA 4F2TA 2CKSA 3HMJG 5DRIA 3NQ8A 4DXKA 3ZT6A 3GH7A 5ECUA 1TREA 4UZSA 2NQLA 2X2YA 1S46A 1SZGA 3CO4A 3N4FA 2O0TA 4GUJA 4F0HA 3UWYA 2QMKA 1ZBCA 1V02A 3SSZA 3DBNA 1VHCA 4BFAA 1BGAA 1E40A 1JR1A 1HL8A 4W93A 4S39A 1EIBA 3W7QA 2HEJA 5C54A 3KBMA 2PDLA 4QTGA 2BXVA 4NSBA 4L7ZA 1DWHM 5BRPA 1PWMA 2OLAA 5FOOA 2EPNA 4NZJA 2BNJA 2GOUA 4M6UA 5LIWX 1V6UA 3WNNA 2GJLA 2QCMA 4R88A 4GO9A 4GA8A 1UD6A 2XFRA 3WLNA 1DV7A 1S3TC 3H2NA 4L64A 1NWRA 1SZRA 3UZYA 3HG5A 4YVPA 2GQ8A 3WJXA 4Q4QA 4MB3A 3TJIA 1OGGA 2E6FA 4ONVA 2P8BA 4DBDA 2Y5JA 3RFAA 2F6XA 2POTA 4O18A 1Y0EA 2DGAA 1DJHA 3TV8A 4YJ5A 4MNJA 3T78A 3BJSA 2NQHA 2DVTA 4GCAA 3G6MA 1L8NA 5A8PA 3KW3A 3W53A 2G3MA 2FHBA 2X1IA 3L4VA 2QF7A 1XLFA 1W2PA 2V5CA 3AMLA 4MNLA 3WLJA 5FF2A 3CB8A 4LVGA 5HQLA 1HG3A 2GVGA 3H2AA 3EX1A 5HPCA 4EWJA 4KCUA 4WQ6A 1NF0A 1W31A 3WFZA 1OEPA 4PE8A 4F2UA 1UP3A 4JKLA 3PWIA 4CD6A 4ML9A 1EBGA 2VMFA 5CBIA 5CC7A 3E5PA 4DUXA 1Q66A 2OQYA 4O57A 1HJSA 1NDYA 2XU2A 3T2QA 3LPFA 3EEZA 4JQAA 3BL3A 1UR1A 1TMLA 2VX6A 1W9PA 3AIWA 4AWUA 2OMAA 3P5YA 2VYOA 5I03A 2UV8G 2YCJA 1M65A 4IM4A 4LAKA 3U0HA 4EXBA 5LXXA 2Q8LA 3GH4A 2PDMA 4UTJA 3TYCA 3U2EA 4NF7A 2Y8VA 2I5QA 1ZSXA 1SO6A 3TYUA 5C7HA 5BMWA 4MWAE 3OHIA 4OV4A 3WCZA 3D47A 1NP0A 2QPUA 1XH1A 2D73A 4GRSA 1EP2A 3NYZA 1ZAIA 4CQDA 4JQ1A 1NFGA 3I7QA 3VIMA 3PTKA 2PF0A 3T07A 3DENA 2YDRA 1AL8A 3B97A 2BS9A 2EPLX 4M82A 3FVDA 3UZ5A 4L6DA 4AZHA 5M3WA 2YKKA 2PP1A 4JTAA 1CEOA 3W22A 1OABA 1WXYA 3L2MA 1FH7A 3GTNA 2G8ZA 1GGOA 2ISWA 3MJMA 3VKAA 4AZ7A 3H22A 3FN9A 3TAOA 4QQUA 3P80A 3O15A 5AC7A 1U5VA 3U2ZA 2X16A 2JFEX 1GCYA 4DWSA 4Y7EA 1V3LA 3E12A 1MVYA 3A12A 2ZZ1A 2VX7A 4XD4A 1VD6A 4YHEA 4UUIA 1FRBA 3DYPA 4I5XA 4UOZA 5MF5A 1R6WA 2FLIA 4XBKA 1M04A 3KVLA 3UESA 1XLAA 2RDXA 2TRSA 3GYCA 3WZ0E 3TC6A 1G69A 1S5TA 2ZE3A 4M81A 4DELA 1G67A 4XV0A 1V3KA 1SJCA 4G6CA 3HG2A 3BSHA 4O17A 4P7RA 3UU0A 3S0CA 1TRIA 3DHFA 1XIDA 2FH8A 1FWTA 1UW9A 5HMDA 4KIEA 2EXOA 3VIKA 1VCVA 1XXXA 1V93A 3F4DA 2H9AB 4HHLA 4JKMA 3SUTA 2ZUSA 3IV3A 4H9VA 2EPOA 1PO9A 4U28A 3VGHA 2H8XA 2H3DA 3U48A 2WC4A 1C8YA 2G97A 1W1B1 3C5QA 3GSMA 1XLDA 2QJIA 2QPXA 4KGJA 2PWDA 1KFKA 4L61A 3EDDA 2OTDA 1X6UA 3RLUA 2D20A 3MP3A 3IGXA 3QKEA 4XBSA 2Y8UA 3TSBA 2BHUA 1CT5A 3SGZA 5LKYA 3GFYA 1HTIA 4CKQA 4PODA 3KWSA 3EDFA 2NUYA 4O15A 4HTBA 5A5WA 1BVZA 4JN7A 4PMJA 4GFIA 3S47A 1GVFA 4R85A 3UCQA 4NASA 2J88A 4RK8A 7XIMA 2CESA 1OC7A 3QQ1A 4JFUA 2CHNA 3O63A 4HNUA 4CNUA 3QEZA 3ZJ7A 3KFTA 3MHGA 2V63A 4DJFD 3NXLA 1JCMP 2R1PA 3EEGA 2E68A 2QCEA 2VZOA 2CEQA 4C1LA 1KM0A 4BQ4A 2ZZ2A 3MANA 4J27A 2DT3A 5KETA 4QAWA 1DOSA 1HL9A 5CSUA 2J8FA 4ASTA 2ZDRA 1XF0A 3VOCA 3OBAA 4H9UA 1CXFA 2DW7A 1YIXA 4HGXA 4BWLC 8XIMA 1JI2A 3WQWA 1SZNA 2NVAA 3ZYZA 3G0SA 5ABTA 1ONEA 3V36A 7REQA 1YXYA 5GNYA 1LROA 3FKKA 1FKWA 3CH9A 1EJVC 3URNA 3GVQA 4QXIA 3N19B 3T40A 1OC6A 4LVAA 1A5OC 2VC7A 3PBMA 4C6EA 4QRNA 4JZ5A 3B8DA 4FF5A 2I1OA 9XIMA 2FTYA 3EAUA 1B1YA 3SECA 2AQVA 3EPNA 4PBFA 1OM0A 1R3TA 1M7JA 1FH9A 1JD9A 4HA3A 3QFWA 5EY5A 1QBAA 4G7EA 3GR4A 2B0MA 2YL6A 3NQBA 1PCWA 3C0LA 4NZ1A 2WYSA 4WR3A 2V5JA 5K9DA 4D8ZA 2QCFA 5HA7A 1XYLA 2BXZA 1RPXA 1VJSA 5LIUX 3E0WA 4XZIA 3O0FA 1JRCA 4X22A 1CLVA 4KWUA 4NAEA 4YNGA 3RAOA 4DYEA 1X6NA 1JF5A 3OPSA 1K4HA 2WPGA 2UY5A 3R58A 4FX6M 3BAXA 5EGRA 3A21A 3GU9A 1K9EA 2WZIA 1AMKA 1XYAA 1JZ8A 3N4EA 1NY1A 1UPPA 3OLGA 3WO8A 3W1AA 2PEVA 4C91A 4J4KA 5T9BG 4JAWA 1OYCA 3WD2A 1LL7A 4OBRA 4DI9A 2ASHA 1JPDX 1E1EA 4LAOA 3UG3A 2A3BA 3RN6A 3T1GA 5HJLA 5IM51 4GACA 5CPLA 2J6XA 2PCQA 2FFIA 2OZ0A 3O6CA 4DYKA 3Q4DA 4LJ3A 4H9TA 5D33A 4JX6A 2FZDA 3SM0A 3OJGA 2HJPA 1ZCCA 3KCJA 4LF1A 1UZDA 2XFYA 4GK8A 4JTFA 2PGWA 4YWIA 4PTXA 1POKA 4WUIA 1P0KA 1Q5MA 4BK9A 5KSWA 5HAOA 1GEQA 1BG4A 5E70A 4FI4A 4J35A 3N04A 4EPBC 2QQ6A 2V2CA 2VP8A 4O1DA 4GC3A 2VCBA 2FPYA 3VOGA 3GIPA 1CI1A 4V2XA 3T42A 2DIKA 2VQUA 5GJMA 1D8WA 1OQFA 2FZ9A 1JGMA 4Y90A 3EWUA 3T55A 4UQBA 4Z2JA 4Q32A 1Q4NX 4N4PA 2CLOA 3ARWA 4FO4A 1W1IE 1PTGA 4EIVA 3L0KA 3O6YX 1JXKA 3W2JA 4E2VA 2FB2A 1FHVA 1H7RA 3WK1A 1PZ2A 1ZBKA 4TX9A 2G96A 3M0YA 3P67A 4DAIA 3TDFA 4ZXLA 1VJZA 2W5FA 2WKJA 1W5QA 1DJYA 4HZMA 3VX1A 2JK2A 2CETA 4JY8A 4QG6A 4I3GA 1Q3NA 4ZOCA 4LY8A 4DQWA 5GJPA 1UZ4A 4Y8FA 4UQEA 3TA6A 2QR6A 2IUZA 1W5NA 1LCOA 1QI4A 4PMUA 1TR1A 4IIHA 1OX6A 1JZ4A 4GI9A 3IWPA 3W28A 1W17A 2SFPA 5C55A 4BI5A 3WLHA 3W37A 3DAQA 4B5XA 1X97A 4HPJA 3W71A 1K9DA 4O52A 1H5VA 1H62A 2EHHA 1DYSA 3P0XA 3QQWA 2WMIA 4E8GA 1LDCA 3I10A 3PBWA 3SFKA 2C71A 3LPPA 5A2CA 1E0WA 3GAKA 4NYUA 3IK4A 2GWGA 4PTDA 1F7BA 1U83A 4IUOA 1XRSA 5A6SA 2YZ5A 4RZ4A 3PTQA 1YDOA 4O8AA 1OCBA 1XLLA 4AD3A 1W37A 1J0YA 3IEBA 1DTUA 5C2XA 5A8GA 3GAYA 2VFHA 2BX7A 5T8GA 3IGUA 2GK1A 1G4PA 3PP7A 1EA9C 3KCLA 1MXDA 3ANVA 2PRMA 4GPNA 1TRDA 4MZ1A 3FXYA 1M5WA 3K46A 3HIJA 3NIYA 3NO3A 3TWBA 4HA4A 3ISIX 4WK9A 4O13A 2INEA 4DIAA 4CQAA 3DERA 4QSFA 2GJXA 3R5EA 3WMCA 1UC4A 2GOKA 1EQCA 1QI0A 4JKKA 2HK1A 3B3DA 3CQ0A 1F9CA 4L9XA 1TWDA 3NFUA 4Y2WA 1B3ZA 4NP7A 3P3BA 1EHNA 2IPWA 1MXSA 2PURA 4QDMA 1J0HA 4IGMA 4U2YA 1CGXA 2NX9A 5AN7A 5E6ZA 1E9IA 4WSKA 4JGDA