1CB2A

Cellobiohydrolase ii, catalytic domain, mutant y169f
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLOBIOHYDROLASE II
publication title The active site of Trichoderma reesei cellobiohydrolase II: the role of tyrosine 169.
pubmed doi rcsb
source organism Hypocrea jecorina
molecule tags Hydrolase (o-glycosyl)
total genus 132
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1995-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1cb2A00
1OC7A 2BOEX 2BVWA 2BODX 4B4HA 1UOZA 1GZ1A 2BOGX 1OC6A 3A9BA 4AU0A 1DYSA 1OCBA 3VOGA 4AX6A 3A64A 3VOJA 1UP3A 1OC5A 4I5UA 1TMLA 3RPTA 4AVOA 1QJWA 4AVNA 3ABXA 1BVWA 1HGYA 1QK2A 4AX7A 1OCNA 1UP0A 1OCJA 3VOFA 1QK0A 4A05A 3VOIA 2BOFX 1HGWA 4B4FA 3RU8X 1CB2A 3VOHA 1UP2A 4I5RA
chains in the Genus database with same CATH superfamily
1MVYA 4M7SA 1TIMA 2I7GA 2ESCA 1EQPA 4CCCA 5DEZA 1JZ2A 4PR4A 3GE7A 4CGTA 3T2QA 4GUFA 4ROQA 2JK2A 2V81A 3LXCA 2FLIA 4ACYA 4Q4RA 1MXDA 1L2UA 3NO5A 4I90A 1RLDA 5K9CA 3EWZA 3HMCA 4AYGA 1VIZA 2V3DA 1H41A 4OVXA 3S1UA 4YXGA 4NZ3A 1RQBA 3W1XA 3XISA 2YXOA 1GOKA 2PLCA 4LBSA 3VIJA 3WSUA 3L67A 1BVNP 3UGRA 2Q3OA 3MCMA 4CUCA 3C2RA 1WDRA 3FJLA 3GNPA 4PCSA 3LK6A 4IMEA 4E38A 1HVQA 3QGVA 3R89A 1A4MA 1OY0A 1XLFA 2OX1A 4EKJA 4GQRA 3BJSA 1ZS2A 1UQYA 1ZSXA 3LXAA 1R3WA 3S1GA 1OZQA 5C71A 3UR5A 4IQLA 1JZ6A 1LTDA 3ARYA 2JQXA 1YDYA 4L6OA 3CMJA 5DO8A 2OZTA 1OEPA 2Y7GA 2Y0FA 1DQXA 3WQEA 3W71A 5F2MA 2Z26A 1GPFA 4P7QA 4GJJA 1G67A 1E72M 4LNCA 3A47A 3P5YA 3S1VA 1P0NA 2BNJA 1MZHA 5I06A 2IUZA 3RHGA 3O9NA 1LJYA 3IIZA 4PUUA 4LF2A 3SUUA 3WZ0E 4XD6A 4GWEA 3CQIA 3RO8A 3STCA 1J18A 1GOMA 4F0KA 1Y5WA 4PMDA 3VNLA 3WDPP 3C86A 3QW4B 3OHIA 2ZZ4A 4R9XA 5LSMA 1KRCC 5LNSA 1HJUA 3LM3A 3QLLA 4EK7A 1AJ0A 2YW3A 4YWSA 2B4GA 4Q6JA 3NPVA 3WUGA 2VFHA 1S5VA 4LB4A 1JGIA 2VUYA 3P5ZA 1V77A 4JTHA 5C5YA 1WP6A 1NOFA 2PWGA 1B57A 4BS0A 1LQ0A 3P0XA 1BXBA 4ALDA 2C16A 1TJ1A 3CZ8A 3APGA 3CIXA 3CU2A 1KLYA 5MKGA 1S2AA 1YNQA 4Y9MA 4GCXA 5LXEA 3RJXA 4WGHA 4DLMA 1AQ0A 2WQPA 2A0NA 5CZ0A 3TN5A 4HP5A 3KTSA 4AISA 3FJNA 3L2IA 3NQFA 3GUGA 5H8UA 1TTQA 1WB0A 4KKXA 1QPRA 3CUXA 5EMKA 3OIXA 4G7FA 4GYFA 1VQTA 3WH7A 2G96A 5FF2A 5BU6A 4KFPA 5BXRA 3ZJ8A 4LS1A 3OQEA 4GIYA 1KGWA 2GGIA 1XLBA 4J2MA 4WDUA 4QG9A 3WELA 2ZFAA 4TUFA 5ECVA 3UWYA 3P84A 1DORA 4LXFA 1JYNA 5HDRA 3VOFA 3LENA 2OTDA 3S8HA 1E9LA 2CHNA 4PMNA 2Y85A 3WQ5A 1SZFA 1SZEA 4A2RA 1EGZA 4PRWA 2A3AA 4MB3A 4DELA 2ZX5A 4A8RA 1Q7MA 3CWHA 1OG6A 3N4EA 1E0VA 4IIBA 1UKOA 1UKQA 3C5QA 1JG9A 1W54A 4ERAA 4LC8A 3K8MA 2CITA 1KTBA 4PA8A 3LCGA 4JFSA 1CZ1A 2X42A 1T7LA 4AQLA 3GTXA 3M0HA 3VE7A 5KZDA 4GGBA 1SO5A 4A3YA 3NGJA 3PZQA 3V0SA 1VYSX 3W22A 3DHFA 4P5UA 3C2EA 2AAAA 2VC6A 1W9VA 3WQFA 1XRFA 1QASA 1CXFA 2WZMA 2B0MA 1V3IA 3OZMA 2O9OA 2QHAA 3PBUA 3QYSA 5FACA 3RLUA 2Y89A 1V93A 1VJIA 4F79A 1KXQA 2F2HA 3L4YA 4GGHA 1QI2A 2V63A 4LNYA 3UJFA 4UTMA 4N6EA 3LHYA 4HPGA 4DQWA 2CKSA 4IIHA 3T05A 3WH6A 3ZT6A 4JIRA 1HP4A 1D3CA 3V16A 2PSNA 4JFTA 3GUWA 2YB4A 4W84A 2CBUA 3BJTA 2Y63A 2E8ZA 5DRCA 4PULA 1HO1A 3DG3A 4KETA 4C6DA 3CZGA 2AL2B 5DCDA 1ADSA 1S2VA 3QPYA 1OB0A 3AISA 1E9IA 3BZGA 2VI0A 2OFJA 1AK5A 2WJFA 1GVIA 2QIWA 1M41A 1P6BA 3H2NA 2VDHA 2R82A 2Z24A 1BG9A 1UPPA 1XF0A 4U4MA 3OGRA 3EXTA 4AEOA 3SW6A 4FX8A 2XH4A 1R2TA 4EXAA 4JL2A 2YL9A 1JUKA 1EJVC 3NEVA 1LQAA 1N82A 2V0TA 1D9EA 4PCNA 3S2LA 5BYWA 3QMRA 1H3GA 1UD4A 4FNPA 3N2TA 3SGGA 3TE9A 2FTYA 1OABA 4AIOA 1OFBA 2ABBA 3NQ2A 4G6CA 4GI9A 5T8GA 3R10A 2WXDM 4CQ9A 5AYXA 3GC5A 1BEUA 2XH0A 1TX2A 2KX9A 4AC7C 1A80A 1J0ZA 3AROA 3LBCA 4PEEA 3GXIA 4XZ9A 1OX4B 3N9RA 4ZSUA 3ELFA 1TWSA 1PPIA 1Q6LA 2Q71A 2XVNA 2HEJA 3TUUA 3G77A 1YPXA 2BLEA 2J7HA 4AUBA 3W7KA 3DG7A 1OT2A 4YCPA 3Q37A 1TWZA 4OV9A 3UJRA 4ZBCA 2WVVA 3E2SA 1DE5A 2PRLA 3KP1A 4DXKA 2GQAA 1Q4WA 2JIEA 5CSYA 2ZXDA 4M51A 2Y70A 1I4NA 3QKEA 1CXIA 3O3RA 4GJ1A 2BY0A 1JYWA 1QAPA 4HNCA 3OTRA 4KW2A 3WKZA 5BMXA 3HGOA 1G9HA 1X97A 1EYEA 1O1HA 2BY1A 3V5OA 5KSWA 3P7YA 1GVYA 1R9YA 1DJNA 2ZUVA 1JCJA 2DUZA 5A2BA 1K8ZA 2DZPA 4G2DA 1GVSA 3NXFA 3L9CA 2O0TA 4QDMA 3UETA 3FKRA 3SUVA 1EJUC 1DWFM 1R2SA 3CLMA 4UFMA 3MMWA 4OECA 4UZUA 7TIMA 3EPOA 1T8XA 2GDUA 5HA7A 4N02A 1XBVA 4D6IA 1XRTA 4WY0F 1R46A 3C2FA 3QEZA 4NJIA 1GZ1A 2W6RA 2X09A 1Y8BA 2PEVA 3O6YX 4KCWA 1V0LA 4ICNA 3GO2A 4F48A 3SJ3A 3TQ0A 2ZUWA 4O52A 3VKBA 1B4EA 3AYTA 1G4SA 3OG3A 3ONBA 1R3QA 2OLHA 1OSEA 1R7AA 4UQBA 2IXUA 1RP8A 1HG3A 1K6AA 1U33A 3LSBA 3HPFA 3R58A 2Q02A 4ZQMA 4QHRA 1VRXA 3NZQA 3BAKA 4O12A 1GQNA 4M1BA 3RMJA 1ZJIA 3AIQA 3EX3A 3WJWA 2OX4A 2HRWA 4DO7A 3MQTA 4XK2A 3VNZA 4OOUA 4JN6A 5FF7A 3F4WA 4W5ZA 1E5NA 2Y1HA 1B90A 2FGZA 3OLGA 1ELSA 3H12A 5BU9A 3APYA 1WQ5A 2R9RA 1SR0A 3FEMA 4FNQA 5C9XA 1GKRA 3AMLA 2WSYA 1RA0A 3LG3A 3OB8A 3C0LA 3I4KA 3L4UA 3U6WA 3MVTA 1BVZA 1KNWA 4WY0A 4QQUA 1X1NA 3EWBX 3K30A 3SIMA 4LB3A 4GA8A 2VX6A 1EBGA 3N6HA 2G3NA 1XJBA 3T2OA 3BG9A 4UFKA 1DWJM 1WXJA 1FA2A 1PKYA 1QOQA 2W63A 3SCUA 1VBGA 3VA8A 4Q4MA 1VFMA 3DFYA 3RM8A 4HN8A 4OHQA 2RJGA 3IIOA 3LPPA 4PB5A 4GQ0A 1X96A 5I7GA 3VD4A 3WF2A 3OGVA 1TJ2A 4Q8QA 2C1GA 5KTLA 1DJXA 2W27A 5REQA 2GJRA 3ORWA 1DQUA 4N0RA 1EF2A 3HG3A 2I1OA 3QW3A 2TPSA 3A64A 3BSHA 2WV8A 3IUIA 4NZJA 3IGUA 2I17A 4EE9A 2XIMA 4ADTA 2PURA 4DJDA 3UESA 1P48A 5CLTA 1TPB1 1ZAJA 3BMWA 1UZDA 3SSZA 5DN1A 3MMDA 5H6HA 3W82A 3UQNA 3BK0A 4BR1A 3VCCA 2JGQA 3UXKA 2CC0A 3SI9A 3MT1A 5I3KA 4KT2A 4NJGA 5EGRA 4AFYA 1H0IA 3E2QA 7ODCA 3VX1A 1J5SA 4LWWA 3LEPA 1EXBA 3CXOA 4WF7A 4J35A 5JMUA 1L0PA 1GQKA 2ZUNA 3GSMA 2X1RA 3BANA 5IBXA 3CZKA 3UERA 4CNOA 3WLHA 3ARVA 3M0JA 3KBWA 2X8RA 4ZZ9A 3G8RA 3EX2A 1SZNA 4GC4A 1V0NA 2NQ9A 4A3QA 4FNTA 4K8EA 2YDQA 3PWGA 1R3RA 2BBFA 3H4GA 3REQB 1LUCB 5B7ZA 1KBLA 2D2OA 1NM9A 3A9IA 3GIYA 1MQPA 3VD7A 4C5ZA 3HG4A 3GH5A 3T42A 3KTCA 3BQ6A 1PX4A 1L6WA 3HTWA 2YFNA 1UZHA 1A47A 4AXKA 4GHRA 1NF7A 1FWGC 3U2CA 5LZLA 3MSRA 4IGSA 5HAOA 1QPQA 2PTDA 4L4LA 3UVAA 3B3DA 3CL8A 1J0HA 2IKJA 1UA7A 3C6CA 4L1GA 4S3CA 2VOMA 5D2YA 2O55A 3SRFA 1IIHA 2FFIA 5AC7A 1ZL1A 4G8TA 4TVDA 4YYCA 1PDZA 1I6NA 2ZDSA 1R9XA 1Y5XA 4CCDA 3BICA 2C3ZA 3AZSA 3PZMA 1BWVA 1JXJA 4L80A 1UBSA 2YZRA 5IDIA 3W7JA 1JDDA 4YNGA 3DFPA 5L6UA 2OGYA 5AZ1A 4PB3A 3TYUA 2QMKA 3WIJA 3LCWA 1LLWA 3WFAA 1XYBA 2QJMA 1TZ9A 3GY1A 4GZIA 1WPCA 6REQB 3D46A 3EB3A 3EDEA 1PJ9A 1SW0A 1XYLA 1XDJA 2PWVA 4ZE5A 3URAA 2FZ9A 3N6JA 4DJEC 1DBTA 5BMWA 3N9SA 2YBVA 2QJNA 3TJIA 3TN3A 3C0JA 3RAOA 5ABFB 3LI0A 1S5MA 4QE4A 4QTGA 2E6YA 2WNWA 5HQMA 1XDMA 3WNKA 1EFZA 1H60A 1GOWA 1RZMA 1L2QA 4AX6A 1Q13A 2DUXA 1AQFA 2WMIB 1OD0A 3K5XA 4AF0A 1DL3A 2PBOA 3TH6A 3BSGA 1HXJA 4EF9A 1J0JA 4NI8A 4KRTA 1K8YA 3CLWA 5CSUA 1GVFA 5GPRA 1Q5MA 4I9TA 2PTZA 5DRIA 3LBOA 1FVPA 3WF4A 1E0XA 4AZCB 1K7XA 4WOZA 4LBRA 4R3UA 3F5LA 3I7SA 4PODA 2NVAA 3G18A 4DAIA 1SO6A 3N2CA 4Y8EA 3TFCA 1F3XA 4UQEA 2XFYA 1UOZA 4IXXA 3BOLA 2BP1A 3SFKA 1A5KC 5J04A 5HOSA 3NQAA 3A12A 2VFDA 3UXDA 3B8IA 3QTGA 3NO3A 2XH7A 4ADSA 4AMCA 1SO3A 4CD7A 2GUBA 1XGEA 1JAKA 2VGIA 4NU7A 3BOFA 1X38A 4KEVA 2PP0A 3CV2A 3BXWA 1W2VA 3C4UA 2Y24A 4K7YA 2W67A 1E43A 3MP4A 1T41A 2YA1A 5C7HA 4HIBA 1EJ7L 2R8WA 3H53A 1N8FA 4RCXA 4C6KA 1GVQA 2YKKA 5AYYA 2WNNA 2OSWA 4DWSC 1CXLA 4W7VA 2HQAA 5IDZA 1XKJA 1VCVA 4GFSA 1KM5A 4KH2A 2DV0A 1W8GA 2HVNA 1Q63A 4MB1A 2YBTA 4B3ZA 1PUDA 1C93A 2C1HA 4HNNA 1T96A 2E6AA 3TZFA 2D1ZA 2PDQA 4KCVA 4MWAB 1VAHA 1JF6A 3AIEA 4JTDA 2PF8A 1UA3A 1YNPA 1NP2A 2YL6A 3PBYA 3E02A 1ZAIA 5I3IA 3BMXA 1Z32X 2IXVA 4KIEA 2RH9A 3B40A 4JHMA 4HU3A 5FEPA 3TQVA 1JCLA 3ECQA 3LU2A 3EOOA 3W2LA 4CNPA 1FWIC 4K39A 2ZIDA 1G7VA 3AHVA 1IIGA 1GKPA 4MKVA 5C55A 4O1CA 1EKOA 3CV1A 1NELA 2J74A 2G3MA 3PF3A 4MJ2A 2PDFA 4AG0A 3GXDA 3W88A 3VIIA 5C0QA 3O6CA 2CBVA 3M6DA 5DX7A 4FZIA 1VEMA 3S46A 3MY9A 4FLSA 4ZQCA 1HO4A 2F2KA 2E6DA 3WLNA 5MF5A 4D6EA 4EPKA 1O6IA 4U33A 3PUOA 1Q66A 1TRIA 3CM4A 3NPUA 1DJGA 1H09A 2F84A 1KM0A 3S5NA 2DZXA 1UH4A 4UR8A 5J5DA 4IF2A 3A3XA 2VZVA 5BRPA 3UJEA 3TSBA 4LQ1A 4KEZA 3C61A 4ZOBA 3FDKA 3E0VA 3WNMA 1PV8A 1TWIA 4WK9A 3CH9A 2VYOA 1MWOA 3QSTA 4AD1A 3RGTA 2VR4A 3TTYA 3SRHA 1BRLA 3CJPA 3EEZA 4RNIA 3AO0A 3EZ4A 3FGCB 1PCWA 1KBKA 3R6IA 1S1RA 4XQ6A 1F3WA 4BI7A 1F6YA 1JF5A 3H2CA 1UH3A 3TC6A 4C6EA 1XBXA 2OVLA 3LS9A 1G4PA 5I6SA 3KM8A 4POCA 1OFOA 1YIXA 2FKPA 3T0TA 3VX0A 3N2XA 3W1NA 1T5AA 3GR8A 1XD1A 3NL5A 2POZA 2IW0A 3ZMRA 4PEKA 5D4YA 2PC8A 3RPDA 1H4PA 2Y5EA 3B0XA 3TLLA 2DZAA 4DHGA 4H7CA 5HWMA 2HPMA 2NQHA 1TPH1 4MKNA 3PSVA 3UZJA 3BPWA 1O68A 3C2VA 2XDFA 4GY1A 4PCTA 4ZOEA 4REQB 2DZVA 3S5OA 2Y62A 3ZYZA 3IRDA 3HOJA 4X61A 1XLKA 1R3YA 5FI8A 1I45A 2XGBA 3ATYA 4NIRA 4GQQA 3WLIA 3PZGA 1POKA 3UBPC 1R3TA 2OEMA 5D33A 5A6MA 2JE8A 4A29A 1RCXB 3LMYA 3L7RA 4DZIA 2YL5A 1NWTA 3WYZA 3RYSA 4JY9A 4R5EA 3F2DA 2GGEA 2PDKA 1VHNA 4NL1A 5CAHA 4TQTA 2OSYA 1E1EA 1KM1A 1B3WA 3CPGA 3FCPA 3SRKA 1H50A 4KERA 2HVOA 3W7OA 4RNJA 1W9DM 4JQ2A 3E6EA 4LRTA 1VFHA 5CKSA 4C6QA 1JL8A 2PDNA 3SEPA 2V5JA 2AQVA 3WD1A 3VGHA 2JFEX 4DBUA 1K9FA 2XSXA 1UC5A 2G3JA 4ROPA 1I2RA 2FPTA 4OBSA 2H9AA 5B7YA 3EWUA 1FCVA 1V08A 3LRLA 3S2JA 1BYDA 4LS2A 3QV6A 3EXSA 4ZODA 6PTDA 3F1QA 3DIPA 3QY8A 1UWSA 1DIOA 1W1A1 4YPJA 3QPZA 2ALDA 1R3VA 3CAKA 1DWHM 3B8SA 3HBLA 2QZRA 4J40A 3IGSA 5D37A 5HMSA 2EXOA 1HT6A 4AH7A 4O18A 4E2VA 3CASA 4HSNA 4GH3A 1UG6A 1E4IA 4GFIA 3K1GA 2P53A 2E9LA 2VDIA 3PNUA 3VMPA 2IQ0A 2ACUA 3W7HA 4QR6A 3FXYA 5DBTA 4QNWA 3MZ2A 1JEZA 3F2BA 1BYBA 1B3VA 2PDLA 3NQEA 1K1DA 4BA0A 1KFKA 2QXWA 3WMSA 3EBVA 2DQWA 3PBGA 1FDZA 4OBRA 1G7UA 1JJKA 1RAKA 3U7VA 2DSZA 1G5AA 4MPKA 3ZO9A 3PZIA 3GXNA 3WX7A 1XPGA 4H9MA 4IIDA 1C29A 1H5YA 1UWRA 1B9BA 4O16A 2W4XA 2E6FA 4H9VA 3QLDA 3HM7A 3IAPA 2EKCA 4AD0A 4TV6A 3FV9A 2PA6A 1PXGA 1QUMA 5I3HA 1YBQB 3UWWA 2WWCA 3OJGA 3GD6A 4UMBA 1BLIA 2B81A 1W9UA 2HZGA 4KWUA 2R1MA 1V6YA 3T08A 1M03A 4CEUC 3AHYA 1Q6DA 3RPTA 2NXHA 2QF8A 4OFCA 2O4MA 2DH2A 1ZJHA 3UR7A 2W92A 1P0KA 1NF0A 3WQPA 2FPVA 3A5FA 4DUOA 3HV9A 3N1AA 4LVBA 1W1PA 3EMCA 3LNMA 4DVOA 5A1AA 3RX2A 4IZGA 4GBDA 1OYAA 3VO0A 4PMUA 1XLEA 1XC6A 3IUHA 3QJAA 2WANA 4BK9A 3D5HA 3M0VA 4GUIA 2B31A 4UNIA 4Z17A 3DFOA 3GAYA 5LNRA 3IS4A 3W26A 3KRZA 1OFDA 2WWDA 1ZZMA 1W3IA 3WLPA 5BWAA 3U2OA 4H9XA 5DMLA 3B05A 2D69A 2DZSA 3MWCA 2QT3A 3LGGA 3PM6A 1FXPA 3WQDA 4UTKA 2V68A 5G2HA 5JXQA 3RU8X 2JBMA 2PDIA 1EA0A 1PIGA 3MMTA 4L9XA 3GVRA 1OK6A 3M0KA 4CQBA 2WAGA 1FP9A 5C9UA 2VD8A 3AOFA 3IPWA 4HSHA 4GKLA 3TJXA 4RL3A 2KZHA 1EJSC 1OG0A 1AW1A 3CK5A 3MP3A 5AVHA 5D8ZA 5RUBA 3MS8A 1YPFA 2VDGA 2IPJA 2EHHA 4U28A 3W2UA 3F5KA 4AWSA 5HXMA 3M5ZA 1P4CA 4FHAA 3LY0A 5CLWA 2GPTA 4DF2A 1CX9A 5PTDA 3W84A 2H90A 4A3UA 3BW3A 4M3PA 5MKGB 1YW1A 2WSRA 4Y2WA 3EA1A 1QNOA 3U2EA 3Q4DA 3W7GA 5CPNA 1V03A 3PBVA 1WCGA 1Q8AA 1VFUA 1TX0A 3NXLA 2VURA 1UBPC 1P7TA 3N29A 4Z42C 3SN4A 3W2MA 5EFDA 5C7VA 5I00A 5HJLA 2Z1WA 1XQKA 5I09A 4O0KA 5EMUA 5E9XA 2VGFA 1Z89A 3WQGA 2X05A 1HKVA 3KDNA 4DJFC 3B9EA 3HZ3A 4OZOA 4O1AA 4CU7A 4HPJA 1SW3A 2E7FA 4Q33A 4NAEA 3HMJG 1E9ZB 4DJEA 3WBAA 3PC0A 3MTWA 4A8IA 1A5SA 3EPNA 1ME7A 3AU2A 5DMNA 5C6MA 3TAOA 1IT7A 2PDCA 2ISVA 4U31A 1X8CA 2IPFA 1OHLA 3LERA 4AW7A 4ASTA 1FWWA 3EDKA 2J13A 4L7ZA 1QO2A 2GUUA 3LTYA 5HNRA 2W91A 1ZBKA 2O92A 4Q8VA 1IGSA 2MANA 5J8LA 3PWAA 1DJHA 2ZX9A 5AFDA 4IPPA 1UWAA 2XU2A 3EX6A 3QFEA 4JHZA 3VOJA 4JBRA 4X2PA 2WVTA 4JTFA 5EL1A 5AVNA 2G97A 3F03K 1WXZA 4K8GA 4JTCA 4DF1A 4LUSA 3A24A 2OEKA 4GZEA 4H8HA 4LBUA 1QPOA 3UG5A 2VNCA 3A3WA 3LDVA 4OWGA 3KOXA 1DVJA 1SZRA 1XWYA 3VC5A 2PGFA 2C7FA 2BHUA 3TYDA 3VABA 4C7DA 3HURA 3YPIA 3B8TA 3BAYA 1C90A 5C2CA 3VD5A 1SW7A 2D2GA 2INZA 3PZTA 3EAUA 1U1UA 2GYIA 1GOIA 3KDOA 1RQHA 4UNLA 1QOXA 1GHSA 2OGJA 4A22A 3W1TA 4G1KA 3L68A 4JY8A 3MJMA 4FX7A 4S3FA 3K46A 2WM0A 4PMVA 3IAQA 3M46A 1A49A 3OBKA 3CAWA 3ZFHA 9CGTA 3SRDA 5EKYA 3RR4A 3MO4A 2WSPA 3WH8A 4DWSA 5DELA 4PCFA 2E28A 4L61A 2WVSA 1LOSA 4R33A 2Y8VA 3CUZA 2YFOA 4ERIA 2DY3A 3GFXA 1XX1A 1ZCCA 3NDOA 4E4UA 2XH2A 1OINA 1QK2A 3EYPA 3KL0A 4UQAA 4I7UA 4IG2A 5DT7A 1D3HA 2XFWA 3P93A 3M0IA 2HV5A 1UJQA 4UCGA 1KFEA 2CLMA 3WMLA 1LOQA 2QAFA 1DXIA 5ABTA 2DW7A 2XFRA 4K6AA 1Q2SA 1BPLB 2HWGA 2J27A 2PPGA 4NJKA 2J8TA 3VDHA 1PKMA 2RUSA 1EH9A 3NSNA 3UWQA 3A4AA 2BG5A 3TAKA 1EUAA 3H4XA 1SU5A 5CH9A 5E9AA 3UCQA 1S5WA 4XKMA 2OG9A 4IMDA 4PRRA 3PP7A 1H11A 1XM3A 1GVRA 2QCEA 3VFCA 5G5IA 8CGTA 4DUXA 1KCZA 3GXFA 3P81A 3KOZA 3RN6A 3BDKA 3TWAA 2V8ZA 1OFPA 4D71A 2PODA 1IXPA 5E5CA 4CLMA 3UR2A 1MUWA 1QI5A 1UCWA 5CC3A 4IGMA 1RK5A 1L6FA 4IFKA 1ZFJA 3UXLA 3WK2A 5KZMA 3LMZA 1QU4A 1UMYA 4GD0A 3HQNA 3MU7A 1KM2A 3TNOA 4J27A 1UP3A 3M64A 2ZVRA 5ABHA 2FYMA 3QVQA 3S6TA 3FYYA 1HL8A 2GVJA 4QJ5B 2BHZA 2XG9A 3AXHA 1CIUA 3TP4A 3VIPA 3U8GA 1UHVA 3QQWA 1FWSA 3UY7A 3W29A 2ZX7A 3VILA 5IFTA 3L23A 5D02A 3B4YA 3IK2A 2HE8A 3L4WA 1H5VA 1H1YA 3NQMA 3WN6A 2QEZA 1O5XA 3UFYA 1A3WA 2BY2A 1OWQA 4NZFA 1TV7A 5U7SA 1UC4A 4NKCA 2ZDRA 4XG1A 1CT5A 3WF1A 4HMDA 3WL1A 2ZZ2A 5T26A 4FOKA 2PGRA 3CQJA 1G0CA 3SCQA 2E4TA 3ZJ7A 2CXGA 1GW9A 1XV8A 2XPKA 1EF3A 3N14A 1QO5A 1JD9A 4YTTA 4H6QA 4S3AA 2OB3A 1ODZA 1BQGA 4URIA 3M41A 1BVWA 3CUJA 1E6QM 3FKKA 2GWNA 3QMSA 3NOEA 4IQEA 3AS1A 3G6LA 2BVYA 1YE4A 1ZB5A 3W7RA 1B1YA 3VTRA 3PJWA 3WO8A 1TCDA 1EYWA 4WXZA 5JUVA 2Z1XA 3GDRA 4E8GA 5DBUA 1OVDA 5FAGA 3UCCA 4LFYA 3VZZA 2EG6A 1S1PA 1ZCOA 1CW2A 3ABZA 3W25A 4FNUA 4UFJA 3S2CA 3UWVA 1HL2A 1MQRA 3KCOA 2V2CA 4LS0A 3WMCA 1E4NA 3VOCA 1UR8A 3WK3A 3OZYA 5REQB 3G0SA 2VFIA 1SFTA 4DLFA 1X6NA 4H9TA 1F4HA 1QI0A 6ALDA 1XLAA 2YYUA 2QDGA 4HHPA 1M5WA 4JTKA 1RLCL 2OKTA 4EPDC 2QS8A 4JTJA 1C3FA 5A6BA 5CXPA 1X7IA 3LHUA 3L5MA 4WDTA 4M24A 4ZTYA 1TRDA 2H3BA 4I5UA 3MZNA 2VJXA 5HMEA 5A8GA 3T9PA 1FKWA 2NUYA 3TYAA 1IT8A 1QVBA 3KBMA 2GJPA 1U5VA 1HVXA 4KCUA 4PTXA 4H8VA 1O66A 1XSIA 3BLLA 3ZOAA 3LA4A 2DUAA 3LCFA 3NM3A 4HNVA 1K02A 3FK4A 1H62A 1LWHA 2IKGA 1U5HA 3KUMA 3LI1A 3UZ5A 1MFUA 4O11A 2CETA 4E6MA 3BTNA 5CPOA 3GS6A 4LOCA 2D0FA 2FQIA 5BXSA 1C91A 1OYBA 3B06A 4DY1A 4OJYA 1RPXA 4DM2A 4IIGA 2DEPA 3TOYA 1OC7A 4I6KA 2ISDA 5J5RA 2Y7EA 1A5OC 3QOKA 5AHLA 3RF9A 4O53A 2J7CA 4WSHA 2QUUA 1CXEA 4HPXA 4H8NA 1PX3A 4KF1A 3UEQA 2Y2WA 1W1TA 4ENLA 1JRBA 5CBJA 1V7YA 3DERA 4DM1A 3AICA 1CXKA 3SJNA 2Q8ZA 1GOXA 5GNYA 1J96A 2YA2A 3KVLA 2YYTA 3R11A 3KAOA 1NDYA 3BLOA 1DXFA 2NXGA 1GW1A 1I0DA 1W9BM 4QQ3A 2CBJA 3TJLA 1XIMA 2GVGA 4JTEA 3WEOA 4H00A 2CZDA 2F61A 4PN2A 1BQCA 1A5CA 3EX4A 5C70A 1ZNNA 4BZYA 2HJPA 3V5FA 2HXTA 2ZICA 4PRTA 1ADDA 5FESA 1JDAA 5D2TA 1HUVA 1GG0A 3HB9A 3EGJA 3M7SA 4MIMA 1E1CA 3W7QA 3ABRA 3AMDA 3MI2A 4P2VA 4MMWA 3IJ6A 1FHDA 3ID7A 4M56A 4LT9A 4QJ4B 1XG3A 2HE5A 1IEVA 2HVMA 1TV3A 1FDJA 2WCGA 5FJRA 4EPBC 3ENLA 2HROA 4U3AA 4KEMA 1F4AA 3MPGA 3MV01 3W00A 1AUSL 2Y4SA 1Y65A 4US5D 2Q09A 4AHOA 4AF0B 5B80A 2GL5A 4B3KA 2Z1SA 3VINA 2TODA 3GHRA 3KRSA 3W28A 1NFPA 3G24A 3LD5A 5EA9A 1K6WA 3MUXA 1CI1A 4HJWA 3UA3A 1LT7A 1XCFA 1ISZA 1DJIA 4P7RA 2P3EA 2F6XA 1I1WA 1ECEA 2Q8XA 2J78A 3WLJA 1XCWA 2VR5A 2GJXA 1ME8A 1A5NC 4K36A 1PL9A 3S83A 3IACA 1CXHA 3WQCA 2NXIA 1YXDA 3OPSA 4TMBA 2OR2A 2WHLA 1J6OA 1WKEA 1TO3A 5LA0A 2V5CA 3A21A 4IFOA 5C9RA 4S2BA 3L0KA 3RR1A 4E8DA 1W6TA 4JQ3A 2JF6A 5F2LA 5LIXX 1FWRA 1ZUAX 3TA6A 3T1GA 1CWYA 1TE1A 5E0CA 4XIAA 3URNA 3DX5A 2OWXA 2IMRA 2OZ0A 4UXDA 4AX7A 1KM3A 1V6XA 3RDKA 1GZGA 3NUKA 3IVSA 2O4QA 1M68A 1B3OA 4MVAA 4AAJA 5AC8A 4XUGA 2HS6A 4LY4A 4E4PA 1R86A 3DEQA 2CZEA 1EQCA 3N04A 3PSWA 3RMEA 1PYMA 2NWRA 2ZXAA 2CWNA 2GDQA 2J62A 3VKKA 1HGYA 3IWPA 3SQMA 4JKKA 3HJZA 2VZOA 1VD6A 3V18A 4UTWC 1W17A 3W7CA 2RDXA 2VX5A 2OKOA 4DBDA 2WLYA 1KWKA 3MWAA 4LX4A 5CPSA 4C1KA 4OKDA 3LZ3A 1BKSA 4QX4A 4RE3A 3VVGA 3I7RA 3MUIA 4IPNB 3TNBA 3ARRA 3HQ1A 5G4WA 2YDSA 1MYRA 6A3HA 3FYOA 2F38A 1VYPX 1QCWA 5GNZA 2I9UA 3BOXA 1KR0A 4GYKA 5A6TC 1THFD 2ZKMX 3VGBA 1PS9A 4AHQA 1EDQA 1WOAA 3LB0A 3LXBA 4PUMA 3O16A 4Q8TA 3T2PA 3RRXA 4RZBA 4AYSA 5JU6A 1DJZA 4PGLA 2B7NA 1P0DA 3ANYA 3ES7A 1K8CA 2XN0A 3NQ6A 1QI3A 5LHEA 2Z00A 5U4NA 3NVTA 5XIMA 4JD4A 4G9PA 1DJWA 7REQA 3MHUA 3RLVA 5HUPA 4X3ZA 1DJQA 2WJDA 1TYGA 4ZB2A 4PUEA 4O10A 1ZLPA 3PPHA 1IHIA 1MEWA 3LGDA 3TIMA 4S3EA 1BD0A 5LHFA 1Q2RA 4DBWA 1ZJBA 3MBFA 4PMQA 1E4LA 4N9EA 4LUTB 2VGGA 1KFJA 4XZHA 2DSKA 2YLAA 3KVKA 1C8QA 4MYAA 1UKPA 2C19A 2CHOA 3FAWA 4JTGA 4MZYA 2Z6IA 3ITLA 4D6GA 3OLIA 2F6KA 2WC7A 3UZWA 2O56A 1IZCA 3PAOA 2ZZ3A 2UBPC 2VOTA 3KRBA 4QRNA 4MNLA 4B15A 3Q65A 4OTKA 4ATWA 1LL7A 3H70A 1ONXA 3Q45A 2OQYA 3C52A 5IM51 2W61A 3AXKA 2EKGA 1SFLA 4PYSA 1QNQA 4GABA 2REQA 1C8YA 4C6FA 3JUGA 3AHXA 2PWFA 1ZGDA 2UY2A 4DRSA 3WQWA 2C79A 1BXNA 1BRLB 2YA0A 4XAGA 4RXGA 1FCQA 2VKZG 3KVJA 4XVEA 5DF0A 4XKYA 3BVJA 3R13A 1UD8A 3GHSA 3Q67A 3ZM8A 3DI1A 3WF3A 1L9WA 2BMBA 3NPWA 1R87A 6XIMA 1W3NA 3RJYA 3L65A 1ITXA 3H2EA 1HP5A 3PJUA 1GNXA 3ZJKA 1R85A 2ZZ6A 5AZ0A 1SJAA 1ISYA 1F5ZA 4S2CA 2OCZA 3NQ7A 4QEHA 4Z2JA 3T6CA 4RDWA 1KRAC 5D38A 1PZ1A 4RPQA 1D2KA 1MRQA 4E0CA 1H63A 4JYDA 5HBFA 4BQ2A 3GH7A 3RCMA 4CNNA 1WDPA 2VCAA 1SJDA 1VJZA 3CMGA 4MB4A 3MP5A 1UH2A 3A5VA 4WCJA 3P62A 4EIVA 1DIKA 3DAQA 6TAAA 1RUSA 3R12A 1S2UA 3EPMA 4MWAD 1BGGA 3AXMA 3CQKA 1W8SA 4B4FA 5FAJA 3DYMA 2CW6A 4PUDA 1R6WA 3GK0A 1JCYA 4R7JA 2H8ZA 1HKKA 1AD4A 4GIEA 3SDOA 3UCDA 3ALGA 1CCWB 4GC3A 3VUSA 2PBGA 4A4AA 3GWQA 4CN6A 3L12A 2J47A 4G56A 4C6JA 1XYZA 4MLRA 4UOJA 4DPPA 1W3HA 1QJWA 3I3BA 4GISA 3SQSA 2J77A 2QUNA 4CEXC 2YBUA 1JCXA 4EOUA 3R79A 1CPUA 4IOTA 4AZGA 1YDOA 2D0GA 1O12A 4IICA 5BOOA 1FCUA 4LYKA 4ZTXA 1PTAA 3AIUA 1XYMA 1GEHA 3W1AA 1GOQA 1DIDA 3DHUA 1UUOA 2JKAA 3KBVA 4FS9A 1GGOA 2VFEA 2DQXA 1XIDA 3HU7A 3P82A 1HJXA 1EDTA 3CUIA 4C6NA 3VKAA 4DAFA 5E70A 1KCKA 1KM4A 1JULA 1IXOA 1C7TA 4M29A 4QJ3B 4W7WA 4JTIA 4B9ZA 4NI3A 2XTKA 5JIPA 4QE1A 1GWJA 1F9CA 2VEIA 3SCTA 2E09A 3H26A 4GY0A 3NQBA 3BLDA 3ZT5A 4YIWA 1VH7A 2H9AB 3UJ2A 1L6GA 4GVHA 1HFBA 5I5RA 4IIFA 4TTUA 5HNTA 1H7OA 3BGGA 5TF0A 1B3YA 3PG9A 4W87A 3DFSA 3M0LA 3P6LA 1IEWA 4ILSA 4HBKA 4R85A 1JAEA 2X7VA 2WMJA 3BMVA 5FKYA 2OYKA 4FXRA 3QHOA 3TKFA 2ZUUA 5E93A 4KBXA 3LLDA 4MY8A 3GW0A 4H6RA 3AJ7A 4HA1A 1F8IA 1S46A 3IJIA 2WZTA 1TG7A 4W7UA 5KZEA 3VGFA 1F61A 2PD9A 2VHLA 3RCYA 2XIBA 3GFYA 1MO0A 4PTDA 4AVOA 1XFCA 5F1VA 3BARA 2P8BA 3G1VA 5AECA 3COTA 1A5AA 2FH8A 4WD0A 2BY3A 4B5SA 4H19A 2JKEA 2HISA 5A8OA 3ZSSA 3TC7A 4EACA 3P14A 5DQPA 2DT1A 1EWEA 1G4TA 3WFLA 4Z1DA 1J2WA 1YTDA 2J4GA 4YYFA 4B9YA 4XO6A 2ZZ1A 4DB7A 4UC5A 3ANVA 1GKQA 2BV9A 4FR1A 4F0HA 1LQ2A 1P5BA 4O28A 3TR2A 1IR1A 1F7BA 2J6XA 4MAVA 3GZAA 4US6A 3DECA 2Y7FA 1KGXA 1O94A 3CTTA 2I14A 3KLKA 2Z28A 3DC8A 3GG1A 4UFHA 1V79A 3TXZA 4M81A 3HG5A 2WJZA 4M6UA 5F2IA 1K77A 3WH5A 4C6OA 2V2DA 4IP5A 4LU0A 3U4FA 3KE0A 1YXCA 2G41A 2PWDA 2QCLA 4FEZA 3WUFA 1BFNA 3EX1A 4QITA 3L4VA 3BH4A 1E3XA 4GO8A 2EG8A 5K2ZA 4JCMA 3WUBA 5CSSA 2Y88A 4D1JA 4DNMA 1IF2A 4IGNA 3FDGA 5M3WA 3NTYA 2CU0A 3LV6A 3QC0A 3CL6A 1OFEA 4U5KA 1YTEA 2ZC8A 1FCBA 2QUTA 5FEZA 3CPRA 2HSAA 2CESA 3VYLA 4P7NA 3V7PA 5C54A 2ZRVA 5GJMA 4H1ZA 2QMJA 1Z9AA 4B5TA 4RZ4A 4QE5A 1R47A 2Y8UA 1N55A 2OZ3A 4HSOA 3P67A 1UKTA 4QS6A 3E49A 4Q8OA 1CENA 3DN5A 3WBEA 1XD0A 1JZ5A 4PL2A 1BAGA 4ICMA 2GGJA 4J3ZA 4EWJA 3ZVHA 4X63A 4Z2IA 1EEXA 2X40A 1FFRA 1NP0A 5AC4A 4GVGA 3QN3A 4LYQA 4J7RA 1V0KA 1FBAA 3OW1A 2XIJA 4ZB5A 1VYRA 1Z44A 4NILA 1RVKA 4C6CA 3JR2A 4HCDA 3KHJA 4GMEA 3H22A 1MNSA 1VP5A 2OELA 3UP8A 3U5UA 2D24A 2G0WA 3B0UX 3PVFA 1WV2A 3AJXA 1REQB 2WBKA 4GUHA 3HGRA 5G1TA 1ZPTA 2G3FA 5G2IA 3TQPA 2OWCA 4CVWA 3UY8A 3N2MA 4F3HA 3U3HA 1SR9A 2AAMA 1XIHA 1VGAA 3EWYA 3WBYA 3VGDA 1MXSA 4D8ZA 1TPFA 2VZTA 1W3TA 1ML1A 4IUGA 1RY0A 2JEPA 7PTDA 1ONRA 4LEFA 2PU0A 2QULA 4QISA 1V7AA 3S9YA 1VKFA 1DJYA 1VB9A 3I6EA 3WQVA 4S3DA 2YCKX 3N34A 3N9KA 1Y0EA 5T91A 4ORMA 3K4WA 3LZ5A 1JZ8A 1MSSA 3E0WA 4IUOA 4UNKA 3PZVA 2J7EA 2A21A 3IUDA 2NX3A 3S0CA 3ZLGA 1BHGA 4QFUA 3WDRA 3QQ1A 4CNUA 3PPGA 1KA9F 1NSJA 5EB8A 3S2MA 3TC3A 3H7VA 3M1ZA 2CFFA 3G8EA 1WAWA 3ZWTA 1BTMA 4JS3A 1EGMA 3I65A 1US2A 1J2BA 3B9DA 4J2PA 1YRRA 2G4JA 3SCSA 4Y96A 2QPUA 4JNYA 4GE8A 1KXTA 4JQAA 4B5XA 4Z08A 4BI5A 2F9RA 2Z1BA 1RJPA 1RV8A 4H2CA 4L56A 2C13A 4C6BA 2O9PA 1FY6A 3VIKA 2DIJA 1XLIA 1CTNA 4HMNA 5JBEA 3ABXA 1GCYA 2D23A 1YEYA 2QCDB 4M7TA 2J6VA 1UD2A 3WBWA 2DSWA 5I77A 3V75A 1I2PA 2AQWA 4GI8A 3NQGA 3W3OA 3IK4A 1F6PA 5BRBA 4F40A 1HX0A 3SCVA 3W53A 4Z1AA 2VCCA 4M80A 1H51A 1OGBA 1WZKA 1Q6EA 2VXNA 1NOUA 4CNSA 4M8UA 4Q8NA 4GXMA 1X6LA 1XR2A 3QQ0A 3W9ZA 1UP2A 4MNJA 1KC7A 4E2OA 4RNHA 3V1HA 2HTMA 3KCJA 1FH7A 4WR3A 1ZHAA 3TW9A 2R1LA 1R7OA 1MW3A 1TUFA 4U2YA 5D32A 5K7JA 4WX2A 4BKNA 4O17A 1ZP3A 2OU4A 3H55A 4DWSB 2FHBA 4CKQA 1KRMA 1NOWA 3BGJA 3TROA 5I78A 3JU2A 4TX9A 1QWGA 4QM1A 4UTWA 1OX4A 3IIXA 2YCLA 3LN3A 3AHZA 1XP3A 7TAAA 3OP2A 2X1SA 2EGZA 3ARUA 1UWIA 4IG2B 1K4GA 5LA2A 1Z3NA 2CHRA 4EXBA 1MUMA 4ZO7A 4HOXA 2CXEA 3E3HA 4RPPA 4C1LA 4O15A 4BQ4A 3MCOA 4D6FA 4ZA0A 4XZIA 4D6JA 3U7BA 4MWAE 3NJ3A 4K1WA 2FZNA 4L64A 4W85A 1SJBA 1W5PA 2VGBA 1XIBA 1A5MC 1AH0A 3OQ8A 3T0BA 1QNRA 2J7GA 1JCNA 2QAPA 1VJSA 3LHZA 1PHWA 2FDSA 1EJTC 2VR2A 3C0QA 2UWFA 1ITUA 3THAA 3NL6A 2XIQA 1NFGA 1T0OA 1ZBVA 3F4NA 1XYCA 2C1IA 4ERGA 1HNYA 4IMAA 1XQLA 1KTNA 3K2GA 5E6YA 3KWXA 3WF0A 2FIQA 4LVDA 3RUBL 4IFKB 3FA4A 5KZ6A 3TOPA 3BLFA 1TV5A 2ZVIA 4W88A 2VT0A 1RPKA 3CTLA 1ZJAA 2AGTA 4X9YA 4MHBA 1FQ0A 2X41A 4ZQNA 3LLFA 3W7MA 4FA3A 3WH9A 2ZX6A 2CLOA 3C3NA 2XM2A 3SAZA 2GSEA 4ZENA 3PR2A 3RNDA 5HK4A 1JI1A 3ZIZA 4XZMX 3RCNA 1OQFA 4XAYA 3LHVA 3QH2A 4UOQA 4IJBA 4GKTA 4MJZA 1UQZA 6XIAA 5A8NA 1NWSA 1KBJA 1LBLA 2X2GA 3U4AA 1WYIA 4H3DA 4FIQA 3WD0A 1N7KA 4V1XA 4XD5A 4N9CA 2B7PA 4O0QA 2BHYA 2DIEA 3QMTA 4IL0A 5A8MA 3VKCA 4FIRA 1VPXA 3AXXA 3ISIX 3NQCA 3U9IA 1I9CB 2Q6ZA 4Q8WA 1PYFA 1KFLA 4B5WA 1IZKA 4J28A 3F4CA 3OG2A 3QY7A 1SQ7A 1XINA 3L0NA 1CEOA 1X39A 2QCMA 2XUCA 2QVHA 3WD3A 1XLLA 5I79A 3TR9A 3WD4A 2GDVA 1NJJA 4UZSA 3UD6A 4HZ7A 4AD5A 5C8BB 3A13A 1IEQA 3IJ9A 1H7XA 4H4IA 1W1YA 4I8DA 1MW1A 3GVQA 3AXIA 4IHCA 2A85A 3C3UA 4FXSA 4X0VA 3HPZA 1S2TA 2CLFA 3O63A 3AAMA 1XIGA 3EB2A 3W1LA 4LC6A 3JRKA 1MEHA 3P74A 3L66A 5EY5A 1VEPA 2GLKA 5D2XA 2I9EA 3WJSA 1M7OA 4YJ5A 2D3NA 1FWFC 1TMLA 1X98A 3VGEA 4O4WA 2G37A 3HPAA 1AH4A 2X1UA 4R9OA 1EPVA 3TA9A 1FWHC 2V5BA 1EGVA 5ABEA 3TV8A 1JCTA 1ZALA 1PWMA 3K4AA 5DXYA 3QHMA 1RSCA 3I3DA 3MBDA 2WKGA 1BSLA 1VIWA 3TQKA 5E0FA 1P1MA 4A21A 5LKYA 3O7UA 2ZBTA 2R91A 3PNZA 3VKDA 2RKXA 4JX4A 1OZMA 4UBPC 3ARTA 1TUXA 1U5JA 5HQLA 4F2TA 1EOKA 1Q3NA 3OGSA 3R1ZA 2Z25A 3BC9A 4EANA 2WHKA 3QYQA 3K4DA 3ABOA 1AJZA 4CD6A 1XLJA 4GBUA 2V3GA 3F7JA 2PD5A 1XDLA 1XUZA 2FMNA 3V5CA 3N12A 2A3HA 3H2OA 1Z48A 4Z0SA 2ZYFA 3DH7A 3BCDA 3SO7A 4HA3A 1M53A 2J8FA 2KAUC 3RM4A 2FVLA 4GIAA 5T9BG 4HHMA 3JW7A 4X60A 4Q3MA 3HGSA 3URBA 4E3VA 2J75A 1J10A 3PANA 1HKIA 4UQDA 1KTCA 2CZVA 5FJUA 4YVVA 1XRVA 4IISA 1GJWA 1VBJA 3N15A 3DC0A 3LRKA 5I07A 4HB7A 3LCLA 1TZ7A 3WLQA 4HGXA 2ASHA 1KCLA 3RK8A 4O4VA 2XN1A 1F07A 2E3ZA 2O7SA 4GXWA 1F3EA 2P10A 4CD8A 3DBPA 3TEVA 6REQA 4DO5A 1XHGA 4CNTA 2PGEA 1CLVA 2I16A 1KFBA 4H9YA 1CYGA 3KW3A 1OCBA 4Q4KA 5AB3A 4WHBA 4ML4A 1QBAA 1DHKA 1I0BA 5HQEA 2QDDA 4R7WA 2VQUA 2EPMX 1B9ZA 5A69A 4YS1A 3RO6A 3AMCA 3SUWA 3VNDA 4X0NA 2WMIA 1JQXA 5FJIA 3H2MA 2WC4A 3RRAA 3G3MA 3VPLA 4IX0A 4PSPA 1AZ2A 3FYPA 1ZQ5A 5XINA 1QFEA 3GXTA 2ATSA 3QFWA 1HJQA 1NH6A 4L4PA 1W2PA 5CC5A 3DFNA 4PUNA 2PI6A 4JX6A 4K37A 5CBIA 3DFTA 4F0LA 1V3JA 4AZCA 1CGXA 4I9AA 2ZTKA 3SIZA 3NYDA 1UD6A 3D3AA 4PBGA 4QS5A 4P7LA 1TWDA 1LL4A 4S1FA 4HK5A 1O5QA 2FHFA 4KWWA 3DKLA 1OF8A 3QTPA 1NDVA 4GLEA 4DJDD 1NDWA 3E0LA 1YX1A 1M6JA 3ME3A 3N6QA 1X1OA 2XVKA 2QGYA 1ISWA 4I3GA 3ALFA 4DYKA 5GVJA 3W70A 4OOZA 4ORIA 2NT1A 2R1NA 3LBMA 3M6YA 4IXHA 1DPMA 5D9MA 4Z2HA 2YJQA 1S5NA 1U22A 5DCBA 3EWDA 1EL3A 3UWEA 4WQ6A 4H83A 7XIMA 1ITQA 4J9JA 5I0DA 4O50A 3ZLFA 1CNVA 1QK0A 1EIXA 3DBNA 4Q4QA 4X9SA 3TFXA 3MUZ1 4WKHA 3B03A 4AWEA 1X7FA 3U57A 4CCZA 2F7FA 3LCXA 2W9MA 2PP1A 4N6FA 1OD8A 2V3FA 4MADA 3QR1A 3II1A 3C8FA 3SBFA 1O1ZA 1UR1A 3L5AA 3AALA 3OZPA 2WMFA 3CWNA 1TV2A 2PWHA 1OX5A 1RD6A 4RW3A 5CGMA 1EP2A 1OFAA 2QDEA 4WIWA 3ITCA 1ESWA 1IEIA 1Q8JA 4KS0A 1JFXA 5BW6A 2CPUA 2W5FA 4MWAA 2EEXA 3PY2A 4JKMA 3W6MA 4QEEA 3GIPA 4PTMA 3BAJA 4ADUA 3N19B 1QW8A 1J93A 3VIOA 4F0MA 2ZOXA 2CZFA 4S3KA 5I23A 2BS9A 4M1RA 3U48A 3CYJA 1VEOA 3B0PA 1MDRA 3HIJA 3NDYA 4Y6GA 2QYGA 3EOUA 4Q22A 2OOFA 3QRHA 2J9YA 1BF2A 3D6NA 4XWUA 2QJJA 2HCVA 1R8LA 2F8QA 4NQ1A 5CSRA 3IIPA 3E74A 3SB0A 4GG9A 1Q85A 3GM8A 1H0GA 1OBAA 1A5LC 2DVTA 1S39A 1ZTVA 1D8WA 1EX1A 1RJQA 2IKHA 4AY1A 4TXEA 4ZL1A 1QXLA 4K68A 1DQWA 2D22A 2ZE0A 1B30A 1P6WA 3O15A 1QT1A 3UW6A 1H1ZA 2CERA 1ISXA 4QNEA 4ZFCA 3CIWA 3K13A 4PTWA 5HINA 1DWIM 2ZZ5A 3TZNA 7REQB 3UNTA 3UZZA 5M17A 3QOMA 3ZLHA 2NX9A 3OVGA 4J3XA 3S5ZA 1W5QA 1JZ3A 3H21A 3CC1A 4NVTA 4AMAA 5KITA 5M03A 1GHRA 3ZR4A 1X8FA 3CH0A 1EC9A 4XUYA 4BFAA 2VRJA 4XBKA 4M19A 3S4TA 4GUGA 2OEJA 4CCEA 4LALA 2PDJA 5DMYA 1OC5A 4OGZA 4L6HA 3CUHA 2P0OA 4J3VA 8RUCA 3UPBA 2ZRWA 4BQ3A 3L0GA 4Q7BA 3V3WA 2Z2AA 2AGKA 1R3SA 3BAIA 3FA3A 3EOSA 1Q45A 4KGLA 1W1VA 4LF1A 4GNJA 2ACQA 4CN1A 2GQ3A 3WK1A 4OU1A 1SFSA 2G8ZA 5GQBA 3SM0A 3UG8A 2FB2A 2Z2BA 2FZMA 5C2XA 2J7DA 1ZAHA 2REQB 4X2RA 4AIEA 4TVUA 1QNPA 4B5VA 4FPSA 1E6XM 1OFRA 3FAXA 4B92A 1E51A 3AFBA 1LDCA 4AVFA 5LXXA 1AA1B 5EBAA 4XBJA 2V38A 1U83A 4XKYB 4F0SA 1OF6A 4XTDA 1XC4A 5AHFA 1NTHA 4FB7A 1YXYA 3NWRA 3PUDA 4S3GA 1W31A 2A3CA 2CZ5A 3L2MA 1FH9A 4R34A 1PEZA 3SY8A 3W7EA 2I57A 2CCRA 3GLCA 1KO0A 2IPGA 2HNEA 1UKSA 3QXBA 2VX4A 4O19A 4N4PA 5ECUA 1W5NA 1BWKA 3E38A 4PE8A 2WPBA 1J5TA 3JVAA 1UWUA 3B8WA 3R8HA 3WENA 1BKHA 4Z1YA 4WSKA 1DXEA 1TREA 4QBXA 5EYWA 1G4EA 4C65A 3KX6A 2OYLA 3IGXA 2ZWZA 1P6CA 4WDXA 2A2IA 2D20A 1TVPA 3KBSA 3DDMA 2IPWA 4GNKB 4UMAA 2MUCA 4PZVA 5FJOA 2TYSA 4PUKA 2BB0A 3RFAA 4ZMGA 1UYQA 3RX4A 4A2SA 1VBUA 4ATLA 3VCNA 5E09A 1JUBA 1V0MA 2PCQA 4AZIA 1X1ZA 3SFWA 3O0KA 1IV8A 2VUNA 3AC0A 3BSMA 3VIGA 4KRUA 1J79A 1LORA 1NVMA 2ZUSA 2X1TA 4ATDA 2YDRA 1E73M 3GG8A 1HQTA 4NAFA 3SY5A 4GYPC 3TMLA 2FH6A 2PC4A 5I3FA 3UPMA 2E25A 3UGVA 4J3UA 2VCBA 2Z1VA 3NA8A 1XI3A 2WW5A 3EDFA 3LTSA 7ENLA 1XS2A 1J6PA 4I5XA 1ALDA 4DX3A 4CD5A 1PDYA 5A5WA 1GK8A 3DOPA 2VC9A 5JBFA 2RAGA 2PDWA 3K8KA 3NQVA 1TPDA 3LNPA 3GQYA 2QPSA 3ONCA 4JFVA 1T99A 3H6OA 5CJMA 4OUIA 3USZA 3MMUA 1FRBA 2E77A 2ZRUA 1FX6A 1MQQA 2PS2A 5EBUA 4AZ5A 1HJVA 2D2HA 1V02E 5IOBA 4GZJA 2ZA3A 5A2AA 4J3WA 3UA4A 4RDVA 3TW7A 5XIAA 4RZ6A 2Y6ZA 3KOYA 2UY3A 5D9PA 2NQJA 1XYAA 3QR0A 3W27A 1TCMA 2BZNA 3LQGA 1KCXA 2CLLA 3KS5A 1PCKA 1RBAA 4W5UA 4XZLX 2DT2A 3N13A 1ZRQA 3CNYA 3OLEA 1TA3B 3NCOA 4HZMA 3QGKC 2G50A 3KVMA 4WGXA 4HNLA 4EPEC 3G1HA 1RK6A 4B5UA 3EXRA 4C6LA 1POJA 4FR6A 1YBQA 4OUEA 1IEXA 1UP0A 1SO4A 1VHCA 2E5CA 5JIWA 3BAXA 3FJ6A 2WCSA 4MB5A 3BG3A 3GXPA 1H7RA 3QHNA 3GC4A 4NZCA 1UASA 3OBAA 4GINA 4MTVA 4HPHA 3WMBA 4MY1A 3QSRA 3B0VC 4NP7A 1T40A 4XIMA 3THUA 3W23A 3S1XA 4U10A 3TYBA 3FS2A 5AKQA 1TMQA 3ITXA 2J66A 3V1PA 1IWPA 3M07A 1JDFA 1J9YA 4IFRA 3W7IA 5CZJA 1IGWA 4BI6A 2FZ8A 1HGWA 2HXUA 4NXSA 1VC4A 1ICPA 1G69A 2PDPA 5D9NA 2UY4A 4KWVA 3TN6A 1GTEA 5LIWX 1XL9A 1RVGA 3BLPX 4AB4A 4UQ9A 4U3CA 2V69A 4NNCA 3SQLA 1PZ2A 1LP6A 1QMLA 2A3EA 1JGMA 1ZBCA 1QI4A 3VD9A 4NSBA 1Z7AA 3PPCA 4S39A 1XH0A 1TWWA 3FVMA 5LIYX 5FL0A 1LG1A 2X0YA 1AG1O 5EMLA 1NWUA 3N4FA 4HJFA 3R94A 4HCHA 3BW2A 1NARA 4LVGA 1XSJA 3TW6A 1KV5A 1L6SA 1GT8A 1W9XA 4AD2A 4V33A 1BXCA 4Q8PA 3C8NA 3ITYA 2RDTA 2BOGX 5LGZA 3JZUA 5FJTA 3W24A 4RZ5A 2EO7A 3ZT7A 3RPMA 2VMFA 2YDAA 3SADA 1EIBA 2VD9A 3G1AA 1W91A 1PVNA 2BOFX 4UUIA 1Q7ZA 4L9ZA 4FOJA 4ZQRA 3OYXA 4WLCA 1E6PA 1FKXA 3E0FA 2XGZA 2C91A 4JTSA 8A3HA 1DIEA 4GK8A 2G3IA 3ZVHB 4XZWA 4PMXA 1GVEA 3PB0A 2CEQA 3VKJA 2HBVA 4D6DA 3QY6A 4DWDA 1J0IA 3O6AA 1Y7VA 2NQ5A 3E0IA 1Q6CA 3GR4A 3BO9A 2GK1A 2XFFA 4YN5A 4ZO8A 2YCEA 5HWNA 4S3BA 1TV8A 4H6EA 4NJJA 4YWIA 5LIUX 1E1FA 1Q6QA 3S42A 3CHEA 3GIQA 2YXGA 3EB4A 1GYMA 4HNUA 4JIHA 1E55A 1GVOA 3G3DA 3KOWA 4YTRA 3GHUA 1T6MA 1RHCA 2WO5A 1XLCA 1WO2A 1J4EA 1TB3A 1EBHA 4W89A 4E8CA 4JNMA 4TX6A 1LM1A 3CYVA 3TWBA 3T78A 1XISA 1ODUA 2RDWA 2NVDA 4FXFA 2FMOA 3GH4A 4FMVA 4JNZA 2PDHA 5BROA 1FHUA 4E2BA 3AIBA 3CHVA 4NYYA 4D6CA 1JPKA 1FUYA 4LCSA 3UPWA 4MDPA 5CBBA 1XXXA 4D6HA 2QVNA 2QCGA 2QQ6A 5I02A 4Y7EA 5HJXA 2QF7A 2AKZA 2BTMA 1H49A 4NRSA 4LAKA 4ACZA 3EDJA 1SYTA 4QLJA 3TVAA 2ZCGA 2PLKA 2QIIA 5DFAA 2OT0A 3GNDA 1WZMA 1HKWA 3W2KA 1M1BA 2ZWYA 1WBJA 1N2VA 4P8VA 3SY1A 4H7VA 2NZLA 4MYXA 3T55A 4C6PA 1VLIA 2ZUMA 1JDCA 2ZA2A 2H8XA 5FEWA 5CGQA 2Z0IA 3H8AA 3IEBA 3RM9A 4H04A 4H9UA 1TPVA 3BV4A 4ZOAA 4JL1A 2F6UA 5EU9A 2D3LA 4GI4A 4KEUA 4EAYA 3FFSA 1FHVA 2QCCA 3A4JA 3DGRA 4BF5A 3IANA 2TAAA 1K70A 1C9DA 1YQ2A 5I03A 2VEMA 2YGYA 1TZZA 3PAJA 1OT1A 4O14A 2GVYA 3GYEA 3B97A 3BLKA 3ZZ1A 3HQOA 3EEGA 5H91A 4ZCWA 2PE4A 4IH3A 3UZYA 3GZ3A 2OODA 4W9TA 1H2JA 1B54A 4JTTA 3ANUA 4DI9A 4RR4A 3OVPA 4JYFA 3AUOA 3WJZA 1XSKA 2PF0A 3PN8A 3QZAA 1FP8A 2PTWA 3HA1A 2AMGA 1SPQA 3GVWA 2QV4A 1HN1A 3KCLA 3TX9A 3CQ0A 3DUGA 4KFNA 1ADOA 2EPNA 3PZOA 3A6OA 1ZY9A 3ITVA 1RXOB 4M0XA 2QDHA 1QR7A 3E12A 4K38A 2PTYA 1W3LA 2YXXA 4ECLA 2VWTA 3NPXA 2E1DA 3W2NA 4QG8A 3W83A 4E5TA 4HU8A 3AMGA 1Q65A 4JEQA 4L5ZA 1WKDA 4LPCA 3HO8A 5CZKA 2WYSA 4HOZA 4F4RA 1QNVA 2BX7A 2ZXQA 3O1NA 2FDMA 1R5YA 2EF9A 2CBIA 3ZR6A 1EUNA 1XPYA 4ZVJA 1UWQA 4M6VA 2YCLB 4GACA 4GXPA 3VIFA 3WQ8A 4DYEA 3W1QA 6ENLA 2ZUTA 4B2DD 4BCEA 4Z1CA 4H2HA 5D8WA 1GOOA 3BCFA 3R0DA 1FHLA 3OOQA 1DTUA 3ICJA 3SGZA 4PL1A 4KQNA 2WZHA 1W9PA 3ZVIA 2VQTA 3MI3A 2FTWA 4L1XA 4H41A 3TSMA 2J9XA 1EC7A 1VZWA 3B9AA 4WKAA 2FTPA 5AYIA 1JDEA 5H8PA 3Q2DA 2QCHA 4BF9A 4GIRA 1FWAC 5HANA 2PMQA 2INEA 4BEQA 4DJED 3MKKA 4X22A 2R1PA 1FH8A 1Q4NX 2JEQA 4KWOA 2FGBA 4QIUA 1H61A 2YB1A 4CQCA 2R14A 5I3JA 2FPYA 2TRSA 3C2YA 3H2FA 4XTIA 1V02A 4Y9AA 1VCGA 3I10A 1KFWA 1LRTA 4Z0JA 3S2NA 3B0YA 5HULA 4MNKA 2A3LA 4O54A 1E6SM 5CCZA 4A8LA 5DANA 4WXYA 1S38A 3WQ6A 4PH6A 2P1FA 2PUZA 1LF1A 3G1RA 3UYCA 4ONVA 4O8AA 2YR1A 3VNIA 2C71A 2E5DA 3HFTA 1IYXA 4LUIA 3STPA 1IXNA 3KHDA 4D72A 5FF4A 5HMFA 1CB2A 1KB3A 5I3DA 4ZGYA 1YTKA 3ARSA 4E3TA 1VS1A 1V6VA 4Y9PA 3WNPA 4TMCA 3PFMA 2O9TA 3DHDA 1G1YA 2DH3A 1B5TA 1PX8A 5FA5A 2GFTA 3N11A 4GZ7A 4HN4A 3WLOA 2WSKA 2DGAA 1CGVA 1MFVA 1DHPA 1W1ZA 3WJXA 4HA4A 4W8BA 1YNYA 1MRAA 1JPIA 4V15A 3OU8A 4CQ8A 5LNUA 1CGYA 3PG8A 3E2RA 3TYZA 3WBXA 4QCEA 3C56A 4MM1A 1RY8A 1G94A 3D3FA 3TYCA 1M9HA 3MB9A 2GJLA 5E1QA 1EX5A 3CAQA 5HMDA 1AODA 5DXXA 1AQMA 2BGQA 4GOAA 4Z2GA 4AWTA 1YHTA 3LM7A 4DWSD 4YVXA 2YSWA 2POTA 3SN0A 5HR7A 1MW0A 4Z2LA 3G1SA 2EG7A 3F4VA 2HK0A 1KQYA 4NNAA 2OZ8A 5D05A 1AJ2A 2ISWA 3H24A 4DF0A 1TV4A 5AHNA 5DCEA 1VFLA 4HT3A 4JXCA 2E40A 1I2NA 1LL6A 4E2DA 1CGUA 3LHTA 5E0KA 3KEHA 1EP1A 3G2GA 2BXZA 1M01A 4MZ1A 3RLGA 3MSYA 4AZ6A 5I24A 4DNHA 3LV5A 4HMCA 1TPUA 1UZ1A 3H4WA 3VZYA 3W7DA 4MGGA 2JALA 2C8NA 2VFFA 4UWMA 4L4MA 2ADAA 2ALRA 2SFPA 5A6SA 3WDQA 3AYVA 4JEJA 2V30A 2CLPA 1R9ZA 2XYLA 3W7LA 1KKRA 2D2JA 2YIHA 4H6KA 2OMAA 2E9MA 2WVVB 3LOTA 4AHPA 1YKWA 3W85A 2ZA1A 4V27A 4GYPA 4C6IA 1CLXA 3GVGA 6TIMA 1JUEA 4XSLA 2VEGA 5CG0A 1DYSA 2WNQA 4IMGA 3ARPA 5FSEC 4RE0A 4OBTA 4CU6A 3AUJA 3WLRA 3QZEA 4HHHA 3MCNA 2PZNA 3TYEA 3RILA 1OCJA 1SMAA 4N7QA 4PBEA 2P50A 2OQLA 3W75A 2X16A 4NASA 4AIUA 3C2OA 3D47A 1TSIA 3NG3A 1VFFA 2CNCA 4B91A 1QHZA 3AWOA 1D7KA 1IQ8A 1ME9A 2Y7DA 2NW0A 4JTLA 1SM9A 5DLCA 3IRSA 1PBGA 2E67A 2H3DA 4J5NA 3GDBA 5D09A 1CLKA 3MYOA 3S5SA 4MUZA 3CQHA 2WOQA 3NURA 1WZAA 4I7VA 1TJ0A 4XO7A 3VI2A 1VFOA 2VM8A 5K4ZA 3PZNA 1I75A 1LOLA 3AZRA 4RE2A 3AZTA 3CV7A 4D1IA 4RE4A 4QAIA 4L6DA 4V2XA 3GRIA 3P8IA 1VRDA 4PFHA 5FIPA 1OIMA 5JQ9A 1FFQA 1GQIA 4AVNA 4Y9NA 4M6PA 1V3KA 5JVLA 1U1HA 2G5WA 1K9EA 1QHPA 3CHCA 1RALA 3TK7A 1J0KA 1RP9A 4I9MA 1FOBA 3HG2A 4IIEA 5T9CE 4UTTC 5D04C 5CPMA 1HW6A 1KRBC 2VEPA 2Y61A 1B31A 4YLWA 3GDTA 4ZQPA 1RBLA 2L5HA 3MDWA 4HZ6A 3W01A 2GUYA 1E0WA 4XZBA 2J8GA 2VZSA 4WY0B 3BZJA 2FB3A 5HPOA 9XIAA 5KEZA 3GVVA 8XIMA 2VEKA 3CT2A 1LG2A 2QW5A 2INFA 3DU0A 3P2VA 2PDGA 3H7UA 2EPHA 3WUEA 3TCSA 3O07A 3W86A 3ARWA 3UF9A 4DZHA 2Z27A 4H01A 3LHWA 5H8MA 1A3XA 3FJ4A 4QAWA 2YZ5A 3XINA 1JVNA 3H23A 3PUGA 3DFHA 3EMZA 1NEYA 4DZ5A 1Z41A 3RIKA 4I7WA 2UY5A 1UUQA 4LUJA 3O06A 1OCQA 3S6DA 1C9WA 2QV5A 2ON3A 1V8EA 3J7HA 3TLQA 1KLZA 2QJGA 5FF3A 1WKFA 4CQAA 2V9DA 4I6VA 4FX6M 3PBWA 4JZ5A 3MI6A 2WZIA 5DMMA 4C6MA 1XG4A 3PJXA 3P3BA 1TQXA 2QLYA 1UJPA 5H1WA 4WKFA 1CDGA 1AH3A 5A6BD 6CGTA 2WB5A 4A6GA 1BSIA 2OLAA 2GOKA 3POHA 3VU2A 3BG5A 4A3HA 1EEPA 1FWTA 4B5NA 4HPNA 5AOUA 2Z7GA 2VX7A 2XHYA 3WJYA 3TU9A 1LRNA 3KP0A 4C1NA 3TTSA 3W1PA 2DVXA 3N18A 2RJHA 3U0HA 1WKYA 3L21A 1HZYA 3FSTA 3M5XA 3HF3A 3S47A 2P5NA 3WLLA 1H1NA 1F6KA 4UQCA 3VNJA 3CEPA 3QF0A 4W4QA 3VDBA 3HV8A 4PUJA 1EHNA 5A94A 4AXNA 3CUGA 4WJEA 5IXEA 2WPGA 2JF7A 3M7WA 3TXVA 3CB3A 2NT0A 2X30A 2OXNA 2GQ9A 2OPJA 3E5PA 4DBSA 1LT8A 1DV7A 3UWZA 1K4HA 3VNKA 5K3VA 4WDWA 4W8AA 1PKLA 2OO0A 4ZO9A 3FX4A 3OBEA 4HD5A 4JIQA 3ABSA 3M5YA 1B4KA 1UR0A 1ZENA 4O13A 3VIHA 1UR4A 1J01A 2PU1A 3UXIA 1WDWA 3NR0A 5I2UA 3STEA 1UD3A 1LROA 3GR7A 1PAMA 3WD2A 3N25A 3EA3A 5EMJA 1XFBA 2RDUA 5H2ZA 2IQDA 4AU0A 1AQHA 4MFEA 1A50A 3ZS4A 5M1TA 1P43A 1EO7A 1TTIA 4LYPA 5BNKA 4RX0A 1PKNA 2BGNE 3KTXA 5CQ1A 1PO9A 3T07A 3W7PA 3VDCA 1QDSA 5F4SA 4UOZA 3O0FA 3EWWA 3EWXA 4LUTA 3NZPA 4O8RA 2ICSA 3R8RA 4DO6A 1EDGA 1WBHA 3AWNA 1S2WA 1BGAA 5AHEA 2FHCA 2ZC1A 1B0IA 5F4WA 2ZRYA 2VTFA 4YTSA 4F8XA 3BGAA 4LGXA 4JYEA 3VZXA 2J25A 1KR1A 1QPNA 2VFGA 2BODX 3OA5A 4HHLA 4FSAA 5G1YA 2ANUA 4IGHA 2XVPA 3M0MA 2WKJA 4QCFA 3CGTA 4ZOCA 4WOQA 1QBBA 2A6NA 2HPIA 1KXVA 2DT3A 4NUWA 4C5YA 1LLOA 2D0HA 4G7EA 3VM5A 1XH2A 4FALA 3HPXA 1IT0A 3DHPA 4O1DA 5D30A 4L4OA 3QPEA 1HL9A 2Q8LA 3RITA 1GTHA 4ES4A 5ABGA 4D2JA 4Q6XA 4NZ4A 3LPGA 1MI3A 3EA2A 5M2FX 3NOYA 4DUVA 3GDLA 1K7EA 4GO9A 3CV6A 4S3JA 2PDUA 3S9IA 4M6QA 4I5RA 1YPIA 2E8YA 3OVRA 2Y8KA 3A9BA 5AYZA 1O5RA 2V5DA 4FNRA 3WQOA 1TPC1 4JTQA 4RDZA 3BURA 4F9DA 3MHFA 5A6KA 3CBWA 4YTUA 2E68A 3WLSA 5BXPA 3T0DA 1B2YA 4LUYA 1I2OA 1JI2A 1BF6A 4W8LA 2JGYA 2H6RA 3EMQA 2QUMA 1PTDA 2UZ9A 4C91A 3ARQA 2WC3A 1TQJA 4HYVA 4ICCX 4O1EA 3N4AA 2W0UA 4K3ZA 2CLHA 2DZWA 3IJLA 3MUAA 1HJSA 4HOWA 1OC6A 2PWUA 2VVSA 2OOGA 5FJPA 4IWWA 1US3A 1IE7C 2WBGA 4NYUA 4S23A 4YMZA 3EOLA 2EPLX 5CGTA 5G4HC 4FAMA 1TPEA 4TV5A 4R88A 4YTQA 3LUTA 5EMYA 3CZJA 2A4AA 4RUBA 3BWWA 4LAOA 5G1MA 4TR9A 4F2UA 5A3HA 3AIRA 4JICA 1VR6A 1XBZA 4DJFD 5F7UA 1JZ7A 3T0CA 2AMXA 2DVUA 3NZ1A 3KFTA 4HNOA 5D2WA 2NVCA 1BG4A 4HA0A 5TD4A 3KZSA 3GC2A 2PFHA 4NAFB 1R2RA 4RV3A 3CHDA 1W5OA 1KWGA 4AC1X 4MNMA 4IPJA 4MUPA 1LRQA 2EPOA 1JFHA 4KPLA 4UMCA 3N73A 3EKZA 3M43A 2BGSA 3SCRA 1R38A 4QLLA 1E71M 1OJXA 2NLYA 2A6LA 4IJRA 4J1OA 2WQDA 4QROA 1XRSA 3DENA 3FIGA 2BVTA 2J7FA 4AD3A 5GJNA 2WSQA 1E4MM 1F73A 4A05A 4YU1A 1UROA 3E1F1 2WMKA 5EMMA 2NSOA 5BRQA 2BXVA 4MOZA 1QHOA 3CPUA 3KBJA 1EA9C 4GX8A 4FOUA 1LZOA 3W6YA 2VO5A 3CB8A 2FVMA 4N9DA 4L65A 4QGCA 4K8HA 3BW4A 2YL8A 4RW5A 1H7WA 4MAZA 2DSVA 3KWSA 3M44A 2QNEA 4LTSA 2BVWA 3T8QA 1TE6A 5HATA 2PLJA 3O8AA 5HNNA 4PCPA 2V5KA 4HTYA 1Q6FA 3LRMA 2RGMA 1W3KA 1W1IE 4OE7A 3THDA 4KFOA 1LLZA 3QM3A 3OVQA 3T4CA 5LNVA 1BYCA 1NY1A 3DYPA 2DPEA 2DJXA 4KIRA 3MV11 2W66A 1F76A 4RDYA 4Y90A 4ZFMA 3TDFA 2RHGA 3OIHA 2B7OA 4UCFA 4O57A 1GJUA 1OCNA 3MANA 4LV4A 5CC7A 3HN3A 4HTBA 1Y5VA 3VDGA 3LX9A 5CG7A 1RCQA 2V2HA 3APTA 3GU1A 2IKIA 4WRHA 1U1JA 1A5UA 3W73A 4IPIA 5IFPA 3UT0A 3SN1A 4JAWA 1NAL1 3EKGA 1VFTA 5CPTA 5A95A 4O1FA 3R5EA 2BXYA 1A0CA 1KBIA 3G1YA 4PBFA 3LPFA 3S5YA 2OYMA 2OJPA 2PAJA 2PB1A 2A5HA 3TSDA 3IVUA 1CBGA 1TELA 2HBXA 3VIMA 2WK2A 4BWLC 2VVNA 3ZWSA 3U2ZA 3R25A 5AHMA 4JTAA 1RCOB 4LH8A 3PULA 3GNRA 4S38A 2WM1A 3NZRA 4PTVA 1HIZA 1X6UA 1RJRA 4R7OA 5CPQA 1V6UA 1ZU8A 1TVNA 1A5BA 3L4XA 2VRKA 4MJ4A 3GDMA 1MMFA 1XCXA 3G0XA 4PFMA 2CLKA 1QNSA 3B8UA 4LV9A 4UTJA 2ZZ7A 4W93A 5JH2A 3EWCA 1QPKA 3FLUA 4RLIA 4IX2A 1IWBA 1MZRA 4NG3A 3M0XA 5K9XA 4JR5A 2XM1A 4ZR8A 2NQLA 1JYXA 2GGHA 1W56A 3H54A 3DESA 1F74A 3W2JA 4P8XA 1SUXA 4HMEA 1TFVA 3KL3A 5A6JA 2OWWA 2Q3RA 2HMCA 4GVFA 1J11A 1H7NA 4JIPA 3V0TA 2EPKX 4F0RA 3NGFA 3V35A 4LY8A 1TPWA 1IXQA 2PWEA 1MEIA 3FXGA 3ITOA 4HYRA 3F4DA 2ZADA 1HKMA 3WDIA 1LYXA 4IQDA 3E9AA 1W5MA 1A3HA 2X0SA 2QJIA 1REQA 3HFYA 2X2YA 3EDDA 1F05A 3I68A 1EB3A 5L9FA 4A35A 4AZ7A 3WNNA 4IL2A 1FWCC 3VOGA 4HQVA 3GX9A 2BFGA 4N42A 1V6TA 3QR3A 4DIAA 2GK1B 3UR8A 5TNVA 1YLVA 3NAVA 1PE1A 4B2DA 1C92A 1XIJA 4UTTA 4RKAA 2DU2A 2E0PA 1NFBA 3PWIA 2EJAA 3CIVA 1TVLA 2DFAA 3RXZA 3NFUA 3T40A 5F2GA 4JKLA 5CZSA 3P61A 4FLRA 4RNFA 3TTOA 3IV3A 2JKPA 4DUWA 2G95A 2B7QA 2OT1A 3CT7A 5M5DA 3TJ4A 1E5JA 1VLWA 3MW7A 3MYPA 1M3UA 1OIFA 2FFCA 4UTFA 1XIEA 4JN7A 4DYJA 4HNTA 3SUTA 5C2GA 1M7PA 2HK1A 4JQ1A 4GUJA 5CZTA 4UTUA 3AMKA 1W1B1 1C7SA 5LIKX 4ACZB 2EQDA 4DPQA 3GBEA 4V28A 4O0ZA 4NX0A 1S3HA 1KKOA 4C60A 5I3GA 1CECA 3W0KA 4RV8A 1M65A 2FGLA 4N4QA 1HKJA 3M47A 3JS3A 1L8PA 1TMHA 2QKFA 5IHSA 5E6ZA 3VOHA 4M82A 3GU9A 2NSXA 8XIAA 4PMRA 4WUIA 5HUOA 3AQUA 1EXPA 1AFSA 4DXXA 1I60A 1K7FA 4JFWA 4QJ1A 2QCDA 4ZEPA 2CLIA 4J4KA 1U30A 3L5LA 3S6OA 2D73A 4DZAA 2BDQA 4HCLA 1EC8A 4ZE4A 1ECQA 1EPXA 4NT0A 3OA3A 3LLXA 4CVUA 2NUXA 3NEHA 4Q4PA 4MKSA 1AL7A 3WL0A 3B4UA 3L4ZA 1PTGA 2NWSA 1JR1A 2W62A 5FL1A 3OZOA 1DWGM 2V5LA 4XAZA 3USBA 2ONEA 1BYAA 1A53A 3R43A 1EZ2A 1QWKA 4XZNX 3T0AA 3UZXA 3LSCA 3UU0A 2PCEA 4ZB0A 1GEQA 1E6RA 1K8XA 2ZX8A 5D9OA 1GZJA 1J8VA 3PFRA 2E5BA 4NNBA 3GAKA 3AIVA 1VCFA 1OADA 1YE6A 3R4IA 1XKYA 2C0HA 1JIBA 4MWAC 2EJ1A 1TJRA 1SGJA 5MHBA 1E0UA 1D8CA 3RLHA 2V3EA 3T81A 4K1GA 3PS7A 1E70M 3N2BA 1U2YA 2O7QA 3KS6A 2DSUA 1WUFA 4CU8A 4KGJA 3LYEA 4UTIA 2ISSA 2NLIA 1P7TB 4AZHA 3CS2A 1RD5A 4PSRA 3PPFA 4MPQA 3AU6A 3M0ZA 2JIWA 4LCQA 5CPLA 3VMOA 2XWEA 3QKZA 1IR2A 2XSAA 3EKLA 4IMFA 3FEQA 4XB3A 2I5GA 2A1YA 4IT1A 4U5IA 4CQDA 5A8PA 1WOBA 1UW9A 2Z7KA 4EVZA 1W32A 4MF4A 1DOSA 1UR3M 4NAEB 4Q7IA 3KBNA 2P3ZA 3FNDA 1R30A 1BWLA 4TOQA 1L6YA 5CJ5A 3NVDA 1YYAA 2ZE3A 3PHAA 2BVDA 2NQZA 3G22A 1E40A 3TTQA 3M0YA 2GJNA 4JDYA 4H7ZA 3O05A 1XIIA 3D0CA 2ISFA 4JIEA 4NX5A 4QSFA 1VBRA 2GVLA 2PGWA 4JIIX 4DBEA 2XVLA 4F2BA 4GI6A 3ABQA 1VBHA 4XV0A 1AVAA 3URQA 2ZQ0A 3CAVA 3NL2A 3DYOA 1K9DA 4FF5A 3WEZA 3AS2A 4JTUA 2ODOA 1AZ1A 3PBMA 3ZXWA 4LUSB 3O6DA 4FI4A 1F2JA 1XLDA 3BUVA 4B4HA 5FF0A 1WNOA 3G1XA 1W0MA 1SJCA 4MLJA 2EBNA 2J88A 3M16A 2VWSA 1XW8A 2OSXA 2AL2A 1TTPA 1WAUA 1CGTA 3UNDA 3QV7A 4N2YA 3ZSTA 3VM7A 4JFUA 5JH1A 2RGLA 3QZ6A 3LCHA 2BOEX 4LVFA 5BCAA 3MKCA 3EOEA 2XWDA 3OEXA 2PZ0A 1S5TA 1OGSA 4J3TA 4KCTA 4FXJA 4HU0A 4IP7A 3W72A 2GVEA 4IPLA 2DZTA 3ITTA 3N3TA 1Z8AA 3R2GA 2OO6A 3WLMA 1NIUA 2J7BA 4GX9A 3B8DA 1WE5A 4HVXA 3GHTA 3DZ1A 1P0EA 5A6AA 4XD4A 3A3HA 4XD3A 3CEUA 4NZ5A 1OM0A 3P60A 4JHOA 2Z4GA 4EF8A 1EO5A 1I2QA 4OV4A 4XVDA 2AKMA 2YW4A 1K03A 5DT5A 3SCNA 3DCPA 3VNYA 2CYGA 1XH1A 4BJHA 2E9BA 2QJHA 4PMJA 1KD0A 3CHFA 4MFDA 3M9YA 3CUFA 1WUEA 4FNSA 3H2AA 3A4WA 3B8VA 3GG0A 4OQVA 3S3GA 4LSBA 3BL3A 4JCLA 4A3RA 1EZWA 3NQDA 3WDHA 3OO2A 3AHTA 2C15A 1D7FA 2GSJA 1E56A 1SZGA 3VE9A 4LRSA 4BQ5A 2A3BA 3W81A 4PMYA 2V6AA 5AN7A 3G0UA 3B9NA 3IJDA 4RJEA 5LNWA 2FJUB 1UOKA 5GNXA 3DKJA 5D2VA 4Z2KA 4XSMA 5AC6A 1VF8A 3SCOA 3MHGA 4D8LA 2VEFA 2VRQA 3NIYA 3PB2A 4GY7A 3PK7A 4JQ4A 1A4LA 4V1YA 3DGBA 1EJRC 3T8LA 4FLOA 3UG4A 5C9WA 1ICQA 1Q7QA 3RX3A 1OYCA 2TMDA 2TSYA 3BLIA 3SCPA 1UIPA 1AW5A 1WXYA 2WLZA 3WY1A 4FK9A 1V51A 1DE6A 1MUCA 3GNNA 1Q6OA 3VMNA 2VL4A 2V67A 3FSUA 3BCJA 4JN8A 3L4TA 2HDJA 4CD4A 4FP1A 4Y9OA 3I4EA 3SCWA 1UR2A 4UIOA 3BLEA 5AHIA 4K2SA 2QPXA 3WFZA 4MSSA 4GH1A 2ABAA 3PZ9A 1V3MA 3JZEA 2XJ7A 4CN4A 5LA1A 2C18A 1UR9A 3C0SA 2V82A 4EXQA 4UR9A 5D03A 4TO8A 3HGJA 1ICSA 3GU2A 3MUY1 3I6TA 1P1XA 5F4XA 2I5QA 3T7VA 2P88A 3V36A 1V5XA 4OT7A 3PTKA 3PUEA 1KW1A 3AS0A 4G1NA 1XGZA 4HYWA 2DW6A 3PJTA 4A8NA 4NY2A 1PZ0A 2ZRZA 4JPGA 1O5KA 4WVXA 1OFQA 1UD5A 1VPQA 3T4WA 1E0TA 2Z6JA 3ATZA 2UV8G 3SGUA 5TBOA 1G6CA 4ML9A 2O9RA 2WHMA 1QW9A 2ATMA 3W76A 4Q7NA 3WNOA 3PTQA 1A0DA 1S3TC 3MKVA 1UIOA 1KV8A 4XX6A 4QP0A 3VGGA 4ZO6A 7CGTA 1MXGA 1FXQA 4JGDA 1XLMA 1PHQA 3N17A 1HJWA 3DI0A 1C8VA 3GG7A 1AW2A 3K1DA 4LAUA 2GSHA 1Z42A 4PC8A 2AQOA 3GBDA 5FOOA 3G5EA 2MNRA 4GVIA 2PDMA 4P8WA 3GW3A 2DDXA 1PB0A 3GDKA 1K9TA 3WEMA 1CGWA 1XLGA 3VD3A 2Z2UA 5ENLA 4BF7A 5CJNA 3SSJA 1PIIA 4US5A 3H7RA 1V4YA 5DY2A 4DN1A 5A2CA 4IP4A 2WNZA 5K4XA 1EOMA 3DG6A 4AEEA 2QR6A 3NL3A 4JX5A 1NQ6A 3DXIA 3W4RA 4QXIA 3IIVA 4TTGA 1MW2A 4I8YA 4BWLA 3W6LA 2DT0A 3KXQA 2DJLA 1W3JA 4DXVA 2PLMA 2XINA 4YHGA 4BHYA 4C90A 4J3SA 7A3HA 3XIMA 3I7QA 2YPIA 4HK7A 1G01A 4TIMA 3STGA 3ES8A 3FVDA 3INPA 4QDWA 5JBDA 4N9BA 4ZQOA 3KZPA 3IJQA 1V6WA 1XLHA 1EHAA 4UB9A 1JXKA 3A22A 4EP8C 3MVIA 1NWRA 1RA5A 4HU4A 1FWDC 2VC7A 2XN2A 2YCJA 3MC5A 4F66A 2XZ7A 1EWDA 2WMHA 4PUWA 3HJEA 3CWOX 3Q58A 4R27A 1Q6GA 2I5IA 1UWTA 2R1KA 3REQA 3L2LA 5HPCA 1LUCA 2P76A 4C7FA 3GXMA 3GKAA 1ONEA 4GRSA 3GB6A 2FZBA 4Q4OA 3LQLA 3CZEA 1IZJA 2HS8A 2WJEA 1E9YB 4DEFA 2AOSA 3K8LA 4F9JA 1YADA 2Z29A 1V3LA 2VP8A 2NV9A 9XIMA 2X1IA 4HZ8A 2NV2A 3VC6A 2PP3A 2VELA 4C1NB 1M7XA 1NDZA 3KRUA 2LLEA 3WCZA 1N8IA 4P8UA 1LCOA 4B90A 1I8JA 1SVDA 4GCAA 4NJHA 2BWGA 5GJPA 5A8QA 3P80A 4PMZA 1HTIA 3W1RA 1UPMB 1JNEA 1SFJA 1FDYA 4QLKA 1FWNA 1XBYA 2J9ZA 3QV9A 4JTRA 3CO8A 2YX0A 5BOEA 2GWGA 3BJFA 4NRRA 3IJ7A 3CZLA 1F3TA 4KMQA 1VPYA 3GTFA 3R7MA 4LAZA 3WQ4A 2XISA 5EPDA 1PSCA 4D8AA 1JPDX 2XIOA 2ACSA 1NQKA 3KOFA 3ZJ6A 4UR7A 5F1UA 1LWJA 3G6MA 1XICA 3MJYA 1M7JA 1TR1A 4DJFA 1YMYA 3N3MA 3NO1A 1L8NA 3F2CA 3ZQ9A 1GG1A 3ERPA 4YL2A 2GZXA 3MUCA 2QGHA 5ABFA 1RR2A 3GKFA 3STFA 2WMGA 3TONA 5TIMA