1CB2A

Cellobiohydrolase ii, catalytic domain, mutant y169f
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
363
structure length
363
Chain Sequence
TATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVFDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRALRGLATNVANYNGWNITSPPSYTQGNAVYNEKLYIHAIGPLLANHGWSNAFFITDQGRSGKQPTGQQQWGDWCNVIGTGFGIRPSANTGDSLLDSFVWVKPGGECDGTSDSSAPRFDSHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (o-glycosyl)
molecule keywords CELLOBIOHYDROLASE II
publication title The active site of Trichoderma reesei cellobiohydrolase II: the role of tyrosine 169.
pubmed doi rcsb
source organism Hypocrea jecorina
total genus 132
structure length 363
sequence length 363
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 1995-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1cb2A00
1GZ1A 1HGYA 4AU0A 3A9BA 4AVNA 3VOJA 4I5UA 1OC6A 1CB2A 1OC7A 3VOIA 3ABXA 4B4FA 1QK0A 3VOHA 4I5RA 1TMLA 1QK2A 1HGWA 3A64A 1BVWA 3RPTA 1QJWA 3VOFA 3RU8X 1OCNA 2BOEX 1UP0A 4AX7A 1UP2A 1OCBA 1UP3A 2BOFX 2BOGX 2BVWA 4B4HA 1DYSA 4A05A 3VOGA 1UOZA 1OC5A 4AVOA 1OCJA 2BODX 4AX6A
chains in the Genus database with same CATH superfamily
3CYJA 3UJEA 5FSEC 3WLNA 1V7YA 5FAGA 1XRVA 3G1XA 1HXJA 2WJEA 4IFOA 3JRKA 2PDMA 1BKHA 2GOKA 3SUUA 1JDEA 4HPXA 3KLLA 3V1PA 2C79A 3RU6A 3T4WA 2NLIA 1I45A 4H9VA 4ZFMA 4FLSA 1GQIA 3RPDA 5G1MA 3RLUA 3DGRA 3SADA 1V77A 3RM9A 1Z8AA 3A23A 4TU1A 5C7HA 2Z1KA 1W1PA 4KMQA 3T0BA 1UMLA 4PE8A 2OMAA 4GYPC 1B4KA 3APYA 3PFMA 3VTRA 3M07A 3BMXA 2V5BA 4GISA 3TYEA 2WJZA 2X0YA 5BMWA 1BYDA 3WLTA 4NAEA 1PDYA 2A3EA 2AAMA 3NSNA 4HA1A 1VCVA 5L6UA 2EJAA 1OIFA 4CLMA 2BWGA 4U2ZA 1WKYA 1XX1A 4TTUA 1F73A 3HPAA 4NAFA 1J0YA 1M03A 3B9NA 1EJRC 3LD5A 3C52A 3U4AA 2KX9A 4GO9A 1EBGA 1I2OA 5FF3A 2YB4A 1OVDA 2PTZA 4LUIA 2FPTA 1AQ0A 3BQ5A 1S5VA 1MXDA 1E6XM 1P4CA 2NV1A 3RCYA 3PG9A 4J1OA 4V2XA 4ZXLA 3TN4A 1FKXA 4H01A 3LXCA 3QV7A 1OB0A 2BTMA 1WV2A 3TJLA 1CBGA 2CC0A 3T0CA 1VPQA 3CZJA 3MSDA 1LBLA 2YZRA 3TMLA 1WOAA 1ZALA 4AD1A 3H4XA 3NO1A 3PB2A 3WDJA 3HG2A 3CLMA 1UIPA 2X42A 4HPGA 5LGXA 1C29A 1Q4WA 3FGCB 4U5KA 1LTDA 2Y6ZA 1HKJA 2ZIDA 3BLEA 3CBWA 4CQBA 5FF0A 3FXGA 5EMJA 3O9NA 4ZEPA 3MB9A 3MCNA 3GVQA 1V0LA 1V6UA 1LUCB 1E51A 2V5KA 3P60A 1A5MC 3MSYA 3GK0A 3VXGA 3GXIA 1V79A 4N2YA 3A6OA 3RJXA 2A7RA 5K4XA 4XIMA 4RXFA 4K1GA 3STCA 1EC9A 2HNEA 2EQDA 1GTHA 3LCGA 2OB3A 3EKLA 4UWMA 1M7PA 4TMBA 2C0HA 3R10A 3BGJA 1A4LA 1JPIA 1CEOA 5A2AA 5GJPA 1IEVA 1H7OA 1JQXA 2A2IA 3CQ0A 4Z2LA 2E6DA 5BROA 1JDDA 1YPFA 3UPBA 2EG7A 3Q58A 1CZ1A 1TUFA 4AC7C 2GOUA 2Y70A 2AMGA 3FVMA 1NWUA 5JVLA 1XIJA 1E6QM 3ISIX 4QTGA 2JIEA 1KGXA 2YDQA 2CKSA 1F9CA 4I5UA 4RZBA 3W6LA 4C6EA 1BF2A 1BVWA 1U83A 2ZC8A 3KOFA 3UFYA 2E4TA 4J27A 3OBKA 4HNTA 1H49A 2Z2BA 5G2IA 2VFHA 5ABTA 1ECEA 3ABXA 1WZAA 4JDYA 4UTWA 2WPGA 6PTDA 1W9BM 4XBJA 2J9YA 2FGZA 2FFIA 4NHVA 3CQHA 5BRQA 1TYGA 2D2OA 4DJDA 4WJ8A 4OKDA 3GC5A 2FVKA 1RALA 4HNNA 3QLDA 3VMPA 1XH1A 1KFBA 4ZOCA 3H70A 1RCQA 2B7NA 3EKZA 3LHYA 5JBFA 3E3HA 3WD0A 1OFPA 1KR0A 4ATLA 1M5WA 4C6OA 4PL2A 1W32A 2V5DA 3E49A 4HQVA 3BL3A 3GW3A 1FHVA 3I3EA 2GK1B 1V6YA 1C93A 4DI8A 2QUMA 3DIPA 1R2SA 3DKJA 2EPHA 4LT9A 1ZBVA 3NR0A 4NNCA 5BRPA 3KVJA 3S1XA 3CWHA 4B3ZA 4NXKA 4C65A 2HPMA 1OSEA 1LOSA 4PUWA 2GWNA 2H3BA 1IWBA 1ZL1A 1JI2A 4UNIA 3BCDA 2GUBA 4NT0A 2PEVA 2ZYFA 4OUIA 3VIPA 1ADSA 3RJYA 4W93A 1EJ7L 1DBTA 1DXFA 1MZHA 3BAXA 4KF1A 3TR2A 2Z6JA 4NSBA 4DZAA 4MLRA 1QI4A 1IR1A 4IGMA 4DIAA 3WD1A 5CBJA 2CLIA 1OC6A 3OHIA 4O1AA 2QV4A 4GNKB 3QQ0A 2PDJA 4E3VA 1KKRA 1XP3A 2Q3RA 1MSSA 4JIRA 3VZZA 1AJ2A 4UQCA 3LRLA 2BGSA 1X96A 4K37A 3W37A 1POKA 3UWYA 4HMCA 3I6EA 1VEPA 4PB4A 7TIMA 3P74A 1N8WA 1KRMA 4NYYA 3P67A 3BG9A 1VP5A 3V35A 1M41A 3UXIA 1Z3NA 3DFTA 4JTUA 7A3HA 1QPQA 4H6RA 3M0JA 2DSVA 5IHRA 3CAVA 1X8CA 4EWND 3WUBA 1I9CB 3HPZA 2BOFX 5TAOA 2GFTA 4GYKA 4J2MA 2W91A 4MNJA 1V3HA 3GFXA 2C18A 3TZNA 1P1XA 1O68A 4MG4A 1GOKA 2YCIX 3R1ZA 3V5OA 1QATA 2UWFA 2XH4A 3NQCA 3K8MA 3KBWA 3W1UA 1N82A 3W72A 2PGFA 1UP2A 2SFPA 3LCIA 1AA1B 2PC4A 2WO5A 3MHUA 3WH8A 1Q6RA 4C6QA 3OA3A 1I8JA 1AFSA 1TTJA 5LKYA 4F40A 3MCOA 4WRHA 5CC6A 4M6PA 1SYTA 3KBSA 3IJLA 4GGBA 3WDHA 2C15A 4AVOA 3RN6A 3MI3A 4XUYA 1UC4A 3O6YX 3KLKA 4LAKA 4O12A 2W92A 1T41A 2CXGA 4K1WA 2DSKA 1B1YA 4ZOBA 1OT1A 3W7NA 4DNMA 3NWRA 2X2GA 1IT8A 4C6PA 2VCAA 3N13A 3UP8A 1PCWA 3PUGA 3W7OA 2OKOA 3N4FA 3B0VC 2DPEA 3EWDA 5A2CA 2X1IA 3WBWA 1TWSA 4KPLA 3VD3A 1BXBA 4D6DA 3E5PA 1I1WA 4AY1A 2HMCA 1BXCA 1S39A 1PS9A 1JF5A 4JGDA 4O4WA 4KEMA 1DEDA 4S38A 5EBAA 4H6KA 3L0NA 1ZZMA 2OYLA 4O13A 5CPSA 4NZ3A 1E9IA 1FWWA 1UH3A 2ZX6A 3GNOA 1JR1A 1K9TA 3U2ZA 2YSWA 4RDWA 1ZS2A 3AIVA 5L9FA 3CWNA 3NL2A 2WV8A 1OQFA 4IMDA 2QVNA 5E0CA 3ZQ9A 3LPPA 3G1RA 4P8XA 2OCZA 2VC5A 1O5XA 3UGRA 1XI3A 4CD5A 3F5LA 2CLKA 3G0XA 2NQHA 1TX0A 2PU0A 2BGQA 4ZODA 3TMQA 3N4AA 3AWOA 3VCNA 3GAYA 4NIRA 1HG3A 1AD1A 4KQNA 2ISWA 1OK4A 3DN5A 3L4VA 4WOQA 2J24A 2Q02A 3GR7A 1NDVA 2E68A 3BOXA 4WEVX 2PDXA 4PMRA 4UOJA 2O4QA 1M68A 4EAYA 2VGGA 1O1HA 4OTKA 5D02A 2F2HA 1GEHA 1CECA 1H7RA 5CPQA 3EOSA 4J9JA 5AHIA 1BQCA 1MW2A 3ZXWA 1XLAA 1TJ1A 4O1EA 1F07A 5JIPA 1XG3A 4GIAA 4HHLA 4GYFA 3ELFA 4XD3A 1W5PA 4IWWA 3C6CA 4H8VA 4B5UA 3OO2A 1OABA 2DJXA 4HK5A 3VYLA 5HQEA 5BU9A 3ZOAA 3HU7A 1EP3A 3OGVA 3CT7A 3MT1A 1U1HA 1XINA 1EXBA 2JBMA 3B9EA 4CCEA 4TVUA 1MVYA 4EWJA 5ECUA 2J27A 3TAOA 5G1TA 3DH7A 4ZZ9A 2QF8A 2Y7GA 5CXPA 1XQLA 1CGUA 3LBMA 2HEJA 1UUMA 3NEVA 1ZHAA 3O2LA 4LUYA 2EPLX 4E38A 2D2JA 2W27A 3AOFA 3CEUA 4IISA 1FHUA 1KR1A 4QG6A 2EBNA 2KZHA 3BZGA 1QMLA 3PBYA 3WF1A 4GI9A 3GH4A 3LMZA 3CAQA 3CUJA 3NQ2A 2BLEA 5D2YA 1T96A 3DFQA 4QSHA 3H53A 4Q4OA 2BDQA 2DT2A 4ZXOA 4ZL1A 2I17A 2OZTA 5CJMA 3QM3A 1GVIA 3QPEA 2P50A 5I2UA 4R27A 2WNZA 4RUBA 2AQOA 3IVSA 1GPWA 3MQTA 2W0UA 3LCWA 2JKEA 2R6OA 2NX3A 4NZCA 2G0WA 8CGTA 1C9WA 3LGDA 2G3MA 2YXGA 3W7JA 2BS9A 3THQA 2R1LA 1EJSC 1PBGA 1SZNA 3AUJA 3MYPA 4GIYA 2NV2A 1VCFA 1FCBA 3T05A 3QRHA 1IEXA 3CUFA 3QGVA 3FHAA 3QPZA 1V3LA 4GJJA 1W3NA 4HZ7A 1U5HA 5I00A 3HBLA 1XL9A 3KVMA 1VFOA 1KD0A 3G1YA 4TV6A 4H04A 1G69A 1G94A 3CIXA 4HSNA 3V75A 3S5SA 4LAUA 4N7QA 2C91A 1O1ZA 1YHTA 1P48A 2NUXA 1RQBA 1KM1A 2VZOA 3ZFHA 3ZWTA 4LTSA 4GJ1A 3NFUA 4NF7A 7CGTA 5I3FA 4DF1A 1TUXA 4H3DA 2ALDA 3WNLA 2HVOA 5C9XA 1RQHA 4JL1A 5D9PA 4ZO8A 2A4AA 3OB8A 3WQ5A 3BJFA 2IQDA 2WVTA 3BLLA 1W1TA 4LS1A 4R53A 3HURA 4Y8FA 3WNKA 3T0DA 3CB3A 3I7RA 5A8OA 2PWUA 3KX6A 2UY5A 4IPJA 4YVPA 4PGLA 3AROA 3UEQA 2YXXA 2PGRA 1E0TA 3MUCA 3W1TA 5JIWA 1LLWA 2PPGA 1K6WA 5E70A 3GFZA 3V7PA 3W73A 1JI1A 5FJPA 3GIPA 4RNJA 3RPTA 3AUOA 1V0KA 3EKGA 5M5DA 5XIMA 1EOKA 1S3TC 4QG9A 1DIOA 5CH9A 2ABAA 4HA0A 5HJLA 1MEIA 2QJJA 1O12A 3NL6A 3V5FA 1HZYA 4FXFA 2ZRVA 3GB6A 3QZAA 2CLOA 1GEQA 4HOZA 1EEPA 3MY9A 6REQB 3TTQA 3K4WA 3AMCA 2HK1A 4LNYA 2X09A 1HO4A 1G4PA 1C91A 2BXZA 3K46A 1JGMA 2DW7A 2JIWA 4PMVA 4QE4A 3IUHA 2CBVA 1U5VA 1VENA 3SQSA 4HBKA 1XIHA 4B9ZA 3HG4A 2BMBA 1UR0A 3A3HA 4GQQA 2QGHA 3LHVA 1Y8BA 3SQMA 4BF5A 4GJIA 1Q6EA 4AYGA 3JU2A 3G77A 3VX1A 5A3HA 1HKVA 2GVGA 3VNKA 3TE9A 3STFA 5H1WA 2Q8XA 3EYPA 3QV8A 4NU7A 1MUCA 3E6EA 2PB1A 1RA0A 4GC4A 3W7PA 2WM1A 1E1CB 3FEQA 2BY0A 2JKPA 2V81A 2FFCA 1U2YA 4N6EA 4O57A 4HP5A 2PGEA 2WHKA 2PZ0A 3STPA 4AIBA 3PJXA 1DWIM 1QHPA 4IG2B 3R0KA 4B5XA 2L5HA 3CH0A 3LMYA 3KZPA 3RRXA 3KTSA 5ENLA 4FEZA 4A2RA 3M0VA 2CBJA 4XZIA 1X7FA 5I02A 4MSSA 2AQVA 4PUUA 3WD3A 1Z41A 2OXNA 3PZIA 4ENLA 1OFRA 5C70A 3UG3A 3W7GA 4JBRA 4WUIA 2ZZ6A 4R9XA 1BGAA 4WKHA 3WUFA 4LUJA 2E8ZA 1TREA 1IIHA 1V0MA 3VC6A 1YBQB 1C8XA 1UD8A 4XTDA 2VZUA 1ZFJA 1XIEA 3TYUA 3BC9A 1M65A 2EAWA 2EPKX 4X63A 3K30A 1B0IA 3CU2A 4QLLA 3VIFA 1KKOA 1M01A 1LWIA 4NI3A 3E02A 3WENA 2XIBA 2FZMA 1DWJM 2DT0A 1TPEA 2XH7A 6ENLA 1LP6A 4U2YA 1FFRA 4NZ1A 4W87A 1KV8A 4IH3A 1UB3A 2ZX8A 4BF7A 1EYWA 4M3PA 3SW6A 1BWKA 1V6TA 4ACZB 5HWMA 1LORA 4LEFA 4KWVA 3EXTA 3VNYA 1PKNA 3GHTA 5AZ0A 1IGWA 4AUBA 3RYSA 3R25A 3ARTA 1PZ0A 3WH6A 1XLBA 1HKMA 3NXLA 5LIKX 5DN1A 1A5KC 3KTXA 1IWAA 3GWQA 1AZ1A 4CU8A 4JFVA 1O5QA 1TO3A 1MEHA 4DZ5A 3HF3A 4MMWA 1CGYA 3WK0A 1UR9A 4XZHA 4ALDA 1UWSA 4ZQMA 5EBUA 1JAKA 4R3UA 1LQ2A 1O4UA 3G0SA 3W38A 1SQ7A 1V6XA 2VTFA 1OEPA 3SUSA 1NFBA 2XN0A 2VUNA 4NRSA 3MCMA 1NP2A 1V5XA 1R0MA 1JZ8A 3NGFA 2XDFA 2FLIA 3NZGA 5AHNA 2NVAA 4GH3A 2ADAA 4GQRA 3VGGA 3OLGA 1Q63A 1K8ZA 1FHLA 4H4IA 1G01A 4PBGA 4LVDA 1WZLA 4H9XA 4HN8A 4MJ4A 4BFAA 4L1WA 2VDHA 3GE7A 4W5UA 4YJ5A 4K2SA 2R94A 1JNDA 3S5YA 3HFTA 3OJGA 4BR1A 2CZFA 3FJ6A 3TTYA 4GBDA 1B3ZA 2XVLA 3CMGA 2PUZA 2E25A 3AIWA 1OX4A 4QR6A 3PWAA 3TYBA 4NX0A 2JE8A 4YNGA 1WKEA 3FLUA 4HTYA 3KW3A 3GIYA 1SUXA 3S2NA 2YL8A 4XD6A 3KP1A 2J13A 1JG9A 1NF7A 1BLIA 1I0DA 2XVPA 5D4YA 2FZNA 3KAOA 4KWUA 2P88A 4QBXA 3UBPC 3EBVA 5AOUA 4WDXA 2CKRA 1OZQA 4FNRA 4NZJA 1G4SA 4JIPA 2GSHA 4QRNA 1H5VA 3C56A 2FTYA 2PS2A 3H7VA 3B8SA 3FK4A 2PURA 3N11A 2Y4SA 3UPMA 1W1YA 1XIFA 3CL7A 5HMSA 1ZP3A 2WZEA 2DZAA 5C54A 1G9HA 5BZAA 5KMYA 4S2CA 1WDPA 2Z1VA 4C7DA 4WDUA 3TNOA 1GVEA 1EOMA 1BTMA 1N2VA 5AHFA 3QN3A 1J9YA 3OODA 1FCVA 3LSCA 1X1ZA 5J04A 2VX5A 4LGXA 1XKYA 3FYOA 4XVEA 3H2AA 3I4KA 3PUOA 4IFRA 4LC6A 4Z1BA 5K4ZA 4NP7A 3ARYA 1GQKA 4DY1A 5G4WA 3BMWA 1J6OA 1X98A 1W1A1 3AS0A 1TJ2A 2QYGA 2BOGX 3WUEA 4US5A 4XAYA 1K7XA 1NU5A 1H7XA 2WCSA 4LQ1A 3WFAA 3H2MA 3N9SA 1TSIA 2J4GA 2D3LA 4RKAA 3KRZA 2QQ6A 3DBPA 1QO2A 3PP7A 1J79A 4O18A 1JYNA 4N9EA 1YLVA 2AAAA 3PTDA 2J7CA 1JNEA 1JL8A 4EPBC 5A6LA 1Z89A 2Y1HA 3GFYA 3AMGA 1DE6A 4Y7EA 3LB0A 3UD6A 4GO8A 1A53A 2ZADA 1O5KA 1JPMA 3PJUA 1Y5WA 1NOUA 5LZLA 4QSFA 4DBWA 5JBEA 3ANVA 2XSBA 4FK9A 4M5PA 3GU1A 4AX6A 1F5ZA 2WPBA 5E5CA 4MTVA 1NDYA 4LUTB 3AHXA 4S3EA 3WQ4A 4FNTA 3BLFA 4S39A 4JIEA 4IPPA 4D1JA 4HNOA 3TYAA 4LBUA 4MNKA 2H9AA 4AD0A 4R34A 3ARVA 1DJQA 4FHAA 4H1ZA 4UZSA 2WK2A 4ZTXA 4ZOEA 4YCOA 4EF8A 3EOLA 4KWOA 4UB9A 5D9NA 4C6FA 3QVQA 3ATZA 2JFEX 4PSPA 3B0PA 4ORIA 3HQOA 4NL1A 2OQLA 1KQYA 2HBVA 1R3VA 2RJGA 4S2BA 2PMQA 1YTEA 7REQB 1W1VA 3IJ9A 5C71A 2ESCA 4LAOA 3NPUA 4C6BA 4XO6A 1R6WA 2Z1BA 5G4EA 4PC8A 1R9XA 3GY1A 3WF2A 3ZLFA 3QYQA 1GK8A 3SRKA 2PWDA 3WCZA 4JN6A 5E0FA 1XR2A 1V93A 8A3HA 4ICCX 1VR6A 4FNQA 5C9WA 4CN6A 1GOWA 3OPSA 1TVNA 5I09A 2VC7A 2G3JA 1PZ2A 2VGBA 2PBGA 4IJRA 2RGLA 3RR1A 1UP3A 3EXSA 1FWRA 4CVWA 5D38A 3WEZA 1EJWC 2GYIA 3TH6A 3GDMA 3W7IA 1VFLA 1FCQA 2ZTJA 5FJTA 4WF7A 3GR4A 1G0CA 3RMJA 4D8AA 3HJZA 3J7HA 4K8GA 3KBNA 3KUMA 4C5YA 4UQAA 3LERA 4IZGA 3M44A 4IFKB 3NJ3A 2I7GA 3AI0A 3LHZA 3W7EA 3C0QA 1GW9A 1TA3A 2OU4A 3GRIA 3BURA 3BLDA 1QVBA 4BQ3A 3W6YA 5BMXA 3S1UA 1AMYA 1P0NA 1XWYA 1PWMA 2BB0A 5BRBA 1UIOA 2WC3A 2V69A 3RILA 4LYPA 1YDYA 3CUXA 4ZQNA 4HMNA 1C7SA 1ZBKA 1PKMA 3QZEA 3WK1A 3HQNA 3VOJA 3QY6A 1ZAJA 4B3LA 1ME9A 3ALFA 4L4LA 2VELA 4D1IA 2ZXQA 3THCA 4DRSA 4BWLA 3KWSA 4P7RA 3AJXA 2CETA 2PBOA 1S2VA 3T09A 3LN3A 1E0XA 4IMGA 1D9EA 1EGZA 1V02A 2QXWA 1UWTA 3W29A 4FOKA 1MMFA 5XINA 1F3XA 4QFUA 3BSHA 4QROA 3W27A 5IBXC 2IPWA 1LUCA 1UD6A 4B5TA 1QR7A 2DSUA 4DYKA 1JZ2A 5DCDA 1KO0A 5BW6A 1QO5A 3GG0A 1L8PA 4L61A 2V0TA 1K9EA 1ZPTA 4ASTA 1HFBA 4M19A 3ZT6A 4DBEA 1E55A 1JF6A 3UY8A 4M1BA 1Y0EA 4DAFA 4MB4A 4MYXA 4GYPA 1QUMA 3W07A 5DMMA 1E1EA 1WOBA 2IXVA 3HQ1A 3W02A 2HXTA 3L0GA 3BSGA 3LCFA 3B8WA 1S3HA 3STEA 4HCDA 2Q09A 4QP0A 2J79A 1Z6KA 3TK7A 3VGFA 4V1YA 2Y61A 1QBAA 1XH2A 1XIBA 1LRNA 2PDUA 1IF2A 2D20A 3SBFA 4FNPA 2E77A 3VX0A 4H8HA 3S8HA 2R1MA 3G3DA 1OFDA 1AK5A 1UD3A 5BXSA 2XINA 1LZOA 1VYSX 4QM1A 5D9MA 4PMQA 3S46A 1RXOB 1VH7A 4HOXA 4K38A 3TYZA 5DANA 2FHCA 3WZ0E 4ERAA 4IMCA 1DWAM 4W7UA 4A8RA 2WOQA 4CU6A 4HSHA 1EEXA 5AC7A 3KDNA 1C8VA 2CU0A 3S6DA 4A6GA 2GJPA 2A0NA 1ZSXA 4FXSA 4K68A 3E0WA 4RNIA 2E1WA 4U3AA 2CLHA 4XK2A 5KEZA 1KBLA 2QIWA 4IUOA 4W89A 3HIJA 3PR2A 3R89A 3W6MA 4G5DA 3AALA 4PH6A 1ZGDA 2PDKA 1RPKA 4WVXA 1KXQA 4GPNA 4UTUA 3LY0A 2IKIA 4WY0B 1DV7A 3SCVA 3WLKX 4PMJA 2G4FA 2DSWA 1B90A 1X1NA 4QE1A 1CIUA 4NX5A 4YVVA 3A12A 2DVXA 1VBUA 2EPOA 3GNNA 4M7TA 2PDHA 5BOFA 3CGTA 4GUGA 4DPPA 2A3HA 4E2VA 1V03A 3DUGA 1SO5A 1A3XA 3AS1A 2FGBA 4YIWA 3P14A 3SY5A 2V2HA 4F3HA 4PCFA 1UJPA 2OX4A 4YYCA 4O16A 3SGUA 4EP8C 1CXKA 1ELSA 2PU1A 4O17A 2X05A 4W4QA 3F4CA 2OOGA 2WKLA 1QI5A 2GK1A 1ISVA 1GZ1A 2DZUA 1PIIA 1UQZA 3IAQA 1SO3A 3TNBA 1KGWA 1UR8A 3CUHA 2VQUA 2P0IA 5FAJA 2ZZ7A 3WF4A 5HOSA 1TJPA 4XISA 1ZY9A 4Q4QA 1ME8A 3F4DA 1FKWA 4M6VA 1UROA 2WMGA 3GVRA 5H8PA 1UR1A 4LXFA 1K77A 1UWRA 4JCLA 3LOTA 2X2YA 4O0ZA 1J5TA 1UOKA 4EPEC 4GQ0A 4AHQA 3HOJA 4ERIA 1BWLA 2EF9A 3IIXA 4YHGA 1R8LA 3WQWA 1QNRA 1EUAA 1HL8A 1DJZA 2ZUMA 4UMBA 3H6OA 1J0KA 3KZSA 3B8VA 4MWAC 2FJKA 1OFAA 1FCUA 4FB7A 4XX6A 3E2VA 2NQJA 2BNJA 2G41A 4I6VA 4GRSA 1M1BA 4HGXA 1T99A 1K8YA 4TX6A 4AF0A 1KQZA 1PKYA 1Q5MA 5A1AA 2WHMA 2WB5A 3ATYA 2PWEA 1XLKA 1Z9AA 3MC5A 2UY4A 5DBTA 1QFEA 1XBYA 1A3HA 2E8YA 4WDTA 1E71M 8XIAA 2OLSA 1QDSA 1H0IA 3BPWA 4IQLA 4L64A 4IX0A 1F05A 3VC5A 1OFQA 1ODZA 5FJIA 4PTDA 1BVNP 1CGTA 5EMMA 1CXIA 3ARUA 1EBHA 4C5ZA 1MW1A 1GORA 3N12A 2PA6A 2QDEA 5A94A 4OUEA 4MNLA 3RUBL 2V3DA 2QS8A 2EG6A 3G24A 1ZAHA 3M0KA 4IP5A 3UT0A 1DJIA 1A0CA 4NVTA 3PNUA 2QUUA 2DQWA 3WUGA 3IV8A 5DO8A 4JTAA 3PPFA 4ZO6A 3EDJA 1P6CA 1D8CA 1XLGA 3RAOA 3P84A 3U8GA 3C0JA 3CHDA 5LYRA 4KW2A 5LA2A 3TN3A 3GKAA 5XIAA 2REQA 3EX4A 4ATDA 2DZSA 4U31A 4W5ZA 1SJDA 3OBAA 2BY3A 4MWAB 4JIHA 3GVVA 4TUFA 4GQGA 2FHFA 3PC0A 3R11A 1VC4A 2D23A 1DIDA 2AKZA 3SFWA 3TN5A 3VNZA 4NI8A 3W24A 4H00A 1XCXA 3BSMA 3TTEA 1QK2A 1CTNA 5B80A 3A5VA 1EKOA 1Z69A 3WQEA 4MAZA 2V30A 1U1JA 4PFHA 3D46A 4MY8A 3MWAA 5DCBA 1JIBA 4CCDA 4HZ6A 1DOSA 3EPMA 3W1LA 1ADDA 2QUNA 1A5SA 3VK5A 4GVIA 3VGDA 5I79A 5A8QA 1J0IA 1XKJA 3W01A 2ZRZA 2F61A 3I6TA 1IWPA 1H1NA 1Y65A 1QAPA 3UWUA 3W75A 4E2BA 3GNRA 3NPWA 3T44A 2WNNA 3CB8A 3T9PA 5D30A 4Z2JA 4XTIA 1EDTA 1QPOA 3L66A 2R9RA 3AISA 1XYMA 1S5TA 4DBDA 3VDCA 3KVKA 3VPLA 4PN2A 1M9HA 3OHMB 1YNQA 1Q2RA 4IX2A 4MGGA 3CAWA 3IUIA 1E70M 1XXXA 2FMOA 1TTIA 3AXHA 2AOSA 4GNVA 3LHWA 4DJDD 4C7FA 2YBUA 2VCBA 5ABHA 5A6JA 4KCVA 3MJMA 5CPTA 2CWNA 1V3KA 4X9YA 1XLLA 4JFSA 4NJHA 3RX4A 1DPMA 3MKCA 3S1GA 3KBMA 3HPSA 1Q6DA 3VILA 3M9YA 4MVAA 2XGBA 1KLZA 2INFA 4EX4A 3EOUA 3BV4A 5A69A 1HW6A 4HTBA 5HNTA 3NOYA 2BSLA 2Z1SA 1AJZA 4DF0A 5HJYA 3AXMA 2RKXA 2EPMX 3UYCA 3A5FA 3U5YA 4X22A 4M6QA 4OOZA 4JY9A 2A21A 2DQXA 4GC3A 4G1NA 2O9RA 1HKWA 1FY6A 3CC1A 4I9AA 2DH2A 4S3GA 1KRBC 2QCDB 1YTDA 5CSRA 3H21A 1PTGA 2QCMA 1EDQA 5I6SA 1DJHA 1NVMA 1J10A 4AD3A 3F2DA 4G6CA 5FF4A 4OU1A 4POCA 2BHZA 3GVGA 2DY3A 1UZ4A 1MDRA 2CHRA 5FSDC 2DV0A 1BAGA 1YXCA 4S3AA 4H7ZA 2X16A 3DERA 3CQIA 3AYVA 1KXTA 3H2CA 4JYFA 3IGSA 3LPFA 4A4AA 2KAUC 1PL9A 1MYRA 4M80A 3NA8A 4JS3A 3CUIA 5I78A 3KOWA 2OZ3A 2VRQA 3APTA 4UIOA 4ES4A 2UV8G 2J47A 2BXVA 3OZMA 3MI6A 1XLEA 1OCQA 3UVIA 2ZVIA 4UBPC 4REQB 4Q8OA 4DB7A 3RU8X 4W8AA 2WMJA 1SPQA 1PX8A 4I90A 3DENA 1XFBA 4C6IA 3HB9A 4V27A 2P8BA 3E0IA 3EWBX 3QR1A 5EFDA 5DRCA 4C6LA 2J77A 4L1GA 2Y8UA 4JTFA 1R46A 3NSXA 1WDDA 4B2DD 1VLWA 1IQ8A 3C4UA 4UZUA 3GBEA 3TN6A 1UPMB 3OYXA 4MM1A 4DNHA 3EEZA 1QNVA 4ZGYA 2VR5A 4C6CA 4ZQOA 5BOOA 1W37A 4QAWA 3KBVA 1ZBWA 4XZLX 3A13A 3BCFA 1MQRA 2BASA 5F4XA 2QT3A 3RFAA 4AFYA 3PTKA 4Q4SA 1AQHA 5A8GA 1RY8A 4PL1A 2F6KA 2ISSA 1R3WA 4UFJA 2OKTA 3ZVIA 3TYDA 1CXHA 1ICPA 2YCLA 3DC8A 3WH5A 1ME7A 2UY2A 3SCPA 1AD4A 3DZ1A 2GQAA 4KRTA 1AG1O 2D3NA 4ZB2A 4BQ2A 4UCFA 1VEOA 4J3XA 1DJYA 4ZMGA 2FHBA 2WHJA 3ZS4A 4O50A 3VKKA 2POZA 1H3GA 2PTWA 5FACA 2OGYA 3WQGA 5BU6A 3WD2A 2PTYA 3PULA 4IL0A 1JYWA 1GJWA 4IL2A 3O6DA 5DEZA 4Z08A 3L2MA 2WSYA 3SI9A 1I0BA 3CASA 2OLHA 2PC8A 4R33A 3VKCA 6REQA 4UTKA 2VURA 1POJA 5AYZA 4UQEA 3FKRA 4CNPA 1U22A 3C2RA 3LK6A 3E2SA 4DO7A 3EA1A 4MZ1A 2GDVA 1EO5A 1LWJA 4AVFA 1FWHC 2NWSA 1ZAIA 4R7OA 4QLJA 3R6IA 1GQLA 1I60A 1SW3A 5GNXA 3BVJA 4IGHA 4QNWA 2B7OA 3NO3A 3C0SA 4XSMA 4IP4A 5D05A 3AHVA 5I3KA 1LL4A 3PFRA 2VX4A 4PA8A 3VNMA 1REQB 1PV8A 5D33A 4P7OA 2BVYA 4H8UA 1TRDA 4UMAA 2HS6A 1TG7A 1IGSA 3FN9A 1E1CA 4S23A 4EOUA 4AMAA 2BY2A 1A5OC 1VB9A 1PTAA 2Z25A 5AHEA 4UXDA 4P61A 5HR6A 1MXGA 4IG2A 3SY1A 3EB3A 4HJFA 2OQYA 1GVQA 4O19A 4BF9A 4JX4A 1K4HA 1J18A 1RR2A 5AYXA 4AWEA 4QE5A 2FDSA 3KDOA 2A7PA 1IZJA 3E74A 3L65A 1VFUA 3GYEA 1YXYA 2CXEA 2QDGA 4WKAA 5AC8A 2O55A 3VDGA 3GDLA 1JFHA 1JJKA 1T7LA 1TTQA 3L5MA 5LNUA 3GBDA 4AEFA 1YBQA 3ALGA 2ZE3A 4UTHA 4W7WA 2GJXB 3MMUA 3O15A 3ABQA 1SJBA 5FEPA 3AMDA 1F76A 3H4WA 3W1RA 1US0A 1BG9A 1B3OA 3NPXA 4IPIA 6XIAA 1Q6FA 1RQEA 2VR4A 3FY1A 3ANUA 4RE3A 4HHPA 2A3AA 3H7RA 3PZNA 1DXEA 1WYIA 2Q3OA 2WMHA 4R5EA 3VUSA 2WHLA 4L9ZA 1W2PA 2FVMA 1KM6A 3LV6A 4WIWA 4NUWA 1WP6A 5FD0A 4F2UA 3MU7A 2QW5A 3QOKA 3KOXA 4AY7A 3UR5A 1XC4A 8RUCA 2Y88A 4A22A 4GOAA 1HJSA 1PIFA 1VBGA 2J8TA 2B31A 3H23A 3THAA 4EXAA 4H7CA 5FEZA 2ACUA 4ACZA 1VGAA 1P0KA 2FZ9A 2NXGA 4ADUA 3N17A 3ZO9A 4ICMA 3B4YA 2BBFA 3TR9A 2PRMA 3WLLA 4IXHA 1V02E 1GQJA 2HVNA 3QC0A 4BI7A 1W9VA 4LF2A 3H2OA 4FPSA 4IJCA 1CW2A 3BJTA 4TO8A 4PCNA 1LOQA 3THUA 3VIMA 4QEEA 1Q8JA 1QPNA 1FVPA 3C3UA 1X97A 3SB0A 4O28A 4J4KA 1MUMA 4A3RA 3RX2A 1CENA 3PK7A 2WXDM 3V1HA 5LNSA 1VFTA 3U7VA 4ADTA 1Q6OA 1T0OA 3BWWA 3G1HA 1TPUA 4E3TA 4DO6A 2XGZA 1A5LC 3VD7A 3ABRA 4K8EA 4MKVA 3GQYA 3ZZ1A 1OCNA 5EB8A 1BXNA 3FFSA 3PPGA 4DUWA 4F2BA 3B0YA 1WAWA 1PHQA 2XIOA 3V36A 8XIMA 2WZIA 4B3KA 4KFNA 2POTA 1EZ2A 1H7PA 1W0MA 1W3JA 2XZ9A 4Q8QA 5B7YA 3P5ZA 3OZPA 2ASHA 1V4YA 1W9PA 4KT2A 1GHRA 1ODUA 1D7KA 1BFNA 4ZOAA 2DH3A 1TV2A 2X8RA 4ROPA 1Y5VA 1T8XA 4WK9A 1WX0A 2XHYA 3M0LA 4MYAA 4AWUA 3DKLA 3WFZA 5C2CA 3VNJA 4GXWA 4GFIA 1XYZA 1W9UA 4EXQA 4DO4A 2Q8ZA 2VHLA 2IQ0A 1E56A 4DWSD 2D22A 4LS0A 1KWKA 1QWKA 1XPGA 3FEMA 3V0TA 4GUHA 4ZVJA 3NVDA 2QHAA 1KW1A 1WKDA 2YDAA 3MVTA 3SSZA 1JPKA 3WJSA 1OD8A 1PZ1A 3BAWA 4KFOA 4O8AA 4TQTA 3LU2A 4KEZA 2CBIA 4AHPA 4JTGA 4YTTA 2Y85A 3IIZA 3RIKA 3VOHA 3BJSA 3OOQA 1Q85A 1O95A 1V3IA 1WA3A 4HK6A 2W4XA 1LCOA 3HPFA 3HMJG 5HAOA 2ZZ5A 3WL0A 3QMTA 3GM8A 1FX6A 1HP4A 4UFLA 4PBEA 4X2RA 5E93A 1HN1A 1OC7A 4MZYA 2A7NA 3KS6A 3N14A 1W8GA 3PBUA 4ONVA 2VKZG 2E5DA 1AH3A 3IJDA 2QPXA 4NRRA 5D04C 3N15A 3BLKA 1VHCA 1FBAA 5IRPA 3L7RA 3E96A 3VZYA 4F48A 4FXJA 4NAEB 2FPVA 3GXDA 2CW6A 1IYXA 3KBJA 5KZDA 3WBYA 1ZB5A 3N34A 4UR8A 4U33A 1F6YA 3PZ9A 3NNTA 3RHGA 4BHYA 2Y7EA 1ONRA 4O1BA 1YXDA 4E5TA 4OE7A 1B9ZA 4BCEA 1DP0A 1UC5A 4WLCA 2OZ8A 3R2GA 1RJRA 4GY1A 2C1IA 2IPFA 3IUDA 2ZX5A 1EGVA 1OGSA 1XCWA 5TIMA 3HJEA 4EPKA 3TWBA 4BQ4A 3R8RA 4Y90A 3FDGA 5CC3A 2FJUB 3G1FA 3UERA 3S6OA 3CYVA 2CESA 4J3WA 3NIYA 1AJ0A 3GSMA 1EJVC 1JCYA 4BA0A 1WCGA 5DMNA 1WB0A 3CT2A 1H63A 3VNLA 2IS7A 3MYOA 3AXKA 4HMDA 5DLCA 2W63A 2RDTA 4K7VA 3ITGA 4ZO9A 4NY2A 3MBFA 4DJFC 2CLLA 3LPGA 4Z2HA 1FWIC 4KEVA 4L7ZA 2V9DA 4N6FA 4Q8NA 4QJ1A 1JUBA 2QCEA 1JEZA 5REQA 3RR4A 1TVLA 1XRTA 1QW7A 2BGNE 4GKLA 4XBSA 3GXNA 1R47A 3C8FA 5GNYA 3GUWA 2ZE0A 4U3CA 3N2XA 1NWSA 3B0UX 4OV4A 1AVAA 1P0DA 3P8JA 1I2RA 2IW0A 3CZGA 3LEPA 3E9AA 1L2QA 3UF9A 3NQVA 4O4VA 1PIGA 4HB7A 1AL7A 3LPOA 3OVGA 4LAMA 3IIVA 3QFWA 1EH9A 4D8LA 3HGSA 4NKCA 4RZ4A 5EMKA 4DJED 2VVNA 3RNDA 1RSCA 2GVYA 3WF0A 3DFOA 1EQCA 3CV1A 3R43A 2XN2A 2FQIA 2J8FA 1KGUA 3LTPA 3OU8A 7REQA 3CPUA 1QBBA 2TSYA 2WZHA 3ZWSA 1IZKA 2YIHA 1OFEA 2V2DA 1UWAA 2RGMA 2E6FA 1QNSA 3S6TA 5JMUA 1VBRA 4QX4A 4L6DA 5DX7A 1CB2A 4K8HA 1CNVA 3POHA 3F7JA 4HYRA 4DLFA 3SCNA 1TZZA 1AUSL 1RD5A 3VIJA 1TMQA 1S2UA 1Q7ZA 3M0MA 1W5NA 4ERGA 3ITLA 4Y6GA 2CERA 5AC5A 4GVFA 5FEWA 1KM0A 2DFAA 4MIMA 1XD1A 3R12A 3V5CA 2QGYA 4M6UA 4QQUA 3BZJA 1R7AA 3N2CA 1QOXA 4IICA 2VP8A 3EMQA 3FAWA 3BGGA 2P1FA 1KB3A 2RFGA 2ZBTA 3O07A 4BI5A 4DPQA 4IFKA 2YPIA 5EPDA 1HKKA 5HXMA 2D0FA 1B5TA 3B9AA 4PTMA 1S1PA 3UXAA 3TOYA 4A3UA 1WXZA 3EDEA 2VXNA 3HQPA 3VKDA 4L6HA 5IHSA 2DEPA 3AHZA 4JXCA 4L4MA 2BG5A 4YL2A 2JQXA 4R85A 1OG6A 3M1ZA 1R9YA 3PWIA 4CNNA 3OW1A 1NAL1 1YEYA 4F0SA 4D72A 3HM7A 1JPHA 2YW3A 2Y63A 2O56A 4KCTA 3MUXA 3LDVA 4GXMA 4MJMA 2ZDSA 5D09A 1XSIA 5I3DA 1UZ1A 4B90A 3GW0A 1KBIA 4HJWA 3FVDA 3L4UA 5HK4A 2WLZA 2GUYA 2ZRWA 4OOUA 4GH1A 1YNYA 2VFFA 1TWIA 3LSBA 1H0GA 2VFDA 3CIWA 3O3RA 4C7GA 3ZJ8A 5I3GA 2XUCA 1O5RA 3N4EA 5I5RA 3T2PA 5AZ1A 3WMSA 3FAXA 4JN8A 3WNPA 4F0RA 1OYAA 2HISA 5D9OA 5F2GA 4O1CA 2PGWA 3EX1A 3FYYA 4WD0A 3WQFA 4N9DA 1UKTA 2BODX 4O52A 1E72M 2WJFA 1N7KA 3PUEA 3TC3A 4KCUA 2D73A 1GYLA 5HPOA 3GDRA 3UJFA 1R7OA 4KEUA 4D6HA 3ITVA 4JFUA 2J6XA 2ZZ2A 3M47A 4GBUA 1OBAA 3TW7A 1EQPA 1NWRA 3AS3A 3EB2A 4UTLA 2P10A 1YQ2A 5FIPA 2FB3A 1BEUA 1HL2A 5FESA 1UZDA 1JCMP 3A9IA 4US5D 4Y9NA 3FA5A 3JZEA 1PJ9A 5KSWA 3HG3A 2JK2A 2PP0A 4RZ5A 3XISA 1YE6A 4ZBCA 5CBBA 1P0EA 4BQ5A 2YCJA 4Q7NA 1M53A 1A50A 3QJAA 3V0SA 4MB3A 3WLPA 5I24A 1VRDA 3S2LA 1PDZA 4AQLA 2J62A 5FA5A 2PWVA 5CZSA 1Q6GA 3V0UA 4LUSB 2ZA3A 3ZIZA 3EWZA 3DU0A 1EC8A 3B0XA 4X0VA 1PPIA 4AIUA 4RZ6A 3MP3A 2DT3A 2J9XA 3GVWA 3ZLHA 5IBXA 2PZNA 3FW6A 4B5WA 2CBUA 4WY0A 5LIYX 2QAPA 5C2GA 3T0TA 3EA2A 4H9MA 2QEZA 1FXPA 3G8RA 3N18A 4RL3A 3T81A 3N2MA 4YTUA 3S9YA 3L12A 5F1UA 3P5YA 1ZTVA 1RBAA 3NQDA 1UWUA 1E5JA 1GJUA 3KOYA 1XLIA 1PSCA 3U2OA 4CEUC 4AISA 3EEGA 3HGRA 3KHJA 2WAGA 3NM1A 1EGMA 5CPLA 1VLIA 4Z2IA 1HL9A 3VOCA 1Q8AA 2PD5A 3Q94A 2WSRA 3ITCA 1TX2A 1BSLA 2QV5A 3B40A 1G7UA 1OT2A 3EX6A 3L9CA 1KFKA 1VF8A 1QI3A 4S3FA 2PWFA 4GMEA 4K39A 4QGCA 3B3DA 4XAPA 5FL1A 4YN5A 6TIMA 3BOFA 3ERPA 5TQLA 1S5MA 1JXJA 1LRQA 4IIDA 2RHGA 3LZ5A 4IQJA 2ZX7A 4AVNA 2J9ZA 2HJPA 4JQ1A 3W7DA 1RVGA 4MJZA 1N8FA 4FX7A 6ALDA 3QYSA 2VOMA 4ATWA 3SQLA 3P8IA 1LLOA 4TIMA 3DX5A 1I2NA 1MFVA 1UQYA 1UUQA 3KXQA 4X2PA 4WQ6A 3CO4A 3U2EA 4UTMA 4IT1A 2ZC1A 4J3SA 3LM3A 2CIPA 3QFEA 1R3TA 1E3XA 1XH0A 1CX9A 1X6LA 2TRSA 2DZWA 3LTYA 4K3ZA 3I68A 4PRRA 2JGQA 3OGRA 1J8VA 2HDJA 4H8NA 4WCJA 3R0DA 4XKMA 4ZCWA 2V3EA 1NQKA 3PN8A 5EY5A 1XRFA 2VEFA 1VAHA 4G2DA 5D32A 3CHCA 4KRUA 2IQTA 3JS3A 3RDKA 5I0DA 1W8SA 2HSAA 2ZXBA 3VO0A 1QOPA 2XFWA 2J66A 2E7FA 2MANA 3F5KA 1VPXA 2E09A 4WSJA 3CAKA 2GSJA 3VM5A 2XJ7A 4ZQCA 1WDQA 1MW3A 1VFFA 3RCMA 1H1YA 4J3VA 1NP0A 4V28A 4KKXA 4GINA 5HJXA 3TFCA 2YYUA 4WSKA 4GG9A 3CH9A 2X1SA 2RAGA 4GA8A 2O9PA 1KWGA 4V1XA 1V08A 3VZXA 4YTRA 4C6MA 1BD0A 1P43A 1H62A 3P81A 3L5LA 1LF1A 1FWDC 2OYMA 3PNZA 2YBTA 3F1QA 2WC4A 2PFHA 5CPNA 4O1FA 1GOOA 2YLLA 3MHGA 3CTLA 1GOQA 4H19A 2VFEA 5T26A 3VFCA 4JNZA 4PMNA 1XV8A 3L4ZA 5ECVA 5CLWA 3UJRA 1XIMA 1OIMA 3BXWA 4MWAA 4YCPA 4AY8A 3NQ6A 1VFSA 5LIUX 3GZAA 3QGKC 4O11A 4YS1A 1R2TA 5AYIA 2ISDA 2J25A 4B2DA 3QPYA 2I56A 3NO5A 1YPIA 1Z44A 3TROA 4O10A 5FEXA 5CSUA 4HU8A 1CDGA 2NSXA 1VJSA 4XV0A 4DELA 1GKRA 2D69A 1D8WA 3U4FA 4C6JA 4GXPA 1V6VA 2AL2B 1R3YA 5KZMA 1TR9A 1VIWA 4UFIA 4P8UA 3CHVA 3USBA 2A3CA 4OWGA 2HV5A 3B97A 3AIUA 4RW5A 3VKJA 4DQWA 3ZR4A 1XW8A 4I5XA 1EF3A 3OIHA 1ISXA 1LQ0A 3REQA 5E6YA 1B2YA 1F7BA 2YX0A 2R8WA 1TWWA 1VFHA 2Y7DA 1WAUA 4N4QA 3AIQA 2OOFA 4PULA 1GTEA 1EUNA 3OQEA 4PMYA 1C8YA 4DI9A 3V18A 1PYFA 3GS6A 3MMDA 5DELA 3HG5A 2EG8A 2CLMA 3WSUA 3TC7A 2QKFA 2OPJA 4S1FA 1TKKA 2PAJA 1XICA 4YHEA 2OWCA 4CD7A 2QAFA 3FNDA 4EANA 4Q6JA 1SGJA 3CUZA 1JRBA 4UTJA 3BUVA 1Z48A 1F74A 2Y89A 4HNLA 3M16A 2QNEA 1J01A 4OHQA 1QXLA 4A21A 3CPGA 3LGEA 4F8XA 5HMFA 5A6KA 2CCRA 3OZYA 3EWWA 1DWHM 3VI2A 2RUSA 2OJPA 5IOBA 3VNDA 1G4TA 1WZMA 5T9CE 4H83A 2WMFA 1NIUA 2GQ9A 1E40A 1E0WA 4LS2A 5CC7A 5TF0A 2TMDA 4ZENA 2G3NA 2WWCA 1CWYA 3NGJA 3NSMA 4E4FA 4A05A 4JNMA 1XGZA 4PODA 1TR1A 2AMXA 4DWDA 1AQFA 3MP5A 4ML9A 3ZT7A 3NZ1A 1PCKA 1AMKA 2DVTA 1EX1A 3PPCA 4GZJA 3DHUA 1DJWA 5JH2A 3FSTA 3C0LA 4CD8A 1VS1A 2QCDA 1H7NA 3IEBA 2X1TA 3ORWA 3VGEA 1R9ZA 2V3FA 4UOZA 1UA3A 2VRJA 1CPUA 2Z7GA 1WQ5A 2VZSA 3GNPA 1RHCA 3NQFA 3WLQA 3NVTA 5LA1A 3B04A 3RXZA 5CCZA 4V15A 4NG3A 3QTPA 3T6CA 2YOCA 2Q71A 2FH8A 5LA0A 1UCWA 1CLKA 3N2TA 3N3MA 5BNKA 4LW7A 2TYSA 4HHHA 3W88A 2NSOA 4RX0A 3LCLA 1L6WA 4HNCA 4PFMA 4I7VA 4I9JA 4QISA 3W2JA 3TJXA 3NDYA 3WYZA 1EHNA 3M7WA 4RNHA 1LDCA 3PBMA 1AODA 5HQLA 2C1HA 2IXUA 2F6UA 4QDWA 2CEQA 3ITXA 3BAKA 3NQBA 2XFYA 2VEGA 3BW3A 2J8GA 1R38A 1JAEA 3P6LA 3UR8A 3CPRA 4Q7BA 4X61A 4AG0A 1YYAA 3T07A 3CHEA 2R14A 2VI0A 4MFDA 1WE5A 2OR2A 2Q8LA 2F38A 4CKQA 1TV4A 4YTSA 4PSRA 4OJYA 4REQA 2Y24A 4UQ9A 1YMYA 2YL6A 3EXRA 2XVKA 1OINA 3V16A 6CGTA 5LHEA 2EHHA 4DZHA 4CUCA 3W7MA 4WHBA 1R87A 3ZMRA 3MANA 1EJUC 1GUVA 5HNRA 4O1DA 4LAZA 5E9XA 3OEXA 3TQVA 4WY0F 3F5JA 4B4HA 3NM3A 4QITA 4WOZA 3WQPA 2FYMA 2GVLA 3M0XA 2Y5SA 1S38A 1J0JA 4AXKA 2GPTA 3BW2A 1E43A 2NW0A 4GY0A 1L9WA 3E0VA 2JF6A 3O0FA 3FA3A 4A8LA 3I10A 4HNVA 1ZJAA 4FZIA 2XVNA 2YLAA 3N9KA 4IIBA 3GR8A 3L67A 4O54A 1JGIA 1C9DA 3LM7A 3H54A 1TV8A 2H3DA 1TQXA 3S2MA 5I3IA 5MKGB 2OWWA 2UY3A 3WK3A 4NILA 1N8IA 1OCBA 3ES8A 1TWZA 3HFYA 1NARA 1PXGA 5ABFB 1EA0A 1ADOA 3QHNA 2WZMA 4IF2A 1K1DA 2WSQA 4D71A 4PZVA 4D2JA 5GNZA 5LNVA 4FR1A 1UBPC 1LBMA 4G7FA 1RLDA 4LVBA 4I6KA 3RO6A 4B5NA 2A3BA 3LLFA 4NNBA 2J7HA 4TXEA 4DO5A 1H4PA 5LGZA 3R13A 1BHGA 1FUYA 4LBRA 2A1YA 1TV7A 1K8XA 4NYUA 3CUGA 4DUOA 1FWBC 1TV3A 3C61A 4F9JA 3ABOA 2XWEA 2DIKA 3GD6A 1BRLB 3EWYA 3GG1A 3BOLA 3G1DA 5C2XA 3JW7A 1MNZA 4DWSA 3C2OA 2GQ3A 4EXBA 5AB3A 3VE9A 1E5NA 5EGRA 5F4WA 3NQ8A 4RDYA 1DORA 2QCFA 3GHUA 3QXBA 1VIZA 2WMKA 1EWEA 5T8GA 5JU6A 2FZDA 1REQA 3A4WA 2WVSA 1M3UA 1JYXA 1NELA 4CN1A 3LZ3A 1KFJA 1OCJA 2IUZA 2G95A 3A9BA 3U3HA 1MEWA 2VRKA 5AY7A 3UNTA 1MNSA 3TCEA 2WBGA 3WH9A 2OZ0A 1GVFA 1NSJA 3MPGA 2YR1A 1JUEA 3Q2DA 2B0MA 5H8UA 3R8HA 4U5IA 3F2BA 3UR7A 1VFMA 1RD6A 3WJXA 2HBXA 3EWXA 2BHUA 1KFWA 4YWIA 5I03A 3R8GA 3CK5A 1QI2A 2WNQA 3DFSA 1SMDA 1D2KA 3URNA 1OX4B 3ZLGA 1UG6A 2OLAA 4DBUA 1HKIA 3W1QA 2B81A 2G8ZA 1IZCA 3I3BA 1GQNA 2ZZ4A 4DUXA 3WD4A 3P3BA 3D3FA 4D9PA 1FXQA 5CC5A 5AC6A 4F9DA 3NURA 4Q8UA 3GHSA 3C2EA 3SCWA 1UUOA 1H50A 1XIDA 3BH4A 4LOCA 4ML4A 3NEHA 2GJXA 2X41A 4LY8A 4JQ2A 4IPNB 3ZSSA 1H5YA 2AL1A 4DYJA 3SIZA 3ENLA 3F4VA 3TW9A 4UTIA 5A8NA 1EPVA 2PDPA 4XAGA 1H09A 2PE4A 2Z00A 2VJXA 2EKCA 2ZWYA 4MZ8A 1A5BA 4GE8A 1JZ6A 3O8AA 4ZQPA 1I6NA 3MA8A 3AAMA 2C14A 3L23A 1B9BA 2ON3A 4Z2GA 1C92A 1PZ3A 4XWUA 3LXAA 4A29A 1ONEA 2V5JA 2E28A 1GG1A 1H41A 1SMAA 3UZZA 1AW1A 4OGZA 3I4EA 1F6PA 4FP1A 5IM51 3CTTA 2XSXA 5G1YA 4PTXA 1NF0A 4AIOA 4IP7A 1LROA 3W3OA 3C2YA 4UTTA 3O63A 1B3YA 4RK8A 1JZ7A 1W5OA 2OO0A 5MF5A 1B3VA 3L2IA 5K9CA 2ZUVA 2WC7A 1GOIA 3S9IA 5C8BB 3GX9A 2IPGA 3UWEA 1HUVA 4B16A 1UHVA 2INZA 3M43A 2BV9A 2RJHA 5BCAA 5FOOA 3W2MA 3CQKA 1W54A 4QJ3B 3EOEA 3WJYA 4Q7IA 3KEHA 3CJPA 4FA3A 2PRLA 1Q4NX 3M0IA 4KESA 3D5HA 4LVGA 2QJGA 1SFLA 3W84A 2PDCA 4N02A 4DZIA 3OQ8A 3OTRA 3W7QA 1VBJA 3S5ZA 3LBCA 3A21A 3L4TA 4IXXA 4AU0A 5HUOA 2VYOA 3B8IA 3H26A 1L2UA 2I1OA 1FFQA 4DJEA 3RITA 4RV3A 4UMCA 3EMCA 2OTDA 4KWWA 4NJJA 4BK9A 4E8GA 2YW4A 3H2NA 4HNUA 3KCJA 1AL8A 5ABGA 4N9BA 3W28A 3DECA 4XD4A 4D6EA 2BXYA 3UXDA 2H9AB 5AYYA 3O16A 2NXHA 1DTUA 4NXSA 1KM4A 4KRZA 4OT7A 4RE4A 4P7NA 4GY7A 4Q4KA 3UWQA 3C2FA 3VE7A 3U57A 4R88A 2DZBA 1XF0A 1PKLA 4BEUA 1SW0A 3LV5A 3I3DA 2R1KA 1SSDA 1FWJC 4H41A 1SW7A 3VU2A 2B7QA 2PF0A 2ACQA 3SR7A 5LHFA 5C0QA 1JZ5A 5HBFA 4HK7A 3UVAA 1AQMA 1KM5A 3G3MA 3NYDA 3KP0A 4CD6A 4GD0A 4Z17A 3TONA 1GKQA 2VWTA 1F61A 4G7EB 1QPKA 4C91A 2YA2A 3PWGA 5DMLA 3WQ8A 1DQUA 4AD2A 2QLYA 5EMYA 3Q65A 1EO7A 1WUEA 2J6VA 3GH5A 1VD6A 5D2WA 3I65A 3MSGA 1UBSA 2NV9A 3HPXA 2Z27A 4UC5A 2QDHA 1I4NA 4RNFA 4AZ7A 1P6BA 1B3WA 3FS2A 5BXPA 5CZ0A 1L0PA 4Q3MA 4JX5A 2A3LA 4QCFA 3CEPA 4PMXA 5CSSA 3CS2A 1O94A 1E4LA 1NFGA 4B4FA 1GOXA 1TVPA 3GTFA 1DHKA 4F0MA 4HD5A 2QCGA 3VKBA 3UWWA 3KM8A 1EIXA 1FTXA 4DBSA 1GG0A 1LYXA 1SO4A 1LM1A 1TA3B 3MMWA 4Y9MA 4LANA 2FIQA 4HOWA 1IXPA 4K7YA 1KBBA 1XBXA 4Y96A 3DFYA 3AO0A 4LYQA 1A80A 4LYKA 2CLEA 3R94A 1PUDA 2FVLA 4CVUA 1ICSA 4J40A 1RZMA 1YE4A 3VD9A 4JZ5A 5CBIA 1QW9A 1OYCA 4DEFA 1B54A 1XHGA 2D2GA 1KFLA 4JHOA 5TBOA 4CNTA 1A49A 2O92A 3TV8A 3EOOA 1W56A 2ZXDA 3D0CA 3SO7A 4A8IA 2WW5A 3MVIA 1LLZA 4W84A 1UKSA 4G1KA 4Q22A 2FZBA 4RE2A 3U6WA 3M0YA 4IIHA 4JTTA 2DUZA 4JTRA 5KTLA 1XM3A 3AMLA 4A2SA 3U5UA 1XFCA 3M5XA 4IOTA 3QMSA 1JDAA 3NAVA 1FWSA 1ESWA 2G97A 2R1NA 2YA0A 3VGHA 2Y5EA 5A2BA 3T8QA 1E4NA 1OG0A 3VIKA 3WIJA 4JY8A 2FTWA 1GWJA 5A95A 4MY1A 3LXBA 1IXQA 1X8FA 4MDPA 3ONBA 2CZDA 3CHFA 1TPC1 2DUXA 1B4EA 4PCTA 3A4XA 1BSIA 2FPYA 3LGGA 1JPDX 1VQTA 1YADA 2P8CA 4E8CA 1NEYA 3FXYA 1GVYA 2Z7KA 4LPCA 3MSRA 2CZVA 3PSVA 1S5NA 4TV5A 3HN3A 3ZT5A 4EVZA 3IS4A 2ZZ3A 3W1MA 2W79A 3B9DA 1NJJA 5GJMA 1QU4A 4ZE5A 2ISFA 3TFXA 4GQBA 3N6HA 4LCSA 3WK2A 2V38A 1WO2A 4JFWA 1XLMA 2ACSA 1RV8A 4TR9A 2AKMA 1O7AA 2XWDA 1PTDA 3LUTA 2OT0A 4GX9A 5H91A 1SR9A 1WDRA 2ISVA 1W1ZA 2X0HA 2ONEA 3NQEA 2XZ7A 1QCWA 1C3FA 3W25A 4MWAE 2OELA 5F2MA 3BAIA 3YPIA 4Z2KA 3W83A 3ZJ6A 4JHZA 1I2PA 4W86A 2GVJA 1PWLA 1RLCL 5G4HC 5AHMA 2XISA 3S2JA 4AZCB 4B92A 4QS6A 5M17A 1YIXA 1K6AA 3HGJA 5GPRA 4DJFA 5CQ1A 3ES7A 2ZUUA 4PB3A 1D7FA 1VYRA 1OD0A 3N04A 4XO7A 4P2VA 3NXFA 5AHLA 1E6SM 3KHDA 3OLEA 3V4BA 3KL5A 2FB2A 4L9XA 4H2HA 2PTXA 3TSBA 1JUKA 3WFLA 1MFUA 4JTJA 1QNPA 4AWTA 3WH7A 3W87A 2ZQ0A 3R5EA 1XLJA 3SCTA 1X38A 4CNSA 4PMOA 4C60A 1A5AA 3M64A 3W2UA 2WZTA 3N73A 3P0XA 4LH8A 4CD4A 1TPWA 4JOMA 3FX4A 2PLCA 5AYBA 3T8LA 1RY0A 1FDJA 3OZOA 4M24A 1ITQA 4AB4A 2VDGA 4ZSTA 3WQOA 2VZTA 4M8UA 1VYPX 1QWGA 1FH8A 2XH2A 3NQGA 3LENA 5HNNA 4JDBA 3C3NA 2ZCGA 2VDIA 4JCMA 3EPOA 2YFNA 3A64A 1ICQA 2MNRA 3CO8A 3Q45A 2NWRA 3DCPA 4CEXC 4FR6A 1W2VA 5HNUA 2ZDRA 5A8PA 5PTDA 4N42A 4XZNX 3VOGA 1UP0A 4JPGA 4W85A 1KTBA 5CZKA 3S4TA 3NDZA 2WYSA 2WKGA 2XYLA 2CYGA 1ZLPA 1VPYA 5A6BD 1A4MA 4AF0B 2DP3A 2QJNA 4GUIA 3VMOA 1KRCC 1K3UA 3FGCA 7PTDA 3GTIA 5EKYA 3WL1A 1WXYA 2QIIA 2QPUA 2DDXA 3UU0A 3W2LA 3QQWA 1TJ0A 4QEHA 4CU7A 3LTSA 1J96A 1EFZA 1U1UA 4C1LA 2PDQA 3PSWA 2QULA 3BCJA 2RDUA 2ZA1A 5IDIA 3CMJA 1ISYA 1OC5A 3M0ZA 1V51A 2IKJA 5CAKA 1THFD 4JIIX 3TTOA 3A4JA 3MBDA 1YX1A 5IXEA 3ARQA 2OODA 2P76A 1QT1A 5A5WA 3WQ6A 2A85A 3U7BA 4LUSA 2C1GA 1KCZA 3QV6A 3HO8A 2DVUA 3QHOA 3MMTA 4JTCA 1P6WA 2TPSA 3VIGA 1XS2A 4IJBA 2VD9A 4P7QA 3NQ7A 1TZ7A 3D3AA 1Q45A 2CLPA 4XZBA 3I6RA 1HX0A 3WEOA 4KETA 3POCA 4MHBA 2FGLA 2WBKA 4LRTA 3GTXA 1S46A 2O7SA 3S1VA 2PDWA 2OEMA 3AMKA 2REQB 2Q6ZA 4MPQA 1L6FA 2HQAA 2C6QA 2ACRA 1UYQA 3NQMA 4I9MA 2I5IA 1ECQA 4LFYA 7ENLA 4F0HA 5KZ6A 3IANA 3TUUA 1ZUAX 2ICSA 2G96A 1C8QA 5A8MA 1YDVA 1RVKA 2QVHA 3R7MA 2XTKA 5HMEA 4CN4A 3SECA 2CPUA 1MQPA 1OJXA 1IEQA 4JYEA 3VDAA 1BYBA 4JNYA 3OA5A 2CWXA 2HZGA 4HA3A 4D6CA 2XM1A 3VIIA 2OX1A 3BDKA 2PD9A 3IACA 3KTCA 1D3CA 3JZUA 1Q6QA 3SIMA 3UXKA 4X3ZA 1DIEA 1ZP4A 4PR4A 1RP8A 4JAWA 3TXZA 3W86A 3MO7A 4YWSA 3W26A 4PTWA 2WMIB 1UA7A 2QCNA 1A0EA 1CT5A 3AC0A 3W7CA 3L2LA 1XDLA 2CITA 4EF9A 5GQBA 2HVMA 1NDWA 2OEJA 3WLMA 1CGVA 4GVHA 3WMLA 2HXUA 1QNQA 4W8BA 2X0SA 3LI1A 1J0ZA 3CZEA 1ITCA 3H4GA 4RPPA 5AVNA 2V68A 2VD8A 5DMYA 5BYWA 4DXXA 1L6GA 3VOIA 1ZJHA 4ZSUA 5DT7A 3V3WA 3ZJ7A 4IMAA 3MO4A 4JN7A 3AYRA 3W7RA 1MRQA 4AC1X 4OZOA 3IJQA 1N55A 3MHFA 3NYZA 4UR7A 3W00A 1DXIA 1YPXA 3CV2A 1XIIA 2YBVA 4PRTA 4TMCA 3K8KA 4NZ5A 1K9FA 3CV7A 4LALA 1J2WA 1EL3A 4ZA0A 5CPMA 2XN1A 1RBOB 3W23A 1OX6A 3L5AA 4Q33A 4XKYB 2W67A 3PZOA 3CIVA 4WJEA 3W0KA 2OGJA 4NJKA 3N9RA 5LXEA 3UYIA 4KIEA 2Y8KA 3PS7A 4AZHA 1KXHA 3BE7A 3WDIA 2OSWA 1MW0A 4FF7A 3B4UA 4HN4A 4LYRA 4LWWA 4U4MA 3LX9A 3W74A 1HNYA 3CNYA 1T8QA 3NL5A 5HQMA 2Y0FA 3M7SA 5CSYA 4BI6A 1EB3A 4MADA 9CGTA 3PAJA 3GDTA 4AMCA 4IGSA 2GGEA 5CG7A 3HZ3A 5CLTA 1TMLA 3MV01 2X40A 3SN0A 3GU9A 3BAYA 3PUDA 4FI4A 2Q01A 3HV8A 4M56A 2PWHA 2HNHA 2Z4GA 4J5NA 3COTA 4Z0SA 1XSKA 5D2XA 3W7HA 3WNNA 3PAOA 4I9TA 3G0UA 4LCQA 3VGBA 2VM8A 2DT1A 4EK7A 1ZNNA 2VFIA 1NY1A 1OYBA 3AU2A 3LA4A 5BOEA 1KBJA 4ZR8A 1X1OA 4P8VA 4KIRA 2UBPC 2W66A 3OIXA 2WNWA 4L4OA 3VUPA 3H7UA 1VHNA 3BAJA 1M04A 3T78A 1BGGA 4CCCA 2VNCA 2PDIA 3WBEA 2VGIA 2GJNA 5AVHA 2ZX9A 1SZGA 3SUTA 4BZYA 2TAAA 2XSAA 2AL2A 1OX5A 1VCGA 3IAPA 5CGTA 3KCLA 3HMCA 3W22A 3GO2A 4IMEA 1R3QA 4XVDA 4FXRA 3LYEA 4IIGA 5HWNA 5D03A 4HPNA 1WDSA 3L4WA 5EA9A 1T5AA 3F03K 4HHMA 3N2BA 2VENA 1XD0A 2HE5A 3VDHA 1DQWA 1OY0A 4TX9A 3W7LA 1NOWA 4GGHA 4KS0A 1XUUA 3EMZA 1P0BA 3M6YA 4Z1CA 1RK5A 4PTNA 3S3GA 2OQHA 4ECLA 1UD2A 1KTNA 4J3TA 1XLDA 3THDA 2VFGA 4PCSA 4O8RA 1HJUA 3NUKA 2RDXA 3TA9A 1IR2A 3G6MA 3MS8A 1RUSA 3M5YA 2QMJA 4Z42C 4E8DA 4R7JA 4G9PA 1JQVA 2NLYA 3WLJA 2YCLB 3JUGA 4OBSA 2BFGA 1QOQA 2DIJA 3AIRA 4OFCA 4K36A 1V0NA 2PLMA 4JQ3A 3LCXA 4WDWA 4KGJA 3UCDA 1U30A 3ZYZA 3LQGA 1XRSA 5D2VA 2HS8A 1LWHA 2GGGA 3TQKA 1MI3A 2YL5A 4J35A 2I14A 4Q8WA 2D0HA 2VC9A 1TFVA 4A3YA 1S2CA 2GGIA 4P8WA 3W2KA 3ZVHB 1EZWA 4AX7A 2JALA 4Y9AA 1W1IE 1F3TA 4PEKA 1F8IA 4JTKA 3U9IA 5AFDA 4D6FA 1UR4A 2V82A 4XBKA 5J5RA 2CNCA 2IKGA 1OWQA 3PJWA 5J8LA 1M7OA 1FWAC 3WQCA 2GDUA 2OSYA 4MF4A 4CNUA 5BWAA 1DHPA 1FWNA 1XUZA 4PEEA 2ZICA 4S3DA 5CGQA 3P80A 2YKKA 4UOQA 1E4IA 1GNXA 4QHRA 3TSDA 1PYMA 4P7LA 2ZRUA 3K1DA 1BYAA 3IARA 2FMNA 2WVUA 2C16A 1QW8A 1P7TB 1Z42A 3DEQA 1ZQ5A 4CQAA 4F79A 3WBXA 3NTYA 1OFBA 4YVXA 4C6KA 2ZA2A 1FA2A 3KL0A 4L65A 4FX6M 4YMZA 1O6IA 1W6TA 1VKFA 3DC0A 3M5ZA 3FV9A 2PCQA 3UY7A 2VEMA 5GVJA 4MAVA 1SM9A 1IT0A 1C90A 4AHOA 1JZ4A 1IHIA 5K3VA 3T7VA 3CQJA 1R3RA 4BY3A 3OBEA 2P3ZA 4JL2A 1S2WA 2WANA 3AYTA 1W3IA 1HF6A 1HJQA 4PRWA 3GZ3A 4A3QA 5F7UA 1DE5A 1GHSA 2X30A 2A79A 3TC6A 2WSPA 3W1PA 1XYBA 2G3IA 4PTVA 1AH0A 3MUY1 3QV9A 1Q66A 1ONWA 1E0VA 4AZ5A 1F3EA 1HQTA 1RJQA 3TJ4A 4EKJA 4LV4A 3EDFA 1E9LA 3II1A 3UQNA 2PP1A 4XIAA 3K8LA 3A47A 3MUZ1 4M81A 4Q6XA 3ICJA 3ITOA 1PB0A 2FTPA 3PY2A 3W2NA 3EPNA 3I7QA 1YTKA 2E5BA 2XFRA 3CXOA 1UWIA 4MLJA 1X6NA 1A5NC 2IKHA 3TDFA 5JUVA 3C86A 2PI6A 1OF6A 3BW4A 1UASA 1W3HA 4ZO7A 3IJ8A 3OG2A 3B06A 4MUZA 2IMRA 1XQKA 4GK8A 2C13A 4H6EA 4M51A 4MWAD 3C2VA 2PLJA 5MKGA 2YXOA 2JEPA 3XINA 5DFAA 1A47A 1BTCA 3OYZA 2ODOA 5E1QA 3PBWA 2IPJA 5ABFA 4L80A 1UR2A 4WKFA 3P93A 3QKEA 4L6OA 3TVAA 3GXFA 3VABA 5M03A 4AW7A 4HCHA 6TAAA 1AW5A 3QSRA 4RDVA 3GDKA 4LB3A 3AIEA 1Q6CA 5K9XA 1QI0A 3HTWA 1BYCA 4Q8TA 1KCKA 4Y2WA 5M3WA 3N29A 2CFFA 2F9RA 2Z2AA 3SGZA 3ARZA 3VFLA 4FLOA 4ZB0A 1TPH1 1KLYA 4FLQA 4QXIA 3P61A 2Z0IA 1D3HA 3FJ4A 4OECA 3ZJKA 1T6MA 7ODCA 1BRLA 3PZVA 4LY4A 1RBLA 1E15A 4XAZA 3B8TA 4HZ8A 2D0GA 2PDFA 4E2OA 1RK6A 3KRUA 2OEKA 1W3KA 1NH6A 2YYTA 5FF2A 1HO1A 3WNMA 4EAMA 2BY1A 1LBFA 2HWGA 1LRTA 1XYFA 1VBHA 3P0WA 9RUBA 2Z6IA 4DM2A 4MKSA 1XGEA 4RJEA 2ZUTA 1O66A 1R5YA 4IHCA 3H12A 4YXGA 5C9RA 1NOFA 4R7WA 1OGBA 1GONA 4WZHA 4LVAA 3DHDA 2A5HA 3SRHA 3T08A 1W9XA 1JCNA 1KRAC 2JEQA 2Z2UA 1W3LA 2W5FA 3D47A 2NUYA 4WSHA 1HT6A 1GYNA 2OT1A 3XIMA 2V5LA 5D8ZA 1HVQA 3OVPA 5G5IA 3GNDA 4EE9A 1SFSA 3ID7A 3JVAA 3VDBA 1FOBA 3VA8A 4HYWA 3LBOA 4WGHA 1W91A 3S42A 3WJWA 5AN7A 4B5VA 4LJ3A 2B4GA 3E38A 4XSLA 3F2CA 7XIMA 5FL0A 4L9YA 3KOZA 2PF8A 4BEQA 3URQA 4UQBA 1FWEC 1OK6A 3QC3A 3ZSTA 3T0AA 2YA1A 2ZVRA 4PUMA 4G8TA 4CQCA 3FKKA 2DIEA 1VJZA 4OQVA 3CZKA 3VOFA 5I23A 4X0NA 5D8WA 1HTIA 4LX4A 2JGYA 2E0PA 1IEIA 3GC2A 3IV3A 4CQ9A 4GX8A 4I3GA 4GZ7A 1D3GA 1EA9C 4GACA 4N9CA 5AC4A 3G1AA 4FX8A 3AXXA 1R85A 5FKYA 3URAA 1X7IA 1DKWA 2EEXA 2V67A 2NT0A 3UZYA 3IGHX 2VX7A 2OFJA 2VL4A 2J74A 2VVSA 4TX8A 3SRDA 4Q8PA 4TTGA 5C55A 3GDBA 1JULA 4CNOA 1K70A 1SO6A 3QTGA 3DXIA 2GL5A 2PDNA 3NL3A 4HCLA 3S83A 1ISWA 3EAUA 4UFMA 1GT8A 1I1XA 2ZKMX 3RK8A 1EPXA 1KXVA 3O0KA 3RPMA 5KZEA 3GXTA 1ONXA 2XM2A 4HYVA 4C1NB 3APGA 4N4PA 4S3BA 1LL7A 2NX9A 3T2QA 4W88A 4GCXA 3PZUA 4QLKA 3LI0A 3CL6A 3F4NA 4RCXA 3WELA 1EF2A 1ZBCA 1GW1A 4RDZA 1EC7A 2BP1A 5T91A 1RH9A 4M1RA 2WQDA 2AGKA 1U33A 2G50A 3GH7A 4HPJA 3EGJA 1CXFA 3WMBA 2ZRXA 3L4YA 1ITXA 4AWSA 3PPHA 5DY2A 3AHYA 3DAQA 1TPFA 3DYOA 4PMDA 2YJQA 4ACYA 5REQB 2CLFA 3W1AA 1NDZA 1UKOA 3ARPA 3IGXA 4FMVA 3TEVA 4J28A 3LLDA 3E2QA 4JR5A 3WG6A 3OGSA 1RPXA 4ZFCA 3W82A 1CYGA 3N3TA 3PM6A 3WX7A 5C5YA 1YW1A 3MJYA 5I06A 3QBUA 3OLIA 3LS9A 1QHZA 1TQJA 1TIMA 4FALA 3RMEA 1V3MA 2WCAA 3IRSA 1J93A 1W9DM 1F4HA 2ALRA 4GI6A 2VEKA 4QS5A 2JKAA 2X7WA 5K2ZA 3M46A 3PBVA 4AXNA 3K4AA 3H22A 3R4IA 5LXXA 4O53A 1QNOA 1PE1A 4MOZA 4C90A 3EX2A 3CZ8A 4NQ1A 3URBA 3FJLA 1GKPA 4AEOA 1B3XA 2QJIA 4GHRA 2GWGA 1XYCA 5E6ZA 3GXMA 1ZENA 1ENUA 2NT1A 3HV9A 3GC4A 4G7EA 2ZTKA 1CLXA 1I75A 3UJ2A 1FWTA 2W3ZA 1WBJA 5FI8A 3CZLA 4ZE4A 1GZGA 3BMVA 3DG3A 2R24A 3RO8A 1EX5A 1JCJA 2WVVB 1R3SA 1VJIA 1TPVA 1I2QA 3AICA 4JD4A 3SDOA 2BOEX 3B8DA 1XLFA 4IIFA 1E6NA 2BVWA 5FJOA 2VEPA 3DYMA 5DY3A 4Z1AA 3PG8A 1FDYA 2HCVA 4YYFA 4NJGA 3QR3A 4KFPA 2Z28A 4BS0A 3L21A 1R2RA 2XIJA 1CI1A 3VM7A 4L56A 6XIMA 1RCXB 4RR4A 1GZJA 1EP2A 1MDLA 2XGIA 3K4DA 1PHWA 2EO7A 4XAFA 2NVDA 3VVGA 4LRSA 3S5NA 4ILSA 4PUEA 4JTQA 3B9OA 4JEJA 3GIQA 3DHFA 2P0OA 3G6LA 3MZ2A 4X60A 3P82A 2YFOA 2YL9A 1E3ZA 4YPJA 2Y5JA 4LU0A 4M29A 4GYJA 3M41A 1W5MA 1XGDA 1HJXA 1KBKA 4J2PA 1YRRA 3SCOA 3W9ZA 4IQEA 5CZTA 5A6BA 2F84A 5I3JA 3AHTA 1RAKA 1HIZA 1DWGM 4HKPA 3DFHA 4H9TA 3TKFA 2DU2A 2DZXA 3SUVA 3RGTA 1US2A 4XD5A 3AQUA 1K02A 5T9BG 2C3ZA 3AXIA 3SCQA 4OBTA 2G3FA 1FDZA 1WKFA 5LNWA 4WGXA 4NAFB 4Q8MA 2C0AA 2EPNA 5CG0A 3WMCA 2DJLA 1S2TA 5AKQA 4TVDA 3VCRA 3IK2A 1ZRQA 2E5CA 1VZWA 3MWCA 3E12A 3UWZA 3Q4DA 3MUAA 1EXPA 4GVGA 1ZCCA 4A3HA 3UCQA 1H7WA 3O06A 1HJVA 2E1DA 1JD7A 2F6XA 3N1AA 1WZKA 1E9ZB 3S47A 1CXLA 1JZ3A 1XDJA 5CPOA 4D8ZA 1DTNA 3K2GA 4OVXA 3HGOA 4GI4A 4I7UA 4QJ4B 3CMFA 3EX3A 2NXIA 1JD9A 1KNWA 2EKGA 2C19A 2VUYA 2WJDA 1DJNA 3WQVA 3PZTA 1S2AA 3GUGA 3A4AA 4UTWC 2FKPA 4CQ8A 3QR0A 1DJXA 3UZXA 1WNOA 2QJMA 3LRKA 2OVLA 2VR2A 1NTHA 3FHQA 1M6JA 3PHAA 4PB5A 3VIOA 4KERA 4DJDC 2C71A 3K13A 1NM9A 2DZPA 4LUTA 2CHOA 3PANA 1X6UA 5FF7A 3NZPA 1GVOA 3FSUA 1ITUA 2VQTA 4MUPA 4UQDA 4JX6A 2X1UA 3SURA 1BWVA 4C6DA 2J7BA 1FWFC 3DI0A 4Q4PA 2PRHA 1FP9A 3MUIA 4IPLA 2Z1XA 3MI2A 9XIMA 3C5QA 4AZCA 2H8XA 1F6KA 4U10A 3QOMA 1HGYA 1JDFA 3W4RA 3BG5A 1E73M 3SSJA 3AU6A 2G4JA 2GJRA 5CAHA 3P7YA 4GCAA 1V8EA 3TOPA 5HANA 3AS2A 4XZWA 4AD5A 4JTEA 1S1RA 1EP1A 1JFXA 1IXOA 1XISA 2I57A 4DM1A 1H60A 1K4GA 3EA3A 2YDRA 1GVSA 1TE1A 2C8NA 2Z24A 3VD4A 1JVNA 5AECA 3WJZA 3TXVA 1BPLB 4US6A 2PDLA 2VEIA 1JYVA 1G7VA 4L1XA 3W70A 3W1XA 3UA4A 2VGFA 5JH1A 3TA6A 1KFEA 1ZJIA 4D6JA 1KM3A 1NWTA 1L6SA 4Q8VA 3BG3A 3DG6A 3OG3A 1XC6A 3ME3A 3GXPA 3VD5A 4X9SA 1OGGA 3RG6A 4LNCA 1EJTC 2PWGA 2VT0A 2PDYA 3BLIA 3VAVA 5D2TA 2GJLA 2QZRA 2E40A 2ZWZA 1XBVA 4OIFA 1K9DA 2E6AA 3TU9A 4QCEA 1JXKA 5KINA 3UR2A 2DGAA 3NZQA 3WNOA 4ZB5A 5U7SA 4JIQA 3DYPA 1SVDA 3EWUA 2CZ5A 4YU1A 4LC8A 2PDGA 4IQDA 4W9TA 3DG7A 3M4HA 4DF2A 1XLHA 5DXXA 1Q13A 4IIEA 3ECQA 1UWQA 4Z1YA 1B30A 4JTLA 1AW2A 4ROQA 1JCXA 4AZBA 5LNRA 3KRBA 2Z26A 3NDOA 1CXEA 1TWDA 3N19B 3LCHA 2EXOA 4HVXA 3UXLA 3U2CA 1J0HA 4Q4MA 3TLLA 2P5NA 4PUNA 1J12A 3KRSA 1HVXA 3TLQA 8TIMA 3BANA 4XZMX 4DN1A 9XIAA 2DZTA 5KETA 5DT5A 4WXYA 1KCLA 1XSJA 1F3WA 4HMEA 5CJ5A 2VMFA 3LG3A 5EL1A 4JFTA 3OVQA 1PEZA 1SSGA 1SFJA 2FDMA 2E6YA 1G67A 3GAKA 1DQXA 3SCSA 3EZ4A 3SCUA 5A6TC 3SN4A 4ZQRA 3UCCA 5G2HA 3ARRA 4XB3A 4MKNA 4EPDC 3TCSA 3GNXA 1PX3A 1JCLA 3SFKA 3S0CA 1DWFM 3GG7A 3W85A 3MKVA 2ATMA 4RPQA 2CHNA 2GSEA 3O6AA 1UH4A 4U28A 4AD4A 4B91A 4FSAA 1TCDA 1OM0A 3CLWA 5HA7A 1TJRA 1XYLA 4NNAA 1G6CA 2O7QA 3GU2A 2UZ9A 4H2CA 5H2ZA 1BKSA 2O0TA 3SY8A 3D6NA 1LT8A 3BICA 3OP2A 4M7SA 1OZMA 4YTQA 4FF5A 4CQDA 5FJRA 3C8NA 5DXYA 2BVTA 4WX2A 3VCCA 4D6IA 3WN6A 1M7XA 3RCNA 3WO8A 1R86A 2DW6A 3IK4A 4E0CA 5U4NA 3T42A 1WUFA 3QSTA 1E6PA 4F2TA 5LSMA 2BX7A 4QAIA 2E3ZA 3G1VA 4MFEA 4UUIA 3KWXA 2F2KA 3FJNA 1FRBA 2ZUWA 2GUUA 3IVUA 4HIBA 3BK0A 4JKLA 3H2FA 3PZQA 4P5UA 1QTWA 1XPYA 5FJUA 2R82A 1UZHA 1CLVA 4LSBA 3MDWA 4FAMA 4E6MA 3EWCA 2XIIA 4S3KA 2XH0A 4AH7A 3UZJA 3REQB 1ZU8A 5FCZA 2OWXA 2VZVA 1XG4A 4XZ9A 1B31A 2J88A 4MY9A 2YCEA 3IWPA 5ABEA 2WMIA 5C7VA 2PSNA 2D2HA 4D6GA 5H8MA 2WLYA 4C1KA 4MB1A 4KGLA 4DXVA 4E4PA 1QRQA 2V5CA 4MPKA 4K6AA 3O6CA 1KM2A 5D37A 1F8MA 3MDUA 2YB1A 1TB3A 2GVEA 1XJBA 1XBZA 4FO4A 1FQ0A 2YZ5A 1CGXA 4DJFD 2Y2WA 3UGVA 2GQ8A 4B9YA 3B05A 3A3XA 1ALDA 1JCTA 3G5EA 3P2VA 4DX3A 1ISZA 2ZXAA 1H11A 2C7FA 4LCRA 2MUCA 1X39A 1HJWA 2QCHA 3M6DA 2WM0A 3RM4A 2OYKA 3TTSA 1W1B1 3S5OA 5M2FX 3UW6A 3INPA 4XKYA 1K8CA 2O4MA 1WBHA 3SGGA 1MQQA 2ZUSA 4LV9A 4MB5A 2D1ZA 4JTSA 3GKFA 3USZA 3GTHA 3DDMA 3QZ6A 1PX4A 4S3JA 4FNUA 3LHUA 2XPKA 5BWFA 3WQDA 3WLOA 2A6LA 2F8QA 3ZR5A 3H8AA 1R30A 4GZEA 4MDOA 3R0UA 3UZWA 4HU3A 5GJNA 4AZ6A 3QLLA 4DAIA 4ICNA 3E0LA 5HATA 2NQ9A 3BLOA 5TD4A 4QDPA 1H1ZA 1UPPA 3FYPA 4JTDA 4LBSA 4RV8A 4UFHA 2QUVA 3QY8A 3IVTA 5MHBA 1YDNA 3O1NA 4UNKA 3UG4A 5K7JA 2ZOXA 1GPFA 5BXRA 4MJ2A 2QR6A 3DGBA 2NQZA 3QMRA 1WPCA 1WDWA 1FWCC 1DL3A 3K1GA 3CL8A 3GTNA 5DRIA 1A3WA 3BO9A 3SEPA 3S2CA 3MTWA 1CB7B 3G1SA 1EYEA 1IEWA 4JKKA 4H9YA 3CWOX 4FS9A 5E0KA 2R91A 4GZIA 1RJPA 3QY7A 1MWOA 1FWGC 3ONCA 3I7SA 5EU9A 4EACA 4L5ZA 4UCGA 3A3WA 2I9EA 3TZFA 1SR0A 1DIKA 4E2DA 3FDKA 3E0FA 4O0KA 3W7KA 1F4AA 4QIUA 2WKJA 1YNPA 2NVCA 2OSXA 4AAJA 3UG5A 3E1F1 2QCCA 4OBRA 4N0RA 1LT7A 5IFTA 3PZMA 4PMZA 4V33A 2Z1WA 3T1GA 3MZNA 3ARSA 1EIBA 4AIEA 4J3UA 3WBAA 1O60A 1UR3M 2LLEA 3GYCA 4Y9OA 3DESA 5EYWA 4DWSC 3IJIA 3SCRA 3VNIA 1HP5A 2X1RA 4PBFA 2PLKA 4F0KA 1QHOA 1E9YB 3AZSA 1RP9A 1DVJA 1SZFA 1PAMA 1BVZA 1NQ6A 3TQ0A 3IIPA 5IDZA 4YLWA 2HTMA 3TX9A 1J6PA 5EFFA 3DBNA 3BQ6A 4H9UA 4DYEA 3R79A 5JXQA 3NPVA 5CJNA 5B7ZA 3FOKA 2H8ZA 1GCYA 1CGWA 2J75A 4A8NA 4MNMA 2WSKA 3L4XA 1TV5A 1FHDA 4H9ZA 3PJTA 1CCWB 3GG8A 5CZJA 3WLRA 4RW3A 3AZRA 1RA5A 2D24A 2HE8A 3N25A 3MV11 4L4PA 3PVFA 1Q6LA 2X7VA 3QEZA 3HA1A 2H6RA 3ZVHA 5C9UA 5JBDA 1IV8A 2ZFAA 5JQ9A 2PP3A 2ZZ1A 2E9BA 4B5SA 2VC6A 3QGAC 5G2WA 3ZR6A 2ZRYA 1GVRA 2ZUNA 3AJ7A 1G5AA 4GUJA 1UW9A 4UTFA 2QDDA 3LNPA 3BLPX 2BHYA 2J7GA 1LOLA 3OVRA 4JTHA 5M1TA 2HRWA 2VCCA 1SJAA 3DFNA 2QJHA 2GDQA 4LF1A 5I07A 3Q37A 1XLCA 3KL3A 4HU0A 5I7GA 1IXNA 2EJ1A 4JTIA 4INFA 5EMUA 4DWSB 7TAAA 2BVDA 1W5QA 4TOQA 1UMYA 4IGNA 4QQ3A 5HULA 1BQGA 4AYSA 1WXJA 1KA9F 1LL6A 3TIMA 4CCZA 3S9ZA 2HPIA 1P7TA 3TW6A 3N6JA 3WEMA 3OLDA 5CKSA 3TAKA 1E6ZA 3FIGA 3SJ3A 4GKTA 2YCKX 3SJNA 1Y7VA 3U48A 5KITA 1AH4A 2GGJA 4ZTYA 1EHAA 3TP4A 1H61A 1GGOA 4WJXA 1LG1A 2QMKA 5A6AA 3BV7A 4UTTC 4GLEA 3WLSA 2PDBA 4UR9A 1G1YA