1TVNA

Cellulase cel5g from pseudoalteromonas haloplanktis, a family gh 5-2 enzyme
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulase
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvnA00
2VI0A 1BLIA 4U5IA 1ITCA 1J9YA 1WCGA 3F4VA 3VO0A 2WVVA 1CLXA 4AZIA 2CKRA 2JIEA 1V6WA 2WVTA 4MPKA 3K8KA 1A47A 4RE2A 1GOWA 4F9JA 5ABGA 4BQ3A 3U5YA 3RO8A 5I5RA 2G4FA 4D1IA 1V3LA 5I6SA 3L4WA 1P6WA 3N9KA 1OM0A 4JIEA 2X09A 1UKQA 1BYDA 2WMJA 1ZS2A 1MQRA 3N13A 1HP4A 1ISWA 4A3HA 2QF8A 4P7OA 3W53A 3ARSA 2FH8A 4UQAA 5EMYA 1OT1A 3MMWA 1HL8A 2MANA 1PX3A 3WY1A 1CXLA 5JBEA 3RM4A 1PEZA 4YN5A 4F8XA 4UR9A 4NI3A 4WKAA 1HKJA 3ZJ7A 2A3BA 1R87A 2FHCA 1C90A 2O9TA 3IJ8A 1GW1A 3SIMA 3WH5A 4JKKA 2ZIDA 3WDJA 1DWGM 2VRKA 1VFUA 4ML4A 1W91A 2OLHA 2CEQA 4OBSA 4XB3A 4CU7A 3WDIA 1C7TA 5LA1A 4WJXA 4BS0A 1GONA 2AAAA 2DSKA 4H8VA 3M46A 3ZT5A 1ZBKA 1JDDA 2CESA 2WCGA 2E4TA 2WZEA 4PSRA 2VR5A 1CGYA 4X0VA 3PZNA 1DWHM 1QVBA 2E0PA 3SUTA 4Z2GA 3VINA 2BVDA 3MANA 5IDIA 3D5HA 1OIFA 2QPUA 4DWSB 1HJUA 2VTFA 3PZTA 1V6UA 4FF5A 3W27A 3DECA 5FL0A 3AFBA 3QHOA 1ITXA 2WSKA 2G3IA 1AQMA 2BY0A 2WMKA 4WF7A 3ZT7A 5GNYA 1GJUA 4CD8A 1W1PA 1CPUA 2EPKX 5AY7A 1V0MA 1H2JA 4C7GA 3AOFA 3B9AA 4TUFA 4E8DA 1EO5A 5CSYA 4PYSA 2J7CA 1J01A 1KQZA 1OGSA 1GOMA 1ISZA 6TAAA 2WCAA 5BYWA 3ECQA 1C8XA 3AS2A 5A8PA 2WMIB 2CITA 4Z2JA 2OYMA 4QP0A 1GUVA 3A3HA 5JIWA 2VX7A 2CCRA 1XSJA 2DT2A 3S2CA 4IUGA 5KZ6A 4IPNB 2DSZA 4W84A 4ZFMA 3VMPA 4F79A 2VJXA 3MO4A 1UD2A 2PWEA 3AS0A 5I79A 2D23A 2YL8A 3TP4A 5A6AA 3K1DA 5D9NA 5BXTA 3ZM8A 1JG9A 3D3AA 5DEZA 4CD5A 4W5ZA 1LJYA 3EMCA 4LX4A 1WKYA 1WO2A 1JYNA 4P7RA 1WPCA 3FNDA 2YA1A 2UWFA 3PN8A 1B0IA 2YLLA 4H8UA 1H09A 2VCBA 2VRJA 1JI1A 3OA5A 2Q8XA 5FKYA 2GK1B 3SUUA 1W32A 4W89A 1CYGA 1C8YA 1TG7A 2DSUA 1D7FA 2XTKA 1QI4A 1OB0A 3N12A 4JFSA 2ZX5A 2D24A 4N42A 1B90A 4GIAA 1GQKA 1HVXA 3VX0A 1CXKA 1CLVA 5A6LA 5GNZA 2JFEX 2YA0A 3W4RA 1UKSA 3ZQ9A 2J78A 1W1VA 2CHOA 1HF6A 1MQPA 1AQ0A 4D72A 5AC4A 3VGGA 5I23A 1UQZA 1UR1A 4UFMA 3WDHA 3WQWA 5GQBA 3GDBA 2QV4A 3VILA 5A95A 1QPKA 4V27A 1JNDA 4ACYA 4CUCA 5D4YA 3CZEA 3AHYA 1JD9A 1EH9A 2WNWA 4DM2A 1JL8A 2XM2A 1BVZA 4M56A 3A4AA 1ODZA 4HMDA 3VIPA 2NSXA 4UTFA 1H4PA 2BXYA 2WB5A 1UR4A 2GUYA 4PMXA 4U3CA 1XH0A 3ZJKA 1X6LA 2CBVA 1MW3A 2CHNA 3UESA 2WC7A 1UD6A 1ISXA 1JXJA 4S3KA 5E9AA 4PMYA 3FY1A 3NUKA 4MJ4A 1E15A 4GO8A 2ZXQA 4D6CA 4LYRA 2VO5A 4HA1A 4JFWA 2EPNA 5A6MA 4AIUA 1PJ9A 4GXPA 2YDQA 2WVSA 3W29A 1LL6A 2CNCA 1ESWA 3NJ3A 1JZ4A 4PUEA 3VPLA 5IXEA 2PWFA 1L8NA 5FOOA 3MMUA 3CZGA 4ZEPA 1UKOA 3AHXA 2G3JA 1F4HA 1TUXA 1V3JA 1KWGA 3WUEA 5CSUA 3APGA 3L2MA 4WK9A 2BVTA 5CQ1A 3MU7A 3CMGA 2DIJA 3GM8A 4TXEA 3F5KA 5GNXA 2CXGA 1HJWA 3OLGA 3VGDA 1JYXA 1Z32X 2ZXBA 3PZMA 1E9LA 2PWHA 3SCNA 3W0KA 4UOQA 4WKFA 3WENA 3BC9A 4OZOA 2XIIA 3UERA 2X0HA 1Q4NX 1H41A 2OYKA 3OZOA 3WQ6A 5CG0A 4GO9A 5IHSA 2BY2A 5CZKA 1UYQA 1EDTA 2XG9A 4D6EA 4PTMA 4EAMA 1HL9A 3BMWA 3BMVA 4LXFA 4W7WA 4CN1A 1PX8A 1E6SM 2WWDA 3L4YA 5BXRA 3VIHA 2E9MA 2A3CA 1J0YA 4KGJA 4JL2A 2W91A 4C7FA 3TTYA 2JE8A 4LQ1A 1JYWA 4MB4A 1V3HA 5LA0A 5HDRA 1G94A 2XGBA 3IJ9A 1JZ8A 5A8QA 3JUGA 3NIYA 5EFFA 3K4AA 3WF4A 3HN3A 2E8YA 1NWRA 3ZJ6A 4MJ2A 3W28A 5D8WA 1TZ7A 3N04A 1VAHA 3GTNA 2WZHA 1HJSA 1ISYA 1AQHA 2EQDA 4JCMA 3AISA 3W24A 3CBWA 1FH9A 3AIUA 5ABEA 1DWJM 1HJXA 2VVSA 5BXPA 1BSIA 1J0JA 1XH1A 1E0XA 3W6LA 3FN9A 4W85A 3AIRA 3SUVA 3AMKA 3T0BA 2DT1A 1UZ1A 3ARXA 2D0HA 3NSNA 2NW0A 2EBNA 2WHKA 1J0ZA 5E6YA 4M81A 2BY3A 2YIHA 2W67A 2VVNA 2OSYA 1O7AA 4QCEA 3CUHA 3CHFA 1MW1A 4DUWA 3AICA 1K9TA 2DGAA 1XHGA 3DYMA 3BLPX 3OGVA 5CLTA 3QR3A 4P8UA 1UKPA 4HZ6A 1W2PA 2GDVA 4UQEA 2J77A 1B9ZA 3WF2A 1KXQA 1UKTA 2GJXB 1EHAA 5ABHA 3VOCA 3VIIA 2JF7A 5CJ5A 3WNLA 1MFVA 2CETA 3IANA 1TE1A 3UR7A 3WNKA 1VJZA 4Q7NA 2YL5A 3SCQA 4N0RA 3PTQA 2XYLA 4U2ZA 2GVYA 2WANA 3L2LA 3IAQA 4AEFA 1IZJA 1MXGA 1NARA 1JNEA 4LYQA 4JFUA 1Q6GA 3T0DA 3CZJA 2GK1A 3GZAA 2ZUNA 3CO4A 3L4XA 1US2A 1XCXA 1CWYA 1LWJA 2WCSA 3SCSA 2J8FA 1E3ZA 4OJYA 4D6IA 4F9DA 1E6RA 1CXEA 2WMHA 1V3IA 3WQ5A 4MNMA 3RM9A 1QI3A 2BHYA 1V08A 2VQTA 3WELA 3VIKA 3AXHA 1WNOA 4AXNA 2XHYA 3CUFA 5EBAA 3SCUA 3BAJA 3EMQA 2HISA 1M7XA 1UG6A 1W1TA 4HTYA 4AZBA 4D1JA 4AZGA 4MAVA 1EQCA 3ZO9A 1H0IA 2VT0A 2BS9A 3QGVA 4FLRA 4LGXA 3AMDA 2FHFA 2YOCA 5A2BA 2XFFA 5D8ZA 5E70A 3O6AA 1JXKA 1RD6A 2BY1A 3GH5A 1GJWA 4AD4A 2G8ZA 4DWSC 3ARYA 4CGTA 1FHDA 5JUVA 1U30A 1BYCA 1XSKA 3TA9A 4CVWA 3OIHA 3MSDA 1OBAA 3AIVA 3W37A 4GI6A 5C71A 1X1NA 2VX6A 3PZ9A 1WZKA 5ECUA 8CGTA 3VD4A 1PZ3A 4QAWA 4BF7A 3CH9A 1FFRA 4CN4A 1IV8A 4B16A 2XVLA 3L4TA 1J18A 3PHAA 2WC3A 1G5AA 3WUBA 3KZSA 4AIEA 1S46A 1CGWA 2BNJA 3G6MA 3T08A 2FH6A 4K68A 1ISVA 4V28A 1JD7A 1VENA 2ZX6A 3VKKA 1E5NA 4UQBA 1JF6A 4HMCA 1SMDA 1GVIA 3CMJA 1PIFA 2D3NA 2JALA 4ACZB 2VMFA 5DF0A 1W3KA 1VFFA 4GINA 2WWCA 3VM7A 2XFRA 4UZUA 2DSWA 3UG5A 1BG9A 1E72M 1XCWA 3VIMA 1BYBA 3VD5A 3CHCA 1QHPA 1B3ZA 2DH3A 1PBGA 2W5FA 3VGBA 1FP8A 1QI0A 4B15A 2CKSA 3HJEA 4TTUA 3EMZA 4HA4A 1GCYA 3WD3A 2W61A 2V38A 3UG3A 1H11A 4P8WA 4Z2IA 1V0NA 3BGAA 5FD0A 1XD0A 1DTUA 1HJQA 5CXPA 1E4IA 3AQUA 1KCKA 3PZVA 3TONA 1E4MM 3FW6A 2A3EA 4JZ5A 2E8ZA 3HMCA 2VX5A 2EPLX 3A47A 4AZCB 5C70A 3VU2A 3K4DA 3WH7A 3CTTA 1WP6A 2VX4A 2WMGA 4GQQA 4C7DA 3GBDA 4Z2KA 4AW7A 4E4PA 5I24A 4PTWA 1VJSA 3MS8A 1QHOA 3EDDA 1XV8A 3M6DA 5A8OA 6CGTA 5A6KA 3SCRA 3A6OA 1GHRA 4BA0A 1GORA 1NP2A 1HP5A 4W7UA 1V3KA 4KRTA 3W26A 1K9FA 2J8GA 1VF8A 2EO7A 3EDJA 1E4LA 5IFTA 3N17A 1NOWA 2OWCA 3L4VA 3AS1A 3ZIZA 4AZ7A 1NOFA 3CZ8A 1LG1A 3NDZA 2J7BA 2Y5EA 4BZYA 1CTNA 1EO7A 1W3HA 4UCFA 3CZLA 4M29A 3WSUA 2WHMA 2XIBA 4ZXLA 3U7BA 2VRQA 2UY3A 2V3GA 3VDHA 2NT0A 1WDPA 5DT7A 2J7HA 1W9PA 2TAAA 1WDQA 1KWKA 4X0NA 4MB1A 4ZXOA 1EDQA 2X8RA 1PZ2A 2BHUA 1DWIM 1TA3A 2DT3A 3BAYA 1UWUA 3SCPA 4ATDA 1B3YA 3T2OA 2F61A 4DUVA 3ZMRA 1K9EA 3WFZA 3T2PA 1E4NA 1TVPA 3I3EA 3OLDA 5D9MA 5ABFA 5A3HA 5JIPA 1GOIA 1YQ2A 5TD4A 3RCNA 2FGLA 1W9DM 2CPUA 3I3BA 3L4UA 4S3JA 2QHAA 4R27A 5D9PA 4EK7A 1LF1A 1E1EA 3VIJA 1OD8A 4DWSD 4P7LA 2DT0A 4CN6A 3ZR5A 8A3HA 2WVUA 1TVNA 4ATLA 1I75A 3EDFA 1JAEA 2J7DA 4CD6A 4QDMA 3GNOA 3VD3A 3WL0A 2UY2A 1BF2A 4AD3A 3BSHA 2WLZA 3QOKA 4E8CA 1H3GA 1K9DA 3PBGA 1EOMA 4M82A 1OD0A 1Q6FA 3WNNA 1E6NA 1PAMA 4P7NA 1R85A 3PZUA 2EEXA 2OWXA 2ZWZA 4J27A 4XX6A 1CZ1A 2WM0A 4A3YA 4HOZA 4KH2A 3NSXA 1W2VA 1FH8A 5BWFA 3GXIA 4JFTA 4U5KA 2DQXA 2YJQA 3VGEA 5I78A 4TOQA 3AZTA 2RGLA 3B9EA 2J62A 2FDMA 3EYPA 4H41A 3SCVA 4GI9A 4QLLA 5EFDA 5E6ZA 4AYSA 3ARPA 5DT5A 2J7FA 1E6ZA 2EJ1A 3ZR6A 1KCLA 3FAWA 4W8AA 4AD0A 3DYPA 2OYLA 3WDQA 1WB0A 1WZLA 3UR8A 2Y4SA 4KGLA 3SCOA 4YHEA 1V03A 3VDAA 3WH9A 2PBOA 1QNOA 1VEMA 2WVVB 3WEMA 2QMKA 2GSJA 1ZL1A 1C8QA 2JEPA 2J7EA 1XRVA 5CGMA 1CBGA 3VVGA 1JDCA 3J7HA 4AIOA 1U2YA 4GPNA 3BSGA 2VCCA 1CXHA 1XC6A 5AYIA 4RE4A 4B3KA 3GYCA 4HU0A 1UA3A 2B31A 4KRUA 4AD5A 4BCEA 3K8LA 1UR8A 2ZUTA 4U2YA 1F4AA 4QFUA 3THCA 4V2XA 2VNCA 3VM5A 5BRPA 5F7UA 2WKGA 2V3FA 1E43A 3WUFA 3BCDA 2XVPA 4AD2A 1N82A 4FLOA 3W6MA 3WF0A 2YL9A 5CPSA 1QI5A 2ZE0A 2PBGA 1E40A 1BG4A 3T09A 2A3HA 1WDSA 1W9UA 2X1IA 2GFTA 1GOOA 3WMSA 4Q22A 5A8MA 2VCAA 3CUIA 3W38A 3VMNA 4AEEA 2X05A 2OWWA 1M03A 4H04A 3POHA 1XH2A 2D20A 1BYAA 1LL7A 3MUZ1 4W7VA 1VRXA 3G6LA 4M80A 4PMNA 3QHNA 4PMQA 3BCFA 1RPKA 2ZUSA 2WK2A 1J12A 2PC8A 4Y7EA 1CECA 2WBGA 2E40A 1E70M 1KXHA 4W88A 3TTSA 2AOSA 2JF6A 1U33A 4TX8A 1B1YA 3M7SA 4UFHA 1QBBA 2WW5A 2BFGA 4DWSA 4OOUA 1GOQA 1M04A 3ARQA 2WHJA 5GPRA 1FHLA 4AZCA 1MFUA 3KE0A 3ARUA 2EPMX 4OUEA 2X2YA 1JYVA 5KEZA 9CGTA 3WN6A 1E55A 1XYFA 3DHPA 4B9YA 4QCFA 2QLYA 2O9PA 1EDGA 1R86A 1Q6CA 3WL1A 4IM4A 4F66A 2YL6A 1VFMA 4JFVA 3GXMA 4U33A 3DHUA 4GKLA 1ZBVA 1G0CA 3UETA 4D6DA 2D0FA 2ZX8A 1KBKA 2WMIA 3EBVA 2O9OA 1KXTA 1KR0A 3BH4A 4PMDA 1J10A 1E0WA 3AIWA 3CZKA 3A4XA 1CGXA 3WNPA 5A94A 3AYRA 3SCWA 2VZTA 4W87A 4A4AA 4UFLA 4UFJA 2BV9A 4ATWA 1GPFA 2Z1SA 1UA7A 3AMLA 3AHZA 2YDRA 2CYGA 1US3A 1QNQA 2XJ7A 4L4OA 4GZEA 2WC4A 1D3CA 3PZOA 1SMAA 3ZSSA 1IT0A 2E9BA 1Q6EA 4OIFA 3SURA 3CPUA 1BGGA 2WYSA 1OGGA 4HA3A 1J0HA 5M17A 3MV11 4ZE5A 1FA2A 3L4ZA 3N15A 1B3VA 5A6SA 1MQQA 1V02A 1FOBA 1XGZA 3II1A 1W9BM 4U31A 3OLEA 3RIKA 5HOSA 4PCSA 4IPLA 1EQPA 1X6NA 3O9NA 3U5UA 1M01A 3WDPP 2ZX7A 3W82A 1G9HA 2V5CA 2W4XA 4J3SA 1J11A 1D2KA 5BXSA 1OINA 1V6XA 4B3LA 4D6GA 3LPGA 2W92A 2WLYA 3TTOA 2D3LA 1MW0A 3CIVA 1BTCA 2ZUUA 1KFWA 5CPTA 4UOJA 4LPCA 1UWQA 4PSPA 3N1AA 4WLCA 4YPJA 5A69A 3IK2A 2IXUA 4JCLA 2WAGA 3WFLA 1NOUA 4EE9A 1OGBA 4NF7A 1GHSA 1NWTA 3GXFA 4GI8A 1KB3A 2NT1A 3AXXA 1FFQA 1VFOA 1BQCA 2ZUMA 1JZ5A 4J3UA 1QNSA 2D0GA 4AISA 4E2OA 4RE3A 1J0KA 1H5VA 1RP8A 4MB3A 3RDKA 3BLKA 2BVYA 2DEPA 3GNPA 1UUQA 2VZSA 1UQYA 4MB5A 1QHZA 4CCCA 4WSJA 5JBFA 1JGIA 2GDUA 2ZXAA 1CIUA 1VB9A 4BQ5A 4XUYA 3BXWA 1I1WA 3GH4A 3K8MA 4PMZA 4TVUA 3AIQA 4RL3A 2J4GA 1OWQA 2E3ZA 5LYRA 1HKKA 3MKKA 4M1RA 2XVNA 4M8UA 2WXDM 2YDSA 3FHQA 4J3XA 2J79A 5HPCA 5E0CA 2ZOXA 4JAWA 4W5UA 1UH2A 4FMVA 2PI6A 3RMEA 1EIBA 2J47A 1CENA 1FH7A 1E0VA 3F5JA 2ZWYA 3W81A 1W3LA 5AC5A 1E73M 4UQCA 4NSBA 4UOZA 4TTGA 3IAPA 1J0IA 3S6TA 3LMYA 4FLSA 2OSXA 1MWOA 1MVYA 3ZJ8A 1SR0A 1UWTA 2Y2WA 4J28A 4MNLA 3ARTA 2XFYA 1UD4A 3AIEA 3BAXA 3T0AA 3RJYA 2EPOA 1W3JA 2ZUWA 1HN1A 3AYSA 3SCTA 1KQYA 3HU7A 1TMQA 3SUSA 4QLJA 1CXIA 4KWUA 4HPGA 4CCEA 1VEOA 1V0LA 1VEPA 4CCDA 3WUGA 3ARZA 1LL4A 1TR1A 3AJ7A 4HOXA 3OBAA 4J7RA 1HIZA 3I3DA 3ZT6A 3RJXA 1UH4A 5BROA 2YA2A 4MNJA 1O6IA 1WZMA 2ZUVA 3RILA 4FLQA 1BGAA 3WF3A 2XGIA 5CGTA 4HZ7A 3VIOA 4AMCA 2HVMA 4UFIA 1W9XA 3UEQA 3POCA 5BCAA 2ZXDA 3VNYA 3DYOA 3PTMA 4AZ5A 1G01A 2X0YA 2VUYA 3AI0A 2Z1KA 4BQ2A 6A3HA 3ARWA 3FHAA 4MADA 1EOKA 3KWXA 7CGTA 1JZ2A 2IXVA 1G1YA 2DPEA 2O9RA 3QHMA 5DO8A 4CVUA 2D22A 3NSMA 1E3XA 5IFPA 3OGRA 1UWSA 3VIFA 4J3TA 1HNYA 3WH6A 4PTXA 2WPGA 1XD1A 4UZSA 3MV01 3KL3A 3EDEA 3CUJA 3OLIA 4J3WA 1C93A 2XSBA 3GBEA 2WSPA 4D6JA 3ZSTA 3N11A 3RM8A 1ZU8A 1CNVA 1UD8A 2XUCA 1GVYA 2IUZA 4UNIA 1MXDA 1W9VA 2BXZA 1E6PA 2J75A 2VZVA 2XVKA 4OKDA 4J3VA 4HOWA 1BPLB 4URIA 1DWFM 1PPIA 4MTVA 2PWGA 1PIGA 3ZOAA 2GJXA 2V3EA 3WNMA 5DMYA 2XPKA 3QOMA 4PMOA 1CGVA 1GQLA 2GJRA 2Y24A 1JZ3A 1NP0A 1JAKA 3AROA 3LPPA 1AMYA 1KGUA 3WBEA 2ESCA 3W25A 2VURA 4JL1A 1HX0A 4HU8A 2YLAA 1DP0A 2CBUA 1JF5A 3O2LA 2PF0A 3F5LA 4CD4A 1UD5A 4CU8A 1E1FA 3NDYA 2F8QA 4CU6A 3VGFA 2J74A 2A3AA 1V0KA 1WZAA 4DM1A 2XVGA 2EXOA 1V6YA 3BAWA 3ALFA 5A2AA 1QBAA 1E6XM 1UR2A 1HT6A 1JDAA 4L4PA 2J7GA 1EGZA 4PUDA 1M53A 2Y8KA 3AS3A 4XV0A 3MUIA 4AY1A 2E9LA 3OZPA 2UY4A 4GZIA 3VMOA 1LWHA 1R8LA 1BAGA 3U57A 2WKLA 4H8HA 2JEQA 4NRRA 4UFKA 4W93A 4NZCA 2WZIA 1GOKA 4OOZA 1UR0A 2ZX9A 3M07A 4TVDA 3OB8A 4JKMA 4P7QA 4UQ9A 3OGSA 1NM9A 1GQIA 4XZBA 4H2CA 1V6VA 1L0PA 1QW9A 1W1YA 1JFHA 1OSEA 4GQRA 1ZJAA 1NWUA 1EHNA 2RGMA 1JFXA 1JI2A 3NYDA 1EXPA 3AHVA 2XSAA 3N18A 1VIWA 3DC0A 1CGUA 1E6QM 3WIJA 3SEPA 4PBGA 3WD4A 1GNXA 4OBRA 5C8BB 7TAAA 4Z2LA 1OIMA 2GJPA 4TX6A 1KXVA 5A6BD 4PTVA 1R7OA 2WMFA 1FP9A 3TTQA 4YHGA 4P8VA 5A2CA 2OSWA 1E71M 4HP5A 4M24A 1UR9A 4W8BA 2V3DA 3ARVA 1DWAM 1ODUA 2D1ZA 1UWIA 4H7VA 4AZ6A 5CPQA 1V02E 3NCOA 1UZ4A 2D2OA 3K46A 2QPSA 4ZENA 5I0DA 1NQ6A 1C92A 3VD9A 5A8NA 5A1AA 4ACZA 4Z2HA 4DUXA 4QLKA 3WMCA 5BRQA 3VX1A 4D6HA 3T2QA 2VR4A 3OG2A 3CHEA 5AYBA 3SUWA 1HKMA 4PEEA 3U7VA 1CGTA 1WAWA 1NWSA 4WKHA 5HNNA 1Y7VA 1B31A 3GXDA 3WD0A 4W86A 4B9ZA 4WIWA 1ZBWA 3AIBA 4AWEA 1C3FA 2YBUA 1HJVA 2G3NA 3WD1A 2VQUA 2XWEA 3VTRA 3WBAA 1DEDA 3WKZA 3MUY1 4NRSA 3EDKA 3GH7A 4IISA 1BHGA 2UY5A 3LPOA 3KL5A 2XM1A 4HPHA 4XZWA 3VGHA 1JIBA 5EB8A 1Q6DA 1BFNA 4AZHA 1HVQA 3BAIA 1MYRA 1HXJA 1EA9C 1TCMA 3KL0A 3VNZA 3WD2A 1K6AA 3AMCA 2CBIA 5IHRA 2XWDA 2CBJA 2C0HA 4MNKA 4CD7A 5I2UA 1QOXA 1ZB5A 1WDRA 1PX4A 2PB1A 1H0GA 1GZJA 1XYZA 4PMRA 1OCQA 5HBFA 4AD1A 1JZ7A 1KGWA 1QNPA 2DIEA 1CXFA 4MAZA 1VBUA 1MW2A 1KR1A 1B30A 2C8NA 4W8LA 1NH6A 3UCQA 2DSVA 3CLWA 3VIGA 4ZE4A 3PZQA 3WMBA 5E0FA 5LA2A 2O92A 5DFAA 1B3XA 3WNOA 2DDXA 3E1F1 3MMDA 4R5EA 1UHVA 3B8SA 4JHOA 5E09A 3TOPA 3KEHA 5FL1A 3AHTA 1C91A 4U3AA 1YHTA 3PZGA 3PTKA 4PMUA 1ZJBA 4X9YA 3RPMA 5D9OA 1KBBA 4AC1X 1B2YA 3WQ4A 1XSIA 3MUAA 4JHZA 3LPFA 3WF1A 2W66A 2FGZA 1UOKA 2VL4A 2Y8VA 1E5JA 1CDGA 2BHZA 2CIPA 4FK9A 1QW8A 4PMVA 5M3WA 3FAXA 1TA3B 1QI2A 1QNRA 3VDCA 5HXMA 1JZ6A 2F2HA 1VBRA 4HZ8A 1IZKA 4CKQA 2ZICA 2VZUA 5FCZA 5A6BA 4UQDA 3BAKA 3AXIA 3VUPA 2JIWA 5ABFB 3WQVA 4D71A 5M5DA 2V5DA 2YBTA 2VZOA 5I77A 4PRWA 4KMQA 3A4WA 4PN2A 1RP9A 2G41A 3AZRA 2W63A 2AMGA 4JKLA 2WHLA 1HKIA 1LG2A 2YKKA 1LLOA 3ALGA 3WQ8A 1E56A 1I1XA 1LQ0A 4BQ4A 1UWRA 3CGTA 3AMGA 2CERA 3IJ7A 4D6FA 5M03A 4GZJA 2W62A 1AVAA 2DH2A 3MSGA 4MDOA 5JBDA 3PZIA 1WE5A 2J25A 1A3HA 1H1NA 1OT2A 2WBKA 5HPOA 5FIPA 1UH3A 1SYTA 1TFVA 1C7SA 1V3MA 2G3MA 1BVNP 2VOTA 4P8XA 2C7FA 1RH9A 7A3HA 3VDBA 1DHKA 3VD7A 4TVCA 4EKJA 3THDA 3FXYA 4EANA 3WEOA 5A6JA 4WSKA 3AZSA 3B9DA 1CEOA 5I3DA 1R7AA 1H49A 2QMJA 2PWDA 3UG4A 3WH8A 3CUGA 1SFSA 3CHDA 4LYPA 3WEZA 4MDPA 2VC9A 3ARRA 5CLWA 4HMEA 3GNRA 1UD3A 1ECEA 3WDRA 1GQJA 1KGXA 2FHBA 1B3WA 4PCTA 1ZBCA
chains in the Genus database with same CATH superfamily
3TN3A 1BLIA 4U5IA 1WCGA 3V0TA 4H6EA 3GG8A 3O0FA 1V6WA 3TR9A 5M1TA 3PBVA 2V0TA 3UY8A 3S5SA 5H8UA 3M0IA 5KZMA 3B97A 2P50A 3PVFA 3WBXA 3L23A 4FZIA 3N9KA 1P6WA 3HPFA 1OM0A 4JIEA 2V67A 4QGCA 3W7DA 1R30A 3EPMA 2P3EA 3DI0A 1MQRA 4IIGA 3N2XA 3CV6A 2J8TA 1U22A 2QF8A 4ZMGA 1HKWA 4UQAA 4Q8QA 3WY1A 1VQTA 1CXLA 5JBEA 1IEXA 3H4XA 4WKAA 3HGJA 1M65A 2A3BA 2QZRA 4O4VA 2BMBA 4H9UA 3WDJA 1W91A 4DJED 2EKGA 3VKCA 3CEPA 2RKXA 3VXGA 3I7SA 4O1DA 4BS0A 3ZT5A 1ZBKA 4YNGA 1ZAHA 5A8GA 4S38A 3LCHA 4GLEA 2E4TA 2WZEA 3CTLA 4NZJA 1CGYA 3SSJA 2EF9A 4Z2GA 1U1JA 2BVDA 3D5HA 2EHHA 1JCMP 2QPUA 3A4JA 2Y85A 3QHOA 2PDJA 1RJQA 2BY0A 4WF7A 1J96A 1PSCA 1GJUA 3N6JA 4CD8A 5AY7A 3GVVA 1H2JA 2CFFA 1WKDA 3W1MA 1WA3A 4NG3A 2AAMA 1J01A 1ISZA 1UC4A 4KQNA 1C8XA 3AS2A 1TJ0A 4QP0A 3AUJA 3GDLA 4DPPA 5HJYA 1SW3A 3LA4A 1O5RA 3M0VA 3QQ1A 3T78A 1D8CA 3HFYA 1ME9A 4ZFMA 2OLAA 3VMPA 4E4FA 4F79A 1ML1A 2PLMA 1UD2A 2PWEA 3AS0A 2NQLA 2D23A 4XAFA 3K1DA 4WJEA 3ZFHA 1SZNA 1K1DA 1QATA 2CZDA 4JTFA 4ZO8A 1ZCCA 4X2PA 4RV3A 4P7RA 3CXOA 1KFCA 3PN8A 4A3RA 3BJFA 1BVWA 1JI1A 2VEFA 3OA5A 2Q8XA 4RW5A 2NXIA 4W89A 1IIGA 7TIMA 4PUNA 1TG7A 5KETA 4YMZA 5FI8A 2DSUA 1I0DA 4GHRA 3T44A 2YCKX 5HINA 1QI4A 1EA0A 3O6YX 1OB0A 1JCJA 1NDYA 2ZX5A 1GQKA 1H7WA 4JTHA 2ZCGA 1YPXA 2H3DA 1XX1A 2JFEX 2YA0A 3BLDA 4Z0SA 4D72A 4NP7A 1XM3A 1VZWA 1TWSA 3R11A 1PTAA 1ZCOA 3E2SA 3GDBA 5A95A 1QPKA 3S2JA 4V27A 4ACYA 1A5CA 1PWLA 4DM2A 3KRZA 3G5EA 1BVZA 1SZFA 4YTQA 4PL1A 3A4AA 1L6YA 3VIPA 2GLKA 4LANA 4UTFA 4GJ1A 2KX9A 2WB5A 3WLPA 1POJA 3W7OA 3JVAA 3MVIA 3L7RA 4Q8PA 2P1FA 2CBVA 1MW3A 3UESA 1UD6A 4YL2A 2WSYA 5E9AA 5MKGB 3COTA 1P43A 3GQYA 1GYLA 4MJ4A 1K4GA 2E28A 2ZQ0A 1RCXB 3HIJA 3TW6A 3LOTA 4GXMA 1PJ9A 2QJNA 4Y9PA 3IGSA 1A4MA 1GVSA 3RYSA 1L8NA 3RRAA 5K3VA 3CZGA 1UKOA 3OP2A 1B9BA 1VFTA 3BQ6A 3R0KA 1K7XA 2F6KA 2FZDA 4GYFA 2PDFA 1V3JA 2HTMA 3R6IA 4CQBA 2BVTA 3CH0A 4ML9A 1RJRA 3MU7A 2H9AA 3GM8A 4IJCA 3STFA 4XWUA 4O4WA 1XFBA 2D2HA 1HJWA 2QR6A 5G2IA 1TSIA 1IXOA 2PDLA 1AH4A 3HFTA 1K8ZA 4NJJA 4O1EA 3DEQA 2NXGA 5LHEA 4MM1A 3BC9A 1Q4NX 4IIHA 2JKAA 1H41A 4HYRA 2OYKA 3OZOA 2BX7A 5IHSA 5FJIA 4D6EA 4EF9A 2YYTA 1HL9A 1TV3A 3W7MA 1W37A 2ASHA 3A24A 4LXFA 4W7WA 3OQEA 2V5BA 4LWWA 3CB3A 3NQBA 4LUIA 1U1UA 4R7WA 5BXRA 3SN1A 2E9MA 2H3BA 2QVHA 3H2CA 3W87A 4JL2A 4C7FA 4US5D 4LQ1A 1JYWA 1V3HA 5LA0A 5HDRA 1M41A 4LB3A 1IWBA 1YBQB 3TW7A 4ZTXA 5EFFA 5G1MA 3T0CA 3ZJ6A 3W28A 2VGGA 1TZ7A 5D8WA 1VAHA 4QJ5B 1PVNA 1AQHA 4O15A 4I7VA 5T26A 2QJGA 1FH9A 2E6DA 5KZDA 4F0RA 3W86A 1BSIA 1J0JA 1XH1A 4ZQCA 1SGJA 2FVKA 3H4WA 3AIRA 3SUVA 3PUGA 3ARXA 4R3UA 2QGHA 2E68A 3SGGA 4AIBA 5E6YA 4CEUC 1FRBA 5KITA 4O53A 3IV3A 5AHFA 4HPJA 4DQWA 1LBFA 2Y70A 3M0JA 1Q6LA 5CLTA 4HCHA 4WOZA 2OFJA 4EXAA 2VP8A 4MOZA 3RNDA 4X3ZA 3SZ8A 3S6DA 2GDVA 2C91A 3UXAA 2GJXB 4JDYA 3RPDA 4IQDA 3VOCA 4DF2A 4JY8A 3WNLA 1L6FA 3VI2A 5EMUA 4L61A 3DCPA 4GE8A 3ES7A 3WJZA 3GIQA 3WNKA 4QDWA 3URAA 2WANA 1XWYA 2HK1A 4JX6A 3GWQA 5ABTA 4AVOA 1MXGA 2NV2A 1AL7A 1JNEA 4JFUA 2D2JA 2PDGA 4F0SA 3NQEA 4POCA 3L4XA 3TQKA 1EUAA 1IWPA 1YEYA 2PMQA 1E3ZA 3SAZA 4D6IA 4F9DA 1E6RA 1P0DA 4MWAD 1A5NC 4GG9A 3RM9A 3S1UA 2BHYA 2VQTA 3AXHA 1P5BA 4Z1AA 5EBAA 4LY4A 3SCUA 3EMQA 3FOKA 1UG6A 4D9PA 2O0TA 4LW7A 4UTIA 3TZNA 3TNBA 4AZBA 4N9DA 2VT0A 1XUZA 2BS9A 1RD5A 5LGZA 3NZQA 2IPFA 5CPMA 2FHFA 1KO0A 2YOCA 1BXCA 4I6KA 1MNZA 1RD6A 2XSXA 4IGHA 4DWSC 1TE6A 1GVRA 4LH8A 2YCLA 4JQ4A 4GWEA 1AL8A 3EB4A 2HWGA 3PZ9A 1KKOA 2H8ZA 5ECUA 3ABSA 4QAWA 1JUBA 4DJFD 4O17A 4CN4A 2XVLA 3GSMA 3WUBA 2BTMA 5CH9A 2YX0A 4XD6A 4RDWA 3VKKA 2OO0A 4UQBA 1GVIA 3CMJA 4NYUA 2Z1WA 2JALA 2GJLA 1TCDA 1MEIA 2WWCA 3VM7A 4K37A 1XDJA 2GQ3A 4HQVA 3M5ZA 4RKAA 3LZ3A 4TX9A 3VD5A 3HQOA 1Z89A 3CHCA 3W02A 2DH3A 1PBGA 1XUUA 1QR7A 2VGFA 2Y7EA 1JDFA 4TTUA 5I3KA 1GCYA 2W61A 3BW4A 2XN0A 3ABZA 3H2NA 1H11A 3ZLFA 1LT8A 4JTDA 3KDNA 3TKFA 3W2JA 1KCKA 2J9XA 2YSWA 1AH3A 1W1IE 1IGWA 3LM3A 3EX1A 2A3EA 1EC8A 4JZ5A 1CB7B 5LXEA 4JTEA 3TEVA 3FFSA 7PTDA 4JTIA 2EG8A 3WLIA 1Y65A 4C7DA 1X1ZA 4A2RA 1W5QA 3DUGA 1TV7A 2ZTKA 1RY8A 3NM1A 1K8YA 1KA9F 4LB4A 3W2MA 4ONVA 1ZQ5A 3UJRA 4PTWA 3R5EA 2IPJA 3G18A 5A6KA 6ALDA 3MDUA 3W7JA 4BA0A 1GORA 1Q8JA 3H7UA 1HP5A 1V3KA 2J8GA 3KVJA 1VF8A 4J1OA 1E4LA 4WQ6A 3ZIZA 3V5FA 4U28A 4E38A 3VA8A 2QT3A 2J7BA 3MO7A 4NJGA 4BZYA 3CZLA 1J93A 2HBVA 4HPNA 3ANVA 3U7BA 2UY3A 2V3GA 3VDHA 2NT0A 4X0NA 5IBXC 3W7RA 1S3HA 1MRQA 2X8RA 3LBOA 4HGXA 6REQB 1H1ZA 3TYEA 1S5VA 4Y6GA 2DT3A 1TA3A 1IR1A 3URQA 3VNLA 4H83A 3KBMA 3QR1A 5DY2A 1F6YA 1GEQA 4NQ1A 1E4NA 1NU5A 2CLPA 3AALA 5ABFA 3RLUA 1GOIA 1FXQA 1YQ2A 4GI4A 4WVXA 3I3BA 2DJXA 4S3JA 2J24A 3VIJA 1OD8A 3TC6A 1V77A 8A3HA 4UR8A 4ATLA 1AG1O 3GTHA 2XDFA 3LK6A 2PGEA 5HMSA 4N4PA 1BF2A 4PUJA 2WLZA 3C52A 1UP0A 3S5OA 3QOKA 2H6RA 2PTWA 1B57A 4ICCX 2O55A 3QV9A 3RO6A 1IQ8A 1Q6FA 1T5AA 4OE7A 1E6NA 3G3DA 4JICA 2GYIA 2DW6A 3W2NA 1W3TA 2OWXA 2ZWZA 4XX6A 3ITVA 3U0HA 3EWXA 3A64A 1FH8A 3GXIA 2HS6A 4JFTA 4U5KA 2YJQA 3HG3A 4TOQA 4O14A 2RGLA 4MWAC 2FFIA 3EYPA 4H41A 4GI9A 4I3GA 1YE4A 3ARPA 4AD0A 1SO4A 1WZLA 3UR8A 4KGLA 1V03A 3AWNA 2WVVB 3UPBA 2QMKA 4JPGA 1DJZA 2JEPA 4Z1CA 1JDCA 2E5BA 4AIOA 1U2YA 5HR6A 2VCCA 1XC6A 3BDKA 2G95A 1XLLA 4ZGYA 4B3KA 3DOPA 5AVNA 1TV4A 3GNDA 2Z29A 4WCJA 3K8LA 2ZUTA 3FJNA 4AWTA 2WKGA 3E0LA 2PLKA 1DXFA 1PCWA 3IJ6A 2CHRA 4WDUA 3BCDA 4DJFC 1ZALA 1QI5A 4L80A 4PUKA 2C15A 2JQXA 1RY0A 2X1IA 1P7TB 1M3UA 3WMSA 1JPKA 4PTDA 4Q22A 4JYDA 1ZRQA 5A8MA 2VCAA 3R25A 4JTAA 2R82A 4AEEA 1CLKA 2OWWA 1M03A 4KEZA 3MYPA 1CI1A 5EMMA 4HNUA 3G1YA 1ONXA 3L21A 4QHRA 3MUZ1 3P81A 1YTKA 4PMNA 3FYPA 3BCFA 4Y7EA 1J12A 1VP5A 3WLTA 1JGMA 3WJYA 2Z26A 3R1ZA 9RUBA 3I6RA 2AOSA 3A22A 3C4UA 3A3WA 3QMTA 4ZO6A 1H7NA 1U33A 1KM6A 1QBBA 4D8ZA 2CLIA 2BFGA 4AXKA 4JYFA 4OOUA 3L66A 3N2OA 3PSVA 2I56A 3NZPA 4IMAA 3I65A 3ICJA 4AZCA 4A8NA 4QE5A 4OUEA 5LHFA 3H2OA 4GYPA 3B40A 4B9YA 2QLYA 1EDGA 4IM4A 3TLQA 4XIAA 4AVFA 4Z0JA 3OVRA 4F66A 2E5DA 4JFVA 4WD0A 4WY0B 4C6IA 1ZBVA 3RN6A 7REQB 1G0CA 3APTA 2ZX8A 1LRNA 7ODCA 1KBKA 3LERA 4FNUA 3UJFA 3ATYA 4D8LA 1KXTA 4GQ0A 2OCZA 4E2VA 4EF8A 1KR0A 3KCLA 5JQ9A 3EKLA 4J2PA 3UG8A 3AIWA 3THQA 5FF2A 4CQ8A 1FQ0A 1XYBA 2VDHA 4GOAA 3XISA 1F74A 4QE4A 1A53A 3AHZA 4ZODA 5AYXA 2YDRA 4L1XA 1US3A 2XJ7A 4L4OA 4KEUA 4GZEA 2WC4A 4AHOA 3LGEA 3WBWA 1IT0A 1MUCA 3P8JA 4NZFA 1OGGA 1OZQA 4HA3A 1JPHA 3GW3A 3L4ZA 2Z1XA 4KRZA 1JCNA 1W9BM 2FZBA 3UA4A 5HULA 1XLAA 1X6NA 3O9NA 3U5UA 3QSTA 4BWLC 3GXPA 2ZX7A 4B2DD 2W4XA 3ZXWA 4K8EA 4BEQA 5HNUA 1J11A 4TMCA 5BXSA 2PTYA 3ZVIA 4FNRA 3S5ZA 2IKGA 3LPGA 4MWAE 4Y9OA 3CIVA 5I02A 1BTCA 3W83A 4ZO9A 2ZUUA 1KFWA 3NGFA 3STPA 4PSPA 3SQMA 4YPJA 1NSJA 3EGJA 4GACA 3W7IA 4HCDA 9XIMA 1NOUA 1NAL1 1EJUC 4S2BA 1NWTA 2YW4A 2R1PA 3DX5A 4DBSA 1JZ5A 5H6HA 1J0KA 2FMOA 3TIMA 1RP8A 2VENA 1EXBA 5HWJA 4A3UA 3M0ZA 2ZKMX 5TQLA 1GTHA 2GDUA 1FY6A 3WLNA 1CIUA 4BQ5A 5MKGA 3GYEA 3BG5A 3BTNA 3BXWA 3MWCA 4H7ZA 3K8MA 2YXOA 4GX8A 3KRUA 1HL2A 1S39A 3E5BA 1A5AA 4L64A 2HXTA 4M1RA 2XVNA 2YDSA 3FHQA 4J3XA 2J79A 1MDRA 2ZOXA 4NU7A 4W5UA 3VNJA 2J66A 2CLHA 3EXRA 3RMEA 1FH7A 1CCWB 1QPNA 3F5JA 3NQMA 4H4IA 1IEQA 2ZWYA 3W81A 1W3LA 1FUYA 3RLVA 1XLMA 5H8PA 3CV1A 4KWWA 1FHUA 1H50A 3LMYA 1S38A 2OSXA 3BPWA 4XAYA 1MWOA 4PCNA 4H6RA 1SR0A 1QMLA 2PDWA 1HFBA 1W5OA 1EWDA 3VE9A 3RJYA 5J5DA 1ZFJA 3AYSA 2RJGA 5DBUA 3SUSA 1O94A 1GGOA 4CCEA 4RZBA 2Z25A 1X96A 3WUGA 4R88A 2Z1VA 1RA0A 1F9CA 3JW7A 3OBAA 1HIZA 3FDKA 3EAUA 1F6KA 1R3QA 4GA8A 1IEWA 4FLQA 3E0WA 4AEOA 5CGTA 3LI0A 2QUVA 4JQ2A 3GG1A 4C6JA 4ES4A 4UFIA 4C6PA 1ZAIA 2RDUA 3N2BA 1Q7QA 3B9NA 3C0SA 3PTMA 1G01A 3VNKA 3AI0A 4BQ2A 2FYMA 4AY8A 1P4CA 3GTIA 3BW2A 3NWRA 3ARWA 3FHAA 3HO8A 4GBUA 1YBQA 3N19B 3H8AA 2DPEA 1SJDA 1LM1A 2ADAA 1O95A 5K9XA 4JBRA 4CVUA 3NQGA 2V9DA 1E3XA 5I3JA 3VIFA 1R5YA 5H8MA 1E0UA 2FJUB 2FZNA 1HNYA 3WH6A 2ZDSA 6PTDA 3MV01 3LM7A 3OLIA 4J3WA 3TYCA 1TWWA 3GBEA 3N11A 1WV2A 3RM8A 3PBUA 3F4DA 3R0DA 1CB2A 4RW3A 5D2XA 1TB3A 2XUCA 4CNPA 1UB3A 1Z3NA 1MXDA 1QK0A 1IT7A 4Q4RA 4NAEA 3GS6A 1E6PA 2XVKA 4OKDA 4OU1A 1PIGA 3ZOAA 2GJNA 4DBEA 3QGAC 2GJXA 2V3EA 3WNMA 1V7AA 1SJBA 1CGVA 1GQLA 2GJRA 1JZ3A 1NP0A 3AROA 1F3TA 1KGUA 3HQNA 2ZZ3A 4RPQA 4JTUA 1PTGA 3FYYA 3KCJA 5SWUA 2PDKA 2YLAA 1ECQA 3O2LA 3F5LA 1XRTA 1R3WA 3NPWA 4CU8A 3O06A 3PJWA 2J74A 3G1HA 4Q8UA 4M19A 5HA7A 1DYSA 3IUIA 2XVGA 4I8YA 3CO8A 5EL1A 5T9BG 2PTDA 1QBAA 1E6XM 4C1KA 2YXXA 3C2RA 4C90A 1GW9A 1V93A 2E1WA 2E9LA 1W5MA 1OX5A 2E6YA 2WKLA 3W3OA 1H60A 2JEQA 3I4EA 3WK2A 4NRRA 3UT0A 4W93A 1LLWA 3MQTA 4KIEA 3OB8A 3UCCA 2A7NA 5CC5A 1L0PA 1NF0A 4QROA 4GQRA 3WJXA 1TPDA 1JFXA 1JI2A 4BF5A 2GWGA 3STGA 3TFXA 1E6QM 4PBGA 3WD4A 1GNXA 4OBRA 3WLOA 2OR2A 3WQOA 4IG2A 7TAAA 1R3YA 3KLKA 2VM8A 5XINA 4Z2LA 4CNUA 4TX6A 4N02A 2WMFA 1FP9A 3TTQA 2BP1A 4IT1A 5A2CA 1E71M 4HP5A 3GXTA 4ADSA 5AHLA 4ZB5A 1DXEA 4AZ6A 3BANA 5CPQA 4LCSA 4ZQNA 3V5CA 3ZS4A 3K46A 2QPSA 4HNVA 2ZZ5A 1HZYA 3WX7A 1TWDA 4Q4QA 5GJPA 2YFOA 3KAOA 3O1NA 1U5HA 3KX6A 4C6DA 4IOTA 3L5LA 1Z8AA 3OG2A 3AJXA 2NWRA 4K36A 4PEEA 3U7VA 2PTXA 2W3ZA 1B31A 2P8CA 3VOIA 4W86A 3NA8A 4DI9A 3WD1A 1TPFA 3VTRA 4QSFA 4Z1BA 4LF1A 2VUNA 1QAPA 1TPEA 1VBJA 4V33A 4Q4KA 4NRSA 3ANUA 3CAVA 3GH7A 4IISA 3LPOA 4I5RA 5J04A 2OT0A 4YJ5A 1JIBA 4C6QA 2J6VA 1YNPA 3HGRA 4AZHA 2YGYA 4ORMA 3TROA 1TCMA 2B7NA 3VNZA 3WD2A 3AMCA 4ZTYA 1K7FA 4MNKA 3QVQA 1PTDA 1QOXA 1BXNA 1ZB5A 1XINA 2QUUA 1I2QA 3ZVHB 2XIOA 1XYZA 1JZ7A 1P1MA 1QNPA 1DJWA 1VBUA 3REQB 4BI6A 4A8LA 5C2XA 3UCQA 4OV9A 4B3ZA 3UNDA 3IK4A 3PZQA 1Y5WA 3G24A 2BOEX 2OZ3A 4GYJA 1XFCA 4M5PA 4R5EA 1UHVA 2ISFA 3QFWA 5F2GA 5E09A 2YYUA 2Q02A 3N3TA 5FL1A 3P60A 4U3AA 3PZGA 2J9YA 2A21A 3HMJG 2HVNA 3QH2A 3M1ZA 3ITXA 2VL4A 2Y8VA 1E5JA 5M3WA 3LXAA 4IQLA 1OY0A 1PHQA 4LALA 6REQA 3TJIA 1A4LA 4MLJA 4HZ8A 3UYIA 2HPMA 1XKYA 4CKQA 4NNCA 3BW3A 3YPIA 3AXIA 5M5DA 4HK7A 2YBTA 4ORIA 1E1CB 1OCJA 4PN2A 2G41A 2QAPA 3AZRA 2J6XA 4FX8A 1LG2A 1QFEA 1S2UA 1LLOA 2QUNA 1E56A 2I5GA 1K3UA 1NTHA 1I1XA 1Q4WA 4PGLA 4ZOAA 1TWIA 4GQBA 5DRIA 4GNJA 4YCOA 2EG7A 4D6FA 3B9OA 4GZJA 2W62A 3LX9A 3S47A 4JDBA 1WE5A 2WBKA 1OT2A 1TYGA 5FIPA 5REQA 4NNBA 1UIPA 4Y8FA 4Q7IA 1QUMA 1BVNP 4O12A 3TWBA 4XVDA 1RH9A 3E12A 3RFAA 1XRSA 1TR9A 1DHKA 2A85A 2A79A 3HF3A 3WEOA 5A6JA 1ZP3A 3B9DA 3CAKA 4ICMA 1R7AA 3W2KA 3GDRA 4LNCA 2A6NA 1H49A 1B3OA 4HNOA 3CUGA 1SFSA 4LYPA 5CLWA 4U10A 1UJQA 3IS4A 3G0XA 1OK4A 1N8IA 2C13A 4A3QA 1UD3A 4EOUA 3EWCA 3ME3A 1TQXA 4Z42C 4YTSA 1EBHA 4PCTA 3PB0A 3AWOA 2VI0A 4CQAA 1ITCA 4OECA 1K70A 2WVVA 4Q4SA 2CKRA 3DGRA 2GSEA 3O0KA 1RUSA 2JIEA 2TSYA 4RE2A 4KFOA 2C0AA 4ZL1A 2OPJA 2QJHA 3TUUA 3U5YA 3RO8A 3UQNA 5I5RA 1PCKA 2PWVA 2G4FA 4D1IA 2CWNA 1V3LA 3U6WA 5H91A 3G1FA 3L4WA 3LGGA 2XGZA 4E3VA 2C1HA 1IEVA 1G6CA 3N13A 4WGHA 4QQUA 4M3PA 1K8CA 4A3HA 5HJLA 3ARSA 4B5TA 2OQHA 1BF6A 4DI8A 2NLYA 1PX3A 4L65A 2OELA 3RM4A 1PEZA 3MBDA 2YCEA 4UR9A 3D3FA 4M6PA 1R87A 2PRHA 3WQEA 2O9TA 3SIMA 3WH5A 1Y5VA 3T40A 4ZZ9A 1DWGM 4O57A 4ML4A 2RDWA 4N9BA 1H61A 3WDIA 5H2ZA 3EX3A 1US0A 1FWAC 4GFSA 5BOOA 3KOYA 1JR1A 3HBLA 1W6TA 3T42A 3TE9A 1LYXA 5LIYX 5K9DA 2PDQA 4MJMA 3UNTA 1UBPC 4AC7C 1I2NA 4DWSB 2VTFA 3W27A 3DECA 2O56A 2XH4A 3AFBA 1ITXA 2W9MA 2WSKA 3CJPA 1XP3A 2WMKA 5I3IA 3BWWA 3TYZA 1SVDA 2I14A 1BQGA 1VIZA 1EO5A 1NVMA 2QVNA 3DHFA 4JHMA 4PYSA 5CSYA 1KQZA 6TAAA 1EF3A 1VBGA 5BYWA 4YTTA 4WY0A 3HPZA 3L0GA 4Z2JA 3CV7A 4AU0A 7REQA 1GUVA 2WZMA 1UP2A 3DAQA 4B5XA 4A6GA 3W70A 3USZA 1P48A 2GVLA 4LT9A 3SQSA 4L1GA 3TWAA 4GH3A 1XSJA 4XK2A 2HNEA 2PP3A 4GVGA 4W84A 3TSDA 1QT1A 3C3NA 3H54A 2VJXA 3MO4A 3NL3A 3NL2A 2QIWA 3WLKX 4JOMA 3TXVA 4S1FA 5DEZA 3U4AA 3DG7A 4Y9AA 4RNFA 4CD5A 4L4MA 3B0XA 4W5ZA 1RLCL 4BY3A 3P3BA 3MCNA 3FNDA 2YLLA 3TCEA 2VCBA 3D0CA 2VRJA 2GK1B 3SUUA 4DZ5A 1KBIA 1CYGA 1VD6A 1KFKA 3C3UA 4FNPA 1D7FA 2XTKA 3RLGA 3SGZA 4BI5A 4ZFCA 4JFSA 5BU9A 2D24A 1HVXA 3VX0A 1CXKA 1CLVA 5A6LA 1S2TA 1Z9AA 4QDPA 1TO3A 3W4RA 3ZQ9A 1HF6A 1RZMA 5AN7A 2Z7KA 3OIXA 1UQZA 3VFCA 4HPXA 3DU0A 9XIAA 3VILA 1JRCA 1D8WA 4ZR8A 4QG8A 3B8WA 2G4JA 2NX1A 1C9DA 2DZTA 1JL8A 5IOBA 1ODZA 1RQBA 2BXYA 1XJBA 2DUAA 2GUYA 1LQAA 1ELSA 4U3CA 1G7VA 4L6DA 1MZRA 3P5YA 4PMYA 3NUKA 1E15A 5DMLA 1DHPA 3M7WA 5E9XA 2QCGA 5A6MA 3IACA 2CNCA 1ESWA 5G2WA 3G1XA 4ZQPA 1EBGA 4L4LA 3P93A 1HKVA 5C9ZA 2PWFA 3LXCA 3W1RA 3IWPA 2QS8A 3A21A 2G3JA 4H9TA 4NZ5A 4FPSA 1TUXA 5ENLA 4IXHA 3APGA 4NZ1A 4GCAA 1DIOA 3B8UA 3FJ6A 5FJRA 3OVQA 1N8WA 2BOGX 4TXEA 3T7VA 2DVTA 2SFPA 3TK7A 5XIAA 4PODA 2CXGA 1O68A 1Z32X 1AW2A 3V16A 1E9LA 2PWHA 4GKTA 3RRXA 2XINA 3LTPA 3QRHA 3W0KA 4I9MA 3OZMA 4WKFA 1IZCA 2X0SA 3V7PA 2V81A 3LRLA 2QCCA 4NT0A 2TRSA 4GO9A 5CZKA 2DQWA 1UYQA 1EDTA 4EAMA 1O1HA 4PC8A 5G1TA 1LT7A 4QS5A 4KWOA 4CQDA 1LBLA 4J5NA 2WWDA 1HGYA 1U83A 1XG3A 1OEPA 4ENLA 2GL5A 2OQYA 2A3CA 1J0YA 4KGJA 2TPSA 2QGYA 2VDIA 4MWAB 5HUOA 1SZRA 3IJLA 3OHMB 3SY1A 4FXSA 3NIYA 3CUXA 4ZA0A 1NWRA 1L6WA 4MJ2A 4MZ8A 1R9YA 4JTJA 5C2GA 2EQDA 3IIOA 3W24A 3EA1A 3AIUA 3GVRA 2XIJA 3RR4A 1DWJM 2NZLA 5BXPA 2PDCA 1E0XA 3P74A 2BGQA 3O6DA 1OFOA 3N3MA 4W85A 6ENLA 3T0BA 2DT1A 1UZ1A 3S1GA 4FALA 1ZUAX 3HV8A 2EBNA 2WHKA 4MKSA 1O66A 4GBDA 1J0ZA 4M81A 3IIZA 3EA2A 1AW5A 5FEWA 2R1MA 2YIHA 1QASA 3ITOA 3PBYA 4LU0A 2PDHA 1PS9A 4DUWA 1E9YB 3DYMA 3N6QA 4HYVA 1AH0A 3H4GA 3UU0A 3JR2A 3QR3A 4E0CA 3BLFA 2D73A 4HZ6A 4MF4A 2E25A 3SR7A 3WF2A 3H22A 1KXQA 5BNKA 1EHAA 3B03A 1UASA 1W31A 5LGXA 1X8FA 1XF0A 2BB0A 3CIWA 3SRDA 1H7PA 1M7OA 1YDNA 1A3WA 3PY2A 3SJNA 3PTQA 4U2ZA 3E0VA 3MC5A 4I6VA 4AEFA 3WJWA 1NARA 5K4ZA 4BEUA 4NXSA 1Q6GA 4AX7A 3CZJA 3GZAA 3NQAA 1US2A 5A6TC 2B0MA 1X97A 3W85A 4UUIA 1LWJA 3E2RA 3G1AA 2XZ9A 4HBKA 3S5NA 2C1GA 2Q8LA 4LCRA 5HR7A 1XXXA 3XIMA 4H00A 5FF4A 3W1LA 3VOJA 3E02A 2GQ8A 3M0HA 1DXIA 4MNMA 5T9CE 3O15A 1V08A 5F2MA 1KTNA 2XHYA 3CUFA 2ZA2A 2HISA 3W76A 3W9ZA 3W2LA 2W6RA 3ZO9A 4PUUA 2OQLA 1T6MA 2W27A 4FLRA 4LGXA 3IRSA 3AMDA 1F6PA 4GIRA 3EB2A 5E70A 3WK3A 4HNNA 1YLVA 2WM1A 1JXKA 3GH5A 3FX4A 2G8ZA 4JQ3A 3ARYA 3THUA 3ZWSA 2ICSA 5JUVA 1XSKA 3EWUA 3TA9A 1EEPA 3MSDA 3C8NA 2FB3A 1RR2A 4FHAA 3W37A 1FWFC 1X1NA 3EOSA 1WZKA 4EX4A 3KRSA 1PZ3A 1FFRA 3PUEA 1IV8A 2CWXA 3EOUA 3N4EA 2KZHA 1REQB 3LG3A 4AIEA 1S46A 1SZGA 1YDVA 3MZNA 3T08A 1A5OC 4YYCA 3O05A 4K68A 2CZVA 4GGBA 4DELA 1VENA 5HNTA 1E5NA 1DKWA 3WFAA 3UWYA 4HMCA 1SMDA 3QW4B 1ZLPA 4RNHA 1GKQA 4AWSA 4GUFA 1VFFA 2Y63A 1H63A 4GINA 4IZGA 5DY3A 3HPSA 3T05A 3UG5A 3W07A 2YCJA 1BG9A 2HZGA 4NZ3A 3VIMA 2QCDB 1JEZA 4EAYA 3KS5A 3ZR4A 1B3ZA 3GUWA 5D2WA 1NY1A 4EPBC 1FP8A 1QI0A 2RFGA 3N25A 2CKSA 3HJEA 3W1XA 3W1AA 4DO4A 3WD3A 1QXLA 2V38A 5C9RA 1P0KA 1SR9A 1TX2A 1RVGA 3MUXA 1TVLA 5CXPA 3F4NA 4GC4A 4FXJA 4LSBA 2OXNA 2W0UA 3PZVA 3TONA 1E4MM 3FW6A 1JUEA 1XLFA 1TUFA 1GT8A 1RBAA 1W5PA 4FR1A 2OKOA 2ISSA 2EPLX 2A1YA 4MUZA 5C70A 3WH7A 3K5XA 2XN1A 1V51A 2XU2A 1PXGA 4GQQA 5K7JA 3GBDA 4AW7A 3UFYA 4E4PA 3WQPA 4O1FA 3ZVHA 4XSLA 4NIRA 1RLDA 1Q65A 1AJ2A 1B4KA 1FWRA 3EOOA 3KBSA 1QHOA 3EDDA 1XV8A 3REQA 6CGTA 3SCRA 1NP2A 4XAZA 2EAWA 1K9FA 4WUIA 1DIKA 2EO7A 3KUMA 3LZ5A 5IFTA 2PLCA 3VFLA 3MMTA 2VFDA 2OZ8A 4LUTB 3IIXA 3HG5A 4HSNA 1W3HA 3EXSA 4UCFA 2XIBA 4ZXLA 3HPXA 3CASA 5DT7A 3RMJA 3N6HA 1WDQA 2FIQA 4F0KA 3JZUA 1EDQA 3UJSA 4HSHA 1DWIM 3GIPA 3BICA 1UIOA 3S5YA 3T2OA 4DUVA 2BOFX 3EX6A 4XZIA 5AKQA 3WFZA 5J5RA 1XQKA 2PSNA 2FVLA 3T8LA 3I3EA 1LCOA 4OUIA 2YB1A 3NXLA 4NI8A 4OHQA 3TOYA 3SY5A 1W9DM 1E1CA 2HMCA 4RUBA 2CPUA 2ABAA 1PO9A 1BD0A 4R27A 5D9PA 3LY0A 2NUXA 1KBLA 5FAJA 2WVUA 4DO6A 1I75A 2ACSA 2J7DA 1CW2A 4CNTA 4BI7A 1PDZA 3GNOA 3K30A 3VD3A 5CZSA 1OYCA 1SO6A 3STCA 3BSHA 2GGIA 3VKDA 2ZRXA 2PDNA 4UTWC 1UMYA 4ZCWA 4OVXA 1OCNA 3EPOA 1G4PA 3PBGA 4HK5A 1YXYA 4PRRA 3RF9A 3WNNA 5CPLA 4IWWA 1R85A 1L9WA 3PZUA 2EEXA 4PBFA 1CZ1A 4A3YA 1K8XA 3NSXA 1X6UA 4Q8NA 6XIAA 5I78A 3QLDA 1M9HA 2ODOA 1C8VA 2PP1A 3W74A 1A5BA 3SCVA 2E5CA 2GVEA 1GTEA 5E6ZA 3W1NA 2G37A 2ISDA 3M0KA 3ZR6A 1KCLA 3DYPA 4O1BA 1J2BA 2Y4SA 2VD9A 2PDPA 2AL2B 3ELFA 4JIIX 3WH9A 2PBOA 1QNOA 1VEMA 3WEMA 2GSJA 1MI3A 1C8QA 1SUXA 1TRDA 3S2LA 4DVOA 3USBA 5FEPA 3QTGA 5CGMA 1XRVA 2F38A 3TMQA 3QKEA 1I2PA 1CBGA 4XBSA 2NV9A 4XSMA 4GPNA 2ZRVA 5AYIA 1UA3A 2X1RA 3L9CA 1FWTA 4AD5A 4S3DA 4BCEA 1R2TA 5FA5A 4WXYA 4GVFA 3KHDA 2VNCA 3AXKA 1T8XA 3H7RA 3VM5A 2PE4A 5F7UA 3WLJA 1GVOA 2V3FA 1PE1A 4MY9A 4YU1A 4XBKA 3GR8A 3FA5A 3WUFA 3LCXA 5I07A 4ZQMA 2ALDA 2XVPA 4M7TA 3OU8A 1S5MA 1XC4A 3W6MA 4H2HA 3WF0A 2YL9A 1LRTA 4MLRA 1A0EA 1E40A 4ASTA 1BG4A 3LHWA 3T09A 2A3HA 1WDSA 1TMLA 4EIVA 1K7EA 1BEUA 3UJ2A 2H90A 1GOOA 4PUMA 1W1ZA 3AAMA 2B7QA 3TVAA 5EYWA 2WNNA 2X05A 2HRWA 3HB9A 2C71A 1XH2A 4W7VA 2JKPA 1XLEA 4WRHA 2VFIA 4PMQA 3NQ6A 3GDKA 2E40A 3C2EA 1E70M 1KXHA 3TTSA 1LOSA 3U2ZA 3UZYA 2JF6A 4GUHA 1TZZA 3VCNA 2P76A 4JTSA 2WW5A 1BTMA 2UZ9A 4JNZA 4DWSA 4HB7A 2VDGA 1NEYA 2WHJA 2HCVA 1MFUA 2ZA1A 3ARUA 2CLEA 2X2YA 2GUUA 3WMLA 9CGTA 4QNWA 3WN6A 3GLCA 2O9PA 1R86A 1Q6CA 3WL1A 4ROPA 1PKMA 1F07A 1VFMA 3Q94A 4C91A 3CL7A 5AHEA 4D6DA 2D0FA 4RDYA 5EGRA 2PD9A 2VYOA 4N6FA 2ZA3A 2Z2UA 4O1AA 1GVEA 4PMDA 2PCEA 2BASA 5FJPA 3VDGA 3WLSA 1KFEA 3E5PA 3F7JA 2VZTA 4GFIA 4W87A 4A4AA 1H1YA 2QXWA 1Q7ZA 2Z1SA 3MW7A 5C9WA 1UA7A 3AMLA 3TLLA 3A23A 3OVGA 1HO4A 3C2OA 1QJWA 3PZOA 3ZSSA 1V79A 1I0BA 2WYSA 3LLFA 4IHCA 1J0HA 4U4MA 3LRMA 2V2DA 2PODA 5M17A 1XYAA 4L7ZA 3UYCA 4INFA 3VYLA 1MQQA 1OFAA 4UTUA 3DFPA 4IMDA 1XGZA 3QGKC 4GMEA 3S1XA 3OLEA 3UW6A 4IPLA 4G8TA 4XKYB 2ZVRA 3W82A 3S9YA 3SY8A 4MZ1A 3EWWA 5FJTA 1OINA 2R6OA 2QJJA 3TC7A 1K6WA 3FDGA 3L5AA 3I6TA 4FA3A 3NQDA 4LUJA 4G2DA 1IT8A 3T8QA 4AF0A 4WLCA 3N1AA 4N9CA 1X7FA 2WAGA 2NXHA 4EE9A 1YDOA 3W7PA 4I7UA 1GHSA 1PL9A 3E9AA 3AXXA 3WCZA 4I90A 4MB3A 3RDKA 1VYSX 5D37A 2BVYA 2DEPA 1XPYA 1UUQA 4R9XA 4GYPC 4MB5A 4CCCA 4NUWA 1KFLA 3E49A 4B5NA 4GH1A 4XUYA 3LQGA 2PEVA 4IX2A 1XBXA 3V3WA 3T1GA 4TVUA 5BWAA 2J4GA 1OWQA 4P5UA 3A9IA 2E3ZA 5LYRA 3VCRA 2DW7A 3MKKA 2WXDM 4TV5A 5IBXA 2FB2A 4I9AA 3UP8A 5KSWA 2PPGA 1N2VA 3LHUA 4FMVA 3LTSA 1QU4A 2PI6A 3HGSA 3PG8A 3DFOA 3N2TA 3BE7A 1F8MA 1BRLB 1UUOA 3RX3A 4NSBA 1UZHA 1OHLA 2NUYA 2FTYA 4ERGA 3S6TA 3S42A 3GTXA 5B7YA 3PJXA 5LNUA 4J28A 1AD1A 1XG4A 2GWNA 3ZZ1A 3G1DA 1UD4A 3BAXA 3T0AA 1TV5A 2EPOA 1W3JA 2PLJA 2ZUWA 1HN1A 3S8HA 3HU7A 2GZXA 3PWGA 2YZRA 4CNSA 4AVNA 5I3GA 4ERIA 4Y9MA 1KFBA 3UPMA 5D38A 2WJEA 3ARZA 2PU0A 5CG7A 2AKZA 1TR1A 1OFPA 1TKKA 4JTQA 4GISA 1UP3A 1XISA 1XL9A 3VZXA 4ECLA 3M0MA 3GKAA 3ZYZA 2YA2A 3CMFA 1O6IA 3MI6A 4DBWA 3RILA 3F03K 3PPHA 3WF3A 3R43A 3NPUA 3UWEA 5HUPA 3VIOA 4DYEA 2HVMA 4PCPA 1W9XA 3CL6A 3RGTA 3UEQA 5BCAA 1NIUA 3VNYA 2HJPA 4DF1A 2G96A 3P14A 1J8VA 3SFKA 1IHIA 2P8BA 6A3HA 3S9IA 2INEA 5EY5A 3H12A 1PZ0A 4P61A 4MADA 4DAIA 4QJ4B 2IXVA 1G1YA 2O9RA 2VOMA 1E51A 3LEPA 3NSMA 3STEA 1UWSA 1R9XA 4PTXA 3KL3A 1LROA 3O16A 3URBA 4NZ4A 2R1LA 1C93A 2XSBA 1KRMA 3ZSTA 3MVTA 1RV8A 5HATA 1CNVA 1UD8A 5FSDC 3LBMA 1GVYA 4E2BA 4UNIA 3IRDA 3OA3A 2X2GA 3KRBA 1VPYA 2BXZA 1DQXA 3FXGA 4LVAA 2F9RA 2J75A 5EU9A 1DWFM 2PWGA 5IM51 4DJFA 5F1VA 3RITA 3E0FA 1X8CA 1XGDA 2XPKA 3R8HA 5HK4A 4H01A 5A5WA 5JVLA 1VRDA 3D46A 1AMYA 1XIMA 3WBEA 3UXLA 2PS2A 2YPIA 3BZJA 2VURA 1HX0A 4HU8A 2X1SA 1TJ2A 2PDUA 3GFYA 2CBUA 1JF5A 2G3FA 2PF0A 2OO6A 4QS6A 2X7VA 4IFKA 3T0TA 4BF9A 2NQHA 4AY7A 4QRNA 3GO2A 2IKJA 1WXJA 1V0KA 4DM1A 5K4XA 2EXOA 1Q6OA 1JDAA 4Q7BA 1EGZA 1KD0A 3OG3A 4EACA 4AY1A 3O7UA 1XIBA 3OZPA 1DJHA 4GZIA 3VMOA 1LWHA 1BAGA 3QSRA 3U57A 4H8HA 1P6CA 3K2GA 3M9YA 1MEWA 4OOZA 1UR0A 3M07A 4M1BA 3H24A 2HV5A 1SU5A 2XFWA 4UQ9A 3OGSA 4XZBA 4H2CA 1NFPA 3M44A 1QW9A 1W1YA 1JFHA 1NF7A 3UD6A 1ZJAA 1TTJA 4G7EB 1NWUA 4LJ3A 3N4AA 3NYDA 1SSDA 3AHVA 1A5MC 1VIWA 1ONEA 4LBSA 2O4QA 1EP3A 2Z27A 5D32A 4DAFA 4GUIA 1JQVA 4N6EA 3GE7A 2QF7A 3V36A 1FX6A 2GJPA 1KXVA 5CSRA 1BWKA 4YHGA 1REQA 4P8VA 1IF2A 1MUWA 3CT7A 4M24A 4B5WA 2V3DA 4H7VA 4M6VA 1MSSA 3NCOA 2A4AA 1W8GA 2BXVA 1UZ4A 2D2OA 3DHDA 4LS2A 4WGXA 5FF0A 5I0DA 4R9OA 1C92A 3CYVA 4H7CA 2DU2A 2XZ7A 3IJIA 4O10A 5LIUX 3VAVA 4G9PA 5AOUA 3V0SA 1A5KC 3CHVA 5C9XA 4QLKA 2C1IA 5BRQA 5E93A 3UZJA 3T2QA 3BV4A 3CHEA 5AYBA 1HKMA 2Y88A 4KKXA 1CGTA 1GVQA 1HG3A 3QV7A 5HNNA 3OVPA 2OB3A 3GXDA 5I03A 4B9ZA 4AWEA 2VQUA 3NQ2A 3GU9A 4XTIA 1IYXA 4DLFA 1FWBC 1TPH1 3EB3A 3MUY1 4LAUA 3PS7A 5CCZA 3MZ2A 2ZDRA 3W01A 1FWNA 3PFMA 2DUXA 4HPHA 3KL5A 4QAIA 4GYKA 5EB8A 1WOBA 3BARA 1EGMA 2Z24A 1BFNA 3QY7A 3CNYA 1HVQA 1HXJA 4X63A 4J35A 3A12A 2CBIA 1XIDA 4YIWA 2XWDA 1FWDC 3R12A 2CBJA 4WDTA 4CD7A 1OJXA 3VOGA 3DKJA 2P0IA 1WDRA 2BBFA 3P0WA 3TSMA 2F6UA 2F7FA 1GZJA 2I57A 1FCUA 3LHYA 1OCQA 3FGCA 2Q09A 3E2QA 4S3CA 1KGWA 2A3LA 4MAZA 1XIGA 1TV2A 1MW2A 3GB6A 3TH6A 3WQGA 3LNMA 4DJEC 3NAVA 1B30A 5EBUA 2C8NA 4W8LA 5T8GA 1NH6A 2IPWA 4O19A 1ENUA 5E0FA 5LA2A 3LSCA 2O92A 3UXIA 1L6GA 4X22A 4RNIA 4S3BA 1YYAA 5CPOA 3MMDA 2FDSA 3N73A 4JTTA 4PBEA 3TOPA 3AO0A 5MHBA 3AHTA 1X7IA 1C91A 2WSQA 4LUTA 3T55A 3PTKA 4MMWA 3RPMA 4A2SA 3WK1A 1X38A 1B2YA 1JCLA 3QJAA 1FWSA 4JHZA 1AUSL 3V0UA 3WF1A 4FXRA 3B8IA 4XAPA 3U3HA 2FZ9A 1QWKA 4LRTA 2BHZA 4EVZA 3H23A 2ACQA 1ALDA 1QWGA 3CQJA 4V15A 4GX9A 1IZKA 4XKMA 2ZICA 5FCZA 4UQDA 2RAGA 3VUPA 1QPRA 2INFA 7XIMA 4C1NB 5DCBA 3NO3A 1WYIA 3VK5A 2HNHA 5I77A 4PRWA 4KMQA 5ECVA 2V5JA 1H7XA 2AMGA 2VR2A 1HKIA 3ALGA 4XG1A 3DBNA 1A80A 1XLKA 4BQ4A 4H9XA 4O0ZA 5CC7A 2CZEA 5FJJA 5M03A 4M0XA 4R7JA 1R47A 2LLEA 3C2VA 1A3HA 5HPOA 2R1KA 5HQEA 2RDXA 1FWWA 1UH3A 4LNYA 1SYTA 2B81A 3M64A 4P8XA 2C7FA 4ILSA 3C86A 2QCLA 3A5FA 3VDBA 2NVDA 3VD7A 4C6NA 4OT7A 4MGGA 2QQ6A 3WQCA 3CS2A 2ZC1A 1Q8AA 1KM1A 3AZSA 3B06A 4UB9A 3PNZA 3L65A 3WH8A 3FA3A 3TN6A 4L56A 3OPSA 2OOGA 3CT2A 2NVAA 3ARRA 3B8TA 3LXBA 4K8HA 1FVPA 2NQ9A 4L6OA 3WZ0E 3OYXA 4FB7A 4O0KA 3KVLA 4I5UA 4JR5A 3RLHA 4F40A 4FNTA 2Z6IA 4O52A 3GK0A 1LP6A 2AL2A 2ZRWA 1FBAA 1CLXA 2YXGA 2VWSA 4ICNA 4XAGA 5JH1A 4MPKA 3K8KA 1A47A 1GOWA 1EYEA 4F9JA 4BQ3A 1R3VA 3UF9A 1JCYA 3PUDA 2CXEA 3IEBA 2H9AB 4AFYA 1XBVA 3BG3A 4XO7A 1ZS2A 3BJTA 1HP4A 3N9SA 1ISWA 2P0OA 3MI3A 4KETA 2X41A 4E2DA 1LOQA 1KCXA 5EMYA 4JTGA 2R1NA 2MANA 4UTTC 2H8XA 5I06A 1OFBA 2OGJA 3GR4A 3CQIA 4NI3A 1HKJA 4KCUA 3ZJ7A 1PDYA 3RU6A 3KLLA 1M68A 5L6UA 5F2IA 1GW1A 4ZVJA 2ZIDA 4S23A 1YKWA 1VHNA 4OBSA 4XB3A 2Q6ZA 3R8RA 4CU7A 2JGQA 3UZWA 2R91A 5LA1A 4WJXA 4AWUA 1IXNA 4C6BA 5L9FA 2Y61A 3ERPA 4PSRA 2VR5A 4ROQA 4X0VA 2QDGA 1DWHM 3UJEA 1R3RA 1QVBA 2E0PA 4GQGA 4BR1A 4KT2A 1G4SA 3MJYA 5IDIA 1OIFA 1X39A 4B2DA 1LTDA 2PFHA 4C6LA 1HJUA 3PZTA 1V6UA 4FF5A 4HJFA 4GXWA 2PP0A 5FL0A 3SM0A 4G1NA 1R3TA 2G3IA 3ZT7A 2VEMA 3P84A 4Y90A 5D04C 3NZRA 1MRAA 4XUGA 4B90A 2EPKX 4X61A 3IGUA 3OO2A 1P6BA 1ITQA 3B9AA 1V4YA 4A29A 2J7CA 4MY8A 1OGSA 1GOMA 3W7HA 4GY0A 1IWAA 2FGBA 3GAKA 1B5TA 3NM3A 2WMIB 3UR5A 2CITA 3GAYA 2OEMA 1RK5A 2EG6A 3DDMA 5JIWA 4HJWA 1VPQA 2DT2A 3S2CA 4NJKA 4IPNB 2V5KA 1XYCA 1Y0EA 4PFHA 2YL8A 1JDEA 3TP4A 5A6AA 3G8EA 2Z0IA 1JG9A 3WBYA 3D3AA 1LJYA 3EMCA 4LX4A 3R58A 1WO2A 2HS8A 3BV7A 4LC8A 1GJPA 3LHTA 5JH2A 3TA6A 1WPCA 1F73A 2OODA 4FIRA 2QCEA 2UWFA 3P8IA 1B0IA 4H8UA 3GC2A 1Z48A 4C6MA 1W32A 1NDVA 1TTPA 4D2JA 4RPPA 3QZ6A 2HK0A 4DBUA 3N12A 4LRSA 1OX6A 4FNQA 3UCDA 1B90A 2C19A 4XKYA 2PGFA 3CC1A 4KCTA 1UKSA 2J78A 4ZQOA 2CHOA 1AQ0A 3NDOA 1Q45A 1DTNA 3VGGA 3MT1A 4IPIA 4XD5A 1K02A 5BOFA 4IX0A 4EP8C 1UR1A 3A3XA 3QYQA 1FWHC 3NL5A 3WQWA 2QV4A 1O5QA 1GOXA 4K2SA 3ANYA 1WUEA 3CM4A 3B0YA 3M0LA 1QDSA 3CZEA 3AHYA 1EJWC 2WNWA 3TC3A 2XM2A 4LOCA 3C2FA 3DG3A 4HMDA 5HNRA 3GHRA 4C6CA 4GZ7A 5CBJA 1S5TA 3TR2A 5PTDA 4G6CA 1X6LA 4H9MA 1BWVA 2WC7A 1ISXA 2G0WA 3IVTA 3DIPA 2Q01A 1DJQA 3FY1A 3Q67A 1L2UA 1PYFA 2ZRUA 1XLJA 4HNLA 4D6CA 4HA1A 2HVOA 3DXIA 4AIUA 1ICQA 1G4EA 3W29A 3C8FA 2A5HA 4DYJA 3LTYA 4PUEA 3VPLA 5IXEA 3DERA 5FOOA 1KM3A 3OZYA 3NGJA 4UTLA 3RX2A 3AHXA 4QBXA 3PPCA 3DENA 2Z00A 3HJZA 3MSRA 1F4HA 4AYGA 2OGYA 1BRLA 5CSUA 3NPVA 4WK9A 4LBRA 2QULA 2VD8A 2ZRYA 4J4KA 1XLGA 3MDWA 5GNXA 3W23A 2GUBA 3G0SA 1XS2A 5AVHA 3L0KA 3EKZA 4PCFA 1L2QA 3OLGA 3VGDA 2NQJA 5LNSA 2ZXBA 2CLFA 5M2FX 3GFZA 5CBIA 3U2CA 1YW1A 2VC6A 3W7CA 1YX1A 4UOQA 2CLOA 5FEXA 3NQ8A 4M51A 3M5YA 4AX6A 4OZOA 2VC7A 2XIIA 4RX0A 2X0HA 4L9YA 4RDVA 4B92A 3FEMA 1E0TA 4J2MA 3WQ6A 1ZJIA 1WDDA 1W17A 3ENLA 3NPXA 2IMRA 1PKYA 3FKRA 1D9EA 1S1PA 5TNVA 3BMWA 3BMVA 4ERAA 4B5VA 1F3EA 4KW2A 4R33A 1PX8A 1SJAA 1E6SM 4IP5A 1FWCC 1TELA 3NR0A 1RSCA 3VIHA 1OF6A 4MKVA 5LXXA 2W91A 2JE8A 3F2BA 4MB4A 4I8DA 3PNUA 1G94A 2XGBA 3IJ9A 1JZ8A 2PU1A 3K4AA 1OFRA 1XYLA 1P0NA 3D47A 4QEHA 2WZHA 1HJSA 3AU6A 1ISYA 3M43A 4JCMA 2WSRA 5ABEA 1EX5A 1YXCA 1HJXA 3CQHA 1GKRA 3T4CA 3W6LA 3IV8A 2I16A 1XLCA 4WEVX 2O7SA 4K39A 4BKNA 3FYOA 1WAUA 4IJBA 2NW0A 3T9PA 4UBPC 3SI9A 1A5LC 2BY3A 3LLXA 2QDDA 4QCEA 5CAKA 1YDYA 3CUHA 3CHFA 3N34A 3OTRA 4O11A 3H2AA 3AICA 1K9TA 1H51A 2DGAA 1R2SA 1XHGA 1OYBA 3OGVA 5HMEA 4P8UA 1UKPA 3N29A 5AHMA 1W2PA 4UQEA 2J77A 1B9ZA 2TYSA 2UBPC 5ABHA 3G0UA 3VIIA 5LNWA 2Q3OA 2XIQA 2YB4A 2CETA 3IANA 4DIAA 5K2ZA 1TE1A 3UR7A 1VJZA 3SCQA 4WJ8A 4H1ZA 2XYLA 3GFXA 2GVYA 4UMCA 2P88A 3IAQA 5G5IA 3H7VA 3FLUA 3BQ5A 1FDYA 2QUTA 5TAOA 4JTLA 1XCXA 2WCSA 3SCSA 1FWGC 3Q58A 3B4YA 5DCDA 1CXEA 2WMHA 3MWAA 1V3IA 1L8PA 4DRSA 3WQ5A 1UUMA 2HDJA 1QI3A 2ACUA 1HQTA 3WELA 5D05A 4F3HA 1DBTA 4AXNA 3EWDA 5DBTA 1UC5A 3E3HA 3BAJA 2QCHA 1W1TA 3IGXA 1ZPTA 4GJIA 3LYEA 4AZGA 2X30A 3MCOA 1EQCA 5CZJA 3K1GA 1M7PA 4KS0A 4AG0A 1EJVC 1YPFA 3O63A 1F61A 2XFFA 1HW6A 1MNSA 4K6AA 3PPFA 4AD4A 1RHCA 1FHDA 3WQFA 2WNQA 1U30A 3LN3A 3R13A 4FI4A 4A35A 4G7EA 4CVWA 3OIHA 3TW9A 3G1SA 4DYKA 2ZTJA 3JZEA 4GI6A 5C71A 3H2EA 3OBEA 1Y8BA 4M7SA 8CGTA 1M6JA 4BF7A 1BWLA 3AC0A 3GHUA 1J18A 1I2OA 3I6EA 2ISWA 3CL8A 1FDJA 3KZSA 3SN4A 1CGWA 4UC5A 2Z28A 5GJNA 3BO9A 2FH6A 1ISVA 4V28A 1RA5A 3HQ1A 2XN2A 1I60A 3S83A 5HQMA 3PUOA 4E4UA 3K4WA 3U48A 3IUDA 3PF3A 1OABA 2D3NA 3APYA 3G77A 2QIIA 2VMFA 2J27A 5HWNA 1W3KA 4UCGA 3CPRA 1VC4A 3VKJA 3LLDA 3W7GA 2XFRA 3W00A 1E72M 4IMEA 1BYBA 5JXQA 4KF1A 2VGIA 2GGGA 1KFJA 2W5FA 3VGBA 4B15A 4IMCA 1Y5XA 3SB0A 2IPGA 2CLMA 4QISA 1TQJA 4QTGA 1W0MA 4LYKA 2C18A 3UG3A 4P8WA 4S3AA 4F2UA 1G4TA 1V0NA 5FD0A 2TMDA 1XD0A 1FHVA 3P80A 1HJQA 3V18A 1RQEA 1J6PA 1E4IA 2WOQA 3AQUA 4DJDD 1JQXA 4KFPA 4GRSA 3MPGA 1S3TC 2Z1BA 2Y0FA 4Q3MA 2VX5A 1XCFA 3A47A 4AZCB 3MSYA 3K4DA 4TR9A 3CTTA 4KERA 1WP6A 5AECA 2AQOA 1WBHA 2WMGA 1Z69A 2ZRZA 2NX9A 5G1YA 4HU4A 3EKGA 4H9YA 4JIHA 3SECA 5I24A 3NEVA 1KM2A 4I7WA 3ISIX 5A8OA 3UVIA 3A6OA 4W4QA 1QPOA 5CGQA 3B8VA 4W7UA 3FIGA 3W72A 2PDBA 3BURA 3N17A 1NOWA 3AS1A 4GVIA 1AFSA 2NLIA 2BODX 5D09A 3SRFA 2HBXA 1V6TA 4KCWA 2EGZA 4K3ZA 3NDZA 2Y5EA 3KBNA 1EO7A 3HGOA 1NFBA 3NL6A 4FSAA 2WHMA 3UXKA 4YVVA 1QCWA 1WDPA 2J7HA 2Z6JA 1RQHA 2TAAA 2V5LA 4B5UA 1FKWA 4MB1A 4ZXOA 1KCZA 1XIEA 1ZSXA 3GX9A 2DZUA 2GGEA 1PZ2A 4B5SA 1S2CA 3BAYA 4LUSB 3S1WA 3SCPA 4ATDA 1B3YA 3EPNA 2VFGA 4OBTA 3RG6A 1A49A 4LBUA 3R89A 5EMKA 4C1NA 4TQTA 3MKVA 3I7RA 2NX3A 5TD4A 2FGLA 4CEXC 1KTCA 2DZBA 4EK7A 3AUOA 2FJKA 1E1EA 4B91A 4DWSD 1O5KA 4P7LA 3UGVA 2DT0A 4CN6A 3NQFA 3ZR5A 3QN3A 3IPWA 1JAEA 4PTNA 4TMBA 3DKLA 4Q32A 2BWGA 5I3HA 2DJLA 4QR6A 1R9ZA 4E8CA 3F1QA 1EOMA 2HSAA 4M82A 1OD0A 3LU2A 2YCIX 4L9XA 2ZZ1A 1F05A 4HZMA 4J27A 4HOZA 2WQDA 3QV8A 3PTDA 4KH2A 1W2VA 3QZAA 3VGEA 2DQXA 3HTWA 3AZTA 1V5XA 3A9BA 2VGBA 4QLLA 5D2YA 5EFDA 4AYSA 1D3HA 1W54A 1E6ZA 2J7FA 2EJ1A 2WJDA 3M4HA 2GSHA 1YPIA 3FAWA 1RBLA 2QDEA 2CU0A 1WB0A 4QQ3A 3FVMA 2QDHA 4YHEA 2PZ0A 3KOFA 1ZL1A 3PWAA 3GW0A 3CAWA 1OC5A 5C2CA 3VVGA 3J7HA 4WOQA 1EC7A 2ZZ2A 1PHWA 3BSGA 4RE4A 3GYCA 4HHHA 4HU0A 4X9SA 3ORWA 4PB4A 4KRUA 3EOEA 3FJLA 1E9ZB 3VC5A 4QFUA 3ONBA 4V2XA 3LCGA 3TJXA 4FO4A 5BRPA 4Q8WA 1DJIA 4DZIA 1J5SA 3H21A 4AD2A 1SQ7A 4FAMA 1GZ1A 1ZZMA 2ZE0A 2PBGA 3DFQA 4S39A 4TIMA 5AYZA 2GFTA 4HCLA 2OTDA 3R2GA 3KM8A 1DJYA 1J2WA 3W38A 1EC9A 1U1HA 4QE1A 3BMXA 3POHA 3MA8A 1W56A 1LL7A 3G6LA 3QHNA 5F4WA 4LY8A 4HNCA 3DN5A 1RPKA 1XI3A 1CECA 2WBGA 3EEGA 5C5YA 2E67A 4UFHA 5K9CA 1RPXA 1KM4A 3CWHA 4C6KA 3ABRA 1SPQA 4WY0F 3L68A 1GOQA 2INZA 5GPRA 1MXSA 4TU1A 1FHLA 2OVLA 1ADDA 2ON3A 3UA3A 3HOJA 1JYVA 5G4HC 3AXMA 5AB3A 1XYFA 4QCFA 4YWIA 4Q4OA 1P0EA 1F3XA 2PA6A 4DJDC 2YL6A 3N9RA