1TVNA

Cellulase cel5g from pseudoalteromonas haloplanktis, a family gh 5-2 enzyme
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords cellulase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvnA00
2WC3A 3BAWA 4UQDA 2Y8KA 4AZCA 2XVLA 1BVNP 1ODZA 2C8NA 3ARRA 1ZBVA 3WD0A 4J3TA 2NT1A 1K9TA 2XIIA 2WHMA 2JF7A 3VD5A 1LJYA 1UKTA 2VX4A 1C8QA 2ZX9A 4Q22A 4D6EA 2O9TA 3AS0A 5I79A 6A3HA 3N12A 1B0IA 2PI6A 1W2PA 2VI0A 4DM2A 5JBFA 1UKQA 4PMOA 4MB3A 3BAJA 1MW3A 4QCFA 3EDJA 3NUKA 3UG4A 1CLXA 3WH5A 1C7TA 2DT2A 2JIWA 4BF7A 1HJVA 3A6OA 3L4XA 1XCXA 2IXUA 3VIGA 4B3KA 4D6IA 1EGZA 1B3WA 4AEFA 2WXDM 4YHGA 3PZNA 3MSDA 3MS8A 1OCQA 3MU7A 3MO4A 1XD0A 9CGTA 4A3HA 1E9LA 1UG6A 1DP0A 3VU2A 2EQDA 1BG4A 5HOSA 3WH8A 2A3AA 1B90A 1E0WA 3DYPA 3W0KA 1WAWA 2FGZA 2XTKA 2WCGA 2CCRA 5BCAA 2VVNA 1AMYA 3O9NA 2WWDA 5TD4A 5D9OA 4QCEA 2JEPA 4F79A 2VMFA 3L4WA 2BXYA 1BGGA 3QHNA 3SCNA 5LA0A 2DGAA 3DECA 3OA5A 1F4AA 3O6AA 4Y7EA 5CSYA 3A4XA 1CXHA 5IHRA 5JBDA 4PN2A 5BXPA 2D3LA 4U3AA 2WSKA 2BVDA 1C91A 3M07A 1DHKA 1EHAA 3SUUA 3MSGA 1XHGA 3WUBA 4NI3A 2BFGA 3T2OA 2WWCA 1M01A 4XZBA 2VL4A 4FF5A 1FHDA 2QLYA 1UWIA 5GPRA 4UOZA 5I78A 1H3GA 1V6XA 1AQHA 1WZAA 2X0YA 2EPOA 1I75A 3RPMA 4RL3A 1I1WA 2PWFA 1M03A 2E8YA 2BHUA 4ZE4A 3JUGA 2D24A 1GVIA 5EFFA 1JFXA 3OZOA 3UG5A 1CGYA 2WLZA 5ABGA 5DT7A 2J7DA 5A2AA 2G3MA 3NDZA 1JAKA 3L4TA 2OSYA 2YL5A 1C90A 3AOFA 3NDYA 4AZHA 4WK9A 5AC5A 1QBAA 4OUEA 3EDDA 1A3HA 1PX4A 3NSNA 2DT3A 4IPLA 1EQCA 2WW5A 1GJUA 4W5ZA 1LG1A 3CZEA 4P8VA 4UOQA 3S2CA 4UZSA 1CECA 2FGLA 1E6QM 4WKHA 3WUEA 3EYPA 4M81A 2E9MA 1JYNA 1UA3A 5C71A 5BRQA 4JFWA 3VIHA 4JL1A 5C8BB 4U3CA 4J28A 2EO7A 3ZIZA 2O9PA 1GOOA 1DWHM 1UH2A 5CSUA 2J78A 4JFTA 1BLIA 5CGTA 1JG9A 4GINA 4P7OA 4URIA 5IDIA 3RILA 2WKLA 1BHGA 1E6ZA 3VUPA 3AQUA 2QPSA 1HX0A 2XG9A 2YLAA 3PBGA 3L4YA 1GOQA 3WNNA 2J8GA 2VZSA 3APGA 2J75A 4QLLA 3RMEA 3DYOA 3WY1A 2PBOA 1HVXA 2RGMA 1MQRA 1GVYA 2VNCA 2EJ1A 4CD6A 1PJ9A 4PSPA 4UFHA 4ZFMA 3AYSA 3VGGA 4OOUA 5AY7A 3VOCA 1OT1A 5M3WA 2XUCA 4D1JA 3N1AA 3POHA 1FHLA 1EXPA 1NOUA 3AMDA 2D23A 3AIWA 1EDGA 2DIJA 3W27A 1SMDA 5FOOA 1TZ7A 4W8BA 2VR4A 4F66A 4EE9A 3TA9A 4CCEA 4CKQA 3VX1A 4WLCA 1EDTA 5I5RA 2WVUA 2D0HA 1ISXA 1L0PA 4QAWA 4X9YA 2HVMA 4UQAA 1JAEA 1KQYA 2BV9A 3CIVA 4AMCA 1KB3A 1UH4A 4ZXLA 1D7FA 3F5JA 5A6MA 1VJSA 4MNLA 3ARYA 3PZ9A 1W2VA 2A3CA 4BA0A 4JIEA 4HOZA 2DSVA 1E6NA 5BXRA 4H41A 2X0HA 2J79A 1ISVA 1P6WA 4EK7A 1VEMA 1JI2A 1UQZA 4JHOA 4WKFA 4GIAA 4XZWA 5D9MA 4AZ7A 4CCCA 1R87A 3GTNA 1B9ZA 4HA1A 3WDJA 3AICA 4GI9A 4UFIA 1RH9A 1TVPA 2WSPA 3WQWA 4FK9A 1E4IA 2VRQA 1FOBA 3WL1A 4P7LA 5CGMA 2CETA 1UD2A 4BQ5A 2DSZA 2BS9A 2V3GA 3DYMA 1XYFA 4UQBA 5FL0A 3F5LA 2VO5A 3VGBA 5E6YA 3AHYA 4GQQA 3AS3A 2Y4SA 1V0MA 4GPNA 4H8VA 3W81A 2O92A 4E4PA 1VB9A 3GXMA 2ESCA 4PMQA 4FMVA 3VO0A 3L4UA 1VIWA 2E9BA 4UOJA 2OYKA 2GDUA 4J27A 4BZYA 1D3CA 1E3ZA 5IFPA 3GZAA 1W9BM 5A8QA 3T0AA 1UD5A 3WQ4A 1ZBCA 1JZ8A 2F61A 4YPJA 7CGTA 5FKYA 2CKRA 1UD4A 4OOZA 2J77A 3CMJA 3AIQA 4GKLA 1VF8A 3VPLA 1CXFA 4ACZA 1DWAM 5A6JA 1EOKA 1HN1A 4TVCA 3I3BA 2ZICA 1V3JA 1SR0A 1TVNA 3U57A 2WVTA 3ARVA 1GOKA 3GH5A 3ARXA 1UQYA 5CQ1A 3GH4A 3CUIA 2W63A 5EFDA 4MTVA 4PTMA 2WZIA 1ESWA 2W4XA 1UWUA 4F9JA 4WSJA 3MMWA 3UG3A 4DWSC 5A6BD 1EO5A 3QOMA 2G3IA 4LYRA 3M7SA 2YDSA 5FL1A 1Y7VA 4PMYA 1SMAA 4D6FA 3UERA 2CYGA 3AI0A 1XH1A 1BYCA 4AZIA 2YKKA 3FW6A 3AHXA 3BSGA 3OGRA 3WNPA 1FH7A 1EH9A 4UQ9A 2ZUSA 2JE8A 3PZIA 1E6PA 3LPOA 4MADA 4JKKA 4HA3A 4TTGA 2WAGA 3WD3A 4CU8A 1WDSA 4W8AA 3SUTA 2FHFA 3WSUA 3FNDA 3N9KA 3VD4A 3AMCA 4WIWA 3BAXA 3VILA 4QDMA 4U2YA 1H5VA 3T2QA 2DSWA 3WUGA 1E72M 1X6NA 2YL6A 3VX0A 1K9EA 1QHPA 1B30A 2G3JA 3WDRA 3BXWA 3VD9A 3RDKA 2PWDA 3PTMA 3SUWA 5GNYA 3ZO9A 1W9UA 2DT1A 2YLLA 4DWSB 2XGIA 3AIBA 4P8UA 4D6HA 2YOCA 3WQ6A 3F5KA 2OYMA 4AIUA 1F4HA 2XSBA 1J0JA 2GJXB 2ZX8A 3IJ7A 4JFUA 5E70A 1UD8A 1BGAA 3ZR6A 3KL5A 3ZT5A 1J01A 1SFSA 2D3NA 3UEQA 1C8XA 3WMSA 4JZ5A 3AMKA 4LPCA 4HOWA 4LYPA 4OZOA 2GJXA 4H8UA 2CBIA 1BPLB 2J62A 1US3A 1V3LA 5LA1A 3L2MA 4PTWA 1WP6A 2CPUA 1JZ6A 1RP8A 5M03A 3CZJA 2VRKA 1E0XA 4D6GA 2J74A 4HA4A 4W5UA 1ITXA 1QBBA 4K68A 4JHZA 1JDAA 4JFSA 2FHCA 2ZUVA 3TTOA 1BQCA 1BYBA 2J7BA 2OWXA 1ZB5A 3G6MA 1QNOA 1JIBA 4W88A 5DMYA 3ARWA 1E5NA 3WF2A 2CHOA 1UD3A 1V0NA 1VEPA 1NWRA 5EBAA 2XIBA 3EDEA 1CIUA 4UQEA 3GM8A 1HJSA 5I2UA 4NRRA 1O6IA 1W3LA 3N15A 4PRWA 1W1TA 1BFNA 2XYLA 4PTXA 3WUFA 3WNKA 4C7DA 3VINA 4FLOA 1ITCA 4NSBA 4AXNA 3SUVA 3A3HA 4PUDA 1W9XA 1VFFA 1UWRA 1J10A 2V5CA 2CITA 3GBEA 3FXYA 2VC9A 2VRJA 5A3HA 3CO4A 3WDPP 4ATWA 3VIFA 1HL9A 3ARQA 4CGTA 2MANA 3L4ZA 4ZE5A 2GVYA 3OG2A 3LPFA 1WZKA 3VM5A 4TVUA 5BROA 2JALA 3SIMA 4AZ5A 1CGVA 4Z2HA 1UHVA 2E9LA 1WZLA 2OLHA 4R5EA 4A4AA 1QOXA 1UH3A 1R86A 2DSUA 4PMXA 1NOFA 4ZXOA 4Z2KA 1TR1A 2J7GA 5CXPA 1GNXA 1TMQA 1OSEA 1O7AA 1CXEA 5F7UA 1JD9A 2A3EA 2J8FA 2WMFA 4Z2IA 4ZEPA 3GXIA 2XGBA 3AFBA 4HP5A 1B1YA 1JYWA 2W5FA 2UY4A 3SURA 2CBVA 3VD7A 3KL3A 1K9FA 3ARPA 3T08A 2BY2A 2J7EA 1KWKA 1QNPA 3PZVA 3MV01 3VGHA 5I24A 1KR0A 1XCWA 5E9AA 1JYVA 4WSKA 4PMNA 4BQ3A 4GI8A 4W87A 3ZJ6A 4HPHA 2VQTA 4FLQA 1KXQA 2PWHA 1GOWA 1LF1A 3M6DA 3ZM8A 2WCSA 4AZCB 4HZ7A 1OM0A 4UCFA 2DIEA 4JAWA 5ABFB 3WD2A 5HXMA 1CENA 3AMLA 4KGLA 2BY3A 3CZGA 3OGVA 3CGTA 5DEZA 1GQKA 4DUVA 2WMJA 2BVYA 1E40A 4AY1A 5CLTA 1GPFA 2FH8A 1H1NA 3AIEA 1QNSA 4ML4A 1QNQA 1QW8A 4AZ6A 4DWSD 4R27A 4ATLA 1JFHA 4C7FA 4KGJA 1E6RA 3VDBA 1JF5A 3K1DA 1OD8A 2Q8XA 4GZEA 1NQ6A 1JDDA 5EB8A 3VGEA 3RIKA 2VX5A 1WDPA 3MUIA 3CTTA 1VRXA 2G4FA 2X8RA 1QI0A 3NSXA 3VMOA 4JKLA 4XUYA 1XSJA 2VCBA 2VZVA 3VIPA 4MNKA 1OINA 2GFTA 2E3ZA 4PSRA 1W3HA 3W6MA 3T09A 3VDHA 3VM7A 3FHAA 5CJ5A 4L4PA 1OIMA 3WMBA 2FDMA 3S6TA 2HISA 1EA9C 1HKKA 3CLWA 3II1A 3BMWA 4UQCA 1QI4A 1UA7A 1ISWA 1UKSA 5BXTA 1E5JA 2ZIDA 3UCQA 4CCDA 1H11A 5HPCA 1RPKA 2DQXA 3AXXA 2WPGA 1RP9A 4MB4A 1ZL1A 5D4YA 3TONA 1J0IA 3UR8A 1K6AA 1VENA 7TAAA 4QLKA 3UESA 2YDQA 1HL8A 2JF6A 3WQ5A 4E8DA 4UZUA 1KCLA 2TAAA 3NYDA 1W3JA 2XWEA 3OGSA 4F8XA 4UFKA 4HOXA 4J3WA 5BYWA 2Z1KA 1E71M 3A4AA 3MANA 1HP4A 1MXDA 4P8XA 2G3NA 3VVGA 5FD0A 1WNOA 1M7XA 2VJXA 2ZXDA 3KWXA 2WKGA 1M04A 2YA1A 3WF0A 5AYBA 4W7VA 1YHTA 4JL2A 4ZENA 1CWYA 5A8MA 4CD4A 4AWEA 2OSXA 1TUXA 3RCNA 1WZMA 4W8LA 5A8PA 3B9AA 2XVKA 3W4RA 3AS2A 1XD1A 3CUHA 2VQUA 2VCCA 3NCOA 5A6KA 3A4WA 3MKKA 5D9PA 4P7RA 3KE0A 1MYRA 4TXEA 1JZ3A 2Z1SA 5A6SA 1LG2A 3CZLA 4YN5A 2NSXA 1VFMA 1W32A 1NWSA 1CNVA 1ISZA 1CGWA 2JIEA 2XM2A 1JD7A 4W7WA 4U5IA 1XRVA 4AZGA 4BCEA 2ZXAA 2VVSA 1VBRA 1EQPA 1PPIA 3GDBA 2W67A 4PMVA 1MW1A 3WDIA 2WMIB 2J7FA 2YDRA 3WF3A 3GYCA 1JNDA 3RO8A 3OZPA 4H7VA 4PMDA 3WBAA 3N18A 1HT6A 2ZXQA 1SYTA 3SEPA 4D6DA 2Y2WA 1L8NA 1TG7A 5BRPA 2JFEX 2UY3A 3CH9A 2WK2A 3PZOA 1UZ1A 2XPKA 1E3XA 4J3UA 1UKOA 2C7FA 2ZWZA 2RGLA 1OD0A 4QFUA 1H0IA 3W24A 3WEOA 3N04A 4MAVA 3PZGA 3OIHA 1HJQA 4MJ2A 1J18A 5FCZA 1FA2A 2VR5A 1FH8A 1JZ5A 1V6YA 4TX6A 2DH3A 3ARSA 3MUZ1 3TP4A 4BQ2A 1G5AA 3TOPA 4J3SA 1A47A 3QR3A 3CHEA 1V3IA 1WKYA 1UOKA 3T2PA 1LL7A 3QGVA 3ZSTA 3WNOA 1C3FA 3WH9A 1OIFA 2CHNA 7A3HA 4HPGA 1IT0A 1CTNA 2GUYA 5AYIA 2ZUWA 1IV8A 2GK1B 5ECUA 2WMIA 1LL4A 2D2OA 5CPQA 1TFVA 2CEQA 2ZE0A 2V3EA 1Q6CA 3EMZA 3BH4A 4H04A 4M56A 2A3HA 2VZUA 3AROA 3QOKA 1PIFA 3SUSA 2F8QA 5A95A 5E6ZA 4AIOA 1JZ4A 4PEEA 1LWHA 4F9DA 2GDVA 4KH2A 4AD3A 5A6LA 3K8LA 1PX3A 1GHSA 4W7UA 4BS0A 4U5KA 1KGXA 3ZQ9A 4GO9A 1BG9A 2XVGA 4HMCA 2WZHA 4GZIA 1KXTA 1R85A 1W3KA 3BLKA 3TTYA 3PZMA 3W6LA 1GQIA 3I3EA 1GOMA 3ZSSA 3U7BA 1C93A 3AIUA 1LWJA 4UFLA 1IZJA 3WNMA 1HXJA 3M46A 2ZUMA 4NZCA 1BYAA 4W85A 4C7GA 1VFUA 1GW1A 1HP5A 2QV4A 3ZJ8A 4S3KA 1G1YA 1E43A 1CEOA 1E1FA 1D2KA 2UWFA 4RE3A 3WMCA 3GNOA 4V28A 3AZTA 1PIGA 3UR7A 1DWGM 4RE2A 2V3FA 4CVWA 3WEMA 3UETA 3W28A 2PC8A 5I6SA 1H09A 1TCMA 4LGXA 2PBGA 2CBUA 4H8HA 3FHQA 4PMRA 3CUFA 4X0NA 8CGTA 4B15A 4AC1X 1RD6A 4KWUA 2XHYA 2X09A 1HJWA 1J0YA 3IAQA 2E8ZA 2W92A 3WELA 1NP0A 1GQLA 1QHOA 3N13A 4B9ZA 1H0GA 3LPPA 2XWDA 3K8MA 4GO8A 2D0GA 2BHYA 2VX7A 1E73M 3WN6A 3GNPA 4LQ1A 4H2CA 5CLWA 4HTYA 2W62A 3VMPA 2IXVA 2ZUNA 2ZWYA 5D8WA 5LYRA 4J3XA 4TUFA 4N0RA 1E4MM 3WF1A 1NARA 1BAGA 3CHCA 1PZ3A 3OBAA 5C70A 4B9YA 1HIZA 4D71A 4CD7A 4W89A 3AS1A 3W25A 2PWEA 4NF7A 4E8CA 4CU7A 3VIMA 3AHTA 1J0ZA 4IM4A 3VNZA 5I3DA 1CXKA 4DWSA 5KZ6A 2UY2A 1CGUA 4JKMA 4J7RA 4P7NA 1E6XM 1EO7A 3KL0A 1BF2A 1J9YA 3CZ8A 4XX6A 3WQVA 2D0FA 4NRSA 4MB1A 3OLEA 3POCA 4HU8A 1WB0A 1V0KA 2BHZA 1B2YA 1KBBA 2GJRA 5ABEA 3SCTA 3QHOA 5GQBA 1HJUA 1V6UA 3MMUA 5EMYA 3CZKA 1K9DA 2E4TA 2VCAA 1U33A 4Z2GA 1BYDA 4PMZA 3U7VA 4EAMA 3ALGA 2F2HA 1KXVA 1VFOA 2XM1A 2WNWA 5DFAA 3CHFA 2YA0A 1S46A 1UD6A 2Y24A 3U5UA 1QI2A 5ABHA 4GZJA 1FFQA 3WNLA 1VBUA 3L4VA 5GNXA 4PCTA 1V03A 1CXLA 2X1IA 3AMGA 4PBGA 2BVTA 3AIVA 1CGXA 1H41A 1MWOA 1UR0A 1KFWA 1N82A 1J12A 2DPEA 4OJYA 2O9OA 3AXHA 3NIYA 1TA3B 2PB1A 1GOIA 1C8YA 5BXSA 5A1AA 3ZT7A 4WF7A 1HNYA 1WPCA 1LQ0A 4X0VA 3TTQA 1H4PA 1QI3A 4IUGA 1UR9A 1GJWA 4GI6A 1V02E 1DWIM 5DF0A 1CGTA 3N11A 2GSJA 3BMVA 3ZJKA 1X1NA 3SCPA 2VURA 2J47A 4J3VA 1QVBA 1JDCA 1E70M 4DUWA 6CGTA 3NSMA 4MPKA 4TVDA 1BVZA 2DDXA 3MUY1 4MAZA 3MUAA 1R8LA 3OLGA 1MQQA 1MW0A 2WVSA 3EBVA 2ZXBA 4CN6A 5M17A 1UKPA 3AHZA 4EANA 3VTRA 3K46A 1KGWA 1AQ0A 5E0FA 3FAWA 1JGIA 1V0LA 1WCGA 2ZOXA 2G41A 1W91A 3PN8A 3NJ3A 1DWFM 1W1PA 1Z32X 2WHKA 4PCSA 1GONA 1E55A 2AAAA 1XH2A 3LMYA 4HMEA 4QLJA 3EMQA 1VJZA 4MDPA 5D9NA 5JIPA 2E0PA 1MVYA 1E6SM 2YA2A 4PYSA 1CDGA 2EXOA 3BCDA 3AYRA 2ZUTA 2Y5EA 3FY1A 1ISYA 4BQ4A 1KWGA 1DEDA 2AMGA 1VEOA 1NWUA 3D3AA 4LXFA 5HDRA 1R7OA 3GBDA 5IFTA 3CUGA 2IUZA 5GNZA 1E0VA 1CLVA 1V6VA 1V6WA 5D8ZA 4A3YA 2WANA 2V38A 4CU6A 3OLDA 1V08A 4D6CA 3WKZA 3BAIA 1JZ2A 1XSIA 2BXZA 4XB3A 3BAKA 1PZ2A 5AC4A 1UYQA 1EIBA 3ZOAA 4MJ4A 3K8KA 1UWSA 3ALFA 3AZSA 1V3KA 4Q7NA 2AOSA 2EPKX 1MXGA 5DO8A 1UR1A 3SCVA 2CESA 4MNJA 2FHBA 2E40A 1NH6A 3IK2A 3PHAA 1EHNA 2VX6A 4D1IA 3SCQA 4M29A 1OB0A 4GQRA 3THCA 5A8OA 1M53A 4MNMA 3GH7A 1GHRA 3VIIA 3SCWA 4TX8A 2XFRA 1I1XA 3J7HA 1UWTA 2X05A 1Q6FA 2XSAA 2W66A 3VMNA 4JFVA 3G6LA 1W1YA 3WL0A 3TTSA 2OWWA 1W9DM 3VGFA 1QI5A 1OGSA 1XYZA 4DUXA 1KR1A 1ZBKA 4XV0A 1U30A 3WEZA 2WB5A 5LA2A 3T0BA 4LX4A 1NOWA 1UR8A 4OBRA 3SCOA 1G9HA 2GK1A 1E4NA 2QHAA 3ARUA 3WIJA 5A6BA 1ECEA 3L2LA 1KCKA 3VDCA 4HU0A 3I3DA 1WDQA 4MB5A 2OYLA 1XV8A 3W37A 1E15A 1UUQA 1W9VA 2WMKA 4UR9A 4W84A 3AZRA 3KEHA 5HNNA 4PTVA 1FH9A 1JYXA 3U5YA 1V3HA 1JZ7A 2FH6A 2BNJA 3RM9A 1MQPA 3IJ8A 1U2YA 2D20A 1CPUA 3D5HA 5HPOA 1NWTA 1HKJA 4DM1A 3ZT6A 5E0CA 2WMGA 3W53A 1E1EA 1G01A 4V27A 1AVAA 3QHMA 1HKMA 1KGUA 3K4DA 4FLSA 4HZ8A 5I77A 2YL8A 1JI1A 1QNRA 2PWGA 3B9DA 3WQ8A 4QP0A 4Z2JA 2WC4A 1XSKA 3FN9A 2YJQA 3RJXA 1JXKA 3ZR5A 2XFFA 2QMJA 3AHVA 3ZJ7A 2D22A 5I23A 4OBSA 4LYQA 1J0HA 1C7SA 3GXDA 5A2CA 8A3HA 2XFYA 2EBNA 4AD1A 2J7CA 2WLYA 3WFLA 1HKIA 1HJXA 3DHPA 1OGBA 2WBGA 4AYSA 1JNEA 4CD8A 3W29A 5DT5A 3OLIA 2OSWA 2QMKA 1KXHA 1WE5A 2X2YA 3CHDA 3KZSA 5FIPA 2PF0A 1WDRA 4M24A 2WBKA 1V3MA 3IANA 2CERA 3OB8A 2ZX7A 3BSHA 5A69A 6TAAA 2JEQA 3PZQA 3RJYA 2J4GA 1E56A 1UWQA 1QHZA 2QPUA 1BTCA 3SCUA 2NW0A 1GORA 3BC9A 3SCRA 1TE1A 2WMHA 2WVVA 1CXIA 3WH7A 4AZBA 3VD3A 1J11A 3VIOA 1BSIA 4AEEA 1MFUA 3AJ7A 4TTUA 1Q6DA 4EKJA 2CKSA 4E2OA 1KQZA 3WD4A 4M1RA 1UR2A 1B3VA 3A47A 2WC7A 1JL8A 1W1VA 2YBUA 3HMCA 4RE4A 1CBGA 4AD4A 3VKKA 3CBWA 3WDQA 2NT0A 3IJ9A 1YQ2A 4M80A 4M82A 3F4VA 1GUVA 1EOMA 5A6AA 1Q6GA 5A8NA 2WYSA 1KBKA 1ZU8A 4WJXA 3CUJA 3HN3A 2WVVB 5CG0A 4CUCA 2W61A 1H2JA 2VUYA 3AXIA 3BGAA 3PZUA 3RM8A 4ACZB 2WHLA 2DEPA 1OWQA 3MMDA 1B31A 1VAHA 1US2A 3GXFA 3SCSA 5A2BA 1OT2A 4P7QA 1QW9A 2VOTA 5JIWA 4PMUA 5E09A 4FLRA 3O2LA 4CN1A 4UTFA 3WDHA 1UZ4A 2WCAA 4Z2LA 1HVQA 2WZEA 2QF8A 2UY5A 2EPMX 3BLPX 3HU7A 4IPNB 4L4OA 3WBEA 2CXGA 1ODUA 3THDA 2V3DA 2VZTA 5JUVA 1UR4A 1G0CA 4UNIA 3IAPA 1FP8A 4S3JA 4N42A 5IXEA 1X6LA 2CBJA 2XVNA 4CN4A 4W86A 1PAMA 2BY1A 2ZX6A 3PTKA 3ECQA 1E4LA 5HBFA 4WKAA 1LL6A 1EDQA 4B3LA 5M5DA 2EEXA 1B3ZA 1OBAA 4KMQA 1NM9A 2J7HA 1JF6A 4UFJA 4MDOA 4D72A 3N17A 5CPSA 1Q4NX 2VTFA 4HZ6A 3MV11 3CMGA 5CPTA 1AQMA 2WM0A 3K4AA 1IZKA 3AISA 1Q6EA 2W91A 2EPLX 1ZJBA 1R7AA 3LPGA 2VZOA 1GCYA 5BWFA 1MFVA 4UFMA 4ACYA 1HF6A 2VT0A 3WFZA 3ARTA 3DHUA 3W82A 2XJ7A 3B9EA 2YIHA 2YL9A 2DT0A 3FAXA 3WF4A 2CNCA 4AW7A 3B8SA 4W93A 4JCLA 3RM4A 1XH0A 1OGGA 1B3YA 2V5DA 5KEZA 3VIJA 2XVPA 3ARZA 3BCFA 1MW2A 5IHSA 3VNYA 1J0KA 4GXPA 1B3XA 1ZBWA 2O9RA 3EMCA 4U33A 4AIEA 4P8WA 1ZJAA 2A3BA 4AISA 1XC6A 1FP9A 5I0DA 2BY0A 2J25A 4AD2A 3EDFA 4OIFA 4M8UA 2ZX5A 4U31A 4KRTA 5ABFA 3E1F1 3CPUA 3DC0A 2EPNA 1WO2A 2ZUUA 3W26A 1C92A 2DSKA 3PZTA 2G8ZA 2DH2A 1LLOA 3T0DA 1H49A 5A94A 4AD5A 1PBGA 2WHJA 3AIRA 3WD1A 1DWJM 4B16A 1JXJA 2GJPA 3HJEA 3EDKA 3PTQA 1GZJA 1DTUA 1QPKA 3GNRA 1ZS2A 1GQJA 2D1ZA 2OWCA 1FFRA 4OKDA 1CZ1A 4YHEA 3WENA 1PEZA 1TA3A 2CIPA 4D6JA 1NP2A 2YBTA 3BAYA 4HMDA 1CYGA 4CVUA 4TOQA 1G94A 1V02A 4U2ZA 5CZKA 4JCMA 5JBEA 4AD0A 3VGDA 4ATDA 4CD5A 4PUEA 3VDAA 1PX8A 2B31A 4KRUA 3VIKA 2C0HA 4V2XA 1W9PA 3WH6A 3ZMRA 1XGZA 2Y8VA 3W38A 4IISA
chains in the Genus database with same CATH superfamily
3RK8A 1K1DA 2XVLA 3G1SA 1ODZA 3ARRA 4UNLA 2WNZA 5D05A 2NT1A 1NFBA 3UP8A 3VD5A 1LJYA 3LNPA 1A5BA 6A3HA 5EMUA 2PI6A 3UWZA 2OOFA 3MCMA 6REQB 1TRDA 1LBFA 2O56A 2ZZ7A 3UY8A 1BSLA 3UG4A 2CLEA 3ID7A 2IKGA 3W84A 4O50A 2DT2A 4R53A 3S5OA 1DXFA 5BOFA 3N2MA 1HJVA 1E9YB 5LGXA 4BF9A 2PDLA 3W86A 4D6IA 1EGZA 4YHGA 1OEPA 3PZNA 2PP3A 3MSDA 3MS8A 1RJRA 2HVOA 1XD0A 4ZO8A 1UG6A 1W1A1 3QLLA 3ZS4A 2A3AA 1B90A 2C91A 3W0KA 2FGZA 2WJDA 2VC7A 5TQLA 1XKYA 3PJTA 2Q71A 2VVNA 3O9NA 2JEPA 4K1WA 4ICNA 2VMFA 3L4WA 4FX7A 3S6DA 5E9XA 2BXYA 1BGGA 5LA0A 4Z1YA 3DECA 4GVFA 3I68A 3L21A 3QY8A 5HWJA 4DRSA 4UTTA 5KINA 1Q4WA 5LSMA 2WSKA 1W1B1 4MF4A 1FWHC 3SUUA 3MSGA 3SM0A 1EJSC 2EAWA 5F2MA 3GDKA 2ZKMX 3GU9A 2O4QA 3H2EA 2QDEA 2VL4A 1R6WA 5GPRA 2GYIA 5I78A 1V6XA 4EPEC 2IPWA 2X0YA 2PDNA 3VUSA 3RU8X 1DYSA 5HWMA 1QOQA 3DHDA 1M03A 3M64A 1K02A 1EIXA 1GVIA 5EFFA 1JFXA 4H19A 1TTQA 3TA6A 2Z6JA 3NFUA 3U4FA 2G3MA 1XRFA 1JAKA 1DIKA 4AHQA 2YL5A 2Y0FA 1N55A 1UPPA 3NDYA 3SFWA 5AC5A 5IBXC 1EC8A 3MVTA 3GD6A 3VOIA 1JUKA 1I2QA 4IPLA 1LG1A 4L4MA 5MF5A 1VFTA 4P8VA 3LV6A 3S2CA 3DG6A 4UZSA 4BY3A 3P60A 1MNZA 3JZUA 4B4HA 2E9MA 4US5D 2J13A 1FVPA 4JFWA 4YTRA 3VIHA 1WUFA 1WXZA 4J28A 4CLMA 4CNUA 1UPMB 2DZBA 1EJVC 1F6PA 2PLCA 4Z1CA 4I7VA 1AUSL 4WDTA 4DNHA 4LAUA 3MBFA 4URIA 5IDIA 3W7KA 1BHGA 1LRNA 3VUPA 4Q8UA 4BJHA 4HMNA 4UWMA 4AWUA 3PBGA 3U4AA 1GOQA 4IPPA 1YEYA 2OKOA 4EPDC 1UZHA 5TBOA 2OB3A 3RMEA 1IGSA 1MQRA 4PGLA 1Z89A 4UTWC 3KS6A 1X97A 3AYSA 4Q7BA 4NXKA 1OT1A 3N1AA 4LUIA 2OELA 4DLMA 1NOUA 2J6XA 4C1KA 2D23A 3AIWA 4RZBA 3W27A 5FOOA 3W71A 1G6CA 3OYZA 2X42A 3M0IA 2VR4A 4FXFA 2F6KA 4PC8A 3LV5A 4OV9A 3T78A 4FHAA 1EDTA 5I5RA 1ISXA 1B5TA 4EXAA 3MA8A 3CIVA 1R47A 3G5EA 4U10A 4I7UA 4O12A 1KB3A 1D7FA 5A6MA 3H54A 4I9AA 3W1UA 4WD0A 3NQEA 4M19A 3R89A 3I6EA 4JIEA 2DJXA 4HOZA 1E6NA 4Q4OA 5BXRA 3RN6A 4C6EA 2J79A 1ISVA 1HKVA 4GH3A 1VEMA 4JTEA 4LAOA 1X39A 4GIAA 5D9MA 3TYCA 4JNZA 1R87A 3WDJA 4F48A 4UFIA 1XKJA 2PCEA 3WQWA 1KFKA 3F2CA 2VRQA 1FOBA 2QCCA 3JS3A 4P7LA 5CGMA 2GWGA 1EZ2A 2CETA 1UD2A 2DSZA 1XYBA 2V3GA 3DYMA 4UQBA 5FL0A 3KUMA 3GG0A 3VGBA 3VOHA 4GQQA 3AS3A 2A6NA 1F07A 3T0CA 2BTMA 3S0CA 1S38A 2Z26A 2NLYA 3BG9A 1P48A 4E4PA 1IEWA 4PMQA 5HULA 4DJDC 4DF2A 3L4UA 2TMDA 3GDMA 4XKYB 3AYTA 3P74A 3LBCA 3UXAA 5A8QA 3T0AA 1JZ8A 2FMNA 3B8WA 1F3WA 1EFZA 5FKYA 2J88A 1WOAA 2J77A 2R1PA 4GKLA 4QQ3A 2PGEA 5A6JA 3PWAA 1EOKA 5C2GA 1HN1A 1V3JA 1QWGA 3TAOA 1I0BA 2CLLA 2WVTA 4WY0F 3ARVA 2A79A 3GH5A 3ARXA 1UQYA 3IGXA 3TYZA 3GH4A 3CUIA 4FR1A 5EFDA 3EB3A 4MTVA 2XZ9A 2CWNA 1ESWA 2IPFA 5FJTA 2E1DA 3LHYA 4G2DA 3SGUA 4DWSC 7PTDA 3EAUA 1ICQA 1F76A 4GUGA 4PMYA 2V68A 2MNRA 1SMAA 1EKOA 3D6NA 4F0SA 1XH1A 3BSGA 1MI3A 4H9VA 1W5PA 4YXGA 1TIWA 2ZUSA 3M41A 5HAOA 4MADA 4DYKA 4TTGA 4DBUA 3UWUA 1WDSA 4W8AA 3SUTA 2BP1A 3RLVA 4C6NA 3RPDA 2HSAA 4C6QA 2NQ5A 1H5VA 4PA8A 2YL6A 4S1FA 4PB5A 3QMRA 1X98A 1B30A 2ANUA 4W4QA 4ENLA 3G0XA 2PWDA 1MEHA 3SRKA 1W9UA 3G1AA 4DWSB 1ZAJA 2R24A 1W31A 2PZNA 3AIBA 3WO8A 4P8UA 4JDBA 2VWTA 1OK4A 2HS8A 2QDGA 4PRTA 4KEUA 4M3PA 1A0EA 3ZT5A 1WYIA 3THUA 4JZ5A 3AMKA 4LPCA 3IIVA 2ZRZA 3RLGA 4OZOA 4G5DA 3H70A 4UTUA 2CPUA 2POZA 2C1GA 1LOQA 1TPB1 3CZJA 1SO6A 4WVXA 3U8GA 4TU1A 1E0XA 3G0SA 4HA4A 4W5UA 1QBBA 4JHZA 2FHCA 1VCFA 3TTOA 1M7OA 2PGRA 1EGVA 2RHGA 2VDIA 4FXRA 1QNOA 1XF0A 2E6AA 2CHOA 4XZIA 4Y9NA 1JPHA 1V0NA 4DJEC 3G18A 1TX0A 1VEPA 1VYSX 3EDEA 3JZEA 3TN5A 1QOPA 1HJSA 2WPBA 3BOLA 2RH9A 3B8TA 5FJJA 1ITCA 4NSBA 4REQA 3SUVA 2DZPA 1Q8JA 3A3HA 1D7KA 1VFFA 3WLJA 1UWRA 4JQAA 2CITA 2WJZA 2VC9A 1REQA 2V81A 3CO4A 3WDPP 4ATWA 2PTYA 3OOQA 3LI1A 3BOFA 3UWYA 4EPKA 1HL9A 1XISA 3ARQA 4M6QA 4FXSA 3T1GA 3FGCB 1GKPA 3OG2A 4TVUA 1WV2A 5DCEA 3SIMA 4AZ5A 1CGVA 3USBA 2OLHA 4A4AA 4JYDA 1PVNA 1PIIA 4ZXOA 3PSWA 4XAZA 4XAGA 1GNXA 1TMQA 3TYBA 3HF3A 1CXEA 3QF0A 2KZHA 3ITTA 1XINA 1QASA 3P6LA 2XGBA 1BTMA 4HP5A 3E0VA 1H61A 1YDOA 1JYWA 3OHMB 3ES8A 2CBVA 3VD7A 3TSBA 4PUMA 5L6UA 3T08A 3ZYZA 1QNPA 2X1UA 5I24A 5E9AA 1MEWA 5EMKA 3RO6A 4PMNA 1T41A 1J93A 1A5MC 2QVHA 4W87A 2VQTA 1KXQA 3ZVHA 1ME8A 2PWHA 1LF1A 3F4CA 1ALDA 3JR2A 4HZ7A 3O1NA 1OM0A 4JAWA 4QE5A 1KLZA 3WJZA 5F1UA 3HQ1A 1ZFJA 4JHMA 1TCDA 3OGVA 3CGTA 4MZ1A 2YBVA 1E40A 2P10A 1KM1A 5CLTA 4CQ8A 1H1NA 3AIEA 4JICA 2W0UA 1QW8A 1J2WA 4AZ6A 4AWTA 3KBNA 2OZ0A 3DI0A 3QYSA 3T40A 4I6KA 1J4EA 2Q8XA 2A4AA 1MMFA 4XIAA 5DBTA 5M2FX 1KKRA 4MM1A 2VX5A 1WDPA 3E0LA 3LHWA 3QKZA 3VMOA 2GSEA 3U6WA 3VIPA 4MNKA 1JCJA 1MUWA 4BWLC 3H2NA 3FHAA 5CJ5A 4L4PA 3WMBA 2HISA 1ZALA 1QWKA 1GZGA 1FDYA 1RV8A 4UQCA 1QI4A 3IIZA 4E6MA 1UKSA 3LXBA 4HU3A 2ZIDA 1NU5A 2R9RA 5HPCA 3S2JA 5D4YA 3S47A 3V75A 3G2GA 7ODCA 1D9EA 2ACSA 3V5OA 2XH0A 3U2ZA 1WA3A 1ME9A 2XWEA 3OGSA 5GJMA 4HOXA 1TVLA 2Z1KA 3LX9A 2NX9A 1FBAA 2PDBA 4LCQA 2VJXA 3FDKA 4GE8A 3KWXA 1M04A 3ITXA 1BRLA 3QLDA 3TLQA 4W7VA 4PZVA 1YHTA 2NQ9A 3NZRA 1S2VA 1TUXA 3RCNA 2XU2A 3M0ZA 4W8LA 3B9AA 2F84A 4JPGA 5AECA 3DOPA 2CLKA 3GIPA 3AU2A 4Y9MA 3A3XA 1YTEA 3VKJA 3CUHA 3WYZA 3QV8A 4MGGA 5A6KA 1PKYA 5D9PA 4KETA 3A9IA 4R88A 4TXEA 3AALA 5A6SA 1Q63A 4JEQA 3WLMA 3CZLA 4YN5A 2J8TA 1RD5A 1CNVA 4WGHA 2JIEA 3S1VA 4BCEA 3MC5A 2VVSA 3DFPA 2AL2B 2EGZA 2W67A 3HGSA 4PMVA 4I9MA 3WDIA 2F38A 3VCCA 1GVOA 2NVAA 3RO8A 3M5YA 4FOUA 5HNTA 4M6PA 1XIIA 1XIJA 3PC0A 4NVTA 3SEPA 4A8IA 2Y2WA 1N7KA 4DJEA 3GRIA 3BLIA 3GTHA 5FF3A 3LCGA 1H0IA 3PZGA 1HJQA 4MJ2A 4G9PA 5FCZA 4HGXA 2ZCGA 3BW2A 3L12A 1YNQA 1V79A 2RAGA 5DN1A 4KCUA 4K8GA 3TP4A 2ATSA 3RG6A 4J3SA 4LRSA 1DIOA 1AMKA 3QR3A 3CQIA 3NZQA 1WKYA 3C0JA 1GYLA 1VGAA 1GYNA 3QY6A 1CTNA 3QV6A 1OX5A 2WMIA 2ZZ4A 3TXZA 3B3DA 4DIAA 4S38A 4BI7A 2ZE0A 4KFPA 2BVWA 4LCRA 3BH4A 4H04A 4M56A 1DQXA 2I17A 1YNPA 2QKFA 3QGAC 1AQFA 2YCLA 2CLHA 3RX3A 3SUSA 2F8QA 1OY0A 3ME3A 2OGJA 4FALA 4ZGYA 4KH2A 2J9ZA 4FS9A 1GHSA 4YIWA 3TX9A 2QYGA 3E2QA 4GO9A 2DZXA 5CSSA 3TYEA 3NYZA 5BMXA 2VD9A 1E9IA 1R85A 1W3KA 3TTYA 1GVFA 1I2RA 3ZSSA 3UZYA 1JPIA 4XZLX 5LXXA 1LT8A 1I2NA 2ZUMA 1WBJA 6XIAA 1BYAA 3P61A 4W85A 1GW1A 2QV4A 4S3KA 1CEOA 3MMTA 1E1FA 1FWDC 3BJSA 1Q5MA 1H60A 3V16A 1DWGM 3A5VA 3T9PA 3W02A 4CVWA 4WDWA 2QJJA 2PC8A 2PBGA 3C8FA 4H8HA 3WBXA 1S1RA 2ASHA 5F4XA 5F2IA 4AC1X 1RD6A 4KWUA 1J6PA 2PDFA 4NZ4A 5B80A 4RE0A 3H2CA 3IAQA 3RRAA 1GQLA 5HMSA 1H0GA 1SO4A 1VP5A 2OGYA 3LLFA 3N4EA 1MUMA 2ZE3A 2VX7A 1E73M 4LQ1A 1K3UA 2O0TA 2ISSA 5CLWA 2IXVA 4L9ZA 3GW0A 2ZUNA 3W2MA 4Y9OA 3ITVA 4PMJA 1BAGA 3KX6A 1HW6A 3TLLA 4GQGA 3SJNA 3BG5A 2QCGA 3HB9A 2IS7A 4D71A 1RALA 1RXOB 1W3TA 3RAOA 4W89A 4WOZA 2PWUA 3AS1A 3G3MA 3W25A 1FDZA 3R79A 3DIPA 2C0AA 1OADA 3VNZA 1OFEA 4O8AA 7REQA 3MB9A 3PFRA 4P7NA 5FF4A 3XIMA 3QPZA 4G7EA 1H50A 1BF2A 1QU4A 3MVIA 4JQ4A 3WQVA 4NRSA 3GQYA 3CT2A 1W1IE 3E6EA 1R2RA 2BHZA 4C6PA 4LUTA 1LZOA 2ACRA 4UTLA 3CZKA 5CJNA 3TQ0A 4V1XA 5H1WA 1LORA 1QT1A 3KBJA 1XYMA 4YVPA 4UUIA 3ALGA 5KITA 3W74A 5RUBA 1VFOA 1AL8A 3I6TA 2Y24A 3PWIA 5ABHA 2HBXA 3GDRA 3SBFA 2D2JA 1CXLA 1HQTA 1VQTA 3AIVA 1N82A 3SQLA 1TQJA 2O9OA 3BJTA 3NIYA 2PB1A 1GOIA 4FIQA 3TC3A 4QAIA 1C8YA 3RRXA 5A1AA 3HMJG 3NPWA 3NZ1A 5C9WA 2NV1A 5CAHA 3W2UA 1XDLA 3WQDA 1CGTA 2D2GA 2GSJA 1AZ1A 3BMVA 2HXUA 4P5UA 2J47A 3C0SA 3QKEA 1YE4A 1F3XA 3APYA 4J40A 3OQEA 6CGTA 4LS0A 5D2YA 3PBVA 3VC6A 3QV9A 2DDXA 4MWAC 3LERA 3LNMA 3N2XA 3GFXA 4GUJA 4O8RA 3MUAA 2VC6A 3VABA 1HKWA 1R8LA 3OLGA 2GQ3A 3E2SA 3TC6A 3M0HA 4QTGA 3LQLA 1A80A 4N9CA 1TPH1 4EANA 4PH6A 5J5RA 4XAFA 4X60A 2OU4A 3SGZA 1KGWA 1O4UA 5E0FA 2DFAA 3FAWA 1POJA 1JGIA 3ZWSA 3ANVA 3KP1A 1SU5A 2ZOXA 4GY0A 1MDLA 3PN8A 4L4LA 1DWFM 2PRMA 4M6UA 1PB0A 1W1PA 3UPWA 4HK7A 1Z32X 1IT8A 4XAYA 2WHKA 3AWNA 3IGUA 1CB2A 1TWSA 3NL2A 1E55A 2AAAA 4HMEA 1M65A 4XVDA 4QLJA 4WUIA 3EMQA 1WX0A 4IFOA 2FPVA 5JIPA 4YCOA 1E6SM 4H1ZA 2YA2A 3BCDA 4WDUA 2YW3A 1ISYA 1TELA 1XW8A 2AMGA 2OVLA 1Q2RA 4ILSA 1TMHA 4GD0A 3S8HA 5IFTA 2D2HA 4HA0A 1REQB 3R10A 4RZ5A 3V18A 1CLVA 4X22A 4NP7A 4I9JA 4JTGA 5FF7A 5HATA 1A4MA 2AL1A 3W7LA 2OT1A 1BKHA 1R3RA 1V08A 1VYRA 3ZZ1A 2V67A 3GS6A 1UYQA 3ZOAA 4MJ4A 1UWSA 3VNIA 3RUBL 3PG8A 2PS2A 2AOSA 2JGYA 5LIWX 2UZ9A 2ISFA 4GY1A 1UR1A 3LRKA 3SCVA 2CESA 2FHBA 3GHUA 1SFLA 2DZTA 2E40A 2TRSA 1EHNA 3BSMA 3ZWTA 5KZDA 2NQLA 4HTBA 4I8DA 5AZ1A 4MNMA 1FWRA 3GH7A 4KKXA 1DJGA 1I1XA 2C79A 5D2XA 4LY4A 3OO2A 4NKCA 4A8LA 5XINA 4AXKA 4Z42C 4UNKA 1OGSA 1EPVA 3BG3A 4XV0A 1LROA 1F9CA 2A7PA 5LA2A 1NOWA 5AOUA 2GK1A 2OFJA 3ARUA 3WIJA 5A6BA 4JY8A 3P81A 2YCKX 5HJLA 2RKXA 4MB5A 3H6OA 3W37A 1E15A 1UUQA 2J9YA 3W72A 5I09A 3W70A 3C2RA 3O3RA 4ADSA 1EJRC 3OP2A 2AQWA 5HNNA 4QJ5B 1QAPA 2A3LA 4HPXA 3E9AA 4M7SA 4O1BA 3UG8A 2BNJA 2HTMA 5AHLA 1MQPA 3TQPA 5REQA 1U2YA 2OZ3A 3D5HA 4GJJA 1HKJA 1NWTA 4DM1A 3A21A 1I8JA 1I6NA 3MHGA 1AVAA 2NV9A 1KRAC 5I77A 4ZB5A 1JI1A 3GKFA 2HMCA 4DJFD 3ABOA 2VENA 1ONXA 2WC4A 1ONEA 4V15A 3URQA 3BANA 4ZTYA 1XP3A 3CWOX 3GNXA 3ZJ7A 1A49A 3N4AA 4LYKA 1J0HA 4I90A 3GXDA 5CPMA 4HPNA 1LQ2A 5REQB 2WLYA 1HJXA 3DHPA 1QO2A 2F2KA 3UZZA 1OGBA 4QHRA 1JNEA 3KFTA 2HXTA 5C2XA 3LOTA 1WE5A 3CHDA 5FIPA 2Z7GA 2G50A 4M24A 4Z17A 3IANA 2CERA 3OB8A 3BSHA 5A69A 1KTNA 6TAAA 3G1RA 1UWQA 5EA9A 1W17A 4MWAD 1BTCA 3SCUA 3NQBA 3SCRA 2WMHA 1LUCB 3CU2A 2TSYA 4AZBA 1TV3A 4AEEA 4H9MA 1MFUA 1UASA 4TTUA 5KTLA 1Q6LA 3CIXA 2QCHA 1KQZA 4NAEB 3WQOA 2WC7A 3LMZA 1FCVA 4HSNA 3W1LA 3HMCA 5T26A 4BWLA 3WDQA 2H9AA 1M9HA 1U83A 4M80A 3F4VA 4DI8A 4DAFA 2WYSA 3E02A 1KBKA 1ZU8A 3Q94A 2WV8A 1JUBA 2WVVB 2EG8A 4RXGA 9XIMA 4K8EA 2VUYA 4EXQA 4OHQA 2Q8ZA 1L6WA 4ACZB 3UWEA 3R11A 2DEPA 3MMDA 1BWLA 1XS2A 4H9TA 1VHCA 3SCSA 4DO5A 1QW9A 3QW4B 2YCJA 1ELSA 1B4EA 1SJCA 4GLEA 3O2LA 4DX3A 4IG2A 3MSYA 1MXSA 3WZ0E 3UW6A 3HU7A 2CXGA 2HS6A 3UNDA 4BHYA 1R2SA 1TPEA 1ODUA 1P43A 5JUVA 1UR4A 5K3VA 3IAPA 4YU1A 3ONBA 3M44A 4N42A 5IXEA 2EKCA 2YYTA 4A29A 4CN4A 3B0YA 4IH3A 2BLEA 3L65A 5HBFA 3RITA 2IW0A 5M5DA 1B3ZA 2YGYA 4D2JA 5EL1A 1JF6A 2OZTA 3GHSA 3CK5A 4MDOA 4H00A 3ITOA 2E68A 2VTFA 4KFOA 1XWYA 1SGJA 4FNPA 4GIRA 3BV7A 1ENUA 1OJXA 2W91A 2VZOA 1GCYA 3GUWA 4GNKB 2Z28A 1FCUA 1TX2A 4BEQA 3W82A 2NQZA 3HBLA 1LWIA 2CZEA 3KHDA 4E5TA 2DY3A 3P0WA 4W93A 1W37A 1X8CA 3V5CA 1OGGA 3BLDA 3EA1A 2J6VA 5JU6A 2V5DA 3EPNA 1EWDA 3BCFA 3UJ2A 3VNYA 1JCXA 4S3AA 5C2CA 1TWZA 2O9RA 5G2IA 1EJWC 3GVVA 5I3JA 1XLJA 7XIMA 4LRTA 2NV2A 4DNMA 1FP9A 5I0DA 3S83A 3THAA 4TO8A 2ZX5A 2AQVA 5ABFA 3RXZA 3TJXA 8TIMA 2DZUA 3CPUA 1EF2A 1Q13A 2EPNA 3UWQA 1C92A 1LLOA 2YCLB 1PBGA 2VKZG 4XO6A 1J5SA 4YYFA 4JIHA 2WHJA 5FAGA 4PL2A 3WD1A 3NG3A 4B16A 5FEWA 3NOEA 5EYWA 1IEIA 1HL2A 5K9DA 1ZS2A 2OWCA 2QDDA 2PODA 4ZVJA 4OKDA 1PEZA 4R9XA 2CIPA 1NP2A 3BAYA 4HMDA 4AYGA 3GC5A 4U2ZA 1V02A 1IQ8A 4JCMA 8RUCA 3TMQA 5G1TA 4CD5A 4LBRA 4X61A 1VLWA 1PX8A 4JS3A 5FJRA 3MZ2A 3N6QA 3O7UA 1G4PA 4IISA 3FA5A 1YXDA 1BVNP 4UTJA 4XQ6A 3N9SA 7ENLA 1ZBVA 3NVDA 3S5SA 1IXQA 2Y7DA 3M4HA 1V51A 2WHMA 2VX4A 1UKTA 2PDUA 2O9TA 1L6FA 3CAKA 3N12A 1B0IA 1ZJHA 4Q4SA 4EP8C 2FTYA 2VI0A 2ZDSA 3IWPA 1OG6A 4YS1A 4XKYA 1KM4A 4QCFA 3SW6A 1KM2A 4NI8A 2Z2BA 3WH5A 2PDQA 2B4GA 3ENLA 4QSFA 2NZLA 4E3TA 2R94A 3FX4A 3GKAA 9CGTA 4RPQA 1DP0A 1H7NA 1X1ZA 3M0YA 5HOSA 3WH8A 1O5RA 3DYPA 4H7CA 4L6HA 4A3RA 1UB3A 1QPRA 1TPDA 3MYOA 1DBTA 4KERA 4RLIA 1AMYA 5TD4A 3TDFA 4QCEA 2ZFAA 5XIAA 2ZVRA 3TR2A 4DXXA 4F79A 2GZXA 1S2TA 3LUTA 1Z3NA 2QCLA 1F4AA 4B5UA 4Y7EA 5C9RA 1UBPC 4F2UA 2HDJA 1PTGA 3A4XA 2OJPA 5IHRA 3GR8A 4PN2A 5BXPA 5JBDA 2D3LA 4U3AA 4QE1A 3ANYA 1H7RA 3TCEA 3B03A 3M07A 2FTWA 2I9UA 4TMCA 3L2IA 3L7RA 3WUBA 2BFGA 2WWCA 1WKFA 4XZBA 1RQBA 4FF5A 1FHDA 1EB3A 1L2UA 1UWIA 3QEZA 4UOZA 1H3GA 2NUXA 3HPSA 2QEZA 1AQHA 2EPOA 3L5LA 4RL3A 3TN3A 1I1WA 4C6OA 2PWFA 1NFPA 3DGBA 4FNQA 4ZE4A 3E49A 3WK2A 4JTRA 4NG3A 4ECLA 3P14A 2WLZA 4DBEA 4UR7A 2J7DA 4QDWA 5HUOA 4FZIA 2GUUA 3TZNA 2F6UA 1YDVA 3AOFA 4GBUA 5A6TC 1XGEA 5A5WA 2ACUA 1RK5A 4XBSA 3NSNA 4C65A 3WQEA 3R8RA 1R9YA 3BTNA 4HN8A 5FJPA 4WKHA 3WUEA 1CLKA 1JYNA 4GACA 5C8BB 2J66A 2REQA 3PB0A 3ZIZA 3WLRA 2O9PA 1DWHM 4KIRA 4F0KA 5CSUA 2OCZA 1ZHAA 1BLIA 4JD4A 2WNNA 1XPYA 3RF9A 5CGTA 3SY1A 1YLVA 2EKGA 1E6ZA 3WJWA 3AQUA 1R38A 1PHWA 4WJEA 1HX0A 3F2BA 2DZAA 3RLHA 1XUZA 3W01A 3WNNA 1V6TA 3TW9A 3DFQA 1K6WA 1SW3A 3DYOA 3ZXWA 2PBOA 4WJ8A 1HVXA 1P7TB 1C29A 1PJ9A 2QAPA 2XFWA 3Q65A 3BLLA 3GAKA 1LLWA 3NQ7A 3QSTA 3CQHA 4OOUA 5M3WA 1I45A 4Y8FA 4D1JA 4XK2A 1FHLA 1M7JA 4OTKA 3AMDA 2DIJA 4PL1A 1TSIA 4W8BA 4GQ0A 4UBPC 4CCEA 3VX1A 4EVZA 3GXTA 4N9EA 5CPLA 1H1ZA 4HNOA 1JAEA 1R9XA 1KQYA 3MO7A 2FZ9A 3DFNA 4AC7C 3SECA 4AMCA 4ZXLA 1DJWA 1LTDA 2PDJA 3PZ9A 4HYWA 3VXGA 1XG3A 3WLSA 1EXBA 3EOOA 1F6KA 2DSVA 2A1YA 2R14A 1JVNA 1XIBA 2PDHA 1P6WA 4EK7A 1F74A 4YJ5A 1Q45A 2XH2A 4XZWA 4C6LA 3GTNA 4O0ZA 1B9ZA 4HA1A 3W87A 3AICA 4GI9A 1RH9A 2WSPA 1TREA 5K7JA 1E4IA 4QITA 1XFBA 4MWAE 4BQ5A 2BS9A 2VUNA 3IGSA 4E4UA 1VD6A 3QRHA 2VO5A 3AHYA 5HA7A 3SRHA 1V0MA 4H8VA 3ZLGA 3GXMA 1MRQA 1GKQA 3VO0A 2QPXA 2E25A 1VIWA 3NR0A 3I7QA 2E9BA 4UOJA 2OYKA 1E3ZA 4RDVA 4LVDA 3EWXA 3GZAA 4RUBA 5IFPA 1UD5A 3WQ4A 1QUMA 3F2DA 3LCLA 3A3WA 3FVDA 2QCFA 1D8CA 4D9PA 2CKRA 2YW4A 4ZFCA 2V5BA 2AKMA 4OOZA 1SJBA 3AIQA 2Z1XA 4S2CA 3VPLA 3C5QA 4ACZA 1DWAM 5CH9A 4BF5A 4TVCA 2PPGA 1KFEA 3UT0A 3B4UA 1TVNA 4F0HA 3HV8A 1UP3A 3VZYA 4ZBCA 4IIHA 5BZAA 2PTXA 2W63A 4BK9A 4M1BA 2ZVIA 3A12A 4ASTA 2W4XA 3MMWA 2P1FA 3UG3A 3WQPA 4GBDA 1ECQA 1LRQA 3W1XA 3QOMA 4LYRA 3EZ4A 4GYKA 1Y7VA 4E2BA 2X1SA 1J79A 1MZHA 2I14A 2X7WA 3UERA 2CYGA 1FUYA 1BYCA 3CH0A 2INFA 2YKKA 4C6MA 3A24A 1WKDA 3WNPA 3ZLHA 4UMAA 1VPXA 2YYUA 3MUXA 2JE8A 3LPOA 4S3DA 4JKKA 5JXQA 4CU8A 1X8FA 4O11A 4DYJA 5L9FA 2FHFA 3N9KA 3TOYA 3AMCA 4WIWA 1TWWA 3BAXA 3VILA 3KOWA 3WUGA 4R7OA 1E72M 2BODX 3LBOA 3P3BA 1A0DA 1K9EA 1QHPA 4TMBA 3WDRA 2HE5A 5CKSA 4Q8PA 5D38A 3RDKA 3B8UA 7TIMA 3PTMA 5CAKA 3PM6A 3IGHX 3EA3A 3LENA 4OVXA 2XGIA 1TTJA 3T8LA 3WQ6A 2I16A 1RCXB 5F1VA 4AIUA 3SO7A 2XSBA 3UGRA 4JFUA 1NAL1 1JGMA 4NXSA 5CGQA 3WJXA 2LLEA 4EF8A 3G3DA 1SFSA 2CLPA 5BRBA 3S5ZA 1MZRA 3WMSA 3MDUA 2GJXA 4M0XA 1BPLB 2J62A 4GHRA 5LA1A 2H8XA 3R58A 4DO4A 4A21A 2QUNA 3ES7A 3H7UA 3GR4A 1THFD 5EBUA 4IMEA 1UCWA 3PSVA 3DG7A 3EWCA 4JFSA 1TPUA 1XYLA 1OYAA 5D2VA 1VFHA 1BQCA 2J7BA 4LVAA 3VA8A 3CL7A 4CQ9A 2E7FA 2HPIA 3C86A 1UR3M 5DMYA 1E5NA 3KW3A 4AVFA 3WLTA 2FZMA 1UUOA 4UQEA 4IIGA 1MNSA 4AVNA 3LQGA 4QISA 4HHHA 3UA4A 3LGEA 1GOXA 3N15A 2FZDA 1BFNA 2XYLA 5AZ0A 4C7DA 1AD1A 5BU6A 3P62A 2PU0A 3GDLA 2V5CA 5B7YA 3W3OA 3CWNA 3FXYA 2VRJA 3S2MA 3H53A 3W7OA 4DY1A 5E1QA 4GNJA 4UXDA 3RR4A 2HPMA 4CGTA 3UBPC 2C1IA 1KBJA 4IFRA 3LPFA 1AJZA 2ZA3A 3KDOA 4KF1A 5BROA 2JALA 1D3HA 1ITQA 3XISA 2V82A 1OX4B 4R5EA 3U2CA 1R86A 4FNSA 3U2OA 1NOFA 1PKNA 3PPFA 4Z2KA 1TR1A 2J7GA 1O7AA 1ZCOA 5F7UA 1JD9A 3W75A 4DEFA 3W2LA 2HEJA 2VGFA 4ZEPA 5DX7A 1IR2A 1B1YA 2XN1A 2W5FA 1OYCA 2UY4A 2XGZA 1LBLA 2QIIA 1IIGA 4EX4A 1Q8AA 1K9FA 4RNJA 4JTAA 4OU1A 1XLMA 3ARPA 1KWKA 2VFDA 3VGHA 3VYLA 1KR0A 1JYVA 4O1CA 2GQ8A 1ZUAX 4IQEA 4GI8A 4INFA 3N2TA 1PXGA 4Z08A 1P1XA 1GOWA 3ZM8A 4KT2A 3BARA 1JCLA 3I7SA 1GVEA 2OLSA 3R0UA 1IE7C 1JCNA 3E2RA 5HXMA 4KGLA 4ERGA 4RDWA 5LKYA 2PC4A 1GQKA 1Q3NA 1GPFA 5EMJA 1QNSA 3U3HA 3WK1A 4GI4A 5CC7A 3CAWA 1UJQA 2FLIA 4R27A 4ATLA 1ADOA 4CEXC 4KGJA 4S39A 4UMCA 3VDBA 3W6YA 1JDDA 1EJTC 3CNYA 1NF7A 3SDOA 3A9BA 1NF0A 2AGTA 2VP8A 1A3XA 3CTTA 3TKFA 3QQWA 1QI0A 4C6CA 3NSXA 1IWPA 2VCBA 1XXXA 2GFTA 3LA4A 4B91A 1W3HA 3W6MA 3L67A 4ZZ9A 3TWBA 3VM7A 2G37A 2TODA 1BKSA 3NZGA 3K4WA 2FDMA 4H7ZA 3I7RA 3CLWA 3II1A 5EPDA 2P76A 1JDFA 1MUCA 4LV4A 3VNLA 3B9OA 3AXXA 2YB4A 1L6YA 1XQLA 3WQCA 2YSWA 3VKDA 1VENA 2NX1A 4QLKA 1M1BA 5I02A 1YX1A 3M9YA 3ZVHB 2JF6A 4XZ9A 4K8HA 5HMFA 1N2VA 1FWGC 1W3JA 5HANA 3DFTA 1EUAA 2C16A 2O7SA 5BYWA 4LVFA 1POKA 1IXOA 1HP4A 4IQDA 4P8XA 5D2TA 1M7XA 3MP3A 3ZLFA 2WKGA 2YA1A 1Y5VA 2XH4A 1PSCA 4DF1A 8XIMA 4GCXA 4JL2A 4AEOA 1CWYA 5A8MA 4AWEA 3P2VA 3UWVA 4B2DD 4AG0A 1WZMA 4GVIA 3R94A 3W4RA 4ZQOA 3UVIA 3NGFA 1T8XA 4R33A 1XD1A 3TJ4A 4JXCA 4DZ5A 3E0WA 2ICSA 1RLDA 3A4WA 1P0NA 3UD6A 3IIPA 5J04A 2YCEA 4UC5A 1W3IA 4HQVA 2KX9A 2BG5A 3CYVA 5CG7A 3PFMA 1W32A 1NWSA 5DCDA 4FR6A 1RAKA 1ISZA 1JUEA 2VGBA 2XM2A 4W7WA 1A5NC 4U5IA 3H2OA 1XRVA 4AZGA 3C2YA 2Z7KA 3M47A 1P1MA 1VBRA 5HUPA 4FX8A 5AVHA 3LTYA 3GDBA 1MW1A 5CPOA 3PBWA 2J7FA 4HIBA 5HNUA 3PK7A 3UFYA 4OV4A 3SN0A 1JNDA 4JN6A 3L9CA 4KS0A 3N18A 1RVGA 1SYTA 1A0CA 1TG7A 4Q3MA 2JFEX 5BOOA 3EWUA 1UIPA 3O6DA 3L68A 2XPKA 2RGLA 4JYEA 4QFUA 4O13A 3RCMA 2L5HA 4A2SA 3LSCA 4NZJA 3E5BA 1J96A 3KRSA 4PR4A 1FA2A 1XLHA 2FFIA 3FXGA 1FH8A 1JZ5A 1NIUA 1V6YA 2DH3A 2H90A 3ZVIA 3CHVA 4R34A 3LCFA 1A47A 4CNPA 3QM3A 1V3IA 4IIBA 1UOKA 1LL7A 3TWAA 2HK1A 1XIMA 3WH9A 1OIFA 2CHNA 4HPGA 2E6FA 4L9YA 2GUYA 2PDGA 2GK1B 2Y7EA 5ECUA 1FY6A 1TFVA 2W27A 2V3EA 1SSDA 4O18A 4PE8A 2A3HA 2VZUA 3BK0A 3CXOA 5A95A 3BICA 3HG5A 5E6ZA 3TSMA 4CNNA 2VFGA 1TO3A 3CT7A 5SWUA 4IG2B 4GA8A 1PZ0A 2Y7FA 3ZQ9A 2IQ0A 2WZHA 5BW6A 4GZIA 4B2DA 3PZMA 3W6LA 1GQIA 1GOMA 3U7BA 3L5MA 1LWJA 5F4WA 2BXVA 1HXJA 3UYIA 1FHVA 3M46A 3LLDA 5M1TA 4C7GA 1VFUA 3ZJ8A 4EXBA 4ZO6A 3G1FA 1D2KA 1XJBA 2UWFA 4LUYA 4RE3A 4V28A 1PIGA 1V77A 3IJQA 4NNBA 3NNTA 1XLEA 2V3FA 5HQEA 1YADA 2GGHA 1H09A 2GSHA 3U0HA 1YTDA 4O0KA 4PMRA 5E93A 1QDSA 5HR7A 4O4VA 5IOBA 4ZQNA 3TNOA 1IWAA 2W6RA 3FS2A 4C90A 2NX3A 2CLMA 4FSAA 2PLMA 2X09A 2W92A 1G4EA 3WELA 1NP0A 1QHOA 4B9ZA 3W7GA 1QK2A 4GO8A 2D0GA 4X2PA 4QGCA 3MSRA 3WN6A 4JN7A 2ZWYA 4J3XA 4TUFA 1H51A 1NJJA 5LZLA 4LOCA 1DQUA 1SVDA 1PZ3A 3PUEA 5C70A 3W83A 3LLXA 4O53A 3JU2A 3T07A 4RK8A 4IHCA 3UYCA 4CD7A 4DO6A 4E3VA 1TIMA 4L56A 5U7SA 4Y6GA 3QYQA 4UIOA 1KV5A 2Q8LA 1OC7A 5KZ6A 3GR7A 3DFYA 2UY2A 1CGUA 1XQKA 1JCMP 4IJCA 1E6XM 1PKMA 3KL0A 3V1PA 1S2AA 4RR4A 5I00A 1Z7AA 4XX6A 4ZTXA 4RV3A 4O1AA 4MB1A 1XBZA 3BVJA 1A5CA 3OLEA 3POCA 1M6JA 3BZJA 2OR2A 4YTTA 1OCJA 2V2DA 1HJUA 2AQOA 2VCAA 1U33A 4Z2GA 4MJZA 4PMZA 1A53A 4HK5A 1R3TA 1KXVA 4FIRA 4Z0JA 2XM1A 2C1HA 1E0UA 4HK6A 3MZNA 1S46A 1VLIA 4LH8A 4AVOA 4C6KA 3CTLA 5ECVA 1QI2A 3L4VA 5GNXA 1XLKA 4PCTA 1V03A 4PUUA 3G8EA 3AMGA 4PBGA 4REQB 1MWOA 1KFWA 3C4UA 1IYXA 3IK4A 4HHLA 2FB3A 2VDGA 5HJYA 5DELA 5TIMA 4CEUC 3GFZA 1LBMA 4LCSA 1SJAA 3P8JA 1QPNA 1LQ0A 4IUGA 2MUCA 1XX1A 4GI6A 3I4KA 4GYPC 1DWIM 2JGQA 5K4XA 3GW3A 1BQGA 4PULA 2XN2A 1T40A 2OG9A 3QZEA 4H4IA 4I5XA 4PFMA 3NQAA 5LHEA 3O16A 3R0KA 1XIGA 1JDCA 3VCRA 1OHLA 4DUWA 2I5QA 4TVDA 1JQVA 1Q66A 3SY8A 4NU7A 2R1KA 1PWLA 3IACA 1F6YA 4JNMA 4NJKA 1H5YA 4LS2A 1SQ7A 3EBVA 2GVLA 4CN6A 5M17A 3W1AA 4GYFA 2BASA 3G1HA 3KOYA 3VTRA 2XH7A 5D37A 1Z41A 1WCGA 4GC4A 5AN7A 1E51A 1RZMA 1EWEA 3DKLA 2G41A 4GGHA 4JQ2A 3WLKX 3HA1A 2YR1A 4GRSA 4PCSA 1KA9F 2PRLA 1SZNA 4MDPA 5D9NA 3TZFA 2C3ZA 2ZTJA 4PCNA 2GL5A 3PNZA 4DZAA 4JY9A 3WK0A 3AYRA 1XUUA 2ZUTA 1KWGA 4AHOA 5HDRA 3HQOA 1R7OA 3N2BA 3BUVA 1E0VA 3GUGA 1VPQA 6PTDA 2V38A 3OLDA 4GUFA 1VZWA 1GEQA 3WKZA 1JZ2A 2V5LA 2PDYA 1PZ2A 1TQXA 3PWGA 1UIOA 4IZGA 3M1ZA 3BLFA 3R7MA 1KTCA 1W5NA 2Q3RA 3PVFA 3SI9A 5CBBA 2YB1A 3AZSA 1OFPA 1S2WA 2H3BA 1DOSA 2E67A 1PTAA 3IARA 4MNJA 3VOFA 5I3GA 1P0EA 3IJIA 3PHAA 3PPCA 3D46A 4F40A 4QG8A 5T8GA 1XLIA 4M29A 3IPWA 3THCA 1FWEC 4ZQPA 1OK6A 2ZRYA 1GTEA 4MLJA 1M53A 3SCWA 1PUDA 2XFRA 3J7HA 3PANA 3W7CA 4AY8A 2X05A 1Q6FA 2EHHA 3E96A 3C3NA 2W66A 1Q85A 1L9WA 4AMAA 2OO0A 4Q8QA 3BLOA 1W9DM 3VGFA 1QI5A 4O17A 3HM7A 2IMRA 1ME7A 1K70A 1QO5A 1F3EA 2WB5A 2FB2A 1UR8A 4MHBA 4OBRA 2FTPA 1TV5A 2QCNA 4KEZA 3EPMA 4GVHA 3HQNA 4L6DA 1U5HA 2OYLA 1XV8A 1H7OA 3KOZA 3ABQA 1IEQA 5CZSA 3DENA 1XYAA 4L7ZA 2AMXA 1S2UA 3G22A 3VC5A 1Y0EA 3LYEA 2GGIA 4PTVA 1DVJA 2O4MA 4BI5A 3M0KA 3U5YA 3OEXA 2JKAA 5AYXA 5EGRA 1VCVA 4Z1BA 5I3KA 4QDPA 2PMQA 5HPOA 1KRBC 3ZT6A 3FOKA 4MKNA 4Q4KA 1KFCA 3W53A 1E1EA 3CQKA 1G01A 4JTLA 5CJMA 3QHMA 5G2HA 1HKMA 1KGUA 4GYPA 3H26A 3FKRA 1NELA 4EWND 2VEGA 2NUYA 1XLGA 2PWGA 3FYPA 2B0MA 3FGCA 3DFOA 3EXTA 4XWUA 4QP0A 1F5ZA 3FN9A 1O1HA 3AHVA 2G3FA 5I23A 1M5WA 8A3HA 2XFYA 2F6XA 2EBNA 3EA2A 5I07A 2Z6IA 3WFLA 1HKIA 3URAA 1TYGA 4CD8A 3T81A 4KQNA 3OLIA 4JBRA 2ALDA 1KXHA 3KZSA 2FIQA 2NVCA 2DVXA 4S3EA 1TV8A 4DYEA 1RR2A 4RX0A 1F73A 3PZQA 3UPMA 1QHZA 3TV8A 1YXCA 3KLLA 1TWDA 3ZFHA 1GORA 4NAEA 5G4HC 5KZMA 3WH7A 4TV5A 1I2OA 4IGMA 4GUHA 1KV8A 4G1NA 3AJ7A 5LIXX 1IR1A 3GC4A 2UBPC 2CKSA 3K2GA 4DXKA 2YBUA 5KZEA 2EPHA 4KCTA 1TJ2A 3OW1A 4FA3A 2ZRWA 3IVTA 4WR3A 1L2QA 1YQ2A 1GUVA 3NPXA 2Q01A 1Q6GA 1M68A 3D47A 2A7RA 3EX2A 2V2CA 1KBLA 1K8YA 1I0DA 1H2JA 4N4QA 1U1JA 3BGAA 4K1GA 3MQTA 4DELA 3RM8A 6ENLA 4H6QA 9XIAA 1OABA 1B31A 4JYFA 1US2A 1VFLA 3OHIA 2OQLA 1ZCCA 4CN1A 3QMSA 4UTFA 3P5YA 1UZ4A 3WJSA 3E74A 4Z2LA 4K2SA 2QF8A 1X7IA 4L4OA 3WBEA 2DZVA 2H3DA 1KO0A 3O0FA 1IHIA 4O28A 2VZTA 1EEXA 3FYOA 4UNIA 3DESA 4NJIA 4MMWA 1IIHA 4S3JA 3PTDA 1W54A 1QATA 2XVNA 2GOKA 1OC6A 4W86A 2BY1A 3NWRA 3VOGA 1E4LA 2G97A 3HPZA 2G5WA 1EDQA 2EEXA 4JTCA 1NDVA 4GQBA 1M41A 1W6TA 5E5CA 4QNWA 1DJZA 4HZ6A 3MV11 3SAZA 2Z2UA 3GX9A 3K4AA 5J5DA 1X96A 3TIMA 4PB3A 3WLHA 1RBAA 3VCNA 1R7AA 3GTXA 1H62A 4MYXA 2ISVA 2YCIX 4Q8MA 4Y2WA 3P5ZA 2B7NA 3WFZA 2XJ7A 1LP6A 2YL9A 4O54A 1VHNA 2DT0A 2ZZ3A 4QX4A 2INZA 2CNCA 1R3YA 1W8SA 1B57A 1SR9A 5DXYA 2QDHA 2VEKA 1YYAA 2YDAA 3RM4A 1B3YA 3VIJA 4V1YA 3ARZA 2HRWA 2QCMA 4LVBA 1J0KA 1ML1A 4XZMX 1B3XA 3QQ1A 5K4ZA 4MUZA 1GVQA 4DZHA 4U33A 4AIEA 2OOGA 3K30A 1ZJAA 3F4NA 3MJYA 2V9DA 4IUOA 2P0IA 3RHGA 1ZY9A 2R1MA 4ROPA 2P3EA 2FZBA 4U31A 2Z29A 4B5TA 3EGJA 4B92A 3B0UX 3SFKA 2PDPA 2XZ7A 2ZUUA 1VKFA 5I3HA 1M7PA 1TWIA 2QW5A 3ABXA 1UC5A 1H49A 3NTYA 5A94A 2QCDA 1VH7A 1N8FA 5K9CA 3P80A 2B7QA 5CZTA 3FLUA 1DIEA 3TK7A 4FNUA 1DWJM 1JXJA 2GJPA 3EDKA 3K5XA 3PTQA 3DH7A 1NQKA 5GVJA 2D1ZA 1BXNA 5HMEA 4D6JA 1G4TA 1CYGA 4TOQA 1G94A 2GDQA 1E1CA 4AD0A 5DRIA 4AQLA 3CMFA 3VDAA 1OCBA 3TCSA 2B31A 3GSMA 3KTCA 3VIKA 2CZDA 1W9PA 1DE5A 1LRTA 4LAMA 3GO2A 2QR6A 2DUAA 4LUSA 3KRZA 3W38A 2WC3A 2QXWA 4AZCA 4EACA 3G24A 4NNCA 2C8NA 4Q32A 2VR2A 3MHFA 5C6MA 3DG3A 1FWNA 4RDYA 2JF7A 3R6IA 3TQKA 1C8QA 4Q22A 3URNA 4D6EA 3T05A 3V1HA 1W2PA 1XG4A 4DM2A 4LB3A 3BE7A 1UKQA 1L6GA 1RLCL 4MB3A 3BAJA 3CM4A 2Y5JA 3QZ6A 3EB2A 3EDJA 3HJZA 3CV1A 1CLXA 3KBMA 3CPRA 4RXFA 4ERIA 1T5AA 2JIWA 4BF7A 3W1NA 4B5XA 4B3KA 1U5JA 4RNIA 1B3WA 4GJ1A 4US6A 3L66A 3HO8A 3LHVA 5C7HA 3LZ3A 1OCQA 1DPMA 2G95A 2QJGA 4A3HA 4I8YA 5HQMA 5AC8A 1YDYA 3PUGA 2Y63A 4EPBC 3NURA 4GVGA 1DKWA 1WAWA 1YDNA 2XTKA 2CCRA 4WY0A 5BCAA 1NSJA 3UF9A 3ISIX 4G8TA 2DGAA 2E6DA 4WX2A 5I3IA 3F7JA 3Q4DA 1ZAHA 1EYEA 4JX4A 3W1RA 3S9IA 4BFAA 1C91A 3W73A 1EHAA 1O66A 4FNRA 3NGJA 3HV9A 3KCLA 1XHGA 4NI3A 1EYWA 2QLYA 4B3ZA 3LEPA 1B4KA 3ZR4A 1WZAA 3BL3A 2TPSA 1SJDA 1I75A 3F1QA 3RPMA 2ZRUA 5LNRA 1TJRA 4HJFA 2D24A 1FWJC 3UG5A 1CGYA 2OZ8A 4YL2A 3JVAA 5ABGA 4KW2A 4Q4QA 3H22A 4MKSA 4F2BA 3WLOA 3L4TA 2XIOA 2OSYA 3LB0A 1H7WA 1C90A 1NDYA 4WK9A 2FPYA 3BGGA 1QBAA 4IXHA 4OUEA 3UZWA 1AD4A 4LEFA 3COTA 1PX4A 5LHFA 2H8ZA 2DT3A 1J5TA 3C2OA 2WW5A 4W5ZA 2P53A 1I2PA 4UOQA 3QN3A 1CECA 2G96A 1E6QM 3EYPA 4M81A 3FJ4A 1H7XA 1Y5WA 3KDNA 3GAYA 4U3CA 1O12A 5DBUA 1RCOB 1U1UA 1GOOA 2VDHA 2V0TA 4DUOA 1U22A 1UUMA 4PBEA 3GYEA 4UTTC 4IOTA 4GINA 1OZMA 4P7OA 4KCWA 3RILA 3GG8A 3BZGA 2E28A 3B05A 2XG9A 2YLAA 2YFNA 5AHMA 2PDCA 2YXOA 3M5XA 3L4YA 2J8GA 2FZ8A 4GXMA 2VZSA 4HYVA 4N2YA 1U5VA 5AKQA 2J75A 3WY1A 4YCPA 5DANA 2PEVA 1TMLA 2NLIA 4XSMA 1KM0A 3FYYA 1HO4A 3CB3A 3AUOA 4NIRA 4CD6A 2QGYA 3DX5A 5FEZA 3F4DA 4UFHA 4ZFMA 3QY7A 1G69A 3TXVA 5AY7A 3VOCA 2XUCA 3POHA 3OA3A 1EXPA 1EDGA 5T9BG 1SMDA 1TZ7A 3B4YA 1EJUC 1Q7ZA 4F66A 1SSGA 3TA9A 2PFHA 1E1CB 1HTIA 1ADSA 1GKRA 4WLCA 2EF9A 1EC7A 1OYBA 4MWAA 1L0PA 3VNMA 2HVMA 4UQAA 4LANA 2PDMA 1TV7A 1V7YA 3LCXA 3QQ0A 1UH4A 4IGSA 2WQPA 2RJGA 3LHZA 1VJSA 4JR5A 4MNLA 2CXEA 3UXIA 2GJLA 1W2VA 3S3GA 2A3CA 1RBOB 3DGRA 3O6CA 4PBFA 4IIFA 1DQWA 1AW2A 1GWJA 1OF8A 3HG3A 3RGTA 2TYSA 1UQZA 3AAMA 4CCCA 3KS5A 5AFDA 1I4NA 1P0DA 1TVPA 1YTKA 3WL1A 3STPA 4DJFA 4QXIA 3R12A 2Y4SA 3ELFA 4GPNA 2OEJA 1GZ1A 2O92A 4AX6A 3IIOA 5HNRA 3MDWA 3KOFA 1K77A 4LV9A 4DXVA 6TIMA 1P7TA 5FSDC 1GW9A 1W9BM 4MLRA 2F61A 3ITYA 1Z44A 1YNYA 2SFPA 7CGTA 2EG7A 1QFEA 3LHUA 1UD4A 3CMJA 3N3MA 4YTSA 1QK0A 3VKCA 3QFWA 1OQFA 3W07A 2ZICA 4HCDA 3KVJA 4O57A 1SR0A 1C9WA 3U57A 1A5AA 1UP0A 3SY5A 3OJGA 1GOKA 1UZDA 3GG7A 2Y61A 1FKXA 4PUJA 4MWAB 2WZIA 1UWUA 2IKHA 2CLOA 4HB7A 5A6BD 1EO5A 3RNDA 4XISA 1CCWB 2G3IA 3TYAA 2XIQA 1IZCA 3MI2A 1ZP4A 2BDQA 4KESA 2Z00A 2VXNA 3OGRA 2X7VA 1FH7A 3PPGA 4L64A 1EF3A 1EH9A 4HNLA 3PZIA 2P5NA 2WAGA 3PS7A 4QBXA 3BGJA 3HTWA 1GPWA 3LGDA 3WSUA 3LCWA 3N3TA 4HD5A 3EEZA 4QDMA 1VPYA 2GLKA 2DSWA 3MPGA 4GCAA 1ZRQA 4MFEA 3T2QA 4ZSTA 1NTHA 3EX1A 4HJWA 3N25A 3BXWA 3VD9A 1XDJA 3SUWA 3MYPA 1YRRA 2DT1A 2FVKA 2P50A 5FI8A 2AL2A 1XLFA 3S2NA 2ZRXA 3EKLA 3W76A 4D6HA 2YOCA 3R43A 1XLCA 4PODA 3TMLA 4G56A 2GJXB 4MUPA 1OC5A 2Y62A 1BGAA 3ZR6A 1J01A 3AC0A 3Q45A 2D3NA 3UEQA 1HG3A 1TUFA 1OFRA 3STCA 2ZQ0A 1H63A 4LYPA 2DW6A 4H8UA 3QC0A 3KVMA 1WP6A 4PUKA 4QSHA 1JZ6A 1RP8A 5FEXA 2YXXA 4YTUA 1BXCA 2VRKA 2ZBTA 3R13A 1ZGDA 1D8WA 4D6GA 2J74A 1WDDA 2BBFA 1ITXA 4K68A 1JDAA 4DBSA 3S9YA 2ZUVA 4NQ1A 5AVNA 2V2HA 2PGWA 3IVSA 4DQWA 1ZQ5A 2DIKA 1BYBA 5D02A 4LF1A 2NQHA 3G6MA 3GC2A 4JDYA 1JIBA 5CCZA 3WF2A 4KWSA 1UD3A 1R3VA 4A8NA 4N02A 1NWRA 1XPGA 2BGQA 3OPSA 3GM8A 1O6IA 2PGFA 4PRWA 4JTTA 2VM8A 4PTXA 5ABTA 3ERPA 4GG9A 4S3FA 2RDUA 2PP1A 3NQFA 1W9XA 1J10A 1S5NA 4MYAA 3GBEA 4OQVA 1AH3A 5A3HA 2X41A 3KBWA 4GOAA 4ADTA 1TB3A 1A50A 3H24A 2MANA 9RUBA 4O16A 3H12A 3JW7A 3FDGA 3HGJA 4JQ3A 3UCCA 1P4CA 4Z2HA 3C2FA 3PJUA 4PMXA 2DSUA 1O5XA 1G7UA 4HHMA 2Y8UA 1EP3A 3VK5A 5CXPA 3FJ6A 1OSEA 3G1XA 1PCWA 4KPLA 3T4WA 4H8NA 3WFAA 1J8VA 3GXIA 4FX6M 3EXSA 2VFFA 5CBJA 3DKJA 4J2MA 2AAMA 4IP4A 1UMYA 1TE6A 3NPVA 3KL3A 4I3GA 4N9BA 1K8CA 4DJDA 2WOQA 3PZVA 3MV01 4DB7A 1IF2A 1XCWA 4QEHA 2Q09A 4XBKA 3IV8A 3GFYA 5DLCA 1K03A 2GQ9A 4BQ3A 2OO6A 5EY5A 3MCNA 3M6DA 2GQAA 4F0MA 5EKYA 5ABFB 2DIEA 1KFJA 3CPGA 2ACQA 3WD2A 1KD0A 4Y90A 2R6OA 4J1OA 3AMLA 5DEZA 2BY3A 3CZGA 4IMDA 2FZNA 3W2JA 2WMJA 2BVYA 4AY1A 4POCA 3F03K 3KP0A 2ISDA 3UXKA 2FVMA 1S39A 1JFHA 1SFTA 1E6RA 2I7GA 1S3HA 1JF5A 1J6OA 3K1DA 1OD8A 4GZEA 4C6JA 1NQ6A 3NEVA 3VGEA 3RIKA 5XIMA 1VYPX 3DHFA 3MUIA 1CT5A 1VRXA 2G4FA 2C71A 1RSCA 4O1DA 5CPNA 1T7LA 4CNTA 1G67A 1XSJA 3KRBA 1KNWA 4DWDA 3TJLA 1OINA 4HSOA 3WLLA 4PSRA 4QR6A 3T09A 1KKOA 3UXLA 2R82A 1OIMA 3FJNA 3S6TA 6XIMA 1HKKA 5J8LA 1SW7A 1UA7A 3P67A 4J5NA 5BXTA 1E5JA 3RPTA 3SN4A 2HE8A 3H7RA 1W8GA 1IXNA 3UCQA 4CCDA 3BV4A 4NNAA 4ADUA 2H6RA 1RPKA 1I9CB 2DQXA 1QW7A 1RP9A 1ZL1A 1MEIA 1BVWA 3TONA 3AUJA 2PDIA 4QQUA 3IS4A 1J0IA 2VOMA 1K6AA 3UESA 2Z1WA 1HL8A 1XBVA 3XINA 3WQ5A 3HFYA 1HGYA 4E8DA 1GQNA 4UZUA 1KCLA 3WBWA 1NVMA 2TAAA 3HPFA 1HGWA 2I57A 4HNNA 4UFKA 1I60A 4J3WA 1RJQA 1AH4A 1E71M 3A4AA 3UJSA 3MANA 1GTHA 3MCOA 4YLWA 4WOQA 3NO3A 3WF0A 1EC9A 1Q65A 1IWBA 3AJXA 4JTHA 4CD4A 2QF7A 5A8PA 2XVKA 1DJHA 3TYUA 4TX9A 4IX0A 1XBYA 4YWSA 5F2GA 5FJIA 2VQUA 3C3UA 4CNOA 4NJGA 5D30A 2Y5SA 1AODA 3KE0A 3EX4A 4UTMA 1JZ3A 4Q8WA 2Z1SA 4XD4A 1HUVA 1UOZA 1JJKA 1QCWA 5DQPA 2NSXA 2AKZA 4AY7A 3IV3A 4LW7A 2E5BA 3NDOA 2OKTA 3R5EA 1QRQA 5T91A 4XKMA 4WZHA 1JD7A 5MKGB 2JBMA 2ZXAA 4NHVA 1EQPA 1PPIA 1PKLA 3NQCA 3SJ3A 2PTZA 4K6AA 3P0XA 2YDRA 1RA5A 3WF3A 3GYCA 3VZZA 4WXZA 4H7VA 4PMDA 3LI0A 4D6DA 1EPXA 1L8NA 4PTDA 3RMJA 1GYMA 4JX5A 3W2KA 4E8GA 3R8HA 3WQGA 1UZ1A 3BQ5A 4O1EA 4MFDA 2YZRA 4J3UA 4MSSA 4DPPA 2ZWZA 1Q6OA 1OD0A 1W5MA 4ORIA 3W24A 1GG0A 1TKKA 4L6OA 1A5SA 4D8ZA 3EWBX 3UVAA 2ZZ5A 3ORWA 3PJWA 4R7WA 2IQTA 2VR5A 3W1MA 1RY0A 3MUZ1 2BGNE 4BQ2A 1G5AA 3NM3A 5AB3A 3GTFA 1W1ZA 1K8XA 4XIMA 3H21A 3SR7A 3QGVA 1PDZA 3I6RA 3ZSTA 1K7EA 3B40A 1C3FA 4FNTA 2ZRVA 7A3HA 1WOBA 5AYIA 1GG1A 1F2JA 4UMBA 4L1XA 1LL4A 4O1FA 3M0MA 2D2OA 4E38A 4Z1AA 2CEQA 4NAFA 2FJUB 5TNVA 1TZ9A 1O68A 1O1ZA 1PIFA 2JQXA 5G2WA 1NFGA 1V93A 3PULA 5G1MA 3OVGA 4Q6XA 4AIOA 1JZ4A 4PEEA 2GDVA 4Q33A 4C1NB 3K8LA 5H91A 4K7VA 4NASA 4BS0A 3OVRA 3T8QA 1BG9A 1A5LC 1RHCA 3OBEA 4HMCA 3QC3A 1G4SA 1KXTA 2X16A 3BLKA 4UTKA 3MKVA 2QCEA 3FJLA 1C93A 3SB0A 3AIUA 2X1TA 2VD8A 4UFLA 1IZJA 1NY1A 1L8PA 2XDFA 1AA1B 1HP5A 4GY7A 4GIEA 1TTIA 1CW2A 4C5ZA 3WMC