1TVNA

Cellulase cel5g from pseudoalteromonas haloplanktis, a family gh 5-2 enzyme
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
molecule tags Hydrolase
molecule keywords cellulase
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvnA00
1C7SA 1XCWA 1SFSA 2A3CA 2EBNA 3D5HA 1EO7A 3AISA 5ABFB 1JZ8A 4JCMA 4JIEA 4W8LA 3O9NA 1JI1A 2X05A 1MFVA 3CHCA 4K68A 3CUIA 4RE4A 1JDCA 4HTYA 3WH9A 1KXVA 4P7OA 1TG7A 2DSZA 1JZ3A 1H4PA 2YA0A 1UD8A 2XJ7A 4HA1A 2NT1A 1JZ2A 4PCSA 2JF6A 2WZHA 3VIGA 4MDPA 4ACZA 3NDZA 1QHZA 3ARWA 3OLEA 1H1NA 3WFLA 3U7BA 3DC0A 1V3LA 1E43A 1V0KA 3AMKA 2VL4A 3TTSA 3ZJ8A 3MANA 3G6MA 3VGFA 4AC1X 1UD3A 1QHPA 1UR4A 4J28A 5A1AA 2CBVA 4KGLA 5A8PA 2ZX8A 5A95A 2BVTA 5ECUA 2JIWA 3W28A 4ATDA 1HKKA 2WBKA 1M03A 1CXFA 1QNPA 4ATLA 3AMLA 1FFRA 2W4XA 2HISA 4M29A 1BPLB 3VMNA 2DSVA 4XZBA 3AMGA 2W66A 1XYZA 3UG5A 4NSBA 4AZBA 1GOWA 1XHGA 2VRQA 1CZ1A 4UZUA 3W6MA 1DTUA 1QW9A 1R8LA 4UQDA 4EAMA 4D1JA 5A6BA 1W9VA 1H09A 4UR9A 1E40A 2UY4A 3WF4A 4AZGA 4YN5A 1BGGA 2W61A 5FCZA 3K8KA 3TONA 1KCLA 4B3LA 3WEZA 1IV8A 3PBGA 3UG4A 1LL4A 1UYQA 1HJWA 3WDRA 1XSKA 2GK1A 6TAAA 5I6SA 1CGWA 1GJUA 4R27A 1PBGA 2CYGA 3SCOA 3VDAA 3OLDA 3WSUA 2CXGA 5KZ6A 1HN1A 2VC9A 5LA2A 3BH4A 2QPUA 3QGVA 4QAWA 3OLIA 4ACZB 4D6JA 3OZPA 1VFUA 1EH9A 2C8NA 1JXJA 4CD5A 2PF0A 1HP4A 1CBGA 3CMGA 1B3ZA 1K6AA 1ISWA 3K4DA 2VOTA 1J9YA 3SCPA 4AW7A 1J12A 4HZ6A 4WSKA 3WH5A 1V02A 1NQ6A 4PTVA 5LA1A 3I3BA 4A4AA 1UR8A 3O6AA 4V28A 2NT0A 1CGVA 2GDUA 3E1F1 2EJ1A 1JD7A 4AZIA 2VNCA 1WZAA 1ZBCA 5IHRA 1DHKA 4JFWA 2ZUWA 4JFUA 2IUZA 2MANA 2YLAA 1E56A 2DSKA 1MW0A 5A94A 4F66A 2WM0A 3TA9A 3WL1A 5A6JA 1HIZA 2ZWYA 1S46A 3BMWA 3RIKA 3QHNA 2PWHA 2BY3A 1E5JA 2WVVB 1US3A 5GNYA 3M46A 5CPQA 3FXYA 1E72M 3W6LA 3AS1A 1JF5A 1TVPA 3ARYA 4AY1A 2XGBA 3WFZA 2QLYA 4GO8A 4D6CA 5M17A 3WDQA 4AZ6A 2J77A 5A8OA 3CZLA 3VUPA 4LGXA 4QCFA 3IJ9A 1E0XA 4W89A 1US2A 1CTNA 2ZXBA 1ISVA 4DM1A 4TVUA 4LX4A 1I75A 3QHOA 4M8UA 3WQWA 3MUIA 4EANA 3ECQA 3KEHA 3IK2A 5EBAA 3IJ8A 5C71A 1JFXA 1JAEA 2BY2A 4U3AA 3AIBA 4F8XA 1OINA 2XIBA 5IHSA 4NRSA 1OBAA 2JALA 1W9UA 4W8AA 2J47A 1GVYA 2O9RA 3ARXA 4Z2IA 2F61A 2EPKX 3NJ3A 3WENA 3SCVA 1NP2A 2Y24A 4JZ5A 1KWGA 3WQ6A 1V08A 1E3XA 1EDQA 5E09A 2W63A 2PWFA 1P6WA 1E55A 1JXKA 5E9AA 1HKJA 1QNRA 2VX6A 3GXDA 1B90A 2UY3A 2ZUSA 5AYBA 3BSGA 4D71A 2VVSA 5ABEA 4UFKA 4FLRA 1NH6A 4WF7A 1KCKA 3THCA 3ZO9A 4Q22A 4TOQA 4UFHA 2CETA 1W1VA 1B3WA 1JAKA 1UD6A 3AYRA 4M81A 1VENA 1CPUA 4X9YA 5D9MA 5BROA 4MNKA 4OKDA 3GBDA 3W81A 4QLJA 3AI0A 3N17A 3IJ7A 1V6UA 1V3MA 1B31A 1VJZA 2GUYA 4B3KA 3ZR5A 2WMJA 1KWKA 1ISYA 3A6OA 3CH9A 2JE8A 4U5KA 3AIEA 1W1TA 1JF6A 2WNWA 3CBWA 3RDKA 4GI6A 3VO0A 1QI0A 2CBUA 3OGSA 4PMYA 3CUJA 2QF8A 1UZ4A 4DUVA 1E4MM 3VDCA 2GDVA 3N9KA 3CZGA 4CN6A 3CGTA 3SCTA 1G9HA 4CN4A 2DT0A 4URIA 1G94A 3SUVA 2VZTA 1DWGM 2YLLA 2FGZA 2CNCA 1D3CA 3GNRA 8CGTA 1F4AA 1I1XA 2CCRA 2WANA 1VB9A 2ZUNA 1XSJA 1ZBKA 2J75A 1RP9A 2YIHA 1UUQA 1Y7VA 1E71M 1UA3A 1OGBA 5GPRA 1MYRA 4Y7EA 1MQQA 3GNOA 3MUAA 3W0KA 1GORA 3WQ4A 4AZHA 1DWFM 4CCCA 3PZTA 1XRVA 2J25A 3GZAA 2OYMA 4TXEA 4BF7A 2J62A 1UWIA 2PWGA 1Z32X 4OOUA 2PC8A 4PYSA 4BZYA 4H04A 3VKKA 4PCTA 2BY0A 4JKLA 4P8WA 1H11A 4D6FA 2VR5A 4GPNA 2CEQA 2XFFA 5CQ1A 5BXTA 4F9JA 3WNMA 5E6ZA 2DQXA 5AC4A 1E5NA 2D3LA 4A3YA 1EXPA 2VCBA 1V6XA 1HKMA 1LF1A 1JNDA 3SCUA 4JCLA 1J0KA 1MXDA 4JFVA 1E0VA 5EFFA 2D3NA 1VFFA 2W67A 1XD1A 5FL0A 4E8DA 8A3HA 2WC7A 3AHXA 3ARVA 3WEMA 1PZ2A 5I0DA 4WLCA 3VIHA 4XX6A 3T0AA 2WBGA 1UZ1A 2E9LA 1H0IA 1XYFA 3EDFA 3TP4A 4FF5A 3A4AA 3QOKA 1EOKA 2WLYA 5HBFA 5IFTA 1DWAM 1CXKA 1QPKA 3ARZA 5KEZA 3WF3A 3ZR6A 4CN1A 1CEOA 3OLGA 3PTQA 4MJ2A 1BYCA 3A47A 4Z2KA 4J3UA 3BAJA 4DWSA 1UH2A 1BQCA 2VR4A 1JZ7A 5BRQA 5D8ZA 5I23A 1VEPA 2A3BA 4E8CA 3WNNA 1EO5A 5GNZA 2J7HA 1UWRA 3OZOA 2Y8KA 1AQMA 3WDPP 1DWIM 1UHVA 1L0PA 2YL8A 4W84A 1MW2A 2RGLA 3U57A 1WZLA 1ZB5A 4CD4A 4JFSA 2VJXA 4N42A 1H41A 4P8UA 1PX4A 2VRKA 2ZIDA 3WD4A 1RD6A 1BF2A 1F4HA 5CSYA 2WB5A 3WQ5A 3VILA 3PZUA 4PMRA 4P7QA 1CGTA 5BWFA 4DWSB 4M82A 3AYSA 4P7LA 3QHMA 3QOMA 2DT1A 2YL6A 3AXIA 4IPNB 7A3HA 2WHMA 4J27A 2ESCA 6CGTA 1KBKA 1E6ZA 1CENA 2DDXA 4W8BA 3WIJA 1PIGA 1UKQA 2Y2WA 3DYPA 3PZGA 2D0HA 5DT7A 1UG6A 3L4UA 3KE0A 1C7TA 4MJ4A 5HPCA 4PTMA 1WB0A 4PMDA 5E0CA 3WH8A 4BA0A 4YHEA 4UOQA 1B30A 4BCEA 3AS3A 3L4WA 4UNIA 1BFNA 1XD0A 4DUXA 5M5DA 1M04A 2F8QA 1Q6GA 4MNLA 4C7DA 5DF0A 4J3XA 1A3HA 1EHAA 3WH6A 1I1WA 3M6DA 1OM0A 3BAIA 3BAXA 3EMZA 4GKLA 5A2CA 5GQBA 2VX4A 1JZ6A 3TTOA 4PSRA 1CDGA 2Y4SA 1GQIA 4P7NA 1WDPA 2BFGA 2GJPA 4H7VA 1M53A 3UERA 5AY7A 3PZQA 4FMVA 3WKZA 5FKYA 2WHKA 4PN2A 2C0HA 2WCAA 2XFRA 2Y8VA 3ZJKA 1YQ2A 1CLVA 1H5VA 3AMDA 3WNLA 4CVUA 3GBEA 2GFTA 2D0FA 2CBJA 4H8HA 1IZJA 1JL8A 3AIRA 4BQ3A 1TE1A 3RJYA 1CIUA 1B1YA 4AZCA 4V2XA 4CD7A 2YDQA 2OWWA 1M7XA 4OBSA 3AZTA 1OGSA 4D1IA 5CJ5A 1V0LA 1BHGA 1VJSA 4HZ8A 9CGTA 3II1A 1LWJA 3SCNA 5A6KA 1HNYA 1D7FA 3ARPA 4AEEA 1ODZA 4FK9A 4D6EA 2XVNA 4H8UA 2FGLA 4EK7A 1JI2A 2XVPA 3CLWA 4HU8A 3WDHA 3VDBA 1C8YA 5EB8A 1JFHA 3WNOA 5FL1A 2BHYA 2WWDA 1JZ4A 4IM4A 2WCSA 1FP9A 1V3IA 1PJ9A 3KWXA 2ZX5A 5I77A 2D2OA 3W37A 1C91A 1NOWA 1TA3B 3VGGA 3WMBA 1HJVA 2BXYA 3PZNA 3U5UA 3T2PA 1E1EA 3WELA 2AOSA 2G3IA 4MB4A 1AQ0A 4TTGA 2EPOA 4HPGA 3GNPA 2WMIB 2ZXDA 2ZX7A 1E3ZA 2A3EA 3NSMA 3ALGA 1WDRA 1NWSA 4RE2A 2YL5A 4OJYA 1J0JA 4D6IA 1EDTA 5D8WA 3CHFA 4UOZA 4J3TA 4ATWA 1E1FA 2E0PA 3TTYA 3VIKA 1H0GA 1E6QM 1PIFA 4NF7A 4CCDA 1J0IA 3BCDA 1GJWA 3VD3A 3GXFA 4WK9A 4J3VA 2BHZA 4WIWA 4UFIA 1OD8A 3EMCA 2WW5A 5BXSA 3VINA 3WQVA 3KL0A 1KXQA 1G5AA 1EOMA 2W92A 3PTMA 2G41A 3ZQ9A 3AROA 3F5LA 1KR0A 3ARRA 4GI8A 3CPUA 1E70M 3AFBA 4HA4A 1NWRA 3FNDA 1HJUA 1CXEA 1J18A 3CUHA 3BAWA 3OGRA 5A6AA 1G0CA 4PMVA 4M24A 3WF2A 1W9XA 2XVGA 3WQ8A 1AVAA 3VVGA 1UD2A 1K9FA 3VD5A 3A4WA 4JL2A 3WDJA 1TFVA 1FH9A 3WMCA 1TUXA 1ZJAA 3WD3A 5D4YA 1W2VA 1R7OA 3KL3A 4OOZA 2Q8XA 4DWSC 5DFAA 3D3AA 3K8LA 2ZX9A 1OGGA 3T2QA 4F9DA 1Q6DA 5IDIA 1ITXA 2VVNA 3VM7A 3T08A 4QLKA 5ABGA 1E4NA 4LYQA 1WO2A 4HOZA 2CESA 3W27A 3M7SA 1W3HA 4C7GA 2G3MA 1LQ0A 1NOFA 3DECA 4UQAA 1R7AA 3BGAA 2XM1A 1HL8A 4HOWA 1E73M 2E4TA 2WK2A 2XVKA 4WKFA 3OG2A 3VIJA 2ZOXA 3MUY1 2NW0A 3RCNA 2O9PA 4L4PA 1WDSA 3MMUA 4OZOA 3AOFA 1OCQA 1X1NA 3WUBA 1J0HA 5EMYA 4PTWA 4AZ5A 3W29A 2VTFA 1OT2A 1E6XM 1MWOA 2DT2A 4HA3A 4R5EA 1GW1A 1U33A 4AIOA 3FAWA 2C7FA 1E6PA 1RH9A 2X0YA 4TUFA 3WF0A 3APGA 5BCAA 2XHYA 2J78A 4CD6A 4UFLA 4JHZA 4HPHA 1VFOA 3CUFA 3RJXA 1V02E 4MDOA 1CXIA 1CXLA 1VEOA 5IXEA 2EPLX 3N11A 2WMGA 4FLOA 2FHBA 1OB0A 5FIPA 1ECEA 1V6YA 4TVDA 1J01A 1WZMA 3HJEA 1V0NA 2WSPA 1W9BM 1XSIA 3NIYA 2PBOA 2V38A 3ZIZA 1WDQA 4RE3A 5E6YA 1QNSA 2WC4A 1TA3A 3PZ9A 4UTFA 4QCEA 2D22A 1NWUA 3VGEA 4JKKA 3ZJ6A 5BYWA 4FLQA 4UQBA 1EQPA 4AIUA 3SCQA 3WD2A 3AQUA 3AXHA 1TMQA 4PMOA 2VMFA 4L4OA 3WMSA 4W85A 1PPIA 4S3KA 2JEQA 2WKGA 3JUGA 4KRTA 4U31A 3IAQA 4W7UA 3WDIA 5JBDA 5A6LA 1ISZA 2A3HA 1E15A 2W5FA 2J79A 3AS0A 3VD9A 4ZXOA 1E9LA 3CTTA 4B16A 1JIBA 1LWHA 3ARUA 1X6LA 3AHTA 4KGJA 2VCCA 1WP6A 4UQCA 5D9NA 4JAWA 3VD7A 3AIQA 4UCFA 1SMAA 1UWSA 3W25A 3MS8A 1JYNA 5C8BB 2G8ZA 1ESWA 1GONA 2HVMA 5CLWA 3IANA 4XV0A 2OYKA 3EYPA 1UH4A 3THDA 1DEDA 2XSBA 5AC5A 1GOKA 3OA5A 3VDHA 5ABFA 3PZOA 3AHVA 4YPJA 1OIFA 4X0NA 1CLXA 2PB1A 1AMYA 4UQEA 4CU6A 5A3HA 3LMYA 3GYCA 2XYLA 2V5DA 3UETA 1LG1A 1EHNA 1SYTA 4PSPA 4W86A 1KQYA 2DGAA 4AEFA 3EDJA 2FH8A 3HMCA 1QNQA 2AAAA 2EQDA 2O9TA 5LYRA 2DSWA 3SURA 1B2YA 1W3JA 3J7HA 2VZSA 3PZMA 4UFJA 1D2KA 1PEZA 4BQ5A 4AMCA 4OUEA 4LYRA 4U2YA 1G01A 4GQRA 1HJXA 4ML4A 4AXNA 2RGMA 2BHUA 3N12A 4QP0A 3VGHA 4CVWA 1R85A 2V3DA 4CU8A 2FHCA 1W9DM 2EPNA 4IPLA 3I3DA 4Z2HA 1W9PA 2EO7A 3W4RA 1JGIA 1IZKA 1GUVA 4XB3A 1KGUA 2QPSA 1PZ3A 2YJQA 3N15A 3CZKA 3KZSA 1C8XA 5HPOA 3B9DA 3CIVA 3ZT7A 3VGBA 1C3FA 2CIPA 2ZWZA 3AMCA 2J7GA 2B31A 3VX1A 4IUGA 2YA2A 3GM8A 3MKKA 1MVYA 1V0MA 1K9DA 3VNZA 3U7VA 4GZIA 1Q6EA 1QI3A 2J4GA 2XG9A 3WY1A 3PN8A 7CGTA 1M01A 1J11A 1OWQA 3VTRA 3FAXA 2X0HA 3HN3A 3BCFA 2X1IA 2VX7A 2YBTA 3VX0A 1GZJA 3GH7A 3LPOA 1VIWA 1GOMA 5M03A 4HMCA 1LG2A 3SUTA 3B9AA 4QFUA 2ZUMA 3RPMA 2WMFA 5CGTA 4BS0A 3N18A 4GQQA 2ZX6A 5CSUA 1NWTA 1WZKA 1FHLA 3L4ZA 4AD2A 1XH0A 4PMNA 4TVCA 4B9ZA 3LPPA 4A3HA 3VGDA 3B9EA 4PUDA 2ZXQA 3WNPA 1XH2A 5JIPA 2GK1B 2PBGA 3NSNA 1E6SM 4D72A 4CGTA 4PMQA 2XIIA 1KB3A 3UESA 1KXTA 6A3HA 4JFTA 1XH1A 1CGXA 1RP8A 4V27A 2BVDA 1UR2A 1ISXA 2Z1SA 4KH2A 4BQ2A 4E2OA 1Q6FA 1XV8A 4C7FA 4X0VA 4AD3A 2GJRA 2W62A 2OSYA 2JEPA 1H2JA 3BXWA 1KXHA 2ZUUA 4MB1A 5CPTA 3CMJA 4GIAA 1PX8A 1EA9C 1O7AA 2WYSA 3BC9A 3MV11 5GNXA 5CGMA 2VO5A 5DMYA 1EQCA 5ABHA 3WBAA 1UD5A 3POCA 2CHNA 2WVUA 2V3FA 4EKJA 1GVIA 1WCGA 2D24A 2XPKA 5BXPA 1BSIA 1BVNP 2VT0A 1JG9A 1RPKA 3AS2A 1TZ7A 4GO9A 3ALFA 3EBVA 1FA2A 3L4YA 4GZJA 3BAYA 4W88A 3AIUA 2V3EA 1NP0A 2X8RA 2DEPA 3NDYA 3W24A 2A3AA 1W91A 2O92A 2DSUA 2VZVA 1BVZA 5AYIA 3GDBA 2XVLA 3BLKA 2ZXAA 2GVYA 2OLHA 2YBUA 2FH6A 5I78A 3CZEA 2VRJA 3QR3A 2YOCA 3EMQA 1SR0A 2D20A 1MFUA 3GH4A 5F7UA 4QLLA 1LJYA 2TAAA 2PWEA 4MB5A 5A6MA 5DT5A 3N13A 1IT0A 4WJXA 4PBGA 3NCOA 1R87A 3L2MA 3OB8A 3VM5A 4MTVA 1OD0A 2NSXA 1BLIA 3SIMA 1OSEA 3F5JA 1O6IA 2CBIA 5BXRA 1QI4A 1CGYA 1B3VA 5HXMA 3PHAA 1KFWA 2QHAA 4AD0A 3AHYA 1W2PA 4P8XA 3AJ7A 1J0ZA 2DIJA 2J7EA 3RM9A 1BG9A 2X2YA 1ZBVA 1OT1A 1HL9A 3ARQA 1JNEA 5JUVA 2DH2A 4MPKA 2XFYA 2D1ZA 1DWHM 2CERA 1DP0A 5FOOA 1UR1A 4S3JA 2XTKA 1KQZA 4PUEA 1VBRA 3VOCA 2GJXB 2IXUA 3T0BA 3FHAA 3EDEA 4B15A 3SUUA 4GINA 5IFPA 1X6NA 4AD4A 1L8NA 1NM9A 2WSKA 4MNJA 3T09A 2G3JA 1AQHA 3WUEA 1B3XA 1LL7A 4P8VA 1V6VA 1V3HA 3VD4A 4B9YA 5JBFA 3NYDA 4Z2JA 2ZE0A 2WZEA 2E9MA 1JYXA 4P7RA 1HJSA 3G6LA 1BAGA 1XGZA 1N82A 2VI0A 1LL6A 3SEPA 3OIHA 3RMEA 2UWFA 4M80A 4CD8A 3W82A 1V3JA 1FH7A 3B8SA 1MQRA 2WMIA 1TR1A 1OIMA 1E0WA 1B0IA 4ZENA 4W7VA 3AZSA 3GXIA 5CLTA 2CHOA 3T2OA 4AD1A 2OSXA 2QV4A 3O2LA 1MW1A 5A6BD 4ZEPA 1EDGA 3W26A 1BGAA 2BS9A 2EEXA 2E9BA 2J8FA 1VRXA 4MADA 4D6GA 1CXHA 1TVNA 4IISA 4W93A 5A8MA 4KMQA 4HMDA 3RM4A 4KRUA 1C90A 3F5KA 4HU0A 3ZJ7A 2WMKA 1QBBA 2EPMX 3FY1A 3AXXA 3IAPA 1G1YA 4ACYA 5A8QA 4H8VA 1BYDA 2FDMA 3FHQA 3K46A 4PMZA 3LPFA 3BSHA 2WAGA 2DPEA 2VURA 3ZSSA 4GZEA 5LA0A 2FHFA 4J3WA 3RO8A 1WNOA 2BY1A 1R86A 4MNMA 2XM2A 3NSXA 4DM2A 1W3KA 1QBAA 3SCSA 4HZ7A 5A6SA 2E3ZA 1GCYA 1FOBA 4AIEA 5I3DA 3WN6A 1FFQA 2XWDA 1QVBA 1E6RA 5DEZA 5A2BA 4CUCA 1FP8A 4Q7NA 2CKRA 4MAZA 3CHDA 1GNXA 4WKHA 3RM8A 3ARSA 3ZSTA 3L2LA 2YKKA 3VIMA 2UY2A 1Q6CA 3M07A 3HU7A 1QNOA 4NZCA 5C70A 3ARTA 3VIIA 3WD1A 3GTNA 1U2YA 3TTQA 3MO4A 1ZBWA 2JFEX 2V3GA 4PRWA 3ZOAA 5I79A 3VIPA 4AZ7A 1GQJA 2VQTA 5CG0A 3N04A 2Y5EA 1VF8A 4DWSD 1ZU8A 2YDSA 1KBBA 4W7WA 1YHTA 1ZJBA 2J7BA 3NUKA 3DHPA 2WWCA 4TTUA 2BXZA 4MB3A 2WC3A 3DYOA 2YDRA 2J7FA 4KWUA 4Z2LA 1GQLA 4ZE4A 1SMDA 3DHUA 3WBEA 4GXPA 3S2CA 1GOIA 3AZRA 3CUGA 2ZICA 4HOXA 1VFMA 4DUWA 1XC6A 5D9PA 3UR7A 4NRRA 3A4XA 1U30A 3K1DA 2WKLA 4D6DA 3K4AA 4WKAA 3W53A 5JBEA 2GJXA 3U5YA 1JDAA 1PX3A 3MMWA 1MW3A 2OWCA 5E0FA 3T0DA 1HX0A 2XUCA 3S6TA 4XZWA 1FH8A 4YHGA 1GPFA 2QMKA 3EDKA 1HXJA 2CITA 2G3NA 3L4TA 1W1YA 2G4FA 2WVSA 1W3LA 2DH3A 3GH5A 4XUYA 4AISA 1HT6A 4M1RA 4U33A 4AYSA 1UWTA 2GSJA 3UCQA 4OIFA 1HKIA 3VIOA 2F2HA 2UY5A 1JYVA 1ZS2A 2X09A 4OBRA 1MXGA 5HDRA 4WSJA 4JL1A 5M3WA 4J3SA 1MQPA 2ZUVA 3W38A 1GHRA 3MUZ1 3ZM8A 1KGWA 1QHOA 2D23A 1WPCA 1HVXA 5JIWA 1KGXA 1C93A 2VZOA 1WE5A 2DIEA 4QDMA 3MU7A 5CXPA 4LPCA 1J10A 4HMEA 2ZUTA 2AMGA 4U3CA 1JDDA 1UOKA 3AHZA 3EDDA 5DO8A 5EFDA 2OSWA 4JKMA 2J7CA 4CU7A 2OYLA 2WVTA 4AZCB 1UQZA 4GI9A 3SUSA 2W91A 4W5UA 1UKOA 3PZVA 3WF1A 1HP5A 3CZ8A 1V3KA 3F4VA 2J7DA 4AWEA 1DWJM 4LYPA 2E8ZA 4EE9A 4UFMA 1K9TA 1HJQA 3VU2A 4U2ZA 4W87A 1UKSA 1PAMA 2VZUA 2CKSA 1UR9A 4LQ1A 3VIFA 4Z2GA 1QI5A 5A8NA 4JHOA 2YA1A 3VMPA 1QW8A 2J8GA 1QOXA 4PMXA 1K9EA 1V03A 3A3HA 1BYBA 2V5CA 3BLPX 1EIBA 5I24A 2JIEA 4TX8A 2WXDM 1Q4NX 1E4LA 3UR8A 2EXOA 3WH7A 2IXVA 1BYAA 4PMUA 1H49A 1NARA 5E70A 1UA7A 1GOOA 5CPSA 4H41A 4M56A 4NI3A 1A47A 3WUGA 2VCAA 1UWUA 2CPUA 4MAVA 3MMDA 3I3EA 2PWDA 2DT3A 3L4XA 4PTXA 3VPLA 1WAWA 3FN9A 4D6HA 4CKQA 5D9OA 7TAAA 1ITCA 4U5IA 3MV01 2VQUA 3SCWA 3SCRA 5HOSA 4H2CA 3VMOA 2OWXA 3WD0A 3UG3A 2WMHA 3CHEA 2BV9A 5I2UA 3AIVA 4W5ZA 2BVYA 1TCMA 2WLZA 5BRPA 3OGVA 2JF7A 1UR0A 4N0RA 1WKYA 1VAHA 3K8MA 4UOJA 2J74A 4HP5A 1CWYA 3ZMRA 1LLOA 1E6NA 4F79A 2XSAA 3BAKA 1E4IA 2WZIA 2VX5A 1GOQA 1W32A 2BNJA 2D0GA 2Z1KA 4AD5A 2E8YA 5TD4A 4CCEA 1HF6A 1H3GA 3TOPA 4RL3A 5I5RA 1B9ZA 1UKTA 1ODUA 1V6WA 4PEEA 1HVQA 4FLSA 1VBUA 2QMJA 5FD0A 2E40A 2WPGA 1C92A 4ZXLA 1QI2A 1UD4A 4UZSA 5HNNA 2XWEA 3BMVA 1JYWA 3GXMA 4J7RA 2O9OA 3PTKA 1C8QA 3WEOA 3AIWA 1BG4A 1VEMA 3UEQA 1JZ5A 1CECA 2YL9A 1UWQA 1EGZA 5CZKA 5A2AA 3WUFA 4E4PA 1XCXA 3FW6A 3DYMA 1FHDA 2PI6A 1W1PA 1GHSA 3MSDA 3POHA 1KR1A 3L4VA 1GQKA 4UQ9A 4ZFMA 4TX6A 5A69A 1CYGA 3ZT6A 1BTCA 3SUWA 3WL0A 4BQ4A 1UKPA 3VNYA 1J0YA 1CGUA 1CNVA 3CZJA 2VUYA 4ZE5A 3CO4A 2XGIA 4LXFA 3WNKA 3LPGA 3AICA 2WHJA 3KL5A 1JD9A 2WHLA 3OBAA 1NOUA 3MSGA 1B3YA 3RILA 1UH3A 1UQYA 2WVVA 3N1AA 1ZL1A 2WCGA 3PZIA 3ZT5A
chains in the Genus database with same CATH superfamily
1C7SA 1XCWA 3H8AA 5G2IA 2HV5A 1G4TA 3D5HA 5AYZA 2A7NA 1JZ8A 2YB4A 3O9NA 3WG6A 2ZE3A 1MFVA 3CHCA 4FPSA 1L2UA 1ECQA 1VPXA 3CEUA 2NXIA 1O1ZA 4HHHA 4IIHA 4NZFA 2G4JA 1AH4A 4JTCA 2DSZA 3UXAA 1JZ3A 3LB0A 1BXNA 1UD8A 2XJ7A 4HA1A 4GUIA 3W83A 1EP3A 2OZ3A 4O8RA 4FNTA 2NT1A 1JZ2A 4PCSA 4QX4A 2E5DA 5LNVA 5H6HA 2Z1WA 4B90A 4MYAA 2VC5A 4LUYA 4ACZA 2YFOA 3B9OA 3OLEA 5XIAA 3FJNA 4I5XA 4AY7A 2AL2A 3NA8A 3GK0A 1E43A 1FKXA 2CXEA 3TR2A 3H24A 2E6YA 3TTSA 5C9XA 3MANA 3VGFA 4AC1X 4J28A 1TJRA 5A8PA 3EOLA 2BVTA 4J2PA 2XIQA 3APTA 1Q65A 2B4GA 3W28A 1W5MA 4ZSUA 1FFRA 2W4XA 1DJWA 2HE5A 4M29A 1BPLB 5CPNA 1QXLA 2OODA 4U28A 1M68A 3G1FA 3URQA 3UG5A 3RN6A 2CFFA 1GOWA 1XHGA 1CZ1A 4O0ZA 3K2GA 4DBUA 4UTUA 1WYIA 2B7PA 3KUMA 3PVFA 2FZNA 1BGGA 4UTLA 2P1FA 2PFHA 4B3LA 2PZ0A 3UZ5A 2A4AA 2A5HA 1HJWA 5I6SA 3W7MA 2CYGA 3E2SA 3SCOA 3IK4A 4MGGA 4QDPA 1LCOA 2CXGA 5KZ6A 1FWHC 4S38A 2VC9A 3MCMA 3VFCA 2J24A 4HJWA 3BH4A 2B7OA 3QGVA 5BW6A 2X7WA 2ZRUA 3OBKA 1EH9A 2C8NA 4GGBA 1B3ZA 1K6AA 1UOZA 1F3TA 1ISWA 1RY0A 4M6UA 2QVHA 5CC5A 3BUVA 4HZ6A 4WSKA 1UP2A 4Y9MA 1NQ6A 1A0EA 3RPTA 1PXGA 3HPZA 4IQLA 2AGTA 1UR8A 1X8FA 4TIMA 5K9CA 2V2CA 2CHRA 4H8NA 1E9IA 3B3DA 5CZJA 1LOLA 1OQFA 1ZJHA 2QIIA 4H1ZA 4JFUA 2A6NA 2DSKA 1EGMA 4F66A 3TA9A 3WL1A 2XH7A 4WR3A 5KMYA 3NAVA 3CYVA 1W8SA 2PWHA 2BY3A 2QPXA 4IP4A 4O13A 3W7OA 5CPQA 3AS1A 3ARYA 3CQHA 4AY1A 4NJGA 2XGBA 1I0BA 2WZTA 4D6CA 1B4EA 2DUAA 4AZ6A 3CZLA 4LGXA 1DIKA 1E0XA 3BWWA 3LMZA 3BL3A 1ISVA 4DM1A 1EF3A 3OW1A 4LX4A 1I75A 1YXDA 4G1NA 2Q6ZA 3GHUA 3IK2A 3IJ8A 5C71A 4A8IA 3LY0A 1H7RA 3WFAA 4LBUA 3RU8X 4LAUA 1DJQA 3AIBA 2FMOA 2XIBA 2QUNA 1JR1A 2DZSA 2DZWA 4W8AA 2J47A 2O9RA 2EPKX 2QKFA 3A24A 4HKPA 1KWGA 4XSLA 1E3XA 1EDQA 3O3RA 1IIHA 1JXKA 5E9AA 3N6HA 5CSSA 1B90A 4ADTA 2IKGA 1NDWA 1TPEA 3GAYA 3ITGA 4MFEA 3G18A 4TOQA 1B3WA 1JAKA 4DBDA 1TV7A 1RA5A 1VENA 3EA2A 2A79A 3APYA 1Q7ZA 3FA3A 3M0KA 3N17A 4NAEB 1V3MA 1O4UA 3P80A 4B3KA 2WMJA 3WBWA 3GDKA 4JTKA 1UASA 4KWVA 2JE8A 4U5KA 1W1TA 2WNWA 3RDKA 4PUJA 4O17A 3CUJA 2QF8A 1E4MM 1PCWA 3CZGA 4CN6A 1QFEA 3CGTA 1V7YA 2CWXA 1G9HA 4CN4A 3VNIA 1SW3A 5LKYA 3DIPA 4XD3A 2YLLA 2CNCA 2XINA 4FX6M 8CGTA 1PSCA 1I1XA 2CCRA 2ZUNA 1VB9A 3W7NA 5D2TA 2FPTA 1RP9A 1E71M 1UA3A 4K1WA 3IGUA 2WQDA 1TKKA 3WLRA 1NFGA 1MQQA 3UZZA 3M5XA 4N02A 4CCCA 1WKFA 3M9YA 3SBFA 3TN3A 2TSYA 4TXEA 4BF7A 1UWIA 2V9DA 4JTLA 3V1HA 2O4MA 3M41A 3ZVIA 1TZZA 1EBHA 2PC8A 3R10A 1L6SA 4H04A 3E2QA 3EX3A 3VKKA 4ZFCA 4JKLA 3GY1A 4P8WA 3VCRA 1H11A 5CPOA 5BXTA 4I9JA 4FF7A 2DQXA 5AC4A 1E5NA 4C6IA 1EXPA 1TWDA 3VYLA 2VFIA 1JNDA 5BOFA 2ON3A 4M7SA 1C29A 2D3NA 3D6NA 2W67A 5EGRA 2WZMA 4NU7A 4YNGA 1L6WA 3E49A 5I0DA 1RCQA 4DF1A 2BMBA 3T0AA 4H2HA 5B7ZA 3EDFA 3FVMA 5TAOA 1YDOA 4M0XA 1DWAM 1CXKA 1QPKA 3ARZA 3IJ6A 1FCVA 4CN1A 1JRBA 3PBVA 3OLGA 4Z2KA 5AYXA 4J3UA 3DBPA 3IV3A 4XZ9A 4X2PA 2Z6IA 2VR4A 2AQOA 3FA5A 2A3BA 4QS6A 1EJVC 3I4EA 1EO5A 4O16A 5GNZA 1W31A 4ZO7A 5AZ1A 1AQMA 4Z0SA 5HMSA 1DWIM 3C0JA 2FKPA 2BGSA 5LIWX 4Q7IA 4NASA 3U57A 3ONCA 1NIUA 4QISA 3UJFA 4PB4A 3WD4A 2G96A 1ZCOA 4D9PA 3FJ6A 3PZUA 3SRFA 1HKWA 5BWFA 4QG6A 3UWEA 1XR2A 3QOMA 3AXIA 4DUOA 4IF2A 2WHMA 4QQUA 4H6QA 1KBKA 4W8BA 3WIJA 3FDKA 3N34A 3FFSA 3HQNA 3COTA 1XGDA 3DYPA 2D0HA 3I7SA 5DT7A 5AN7A 2C15A 1ME9A 4AVFA 1UG6A 3L4UA 3KE0A 1W5PA 3C0SA 3EXTA 1WDWA 5C5YA 3NQEA 4MJ4A 4IIEA 5HPCA 4PTMA 1J2WA 1Y5WA 3B97A 4BA0A 3OBEA 3EB2A 4UOQA 1B30A 3P84A 3FCPA 3AS3A 3PSVA 3L4WA 4LAZA 4K1GA 4Q6JA 4H01A 2PDGA 2RDWA 2JGQA 1IE7C 3WJYA 3N25A 3TNBA 3TJXA 1A3HA 2IPFA 5D09A 1G69A 3BAIA 1XPGA 4GKLA 3SO7A 5A2CA 3QV7A 3USZA 4O12A 3TEVA 1JUKA 3PAJA 3MP4A 3L0KA 1MSSA 1OFAA 5AY7A 2UZ9A 6ENLA 1M7JA 2SFPA 4FMVA 1FCQA 1FCUA 2I9EA 1V7AA 4PN2A 3UZWA 1KCZA 3IJDA 1YQ2A 3AMDA 3R79A 5DCEA 3I7QA 3RJYA 1CIUA 3PSWA 3IRDA 2YDQA 1DJYA 1M7XA 3N4AA 4OBSA 1OGSA 2V67A 1F6KA 1VJSA 3EAUA 1UBSA 3II1A 1T7LA 3E0WA 3SCNA 5A6KA 1EP2A 3P62A 3ARPA 3NQMA 4QIUA 3TIMA 2XVNA 5H8MA 1Q2SA 4H8UA 4LFYA 1KBJA 4A8NA 4EK7A 4Z1CA 4E4UA 2Z25A 1CW2A 3SI9A 2WPBA 1JI2A 1GVFA 2TYSA 4YMZA 3TSMA 3CJPA 4ASTA 4XKYB 4TQTA 2OGJA 5FL1A 3ZVHA 2EJAA 4DJFD 2WWDA 4IM4A 3D46A 3CYJA 1FP9A 3LV5A 3M47A 3KLKA 3QZEA 1PJ9A 3STPA 5I77A 2HK1A 4JNMA 2D2OA 4DYEA 2BXYA 3PG8A 4CQ8A 3D3FA 3WELA 2AOSA 4UTJA 5F2IA 4MIMA 7REQB 1PVNA 3GNPA 2WMIB 2ZXDA 3WLHA 1PS9A 1WDRA 3MJYA 2VFDA 2YL5A 4UTMA 1EDTA 5J8LA 3UPMA 1K02A 4MZ1A 3MDUA 4AAJA 4J3TA 3IIVA 3TW9A 3TTYA 2QCGA 1VHNA 3TC3A 1PIFA 4L65A 2HS6A 3LERA 2QJHA 2BHZA 2PZNA 1OD8A 1S5WA 5LIUX 1HFBA 4GUHA 3VINA 3KL0A 3EXRA 1FHVA 1G5AA 4OT7A 2W92A 3I7RA 3KBVA 3TYBA 3GC2A 4JQ1A 3AROA 5F4XA 3MI3A 3TSDA 2Y0FA 4GI8A 4YYFA 3BVJA 3P6LA 1J18A 5A6AA 1G0CA 3WF2A 2I56A 2YBVA 2V30A 2GGJA 1U22A 3F2CA 1FH9A 3R58A 1P0EA 2GUBA 3T8LA 1TUXA 1ZJAA 3WD3A 4FNUA 2YGYA 1R7OA 2R1NA 4REQB 2PS2A 2XISA 4DWSC 5DFAA 2GGHA 4JYEA 1SVDA 2Z27A 4QLKA 1E4NA 3SN4A 4JIPA 4LYQA 1WO2A 5U4NA 1TWZA 4MM1A 2CESA 2PGWA 3NFUA 3LHVA 1BRLA 4HCHA 3BGAA 2XM1A 1HL8A 2VWTA 3VIJA 2ZOXA 1DOSA 2NW0A 4DRSA 1OK4A 1BTMA 4L4PA 4G5DA 3NG3A 4OZOA 4LUJA 3ZS4A 2YYUA 1X1NA 1J0HA 1H60A 4AZ5A 4IGSA 1H7OA 2YXGA 2VTFA 2I1OA 2WNQA 4IT1A 1E6XM 1YTDA 3THQA 3WQPA 4HA3A 4R5EA 3H53A 4AIOA 2C7FA 4BY3A 4TUFA 3WF0A 2DVXA 2J78A 3O8AA 4XK2A 4BI5A 4DAFA 4DZ5A 3DFQA 5DCBA 3RJXA 3TKFA 1H50A 2WQPA 4JOMA 6REQB 3SY1A 3WK3A 3SN1A 2B81A 3CHVA 3HJEA 1HO1A 1J6OA 3H2CA 1W9BM 5D2WA 4IMAA 2V38A 2GQAA 4RE3A 1QDSA 3N6QA 4WDXA 4HPNA 3QZAA 4HNUA 3VGEA 3D0CA 5DQPA 4JKKA 3M0VA 2OLSA 3HGJA 4FLQA 2KAUC 1EQPA 1TMQA 4OWGA 4S2CA 2AL2B 3LI0A 3RLHA 3W7CA 5D2VA 4KRTA 2PWVA 4W7UA 2Y7GA 1E15A 3MA8A 4IICA 3AS0A 4AC7C 3SY8A 2FTYA 1K70A 1ONEA 4ES4A 1LWHA 3ARUA 4IGNA 2AL1A 1POKA 3W1NA 4UQCA 2Z0IA 3AIQA 1Q8JA 1DXEA 3GC5A 3ABSA 3W25A 1JYNA 3G1RA 3NOEA 2HDJA 1ESWA 4RCXA 1OFBA 3S42A 2ZRZA 3IANA 3QMSA 1A5UA 3EYPA 3B8WA 4Q8MA 4NZ1A 3UWYA 1GOKA 1R2SA 2F9RA 1OVDA 3AHVA 3WQEA 4WDWA 3FV9A 4DJDD 2PB1A 1RUSA 4EX4A 4C1LA 2QUMA 4UQEA 5A3HA 2XYLA 3GB6A 1VRDA 1EHNA 4H9UA 3K13A 3HMCA 1QNQA 2EQDA 4NAFB 3TC6A 4ZVJA 3SURA 1W3JA 3ICJA 1AL8A 3LG3A 4ZB5A 2GUUA 2ZKMX 1PEZA 1VFHA 4BQ5A 4GCAA 5D33A 4OUEA 4U2YA 5LNRA 1G01A 3CU2A 3H54A 4AXNA 1V8EA 3N12A 4WCJA 4QP0A 3R8RA 4L7ZA 4CU8A 4O1CA 3BV4A 4PUMA 1W9DM 2EPNA 3A12A 5F4WA 2RH9A 3I3DA 1AODA 1W9PA 2I5IA 2IPWA 2EO7A 4OU1A 1RR2A 3QPEA 3W4RA 1IZKA 1KGUA 2QPSA 3WJSA 2YJQA 5HPOA 1A0CA 1E9ZB 4DHGA 3VGBA 1C3FA 1VH7A 2CIPA 2OO0A 4CQBA 2J7GA 2B31A 2P8BA 2WNZA 4IUGA 3CUZA 1I6NA 3E0FA 5CG7A 1H61A 3GM8A 1TYGA 1V0MA 1K9DA 2VFGA 4IMEA 3RUBL 4WOZA 3U7VA 4F0LA 1KFCA 2Y6ZA 2PMQA 1QI3A 2J4GA 2E77A 2E5CA 1EJSC 1ONRA 4LW7A 3WY1A 1D8CA 3MWAA 1M01A 1J11A 1VFTA 3PK7A 3HN3A 3BCFA 1UR3M 2VX7A 2YBTA 3ENLA 3VX0A 2J66A 5TNVA 2DFAA 3LPOA 1ZCCA 4PUNA 3R8HA 1OYCA 2EKCA 1RXOB 1VPYA 1W3TA 2Z2AA 4LH8A 3P2VA 4A3HA 3VGDA 3B9EA 4PUDA 1XH2A 2GK1B 1EWEA 4D72A 4CGTA 4PMQA 1ELSA 4RZ6A 1KB3A 5PTDA 3IV8A 2FLIA 3G3MA 1XH1A 5F4SA 3EX2A 3RPDA 3P61A 3ME3A 4DJED 2BVDA 3G8RA 4MLRA 5AHLA 1ISXA 4IIFA 1XV8A 4JTJA 3DHDA 4AD3A 2CZFA 3H2AA 4G8TA 2RHGA 1OG6A 4MB1A 2ZUUA 4PC8A 1GQNA 1OJXA 1HO4A 1SU5A 4C5ZA 1PX8A 2WYSA 2X40A 4MKVA 3MHFA 3BURA 2BGNE 1T41A 5D05A 4US6A 4Q8PA 1K7XA 2PU0A 4E3TA 2OOGA 2JBMA 1KKOA 3ORWA 1GVIA 4O8AA 4UB9A 1SO6A 1PCKA 3U2ZA 1BVNP 2C19A 2VT0A 3AS2A 3GTFA 3IIOA 3F4WA 5FEXA 3ZFHA 2PEVA 5CBBA 3EBVA 1W1A1 2V3EA 3U8GA 2NQLA 1VIZA 3EB3A 2BX7A 2GLKA 3AALA 1QW7A 3PM6A 1EJ7L 3C8NA 4G56A 4RPPA 5CKSA 3GDBA 2XVLA 4PRTA 3SY5A 4EXBA 5I78A 4B3ZA 2YCLA 4GUGA 4Q8TA 3R94A 1VZWA 4A6GA 3TAOA 2PWEA 3KDNA 1JCTA 3LGGA 1W17A 5IBXC 3S9ZA 4WVXA 4AMAA 3VM5A 5D38A 3CB3A 3TTEA 4YS1A 1OSEA 4HNLA 3OVPA 1TWWA 1CGYA 2V5BA 2QCCA 1B3VA 5HXMA 3HFTA 2QHAA 4FX8A 4ROPA 3AHYA 4F0KA 3HPAA 2F6UA 2PURA 1AMKA 1J0ZA 5FJUA 1SZFA 4FXJA 1HL9A 1LBFA 4EWND 4AB4A 2QDGA 3JR2A 3GIPA 2EG8A 4AHQA 3M0IA 4GI4A 4PUEA 2YX0A 3GTIA 3FHAA 3EDEA 5I3JA 1NF7A 5IFPA 3F1QA 4LTSA 2IKJA 1L8NA 4JTDA 3KOWA 3T09A 3URBA 2G3JA 1AQHA 1YNQA 1B3XA 1E0UA 2ZYFA 5JBFA 2ZZ1A 2WZEA 2E9MA 1X96A 1JYXA 3LZ3A 1KNWA 4P7RA 3W2UA 4IIBA 2PP3A 1XGZA 1ICSA 2UV8G 3MVIA 3QQWA 2PLKA 2UWFA 3QBUA 1FH7A 1YTEA 3BLEA 2IMRA 5I3KA 4I5RA 2BOGX 1T99A 2PPGA 2YCJA 2ZA3A 3W74A 3HIJA 4B5UA 3V5FA 3O2LA 5FJTA 4LUTA 4LCRA 5A6BD 4PTDA 3W26A 2C18A 3VABA 2XH0A 4O14A 4KMQA 4HMDA 2VELA 2MNRA 3EWWA 3S9YA 1QBBA 2BTMA 4NI8A 3FY1A 3VZYA 4ACYA 4UNKA 3CPGA 3LPFA 2Y5SA 2VURA 1VYPX 2FHFA 2WKJA 4KWWA 4POCA 3CEPA 4M51A 2XN2A 2BY1A 1RBOB 1XDLA 4S3BA 4UMBA 5AYYA 4DM2A 3KW3A 4MY9A 4H7CA 2E6DA 1A5BA 3QEZA 1BEUA 3EA3A 3WLMA 4PCPA 4PUWA 2PLJA 2V2DA 1QVBA 1TPB1 5DEZA 2FIQA 4GK8A 3CHDA 2TMDA 4C6DA 4UTIA 1PWMA 2YKKA 1Q6CA 3SADA 4F0SA 1KA9F 1OEPA 1DPMA 1SW7A 3ZOAA 4H83A 2HEJA 2Y5EA 1DIOA 4DWSD 3BLIA 2YDSA 1KBBA 1FVPA 3B03A 3H7UA 3M0ZA 3RCYA 3B8DA 1TQJA 3GG0A 4Q32A 3CM4A 3G1AA 1LBLA 1SMDA 3DHUA 3WBEA 5FF7A 4YVXA 4Q8WA 1A50A 1EPVA 2J6VA 3QFWA 3EX1A 4KEVA 4R34A 3PPFA 3E5PA 3OPSA 1V77A 2OEJA 4ICMA 4HD5A 5E0FA 3T0DA 5D2XA 1GPFA 3KRSA 2XIOA 1EJWC 1HXJA 2CITA 2G3NA 3L4TA 2WVSA 2PDNA 3SGZA 4XUYA 4AISA 1TREA 1HT6A 4M1RA 3SQSA 4R7WA 4U33A 2PDUA 4FSAA 1WA3A 3BLOA 2F2HA 3H4WA 3GX9A 4NX0A 3T7VA 1OC6A 3R5EA 1XGEA 3JS3A 3TX9A 1XIJA 4R85A 5LXXA 2NVAA 2QGHA 3UJ2A 3TU9A 1MQPA 3R12A 3MBDA 1KGWA 3NO5A 2L5HA 3UG8A 1KGXA 4YIWA 3QGAC 1TPUA 3KTCA 1KM1A 4LPCA 1XLBA 4HMEA 4A3UA 4U3CA 4YXGA 3L5AA 5FJRA 1TPH1 1JDDA 2O7QA 5LHFA 4NY2A 2WVTA 2OYLA 4AZCB 4GI9A 4BI7A 3NTYA 2PGEA 3SGUA 3WF1A 3I6RA 5FEPA 4XVEA 3EB4A 2J7DA 1DWJM 4F3HA 3U4FA 2E8ZA 3BSMA 4NZ3A 2OEKA 9XIAA 1M65A 4HNCA 1UR9A 4NT0A 4DVOA 3VIFA 2YA1A 3VMPA 4X3ZA 4PMXA 1BYBA 2JIEA 1XDMA 1S5MA 4IP7A 1C9WA 3FKRA 3UR8A 3WH7A 1UP0A 4ZSTA 4PR4A 1BWVA 4Q4MA 2AKMA 5AC8A 4N4QA 2CLFA 1UA7A 2Z24A 3GE7A 4H41A 4B5WA 4NI3A 5FJOA 2NX3A 2NLIA 3MMDA 3CV7A 1ZGDA 1X8CA 3VPLA 3VNJA 3C2FA 4U5IA 2VQUA 3IJLA 4XO6A 1TRIA 3IUDA 4MWAE 2VEKA 3NPXA 1XG3A 5F1UA 3TROA 4I3GA 2F2KA 3TK7A 3IRSA 5HMFA 3PBUA 3R0KA 4C1KA 1TCDA 4S3EA 3AWNA 4S3FA 3A64A 5T26A 1OHLA 3AYTA 2Z4GA 4Q8OA 3K8MA 3GAKA 3H7VA 4LNYA 2J74A 2YR1A 1O94A 3W76A 1U1HA 1LLOA 5EMKA 2WZIA 5TQLA 7ODCA 4QAIA 1DTNA 2Z1KA 3C86A 3OG3A 3W1RA 1FTXA 2E8YA 1LQ2A 2PD9A 5TD4A 1U5JA 1HF6A 4NHVA 3OHMB 1UKTA 1I4NA 3KOXA 1ODUA 2JQXA 1HVQA 3DI0A 4LC6A 2E40A 3W7HA 5H8PA 3IIZA 1RALA 2O9OA 2E6AA 3GDRA 2W79A 1DORA 2PDBA 1VEMA 2CC0A 1SFTA 1JZ5A 1CECA 1EGZA 3HPFA 1TX0A 2VM8A 3WUFA 2PRMA 3FW6A 1YNYA 1P6BA 4ML9A 1KR1A 3L4VA 2DW6A 3E6EA 4ZFMA 4TX6A 1Q6OA 1RSCA 1I8JA 2WSRA 3WL0A 3TXVA 3W07A 4EXQA 4GY7A 2I17A 3SQLA 2WHLA 3OBAA 3BJTA 3RILA 5FEZA 3TYUA 1UQYA 2ZRYA 4IXHA 1XS2A 4HN4A 2DIKA 4GQ0A 5T91A 1TV8A 1ZL1A 2A3CA 2EBNA 1IF2A 2E1WA 1TWSA 5ABFB 1F07A 1JI1A 1XYAA 3LTSA 1O5KA 4AFYA 1JDCA 4DZAA 1OX6A 4P7OA 4MKNA 4ZB2A 1MDLA 1TG7A 2BSLA 3KTXA 1H4PA 2YA0A 2PDIA 3IUIA 4BWLA 4FNPA 1P0NA 2WJFA 5DRIA 3FA4A 2JF6A 1R3SA 2Q09A 1EF2A 2OCZA 2P88A 2X2GA 3ITYA 4L61A 3ARWA 3U0HA 4V1YA 4O1FA 3N4EA 3TN4A 2GDQA 1KO0A 2F7FA 4Z08A 1V3LA 3URAA 1V0KA 4PB3A 1XBYA 4N9BA 2VL4A 3ZJ8A 4IMFA 1R3RA 1QHPA 1UR4A 4A2SA 1UC5A 4JNZA 3EWZA 4C90A 4KGLA 1OZQA 2ZRXA 4BFAA 1O60A 5TIMA 1FDJA 3M16A 1M03A 1QNPA 2JK2A 1Q5MA 3AMLA 1R0MA 3M0YA 1QUMA 3WBXA 3OODA 3VMNA 2DSVA 1WKDA 3AMGA 2W66A 4ALDA 3UXLA 1R38A 4NSBA 1U1UA 5KZMA 1QWKA 2Z6JA 3IARA 4UZUA 2ASHA 1A3XA 1R8LA 1L6FA 1W9VA 1H09A 5FESA 3KVJA 1J4EA 3HMJG 1E40A 1EGVA 5EMLA 1CLKA 3OP2A 3TONA 3DENA 3UVIA 3H22A 1IEXA 3C3UA 1XSKA 2GK1A 2PDWA 4R27A 1EL3A 1NU5A 1XJBA 1O5XA 3PANA 4QG8A 3OLDA 3MI6A 4R33A 4GJ1A 1QATA 3NL6A 1LDCA 2D2GA 5LA2A 7REQA 1MI3A 2B0MA 1S1PA 4C6BA 2Z7KA 1XW8A 4D6JA 2QCDB 1Q13A 2INEA 1W6TA 2PF0A 1F8IA 1HP4A 4CQ9A 4BK9A 1CBGA 4DX3A 3CMGA 2JGYA 1XCFA 3K4DA 4I8DA 1EUNA 3S2JA 4KCVA 1X39A 1V02A 2X1RA 3I3BA 2QJIA 3RNDA 3VZXA 5LZLA 3KVLA 3SECA 4KF1A 3VZZA 3EOOA 1NJJA 4US5D 4HSNA 4ORIA 2ICSA 4GD0A 4AZIA 2VNCA 3LNMA 1DHKA 2MANA 3U48A 1EA0A 3EWXA 5KITA 4UTWC 3RFAA 1KV5A 1GVEA 2ZWYA 3MVTA 3BMWA 4JIIX 3RIKA 1S2WA 4QG9A 3UNDA 3EA1A 4M6PA 2WVVB 1US3A 5GNYA 3BICA 2HROA 4GH1A 4O50A 3W6LA 1JF5A 2V6AA 3UR5A 1NSJA 2QCDA 3QYSA 3WQGA 4GIEA 5FAJA 1ZFJA 1NELA 1ZY9A 1PTGA 4W89A 2ZXBA 2KZHA 1OFQA 1VGAA 4TVUA 2HXTA 4M8UA 3QQ1A 1JDEA 4NNBA 4J40A 3M5YA 3P5ZA 3UA3A 1NF0A 3W1TA 2I5GA 1DQUA 2BY2A 3CT7A 4XQ6A 1EPXA 5K3VA 4BKNA 1W9UA 4Z2IA 1SZEA 2F61A 1OCBA 2VR2A 3SCVA 2OGYA 3CH0A 1V08A 5E09A 2C0AA 2W63A 4AQLA 3GNDA 4GG9A 3EOEA 1XLLA 2PTZA 1JULA 7TIMA 3ABQA 4FLRA 4UNLA 1KCKA 2Q8LA 3UZYA 5I07A 3OJGA 3H26A 4Q22A 1FWJC 2QULA 2CETA 3OYXA 1PDYA 4DO6A 1JPHA 3M0LA 4HBKA 4M81A 4GBDA 4DI9A 3MCNA 4MNKA 4O11A 4E4FA 3GBDA 3G0SA 3IJ7A 1V6UA 1M3UA 1B31A 3OO2A 3M1ZA 4H9XA 3CH9A 3MT1A 3N3MA 1KRBC 2G50A 4XD6A 1JF6A 3CBWA 4GYFA 1FRBA 3VO0A 2NSOA 4O57A 3PP7A 4CNSA 2X1UA 2OXNA 3WK1A 1UZ4A 4DUVA 2GDVA 3P82A 1FWTA 4XTDA 1BWKA 3WMLA 3HGOA 1A5OC 3UP8A 3SUVA 3URNA 2VD9A 1D3CA 3GNRA 2LLEA 3KCJA 1XSJA 1UUQA 2YIHA 1TJPA 2GQ3A 2IKHA 3LBOA 4AVNA 4N4PA 2QT3A 1QPNA 4Y7EA 3GNOA 1N8FA 1W3IA 3WQ4A 4AZHA 2DJLA 1EEXA 1K4HA 2C91A 3A3XA 2IS7A 3N3TA 2HNHA 3F7JA 3SDOA 3I6TA 2PWGA 4EACA 2QJJA 1PE1A 1KRAC 4OOUA 4PYSA 4BZYA 2GSEA 4HYWA 4PCTA 3L67A 5JU6A 4D6FA 2VR5A 3S5SA 4GPNA 4IX2A 3S1VA 2EG7A 5E6ZA 3S2LA 4A3YA 1JEZA 1X7IA 1XYBA 2Z29A 1H5YA 1V6XA 1HKMA 1ADDA 1LF1A 1J0KA 4JCLA 1MXDA 1E0VA 5FACA 1VFFA 3GVGA 1UB3A 5HJLA 5FL0A 4E8DA 4AWSA 4Q8NA 3WEMA 3VIHA 3PWAA 1UZ1A 1XYFA 3TP4A 4FF5A 1V5XA 4QSFA 5AOUA 1EOKA 5HBFA 3PAOA 3OZYA 3B8TA 4BWLC 5IFTA 1SO5A 5AZ0A 4QE1A 3H2OA 3A47A 5I06A 1XRFA 1UH2A 1JZ7A 4JQ3A 5BRQA 1VEPA 4HK5A 2RKXA 3IIXA 4Y6GA 4E8CA 3WNNA 2PCEA 2V69A 3QTPA 2J7HA 3HFYA 3OZOA 4HHPA 4ZTYA 3RU6A 2PAJA 1L0PA 3CL8A 1XFCA 1OYAA 3Q4DA 3W22A 3NWRA 2RGLA 1ZB5A 3BV7A 4CD4A 4JFSA 3WZ0E 5J5RA 2ZIDA 1G6CA 1BF2A 1F4HA 3QTGA 5CSYA 3WQ5A 3QH2A 4PMRA 3P60A 3VAVA 1FHUA 1UBPC 4M82A 4ROQA 3AYSA 4P7LA 1XG4A 4J27A 2HVOA 3W70A 5A6TC 3AU2A 1XIGA 1E6ZA 1CENA 1RJQA 2Z00A 3SB0A 2INFA 1O66A 1A80A 4V33A 1OF6A 1WB0A 3E0LA 4DLFA 4K7VA 3WH8A 5JMUA 4YHEA 4DPQA 5I00A 1RA0A 5JH2A 5C6MA 3U2EA 3UT0A 1M04A 2F8QA 4Q4QA 4MNLA 4C7DA 3OZMA 1AZ1A 1RLDA 3QV9A 3BMXA 5EY5A 2VX4A 1YPIA 1RJPA 4OQVA 4PSRA 3HTWA 5AHIA 3TTOA 3E2RA 1WDPA 4LUSB 1TWIA 2GJPA 3KCLA 3BDKA 1R9YA 2HJPA 1M53A 3UYIA 5LIXX 1I9CB 5LXEA 1EFZA 3Q58A 3PZQA 1Z44A 2JKEA 1WUFA 6XIMA 3NPWA 4K37A 2WHKA 3HPSA 4B5XA 2FPVA 3LQLA 4MUZA 2XFRA 2XSXA 2Y8VA 2YDAA 3ZJKA 1CLVA 3WNLA 2AMXA 5K2ZA 2D0FA 4H8HA 1JL8A 1LORA 1AFSA 4BQ3A 3W73A 2POZA 1B1YA 4V2XA 4CD7A 3KBNA 4GJJA 3LV6A 5CJ5A 3RX4A 2PDXA 1V0LA 3P8JA 1BHGA 4HZ8A 2VEFA 5CZTA 3GUWA 1LWJA 3N4FA 3S5NA 1A5CA 3NNTA 3SRHA 3FIGA 3ZR4A 3V5CA 3M0XA 1A49A 4OTKA 3TQ0A 5CAKA 4QS5A 2RDXA 1GYLA 4JTGA 3WDHA 2PODA 1QAPA 3GNXA 4XTIA 3TUUA 3WNOA 3QVQA 2BHYA 4LVAA 1JZ4A 3R13A 1V3IA 3KWXA 1NDYA 3NQFA 3W37A 3WMBA 5HQEA 3MZ2A 3O16A 3T2PA 4C1NA 2VHLA 4N2YA 2G3IA 1DE5A 1GK8A 3SFWA 5EPDA 1P0KA 3VKJA 2QJMA 5C2CA 2YW3A 1AH0A 2ZX7A 1NWSA 4S23A 3WLSA 4OJYA 1J0JA 4D6IA 1IEVA 1DVJA 3W1LA 3CHFA 2YXXA 1E1FA 3RGTA 2E0PA 4XKMA 3VIKA 4NF7A 2E7FA 1GJWA 1N7KA 3BCJA 4GY0A 4WIWA 3FGCB 4KIRA 4UFIA 3EMCA 1VC4A 4IG2A 5FF3A 3H4XA 1ZRQA 4PODA 3RCMA 2QVNA 4HPJA 2VGBA 2NX9A 4V15A 3B0XA 3L5MA 5AECA 4K3ZA 4RDYA 3BGJA 1E70M 1K1DA 1M7PA 1NWRA 3FNDA 3VCNA 3S47A 1CXEA 3QC0A 4HMNA 3OGRA 4R53A 4PMVA 1JUBA 2PP0A 4M24A 3TN6A 3LTPA 3F2BA 3KRZA 1QT1A 3VVGA 3A4WA 2ZFAA 1TFVA 1A5MC 3CAKA 5CBIA 3C61A 2Q8XA 5AVNA 3PWIA 2CZVA 1Z7AA 1OGGA 4PGLA 4X2RA 4F9DA 5IDIA 1I60A 1S2CA 4I7VA 3VM7A 4ERAA 1V51A 1XWYA 3LHWA 5E5CA 5F2GA 1FWWA 1F73A 4LBSA 3TV8A 3M7SA 1W3HA 4HYRA 3TZNA 2GVEA 1Z41A 1ONXA 1NOFA 3PBWA 3IVTA 1AJZA 4KETA 1T8XA 1AUSL 3OG2A 3OVRA 5CEWA 3NO1A 3MW7A 2O9PA 3MMUA 1GYMA 1KBLA 5EMYA 4REQA 2O7SA 3PBYA 1TV3A 1YBQA 4LAKA 3W29A 4DAIA 4E2BA 3NQDA 5DCDA 3F4DA 4F0RA 2DT2A 1OCNA 3S1XA 2DZXA 4B5TA 5AC7A 1GW1A 1U33A 1WX0A 4E5TA 2IQDA 1RH9A 3W72A 3APGA 5BCAA 2YW4A 3QN3A 4UFLA 4HPHA 4CNUA 1KM2A 3CUFA 3C4UA 2AGKA 4HZMA 1S2UA 4GUFA 4MDOA 1VEOA 4K8EA 2G5WA 2EPLX 3QLDA 4FLOA 2FHBA 1JPIA 3DFNA 3OVGA 4ZCWA 1OB0A 2W9MA 3H2NA 3G1XA 3KLLA 3VC6A 1J01A 3O63A 2OG9A 1QASA 5G1YA 3A5VA 2J6XA 3NIYA 2PBOA 3LRKA 3CV1A 1ZAHA 3B0PA 1QNSA 1W1ZA 4GWEA 3W7PA 2VGGA 2ZA1A 3VC5A 1NWUA 3ZJ6A 4AIUA 2WJDA 3LXAA 4PMOA 5K9XA 3W7KA 1ZUAX 3ZWSA 3WMSA 4O52A 1PPIA 4ERIA 3JUGA 4U31A 3G1HA 3WDIA 5JBDA 3ZYZA 2A3HA 4LVDA 4Y9OA 3FEMA 4WOQA 2NV1A 1ZNNA 1TRDA 4RW3A 3WLQA 1LQAA 1E9LA 3CTTA 3AUOA 4B16A 4I9AA 1LBMA 1QOQA 3RMJA 1DQWA 1TUFA 3CT2A 2R24A 1WP6A 1KM4A 4QHRA 3VD7A 1FKWA 4AY8A 1O95A 2E67A 4G9PA 4UCFA 3MS8A 1XBXA 2G8ZA 3PULA 3SGGA 2QF7A 2OYKA 4WRHA 1UH4A 1YTKA 4HSHA 3MCOA 2ATSA 2AAMA 2BB0A 2VYOA 5AC5A 1B3OA 3G1VA 1IT8A 4C6CA 2QW5A 2DZBA 4XBJA 3QSRA 4E3VA 1SFLA 1VHCA 4IL2A 3DG3A 4LUTB 3LMYA 3BG9A 3N73A 4PSPA 1DXFA 4Z1DA 4FS9A 4RKAA 3EDJA 2FH8A 2AAAA 3DFTA 1WAUA 3STFA 2DSWA 2C13A 4UFJA 1D2KA 4LYRA 5FF0A 4GQRA 4Y8EA 2WJZA 4NJIA 4C60A 1PKYA 5EKYA 4NXKA 3VGHA 2ISWA 1LRQA 3Q45A 2V3DA 1YPFA 4MPQA 1PL9A 1QO5A 5AHEA 4Z2HA 1GW9A 3EPMA 3WQFA 1JGIA 4HCDA 3MHUA 1EIXA 4WD0A 3MQTA 4GHRA 3CIVA 2Q3RA 3C0QA 4DZIA 3IGSA 4IQDA 2VFFA 2PTYA 2P3ZA 2ZDSA 1OK6A 3BOXA 1SUXA 1Q6EA 1JRCA 2XG9A 2YCKX 1K4GA 3G0XA 3PN8A 7CGTA 3BZJA 4ZQPA 5HNUA 4GYJA 4HNTA 1XXXA 4JY9A 1XLHA 4QJ1A 2QUUA 1YADA 1TTJA 4L5ZA 5BU9A 2R1MA 2GOKA 3U9IA 2DVUA 1GOMA 4C5YA 5M03A 1LG2A 3SUTA 3AWOA 3HO8A 5IM51 3PG9A 3T05A 3N2MA 4GQQA 1Z89A 4IFRA 2ZX6A 1FHLA 1XH0A 4PMNA 2JKPA 4TVCA 4UMCA 2WJEA 2Y7EA 2ZXQA 3WNPA 4LCSA 3NSNA 4I90A 2VOMA 4KQNA 2XIIA 5DXYA 4LVBA 1R6WA 3UCCA 3QKZA 1SO4A 1CGXA 2OB3A 1XUZA 1QJWA 3BOFA 3A4JA 2ANUA 3CIWA 1LLZA 3LS9A 4V27A 2Z1SA 4AUBA 4KH2A 4C7FA 5D04C 4UBPC 1S5TA 2GJRA 2W62A 4JICA 1V79A 3LBMA 1H2JA 2CLMA 3H12A 2NWSA 2E6FA 4EPKA 5GNXA 1O7AA 5DMYA 1EQCA 4Q8VA 5ABHA 4S39A 3I68A 2P10A 3ITLA 2WVUA 4WEVX 3UU0A 7XIMA 4EKJA 3W7DA 3GIQA 1BSIA 2QAPA 3W1PA 1F3EA 4GVHA 2QS8A 2I5QA 3LN3A 4EF9A 1IXNA 2QGYA 1FA2A 3AIUA 2OQHA 4A21A 2X8RA 2DEPA 1LRNA 1YW1A 3NDYA 3SSJA 3R89A 1W91A 2VZVA 1TMLA 4MF4A 5AYIA 3PC0A 4F4RA 3BLKA 1SJCA 2GVYA 2ZXAA 2YBUA 3WYZA 2FH6A 4AF0B 2VRJA 1SR0A 3SR7A 1LJYA 1W0MA 4WUIA 2TAAA 2VC6A 3N13A 1IT0A 4GZ7A 5DN1A 4WJXA 3NCOA 3OB8A 3LDVA 4IMDA 2VP8A 1BLIA 3SIMA 2ONEA 4HHMA 3F5JA 1O6IA 1QI4A 3HURA 4H9VA 3PHAA 3LX9A 2J88A 2BVWA 3T9PA 2NV2A 3C56A 2BODX 3AJ7A 5JVLA 5JUVA 3I65A 4L80A 4NZ5A 1Q3NA 1XLIA 4OECA 3S2MA 4GA8A 4RUBA 2YPIA 3SRDA 2G95A 3UWVA 4ONVA 3ES8A 2IXUA 2ABBA 5I3HA 3SUUA 4FOUA 3I4KA 1LL7A 3E12A 2FYMA 3OOQA 3Q67A 2X1TA 3W2KA 1IQ8A 3W1UA 1V3HA 3VD4A 3ELFA 4Z2JA 2ZE0A 2Y7FA 3RHGA 4MHBA 1ZAJA 1TIWA 4WHBA 1LL6A 2RJGA 4X61A 3OIHA 3KS5A 1L6YA 3RMEA 3ZLHA 2R14A 2ZZ7A 4HJFA 4D8LA 1V3JA 1DIEA 3B8SA 1MQRA 5AFDA 1TR1A 4JIRA 4ZENA 4W7VA 1F61A 4QR6A 1TTQA 4L1GA 5KZEA 3GXIA 5CLTA 3C8FA 1PDZA 4AHOA 4IQEA 3BLLA 4F2TA 1ZTVA 4AD1A 2OSXA 4GXMA 4Q8QA 1HTIA 2EEXA 1VRXA 5HAOA 4R9XA 4QM1A 4MADA 4D6GA 4GNKB 1TVNA 4IISA 3K4WA 1VBGA 5A8MA 3LBCA 4K8HA 2ATMA 1C90A 1XIIA 2GJNA 3MI2A 3GIYA 4HU0A 2NQJA 3ZJ7A 2YB1A 5E9XA 3MP3A 2DJXA 1G1YA 2Y8UA 1BYDA 4WSHA 1TVLA 3W7EA 4PMZA 3GU2A 2DPEA 3ZSSA 1S5VA 1H7NA 3HM7A 3RO8A 1Z9AA 1WNOA 4WQ6A 3VA8A 1JPDX 1LROA 5J5DA 4MMWA 3PFMA 3PPCA 4GYKA 5G4EA 1TPC1 3SCSA 3L65A 3DHFA 3LGEA 2E3ZA 3CAWA 5A6SA 1GCYA 1CT5A 3S3GA 4GJIA 1W3NA 6PTDA 5AC6A 4RPQA 1D9EA 4HCLA 4ZQRA 4FXSA 4CUCA 2QCLA 4MY8A 1GNXA 4NQ1A 3L2LA 3S5OA 1K8XA 3M07A 2ODOA 4QNEA 4OFCA 4UR7A 1BKHA 4LUSA 3WD1A 3GTNA 1U2YA 1X98A 4HYVA 2H8ZA 3NPVA 2I9UA 2X41A 3LU2A 3W88A 3H23A 5FJIA 2A0NA 4AZ7A 1TB3A 1PV8A 2FZ8A 1VF8A 5CC7A 4RDWA 2FTWA 4W7WA 2QYGA 2I16A 3P93A 2J7BA 3NEVA 1ME7A 1SZGA 2WWCA 3DHPA 4TTUA 1PO9A 4QGCA 3TMLA 2GQ8A 3FGCA 2J7FA 4KWUA 1GQLA 1JCYA 3NZPA 3RG6A 1UP3A 4JTHA 4GIRA 3AZRA 3CUGA 3RK8A 2OPJA 4FNQA 3VUSA 3EKZA 5U7SA 1KM6A 4AXKA 3G1YA 2A2IA 4GY1A 4NG3A 3VKAA 3K1DA 2WKLA 4YLWA 1EYEA 4IMCA 4D6DA 3K4AA 3FSUA 3LRMA 2ISDA 1K8YA 2CW6A 4RZ5A 2GJXA 3MMTA 4A29A 1PX3A 4LWWA 3MMWA 3NQGA 4US5A 5GJPA 3NDOA 3S6TA 4XZWA 3IVSA 3OQEA 1ZP4A 1IWPA 4FR1A 2G4FA 3GH5A 4ZO6A 2KX9A 3UCQA 1Y8BA 5JXQA 1KM3A 2UY5A 1AW5A 3MZNA 4UMAA 1JYVA 4GXWA 4OBRA 1NVMA 2CLEA 1IGWA 4WSJA 2A6LA 3B8UA 5TBOA 3ITOA 5M3WA 4H9ZA 2ZUVA 1GHRA 3T6CA 3HGSA 4V1XA 4IG2B 1DL3A 2VXNA 1HVXA 1C93A 3UFYA 1WE5A 4QDMA 3MU7A 2ZUTA 2AMGA 4MLJA 4LEQA 1S1RA 3CB8A 3UWWA 2ZRWA 3EDDA 4YVVA 2J7CA 3K1GA 4CU7A 3EEZA 1DQXA 3SUSA 2BP1A 4LF1A 4JYFA 1W1B1 1WUEA 3PZVA 4JQAA 3CZ8A 1V3KA 3F4VA 4QJ5B 2UBPC 4NAEA 3VU2A 5CZSA 4BF9A 5GJMA 1UKSA 3U2OA 2GJLA 1SJAA 2F84A 4LQ1A 4JQ2A 2Z2UA 2GPTA 4JHOA 2J8GA 2DORA 4RE0A 3TDFA 1QOXA 2ZA2A 1S39A 3BLPX 1IHIA 5D37A 4W4QA 5HUOA 3LRLA 3VI2A 1Q4NX 1E4LA 2EXOA 2PDJA 3L21A 2C16A 1J8VA 4PE8A 3DFSA 2J13A 1H49A 3L23A 2VKZG 2DV0A 5LHEA 5CPSA 4M56A 5HNTA 4IGMA 5JQ9A 2VCAA 3E96A 4MAVA 4DIAA 3IJQA 1DJNA 2DU2A 2PWDA 3WK2A 1GVOA 3L4XA 4PTXA 3EGJA 4N6FA 4Q8UA 4D6HA 4CKQA 2HE8A 1FWNA 1ITCA 4JN7A 2VDGA 2CLPA 4L6HA 3S5YA 3W71A 2XH2A 3DX5A 4DXKA 3FKKA 4H2CA 4LJ3A 3P8IA 4M5PA 5I02A 1FCBA 1UZDA 3FJ4A 5T8GA 2PGFA 5IRPA 2BVYA 2BASA 4QRNA 1TCMA 2DVTA 2FZBA 3OGVA 1H62A 4N0RA 2DUZA 4A8RA 2GWNA 1VAHA 4UOJA 4HP5A 1CWYA 1A53A 1E4IA 1X1ZA 2VX5A 4QROA 1GOQA 1W32A 2BNJA 4AD5A 4A3RA 1TSIA 5AB3A 1K8ZA 3TOPA 4RL3A 2DZAA 3CTLA 3V5OA 5EMMA 4FLSA 1ADSA 4NILA 2BBFA 3JRKA 2GGIA 1GG0A 2VEMA 4B5VA 4S3AA 3QMRA 1B57A 4ZXLA 2WPGA 1QI2A 5HNNA 3H2MA 4A2RA 4Y96A 5EMUA 3R2GA 4J7RA 4Q6XA 1MRAA 3LCWA 3WEOA 1BVWA 2P5NA 2OMAA 1J5TA 2RDTA 1I2RA 5A2AA 4H4IA 2VFHA 4GH3A 4E4PA 5E1QA 2PI6A 1GZ1A 4JTQA 1GHSA 2GZXA 3PNZA 3POHA 1R9XA 3H55A 1GQKA 1MNZA 2GGGA 3SUWA 1Q63A 3VNYA 5D2YA 2D2HA 2VUYA 4ZE5A 3IJIA 3LPGA 3AICA 2WHJA 3DFYA 1ZPTA 4HNNA 3BTNA 3KBSA 3MSGA 2IPJA 3EKLA 1GJPA 2WVVA 2EPHA 1XL9A 3W00A 2FVKA 1SO3A 4FI4A 3PZIA 3M0JA 3BQ6A 1SFSA 2E1DA 2OVLA 3NOYA 5IOBA 1MRQA 1EO7A 3AISA 3W2MA 3GS6A 4G7EB 4OV4A 4C6MA 4ZB0A 2X05A 2V0TA 4K68A 4RE4A 2V81A 4C6LA 4J2MA 2FJKA 1KXVA 4UTTA 8XIMA 4UR8A 1T8QA 4JGDA 1Z42A 1XX1A 3TFCA 1GGOA 1H7WA 4L4MA 3UWZA 3NQ6A 3QXBA 1A3WA 2PTDA 1BWLA 1R3VA 2WZHA 5I3GA 2GVGA 3ABZA 4MDPA 4ECLA 3RLGA 3HV8A 4CNPA 1YPXA 2J9XA 4YJ5A 4EXAA 3M0MA 4HGXA 1QHZA 5CZ0A 1XRTA 1KKRA 3GYEA 4UTWA 1XP3A 1YDVA 1MUWA 4JEJA 3TQPA 4C6OA 3S1WA 4JIQA 2PDQA 1NFPA 2QDHA 3R0DA 2Y88A 3G6MA 1EJXC 3RXZA 4DQWA 3CK5A 1A0DA 2CBVA 3B06A 5ECUA 2JIWA 1IZCA 4L4LA 1CXFA 4XZMX 3TN5A 2QV5A 3S8HA 3N14A 3CWNA 3VNKA 4XZBA 3L9CA 1NDVA 1XLCA 5DMLA 3CMFA 4JIHA 4E0CA 4PTNA 3QKEA 1UJQA 3UWUA 4AZBA 4R7JA 2VRQA 1LRTA 2ACRA 1DHPA 3TZFA 5ABTA 3T0TA 1DTUA 3KS6A 3UPBA 3UGRA 4YCPA 4UQDA 4XD5A 1M5WA 4D1JA 5CAHA 3GHTA 3GXPA 2XU2A 2UY4A 3DGBA 3WF4A 4ZTXA 2W61A 3TNOA 4FOKA 1K7FA 3K8KA 4NKCA 2HWGA 7ENLA 1IV8A 1LL4A 1ICQA 2OELA 3WDRA 3WLJA 1VYRA 2FJUB 1MEHA 1CGWA 1PBGA 4MJZA 3A21A 3LHZA 1XINA 4IPPA 1HN1A 3KM8A 1ITUA 3STEA 2Q8ZA 2QPUA 2FZMA 4QAWA 3OLIA 5T9CE 3HPXA 4L56A 3V3WA 1JXJA 4CD5A 1AG1O 5KETA 4DO5A 4OHQA 3EXSA 4MY1A 4NL1A 3FVDA 2VOTA 4LF2A 1J9YA 3SCPA 4AW7A 3KBWA 3WH5A 4PTVA 5LA1A 3LENA 4JDYA 3CL6A 1R9ZA 1WOAA 1RVGA 1SZRA 1YX1A 3GHRA 3BJFA 4LY4A 3DGRA 1VJIA 3QW4B 1KFEA 1CGVA 5HULA 3W1AA 2GDUA 3NL3A 1JD7A 1WZAA 1L2QA 3CV2A 4JFWA 2ZUWA 4IXXA 2QZRA 1E56A 1MW0A 3OTRA 1EZ2A 5A94A 2WM0A 5A6JA 2ZZ3A 4ERGA 4XAZA 2IPGA 3TQKA 1S46A 2ACUA 4BEUA 1E5JA 1JCXA 3V0SA 1UZHA 1QNVA 4YL2A 1SM9A 1KTCA 3M46A 3WJZA 1E72M 2ZADA 1GZGA 3R4IA 1U1JA 3S1GA 2QLYA 3W1XA 4GX8A 1XYCA 2QDDA 2Z2BA 5A8OA 1FWRA 3EOUA 1EX1A 4QCFA 1CTNA 2G0WA 3LCLA 1OF8A 3RO6A 3F03K 3PUGA 1XQKA 3WBYA 3QHOA 3WQWA 1HGYA 1IEQA 3KEHA 2V2HA 5EBAA 4RNFA 1JFXA 2NV9A 4I6KA 4U3AA 3T4WA 4RV8A 3V7PA 1OINA 5IHSA 1VCVA 1OBAA 2JALA 2C1GA 4LS2A 1PZ0A 2A7PA 3ARXA 2OKTA 4PH6A 2ZVIA 2PUZA 3G0UA 3JW7A 1NP2A 2Y24A 4JZ5A 1P48A 3E02A 3KCOA 4O54A 4DF2A 5KINA 2ZRVA 2PWFA 1P6WA 1AW1A 4QITA 1HKJA 4GABA 2VX6A 2UY3A 2ZUSA 4GQBA 1WBHA 2E28A 2VVSA 1NH6A 4WF7A 3V4BA 2OR2A 4XAFA 3UGVA 3LLFA 3THCA 4ZL1A 4AWTA 3STCA 4DEFA 1W1VA 1FX6A 3DERA 1LUCB 1UD6A 3T81A 2VGIA 3W81A 4QLJA 3KP0A 3AI0A 1EZWA 5C9UA 2ISFA 3LA4A 1Q6QA 1VJZA 5CJMA 5AKQA 3W85A 4JTUA 3ZR5A 1A5KC 4EWJA 2GOUA 1ISYA 3FK4A 4O1AA 3AIEA 4O18A 1QI0A 2ABAA 2CBUA 3LYEA 3OGSA 4EPBC 2BDQA 1JPMA 3VDCA 3L2IA 3N9KA 3VOGA 4FNRA 1MDRA 3TA6A 1AL7A 1IR1A 4KRZA 1R46A 1BRLB 2NQ5A 1J93A 1HW6A 2H3DA 1RY8A 2FGZA 1CX9A 3R11A 5F2MA 3EX4A 2WANA 2R9RA 1Q66A 1Y7VA 1OGBA 5GPRA 1MYRA 2FGBA 3CWOX 1GOXA 4ZO9A 3W0KA 2OZ0A 4Q4PA 5HMEA 4JN8A 3FS2A 3PZTA 2PDHA 2ZBTA 1XRVA 2J25A 3GZAA 2OYMA 3GC4A 4QE5A 2J62A 3GKAA 2R6OA 4PFMA 5BMXA 1GPWA 4GCXA 4JHMA 1IEIA 1Z32X 2OQLA 4LS1A 3G1DA 3LXCA 5HJYA 4XSMA 2CEQA 1XI3A 3WNMA 1CB2A 4NIRA 1UUMA 3EPNA 3SCUA 1PHWA 4O4WA 1ADOA 2H9AA 4HB7A 8A3HA 2WC7A 1A5LC 3AHXA 1EC8A 1PZ2A 2OU4A 1RD5A 5D30A 3ITVA 1GWJA 2Q02A 3OA3A 4KCUA 4B5SA 1H0IA 3A4AA 3KHDA 4F2UA 3B4UA 5KEZA 2BLEA 3WF3A 3ZR6A 3G2GA 3PTQA 3LLXA 4MJ2A 4KEMA 3BJSA 3NVTA 1TO3A 4DWSA 4H7ZA 5D8ZA 5I23A 2X42A 3U2CA 5MKGB 1UWRA 2Y8KA 3G22A 3GUGA 3WDPP 2QQ6A 1UHVA 4ICCX 3UW6A 5G1TA 1QMLA 4W84A 2C6QA 3QR0A 3O07A 1WZLA 4H9MA 2A3LA 4N42A 4P8UA 1SPQA 1F7BA 1PX4A 4O1EA 2WB5A 4P7QA 4LC8A 3QHMA 1XRSA 1YDYA 2DT1A 4ZOAA 6CGTA 4NZJA 2DDXA 1PIGA 4LYKA 1UKQA 2Y2WA 3PZGA 1ENUA 5C54A 5C2XA 1XBVA 3P14A 4EPDC 1C7TA 1IWAA 1EBGA 4LNCA 1HUVA 4AEOA 4BCEA 3R0UA 5LGZA 4GFSA 3TMQA 1K3UA 1XD0A 4DUXA 5M5DA 3HV9A 4CEXC 1Q6GA 2PGRA 5DF0A 3NQ2A 4J3XA 1EHAA 3WH6A 1I1WA 1OM0A 2Y89A 2Y4SA 1GQIA 4P7NA 4IFKB 2BFGA 4N9EA 4H7VA 2FVLA 1RK6A 5FJPA 2HK0A 4WDTA 1RLCL 3UERA 4N9CA 4KEZA 3AJXA 1J6PA 3KRUA 4NX5A 3WKZA 5FKYA 3UXIA 1GTEA 3TW7A 4ZGYA 2WCAA 4CVUA 1JUEA 4GKTA 3GBEA 2GFTA 5GVJA 2CBJA 1IZJA 3AIRA 2F6KA 2Q01A 2P0IA 4RNJA 4AZCA 4GVIA 2OWWA 3R25A 5HANA 1WBJA 3AZTA 5GJNA 1TPWA 5AHFA 3DFHA 9CGTA 4JX4A 5RUBA 4IQJA 1HNYA 4ZBCA 1DJXA 1ODZA 2R1KA 4FK9A 4D6EA 3IPWA 4MZ8A 2PSNA 3PY2A 3IGHX 4UTTC 4HU4A 2XVPA 3CLWA 4HU8A 2ZVRA 3IACA 3MYPA 3VDBA 1C8YA 4H9TA 4Q3MA 3KXQA 1PHQA 3MJMA 1UIPA 1Y5VA 5D32A 1TPFA 1P7TB 2POTA 1TPDA 1OFOA 4LSBA 1AD1A 1SZNA 1NOWA 1TX2A 1HJVA 4UXDA 2XN1A 3U5UA 2E68A 3JZEA 1E1EA 4A22A 4MB4A 1EC7A 5B7YA 4TTGA 4TMCA 3TXZA 3MKCA 3NSMA 3ALGA 1P5BA 3NZRA 1GVRA 1XIMA 1TQXA 4RE2A 4RNIA 3C0LA 3DG7A 5FSEC 4GYPA 2IQTA 4TV6A 1XLFA 4CCDA 1J0IA 3BCDA 4CCZA 1PKNA 2DW7A 4RK8A 3VD3A 3GXFA 4WK9A 3TLQA 4DJFA 2WW5A 1KXQA 3GSMA 4L6DA 4IJCA 5HQLA 1EOMA 3PTMA 3ZQ9A 3DG6A 4HIBA 1KR0A 1Q8AA 3CLMA 3RITA 3CPUA 4XAPA 5C7VA 3A9IA 3BAWA 3EPOA 2NXHA 1DJIA 1AVAA 1UD2A 3VE9A 1K9FA 3RRXA 1FWAC 3VD5A 1TELA 1FY6A 3WDJA 2X16A 2PA6A 4GISA 3QY7A 3W1QA 4MKSA 3TW6A 1JJKA 4H6EA 3GVRA 2WSQA 3KL3A 2HBVA 1SQ7A 3RLVA 4MZYA 3T2QA 3WLTA 5ABGA 4HOZA 8XIAA 1TJ0A 1D3GA 4BHYA 3DECA 4UQAA 4UIOA 1ZZMA 3TYZA 1R7AA 4TO8A 4LALA 1ZHAA 1E73M 2E4TA 2WK2A 4WKFA 2OJPA 4YVPA 4RLIA 3MBFA 1OCQA 3WUBA 3LCGA 4PTWA 1ME8A 4QXIA 2NWRA 4PA8A 3GW0A 2A21A 1LP6A 1EJTC 2R82A 4IX0A 3F4CA 3FAWA 1AQFA 1E6PA 3KDOA 1X6UA 1R3WA 1LUCA 2XHYA 3DU0A 4CD6A 2PDFA 4JHZA 1O12A 1E1CA 2BZNA 1VFOA 4X22A 2VUNA 3B8VA 2W27A 4OE7A 4DJDA 1V02E 3EZ4A 1CXIA 5IXEA 3N11A 2WMGA 2QJNA 3T40A 3WLKX 1EC9A 4ZZ9A 1V6YA 2JKAA 3TYEA 1V0NA 1GKQA 4XZIA 5FEWA 2CLKA 3ZIZA 3W02A 4CNTA 4UTFA 3IGXA 4GOAA 4QCEA 4JS3A 2X30A 1YXYA 5BYWA 1JCMP 3HZ3A 5HNRA 3SCQA 4L4OA 4O28A 1ZAIA 4W85A 3WQOA 2BGQA 3IAQA 3UBPC 1ISZA 3GDMA 2PDCA 5BOEA 1JCNA 4A8LA 4JTRA 2QXWA 3NM3A 4PCNA 4KGJA 4AG0A 3LZ5A 4JAWA 3NL5A 3WK0A 1SMAA 1UWSA 1I2QA 5C8BB 3MY9A 2PU1A 3LLDA 3OEXA 3N2CA 3MKVA 5CLWA 4FXFA 1QWGA 4IFOA 1FWSA 2XSBA 1UUOA 3OA5A 3VDHA 1NEYA 3PZOA 1KFJA 4QNWA 4YPJA 1OIFA 1UPMB 4EPEC 4RNHA 1ITQA 2C14A 2YCEA 4FEZA 3UD6A 2V5DA 3NQ8A 3UETA 1LG1A 4W86A 3NL2A 3ONBA 2O9TA 3QMTA 1B2YA 2FB2A 4I8YA 3BW4A 3Q65A 1JCLA 5XIMA 5G1MA 5G5IA 4AMCA 3B40A 1BKSA 1UMYA 3DUGA 1HJXA 2RGMA 2WOQA 3NQAA 3G5EA 4HK6A 1UIOA 1YRRA 4MOZA 1GKPA 5FI8A 4GYPC 4DNMA 3NO3A 1TR9A 1KD0A 2ZC8A 3S1UA 3GFZA 1XPYA 1GUVA 4XB3A 3GG1A 1PZ3A 3N15A 3KVMA 3GVQA 3P3BA 1C8XA 3B05A 3ZT7A 2YYTA 1OABA 3AMCA 1FUYA 3VX1A 1GVSA 3MKKA 1MVYA 1EP1