1TVNA

Cellulase cel5g from pseudoalteromonas haloplanktis, a family gh 5-2 enzyme
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cellulase
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
source organism Pseudoalteromonas haloplanktis
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvnA00
2Y24A 1CDGA 4IM4A 4LXFA 4H8VA 3K8KA 1BVZA 2CNCA 1R87A 3NSNA 4DM1A 1UD4A 3GXFA 4HPHA 2PWEA 4PTVA 1G01A 1CIUA 1OSEA 4K68A 1J0ZA 3FNDA 1PAMA 4H8UA 1MXGA 4MJ4A 4W8LA 3ARZA 2EJ1A 5KZ6A 3AQUA 1A3HA 1JF6A 3CMJA 2VTFA 3SCOA 3AISA 1KBKA 2YIHA 1KGUA 1GOOA 4J3WA 2WHJA 3UETA 4D6IA 2XVKA 1CGTA 3VGHA 2X09A 5CGTA 3MUAA 3WL0A 3VIHA 3D3AA 5AYIA 3L2LA 3CUFA 3QGVA 3GNPA 4QLKA 3AJ7A 2QV4A 3W53A 5JIPA 2WSPA 3N17A 4J3UA 3VVGA 1E9LA 1FHDA 4ATDA 2JALA 2J25A 3F4VA 4PUDA 2GDVA 1TA3A 1SMAA 3CHDA 3VIIA 3PZTA 4W7UA 2XVLA 2W63A 4WKHA 1V03A 3AIWA 1CGUA 1ECEA 2WMFA 2UY5A 5D9NA 3B9EA 2OWCA 4CU7A 3AYSA 1CXKA 4EE9A 5E0FA 3SCTA 3OG2A 3WSUA 1BYAA 1E6SM 2Z1SA 3WD4A 2VX6A 4F8XA 1MWOA 2FHCA 1UA3A 4HOZA 2VCAA 4AD1A 1UR2A 1IZJA 3BAXA 4UOJA 1CXLA 1R86A 5HDRA 5EFDA 1WPCA 2CERA 2YBTA 1QNOA 3QOKA 4N42A 4MNLA 4PSPA 2XFRA 5JIWA 1UWUA 1DWIM 3GXIA 4FLQA 2ZX5A 3GH7A 1J9YA 3VUPA 1HJWA 4W93A 1W2VA 4YHGA 1RH9A 3OIHA 1E5NA 5E9AA 1LG2A 4H8HA 2DIJA 2WNWA 4KGJA 4M1RA 3THDA 2WSKA 4AMCA 3BH4A 3PTQA 5D8WA 1BHGA 3AOFA 4PUEA 2EBNA 1CPUA 9CGTA 2ZXAA 4Z2HA 3RMEA 4BA0A 1CTNA 4B9YA 1E55A 4OJYA 1PX4A 3PTMA 2W67A 1H3GA 3GM8A 1K9FA 2F61A 4MAZA 1EHNA 1CECA 1JL8A 4ACZB 3ARSA 3AIVA 3WUFA 3WD1A 3MSDA 1ZS2A 2VT0A 4PMNA 2V5CA 1H5VA 1PZ3A 3CZJA 8CGTA 1B0IA 2CETA 1JNDA 1GONA 3UG3A 3CUIA 4ZXOA 2WZIA 2YBUA 5HXMA 2GJRA 1OINA 2CCRA 2CXGA 2DT3A 1UWTA 4MAVA 2PWFA 4U5IA 2J7CA 3VIJA 2DSWA 3M46A 4JKKA 2JIWA 1TE1A 1BLIA 4WF7A 3CHCA 3EYPA 1LL4A 1FFRA 8A3HA 2W4XA 2OYLA 3WBEA 1TR1A 4H2CA 4UFIA 2WCGA 4Z2JA 1UH4A 4H04A 3B9AA 3BCDA 3L4YA 3LPOA 1QI2A 1HXJA 2F2HA 5D4YA 3WDJA 3L4ZA 1BGGA 2YA0A 3APGA 4TX6A 5HPOA 1QI4A 1JDDA 3ZR6A 5EB8A 3RM8A 3ARTA 3W82A 4M82A 3WN6A 4D1IA 1JAKA 1VF8A 2E9BA 2HISA 4IPNB 3RJXA 1W1YA 3K8MA 3UR8A 2X0YA 4L4PA 4BCEA 1PIGA 4HMCA 7A3HA 3AS3A 4AIOA 3L2MA 3G6LA 1E6PA 5CPQA 2FHFA 5A1AA 1E43A 4PSRA 3SCRA 1B3XA 4F9DA 2J4GA 5IFTA 2ZX7A 1OGGA 4W8BA 1B30A 5DF0A 4UQBA 1AQ0A 3ZJKA 5BXPA 1FOBA 2D23A 1KBBA 3W27A 2J7DA 1HT6A 2FGZA 3A4AA 1DWHM 1W3KA 3WNPA 1E1FA 4Z2IA 1R8LA 2WKLA 3ARQA 2UY2A 1R85A 2AAAA 3WDQA 4QCFA 3WNOA 3IAQA 3VGGA 4MB1A 3AS0A 2ZUSA 1E72M 2EEXA 4JAWA 2XFYA 2BFGA 2ZIDA 1OWQA 5I79A 4QFUA 3F5JA 2Y4SA 2ZWZA 3VD7A 1WDPA 3CH9A 2IUZA 1UKPA 1E6ZA 1FP8A 3F5KA 3RJYA 2PC8A 4JKLA 1NOWA 3VNZA 4MPKA 1D7FA 3IANA 2WM0A 1AQMA 3ZJ6A 4DUVA 5I0DA 1CXFA 1E4LA 3OZOA 2WVSA 3ARRA 5GNYA 3WUGA 1JDCA 1W3JA 3DYMA 4PCSA 4PMDA 5HNNA 1BF2A 4MB3A 4AD5A 5A2CA 6CGTA 1NP2A 3HJEA 1VBUA 4CD4A 2XG9A 2PB1A 5LA2A 5FKYA 1IV8A 1DWJM 2YOCA 4MJ2A 2XVPA 4D6GA 4TVDA 1C8XA 4CVWA 1RP8A 3BMVA 4QP0A 3OLGA 2QPSA 3U7BA 4J7RA 2CBUA 1SFSA 2D1ZA 1E6NA 3S6TA 1LL7A 1HJQA 2X0HA 1GQKA 4JCLA 3CUJA 4Z2KA 1E73M 1V3IA 3VIOA 1QBAA 4ZEPA 1GVYA 4M56A 4D71A 1H4PA 3QHOA 4OIFA 4QAWA 3MUY1 1GJUA 3UESA 3ZJ8A 1MW2A 4HA1A 2WMIB 4A4AA 3FXYA 3N9KA 4Y7EA 3VNYA 3GH4A 3W29A 1KXTA 2XUCA 3SCUA 2Z1KA 3EMQA 2ZUWA 4F66A 1XHGA 1ZJAA 2O92A 1XSKA 2XSAA 2YL8A 2XHYA 4HU0A 5FL1A 3WF2A 5AY7A 3THCA 2ZICA 1G94A 3BLPX 3HMCA 4ATWA 1GOQA 2EPKX 1FA2A 3TP4A 3VD4A 2B31A 1B1YA 5DT7A 1UA7A 4J3TA 1C91A 1EOKA 3SUVA 1Q6FA 2D22A 4JL2A 4LGXA 4CU8A 3W38A 3W6LA 1E6RA 1E40A 1JI2A 1ITXA 1EDTA 1HKKA 1D2KA 3U5UA 2JIEA 3KL0A 1HJVA 1OT1A 3POCA 3WMSA 1VFMA 1UWSA 2DT1A 1VENA 2D0GA 1E6XM 3CIVA 5I77A 1EO7A 4CVUA 5FOOA 1AMYA 5BXRA 1E1EA 2YL9A 4HU8A 4IPLA 2DSZA 2YL6A 2VRKA 3PBGA 4J27A 5GQBA 4J28A 2E0PA 2QLYA 2EXOA 5EMYA 2X8RA 1H1NA 1BG4A 1B90A 3AXXA 4OOZA 2ZX9A 2WLZA 1OIMA 1ZL1A 2CEQA 4W5UA 1C8QA 1JAEA 3TTOA 3DYOA 3VDCA 3N11A 2YDQA 3W28A 5CG0A 2J75A 1GQIA 4OUEA 4AIEA 1V3KA 4UNIA 1B2YA 3WEOA 3ZQ9A 4J3VA 3TA9A 3ARPA 3IAPA 3KZSA 5D9PA 4AZ5A 4GO8A 1RP9A 1B9ZA 5I5RA 3PHAA 4UFHA 3VMPA 3WF4A 3T2QA 3EDFA 3UG4A 1CYGA 1DHKA 3U5YA 1CEOA 3A6OA 5CXPA 3WUEA 1C93A 2CIPA 2CKRA 4ZE5A 1PZ2A 2O9TA 4DWSC 4E2OA 3ALGA 4ACZA 1MQQA 1V6WA 3VMOA 4M80A 3VKKA 3CLWA 3I3EA 1IT0A 2V3FA 5ECUA 3WF0A 1QHOA 3RCNA 1EHAA 4V2XA 1B3ZA 3PZIA 4AEFA 1MFVA 2WB5A 2ZUMA 1OCQA 4J3XA 3VGBA 3AMGA 3ARUA 4KGLA 3SCVA 3EMZA 3F5LA 3NSXA 2VOTA 5A8QA 1KFWA 2VZSA 3VINA 3WH9A 3VX1A 5A6BA 1XC6A 1EOMA 4D6CA 4CD7A 1HNYA 1K9TA 1US2A 1W9DM 1V0KA 4EANA 1XCXA 4EKJA 3ZMRA 1RD6A 3VDBA 1ITCA 3N18A 3SCQA 3AMLA 3CZGA 1Z32X 2J7EA 3WQ5A 3BAYA 3W81A 1U2YA 1GORA 1PX3A 2ZUVA 1TCMA 1DTUA 1FH9A 2XPKA 3B8SA 4UQAA 4AZIA 5BRPA 1KR0A 1CXHA 1OD8A 1BGAA 3VPLA 1G0CA 1JZ2A 1ODUA 3UG5A 4UQDA 4HOXA 1V3LA 3ZSTA 4V27A 3TTQA 1E70M 3AICA 3VIKA 2V3EA 3RILA 2OSYA 1KGWA 1JD7A 3O6AA 1RPKA 1JFXA 1H0GA 1W3HA 1OBAA 4TUFA 2EPMX 3VDAA 1TG7A 4MTVA 1GNXA 2RGLA 5M03A 4OOUA 5CSUA 5A2BA 3LPFA 3O2LA 1UWIA 1UWQA 3MUIA 1J12A 2G3MA 5IFPA 1UG6A 1FP9A 1J0HA 1VFOA 1LG1A 2MANA 1JF5A 4RE4A 1JYXA 4DWSD 3BLKA 2XGIA 1M53A 3QR3A 4UOZA 3VIFA 2PWGA 4PRWA 2VX7A 5A8PA 3LMYA 1BYDA 4B15A 1GW1A 2V3GA 2E8YA 3WEZA 2DEPA 4V28A 1QW9A 2OWWA 5LA1A 4AZCB 4URIA 5ABFB 1NH6A 1K9DA 4JCMA 4W85A 3PZQA 1MVYA 1WDRA 3DECA 1PEZA 1GJWA 2UY3A 4OZOA 5FL0A 2XYLA 4P7QA 3GBDA 3VMNA 3AXHA 1VJZA 5E09A 3AIEA 3VIGA 3SURA 4TOQA 4AZ6A 4JHOA 1EDQA 3K4AA 1MQPA 1UUQA 1KQZA 4XZBA 1W9VA 4TX8A 1CGYA 1J10A 4E4PA 3WQ8A 4AYSA 4W88A 2TAAA 4XB3A 3U57A 3BAWA 4H7VA 1JG9A 1H11A 2BXZA 4QLLA 4X0VA 2WMIA 4PMXA 4JFTA 1WZLA 3ZM8A 5A6SA 1HP4A 1ZBWA 1JXKA 4PTMA 1J0KA 1TVPA 3BSHA 2W66A 4PMRA 2VC9A 1G5AA 4LYQA 2O9RA 3PTKA 4AW7A 3WH8A 2BXYA 3WIJA 1ZBVA 3VTRA 1IZKA 2XM2A 1W9XA 2O9PA 3AHYA 4A3HA 3WNNA 1E71M 1YQ2A 3ARWA 1DEDA 1O6IA 4CU6A 4CN6A 4D1JA 4B3KA 3AIUA 3VGEA 3OLDA 3ZOAA 5A6MA 3DC0A 4D6HA 2PWDA 3SEPA 2BHYA 2Y8VA 3GYCA 1JYWA 2G41A 2CBVA 4MNJA 1HVXA 5E6YA 5FD0A 3IK2A 2XGBA 1GVIA 2XIIA 2ZE0A 5ABHA 4UR9A 3VIMA 4MADA 4HZ6A 1UH2A 5BRQA 1TUXA 3AIQA 2OSWA 4WK9A 4CUCA 5I6SA 4CCDA 4FLOA 1W1PA 2JFEX 1VB9A 3CGTA 2BV9A 3ALFA 1KGXA 1W2PA 2D2OA 4D72A 4W5ZA 3OLEA 2PWHA 1QHPA 1G1YA 4JKMA 1XH1A 2J7FA 4GZJA 4LYRA 2VZVA 4W84A 1LWHA 3VU2A 2QPUA 1CLVA 1HJUA 5JBDA 1JZ7A 1UWRA 2DSKA 3AZSA 3CZKA 3WUBA 1PIFA 3VIPA 5I78A 4PMQA 2ZUNA 4HTYA 1P6WA 2VX4A 2W62A 2WHMA 4BQ4A 4UQCA 3AMDA 1NWSA 2D0HA 4P7NA 3WQVA 2D0FA 3EDEA 1E0XA 4ZE4A 1DWFM 2VUYA 2WLYA 1EQCA 1EGZA 3A3HA 3ZJ7A 3RDKA 3L4WA 4MDPA 2J7GA 3T0DA 4JHZA 3A47A 4F79A 3MMWA 1W32A 2YLLA 4MNMA 1KCKA 3LPGA 3N13A 4DUWA 4CGTA 1WDQA 1FFQA 1V0MA 1HJXA 3DYPA 5EBAA 3B9DA 3WD0A 3AYRA 5M3WA 2VR4A 2WKGA 3MV11 3WDIA 4GO9A 4DWSB 4NRSA 2VNCA 1UYQA 3K1DA 2JEQA 1BYBA 3RM9A 4HMEA 2CITA 3PZOA 1HKMA 2D3NA 1TZ7A 3FAXA 1J0IA 3BXWA 1E4IA 2IXVA 3T2OA 2WHKA 4DM2A 1NARA 2ZUUA 3U7VA 2VURA 3ECQA 2YA1A 4UFKA 1Q6EA 4PN2A 4AC1X 3VM5A 1QOXA 3FHAA 1W3LA 1OT2A 3W4RA 3BMWA 2CBJA 3I3DA 2V5DA 4KRUA 3QOMA 4RE2A 1UZ4A 3WD3A 5C70A 5JBFA 3CMGA 4W89A 1UZ1A 4ZXLA 2A3EA 2VL4A 3WQWA 3WNMA 1HVQA 1VFFA 1F4AA 1EDGA 4BZYA 4H41A 1KCLA 1NOUA 5IHSA 3N12A 4AZ7A 3A4WA 1KXQA 2VO5A 1B31A 3CZ8A 1W1TA 1I1XA 1H49A 1UKQA 3WMCA 1JZ8A 3SIMA 2WBKA 2Q8XA 3PZMA 3WF1A 4U2ZA 4JFUA 4TTGA 1XCWA 1CGXA 3RIKA 1UKSA 1OIFA 1M03A 4UZSA 1Q4NX 1QW8A 3WDHA 2W92A 4TXEA 3VD9A 1V3HA 5AC4A 4JFSA 3E1F1 2J8FA 2C8NA 2GK1B 2V38A 3MMDA 2WVTA 3NDYA 1VEMA 1SR0A 1WO2A 1E56A 2BY1A 5GNZA 1LF1A 4JFWA 2BY3A 1XD0A 3SCNA 2ZX8A 1EO5A 1CBGA 1QBBA 2BVTA 1BAGA 3ARXA 1R7OA 1WKYA 3QHMA 2G3IA 4UFMA 4R5EA 2CKSA 2J79A 1GOMA 1W9PA 1WE5A 2WC3A 4Z2GA 1MW0A 1QVBA 1ZBCA 3NJ3A 1ISWA 1UH3A 4B3LA 1ESWA 1CLXA 1C92A 1UD8A 2EPLX 2G3JA 3FW6A 3AMCA 4GKLA 4AZCA 4B9ZA 5ABFA 3ZT5A 2E3ZA 4U3CA 3MSGA 4X9YA 4UCFA 3L4VA 3OGRA 3VOCA 1TFVA 4D6EA 3NIYA 1V02A 3TTSA 1KXVA 1JI1A 2BVDA 4BF7A 4TVCA 2G8ZA 1GOIA 1PJ9A 3CHFA 4M81A 4MB5A 4W7WA 1V3MA 1QI3A 4KRTA 2VCCA 4XX6A 1EA9C 2VZUA 3WFZA 1XV8A 3N15A 4Z2LA 1LLOA 4PMVA 1NQ6A 1UD5A 4E8DA 5I23A 5LYRA 1QPKA 3CBWA 2WZEA 3TONA 2XJ7A 1JNEA 3M7SA 5D9MA 1HL8A 1UR8A 3AIRA 3S2CA 2WWCA 2QMJA 1QNQA 3WL1A 3EMCA 4UOQA 4LQ1A 3CUHA 1CWYA 4NI3A 1HF6A 4PMOA 4YPJA 4CCCA 1UR9A 2XSBA 2WMKA 1VJSA 4M8UA 3TTYA 1MFUA 4PYSA 2XWDA 3DHUA 2WVVB 2WANA 5E70A 2WW5A 2WMHA 1ZB5A 3WQ6A 5CSYA 4AY1A 4UQ9A 4CD5A 2VJXA 1Q6GA 2D24A 1L0PA 1PBGA 4GIAA 5BCAA 4PCTA 1J18A 3WELA 1Y7VA 1JYNA 2AMGA 2AOSA 1NOFA 3ZO9A 2VMFA 4U3AA 1BQCA 1F4HA 4NZCA 3T2PA 1X6NA 5FIPA 2DDXA 4XUYA 4QLJA 3N04A 2GJPA 1E3XA 2WCSA 3RO8A 3K8LA 1C3FA 2J7HA 1JZ5A 2NSXA 2BHZA 1DP0A 3GBEA 3KL3A 1QNSA 1OGBA 1WDSA 1UD6A 2OYMA 4NRRA 4M24A 5GPRA 1VAHA 1VEPA 4W8AA 3ZR5A 1ZJBA 4ACYA 1U33A 1C90A 5IHRA 4JFVA 3J7HA 4TTUA 2JF7A 4CD6A 3WH6A 2FGLA 3POHA 3PZVA 4D6JA 3VDHA 1AQHA 1BVNP 1XD1A 2EPNA 5CQ1A 5GNXA 3TOPA 2FDMA 2GSJA 4E8CA 1HX0A 4P8UA 1WAWA 2ZXQA 3MMUA 2DGAA 1W1VA 1LL6A 1AVAA 1BSIA 3KWXA 3MANA 1BG9A 2XM1A 3GXMA 2E40A 4JZ5A 3W25A 1H09A 2Y8KA 3EDJA 4UTFA 3CO4A 4U2YA 1JFHA 1GQJA 1J0JA 1MQRA 1X6LA 3RM4A 1XGZA 1ZBKA 3VGDA 4A3YA 1UHVA 3VILA 2DH2A 4L4OA 3OZPA 1HP5A 1B3YA 3T09A 4JIEA 2PF0A 3OLIA 1UD3A 2WPGA 3PZ9A 1GOKA 1E4MM 1VRXA 4AZHA 2GVYA 5DT5A 1Q6CA 1EIBA 2W91A 2X1IA 4GXPA 1OB0A 2O9OA 2X05A 1VFUA 4UFLA 3G6MA 1WP6A 1V3JA 1R7AA 2BVYA 1LQ0A 5CZKA 2CHNA 2WAGA 4BQ2A 4P8XA 3NSMA 4DWSA 5JUVA 4QDMA 2WMGA 3T08A 4XZWA 3KEHA 1CGWA 3UR7A 1I1WA 1H0IA 1K9EA 3EDDA 4KWUA 1CENA 4AD0A 4AXNA 3W6MA 3KE0A 6A3HA 4HZ7A 5E6ZA 3M07A 3SCWA 3OGSA 1UR0A 1LJYA 1W9BM 4FLSA 5LA0A 1J01A 1ZU8A 4NSBA 1HJSA 2X2YA 1H41A 3AHXA 4GINA 4GQQA 1FHLA 1GPFA 3UEQA 3K4DA 2VQTA 3WY1A 1KB3A 3K46A 4MNKA 2DSUA 1JD9A 3BCFA 1VEOA 1XRVA 3KL5A 4RL3A 2XVNA 7TAAA 2YA2A 3O9NA 3AROA 3AZRA 3MKKA 3ZT6A 3MO4A 1E3ZA 5CJ5A 3VO0A 5M5DA 1V6UA 1HN1A 2DPEA 5HOSA 5AC5A 1I75A 2XWEA 5I2UA 1JIBA 4LX4A 1PX8A 3MS8A 1US3A 1ISZA 1V08A 1QI5A 5E0CA 1V02E 4U31A 2WHLA 4UFJA 2YDSA 5IXEA 5ABEA 4HZ8A 4P7LA 3WH5A 3T0AA 1UKTA 2GK1A 2Y2WA 1WZKA 5DEZA 5BYWA 4CN4A 1XYZA 3AXIA 2A3HA 4ML4A 3MV01 1A47A 1GUVA 3CZLA 2G4FA 2PI6A 1OGSA 5A6JA 2QHAA 1OM0A 3AMKA 4WSKA 3VX0A 1JYVA 4OBRA 1CGVA 2BHUA 1TMQA 2CESA 4HP5A 1DWGM 1GQLA 4GZIA 5I3DA 1FH7A 3ZIZA 2A3CA 3NYDA 3PN8A 1BYCA 4WLCA 2VRJA 4CKQA 3AI0A 4R27A 3WH7A 2GJXB 1MXDA 3M6DA 3L4TA 3MU7A 5A69A 3WDPP 4WSJA 2CHOA 4M29A 6TAAA 3BAJA 2WBGA 4C7FA 4PMUA 4X0NA 1NWRA 1KWKA 1E0WA 1EH9A 3RPMA 2YJQA 5A8OA 3GDBA 4LYPA 4AEEA 3FHQA 1U30A 5A95A 2V3DA 2CBIA 1GZJA 1EQPA 4D6DA 2EQDA 2XTKA 1V6XA 5KEZA 4HA3A 4ATLA 3AFBA 3OBAA 3SUWA 3EBVA 3HU7A 4NF7A 4F9JA 3WENA 2J7BA 4GI8A 1HKJA 2FH8A 3OB8A 4LPCA 4HOWA 1UKOA 5BWFA 2HVMA 2YLAA 3WD2A 1E4NA 2YL5A 1QHZA 3NDZA 1WB0A 1W9UA 4PBGA 3OA5A 4Q7NA 4WKAA 5C71A 5DMYA 4HMDA 4GZEA 2ZXDA 1FH8A 2VZTA 3CZEA 1V0LA 2ZX6A 4S3JA 3LPPA 2EO7A 2VQUA 3OGVA 2WVVA 2WYSA 4BQ3A 2DT0A 1UQYA 2WVUA 4P8VA 1NP0A 1JXJA 1MW1A 4WIWA 1B3VA 5CLWA 4ZENA 2DSVA 3PZUA 1QNRA 1W91A 2VVNA 4S3KA 1YHTA 1NWTA 1JDAA 3AHZA 3D5HA 4OBSA 3UERA 5DFAA 5M17A 3WDRA 2UY4A 3SUUA 4BS0A 4MDOA 3HN3A 2C0HA 1PPIA 1S46A 2XVGA 1NM9A 3FY1A 1QNPA 3FN9A 2Y5EA 2NT0A 2J74A 2ZXBA 1SMDA 2WWDA 2J77A 3L4XA 1GHSA 1SYTA 1TA3B 4U5KA 3NCOA 4W86A 2FHBA 2E4TA 1MYRA 3MUZ1 5DO8A 2GFTA 1VBRA 2WCAA 4CN1A 3BAIA 3GTNA 1CXEA 2NT1A 2PBGA 3VM7A 1K6AA 1XH2A 1LWJA 3GNOA 2YDRA 5CPSA 1TVNA 3BGAA 3I3BA 4C7DA 1HIZA 1B3WA 1UD2A 1XSIA 1KR1A 2GDUA 3NUKA 2D3LA 1L8NA 3CUGA 1M7XA 1UR4A 4YN5A 2J78A 2W61A 3GXDA 4PEEA 5I24A 2VRQA 4DUXA 5ABGA 2WK2A 3WMBA 3II1A 2DT2A 4B16A 2PBOA 7CGTA 3CTTA 3UCQA 2CYGA 4EK7A 4CCEA 3BAKA 5BXSA 5EFFA 2OSXA 4AZBA 1CXIA 3BSGA 1HKIA 4HA4A 5FCZA 1CNVA 1GCYA 2E8ZA 2J8GA 2VX5A 2DH3A 1DWAM 1UQZA 1KQYA 3SUTA 4P7RA 1BPLB 5A8NA 3SUSA 1XSJA 1V6VA 2NW0A 1E15A 1M01A 1KXHA 4KMQA 3WF3A 1E6QM 1WZMA 3VD3A 3N1AA 2BY2A 1QI0A 1GOWA 5JBEA 5TD4A 1D3CA 4AD4A 3ARVA 4PTXA 3AZTA 1C7TA 2E9LA 3WNLA 3IJ7A 1J11A 2OWXA 2W5FA 1XYFA 4YHEA 4QCEA 2JF6A 5C8BB 2D20A 1XH0A 5A94A 4XV0A 4D6FA 4P7OA 3W26A 1GHRA 4HPGA 5HBFA 3W37A 5A2AA 4UZUA 1WNOA 2BY0A 1MW3A 4EAMA 2WXDM 3WQ4A 4TVUA 4IUGA 3GH5A 3L4UA 3JUGA 2J62A 1E0VA 2VVSA 3CPUA 1H2JA 2QF8A 2VR5A 2EPOA 2OYKA 3SCPA 3WNKA 1ODZA 4PTWA 2DQXA 2BNJA 2WC4A 3SCSA 4IISA 3ZSSA 3AHVA 2YKKA 4KH2A 4Q22A 3GNRA 4AZGA 4FF5A 2A3AA 4FK9A 2C7FA 2VZOA 5BXTA 5HPCA 1E5JA 1BTCA 3W24A 3AS2A 2A3BA 1V0NA 3CHEA 1N82A 4GQRA 4U33A 3WFLA 2JEPA 5CGMA 5A6AA 2DIEA 2RGMA 2WMJA 5A8MA 5F7UA 1NWUA 2ESCA 4GI9A 1C7SA 1UOKA 4CD8A 5A6LA 1JGIA 1V6YA 2J47A 4PMYA 1UR1A 3WKZA 3IJ9A 5BROA 2WC7A 1O7AA 2E9MA 3PZNA 1KWGA 3A4XA 4AWEA 1CZ1A 1JZ4A 1EXPA 2ZWYA 4AISA 3PZGA 2QMKA 4J3SA 3W0KA 3IJ8A 4BQ5A 3AIBA 2BS9A 4W87A 2JE8A 4FLRA 2IXUA 2FH6A 3T0BA 1VIWA 5A3HA 5CLTA 1JZ6A 2G3NA 3EDKA 3ZT7A 1ISXA 2UWFA 2GJXA 2XFFA 4RE3A 4WJXA 2ZUTA 4GI6A 4AD2A 5AYBA 2XIBA 3GZAA 1X1NA 4OKDA 3WEMA 1M04A 4WKFA 3VD5A 2GUYA 3AS1A 1HL9A 1OD0A 4AIUA 5A6BD 4FMVA 3QHNA 1WZAA 4P8WA 4ZFMA 3ARYA 4AD3A 4PMZA 3WBAA 2OLHA 2WZHA 1J0YA 1ISYA 2ZOXA 5CPTA 4UQEA 4GPNA 4MB4A 3FAWA 1WCGA 2VCBA 4N0RA 5IDIA 5D9OA 4JL1A 4W7VA 2VI0A 3BC9A 1JZ3A 1Q6DA 3AHTA 3DHPA 5D8ZA 4C7GA 1BFNA 1G9HA 1C8YA 5A6KA 3VGFA 2CPUA 2F8QA 1ISVA
chains in the Genus database with same CATH superfamily
1BWKA 1KA9F 3HQOA 4R88A 3FVMA 2A79A 1RUSA 4HHMA 2HPIA 4LVFA 2OXNA 3NSNA 1LOSA 3IIOA 4QJ3B 4JIIX 2AL1A 4HPHA 3OVQA 4IP4A 2PWEA 2PDYA 5D33A 2XINA 3GWQA 2SFPA 1CIUA 4LY8A 4NAEA 1OSEA 4PUWA 3TSDA 3MI3A 1TPFA 2PTZA 3ARZA 5KZ6A 3AQUA 1W3IA 2FB3A 2GVJA 3OIXA 4LUTB 1FHVA 2VTFA 3SCOA 1GVQA 3OQEA 3B0YA 5CZJA 4UTKA 3RN6A 4UMAA 1HGWA 4FNUA 3WL0A 3D3AA 5AYIA 1K02A 3PPFA 3QGVA 3GNPA 3DIPA 2WSPA 1DIKA 4JHMA 3R58A 3GZ3A 4ATDA 1KKOA 3TYCA 2GDVA 1TA3A 4PRTA 3VIIA 3RR4A 4O19A 1V03A 2PCEA 1CGUA 1YPXA 2WMFA 4WY0A 5E0FA 2Z1SA 1E6SM 5M2FX 1AL8A 4WDTA 2VX6A 2FHCA 5KITA 2VCAA 3UPBA 4IPIA 3NM1A 3C4UA 2CERA 2PDBA 3WLOA 3QXBA 4MMWA 3CWNA 1TV4A 1UWUA 2YXXA 3T81A 4WDUA 2ZX5A 4IG2B 3VNMA 2VGGA 4N4QA 3EWWA 4S3FA 4B5WA 1AJ0A 1W2VA 4W93A 3H4GA 3OIHA 1QK0A 1LG2A 4H8HA 2DIJA 4DYKA 3THDA 3MB9A 2JKPA 3BH4A 1VYSX 1BHGA 3NL3A 3OQ8A 4AX6A 3W2NA 2FTPA 3NNTA 2ZXAA 4B9YA 3MBDA 5TQLA 3NQGA 4NX5A 1NIUA 4GY7A 3PTMA 3GM8A 2F61A 1EHNA 3FKKA 2R94A 3FKRA 4NYYA 4LNYA 4IQJA 3PJTA 3SN1A 4S23A 1QT1A 1LDCA 3WUFA 5DY2A 3EXRA 3P62A 1OJXA 3S9IA 3CZJA 3NO5A 1HKVA 8CGTA 3RFAA 1LRTA 1B0IA 1O95A 3RX2A 3RR1A 3UG3A 2CCRA 1GZGA 4KEUA 4G6CA 4U5IA 2J7CA 1RY8A 3W1PA 1Y8BA 4R53A 2ZVIA 2FVMA 2JIWA 1TE1A 3UY7A 3CHCA 2DQWA 2PD5A 3LHYA 3EYPA 3EA1A 3U48A 4LUYA 4B5SA 4NASA 4S3DA 4Z2JA 4F0HA 4XZHA 3BCDA 3L4YA 2EGZA 3RLVA 4HN4A 4DNMA 3WDJA 2PLCA 3L4ZA 1RA0A 1ZPTA 3KVKA 1ZUAX 4H00A 2HCVA 1FWWA 4IJCA 3ARTA 2E9BA 4IUOA 2AL2A 4A8NA 2UZ9A 4IPNB 1MI3A 2Z1VA 4G9PA 1YNPA 4HMCA 2OO0A 3S3GA 4AIOA 4JX5A 3G1HA 3P0XA 3IS4A 3K2GA 3TTEA 1CLKA 2V69A 3TUUA 3UW6A 5A1AA 3NPWA 3A9IA 2R6OA 2V0TA 5F1VA 4TU1A 2AGTA 1W8SA 4W8BA 5DF0A 3KS6A 4UQBA 4OBTA 1H1YA 4OVXA 3M0KA 1DJZA 3QZEA 4MFEA 5BXPA 3MCNA 2D23A 3BL3A 3W27A 3IVUA 2OX4A 3EGJA 1R8LA 3F4NA 2Y7FA 2QULA 3WDQA 2GWNA 3ME3A 2DZAA 2ZUSA 2EEXA 1PCWA 4JAWA 2ZIDA 4D9PA 4QJ1A 4IIEA 4QFUA 3VFLA 3E0LA 2ZWZA 2IUZA 3QLLA 1E6ZA 1M68A 3OYXA 1A5SA 4JKLA 3VNZA 1XYBA 5F4SA 3IANA 1AQMA 2CFFA 2A5HA 5K9XA 3R89A 2QIIA 3DYMA 2X1TA 3WQPA 2WNNA 3QEZA 6CGTA 2V67A 3VC5A 3HJEA 4GYPC 4I9AA 1ZTVA 3W7HA 1F07A 2XG9A 1ME7A 1IV8A 4L5ZA 3PSWA 3IJ6A 4QP0A 4H9XA 4HNCA 4KQNA 3H8AA 4JTHA 1KBJA 1G4SA 4ZL1A 1LL7A 3M5YA 1VS1A 2E5DA 3VI2A 4QAWA 3WK3A 3UESA 3R12A 4GXWA 2F6UA 9RUBA 2PDQA 4YWSA 3LCLA 2XUCA 4KESA 2I16A 4Q3MA 4K39A 3CYJA 5FL1A 5M1TA 3IPWA 3WF2A 1QK2A 3KOWA 2JGQA 3WQOA 4L4MA 4Y2WA 2VDHA 2TSYA 4I6VA 3H7RA 2HRWA 5D37A 4GUGA 1IWAA 3VD4A 1PTAA 5JU6A 2DIKA 1EOKA 1EEXA 3DFQA 4L7ZA 4LGXA 4CU8A 1UJPA 4ZB5A 3VZYA 4HHPA 2YCKX 1E6RA 1E40A 1LM1A 2R1KA 1EDTA 3SY8A 3SY5A 1D2KA 4C6QA 2JIEA 3CV6A 1OT1A 2HEJA 3P74A 3H6OA 3WMSA 2VDGA 2DT1A 1KCZA 5TIMA 4NP7A 2QPXA 1W56A 4BI6A 1FWGC 3LRLA 4CVUA 4A3RA 2E1WA 4YS1A 4B4HA 3GVRA 2GDQA 1Y5WA 2DZTA 4PRRA 1E1EA 5BXRA 3DC8A 2DSZA 4LBSA 2VRKA 5EBUA 3LD5A 2BOGX 4Y9MA 4Q8OA 1IZCA 4LW7A 1IQ8A 3NG3A 2PDFA 1YBQB 2EXOA 1AW5A 3BLFA 4HKPA 4F48A 2V5LA 3MC5A 3MT1A 4IICA 4PH6A 1NFGA 3I7QA 5EMKA 3A24A 4GUFA 4C6DA 2CEQA 4W5UA 3ZR4A 1F9CA 1C8QA 2VFIA 3TTOA 3N11A 2YDQA 5CG0A 1GQIA 4AIEA 4GC3A 3KBSA 5LIKX 3WEOA 4RUBA 4AY8A 1QNVA 5B7ZA 4J3VA 3TA9A 3KZSA 5D9PA 4B5VA 3OU8A 1RP9A 1WBHA 3VMPA 2NQJA 3UG4A 1ONWA 5BMXA 3WBYA 1F76A 3A6OA 3WUEA 5KMYA 2CKRA 1RQBA 1EEPA 1UZDA 4XISA 4R3UA 1LQAA 4ACZA 3UXLA 4NHVA 3VDGA 1NDWA 2V3FA 3K13A 4OU1A 4DJED 1PE1A 4XZIA 4UTIA 3PZIA 1MFVA 1AODA 2WB5A 4YWIA 3UG8A 4RPPA 5CEWA 3NQ2A 1W17A 3VGBA 3KBJA 3ARUA 4KGLA 3UXKA 2C16A 1AH3A 3TIMA 3WO8A 2IQTA 3HBLA 9XIAA 1EB3A 1TQXA 3K5XA 1KFWA 1Y5XA 1K8XA 3WH9A 4XZNX 2FPYA 2C1IA 4NNAA 3MSYA 3KVLA 4EAYA 3G18A 3PPGA 1QASA 1V0KA 4Q8WA 3TZFA 1KC7A 1RD6A 3N18A 3OG3A 4NJJA 4RJEA 3OZYA 3UCCA 1GORA 1PX3A 1TCMA 5G1TA 1FH9A 1BRLA 3B8SA 3MUXA 1VIZA 1OD8A 1Q63A 1K70A 4QIUA 1G0CA 1SW0A 3T44A 4DUOA 2DUAA 4QG6A 3UG5A 1XLBA 2VGBA 3JU2A 3FS2A 2DZBA 4V27A 2FGBA 4XWUA 5HQLA 4AU0A 1E70M 3VIKA 1IR2A 1J5SA 3TR2A 2XIMA 3U6WA 3FJ6A 1W3HA 3O7UA 3VDAA 1TG7A 3W7IA 1GNXA 5M03A 2QUNA 3LRKA 3LPFA 3O2LA 4CEUC 3WLQA 1UWQA 3W7EA 1T5AA 4MZ8A 4B2DD 1TO3A 3CQHA 3HG5A 3L5MA 3W72A 4HPJA 3CQJA 1W6TA 3VIFA 1W5NA 4PRWA 1P1XA 4PUJA 3CQKA 1SO4A 1BYDA 4B15A 1GW1A 4KCUA 2RDWA 1GG1A 1DYSA 2IKGA 2YZRA 3WEZA 2DJXA 2DEPA 3U2OA 3BURA 5ABFB 2FZDA 2EG8A 2OEJA 4EPDC 3DECA 3DESA 5DN1A 4OZOA 5FL0A 2VWSA 3B05A 3KP1A 4P7QA 3GBDA 3OHIA 3GC4A 3AXHA 1GQNA 2ZRUA 1YTDA 1A50A 1XIIA 1VJZA 3MKCA 4JN8A 3SURA 4HU3A 1MUWA 3EOEA 2CLHA 4AZ6A 4A05A 3MHFA 1FHUA 1GJPA 4I7UA 3A64A 4MF4A 1KQZA 4XZBA 4TX8A 1CGYA 3VOGA 3CUZA 1XLLA 4UR8A 3EX4A 5AHIA 1WYIA 4W88A 2TAAA 3EPNA 3LCGA 4QLLA 3E02A 3NQDA 4FXRA 4JFTA 1MDRA 4CQ9A 3APYA 4LWWA 2W66A 1RSCA 4FNQA 4PMRA 2QDDA 3IV3A 2VYOA 4EPBC 2O9RA 4H6RA 5FA5A 4AW7A 3WH8A 2BXYA 3BANA 3W1RA 3JRKA 1TX0A 1IZKA 3QVQA 1E71M 3TKFA 1DEDA 1O6IA 4MUPA 1P6BA 3ABXA 3OLDA 4WHBA 5A6MA 3CV2A 1XGDA 4BJHA 3B9OA 4XTDA 4QAIA 4GYJA 1MZHA 4MYAA 1HVXA 2XGBA 2XIIA 4UWMA 5ABHA 4C5YA 4UR9A 1RR2A 3BW2A 4MADA 3G1FA 5BRQA 2OSWA 4WK9A 4GGHA 4CCDA 3CXOA 3TMLA 3KFTA 2C14A 3B0PA 4D72A 4JNZA 2V5JA 3JZUA 4LYRA 4Q4OA 1F3EA 4Q32A 3UU0A 1IEXA 5JBDA 1JZ7A 5I3FA 1UWRA 2Y1HA 1LT8A 5C54A 3BW3A 1IXOA 2ZUNA 4HTYA 1IEQA 2WHMA 1KTNA 3E74A 3EWDA 2D0FA 2FIQA 1E0XA 3FYOA 1DWFM 2VUYA 3PNZA 1FKXA 3N73A 1DQWA 3MI2A 2FPTA 1P48A 1UBSA 3RDKA 3GE7A 1JPDX 2J7GA 1QPNA 1S2CA 1YTKA 2YLLA 2A7PA 4NVTA 3N13A 3C2RA 2QJGA 5EMUA 4DUWA 4CGTA 4Y9NA 1WDQA 4PL2A 2O7QA 3ITGA 2G96A 2UV8G 1EYWA 1DJIA 3DOPA 3AYRA 4O50A 3UVAA 4S3EA 3IIPA 1K7EA 1BYBA 4FNTA 4MLRA 4O1FA 3RM9A 3GK0A 4ECLA 2D3NA 2BLEA 1TZ7A 4ZMGA 1A5MC 3BXWA 3T2OA 1SZRA 1D7KA 1BSLA 3KVMA 4G7EA 2GLKA 3ECQA 4UFKA 3HJZA 3VM5A 4S2CA 2JGYA 1SJAA 4IFKB 5LNRA 4KRUA 1JPMA 3WD3A 1KRMA 3P93A 3P8JA 2GJNA 3ATYA 4RZ6A 1QTWA 4ZXLA 2A3EA 4LRTA 5BOFA 4P5UA 1HVQA 5CBJA 3LHUA 3B9NA 1XCFA 1M7OA 3KTSA 3GC5A 2VEKA 3N34A 4LAOA 2Q6ZA 3I6EA 2QCDB 4RXGA 3QTPA 5HR7A 1B31A 3UQNA 4GBUA 1I1XA 1V6TA 2H8XA 3B0UX 4HPXA 2WBKA 2Q8XA 3W7DA 4ZZ9A 3P6LA 5BRBA 3U0HA 4TTGA 4JFUA 3H7VA 3LBOA 1CGXA 5F2IA 3TW6A 3TU9A 1UKSA 1F05A 2W92A 1PDZA 2I9UA 4OECA 5AC4A 3VYLA 4JFSA 3S5SA 1O5RA 2GK1B 5I3KA 3VKCA 3NDYA 4DXKA 3HTWA 4UCGA 5RUBA 3UR2A 5C6MA 3UPMA 3W1AA 5JH2A 4EVZA 4I3GA 1EO5A 4DXVA 2VENA 3TYUA 1WKYA 3E0WA 4R5EA 2CKSA 4Z2GA 1QVBA 3WMLA 2HSAA 1C92A 2FJKA 3B03A 4DJFD 2EPLX 3FW6A 3AMCA 4GKLA 4AZCA 2D73A 1REQA 2GQAA 4B9ZA 4C6FA 2DZVA 3V5CA 3OGRA 3THAA 3DG6A 1M5WA 4I9MA 1KXVA 2ISDA 2BVDA 3QGAC 2FZ8A 3LCWA 4BF7A 3U3HA 4GMEA 1GOIA 2IPFA 2YCLA 4M81A 1QI3A 4KRTA 4XX6A 1SZEA 1I2NA 1JUEA 3RUBL 2H3BA 4S3AA 1UD5A 3PUEA 1L6GA 5I23A 3NO1A 1BXCA 3CBWA 1UR8A 3S2CA 1I9CB 1QNQA 8TIMA 4LQ1A 1HFBA 2P3EA 6PTDA 3CPGA 3CUHA 1CWYA 4LUJA 2VC7A 4E2DA 1HF6A 4JEJA 3QV6A 1UR9A 1JCMP 4K37A 4C5ZA 1VJSA 2DY3A 1X7FA 1K77A 1T0OA 1YNQA 3DHUA 2WVVB 5E70A 2E6YA 1ZB5A 3BG3A 4C6OA 2QCCA 4HCDA 4UQ9A 2OLSA 1XYCA 2VJXA 1Q6GA 1C29A 3P60A 1NDVA 4PCTA 1J18A 4N02A 1KRCC 4L61A 3GVWA 2PDNA 3SFKA 3LBCA 5MF5A 3ID7A 3VOFA 4O53A 3RO8A 1JZ5A 5A6TC 5C55A 4GI4A 3HOJA 3GBEA 1QNSA 3BTNA 2YZ5A 1WDSA 4RZ4A 1T6MA 4NRRA 4O16A 3DBNA 1Q6RA 3D6NA 3QM3A 4W8AA 1PIIA 4C1NA 1NTHA 4JFVA 3ZFHA 3J7HA 1TRIA 2GGEA 2FGLA 5C2GA 4MWAA 3VDHA 1XD1A 3U8GA 4IOTA 2FDMA 3L12A 3LXAA 4E8CA 2ZXQA 3W00A 2WNZA 3UNTA 1AVAA 1NDYA 4QJ4B 1BSIA 2WPBA 1BG9A 3GXMA 4GYFA 4JZ5A 3W25A 3TDFA 1M3UA 4KCWA 1AZ2A 4N9DA 1OYAA 1FX6A 1GQJA 4M1BA 3LZ5A 4K36A 4Z1CA 1ZLPA 4IIDA 4A3YA 3VILA 2HS6A 5D2TA 4L4OA 2VR2A 3QV7A 3T09A 3LCHA 2GYIA 3V75A 4LS0A 4B5XA 3UF9A 2W79A 3PZ9A 4J3ZA 1E4MM 5DT5A 1Q6CA 3EB4A 4K3ZA 1TPVA 3UXAA 4PZVA 2YB4A 4Z0JA 2O9OA 2YGYA 4FA3A 3G6MA 2ZZ2A 3H2NA 2KAUC 3LYEA 3NL2A 3C52A 5CZ0A 3S6DA 1I6NA 3TE9A 3UR7A 1I1WA 3EDDA 4KWUA 3KCLA 1CENA 4WRHA 5FSEC 3OVRA 2BDQA 1JPHA 4B4FA 2YYTA 4HZ7A 4YCOA 5E6ZA 1UR0A 1RY0A 2FVLA 3W71A 2Z1XA 3H24A 1VCVA 2A85A 1S5VA 5J5DA 4IT1A 3A3XA 1ICQA 3N2OA 3AHXA 3TQ0A 1FBAA 3S1GA 5B7YA 3NPUA 2PU1A 1B9BA 2CLPA 1SQ7A 4K6AA 5CCZA 4H8NA 3G77A 4RL3A 3O9NA 3MKKA 4LBUA 3ZT6A 1ELSA 3MZ2A 3DH7A 5HOSA 3ITTA 3CUXA 3R8GA 5E0CA 2Y63A 1XGEA 3AALA 4ZQOA 5IXEA 2OQHA 3JS3A 4C65A 1K8ZA 2E6FA 1OC5A 3T0AA 2XIOA 4GVFA 3EA2A 3R79A 1YX1A 2QVNA 3SECA 3H2OA 1GUVA 5LNVA 2G4FA 1QPQA 2QHAA 3C86A 1JYVA 3GU2A 1CGVA 5HK4A 4ICCX 3TCSA 4HP5A 1JQXA 1FH7A 2XSXA 3G1RA 4WLCA 4CKQA 4R27A 3WH7A 4XD5A 3WDPP 1MEHA 3NZQA 2V68A 4XIAA 3RCYA 4N6FA 5D03A 3QW3A 1NWRA 1AMKA 1E0WA 4Q4MA 1XLKA 3RPMA 5A8OA 1OY0A 4LYPA 3UZWA 4Y90A 4L9ZA 4PCNA 6XIAA 3NR0A 3COTA 2H3DA 1K1DA 2WJZA 1GGOA 4D6DA 1JDFA 3XISA 4XG1A 1VBHA 3L5AA 2J7BA 1HKJA 1B3OA 1SO5A 1Q85A 4QS6A 3OA5A 4Q7NA 1FH8A 2A1YA 2FB2A 4LVDA 1T8QA 3SRHA 2BASA 4GKTA 2ZX6A 3QFWA 4ZSTA 3LPPA 2PTWA 3D0CA 4G8TA 4NAEB 4W9TA 3HQNA 2WYSA 4BQ3A 3LCIA 1O5KA 1NP0A 1B3VA 1Q8AA 1OZMA 4PL1A 1VCFA 3QMTA 1QNRA 1XISA 4LFYA 3AHZA 3WDRA 3UZJA 3SUUA 3E38A 2HXUA 2WZMA 2Z4GA 1EUNA 2C0HA 3KS5A 1EGMA 4PGLA 4DF0A 1TZ9A 5DQPA 1NM9A 3LTYA 3PJXA 4EX4A 1EPXA 2NT0A 3G5EA 5L6UA 2NXGA 3NVTA 2HNEA 1S38A 3L4XA 1GHSA 1TA3B 4W86A 3T6CA 3M0XA 3MUZ1 2GFTA 1VBRA 4WY0B 3AU6A 3ZVIA 3P0WA 5AHLA 3OZMA 4GA8A 1DBTA 3VKAA 1KFEA 3VM7A 3W75A 4AH7A 2C13A 5BW6A 3MCMA 3P80A 2ISWA 4E3VA 1O5XA 2HBVA 3R94A 3LGEA 1TVNA 3OA3A 4YMZA 4K1WA 5AC6A 4C7DA 1UC4A 2ZZ3A 1B3WA 1TVLA 2DZUA 2FFIA 3PPCA 5FEXA 1M7XA 1UR4A 3QC3A 5CAHA 4YN5A 2J8TA 2J78A 4L4LA 4PEEA 3SGUA 4LCQA 5I24A 3IK4A 2VRQA 1HO4A 2PBOA 2NSOA 4DHGA 4S3BA 3ATZA 1LOQA 4FAMA 1A5NC 4EF9A 4UTMA 2QCNA 4QNWA 1LRQA 2OSXA 3EKLA 1CXIA 4XD6A 2Q8ZA 5AHNA 3AXKA 1AJ2A 3KRZA 2DH3A 1RALA 3A23A 3VKDA 4S2BA 1TJ0A 1BPLB 5J04A 5A8NA 3TVAA 4ZVJA 5DRIA 5C9RA 3TNOA 3B4UA 2CLEA 1P0DA 5TD4A 2J9ZA 5K9CA 4PTXA 1C7TA 3CEPA 5K4ZA 1W31A 1J11A 3F2BA 2QVHA 1H61A 4QCEA 1ECQA 2PDKA 2D20A 1XH0A 3VKJA 3HGRA 3EKGA 4O52A 4D6FA 5A94A 4KWOA 3OW1A 5A2AA 3LI1A 2MNRA 4UZUA 1WNOA 4JR5A 3WQ4A 4TVUA 1V5XA 5GJPA 3C61A 2PFHA 4MM1A 2VVSA 4EWND 1FWJC 1F2JA 3BW4A 1TWIA 4KPLA 2OYKA 1G4PA 2QIWA 4JN6A 3SCSA 4IISA 3ZSSA 3AHVA 2P88A 4F4RA 2YKKA 5I3HA 2FKPA 3C2EA 3PJUA 1KO0A 1TJRA 1SJCA 3ANUA 4FK9A 2A3AA 4C6NA 4OQVA 4ERIA 2DUZA 5HPCA 5LKYA 2XH4A 1R9XA 3HB9A 1BTCA 2VEGA 2O4QA 3UJSA 1N82A 5DBUA 1ZCCA 5CGMA 5A6AA 4ENLA 3VA8A 2RGMA 4DF1A 3N6JA 3Q65A 4CD8A 1SM9A 3KOFA 1V6YA 4YCPA 3DFYA 3WKZA 1QAPA 3SAZA 1QPOA 1UUMA 5LIUX 1CZ1A 4GE8A 4ILSA 5HR6A 3EX2A 3SZ8A 2NX9A 3V18A 2PTYA 3IJ8A 3MUCA 2NQ5A 1XKYA 4TQTA 3B8WA 3EB2A 1QUMA 3GDMA 5HWNA 3P3BA 5A3HA 5CLTA 1JZ6A 1DJGA 1RAKA 4WJXA 2ZUTA 4GI6A 4AD2A 2XIBA 4XZ9A 2ON3A 4OKDA 1C9DA 3UGRA 4EACA 2RH9A 4EIVA 4HHHA 4ZFMA 3TN4A 5CJNA 4AD3A 2V30A 1EC9A 1PV8A 3TH6A 4XKYA 2VC6A 5CPTA 4UQEA 1W1IE 4GPNA 1OFAA 3FAWA 3C3UA 4HHLA 1A0DA 4IP7A 5AC8A 1MEWA 3FFSA 1KTBA 1JZ3A 1FWAC 1Q6DA 3AHTA 3DHPA 4C7GA 1QR7A 2PRMA 1G9HA 3VGFA 5BOOA 2F8QA 1MDLA 1WXYA 4IM4A 2X0SA 4LXFA 4QDPA 4TO8A 3K8KA 1BVZA 3ZLFA 1ENUA 2CNCA 3CQIA 4BR1A 3CYVA 4UTWC 5BU9A 4PTVA 1G01A 1RD5A 3MWCA 4K7YA 4K68A 3LLFA 1TJPA 1A5CA 2B7PA 2YB1A 2OKTA 3A5VA 1JF6A 3CMJA 3ELFA 1KBKA 4J3WA 1GOOA 3AU2A 3FXGA 2Y85A 4D6IA 2XVKA 3VGHA 4UC5A 5CGTA 3MUAA 4JOMA 3VIHA 3VFCA 2X7VA 1KRBC 4K8HA 1CX9A 1W3TA 3AJ7A 3W53A 5CPNA 4J3UA 4Z08A 5U4NA 4ZSUA 1MMFA 4DZHA 1X8CA 1FHDA 4PTNA 2XDFA 2JALA 2F7FA 7TIMA 4PUDA 2WV8A 1XLEA 1Z48A 1SMAA 4WKHA 1S5NA 1J93A 3DDMA 2OWCA 1JRBA 4AVOA 4H19A 4EE9A 3OG2A 1BYAA 2Z2AA 4FO4A 2ACSA 3WD4A 5LNUA 2G97A 3AAMA 5I3JA 3B06A 1Q65A 4BEUA 1Z9AA 1N8FA 1T99A 1IZJA 4UOJA 5HDRA 1CXLA 5D2VA 3QOKA 4IZGA 4N42A 4TMCA 4ZA0A 2XFRA 4JQ4A 5JIWA 3L65A 5JH1A 3Q45A 5G4HC 3EOUA 3MBFA 3TR9A 1OK4A 4YHGA 4XVEA 4GBDA 7REQA 2WNWA 3C2OA 4KGJA 5I00A 1VHNA 4DPQA 4IJBA 3P5ZA 5H8UA 4PR4A 1ME9A 2EBNA 1V8EA 2XH7A 9CGTA 5FAGA 2CLOA 4Z2HA 3RMEA 1CTNA 4WDWA 1E55A 4OJYA 3ZYZA 3P14A 3T78A 2W67A 1H3GA 1K9FA 1GVSA 3IUDA 2OZ3A 3UGVA 1KBIA 1CECA 4GNKB 1JL8A 1K4GA 4ACZB 3ARSA 3AIVA 3WD1A 1ZS2A 3L7RA 4IIBA 3MTWA 5DMNA 1PS9A 5FEWA 4A3QA 3MY9A 2QJJA 4AQLA 5A8GA 3CUIA 3IGSA 4ZXOA 2WZIA 5HMDA 2DT3A 1UWTA 2PWFA 3VIJA 1M7PA 2DVUA 4JKKA 3NQVA 1BLIA 2BOFX 1LL4A 3R6IA 2OYLA 3W2LA 2QV5A 1QI2A 2AKMA 2F2HA 3GS6A 3S5ZA 3TAKA 3KOYA 3G1XA 3GW3A 1Z41A 3APGA 2PDHA 5AYXA 5HPOA 1H7XA 4ADSA 3RM8A 4Q8PA 4M82A 1NELA 1FKWA 1BRLB 4L56A 1Z89A 3K8MA 5EY5A 3DG3A 4DWDA 5DCEA 3PBMA 2G0WA 2WSRA 2TYSA 4O8RA 2QCEA 3G6LA 2FFCA 4NZ3A 1E6PA 1VC4A 5FF4A 4M6PA 4PSRA 1B3XA 4F9DA 2J4GA 5HWJA 5IFTA 2ZX7A 3LDVA 1B30A 1AQ0A 3RK8A 3W7NA 1KBBA 4JQ1A 6TIMA 5C9UA 4Z2IA 2BG5A 1OCJA 2E6DA 1TWDA 2FQIA 4DN1A 3AS0A 1MEIA 2XFYA 3KBWA 2BFGA 2I9EA 3CHVA 4JD4A 3MYOA 1A0EA 3F5JA 1W8GA 1D7FA 1F3TA 4GC4A 3UA4A 5I0DA 4LUSA 3ARRA 1JDCA 1W3JA 4PMDA 3DZ1A 4AD5A 3NA8A 4RE0A 1FTXA 1RV8A 1VFSA 5AN7A 2PB1A 4N2YA 2JK2A 2NQ9A 2E1DA 1DWJM 1U22A 3EWUA 4ZO9A 2F38A 3O15A 4TVDA 1C8XA 3FIGA 2IS7A 1XC4A 3C0SA 4QSHA 3SIZA 1E6NA 4IXHA 5D04C 3S6TA 1ZAJA 4LV4A 4F0MA 1GVYA 1QO5A 2OKOA 1SSDA 3GIPA 1IXQA 3M16A 1T7LA 2HZGA 1MRQA 3VNYA 4DYEA 2FDSA 3NVDA 3W29A 1KXTA 1XBXA 3SCUA 3EMQA 1S2WA 2ZUWA 4F66A 2O92A 1XSKA 2V82A 2YL8A 1XLDA 2HWGA 4UNLA 4HU0A 4NJKA 3W9ZA 3CJPA 3HMCA 1GOQA 3TP4A 2QCHA 3C8NA 2B31A 1US0A 3SGZA 4GY1A 5DT7A 3M47A 1UA7A 4J3TA 3SUVA 4JL2A 3W38A 3GXNA 3DG7A 2VEIA 1JI2A 2IQDA 3QZ6A 1EZWA 5IM51 1HKKA 4XAFA 5C2CA 3WJXA 3L0NA 1NU5A 4MY9A 1VFMA 3P81A 4HD5A 4H2HA 4GY0A 2DV0A 3URQA 3QSTA 3WK0A 5I77A 3DFTA 3MP3A 3KBVA 5FOOA 2ATMA 4IMAA 3Q94A 3LN3A 3NZ1A 2PP3A 4IPLA 3B8TA 2YL6A 2OT1A 3GTIA 4XAZA 2ALDA 3TYEA 4J27A 3S1WA 3TC3A 3RYSA 5CGQA 2P0OA 1A3WA 3P82A 2HQAA 5LIYX 3GUWA 2X8RA 3SQMA 1BG4A 3CQ0A 3IGXA 2GOUA 5IDZA 4B5UA 1AA1B 1DKWA 1ZFJA 1OIMA 2BTMA 3P61A 4NNBA 3VABA 3VDCA 1YKWA 3TROA 2J66A 5DMMA 4HMNA 2J75A 1TV2A 4M6UA 4UNIA 1B2YA 2BBFA 4LH8A 3WLIA 4IFOA 3W22A 3WK1A 5I09A 4AZ5A 4GO8A 4MOZA 3WF4A 3T2QA 1CYGA 1FWFC 1S39A 4DZAA 2ZYFA 4ZE5A 2O9TA 4DWSC 1HW6A 4E2OA 4BWLA 5D32A 1V6WA 1JPKA 1XBZA 3QPZA 1L2QA 3RCNA 2D2JA 2FJUB 4NU7A 1B3ZA 4J2PA 1R46A 3HQPA 3CWHA 1BWLA 2V8ZA 2P76A 3GG7A 2PDCA 1EP2A 2HBXA 2Y61A 3UT0A 3H7UA 3EMZA 3F5LA 1OG0A 1PUDA 3U2ZA 2ZA2A 5A8QA 3VINA 4G7EB 1R3SA 5A6BA 2ZZ7A 4NXSA 1K9TA 1F7BA 1UROA 1V4YA 1W9DM 1VH7A 3DGRA 4EANA 4MWAD 1XCXA 2XFWA 4AWTA 3ZMRA 3SCQA 3AMLA 3KUMA 3UXDA 1IIGA 2BODX 2QUVA 3WQ5A 3LMZA 3BAYA 4JN7A 3IIZA 2ZUVA 1DV7A 2XIQA 3GW0A 2OGJA 2ZC8A 2XPKA 1OX6A 1KM1A 4UQAA 1GG0A 1VPXA 1BGAA 3VPLA 4UQDA 5EMMA 4HOXA 3R10A 5T9BG 1NVMA 5G2WA 4KRZA 5C9ZA 3LXCA 1S1RA 5AKQA 2V3EA 1UUOA 3RILA 5I07A 2OSYA 4KEVA 3O6AA 5FESA 1RPKA 1H0GA 4MTVA 4OOUA 1NQKA 1NF7A 4WR3A 4NL1A 2B0MA 4HT3A 3MUIA 2G4JA 5J5RA 3W7RA 3GRIA 1FP9A 4FXFA 4LAMA 1J0HA 1EL3A 1LG1A 4RE4A 4A21A 3DFNA 2XGIA 4QEHA 4UOZA 2HK0A 3IARA 3F7JA 5G5IA 3H2CA 2AQVA 3QQ1A 1IXPA 1VD6A 4G1NA 3M0MA 2V3GA 4QRNA 2IPJA 2E8YA 2X1UA 1EX5A 3LLDA 5ABTA 1I2PA 3CMFA 2LLEA 4I90A 4AZCB 4URIA 1REQB 1YNYA 1NH6A 2OOFA 3FDKA 5JQ9A 1K9DA 1MVYA 4ML9A 2UY3A 4UTHA 1RXOB 3VMNA 4AAJA 1T8XA 5E09A 4KBXA 3OTRA 2ZADA 3AIEA 1TQJA 3VIGA 3M5XA 3I4KA 2YCLB 1C8VA 3HPZA 2I17A 4F0LA 1EDQA 1RBAA 3TAOA 5AYYA 4JNMA 2CHRA 4Q4RA 1J10A 3WQ8A 3LV6A 1O4UA 1KV8A 1QFEA 1JGMA 1N8IA 2DJLA 1JG9A 2DZXA 4GNVA 2V2DA 4X0VA 3HM7A 2WMIA 5AC7A 2ZRWA 2HROA 1WZLA 1XUZA 1EJVC 3CK5A 2V2HA 1JXKA 3I7RA 2VC9A 1G5AA 3PTKA 3AWOA 3NAVA 3N6HA 2DZWA 3VTRA 1W9XA 5LNSA 2EPHA 2QJIA 2I7GA 2UBPC 4NXKA 3WNNA 3F4WA 2E77A 2VDIA 3NPVA 4RDYA 3KCJA 4LCRA 3AIUA 3ZOAA 2OR2A 3GTFA 4OFCA 3EKZA 5FEPA 2CBVA 1FWRA 1D8CA 3IK2A 1DE5A 2J88A 2FZ9A 3TJXA 2ZE0A 3GU1A 4C1NB 3O3RA 1XR2A 3USZA 1LZOA 3TYBA 1TUXA 4MLJA 3C8FA 5I6SA 4FLOA 3C56A 3W2UA 3SSJA 3FDGA 1VB9A 1FDZA 4MWAB 3S6OA 4XAGA 1W2PA 3CLMA 3TLQA 6ENLA 4Q7BA 2GQ9A 1QHPA 2PWVA 1G1YA 7ODCA 1XH1A 4QX4A 4GZJA 4PFHA 3PS7A 4W84A 1LWHA 3VU2A 5KSWA 1CLVA 1HJUA 3SFWA 4IQEA 1ZZMA 5I78A 4F0SA 3W88A 1IIHA 2PDPA 4BQ4A 2PD9A 5GVJA 4LSBA 1NWSA 3BSMA 4BI5A 3EDEA 3TEVA 4MKSA 3CL7A 1EGZA 3ZJ7A 4JHZA 4AY7A 4F79A 3MMWA 4MNMA 4LF2A 1BXNA 3LPGA 4LEFA 4AF0A 4G5DA 4RNHA 1YMYA 1HJXA 4A3UA 1P7TA 5EBAA 1XLJA 3ES8A 4W4QA 3SM0A 3G0XA 3PBWA 3GR8A 2WKGA 3MV11 3WDIA 4GO9A 3C2FA 2VNCA 4IGMA 3BJTA 2AKZA 3W1MA 4KEZA 1RPXA 1WX0A 4K38A 3PZOA 4FOKA 1UWAA 1JCNA 3IGHX 1YXDA 3RRAA 4DM2A 4GH1A 2VURA 2YA1A 1Q6EA 1IE7C 4IMEA 1OT2A 3NFUA 3W86A 3KDOA 1EUAA 1CI1A 5F2LA 2CBJA 5LIWX 3I3DA 2F6XA 3QOMA 2TMDA 4ZBCA 1HKWA 3FLUA 1EZ2A 3CMGA 1WDDA 3WNMA 1UP3A 1VFFA 1F4AA 4BZYA 1E9ZB 1TPUA 4LVGA 3VNLA 1KFJA 1NOUA 5IHSA 5F2GA 3N12A 3G8EA 4XIMA 4GLEA 2YW4A 4IPJA 4AZ7A 4MY8A 2VO5A 3CZ8A 1H49A 4XAYA 4WCJA 5DBTA 5XIMA 4TV5A 1JZ8A 1ZALA 4QISA 4PBFA 3F4CA 4U2ZA 1XCWA 1OIFA 2RDUA 1G7VA 3UR5A 1BF6A 4WOZA 1QW8A 3OBEA 5FF7A 4TXEA 4CQBA 4HNVA 5MKGA 2INZA 3MMDA 1A5OC 2WVTA 1VEMA 4L9YA 1WO2A 1E56A 2ONEA 4PA8A 4GISA 2BY1A 4OWGA 3O8AA 3L66A 3VCRA 1DQUA 2BY3A 3RU8X 1XD0A 4NNCA 1FWTA 1QJWA 1YDNA 2ZX8A 3NQMA 1ZENA 1XQLA 3IRSA 4UFMA 1TR9A 1GOMA 1WE5A 3BJFA 3NJ3A 4OT7A 4CLMA 3STPA 1UD8A 3QKEA 2IKIA 4LANA 3TN5A 4C90A 3N3TA 1A4MA 3E2RA 3FCPA 3ZT5A 2E3ZA 4U3CA 3IV8A 4X9YA 1TFVA 3C5QA 4D6EA 2I14A 1AD1A 1RBOB 1V02A 3FEQA 3TTSA 1DXIA 1FXQA 4XBJA 1DIOA 1RZMA 3NQEA 3CHFA 3UWEA 1FQ0A 4MB5A 1XIBA 4MYXA 3ITCA 1FUYA 2VCCA 4NZ5A 2NWSA 4Z2LA 4GYPA 1LLOA 4QGCA 1YRRA 2PURA 4PMVA 4E8DA 4P61A 5LYRA 4PMJA 3VCCA 2XJ7A 2DUXA 3HF3A 2Z29A 3WL1A 1NEYA 3GUGA 2OELA 4UOQA 3GDTA 2WJDA 4IMGA 3T07A 2OQYA 4C6MA 1TELA 3M7WA 3H21A 4PMOA 2FMNA 2DW6A 1ZP3A 3TTYA 3RPDA 5CZTA 3WFAA 1W3NA 3UYCA 2I56A 2GGHA 2ZDSA 1J4EA 5CSYA 2FYMA 4FF7A 4AY1A 4JIQA 2B7NA 2Z00A 3UJFA 2Z6JA 1ADSA 3KDNA 1KTCA 4E2VA 1PBGA 2H90A 3GLCA 2PRHA 2AMGA 3IEBA 2AOSA 1AZ1A 1BQCA 3DBPA 4NZCA 3E9AA 1X6NA 2DDXA 4XUYA 3UBPC 3B3DA 1C3FA 4JTAA 2X7WA 2NSXA 1OFDA 3CTLA 4OHQA 1MO0A 4O10A 3KL3A 4OV4A 4IIGA 1UD6A 1V77A 1EJWC 4M24A 5GPRA 1VYRA 3KW3A 3ZR5A 3MO7A 4ACYA 4AB4A 1U33A 4C6PA 3CM4A 4BI7A 3WH6A 4D6JA 4PCFA 5LGZA 4IGHA 2NVDA 4HSHA 5T9CE 5DY3A 3SB0A 2PU0A 5DXXA 4UTTC 4P8UA 3MMUA 1KFBA 1PHQA 1UOZA 4WXYA 2OJPA 3S5NA 3C3NA 3C2VA 5H91A 5HA7A 3CL8A 1DJXA 2Y8KA 4UTFA 3O07A 4NQ1A 3KLKA 1CCWB 1MQRA 1CW2A 1ZBKA 1F3XA 1UHVA 3W76A 1VKFA 1B3YA 3ANYA 4IMDA 1UD3A 2WPGA 4AZHA 3VXGA 3MKVA 2OZTA 1VCGA 2W91A 2X1IA 4GXPA 1OB0A 1ADOA 4C91A 1S3HA 2X05A 1UP2A 5CC5A 1R7AA 1MSSA 1RVGA 2BVYA 1LQ0A 5CZKA 2V5KA 1X1OA 4BQ2A 1TIWA 2OLAA 4NILA 2OEKA 3BO9A 3W70A 3KEHA 1CGWA 2NXIA 2R1PA 1X96A 4K1GA 2ZVRA 2OQLA 2C18A 3W6MA 1G69A 4M0XA 1FWSA 6A3HA 3CAKA 2XN0A 4GUHA 2HTMA 2Y62A 4IIFA 2XIJA 4A2SA 4MUZA 3STFA 4FLSA 3GTXA 4HTBA 4NSBA 1HJSA 3QH2A 1DOSA 3WQCA 3TV8A 2GQ3A 2GZXA 2X2YA 4XD3A 4GINA 4FX8A 1XYLA 2QR6A 4GG9A 3WY1A 3K46A 4MNKA 1J79A 1DIDA 3EXTA 5HMFA 1VEOA 4GHRA 1JPIA 1O1HA 1L2UA 2WKJA 1E3ZA 5CJ5A 4DBEA 2BSLA 1XPYA 2XWEA 1JIBA 4LX4A 1PX8A 3MS8A 4FOUA 1PVNA 3UCDA 3CU2A 1OZQA 4UFJA 3E2VA 2XGZA 3HV9A 1DQXA 2R24A 2QS8A 1NY1A 2Y2WA 3W2JA 4GX8A 5DEZA 4V33A 1SZGA 1XYZA 3AXIA 4ML4A 5AOUA 3KTCA 3T4WA 1WV2A 2PI6A 2W6RA 3VOHA 3GNNA 2CLKA 4WSKA 3VX0A 2CESA 1DWGM 4YLWA 4GZIA 2Z1BA 3ZIZA 2PA6A 2A3CA 3URBA 3M0YA 2VRJA 2QAPA 4HNNA 3CIWA 5DMLA 5AZ1A 2CHOA 1DTNA 3BQ6A 1AH0A 2WBGA 4GD0A 5EYWA 4DQWA 5HANA 4C7FA 2HDJA 3RRXA 4X0NA 1EH9A 1TCDA 3GDBA 4XKYB 3FHQA 4PTDA 5LNWA 1U30A 2NX3A 3UZZA 4PBEA 1GZJA 1EQPA 3B4YA 1V6XA 5KEZA 2CW6A 4ATLA 3GIYA 5H1WA 3AFBA 3SUWA 5I7GA 2FH8A 3MW7A 3NXFA 4LPCA 2OZ8A 3GFXA 3L5LA 2HVMA 3WD2A 4O0ZA 2FTYA 2VGIA 1YPIA 2YL5A 1QHZA 3NDZA 4NJHA 1W9UA 4PBGA 4WKAA 2PPGA 1F8IA 3D3FA 4Y8FA 3G1AA 3PPHA 3CZEA 3HFTA 2D2HA 2VC5A 4UNKA 4N6EA 3T0CA 2VQUA 3RLUA 3KRSA 4MWAE 4WGHA 3TXVA 2FTWA 4WIWA 3SQLA 5LGXA 3PZUA 4S3KA 1YHTA 3GNDA 3MPGA 5DCBA 1F3WA 4EPEC 3D5HA 3UERA 3RAOA 2UY4A 2BP1A 4BS0A 4HK6A 4NZ4A 1QOPA 1OFBA 1PPIA 1S46A 4O11A 1M7JA 1U1UA 1SFLA 4E38A 3DI0A 2Y5EA 2ZXBA 1R2TA 3O1NA 3Q67A 3NQFA 1SYTA 3C0QA 2GL5A 4U5KA 3NCOA 5F4WA 5LIXX 1VGAA 4QQ3A 2FHBA 2VD9A 3KX6A 5HMSA 1RJQA 2ISSA 1J5TA 4C60A 2JBMA 2V6AA 3GTNA 1EKOA 3A3WA 2F9RA 3W7GA 1TPC1 4Q6JA 3UJRA 3PP7A 1P0BA 1LWJA 1XBVA 2YDRA 4I7VA 3EA3A 1JUKA 4YYFA 3FJ4A 3JZEA 3M1ZA 4L1WA 2ATSA 3BGAA 3VCNA 1OX4A 1XSIA 1OHLA 3NUKA 3CUGA 3N4AA 3TWBA 3GSMA 2W61A 3RO6A 3G0UA 3CV1A 4WVXA 3UNDA 2F6KA 3URNA 3TCEA 5ABGA 3WMBA 2X2GA 2DT2A 7CGTA 5DLCA 2CYGA 2A7NA 4CCEA 1ZP4A 3B04A 7REQB 3UWUA 4HA4A 3UD6A 1GCYA 3IIXA 4S38A 5CAKA 3KRUA 1UQZA 1OFOA 3N4FA 3BOFA 1RQEA 3TQVA 4M51A 1E9IA 3LM3A 2ZE3A 2VFFA 1AQFA 2PDUA 3WBXA 1XSJA 4AMAA 1TJ1A 2Z24A 1E15A 5AVNA 1KXHA 4KMQA 2FZBA 3WF3A 1WZMA 2VUNA 4ZOBA 3N1AA 3TJ4A 2BY2A 1QI0A 1D3CA 3GIQA 3ARVA 3W73A 5HQMA 2ISFA 3WNLA 1A80A 2A21A 4H9TA 3I6RA 2X1SA 4ZQNA 2QUUA 4MY1A 3CWOX 3XIMA 1KFCA 2ZZ4A 4P7OA 3W26A 4HPGA 4I5UA 5HBFA 4KCTA 4M7TA 1LCOA 3EWXA 4EAMA 4ZO8A 3G24A 4M6QA 3GH5A 4L80A 1KFLA 1E0VA 4CCZA 2XH2A 2VR5A 2EPOA 1F8MA 2NV1A 1ODZA 3QLDA 4PTWA 2DQXA 2WC4A 1TZZA 3W1UA 1V79A 3GNRA 1P6CA 4FF5A 2C7FA 7ENLA 2X41A 1KNWA 3EZ4A 4HNLA 4UBPC 4UMBA 5LSMA 1QWKA 1E5JA 1X38A 2Y5SA 1JCYA 2RJGA 3PC0A 4IFRA 4FHAA 2OFJA 3CHEA 4GQRA 4U33A 3WFLA 2JEPA 6ALDA 4I7WA 1HQTA 2ESCA 4LALA 1UOKA 5A6LA 2HV5A 4PMYA 4X22A 5BROA 3V7PA 1O7AA 2E9MA 1SUXA 2OCZA 2Q3RA 3PZNA 3USBA 3W7CA 1KWGA 5EKYA 3A4XA 1GT8A 2H9AA 4AC7C 3ISIX 4IHCA 1JZ4A 2ZWYA 1VLIA 4AISA 4AHOA 4JTUA 1I8JA 3E0IA 2ZRZA 4J3SA 3W0KA 4OE7A 3TX9A 3H4XA 3GR7A 3AIBA 2BS9A 4W87A 2JE8A 1UZHA 4NY2A 4AXKA 1XIFA 1FY6A 3EDKA 3LM7A 3ZT7A 3EXSA 2GJXA 4O4VA 3H26A 4AX7A 3GZAA 3NGJA 1X1NA 3WLLA 1UMLA 3DI1A 4US6A 2ABAA 3R4IA 4UR7A 4NJIA 2FMOA 1TV8A 3UWZA 3VD5A 1HL9A 4RR4A 1OD0A 3HIJA 1J2WA 4LUSB 4AIUA 5A6BD 3S2JA 2HE8A 4FMVA 1WZAA 2OU4A 4PMZA 3XINA 4H9ZA 2WZHA 1S2TA 3APTA 1ISYA 3T1GA 2ZOXA 3G0SA 4MB4A 2ACRA 2A6LA 2NUWA 4GUJA 3OO2A 3ITYA 4NIRA 3U2EA 4JL1A 3Q37A 2VI0A 3BC9A 3OODA 3W7LA 2HPMA 1JEZA 3T42A 4DB7A 1ISVA 2Y24A 1ZRQA 1YADA 4XZLX 3P84A 2Z2BA 3NPXA 2QCGA 2PCQA 1W5PA 4GQBA 4RZBA 4LRSA 1XIDA 3WZ0E 1AW1A 1O5QA 3ZXWA 3AC0A 1UD4A 2YPIA 3GXFA 3W7MA 1N8WA 6XIMA 4NZJA 3BUVA 3E3HA 2E67A 2ZA1A 3H53A 3FNDA 3TJLA 1PAMA 4RPQA 3O63A 4MJ4A 4W8LA 3TNBA 2EJ1A 1A3HA 1OG6A 2E6AA 4BY3A 3GDKA 2GPTA 3AISA 2YIHA 2OG9A 1KGUA 2IKJA 3CB3A 2WHJA 4E5TA 3UETA 1IHIA 1CGTA 3VAVA 2X09A 4Q33A 2CLLA 1B57A 4GVIA 3CASA 4YTSA 2CLFA 3CUFA 4JNYA 1GYLA 4KWVA 2QV4A 3N17A 1LBLA 2X40A 3C0JA 4D8AA 4FR6A 2J25A 3E12A 3F4VA 4C6JA 3B8DA 5HQEA 3CT2A 1L8PA 1XBYA 1ZAHA 4W7UA 2XVLA 3AIWA 8XIMA 1QOQA 2UY5A 3B9EA 4HA0A 4KEMA 2J9YA 3AYSA 1P5BA 5KZDA 3SCTA 4PODA 4F8XA 4KCVA 1UA3A 3AJXA 4AD1A 4X61A 4EXBA 2DFAA 2ZRVA 1UR2A 3BAXA 3G3MA 1SJBA 1RA5A 1WPCA 2YBTA 4PSPA 2RDTA 4RK8A 3GXIA 1T41A 2DU2A 1J9YA 1HJWA 4A6GA 1WUEA 4RV8A 4QJ5B 1ITUA 1RH9A 1XDJA 1E5NA 4M1RA 1XRTA 3ZVHB 4AMCA 3EB3A 3PTQA 3AOFA 2BWGA 3GB6A 3VE7A 1TX2A 3HPAA 1CPUA 3FGCA 4E0CA 3VZZA 4BA0A 1Q6LA 3EEGA 3GDLA 2OX1A 1PX4A 4GGBA 1EBGA 4ERAA 3BE7A 3O05A 3QR0A 2X16A 2ZDRA 2VHLA 4J2MA 5G2HA 4KFOA 1DVJA 1K03A 1TPB1 3MSDA 1JR1A 5KINA 4PMNA 3L0GA 3MHGA 1H7NA 1H5VA 5EL1A 3LTPA 4YVPA 1SZFA 3THQA 3KBMA 3SJ3A 3TXZA 4US5A 1XLHA 3ONBA 1A3XA 3R25A 1GONA 2I57A 2Z7GA 3RX3A 3LHZA 1D3GA 5REQA 4MAVA 2W27A 1J8VA 3F03K 2PTXA 3O6YX 3I68A 4EPKA 5HJXA 4BHYA 3HV8A 1O12A 4LY4A 2ISVA 2W4XA 1NJJA 1RCQA 1TR1A 2PDIA 4UFIA 1FCUA 3GC2A 3B9AA 3S83A 5HAOA 2WM1A 1CB2A 3WLPA 2J13A 3NEVA 3TSMA 4EWJA 4MIMA 4TX6A 1QI4A 3ZR6A 5EB8A 1H7RA 2OT0A 3W82A 3WN6A 2C0AA 1VF8A 3CV7A 1R0MA 1E1CA 1SW3A 2P50A 3RJXA 1EIXA 1W1YA 4L4PA 1ONXA 1PDYA 4BCEA 7A3HA 1QU4A 3ZZ1A 1SGJA 3L2MA 1T96A 1B4EA 4JX4A 1PO9A 4Q4KA 2FHFA 4NT0A 1WA3A 1FWDC 3JR2A 5FJOA 3H54A 4QBXA 4FX7A 2D2GA 3TN3A 1FOBA 3W6YA 2J7DA 1TPDA 3GVVA 1HT6A 2FGZA 1RLDA 3A4AA 1DWHM 2HJPA 1W3KA 2ZRYA 1U5JA 2P53A 1E1FA 2WQPA 3NM3A 3ERPA 2WKLA 4DLFA 4CQDA 3ARQA 2AAAA 1U5VA 3WNOA 4JQ3A 3IAQA 4ZOAA 3P7YA 1EXBA 2NZLA 3WLRA 3SRFA 4TIMA 3PFMA 5BOEA 1XICA 1IWPA 1Q5MA 2R1LA 5I79A 2XU2A 2Q01A 1L6SA 3UZYA 2Y4SA 3VD7A 1H1ZA 1R3TA 1UKPA 3OVPA 3CT7A 3PSVA 1MNZA 3FA5A 2B81A 2PC8A 3IUIA 4QXIA 5AYZA 5MHBA 4MPKA 1D8WA 4YTQA 4HYRA 2WM0A 1U1JA 3ZJ6A 1WXJA 5GNYA 2WVSA 2DVXA 3WUGA 3URAA 3KOZA 4FEZA 4PCSA 1HTIA 5CSSA 3W1TA 1BF2A 2J24A 1JVNA 3GHTA 1XG4A 1W5OA 4CQCA 4CD4A 3G8RA 5LA2A 4Q7IA 2YDAA 3UY8A 1OFRA 4MVAA 4HVXA 1HO1A 2ASHA 1P43A 4JIRA 3S1XA 2YOCA 4MJ2A 4Y6GA 4D6GA 1MUCA 3H23A 4RNFA 1RP8A 5FJIA 3BMVA 2QPSA 1TKKA 4J7RA 3MDWA 4JIHA 4O57A 3M41A 1HJQA 1GQKA 2HE5A 3FA4A 3QKZA 1E73M 1V3IA 1R30A 4XTIA 3VIOA 1QBAA 4GFSA 5EPDA 4ZEPA 1XFCA 4M56A 4D71A 2PTDA 2ICSA 2V5BA 3QHOA 4OIFA 4BWLC 4WY0F 4JTKA 3ZJ8A 4HA1A 2WMIB 4A4AA 3FXYA 3N9KA 3DFPA 4RDWA 4R7OA 1XHGA 1ZJAA 2XSAA 2PZNA 4G1KA 4DJEC 2XHYA 3MDUA 3NDOA 1I4NA 2PLJA 3G1SA 1G94A 3BLPX 4H1ZA 1Q7ZA 2POTA 2EPKX 1W54A 5H8MA 4Y9PA 1C91A 1Q6FA 3BVJA 2D22A 2VM8A 4L64A 4AVNA 5BWAA 4JTDA 1ITXA 3U5UA 3GG8A 3QV8A 3KL0A 3M0ZA 2GVEA 1AW2A 3POCA 4KS0A 2ZC1A 4LCSA 2I5GA 4DAIA 5IBXA 1VENA 3N6QA 2D0GA 3UWVA 3RCMA 5AZ0A 3BOLA 1EO7A 4WQ6A 2G3FA 3KHJA 1IEWA 3H2FA 3QRHA 4HU8A 2E68A 3PUGA 4XO6A 3QR1A 4ERGA 2E0PA 1XW8A 3MHUA 3PBUA 3LGDA 5EMYA 4MJMA 1H1NA 2G5WA 4R9XA 5U7SA 1B90A 3CNYA 3UWQA 1XIJA 4ZQPA 4YJ5A 4JTLA 3REQA 3YPIA 2ZX9A 2WLZA 2YSWA 5E93A 1JAEA 3M5VA 2DZSA 1RHCA 4IWWA 3KXQA 1V3KA 1FDJA 3ARPA 3IAPA 4UFHA 3EDFA 4PFMA 5JXQA 4QE5A 1DHKA 2REQA 4DBUA 1EWDA 4QSFA 1C93A 2CIPA 3DFOA 4AF0B 1PZ2A 1W1B1 1GVFA 1MQQA 3GTHA 4FP1A 1P7TB 4M7SA 4M80A 2BOEX 3CLWA 1IT0A 3G3DA 5ECUA 2KX9A 1YEYA 2XN2A 5JVLA 1EHAA 4V2XA 2J6XA 4QEEA 4IGSA 2FLIA 4LF1A 1P4CA 4Z1BA 1OCQA 3QMRA 4BFAA 4J3XA 3TOYA 4NX0A 3L21A 2Z2UA 1Z44A 3SCVA 2Y7EA 4GIEA 3WJSA 1PKYA 2VOTA 5CJMA 3UA3A 3N2XA 2PP1A 4D6CA 4CD7A 1HNYA 2NLIA 1M65A 4UTUA 2PRLA 4EKJA 4F2BA 3VNJA 1ITCA 2QJMA 1XM3A 1Z32X 2J7EA 3SI9A 1J6PA 1U2YA 3A21A 3ABQA 4WX2A 3ZS4A 5TF0A 1JCJA 4AHPA 1HUVA 1XXXA 4AZIA 1KR0A 5CC7A 2EG7A 1JZ2A 5EU9A 4DBWA 3FSUA 1RCOB 3HFYA 4GK8A 3ZSTA 3LZ3A 1Q6OA 4HB7A 2QGYA 4A35A 5HATA 4X3ZA 3BQ5A 3ES7A 1HL2A 2CZDA 5J8LA 1KGWA 3H70A 3KWSA 5MKGB 3ABRA 4TUFA 3HZ3A 3KVJA 4MPQA 3HGOA 5CSUA 5A2BA 1UWIA 1L6FA 2G3MA 5IFPA 1RK6A 4XO7A 1VFOA 1JF5A 1AFSA 3LY0A 3BLKA 1M53A 4D8ZA 1K7XA 2PWGA 2VX7A 4GH3A 4AHQA 5A8PA 3QPYA 3WYZA 3S2LA 2OZ0A 2QT3A 3MVIA 3OYZA 5GJNA 4HIBA 3E49A 3HG3A 1ADDA 3I10A 4V28A 1A5BA 3C2YA 2OWWA 3NQ6A 2B4GA 2YYUA 3E2SA 5C7VA 4W85A 4YTRA 5CC6A 4HSOA 5BU6A 1T40A 1IR1A 4U4MA 3U9IA 3WLMA 4I5XA 1GJWA 3LBMA 1LUCA 2XYLA 4A8RA 1O94A 1OEPA 1D3HA 3QV9A 4DLMA 4X2RA 4JTGA 2P1FA 4LOCA 4JHOA 4WXZA 3RITA 1XP3A 2VWTA 3TJIA 4IQLA 4IMFA 4LJ3A 4N9CA 3LK6A 4ROQA 1W9VA 1Z3NA 9XIMA 2OEMA 5CKSA 3KAOA 4H3DA 3N2TA 3S9ZA 5FJTA 5FF3A 3U57A 4H7VA 3MP4A 1R9ZA 2BXZA 4NYUA 1XJBA 2E5CA 3NYZA 3B97A 4LU0A 1UIPA 5A6SA 1HP4A 1ZBWA 4PTMA 1TVPA 3BSHA 4UTWA 1PCKA 4HQVA 5T8GA 4KFPA 2C15A 3GYEA 4LYQA 1X98A 4GXMA 1ZBVA 3FK4A 1NDZA 2XM2A 3SRDA 3LA4A 4A3HA 3IJIA 2X1RA 1YQ2A 3WJWA 4CN6A 4D1JA 4B3KA 4D6HA 2PWDA 1CT5A 2BHYA 4AYGA 3GYCA 2G41A 6REQA 4JTFA 3R0UA 2CU0A 5E6YA 4NAFA 1GVIA 2IQ0A 3NL6A 3WLSA 1OCBA 4B5TA 3OP2A 2NVCA 2YXOA 2C91A 4NG3A 1XWYA 4HZ6A 3AIQA 4CUCA 1V93A 1DXEA 2AQWA 2BV9A 1QRQA 2QCMA 1LROA 2D2OA 3TA6A 2JKEA 3OLEA 2PEVA 3T4CA 4JKMA 2J7FA 4REQA 2VZVA 3UWWA 2OMAA 3MCOA 2DSKA 3CZKA 3WUBA 1UR3M 3VIPA 2NWRA 4OUIA 3N29A 2PWUA 3G1DA 4V15A 4HNOA 2P0IA 4ZB0A 4UQCA 3AMDA 5B80A 3S2NA 1XLCA 3EOLA 4P7NA 5HULA 1BXBA 3R1ZA 1EQCA 5TNVA 1S5WA 1Q4WA 3A4JA 4IJRA 3L4WA 4O1DA 3T0DA 2INEA 1H5YA 3A47A 2NV2A 2EKGA 2C1GA 1BQGA 1KCKA 5FEZA 1EF2A 1FFQA 4DRSA 3W01A 3DYPA 1G4TA 4B5NA 4UXDA 3NQ7A 2O55A 3CC1A 3T05A 2VR4A 4H6QA 2HNHA 4DJFC 4NRSA 3CIXA 1KD0A 1W5MA 1LTDA 2YFNA 2JEQA 4ZFCA 4GIYA 4LVBA 4HMEA 4AFYA 2WSYA 3LTSA 1HKMA 1KCXA 1ITQA 3CH0A 4DBSA 1PZ0A 3FJLA 1J0IA 4O1AA 1GWJA 1E4IA 2IXVA 4HSNA 2WHKA 1NARA 4MG4A 2ZZ6A 1EP1A 2XH0A 3V5OA 4TMBA 1W3LA 1L6WA 4LC8A 3C6CA 1ZJIA 2ANUA 4JYEA 4ZO6A 1BTMA 3M6YA 4YU1A 5JBFA 5AHFA 3GDRA 1MNSA 3G1YA 2ADAA 3HMJG 4Q8VA 4JTEA 1F61A 3WQWA 3THUA 4H41A 3DGBA 4ZCWA 4N9BA 4B90A 2RKXA 3DX5A 1KXQA 3QF0A 1EP3A 1W1TA 3N2CA 3AO0A 3MWAA 1UKQA 3H12A 3WMCA 4H01A 3LQGA 3LV5A 3LHWA 3PZMA 2GSHA 4LAKA 2CZVA 1N2VA 3RIKA 1S2VA 1XDMA 3QYSA 1M03A 3DEQA 3LERA 3WDHA 4Z1YA 4ASTA 2C8NA