1TVNA

Cellulase cel5g from pseudoalteromonas haloplanktis, a family gh 5-2 enzyme
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
293
structure length
293
Chain Sequence
b'AVEKLTVSGNQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATKYGQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAIDPDNLIVVGTPTWSQDVDVASQNPIDRANIAYTLHFYAGTHGQSYRNKAQTALDNGIALFATEWGTVNADGNGGVNINETDAWMAFFKTNNISHANWALNDKNEGASLFTPGGSWNSLTSSGSKVKEIIQGWGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulase
molecule tags Hydrolase
source organism Pseudoalteromonas haloplanktis
publication title Structure of a Full Length Psychrophilic Cellulase from Pseudoalteromonas haloplanktis revealed by X-ray Diffraction and Small Angle X-ray Scattering
pubmed doi rcsb
total genus 120
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tvnA00
2EPKX 3SUSA 1QBAA 4NF7A 1ODUA 1LLOA 3MO4A 2FGZA 4YHEA 2WVVB 2WANA 3CZKA 4E8CA 7A3HA 4RE4A 4JHOA 4BQ2A 3NSNA 4GIAA 2ZUSA 1XSKA 2WMGA 4OBSA 1JI1A 4Z2KA 3UR7A 3L4YA 4MJ2A 3FY1A 3ZJ8A 2CEQA 3MMWA 2E4TA 2VURA 3VDAA 1BVZA 2DQXA 1QPKA 1M53A 1B3ZA 1S46A 1W3LA 4AZGA 4JFSA 3OLGA 2J8GA 3OG2A 4A3YA 2G4FA 3AS1A 4UNIA 2VX6A 1K9EA 1B9ZA 3WMBA 4Z2IA 4CUCA 1MYRA 4MADA 2J4GA 5HXMA 3SUTA 1E55A 3AMLA 3N17A 2VRJA 3WF3A 1UD4A 1QVBA 4S3KA 3PZVA 5BWFA 2X8RA 3AJ7A 4M8UA 7TAAA 2XVLA 4QDMA 4Q7NA 1WDSA 3ARYA 3WH7A 4M56A 3GBEA 3U5UA 1HX0A 3BAJA 1GQKA 3ECQA 3N12A 4AZCA 1HVQA 1LL6A 1NH6A 2DH2A 4D1JA 2ESCA 4P7NA 3D5HA 4LYPA 2XSAA 2EPOA 3WD0A 1UWIA 1CTNA 2VUYA 3UETA 3SIMA 5A6BD 1CNVA 1FH8A 1BHGA 2JIEA 2VVNA 2JFEX 3MU7A 1ISWA 1EQCA 4HMCA 1E6SM 2BY3A 1U30A 1GOIA 4XB3A 2J7BA 4KMQA 4HMDA 4WSKA 1BGGA 5AYBA 5A6SA 2WHKA 1IV8A 1UR9A 3U7VA 4CU6A 1V03A 1UR1A 4LYRA 2ZOXA 4QCFA 2YBUA 4JFVA 4LX4A 1GOKA 3BH4A 2VR5A 1KBKA 3DYMA 3DYPA 3T2QA 3VGGA 3O6AA 4NRRA 4F9DA 4GZEA 1V3KA 4DUWA 1KCLA 2WVUA 1NWUA 3SCWA 4KGJA 1E71M 1MQRA 2CBIA 3ZT7A 4QLJA 3ALFA 4JAWA 1V0LA 3HMCA 3AIRA 1M04A 5FL1A 3POCA 5D9NA 3OLEA 1JZ3A 2D23A 4W7VA 1V02E 4CD7A 3QOKA 4WIWA 2BV9A 2VCCA 1HF6A 3VUPA 4PSPA 2E40A 1I1WA 1GW1A 3M7SA 1AVAA 3M46A 6CGTA 1RH9A 2DT3A 2CHNA 2BHYA 2J7CA 6A3HA 4D6EA 3CZLA 2NT0A 3OZPA 1ZS2A 4X0NA 5DO8A 3PBGA 3T08A 1V3MA 3EDJA 2PWGA 1CGVA 3AMCA 3EMQA 4TTUA 5IDIA 3T0BA 2WMIB 2IUZA 4AZCB 1HJWA 1R8LA 3CUJA 4CD5A 1VBRA 1BYAA 3WH8A 2WB5A 1J0HA 3J7HA 1R7OA 1QNQA 1AMYA 4P8XA 4AZIA 4HPGA 2YL8A 2ZX8A 3MSGA 3N1AA 2EEXA 3EBVA 1HN1A 1VEOA 2VC9A 4UCFA 1M01A 3PTQA 5ABGA 2WLZA 4MAVA 2JEPA 1PX4A 1NM9A 4GKLA 5GNXA 1ESWA 3QGVA 1X6LA 3CZEA 1J9YA 1GOWA 1CGUA 1F4HA 1V0MA 5E09A 1J0ZA 1HKKA 1ZB5A 4U2YA 1RD6A 3L4ZA 1UH3A 2C8NA 2VRKA 3CUGA 1OB0A 3F5KA 1ZBVA 1PX8A 3EDDA 5CGTA 4GO8A 4FF5A 2YL6A 2ZXDA 3L4UA 3QR3A 4P8WA 3RDKA 3K8LA 3ARVA 5I79A 5ABHA 5FOOA 2QF8A 4AZHA 1HJQA 3WD1A 2J7HA 3UERA 1J11A 1C8QA 4LGXA 1VIWA 1EO5A 1WAWA 3EYPA 2JEQA 4Z2GA 2WC3A 2PBGA 5CGMA 1XD1A 1EXPA 3U5YA 1DWFM 1JDAA 2XWDA 2UWFA 2HISA 1E4NA 3TTQA 1C7TA 3MMDA 3SEPA 3TA9A 4W89A 1TA3A 3CHDA 1DHKA 4MB4A 4DWSA 3CLWA 1HJUA 5M3WA 1K9DA 3ZR6A 4DWSB 5CZKA 2DEPA 3WQ5A 1LL7A 2E9MA 4PMRA 1PEZA 4OJYA 1QNRA 1D3CA 1TG7A 5D4YA 1WZLA 4D1IA 3A4XA 2WVVA 1H2JA 2HVMA 1PZ2A 4HU8A 4J3UA 1QI4A 1FH7A 4TVUA 1ISVA 1JIBA 4OOZA 3WEMA 1EH9A 4ATWA 4J3WA 2OYKA 1H0GA 4W7WA 4ACYA 2Q8XA 1B1YA 2Z1SA 4YPJA 1C92A 3W38A 1WB0A 2IXUA 4AYSA 2EXOA 2VRQA 5FKYA 1JL8A 2WLYA 3B9AA 3T09A 2XVPA 4HP5A 3W6MA 1KR1A 1H3GA 3BAIA 1JNDA 4MNMA 3WDHA 2G3MA 1UR2A 5A6JA 3K8KA 2UY4A 2GJRA 4QLLA 3AIQA 1DWGM 3AS3A 3BXWA 2YDSA 2D20A 1PIFA 1GPFA 3VDCA 5I5RA 4KH2A 1NWTA 1MW2A 1AQHA 2VX7A 1UD6A 2J78A 3AZSA 1G1YA 5D9MA 3M6DA 1RP8A 1HIZA 1C90A 4TVDA 1HKIA 8A3HA 3WL0A 1CXKA 1TA3B 5E6ZA 1WZKA 2CIPA 1R86A 4BA0A 4J3VA 3IJ9A 4HA1A 1MW1A 4CCEA 3APGA 1UZ1A 1DP0A 1L0PA 3W81A 2YDRA 4HTYA 2D24A 4D6HA 1JXKA 2XWEA 2UY3A 4CD6A 3BLKA 3OLDA 1TR1A 2BHZA 1C91A 1UWRA 3NDYA 5AY7A 1B30A 2YA1A 3HJEA 2OYMA 2QV4A 4D6JA 4AW7A 1E1EA 4PCSA 3VVGA 1G01A 1LWJA 4YHGA 3WBEA 1UH4A 2WAGA 4AWEA 5F7UA 3VMNA 3ARTA 3K1DA 1L8NA 4D72A 3KL3A 3O9NA 4Q22A 2JF6A 4C7FA 3VIGA 1W9DM 2J7DA 1E5JA 3WIJA 3N11A 1ISZA 3FW6A 3CPUA 3CIVA 2V3FA 4J27A 3WNMA 4PUEA 4AY1A 1HKJA 1CXIA 3BMVA 3WQ4A 1H09A 4YN5A 4NRSA 4W5UA 1UQYA 1HJXA 1GUVA 2VX5A 3WD2A 4DWSD 1UWQA 3WF2A 3D3AA 2DSZA 1WZAA 3WKZA 2QMJA 3WH5A 1OM0A 1Q6CA 2OLHA 1E6QM 2BVTA 1US2A 2ZUMA 2CCRA 3G6MA 3ZJ6A 4H8UA 3WSUA 3T2PA 1H1NA 2ZUTA 5LA0A 2VZUA 4FLQA 4P7QA 1HJVA 2C0HA 2X2YA 3GH4A 3VGBA 2EO7A 3VIJA 1UHVA 3AZRA 5ABFA 4CVWA 3RCNA 1UWTA 1JZ7A 2E8YA 3B8SA 3K4DA 2WWCA 2ZE0A 1W9VA 2ZX6A 4J7RA 4PN2A 4WF7A 1W9UA 3W6LA 1KGWA 1C7SA 1XH0A 3VD5A 3WQ6A 4H41A 1MW0A 4GZIA 1IT0A 4NZCA 2OSWA 1VFMA 2XIBA 2DDXA 3U57A 3K4AA 1B3VA 1E4IA 1V6UA 1QHZA 1CGTA 6TAAA 1ZJBA 1VRXA 3ZOAA 5FD0A 4AIOA 4HPHA 2FHCA 5DEZA 3AIUA 1BSIA 2FHBA 3EDFA 3FXYA 4J3XA 3PN8A 3BC9A 3WUEA 5I2UA 4OBRA 4XZWA 5IHRA 3ZSTA 3WF4A 3II1A 1XH1A 4CU7A 3PZGA 4AIEA 3ARZA 3CBWA 2WSKA 3JUGA 4AD3A 4CD8A 1O6IA 2VVSA 5CQ1A 1ISYA 2GDVA 1BYCA 3CUIA 2RGMA 4UTFA 2XHYA 2ZUVA 5CLWA 1E6PA 1JNEA 2VL4A 5CPSA 1W1YA 4Z2LA 1J10A 1JYXA 2YL9A 2QMKA 3AHXA 5FCZA 8CGTA 1CYGA 4QCEA 3PHAA 1W32A 1UH2A 3WDPP 4PMXA 1E43A 3VIHA 1E1FA 1WE5A 5A8QA 4B3KA 1Z32X 1B0IA 2Y24A 3LPOA 1KGXA 3VGDA 5DF0A 2GFTA 3KEHA 5DT7A 3A4WA 4CCCA 4TTGA 3SCUA 2O9TA 3GXIA 2BVDA 2YJQA 1CXEA 3AXIA 2V5CA 4F66A 1BTCA 3AXXA 1H49A 3W26A 2F61A 4U3AA 2GK1B 3AI0A 1MQPA 5DMYA 3GNPA 1UUQA 5HDRA 1IZJA 2WBKA 3ARPA 1CECA 3BAXA 5IFTA 1TCMA 1V3IA 1FA2A 3N04A 5A2BA 4W5ZA 4KWUA 4A4AA 4MB1A 4A3HA 4WJXA 5E0FA 1SMDA 2DT1A 3CGTA 4LYQA 4GPNA 3KL0A 3WUFA 4R27A 1W1TA 5JIPA 1ZJAA 4IPLA 2WVSA 2ZIDA 5C71A 2O92A 2E9BA 1KCKA 1SFSA 4W8AA 1UA7A 1JF5A 5A6BA 3N15A 3BSHA 1FFQA 5I23A 4M29A 1FFRA 2O9OA 1R7AA 1QW8A 1K9TA 2ZXQA 1IZKA 5BRQA 2A3AA 3WNLA 4FLRA 2ZX5A 1TMQA 3MV11 5A8MA 3VO0A 1CBGA 5AC5A 3NYDA 4JZ5A 3A47A 3B9DA 2D0FA 3PZNA 1V6VA 5JBDA 1JZ5A 2QHAA 2QPSA 1J0IA 1DWHM 4TX6A 4D6IA 2GJXA 1CGWA 4U33A 5JUVA 4GO9A 4Z2HA 1XHGA 4PYSA 4IM4A 1UR4A 5FIPA 1SR0A 5JIWA 1KFWA 4ACZA 1UG6A 2G41A 3QOMA 4BQ5A 2GK1A 2PC8A 1JZ4A 3VX1A 3LPPA 1VF8A 1U33A 2PI6A 2X09A 4JCLA 3K46A 1WCGA 4QFUA 4K68A 2TAAA 4Y7EA 2VZVA 2WNWA 1C3FA 2ZUNA 1JAKA 2VZOA 5CSYA 2ZX7A 1KXVA 1PPIA 1V6XA 1EO7A 2YLAA 1BAGA 1JDDA 1GHSA 2AOSA 1I1XA 1DEDA 5BXRA 1KQZA 1HL9A 1FHLA 1J18A 1XGZA 4RE2A 1UD5A 3IAPA 3E1F1 1LG1A 1GONA 2J7GA 4JCMA 2XVKA 2XVGA 1TVNA 3GNOA 4UR9A 2MANA 5LA2A 5BXSA 2G8ZA 4ZFMA 2JE8A 1KXHA 4IISA 1OGSA 2DSVA 2ZXAA 4M82A 2BXZA 3TTOA 1SMAA 3WNOA 1UA3A 3VD4A 4N0RA 3DYOA 5E6YA 3POHA 2J7EA 3VNYA 4U5IA 5HOSA 4AEEA 3L2MA 1Q6DA 2FGLA 1M7XA 2VCBA 5CJ5A 3WEOA 4GXPA 2XFRA 2GJPA 2DGAA 2WM0A 2AAAA 4M1RA 5A2AA 3MSDA 1UZ4A 4UQCA 2BHUA 5A6MA 1TVPA 3SUVA 1ZBWA 4X9YA 4F9JA 4B16A 5GPRA 5C8BB 2WK2A 2VO5A 4HA4A 2XM1A 5IHSA 2OWWA 4JKMA 1WP6A 1NOWA 2XFFA 4J3SA 3NJ3A 3GYCA 1XC6A 4TUFA 1HJSA 3OA5A 2PBOA 3DC0A 1GQIA 4V27A 4E4PA 4MTVA 4UQ9A 3ZJ7A 2CBJA 2WC7A 2DT2A 3ZSSA 1KWGA 3WNKA 1NWSA 4W84A 3WL1A 4OOUA 4HZ6A 3N9KA 5AC4A 2WKLA 1C93A 1E6RA 1QHPA 3EMCA 1XSIA 1UQZA 2BFGA 5ABEA 2OSYA 1CENA 5BXTA 4PCTA 4ATDA 4DWSC 2GUYA 1O7AA 4H04A 1UD8A 4CD4A 1OSEA 3L4VA 1H4PA 3VOCA 4MNJA 1OCQA 1BPLB 5FL0A 4MPKA 1OGGA 1QHOA 3VNZA 2WBGA 3BAKA 1R87A 3VPLA 2XG9A 2CKSA 2PB1A 3W27A 5BRPA 1B3XA 1HNYA 2J7FA 3AISA 2XTKA 1ZL1A 4J3TA 2A3BA 5I77A 4CN6A 4TXEA 2E3ZA 3OGSA 1LG2A 3ARWA 2WCAA 2ZUWA 5LA1A 2V3DA 3BCFA 4BCEA 4EKJA 3W28A 4UFHA 1WPCA 5E9AA 3CO4A 2W63A 4NSBA 4CU8A 2C7FA 1E0VA 2J75A 3ARRA 5CLTA 2FDMA 2JIWA 1UD2A 2WZHA 1V3LA 2VOTA 3WQVA 3WBAA 2E9LA 2WMFA 4W88A 4MJ4A 5EMYA 4ZEPA 1V3JA 3RM8A 2JF7A 3VGFA 1JYVA 3CTTA 4PUDA 4URIA 4PMDA 1JD7A 2YDQA 4TOQA 4TX8A 2ZUUA 3F5LA 1QI2A 1GOQA 1V3HA 3RM4A 4E2OA 2FHFA 3I3DA 1BFNA 3FAXA 1E72M 1KGUA 4LPCA 2GJXB 2CNCA 5HPOA 1R85A 1J0JA 1Q6GA 3OLIA 3KL5A 2DH3A 4P8VA 1B2YA 1CIUA 1MW3A 4AD4A 2V38A 4PTMA 4DUXA 3VX0A 4PMYA 4QAWA 1GOOA 1MVYA 1E40A 1QBBA 5I78A 1JGIA 4N42A 4F8XA 3NCOA 4UFMA 3TTSA 2V3GA 5KZ6A 2WPGA 2WHLA 1W1VA 2VQUA 4D6GA 1XD0A 1FH9A 3AIBA 1GHRA 1LJYA 3UG3A 4CCDA 1E6XM 3CUFA 4PMOA 3OGRA 2AMGA 1QI3A 3L4WA 4XX6A 1BG9A 4JKLA 2XFYA 2WHJA 3AHTA 3CZGA 1W91A 1CXFA 1QW9A 4PEEA 2J74A 2OSXA 4GI6A 2UY2A 1BYBA 1BGAA 2X0HA 1G5AA 3SCPA 1KBBA 3PZTA 3S6TA 1B90A 2F2HA 2XVNA 5BCAA 1H11A 4UFJA 1UKTA 2E8ZA 3ZM8A 3EDKA 4M24A 1E0XA 1X1NA 3W0KA 2G3JA 1C8XA 5DT5A 1VBUA 3VD9A 1E70M 1KWKA 4L4OA 5GQBA 4B15A 2BVYA 4CGTA 1Q4NX 1EHAA 2BXYA 5A94A 2W62A 1JDCA 4OZOA 2J47A 2BY0A 4W8BA 1CZ1A 5EBAA 3WELA 1EDTA 2GVYA 2VJXA 9CGTA 4PMQA 5CSUA 2F8QA 4XV0A 3HN3A 2OWCA 4AXNA 5M5DA 3VGHA 3WFLA 4LXFA 4H8VA 4H8HA 2PWHA 1XSJA 2UY5A 3THCA 4W85A 3EDEA 3A6OA 1XH2A 1GJUA 4AMCA 4UZSA 2PWEA 1K9FA 1A3HA 1E3XA 4B3LA 2GDUA 1AQMA 4MAZA 3VM7A 4XUYA 3DECA 3VDBA 3HU7A 1E73M 3ARXA 4UOJA 3IJ8A 3VILA 1EA9C 3GXFA 2EQDA 2VTFA 3IAQA 3SCRA 3WD3A 5CG0A 4HOXA 4JFUA 2WZIA 1HVXA 4UFIA 3VIKA 5BYWA 4OIFA 4W7UA 3FHQA 4UFKA 4GQQA 5CPTA 2YBTA 3QHNA 4U5KA 2DIJA 2YL5A 1CDGA 3WQ8A 2Z1KA 3TP4A 2EPMX 1B31A 3QHMA 2W5FA 1PAMA 4PBGA 1XV8A 1UKQA 4IUGA 2WMHA 4ZE5A 3WENA 3AFBA 2J25A 1V6YA 3WF1A 3F4VA 4M80A 5D9PA 2Y4SA 1Q6EA 3RILA 3K8MA 1D2KA 4UQBA 5A69A 1MFVA 2W66A 4UQEA 2XM2A 4PTWA 2XGIA 5CPQA 2G3NA 1QNPA 1XYFA 1E6ZA 3NDZA 5HNNA 2XUCA 1PBGA 4CVUA 3QHOA 3MUY1 4AISA 3SCVA 3AIEA 4AC1X 2J77A 1CWYA 1EOMA 1TZ7A 1UOKA 1JG9A 1BLIA 3GNRA 1NQ6A 1VENA 3S2CA 4WK9A 3W29A 2YOCA 4WKHA 1W1PA 2O9RA 2D3NA 2W92A 1LL4A 2PWFA 3KZSA 3SCNA 1TFVA 5ABFB 3ZO9A 2WW5A 3ZT6A 3L2LA 1DTUA 2QPUA 3W37A 3PZMA 1J01A 2BY1A 1UKSA 5IXEA 3AYRA 2X0YA 4MB5A 2BY2A 3VIIA 3MS8A 1HT6A 4FLSA 1V6WA 2W61A 4JHZA 1CGYA 3GDBA 3ZJKA 3OGVA 3AYSA 1FP9A 5I6SA 1BG4A 4LQ1A 3AZTA 5KEZA 3VDHA 1OINA 1VEPA 2Y8VA 2ZXBA 1DWAM 4B9ZA 4BQ3A 2FH8A 2WXDM 3IANA 4GINA 1Y7VA 3UCQA 3MUIA 1WKYA 3ALGA 2J79A 3BAWA 1BQCA 1EGZA 4HOZA 4FLOA 4AZ5A 2RGLA 1WO2A 1US3A 1UWUA 2CESA 3VD7A 1VEMA 3OZOA 1W2PA 1GCYA 4P7OA 2D0GA 1CXHA 3OIHA 1AQ0A 1OD0A 3WF0A 2OYLA 3SUUA 3UEQA 5TD4A 4H7VA 1CLXA 1V0KA 3SCTA 3W25A 5A8OA 4CKQA 3TTYA 3ZIZA 4C7DA 1E3ZA 1EIBA 3W53A 2ZWZA 1HL8A 4PTVA 3AS2A 1QI0A 2EPNA 2D2OA 3AHYA 2NW0A 3GZAA 1Q6FA 4ACZB 1U2YA 4EE9A 5BXPA 4JL2A 4EANA 3BLPX 4DUVA 3VIOA 2A3EA 1J0YA 5EFFA 1D7FA 2J62A 5DFAA 4DM1A 1WDRA 5JBEA 4U2ZA 2WSPA 2YA0A 4UOQA 4TVCA 4HMEA 3KWXA 1OT2A 4KRTA 1CXLA 1N82A 3MV01 1E4LA 4DM2A 3AQUA 1OGBA 1KB3A 3CHFA 2X1IA 2ZICA 3PZOA 3SURA 1JYNA 4D6CA 4S3JA 5EFDA 3AHVA 3AICA 1G94A 4FMVA 4AD0A 2D22A 1WZMA 1WDPA 4X0VA 3SCQA 2W67A 4UZUA 1LF1A 3NSXA 4WKFA 2CPUA 1KR0A 5E0CA 1I75A 3MANA 1X6NA 4IPNB 1VFFA 4PMUA 5A3HA 1C8YA 1W9BM 2WMKA 3NUKA 4JKKA 3WMSA 1CLVA 1W2VA 3VIFA 3WY1A 1J12A 1TUXA 3ARSA 3WH9A 3VINA 1BYDA 1GNXA 2VNCA 1B3WA 2DIEA 2EBNA 1G0CA 2D3LA 5M17A 5A6LA 4UFLA 3G6LA 4P7LA 4P8UA 1JFXA 2VZSA 5E70A 1MQQA 3MMUA 5I24A 1W9PA 3CZJA 1VFOA 1A47A 2D0HA 1NP0A 3WMCA 4AD5A 3VU2A 4PSRA 3BCDA 4ATLA 1VAHA 2W4XA 1LWHA 1PIGA 3A3HA 3L4TA 1E5NA 3CMJA 3NSMA 1JF6A 3WDIA 2V5DA 2EJ1A 2Y2WA 1ITXA 2A3HA 2PWDA 4MNKA 4BZYA 2YA2A 1UR8A 2E0PA 2WKGA 1W3JA 5IFPA 2WHMA 3FNDA 3AOFA 2G3IA 1CEOA 3VKKA 1V02A 3KE0A 2VX4A 1SYTA 1JI2A 4HZ8A 4L4PA 5HBFA 1OIMA 5A2CA 3CZ8A 3AMGA 4W87A 5EB8A 5D9OA 3WH6A 3GBDA 4V28A 4UQDA 3VMPA 4W8LA 3LPGA 4BQ4A 2DT0A 5M03A 2O9PA 1JZ2A 1PJ9A 2IXVA 3RM9A 3PZQA 1BVNP 3ARUA 2WCGA 4MNLA 2VR4A 3RJXA 1HXJA 1FHDA 3W4RA 2VMFA 1PZ3A 2X05A 1V0NA 5D8ZA 1GVYA 4M81A 3ZT5A 2NSXA 4MDPA 1BF2A 4AZ6A 4EAMA 1JXJA 3FHAA 2VZTA 1UD3A 1JFHA 1DWJM 1XYZA 2WC4A 4UOZA 4F79A 5JBFA 1OIFA 3OBAA 3N13A 2B31A 3N18A 4AD2A 4PMNA 3T0AA 3T0DA 3THDA 3VIPA 4D71A 3GXMA 4ZXLA 1H5VA 3WN6A 1OWQA 4HU0A 1E15A 1KQYA 3TOPA 5A6AA 2DSUA 1GJWA 3VMOA 2XJ7A 2PF0A 3ZMRA 4FK9A 2WMIA 1JAEA 4OKDA 3SCSA 2A3CA 1H41A 2OWXA 2VI0A 1EDGA 5C70A 3GTNA 5A8PA 2FH6A 1M03A 4BS0A 2WWDA 4GQRA 1JYWA 2XSBA 2BNJA 3LPFA 4R5EA 3CHCA 4CN1A 1YHTA 3AXHA 2WZEA 4NI3A 4PMVA 2WYSA 3AHZA 4D6DA 1NARA 3RIKA 1NP2A 3M07A 1DWIM 4WLCA 4XZBA 2CETA 1E4MM 1QOXA 2EPLX 4AZ7A 2WCSA 1YQ2A 1QNOA 1UKOA 1W9XA 3IK2A 1MXGA 1TE1A 2DSWA 1QNSA 3FAWA 2XPKA 2D1ZA 3B9EA 1OBAA 1ZBCA 2CKRA 3WD4A 1UYQA 2QLYA 2VQTA 4GI9A 4EK7A 1XCXA 1E56A 1V08A 1VJZA 1MWOA 5GNYA 3UESA 1OD8A 4U3CA 1E0WA 3AIVA 3PZ9A 2DPEA 2DSKA 3MUAA 3FN9A 2V3EA 1ECEA 3U7BA 4JFWA 1VB9A 1F4AA 1MFUA 1P6WA 1WNOA 3UG5A 1B3YA 1RP9A 1K6AA 3F5JA 2CBUA 1UKPA 3AROA 3DHPA 3WFZA 4D6FA 2GSJA 1ISXA 3PTKA 1GVIA 4WKAA 4ML4A 4QP0A 1NOFA 3BMWA 5I3DA 4UQAA 3TONA 1VFUA 1H0IA 4ZE4A 3AIWA 5GNZA 4AIUA 1EDQA 2W91A 5BROA 2VT0A 3EMZA 4Z2JA 1W3HA 4MDOA 1W3KA 3SUWA 4W86A 1ZU8A 4JIEA 3MKKA 1UWSA 3PZIA 4QLKA 3VM5A 1VJSA 3ZQ9A 3UR8A 4V2XA 1HP4A 2CXGA 1ZBKA 3BSGA 5A6KA 3WDQA 3WUBA 4ZENA 3AMDA 3AMKA 2Y8KA 1EQPA 3I3EA 3VD3A 3W82A 3CUHA 4RE3A 3WNPA 5HPCA 1MXDA 3LMYA 1PX3A 4GI8A 4W93A 3UG4A 4P7RA 2NT1A 1JD9A 5A95A 1GOMA 1OT1A 4CN4A 2CBVA 2CITA 4PMZA 4OUEA 1KXQA 3IJ7A 1GZJA 2VCAA 4U31A 4HOWA 2CYGA 3PZUA 4WSJA 3T2OA 3RO8A 1EOKA 5LYRA 5ECUA 3AS0A 3GH7A 3NIYA 5D8WA 1G9HA 5I0DA 4JL1A 2XGBA 3RPMA 2WVTA 4AEFA 3PTMA 2XYLA 2JALA 3O2LA 3BAYA 1JZ6A 1HKMA 1J0KA 3WEZA 4ZXOA 4AZBA 4HZ7A 3GH5A 2J8FA 1XRVA 3VGEA 2YIHA 2BS9A 3A4AA 1KXTA 5CXPA 1WDQA 2YLLA 3WUGA 2ZX9A 1RPKA 5A8NA 3WNNA 3L4XA 1HP5A 1CPUA 2CHOA 2ZWYA 4HA3A 4B9YA 1E9LA 1XCWA 2CERA 3CH9A 2XIIA 1JZ8A 3VTRA 1CGXA 3DHUA 3WQWA 1FP8A 1UR0A 4KGLA 5AYIA 3BGAA 3VIMA 3GXDA 3GM8A 1ITCA 4KRUA 3CMGA 4GZJA 2WMJA 4AD1A 3MUZ1 3RJYA 1GORA 2YKKA 1GQJA 1LQ0A 2Y5EA 4PTXA 4H2CA 4C7GA 3CHEA 1QI5A 7CGTA 1ODZA 1FOBA 4J28A 3ZR5A 3OB8A 3ARQA 4E8DA 4JFTA 4MB3A 5A1AA 4BF7A 3RMEA 1NOUA 3W24A 3I3BA 1E6NA 3WDRA 1NWRA 3WDJA 3SCOA 4PRWA 4RL3A 1GQLA 1EHNA
chains in the Genus database with same CATH superfamily
3IK4A 2EPKX 3SUSA 2VEIA 1GVFA 2VEFA 3M41A 4FHAA 1LLOA 5HANA 4LAUA 3BG9A 2WVVB 1EUAA 3RX4A 4JHOA 4BQ2A 5LIKX 4NJHA 5AC7A 4I7VA 4NJKA 3UR7A 4MJ2A 1JGMA 3FY1A 3NZ1A 4NAEA 3VC5A 4JEQA 2CLLA 1SZFA 3PWIA 1M53A 2ZRZA 4AZGA 1X1ZA 1XS2A 2J8GA 4PL2A 2XFWA 2PLMA 4UNIA 5I03A 1XBYA 3FVMA 5HK4A 1MYRA 5BMWA 1I2RA 4P5UA 1XGDA 4MADA 3SUTA 2RDXA 3W86A 1UD4A 3LHWA 2F6KA 1DL3A 3BJTA 2P0OA 3RO6A 1R3RA 2X1SA 4DJED 1MZRA 4JY8A 3RLUA 7TAAA 4AVOA 5CG7A 1C9WA 2VGIA 3N12A 4N7QA 3W7PA 4HK6A 4HK7A 2PDFA 4BI7A 2G5WA 3LI1A 2YDAA 1H1ZA 3TXZA 4ZQMA 2VVNA 5CPMA 4FX8A 1E6SM 1F5ZA 2BY3A 1BQGA 4BF5A 4H9ZA 3HZ3A 1F6KA 4PRTA 3W9ZA 5A6SA 2OT1A 4YJ5A 2F6UA 1WXJA 1XI3A 4O54A 2I5IA 1ONWA 4QCFA 2YBUA 1UIPA 3BH4A 2YR1A 3M0ZA 3DYMA 4IF2A 4HHPA 3DYPA 4QQUA 1S1PA 3R13A 4YS1A 2WVUA 3SCWA 1E71M 4LUYA 3SAZA 5FF4A 3HMCA 1M04A 1OFOA 1VH7A 3GVQA 1S5VA 2R94A 3QY8A 3B0XA 4DPQA 4CD7A 3QOKA 4WIWA 3ONBA 4XTIA 3VKBA 2FFCA 2VCCA 1QATA 3H2EA 3PBVA 3LXAA 3LQGA 1I1WA 1H63A 1SSGA 1RH9A 2DT3A 2BHYA 1XUZA 3FJ4A 4GJIA 1LRQA 3CZLA 4IIGA 5C0QA 2NT0A 5CH9A 1X1OA 1F3XA 1ZS2A 3FIGA 5DO8A 3PBGA 3T08A 4LCRA 3AMCA 3MQTA 2WMIB 5D33A 1HJWA 3CUJA 2QAFA 1JPDX 3TZNA 1AMYA 2J6XA 3L2IA 3C0QA 4FSAA 4NIRA 4HPGA 2YL8A 2O7QA 2ZX8A 5L6UA 3TSMA 4Q4QA 3U48A 1RQHA 4O17A 3IWPA 5E0KA 2WLZA 1PX4A 4S3AA 1NM9A 4GKLA 4XISA 3CZEA 4IQDA 1J9YA 1GEHA 1IE7C 1CGUA 3IV3A 4IFRA 3SY1A 2CZFA 1J0ZA 1HKKA 1ZB5A 4U2YA 3KBMA 3TCSA 4I5XA 1UH3A 3IIPA 1KRBC 1FWEC 1XP3A 4QGCA 4LWWA 3K8LA 1EJUC 1PB0A 5FOOA 3EA1A 3K2GA 1SM9A 1Q63A 2DJLA 4PFMA 5KZMA 1VIWA 2H6RA 1G4SA 2HTMA 3C0JA 2I1OA 3GQYA 2E6YA 3BCJA 2C91A 1AG1O 1EXPA 4Y2WA 3U5YA 3MCOA 1UP3A 4V1YA 3A24A 4JDYA 2YCKX 1QJWA 3FVDA 3TTQA 3T8LA 3ZR4A 3MMDA 3CHDA 3TKFA 5K9CA 1Q65A 1X96A 1RR2A 1HJUA 2R91A 4ZQCA 5CZKA 4S38A 3QC0A 1PEZA 1TG7A 1WZLA 4D1IA 3A4XA 5D04C 2WVVA 4EPKA 4FNUA 4HU8A 1IT7A 4E3VA 4J3UA 2ZTKA 1RPXA 3KTCA 4DZAA 2A1YA 4L5ZA 3N2BA 1ZUAX 1SR9A 2V81A 3WEMA 4J3WA 3KP1A 4XZNX 2Z1SA 1XGEA 1C92A 2Z2BA 2PWUA 1GT8A 2WLYA 3CV2A 2VFHA 3T09A 2QJMA 2UBPC 3W6MA 1WYIA 1JNDA 4KETA 2HNHA 1W5MA 2VR2A 2Z28A 2UY4A 2GJRA 4JR5A 1DWGM 1S5WA 3IGXA 2FTYA 3A3XA 3VYLA 3URBA 3VDCA 2PDCA 1VFLA 4LYKA 4FXRA 4I90A 4TVDA 3I6RA 1NSJA 2GVEA 8A3HA 4AF0A 5E6ZA 1L2UA 1WZKA 2CIPA 1R86A 2PU0A 3QTPA 2D69A 4J3VA 1DIEA 4HA1A 1MW1A 1DP0A 4KRZA 1ZNNA 4HJFA 1VRDA 2QIIA 4HTYA 3EEGA 4D6HA 4A6GA 2UY3A 3QTGA 3BLKA 3QV8A 1TWWA 1TR1A 3A21A 4GIRA 4DAFA 4Q8OA 4QJ4B 3NVDA 3P61A 4YLWA 5AY7A 1K03A 4JN8A 4LV4A 3GHRA 2ISDA 3HBLA 3DUGA 2PSNA 2QJGA 1XFBA 3VMNA 1CT5A 3SW6A 1LTDA 2H8XA 5BOFA 3UR2A 3BQ6A 4C7FA 3VIGA 4ADTA 3CUZA 1E5JA 3N11A 1ISZA 4RNHA 1O95A 3MP5A 2PUZA 4UTUA 1U5HA 2FMNA 2V3FA 3A9BA 1MUWA 3BMVA 4NRSA 1HJXA 3WBYA 3D3AA 1Z69A 1WZAA 3WH5A 2BVTA 4K1GA 2ZUMA 5FJOA 4H6RA 1XYMA 3E2SA 3P0XA 3V7PA 1LT7A 3OHMB 5EMJA 5F1UA 5ABFA 1W1IE 4EF9A 3RCNA 3GRIA 4C6FA 3HIJA 1JZ7A 2E8YA 4FOJA 3K4DA 3KBWA 5D2XA 2ZE0A 3LZ3A 1TELA 3W6LA 1AA1B 1Z41A 4JICA 1TPUA 4GYFA 2HDJA 4BF9A 4NZCA 4JYDA 4QBXA 2QCNA 5MKGA 4S3GA 2DZPA 5REQA 1B3VA 4GACA 3DGBA 3TWBA 1RSCA 2WKJA 4MGGA 2Y8UA 4MY1A 1CGTA 4ZVJA 3IVTA 4Q8WA 3UZXA 3WLHA 3ZOAA 3F4DA 3AIUA 1BSIA 3VE9A 2IW0A 3MSYA 4J3XA 1VLWA 4KERA 3BC9A 1FQ0A 3WUEA 1LLZA 3EX6A 3GNXA 2DIKA 3Q58A 1KTNA 5E5CA 1P4CA 5KINA 2RAGA 4AIEA 3ARZA 3R8HA 1IEQA 3MBDA 4NXSA 4IX2A 2NVDA 1J4EA 2FB3A 2HK0A 1BYCA 4H19A 2XHYA 2JQXA 1RLDA 1R9YA 3KVKA 1KFBA 4YXGA 1W1YA 1J10A 2OKOA 1JYXA 2GVJA 2QMKA 4K39A 1XLMA 3TZFA 3EB4A 3R11A 4QCEA 1I0BA 1W32A 2QCEA 3VIHA 1E1FA 5A8QA 3U4FA 3MUXA 5FJUA 1J79A 1IR1A 5DT7A 2NSOA 5HNRA 1PO9A 2B7PA 4FAMA 5EL1A 3QPYA 3PSVA 2VEKA 1KD0A 3GXIA 1FWTA 4TU1A 2BASA 4Q8QA 4FF7A 2RHGA 3W26A 3STCA 3S5YA 2Z1VA 1KM2A 2CLEA 1JRBA 2V5LA 3GNPA 2E77A 2TSYA 5HDRA 3T07A 4CNUA 3THUA 1IZJA 1M6JA 1CECA 3S4TA 1TCMA 3C2OA 4XSLA 4C6JA 3N04A 1YYAA 4W5ZA 4A4AA 1PTGA 2W79A 2XDFA 4GUIA 2DT1A 1DVJA 1VFSA 3BOXA 3WUFA 3NM1A 2WVSA 4DF2A 4E2BA 3DG7A 4W8AA 4DYJA 1JF5A 3CS2A 5LKYA 1YRRA 4JNZA 4G1KA 2ON3A 3W7GA 4AC7C 1FFQA 5I23A 3M0YA 4NJIA 3HPAA 4C91A 2ZZ6A 2O9OA 3FCPA 3T4CA 1X97A 3NPVA 3G18A 1IZKA 2VFIA 4HNNA 1FWAC 5G2WA 2QQ6A 3KVJA 2DZBA 4CQAA 3QSRA 1TMQA 3VO0A 1CBGA 4DJDC 1FY6A 3NYDA 3M0KA 4PUMA 3LEPA 4ZR8A 4CNNA 2PRMA 3LY0A 1R5YA 2PTWA 4D6IA 3PG9A 2GJXA 4U33A 3KWSA 4ZO9A 2WPBA 3S5NA 2V82A 3OHIA 4GVFA 3QOMA 3QY6A 3IIXA 4BQ5A 2XU2A 4PTNA 2Y88A 2FGBA 2C19A 2PI6A 2R24A 3WLJA 4GHRA 3TYCA 5DY2A 1EX1A 1POKA 3DX5A 5C9XA 3GXPA 4UTKA 4QFUA 2TAAA 2I9EA 4OGZA 1NFBA 2BZNA 1HO4A 5FF0A 2RUSA 1R3WA 1I4NA 4PUWA 5I02A 1PPIA 3VCCA 2V69A 1V6XA 4UTJA 3QH2A 1HO1A 1BAGA 2AOSA 4O28A 5DCDA 4HSNA 1ICQA 4I9AA 3IGSA 1XDLA 1KQZA 3PM6A 1HL9A 3VOHA 4MVAA 1XGZA 1J18A 3L68A 3E1F1 1LG1A 2VKZG 4LUJA 1TVNA 2PCQA 2JE8A 3B8DA 1HUVA 4DO7A 5BZAA 2DSVA 2GGHA 2R1MA 3P8IA 1OX5A 3TTOA 2HCVA 3MI3A 3BLLA 5LGZA 3VD4A 3DYOA 2J88A 2YYUA 3SQSA 2XH2A 3VNYA 3ITGA 1EJXC 3VKJA 4AEEA 3N9RA 5CJ5A 5HWMA 3PP7A 2GJPA 2DGAA 3R0KA 1UZ4A 5A6MA 3SUVA 4X9YA 5C8BB 2WK2A 6ENLA 4HA4A 3DFQA 3MYOA 4DF0A 1BKHA 1SJDA 4JKMA 4Q8VA 5XIMA 4O0QA 2XIQA 2PF8A 5G4HC 3PANA 2Q8LA 3GYCA 1XC6A 5DXXA 4MJZA 3OA5A 4DAIA 4M6UA 3XISA 3DC0A 2J13A 4GK8A 4IJRA 2CBJA 3DFSA 4Y9PA 3WNKA 3H26A 3F2DA 4YYCA 3WQDA 1H7PA 3NQ6A 3E02A 3LM3A 4M19A 4HZ6A 3N9KA 1FCVA 4YMZA 3PBYA 4IP4A 3LXCA 4FNSA 3WX7A 1LRNA 2BFGA 1XWYA 2OSYA 4PCTA 3WLPA 3I65A 1O7AA 4H04A 4CD4A 1OSEA 1H4PA 4MNJA 3V0SA 5FL0A 3VNZA 4DI9A 3DN5A 1R87A 3N2XA 3W74A 5J04A 4HNLA 4L9XA 4REQA 4I7UA 5BRPA 2V5BA 1B3XA 3DAQA 3LHZA 3SRHA 1LLWA 2A3BA 1V79A 2E3ZA 1XIEA 4S3DA 5JH2A 3FYPA 3CAKA 1LOSA 4EKJA 2R6OA 4AX6A 4IP5A 1RJPA 2A3LA 1BF6A 4N6FA 4DB7A 1DOSA 1E0VA 2J75A 4F4RA 3ARRA 5CLTA 2FDMA 2ZADA 1I8JA 2VOTA 4FIQA 5EMYA 2CLOA 3WBWA 3WLTA 3RM8A 1JYVA 2OZ8A 2Y5JA 4URIA 1GYNA 1SZEA 5AOUA 4Z1AA 3ORWA 1RA0A 1OFRA 1W56A 3RM4A 4QSFA 4MWAB 3LM7A 1E72M 2AAMA 3P6LA 4QDPA 3A64A 2QJIA 4LAOA 4PRRA 1ZJIA 1R85A 4MOZA 3FKRA 1Q6GA 2NXIA 4Y9NA 3SGGA 3ZZ1A 2ASHA 4O8AA 4YNGA 1PE1A 4DNHA 2B0MA 4EPBC 2HXTA 1CIUA 3A3WA 3NZQA 3CL6A 2YW3A 3OVQA 5FEPA 4DZ5A 3FV9A 3C2YA 4OFCA 5CCZA 3DOPA 3MTWA 1Y5WA 4DJEA 1XIMA 4D6GA 2DORA 3TK7A 2OGJA 2PDQA 4CCDA 1E6XM 2E68A 2G97A 4JKLA 3W88A 4HPNA 2WHJA 4D8ZA 1W1A1 2ACQA 3CC1A 4RV3A 3GKAA 4HZMA 1G5AA 3SCPA 1KBBA 3UZJA 4IMGA 1B90A 3S8HA 2F2HA 1M9HA 5BCAA 4JDBA 4JN7A 3G1DA 2PDIA 3ZM8A 2HV5A 1OZMA 2GZXA 3UA4A 1VBUA 5JH1A 1KWKA 1AMKA 4OHQA 4NAEB 4CGTA 3GC4A 1Q4NX 2Y7EA 1EFZA 2AL2B 1JDCA 4OZOA 4W8BA 2BY0A 4K8EA 4XK2A 2FLIA 9CGTA 2F8QA 4GQGA 3HN3A 2CW6A 3WFLA 3SR7A 4H8VA 1OK4A 2OEMA 3E2VA 2PDLA 2PWHA 4FXSA 5IRPA 1A5UA 3N9SA 2UY5A 2DZAA 1G69A 4R7OA 4LU0A 2HMCA 4UZSA 1K9FA 2OODA 3VM7A 1W5QA 4LBRA 3O3RA 1D8WA 1E73M 3B0VC 1D3GA 3R4IA 4HOXA 3D46A 1JPIA 3BPWA 4JFUA 1SW0A 2PP3A 4OIFA 3P74A 3OG3A 4QNEA 4V1XA 3FHQA 4PCPA 2PDNA 3W7DA 3NQCA 2YBTA 3QHNA 1E1CB 3CXOA 2DZUA 3BV7A 3WQ8A 2EPMX 4GVIA 4LEQA 3WLMA 1XV8A 1UKQA 4UCGA 1UP2A 1RD5A 2NQHA 1XDMA 4G8TA 2F6XA 4ZOEA 1Y5VA 2W0UA 3WENA 4WOQA 4HGXA 3WF1A 1UBSA 1FWGC 4GCXA 1FCBA 4M80A 4NNBA 3ITOA 4P61A 1IWAA 1Q6EA 2YW4A 3RILA 3C0SA 3FJNA 3CASA 3G24A 3NG3A 4PTWA 2XGIA 3L21A 3SGZA 2G3NA 3TOYA 3CTLA 5LXEA 3LCFA 2VXNA 3BICA 5HNNA 1PBGA 4CVUA 3QHOA 3MUY1 3G0XA 1CWYA 1EOMA 1UOKA 1BLIA 1H61A 3GNRA 3W29A 1JCJA 1KKRA 1MZHA 3L67A 4HA0A 1W31A 1ZJHA 2O9RA 4YL2A 1LL4A 2PWFA 3QRHA 3CV6A 3KZSA 5ABFB 2WW5A 2Q3RA 2Q71A 1DTUA 2QPUA 5I07A 1KRAC 2ISWA 3W37A 3EKZA 4IMDA 5CZTA 4US5D 3DXIA 3HGRA 4FR1A 5HULA 4I6VA 3NO1A 2BY2A 3DFHA 3U2ZA 2BDQA 2QCGA 1V6WA 3SJNA 3CIWA 2W61A 2Z7KA 3VZXA 1H7NA 4JHZA 2O0TA 5CAHA 1CGYA 1GYMA 3LX9A 2R9RA 3AZTA 5KEZA 4MG4A 3N3TA 2A6LA 4IHCA 2FH8A 1VCGA 1VPXA 3MUIA 3ERPA 2J79A 2RFGA 3BAWA 3VNDA 4DLMA 2FPYA 4HOZA 1WO2A 1DJWA 4XVEA 3VD7A 3OZOA 1W2PA 4C6OA 1CXHA 3OIHA 3N19B 4KIRA 5B7YA 4JTUA 2OYLA 3UEQA 1FKXA 1IXPA 1V0KA 2UV8G 3W25A 4CKQA 3TX9A 1EIBA 3W53A 3PSWA 2QUVA 1QI0A 3W83A 3B3DA 2NW0A 3GZAA 4RK8A 5PTDA 4ACZB 1PS9A 4EE9A 4EANA 1IEWA 3BLPX 4IX0A 1G7VA 1D7FA 3LYEA 2X7WA 4U2ZA 4UOQA 4HMEA 5DCEA 3CIXA 3UCDA 2F2KA 1CX9A 1EP1A 4DM2A 3CAWA 1LOLA 4JTGA 4LNYA 4ICMA 2ZZ3A 2X1IA 3SURA 4D6CA 3AHVA 3AICA 1XLGA 3JZEA 1Y8BA 2O7SA 1O60A 1IHIA 3DFTA 4IGNA 1XLHA 3EZ4A 1WDPA 2NWRA 4M5PA 3NQVA 3C6CA 2AQOA 4WKFA 3VXGA 3MANA 2Y7FA 5RUBA 4CQ8A 4IPNB 4PMUA 5E9XA 3UJRA 4JKKA 2B4GA 5T9CE 1YTKA 3UW6A 1CLVA 3VIFA 1Y5XA 3WH9A 3PUOA 1BYDA 3U0HA 2EBNA 4KPLA 2V67A 3G3MA 2ZRVA 4PCFA 1W54A 2HS8A 4ORMA 3NM3A 4R88A 2VGFA 1VHCA 4P7LA 5I3IA 1JFXA 4S23A 5SWUA 3H2FA 1HFBA 4HNTA 1W9PA 3IS4A 1GZ1A 3LXBA 3CZJA 3HV9A 2E6FA 2ZVRA 3NQDA 1NDYA 2PE4A 2CFFA 3WMCA 7REQA 1A50A 3VU2A 1HKVA 1M65A 1GZGA 3N34A 2J8TA 2W4XA 3RCMA 3L4TA 1TJPA 1E5NA 3CMJA 3QPEA 1K1DA 3REQA 2V5DA 3CEPA 2A3HA 4MNKA 1NDZA 1L9WA 4LRTA 4H2HA 5IFPA 2G3IA 1EEXA 2Z00A 3RLHA 1KM5A 2VEMA 3H2CA 1GG0A 3PR2A 4HZ8A 5HBFA 1K8ZA 5A2CA 4OWGA 3K4WA 4W87A 4KW2A 4BJHA 2Z2AA 1W5OA 2C16A 4V28A 4W8LA 3Q37A 3LPGA 3EA2A 2DVTA 3PZQA 2WCGA 1K02A 4HN4A 3MCMA 2YBVA 3S9YA 5HQLA 4LSBA 3RJXA 3KVMA 2GL5A 2DU2A 2VMFA 1R2SA 2X05A 3WFAA 2TPSA 3MP3A 3ZT5A 4R9XA 3KM8A 4FP1A 5F4WA 1UPPA 2VZTA 1UD3A 1TSIA 5IBXC 2PTZA 4UOZA 3H8AA 4JBRA 1IYXA 5JBFA 1AZ2A 4MFEA 1EB3A 2GQAA 3UVIA 4PMNA 2PGRA 3VNLA 3GXMA 4ZXLA 5LIXX 2VEPA 3WN6A 3P2VA 4FXJA 1KQYA 1GJWA 4KEZA 2BGSA 2QDEA 3EX4A 1DIKA 1H41A 1EDGA 1OF6A 5C70A 3PF3A 1EJWC 1Q5MA 5AYZA 3B40A 4BS0A 4GQRA 3FDKA 3H2OA 1P48A 2I5GA 3LPFA 4R5EA 4GQBA 3U6WA 3GFZA 4NI3A 3UG8A 3E0VA 3ZWTA 3BLEA 1AW1A 4DY1A 4D6DA 1X8CA 3FSUA 7ODCA 5DANA 1NP2A 2Q02A 3M47A 3QGAC 1I6NA 1IEVA 1QASA 1S2AA 2OOGA 2WCSA 1QNOA 1W9XA 2OCZA 4IFKB 3UA3A 3FAWA 4KEMA 3HURA 4IICA 3B9EA 1PKMA 2CKRA 4GC4A 4EK7A 4GI9A 3MDUA 4A29A 1E56A 3W1AA 1MWOA 1PCWA 2OJPA 5REQB 3EOLA 4KF1A 3UESA 1T7LA 1E0WA 3AIVA 3PZ9A 2DPEA 3KLKA 3MUAA 4GE8A 1JDEA 2IMRA 4Y96A 3CV7A 4JFWA 1KA9F 4N4QA 4JHMA 3F5JA 4W9TA 4GFIA 4LANA 2CBUA 1LYXA 2Z1BA 1T6MA 2VFDA 2P3ZA 4D6FA 1ISXA 1XDJA 3PTKA 3QGKC 3DBPA 1O4UA 3TONA 1H0IA 1B57A 2P3EA 2ABBA 3QW3A 2W91A 3EMZA 4Z2JA 3AWOA 2A4AA 3W72A 1ZU8A 3HPZA 3MKKA 1EC8A 1QT1A 3PZIA 1EJRC 4QLKA 3MPGA 1VJSA 3REQB 3VM5A 3UR8A 4V2XA 1XLCA 3AWNA 1FWFC 3T0CA 3LCWA 3AMDA 1IWBA 2QJNA 1J6OA 4MMWA 4R53A 2Y8KA 4GQ0A 3VD3A 3W82A 1O1ZA 3LMYA 1PX3A 4GI8A 4CEUC 3UG4A 3E3HA 1BXNA 5A95A 4CN4A 1XLAA 3O0KA 1Y0EA 2PZ0A 5C9UA 4PMZA 2FDSA 3VA8A 3IJ7A 3ABRA 4U31A 2ISVA 1FWWA 1KBIA 5LYRA 4DJDA 3BGJA 1DJNA 1ADOA 4BK9A 4LVAA 4JL1A 2XGBA 1H60A 4AEFA 1D3HA 2OZ3A 1WAUA 1KLYA 4LH8A 4ERGA 2C18A 1I0DA 5C6MA 2JALA 1J0KA 4MY8A 5EYWA 4HZ7A 3VGEA 3W2JA 3WUGA 5LHFA 1G4EA 1RPKA 3DI1A 1HP5A 5XIAA 3L0KA 2CHOA 3TR2A 3U2CA 3EWWA 4AB4A 1XCWA 2QUNA 3RYSA 3LERA 3LDVA 2ABAA 1CGXA 1XYCA 1TTQA 3DHUA 4CQCA 4WY0A 3QXBA 3IUHA 3VCNA 3OTRA 3T0TA 2VWTA 3UPMA 4KRUA 3VE7A 4AD1A 4ZGYA 3RJYA 1TRIA 4B5VA 3O1NA 4C7GA 4Q4MA 4ONVA 7CGTA 1ODZA 4LAZA 3BLOA 1FOBA 4L9ZA 4J28A 3ARQA 3FSTA 4Q8MA 3MMTA 4LTSA 5A1AA 2NUYA 1NOUA 3W24A 4N4PA 1TWIA 2CLFA 1NWRA 1Z89A 4NP7A 4V15A 3WDJA 2G0WA 3SCOA 3G1FA 4RL3A 4A2RA 3UQNA 4NAFA 2NZLA 1NTHA 7PTDA 1ODUA 1ITQA 2HE5A 5FF2A 1YDYA 3MO4A 4GJ1A 3CQKA 4AWTA 2PDJA 2WANA 4LUTB 1V5XA 3E96A 1XSKA 3HGOA 3RU6A 4OBSA 5C2CA 3C56A 4H3DA 3O8AA 1RUSA 3ZJ8A 1RY0A 3E38A 3SSJA 3VDAA 1QPKA 3LB0A 5AVHA 2RDUA 5C9WA 1W3LA 4KBXA 4JFSA 3DI0A 1EJ7L 1FDJA 1K9EA 3WMBA 4JYEA 4Z2IA 3GK0A 4XAGA 4RDZA 2J4GA 1E55A 2WZTA 3AMLA 3NZPA 4P2VA 3WF3A 3MA8A 1QVBA 1TWZA 3TAKA 4M8UA 1H51A 4IIHA 4CCZA 3ARYA 3WH7A 4M56A 1W3TA 3BVJA 3PUGA 3BV4A 3ECQA 3EWZA 1G4PA 1HVQA 3QW4B 3QR1A 3N4EA 4BKNA 1NH6A 1AQFA 2KAUC 4L4MA 2EPOA 2XIMA 3WD0A 2VGGA 1CTNA 3UETA 5CJMA 1H7OA 3T55A 5EA9A 3SIMA 2JIEA 4DELA 1BHGA 4O18A 5C9RA 3CL7A 1P6BA 3MU7A 4K2SA 1EQCA 4J2PA 1U30A 3ENLA 4ICCX 1O1HA 3H22A 2J7BA 1MEHA 4KMQA 5AC8A 4HMDA 4WSKA 1EJTC 4IIBA 2HVNA 3U7VA 4MY9A 4QNWA 1V03A 4CU6A 4LYRA 3HQOA 4DBSA 4JFVA 1SGJA 2Z4GA 2XZ9A 4HU3A 2YB4A 1RALA 4NRRA 1EF3A 4F9DA 1V3KA 1IWPA 1KCLA 1SO6A 1VS1A 3KXQA 1MQRA 2HROA 3AYVA 2PS2A 4LBUA 3ZLGA 4RZ5A 2VDHA 4D9PA 3AIRA 3POCA 4A05A 4HQVA 4L1GA 1OCBA 1XFCA 3TW7A 2CLKA 4O1AA 3W70A 3M0HA 2ISSA 4J35A 4S3BA 3VUPA 3GTFA 4A21A 5T91A 3M7SA 2JGYA 1AVAA 3PAOA 2J7CA 1ECQA 6A3HA 4D6EA 1XLJA 3OZPA 4I9JA 1AJ2A 1OABA 5CZJA 4QHRA 1CGVA 4TTUA 1XKJA 4XZIA 8XIMA 3T0BA 5LNRA 3LOTA 3P0WA 4CD5A 3IJQA 1OHLA 1VBRA 1EJSC 1YDVA 3NO5A 2AGKA 1OQFA 4ILSA 4NNAA 1XIIA 3ICJA 1T0OA 3T78A 5U7SA 4S3CA 4PUJA 4UCFA 1K4HA 4Q4OA 3PTQA 1RA5A 4MAVA 1SFTA 1U83A 4O1FA 3QGVA 1X6LA 1GOWA 3S1UA 3FLUA 3I7QA 4XZLX 1GG1A 1RD6A 3L4ZA 1OB0A 4FEZA 3EDDA 4DWDA 3QR3A 4ZQNA 3L4UA 3VC6A 4P8WA 3RDKA 1GJPA 1TE6A 2CHRA 2O55A 1TWDA 3ARVA 4DYEA 1FWIC 1HJQA 3WD1A 2J7HA 1AH4A 2Z1WA 1OG0A 3UERA 1J11A 1SQ7A 1ZP3A 1A3WA 1R30A 3ZXWA 4H4IA 4J9JA 4HNOA 3EYPA 4BEQA 8RUCA 3EXRA 3WJXA 2VWSA 4Z2GA 4KKXA 5CGMA 1XD1A 4ZO8A 5CPNA 2A21A 2UWFA 2ALDA 7ENLA 1F3EA 4PC8A 1QPQA 2HISA 3TA9A 4NZ5A 4WZHA 1XLBA 4KCVA 4JTAA 1KBLA 1DHKA 1YDOA 2VOMA 2SFPA 4Z1YA 1P0KA 4DWSB 3GFYA 3GG7A 4PMRA 5TF0A 1QNRA 4IMCA 3VZZA 1D3CA 5D4YA 2FTWA 3TYEA 2HVMA 3GDTA 3DKJA 3K1GA 4TVUA 1ISVA 1JIBA 4OOZA 1YPFA 3ZFHA 1H0GA 4FXFA 4ACYA 3N2MA 1A53A 1SJBA 4YPJA 3OYZA 4MJMA 1WB0A 1AH3A 2X30A 4UWMA 5FKYA 2GOKA 2TYSA 2XVPA 3LTPA 4HP5A 3PULA 3RITA 3FYYA 3BAIA 1VJIA 2P50A 2G3MA 3F7JA 1AJZA 1UR2A 5A6JA 3FJ6A 3GDLA 1Q85A 2D2JA 3KOXA 2DFAA 2YDSA 2D20A 3QV9A 1GPFA 2MNRA 4KH2A 4KWWA 2WJZA 4DLFA 5HQEA 5LHEA 2VX7A 4Q8TA 1PCKA 2J78A 3AZSA 1G1YA 1ME9A 3W1XA 3TFXA 3M6DA 1C90A 3R8RA 1ZAHA 2ZTJA 4Y9AA 2V68A 5K2ZA 2R1NA 3A5VA 1HKWA 3O0FA 3W2UA 2BG5A 4XD5A 3TU9A 1UZ1A 1V6TA 3ITCA 2GVGA 1R46A 3GUGA 3SECA 3GHTA 3YPIA 1TTJA 4XSMA 1F05A 3OLDA 5E93A 2HWGA 3GC5A 1C91A 4X9SA 3TV8A 3GUWA 4LF1A 4JD4A 2YXOA 2NQZA 1B30A 1YBQB 2YA1A 3CAQA 3HJEA 1NU5A 2R14A 2QV4A 4AW7A 1E1EA 4PCSA 1LWJA 5TBOA 2FPTA 2CLMA 3WBEA 4AWEA 3TXVA 5B80A 1L8NA 3DFPA 3EWXA 3HF3A 3O9NA 1RAKA 4ZA0A 4L4LA 4Q4RA 1T41A 4G6CA 1N2VA 2QPXA 3SDOA 3KX6A 3CIVA 1PXGA 3RR4A 4IIDA 1CXIA 3NZGA 4XD6A 3QQWA 3ANVA 3M7WA 4W5UA 5D2YA 1QCWA 1R3QA 2DSZA 2BSLA 1B4EA 2CC0A 2QMJA 5FSDC 1Q6CA 4DF1A 2OLHA 1E6QM 1US2A 4S3EA 4LW7A 2CCRA 4H8UA 4IGHA 4IH3A 5LA0A 1A5SA 4FLQA 2Y7GA 3LG3A 2F7FA 4P7QA 3GH4A 3VGBA 1UHVA 3AZRA 4CVWA 5EY5A 4MKVA 3W22A 4R7JA 1QUMA 2OFJA 2I14A 3I4KA 4DEFA 3UZYA 2ZX6A 4J7RA 3WQPA 2DJXA 1C7SA 4QQ3A 4WCJA 3WQ6A 1CI1A 4H41A 1XG4A 1MW0A 4GZIA 1IT0A 2I5QA 4C6PA 1CB7B 1DJHA 2XIBA 3K4AA 4N9CA 3I6EA 4UR8A 3WQOA 1S2WA 3E2QA 1YPXA 4GY7A 4HN8A 3DC8A 1EC7A 2A79A 4QROA 3DGRA 1EWDA 2FHCA 4MF4A 1XPYA 1TPB1 1E9IA 3FDGA 3EDFA 3FXYA 9RUBA 2VELA 6XIAA 4JNMA 4JTDA 3ZVHB 5IHRA 1XKYA 3ITXA 4GFSA 3UJ2A 3WF4A 1QAPA 1F6YA 3II1A 2VDIA 1XH1A 3L0GA 2CXEA 1SPQA 2A7PA 2Z6IA 2HS6A 4O0ZA 1O6IA 3BLIA 3V18A 3UBPC 2DY3A 4UTFA 3M9YA 1F6PA 1QOPA 4LFYA 3GS6A 1JNEA 4LVGA 2YL9A 5CBIA 4QJ1A 2WSQA 1CYGA 1UROA 3TVAA 1E43A 3W7EA 1B0IA 2Y24A 1ZALA 4UR7A 3WQCA 3A4WA 1WBHA 4CCCA 4TTGA 5HUPA 4LUSB 1CXEA 3GVRA 2V5CA 1H49A 2GK1B 4DBUA 5DMYA 2WQDA 3FXGA 1UUQA 3DU0A 7TIMA 5HMFA 1FA2A 2J9ZA 3CPGA 4KWUA 1PYFA 4A3HA 4WJXA 3PS7A 3IEBA 4GPNA 3KL0A 1W1TA 1ZJAA 1EYWA 1ME7A 4J5NA 1LP6A 2E9BA 1J5SA 4AYGA 3IJIA 3M5XA 1KCZA 2X41A 4YU1A 3TYZA 5G5IA 4M29A 1A49A 1FFRA 5JU6A 2OX4A 1O5XA 1K9TA 2QF7A 5FF7A 3WNLA 3CWOX 4FLRA 3NXFA 3QF0A 4Y9OA 2QJJA 4L1WA 5D30A 1SO3A 4US6A 5AC5A 4HPXA 2EPHA 2PTDA 3PZNA 1A0CA 1V6VA 5JBDA 1JZ5A 2Y6ZA 1J0IA 1YX1A 4TX6A 2OGYA 2KZHA 4Z2HA 1EBGA 5FIPA 5JIWA 4B4FA 1OK6A 1PSCA 1VCFA 2G41A 2OT0A 3E6EA 1VIZA 5AFDA 1Q66A 4C6EA 1UZDA 4L61A 1YTEA 3EXTA 4TIMA 1OC7A 2H9AA 3L9CA 4Q8PA 4FNQA 3KOZA 3WQEA 2GWNA 3M1ZA 4Y7EA 2IPJA 2WNWA 1MI3A 3AALA 3PWAA 1C3FA 5C55A 4ADUA 1JAKA 1XYLA 4A3RA 3GU2A 3PJTA 2ZX7A 1KXVA 5CSYA 4BR1A 3TIMA 1CCWB 4IPIA 1GHSA 5B7ZA 1DEDA 3SI9A 2VHLA 2OG9A 4DBWA 1RJQA 4RE2A 1QMLA 3ATZA 1GONA 4AHPA 2J27A 2XVKA 4LY8A 1G67A 1FWBC 5AYYA 3GHUA 3OZMA 3MZ2A 3GNOA 1Q2RA 3BARA 4PZVA 5LA2A 1Q2SA 1WQ5A 3TC7A 4Q6JA 3MVIA 3C61A 3HPFA 3NA8A 2Z27A 3HJZA 1QK0A 4S39A 2ZXAA 3A22A 3HQ1A 2BXZA 2I56A 1VGAA 5IBXA 3WNOA 2I7GA 4H9YA 1GTHA 4N0RA 3A4JA 2J7EA 4C6QA 3G1RA 4YCPA 4U5IA 2EKGA 3LLXA 1M7XA 2VCBA 1BKSA 3WEOA 1F2JA 2QT3A 1RV8A 4D8LA 2XSXA 4A8NA 2C15A 4IFKA 2WO5A 5I3HA 2OQLA 1FDZA 7XIMA 5A2AA 2WV8A 3EB3A 3UZ5A 3C2EA 4UQCA 1ZBWA 3LGGA 1M7JA 3KHJA 2Y0FA 3OBEA 4RCXA 2XM1A 5H1WA 2GVLA 1CB2A 2QVHA 2XFFA 3PUDA 5FEXA 2PRHA 8XIAA 4AY8A 1AD1A 4FZIA 4TUFA 2MUCA 3NNTA 2ZA1A 4MUZA 1UZHA 4DN1A 1GQIA 1F7BA 3WLNA 2FMOA 4MTVA 1I2QA 3ZSSA 4G9PA 1KWGA 3SO7A 4QM1A 4W84A 5HJXA 1EXBA 4OOUA 4NNCA 3MDWA 3R1ZA 5JXQA 4PGLA 1C93A 1QHPA 1NDVA 3B8WA 5DN1A 1XSIA 3U8GA 5BXTA 3JU2A 4ZOBA 3UT0A 1J2WA 4JXCA 3H12A 3H6OA 3EXSA 3L4VA 3URNA 1BPLB 4TX9A 3CWNA 4Q4PA 3C2RA 2WBGA 3BAKA 3TNBA 3VPLA 2XG9A 2PB1A 5GJNA 2QEZA 3QLLA 5BNKA 3G1XA 3LRKA 4J3TA 2IPGA 4CN6A 1S2CA 2OU4A 1GGOA 1X7IA 4TXEA 3T8QA 2RH9A 2YCEA 2ZUWA 3BCFA 4HTBA 4UFHA 4GH1A 2W63A 1IQ8A 4BWLC 1I2PA 3HB9A 2NLYA 2QCCA 4CU8A 1S3TC 1XXXA 1S2VA 3VOIA 2WMFA 1LM1A 1M41A 2CZ5A 4HJWA 5FAGA 1KKOA 4QG8A 1JQVA 3Q4DA 4JGDA 3E2RA 1YKWA 5G2IA 4PMDA 1JD7A 4TOQA 5DRCA 2C1HA 2ZUUA 1Z44A 4KQNA 1I60A 1TV5A 1V3HA 1L8PA 3I3DA 1BFNA 3FAXA 3GDMA 4Z1DA 3V5OA 4LPCA 1HGYA 3BMXA 2CNCA 2FZ9A 5IOBA 1SO4A 4GBDA 5DQPA 2FQIA 2DH3A 4P8VA 3TH6A 3MJYA 3L23A 4LCQA 3BJFA 3O6YX 4PTMA 1FXPA 4DUXA 3VX0A 4L64A 4PMYA 3PFRA 3MBFA 4PBEA 1QBBA 4TQTA 4XZMX 4F8XA 5U4NA 3NCOA 4G5DA 4J40A 3TTSA 2V3GA 3B0YA 2EG8A 4A3QA 3IJ6A 4PR4A 2WHLA 4HYVA 1XD0A 3AIBA 5BU9A 4IL2A 3UG3A 4IOTA 2AMGA 1RBOB 2BODX 4XX6A 1TKKA 1AD4A 3AHTA 1JCYA 1QW9A 4PEEA 3GWQA 4ZSTA 1BYBA 1BGAA 1V7AA 4H6QA 3WK3A 5FACA 2ACSA 1H11A 4UFJA 2DVXA 4M24A 1Q6OA 1X1NA 3W0KA 3TN6A 1BEUA 2G3JA 4JIHA 1M7PA 5DT5A 3I7SA 3LSBA 4XAPA 1E70M 5J5RA 1LOQA 5FJPA 4GYPA 4B15A 2OO6A 2X40A 3NXLA 1OX4B 1MEIA 1QDSA 1FHVA 5A94A 4QJ3B 1L2QA 4UNLA 1CZ1A 1DQUA 1ZFJA 3M64A 3T1GA 3ABSA 2XISA 3CO8A 3HM7A 1TRDA 1K8YA 2GLKA 5HMDA 2FVLA 4XZ9A 5LIUX 1XH2A 3DG3A 1IGWA 2PWEA 4JTRA 3BURA 2BMBA 3FA3A 3ZVIA 2ACUA 4UTMA 3DECA 1SFLA 3LHVA 3ARXA 5CG0A 4GNVA 1OYAA 1XLFA 4O16A 5E1QA 5JQ9A 1AL8A 4UFKA 3E5BA 4O4WA 5DLCA 2D73A 5CPTA 3NGFA 3V1HA 1PHQA 2A85A 5I09A 3TP4A 2O4QA 3QHMA 2W5FA 1U22A 1XPGA 1NEYA 3QN3A 3KRSA 4F0HA 1TZZA 1ZRQA 3FEQA 4ZE5A 4O15A 2REQB 4E2DA 5KMYA 3LHYA 1WXYA 3AFBA 1V6YA 4F0SA 1IXNA 4KT2A 2Q09A 4ZL1A 4XUGA 3K8MA 1D2KA 2CWNA 5FJIA 1KV5A 1MFVA 2W66A 5A69A 1S2UA 1JPHA 5CPQA 1DHPA 3LBMA 4TV5A 3GIPA 4E2VA 5MKGB 1AK5A 3NDZA 3RLVA 2NQLA 1XIGA 2QUUA 2HRWA 2P76A 4AISA 3P81A 4A2SA 2J77A 1TZ7A 4JTJA 3LCIA 4M3PA 1RLCL 4WKHA 4HNVA 3O15A 5KSWA 4JX4A 2D3NA 4Q6XA 4XVDA 2ALRA 4WDUA 3WLKX 1TV8A 3EPMA 3ZO9A 3ZT6A 3L2LA 1J01A 4AMAA 3UNTA 5IXEA 2AQVA 4Z0JA 1PWLA 5AHFA 4JTHA 3COTA 1RBLA 3AYSA 1E1CA 3TMQA 4JTIA 2R82A 4LQ1A 2E5DA 4MIMA 3GG8A 2BOFX 3IJLA 1A4LA 2D2GA 1OINA 6PTDA 1XM3A 5D09A 2Y8VA 2IKGA 1XJBA 1HQTA 3NQAA 1Y7VA 1A3XA 1OFEA 4EPEC 3RXZA 4IGSA 4C6NA 3GVVA 4JTCA 4AZ5A 2RGLA 3B4YA 3SQMA 5CC7A 2CESA 2G50A 3UXKA 1EP2A 4N9BA 4P7OA 1MNZA 3WK0A 3SQLA 1A0EA 1DJIA 3B05A 3NL3A 1AQ0A 1ADDA 2JKPA 3V3WA 2FPVA 3E0LA 3R79A 1CLXA 1JCMP 3UD6A 1THFD 3TTYA 1E3ZA 4C1KA 3EEZA 2ZWZA 3EWDA 3AS2A 3NQ8A 1Q6FA 4HNUA 4JL2A 3F4CA 4O1CA 5I3GA 4Q7IA 4ZB5A 5EFFA 3TJXA 5K4ZA 2J62A 1NQKA 1QW7A 5DFAA 3E5PA 4EVZA 1HL2A 4O53A 3B06A 5JBEA 2XIOA 1NF0A 4WY0F 5CEWA 2YA0A 4TVCA 3PB2A 3QQ0A 3WQGA 1BWKA 1TJ2A 4DZIA 1XLIA 2A0NA 1VLIA 1KB3A 3CHFA 2ZICA 4AUBA 1XINA 2PGEA 5F2LA 4FMVA 4AD0A 2D22A 4GJJA 1UP0A 4Y6GA 2TRSA 1LT8A 3UY8A 4X0VA 3IV8A 3RU8X 4A8LA 5E0CA 1X6NA 1P0BA 3GE7A 1XF0A 3M44A 1Z8AA 4B4HA 2BBFA 4I8YA 1TUXA 1EIXA 3F2BA 5FSEC 1K7EA 1K7XA 3OEXA 3VINA 4UTHA 1GNXA 1B3WA 2DIEA 5G1YA 2D3LA 3ZS4A 5A6LA 2DZVA 3G6LA 2C1IA 4XO7A 1RY8A 4YTSA 4ES4A 3WJWA 2OPJA 3M0MA 4JQ2A 3H55A 3I10A 4DO5A 2D0HA 4RPPA 3M4HA 1CW2A 1UR3M 4PSRA 3BSMA 3LTSA 1VAHA 4I9MA 3A3HA 3C52A 2ZZ1A 3UP8A 2AQWA 3K5XA 1Q45A 1E0TA 5HNTA 2YA2A 1UR8A 4QDWA 2WHMA 3AOFA 2ZVIA 1V02A 5EGRA 5D2WA 3AMGA 5EB8A 5D9OA 3WH6A 3L65A 3VMPA 4WDWA 5G1TA 3DIPA 3KDOA 4BQ4A 4LVBA 2DT0A 5M03A 2O9PA 4LF2A 3PPGA 1PJ9A 4PULA 4TO8A 3U4AA 3IRSA 1LBMA 4MNLA 2VR4A 3E49A 1HXJA 1FHDA 5DRIA 3W4RA 1PZ3A 1V0NA 3OVGA 1GVYA 4M81A 4J3ZA 3W7QA 2CU0A 3UWYA 4QAIA 2PC4A 3B03A 2ZRYA 1W1B1 5M2FX 1VBHA 4JIQA 1S5TA 4GZ7A 1DWJM 3OU8A 1WV2A 2VM8A 3JW7A 2WC4A 4PB5A 4DXKA 3U2EA 4HNCA 3NDOA 4ZOAA 1Z7AA 3R25A 2C79A 4PFHA 4AD2A 1X38A 3L5AA 5LXXA 4G7FA 1TTIA 1R3TA 4D71A 2DZSA 3I4EA 3H7RA 1E15A 3TOPA 3W85A 1TPVA 2PF0A 4H6KA 2WMIA 4IP7A 3URAA 1JAEA 2EHHA 4RJEA 5HWJA 2OWXA 1TTPA 4Z42C 5A8PA 2FH6A 5CBBA 2WWDA 1JYWA 2BNJA 1ZPTA 4CN1A 3H23A 3LQLA 3AXHA 4QSHA 1BD0A 4ROQA 4FOUA 4PUNA 1NARA 4GYKA 3RIKA 1XLKA 4WLCA 2CETA 4JTTA 5F4SA 1YQ2A 1UKOA 5EU9A 3TSDA 3W7CA 3IACA 1TE1A 1G6CA 2D1ZA 2WZMA 4GC3A 3W71A 3WD4A 1V08A 3M43A 5GNYA 1OD8A 2FZMA 4H9TA 1P43A 1EWEA 1ECEA 3R58A 2B7QA 1F4AA 1P6WA 1Q7MA 3UG5A 4E4UA 3AU6A 1RP9A 3NOYA 1Z48A 3ABZA 1UKPA 3EAUA 4KCTA 2AKMA 2ZQ0A 2ZA2A 2GSJA 3CAVA 3L7RA 4PB3A 3BMWA 1C8VA 3DZ1A 2XIJA 3M0VA 4TR9A 3AIWA 5GNZA 4AIUA 4XBSA 5HUOA 3FS2A 3QZAA 5K3VA 2VT0A 3M5YA 4UMCA 2YB1A 1W3KA 3GDKA 3V5CA 4LUIA 3GR7A 1UWSA 3ZQ9A 4MFDA 1ZBKA 3O63A 5A6KA 4C5YA 4LC6A 1EYEA 3AMKA 1L6GA 4OBTA 1B4KA 2V2HA 3WNPA 5HPCA 1MXDA 4O0KA 4W93A 4GH3A 1JD9A 3EPOA 1GOMA 1OT1A 3QMTA 4OE7A 3EKLA 1JR1A 5LNSA 4IJCA 1KXQA 2VCAA 4HOWA 4QS6A 3PZUA 1V8EA 1DXEA 4WSJA 3RAOA 3BLFA 5ECUA 3PBWA 3BZJA 5I0DA 4QRNA 3RPMA 3KZPA 1Q4WA 3APYA 3H7VA 3RRXA 4U28A 3IJDA 3TFCA 3QMRA 1KM4A 3BAYA 4HT3A 3WEZA 1UW9A 4AZBA 3CLMA 2GQ8A 5TIMA 1XRVA 3B0PA 2BS9A 3A4AA 1KXTA 1Z3NA 4B9YA 4GUHA 3UYIA 4E0CA 1PVNA 3N14A 4DJDD 5CKSA 3K13A 5DY3A 4C1LA 2CERA 3CH9A 2INZA 3HTWA 2XIIA 4NZJA 2QKFA 1KFEA 2PTXA 1FP8A 1UR0A 3GXDA 3MSRA 3GM8A 1ITCA 2AKZA 3HFTA 3B8IA 1GORA 4DNMA 6TIMA 4HKPA 1RCXB 3OB8A 4OECA 4DJFA 4JFTA 4BF7A 3I3BA 4LUSA 4QE1A 2QCDA 4JIIX 5M1TA 3WDRA 4TMBA 1G7UA 3OIXA 2HPIA 4X61A 2PDWA 5ENLA 3NYZA 4NF7A 4ZB0A 4JX6A 1C29A 3DESA 3RGTA 2FGZA 4YHEA 2HPMA 3T44A 3CZKA 1YXCA 7A3HA 2OR2A 3G1AA 4Q33A 4UMAA 4B5UA 4GGHA 1QR7A 3GW3A 1JI1A 1S5MA 4NY2A 3L4YA 3N6HA 3MMWA 2E4TA 4GOAA 2H8ZA 1BVZA 2DQXA 4XG1A 4RUBA 1YNQA 1EUNA 1S46A 3TC6A 4BEUA 3BL3A 3OG2A 3DH7A 4A3YA 2G4FA 4NJGA 4CNOA 1B9ZA 1Q7ZA 1EJVC 1BWLA 4R9OA 1JEZA 1LZOA 4DUOA 3DKLA 3N17A 2VRJA 3V4BA 2CLPA 3HOJA 1V77A 5BWFA 4HIBA 2A7NA 3NO3A 1WDSA 3E0IA 1IXQA 4GYPC 3GSMA 1HX0A 3BAJA 1GQKA 4QEHA 3LTYA 2DZXA 3H7UA 1VR6A 4NASA 3D5HA 1KW1A 3O6CA 2NX3A 4Z17A 1UWIA 1XIDA 4QR6A 2HZGA 5EMMA 5A6BD 1CNVA 3W7RA 2JFEX 1ISWA 4HMCA 3IPWA 1GOIA 4XB3A 3PJUA 4Y8FA 3EX1A 2V5KA 3W1UA 3QFEA 4LY4A 1BGGA 5AYBA 2WHKA 3KP0A 3GYEA 1UR9A 1UR1A 4Z1CA 1MDRA 2ZOXA 2DP3A 4K6AA 1V93A 1KBKA 1PTDA 2QW5A 3T2QA 4IUOA 3O6AA 2NUWA 2AMXA 4YVVA 1NWUA 3MVTA 4QLJA 4JAWA 3RN6A 3SM0A 1V0LA 4L80A 5FL1A 3NAVA 4RR4A 5D9NA 3QZ6A 3OLEA 3STGA 5LSMA 3GNDA 1JZ3A 2D23A 3RPDA 3CV1A 3WLQA 1V02E 1XRTA 1ZAJA 1WOAA 2BV9A 3R0DA 4IFOA 4PSPA 2OB3A 4EXBA 2E40A 1J96A 3C3NA 2E5CA 4BY3A 1P0EA 3JVAA 4UTWC 4M7TA 4LVFA 2RDWA 3RX3A 4NT0A 4EXAA 4YYFA 1V3MA 4WR3A 3EDJA 4Y8EA 2EF9A 3SGUA 4BHYA 1UC4A 5EKYA 2R8WA 5IDIA 1PDZA 4RXGA 4AZCB 4H9MA 4Q3MA 4DO6A 3AUJA 1R7OA 3H4XA 1QNQA 3GC2A 4AZIA 3N29A 3L5MA 3W2MA 2EEXA 3KBSA 4HYRA 1VEOA 2VC9A 2JEPA 1IEIA 1ESWA 4GABA 1V0MA 1F4HA 3QBUA 5E09A 3C4UA 1Q8AA 3L5LA 1R38A 1F76A 1PKNA 3CUGA 5CC5A 4K38A 5CGTA 4FF5A 5ABHA 1XIBA 4AZHA 3KOWA 3WK1A 3LENA 3WLOA 3W7LA 1H7RA 1WAWA 4KESA 1ITUA 3MY9A 2RDTA 3W87A 2R1LA 1TPC1 1DJGA 3KFTA 3R2GA 1FCUA 3L66A 1DWFM 1RBAA 3AJXA 2XWDA 1GVQA 4RNFA 1E4NA 4S2CA 3ATYA 1TA3A 2FKPA 4NQ1A 4ROPA 4DWSA 4WRHA 4KWOA 4XBJA 3MZNA 1K9DA 5KTLA 5M3WA 4O4VA 3LRLA 3WQ5A 1MNSA 4OJYA 3BW3A 1GOXA 3VKAA 2XH7A 4HMNA 1H2JA 3LMZA 1PZ2A 4O50A 2G37A 1QI4A 4C6IA 3KLLA 3CH0A 3SADA 1A5OC 3CQJA 1EH9A 3NOEA 4ATWA 2OYKA 2ZDRA 4W7WA 3GZ3A 3W23A 2H3DA 3W38A 2IXUA 4AYSA 4HK5A 4F2BA 2EXOA 1PKLA 2VRQA 3QSTA 4RE0A 1JL8A 1JJKA 1OFDA 1UUMA 2YXGA 5I06A 1KR1A 4OVXA 5T26A 1H3GA 1EF2A 5D05A 3WDHA 5H8UA 2ZZ4A 3C86A 4AHQA 3K8KA 4A8IA 2HSAA 4FNRA 3BXWA 1E0UA 1GKRA 1PIFA 5I5RA 2G95A 1MW2A 1YE6A 1AQHA 4LS2A 5HR6A 1HIZA 2P10A 2PDPA 1RK5A 3SFKA 3M0IA 1CXKA 1TA3B 4Q8UA 3W2NA 4BA0A 4ICNA 3T05A 3UWZA 1T99A 5HMSA 2X7VA 1L0PA 1M5WA 2YDRA 4UTIA 3W81A 1Q6QA 2IPFA 2F84A 5DMNA 4MYAA 1PTAA 2PD9A 4NX5A 3PG8A 3PNZA 1P1XA 2PDXA 1UBPC 3VNKA 3R8GA 1GKPA 2WM1A 3JR2A 3VVGA 1W37A 3N73A 4JX5A 1UH4A 4LB3A 2WAGA 5F7UA 2HXUA 1SW3A 3FEMA 3MT1A 3UXLA 1FWCC 4H00A 5C9ZA 1W3IA 1A5NC 3GR8A 3MWAA 3WZ0E 2VC6A 3FK4A 1TX0A 4IL0A 3CK5A 3WIJA 3FW6A 3BW4A 4XIMA 3S3GA 3CPUA 3F2CA 1OADA 1ZTVA 3M5VA 3WNMA 1HKJA 4F3HA 3NWRA 5LNVA 4NVTA 4GLEA 4YN5A 4DWSD 1UWQA 3WF2A 3NEVA 2Y5SA 3R10A 4HSHA 1A5LC 1OM0A 2E7FA 4MZYA 1X8FA 3WSUA 5DX7A 1TCDA 1H1NA 2VZUA 3S1XA 1HJVA 4ADSA 2C0HA 3LLDA 3STPA 1ELSA 3EOOA 4F0MA 1GQNA 2WWCA 4NJJA 4QIUA 3RF9A 3AAMA 3FFSA 4FPSA 3EOEA 5JMUA 2TODA 3TN4A 1KGWA 3S2LA 1OX6A 4K8HA 3VD5A 1XC4A 4GNKB 2OSWA 4WQ6A 1K7FA 1MSSA 3U57A 4JYFA 2DV0A 3PJWA 3V1PA 1E4IA 4ZTXA 3M0XA 1QHZA 2NWSA 2QYGA 6TAAA 1Z9AA 1VRXA 2QAPA 5FD0A 4HPHA 1D8CA 4MWAD 3SJ3A 5DEZA 1SJCA 2WJEA 3S1WA 4K37A 3NL2A 2OMAA 1QO5A 1F3WA 3EKGA 1W17A 4WUIA 5H6HA 1A5MC 2X1TA 3W84A 3MKCA 2Y89A 4CU7A 4ASTA 1K6WA 5F2GA 3O16A 3CBWA 4G7EB 3JUGA 1X98A 3USZA 2WJDA 3H2MA 4DZHA 4MSSA 4CD8A 3S42A 2VVSA 2RGMA 4GX8A 5BWAA 4IG2B 5CLWA 4ALDA 4QJ5B 1E6PA 2VL4A 3EX3A 1FWDC 2QNEA 1XQKA 3RMJA 3PAJA 4Z2LA 5ECVA 1Q3NA 3UR5A 3D3FA 1US0A 1I9CB 4F0RA 3AHXA 5FCZA 8CGTA 4FX7A 3PHAA 1UH2A 4PMXA 3B9NA 3BO9A 1WE5A 1Z32X 1TO3A 1DYSA 5L9FA 2GOUA 1SO5A 5CBJA 3VGDA 4RDVA 3KEHA 1P1MA 4WOZA 2VC7A 3CYVA 1M68A 4XD4A 3HPSA 3SCUA 1YIXA 2O9TA 1R0MA 2REQA 4HPJA 4C6MA 3W7KA 2ZRUA 4RNJA 2QUMA 4CQ9A 1KM1A 3AXIA 5FA5A 1BTCA 2W9MA 2F61A 4U3AA 3AI0A 3TTEA 5KZDA 1ENUA 2PDKA 1PYMA 4GX9A 4XAYA 2WBKA 5IFTA 1V3IA 3MB9A 3PVFA 3NQFA 5E0FA 5F2MA 1SMDA 3CGTA 4JTLA 4LYQA 1VP5A 1P7TB 1PDYA 4R27A 5JIPA 4IPLA 2Z2UA 4X2RA 2ZIDA 2O92A 1KCKA 1SFSA 2H90A 5A6BA 3SRFA 3GR4A 2OXNA 4NAFB 5IM51 1XW8A 3TCEA 4DI8A 2NLIA 4RXFA 4O11A 3H54A 2NV1A 3VFCA 1PKYA 4HYWA 2VENA 1QW8A 4CNPA 3EWYA 5BRQA 2QUTA 5XINA 1TB3A 2ZX5A 1X39A 1A5AA 5LNUA 4JZ5A 3A47A 3B9DA 2D0FA 2POTA 4JY9A 4AF0B 4UTLA 2QPSA 1XBXA 1DWHM 3W3OA 4B5NA 5DBUA 4ERAA 3RFAA 1XHGA 4WEVX 4PYSA 4IM4A 3G1SA 5AN7A 1KFWA 4ACZA 1UG6A 3LBCA 3A5FA 5BRBA 1B3OA 2GK1A 3CQHA 2PC8A 3VX1A 3WYZA 1GWJA 1BXCA 3Q2DA 3GHSA 1WCGA 2QVNA 3DHDA 4DO4A 1A5KC 4K68A 2OO0A 1ICSA 2VZVA 2ZUNA 3I68A 4PCNA 2G96A 4JTEA 3P60A 1Y65A 5AB3A 3BZGA 2I9UA 1R6WA 1FHLA 1UD5A 3IAPA 1F3TA 2PLCA 1FWSA 2XVGA 4O12A 2CZDA 2MANA 5BXSA 1KXHA 3G1HA 1OGSA 1ZP4A 1I2NA 4E6MA 3VNMA 3NL6A 3D6NA 1UA3A 5HNUA 3POHA 3B8UA 3SZ8A 3UVAA 5HOSA 4DJEC 3GG1A 1W8GA 1TZ9A 2FGLA 3TEVA 2XFRA 2WM0A 1LORA 4PB4A 1UUOA 1JCLA 2AAAA 5D02A 1TREA 4N02A 4QS5A 5AHEA 4PH6A 1MRAA 4F9JA 1JQXA 4B16A 1XCFA 2VO5A 2PLKA 4H9UA 2OWWA 1NDWA 3TMLA 1BXBA 4REQB 1WP6A 1NOWA 1ZCCA 2FZNA 4YTQA 4JNYA 3NJ3A 1HJSA 2VP8A 4HSOA 3PFMA 3P80A 3P84A 4E4PA 2YXXA 5G4WA 4UQ9A 1DJZA 2WC7A 2DT2A 4I7WA 5LNWA 5MF5A 2NUXA 1NWSA 5FEZA 3JS3A 3WL1A 2UZ9A 5AC4A 4OT7A 1ALDA 3B8TA 3SFWA 4LRSA 1E6RA 1QNVA 2AL1A 4EACA 1BTMA 1DKWA 1K8XA 5ABEA 1CENA 2DZWA 3H4WA 4DWSC 1A4MA 5I3JA 1ZQ5A 3CNYA 2GDQA 2E67A 5GJPA 4MPKA 1QHOA 1EA0A 1EX5A 2CKSA 1ZENA 3W27A 3NTYA 3LI0A 1GKQA 1R3VA 3HA1A 5CGQA 4GUFA 3AISA 4YVXA 1ZL1A 1A5CA 1Q7QA 3VUSA 3CHVA 1U1UA 1BVWA 1LG2A 3ARWA 3RRAA 5LA1A 4LB4A 4K7VA 1R9ZA 3G5EA 3W28A 3CO4A 1HGWA 5AHMA 4IZGA 1OC6A 3NQBA 1S3HA 3VNIA 4DVOA 4NSBA 2NV2A 3Q65A 4HCDA 3TSBA 2JK2A 9XIMA 3U9IA 3WBAA 2ZBTA 1E9YB 4ZBCA 1DE5A 4MJ4A 1TMHA 2JF7A 3VGFA 1ONEA 3KTXA 2GUUA 2D2HA 2YDQA 1MO0A 4M6VA 1QI2A 1K77A 5K7JA 1GOQA 4E2OA 2FHFA 1TUFA 1RK6A 3WJZA 1KGUA 4H83A 2E1WA 2GJXB 3GFXA 3GY1A 1OX4A 5EMLA 5HPOA 2OLSA 1GEQA 1J0JA 4B92A 3OLIA 3KL5A 3LGDA 3HPXA 1B2YA 2B7OA 3HMJG 3WG6A 4AD4A 1EZ2A 1EPVA 4QAWA 1GOOA 4JTSA 3S47A 3WLIA 1MVYA