3G1SA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
209
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 78
structure length 209
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1sA00
3RLUA 4MZ1A 2V30A 4BI7A 1PE1A 1PHWA 4K7YA 3UWUA 1EUNA 1T8XA 3F1QA 4U4MA 1BKSA 2PRLA 5G4WA 2E68A 3MP5A 2A7NA 1D3GA 1VLIA 4GUIA 1DBTA 3MJYA 2DP3A 1AL7A 1GVFA 4ADUA 4D2JA 2C19A 1XUZA 3NR0A 2BTMA 2CFFA 2RHGA 4OHQA 1AK5A 3PULA 3HG2A 5K9XA 3TK7A 1FCQA 2GQAA 3L68A 1JRBA 3T4CA 4JIPA 5DXYA 2QCNA 4KFOA 4JX5A 1TPC1 3LM7A 5FEZA 3G1SA 2X1UA 3SY5A 1SW7A 2Y85A 2V5LA 3KVJA 3OBKA 4POCA 1LROA 1R30A 4O1CA 1ZENA 3W1AA 2BSLA 1LP6A 1WQ5A 1LZOA 4JD4A 3ABOA 4FX8A 4NJJA 3RLVA 4JN6A 1SO4A 3R8RA 1RPXA 2R8WA 3EWYA 3B0PA 4CNOA 3H53A 4RXGA 7TIMA 3GDKA 3W71A 3LDVA 4H6KA 3I65A 5CZJA 3W72A 1ZALA 5I3JA 2V0TA 1YDVA 3HF3A 3IV3A 1DOSA 2HSAA 1WX0A 3GX9A 1I2RA 1R46A 1J2WA 1SO6A 2OT1A 4MIMA 1LOSA 4WQ6A 3T40A 1F6PA 2J9YA 5AHFA 3HG3A 4JICA 5D2XA 3DZ1A 1OF6A 2QEZA 1GVRA 1KLZA 5T26A 4R33A 3H55A 2QCHA 3KVMA 3O1NA 1F5ZA 3L5AA 1FXPA 1H7WA 5FF7A 2B0MA 1HTIA 1QOPA 4FIQA 2QCEA 1IF2A 1SSGA 1K7XA 1MO0A 1EIXA 5DCBA 1GT8A 1ONRA 3O6YX 3QMRA 3HPXA 2RDWA 6ALDA 2VKZG 5E0KA 2DZUA 3S8HA 4OV4A 1W3NA 3IIZA 2OJPA 3L66A 4FIRA 4WXYA 4Q33A 3QYQA 4LVFA 4ZL1A 5EKYA 3S9YA 3R5EA 2YXGA 3UD6A 4Q32A 2P10A 4O54A 3EB2A 1TO3A 1SFJA 4QJ1A 2C6QA 2OX1A 1W5MA 1OFEA 5BRBA 2WNZA 3S1XA 3NQGA 3G1FA 1JCLA 4O12A 3BG9A 1JULA 4UMBA 3WFAA 4O1BA 3YPIA 2WSYA 3QC3A 1QAPA 2NUWA 2JKAA 3DHDA 3R89A 5D05A 1LRNA 3BPWA 2DZSA 1OFPA 4ZQPA 3KRSA 4BFAA 3NPVA 2VXNA 2C3ZA 3OVQA 2CZEA 3LRLA 4UTIA 4QITA 4JTEA 4O1AA 1N8FA 5AYYA 2E6AA 1X1OA 3G1XA 5LNRA 3EKZA 1M5WA 4XQ6A 5K4XA 3IEBA 1YXCA 2ZA1A 3NQ2A 5TBOA 5LGZA 3G8RA 5EPDA 1FWRA 1G69A 2JKPA 3LXAA 2DJLA 3NVTA 4NZJA 3P5YA 3U2OA 3KRZA 3SFKA 3C2OA 2ZZ3A 1RQEA 1I2QA 2YPIA 4QM1A 4JNMA 3TE9A 4UCGA 5C2XA 3NDOA 1J5TA 3TROA 5I3IA 4DF0A 2NZLA 5EL1A 4DO5A 2RDTA 1W0MA 1WV2A 3MHGA 3ABQA 3B05A 3QMTA 3W1TA 3W7JA 1EP3A 1IXPA 3IIXA 2B4GA 3QSTA 1TCDA 4Y90A 1IXOA 4WOQA 5IM51 2ZRZA 3UQNA 4Z0JA 1GG1A 1OX4A 5K4ZA 1NF0A 3NA8A 2Z0IA 1PCKA 1KW1A 3D0CA 4OE7A 4AWTA 1YDOA 1HG3A 1QO2A 3IIVA 3TW6A 3CC1A 3MBDA 1YTEA 2E1DA 4E2BA 3PBWA 5LNSA 4LV4A 3NOEA 3C8FA 5LHFA 3TUUA 2ZZ2A 2A1YA 1O95A 4GRSA 4GBUA 3W7QA 1O5KA 4PCFA 4CQAA 4QIUA 4O53A 3TXVA 4UFHA 4UC5A 4A29A 1TYGA 5LSMA 4LUJA 3NL5A 5CPMA 2C18A 3NXFA 1VHCA 1IGSA 3S5NA 3ABSA 4TMBA 1Z48A 3P74A 1TQXA 1SZNA 1Q6QA 2VEMA 5L6UA 1W3IA 1D9EA 1DORA 2XN2A 3QQ0A 4DO6A 2Y89A 2IQTA 4HSOA 5IBXC 1KFJA 4YCOA 5AYXA 1KM1A 4JTJA 5H2ZA 1ICSA 1U5JA 3P82A 4GE8A 5LNVA 3P8IA 4LS1A 1ADOA 3MW7A 2FJKA 2ZRUA 5KITA 3MI6A 1IXNA 1MZHA 3E49A 1H63A 5HWJA 1I2PA 3MMTA 4JTTA 2NX1A 4FO4A 3GAYA 2ZCGA 3C0JA 4RZ5A 2NXGA 1R47A 3SZ8A 2YFOA 1OYCA 2CLLA 1JCNA 4GUJA 2NX3A 1BEUA 3TJXA 1AW1A 2A0NA 3BG3A 1GWJA 1LOQA 4DPPA 3R12A 4MZ8A 5TQLA 2BXVA 1ZAJA 3S6DA 2QAFA 3GXNA 3WK2A 2CLEA 3FJLA 1L2UA 1M7PA 1Q6RA 2A7RA 1KA9F 3BW2A 1DJQA 3WJXA 1XFBA 5HR7A 1GVOA 4FXRA 3C2FA 3ZWTA 1ICPA 3E12A 3LOTA 3W76A 1PHQA 3M6YA 4NXKA 3TIMA 1UJPA 4MUZA 3L5MA 1QNVA 3FLUA 3PM6A 4AWUA 3NPUA 4JEQA 3Q37A 3OA3A 3BW4A 4IPIA 1K7FA 3KXQA 2QDGA 2AQWA 5C54A 3B04A 1TJRA 4JTGA 1IIGA 1WA3A 2ZZ7A 3K30A 1H61A 1UUOA 1CX9A 3OVRA 3N73A 3M7WA 1PCWA 3P61A 4WY0A 3LI0A 2QUUA 4PTNA 3W2MA 1Z44A 3CEPA 3W1UA 4M6QA 3NQCA 2QCDB 1QPRA 2TMDA 3L65A 2C0AA 5HUPA 1OFOA 2V2CA 1XCFA 3PAJA 5E93A 4X3ZA 3B06A 1TPFA 3CTLA 1PV8A 1L6YA 4LOCA 3O8AA 4AF0A 3BLFA 1Q3NA 3QMSA 1H7NA 4ALDA 4YCPA 2J9ZA 4XUGA 3HGOA 1K8XA 3R13A 4LTSA 5C6MA 3W7NA 1HO4A 1LDCA 1OYBA 3IGSA 1H7XA 1ME8A 1F2JA 2H3BA 4PA8A 3FKKA 3EWBX 3PUEA 1WBJA 5HR6A 1OFQA 5G4EA 4N2YA 5KMYA 3ABRA 3TKFA 3LX9A 4R7JA 3HG5A 4HPXA 1TREA 4ADTA 1ZAIA 4J9JA 5LZLA 2ALDA 3W83A 1DQWA 1KFEA 4NXSA 3HIJA 2BX7A 4TMCA 2FB3A 5CSSA 3TC6A 1IXQA 3CM4A 3PS7A 3FYPA 1NF7A 5C5YA 3W07A 1KV8A 1YXDA 4R53A 3SGZA 1FDJA 1A5SA 3M0ZA 2B7PA 2Y7GA 3T55A 5TIMA 3RF9A 4IJBA 1I2OA 4EWND 2GVLA 2YDAA 5FF3A 4M5PA 5A8GA 4GXMA 2ZTJA 1TV7A 3QW4B 3V75A 1TPUA 2DU2A 3TCEA 4C1LA 1SR9A 2XFWA 2QR6A 2OT0A 4K39A 1C29A 5CPOA 4CLMA 5EBUA 2AGKA 3O06A 4DEFA 3I7QA 5CSRA 4IMGA 2ISSA 1QPNA 1RQBA 4FXSA 3TSDA 1GZGA 2DZXA 5HJLA 1I45A 5AHEA 4O18A 1TPH1 4ZQOA 4LS0A 1QDSA 3GDTA 2CWNA 2QCGA 3C4UA 4PL2A 2PURA 4JTIA 1TTPA 3SECA 3DFPA 1KFLA 4L4MA 1C9DA 3UZ5A 3PSVA 3LI1A 1GTEA 1VR6A 2QUVA 3G0SA 2J24A 4KWWA 2NWSA 4UUIA 1FQ0A 3LTPA 3DKJA 4TIMA 2QAPA 3DI1A 1K7EA 1QFEA 4KFNA 5CPNA 3DFOA 1D3HA 4AVFA 3C52A 3L67A 2A21A 1A5AA 2ZRYA 2VFIA 4AHPA 4ZVJA 4UTKA 1FY6A 4BI6A 2J9XA 3W22A 2ATMA 4WY0F 3SIZA 2W0UA 2A6NA 2XN1A 3LV6A 1W8SA 4I7VA 3O16A 3JR2A 3A5FA 5G1TA 1S3HA 2TYSA 1BWKA 2ZYFA 4O16A 3LCWA 4NJHA 1QO5A 3UWVA 2DZWA 1ALDA 4IGHA 2CLOA 4EOUA 5K7JA 3KOFA 3THAA 3HGSA 4XWUA 4RCXA 1MSSA 2JKEA 3MBFA 4BWLA 3INPA 1F6KA 3L0GA 3STFA 1OK4A 5DCDA 1WDWA 1PIIA 3HO8A 1KM3A 2VC6A 3EWXA 1P5BA 2YYTA 3KRUA 3EX4A 3HG4A 1XBZA 2YW3A 2Y88A 5I3FA 3I6RA 1FCUA 1NVMA 5IBXA 4GUGA 1X8FA 3LHWA 3W3OA 4DO4A 4AHOA 5CZ0A 1YDNA 3NL2A 2G97A 3W74A 3H54A 5DY2A 2FTPA 4CCDA 3GAKA 4O19A 5EYWA 3JS3A 2RDUA 4MY9A 4WJEA 4N6FA 5AFDA 2BWGA 4FNQA 2C16A 3O6DA 5F2MA 4OWGA 3OG3A 1LLWA 3GKAA 3LBCA 2E6DA 3MI3A 3VNDA 2WNNA 2CLHA 4M19A 2FLIA 5DBTA 5AHIA 4OT7A 3L0NA 1SQ7A 5AHMA 1KFBA 4IWWA 3HGRA 5AHLA 4S2BA 5KINA 3NM3A 2H90A 4MYAA 3TR2A 2R94A 3UY7A 3WK3A 3A22A 5AYZA 4OV9A 1F76A 1ZNNA 5HWNA 1JUKA 1DV7A 1UCWA 2I9EA 1CI1A 1H60A 2PC4A 2VFHA 4ADSA 4EIVA 3DENA 1KLYA 3M47A 4JTKA 4BF9A 5K9CA 3QM3A 5D37A 2QCCA 4CCEA 3BG5A 3B8DA 5L9FA 5F2LA 3NL3A 2HS8A 5LNUA 2CZDA 4O14A 2Q8ZA 1VCGA 3Q58A 1ME7A 3UXDA 3CPRA 2CZFA 2NV1A 1LRQA 3QZEA 4NT0A 1OFRA 3G0XA 4LRSA 4RX0A 4E38A 1VCFA 3UYCA 3CB8A 3N2XA 2GQ9A 2R14A 1JCXA 2HTMA 2F84A 5DBUA 4PC8A 2E6YA 2RFGA 3QJAA 1VYPX 1OX5A 1TQJA 4LVDA 3M5XA 2O7SA 5AC8A 1QOQA 4JDYA 5K2ZA 1WYIA 1P4CA 5CZSA 4RZ4A 4HKPA 3M43A 4DELA 4IMFA 4P2VA 1K8YA 3GZ3A 3W86A 3DHFA 3G22A 3WJZA 3NQEA 3W7IA 5CPLA 4PEKA 1TPWA 4KWVA 2ZBTA 4O4VA 3G1DA 1TPDA 4Y8FA 2QCFA 2J88A 4AB4A 3GB6A 1OX4B 5F2GA 3CU2A 3CT7A 3HPSA 4UTHA 4QNEA 5G2HA 5G5IA 3GDLA 2ZA3A 5FF4A 2A5HA 3N9SA 3FIGA 3UPWA 4M6VA 1G4EA 1JUBA 4UTJA 2Y63A 4WOZA 5KZEA 3MP4A 2WQPA 3TA6A 2W6RA 4UNKA 2JK2A 3NZRA 3TV8A 1SSDA 5AHNA 1TB3A 2FDSA 4FB7A 3TH6A 1GVQA 2WJZA 3LERA 3T7VA 3EX2A 3TMQA 2FB2A 1RD5A 2Z6JA 4JX4A 1GTHA 3TSMA 3W7CA 2JBMA 3HJZA 4NX0A 4HPJA 3Q94A 2Y7DA 1AG1O 3GLCA 4HSNA 1L6SA 5LHEA 1DKWA 4JR5A 3LLDA 4L4LA 1TPEA 4UTLA 1Q45A 3L2IA 4YL2A 3W88A 4O50A 1W31A 5CZTA 2QJHA 3WJWA 2A4AA 1B4EA 3LRKA 2DZTA 3L0KA 2OCZA 3W85A 3SJ3A 2GVGA 5I3HA 3M5VA 3BW3A 3G24A 1A5BA 4FX6M 2V81A 5BW6A 4ICNA 1UBSA 4MFDA 3GDRA 3M44A 1JCJA 5I3GA 4XKYA 1S5TA 2J27A 4IQLA 2WSQA 1EX5A 4S2CA 3WJYA 3B03A 4O8RA 5LGXA 2DORA 5F4SA 1OHLA 4N9BA 3C3NA 4NJGA 3W70A 3G0UA 2KZHA 2QJGA 3HQ1A 5KTLA 5DELA 2C1HA 3W1RA 3W7KA 3S1VA 1G4SA 1XC4A 1OK6A 4UFKA 4A2RA 1FUYA 3OVPA 4JTFA 3GR7A 1A53A 4Y9AA 1F73A 4BWLC 1LORA 3RFAA 3UNDA 4CQ8A 3N2MA 3IGXA 3RU6A 5D03A 1LBMA 2XN0A 5FF2A 4XTIA 3LRMA 3B0VC 3A21A 2WV8A 4QSHA 3NM1A 3CHVA 4FNRA 5A5WA 1HFBA 3LTSA 1KV5A 4FX7A 1XL9A 3DKLA 1RV8A 1SW0A 4NU7A 1NFBA 1ME9A 1RQHA 2J6XA 3NQ8A 5D2VA 3TDFA 2VOMA 1KFCA 4W9TA 1UUMA 1N55A 2A6LA 3FKRA 1XI3A 3NG3A 4K38A 1GG0A 1G7VA 1SFLA 3VCRA 5D32A 3VI2A 1Z41A 4UMAA 1KBJA 2NV2A 4WY0B 4UFJA 1B3OA 4MVAA 1VGAA 5HINA 1L9WA 3L9CA 3QSRA 1P0KA 3C2EA 3A5VA 4N02A 4PL1A 5D2WA 5F1UA 5AB3A 2GQ8A 5BNKA 1SPQA 3P8JA 4RXFA 8TIMA 4FEZA 4IOTA 3Q2DA 4AF0B 1L6WA 3S5ZA 1T0OA 1B57A 3E96A 3U6WA 2VENA 1DL3A 2ZQ0A 2X1RA 2EGZA 4UFLA 5J5DA 3CEUA 4UTUA 3ATZA 1FDYA 2O7QA 3TQVA 2VEIA 3NGJA 3AO0A 3OIXA 3TXZA 3MHFA 4K36A 3W1MA 3PUOA 1ZAHA 3W6YA 4RK8A 2V5BA 4K8EA 4HIBA 2NWRA 4H4IA 3PG9A 1OG0A 4FNSA 1TMHA 1I4NA 3P84A 2EAWA 3L21A 3W7GA 3ANYA 3FEMA 2QUTA 3N3MA 4NNBA 3M16A 5SWUA 4ZQNA 4JTUA 3MHUA 4O15A 3P67A 5I3KA 3MUXA 1XM3A 4TO8A 3O07A 4FNUA 2CZ5A 2GJNA 4A22A 1DQXA 5FF0A 4LW7A 3E9AA 1GQNA 3LB0A 4NNCA 5D2YA 1UB3A 1QR7A 4UMCA 1KFKA 3LHZA 4E0CA 1EUAA 4AH7A 1SU5A 3TMLA 3LV5A 2Z2UA 3LHUA 3S42A 3N9RA 5D2TA 1XBVA 2D73A 1PL9A 2FPVA 4LC6A 5FI8A 5ABTA 1R2TA 4M6PA 3PB2A 1AW5A 4UTTA 1FXQA 3IVTA 3ZR4A 3EXSA 1LLZA 3SW6A 1VYRA 4JYEA 1B9BA 1SZGA 3NQ6A 2BLEA 4MY8A 4RV8A 3WK0A 4O1DA 2NUXA 4PH6A 3G3MA 2EHHA 1EWEA 4JIQA 1EP2A 1FWTA 1OABA 4A3UA 1H5YA 4WX2A 1OFDA 2X30A 5DY3A 4GNJA 1R2SA 2NLIA 2G5WA 5F1VA 1JUEA 3R2GA 1QWGA 1RR2A 4LVBA 3TFCA 4JY9A 2VFFA 4UFMA 5DCEA 1MEHA 3GYEA 4NQ1A 2A7PA 5HQEA 3T78A 3WK1A 1TPB1 1OFAA 2ABBA 2DJXA 3GNDA 3EXTA 4K7VA 4Y6GA 5KSWA 4N9CA 4HHPA 1Q6LA 3W1PA 3W2UA 4O11A 4I9AA 2ZRXA 2WO5A 2VFDA 5HNRA 3UXAA 2ZZ6A 3PB0A 5LKYA 1WOBA 1G4PA 1XDLA 4O13A 5K3VA 4LWWA 4MPQA 5CG7A 4A21A 2EF9A 1X7FA 5EMUA 2QJIA 1W5PA 1K03A 1O60A 1VCVA 3G1VA 2FFCA 3DFTA 2ZZ5A 4O28A 3GDMA 1AMKA 3NQMA 2Y7EA 3CWNA 1TRIA 1EEPA 3VE9A 1OVDA 1N7KA 3BVJA 1GVSA 5FEXA 1OX6A 3QQ1A 2FPYA 5BMXA 3LCXA 3BV4A 3GKFA 1VLWA 3C6CA 3P60A 1TRDA 3EWZA 4BK9A 2ZRWA 3B4UA 1VJIA 4AWSA 3UWYA 1S5WA 2ZA2A 4FNPA 4N4QA 3WJSA 2E5CA 1G6CA 1NSJA 4N9EA 3W7MA 2YX0A 2ABAA 2VEPA 4A2SA 3VE7A 3STCA 3W7PA 3TX9A 3IRDA 4QQ3A 1EA0A 3W23A 3GXTA 3UWZA 3NQVA 1YLVA 5D33A 1KTBA 3UPBA 4IXHA 1VH7A 4Z0SA 4LS2A 2YYUA 5DN1A 2H8XA 3M41A 5G1YA 2P1FA 1THFD 4UIOA 4O57A 3N34A 1MXSA 4GUFA 4YWIA 3GIYA 3KVLA 3HGJA 2NXHA 2Z1BA 3TNOA 1KM5A 2H3DA 3EX6A 3W7LA 3KHJA 4JXCA 3NQ7A 4PODA 4AXKA 2YGYA 3PVFA 4AAJA 3TJLA 3TW7A 4RZ6A 3LCIA 3W75A 4S1FA 1K02A 1OF8A 3U8GA 3QRHA 2JGQA 3GXPA 4MFEA 2YSWA 3DFNA 2PRMA 4U28A 1H50A 1XXXA 4ZQCA 4NX5A 2QDHA 1ZY9A 3CWOX 3LCLA 2P0OA 3GR8A 3ZS4A 5KZMA 1LYXA 3C56A 3FS2A 3PBUA 2Y61A 2TSYA 1H62A 3DXIA 4Z08A 3O6CA 3PY2A 3P7YA 4ONVA 4WUIA 1JCYA 1FWWA 2G95A 4N6EA 3TFXA 1W3TA 2CU0A 2W79A 3DFSA 4ORIA 1Q6OA 3LLFA 5U7SA 4UTMA 4XZ9A 1GJPA 5HUOA 5FESA 3OHIA 3G3DA 2V8ZA 1S5VA 2PCQA 2V82A 3GNNA 3BLEA 3VKJA 3ATYA 3P62A 5AOUA 4ZQRA 3TC7A 1HUVA 4UR8A 3G8EA 4IX2A 1ZFJA 1JRCA 3QFEA 4FNTA 1H51A 5HMSA 1A5CA 5BMWA 1NAL1 3IVSA 5D30A 3QEZA 3PSWA 4QAIA 1H1ZA 1RVGA 1FWSA 4KKXA 3UY8A 4Q4KA 2Q8LA 3DFQA 2EKCA 4BR1A 4DXVA 4P61A 3THQA 2V2HA 3ZFHA 3IVUA 2OZ0A 1Y0EA 3NO5A 4UTTC 3BARA 4MOZA 4ORMA 5F4XA 5F2IA 1TSIA 3HB9A 1IIHA 5DXXA 1YADA 5AC7A 2V2DA 4NJKA 4RLIA 3RMJA 4LV9A 4MJMA 1W37A 1TV5A 4JX6A 2V9DA 3BGJA 4NUWA 1XBYA 4Z1DA 3S5OA 3SGUA 3QH2A 2EPHA 4XBSA 3W84A 4NZFA 3W2LA 2Q3RA 4K6AA 3HOJA 2E5DA 3CIXA 1T96A 4O52A 4ZQMA 1XDMA 3A23A 3QPYA 3W7DA 1JQXA 3UZJA 2ATSA 3B0UX 1TTQA 3S1UA 3C2VA 2ZTKA 1XKYA 2RKXA 3N14A 1P1XA 3SSJA 4OU1A 3QF0A 4MZYA 1LRTA 4XKYB 3RNDA 4LC8A 2C14A 3F03K 5D04C 3KFTA 4UTWC 4GC4A 4N9DA 2B7OA 4QNWA 5G2IA 5HULA 3TQ0A 2WNQA 3EWWA 5J5RA 5CKSA 1E51A 3NEVA 3IIPA 1BTMA 5D02A 3MYOA 1G4TA 1V5XA 1XUUA 2HS6A 3PC0A 1GEQA 2QKFA 2OMAA 2LLEA 2YR1A 3W7OA 1W5OA 1BWLA 3RK8A 1H7PA 3LCGA 2TPSA 4O10A 3LBMA 3W2JA 1HO1A 5KZDA 3L5LA 3W1XA 4CCCA 1KM2A 1EWDA 4XBKA 3QPZA 3MWAA 4G1KA 4Z1CA 3NAVA 4Y96A 5H91A 3I7RA 1GYLA 2QF7A 4DBDA 5DLCA 1VS1A 1ZJIA 1SO5A 1FCBA 3PG8A 1EP1A 1YPFA 3G1HA 1PVNA 4LU0A 3O63A 1SZEA 3GK0A 5LNWA 2Y6ZA 5EY5A 4IMEA 2WSRA 4LT9A 4I7UA 3VFLA 3A24A 1TPVA 3UWWA 1WOAA 1OJXA 2DZPA 4AHQA 4DF2A 1DHPA 3STEA 1NEYA 2VFEA 1A50A 2ZZ1A 1H7OA 2VEKA 2YFNA 2X16A 1LTDA 2Y70A 3LTYA 3FOKA 1O94A 4O17A 4DF1A 4IMDA 5G2WA 1LCOA 1W1ZA 2NUYA 3M5ZA 4UFIA 3LXBA 3W9ZA 4AMAA 3S0CA 3LHTA 1SO3A 2X2GA 4K37A 3FA5A 1P0NA 5U4NA 3KX6A 5CGQA 4X2RA 2JGYA 4R34A 2R91A 4Z1AA 4ZMGA 2I14A 4BI5A 4OBTA 4JTSA 4DQWA 3EEGA 2FQIA 3TAKA 2NX9A 3M1ZA 4JDBA 2A85A 4YLWA 3F4NA 3PR2A 3DU0A 2A2IA 1VC4A 5EA9A 4O0KA 3QW3A 1KM4A 3P80A 1I2NA 5AN7A 1LM1A 3M9YA 2B7NA 2PRHA 1SW3A 3HPZA 2F7FA 3PBYA 1KM6A 3O15A 4FHAA 1KBIA 3AJXA 2QCLA 4LVGA 3CQ0A 1LBFA 4YXGA 3LGEA 1PS9A 2FIQA 2H6RA 3JRKA 3T44A 4NVTA 1F05A 4MYXA 4I7WA 4MKNA 4IXXA 5MHBA 3NQDA 4JTHA 5D09A 3W2NA 4RR4A 4GWEA 1B4KA 4MLJA 1OYAA 1KM0A 2AAMA 1HL2A 2WKJA 4C1KA 3LCHA 1QCWA 3F4WA 4HN4A 2ISVA 3NPXA 2NXIA 3CLMA 4O0ZA 2G96A 1DJNA 3EX3A 1XBXA 3LHVA 3MO7A 4JYDA 1W5QA 4JYFA 1FX6A 1V7YA 1GYNA 3DI0A 3HBLA 3KVKA 3I7SA 2YW4A 4JS3A 3STGA 1FDZA 1VHNA 1ZHAA 4M7TA 1F7BA 2PE4A 2ISWA 4EF9A 1JJKA 2GOUA 2B7QA 3USBA 3BK0A 4WZHA 1JQVA 3MP3A 3EX1A 4HNNA 1GOXA 4OQVA 3W1QA 4HNUA 4JTLA 1TIMA 2HMCA 4ZZ9A 4CNPA 4CQ9A 1VZWA 2WPBA 1YPIA 3S5YA 3P5ZA 1LBLA 2CLFA 1O5XA 3GVGA 4HNVA 4HNTA 5FEWA 1F74A 4ML9A 2C13A 2GJLA 2GVJA 3NQFA 4LUIA 4MJZA 4DBEA 1TV8A 3TAOA 3UWQA 3W7EA 1QPQA 2Q3OA 2X1TA 3IGUA 1CW2A 3NPWA 4LRTA 4Z1BA 1R2RA 2CW6A 4IUOA 1KTCA 1QMLA 1UASA 3W2KA 3BO9A 3G1AA 3PUDA 5E1QA 3W7RA 4YMZA 1FBAA 1T99A 1MEWA 1SUXA 4QISA 3LXCA 4O4WA 4K8HA 2DZVA 3W7HA 2E77A 1LOLA 4JY8A 3G18A 1TJPA 2TRSA 1JR1A 3C2RA 2Y7FA 1SZFA 3C61A 3S1WA 2CLKA 5AC6A 5HWMA 2UV8G 5C55A 3NZ1A 5GVJA 1ML1A 4EF8A 2X1SA 1OFBA 1EB3A 2YZRA 2H8ZA 4LVAA 1JVNA 3MYPA 1ICQA 2ZRVA 3DAQA 3LCFA 1K3UA 3NL6A 3OEXA 3MI2A 3NQAA 1M6JA 5F4WA 1H1YA 2VFGA 2E6FA 3PWAA 3EWUA 1WAUA 1Z42A 4HT3A 1TTJA 3CIWA 2E5BA 1FWNA 2BZNA 1VYSX 2QCDA 3TQKA 2VELA 6TIMA 3DH7A 1W5NA 4UTWA 3SR7A 2E09A 2ZZ4A 1YXYA 4IX0A 3O05A 1JCMP 4E2DA 1H7RA 4PFMA 4CNNA 1G7UA 1YTKA 3PF3A 3BGGA 4KFPA 4GFSA 1K8ZA 4FF7A 1YYAA 1J4EA 1VPXA 4XTDA 3PBVA 1C8VA 2C15A 3W87A 1G67A 3BLIA 3EXRA 4EVZA 1TTIA 4X9SA 4IPJA 3E02A 4MLRA 2QCMA 3V1PA 4NNAA 1RZMA 1FCVA 4N4PA 3TSBA 3KAOA 4AEOA 5BOOA 3FFSA 3FJ6A 3NYZA 4UNLA 3M5YA 1X1ZA 3P81A 4B5NA 2GUUA 2I1OA 4IMCA 4TX9A 1VRDA 2CLMA 1EPXA 2GPTA 4OGZA 1O4UA 4H3DA 3LHYA 1I8JA 1WBHA 1WXJA 1GPWA 3DBPA 4UXDA 5FEPA 1DVJA 1AW2A 1YTDA 3TU9A 1U83A 2FPTA 4JGDA 4GUHA 3E0IA 4DPQA 3NNTA 3ELFA 4NJIA 1KTNA 2YCEA 3FYOA 2CLIA 4TU1A 2ZFAA 3W1NA 4RJEA 3DGRA 1X6UA 1MEIA 4WD0A 3W1LA 4X22A 1M7OA 1QPOA 3ZWSA 3HMJG 2Y62A 2ZDRA 3SI9A 4LY8A 1W56A 4TR9A 4M7SA 4RKAA 2Z6IA 4MY1A 3W73A 4UR7A 1ZCOA 3A9IA 5D38A 1AL8A 3IIOA 1W54A 3G1YA 3EKLA 3N19B 5K9DA 1VQTA 4WXZA 4LNYA 2WOQA 2RH9A 4GJ1A 3I68A
chains in the Genus database with same CATH superfamily
2JE8A 1MI3A 4IH3A 1PE1A 1PHWA 4K7YA 3F1QA 3SUUA 3D46A 3KBSA 4HPHA 3UGVA 1BKSA 5G4WA 2E68A 2A7NA 1KR0A 3ZVHB 5HQLA 4MWAE 3EOEA 4OHQA 1AK5A 3UZXA 5K9XA 1FCQA 4A8NA 1R38A 2QCNA 4JX5A 3GU2A 4LUSB 3WENA 2CWXA 4QLJA 3KVJA 4POCA 2CZVA 4H9MA 1R30A 4O1CA 2BSLA 1QI4A 1RY8A 1H49A 1UZHA 1PZ3A 4H8VA 3EAUA 3B9DA 1DJGA 3K8LA 4F3HA 3RAOA 3E0VA 1Q7MA 7TIMA 3GDKA 1ADSA 1XISA 2OG9A 3KUMA 3W72A 3IV3A 1BYBA 1SO6A 4NZ1A 3KE0A 3T40A 1WUEA 3IJ8A 1F6PA 5D2XA 4A8LA 1MXGA 1GOKA 4H2CA 2R1MA 1L8NA 1X8CA 4MM1A 4CU8A 3AIRA 1H7WA 3CGTA 3GNOA 4BF7A 1D7KA 4LYQA 3GUWA 4B5XA 1EIXA 1JIBA 4NI3A 1GT8A 2WMJA 1F4HA 2GWNA 2PEVA 2VKZG 2DZUA 3GUGA 3S8HA 2PSNA 4UWMA 4MB1A 1A4LA 4Q33A 3QYQA 4KESA 3R5EA 2PTYA 5ABFB 2YXGA 3EDKA 4YIWA 4Q32A 2DEPA 3EB2A 3VGBA 4QJ1A 2ODOA 1V0NA 1J6OA 2WNZA 3TTSA 1TV4A 3ID7A 1JCLA 2ICSA 2ZUTA 4O12A 1ENUA 5M2FX 2NUWA 2OR2A 2VDGA 1UD2A 3DHDA 3R89A 3BPWA 4XSLA 4ZBCA 4W8LA 3H2EA 1GOIA 1XRFA 2HDJA 2C3ZA 1L2QA 1BVNP 3T0AA 3SY8A 1UBPC 2ZADA 1DE6A 3EKZA 3K4WA 4CCZA 3UU0A 4MNLA 3NQ2A 3G8RA 1BKHA 1G69A 3KDOA 3BMXA 4WKFA 3SFWA 2XH4A 3CZKA 4NZJA 2O9RA 2ZZ3A 1CXFA 3GC4A 3MS8A 1I2QA 3PK7A 2BASA 3BQ6A 1Q7QA 3TROA 5A6JA 5FD0A 5I3IA 4IQDA 3SDOA 5IDZA 2DFAA 3C0LA 1W0MA 1WV2A 2OGJA 5M5DA 1RJRA 2UY3A 1FWAC 5IHSA 2YXOA 3QSTA 1NDZA 5IM51 2NQLA 4GY7A 2ZRZA 5CLWA 4G6CA 4WGHA 1GG1A 5K4ZA 3A64A 2Z0IA 3NA8A 1PCKA 3T1GA 4OE7A 1HG3A 3OZYA 4B4HA 1ECQA 2MUCA 2WVTA 3MBDA 1R0MA 2XSBA 3NOEA 5LHFA 3TUUA 1O95A 4GRSA 1YMYA 3XIMA 4PMNA 3QOMA 3UPMA 5HATA 4HQVA 3GZAA 2YOCA 1P48A 4GI6A 1JF5A 4AD5A 1VHCA 1AJZA 1DPMA 1IGSA 2YCLB 2A3LA 1EJRC 4M6UA 4B5TA 3QOKA 1DORA 3QQ0A 1DHKA 2Y89A 4IMAA 4UB9A 2ZUWA 1CXHA 1WDSA 4H8HA 1U5JA 3P82A 5LNVA 3VOGA 2DQWA 4IIGA 1QK2A 3OLEA 2ZRUA 5KITA 3MI6A 5HXMA 4S3JA 3AS2A 3C8NA 3WNLA 4JTTA 4H19A 4R7WA 3PJUA 3VPLA 4FO4A 3GAYA 2ZUMA 3OHMB 2YFOA 2CLLA 2A0NA 1OQFA 3AROA 1GWJA 3TA9A 4AD3A 4DJEC 4M82A 4M56A 4GI8A 2BXVA 1ZAJA 3S6DA 2CLEA 3FJLA 1GOWA 1V8EA 5XINA 4IICA 1VFTA 2A7RA 4LBUA 1BFNA 4PB5A 1XGDA 1XIHA 1XFBA 5HR7A 1ZPTA 1VENA 3C2FA 3ZWTA 4CNTA 1ICPA 3AZRA 1PHQA 3M6YA 3OZOA 1Q6CA 4NXKA 3TIMA 3ZQ9A 5LA0A 1P6WA 1QNVA 4Y8EA 3FLUA 3WQCA 1Z3NA 3NPUA 3Q37A 1KBKA 4XG1A 3OA3A 1UPMB 4IPIA 1AFSA 3BAYA 2AQWA 1J96A 2BGSA 3B04A 1TJRA 1WA3A 2BMBA 2ZZ7A 3N73A 3M7WA 1PCWA 3RILA 5TNVA 3B40A 1W8GA 4XZMX 3VZYA 5JH1A 2QUUA 4PTNA 3W2MA 3VDBA 2DQXA 2C0AA 1XCFA 3B06A 1K70A 2YL5A 4LAKA 1PV8A 1U1JA 4LOCA 3BLFA 1Q3NA 3QMSA 4DJDD 1O66A 2PU0A 4YCPA 3MV11 5I78A 2J9ZA 3WQ5A 1ZGDA 4LTSA 1ZSXA 3W7NA 5A6LA 1I0DA 4DYEA 1I0BA 3IGSA 2YA2A 3BQ5A 1EJTC 3FKKA 4H04A 2OO0A 1WBJA 4JN8A 3OGRA 2UY2A 3GC2A 4R7JA 3VKBA 1B3VA 3E38A 1EOKA 4HPXA 1TREA 3QC0A 4J9JA 1JFHA 2PGFA 1WCGA 5LZLA 2ALDA 3DYMA 4FK9A 4YJ5A 3CL7A 2FB3A 5CSSA 1IXQA 3CM4A 2G4FA 2CNCA 3CQKA 1KFWA 3FYPA 1E40A 3T8LA 4GVIA 1YXDA 2V67A 4R53A 1FDJA 3SGZA 4E8GA 5IFPA 2B7PA 2WMKA 5TIMA 3RF9A 4QCEA 2GK1B 1YNYA 4G7EA 3S2JA 2YDAA 5FF3A 2ZTJA 1TV7A 3V75A 3FY1A 1LF1A 3VKDA 3QTPA 2DU2A 1SMDA 3BCDA 2XFWA 3GVWA 3SCTA 2QR6A 2OT0A 2XINA 1C29A 1Y5XA 4E2VA 3K1GA 3QZAA 4Q4RA 3TZFA 1QPNA 1REQA 1GZGA 1LQ0A 1E1CA 2HBXA 3GDTA 4QX4A 1Z69A 3IJLA 3SRHA 1V3HA 4J3UA 4JTIA 2VUYA 4IT1A 3P2VA 3DFPA 4JPGA 1MQRA 1C9DA 4YTUA 3LI1A 1GTEA 2QUVA 1A0EA 2J24A 4GVGA 4KWWA 4DWSC 4KFNA 3DFOA 1HXJA 1D3HA 1Y5WA 3WMLA 4BZYA 4Q6XA 4BI6A 1NWTA 2ATMA 1NWUA 1E9ZB 4WY0F 4R7OA 2A6NA 3LV6A 4HU3A 3A5FA 3WUFA 2ZYFA 1K6AA 1JXKA 5EB8A 1U5HA 3LCWA 3ZJ7A 2VX5A 4B4FA 4NJHA 1CLVA 3NIYA 5EU9A 1V77A 1QO5A 3SRDA 3CTTA 3NOYA 3VMPA 4IGHA 2CLOA 4WSJA 4EOUA 4LANA 2C79A 3MBFA 1F6KA 2WANA 2WJEA 4NRRA 1WDWA 1C9WA 1P5BA 2YYTA 4GQRA 1BVWA 2YW3A 2VI0A 1FVPA 3I6RA 2J74A 3LHWA 4D6IA 3V0TA 1JD9A 4DO4A 3UJ2A 4AHOA 3W0KA 3KL5A 2WZTA 3QPEA 3W74A 5DY2A 3GAKA 4O19A 5EYWA 1Z8AA 2RDUA 4WJEA 4N6FA 5AFDA 2BWGA 4ZXLA 4D71A 3O6DA 5F2MA 2YCKX 1GZ1A 4IM4A 1JDAA 1CECA 2O0TA 5BZAA 4LYRA 4OWGA 2GJXB 1LLWA 2E8YA 1PB0A 3GKAA 2E6DA 4UOQA 1RK5A 1UZDA 4EXBA 2WNNA 1KCXA 1E73M 5AHMA 1KFBA 4RPPA 2R1LA 3UVIA 3NM3A 3GVRA 3FJNA 3N13A 3ZR5A 3A22A 1GOQA 4AD2A 1JUKA 2PWDA 1UCWA 2I9EA 3MSRA 4IFOA 4ADSA 4LF2A 1H2JA 4FR6A 4JTKA 4DHGA 5K9CA 3G2GA 4GIRA 3BG5A 3B8DA 4GXWA 3CL6A 2EEXA 1CEOA 3OQ8A 3AICA 1XYMA 3F7JA 5LNUA 1KR1A 1W3LA 3W01A 1ME7A 3UXDA 3VKCA 2CITA 1QHOA 1Q6FA 5D9OA 2NV1A 1V6WA 1M03A 1LRQA 3K46A 4NT0A 4GZ7A 3KBVA 1FHLA 4LRSA 4RX0A 1MFUA 3ITVA 3APGA 3UYCA 3N2XA 2GQ9A 2HTMA 1F8MA 2RFGA 3ZO9A 3QJAA 5MKGA 3UA4A 4DI9A 2EJAA 2VC9A 2O7SA 5AC8A 1WYIA 4LH8A 3KLKA 1HJUA 2NW0A 4RZ4A 4DELA 1K8YA 5HANA 3DHFA 3WJZA 3NQEA 6XIAA 3CUGA 5AZ0A 1IE7C 2ZBTA 4IQJA 1AODA 3WL0A 4WDTA 2V3EA 1PYFA 1EH9A 2XVLA 4ZENA 3E74A 2XG9A 3BDKA 5G2HA 2ZA3A 3UPWA 3N9SA 1MXDA 1U30A 1JUBA 2Y63A 4MWAD 3ARTA 5KZEA 1ZP3A 4KERA 3TA6A 3ERPA 4UNKA 4PYSA 3TV8A 2RDXA 1NELA 1TB3A 4O1EA 4HHLA 4W86A 3R58A 1LLOA 2DT2A 2FB2A 4GNKB 1IT0A 4HBKA 2I17A 2JBMA 3WBAA 4UTFA 4PMOA 3UXLA 5LHEA 1R3SA 4JR5A 3CAKA 1TPEA 4L4LA 2G50A 3AALA 3APYA 4O50A 2QJHA 3WJWA 2A4AA 1PIGA 3WBEA 1PTAA 1OC6A 3F5LA 2EG7A 3ARRA 5I3HA 1D3CA 1FWJC 4FX6M 2V81A 5BW6A 1KQYA 2DY3A 3M44A 4IQLA 4S2CA 2Y5SA 5LGXA 2DORA 2XGBA 2P8CA 4BQ2A 3U4AA 2WMIB 2QYGA 1B5TA 4NJGA 2QJGA 3D3FA 2C1HA 1R9YA 1RA5A 3OQEA 1KWGA 3SBFA 1OK6A 4UFKA 4A2RA 3GR7A 1M9HA 2WPGA 4DWSA 4RNHA 1F73A 3QQWA 3DHPA 4ICMA 5CAHA 3RFAA 4JQ3A 1VF8A 4CQ8A 1DJYA 2ESCA 3PPCA 3NUKA 3D3AA 4XTIA 5LXEA 2PWGA 3KHDA 2QHAA 3LRMA 2WV8A 1QNPA 1XICA 5H8MA 3LTSA 1KV5A 3DKLA 5HA7A 2D2GA 1NFBA 1RQHA 3N11A 3WFLA 5BWAA 3FA3A 3AQUA 4W9TA 3ARXA 1R8LA 2R24A 1EJSC 4WR3A 3ARSA 3BCJA 4AC1X 1XI3A 3NG3A 1GG0A 2HPMA 4GABA 1AZ2A 3VCRA 3TYEA 5D32A 4C6DA 3VGGA 4WY0B 3CUHA 3UR7A 2VEFA 1TMQA 1V3JA 3KBMA 4G5DA 2VVSA 3C2EA 4N02A 4PL1A 1BYCA 2WKLA 5AB3A 3GIQA 4DUWA 4RV3A 1X98A 3P8JA 4RXFA 4FEZA 4AF0B 3D6NA 3R10A 1B57A 4S38A 2PDWA 2VENA 2ZQ0A 4IZGA 1KBBA 3BAWA 4UTUA 2OELA 3HN3A 3H6OA 3TQVA 2VEIA 3H2MA 1J0KA 4DJDC 4K36A 3H22A 3TYDA 5LIXX 3PUOA 3W6YA 4H4IA 4Q7IA 2Y24A 3GNPA 3W7GA 3L21A 1C8YA 3ANYA 3H7RA 4G9PA 4U33A 2QUTA 2BOEX 1GQJA 3II1A 3MHUA 4O15A 1W1PA 4DNHA 3MT1A 2DDXA 3MUXA 3KZPA 1T8QA 4ZGYA 4TO8A 4CNSA 4TVCA 2VRQA 2HXTA 1B2YA 2WVUA 2ZUSA 2QDEA 5FF0A 4LW7A 5HBFA 5D2YA 3PPFA 4MHBA 4E0CA 4LX4A 3LGGA 1SU5A 3LV5A 2Z2UA 3LHUA 4LXFA 4LC6A 3AHTA 2PLCA 4NRSA 4N0RA 3ZYZA 1CLXA 4QG6A 4UR9A 4GZIA 3SW6A 4JYEA 3GR4A 1SZGA 1EHAA 5FJTA 3BLKA 4HJWA 4RV8A 3WK0A 4G56A 1EWEA 1EP2A 4TTGA 1V6YA 2DGAA 1Q7ZA 2X30A 3WBXA 1F4AA 1R2SA 2NLIA 5F1VA 4JIRA 3DX5A 3CT2A 5EMKA 3N9KA 1MEHA 4F66A 5M03A 1HP4A 3ANUA 4MAVA 1TPB1 1OFAA 2GUBA 3BANA 3P0XA 4MG4A 4W88A 4AUBA 4A3HA 5C70A 1Q6LA 3W2UA 4O11A 3U5YA 2ZRXA 3EOSA 2WO5A 3HQOA 4HZ6A 2VFDA 5HNRA 3U7VA 5KETA 1NH6A 4R9XA 1YRRA 3BAIA 4BKNA 3F2CA 4LWWA 5GQBA 4DAFA 2JQXA 2GVYA 3OO2A 1W5PA 1BWVA 1VCVA 1E43A 2PTXA 2ZX7A 4GG9A 2W67A 4O28A 3L4TA 4EWJA 2VD9A 4LF1A 3W24A 4LB3A 5FEXA 1OX6A 4H7ZA 5BMXA 3UCDA 3PAOA 1X39A 1TRDA 1DJXA 4L61A 3LPPA 1VJIA 2ZA2A 2P0IA 4FNPA 3VIGA 2VX6A 4A2SA 3VE7A 3IUIA 3STCA 3W7PA 1O5RA 1EA0A 3UWZA 4ZOBA 1PWLA 2PD9A 4H01A 4U5IA 4LYKA 3UPBA 3BXWA 2QF8A 4WLCA 1VH7A 4Z0SA 2FKPA 2CHNA 3M41A 2ZVIA 1THFD 3NQBA 1IZJA 3VD4A 1WKDA 2F61A 1NM9A 3ABXA 2I57A 3HGJA 2H3DA 1VBGA 3WLMA 1TV3A 4C6NA 4Q7BA 3WMSA 4PODA 1TA3B 2YGYA 3PVFA 3OG2A 2J8GA 1FKWA 1UD6A 1BGGA 3W75A 4L4PA 3U8GA 1NJJA 4GH3A 2X7VA 1UOZA 4MFEA 2YSWA 4U28A 1ELSA 1XXXA 3T2QA 4I5XA 4HTYA 3PZQA 2P0OA 2PF0A 4A8RA 3LU2A 4Z08A 3DCPA 3O6CA 3PY2A 3W53A 3P7YA 4ONVA 1E0VA 4AMCA 2XFYA 2HVNA 3Q4DA 4N6EA 2GDUA 2VO5A 4DM2A 3A13A 2CU0A 2XUCA 1T7LA 4C6QA 3C5QA 5U7SA 3SO7A 1O7AA 2EQDA 3W27A 1TR1A 1GJPA 4C90A 2VZUA 6PTDA 2PCQA 3UGRA 4B9ZA 2E3ZA 4NAFB 2V82A 3GNNA 1VRXA 3BLEA 1TX2A 3ATYA 3AFBA 3MCOA 5D8ZA 5AOUA 2FJUB 3NEHA 4JQ1A 1ZFJA 2FZMA 5FJUA 4FLRA 1OIFA 3JZUA 1XSIA 4DJDA 3WLSA 4XSMA 3IVSA 5HNTA 4INFA 3PSWA 4QAIA 1RVGA 2J75A 3C0QA 7TAAA 4AFYA 3DFQA 3U2CA 2DH3A 5FSEC 4HOZA 1JDFA 1QK0A 4PGLA 5I2UA 1XLKA 3THQA 3IVUA 2VURA 2Q8XA 1KRAC 4X9YA 1C90A 3PJXA 5F2IA 1UR3M 3AMCA 3WIJA 2CPUA 4ERAA 4RZBA 1EXBA 1KQZA 2YCIX 1QUMA 4MWAC 2G41A 3QR3A 1E3XA 1XBYA 1DWAM 3S5OA 6A3HA 3AMGA 1QATA 5TAOA 1ZBKA 4XBSA 5HJXA 2IMRA 5E09A 2FZ9A 3HOJA 2E5DA 2P53A 3H4GA 1UR9A 3ZLHA 1XDMA 3A23A 4FSAA 3W7DA 3O0KA 3MDWA 2ATSA 3B0UX 3S1UA 3C2VA 1XKYA 3EOLA 4PRTA 3N14A 2D22A 3PZVA 1P1XA 5C9ZA 1GNXA 4HNLA 5I79A 3MB9A 1KXVA 4MZYA 1OEPA 4P8XA 3F03K 3TVAA 1GGOA 4GC4A 2QDDA 2DIEA 3TQ0A 4QXIA 1MUMA 1BF6A 2DIKA 3NEVA 1BTMA 4GI4A 1HVXA 3NFUA 1S5MA 1E6QM 2Z7KA 1XUUA 1KRMA 1GEQA 2QKFA 2OMAA 1F8IA 2LLEA 1RY0A 3E0WA 4HGXA 1P6BA 1T40A 1XLMA 3W2JA 5KZDA 1JNDA 3CO8A 2W91A 1KM2A 4PMYA 1NOFA 4F0RA 3L12A 3GG0A 4G1KA 3EZ4A 4XZBA 1CGXA 5H91A 1JD7A 3B0XA 4D9PA 4JIIX 1SO5A 1FCBA 4HTBA 3PG8A 1EP1A 1WXZA 1B90A 4GYPC 1RVKA 3S9ZA 5EY5A 1QXLA 4LT9A 3SCQA 3VGHA 1KGWA 4PSRA 3TC3A 3RCYA 3A24A 1BG9A 1DJIA 2DZPA 3TTYA 2GUYA 2VFEA 3T0BA 1A50A 1RBOB 2DW6A 2VEKA 3MMDA 2VZTA 1LTDA 2Y70A 3TYUA 3LTYA 1TWZA 2G8ZA 3KTCA 1UR2A 3M5ZA 1Q63A 4UFIA 4JTAA 1RBLA 2PS2A 3W00A 3S0CA 3LHTA 2X2GA 4WSKA 3KL0A 3FA5A 5CGQA 4X2RA 2JGYA 4R34A 2J13A 2R91A 4Z1AA 3W38A 4BI5A 2I7GA 1B31A 3EEGA 5IOBA 3UWEA 2D0FA 2XIOA 3VX1A 4MB4A 3P80A 2ZE0A 5AN7A 2V63A 3JW7A 3VNLA 2VWSA 2PRHA 3GD6A 3CK5A 5H8PA 6CGTA 3HPZA 1CIUA 1KM6A 1FWFC 3GS6A 3AJXA 2QCLA 3CQ0A 4UOZA 3S1GA 2RGMA 3LGEA 2GYIA 3T4WA 3JRKA 4BCEA 2OXNA 1V79A 2V3GA 5A6KA 4GZJA 3GTFA 4JTHA 5D09A 1BD0A 4GWEA 1KM0A 2ISFA 3LCHA 2FHFA 1B54A 3SQMA 1QCWA 3O6AA 4JCMA 1S2CA 1DJNA 2IPFA 3EX3A 1BSIA 4HMDA 3W6LA 4JYDA 3L4UA 2VWTA 1W5QA 1FX6A 1RJPA 3LLXA 3WQOA 1GYNA 1QVBA 3KVKA 2D23A 4JS3A 3STGA 1QT1A 1JJKA 4D6JA 2PTZA 4QE4A 4WRHA 3UXKA 1JQVA 4PRRA 3VD5A 1VAHA 2INFA 2ZX6A 4HNUA 3B8IA 3VOHA 3ICJA 1J93A 5EMMA 1VZWA 4EPBC 3FVDA 4QEEA 1YPIA 3S5YA 5ABEA 4HYWA 2CLFA 1O5XA 3TYAA 1WB0A 3R1ZA 4ML9A 4MSSA 5REQA 2GVJA 5FACA 2O55A 1QPQA 2Q3OA 3Q65A 2X1TA 4DAIA 3BSMA 2CW6A 3A4AA 4TV6A 1QMLA 1Q6DA 4C6MA 3BO9A 2BVTA 5E1QA 2XIIA 1FBAA 4X60A 3S3GA 2QW5A 3O3RA 1UD4A 3OYZA 1AUSL 4Y9MA 2ZOXA 1BAGA 2E77A 3BMWA 2WXDM 4JY8A 4KCVA 4LNCA 1JR1A 3N3TA 1VJZA 1XYCA 2HCVA 3C61A 2CLKA 2X0YA 4MWAA 2R1PA 3GSMA 3WF0A 4PUNA 4KGJA 5GVJA 3H23A 1ML1A 4EF8A 3ZOAA 3FNDA 2YZRA 1JVNA 1VEOA 3RJYA 2J66A 1FH7A 1PKYA 2ZRVA 2Y8UA 1TJ2A 3K2GA 1SFSA 5HMFA 5BXTA 3R0UA 3R25A 3TLQA 1J12A 2VFGA 2E6FA 1WAUA 4HT3A 2OYKA 4GO9A 1VYSX 2QCDA 1MNZA 1O6IA 6REQB 1E55A 3AMDA 1X96A 1OC7A 2WZEA 1IEIA 2E09A 2ZZ4A 3AMLA 1YXYA 4LY4A 3RLHA 4IX0A 4D1IA 1JCMP 1H7RA 2HZGA 4K3ZA 1QRQA 4B3ZA 3MO4A 1G7UA 2E40A 3RMEA 3BGGA 4KFPA 4YTTA 2QGYA 4I6KA 3SCOA 3IJIA 1PKLA 4H9TA 3WFZA 5A8PA 2C15A 1PEZA 2E25A 3BLIA 2QVHA 6ENLA 3E02A 3EPNA 1JDDA 3V1PA 3JZEA 3PZ9A 5DQPA 4Q8VA 4LFYA 2GL5A 1FCVA 4N4PA 1R3QA 4ILSA 5EMJA 3F2BA 2VCBA 2DZBA 1UWAA 3SRKA 3NYZA 3KS5A 3M5YA 4UBPC 2I1OA 4TX9A 2WC4A 1VRDA 4GYPA 2YDSA 4H3DA 1RH9A 3GU9A 5I6SA 2VRJA 2CBIA 3AWOA 3KBNA 5E5CA 4Q4SA 1TIWA 1YTDA 5A8OA 2VP8A 1LT7A 1FTXA 3REQB 5CC3A 4BS0A 2V5DA 3ELFA 2YCEA 3W1NA 1VD6A 2GGGA 5AC5A 1X6UA 1UA3A 3HTWA 3MKKA 4WD0A 4HPGA 1QPOA 1XC6A 3HMJG 2Y62A 4KETA 3SI9A 1W1TA 4PBEA 2OX4A 1UQZA 2Z6IA 4MY1A 5DMLA 1ZCOA 4XZWA 3A9IA 2PMQA 1UP2A 1VFUA 3N19B 4C5YA 2PGWA 4TVUA 5ABGA 4PE8A 1W9BM 3KOZA 4WXZA 4QTGA 3LSBA 2O4MA 4GJ1A 3B9NA 2GLKA 3I68A 3NWRA 2V3FA 3CAWA 2V30A 3IJQA 1EUNA 3MCMA 1W2VA 4U31A 2BVYA 1M01A 2PRLA 1LL4A 3MWCA 1D3GA 1VLIA 1YEYA 4GUIA 3MJYA 1AL7A 3REQA 3EWCA 3NR0A 1AD1A 2RHGA 1XLJA 3CV7A 2FH8A 3ZR6A 4RL3A 4CQDA 2GVEA 3ARZA 4DJFD 2VGFA 3T4CA 3TJIA 1YX1A 4JIPA 3I6EA 5DXYA 3AS1A 3SY5A 1ODZA 1E5NA 2D24A 4LCSA 1K4HA 3T2PA 4F0SA 1LZOA 3NYDA 3ABOA 3DIPA 2X05A 3RLVA 1H1NA 1HGWA 1RPXA 3B0PA 3H53A 3PUGA 4H6KA 3GBEA 3RPTA 2PDIA 5I3JA 2V0TA 2HSAA 3K4AA 1R46A 3CIVA 1TZ7A 2J9YA 3RCMA 4JOMA 2VR2A 3A3WA 3DZ1A 4IL2A 2QEZA 1GVRA 3U0HA 5XIAA 1Q13A 3EPOA 1UKSA 4R33A 4XD5A 5AECA 1CBGA 2QCHA 3O1NA 4JQ2A 3L5AA 1V6XA 3WD4A 3FYYA 4KRZA 2B0MA 4HA0A 4PMJA 4FIQA 5LXXA 2QCEA 1W9DM 2Q09A 4GINA 1SSGA 5DCBA 3RO8A 1BRLA 3RR1A 1ONRA 3EMZA 3EDEA 3O6YX 1EJWC 2HBVA 1CB7B 4BF5A 1W3NA 3LPFA 4UZSA 4WIWA 4AYGA 2QULA 2IQDA 3EPMA 1SFJA 2C6QA 1Y7VA 4GYFA 3C0SA 5BRBA 4ZO9A 4ZO7A 2J7EA 3NQGA 3WBWA 5I07A 3WFAA 3YPIA 3XINA 1YIXA 2WSYA 4Q8PA 1QAPA 4ZSUA 4C6KA 1TZ9A 2J25A 5D05A 2DZSA 1R5YA 4BFAA 2IPWA 3M4HA 5CSUA 3D5HA 3OVQA 2CZEA 4L56A 4QITA 1N8FA 4U10A 3EOOA 4QRNA 3G1XA 1X1OA 2RJGA 1XS2A 3H4WA 5K4XA 3L4ZA 3H70A 1YXCA 3OODA 2IKHA 5EPDA 2CERA 3TZNA 2JKPA 2DVXA 4Y9OA 2DJLA 3NVTA 3SFKA 5LA1A 9XIAA 5A6BA 4LAZA 4QM1A 1EPVA 4X63A 4IHCA 1XINA 4BEUA 4AD1A 5CXPA 5C2XA 5FOOA 4P5UA 4XAYA 3NDOA 4XUYA 1ADDA 4LALA 4DF0A 3UESA 1EP3A 4OTKA 2B4GA 4C6LA 2OPJA 3WD0A 1N82A 2BFGA 3SN0A 3UQNA 1TJ1A 3B3DA 1OX4A 2NQ9A 1NF0A 1HJWA 4AZCA 3LQLA 4AWTA 1KW1A 1JYNA 1GHRA 4CUCA 2Z4GA 3RG6A 3TW6A 1JNEA 4X0NA 3VIPA 1M65A 5GJMA 1JFXA 1FKXA 1YTEA 1AVAA 3PBWA 5LNSA 1YNQA 2DSWA 2ZZ2A 1ZU8A 3W7QA 1GJUA 1RALA 1UR8A 4JHMA 4QIUA 4O53A 4UC5A 4A29A 4J27A 3WDIA 4LUJA 5AYBA 2HJPA 3CHEA 1J0YA 4ZFMA 2P88A 1GVIA 3S5NA 4TMBA 1PXGA 4REQB 1MFVA 2VEMA 3DG6A 3FX4A 4IG2A 5L6UA 1D9EA 1P6CA 3L2LA 4IP7A 4HA4A 5CPQA 3QY8A 2F8QA 3AIUA 3GHSA 5CC7A 4GE8A 1PX3A 2CC0A 3MKCA 1DWIM 3BAJA 3HU7A 3BAXA 3MW7A 2PUZA 1FOBA 1MZHA 3E49A 4GIYA 2NX1A 1BGAA 3WEMA 5CBJA 4AX7A 3LN3A 4RZ5A 5C2GA 3C0JA 2NXGA 3TOYA 1R47A 4J3ZA 1JCNA 2NX3A 1BEUA 3TJXA 1AW1A 2VQUA 2J7CA 4GYKA 3CUZA 3ONCA 2W3ZA 2G4JA 1UW9A 3R12A 2VQTA 2XVNA 3DEQA 1Z6KA 1M7PA 3U3HA 1Q6RA 1DWHM 2YDRA 2ALRA 3LOTA 1BYAA 1XSKA 3LMZA 3W76A 3H12A 2OQYA 5DT5A 4UQ9A 3L5MA 2GGEA 4AW7A 4AWUA 2Q01A 2YA0A 3WSUA 3VIFA 5EMYA 3W29A 2DT3A 3VD9A 2QDGA 2ZUNA 3K30A 1A5UA 1CX9A 1RCOB 5CJ5A 2ZDSA 1UKOA 1Z44A 2J6VA 3CEPA 3N6QA 3NQCA 2HROA 4GX9A 3MZNA 4EAMA 3PAJA 5E93A 3CTLA 5IRPA 4JTCA 3RRAA 5DANA 4XIMA 4ALDA 3VMNA 4XUGA 4GQGA 3GHUA 2VJXA 4W4QA 2XGZA 1H7XA 4D1JA 1ME8A 1WE5A 2H3BA 2QMJA 3VNIA 2G37A 3PUEA 3KLLA 3PWGA 1XH2A 3USZA 5G4EA 2VRKA 4N2YA 3BCFA 1OCJA 4ZEPA 3HG5A 4ADTA 5I03A 5LIKX 3VO0A 1UR1A 4CU6A 4BJHA 3HIJA 2BX7A 3M6DA 4RW5A 3PS7A 1V03A 1M7XA 3DESA 2HEJA 1A5SA 1XIIA 4M0XA 1EC9A 3GG7A 2Y7GA 2ZX5A 3T55A 2VDHA 3VXGA 4D6FA 3L23A 4EWND 2GVLA 5CGTA 4UQEA 3CYJA 4ZO8A 1NFGA 3BGAA 5HMEA 4Q8MA 5JMUA 4C1LA 1SR9A 4MUPA 4CLMA 2CBUA 3O06A 5BCAA 4NF7A 4NL1A 4IMGA 2ISSA 3ITCA 4FXSA 2ASHA 1QBAA 3BLDA 4O18A 4RE0A 4CVWA 1QDSA 2CWNA 3PZUA 3C4UA 4PL2A 4PUKA 2PURA 1Y8BA 3KOYA 1HNYA 1HKKA 4JFTA 4DBWA 3LEPA 4S3GA 3G0SA 1TELA 2NWSA 1FQ0A 1CWYA 3LTPA 3T42A 2CEQA 3DI1A 3BV7A 1QFEA 5CPNA 2WNWA 3TWBA 4V1YA 1A5AA 2WVVB 1TWIA 4YTRA 4N42A 4ZVJA 4XX6A 3GH7A 1FFQA 3W22A 2WZIA 4F0HA 3IJ6A 5H8UA 1W8SA 1OZQA 4XAZA 1S3HA 1ZLPA 1VPQA 3MUIA 3AYRA 3EWDA 4DJFC 1KB3A 3OLDA 5I77A 3KOXA 3BL3A 1SJDA 1TJ0A 1ZL1A 1O12A 3THAA 1LG2A 4RCXA 1MSSA 4BWLA 3MA8A 2PLKA 3AS0A 3SCWA 1PIIA 3KRUA 1DXEA 3HG4A 5I0DA 1XBZA 2BB0A 3AHVA 4YU1A 2HISA 4P8VA 1FCUA 1CGTA 1QHPA 1NDYA 2POZA 2WC3A 2FVMA 3VOCA 3KDNA 5CZ0A 1YDNA 3NL2A 2G97A 2OQHA 3H54A 1O1HA 3JS3A 1C8XA 4R88A 3VNKA 2W63A 2WBGA 5HPOA 3MI3A 1JCTA 4E8CA 2CLHA 2FLIA 4EXQA 4OT7A 2DSVA 1UH2A 4HN8A 5E0FA 5AHLA 1W9VA 4EK7A 1Q4WA 4LEQA 1EZ2A 5KINA 3WK3A 3UY7A 1RSCA 3ECQA 2YB4A 3CH0A 5HWNA 2FH6A 4PULA 1DV7A 1CXEA 1FH8A 4PFHA 2PDMA 1KNWA 2PC4A 2XYLA 3M64A 2VFHA 5ECUA 4EIVA 1YHTA 4B3KA 1KLYA 1E4NA 2Z1SA 2ZXAA 3QM3A 4P7RA 2JIWA 2CZDA 2Q8ZA 1VCGA 4GJJA 4RE4A 3M0HA 3CMGA 1TV2A 3VD3A 4U3AA 4CD8A 3H2NA 4IPLA 2F9RA 2IPJA 3N15A 1F07A 3QZEA 1OFRA 5C9RA 4EXAA 2O92A 4E38A 1XD1A 2PGRA 1US3A 2R14A 2POTA 1JCXA 1IEVA 2F84A 4PC8A 2E6YA 1VYPX 3TNBA 3KRBA 4AQLA 1EJVC 1TQJA 4LVDA 3M5XA 1X6LA 3R8GA 2QPXA 4H9UA 3GBDA 2CXGA 3M43A 3TEVA 4E6MA 4P2VA 4J28A 2GJPA 2V6AA 4WJXA 1TPWA 3QN3A 4AIEA 1EGVA 3G1DA 1VFMA 2J88A 4HJFA 3WNNA 2NQHA 5CCZA 1BG4A 3S5SA 5F2GA 2OYMA 1XH0A 3CT7A 3TCSA 4UTHA 5FF4A 2A5HA 1W1IE 4M6VA 1EKOA 4WOZA 5JXQA 2W6RA 2JK2A 3N6HA 3MUCA 1VPYA 3QY7A 1SSDA 3TH6A 1GVQA 5E70A 1JZ8A 2R1KA 3GRIA 2J7FA 2VD8A 5TD4A 4A3RA 3HJZA 4GKLA 2F6XA 3RX3A 3BJTA 4XO7A 1DXIA 4UTLA 3L2IA 3PZMA 1FHVA 4YL2A 3W88A 3UG3A 1W31A 1N8WA 4GK8A 3CLWA 5A8QA 3S6OA 1B4EA 4MMWA 2CCRA 3W85A 3N29A 1GYMA 1E6XM 3BLLA 3A3XA 1R7AA 3L2MA 3H2OA 4AX6A 1A5BA 3PZIA 4PMUA 4AZBA 4ICNA 1UBSA 4MFDA 3ZSTA 1UP0A 4FI4A 1EX5A 1E1FA 3WH6A 2E8ZA 2V5KA 4FOUA 5F4SA 1OHLA 4N9BA 3C3NA 3W70A 3G0UA 3V35A 1XLGA 3QGVA 3S1VA 2PDGA 1FUYA 3OVPA 3TTQA 4DVOA 3TP4A 1HJVA 3N4FA 3K13A 1IT8A 1XP3A 3RU6A 2Z26A 1LBMA 2XN0A 5T91A 5FF2A 4FLQA 3WQPA 2PWUA 3ALGA 3S46A 2C1IA 3F4VA 4QSHA 3L4YA 3WH5A 4FNRA 3AYSA 1HFBA 3LS9A 4X0VA 3A3HA 1W6TA 4NU7A 4AD4A 1LUCB 3NQ8A 2J6XA 2W66A 3UJRA 1PZ1A 4CQBA 4DJFA 1N55A 4ES4A 1GKQA 4TOQA 4W93A 1SFLA 1WDRA 2WBKA 1ONXA 3QTGA 1KBJA 4UMAA 1OSEA 3BMVA 4UFJA 2CLPA 5TF0A 3BH4A 3IANA 3FXGA 2ADAA 3L9CA 3QSRA 3R7MA 4GIAA 5D2WA 1ODUA 2REQA 4YTSA 2YIHA 4JFUA 1V6VA 1L6WA 1MUWA 3S5ZA 1T0OA 3E96A 7REQB 3U6WA 1UYQA 3SQSA 4ROPA 5J5DA 3N18A 2O7QA 3NGJA 1NIUA 5A6MA 3UBPC 1CZ1A 3OIXA 3TXZA 3MHFA 5LIYX 3AXHA 2HPIA 2HRWA 2V5BA 4K8EA 1OG0A 4F2BA 1LQ2A 1CXLA 3TYCA 1JPHA 1TMHA 1UZ4A 2EAWA 4IPPA 4EPDC 2WHJA 1P43A 3FEMA 1NP0A 3N3MA 4NNBA 2PDLA 4P7OA 5DO8A 4JTUA 3NZGA 4B2DA 3BE7A 2CXEA 2VC7A 3WDRA 3ITTA 1XM3A 3UG5A 3O07A 4FNUA 3IK4A 1TZZA 3ZM8A 2CZ5A 2PDCA 1HIZA 4E4PA 1DJWA 1GQNA 4NNCA 3VOFA 4UMCA 3CS2A 3TMLA 3QKEA 3SQLA 3N9RA 5D2TA 1XBVA 2UZ9A 1PL9A 3PFRA 3ZSSA 4G8TA 4LAMA 3KZSA 3PB2A 4UTTA 1FXQA 5D8WA 2Y1HA 1LLZA 3UCQA 5FAGA 4QBXA 4CN6A 5IFTA 2BLEA 2XISA 4MY8A 1P7TA 2FZDA 5JU6A 1YNPA 4JIQA 3TYZA 2ZWZA 4I6VA 1H5YA 2PWEA 2WKGA 4GNJA 2G5WA 9RUBA 5JBFA 1Z89A 1YBQA 1RBAA 1S2AA 4F48A 3T9PA 4UFMA 4M24A 3PPHA 4GC3A 5DCEA 1XIFA 5LYRA 4NQ1A 3CZ8A 2A7PA 2WK2A 3WK1A 3ME3A 1YKWA 2DJXA 4Q4MA 4HZMA 3EXTA 4K7VA 2XZ9A 2PD5A 4N9CA 5BXRA 3LBOA 4I9AA 3R43A 3GW0A 3UXAA 3TN4A 1SMAA 5LKYA 1WOBA 1UA7A 5CG7A 4W5ZA 2VEGA 2QUMA 3OP2A 5I5RA 5EMUA 1H4PA 4XD4A 3OIHA 3A4JA 2ZZ5A 1T5AA 4ATLA 3CWNA 1TRIA 2PDXA 1E15A 1UKTA 1N7KA 3NXLA 3LCXA 3GKFA 3EWZA 2ZRWA 2QXWA 4AWSA 1PTDA 3UWYA 2WZHA 2J7HA 4AEEA 4AISA 3EGJA 1NSJA 2HK0A 5JBEA 2OSWA 1MVYA 4Q6JA 1C7SA 1F3EA 3TX9A 2EG6A 3IRDA 4QQ3A 3W23A 3AU6A 5D33A 2Z00A 4F2UA 1KTBA 3I4KA 4GO8A 4Z17A 2H8XA 5LA2A 1W2PA 4UIOA 4O57A 1P0EA 3N34A 2OU4A 3GIYA 3KVLA 1L6FA 1HGYA 7CGTA 1WZMA 4OVXA 1TFVA 1OCQA 4KCTA 2X0SA 4DNMA 3H7VA 3W7LA 3UXIA 3KHJA 3TONA 3DFHA 1H09A 4AAJA 1EX1A 3TJLA 3OJGA 4RZ6A 4AZGA 1OF8A 3VZXA 1ZRQA 2J4GA 5BRPA 3DFNA 2PRMA 4O1FA 4ZQCA 1F3XA 3CWOX 3GR8A 5KZMA 4K68A 3C56A 3OW1A 3FS2A 3PBUA 1U5VA 4OOZA 1H62A 3DXIA 4PB4A 2PP1A 3VILA 3W4RA 4WUIA 1JCYA 2WMHA 3CZGA 3TFXA 2W79A 3DFSA 3V18A 1Q6OA 3AIVA 4C6FA 3OOQA 1V93A 3T81A 2Z29A 1XW8A 4G2DA 4GXPA 2OWXA 1L8PA 3G3DA 1R3TA 6TAAA 1S5VA 3GFXA 2QJJA 4H9VA 3GIPA 4GIEA 4ZQRA 3P6LA 3FGCA 2RGLA 3TC7A 5JH2A 1XH1A 3AZTA 3G8EA 3QHMA 3RLGA 2CIPA 4FNTA 8CGTA 1H51A 1DJZA 5HMSA 1NAL1 1V3LA 3QEZA 1H1ZA 4KKXA 4Q4KA 2NV9A 1ISZA 2Q8LA 2WLYA 1OGSA 4DXVA 1E0WA 4P61A 1XIMA 3JUGA 2BY3A 2V2HA 2ANUA 2VCAA 2VT0A 2OZ0A 1Y0EA 3BARA 2INZA 4CQCA 3WKZA 1TSIA 4DLFA 3HB9A 2AOSA 3ZVHA 4NG3A 3NZQA 1V6UA 3WEZA 5DXXA 5AC7A 3WDQA 2V2DA 4W7VA 3I10A 4NJKA 2O9TA 3OLIA 3RJXA 2WQDA 4RDVA 3A4XA 3ZVIA 4LUSA 2QPUA 2OSYA 4HMCA 4MDPA 3E5BA 1CGYA 4KMQA 3LY0A 4D72A 1W9UA 3HURA 3B0YA 9XIMA 2V5JA 2WHLA 3WLHA 3QPYA 4B91A 3H7UA 3UZJA 1E9YB 2XPKA 1J0ZA 4LBRA 1H11A 3QF0A 1NQ6A 4XKYB 3RNDA 4B5SA 3CQJA 2C14A 3T07A 4UTWC 2NQZA 4QNWA 4YTQA 3WLKX 1G1YA 2WNQA 3PTKA 4B3LA 3ARVA 5CKSA 3IIPA 4W84A 3IWPA 4KIRA 3PZNA 4XISA 3MYOA 1V5XA 2A79A 2HS6A 3PC0A 3LK6A 4DYKA 2E7FA 2HE5A 3LCGA 2TPSA 4O10A 3LBMA 4Q4OA 4QG9A 1A4MA 2I56A 2FVKA 3QPZA 4MDOA 1HVQA 5H6HA 4Z1CA 3NAVA 1IR2A 4FOKA 3QV6A 3I7RA 5ABFA 3WN6A 4OUIA 3SUTA 2ZC1A 5A2AA 5DLCA 3CV1A 1JZ6A 2FGLA 2HNHA 1YPFA 3GH4A 1PVNA 4LU0A 1SZEA 3GK0A 4GCXA 1TPVA 4U2YA 1DE5A 2XDFA 4AHQA 2BODX 2E28A 1D7FA 1JPKA 4V1XA 4E3VA 4TX8A 4IGSA 5G2WA 2FVLA 3K4DA 3CZEA 1WKYA 4AMAA 1XGZA 1SO3A 2EPKX 4K37A 2OKTA 3FA4A 5U4NA 3VYLA 3KX6A 2NT0A 4AEFA 3ES8A 4J2MA 2FHCA 3GXIA 3POCA 4ZB5A 5FIPA 3FV9A 2FQIA 2A85A 4YLWA 3TQPA 4Q8OA 2YB1A 3W02A 3DU0A 3MDUA 4K1GA 1QNRA 3FCPA 1K9TA 2QVNA 2WW5A 5KEZA 1ZBCA 1TE6A 1KBIA 5GPRA 3LENA 1QI3A 3GQYA 3KCJA 3WNPA 4YXGA 4O8AA 4P8UA 1OT2A 2FIQA 4DRSA 2H6RA 3M0VA 1POKA 4MYXA 3ARQA 3SCPA 2BP1A 3HMCA 3KL3A 4IXXA 1EJUC 4GLEA 4MLJA 2Z1VA 2WSPA 1HL2A 3E3HA 4FLSA 1KRBC 2NXIA 4HYRA 1EXPA 1E0UA 7ENLA 4S3FA 1XBXA 3MZ2A 4KF1A 3RX2A 3MO7A 4I8YA 3FEQA 1R87A 1ITCA 1US2A 1A49A 1Q8AA 3DI0A 3HBLA 5FJOA 2CBJA 1OT1A 3I7SA 2F2HA 2YCLA 4C6PA 2YW4A 1WDQA 1F7BA 3SM0A 2IQ0A 4FF5A 2PGEA 3BK0A 1UC4A 4WZHA 1E6RA 1EGZA 3MP3A 3F5JA 4HNNA 3NO3A 4JTLA 3UNTA 3WDHA 1VBRA 2HMCA 4ZZ9A 5HOSA 4GCAA 4KEUA 5DMNA 4A05A 3P5ZA 3VDGA 3GVGA 5FEWA 2GDQA 2UY4A 3CH9A 3KW3A 3TAOA 3UWQA 3W7EA 3PTQA 4MJ2A 4LRTA 4IUOA 4YVVA 1UASA 3G1AA 4YMZA 1T99A 2TAAA 1O1ZA 2WMFA 4O4WA 2DZVA 1LOLA 1GHSA 1TJPA 5BOFA 1VP5A 1WNOA 1SZFA 1VBJA 4ZFCA 2UV8G 5C55A 5E9XA 4EE9A 4EP8C 1HKMA 1CPUA 4LVAA 1R3VA 3MYPA 5ECVA 2J7GA 3DAQA 3SRFA 1K3UA 4P7NA 3NQAA 4F40A 4NZ4A 4IF2A 2F6UA 5F4WA 4M1RA 2QPSA 3PWAA 4ERGA 2OTDA 3MC5A 3KOWA 2BZNA 2HVMA 4IFKB 6TIMA 1VBUA 1R9ZA 4UTWA 3SR7A 1CXKA 2VGIA 2ZWYA 1MW0A 3NSNA 4EANA 5FL1A 5J04A 2ZUVA 1E70M 2FGBA 4C6BA 3AWNA 4PUEA 2XZ7A 3BICA 3MUY1 4IP5A 3GNRA 4W8AA 1E9LA 3T0TA 1K8ZA 1U2YA 3RITA 2G3MA 4FF7A 1J4EA 4XTDA 3PBVA 1C8VA 5D9NA 3W87A 1G67A 3IARA 1TTIA 2OZ3A 4MLRA 3URQA 1QNQA 2R1NA 3VUSA 1EYWA 3FFSA 3R94A 4UNLA 1X1ZA 1TWSA 3PPGA 4HD5A 4IMCA 2OEKA 3EBVA 1EPXA 2GPTA 2VCCA 2P8BA 3LHYA 4WGXA 3DBPA 3BWWA 1OM0A 4Y2WA 2V68A 2GK1A 2ZUUA 2QNEA 3TU9A 2FPTA 1MW1A 4GUHA 3NNTA 3ARYA 4NJIA 4FALA 2PDNA 2CLIA 4TU1A 4RJEA 3DGRA 1I6NA 5C2CA 4CKQA 3DHUA 1EF2A 4X22A 2R82A 2ZDRA 1TKKA 1CGVA 4RKAA 1XLBA 3EA2A 1Q4NX 3W73A 4J5NA 3RYSA 3KWXA 1E0XA 1W54A 3V0UA 1ITQA 3G1YA 3EKLA 3AS3A 4CD7A 2VZVA 4Y7EA 2VZSA 4LPCA 3ANVA 4PUMA 5I00A 4NAEB 4QLLA 2VTFA 4U4MA 2BG5A 2J7BA 3MP5A 1DBTA 3URBA 1GVFA 1S2VA 1KCKA 4ADUA 4JFVA 1XUZA 2BTMA 2CFFA 5D4YA 3TLLA 3PULA 3O9NA 3VM7A 2GQAA 3L68A 1JRBA 1XIEA 1AJ2A 4KFOA 3LM7A 1M7JA 2X1UA 1M41A 1NDVA 4L1XA 2AGTA 1H5VA 3N2TA 1LROA 3AIWA 1LP6A 3SUSA 4N7QA 4S3DA 3NO1A 5JQ9A 4EPKA 5BXSA 4DJEA 5LIUX 3AU2A 2PDBA 4RXGA 2ACSA 5CZJA 4C1NB 5GJNA 1YDVA 3HF3A 3VMOA 4UQBA 3GX9A 1J2WA 3NTYA 4MIMA 1JL8A 1LOSA 2QQ6A 4Q4QA 5AHFA 4JICA 3BOLA 3AIBA 1KD0A 3VUPA 3A47A 1KLZA 5T26A 2FFIA 3CMFA 3KVMA 3T8QA 1FXPA 1VFHA 1VIWA 3DC0A 2BXZA 4GZEA 4B15A 1R6WA 8RUCA 2WVSA 2GJXA 4HYVA 1FP8A 3QMRA 3HPXA 4MKSA 6ALDA 5E0KA 4OV4A 3IIZA 1UIOA 5ENLA 4FIRA 4WXYA 4ZL1A 4Y9NA 5EKYA 3AUOA 2EPNA 5JBDA 1W1A1 3UD6A 4GI9A 4O54A 4B90A 4HHMA 1W91A 4J4KA 3S1XA 2P5NA 4AIBA 3G1FA 1XIGA 3BG9A 4O1BA 3QC3A 2AAAA 1NWSA 1LRNA 3HZ3A 2UBPC 1OFPA 3U2ZA 2GWGA 3KRSA 1A0CA 1AH4A 1K8CA 4LEFA 2BDQA 1Q2SA 1GKPA 3AIEA 3NPVA 2AQOA 2VDIA 2IUZA 1AQFA 5AYYA 4JKKA 5LNRA 2A3CA 1EDTA 3IEBA 2WCAA 2JEPA 3D47A 3PFMA 4WDUA 3LXAA 4GYJA 1C91A 3U2OA 2DUXA 3CHDA 3C2OA 2PP0A 2E9LA 1RQEA 2YPIA 1DP0A 1CNVA 2PODA 1J0HA 4KEMA 2WYSA 1QBBA 4KCWA 2RDTA 3MHGA 3QMTA 1IXPA 3IIXA 1TCDA 4Y90A 3R0DA 4WOQA 4FOJA 4AZHA 2FTWA 4H7VA 1WAWA 1QI0A 2BHUA 4Z0JA 1WUFA 2AL2B 3QR0A 3IIVA 4TTUA 4K2SA 3GWQA 4P7LA 2B31A 1BTCA 2FGZA 1BQCA 4DZAA 4A4AA 2E1DA 3AHZA 4ACYA 3A9BA 2ZE3A 1AMYA 1O5KA 4PCFA 1B0IA 3FHQA 2NVCA 3GXMA 3TXVA 1TYGA 2GSEA 3EA3A 3NL5A 1Q5MA 4GY1A 3ZLFA 4AZ7A 3LD5A 1D2KA 1R3RA 5LIWX 3MVIA 2RJHA 3ABSA 4WK9A 4DWDA 3P74A 1TQXA 1SZNA 4HCHA 5CQ1A 3QHNA 1W3IA 3U48A 1ZB5A 3C86A 3UYIA 1B3YA 2DSKA 1KFJA 5AYXA 1KM1A 3LPOA 4JTJA 2WSKA 3G6LA 2TODA 3KP0A 5H2ZA 2GFTA 3KBJA 3P8IA 1FWCC 2FJKA 1IXNA 1KGUA 2P3EA 2B81A 2WJFA 1RXOB 1H63A 3IS4A 1I2PA 2FZ8A 2WMIA 3GC5A 2XWDA 3Q67A 2I9UA 2ZCGA 1B9ZA 4NZCA 3SZ8A 2GJRA 3QYSA 4D8ZA 4C6EA 3BZJA 1VBHA 3VKKA 3BLPX 2YL8A 1XHGA 5CLTA 4DPPA 3M07A 1CT5A 1QWKA 4QJ5B 4MZ8A 5TQLA 2QAFA 4C6CA 1DQUA 2A3HA 1L2UA 1LT8A 3WLPA 3BW2A 1DJQA 2P76A 3CYVA 1HL8A 1GVOA 4FXRA 2QLYA 3VIKA 4K1WA 4XV0A 5GNZA 2OOGA 4CEUC 4JEQA 3BW4A 4QDMA 1JAKA 1DWJM 1DTNA 1K9DA 2WM0A 4L80A 1UR4A 4OUEA 2BHZA 4HSHA 1UUOA 2JALA 3OVRA 3ONBA 3R79A 2IPGA 4JFSA 2AKZA 3P61A 4WY0A 4MAZA 5CZKA 4H9YA 4ZTXA 1QPRA 1EEXA 1OFOA 2JFEX 4X3ZA 2C1GA 4NP7A 1L6YA 1Q6EA 2XFFA 4AF0A 4ZSTA 4DM1A 4GISA 2WHMA 1HJQA 1K8XA 5C6MA 3A6OA 1HO4A 1VFFA 1LDCA 4QFUA 3QGAC 3EEZA 2Z1XA 1F2JA 4IP4A 4PUJA 5HR6A 1RCXB 4S3EA 2ZX8A 3E2QA 3ZMRA 4AIOA 4Q4PA 5KMYA 3ABRA 1Q85A 2I5QA 3N2OA 3RX4A 3W83A 3UCCA 1E6SM 4TMCA 3BUVA 1PZ2A 1ZUAX 5C5YA 2BY0A 1KV8A 3N2CA 4PMRA 1LL6A 4I9JA 4A35A 1OC5A 1I2OA 2BV9A 4BY3A 2P3ZA 2ZC8A 3ZJKA 1FRBA 3HA1A 2OQLA 3SCVA 3UT0A 1TPUA 2X09A 3TCEA 5A6SA 4K39A 1VFLA 1AQMA 1MRAA 5CPOA 1DIKA 2AGKA 4DEFA 3I7QA 3WH8A 5CSRA 1RQBA 3TSDA 5HJLA 5JVLA 1I45A 5AHEA 1UIPA 3NJ3A 2ZX9A 2YBUA 4LS0A 4IQEA 1J0JA 2VGBA 4DBSA 1TTPA 1XYAA 2Z1WA 3SECA 2PDJA 1KFLA 1JPMA 1P1MA 3PSVA 1Q6GA 2V5CA 1VR6A 3QLDA 5BXPA 2D1ZA 4UUIA 4HU0A 3EOUA 1EQCA 4TIMA 3UZWA 2YCJA 4GQQA 3WUGA 1ZBVA 3C52A 1CDGA 4AHPA 2I5IA 2E4TA 4OBRA 1BXCA 1EO7A 5DFAA 3SIZA 5FAJA 4I7VA 3O16A 2OZTA 3JR2A 2GDVA 5G1TA 1CXIA 2TYSA 3GTIA 2GGIA 1BWKA 3AYTA 4M81A 4O16A 1VJSA 4ATDA 4AZIA 4QDWA 1J8VA 4V15A 3FJ4A 1ALDA 1ZJAA 5FKYA 4FAMA 3VDAA 3FSUA 1S46A 5K7JA 3KOFA 3HGSA 4NKCA 3FVMA 4UNIA 5D9MA 4DWSD 3INPA 3N4AA 4PCPA 4R5EA 1UD3A 5FJIA 3HO8A 2VC6A 3ITGA 3EWXA 1KXHA 1XJBA 4PZVA 4MNKA 1JDEA 3DFYA 4JIHA 1UOKA 1NVMA 4TUFA 4GUGA 1X8FA 3U4FA 2XVGA 4E4FA 3I3BA 2Z2AA 4MKVA 2DUAA 4AYSA 2Y8VA 3B8WA 4J3XA 1WDPA 3E5PA 4HP5A 4RNIA 4MY9A 1ZJBA 2C16A 1GQIA 3OLGA 1T6MA 3LBCA 3VNDA 2PBGA 3KEHA 4ML4A 4M19A 5AHIA 3PTDA 3L0NA 4JIEA 6XIMA 1SQ7A 3U2EA 4IWWA 3HGRA 2XGIA 3DUGA 4S2BA 4B5WA 4C6JA 2H90A 2D20A 4MYAA 2R94A 5A95A 1FH9A 1W3HA 4JZ5A 1TA3A 2A3EA 4HZ8A 1F76A 3UR5A 3CWHA 2FZNA 1CI1A 1H60A 5A94A 3M7SA 3UFYA 2DT0A 1KWKA 3MCNA 3M47A 3SEPA 4BF9A 2QCCA 4CCEA 2DVUA 5I7GA 4HK5A 2HS8A 4S3AA 3OB8A 4PUUA 3OU8A 4S3KA 3CPRA 2CZFA 3CMJA 3WLRA 3COTA 1UWUA 5B7YA 3BURA 1MUCA 3TN3A 5DBUA 1MDLA 3S2CA 2VR5A 1OX5A 2D3LA 3VDCA 4GVFA 2J79A 3WX7A 1P4CA 5CZSA 5GNYA 4GGHA 4CNUA 2X2YA 5BU9A 4NAFA 4ATWA 4HKPA 1EGMA 4IMFA 2PWVA 1G0CA 2CESA 5FJJA 4PEKA 1V0MA 1V3MA 1OB0A 5A1AA 4D8AA 4KWVA 1JG9A 4O4VA 4GNVA 1TPDA 1WKEA 4Y8FA 2QCFA 3UG8A 4H83A 2OZ8A 3GB6A 2R9RA 1FWIC 1GK8A 3QHOA 3CU2A 3HPSA 3WELA 3M0MA 4PTVA 1G4EA 2W5FA 4AY7A 4UQDA 3FN9A 4ACZB 4JNYA 1J10A 3NZRA 3QZ6A 3R8HA 4JFWA 3V7PA 5AHNA 4FB7A 3T7VA 2W9MA 3TMQA 3MU7A 2YBTA 4W85A 4H9XA 2Z6JA 4JX4A 3W7CA 4NX0A 4FXJA 3Q94A 4F0LA 3WO8A 1AG1O 4HSNA 4UQAA 1SJCA 3DYOA 3CV2A 1Q45A 4LB4A 1EQPA 4Z1YA 2IS7A 3ZT5A 5CZTA 4PTMA 1JZ2A 4C6OA 3L0KA 4E8DA 2OCZA 4GKTA 1R9XA 1U33A 3SJ3A 3ZZ1A 2GVGA 3M5VA 3BW3A 1E5JA 3G24A 2UWFA 4ECLA 3QLLA 3GTNA 1X6NA 3CV6A 4MNJA 2J78A 2OYLA 1S5TA 1GQLA 4ZO6A 3WJYA 3B03A 4NASA 2OODA 4O8RA 3HM7A 5A6TC 3SSZA 1XV8A 4QSFA 4ACZA 2KZHA 1QTWA 3HQ1A 2C71A 1C8QA 5DELA 3W1RA 5AY7A 1G4SA 4H1ZA 2IKJA 3JU2A 5CPTA 1A53A 4Y9AA 5DMMA 5KZ6A 3UNDA 2BXYA 4EX4A 3N2MA 8XIMA 2WB5A 2A3BA 1JDCA 2PDPA 4GFIA 1XR2A 3VDHA 3B0VC 3H24A 3CHVA 2ZVRA