3G1SA

Crystal structure of the mutant d70g of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
218
structure length
209
Chain Sequence
RVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIAGFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: evidence for substrate destabilization.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 78
structure length 209
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2009-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g1sA00
2E6FA 2J6XA 3M47A 4LV4A 4PC8A 5U4NA 3CC1A 2X1SA 1WA3A 2TPSA 3LTPA 3FIGA 4EF8A 1YXDA 3LRLA 1WYIA 4LU0A 2NWSA 4ML9A 2GPTA 1DKWA 1G6CA 4B5NA 4OGZA 3W7GA 4UTUA 3B4UA 5D04C 4EIVA 1A5BA 1UB3A 1WBHA 2JGQA 4OT7A 3W1TA 1I8JA 4LTSA 4ZQMA 3M5ZA 4N4PA 3TC6A 4FIRA 1DJQA 3NO5A 3CB8A 3Q37A 1UASA 4MJZA 1Q6LA 4GJ1A 1H7WA 3V75A 5FF0A 3DBPA 1H7RA 5EA9A 3FOKA 3L67A 4XTIA 5D09A 3DFPA 4LS2A 3LHUA 4Z1CA 3O1NA 1PCKA 1ML1A 4BI6A 1J4EA 1KW1A 2Y7EA 2Q8ZA 4A2RA 1XXXA 4FNUA 1F6KA 1FQ0A 1QO5A 1ALDA 3JR2A 1YYAA 2FFCA 4EWND 2ZDRA 2CWNA 3G1VA 2VFEA 3NPVA 3UPWA 3DZ1A 2Q3OA 4IUOA 3QH2A 2W6RA 4M6QA 4DPQA 5AHNA 4CLMA 4MLRA 4K6AA 1OFAA 2E68A 4LVGA 4NZJA 4EVZA 3KOFA 5AN7A 3OBKA 5E93A 3FYPA 2AAMA 3OG3A 1GTHA 2QUUA 1EX5A 1TTJA 3U2OA 3STCA 1EWDA 1YDNA 2Y70A 2V8ZA 1QPQA 3PVFA 1F76A 2BSLA 2NZLA 2PE4A 4UMBA 3W7OA 3HMJG 3E49A 3GVGA 2DP3A 4MJMA 4K39A 3P81A 3S5OA 4JTFA 2ZRWA 3GKFA 1Z48A 1AW5A 2R8WA 1F5ZA 4MZ8A 3G0UA 4DF0A 2WJZA 1QO2A 4HNTA 2ABAA 3DHDA 3ATYA 2HSAA 4CQAA 4ZMGA 3KVKA 3G8RA 3P5YA 1ICSA 5AHEA 1QR7A 3O07A 3QW4B 3LLFA 2Z2UA 4FX6M 1C9DA 1TPEA 4MUZA 3LBMA 3W2JA 4ZQOA 1G4SA 4LVDA 4H3DA 1S5TA 3PG8A 3CU2A 4ZQCA 4BFAA 3ZS4A 2DZXA 5CPLA 2DU2A 3C6CA 5HMSA 5D33A 3CEUA 5FF3A 4G1KA 1GVQA 3C8FA 1VHCA 3BO9A 3GDMA 4LNYA 4Z0JA 5BMXA 1I45A 4DO6A 4RLIA 1YXCA 3MI3A 2B7OA 1GG0A 3QEZA 3R2GA 3EX6A 3F1QA 2TMDA 1AL7A 2QCMA 1K8XA 1OK4A 3NL3A 1E51A 1Z41A 3GR8A 4MYXA 3W2UA 2NV1A 3ZWTA 3BLFA 3NQ8A 1X1OA 2G5WA 4O1CA 1A5AA 2QCGA 2GVGA 5HJLA 1O95A 1RQEA 1LBFA 4LOCA 3MP5A 3NPXA 1Y0EA 4NJGA 4RKAA 3FJ6A 4DELA 2QF7A 3E9AA 1GWJA 5TQLA 4C1KA 4FXRA 3RU6A 3EWBX 1OX4B 3S5YA 1SW3A 3UWUA 4PL2A 1SZNA 3BG9A 4UFIA 1BWLA 1XUUA 2ISWA 2J24A 2Q8LA 5D2YA 1UUOA 2A21A 2JKEA 4AF0A 1DHPA 2C13A 2DZPA 1KM4A 1TPH1 1K7EA 4NZFA 1PVNA 1OFBA 2Q3RA 3DFQA 3WJZA 4LRTA 3LCGA 2FB3A 5G2HA 1F6PA 3LHYA 1TMHA 1S3HA 4GUJA 3PG9A 1K03A 4WQ6A 1XBXA 2YPIA 1Z44A 2NXIA 3B0PA 2C18A 3W1MA 4U4MA 5FEZA 1TJRA 2IQTA 3VE7A 4AHPA 1EP3A 1N7KA 2G95A 3L5AA 3T4CA 5DCBA 3N14A 5F2LA 2YR1A 3DFNA 2NUYA 3WJWA 4BR1A 4A2SA 4GRSA 4JXCA 3W75A 5I3IA 2FPYA 3W70A 1X8FA 1J2WA 5J5RA 2QCFA 2NWRA 3W7EA 2B7QA 4I7WA 3TAKA 4WD0A 4GBUA 4X3ZA 5DBTA 1TV7A 4AMAA 1QNVA 3PBYA 3U8GA 3UWYA 2YW4A 3W7KA 4HKPA 1TTQA 4JDYA 5AC8A 3FS2A 2QDHA 4GNJA 1IXQA 1ZALA 1FDYA 1H7PA 2E09A 4XTDA 1V7YA 3LTYA 3TMQA 3G1HA 3C2EA 1F05A 1H62A 4MIMA 3HPSA 2C15A 3BVJA 3DFSA 4GFSA 5FI8A 1OYBA 2A85A 2NXGA 2GVLA 3I7QA 3HG4A 1JCLA 3QYQA 2ZZ7A 4RZ6A 4IMGA 2ZRZA 3W7CA 1P4CA 3LCWA 3W1NA 3THQA 2HS6A 3E02A 3W1RA 1IGSA 4O0KA 3HOJA 1EWEA 4MOZA 1W8SA 1TB3A 4FX8A 3UWWA 5CSSA 2QCNA 3NVTA 4TIMA 3S42A 4MY9A 2Y63A 3TFXA 2B0MA 4K7YA 5I3JA 5K4XA 2KZHA 4XUGA 3QQ0A 2WOQA 3IIXA 5AHIA 1WBJA 3BG5A 3E96A 3S6DA 2ZZ6A 3TC7A 1NEYA 3N3MA 1JQVA 4WZHA 4Y8FA 4ALDA 3UPBA 1DOSA 1V5XA 4NT0A 3B0VC 3ABRA 4E0CA 1WOAA 2P10A 3EWUA 4HSNA 3CT7A 4JD4A 1OFQA 1FWNA 1G4PA 1ICPA 4NJHA 3W7HA 3O63A 4UTTC 2B4GA 3KAOA 1H1ZA 4O19A 3IVUA 3QJAA 3SZ8A 4IJBA 4UFLA 4DBDA 4MZ1A 4DO5A 1EEPA 3HPZA 4PA8A 4QIUA 4AVFA 1SO3A 2FJKA 3I7SA 2X2GA 4JTUA 2OMAA 1KM1A 2FB2A 3NQVA 5I3FA 4QISA 3UXAA 3UQNA 2H6RA 3A21A 1OK6A 5KMYA 1KFJA 2EKCA 1X1ZA 1NFBA 3I7RA 3P74A 1ME7A 2ZBTA 3LBCA 4Z0SA 1TPWA 1FWWA 2ZA3A 4KWWA 4OV4A 5D2XA 2ZTKA 4JICA 3BLIA 3ANYA 4K7VA 2GOUA 3TFCA 4HIBA 1VS1A 3GR7A 1PS9A 2DZSA 5F4XA 3ABOA 1GYLA 1WV2A 5CZSA 3R89A 4JYEA 3F4NA 1LRTA 4LT9A 5I3GA 2OJPA 2Y7DA 4LV9A 4S1FA 4UTIA 2ATMA 3O8AA 1EPXA 3WFAA 1ADOA 2E5BA 4RV8A 1ZY9A 4TR9A 3M41A 3PB2A 5K4ZA 4NUWA 1W1ZA 5EKYA 5HUPA 1W5NA 3HGJA 3EKLA 1SUXA 1OJXA 4ICNA 1GT8A 1SU5A 1AG1O 4CCDA 1EP2A 1JUEA 4K36A 5A8GA 3B06A 2DORA 4O1BA 3W1LA 4O13A 1R2SA 4QITA 3S5ZA 1FDJA 2ISVA 4D2JA 2E5CA 3FA5A 4JYFA 4FNSA 2YYTA 5FEXA 5CPOA 3W6YA 3QQ1A 1JCMP 2CFFA 3LI1A 3PSVA 1OFOA 4UTWC 4UCGA 1VCVA 1EIXA 1ME8A 1FY6A 3TK7A 3DU0A 1PHWA 1ONRA 2CLHA 2VFIA 3L9CA 1T0OA 4AHOA 1XI3A 4IPJA 4PTNA 3OVPA 1H7OA 4IOTA 1H50A 1SO6A 3BW2A 4UR8A 5D02A 1VQTA 5CPNA 5LNRA 5LNWA 4UFHA 4ORIA 3KRSA 1KTBA 3TUUA 4JX4A 3TCEA 3LCIA 4NX0A 1NAL1 1VHNA 3FEMA 1WQ5A 5HWNA 4N02A 1LDCA 5G2WA 3MBDA 4FF7A 3TQVA 3NQDA 1KTCA 1UUMA 2NX1A 1LORA 3QF0A 1QPRA 4ZVJA 2WSRA 1O4UA 2GJNA 4MLJA 2WV8A 4NNCA 4RXGA 3QRHA 4LRSA 2G96A 2FDSA 3I65A 3LHVA 3W2KA 1RQBA 3S1WA 3N73A 3B03A 3UZJA 3U6WA 2QUVA 2NX9A 3P84A 1UJPA 1W5PA 1SZEA 2Y88A 3NZRA 3LGEA 4O54A 3SY5A 3O6DA 1A50A 5KSWA 5E0KA 4AWSA 4WY0B 3F4WA 1OFRA 5C5YA 3QC3A 3UWQA 4UUIA 4NNAA 3UD6A 4GC4A 2VXNA 3LOTA 3LCFA 3PBWA 2ISSA 2RDWA 3BW3A 4N9BA 1KFEA 1VYPX 3B04A 3P7YA 1IF2A 3JS3A 1VPXA 4A3UA 3CIXA 3GK0A 1G7VA 5LHEA 1ZFJA 5AB3A 2LLEA 3WK1A 2YCEA 1TCDA 3WJXA 3P60A 4M19A 2V81A 3NQGA 2ATSA 3TH6A 3MO7A 3TSBA 1TRIA 5G4EA 1M6JA 3GAYA 1G69A 4HHPA 4FB7A 3W07A 2RH9A 2CLMA 1LLZA 5CSRA 3TR2A 2X1RA 4HN4A 3W1QA 3IEBA 3UXDA 4L4LA 3KVMA 4UTLA 4PH6A 2WQPA 3W2LA 1TO3A 4IXHA 1TPVA 2C16A 1ICQA 3G3MA 1FCBA 1SSDA 1T99A 2GQAA 1THFD 2JK2A 2JBMA 4UTTA 3L0GA 2WNNA 3FKKA 4HT3A 5F2IA 1F2JA 1HL2A 1O5KA 4XKYA 2B7NA 4UFJA 4MFDA 4QNEA 5DCDA 1TQJA 2A4AA 4R34A 4N9DA 3OIXA 3MBFA 3W1PA 2BZNA 1LYXA 1EA0A 4JX6A 3LRKA 2Y6ZA 1YXYA 3RLVA 4UC5A 4JIQA 3AJXA 1MO0A 1KM3A 2I14A 3VE9A 2ZZ5A 1RR2A 3FLUA 2BWGA 4JTKA 3CIWA 2NX3A 3SR7A 1EB3A 1WDWA 3HG5A 3NYZA 1X7FA 5FF4A 1B3OA 2C19A 1KV8A 1P0NA 5DXXA 3KRUA 1OX6A 4BK9A 1AMKA 4O15A 3ZWSA 1KA9F 4JY9A 3JRKA 1W5OA 2V30A 3THAA 3H54A 1B4KA 2PRHA 2RFGA 3VI2A 1EUNA 3EKZA 3DFTA 3OVQA 4JTGA 4ORMA 3L5LA 1P1XA 3PS7A 3QMTA 3L21A 4JYDA 3YPIA 1IIGA 5AYZA 1GVFA 4QQ3A 3LCHA 1DQXA 1SZFA 3DKLA 3MP4A 2O7SA 5DY3A 1KM5A 2V2DA 1M7OA 3GNDA 2PRMA 3IIPA 4E2BA 3EB2A 1SFJA 2XN2A 1XCFA 2A7NA 2E6YA 3ABSA 4LC8A 4DQWA 1DBTA 3T44A 1GQNA 4Z08A 5F1UA 2E1DA 5BOOA 4N4QA 4KKXA 4UIOA 5CG7A 1OF6A 4RX0A 1NF7A 4DF2A 3IRDA 4YMZA 1TPFA 5MHBA 1H1YA 3P61A 5G4WA 5LNSA 3RFAA 4QJ1A 4O0ZA 4RR4A 1RD5A 3KFTA 1A5CA 4UTWA 1TPC1 1GZGA 4X22A 1YTKA 5G2IA 1JJKA 4FEZA 3HG3A 1WOBA 1FWSA 5K9DA 5HR7A 2QUTA 4AWUA 3W76A 5DLCA 2HS8A 2ZTJA 1JCJA 3UNDA 1F73A 1KFCA 3D0CA 3DH7A 2R14A 3G1FA 4GWEA 1DV7A 5HQEA 1PE1A 4XBKA 1XFBA 4YL2A 3M44A 1JQXA 4GE8A 4OV9A 2H8XA 3G0XA 1I2OA 1QOPA 3GYEA 4Z1BA 3MI2A 5CZJA 2QDGA 2QCDB 4N2YA 3LRMA 5TBOA 1RPXA 2A0NA 4P2VA 1OYAA 1GPWA 5TIMA 5KZMA 1LBMA 1ZENA 3DENA 3OEXA 3A23A 4KFPA 3W72A 3GB6A 4PEKA 5EY5A 5LZLA 1MZHA 3C2RA 4OWGA 3G3DA 1KV5A 5K2ZA 4O28A 2NV2A 5FEWA 1C29A 3BLEA 4CCEA 1QFEA 3CPRA 3EXSA 3OHIA 4TMBA 1AK5A 2A7RA 1FUYA 5FF2A 3H55A 3W7NA 1LROA 1W3IA 3KRZA 5F4WA 4OE7A 3EX4A 1QWGA 3QSRA 3IIVA 4AB4A 1CX9A 1D3GA 4RCXA 5DXYA 3GDTA 5BW6A 2F84A 4O4VA 1OFEA 4O12A 2QAFA 1KTNA 3BARA 1FWRA 1SR9A 3W84A 4LC6A 3Q2DA 1PL9A 1PV8A 1LRNA 1KLYA 2DJXA 3FJLA 1SW0A 2A6LA 3NL6A 3E12A 4R53A 3MHUA 3NR0A 5D2TA 1LBLA 1Q6RA 2J9YA 1Z42A 1RVGA 2G97A 2FIQA 3L68A 2FQIA 2ZRYA 4CQ9A 1TQXA 3TQ0A 4JS3A 3O05A 1SSGA 2V2HA 2JKAA 1ZJIA 2VKZG 3T7VA 2YYUA 2YZRA 5HWMA 3BGJA 3N9RA 5EBUA 3MHFA 1GTEA 4U28A 1XUZA 1LM1A 3EXTA 3O06A 5CKSA 1TPB1 3HG2A 1I2QA 3DHFA 5L9FA 1H60A 3NQ2A 1LOLA 4JTIA 1KLZA 3SGZA 1ZCOA 2QJHA 4IQLA 3W88A 3EWXA 3KVJA 1WX0A 3NQ7A 2DJLA 1DVJA 1H63A 1FCVA 3IGXA 4BI5A 1VC4A 3M6YA 2Z1BA 4HPJA 1BKSA 4WXYA 1XDMA 4I7UA 3NQ6A 2B7PA 4NQ1A 5LKYA 3TNOA 3EXRA 3RLUA 2VEMA 2V82A 4N9EA 4XBSA 4PODA 3QMRA 3EX2A 1N55A 5AHMA 3QMSA 1ZHAA 2C3ZA 1TIMA 1TV8A 3SECA 3IIOA 3WK0A 1K02A 2WKJA 3NL2A 5H91A 2PURA 3BW4A 1LLWA 3CWOX 4WX2A 3G22A 2PC4A 1NF0A 5K9XA 5KINA 4E38A 6ALDA 2FPVA 4ADTA 3FKRA 5U7SA 5F4SA 1EP1A 4WOQA 5CZ0A 4HSOA 1I2RA 4HNVA 2OCZA 2E5DA 1JR1A 2VEPA 3GDLA 5GVJA 4WXZA 1H51A 3GDKA 1QMLA 1OX4A 4DBEA 2DZWA 3DGRA 2ZFAA 5DN1A 5HULA 1FWTA 3ELFA 3PM6A 4QM1A 1W54A 4UNKA 3GIYA 5KZEA 4KWVA 3M5XA 2R94A 2ZZ4A 4A29A 2A7PA 4TX9A 4NJJA 1M5WA 3UY7A 1HO4A 2ZRVA 3A22A 1KFKA 4H4IA 4DEFA 4ZQRA 3PSWA 1SW7A 4O11A 3DXIA 2Y7FA 5AFDA 1ZAHA 1H5YA 1K7XA 5HNRA 2H8ZA 3T78A 3TV8A 5HWJA 4AAJA 3BV4A 3INPA 3PUDA 3PWAA 5L6UA 5F2MA 4XWUA 3TX9A 4YXGA 2RHGA 4FNRA 1KBIA 2V5LA 5F1VA 2NUWA 4TU1A 5LGXA 3HO8A 1PCWA 3PUEA 3STFA 3TJLA 1A53A 4UXDA 3CHVA 3TJXA 1AW1A 3QPYA 1SQ7A 3SI9A 3G1XA 1VLIA 1TJPA 4MY8A 1QAPA 2C0AA 3LCLA 3TDFA 1BWKA 4OHQA 1TRDA 1XBZA 1L2UA 3Q94A 4XZ9A 1DORA 1OFPA 3G8EA 2X1TA 3LX9A 5EMUA 1VH7A 2C1HA 1I2PA 1OVDA 5EYWA 5E1QA 1D9EA 1T96A 5LSMA 1FBAA 5KZDA 1LOSA 3HQ1A 5EL1A 2ZZ2A 2EPHA 1O94A 2Y61A 1MEHA 4IMDA 3GLCA 3R13A 1LOQA 1H7XA 1GVRA 4CCCA 2ABBA 3C2FA 3GNNA 1W0MA 4FO4A 4UMAA 3S1UA 1WAUA 3LI0A 3ZR4A 3TMLA 1L6YA 4GUIA 4RK8A 4O17A 2I1OA 5G5IA 3LHTA 1RV8A 2BXVA 3ATZA 1YTDA 1FX6A 2CZDA 4TMCA 4Z1AA 1XKYA 2VENA 3GXNA 4MPQA 1BEUA 3KVLA 4LY8A 1B57A 3B8DA 3ZFHA 5I3HA 2BX7A 3PR2A 2CW6A 4C1LA 1TPUA 4JTJA 1LCOA 3LERA 2QCHA 4UNLA 3S0CA 4X9SA 3CLMA 1HFBA 1F7BA 2BTMA 2DZUA 3LHZA 2X30A 3W7LA 2ZA2A 1L6WA 2J88A 4JN6A 3NQFA 4TO8A 3RF9A 4ZL1A 4UMCA 1JULA 3IGUA 6TIMA 1GEQA 3NM3A 2ZRUA 1SFLA 1W3TA 1UBSA 2V5BA 4UTHA 4N6FA 1MSSA 2RDUA 2YFNA 3K30A 2OX1A 4Y90A 2P0OA 3A24A 3NPUA 2J9XA 4NXSA 2GQ8A 1KFLA 1JCYA 1PIIA 3L65A 4ADUA 3W2NA 1DL3A 1TV5A 2E77A 3O6CA 4MVAA 2AGKA 5BRBA 5FEPA 3MI6A 3A9IA 3L0KA 3RMJA 3PUOA 3NA8A 1GVOA 4MZYA 3UYCA 1IXOA 1HTIA 2ZZ1A 1KBJA 8TIMA 3IIZA 4O1AA 2Z0IA 2XN0A 1VGAA 2PCQA 3BGGA 3MW7A 4NXKA 1CI1A 4DO4A 1R46A 3C61A 4GUFA 1W3NA 1U5JA 1OF8A 3EEGA 5A5WA 4CNOA 4AF0B 5FESA 3GAKA 1JCNA 3LLDA 2DZVA 1IXNA 3TA6A 3BK0A 4FNPA 3MMTA 2QR6A 1LTDA 2Y7GA 2CZFA 4CNNA 3GZ3A 1I2NA 4Q4KA 4O1DA 3P5ZA 3M7WA 1IXPA 3WK3A 4EOUA 4LVFA 1RQHA 3HPXA 3A5VA 1B4EA 4PL1A 3AO0A 1X6UA 1R2RA 5ABTA 1K3UA 1YLVA 3P62A 1R30A 1Q45A 2C6QA 5HR6A 2PRLA 4XQ6A 3OA3A 4LUIA 1TREA 2O7QA 4IMEA 5IM51 3HB9A 1YADA 3I6RA 3RK8A 2HMCA 3O16A 3T55A 3I68A 3M43A 3SW6A 3PY2A 3TXVA 4ADSA 1Q3NA 1K8ZA 4OU1A 2WSQA 2H3BA 3LXBA 4CNPA 2OZ0A 3RNDA 2WNQA 4NJIA 4IMFA 4X2RA 5AHLA 3QM3A 3BPWA 3NG3A 3NQAA 4BWLC 3W83A 1UCWA 2H3DA 5K9CA 1OYCA 4A21A 4FXSA 2WSYA 2FTPA 1R47A 4K8HA 3P8IA 3NL5A 2QCCA 5I3KA 4HNUA 3LCXA 3UY8A 7TIMA 3TW6A 4K8EA 1FXQA 4NX5A 3UZ5A 1W5MA 3L66A 4LVAA 4NVTA 4Y96A 3LXCA 2V9DA 3W23A 3O15A 3TXZA 4IXXA 1AW2A 5AC6A 1D3HA 1HG3A 3MHGA 2VELA 2RDTA 3MYPA 2GUUA 2QJGA 5SWUA 3E0IA 4I7VA 1OX5A 3TROA 3NPWA 1JUKA 3MWAA 3W7JA 1U83A 1XL9A 1MEWA 3STEA 2H90A 2W79A 3G1AA 3C4UA 3SSJA 2F7FA 2VC6A 2VFFA 3EX3A 1QDSA 4JY8A 3HIJA 1XBYA 4WY0A 3BG3A 4UFMA 4RJEA 1QOQA 3DI1A 5CZTA 3V1PA 4PCFA 2CZEA 5DELA 4IX0A 3W74A 2A1YA 1GG1A 3VCRA 1JVNA 5IBXC 3P67A 1JCXA 1OABA 5D30A 5AHFA 1JRCA 1MXSA 1VCFA 5LHFA 3SFKA 1G4EA 3TAOA 1XC4A 3C2VA 1LP6A 3TE9A 5BNKA 5T26A 4UTKA 4AH7A 3L0NA 4O16A 2CLKA 3DAQA 3IVTA 4KFOA 3S8HA 3FFSA 4O52A 2CLOA 4JTLA 3PBUA 3G24A 4AHQA 3LV6A 2ZA1A 5LGZA 3TU9A 4GUHA 3C0JA 1MEIA 4JDBA 4ZQPA 3HGOA 2XFWA 4H6KA 2ZYFA 3LB0A 2VOMA 3GX9A 4YLWA 1QPOA 1KM6A 3UWZA 3W7RA 2WNZA 4GXMA 1BTMA 2TSYA 3N9SA 2JGYA 3SJ3A 4JTSA 4O50A 5D32A 1G7UA 2A6NA 5G1TA 1TSIA 5H2ZA 3CWNA 3LM7A 3EWZA 3G1YA 5G1YA 4LW7A 1O60A 3S1VA 3W7QA 2J27A 3W86A 4E2DA 3QW3A 4UTJA 3T40A 3DFOA 1JUBA 1H7NA 1N8FA 5KTLA 5D05A 3NQMA 4O4WA 5DCEA 3MUXA 4IMCA 2CLLA 1G67A 1WXJA 3B05A 3CTLA 3LV5A 4MYAA 2CLEA 1YDVA 2C14A 1FCQA 4QNWA 4LS1A 2E6DA 4ZQNA 3M1ZA 4HNNA 5K3VA 1DQWA 4JR5A 4YCPA 4N6EA 2QJIA 2X16A 3TIMA 4FHAA 1FCUA 3QSTA 2V2CA 1VRDA 1LZOA 3TKFA 4RXFA 5D2VA 1SO5A 3STGA 3W7IA 5F2GA 1O5XA 4RZ4A 1PHQA 5AYXA 2GQ9A 2GVJA 5D03A 2FLIA 4AWTA 1K7FA 1VZWA 3NDOA 4WOZA 3QFEA 4JEQA 5HUOA 4LS0A 1W37A 3O6YX 2EHHA 5C6MA 5CGQA 4EF9A 2CLFA 3KHJA 3QPZA 4W9TA 2EAWA 2ZQ0A 5AC7A 3HGRA 2BLEA 1XDLA 3R12A 4BF9A 4FX7A 1QPNA 4I9AA 3DKJA 3W9ZA 5CPMA 1F74A 1H61A 3W1XA 3S9YA 2D73A 1Q6QA 4O14A 3L5MA 3EWYA 2YFOA 1A5SA 1L6SA 5KITA 1HUVA 1T8XA 2EF9A 2WO5A 4P61A 5HINA 1SO4A 1S5VA 3HGSA 3Q58A 4L4MA 4M5PA 5BMWA 2A2IA 3C3NA 5LNUA 5K7JA 3N2XA 3PC0A 4A22A 2RKXA 2QAPA 3WJSA 4WUIA 4WY0F 2HTMA 2Y89A 1DJNA 1XBVA 2ZRXA 5D2WA 3LHWA 1LRQA 4MKNA 4OBTA 4FNQA 3NAVA 1ZNNA 4LVBA 2W0UA 3S5NA 4BWLA 2TRSA 3P80A 3CEPA 1FXPA 3G18A 3M5VA 1W56A 1NSJA 3EWWA 2XN1A 4M6VA 1M7PA 2Z6JA 3N34A 4UR7A 5D37A 3S1XA 2AQWA 4MFEA 3HJZA 2YSWA 3LXAA 2R91A 3UWVA 5LNVA 1YPFA 2ZCGA 4JTTA 1ZAIA 4J9JA 1GOXA 3MJYA 2QCDA 4DPPA 2ALDA 3PULA 1RZMA 1IIHA 4DXVA 4O57A 4LUJA 5C55A 4JNMA 3NZ1A 3NXFA 4K37A 3LDVA 3W73A 2EGZA 5D38A 3IGSA 1OHLA 1W5QA 1GJPA 4ZZ9A 2VFDA 2YDAA 3NOEA 4AEOA 1GVSA 3NM1A 3N2MA 5DBUA 1R2TA 2FPTA 3M16A 3TSMA 1OG0A 3G0SA 4JGDA 2TYSA 5J5DA 2GJLA 1P0KA 4IWWA 2I9EA 4IGHA 3KX6A 4HPXA 1VYSX 1XM3A 1I4NA 4M7SA 4POCA 3M0ZA 1GYNA 2CZ5A 4CQ8A 4NNBA 2CU0A 3R5EA 3PBVA 1VR6A 1Q6OA 4K38A 3CQ0A 3W1UA 4S2CA 2Y62A 4M7TA 3LTSA 2OT0A 2YW3A 1TTIA 4RZ5A 4N9CA 2ZZ3A 3SGUA 3TQKA 5IBXA 2CLIA 3W22A 3W2MA 3W7PA 4UFKA 3NEVA 4R33A 3WJYA 3WK2A 3W1AA 4FIQA 4O8RA 3DI0A 3W7MA 3M5YA 1ME9A 1SZGA 5FF7A 3G1DA 3OVRA 2YGYA 3C52A 2E6AA 4R7JA 3HF3A 4ONVA 4XKYB 5AOUA 2WPBA 3GXTA 4YWIA 4IPIA 2VFHA 1C8VA 1VCGA 4O18A 5EPDA 3IV3A 4KFNA 3MP3A 1VJIA 2NLIA 4QSHA 3R8RA 3W7DA 1P5BA 3H53A 4WJEA 1W31A 1VLWA 2Y85A 4NU7A 1FDZA 1QCWA 3IVSA 3FYOA 3PB0A 1TTPA 3MYOA 3CM4A 2UV8G 2QEZA 4MY1A 2NXHA 1YPIA 4DF1A 3W3OA 2YX0A 3GKAA 2YXGA 4Y6GA 3VKJA 1YTEA 4S2BA 4NJKA 1CW2A 1TYGA 5AYYA 3USBA 3NQEA 1TPDA 2QKFA 3EX1A 1B9BA 3B0UX 4JIPA 3NQCA 4LWWA 1JRBA 1K8YA 3NGJA 3HBLA 2VFGA 4JTHA 3A5FA 3SIZA 2VEIA 1ZAJA 3GDRA 2J9ZA 5C2XA 4YCOA 3GXPA 4M6PA 2QCEA 4AXKA 3TW7A 1KM2A 4Z1DA 3W87A 1S5WA 3W85A 1OFDA 3PF3A 5C54A 2JKPA 3W71A 3N19B 4PFMA 4BI7A 2V0TA 2VEKA 3VNDA 3C56A 4GUGA 3C2OA 2A5HA 2P1FA 2Z6IA 1KFBA 3ABQA 1HO1A 3P82A 1G4TA 1L9WA 4Y9AA 4O53A 1J5TA 4OQVA 3G1SA 2NUXA 3PAJA 3KXQA 2OT1A 1YDOA 4Q32A 3P8JA 3QZEA 4JX5A 1NVMA 2QCLA 3M9YA 4UTMA 1SPQA 1EUAA 2DZTA 2X1UA 1VYRA 4IX2A 3VFLA 3NNTA 4O10A 4Q33A 5DY2A 4JTEA 3F03K 1KM0A 4QAIA 4FNTA 3L2IA 3TSDA 1AL8A
chains in the Genus database with same CATH superfamily
1K6AA 1ZJAA 3KWXA 4C6LA 4PC8A 3GVQA 1DWHM 1B1YA 5CPTA 2TPSA 1TWDA 2QJJA 3LRLA 1WYIA 3C2YA 3OBEA 4ML9A 1WDSA 3CZJA 3PTMA 1UMLA 1DKWA 1Z89A 4OGZA 3T6CA 3U4FA 5D04C 1WBHA 1I8JA 4PCNA 3TC6A 4FIRA 3PJXA 3CAKA 5LIYX 1JXJA 1P6CA 3ZVIA 1UJQA 3AMKA 1UASA 3GTXA 4MJZA 1YW1A 3UZWA 1UHVA 4DJEC 2DV0A 5T8GA 1H7RA 5EA9A 3RJYA 4AYSA 3F5JA 3DFPA 1VD6A 1CCWB 1PCKA 1ML1A 2G50A 3TJIA 4BI6A 1S1PA 1MRQA 3MV11 2YA0A 3BCFA 1PO9A 2E1WA 2ZC8A 4AD2A 2WKLA 4EWND 4C7FA 4F2TA 2KX9A 2VFEA 3MY9A 4DRSA 3DZ1A 4G2DA 3WQ8A 2JIWA 3QH2A 3WDRA 1OC7A 4M81A 4CLMA 5FKYA 4EVZA 2FTWA 4A8LA 1OT2A 1TG7A 3U2OA 1HF6A 1EWDA 2RJGA 2V8ZA 1QPQA 3PVFA 3OGSA 2BSLA 2PWGA 1UR0A 4E4UA 1ITUA 3W7OA 5A6BD 2D69A 3E49A 1XGZA 4K39A 2ZRWA 1XLFA 4DWDA 2R1NA 2D3LA 3AIWA 4DF0A 1J0HA 1QO2A 4HNTA 3U2EA 2G8ZA 1MMFA 1XYMA 3ATYA 4JL2A 1W6TA 3W27A 4ZMGA 3KVKA 2WSPA 2YCIX 2JF7A 3G8RA 3KUMA 3TYEA 1ICSA 3M0HA 3U7BA 3QYSA 3VD4A 1MW3A 4QFUA 2Z2UA 3STPA 1C9DA 3KBSA 3DBNA 2OQLA 4H3DA 5A8QA 3CU2A 4BFAA 3DHPA 1VFSA 3RDKA 5I78A 3CEUA 3PZTA 1V7AA 2YCJA 3KBJA 2VZUA 4LNYA 4X0VA 1BGAA 3ITTA 4R7OA 5BMXA 4PFHA 4DO6A 1YXCA 1V51A 2B7OA 3WMLA 1K4HA 3L2MA 3LN3A 4PMNA 1GG0A 2XIOA 3F1QA 2PS2A 1AL7A 2PBGA 3W2UA 5DO8A 4PTXA 3BLFA 4D71A 4B9ZA 4O1CA 4PMXA 3CXOA 1O68A 5HJLA 2Z2AA 2ZWYA 1Y0EA 3FJ6A 5REQA 3CZ8A 1SJAA 1E1EA 1W91A 3KOXA 3UR7A 4OECA 2CXGA 3S5YA 2YOCA 1UD3A 1UZ4A 4P7RA 1A5MC 4BEUA 5AY7A 1CLKA 4UFIA 1BWLA 5DMLA 2FGBA 2Y2WA 4IIEA 2PDNA 2Q8LA 4RE0A 1FFQA 4AF0A 1AQMA 2C13A 1TPH1 1K7EA 3TN6A 1KWGA 2Q3RA 1BLIA 4FK9A 1V08A 5CEWA 1XIJA 3IJLA 3LCGA 4ERIA 4H1ZA 4YTUA 1TMHA 3GXFA 1HVXA 1XBXA 1OWQA 1MW0A 3AXIA 1FWJC 4DN1A 1DJXA 2VWTA 4U4MA 2J7GA 4AHPA 2G95A 3L5AA 2OZ3A 2PI6A 2PWUA 3WQOA 1LL6A 4RZBA 4GRSA 4JXCA 3W75A 2FPYA 1J2WA 1UP2A 4A4AA 2YIHA 2YXXA 3EDJA 2B7QA 3TAKA 1RPKA 4AMAA 2IXVA 4OOZA 2V3DA 5AC8A 1VFFA 1Y5XA 3HU7A 2PBOA 3FHAA 4LXFA 1FDYA 2O9RA 1TX2A 3UP8A 2WMKA 3LTYA 2J7DA 4MDOA 2E4TA 1F05A 4DJEA 2PDJA 2VQUA 5EMKA 1VBUA 4CEXC 3DFSA 5FI8A 1HP5A 3BLLA 3R8HA 3HG4A 2PP3A 1VBJA 3S83A 3LSCA 2ZZ7A 2YBVA 4M8UA 4MPKA 1P4CA 2ZXAA 1HKIA 2XH2A 3THQA 2PSNA 2KAUC 1XLHA 2HS6A 3W1RA 3SO7A 2HK0A 2Z26A 1GZ1A 3BCDA 1RK6A 1HW6A 3UWWA 5CSSA 2VUNA 2QCNA 4ZGYA 4TIMA 3QHNA 4Q4RA 1P0BA 2EG6A 2WVVB 3ZJ6A 2ACUA 1DXIA 1HKWA 1UOKA 2AMXA 2VURA 4GKLA 2AQOA 1WB0A 4WGHA 2HZGA 3L4YA 3QQ0A 5FJUA 7A3HA 3IK4A 3A3XA 3BG5A 2P0IA 2ZZ6A 3TC7A 3UG4A 3N3MA 2AKZA 4FLOA 3KCLA 3WLSA 1DOSA 1NOUA 2CWXA 2OXNA 3ABRA 4E0CA 2GZXA 4DVOA 3CUFA 3EWUA 3CT7A 3FA3A 3NZQA 4E4FA 3O63A 3FX4A 1HKJA 2E0PA 4JCMA 4RDZA 1JD7A 1H0GA 2NT1A 3BLKA 5IFPA 2XIIA 3QGVA 1BD0A 4JIIX 4MZ1A 4XUYA 2MANA 2Y8KA 2WHKA 3I7SA 3N15A 2CC0A 3UQNA 3A21A 1E5NA 1OK6A 1X6NA 3P74A 3HPAA 5ABHA 1GQJA 3LBCA 4Z0SA 1TPWA 2PB1A 2ZA3A 4HZMA 4REQA 3QPEA 3SUVA 4XAZA 5EFDA 2ONEA 3TONA 4HIBA 5CPSA 1VS1A 1PS9A 2P8BA 2W5FA 5FAJA 3R89A 2NQLA 4JYEA 2QGYA 4S1FA 4UTIA 2CITA 3WFAA 4ZB0A 1ADOA 2QT3A 2VNCA 2WMFA 2WZHA 1ZY9A 3CZKA 3GG7A 1R6WA 2VOTA 5HUPA 1W5NA 2DSKA 4WDTA 4L6OA 1UWRA 1VB9A 2R6OA 1TA3A 3KCJA 3IJ7A 4O1BA 4H9ZA 1ZGDA 3MWCA 2POZA 4QITA 5FJTA 2BHUA 4JFTA 2GYIA 5CC3A 2J8TA 1FVPA 4FNSA 2MUCA 3N17A 1UZHA 3WQGA 3VZYA 3DYPA 4WVXA 4H8HA 3NO3A 3H7RA 1CGXA 1VCVA 3ZR5A 5J04A 1ME8A 2ACQA 3GU1A 5JXQA 3TK7A 1PHWA 4Q8WA 1BAGA 4CN6A 3L9CA 3UU0A 1Q5MA 1V77A 3GHTA 3PZQA 1ODUA 4PTNA 5BWAA 5D02A 2PWEA 5LNWA 3EMCA 3C0LA 4ORIA 3ZT7A 4TX8A 5E6ZA 5ABGA 3LCIA 4IICA 3IK2A 5GNYA 1WQ5A 5HWNA 4N02A 1Q8JA 2GOKA 4AG0A 4GQBA 3QY6A 4IIBA 3QF0A 3WF2A 3ZO9A 4QG8A 2J47A 2WSRA 1M53A 1UC4A 1UR2A 4MLJA 2WV8A 1AQ0A 3QRHA 2G96A 3LHVA 4LCSA 4UQAA 5A94A 1EZWA 2Z2BA 3NZRA 4C5ZA 2FGZA 3SY5A 1YNYA 3O6DA 3OIHA 5KSWA 1OGSA 2HISA 3F4WA 3TYUA 5C5YA 4DYEA 4UQDA 4UUIA 3N18A 1C7SA 1PKLA 4N9BA 3B04A 5LXEA 1BQGA 5TAOA 1VPXA 4OOUA 3H26A 3AHVA 3WD1A 4E2OA 1LL7A 1QNPA 2J79A 1W1A1 5LHEA 2YCEA 2PZNA 1YQ2A 2ISFA 4M19A 4YVPA 2ATSA 2YLAA 3TH6A 4PMVA 2OSXA 1XJBA 3K5XA 4QCFA 1ESWA 4IQJA 3ZJ7A 1S38A 2CLMA 3I6TA 1LLZA 4X61A 3MUCA 3L12A 4C6QA 2O9TA 2YXOA 3AHYA 4J2PA 4UTLA 3SY1A 3GXDA 3W2LA 1JZ2A 2J78A 1TO3A 4H6QA 4IXHA 1VJZA 2JK2A 2WBKA 3U4AA 3EZ4A 1XSKA 4HT3A 4XX6A 1HL2A 1O5KA 2J66A 1Z32X 4YYCA 2NQ5A 1LYXA 4XD6A 1EA0A 4JX6A 3VNMA 3VA8A 1YXYA 3VX1A 3AIEA 4LCRA 1C8XA 1XRVA 3ARYA 1NWSA 1Z7AA 3AUJA 1EO7A 4L6DA 1R3QA 4JTKA 3HV9A 3ARQA 5DMYA 1WDWA 5FF4A 3M07A 5CC7A 1OX6A 3UG3A 4O15A 4XZBA 1V79A 1V4YA 3THAA 1B4KA 3UCQA 2Y5SA 3VAVA 2F8QA 3I3EA 1U33A 3OVQA 3T2QA 3F2CA 4JYDA 3UT0A 3NDYA 1JYVA 1IIGA 3W6LA 3LCHA 2PTDA 1DQXA 3LLXA 4PBFA 1WDPA 2V2DA 1EO5A 4FF5A 3EB2A 1V3JA 2XN2A 4QJ4B 5HJXA 3WNKA 4FXFA 2E1DA 3GTNA 2HVMA 5CG7A 3HQOA 5E0FA 2HQAA 4RX0A 1XIMA 1TPFA 5MHBA 1J10A 1UD6A 3MKKA 3OPSA 1BF2A 1QI5A 3IJIA 3KFTA 3WMCA 1MDLA 1BXCA 4OIFA 3G2GA 2QPSA 1JNEA 5G2IA 3RX3A 4HHLA 1HL8A 4S3GA 2GJXB 4RE4A 5MKGA 4GG9A 3W28A 1F73A 3PFMA 4C1NB 1EJ7L 5HQEA 3W25A 4XBKA 2V5DA 4PUJA 4DUXA 2XZ7A 1ZU8A 2VZVA 4LBUA 3UJEA 3ITVA 4Z1BA 3MI2A 2QCDB 1PSCA 5BU9A 4ENLA 4LQ1A 1LBMA 1W3KA 5BZAA 4YWSA 3AS2A 3WY1A 4XZWA 5EY5A 1MZHA 4OWGA 3G3DA 1OB0A 2NV2A 3KLKA 4C90A 4CCEA 5FIPA 3LPOA 3EXSA 3M46A 1KXTA 2A7RA 3CJPA 1LROA 5F4WA 2GUBA 1QWGA 3IIVA 1D3GA 1KRAC 1YEYA 5I77A 1W9UA 2YKKA 3ZIZA 1KTNA 4MADA 1SR9A 4LC6A 2PU1A 1PL9A 1PV8A 4KESA 2X8RA 4MWAE 3IPWA 3GXMA 2Z24A 2WC3A 3NR0A 3FYYA 4GC3A 1XYFA 2CHOA 4MWAA 1LBLA 1Q6RA 4XZLX 2FIQA 2YJQA 3F2BA 2FQIA 4AISA 1J2BA 4XD4A 1DHKA 2HCVA 4TXEA 4XK2A 2CERA 3KBWA 1F6YA 3GW0A 2W66A 3LGDA 1H0IA 3KZSA 1E6RA 5HK4A 2DZAA 5HWMA 3N9RA 3S5SA 4AY8A 3MHFA 1XUZA 5CKSA 3K4AA 1MQPA 1TPB1 3HG2A 3BSMA 1I2QA 3DHFA 3N13A 5L9FA 2D0GA 3OGRA 3EWXA 4I9MA 3NQ7A 3QZ6A 1EBGA 4E8GA 4JOMA 5HPOA 1VC4A 5HNTA 3TTQA 1TJ2A 1E55A 4HPJA 2XSXA 4JTDA 4JQ4A 3JU2A 2XIJA 4I7UA 4L4OA 4NQ1A 5LKYA 2ZUVA 1S2UA 3WX7A 3A13A 2V82A 3EMQA 4XBSA 1ZBKA 3B8SA 3EX2A 4DAFA 3NVDA 2C3ZA 4Q8MA 1K02A 1R3TA 4PUMA 5A6SA 3WLKX 3FDGA 2PURA 2OX4A 3BW4A 3CWOX 3QR3A 2PDIA 2PC4A 4LAZA 2XGZA 6ALDA 1RUSA 3FKRA 4KCWA 3USZA 4WOQA 4CU6A 4P8UA 1EJVC 4HNVA 2E5DA 2OGJA 4GQQA 3OVGA 3N11A 5GVJA 2IQ0A 2O55A 3VX0A 5KETA 4DBUA 3OZMA 2UY2A 1CWYA 2O56A 4INFA 5DN1A 2INZA 4IPLA 1XHGA 4ZOBA 1W54A 2F2KA 4HK7A 2ZZ4A 1KCZA 4TX9A 4FLQA 1CXEA 3BMVA 1J12A 4ZCWA 3OLDA 2Y7FA 4TVUA 3IJ8A 3UR2A 1ZAHA 1H5YA 2XISA 2XVNA 1M1BA 1GOIA 3WLQA 3VDHA 1S5NA 5HWJA 3C3UA 4LYKA 4AAJA 3GHRA 3BV4A 2NSXA 4MAVA 3SCNA 5TNVA 4FNRA 1KBIA 4EP8C 2E8ZA 3CUXA 4TU1A 3CHEA 4NAFA 5LGXA 2J74A 3HO8A 1PCWA 2EPNA 2AL2B 3AMLA 9RUBA 4V33A 5DRIA 4UXDA 2OO6A 2A3HA 3TJXA 8A3HA 1AW1A 3AISA 3MSGA 3VIKA 3CUIA 2RGMA 2DFAA 3TDFA 1XYAA 1EJUC 1DORA 3G8EA 4IFOA 2X1TA 1VH7A 3QOKA 2C1HA 1I2PA 3DECA 2XM1A 3UNTA 4HU3A 1FBAA 1LOSA 4C60A 2EG7A 2EPHA 4H9XA 4IMDA 3FJ4A 1GVRA 5A6TC 1B3WA 1R3WA 1W0MA 2BHYA 3ZR4A 3LI0A 4XO6A 4GFIA 4QEEA 4RK8A 3ZLGA 4J40A 2CIPA 1FA2A 2P8CA 3LHTA 2BXVA 3ATZA 1I9CB 1EC8A 2EJAA 4PN2A 1TJ1A 3P3BA 1BEUA 2VM8A 4PTWA 1UD4A 1HIZA 3K46A 4PBGA 1KCLA 1AVAA 4GLEA 2BX7A 4C1LA 1OGGA 2QCHA 4UNLA 2OWWA 3LHZA 3VGGA 1J8VA 2WW5A 2ZA2A 1O66A 3O3RA 1E6PA 4TO8A 3LPPA 3VIJA 4XV0A 3VNKA 4UMCA 3IGUA 1VFMA 6TIMA 1V3HA 1UBSA 4UTHA 3EB4A 2INEA 2OX1A 2D23A 4Y90A 2HVNA 2P0OA 3BICA 2J9XA 2GQ8A 3AC0A 3TWBA 1Q6DA 1DL3A 1TV5A 1ZQ5A 2WSKA 1JPIA 1E3ZA 5BRBA 2W92A 3A9IA 3KP0A 3PUOA 2GJPA 3NA8A 1KKRA 4ZOCA 1HTIA 3P14A 1KBJA 8TIMA 2VVSA 1J0ZA 3LY0A 1W2VA 2MNRA 3VC5A 3C61A 1W3NA 3CZEA 3MO4A 4FR1A 3NDZA 3G6MA 1JCNA 3TA6A 1E56A 1V93A 3BK0A 4FNPA 4FLSA 1QW7A 3MMTA 4GXWA 2QR6A 2Y7GA 5DEZA 4AY1A 1KXQA 1I2NA 3K1DA 4ZSTA 3AFBA 1HJVA 1RQHA 1LJYA 5EBAA 3VDBA 1E6QM 2NVDA 1BWVA 4IIFA 1XX1A 3SUUA 1W9PA 1B54A 1J01A 2PRLA 4P7LA 1R9ZA 2JQXA 4LUIA 1IEIA 1PX8A 3I6RA 4B91A 4NASA 3T55A 1VEMA 1GHRA 2WPGA 3M43A 4AZCA 3VIMA 1UH2A 1NP2A 2DT0A 4FLRA 3SIMA 3LXBA 4CNPA 2GVYA 2OZ0A 5AKQA 4HVXA 4N7QA 3PZMA 4BWLC 3W83A 1UCWA 4IFKA 2WSYA 4K8HA 3H2MA 2QCCA 3B0YA 4M51A 3UY8A 1TMQA 7TIMA 4XAPA 1OINA 2VRQA 3DERA 5GJPA 3U3HA 3L66A 4Y96A 3E3HA 3MZNA 1AW2A 3O7UA 3R1ZA 1YNQA 2V5CA 4NIRA 1HG3A 3MANA 4F0KA 5LA1A 2VELA 4F2UA 3MYPA 2GUUA 2QJGA 2BXZA 4CVWA 4I7VA 5FJJA 3TROA 5EMJA 1JUKA 4PBEA 3SRKA 1U83A 3M0KA 1XL9A 1MEWA 1KD0A 3QKZA 4Q4SA 1RH9A 2H90A 2W79A 4JKKA 4DJDC 1DTNA 3SSJA 2VFFA 1C90A 3SRHA 4F4RA 4PSRA 3CPUA 4JTQA 3V1HA 3AWNA 1MW2A 1QOQA 5GQBA 3T81A 3ZJKA 2GWGA 5DELA 1B3YA 3W74A 3ZOAA 3T0DA 1C7TA 3OODA 3J7HA 3UR5A 2A1YA 1GG1A 1MFUA 4E6MA 3P67A 4TOQA 2ZUMA 3EKGA 3TN3A 3GG8A 3CHDA 5LHFA 4CNSA 5LIUX 4WKHA 3SFKA 2UWFA 1MVYA 1Z69A 1E4NA 2Z00A 2CLKA 3TYDA 5A95A 3DAQA 4KIEA 3IVTA 3KCOA 2PDUA 3QY8A 3G24A 3CK5A 3F5KA 1TELA 5M1TA 4ZFCA 2XFWA 1OCJA 2V63A 4ZE5A 3LB0A 4HA0A 2VOMA 5CBBA 1XF0A 1MW1A 4YLWA 1FWHC 1Q2SA 4NILA 3VKAA 1QHZA 4GXMA 3VPLA 2EPMX 2TSYA 3N9SA 4ZTYA 4L65A 4Q8TA 4A3QA 4ZB2A 5G1TA 1TSIA 5FAGA 3LM7A 5FJRA 5H8MA 3EWZA 3G1YA 4LW7A 3PN8A 1O60A 3S1VA 3W86A 4GH3A 3W00A 4C6MA 2F6UA 5D05A 1SGJA 3MUXA 3TYCA 1T41A 1HX0A 2CLLA 3U2CA 3LV5A 4EX4A 1X7IA 4C65A 3CL6A 3VZZA 1R87A 4HNNA 1DQWA 4YCPA 4FHAA 1FCUA 3APTA 1VPYA 3VUPA 2V2CA 3N4EA 5CBIA 2XUCA 2R1PA 4KGJA 4RXFA 3W7IA 5F2GA 1R5YA 2PD9A 4RZ4A 4AWTA 1GJWA 4Y8EA 1A3XA 4EF9A 4HK6A 2NQZA 3HGRA 2BLEA 1Q6GA 3R12A 3VM5A 4FX7A 3MU7A 1H61A 3W1XA 2XYLA 4RPPA 4BKNA 2XVPA 3EWYA 4LGXA 4JIRA 5KITA 1HUVA 3MA8A 4NRSA 3DGBA 4M5PA 1GVEA 2A2IA 3C3NA 3PC0A 4DWSD 2QAPA 3RILA 1CENA 4WUIA 3WJSA 3TCSA 1CLXA 3VCNA 4DBWA 4WRHA 2FH6A 1XLDA 3ZVHB 4F79A 2EKGA 4Q7BA 2ZRXA 2GJXA 5D2WA 1LRQA 2PDGA 4OBTA 4FNQA 1ZNNA 5A6JA 1EQCA 2WBGA 4BWLA 1FXPA 3IJQA 4QEHA 2DT1A 3EWWA 2WJEA 4M3PA 4AVOA 5D37A 4FZIA 1TIWA 1EJTC 3LXAA 1NTHA 4QTGA 2VYOA 2QCDA 2VO5A 2FGLA 4XO7A 4DXVA 4O57A 4FAMA 4JNMA 5D38A 3MV01 1W5QA 3AALA 4ATWA 4ZZ9A 3TTEA 3NOEA 3WQEA 3NM1A 4MKVA 4NRRA 2FPTA 3M16A 3D46A 3TSMA 3G0SA 4PCSA 3R58A 4JGDA 1WZAA 1ITCA 4DJDA 4MTVA 1XM3A 1I4NA 4M7SA 4OZOA 2QVNA 1LWIA 1GYNA 1NWRA 3PBVA 2ZUSA 4K38A 1A3HA 4M7TA 2OT0A 1W1TA 3UJ2A 3A64A 4IJCA 3OP2A 3SGUA 4XAFA 3W2MA 2DUZA 1XLEA 3URNA 3DFYA 1E5JA 3NEVA 3WJYA 3W1AA 1RALA 1XWYA 1QNQA 4WKFA 3I3DA 1B90A 4JL1A 4ONVA 2YCKX 4YWIA 2VFHA 1C8VA 3IV3A 3VFCA 3MP3A 2VCAA 2R1MA 4AYGA 1OD0A 3R8RA 2ZXDA 1AH3A 1W31A 1P48A 1PIFA 2BY0A 5KEZA 3PB0A 1TTPA 2UV8G 4LY4A 2NXHA 1YPIA 1JDCA 1E70M 3DC8A 2O92A 2QUMA 1FH9A 1YTEA 4NJKA 1CW2A 1TYGA 3VO0A 1UKTA 4GIYA 3NQEA 5C9ZA 4JFWA 3B0UX 4LYQA 3HBLA 4JTHA 3S2NA 2HNHA 4US6A 3SIZA 2VEIA 4KWOA 4DXXA 4JIHA 3EPNA 5C2XA 5D8WA 1XYBA 3B8VA 3GXPA 1NJJA 1UD2A 4M6PA 2VDHA 5DF0A 3RG6A 2OOFA 4MMWA 2OODA 5HMDA 2V0TA 3T0BA 5XIMA 3VNDA 4AC1X 2FDMA 4PRTA 5KZ6A 1L9WA 4O53A 2E3ZA 4WJXA 3JZEA 2OZ8A 5HANA 3FAWA 4OQVA 1B31A 3BC9A 1OCQA 5FA5A 4Q32A 1JYNA 3LM3A 3W26A 3TYBA 3EYPA 5BOEA 1SJCA 3E6EA 3M6DA 3QZEA 3THDA 1V8EA 4WDUA 1OM0A 2XIBA 3T05A 3HFTA 3OOQA 5DY2A 2Z29A 4R88A 4QAIA 8XIAA 3L2IA 1E6SM 4C6CA 5B7YA 2E6FA 4LV4A 3CC1A 1MXGA 2XU2A 2X1SA 1WA3A 3LTPA 4EF8A 2NWSA 3NEHA 4OTKA 5AZ0A 3PZOA 2GPTA 5BWFA 3W7GA 3WIJA 2Q01A 4ZQMA 4RUBA 1E73M 5C2GA 2DSZA 5A69A 3NO5A 3E2SA 3CB8A 3DG7A 3V75A 6A3HA 4KPLA 3U2ZA 2AL2A 3DBPA 3TR9A 3H12A 2DIEA 3FOKA 3WQ5A 4GIAA 4XTIA 3S2JA 3GY1A 4GMEA 5D09A 2VTFA 3VIFA 4Z1CA 3KP1A 3AU6A 4PUEA 1GW1A 1R0MA 2Y7EA 4U3CA 1XXXA 2QPUA 4FNUA 1A4LA 4HK5A 4D6HA 1ALDA 3JR2A 1EPVA 1XYZA 2P50A 2X7VA 1YX1A 1O12A 2PDBA 2CWNA 3NPVA 5FCZA 3UPWA 2Q3OA 1NDZA 4U5KA 2W6RA 4M6QA 4DPQA 4ZFMA 3WNOA 4NSBA 4K6AA 1OFAA 4LVGA 4LANA 4GVGA 3OBKA 3R94A 3V4BA 5PTDA 1GTHA 5JMUA 1C3FA 4R3UA 1AH4A 3N6HA 2PE4A 2Y1HA 1XYCA 3B8UA 3TYZA 2DP3A 3S5OA 3GKFA 1XIBA 2VDGA 4A8IA 4KH2A 5C0QA 4YU1A 1AW5A 1XIEA 3RHGA 3RRXA 4MZ8A 5FSEC 1SYTA 3DHDA 1QNOA 4CQAA 1CPUA 3WDQA 4JBRA 1QR7A 3SY8A 1EF3A 3QW4B 3LLFA 3WLNA 1TPEA 3W2JA 2CKRA 4MUZA 1G4SA 3HZ3A 1S5TA 3DHUA 5ECVA 1KXVA 3RLHA 3RCNA 5CPLA 3BANA 3LD5A 3C6CA 4I9TA 5HMSA 1SJBA 4F0MA 1CEOA 4G1KA 3C8FA 4S3FA 4PMRA 3UXIA 3BTNA 3PFRA 3SGGA 4QJ5B 2VC5A 1C8YA 4CU8A 4HMCA 1SVDA 3QEZA 2QZRA 4G7EB 1E51A 2NV1A 4PEEA 3CYJA 2G5WA 3VK5A 4H9UA 5EMYA 1O95A 4LNCA 3PJUA 1BXNA 3NPXA 4NJGA 3L7RA 1W1VA 4RKAA 4L7ZA 4AUBA 1US3A 3CH9A 3E9AA 4P8XA 1XCXA 5TQLA 4G5DA 3V36A 3AHTA 4W8AA 1TV2A 1ISZA 4B15A 5M2FX 5D2YA 4B4HA 1UUOA 1DHPA 3CV1A 3PTDA 4NZFA 4MUPA 1OFBA 3GU9A 1QWKA 4LRTA 1FP8A 2X41A 3B9DA 5G2HA 1IV8A 4ERAA 1F6PA 1PZ0A 4R9XA 2OR2A 5M03A 1Q13A 4I5XA 4WQ6A 2F9RA 2YPIA 1DJGA 3B0PA 2C18A 1MDRA 4DNHA 2PWHA 4LAKA 2IQTA 4W4QA 3DFNA 2WMIA 1UZ1A 3OTRA 2NUYA 3R4IA 4JHMA 5AYIA 3WD3A 2V38A 1PKNA 2OGYA 4HCDA 3W70A 3B3DA 1UKSA 3XINA 1X8FA 4Q4MA 5J5RA 3W7EA 3RYSA 4WD0A 4B3KA 4LUTB 3WBAA 5FJOA 5HXMA 1QNVA 1POJA 3PBYA 3UWYA 2FZBA 3JW7A 2J4GA 2YW4A 1K77A 4IMAA 3T8QA 4JDYA 1KCKA 1ZRQA 3FS2A 4JTCA 4GNJA 1IXQA 3TMQA 3S4TA 4PZVA 2F38A 1CYGA 3D3FA 4YNGA 1VFHA 1Z3NA 1LUCA 3WF1A 3EA1A 2QDEA 2Z1SA 2A85A 3L4ZA 1GGOA 3M64A 2IKIA 4BHYA 5C9RA 1JCLA 2XZ9A 2XH0A 4RZ6A 3MCOA 2OYMA 4KF1A 2ZRZA 2VCCA 3BWWA 3W1NA 7REQB 1CGUA 2BP1A 2W62A 1EWEA 4MOZA 1W8SA 1LF1A 4LYPA 4KBXA 3N25A 1V02A 2Q02A 3DOPA 9XIAA 4GPNA 4NY2A 3NVTA 4DYJA 3VYLA 1UH4A 4MY9A 2WZIA 2Y63A 1RLDA 5HMFA 4UCFA 3GTFA 4K7YA 2I5IA 5K4XA 4W8LA 1NDWA 1RBLA 2KZHA 2VZOA 2WANA 2IMRA 1UC5A 2WOQA 4HQVA 2ASHA 2BG5A 4HJFA 2GK1B 1HNYA 1NEYA 1VFTA 2D1ZA 4IISA 3VTRA 3GYCA 3LPGA 1BGGA 4ALDA 2VI0A 4QXIA 3B0VC 3MVTA 4JNZA 1GVIA 2R24A 4JD4A 2NVAA 1G4PA 4NJHA 3WNLA 4UTTC 2B4GA 1E1CB 1H1ZA 3FCPA 3QJAA 4IJBA 1BKHA 3F4VA 1OCNA 4TV6A 5I02A 4EXAA 3WKZA 1GVYA 2WMGA 3SAZA 4DO5A 4PA8A 4AVFA 2QLYA 3KZPA 1VPQA 1KC7A 3NQVA 2HE8A 3UXAA 2GGIA 2H6RA 4XIMA 1QBBA 1KFJA 1XLGA 3I7RA 1X1ZA 2EKCA 4XAGA 2HK1A 2IQDA 2ZBTA 1F3EA 4Q7NA 1HN1A 4OV4A 5IHRA 1FFRA 1XSJA 3PBGA 4MB3A 4LH8A 1J9YA 2GVEA 3BLIA 3RX4A 2POTA 1IZCA 3ANYA 1GUVA 2GSJA 2GOUA 4ZODA 3TFCA 3WDPP 2R9RA 2QGHA 5BRQA 3H7VA 4IGSA 2JE8A 1GYLA 1WV2A 4GY7A 5CZSA 3V5OA 1LRTA 4LT9A 4OVXA 2OJPA 3M0VA 4BQ4A 1Z6KA 3E0VA 3PB2A 1W1ZA 3AYRA 4YTRA 1BSIA 1S39A 1GT8A 3RPTA 2V6AA 1AG1O 4CCDA 2GQ3A 1JUEA 4K36A 3GQYA 2OU4A 4IIHA 4NG3A 3FA5A 2OEMA 5FOOA 3CTTA 4JQ2A 5FEXA 5CPOA 3QQ1A 1FKXA 4UTWC 4UCGA 4YYFA 2ZX6A 1EIXA 3OZOA 1FY6A 2WMJA 5ECUA 1Q6CA 2VFIA 2PDPA 3L4VA 4AIOA 2A79A 2I17A 4C6IA 4E4PA 4IPJA 4HA3A 1H7OA 4H04A 3UESA 3BW2A 1M03A 1VQTA 5CPNA 5LNRA 4UFHA 1N82A 3WL0A 3HURA 1W3HA 3T9PA 2VRKA 1VHNA 1WO2A 4Y9OA 3WLIA 3FEMA 1PEZA 3ZVHA 1LDCA 5G2WA 1DJHA 2DQXA 3MBDA 4FF7A 3CL7A 4DUOA 2NX1A 1QPRA 1P7TA 2PDYA 2DT2A 3V18A 1O4UA 1F4AA 3VGEA 1TMLA 4RXGA 4LRSA 5A1AA 3W2KA 3N73A 4KCVA 3B03A 1XQKA 3UZJA 2BY1A 4QHRA 1ZTVA 4ML4A 3WYZA 3DDMA 4AWSA 4WY0B 1XICA 2C1IA 4JZ5A 1GORA 1JEZA 5GNXA 2XFRA 3TYAA 3W82A 1NFGA 2VXNA 3LCFA 3PBWA 2Z28A 3QV6A 1JCTA 1IF2A 5H8UA 1CGTA 2WHJA 4JPGA 4A3UA 3R7MA 4AFYA 3TZFA 4EXQA 3F7JA 1D3CA 5C9XA 1DIKA 1G7VA 1ZFJA 5AB3A 2LLEA 1L2QA 4WDWA 3WJXA 2VVNA 4XD3A 5I7GA 3NQGA 1X38A 4DI8A 4F0LA 1S2WA 4CQBA 3NO1A 3MO7A 1G69A 1YMYA 4A3YA 1XG3A 3W1QA 2ON3A 3IEBA 3UXDA 2E67A 4L4LA 3ZSTA 3P6LA 4HBKA 5A6KA 2OO0A 1KGUA 1TPVA 3G3MA 1FCBA 2GQAA 2DPEA 2JBMA 4UTTA 3L0GA 3RJXA 2WHLA 3FKKA 1F2JA 3NZGA 3IJ6A 4OUEA 1V6WA 2FVLA 1TQJA 1RA5A 2OEJA 4U3AA 4ZOAA 4R34A 3ZXWA 4N9DA 3W1PA 2ODOA 2XJ7A 4UZSA 1Z8AA 2Y6ZA 1A5KC 3RLVA 3K8MA 3EBVA 3T2PA 3ES7A 1KM3A 3COTA 2J6VA 1A3WA 3E0FA 1CGYA 2ZZ5A 3FHQA 3SCSA 2VQTA 4R7WA 4HYWA 3NYZA 3WLTA 1KV8A 1HJXA 1AMKA 3ZWSA 1SMDA 2VR2A 1ZBWA 4JY9A 2V30A 3U48A 1AD1A 3PJWA 1EUNA 5HA7A 3MUY1 1KB3A 4ORMA 4P7NA 3BAXA 3PS7A 2IKHA 2GGEA 1LQ0A 4WKAA 1GVFA 4QQ3A 5E6YA 4H6EA 1SZFA 2O7SA 5DY3A 1M7OA 3K1GA 4BQ5A 4F9JA 6XIMA 3IIPA 3ARPA 2FZ9A 3WQ6A 1BYCA 4UIOA 1OF6A 4C6OA 4HOWA 1CT5A 3IRDA 3R0DA 3N04A 3P61A 2Z1VA 4O0ZA 1J93A 4UTWA 1TPC1 1GZGA 1PDZA 4X22A 1O1ZA 1M41A 1M7JA 2XSBA 1VFUA 4A05A 1FWSA 4QG6A 5HR7A 1FTXA 4AWUA 3BAIA 1JCJA 4BZYA 2QJNA 1UOZA 3G1FA 4YTTA 4GWEA 1DV7A 3OGVA 4HP5A 1XFBA 1UQZA 3M44A 1JFHA 4OV9A 2EO7A 2CPUA 2AQVA 3WQDA 2BMBA 2A3AA 1I2OA 1PWLA 3GYEA 4D6EA 1NOWA 1RPXA 3EOLA 1B3XA 3NCOA 5KZMA 3D47A 1QNSA 1E0UA 3SQLA 5I09A 1XIDA 3A23A 4ZXLA 3S47A 3BLEA 1FWFC 4ES4A 3TJ4A 3CPRA 4I5UA 3OHIA 4TMBA 1AK5A 1XR2A 4ZO7A 5FF2A 1W3IA 1BYBA 7PTDA 4AB4A 1EEXA 2XVLA 5DXYA 5BW6A 4Y7EA 3SCOA 3SM0A 1ZB5A 1ZBCA 4REQB 3BARA 4PMUA 2ZIDA 2W61A 3ARRA 2PODA 1LRNA 1JZ3A 2DJXA 1SW0A 3NL6A 3C5QA 3E12A 4E8DA 4HOXA 3MHUA 1F4HA 2PDFA 5D2TA 3DG6A 2J9YA 3GC4A 4DM1A 2AGTA 2ZUUA 1RVGA 2WKGA 4NZCA 4L9YA 2J13A 1QK2A 4PMZA 4EE9A 1TV4A 3QR0A 1VFOA 1SSGA 4Q8UA 1T5AA 2JKAA 3RITA 4V1XA 5I2UA 4HNCA 2YZRA 2BV9A 3LU2A 3WQFA 4U28A 3NWRA 3O06A 1TVPA 1FWEC 4HPNA 1WDRA 1V3LA 2I5QA 2PDHA 1KLZA 1ZCOA 1E71M 2DJLA 1FCVA 3IGXA 4BI5A 1V3MA 3ARTA 4KS0A 4H7CA 4B5SA 1FWDC 2VEMA 5EU9A 1P0DA 1P6WA 3L4TA 4LAOA 3BDKA 4PODA 1XLCA 3AU2A 5AHMA 1ZHAA 1J0IA 3A9BA 3ITGA 4HMEA 1N2VA 1TV8A 4G7EA 3IIOA 4D6GA 2WKJA 5H91A 4H6RA 3O0KA 4XBJA 1XRTA 3OLGA 2X09A 4D9PA 1RHCA 3G22A 3APGA 1NF0A 1TVNA 5K9XA 2G4FA 1EP1A 1ISXA 5CZ0A 2D0HA 1I2RA 4Q8VA 2OCZA 2VEPA 4WXZA 3VNZA 2VZTA 1PTAA 4AX6A 4DBEA 3AXKA 1V0KA 4C6DA 3QQWA 3H2CA 3VM7A 2ZFAA 1JI2A 1FWTA 4URIA 4X9YA 3PM6A 3BOFA 1CXIA 4J3TA 3U9IA 4IQDA 3GIYA 3WF4A 5KZEA 4KWVA 1NQ6A 4C91A 4CD5A 4A29A 3D3AA 4E3VA 1M5WA 1SFSA 1O6IA 1IT0A 1KFKA 4H4IA 4ZQRA 4O11A 3DXIA 3RPDA 3B9EA 3AYVA 4YHEA 1T6MA 3TV8A 4ROQA 3PUDA 3PWAA 5L6UA 2W9MA 3AQUA 1WXZA 2R82A 1S2TA 3V5FA 1PTGA 2RHGA 3E74A 3NZPA 5F1VA 1UH3A 3M0YA 3T1GA 4Z2LA 1J0YA 1CXLA 4HGXA 4LUTA 4V28A 5H6HA 1E9YB 3ARZA 4MY8A 1QAPA 2C0AA 3LCLA 4IZGA 3Q94A 3VD5A 1ZBVA 1RAKA 2G4JA 1OVDA 3AZRA 4RNIA 3UXKA 1JPMA 4CKQA 1FWAC 4UOQA 3OW1A 1IEXA 4MJ2A 3HQ1A 2ZZ2A 1O94A 2Y61A 1UWAA 1JXKA 2C8NA 3GLCA 4NYUA 3OLEA 1ZS2A 4CCCA 3HV8A 2XWEA 1WE5A 3S1UA 7REQA 3TMLA 4GUIA 2VZSA 2GSEA 3K2GA 4W89A 4J28A 1UKQA 2JEQA 5G5IA 1WXYA 3R25A 4X63A 3EMZA 1PX3A 3MUIA 1YTDA 2CCRA 1QNRA 4Z1AA 1XKYA 1KR1A 3W01A 1U1JA 4MPQA 1XIIA 3KVLA 1YIXA 1B57A 1IEQA 5I6SA 3V35A 2CW6A 3RIKA 2GK1A 4Q3MA 1TPUA 1L0PA 1LLOA 1LCOA 3WDJA 3CLMA 1HFBA 4RE2A 1Q2RA 7ODCA 2WAGA 2DZUA 1R3VA 4G6CA 4JN6A 3NQFA 3RM4A 1LQ2A 4ZL1A 3AYSA 3WBYA 4B5VA 3N29A 3NM3A 2ZRUA 1IHIA 1SFLA 1W3TA 3BAYA 3K30A 3F5LA 5DRCA 2E9LA 3ARXA 3NPUA 4CEUC 1QATA 1KFLA 1JCYA 4E8CA 5C7VA 1PIIA 2NV9A 3L65A 4ADUA 1TR1A 4DYKA 8RUCA 1XW8A 2GGJA 4D72A 4XG1A 2G3MA 3WD2A 1VIWA 3O6CA 2AAAA 2AGKA 4W88A 5DFAA 4WLCA 4QS5A 2X0SA 3RMJA 4MZYA 3UYCA 3UWEA 2BNJA 2Z0IA 2XN0A 1VGAA 3MW7A 5CBJA 1CI1A 4RW5A 4WHBA 4DO4A 4QQUA 4ACZA 3AZTA 1E4MM 5FESA 4S3JA 3GAKA 3QV8A 1A0DA 1J11A 3KWSA 1PXGA 3E38A 4KEVA 4HA1A 4Q22A 2GL5A 3QOMA 1LTDA 3GU2A 1Q6FA 2CZFA 4PCTA 3WD4A 2E28A 4Q4KA 4O1DA 3M7WA 2BBFA 3WK3A 3BUVA 1JFXA 4LVFA 4HNLA 3H2AA 3A5VA 2PDMA 3CASA 1A5LC 4AEFA 3CB3A 4PUDA 2D20A 1R2RA 5ABTA 3W81A 4B92A 1YLVA 3P62A 4PUUA 3W4RA 3ITLA 1RY0A 3S2MA 1CBGA 1TREA 2B31A 5IM51 3H2OA 5FACA 4F3HA 3RK8A 1E6XM 3T2OA 4G1NA 3I68A 2PLKA 3ANUA 4ADSA 1VEOA 1Q3NA 4MWAB 1R3RA 1XQLA 2WSQA 1G1YA 1ZL1A 5CC5A 1FRBA 1RJQA 1RCQA 4L9XA 3TTOA 5I23A 2WNQA 1DIEA 4IMFA 1V6VA 3QM3A 3BPWA 2DZBA 3UG5A 1HKKA 1Y8BA 4A21A 3C0QA 2FTPA 1R47A 3P8IA 3NL5A 4HNUA 1IEWA 3TW6A 3UZ5A 1W5MA 4LVAA 4PB5A 5A2BA 1W3LA 2V9DA 3TXZA 1H2JA 1BYDA 5CLTA 1TUFA 4UTFA 4CD4A 4B2DD 4HD5A 2RDTA 3IUDA 3I4KA 3QBUA 1OX5A 4U10A 2WVTA 1DTUA 3CV6A 2HRWA 4PULA 3MWAA 1XIFA 3WQCA 1J5SA 1KBKA 2IS7A 3STEA 3DIPA 3WUGA 3G1AA 3AXMA 5T9CE 3EX3A 1QDSA 5FSDC 3HIJA 4CGTA 1XBYA 3UA4A 4WY0A 1EGVA 3BG3A 2EBNA 2VX6A 4RJEA 2DH3A 3V1PA 1V6XA 3KM8A 3REQB 1U2YA 2JALA 3CAQA 1E43A 1MUWA 4PMDA 2FVKA 4LBSA 1UD5A 1EA9C 1OABA 3Q45A 5D30A 1JRCA 3UZYA 1MXSA 1WDQA 1VCFA 3SURA 3VD7A 2QMKA 5A8OA 1QHPA 1K70A 3TAOA 3SSZA 1XH2A 3WEOA 2XGBA 4U33A 3L0NA 4O16A 5D9NA 1EGMA 4P8WA 5AZ1A 6PTDA 1POKA 4AD5A 4KFOA 2E8YA 1D2KA 4GY1A 4ZR8A 3GDBA 5HNNA 3LV6A 3GSMA 3C0JA 1MEIA 4ZQPA 3HGOA 3M0MA 1WP6A 1LT7A 1V6TA 3BAWA 2AMGA 4H9VA 1KM6A 2WNZA 1OD8A 1X98A 4GH1A 2JGYA 2PTXA 3R10A 1N8WA 4GZ7A 5H2ZA 3GFXA 3CWNA 5G1YA 3CL8A 1S2CA 2J27A 4D6IA 2GLKA 3THCA 4HSHA 1N8FA 3KS6A 4IMCA 6TAAA 1WXJA 3B05A 4MYAA 2CLEA 1YDVA 1DJWA 3ZQ9A 4LS1A 4NAFB 3M1ZA 4JR5A 4N6EA 3TIMA 3IAPA 1XRSA 1ZLPA 3MZ2A 1VRDA 1K1DA 1R7AA 3S6TA 4BJHA 3P2VA 3OZPA 5ABFB 1I0DA 5AYXA 3N2CA 1V3IA 3PPHA 2NQJA 1VZWA 4WOZA 5CGQA 1BTCA 3H2NA 2BY2A 2ZQ0A 4R9OA 1H5VA 3HN3A 4HMNA 3L23A 2WWCA 1UZDA 3DKJA 1Q4NX 2YBUA 1FKWA 4CU7A 1Q6QA 4O14A 3SBFA 2VR5A 3L5MA 4ICCX 3SRDA 3KHDA 1A5SA 1L6SA 1A80A 3ZMRA 3WLHA 1KWKA 3RRAA 1S5VA 3AROA 3VIHA 3Q58A 3WF0A 1LWHA 5K7JA 3GBEA 1B2YA 3BZJA 4IP7A 3M4HA 4GI9A 1JF5A 3A4XA 3CHCA 1G5AA 2HTMA 4MF4A 3RXZA 1UWTA 1PKYA 2ZVIA 1BSLA 4MKNA 5MF5A 4HYVA 2RGLA 3LMYA 4A6GA 2W0UA 2TRSA 3CEPA 5DMMA 2IPJA 4G56A 1M7PA 1B9ZA 4MFEA 3HJZA 5JIWA 1ISYA 4S38A 4J3SA 3WMSA 1JAKA 4JTTA 4EPDC 3AWOA 2BOGX 3VGBA 4DPPA 3PULA 1QI2A 3TZNA 2XH4A 5C55A 3NXFA 4K37A 2QMJA 3IGSA 1ITQA 1J18A 2IPWA 3VGFA 3WDIA 3CUZA 3N2MA 5DBUA 1R2TA 2GWNA 4GBDA 1CZ1A 3VABA 3WELA 3R0KA 1P0KA 4IWWA 2I9EA 3POCA 3KX6A 1VYSX 1BHGA 1JPDX 3WNNA 3OB8A 1E0TA 1B30A 1E1FA 4NNBA 2CU0A 4I3GA 3LNPA 3CQ0A 2FJUB 2G0WA 4S2CA 3LTSA 2EQDA 2V69A 4PMYA 2YW3A 4RZ5A 3MQTA 1A47A 3FVDA 4D8AA 3SADA 4DJED 3TQKA 4DJFC 4ZENA 4C6PA 4UFKA 2PWFA 3GM8A 4C7DA 4J3XA 3WK2A 4DIAA 3PZ9A 3CWHA 4FIQA 1F8MA 3EWDA 4MNMA 4KETA 1TWSA 3M5YA 1ME9A 5FF7A 3OVRA 1U30A 4R7JA 3HF3A 3OQ8A 2WPBA 3SQSA 1DWFM 2QULA 5EPDA 3CYVA 5LA2A 2NLIA 5AYBA 4AU0A 4GINA 4QSHA 3W7DA 1P5BA 4WJEA 3DN5A 5BOFA 3R8GA 3FYOA 3IANA 1GEHA 4DUWA 1PZ3A 4JIEA 3V3WA 4MY1A 1UPPA 1O5RA 2GSHA 1YBQA 1MQRA 3W3OA 2YXGA 2VP8A 4S3DA 2INFA 3GG1A 2VL4A 4AZCB 2D2OA 4TUFA 2A3CA 2CEQA 4JIPA 3MSYA 3UVAA 1K8YA 3NGJA 4AY7A 5IOBA 1DPMA 3WEMA 1Q85A 1E4LA 3GUWA 1ZAJA 3R79A 2FVMA 4HJWA 4AZHA 3VOIA 4JQ1A 2XVKA 3TOPA 4F9DA 4AXKA 1R38A 2OG9A 4Z1DA 3W87A 1QI0A 3W85A 4IFKB 3NGFA 4LF1A 2XINA 2FTYA 3PF3A 2NLYA 5C54A 2JKPA 3R11A 3N19B 4BI7A 3OLIA 2VEKA 3C56A 1CB2A 1AJZA 2P1FA 3BJFA 5C8BB 2GDVA 1G4TA 2NUXA 1GK8A 5M5DA 2NQHA 4QSFA 3P8JA 3NQBA 2RUSA 1E9ZB 3VVGA 3S9IA 1MI3A 4D6DA 5CGMA 2QCLA 5DX7A 2ALRA 2DZTA 3EEZA 4IX2A 2OPJA 3VFLA 4O10A 3P0XA 4JTEA 3F03K 4WEVX 1D8CA 1KGXA 1PZ2A 4FNTA 3ECQA 2OWCA 3W02A 4ZO6A 3M47A 2J6XA 5U4NA 3TA9A 2FHFA 4Q6XA 4NAEB 3PZIA 3FIGA 1SJDA 4LU0A 4IIGA 2WM1A 1KBLA 2VEFA 1ECEA 4HB7A 1G6CA 4B5NA 4UTUA 4MWAC 2FKPA 1B3ZA 3B4UA 1W1B1 4EIVA 4GVFA 4UQCA 2W91A 2Y5EA 4OT7A 4M6UA 3W1TA 4BF5A 4LTSA 3TWAA 2Y8VA 4OKDA 3KTSA 4FS9A 3OBAA 2BOEX 1DJQA 4J27A 1VENA 3Q37A 1Q6LA 4GJ1A 3MC5A 3KTXA 1ONWA 5FF0A 4MGGA 3FW6A 4LS2A 3LHUA 1X97A 3O1NA 3CQHA 3VZXA 1KW1A 4A2RA 1A0EA 2OLAA 1QO5A 3CLWA 2IKGA 1XPGA 3TP4A 1QHOA 2FFCA 2ZDRA 3G1VA 5CAKA 1E9LA 3MUZ1 3WENA 4IUOA 2O9PA 4HU0A 2VGIA 1RD6A 3SN4A 3VCCA 4D8LA 5AHNA 1JL8A 4NZJA 5AN7A 3UERA 1BVZA 2YL6A 1TZ7A 3BSGA 3LA4A 5E93A 4LCQA 3FYPA 2AAMA 3OG3A 4JNYA 3A47A 3STCA 2VX4A 1YDNA 4DJFA 2EPOA 4O8AA 3AIVA 3H22A 4UMBA 3HMJG 5CG0A 7XIMA 4JTAA 4MJMA 4JTFA 3AMGA 1Z48A 1QI3A 4EXBA 1HJWA 1E0VA 2R8WA 2PLJA 1F5ZA 3NOYA 3U0HA 2ISDA 2OQYA 1PDYA 2P88A 4H9YA 2ABAA 3AYTA 2HSAA 1HGWA 2IKJA 3V16A 3IRSA 1GOQA 3VILA 1Q7MA 1WZMA 2Y8UA 4MAZA 4ZQOA 3LBMA 2GUYA 4LVDA 2WHMA 2DH2A 4UOZA 4AD1A 1DJYA 3WD0A 4ZQCA 3VKCA 4U31A 3C0SA 4Z42C 5FF3A 1XKJA 1GVQA 4ATDA 1VHCA 3BO9A 3GDMA 4Z0JA 3WBWA 2W3ZA 3QVQA 4KEMA 1I45A 2UY4A 3WLPA 4QBXA 3TW9A 5JIPA 3R2GA 4IP5A 3UJRA 1K8XA 3WLMA 1OK4A 2ZXQA 1Z41A 3ZWTA 3NQ8A 3WO8A 4Q6JA 1IWAA 1AUSL 4LYRA 1UYQA 3UR8A 1RQEA 1W1IE 2ZX5A 1LBFA 2GGGA 4LOCA 3MP5A 4H00A 4U2ZA 4EWJA 4DELA 3QHOA 3NJ3A 4H8NA 3EWBX 4QE5A 2OVLA 3QLDA 4L64A 4PL2A 5HJYA 1SZNA 3BG9A 3VKDA 3GIPA 1XUUA 3U5YA 2ISWA 3PWGA 4AEEA 2JKEA 2DZPA 4WCJA 4PGLA 2ZE0A 2XTKA 1F3WA 3DFQA 3N3TA 3O9NA 1JZ4A 4KERA 2FB3A 1PBGA 4H8UA 1A5OC 5F7UA 4C6FA 4UB9A 2ZVRA 1K03A 2NXIA 2F6KA 4EPEC 4RW3A 2H9AB 5FEZA 1TJRA 3VE7A 1N7KA 5CZKA 3T4CA 4IGNA 3N14A 1RJPA 3QTGA 2ZUTA 1ZPTA 2ACRA 2BFGA 3WJWA 4A2SA 3LPFA 2OOGA 1JAEA 3QKEA 5IDIA 3VNIA 2PWVA 1UR3M 4PTDA 4HOZA 2OTDA 2QCFA 2NWRA 3QTPA 4HMDA 2NW0A 4I7WA 1B0IA 4X3ZA 1PAMA 1EHAA 1TV7A 3B97A 5DBTA 1SMAA 3W7KA 1SM9A 4HKPA 1TTQA 2QDHA 3UXLA 3ID7A 1UP3A 1US0A 3RU8X 2D2GA 2OSYA 1ELSA 3MJMA 4CVUA 2OB3A 4XTDA 1RCXB 4QR6A 3G1HA 2W63A 3KBVA 1H62A 4GQRA 3HPSA 3BVJA 3TEVA 4WSJA 3N1AA 3AIUA 1OYBA 4GD0A 2NXGA 2GVLA 3BCJA 4YVXA 2OZTA 2HV5A 4MHBA 3LCWA 4S3EA 5CXPA 1XH1A 3SQMA 5BRPA 3HOJA 4PUWA 1TB3A 1GHSA 4FX8A 1DWGM 1EDQA 5EMLA 5C7HA 4W5UA 4L80A 4HPHA 5I3JA 4MNLA 3IIXA 3CMGA 1WBJA 3E0WA 4H9TA 3E96A 3REQA 3S6DA 2VWSA 1JQVA 3UPBA 1XRFA 3WLLA 1BG9A 4LUSB 4HU4A 4HZ7A 4GNVA 5B7ZA 1OZMA 1R86A 3VNJA 2ZKMX 3CMFA 1ICPA 4IH3A 3KAOA 3PZGA 1CNVA 4O19A 2X2YA 3SZ8A 2OQHA 4UFLA 2ZICA 3MMWA 2X7WA 4S3BA 1EEPA 3H4XA 4QIUA 2PFHA 2QUNA 1P1MA 2X2GA 2O4MA 2RAGA 1KM1A 2PU0A 4MWAD 5I3FA 4YN5A 3VDCA 4DZIA 5FJIA 3E2VA 5KMYA 1DQUA 1NFBA 3MS8A 1UIPA 1XGDA 4IFRA 4XISA 4KWWA 4FR6A 1KCXA 2C71A 4JEJA 4US5A 3FV9A 3GHUA 4GZIA 2I16A 1C8QA 1W17A 4XVEA 1UPMB 2DZSA 5F4XA 1PWMA 4QGCA 1K9EA 4DXKA 4LPCA 5I3GA 1V0MA 4DZ5A 2Y0FA 2Y7DA 2ATMA 1EHNA 2E5BA 2PUZA 3SB0A 4W84A 4RV8A 4TR9A 3M41A 5K4ZA 2D2JA 3HGJA 2C91A 3EKLA 1V0LA 1SUXA 2D24A 3GFZA 4ICNA 1A4MA 4FOUA 1JZ7A 1CLVA 5ABFA 1ONXA 3B06A 5I06A 5HOSA 3GS6A 4MJ4A 3K4DA 2ZADA 4D2JA 2E5CA 4Z2JA 1KFWA 4I8DA 2REQA 4JKLA 2AKMA 4JYFA 3N12A 4JHZA 1XSIA 3N4FA 1JCMP 2QHAA 1OZQA 2CFFA 3LI1A 3PSVA 4MB1A 2V3GA 2YBTA 1AQHA 4LUYA 1IT7A 3DU0A 3LMZA 1ONRA 2PGEA 3QFWA 4GCAA 1XFCA 5FL0A 3OVPA 4KQNA 1H50A 2DSWA 4IM4A 4UR8A 4JTRA 4JHOA 4TTUA 1V6YA 1EJSC 3TUUA 1CECA 4JX4A 1E9IA 4NX0A 1NAL1 3PK7A 1LWJA 1MXDA 3TQVA 3NQDA 4L1WA 4ZBCA 1LORA 4DY1A 3KOWA 1QW8A 4L5ZA 4PMOA 5AC5A 4ZVJA 2ZOXA 1C92A 3MCMA 1UWQA 3DC0A 4E2VA 4NNCA 4ATLA 4RDYA 3I65A 1RQBA 3S1WA 1K4GA 1G94A 3B8TA 1KKOA 1XP3A 2QUVA 4L1GA 2NX9A 3P84A 4CQDA 5A6BA 1UJPA 2JF6A 3W38A 1SZEA 3LGEA 1H1NA 1FWCC 2IPGA 3MCNA 2V3FA 1A50A 5CH9A 4ACYA 3EOUA 1CGWA 1OFRA 1K9DA 3UWQA 1K6WA 3PHAA 3TN5A 4NNAA 3UD6A 3LOTA 1VRXA 4WIWA 1W9BM 3FXYA 4AZ6A 2RDWA 1MZRA 1VYPX 3ERPA 3CIVA 3GNPA 3FK4A 3TLQA 1G9HA 3FN9A 3CIXA 3GH4A 1IR1A 3WK1A 4AZGA 3UA3A 4L6HA 1QPKA 4AD0A 1CIUA 4QDWA 1A5NC 3E5BA 3TSBA 5G4EA 3PUGA 1M6JA 2V5JA 4HHPA 3W07A 3WQVA 2J25A 4GO8A 4I9JA 5CSRA 3TR2A 3MVIA 2VD8A 4J4KA 1BPLB 3KVMA 4PH6A 3RUBL 1ISWA 1OEPA 2UY5A 3WLRA 3AIBA 4QP0A 3FA4A 2C16A 1ICQA 1THFD 2XGIA 3UJSA 4UR9A 2WNNA 2JEPA 4GZJA 3TQPA 2B7NA 4QNEA 4AZ7A 3PPFA 5DCDA 1UWUA 1XDJA 1XGEA 2YCLB 1JYWA 2A4AA 1WCGA 3WQWA 3OIXA 1ENUA 2ZXBA 3MBFA 4KWSA 2OLSA 4H41A 4ZO8A 1GPFA 3MMUA 1KO0A 5HBFA 2J62A 2OWXA 3FLUA 4J3ZA 2BWGA 2WMIB 3CIWA 4MM1A 4PYSA 4CD6A 3SR7A 5FD0A 1EB3A 4GGHA 4FA3A 3HG5A 1X7FA 1B3OA 2C19A 3CGTA 1IE7C 3TC3A 1P0NA 5DXXA 3KRUA 4BK9A 7ENLA 1KA9F 3CUGA 3JRKA 5EB8A 1GJUA 3H54A 2PRHA 3MSDA 3VI2A 2DSVA 4C7GA 3EKZA 2FZNA 5LIWX 4JTGA 1ADSA 3L21A 1RA0A 3YPIA 1JG9A 4I5RA 3URBA 5AYZA 2PDKA 3UETA 3D5HA 3I3BA 2PEVA 3DKLA 2IXUA 4ASTA 1E0WA 2QPXA 1LUCB 2PRMA 3HTWA 1XCFA 2A7NA 2E6YA 4LC8A 4DQWA 3T44A 4Z08A 5F1UA 5I79A 3MB9A 2OKOA 4CNTA 4DF2A 3SCUA 4YMZA 1YE4A 1EC7A 4MKSA 5G4WA 5LNSA 5LXXA 3RFAA 1FHVA 3RCMA 1RD5A 1A5CA 3PBMA 5D4YA 1B5TA 5A6AA 4F2BA 1Q66A 4W85A 2O4QA 4AIEA 4GI6A 1JJKA 1XC6A 3HG3A 2QUTA 4L56A 1GYMA 4Y9MA 3W76A 5C71A 3ENLA 2ZTJA