4FEZA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
316
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 107
structure length 316
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fezA00
2Y6ZA 3H54A 2C16A 2E6DA 3HGJA 4UTTA 4JICA 3V75A 4JTLA 2WNNA 1KLZA 4K38A 4JX5A 1KTNA 1SW7A 5HINA 3KHJA 2CZFA 2ZZ4A 2Y7EA 4XKYB 1OF6A 4FNUA 4K7YA 3WJYA 2KZHA 3A9IA 1OABA 3C56A 2YX0A 4UCGA 2CLIA 2QCCA 2TPSA 1TPVA 4G1KA 3R12A 4K37A 2PRLA 1TTPA 2FIQA 3HF3A 3DKJA 4UMBA 3KRUA 1LBLA 1Z44A 3LB0A 4JIPA 4Z0JA 1WBHA 1HO4A 1FWNA 4WXZA 5C6MA 4DO4A 4I7WA 1IXNA 5HWMA 2GVJA 3PF3A 1TPUA 3IGUA 2CLEA 3Q37A 4AHOA 3QYQA 3W1LA 3WK3A 3W7EA 4LY8A 1SW3A 5DXYA 3TQVA 1TPB1 1W5OA 1QCWA 1TYGA 1VGAA 2V5BA 2NLIA 3L65A 3MP5A 3QMTA 2D73A 1GG1A 3ABQA 4ZQRA 3PG9A 2P0OA 3LGEA 3CIWA 1XUUA 1LBMA 4RXGA 4Z1AA 2VFFA 1YXDA 4JX6A 4DXVA 3C2VA 1FCVA 1QPQA 1M7PA 3TH6A 3UWQA 3W2KA 5D2VA 4NJKA 4LS2A 4HNUA 4ONVA 4M6PA 1H7PA 3MHUA 3LI0A 1R2SA 3HGSA 3NQ8A 1WA3A 4LUJA 1KM1A 4RK8A 4MUZA 1RQEA 1T96A 1LP6A 3NNTA 1DBTA 2Y63A 4LRTA 3MMTA 4O4VA 1JQVA 3UXAA 4IUOA 4RZ6A 1IIGA 3W72A 4HNTA 2ABAA 3H53A 1MO0A 4O50A 2YXGA 2GQ9A 3HB9A 3LHZA 3A23A 3QJAA 1L9WA 3CT7A 5IM51 3CIXA 3STFA 2C18A 1FDYA 4CCDA 3LLDA 1JRBA 3W83A 1JR1A 2WOQA 3OA3A 3W7GA 3HO8A 2ZRYA 3PC0A 1M5WA 1ZENA 4HSOA 1OHLA 2QDHA 4Z1DA 3W6YA 5CSSA 3PUOA 4PEKA 2Y7DA 3W7MA 2J24A 1MEIA 1OFDA 5DY3A 5HNRA 3LTSA 3W7JA 1L6SA 3MWAA 3RLVA 3UQNA 4RJEA 1XCFA 1QPOA 4JYFA 1ZAJA 3KAOA 1W8SA 3BLEA 1ZFJA 4JTUA 1VCGA 2H3DA 4XTIA 3W07A 4JY9A 3F4NA 5DCEA 3ABOA 1UASA 1YTKA 3QC3A 3PB2A 3IV3A 2XN2A 4AWSA 3M5XA 1GYLA 5HUPA 1H7WA 3G0UA 3GNDA 4O54A 2I1OA 3WJXA 4DPPA 3WK2A 2BTMA 3EWZA 3R13A 3TV8A 4DF0A 4WY0A 2X1UA 1AL7A 1G4PA 1WYIA 2CLFA 4S2BA 4AXKA 2WNQA 4BI7A 2CWNA 2QAPA 4X2RA 3NVTA 1Q6QA 2H90A 2CW6A 3MBFA 2Y89A 4M7TA 2ZTJA 3GXTA 4O10A 5HULA 2QUTA 3QPZA 5AHIA 4LVBA 3UY7A 5AYZA 4A3UA 3NQ6A 1EB3A 5U7SA 3TQ0A 3STGA 1V7YA 4XQ6A 2PE4A 4CQAA 1EUAA 1H5YA 1MXSA 4O15A 3LCLA 3EKZA 1FWTA 1RPXA 5LNUA 1TO3A 4TU1A 5D2TA 1F74A 3JR2A 2G97A 4OV9A 3THQA 1EX5A 4UTMA 3SI9A 3W1XA 2WKJA 1RQHA 1WX0A 1VYPX 3C3NA 1S5WA 3DAQA 2ZA2A 2CLOA 5F4SA 2FB3A 1Q6LA 2C3ZA 3NQCA 3L0NA 1O5XA 4NX0A 1KM0A 4LVFA 2B4GA 3NXFA 2YFOA 4LS1A 2NWRA 2VENA 4R34A 2A4AA 5I3HA 2V82A 2BZNA 2ISWA 3ANYA 3N14A 1I2QA 3GK0A 4KKXA 3QFEA 3S5OA 1OF8A 2IQTA 3LHYA 4UNKA 5D2WA 1JUEA 1KW1A 4QIUA 3WJZA 3DFSA 1XM3A 2P1FA 2JGYA 5FI8A 3OVQA 4GNJA 4NU7A 2A6LA 2ISSA 2V2HA 2NUYA 2V30A 1QO5A 1PL9A 1G4EA 4O17A 3QMRA 4UIOA 4DEFA 3NQDA 4NJJA 3TJLA 1JVNA 5F1VA 1YLVA 5K7JA 2VC6A 1P5BA 3NDOA 4UTKA 3T40A 3MP4A 4LVGA 1A5SA 2Y61A 3S6DA 4POCA 4U4MA 3P67A 1LZOA 1G6CA 2QKFA 3THAA 1TPH1 5C5YA 1OX4A 3LCGA 3PUEA 4E38A 2E6YA 2NZLA 2Z2UA 5KTLA 3ATZA 2Y62A 2JKAA 4ZQMA 1VHCA 3MYOA 1CX9A 1QO2A 4S2CA 3P61A 3L21A 3BG3A 4TMCA 2QDGA 5LNWA 1YPFA 2Q3OA 1OFOA 3STCA 3FIGA 3GXPA 1K8ZA 2QCEA 5D09A 1X1OA 5AFDA 1TTJA 3GR7A 4GBUA 3DFQA 3MO7A 3TDFA 3GNNA 4O14A 1L6YA 4Y6GA 3BW2A 1GZGA 5ABTA 3EWBX 2GVGA 3MI6A 1Y0EA 1YXCA 1QPNA 2ZBTA 3G3MA 5AYXA 3G0XA 4K36A 1W5NA 3RLUA 3LV5A 3BVJA 1XBZA 3HQ1A 2WSQA 1S3HA 2CLMA 4TIMA 1SFJA 1QMLA 1AL8A 1I2NA 1HFBA 1LORA 2VEMA 3EKLA 1EWEA 2V2CA 1ME9A 4UR7A 3W1PA 2GPTA 1QOQA 3OVPA 1X7FA 4Y9AA 3M6YA 1EUNA 5L9FA 3IGSA 3FKKA 3T55A 2CFFA 1W5MA 3EXTA 3EWUA 5C54A 1WOBA 2JGQA 2X30A 3F4WA 4JNMA 4YXGA 1PS9A 5I3GA 3E12A 1ZALA 5F2IA 3DBPA 4UMCA 4C1LA 3W2LA 4KWVA 5KMYA 1L2UA 1VQTA 1NSJA 3R8RA 3EB2A 1DJNA 1HO1A 2DZXA 4UFKA 2C19A 1AW1A 4OU1A 3VNDA 2ABBA 3O15A 2A0NA 2FDSA 3CWOX 1J2WA 3M16A 4MFEA 4N02A 3R89A 5DN1A 2EKCA 1ZCOA 5LZLA 1W31A 4NJHA 4OT7A 5I3KA 5G5IA 3DGRA 1LOLA 2ZFAA 4WY0B 2OJPA 2YSWA 3P5ZA 2DZTA 4JTGA 1H60A 3W23A 2GQAA 3NQ2A 2O7SA 4RZ5A 2YPIA 4QQ3A 4RCXA 4L4MA 1KA9F 4RX0A 4IMFA 4QM1A 1ZY9A 2J88A 4EOUA 1UUMA 2ATMA 4H4IA 5EKYA 3VCRA 3PAJA 2GJLA 4I7UA 4O0ZA 3STEA 5LGXA 3HG3A 2ZA1A 1OVDA 3QEZA 4MVAA 5G2WA 3F1QA 5D2YA 3M43A 4PODA 1YDVA 5DY2A 3ABRA 1WOAA 3ELFA 4O12A 2J9YA 3TUUA 1ALDA 2J9ZA 5C2XA 2QAFA 1QDSA 3CHVA 4OBTA 1SO6A 2W79A 3NPUA 3QH2A 4YL2A 1IIHA 1XDMA 3W1AA 2A21A 3QM3A 5G4EA 3L9CA 3GZ3A 1LCOA 1TSIA 1VCVA 1W54A 4FNRA 5DCBA 5A8GA 4O1DA 3NL3A 4N9DA 1C29A 1W3NA 1LBFA 2TSYA 1TREA 3W7IA 3WJSA 2NUXA 3HBLA 1KM2A 5F2LA 1OYAA 1OFPA 1UB3A 1ZJIA 1KBIA 2YYUA 4MLJA 4A21A 1F6PA 3FEMA 3O1NA 3TC7A 5EPDA 4M6QA 3TA6A 1VR6A 1Q6OA 3FOKA 3W2MA 5T26A 4GXMA 3U8GA 3JRKA 3LOTA 4FNSA 2V0TA 1KM4A 1LTDA 1TQJA 1A5AA 3FKRA 1VCFA 4MY1A 3CWNA 4HPXA 4A2SA 3W1QA 3C2EA 4UTUA 3BW4A 3M5ZA 5I3JA 3W7RA 3A24A 1U83A 3LHWA 1OX6A 1OX4B 3WK0A 4CNNA 3NL6A 3NOEA 2QUVA 3PY2A 2NX9A 3KVKA 5CG7A 3B8DA 4PTNA 3RMJA 2EGZA 1VYRA 4GFSA 4JEQA 2E5CA 3M9YA 1KFBA 3RNDA 3BV4A 3RFAA 4Z1CA 1PIIA 3GDTA 3S1XA 4UXDA 1TIMA 3RK8A 3TCEA 2ZRXA 1N55A 2X1TA 5H2ZA 4UTWC 4TMBA 3QMSA 2E6FA 5KZDA 4AHPA 4WY0F 3Q58A 5D03A 3T4CA 4JR5A 1FCUA 1GOXA 3DFPA 3B0VC 2ZZ5A 4WOQA 1TV8A 4LV4A 4Z08A 1GQNA 3TQKA 4PL2A 2ZZ3A 3IIPA 1OYBA 3LRMA 1P0KA 3UYCA 2R8WA 1F5ZA 4HHPA 2E1DA 5D32A 3GVGA 5FESA 3WFAA 3A5VA 1RD5A 3GDKA 1FDJA 2EAWA 2W6RA 3B04A 5J5RA 1SUXA 5I3IA 4XZ9A 3W70A 4IOTA 1JUBA 2B7QA 2GJNA 1FBAA 2A7PA 4JIQA 4R7JA 1K7FA 5K9DA 1SW0A 4NNAA 4UTHA 4JY8A 5LKYA 3TFXA 1SFLA 1VYSX 3ZWSA 3DFNA 3PBYA 4JTKA 2C13A 4IXXA 3SZ8A 4Y90A 1NAL1 1FWRA 3L5AA 3C0JA 3W88A 1SR9A 1TPC1 2QJGA 3LHUA 3GX9A 1JULA 4FNTA 2AAMA 3CEPA 4UC5A 2DZPA 3W1NA 3E02A 2EHHA 3L5MA 3KX6A 4GE8A 2X1SA 4AHQA 4O19A 1J5TA 4FF7A 2ZZ6A 2VFDA 4CCEA 1JCMP 1TPFA 2JKEA 1TQXA 3C52A 4IPJA 4BWLA 1ME8A 2V2DA 4GUFA 3LRKA 5K4ZA 2TRSA 4HSNA 3NQFA 4KWWA 1SU5A 3BK0A 1G4TA 1XI3A 3NG3A 4EF8A 4UFHA 4I7VA 3W7OA 1BTMA 3W7CA 2A2IA 4TX9A 2Y7FA 1KFLA 4UTIA 5I3FA 3MI2A 1PCWA 5AC7A 4ICNA 4LRSA 3W2UA 1I2RA 3QZEA 4XUGA 4UTLA 4ZQOA 2HS6A 2NXHA 4NUWA 5HQEA 2A7RA 3KRZA 4H6KA 1F6KA 1FY6A 1QOPA 3TSBA 1FXPA 5KZEA 1Z48A 2FJKA 4HNNA 2C0AA 4UTJA 4A2RA 4PFMA 5FEZA 1XFBA 4MZ8A 2QJHA 1ICQA 1BWKA 1GVSA 1V5XA 5EMUA 1Q3NA 2WV8A 2WJZA 2ZZ7A 2YZRA 4L4LA 2BX7A 1H61A 1WXJA 1F73A 3TFCA 3LDVA 5DCDA 1JUKA 4MPQA 3HGRA 3N73A 1UCWA 1AK5A 5E93A 3EEGA 2QR6A 2R91A 4YMZA 2TMDA 3PWAA 4FNPA 4BWLC 4NZJA 1ICPA 2YW4A 3I7QA 3EXSA 5CZJA 3LCFA 1VZWA 3S0CA 3E9AA 1KTBA 1DJQA 4ORMA 3DU0A 1DV7A 3Q2DA 4O1AA 1B3OA 3B0PA 2WO5A 2QCMA 1LRNA 2PCQA 1OK6A 2YFNA 3G1FA 3QW3A 1MEWA 2VFGA 4XBSA 3E96A 1IXQA 5EA9A 3TMQA 3BGJA 4QNEA 2ZZ2A 2VELA 4E2DA 1RQBA 4FIRA 4Y96A 4LU0A 2YGYA 1Q45A 3GKFA 1OFRA 2ZRZA 5LHEA 2ZRUA 3A22A 3UWZA 3S8HA 5K9CA 2DZUA 4UFIA 7TIMA 3VE9A 3W1MA 4ML9A 3TROA 5C55A 1EP3A 1H1YA 5H91A 1HG3A 4WOZA 1B4EA 3G3DA 2Q3RA 4BFAA 3E0IA 1P0NA 3NQVA 4ADTA 2G96A 2NUWA 4AH7A 4PCFA 1YDOA 3M0ZA 4RZ4A 4RKAA 3W73A 4QAIA 5HUOA 1DOSA 1RR2A 3NQMA 3UWUA 4EIVA 1M7OA 1W0MA 4P61A 3L68A 4QJ1A 1FWSA 1IXPA 4M19A 3W84A 4UFJA 4AMAA 4IWWA 3R2GA 4E0CA 3SFKA 2FLIA 1WBJA 3G8RA 4NJGA 1SO4A 3P60A 1GPWA 3PM6A 5LNSA 2VFEA 1KFKA 1TJPA 1ONRA 1T8XA 5BMWA 3V1PA 3ABSA 4EVZA 1OYCA 4MLRA 2C14A 5D04C 1T0OA 5D30A 5K4XA 3TSMA 1LOQA 3G8EA 3BARA 3NM1A 4AVFA 4R33A 3CTLA 1ME7A 4WJEA 4KFPA 1W3TA 1EWDA 3TE9A 4IQLA 4YCPA 3P84A 2PURA 1GTHA 1LLWA 4HNVA 1JCYA 2DJXA 1R47A 1OFAA 1WV2A 4PA8A 3QW4B 3EX6A 4AWTA 1K8YA 1TV7A 3TAOA 2HMCA 3H55A 3NM3A 4MYAA 1W5QA 4XTDA 3DHDA 4BK9A 3C2FA 1FWWA 3PBWA 3IIVA 3NQAA 4LTSA 2VFHA 4DO6A 2LLEA 1ZAIA 2FQIA 3KVLA 2Y88A 1IXOA 1W5PA 4A22A 1G69A 1ZAHA 1CI1A 3E49A 3BPWA 4K8HA 2YYTA 3I7SA 3GDRA 2CLKA 3EWWA 3G1YA 3O05A 1SPQA 5D37A 1W1ZA 4LVDA 3KFTA 1X8FA 3HJZA 3DHFA 4O11A 4FXRA 4IMEA 5K9XA 4MZYA 3B0UX 1G7VA 3M44A 2ZRWA 3YPIA 2WSRA 2X16A 4A29A 3DI1A 4AF0B 2AQWA 1D9EA 5BNKA 3L5LA 1R2TA 5CPOA 2QCNA 4FHAA 2PC4A 4UUIA 5E1QA 1IGSA 3T78A 3SY5A 4BR1A 1W37A 3VFLA 3G1XA 3S5YA 4LC8A 1O4UA 2RHGA 1LOSA 1EP2A 5EY5A 2CLHA 4Z1BA 4XWUA 1KM3A 5DBUA 2B7NA 1KFEA 3TJXA 4P2VA 3KOFA 2E09A 5CZ0A 5SWUA 4IMGA 3CQ0A 3G22A 3S5NA 4WD0A 3EX2A 1HTIA 3HMJG 1GT8A 1C8VA 4NT0A 3N19B 2DZSA 1H51A 1I2OA 3IIOA 1NF0A 3W87A 3GAKA 3MUXA 3LHTA 1QWGA 5F1UA 4WXYA 3T44A 4YCOA 2HSAA 3DZ1A 4PC8A 4N9CA 4ZZ9A 1K03A 3W7PA 3WJWA 2Z1BA 1DKWA 2BXVA 3W76A 1GYNA 5KINA 4NZFA 4K39A 4CLMA 1WQ5A 4DO5A 4M7SA 5GVJA 2TYSA 1FQ0A 4CQ8A 3SSJA 1XKYA 4IPIA 4ZL1A 3TXVA 3EX3A 3MBDA 3O6DA 3TK7A 1GTEA 3NA8A 4OE7A 2HTMA 2AGKA 1KM5A 1SZEA 1F7BA 4MKNA 3N3MA 2J6XA 3W7QA 1EIXA 5LHFA 3B4UA 2ZRVA 1H7NA 4N9EA 3GLCA 4X3ZA 2FB2A 4RXFA 4WZHA 3AO0A 2YW3A 3SJ3A 4GC4A 1OK4A 3TW6A 3HG5A 3N34A 3MYPA 1JQXA 4K8EA 3P62A 4NNCA 4E2BA 1GWJA 6TIMA 3W86A 4GUHA 4QSHA 4FIQA 2OCZA 5G4WA 2R94A 3QSTA 3KRSA 3TX9A 4RR4A 1GVQA 3M1ZA 3VKJA 4B5NA 3OBKA 1YDNA 3LXBA 4IX2A 3DH7A 3CU2A 1WDWA 1N7KA 2NXIA 3N2XA 3UD6A 2JBMA 2J9XA 2P10A 2A6NA 1TCDA 2ZYFA 3PB0A 1I8JA 3DXIA 3GYEA 4FEZA 3R5EA 3OVRA 1QAPA 3MHFA 4HT3A 3LV6A 2DU2A 3O8AA 2YR1A 3INPA 4JXCA 4LV9A 2RH9A 3NQEA 4O18A 5CPNA 2F84A 3W74A 3FJLA 1BKSA 4UTWA 3O6CA 2I14A 3TKFA 3SECA 4O8RA 3EX4A 1VJIA 4OV4A 4X22A 2Q8LA 4O28A 3LXCA 4N2YA 5F2GA 3TAKA 4IX0A 1P1XA 4ZMGA 1EP1A 3PSWA 3O6YX 3QF0A 1FDZA 3HOJA 3UPBA 3OHIA 4ZQPA 2A5HA 3S9YA 3NGJA 1JRCA 3LERA 1A5CA 2G95A 1XL9A 4IJBA 4GJ1A 5CZSA 1GG0A 5J5DA 4DF1A 2Z6JA 1SQ7A 3TSDA 3TR2A 3QRHA 5LSMA 4ZQCA 2V9DA 3C8FA 3B06A 1TPEA 1K7XA 1AW5A 3NPXA 1VLIA 3I68A 1PE1A 4UFLA 5AYYA 4DPQA 3P8JA 3L66A 1JCJA 1GEQA 3HPXA 3S1UA 2V5LA 2FTPA 2QJIA 3PSVA 3NPWA 1DVJA 1TRIA 3ATYA 5D2XA 5AOUA 2QUUA 3PVFA 1EEPA 3LCWA 1T99A 1RZMA 1AW2A 3IVSA 3GXNA 2NV2A 1O95A 4MY9A 2CZ5A 4LW7A 4W9TA 1KBJA 4MOZA 3LBMA 4GRSA 5LNVA 4N4QA 4J9JA 2RFGA 1BWLA 2PRMA 4Y8FA 3FA5A 2H8XA 4XBKA 4C1KA 1FX6A 2C1HA 1A50A 4UNLA 1VLWA 3DFOA 3LXAA 4ADUA 1YADA 3VI2A 4ALDA 3FJ6A 4GUGA 3VE7A 3TIMA 5MHBA 2VEIA 3LCIA 3L2IA 1SO5A 3NPVA 4K7VA 4FX7A 3W75A 1XC4A 4NQ1A 1JCXA 1Z42A 2Q8ZA 3HPSA 3BW3A 2FPVA 1XDLA 1DQWA 5BW6A 4JN6A 3LM7A 2E5DA 4YLWA 5L6UA 5BOOA 3C4UA 1TJRA 5D05A 3NR0A 4OQVA 3QSRA 1GJPA 1YPIA 4N6FA 4UTTC 4AWUA 3SW6A 4ZQNA 5EBUA 1KV5A 3C2OA 1UJPA 1DHPA 3IIZA 4O57A 1OJXA 4MYXA 1X6UA 3IRDA 2GOUA 4JTTA 3B05A 2G5WA 2DZWA 2QCDA 2Y85A 1GVRA 5AHEA 4QITA 4CNPA 2PRHA 4TO8A 3TW7A 1B9BA 4AF0A 5AC8A 2Z6IA 2NX3A 4Q32A 4UR8A 2OZ0A 4IMDA 2RDUA 5CZTA 4EF9A 2VKZG 3O16A 3KVMA 5TBOA 1FXQA 3HPZA 5CPLA 3W7KA 3M41A 2DP3A 1LDCA 3QQ0A 4FNQA 2ZDRA 2XFWA 1UBSA 4UMAA 1C9DA 2RKXA 1UUOA 3CEUA 4NXSA 3C6CA 1JJKA 1PCKA 3UPWA 4O0KA 3IVUA 4CCCA 3G1VA 3RF9A 3P74A 1K02A 2CZDA 2OX1A 1R46A 3BLFA 4NXKA 2GUUA 3TNOA 4JTEA 5FEWA 1VHNA 1N8FA 2B7OA 1HUVA 2EPHA 3PBUA 2NWSA 3KVJA 2QCFA 3W9ZA 1H63A 4OHQA 1QFEA 4ZVJA 3ZS4A 3EXRA 3GDLA 3P7YA 4Z0SA 3P80A 5IBXA 3W71A 4O1BA 5KSWA 1OG0A 5K3VA 1FCBA 4N9BA 2BWGA 3OG3A 2ZA3A 3W3OA 1O5KA 3TU9A 1LRTA 2EF9A 4WX2A 4D2JA 4KFOA 3S42A 6ALDA 1XXXA 1H1ZA 2H3BA 4IMCA 3GDMA 3QPYA 2NXGA 5U4NA 3DFTA 3LX9A 1PV8A 5AHNA 3W2JA 1S5TA 1PHWA 5AHFA 3G1DA 1QNVA 2ZQ0A 4LOCA 3FYOA 3C61A 3N2MA 1SO3A 4JYEA 3P5YA 1A5BA 1LROA 1LLZA 3ZFHA 5DLCA 3LCXA 3PUDA 3LRLA 2DJLA 3PULA 3PBVA 3M47A 1K8XA 4JGDA 1KV8A 1XBVA 5FEXA 3EX1A 2GQ8A 4UFMA 4NVTA 3TXZA 5D02A 2DORA 2JKPA 3OIXA 1ZHAA 4TR9A 1IF2A 3QQ1A 3GKAA 4KFNA 5D38A 3M5YA 4HPJA 3I6RA 3F03K 1TPWA 4I9AA 2FFCA 5IBXC 3SGUA 4QNWA 1MZHA 3WK1A 3O63A 2QCGA 1G67A 1H62A 2WNZA 1X1ZA 5F2MA 2A7NA 3IVTA 3N9SA 3O06A 3LCHA 4JDBA 1VPXA 1YTDA 3MW7A 2V8ZA 3W2NA 3W85A 3NL2A 1H7OA 3C2RA 1AG1O 4MY8A 2ALDA 1OFEA 3M7WA 4FX8A 1EPXA 3FFSA 4FX6M 3UZJA 2Y7GA 2B0MA 8TIMA 4NX5A 3M5VA 1HL2A 5FF4A 2C15A 3KXQA 3NO5A 4M6VA 5G1YA 3A5FA 3UZ5A 5F4WA 3CC1A 2VXNA 5KZMA 1TMHA 2A85A 2XN1A 5FF0A 3D0CA 3W22A 4FO4A 1KFJA 3IEBA 2UV8G 4ORIA 5G1TA 1D3GA 1H7XA 3ZWTA 1TB3A 4QISA 3BG9A 5CKSA 3NQGA 4MJMA 2X2GA 5KITA 3FYPA 2DZVA 2CZEA 1FCQA 1S5VA 1QR7A 3G1AA 2FPTA 2VFIA 4BI6A 2NV1A 1BEUA 5A5WA 5LGZA 4AB4A 3U6WA 4PH6A 5G2IA 4R53A 5AB3A 5CPMA 3UWWA 3G0SA 2QCLA 1MSSA 3G24A 2H6RA 3SR7A 1VS1A 3NEVA 5CGQA 1TV5A 5DXXA 3SGZA 2HS8A 5HR6A 4MZ1A 1K3UA 5AHLA 5EYWA 2XN0A 2ZZ1A 3U2OA 1VC4A 5FEPA 3OEXA 2QCDB 1YYAA 4RLIA 4RV8A 3W7LA 5BMXA 1F76A 3JS3A 3RU6A 2H8ZA 4WUIA 2RDTA 3DENA 2A1YA 4BI5A 4NNBA 1L6WA 1H50A 2QCHA 4EWND 3BO9A 4FB7A 1PVNA 1NEYA 2WQPA 2VEPA 4WQ6A 4XKYA 4DELA 3I65A 3W7HA 5HWNA 4DF2A 1KTCA 4N6EA 5HMSA 4IGHA 4LVAA 1A53A 3IIXA 1TPDA 5AHMA 3P82A 2E5BA 3HG2A 1SZGA 1JCLA 2ISVA 2R14A 4H3DA 5D33A 2F7FA 3W7NA 3B03A 1I2PA 2E68A 1GVFA 5TIMA 5HWJA 2J27A 1B57A 1G4SA 1TRDA 3CB8A 3DI0A 3TC6A 2I9EA 1PHQA 1LYXA 2C6QA 4JTSA 2FPYA 1OFQA 3CM4A 4GUJA 1DORA 4JYDA 2X1RA 3L0GA 3MI3A 1NFBA 1B4KA 3P8IA 3S1VA 1Z41A 3MHGA 1JCNA 5DELA 5BRBA 3NZRA 2Y70A 1ICSA 1XBYA 4HIBA 3EWXA 1P4CA 4MIMA 2V81A 1DL3A 2NX1A 3S1WA 4DQWA 4LC6A 1AMKA 3K30A 5F4XA 2WSYA 3G1HA 1LM1A 1RVGA 3BG5A 3TMLA 4HN4A 3UWVA 1OX5A 3W1TA 1OFBA 3MJYA 1SSDA 4K6AA 3UWYA 1J4EA 4NJIA 2Z0IA 2CU0A 3GB6A 3NYZA 3LTYA 4CNOA 1TTIA 2YCEA 3L67A 4JDYA 3CLMA 1VRDA 1YXYA 3NAVA 1FUYA 2RDWA 5HR7A 3MP3A 3LLFA 5E0KA 4X9SA 4JTFA 4O1CA 4OWGA 4Q4KA 1QPRA 1SSGA 1SZFA 2BSLA 4IXHA 4AEOA 4O52A 1K7EA 4JS3A 5K2ZA 4JTIA 1D3HA 1W3IA 2YDAA 4GUIA 3NL5A 1F2JA 4O53A 2ZCGA 3G18A 4MFDA 3PR2A 2QEZA 2QF7A 4U28A 4CQ9A 3N9RA 1XBXA 3UNDA 5DBTA 3UY8A 2JK2A 3P81A 4LT9A 4M5PA 1SZNA 4JTHA 1NF7A 1CW2A 3W7DA 4DBDA 2B7PA 5FF7A 1M6JA 3FS2A 1DQXA 4ADSA 2OT1A 2O7QA 1F05A 4DBEA 1MEHA 5G2HA 3LHVA 5FF3A 5TQLA 1E51A 2GVLA 5FF2A 3USBA 1ADOA 3L0KA 1O60A 1XUZA 3G1SA 2OMAA 1O94A 2BLEA 5CSRA 4MJZA 1WAUA 5EL1A 4FXSA 3S5ZA 1VH7A 1EA0A 4LNYA 5LNRA 4BF9A 3Q94A 4N4PA 2ATSA 3A21A 4PL1A 3DKLA 3EWYA 3GR8A 4LWWA 1U5JA 1LRQA 2VEKA 1RV8A 3NZ1A 1GVOA 1THFD 4O4WA 4JD4A 2OT0A 3UXDA 3LBCA 3LTPA 3BLIA 3HIJA 3PG8A 2ZTKA 3HGOA 3T7VA 3SIZA 1I4NA 3GIYA 4GWEA 4YWIA 3BGGA 4JTJA 1KLYA 2CLLA 1R30A 1ML1A 3GAYA 4JX4A 3I7RA 3PS7A 1TTQA 3LI1A 4Q33A 4HKPA 1G7UA 1R2RA 2WPBA 1KM6A 3AJXA 5HJLA 4O13A 1ZNNA 3CPRA 4AAJA 3IGXA 3W1UA 1Q6RA 1YTEA 4S1FA 2E77A 2VOMA 1NVMA 1H7RA 1W56A 3O07A 2E6AA 3W1RA 4O16A 3FLUA 4OGZA 1KFCA 4LS0A 5AC6A 3HG4A 3NQ7A 2W0UA 5AN7A 3ZR4A 1I45A 4LUIA
chains in the Genus database with same CATH superfamily
3H54A 3HGJA 3IV8A 1UC5A 4UTTA 2PDMA 4H04A 4H7CA 4F0KA 3LSBA 4HP5A 4XZHA 2FHBA 1AODA 2CZFA 4K7YA 3A9IA 3M4HA 1OABA 3ORWA 2GL5A 4G1KA 4K37A 3ZLFA 2XVKA 2I16A 3DKJA 3KRUA 1UIOA 3LB0A 5DRCA 5HWMA 3IUHA 3IGUA 2QGHA 2BV9A 4GI8A 1SJAA 2R1MA 5DXYA 3TQVA 4KBXA 1PYMA 1QCWA 2VEGA 4XUYA 3T0DA 2V5BA 2NLIA 4XZLX 3L65A 3MP5A 3UZXA 4GY0A 2NQZA 3ABQA 2V5DA 4XISA 4KEUA 2WSPA 4GACA 1OC6A 3LGEA 1UWUA 1XUUA 1KGXA 1LBMA 3AUJA 3G5EA 3VCCA 5FAGA 3U0HA 2Z28A 3TH6A 3UWQA 2XYLA 4IGSA 1V0NA 1R9XA 4NJKA 3WEMA 4LS2A 1KGUA 4M6PA 1CGUA 1D8WA 1H7PA 4AQLA 1R2SA 2KAUC 4B5UA 4LUJA 1KM1A 4PCSA 3AFBA 1RQEA 1T96A 1LP6A 2YJQA 3CZ8A 4LRTA 4O4VA 3LYEA 1JQVA 1IZJA 2ZX6A 4KIRA 4RZ6A 2E9MA 2Y5SA 1V08A 4GIAA 3RILA 4HB7A 1UMYA 2YXGA 3KBSA 1O12A 3QJAA 2PU0A 3MSYA 1L9WA 3CT7A 3PFRA 5IM51 5MKGA 1E0TA 2WC4A 1FDYA 1LWHA 1JRBA 4GJJA 1JR1A 3W83A 4W5UA 2WOQA 5CH9A 3FSUA 3UA3A 3HO8A 3GXMA 2YL6A 4ZXOA 4ACZB 5JUVA 3QGAC 2Y7DA 4CQCA 3W7MA 2J24A 4FXJA 1CENA 3W7JA 4PBFA 2VYOA 4OOUA 1QPOA 4JYFA 3P93A 1ZAJA 1W8SA 4XTIA 1UR3M 4YTRA 5DCEA 3ABOA 3M07A 4C1NA 4TVCA 1A5NC 1B90A 3EWZA 4Q4MA 2Q09A 3R13A 4DF0A 3HQOA 3PJWA 5BXTA 4HOZA 1WYIA 1AD1A 4LYKA 4M1RA 2AKMA 4I9MA 3ECQA 3MBFA 1OCJA 4M7TA 3WQEA 2ZTJA 3U5YA 5HULA 4XK2A 3N2BA 2QUTA 3QPZA 3I3DA 5AYZA 2PCEA 2B31A 3ZT7A 1JFHA 4XQ6A 4DJFA 2JALA 1QHPA 1EUAA 2HCVA 3LCLA 4DJDD 2X7VA 1RPXA 4LAOA 2MANA 3WLMA 2FZ8A 1SFSA 2WVUA 4NZ1A 1F74A 1UP0A 1RA0A 1E15A 4OV9A 3THQA 4PBGA 1EX5A 5LIWX 2WKJA 1VYPX 5BWAA 3GBEA 3K46A 2ZA2A 5F4SA 2FB3A 2V5KA 2NQHA 3VX0A 4LVFA 4LS1A 2NWRA 2VENA 3PBMA 2A4AA 3WL1A 2V82A 2ISWA 1SZRA 3N14A 5DF0A 5HMFA 3UR8A 3GK0A 4DIAA 3S5OA 1XD0A 3GHTA 4QFUA 4W8AA 3L12A 3VINA 1KW1A 5KETA 3WJZA 1A5MC 4J3ZA 5HATA 4DRSA 3WDQA 1NIUA 2ISSA 3W38A 2V2HA 1G4EA 4O17A 1OIMA 5C9ZA 3ZJ6A 4DEFA 4C6BA 2Z1VA 3NQDA 4NJJA 1OZQA 4EPBC 4C6QA 2RUSA 3NDOA 1DWIM 3T40A 2OWXA 5LIYX 5CJ5A 3WCZA 2V3DA 4B5VA 1HJQA 3L2LA 1J18A 4HMDA 5AC4A 2Z1WA 1TPH1 5C5YA 1OX4A 3DC0A 4QP0A 4TUFA 1ZUAX 1FFRA 3RCMA 3CO8A 1A0EA 5XIMA 3WKZA 4AW7A 3WQFA 2QDGA 1EH9A 3RM4A 1UWSA 1BQGA 2QCEA 4JOMA 3WD3A 1YHTA 3QV7A 2EPLX 3AZTA 1SM9A 4XAFA 3VNYA 5C2GA 2PGEA 3U3HA 4O14A 2QJJA 3HZ3A 4Y6GA 4AWEA 1GZGA 1TX2A 2GVGA 4M1BA 2ZBTA 1IHIA 4PMJA 3RLUA 1K6WA 3LV5A 3PZOA 4ATLA 3HQ1A 1R38A 4ROQA 1IGWA 1QMLA 5HNNA 1VFHA 2V2CA 4MPKA 2GPTA 1VBUA 4EXQA 1H3GA 1ODUA 5L9FA 3CUHA 5CXPA 5D8WA 4J3SA 4ZXLA 3T55A 1W5MA 2BFGA 5A6KA 1XSIA 3VIOA 3EWUA 1WOBA 2X30A 4JNMA 3OZPA 2HBXA 5I3GA 3VK5A 2F9RA 4MTVA 3BSMA 2PC8A 4TTUA 1E6PA 2P3EA 4Y7EA 2SFPA 1NSJA 4F0HA 3GWQA 1DJNA 1HO1A 4UFKA 4U10A 1JXKA 3WZ0E 2C19A 1NQKA 4ERGA 4YJ5A 4OU1A 2ABBA 3VMPA 2A0NA 3R89A 1E9IA 3VAVA 5LZLA 4WEVX 3R4IA 4EAYA 1EJXC 3DG7A 1AJZA 2WMHA 1J0IA 3W23A 2O9TA 2E9LA 3MMDA 1VFOA 1X7IA 2PDFA 2Z1XA 4L4MA 2J62A 1K6AA 8CGTA 1TJ0A 2ATMA 5EKYA 1YQ2A 1Q65A 2GJLA 4I7UA 3VOHA 1VJSA 3STEA 2YLLA 2ZA1A 4MVAA 3F1QA 3AALA 1Z8AA 4MKVA 4MF4A 3BLLA 2PP1A 3GE7A 2I9UA 4EX4A 3WO8A 4OBTA 4RNJA 1YE4A 4F2TA 2W79A 1IIHA 1XDMA 4RZBA 2ZADA 4MG4A 1JPMA 2HE5A 3C0SA 4KS0A 2C79A 4ENLA 1TKKA 4N9DA 1IQ8A 3WNPA 1LBFA 1JDDA 1R86A 1CGYA 1OFPA 1UB3A 2YYUA 5AYIA 3D46A 3V0SA 1TWIA 3O1NA 3TA6A 1VR6A 2F2KA 5CLTA 1HKWA 5T26A 1DJYA 1MZRA 4FNSA 1A3HA 2V0TA 1E0VA 3KM8A 4TVDA 1RUSA 2FMOA 3FKRA 3JZEA 3NEHA 5I3JA 3C2EA 3LEPA 3A24A 1I1XA 2ZVIA 2NX9A 4RDYA 1NWUA 1VYRA 4DM2A 1KFBA 3AC0A 4B15A 2YKKA 1LWJA 4NZCA 1PIIA 4ZOCA 4H9ZA 3WQWA 4S3EA 4GH1A 4PYSA 4QRNA 1W3HA 4UXDA 1HJXA 4R9XA 3TCEA 3AXKA 4UTWC 3MPGA 5C8BB 4AMCA 2I57A 2E6FA 3II1A 4WY0F 1G01A 1XIIA 5EB8A 4C6CA 1UA3A 1UKQA 3OIHA 1X6LA 2OYLA 3IIPA 3IK4A 3V5FA 3BCJA 5FACA 2E1DA 5D32A 4EPDC 2E8ZA 4IIDA 5FESA 4MB1A 3GDKA 1SUXA 5I3IA 4XZ9A 2VUNA 1JAKA 2AQOA 1BRLB 2B7QA 4M81A 4IQJA 4G7FA 4QR6A 4JIQA 3VIMA 3MZ2A 1NWSA 5K9DA 1NM9A 5BROA 3BURA 3BQ5A 4JTDA 4Y90A 4UBPC 1V02E 4XSLA 3W88A 1UWRA 3R94A 3WQ4A 3LHUA 3GX9A 5EU9A 3CUZA 4FNTA 4GOAA 2ISFA 3CEPA 1OSEA 5IHSA 1TA3B 2RJGA 2X1SA 4AHQA 4B90A 1J5TA 1YE6A 3ALGA 5CPQA 2ZZ6A 4IPNB 4KH2A 4CCEA 2OXNA 1TQXA 3H7VA 3W0KA 2VX7A 3L4TA 4IPJA 2V2DA 4GUFA 3SQSA 1H1NA 2TRSA 4KWWA 3NG3A 4LEFA 3W7OA 4XAGA 4C65A 1WNOA 2Y7FA 2F8QA 1IYXA 4CNSA 4UTIA 4QE5A 1PCWA 1OQFA 1KBKA 1PSCA 1I2RA 3QZEA 4XUGA 4ZB5A 4ZQOA 5HQEA 1BXCA 2XH7A 3KRZA 4J3VA 4HPHA 1Z48A 3VM5A 2VGFA 4UTJA 4XBJA 2QJHA 2ZUTA 3KDOA 3B8IA 2IS7A 4IQEA 5BXPA 1Z9AA 1K9TA 2GSHA 3M64A 4S3GA 3LDVA 1JUKA 4L1WA 2F6UA 4CU7A 3HGRA 1UCWA 4O8AA 1E1CB 2QR6A 2IKGA 4IP7A 3XIMA 1MQQA 3I7QA 4Z1YA 3EXSA 2XGIA 5CZJA 2ZXQA 4HYRA 2QDEA 3LGDA 4ORMA 3ALFA 3BAKA 4O1AA 4MKSA 4S3FA 1XWYA 3VM7A 1NARA 1LRNA 1OK6A 3G1FA 4XD6A 4NAEA 3TMQA 4QNEA 2PDLA 3WD0A 2ZIDA 3GU1A 1RQBA 9XIAA 1XG3A 3LPFA 1FP8A 2WW5A 2YGYA 1Q45A 3GKFA 2VGGA 4TX6A 5LHEA 2D2HA 3RHGA 3UWZA 2DZUA 1EL3A 5C55A 4M29A 3QHNA 4NF7A 1HG3A 3G3DA 3UXKA 2Q3RA 3E0IA 3WQDA 3NFUA 3ENLA 1F3XA 3WSUA 4AH7A 1YDOA 3M0ZA 1LT8A 4RZ4A 4RKAA 4QAIA 5HUOA 1RR2A 3NQMA 2D20A 1M7OA 2A3HA 3L68A 2CC0A 1ITCA 1UR2A 1IXPA 1O5RA 4XO6A 2WKGA 3K8LA 1XLAA 4D6GA 4DUVA 1Z32X 2BOFX 5A69A 3KZSA 4E0CA 4DJDA 3T0CA 4H9VA 4XSMA 3PM6A 2VFEA 4KMQA 4WF7A 5BMWA 1PKMA 1W91A 2EQDA 5K4XA 1ISVA 3TSMA 1LOQA 4BQ3A 3AMKA 4ECLA 2PDQA 3ZJ8A 4AVFA 1OC5A 4R33A 3CTLA 4GLEA 3W00A 1US2A 4FA3A 4KFPA 4S3KA 3FGCB 4YCPA 3P84A 4HNVA 1TZ7A 1JCYA 2DJXA 4CD5A 1K8YA 2EEXA 3TAOA 3QR1A 2FGLA 3I3EA 4XTDA 2BOEX 4MAVA 3IIVA 2OLSA 3NQAA 7TAAA 4LTSA 6CGTA 4JFVA 4H8VA 3IJ6A 2LLEA 3ZVHB 2FQIA 2CNCA 2XVLA 2WAGA 5FJOA 4QJ4B 2GVYA 1W5PA 1W1PA 2R1LA 4H9TA 4JKMA 3QQWA 3EZ4A 3BPWA 2J25A 2PF0A 3I7SA 3O05A 1K4GA 1WUFA 1W1ZA 2PDBA 4GKLA 4LVDA 3KFTA 4I90A 2XIOA 1GVIA 1YDYA 4R27A 1G7VA 2ZRWA 2P5NA 2WSRA 1RJRA 3RPDA 5AECA 2PWUA 1A49A 4LY4A 4B92A 3QV9A 4IUGA 5BNKA 2VC7A 2PC4A 2QMKA 5TD4A 5LA1A 1CGXA 1IGSA 2Z00A 3OU8A 3T78A 3GZAA 3VGFA 2IKIA 4AZIA 4LC8A 2RHGA 1LOSA 1EP2A 4Z1BA 4G7EA 3AIVA 1KM3A 5DBUA 3KOFA 2E09A 2ESCA 4C6FA 3ARUA 2EO7A 5SWUA 1A3XA 3SJNA 3A6OA 2HBVA 1FWJC 3ARXA 2VD9A 3KHDA 1HTIA 1GT8A 1WO2A 4GD0A 2E28A 1HVXA 5CEWA 2DZSA 1WUEA 1NF0A 3GAKA 3GM8A 1XIEA 3VNZA 2GDVA 1ZBCA 4F0MA 3LHTA 3TTQA 3VOJA 3T44A 2HSAA 1VRXA 1MW1A 3M0LA 3KTCA 3IPWA 1EO5A 3RAOA 4Y9PA 1K03A 3WJWA 2Z1BA 2X0HA 3VIHA 3FXYA 3RPMA 3QKEA 4L5ZA 4NZFA 4CLMA 4D1JA 4DO5A 1JZ3A 2TYSA 4HZ7A 3TR9A 4CQ8A 3SSJA 1HQTA 4HCDA 1XV8A 2FZBA 5CG0A 1UH2A 3MBDA 3TK7A 2JIEA 1E6SM 4MKNA 2J6XA 5E09A 2BHUA 1JGIA 3WLQA 2NVDA 2P8CA 3B4UA 1WDRA 1KXHA 2PU1A 1J2BA 2X0YA 5AZ0A 1EJSC 4RXFA 4WZHA 3R0KA 2YW3A 3S4TA 3BICA 1PO9A 3MYPA 5GJMA 5B80A 4I5XA 5CJMA 4NNCA 4AIOA 4YWSA 4MWAE 7REQA 3W86A 4QSHA 1ZJBA 3LPGA 2R94A 4PTVA 1KO0A 5FOOA 1GVQA 3VKJA 4B5NA 1FH8A 3WL0A 4F0LA 1GK8A 1QJWA 3WNMA 3EDJA 3UETA 3LPOA 3CU2A 1R3SA 1WDWA 1XRFA 2NXIA 3UD6A 5JIPA 3VOCA 1TCDA 1E1EA 3DXIA 3GYEA 4UQCA 4XB3A 3MHFA 3N2OA 4HT3A 2XTKA 5GJPA 3WNKA 1U1UA 2DU2A 3O8AA 3N12A 2QNEA 2XH0A 3FJLA 3O6CA 2I14A 6TAAA 2J7EA 3ITYA 2INZA 4S38A 1GUVA 2V3FA 1EC8A 4J2MA 1VJIA 4X22A 1NOFA 3F2DA 4O28A 5JU6A 1Q8JA 1P1XA 4ZMGA 5C71A 1JD9A 3PSWA 3RYSA 3QF0A 1XRTA 2OGYA 3CUGA 1TR1A 3S9YA 3SCRA 2WJDA 1DIEA 5D9NA 5CZSA 4DF1A 4QJ3B 2Z6JA 2QVHA 2XDFA 3AWNA 1Q7QA 1QI5A 5M2FX 5AY7A 1K7XA 3AIBA 2VQUA 3NPXA 1P43A 3FA4A 3OLEA 4RUBA 2PUZA 1OCQA 4UFLA 4DPQA 3B8VA 3HPXA 5FKYA 1OB0A 3APYA 1CXIA 1JCTA 2WMGA 5D2XA 5AOUA 2QUUA 3PVFA 2XSXA 1CCWB 3VOFA 1O6IA 1OZMA 4LFYA 3V5OA 4FAMA 2C0HA 4L64A 2RFGA 3SCPA 1YRRA 3N13A 4Y8FA 2H8XA 4XBKA 4C1KA 1FX6A 1FWGC 3DFOA 3TOYA 3PTKA 4ADUA 3DYPA 4ALDA 3FJ6A 2VWSA 3VE7A 4BA0A 5MHBA 2VEIA 3LCIA 2QW5A 1W9PA 5GNYA 4I3GA 1EC9A 1I9CB 3W75A 4NQ1A 4GVIA 3ZVHA 1JCXA 1QU4A 2FPVA 4JFUA 5BW6A 3C4UA 3WLKX 5M3WA 3XINA 3SQLA 1OINA 4GQQA 3SW6A 1KV5A 3QBUA 3C2OA 2C71A 1AUSL 1UG6A 3B05A 1E4NA 2Y85A 1CNVA 5AHEA 4CNPA 5DMMA 3OVGA 5AC8A 4Q32A 4UR8A 4IMDA 2WHLA 2Z25A 4CVUA 2RDUA 5A2AA 3U4FA 4C6KA 4OJYA 4EF9A 4HHLA 4IH3A 1FXQA 3ONCA 3HPZA 2DSWA 5I0DA 3W7KA 1M41A 5RUBA 1G5AA 2VX6A 3KBWA 4JFWA 1CXEA 4HZMA 4JHOA 4UMAA 2DT1A 2RKXA 3E38A 1Q66A 5A8NA 4IPLA 1JJKA 4CCCA 2YCLB 3VKAA 2BGSA 3TNOA 1R46A 3BLFA 3WNNA 1N8FA 2QIWA 2Y5EA 3VGHA 2BVTA 2GJXA 3NURA 2NWSA 3BJFA 3VGBA 3LLXA 3H7UA 1EJ7L 4J1OA 2R24A 1QFEA 3VIKA 1N8IA 4JQ4A 3ZS4A 3EXRA 1JYNA 3P7YA 1GORA 4HU4A 5KSWA 1OG0A 1FCBA 2X8RA 4P7QA 4H01A 4AEFA 2PWDA 2EF9A 4D2JA 4KFOA 2ASHA 4DX3A 1XXXA 2X2YA 4WLCA 1UKOA 3GXDA 5GNZA 1QW8A 1W17A 4IMCA 1UOKA 4HNCA 4LAUA 3LX9A 3LPPA 3STPA 1S5TA 2Q02A 2ZQ0A 4C6EA 1QATA 3FYOA 1GQKA 4PB4A 1ZLPA 3P5YA 4FLQA 3JU2A 3EWCA 4Q4QA 4CGTA 1J12A 3KBVA 3ZLHA 3PBVA 3M47A 1K8XA 3GC5A 1NELA 2YZ5A 3EX1A 3BOXA 3QYSA 3B97A 4UFMA 4NVTA 4B3KA 2HROA 1LL6A 3REQA 1J6PA 4DWSD 1E0UA 3M5YA 2OKTA 3VX1A 1XGEA 3F03K 4LF1A 2WB5A 3A64A 1XICA 3ARSA 1SJCA 1G67A 2WNZA 5F2MA 1Z69A 2VX5A 4A3QA 1KQYA 2VD8A 1BVZA 2D0FA 3NL2A 1H7OA 1UOZA 2Z1SA 4BQ2A 3TLQA 3V7PA 2FHCA 2B0MA 4JNZA 1DJIA 3KXQA 1MW0A 3UESA 4DBUA 3R11A 5KZMA 3D0CA 1EJTC 2G4JA 3EKGA 3K4DA 1KFJA 4M0XA 5DEZA 2VNCA 1D3GA 1E0XA 2OZTA 3S3GA 1KFWA 4PTXA 3WG6A 2VQTA 3G1AA 3VCNA 2VR4A 2J7BA 1BEUA 5A5WA 1G1YA 5LGZA 3TQPA 1M04A 4PH6A 4Z2KA 1U33A 3G0SA 1IEQA 5AVHA 1B3XA 1MSSA 3G24A 4C6OA 3KOXA 1JYVA 3KBNA 1VS1A 3SR7A 3SGZA 2PB1A 2BY3A 5HR6A 3VPLA 3U4AA 2XN0A 4UZUA 2ZZ1A 4FLRA 3U2OA 1AD4A 2OQHA 2ISDA 2RAGA 2DUXA 2QCDB 4RLIA 4K3ZA 2XFYA 2RDTA 1G94A 4E4PA 1L6WA 2QCHA 4EWND 1A4MA 1NEYA 2WQPA 3MKCA 4XKYA 1EF2A 4FXFA 4W8LA 4D6FA 1TVPA 4RL3A 3KWSA 1KTCA 4N6EA 2G3JA 4IGHA 3IIXA 1TPDA 2NT0A 5AHMA 2E5BA 3HG2A 1JCLA 3WEZA 2R14A 2F7FA 4MGGA 5TIMA 3HJEA 5HWJA 1NDZA 2DUZA 3GG1A 3FV9A 3R25A 3CB8A 3RO6A 4N0RA 4JTSA 3OZOA 5I5RA 1OFQA 5TF0A 3S6TA 1DORA 4JYDA 1NFBA 2QJMA 1ADDA 1XIBA 4XKMA 2ODOA 2OLAA 4PCTA 3MHGA 5DELA 2OGJA 3R10A 1ICSA 1JDFA 2D22A 1XLIA 3W29A 3K30A 2WSYA 4QEHA 2NQ9A 4HU0A 1LM1A 4ZB2A 3BG5A 4JTRA 2FZDA 3FW6A 4ICMA 4HTYA 1RCXB 3RLHA 2VGIA 3UWYA 4EE9A 4I5RA 4NJIA 1SVDA 3QY6A 2CU0A 4XD4A 1XS2A 4H8NA 4CNOA 3EAUA 2GWGA 3L67A 4JDYA 1VRDA 1GW1A 4PZVA 6REQB 2JEQA 3OGSA 3MP3A 2GGEA 1A5OC 2HDJA 4X9SA 1XIJA 4LPCA 4O1CA 4LCSA 4JFSA 2FTYA 4AEOA 3KOZA 1TR9A 4JS3A 3GY1A 4GUIA 4MFDA 3LA4A 3QY8A 3LZ3A 1OT2A 5REQA 4XAZA 4CQ9A 3A4AA 3B0YA 3GSMA 4YHEA 4OZOA 5DBTA 3KRBA 3L7RA 2IUZA 2NQLA 1MYRA 3W7DA 4DBWA 3FS2A 1S2VA 2OT1A 1HKVA 1E6QM 4H7ZA 1ONXA 2BASA 3GW3A 4AZCB 1C8XA 1OCBA 5AZ1A 2ZC8A 1E51A 3BL3A 1O60A 2OMAA 1B9ZA 4B5SA 4JIHA 4GZIA 5HANA 4PE8A 6A3HA 2P8BA 3S5ZA 1YNQA 4QE1A 3GR4A 3M0MA 4BF9A 2QDDA 1JPIA 2G3MA 3A21A 1P0EA 3ICJA 4ZOAA 3UR2A 3WX7A 1GVOA 5CAKA 1THFD 5HJXA 1KNWA 2OT0A 3LTPA 5IDIA 4D6JA 1IE7C 1P0BA 3PG8A 4OECA 3SEPA 5HJYA 3RRAA 3ZLGA 1DE6A 3N17A 1I4NA 2BVWA 1A0CA 2PSNA 4YWIA 4NHVA 3CQHA 4JTJA 3N6QA 1TTQA 2A79A 1R2RA 2YLAA 4UQDA 4K2SA 3AJXA 5HJLA 2YIHA 3QTGA 3CPRA 3RR4A 2AL1A 4KCVA 3W1UA 1YTEA 3PZNA 4C60A 4WDXA 2YBUA 1V93A 1HP4A 1W56A 1XG4A 1RLDA 2WZIA 3UG5A 3AQUA 4GHRA 5AC6A 2EBNA 3NQ7A 5AN7A 2W0UA 3ZR4A 3VUSA 1IV8A 2R1NA 2Y6ZA 1XLDA 2POTA 4JKLA 3IRSA 3V75A 1GVYA 3NSMA 3FHAA 4PMDA 4K38A 1SW7A 1W1YA 2Y7EA 2YBVA 3OYZA 1E3XA 1W9BM 3ZT6A 1C3FA 1UD4A 3PTDA 2EPKX 2TPSA 4JTAA 3R12A 4DJEC 3B4YA 2YL8A 3M0IA 1TUFA 1S2CA 1Z44A 3KL0A 3TOPA 4CN4A 1WBHA 1HO4A 3RJYA 5E9AA 3KLLA 3W1LA 1BYBA 2H9AB 2W63A 1UKPA 3QR3A 1XIHA 2IPGA 2QMJA 1TYGA 1VGAA 4L6DA 4CVWA 3QMTA 2D73A 3SADA 1GG1A 1VFUA 2PTYA 4J3TA 4HMNA 4DXVA 3C2VA 1EGMA 1QPQA 5A6SA 3TN3A 1AH4A 3AHZA 1UPMB 1IR1A 4NRRA 3UFYA 4RK8A 1QI3A 3CT2A 1JD7A 3NNTA 3MMTA 1HKMA 4L1XA 3AIRA 1W1A1 2V5CA 4HNTA 3POHA 4MB4A 1P0DA 4RPQA 1PIFA 3PJTA 3H4GA 3PWGA 4Z2JA 4BY3A 4PMUA 2XU2A 1EXBA 1DXIA 3V0UA 4CCDA 3LLDA 1IT8A 3T8LA 4PUEA 3BZJA 3W7GA 2Y8KA 1YW1A 4K1WA 1WZMA 2ZRYA 3K5XA 1S2UA 2QUMA 2QDHA 5CSSA 3PUOA 3VOGA 2VUYA 4PEKA 3DBNA 4PBEA 1BPLB 1GVEA 3R6IA 5DY3A 3DHPA 3LTSA 4A3RA 3F7JA 3TYDA 3A4XA 2KX9A 3RLVA 1NP0A 2ZXBA 1W9UA 2E1WA 3KAOA 2J47A 2YL5A 3VDHA 2H3DA 3UT0A 1S5MA 2PMQA 3UZZA 4GFIA 4MMWA 1R87A 3M5XA 1GYLA 5HUPA 1H7WA 3E74A 3FJ4A 3GNDA 4O54A 3WBWA 4LBUA 4DPPA 2BTMA 3TV8A 1RP8A 4M6UA 1G4PA 2CLFA 4S2BA 4L7ZA 4F48A 4AXKA 4E3TA 2CWNA 4X2RA 2PWHA 1B3WA 2PP3A 2CW6A 2ZX7A 1QBBA 2Y89A 1WKFA 1QNOA 4AD5A 4LVBA 3UY7A 3TQ0A 1PZ0A 4ATDA 3PAOA 1WDDA 1MXSA 1HNYA 1XPYA 4O15A 4E2VA 3T81A 1FWTA 3ANVA 4TU1A 3EEZA 1E70M 2GDQA 4AD2A 1IWBA 3IUIA 3QTPA 4NILA 4J5NA 4DWSA 3SI9A 3W1XA 1F8IA 2Y0FA 1PKNA 1S5WA 2BP1A 1F07A 1WAWA 1Q6LA 5BU6A 4I8DA 3NQCA 3L0NA 5HA7A 4RE4A 1V79A 2BZNA 3ANYA 4DUXA 4KKXA 1E40A 2VDGA 1TWWA 5KEZA 3THDA 4UNKA 4WKHA 2IPJA 2CHNA 3DFSA 4PMOA 4L4OA 4A8RA 4LUTA 2P1FA 3Q67A 3CPGA 4NU7A 2A6LA 1WXZA 3IARA 3UEQA 1U5HA 1JVNA 1YLVA 5K7JA 1P5BA 3MP4A 2O55A 1A5SA 2Y61A 2XIIA 3BOFA 1SJBA 4U4MA 3SBFA 3LK6A 1G6CA 2QKFA 2OQLA 3PUEA 2E6YA 4HTBA 4PTMA 3TWAA 3DHUA 4ZQMA 1VHCA 1X97A 1B3YA 3D5HA 4MM1A 5CZKA 4P8XA 3P61A 3L21A 3BG3A 4PUNA 4TMCA 4HOXA 4YTQA 5CLWA 1OFOA 1EA9C 3B0XA 3G6MA 4RV3A 1X1OA 1QI0A 1TTJA 1P7TB 3GR7A 3BAXA 3DFQA 3AS1A 3MO7A 3TDFA 4F3HA 1L6YA 2DQXA 5CC5A 3MI6A 1E5JA 4ZR8A 1YXCA 5AYXA 1KRCC 1R3TA 3DCPA 1QBAA 2CERA 2WSQA 1S3HA 2CLMA 4TIMA 4W87A 3QGKC 4I8YA 1SFJA 1RY8A 3EKLA 2VWTA 1NFPA 4ZOBA 2UWFA 1QOQA 4OFCA 4GABA 4LEQA 1QPKA 3SCSA 1EUNA 2RDXA 3FKKA 4NI8A 3UJRA 1RBAA 4V33A 4YXGA 3F4WA 1PS9A 3UR7A 1W1TA 5IFPA 5KMYA 4LB4A 3R8RA 3N4FA 2Z24A 3C2YA 3WLOA 4W7VA 1GONA 2XWDA 3BLKA 5BXRA 4GZEA 3TYAA 3VNDA 3TC3A 4DLFA 2FDSA 3CWOX 3M16A 2EKCA 1EO7A 1W31A 4OT7A 1PKLA 5G5IA 3DGRA 1LOLA 2ZFAA 4WY0B 2YSWA 2DZTA 2J66A 4JTGA 1H60A 1PIGA 2GQAA 3WDIA 2AMGA 5C7VA 1T5AA 2O7SA 4RZ5A 3TTEA 2ACUA 1V03A 2YPIA 4RCXA 4Z17A 1GPFA 3EPMA 2AQVA 1C93A 2DFAA 2C91A 4EAMA 4QM1A 5HPCA 1Z3NA 2J88A 3AYVA 3I3BA 3VCRA 3V16A 1TWDA 3PAJA 2PDKA 2G3FA 4F2BA 4BQ5A 5G2WA 2BHZA 2NV9A 3B40A 4BF7A 5DY2A 4NSBA 3D6NA 1H2JA 1W9XA 4QX4A 1WOAA 4LALA 2B81A 3MUY1 2DZAA 2QAFA 3CHVA 2DSZA 3CMGA 3NPUA 3GTIA 4C6LA 3WBYA 4Q7NA 1KB3A 3L9CA 1LCOA 1W9DM 4FNRA 5A8GA 4O1DA 1AVAA 4PUKA 4HZ8A 3ZR5A 1R5YA 3NL3A 2HK0A 1R6WA 7CGTA 1W3NA 4MB3A 2TSYA 1TREA 3WJSA 2NUXA 3HBLA 2QHAA 4OUIA 4A21A 1KBIA 1ISWA 3OHMB 4GYFA 3TC7A 3AIQA 4DWDA 4MNMA 2DSVA 4JN8A 3U8GA 3PZMA 4FR6A 1KXTA 3AXIA 2PDHA 2VP8A 4YVXA 4UTUA 3M5ZA 4RDZA 1U83A 1XX1A 1BGGA 1F9CA 4OKDA 1XD1A 1Q6FA 5CG7A 2GJPA 4PTNA 1TFVA 3RMJA 2GGGA 5ECVA 4GFSA 4JEQA 2E5CA 3M9YA 3UW6A 1AQ0A 3RNDA 3BV4A 1AQFA 3SRFA 3RFAA 4Q8QA 1IEVA 2JF7A 3ZQ9A 1V6TA 3TYUA 2WZEA 1TIMA 2W67A 4E8DA 3N3TA 5H2ZA 4JQ3A 4HA1A 1QI4A 3QMSA 5KZDA 4AHPA 3LN3A 2I5GA 2VVSA 2EG8A 2WSKA 4JR5A 1GOXA 1DXFA 1OGBA 3DEQA 3TN4A 1VBRA 4WOQA 5CSUA 2VRKA 1TV8A 4LV4A 4D8AA 4PTWA 3TQKA 1P0KA 4DNHA 2WKLA 1F5ZA 3OG2A 2VZSA 3GVGA 1RJQA 3VO0A 2F61A 2QV4A 2W6RA 3B04A 3VKDA 1D3CA 4IOTA 1UKSA 1JUBA 2GJNA 5C2CA 2OODA 4R7JA 1AQHA 3UWEA 2WMFA 1BF6A 1SW0A 4NNAA 4UTHA 3TFXA 1SFLA 1VYSX 3ZWSA 5JQ9A 1PTAA 2IQ0A 3FK4A 1L8PA 4IXXA 2CLPA 1NAL1 1LUCB 2XPKA 1OD0A 1EYEA 4DYKA 1SR9A 3TP4A 3I6TA 1BQCA 1JULA 3PJUA 3W1NA 3E02A 2EHHA 4GE8A 3P2VA 2CXGA 3RCYA 4NAFB 1JCMP 3AUOA 2JKEA 4JIEA 1YX1A 5I06A 3VU2A 4G2DA 4BWLA 1ME8A 5DQPA 4EP8C 5AYBA 4HSNA 3BK0A 4UFHA 2FH8A 1DXEA 2NSOA 3R8GA 5I3FA 3MI2A 3GXIA 4ICNA 1M65A 4HYWA 3ZO9A 3OGVA 4OVXA 3SN1A 4LX4A 3W53A 1FY6A 1I6NA 1QOPA 3TSBA 4B16A 3U2CA 5I00A 1FXPA 2AOSA 2CWXA 2C0AA 4IZGA 1ICQA 1BWKA 4CN1A 2WYSA 1QUMA 4Q7IA 3PANA 1F73A 2OYMA 1GNXA 3TFCA 1B30A 2PWVA 4JL1A 5DCDA 2OTDA 1E55A 3F2CA 2FTWA 4AZGA 4MPQA 1C7SA 5EMYA 3N73A 4OTKA 5FJRA 1ZBVA 1AK5A 2ADAA 1Z89A 3SN4A 4PUJA 1K1DA 4YMZA 2TMDA 1LQ0A 1LL4A 3ZMRA 1VBJA 1ICPA 1JF5A 5I09A 1EGZA 1OIFA 4PUDA 3PUGA 1M68A 4MSSA 1QRQA 4IIHA 3DU0A 1B3OA 3B0PA 3IACA 2WO5A 4H1ZA 2QCMA 4DZAA 4IM4A 2J8FA 2YBTA 2HPMA 4MNJA 3OQEA 2ZZ2A 3JVAA 3CZEA 4P7LA 4FIRA 1XP3A 4MWAC 4LU0A 3S5SA 1UZ4A 2ZRZA 3EDDA 4R5EA 4QTGA 4ASTA 4UFIA 3VE9A 3UP8A 3W1MA 3TROA 5DO8A 1PYFA 3IS4A 5H91A 3QZ6A 4C7FA 4WOZA 1B4EA 4BFAA 2OZ3A 3NQVA 2F6KA 2G96A 3HPAA 4ADTA 4C7DA 5FJIA 3EYPA 2YL9A 4QDMA 4EK7A 1F3EA 4QJ1A 1TUXA 4GYPC 4LB3A 2BXZA 4F40A 2W66A 3GQYA 4W84A 1W1IE 3RX3A 3SFKA 4F2UA 4D1IA 1QNQA 1WBJA 3G8RA 3CK5A 1DQUA 1GPWA 3PZTA 3KP0A 2BHYA 2FVKA 3HV9A 1TJPA 1ONRA 3V1PA 4AUBA 3FHQA 3BZGA 4EVZA 1OYCA 3DG6A 3W26A 2WHMA 1UJQA 2ZX9A 1REQB 2BY2A 3KS5A 3URAA 1K4HA 3G8EA 1E56A 3BARA 5T9BG 5CC6A 2GK1A 4GH3A 2PURA 4A35A 3DX5A 4J2PA 2WVSA 4AZ5A 3FA3A 3EX6A 1JZ7A 3B9OA 2VC5A 2HMCA 2CIPA 3H55A 3BMWA 3DC8A 3DHDA 3RCNA 3C2FA 3PBWA 4HNOA 1GW9A 3WQ5A 4LUSA 3W4RA 3T2PA 4DO6A 3NVDA 3KVLA 2WQDA 3SDOA 1IXOA 4NZ4A 4A22A 1G69A 1ZAHA 3E49A 4K8HA 2QT3A 2INFA 3GDRA 1ZRQA 3AS3A 3ITVA 2Z7GA 2YB1A 2X05A 1RA5A 4ZO7A 1X8FA 3HJZA 3DHFA 1O1HA 1VFTA 1DJGA 1NDYA 4IL0A 4IMEA 3USZA 5K9XA 4MZYA 3GC2A 1R7OA 3YPIA 4NKCA 5I07A 4PGLA 3RO8A 1V0MA 3L5LA 3PWIA 3LZ5A 1E3ZA 1X38A 2NSXA 3GRIA 1ZP4A 3SFWA 1NY1A 5FSEC 4BR1A 2XIJA 5FL1A 2ACRA 4TVUA 2P53A 1KFEA 4WHBA 4GIRA 2QVNA 4PSRA 3PFMA 3T1GA 5D8ZA 2E67A 1RH9A 1C91A 3G22A 1TE1A 3S5NA 4KW2A 3WFZA 1C8VA 1EHNA 1BTCA 1H51A 3A4WA 3W87A 5C9XA 3MANA 3IAPA 1QWGA 5F1UA 4WXYA 1V0LA 4ES4A 3DZ1A 3OQ8A 3WMLA 4AVOA 4PC8A 3VD5A 3E0VA 4ZEPA 4ZZ9A 4IP4A 1MUCA 2VZOA 4V28A 4EKJA 3K1DA 1W3LA 4PMRA 2GQ3A 1YBQA 1N8WA 4D8LA 4IPIA 1BYAA 2OVLA 5B7ZA 5CSYA 1P6WA 4ZL1A 3WD4A 3TXVA 3O6DA 1KM5A 2V68A 4GKTA 3SCWA 2OPJA 1XSJA 3N6JA 1H7NA 1K9DA 4GO8A 4N9EA 4DXKA 2FB2A 1DWJM 2EG6A 3VYLA 5JBEA 1OK4A 3N34A 5A6LA 3OPSA 4Q22A 4GO9A 1R3WA 1ENUA 2EKGA 2PDXA 2ICSA 3OW1A 1M9HA 1J01A 5HNTA 4FIQA 3L4XA 3QSTA 3TX9A 1WE5A 5A8QA 1LWIA 1PX3A 1YDNA 2ZX8A 1NQ6A 3DH7A 1N7KA 7PTDA 2JBMA 2OOFA 2ZYFA 2FGZA 2Z29A 1RVKA 2G41A 1KR0A 2YR1A 4JXCA 4LV9A 5CPNA 2F84A 1BG4A 2WMIA 4UTWA 1VIWA 3TKFA 3C3UA 3SCUA 1L6FA 4O8RA 2Q8LA 3L23A 1F3WA 4PCPA 5F2GA 1XLKA 4HPGA 3WQ6A 3BAYA 1B31A 2FYMA 2ZICA 2W9MA 1N2VA 3O6YX 3QHOA 4WSHA 4ZQPA 2A5HA 4BF5A 2I5QA 1CB2A 1S5NA 3C86A 4HK6A 3MY9A 5LIXX 2G95A 4IJBA 2WLZA 3NZGA 4GJ1A 1HVQA 5J5DA 1RALA 1SQ7A 4CQDA 3TSDA 1CGVA 1XIGA 2V9DA 1E9ZB 4GVFA 1SJDA 1TPEA 1AW5A 2ON3A 5EMKA 2Y2WA 4H83A 1VLIA 5AYYA 2DGAA 4CD6A 1GEQA 2EPMX 3S1UA 1IEIA 3MUIA 3PSVA 1TRIA 3ATYA 2PLMA 2A3AA 3TVAA 3LCWA 2VCAA 1T99A 1RZMA 1QW9A 1DJZA 2NV2A 3UCCA 4NG3A 1S46A 3WLSA 3CV2A 1T8QA 3EGJA 4Q3MA 3LBMA 4REQB 4N4QA 2VOTA 4L6HA 4QHRA 1A50A 1WKDA 1VLWA 2PZ0A 3CQJA 3LXAA 4CU6A 4GUGA 3SUVA 3A3XA 5DMYA 4K7VA 4RE0A 3C5QA 1XC4A 5CGTA 3BW3A 1A3WA 1XDLA 3MV11 1J96A 4GISA 5L6UA 1XIMA 3ZT5A 3KBJA 4HNLA 1TJRA 2WXDM 1GEHA 4F8XA 4OQVA 3GO2A 4N6FA 3SURA 3SIMA 5EBUA 3H21A 3GTFA 1DJWA 1EJWC 1UJPA 1DHPA 3FAXA 3IIZA 3I4KA 4IFKB 3CZLA 1X6UA 3RJXA 3IRDA 4KQNA 2VM8A 1QI2A 3VZZA 4QITA 4FOUA 4TO8A 3TW7A 3W37A 4CQBA 2CBUA 3WLTA 2Z6IA 4HZ6A 1UPPA 2VR5A 3KVMA 5TBOA 5H8MA 2YCKX 3QQ0A 5PTDA 1B3ZA 1ZB5A 1DWFM 1UUOA 4NXSA 3OJGA 5FIPA 3UPWA 1XJBA 1C9WA 2O9OA 3WENA 2CZDA 4NXKA 3E2RA 2GUUA 1VHNA 2D2OA 4C6NA 2B7OA 1NDWA 2XINA 1HUVA 8XIMA 1I1WA 4OHQA 3WD1A 3TCSA 3VDCA 3CXOA 2BB0A 1V77A 3A4JA 3GDLA 1ISYA 1TWSA 4HA0A 3W71A 1TMQA 1V7AA 3T0AA 5B7YA 2FZMA 3L4YA 1O5QA 3AIUA 3OG3A 1XRSA 4YHGA 3CIVA 1DWAM 3PZ9A 6ALDA 4IFRA 4S23A 3QPYA 5U4NA 2ZUNA 3KUMA 1PV8A 1A80A 1TWZA 3PTQA 5AHFA 2GVEA 1QNVA 3C61A 1SO3A 1LROA 1LLZA 3ZFHA 5DLCA 2X09A 1XYBA 3BCDA 3H70A 3LCXA 3PUDA 2DJLA 3PULA 1HJSA 5HBFA 4HPNA 5CC7A 1XBVA 2BOGX 1LL7A 5FEXA 3GW0A 2GQ8A 2WZMA 3TXZA 2DORA 1ZHAA 1HGYA 1IF2A 3BMXA 3QQ1A 4HPJA 1XIDA 1JPHA 1TPWA 4XZIA 2XG9A 3SGUA 3SRKA 1JPKA 1BXNA 3CZGA 3O63A 3QV6A 2QCGA 1H62A 1M53A 5JBFA 2R9RA 2Z2AA 1RK6A 1D8CA 1E6RA 1VPXA 4BHYA 2OEMA 3MW7A 3VIFA 2V8ZA 3W2NA 3W85A 4DZ5A 1V3IA 2DZBA 5ABFA 5A3HA 2ALDA 1OFEA 3M7WA 4WDWA 4AVNA 2ZUWA 2WVVA 3OODA 2GGIA 3UZJA 3CUFA 2Y7GA 1KXQA 4KPLA 4NX5A 5FF4A 2BG5A 2PF8A 4ZGYA 5G1YA 4EWJA 1R3YA 3UZ5A 1CGTA 5F4WA 1E43A 2ZE3A 4E6MA 4M3PA 5M03A 5FF0A 4FO4A 4JN7A 1Y5VA 4ORIA 4FALA 5FSDC 1CTNA 1CZ1A 2ZUSA 4Q8MA 3ZWTA 4NASA 3WNLA 3ZIZA 3BG9A 2VEFA 5CKSA 4HU3A 4MJMA 4BKNA 5E70A 2DZVA 2AL2B 1V3MA 2HK1A 1E9LA 1CXLA 4GNKB 5F7UA 1TJ2A 2VFIA 2NV1A 3JW7A 4R53A 1B54A 5AB3A 1CLXA 2BY0A 4LAZA 1HJUA 3NEVA 5DXXA 4A8IA 1TV5A 4QG9A 3MMUA 5AHLA 4ZTYA 4LAMA 5HNUA 2PBOA 1Q63A 3GFZA 3OEXA 3WFLA 4L1GA 4C5ZA 2GJRA 3RU6A 2H8ZA 5BCAA 3DENA 2A1YA 2W61A 1H50A 4FB7A 2VEPA 4WQ6A 1SMAA 4PMZA 4DF2A 2WLYA 5HMSA 4LVAA 1A53A 3VOIA 3P82A 1SZGA 2ISVA 4H3DA 1JGMA 1NH6A 3VD9A 3W7NA 3DYOA 2HXUA 1I2PA 2E68A 3E2QA 2PD5A 1F6YA 3FVMA 5ECUA 1YKWA 2I9EA 4F66A 1LYXA 3CHFA 5LXXA 1LQAA 3CM4A 3F5KA 1H11A 3E1F1 4I9JA 1EX1A 3L0GA 2AMXA 4DYJA 3P8IA 3S1VA 4HGXA 1TX0A 3MJMA 1MQRA 2Y70A 3EWXA 2NX1A 3S1WA 4LC6A 3S47A 2XUCA 3G1HA 4AIBA 1RVGA 4HN4A 3ARTA 3W1TA 2E40A 2XGBA 1ECEA 4JL2A 4ERIA 2WC3A 5CQ1A 3LTYA 4JHMA 1JZ5A 2YCEA 2ZXDA 4Q8TA 3TYCA 1R7AA 2EXOA 4RW3A 1MUWA 3ITTA 4D71A 3CLMA 1YXYA 2WWDA 2VCCA 4HCHA 1FUYA 1GHSA 2WBGA 5HR7A 3CJPA 5E0KA 3QZAA 4GJIA 4YNGA 4RNIA 4OWGA 4ZOEA 1QPRA 2BSLA 3BV7A 3AYSA 1LQ2A 4R7OA 1K7EA 4JTIA 1W3IA 3ME3A 4X63A 4O53A 1F2JA 1W9VA 3WD2A 3PR2A 2QF7A 4U28A 4HK7A 1CGWA 1XBXA 1R3QA 3EMQA 3UERA 4JFTA 3SRDA 4YN5A 4HOWA 3P81A 1H0GA 1NF7A 1Y65A 2B7PA 3RM9A 4ADSA 4QQUA 4ACZA 1F05A 3NO1A 2GDUA 2VDHA 3LHVA 3AAMA 4Z2IA 5TQLA 3USBA 4AY7A 1VKFA 1F4AA 1XUZA 2I7GA 4UQ9A 3SUWA 3GHRA 2BLEA 5CSRA 2D3LA 4YS1A 5EL1A 3H2EA 3AYTA 3EMZA 3HMCA 1PWLA 3N15A 2OR2A 4LNYA 4PMYA 3R8HA 3WEOA 3Q94A 2I5IA 4D6DA 3S9IA 2ATSA 4PL1A 2D69A 2Y1HA 4I5UA 4KWOA 3DKLA 4W4QA 4LWWA 3BAIA 2VEKA 1RV8A 3NZ1A 1FTXA 4TV6A 3AHYA 3SCVA 2VZUA 4JD4A 3LBCA 3BLIA 1BXBA 3CUJA 1EXPA 4Q8OA 3HIJA 2VT0A 2ZTKA 2WWCA 5GPRA 3AXXA 3BGGA 1R30A 1ML1A 3V5CA 3LI1A 4Q33A 3N1AA 1BLIA 1RJPA 5D9PA 4QLKA 5LA2A 3IGXA 3E5PA 3L4UA 4S1FA 1NVMA 1D7FA 2BVDA 3GVRA 3W1RA 3GH4A 1DIKA 3KTXA 1FKWA 3K8KA 1V3LA 1KD0A 1I45A 2ZE0A 2PGWA 4X2PA 3ARVA 4EXAA 4X0VA 3HPFA 2ONEA 1NOUA 1W3JA 3SM0A 3AMLA 3S2JA 3ES7A 2O4MA 4JTLA 1V0KA 1KLZA 3DGBA 1IEWA 4JX5A 2PDGA 3SN0A 1W1B1 5HINA 1AJ2A 2D2GA 2ZZ4A 5DX7A 4ZA0A 1JXJA 4FNUA 5GJNA 3POCA 3DIPA 3WJYA 2KZHA 3N4EA 3CQIA 5IOBA 3RDKA 4UCGA 3UU0A 2QCCA 3PZGA 1TPVA 2OO0A 3G6LA 2ZXAA 2UY4A 2PRLA 3FSTA 3HF3A 3WYZA 2XFRA 1FFQA 1LBLA 3M0JA 2G37A 4JIPA 4Z0JA 2EJAA 2DSUA 4PRWA 5C6MA 4I7WA 1IXNA 1UROA 2GVJA 2J78A 2CLEA 1X6NA 3QYQA 3WK3A 2UZ9A 5JXQA 3LMZA 1FKXA 3W7EA 1TVNA 1EPVA 3EOOA 1SW3A 2C7FA 1TPB1 1UP2A 3WIJA 2XM2A 5A6MA 3ISIX 4ZQRA 1KQZA 3B8UA 4ZFCA 3PG9A 4E4FA 3A47A 4FS9A 3AHXA 3GYCA 1PB0A 3OBAA 1EYWA 4RXGA 4Z1AA 3W82A 2VFFA 1EHAA 2PLKA 4JX6A 4P7NA 1M7PA 3W2KA 2FGBA 2WZHA 4ONVA 1U30A 5HXMA 3MHUA 3ZYZA 3KLKA 3GVQA 2HWGA 4N7QA 4P8WA 4MUZA 1S1RA 4H9MA 2R1PA 1DBTA 2Y63A 4XZWA 3UXAA 3LUTA 3VZXA 3W72A 2ABAA 2GZXA 4Y8EA 4O50A 2GQ9A 4HVXA 3LHZA 3RR1A 3SRHA 3STFA 5I7GA 4MJ4A 2C18A 3WUEA 2DH3A 4IL2A 1WP6A 1V6WA 4WIWA 3P3BA 3BSGA 3CB3A 3VGEA 1HJWA 3PC0A 4NRSA 1M5WA 1ZENA 4HSOA 4IHCA 3O6AA 2E4TA 5HNRA 1OFDA 1L6SA 5A94A 1XLFA 3UQNA 4RJEA 1XCFA 2F2HA 3UF9A 4A05A 3BLEA 5I3DA 4JTUA 1J5SA 1UASA 1FHDA 1YTKA 3O3RA 1JG9A 1VFMA 3MB9A 3QKZA 3PB2A 3IV3A 3B8WA 4MAZA 3G0UA 1PWMA 3WH6A 4CD7A 1AL7A 3H2AA 2W27A 2P88A 3AMDA 2WNQA 4BI7A 2QAPA 5GQBA 1F3TA 1Q6QA 2H90A 3CAQA 4BS0A 1TZ9A 1QT1A 3MDWA 3PPHA 1H09A 1B5TA 1HXJA 3CZKA 4BJHA 4A3UA 2IQDA 1EB3A 3NQ6A 1V7YA 4TOQA 2PE4A 1CT5A 2ZC1A 3CAKA 1H5YA 2ZWZA 3NYDA 1W2PA 3MO4A 2YDSA 3EKZA 3D3FA 5LNUA 4JKKA 2Y8VA 3GG0A 3WF4A 2V67A 3S83A 1MW2A 3JR2A 4LF2A 1ZS2A 1E6ZA 4B5WA 3OB8A 4M82A 4UTMA 1JNEA 3WDHA 1UWQA 4QBXA 1M03A 4H2HA 1JI2A 2CLOA 5A8PA 6XIAA 1O5XA 3RPTA 4FF5A 4NX0A 1KM0A 3XISA 1GOKA 3EOLA 1I2QA 3VD4A 4Q4RA 3SUUA 5EGRA 1OF8A 2IQTA 3LHYA 3GNPA 1TG7A 4C6MA 4WGHA 4L80A 4BEQA 4QIUA 3UJSA 4F9JA 1XM3A 3OLIA 4OIFA 2JGYA 4H2CA 5LYRA 3OVQA 1PTDA 3R0DA 3AYRA 3THCA 1PL9A 3DESA 1R9YA 3QMRA 3QC0A 3TJLA 5F1VA 3SO7A 4A8NA 3M0HA 4XD3A 4LVGA 4AYGA 4M56A 3S6DA 2Q71A 3P67A 1LZOA 3O0KA 3THAA 2VGBA 4FLOA 4JNYA 2WCGA 3PZUA 5G4HC 3NZPA 3KW3A 2NZLA 1TV3A 4Q8NA 1GOQA 1W32A 2BXYA 3EPOA 3LQGA 2JKAA 2CEQA 1BSIA 1CX9A 1QO2A 1EDGA 1KCZA 3ZJ7A 1R8LA 5CBBA 4NP7A 4LANA 4LAKA 5LNWA 4B3LA 1YPFA 3STCA 3EBVA 3GXPA 2PA6A 2WBKA 2X0SA 4OBRA 4MDPA 4BZYA 4GBUA 3V0TA 3VDGA 4W7UA 1VF8A 4TV5A 1BYDA 4HD5A 3GNNA 4Z42C 1VIZA 2ALRA 3BW2A 5ABTA 3KOYA 2Z26A 1MQPA 1XC6A 4JTCA 1D7KA 5I77A 3AHTA 2FDMA 3BVJA 3VILA 1U1HA 1FHLA 5BWFA 5MKGB 5M17A 1I2NA 1HFBA 4FMVA 2VEMA 1BRLA 1EWEA 3NQBA 1ME9A 4UR7A 1JZ6A 3W1PA 1PX4A 3OVPA 1X7FA 4XVDA 4Y9AA 3IGSA 3N9KA 2OU4A 5E6ZA 5C54A 5CBIA 2PTWA 3ITLA 2DT3A 4WJXA 3UVIA 2HRWA 2EG7A 1V6UA 1BD0A 4C1LA 1B2YA 2VR2A 1TA3A 1L2UA 1VQTA 1XINA 3EB2A 4AX7A 1KCXA 2DZXA 1JDAA 1AW1A 4EACA 2V6AA 2CKSA 4GXWA 3PZIA 1Q4WA 1L8NA 3O15A 1Y7VA 4N02A 1XRVA 2X41A 1ZCOA 1HL8A 3N18A 3WH9A 3P5ZA 2X1IA 2FFIA 3NQ2A 1AQMA 1OGGA 3MS8A 3O0FA 4G9PA 2DIKA 1WKYA 2DY3A 4RNFA 1KA9F 3EDKA 3B9EA 3ID7A 4FSAA 5HMEA 3IJ8A 1ZY9A 3VNJA 1UUMA 1Z6KA 3D3AA 2VI0A 4B2DD 2G3IA 4CCZA 4O0ZA 5LGXA 5FJTA 4GY1A 3FJNA 3M43A 1POJA 3TW9A 4PODA 1YDVA 4H9XA 1GZJA 3BC9A 1E1CA 3WLHA 3ABRA 2NQJA 1JIBA 3ITCA 5I23A 1RY0A 2J9YA 3TUUA 3BAWA 5C2XA 4WCJA 1QDSA 4PMVA 1SO6A 4YL2A 3QH2A 2OQYA 1XYMA 2A21A 3QM3A 3APTA 3GZ3A 3BANA 1VCVA 1W54A 1J0JA 4PSPA 5E9XA 3V3WA 2IPFA 2VJXA 2MNRA 2Y8UA 1M7XA 1C29A 4ZB0A 3ZSSA 4K68A 1KM2A 2XVNA 4Y9MA 1F6PA 3DECA 1MUMA 5ABHA 3FEMA 3Q4DA 3WH5A 5EPDA 1JYWA 4M6QA 1NTHA 4GI4A 4LUYA 1QWKA 3FOKA 3W2MA 1UD2A 4UQEA 5TNVA 1LTDA 1TQJA 4EPEC 1S1PA 1A5AA 2HJPA 3HQPA 4MY1A 4A2SA 3HFTA 4Q8PA 3W1QA 1V6YA 1PUDA 3RMEA 2D3NA 3PPFA 3LHWA 1OX6A 1OX4B 3WK0A 3NL6A 3PY2A 4ZENA 4GXPA 3U9IA 2EGZA 4DYEA 1ZPTA 1QXLA 3OLDA 4AC7C 4DHGA 4Z1CA 4HA4A 2QULA 3ZR6A 3T6CA 4H6EA 3OYXA 4D6HA 4QEEA 4ML4A 3M0XA 3E3HA 3T4CA 4RNHA 1FCUA 1TVLA 4XIAA 4HJFA 2WCAA 1JZ8A 4FP1A 1AA1B 4IF2A 3W25A 1KBLA 3FGCA 1GQNA 4B9ZA 3IJ9A 3QR0A 2GYIA 1MFVA 2ZZ3A 1JAEA 3VVGA 3K1GA 1RCQA 1XISA 2WJFA 2ZUUA 5J5RA 2QV5A 3W70A 2CBIA 4GIEA 1J6OA 1HP5A 3KCOA 1FBAA 2A7PA 4GQBA 2O9PA 3N25A 3LMYA 1K7FA 4G56A 3GTXA 4V27A 2WCSA 1XYLA 5LKYA 5HQLA 4JPGA 1RK5A 3J7HA 3DFNA 1KCKA 3WH7A 4KGLA 3VKCA 2HE8A 2C13A 1AH3A 5A8OA 1FWRA 3L5AA 2PLJA 2OEJA 1N82A 4J3UA 2IKHA 2AAMA 1TV2A 5BZAA 3MCOA 4IICA 3L5MA 5E6YA 1Q8AA 1P48A 4O19A 8RUCA 4FF7A 5DMLA 2VFDA 2E7FA 3C52A 3H26A 3LRKA 4MWAD 1G4TA 4EF8A 3NJ3A 2QIIA 5EMLA 3OGRA 1VFLA 1KFLA 4W85A 3VNIA 3GNRA 2C8NA 5AC7A 4LRSA 3IJ7A 2NXHA 2VRJA 4NUWA 2A7RA 4H6KA 1F6KA 4IJRA 5KZEA 3AU2A 2FJKA 4PUWA 4HNNA 5FL0A 4HHHA 4C6JA 1SYTA 1GVSA 3VDAA 1V5XA 3PNZA 5EMUA 1Q3NA 3MCNA 1RP9A 2WJZA 3IGHX 3U7VA 2ZZ7A 2YZRA 4L4LA 4IP5A 2BX7A 1H61A 1XLHA 4E8CA 4A4AA 3EMCA 4JCMA 1EKOA 1TJ1A 4D8ZA 3WQPA 3PPCA 3EEGA 1UR8A 2R91A 3EOUA 4CEUC 3GDBA 1HJVA 4FNPA 4BWLC 2OELA 2QZRA 4NZJA 2DPEA 2PTDA 2YW4A 1AMYA 3RXZA 2HISA 4XZMX 4DLMA 4GGHA 3S0CA 1KTBA 3SSZA 4AZHA 1DJQA 2UY5A 2QGYA 1DV7A 3Q2DA 3WBXA 4DZHA 3NIYA 5I78A 3HURA 1PAMA 2PCQA 4GQRA 2YFNA 3N4AA 4XBSA 1UWAA 3E96A 1DP0A 3PP7A 5EA9A 1PXGA 1ITXA 2VELA 2BMBA 1VFFA 3U5UA 4Y96A 3ARRA 2VO5A 1EOKA 2E9BA 4A8LA 3AMCA 2ZRUA 7TIMA 1EC7A 4ML9A 1EP3A 1H1YA 3G77A 2C1IA 5C7HA 1G0CA 2YOCA 4PCFA 3UGVA 3T8QA 3UWUA 4EIVA 1W0MA 4QG6A 4P61A 1M3UA 5JBDA 1FWSA 4M19A 5DT5A 4PUUA 4UFJA 4IWWA 3RG6A 4HQVA 4ZFMA 2FLIA 5LNSA 4HU8A 1KFKA 4J4KA 1MDRA 2YCIX 3APGA 3ABSA 4F0RA 4MLRA 4GY7A 1IWAA 3H4XA 3M0VA 3NM1A 4J27A