4FEZA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
316
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
total genus 107
structure length 316
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fezA00
1JJKA 1FCVA 3G8RA 1A53A 4U4MA 2F7FA 3LOTA 1KM2A 2CWNA 3CIWA 5CSRA 4UTIA 2W79A 4UC5A 3ELFA 2NUXA 2ATSA 1QFEA 1Q45A 4M5PA 3QQ0A 1LRTA 4HNTA 1YTKA 3EX4A 4NJGA 2D73A 2EAWA 2ZRZA 5LHEA 4Z1DA 2XN1A 3QSTA 2XN2A 3HG5A 5K4XA 2E09A 1KFKA 3PWAA 3IGSA 4IWWA 2NXHA 1K3UA 1S5TA 2PCQA 3A5FA 1TV5A 3O6DA 3M0ZA 5BMXA 3D0CA 4UUIA 1SW3A 3O8AA 1EA0A 2JKEA 3EKZA 5D04C 1Y0EA 4OU1A 2VKZG 1SSGA 3PBVA 5HUOA 1Z44A 1CX9A 1UBSA 2FIQA 3W7PA 3UY8A 1W0MA 4AWUA 2ZBTA 4MKNA 1B9BA 2JKAA 5LNRA 1W5NA 1FCUA 3DU0A 1TRIA 4K8HA 3CB8A 5I3HA 3KRSA 4QITA 3HJZA 3HGJA 3M5ZA 1Z41A 1G4TA 3QH2A 3IVUA 4ALDA 1GVSA 1ZJIA 4LVDA 4Q32A 1GVOA 1H63A 4O13A 1G6CA 3I6RA 2YFNA 1SO4A 4H4IA 1MZHA 2P1FA 1QOPA 4XQ6A 4IMGA 2WNQA 1QWGA 3W7NA 3GYEA 1GG1A 1IXPA 1JUKA 3SI9A 3LLFA 1XM3A 1TIMA 1VR6A 1OHLA 2YX0A 3E0IA 3UWQA 3UNDA 1ZAHA 4MFEA 5G2IA 1EEPA 5LGZA 2DZWA 4GXMA 2NUYA 3PBWA 3TCEA 3DFOA 3QQ1A 4XWUA 1RVGA 3U8GA 1FWNA 4D2JA 4TMCA 1HTIA 1GJPA 4RV8A 3NPWA 4LTSA 2V8ZA 2GQ8A 5K2ZA 1EB3A 1RPXA 3BVJA 4LC6A 4NNCA 2AGKA 2J6XA 4JICA 1NF7A 2NX1A 3UYCA 2CZEA 2Y7FA 4C1LA 3JS3A 3WK1A 4N4QA 5AN7A 3Q94A 3L5MA 3NAVA 1OYCA 2NX3A 4PA8A 2WSYA 1B57A 3LERA 3PG9A 4NJIA 3W75A 2A4AA 2V5LA 5K9XA 1JCMP 1KBIA 1X6UA 5FESA 5LSMA 1LRNA 3O07A 3TA6A 4RZ5A 1H62A 1A5CA 2DZTA 4NU7A 4R7JA 1LTDA 3HPXA 1JUBA 3L0KA 2R94A 4FXSA 4JYFA 3R2GA 2Y85A 5AFDA 3S1UA 5BMWA 3TAOA 1I45A 5AHNA 3SECA 2B0MA 1UB3A 1YADA 2CLIA 3M6YA 3NYZA 2A2IA 4O57A 3LHVA 4WY0A 1YDOA 2A6LA 4MY8A 5FF2A 4BWLC 4N2YA 1K7EA 3LHTA 5FEWA 3FLUA 3HPZA 4MUZA 1I2NA 3BW4A 3PC0A 1GVFA 1DJQA 2GJNA 3FJ6A 5FI8A 4UTJA 4EF8A 2C6QA 3G0SA 3FJLA 1L6SA 3CWOX 4UNLA 3C6CA 4IX2A 7TIMA 1TRDA 3PULA 1BKSA 1O4UA 3UD6A 3HBLA 1ICQA 2X1TA 1OF8A 3TJXA 3ABRA 2NWRA 3TW7A 2ZCGA 3PB2A 4ZQCA 1YXYA 4O28A 5K9DA 5EBUA 1O5XA 3TUUA 3FA5A 3PUOA 5FEZA 1KTNA 1R47A 1YTDA 3A23A 3G1XA 3SGZA 3L66A 3G0UA 1QO2A 4U28A 1V5XA 3B05A 4O18A 3TKFA 1BTMA 4LVAA 4POCA 4CCEA 4NJHA 1W5OA 2CZDA 5CZJA 2QJHA 2BXVA 4J9JA 3BO9A 2CW6A 1ONRA 4M7SA 4K8EA 2ATMA 3E02A 1UJPA 4DO5A 1FY6A 3W1TA 4HSOA 2NUWA 5HWNA 3NEVA 4JR5A 3W1AA 3R5EA 1LOLA 2GJLA 1AW1A 1OFBA 2IQTA 4N9DA 3MW7A 1OX4A 5DCBA 2Y7DA 1JQVA 3OHIA 2AQWA 4O0ZA 3QZEA 3A21A 4AF0A 1TPWA 1IGSA 4AB4A 2O7QA 3TSMA 1EUNA 2Y61A 4LW7A 5KZDA 3W1RA 2TRSA 3TDFA 2C16A 3DHFA 5I3KA 2GVJA 4OBTA 3W7IA 3LXCA 2CLOA 1XC4A 2QUTA 4UTWC 5T26A 1AK5A 4Z0JA 3UZ5A 3TFCA 2EHHA 4I7UA 4UTUA 4UTMA 5AC8A 2QAFA 3O05A 2QCGA 1XDMA 3LB0A 4FIQA 3G0XA 4N9BA 3W2KA 5K4ZA 1L6YA 3WJSA 2QKFA 2WJZA 1VCFA 3NQEA 4WY0F 3LCHA 4L4LA 1JVNA 2PRLA 1FWRA 3MJYA 4MZYA 3MP3A 1L6WA 2Q3RA 4AF0B 4XBSA 3RMJA 3HGOA 3IIZA 2CLEA 1HUVA 4HT3A 1SZFA 1GOXA 3P62A 1U83A 1SZEA 3NNTA 2PRMA 3G24A 6TIMA 3SR7A 4MZ8A 1W37A 3TSDA 4Y8FA 4FHAA 1WX0A 4IXXA 1SW7A 3GIYA 4WZHA 4UTWA 5F1UA 1JCLA 4DF1A 5HR6A 3L9CA 3LM7A 2G96A 5ABTA 1OFAA 2ZA1A 4LRSA 2CLKA 4UCGA 1DHPA 3MMTA 3DAQA 4FEZA 1TPDA 2C15A 3M43A 4NUWA 3SIZA 4O53A 1H1ZA 2CZFA 3ZFHA 2QCMA 3PB0A 1AL8A 3CPRA 1FWWA 4ZQRA 2J9XA 1KM0A 3KRZA 1KM3A 4WOQA 3FFSA 4DO4A 1NFBA 2E5DA 1OX4B 2QF7A 4CCDA 2WNZA 3C56A 3LCGA 3KXQA 2Q8LA 1JCYA 2E77A 1XKYA 3HOJA 3PSWA 3KVLA 3SFKA 2V5BA 2A6NA 3S5YA 5K7JA 1VPXA 1FWSA 3BLEA 3HQ1A 5FF4A 5DELA 4FXRA 1TPFA 3W83A 1DOSA 3GB6A 2OX1A 3IGUA 2DZSA 3MO7A 1O95A 3W2UA 4AWTA 2XFWA 4FX6M 3SZ8A 1KTCA 4ADSA 1KFEA 4PFMA 4UTTC 3I68A 3LBMA 1YPIA 1TTIA 1WBJA 1MSSA 1OABA 4IPIA 4X9SA 2ZZ7A 4LNYA 3HF3A 3STGA 4ZVJA 4AXKA 5L6UA 2QCEA 4KFPA 4WOZA 1SPQA 4AWSA 1WQ5A 4RXGA 1TYGA 1WV2A 3PR2A 1OF6A 2RKXA 4CNOA 4LVFA 3P84A 3T40A 1N55A 4FNUA 3E49A 4JX4A 4UIOA 4CNNA 3LV5A 2RFGA 3EX3A 3Q58A 4MIMA 3DZ1A 1VHNA 1TJPA 1YDVA 2P10A 1VCGA 3Q2DA 3BW2A 5KTLA 3LCFA 1RV8A 2LLEA 3DH7A 4P2VA 1WYIA 3IIVA 2B7QA 3O06A 2GPTA 1FUYA 1WOBA 2VELA 2WKJA 4AEOA 4JS3A 1MO0A 2QUVA 3BGJA 4UFMA 4EOUA 4JYDA 5E93A 3F4NA 4I9AA 5IBXA 4OV9A 2Y63A 1UUMA 3B06A 3P61A 1LCOA 3FKRA 3LBCA 4O1DA 1GZGA 4ZQPA 1B4KA 2WSRA 4PL1A 4RX0A 1TJRA 4UFHA 2E5BA 5AHMA 4OGZA 1SZGA 3LCLA 3M5XA 4GFSA 5F4SA 1GT8A 1IXOA 2G97A 3EXTA 3L68A 3GVGA 3QYQA 1XUZA 3T44A 2HTMA 5EKYA 4FO4A 1I8JA 2FPYA 4XKYA 4CQAA 1KFCA 5D30A 3H55A 3U2OA 2DJLA 5C5YA 4O10A 2CLLA 3EKLA 3VE9A 2I9EA 5HJLA 3MI6A 2OZ0A 1EP2A 3IRDA 3SJ3A 3VNDA 1W5MA 3QC3A 3T7VA 3W7CA 2DZPA 4UTTA 3WJZA 4ZQOA 1QCWA 4YLWA 4NXSA 3W7MA 4FF7A 4S1FA 3LXBA 2ABAA 1ADOA 5LGXA 1KM6A 2C14A 2JK2A 1QDSA 1XL9A 1TCDA 4MPQA 2GQAA 3NQFA 1R30A 1UUOA 4FX8A 3TQ0A 4RXFA 1H7RA 1J4EA 4AAJA 3IIXA 1W31A 3FS2A 2VENA 3NPUA 2ISWA 1DL3A 5GVJA 1T8XA 3N73A 1OVDA 2QDGA 2VFFA 2O7SA 1OK6A 2FTPA 4IMEA 5G4WA 3QW3A 1FWTA 3RNDA 3S42A 4GE8A 2Y7GA 1PV8A 3A9IA 3HGSA 1EUAA 5F1VA 1F74A 3GAKA 4BWLA 3MP5A 2BWGA 2NXIA 4FIRA 1ZHAA 4AHOA 3BK0A 3QSRA 4H3DA 3ZR4A 3L5LA 2UV8G 3N2XA 3L67A 4TIMA 4DO6A 5KINA 3PS7A 3LCXA 1OFPA 2VFIA 3ATZA 1WBHA 1OX5A 2J9YA 4O8RA 3CIXA 3HB9A 4LRTA 3NXFA 1JRCA 3C2EA 1S3HA 3C61A 3QEZA 1LORA 1LRQA 3B0VC 4GNJA 2HS6A 4JEQA 4GUFA 3UPWA 1H7NA 3NO5A 4LS2A 3QMSA 2P0OA 3AJXA 1H51A 2GQ9A 4CQ8A 3NQ6A 5AC7A 1TPUA 3PUDA 1U5JA 3W1MA 3CEPA 3LI0A 3W84A 3YPIA 3HG2A 4ORMA 4Z08A 3VCRA 5F2LA 3KHJA 3LRLA 5D33A 2CZ5A 2VEIA 3MHFA 4O54A 5F4WA 4MFDA 3VFLA 3H54A 3RLVA 2ZZ6A 1GVRA 3M16A 2PURA 3C8FA 1OFDA 2ZZ1A 3W7HA 5LNVA 1ZENA 2G5WA 3UY7A 2ZRXA 2F84A 5DXXA 3LTSA 4UR7A 2OCZA 4CCCA 3P67A 3NQMA 1W54A 1OFQA 1Q6LA 5CSSA 5AYYA 2Z2UA 3W7GA 1CI1A 3TJLA 3EXSA 4W9TA 5DBTA 1C8VA 4LVBA 1N8FA 3KAOA 4DBEA 1CW2A 3EWWA 2FPVA 4JX6A 1S5VA 4A2RA 3W70A 4JDYA 4NVTA 1EP1A 3M44A 3EWYA 3LCIA 4K36A 3TW6A 3OG3A 1F2JA 4JYEA 1XI3A 1NAL1 2C19A 1R2SA 1ZCOA 3TX9A 5EMUA 3VE7A 4XKYB 3WK2A 3DFNA 4O52A 3G1FA 4WUIA 1XCFA 3G22A 2X1SA 1RD5A 4JDBA 4E0CA 4ADTA 3UXDA 5IM51 5HULA 3W85A 3TK7A 1KLYA 1SSDA 3DKLA 3EWZA 3AO0A 1LYXA 4JTHA 4TMBA 3EWXA 3OEXA 3THQA 2ZYFA 4M6QA 4A22A 3MWAA 2CLFA 5HUPA 4GUIA 1QR7A 4DF2A 2ZA3A 3F4WA 2Q8ZA 3DHDA 4GRSA 3W7JA 5KSWA 5J5RA 1JUEA 4JTUA 5C6MA 5D02A 4JTTA 5CPMA 3KVKA 1FCBA 2E6FA 1LLWA 3G1DA 1E51A 1PHQA 2A0NA 1FX6A 2H90A 4ZQNA 4IJBA 3I7QA 5AB3A 3A24A 4UFIA 1JRBA 3RLUA 4HPXA 4LT9A 3ZS4A 4JTFA 1F76A 3EX6A 1VS1A 4O1CA 4XZ9A 2Z6JA 4B5NA 4NX0A 2X1UA 3TC6A 1KTBA 1WXJA 3GDRA 1WAUA 1XXXA 5EL1A 5G1YA 3NDOA 1G4EA 3NG3A 5DLCA 1GYNA 5TIMA 4NXKA 4QAIA 2ZRVA 3Q37A 3O1NA 1R46A 1W1ZA 5I3IA 5D2WA 2JGQA 4Z1AA 1TPC1 1W3IA 1ALDA 3B03A 3BPWA 3LV6A 3N19B 4RLIA 3TC7A 4N4PA 3UPBA 5H2ZA 3CM4A 3DXIA 3W1PA 1NEYA 2NV2A 3MBDA 5D2VA 4N02A 4IMDA 1KV8A 4HSNA 1K8XA 1WOAA 5D2YA 3OVPA 5CGQA 1PCKA 3P5YA 4KKXA 4R53A 5HINA 3LHZA 5AHIA 3ABQA 1H7OA 4PL2A 5G5IA 5DN1A 1PIIA 1I2QA 3GKFA 3NGJA 3GDLA 1W3TA 3EX2A 3NQ7A 4PCFA 5DY3A 4E38A 4DBDA 1OX6A 1TTPA 2C3ZA 3GZ3A 1GTEA 1Q3NA 3NQ2A 3HGRA 4MY9A 3W7OA 3LTPA 3DFSA 4GJ1A 4ZQMA 4IXHA 4EWND 5KZMA 2BZNA 3TAKA 1KM1A 3S1XA 1QO5A 3HPSA 1Q6RA 4QISA 3GR8A 1YYAA 3LLDA 5TQLA 4O0KA 5F2MA 3L65A 2QUUA 3S6DA 4N6EA 4LV4A 5HQEA 3UXAA 4JIPA 2Z6IA 4Z0SA 5C2XA 2BTMA 4Z1CA 3MP4A 2YPIA 3R89A 3UZJA 5DCEA 4CNPA 2Y62A 5G2HA 4Q4KA 1QNVA 4YMZA 4QQ3A 4AVFA 2B7OA 1K03A 1ZAIA 1K8YA 4LY8A 2DORA 4UMAA 1L9WA 3DKJA 3ATYA 4Z1BA 4DPQA 1V7YA 3R13A 3W07A 4AH7A 1HO4A 2WO5A 3LHWA 1SO5A 2DU2A 1A50A 1PE1A 4RCXA 3DFPA 3T55A 1F73A 3O6YX 3TQKA 3M1ZA 5HNRA 3UWVA 2B7NA 3DENA 3TU9A 3GXPA 4JTKA 5BW6A 4K38A 4RZ6A 3OVQA 2X1RA 1UCWA 3KVJA 3RU6A 1KM4A 3NZRA 1J5TA 4DELA 1YLVA 2V2CA 1W3NA 4UTLA 3A22A 3WJWA 4O4VA 1DQXA 1YPFA 2X16A 5D09A 1H50A 2YSWA 5KMYA 5MHBA 1OFEA 2XN0A 2WSQA 4AMAA 4IGHA 3B0PA 1ML1A 2V2DA 1EP3A 2R8WA 3A5VA 4ZMGA 1QMLA 4N9EA 4PC8A 3W76A 4M19A 4NJJA 3WJYA 4IPJA 1A5SA 2A7NA 3NL2A 3UWYA 2AAMA 3W86A 5AHFA 3GNDA 1XBVA 3N9SA 5L9FA 2EPHA 3IEBA 1ICPA 1M5WA 3QMRA 4O4WA 4BR1A 4E2BA 1DKWA 2G95A 1TO3A 3E12A 2VC6A 4XTIA 1QPNA 2EGZA 1X1OA 3M41A 4MZ1A 5EY5A 4WD0A 2ZZ2A 4G1KA 2Y89A 1R2TA 2QAPA 3H53A 4IOTA 3NZ1A 3QMTA 3GXTA 1HFBA 1BWLA 1VLIA 3N2MA 4RK8A 1KFJA 5BRBA 2ZZ3A 4MYAA 4JTEA 4JN6A 2Y70A 4QM1A 2NLIA 5EYWA 2QR6A 4JTLA 1BWKA 3V75A 4O19A 3PF3A 1TMHA 3N34A 2GVLA 3L2IA 5U7SA 3S1VA 1OFOA 4A21A 4IMCA 1SO6A 4MOZA 4JNMA 2Z0IA 3G1SA 2HMCA 4NX5A 2H8ZA 2QJIA 3OBKA 3V1PA 3LCWA 2QCDA 3G3MA 3PAJA 4Q33A 2FB3A 3MYPA 4A29A 2FDSA 3S5NA 3PSVA 3ABSA 1JQXA 4FNPA 2QCCA 4FNTA 3THAA 4K7YA 1TV8A 2Y7EA 2ABBA 4Y6GA 3WK3A 4C1KA 1X8FA 1S5WA 2VFHA 3GLCA 1AW5A 3G1HA 4O15A 4DQWA 5A8GA 4XUGA 3CLMA 2BX7A 1GVQA 1OK4A 5DXYA 3KFTA 2NZLA 4DPPA 1GTHA 3CQ0A 4MVAA 3ZWSA 1FXQA 3EX1A 2ISVA 1NSJA 4WQ6A 4YWIA 1GYLA 4OE7A 1OYBA 1SR9A 3B4UA 3PBYA 3BARA 3FKKA 3TR2A 4Y90A 1ZALA 4UMCA 2ZZ4A 1W5PA 3W2JA 2CU0A 3GAYA 3G18A 1F05A 2E68A 5F2IA 2ZRYA 1MXSA 4LS0A 3QPYA 3EWUA 1VRDA 3KVMA 5EA9A 2QEZA 3NQGA 2ZDRA 1WDWA 1PCWA 3NM1A 3GNNA 2ISSA 2J27A 3G1AA 4FNRA 5FF0A 3LHYA 1LM1A 3FYPA 3NQ8A 3C2FA 1T96A 3G1VA 3VKJA 1FBAA 2NXGA 3L0NA 1R2RA 4M6PA 4WJEA 3IV3A 4ORIA 1DJNA 1FDYA 4BFAA 4NNBA 1TPEA 1TV7A 2J24A 2NV1A 4YCPA 4UNKA 4JX5A 3WFAA 3C52A 5K9CA 1HG3A 4LWWA 4NT0A 4HNNA 2ZQ0A 4O1BA 3EWBX 1TSIA 1H60A 1JULA 2X30A 3NPVA 2C13A 1HO1A 2E6YA 2ZTJA 3LXAA 4JTIA 5FEXA 4E2DA 5I3JA 1EX5A 3W7DA 3DI0A 4JTGA 4WXZA 1LZOA 2QCDB 5E1QA 5AOUA 1AL7A 3QM3A 2FJKA 5IBXC 4BI5A 3CWNA 1KFBA 2JBMA 3IGXA 2ZA2A 1O94A 3TMQA 4OT7A 1KLZA 5K3VA 3W1LA 2A7PA 1P0NA 5I3FA 3NQCA 5CZTA 1D9EA 3EB2A 4LOCA 5DBUA 1ME8A 2C1HA 2FQIA 3C0JA 4UTKA 4DEFA 2A5HA 1I2PA 2WOQA 2QCFA 3W1QA 5FEPA 3HG4A 4UFKA 1W5QA 3INPA 3TV8A 3CU2A 3SGUA 5CZ0A 3SSJA 2YFOA 3PBUA 5CKSA 2VOMA 1AW2A 1G4PA 3NQDA 2QCHA 2VEKA 4O1AA 1XDLA 2YDAA 2QCLA 3W87A 4FNSA 4KFOA 1QOQA 4S2BA 1H1YA 2WPBA 1H5YA 2GUUA 1I2OA 1P1XA 1QPOA 2OT0A 3PG8A 1ME7A 3MHGA 4RZ4A 2DP3A 3F03K 1GG0A 2WNNA 2V81A 3FEMA 3NOEA 8TIMA 4QSHA 2A21A 5LNUA 3UWZA 4ADUA 1MEWA 4YXGA 5KITA 4DF0A 4HKPA 4UFLA 4HNVA 3RF9A 1G4SA 1GEQA 3NL6A 3C2RA 3EXRA 1C9DA 4K6AA 1RQEA 3O6CA 1LBMA 3ANYA 2I14A 1Q6OA 2ZRUA 4A3UA 4A2SA 4HN4A 1XBYA 2ALDA 3L5AA 1IF2A 1TTJA 1PS9A 1M7PA 2EKCA 5AHLA 4UXDA 4O11A 1GWJA 3KX6A 1THFD 3VI2A 1VLWA 4AHQA 1RQHA 3QJAA 1K02A 3W72A 2NX9A 1VCVA 4MJZA 3OVRA 1VYRA 4UR8A 4YL2A 1RZMA 4FNQA 1P0KA 4TX9A 1VJIA 1VQTA 1D3HA 4K37A 2DZVA 1XBXA 1FDJA 4LC8A 1KM5A 2R14A 1LOSA 3NL5A 2C0AA 2YW3A 3ZWTA 5EPDA 1ZFJA 3L0GA 5AYZA 1JCJA 5LNSA 1T0OA 1DORA 2QJGA 2YCEA 4M6VA 2V0TA 3DFTA 3W2NA 3QW4B 3GXNA 5LHFA 1YDNA 1FQ0A 2Q3OA 3P8JA 1OG0A 3W9ZA 1M7OA 5A5WA 3M7WA 1OJXA 1K7FA 4NJKA 3HG3A 3JR2A 1L2UA 2RDWA 4CQ9A 3W7QA 5HWJA 4OHQA 3CEUA 3IVTA 4DXVA 1T99A 3PY2A 2W6RA 1ZAJA 1EPXA 2YGYA 3UQNA 1W56A 4TR9A 2OJPA 1H7WA 3M5YA 4JY9A 1YXDA 3P60A 2RH9A 4MJMA 1TB3A 4NZFA 4O12A 2GOUA 3S5ZA 4PH6A 3CHVA 4L4MA 2W0UA 3O16A 3SY5A 3W2LA 1TPB1 5E0KA 3MI2A 2OMAA 2PE4A 5D38A 3KRUA 3S5OA 1X7FA 2VEMA 3K30A 2TSYA 2H3DA 4EIVA 2YR1A 3PM6A 4JTJA 1SFLA 2FPTA 2YW4A 3BW3A 4NZJA 3WJXA 1PHWA 1G67A 3BGGA 5H91A 3S9YA 1FXPA 4WXYA 4LU0A 4GC4A 1GPWA 1NVMA 3PUEA 4MLJA 3O15A 4KFNA 3DGRA 4GBUA 2FLIA 5C54A 3LX9A 3RK8A 3BG5A 3IIOA 3NA8A 2H8XA 3T4CA 1LDCA 5CZSA 1LOQA 1OFRA 2ZRWA 3DI1A 2BLEA 4N6FA 4LUJA 1UASA 5HWMA 5G2WA 1G7VA 5C55A 3GKAA 3G8EA 3ABOA 1KA9F 1LBLA 2I1OA 3TNOA 1TPVA 4IQLA 4IUOA 4NNAA 4HNUA 5HR7A 3STEA 1P5BA 4TO8A 2ZZ5A 1QPQA 4XBKA 1Z42A 3W7KA 3MBFA 4EF9A 5G4EA 3BV4A 3M9YA 4O16A 4R34A 3W6YA 4NQ1A 3P82A 4ICNA 4I7VA 4RJEA 5I3GA 2C18A 4MLRA 2RDTA 1IXNA 1SZNA 1DBTA 2VXNA 3TROA 1TREA 3W7EA 1JCXA 5D03A 3I7RA 1MEIA 3G1YA 2EF9A 4X2RA 1MEHA 3TIMA 2HS8A 3NR0A 1QAPA 3E96A 3R8RA 1B3OA 3GK0A 4BI6A 1VYSX 3QRHA 4GUHA 3TQVA 1SQ7A 2QDHA 4WX2A 4ONVA 2TYSA 4HIBA 2V30A 4IMFA 5D37A 4AHPA 4K39A 2NWSA 4ML9A 1LBFA 4CLMA 2A85A 3M5VA 4PTNA 3DBPA 4OV4A 4QJ1A 5SWUA 1QPRA 1XFBA 5J5DA 3FIGA 2BSLA 4LV9A 2V82A 3GX9A 3W1UA 4X3ZA 1J2WA 2Z1BA 2QCNA 2FFCA 4ZL1A 5F2GA 3IIPA 1F6KA 3P81A 4XTDA 3TMLA 2JGYA 1VYPX 1LLZA 2ZFAA 3S8HA 4I7WA 2B4GA 2VFDA 2DJXA 1WA3A 5HMSA 3W23A 3FYOA 1DV7A 4GUJA 1RQBA 2CLHA 4H6KA 1GQNA 3MHUA 4OWGA 2JKPA 1FCQA 2A7RA 1OYAA 4O50A 2E1DA 1ME9A 2CLMA 3GDMA 3B04A 4PEKA 3HO8A 1DVJA 3QF0A 3PVFA 1XUUA 3MI3A 3STFA 1YTEA 3GDKA 3OA3A 4LS1A 3NVTA 1D3GA 5LNWA 3WK0A 5BNKA 1DQWA 3TSBA 2GVGA 3U6WA 2E6DA 4RKAA 5KZEA 2A1YA 4PODA 1LROA 4WY0B 1IXQA 1K8ZA 1F7BA 3N14A 4JIQA 3B0UX 3C2OA 1KFLA 3USBA 3TH6A 3DFQA 3CC1A 4M7TA 3W74A 3C2VA 3NM3A 2YZRA 1F5ZA 4OQVA 2J88A 2RDUA 3W22A 5DCDA 3KOFA 4FX7A 2J9ZA 3L21A 3LRMA 1KBJA 5D32A 4R33A 3W73A 5CG7A 3LRKA 2X2GA 1O5KA 2PRHA 3HMJG 1ZNNA 3TXVA 3W7LA 5AYXA 1TTQA 5F4XA 1VGAA 1TQXA 2V2HA 5CPLA 4GUGA 4O17A 3HIJA 3C3NA 1C29A 3B8DA 3R12A 4IX0A 3BLIA 3LDVA 4MYXA 4FB7A 3P7YA 1Q6QA 2YYTA 1I4NA 4HHPA 2YYUA 3TXZA 1VZWA 1M6JA 3P5ZA 1KV5A 3UWWA 4BK9A 4QNEA 4QIUA 3BG3A 1FDZA 4O14A 3N3MA 2PC4A 2YXGA 4TU1A 2E5CA 3P8IA 1H7PA 1TPH1 3CTLA 1SU5A 4LUIA 3S0CA 1SO3A 4Y9AA 5LZLA 3BLFA 2VFEA 3MUXA 2DZUA 4JGDA 1HL2A 2HSAA 3P74A 4N9CA 4JTSA 1PL9A 1AMKA 3W2MA 4P61A 3NL3A 3CT7A 1O60A 1B4EA 3EEGA 4BF9A 2ZTKA 3FOKA 1X1ZA 3M47A 5D2TA 3SW6A 3W1XA 2H6RA 2VEPA 1PVNA 4QNWA 1W8SA 4YCOA 1G7UA 3RFAA 4BI7A 5CPNA 3OIXA 2TMDA 3W1NA 3NQAA 3C4UA 5BOOA 2R91A 3G3DA 3IVSA 4EVZA 3I7SA 2WV8A 3W3OA 2V9DA 4GWEA 1F6PA 2WQPA 3UWUA 4S2CA 1AG1O 3NPXA 1G69A 3W71A 1IIGA 4K7VA 2VFGA 1ICSA 4JY8A 2Y6ZA 2E6AA 3N9RA 1SFJA 3F1QA 4UMBA 3LHUA 1ZY9A 3MYOA 1XBZA 4Y96A 4JXCA 4RR4A 1IIHA 1KW1A 3W7RA 3STCA 4KWVA 1JR1A 4HPJA 1JCNA 5CPOA 4UTHA 3T78A 2OT1A 2TPSA 3W88A 2FB2A 2B7PA 3LGEA 1RR2A 1I2RA 1K7XA 3E9AA 5AHEA 3GR7A 1BEUA 5G1TA 4ZZ9A 3LTYA 2CFFA 5DY2A 2KZHA 2Y88A 1EIXA 2H3BA 3P80A 5LKYA 2DZXA 1A5AA 1TQJA 1H7XA 4MY1A 3QFEA 3JRKA 1NF0A 1EWDA 5FF7A 1VC4A 4KWWA 5D05A 6ALDA 3LI1A 3BG9A 1VH7A 5FF3A 5U4NA 1A5BA 1LP6A 1N7KA 1H61A 1VHCA 1SUXA 5TBOA 2RHGA 1EWEA 3GDTA 3TE9A 5D2XA 4LVGA 3TFXA 4UFJA 3I65A 3O63A 1Z48A 1SW0A 4JD4A 3QPZA 3S1WA 4X22A 1YXCA 3NQVA 1P4CA 5AC6A
chains in the Genus database with same CATH superfamily
2VZTA 4U4MA 3WQVA 3LOTA 1KM2A 2CWNA 4UC5A 1ENUA 1LQ0A 1Q45A 1AH3A 4M5PA 3QQ0A 1YTKA 4G7EB 1D7FA 1GEHA 3V3WA 3HG5A 3TR9A 2E09A 1KC7A 1K3UA 3A5FA 3EMQA 2J62A 4FXJA 2D2HA 2AL2B 3WO8A 1SW3A 2JKEA 4HSHA 2DFAA 1R86A 4S3AA 1Z44A 1QI0A 1CX9A 2DVTA 1BD0A 2ZBTA 2JKAA 3KUMA 4JIRA 3MU7A 4GX9A 4ERGA 4TX8A 3DU0A 4LUYA 3AHVA 1CXHA 3U7VA 3HGJA 1IV8A 3L4TA 1DE6A 3QH2A 4ALDA 4V15A 1QI5A 4Q32A 1SFSA 2WKLA 4EPEC 1J18A 3I6RA 2YFNA 1SO4A 3IK2A 3H2NA 3G6MA 2X1IA 4ILSA 1UC5A 3K4WA 3GTIA 3GYEA 5DFAA 1IXPA 2VMFA 4D8ZA 1Y7VA 3E0IA 1ZAHA 3V1HA 3UWEA 5LGZA 3AYRA 3UGVA 3BAWA 3PBWA 1XHGA 1FHVA 1EZ2A 5LXEA 4DJFA 3DFOA 3V18A 1GJPA 2V5DA 3CYJA 2V8ZA 1EYEA 1RPXA 1NF7A 2NX1A 1J11A 1UHVA 3GNRA 3DERA 4QJ5B 5I6SA 3L5MA 3Q65A 4ZB2A 3NAVA 2NX3A 2R1LA 2WSYA 3PG9A 3W75A 1JCMP 3VZYA 4CGTA 2FTWA 3RN6A 5FESA 3OGRA 4DUWA 4NZ3A 4F79A 1XW8A 2V3DA 3L4XA 1T7LA 3O07A 2ISDA 1X96A 2ZX8A 2BY2A 2R94A 3R2GA 4FR1A 4U31A 4L56A 1J9YA 3TAOA 1I45A 1UH3A 3WF0A 3SECA 4DZHA 3L4VA 2PDYA 2A2IA 4O57A 3TW9A 1R9YA 3H2MA 3LQLA 1LUCB 4AYGA 5BROA 3BMXA 5M03A 1XLEA 1TWSA 2GUBA 4AVNA 2BV9A 1DJQA 3RILA 4CQDA 4QFUA 1L6SA 4CD4A 3VABA 2GWGA 3ARPA 3KLKA 1ZBKA 1BKSA 3CMGA 3ID7A 4B91A 4ZE5A 4Q6JA 3DESA 3OBAA 1KR0A 3QOMA 3H7VA 4ZQCA 1Q8AA 2DZBA 3EB4A 3S6OA 4JHOA 2HBXA 2MNRA 3U2CA 1O5XA 3C3UA 5AYBA 2HXTA 3TUUA 3LGGA 1KTNA 5HANA 6REQA 4CU6A 5IRPA 2IW0A 4MB3A 1E72M 3WH7A 3L66A 4H9ZA 4ZXLA 1CYGA 3VAVA 3B05A 3TKFA 4LVAA 4POCA 1N2VA 1DEDA 1S5MA 2CESA 4KS0A 3MCNA 2G3FA 3BO9A 4H2CA 3MJMA 3L7RA 4P7RA 3W1TA 3BOLA 4L9XA 2NUWA 4JR5A 3R5EA 4XZNX 4MADA 3WMCA 3PTMA 2DSWA 1XCWA 1CXEA 4NAEA 1R87A 1KFWA 4HZ8A 1OX4A 3B8WA 4B3KA 1JQVA 2NSXA 2AQWA 3KLLA 3QZEA 1TMLA 3TSMA 5KZDA 2ASHA 3TDFA 4HBKA 2GVJA 3M07A 1R5YA 2WJDA 4OBTA 3TZFA 5I06A 3NDZA 2QUTA 2XVLA 3OG2A 5C9UA 1ZLPA 2NVCA 1MYRA 2WCGA 4UTUA 1XC6A 2QAFA 3RPMA 3O05A 2QCGA 3LB0A 1Z8AA 1L6YA 3CLWA 1VCFA 1KBKA 2GLKA 4WY0F 1JVNA 3WUGA 1CGWA 2PGFA 4MZYA 4AF0B 4XBSA 4F2TA 3ZZ1A 3M64A 1SZFA 3SCUA 4XD6A 1GOXA 3P62A 3DG6A 2QS8A 2J8GA 2SFPA 3TSDA 1PYFA 4L61A 2GQ3A 1WX0A 4IXXA 1EBGA 1SW7A 1OM0A 2Z7KA 4UTWA 1JCLA 3ARQA 5HR6A 2ZICA 5FJPA 1ODZA 2ZA1A 2RGLA 5EBAA 3WDHA 4AVOA 3CAQA 4UCGA 3QN3A 3AQUA 4PGLA 4MB4A 4MAZA 5REQB 1NDZA 3VFCA 3C5QA 3PHAA 3GE7A 4O53A 3WQ5A 2CBJA 4KWSA 3E0LA 5E0CA 2QCMA 3LEPA 1YQ2A 1EHAA 1FWWA 1G0CA 4MHBA 2PLMA 3TN5A 4GZ7A 1S2UA 2QPXA 1PIGA 1NFBA 2E5DA 1SVDA 2E8YA 4TV5A 1PX4A 3AMLA 2FJUB 3GH4A 3HOJA 3PSWA 4Q4SA 3LSCA 2V5BA 2A6NA 2Z1XA 1UKTA 5FF4A 5DELA 3WBXA 4FXRA 3CHEA 3FHAA 3W83A 1OZMA 4DN1A 1DOSA 2Y4SA 4B16A 2OX1A 2E9MA 3W2UA 4FX6M 3QKZA 3QY7A 2XPKA 4L64A 3I68A 1WKFA 2DT3A 4UOJA 4IPIA 3QLDA 2ZZ7A 4KCUA 2CBVA 2VR4A 2QCEA 4WOZA 3R10A 4AWSA 4RXGA 2WSPA 1WV2A 1OF6A 3FXGA 5BYWA 1CLKA 1N55A 2INZA 5B7ZA 4UIOA 4CNNA 2RFGA 4D6CA 4MIMA 4KEZA 2PWDA 1RV8A 7ODCA 1WYIA 5M2FX 1LL7A 2GDQA 1X39A 1E73M 1F9CA 1EGMA 2VELA 4QS6A 2WKJA 1OIMA 1MO0A 2QUVA 3WH9A 5IBXA 4CU8A 1TZ9A 3P61A 4HYWA 3LBCA 2V5KA 1GZGA 4E2VA 2WSRA 4NILA 3VIFA 3RM4A 4PL1A 4XO6A 1IZCA 1HL8A 5M3WA 3ABXA 5C9XA 1RCQA 4C6JA 3WNPA 3VUPA 4WRHA 3I3EA 2HTMA 2J7EA 3H2FA 4J27A 4FO4A 4QBXA 1OCNA 4QE1A 4CQAA 5D30A 3U2OA 2O9PA 5C5YA 3EKLA 2BY3A 2F61A 3VE9A 5FJOA 4F9JA 2I9EA 2QQ6A 1X98A 2PDIA 5C71A 3EBVA 2FVMA 3SJ3A 1J6PA 1MW1A 4ZQOA 3GQYA 1VFUA 2VZOA 4S1FA 5EU9A 5HK4A 2ABAA 3TTEA 2HNEA 4LCRA 1KM6A 5BOFA 2C14A 2JK2A 3B9NA 3HQPA 4HYRA 4YHEA 1FWEC 4DWSB 1PIFA 2ZIDA 3ZIZA 3S46A 1MVYA 3QV8A 3WH6A 5A8OA 2AAAA 4JFWA 3NPUA 1DL3A 1UR1A 4X0NA 1R3SA 4YTQA 4L7ZA 3N73A 5BOEA 1XKJA 1X6LA 2VFFA 4AD2A 2POTA 1OK6A 4IMEA 5G4WA 1OWQA 4GE8A 5BCAA 2HDJA 2WVTA 3HGSA 3OO2A 3LPGA 2XINA 2PFHA 2D22A 4H3DA 3ZR4A 1OZQA 3AZRA 3WDRA 1XISA 1OFPA 2VFIA 3OU8A 4F8XA 3ATZA 1WBHA 3F2BA 5IDZA 2AL1A 3HN3A 1JRCA 2E9LA 1REQA 3C0QA 4KRTA 1P43A 3AU2A 1LORA 1LRQA 5HMFA 3B0VC 4GNJA 4JEQA 4GUFA 3FA3A 2JEPA 4LS2A 3IGHX 4GA8A 4LFYA 1UJQA 1J0JA 3Q45A 4OOZA 4B3ZA 3AJXA 1H51A 2QJNA 3NQ6A 1EJXC 1TPUA 2Y8VA 4G9PA 1AH4A 3LI0A 3YPIA 1PEZA 4ORMA 1E43A 5F2LA 3DC0A 3LRLA 3DC8A 5D33A 2OQHA 4GVIA 3VFLA 4YU1A 1OEPA 3EB3A 1JD7A 2V5JA 2OO6A 1UKSA 1R8LA 2ZZ1A 5LNVA 3F5LA 3GG1A 1NWTA 4A8LA 1VF8A 2F84A 3ORWA 3QY8A 1BYAA 3LTSA 1JGMA 2OCZA 1ZP4A 1W54A 3P67A 1OFQA 3E1F1 3K13A 1F61A 1C8VA 4LVBA 2VWSA 5IFPA 3KAOA 1BWVA 1LG2A 3EWWA 1QOXA 1TWIA 1TMQA 2VEFA 3MUY1 5FSDC 1W1B1 3F7JA 7A3HA 1F2JA 3AIVA 2XFRA 1NAL1 1H2JA 2GJRA 2ZX5A 2C19A 1EQCA 3VE7A 4XKYB 3WK2A 3EDJA 5GQBA 3V16A 1O66A 4QDPA 2X1SA 3BAIA 4ADTA 3UXDA 3TK7A 1AJZA 4HNOA 2ZXDA 1LYXA 2FHCA 1HKIA 1YHTA 3THQA 4M6QA 5E09A 3PZOA 5I79A 1XRSA 3H70A 1A5OC 1QR7A 3PTDA 1KCXA 1QATA 4QRNA 4H7VA 2PD5A 1OB0A 3VIKA 3KVKA 3WNLA 6REQB 1LLWA 2YBUA 3GWQA 1E51A 2R6OA 4AWEA 1QK2A 3P2VA 2R1MA 1K4GA 1F76A 5LXXA 1M65A 1VS1A 2Z6JA 1C7SA 2EPOA 3K4AA 3GTFA 3IRSA 2VGFA 1E6ZA 3GDRA 5G1YA 3NDOA 4ZOBA 3NG3A 4JCLA 3GY1A 5TIMA 4WVXA 1W1ZA 2JGQA 3GVVA 1UPMB 2WHKA 1AH0A 1T8QA 3ES7A 3LV6A 4N4PA 2PDCA 4F0MA 3VNZA 1US0A 3W1PA 4GK8A 4Q4QA 3A9BA 3RX4A 1KB3A 5FJJA 1H49A 3MBDA 4IMDA 5D2YA 2ZXAA 4LPCA 4Z2KA 4HOZA 1YW1A 5I03A 4PL2A 3FN9A 3GKFA 4RE2A 2BXYA 1W3TA 3PZQA 1HL9A 2DH3A 2Q6ZA 4D6IA 4DBDA 2FYMA 1TTPA 2GOKA 2C3ZA 3QHOA 4H9XA 1A4MA 1GTEA 1Q3NA 3IJ9A 3W7OA 4AZBA 4RPPA 4MTVA 4IXHA 4EWND 2VCBA 5EMKA 1BRLA 3S1XA 3L65A 3BTNA 2CYGA 3H2EA 4LV4A 2DIEA 2A3BA 2Z6IA 4Z0SA 5C2XA 4CCZA 1IEVA 2BTMA 1VJSA 1IEQA 4Z1CA 1UWRA 2HVMA 3B8IA 1MRAA 3W01A 1CT5A 3GIQA 5G2HA 1JZ7A 1QNVA 4AVFA 1V6XA 1V7AA 4AQLA 3W27A 3A3XA 3RIKA 3AIEA 2P8CA 4NKCA 3E2VA 1EJSC 2Y5JA 1M68A 3QGAC 4Z1BA 5HNUA 3VU2A 4LQ1A 1IZJA 1HO4A 3LHWA 5EMJA 4W7WA 1EL3A 1TCMA 5J04A 2OZ8A 2CXGA 1S2TA 1AFSA 4WKHA 1QNQA 1ZBWA 4RDYA 3BAYA 3TYBA 1IEIA 5EMMA 3DENA 3GFXA 1XYBA 5BW6A 1HW6A 3SY1A 3U4FA 3LS9A 2ZUTA 2YCKX 1XLAA 1UC4A 3WJWA 2YL5A 3KM8A 3SRDA 3MMWA 1FP8A 1H50A 1NP2A 3GNOA 3KBJA 4DAFA 1Q8JA 4DNMA 3H24A 4J3WA 4AMAA 3R25A 3Q67A 2V2DA 5A2AA 4FR6A 1ADSA 1QMLA 4N9EA 2F9RA 4M19A 1FHLA 4O8AA 5FAGA 2PDLA 3CAKA 3U7BA 1PTAA 4GQRA 2AAMA 4KETA 4N7QA 2J7FA 2DW6A 1XIEA 2PGWA 4QLLA 1XBVA 1XH1A 2EPHA 1F8IA 1B9ZA 4EACA 1IWPA 1TIWA 2X0YA 4BR1A 1F6YA 4BQ5A 1PBGA 1TO3A 1FH9A 4QX4A 4XTIA 3OYZA 5CLTA 1QPNA 1OGBA 1FWIC 1BGGA 5EY5A 5LA0A 5HNNA 4A05A 3GC5A 2GDUA 4LY4A 4W8AA 4CD7A 2VRQA 3QTPA 4DJEC 4EXQA 4HYVA 3W37A 3PJTA 1RHCA 3GXTA 4RK8A 5BRBA 3AHXA 4JTEA 2NLIA 2YA2A 4ZOCA 3V75A 1UBPC 1TMHA 2QXWA 4H01A 4BZYA 2I17A 3V5FA 3N34A 2ON3A 1OFOA 4A21A 1L6GA 4JTAA 1SO6A 3BLLA 1VFOA 4BY3A 3CL7A 4KRUA 3OBKA 2QCDA 3VKBA 1F07A 2FB3A 3SUTA 5AECA 3AIUA 3UVIA 2ZUSA 4FNPA 4FNTA 3THAA 3M0XA 1G5AA 2Y7EA 4C1KA 2ZWZA 2WQDA 3TP4A 2PBOA 3GTNA 1A3XA 1CCWB 3VZXA 1X8FA 1M1BA 2OXNA 3GC4A 3HFYA 1FRBA 3V36A 5F7UA 1PJ9A 1GVQA 5TD4A 2H9AA 1EXPA 2J47A 2PTXA 1R9XA 2NZLA 2BB0A 4EANA 4MVAA 1PSCA 5B7YA 1XLFA 3AXXA 1E6PA 4WQ6A 3MSDA 1W3LA 1R3QA 2VQUA 1M41A 1A5KC 4Y90A 3W2JA 3RO8A 4WSJA 4LS0A 1UMLA 3GVWA 3NQGA 1WDWA 2O92A 1EX1A 2B31A 1XGZA 2PBGA 3WF1A 4B9YA 2W27A 2J27A 2QDDA 3G1AA 3FYPA 1EJTC 1R3VA 1T96A 4RE4A 3FY1A 1FBAA 2NXGA 2F6XA 2VTFA 3PZMA 3IV3A 3GHRA 5EMYA 3RDKA 3AALA 2RUSA 4PULA 1NOFA 4YCPA 1WDPA 1CZ1A 2ALRA 1E0VA 5K9CA 4L4OA 3PWIA 1GQIA 2J66A 1JULA 4AUBA 3LXAA 2BGSA 2DPEA 3DI0A 4JTGA 2NT0A 2QCDB 4WLCA 1MQPA 3TTQA 2OQLA 3E38A 2FJKA 4ACZA 1CXKA 2VT0A 2ZVIA 3WF4A 3CWNA 2W91A 4H9VA 3LPOA 3VDCA 4J28A 2A7PA 3TTSA 1P0NA 4D6JA 2C1HA 3UZZA 2WOQA 4DZ5A 3HG4A 4UFKA 3LUTA 1JYXA 4LANA 1KD0A 1JGIA 2VOMA 2IMRA 3RX2A 1A0CA 1PTGA 1CLVA 2DVUA 2YDAA 4DXKA 3RM8A 4KFOA 4J3SA 2WPBA 1HKJA 1P1XA 2A3LA 1S2VA 4F9DA 2E8ZA 3BOXA 4KPLA 4RZ4A 3UGRA 2DP3A 2D20A 1GG0A 3G6LA 2WNNA 2V81A 1UMYA 3FEMA 5LIYX 8TIMA 5LNUA 1B30A 1DJZA 3FJ4A 1MEWA 4IQEA 5KITA 4F4RA 2GFTA 3UA4A 3B40A 1GEQA 2ZDSA 3BCDA 3R6IA 1KKRA 1KQYA 3BANA 4DBSA 2ALDA 4AFYA 3L5AA 1TTJA 3EGJA 1DTUA 4XX6A 1DWAM 3CASA 5AHLA 4UXDA 4AY8A 2AL2A 1M03A 4GI9A 1JYNA 3AS2A 3W72A 3NFUA 1XYCA 4UR8A 1ISVA 4FNQA 4TX9A 1VJIA 3VIGA 4S39A 1FDJA 3GU1A 5DT5A 3HV8A 1E0WA 1TVLA 3NL5A 4HCLA 1T0OA 2QJGA 4CKQA 3MSYA 5LHFA 1YDNA 5EFFA 3P8JA 2AMXA 5CEWA 5CG0A 4B4FA 5A8NA 3TLLA 1E9IA 2EG8A 2AQOA 2J7GA 3BCFA 3PBMA 4YWSA 5I09A 3IVTA 4C6EA 3N2TA 1T99A 3B8SA 5EMLA 2J7DA 2YGYA 4GIYA 1W56A 3IV8A 3ME3A 1CTNA 4GZJA 2XIBA 4XSLA 4JY9A 4J40A 2RH9A 4GXPA 1UZHA 2GOUA 3S5ZA 3BJTA 3CHVA 3KEHA 2W0UA 2YCLA 3O16A 3WF2A 3MDWA 3SY5A 4WGXA 3PPFA 4Y8EA 4A3YA 2XZ9A 1A4LA 3KRUA 1RJQA 5MKGA 3LD5A 2ZUUA 4CN4A 3WLNA 1S2CA 2VEMA 4LALA 2TSYA 2YR1A 3PM6A 4JTJA 2YW4A 4NZJA 2W5FA 1D2KA 3P0WA 4LU0A 3D46A 3R94A 3PUEA 5A6TC 4MLJA 2OLAA 5MKGB 1PDZA 2H8XA 3DHPA 3T9PA 1GUVA 1OFRA 4GCXA 2X0HA 2ZRWA 4O1FA 3H23A 4MM1A 5HWMA 4Z2JA 4YPJA 2WMKA 3G8EA 1RP9A 2F2KA 2PSNA 2CHRA 4NNAA 3STEA 1P5BA 4TO8A 4FSAA 3ZT7A 1Z42A 4IPLA 3W7KA 3LMYA 3LENA 5T91A 3CUFA 2X8RA 4NQ1A 1CECA 2Z7GA 1GOWA 4QJ4B 5HDRA 5IDIA 4MLRA 1LUCA 1VEPA 2G4FA 2VXNA 4A4AA 2OODA 4G2DA 3PPGA 3O6AA 5D03A 1MEIA 4S3DA 4U2ZA 4X2RA 1U5HA 1LG1A 1TR1A 4M6UA 1VFFA 3NR0A 2VX7A 2YLLA 4NHVA 1VYSX 3QRHA 4GUHA 2WZEA 2QDHA 4GISA 4IMFA 5D37A 4F66A 2A85A 2WM0A 1ZJBA 1J0ZA 3DBPA 4JN8A 4XV0A 1NM9A 2OTDA 3H4GA 1F3EA 2V82A 5CJ5A 4X3ZA 1J2WA 2FFCA 2ODOA 4H6QA 4RNHA 4YJ5A 3VNKA 3UZYA 2VOTA 1DQUA 2ZFAA 1LLZA 4V1XA 3SJNA 1U33A 2DJXA 3DN5A 2OSYA 1Q13A 3ARTA 3WFZA 3E74A 2UWFA 4JL2A 2C1IA 3MUCA 2QW5A 1FCQA 2E1DA 3GDMA 4Z42C 4PEKA 2PZNA 1HP5A 3QF0A 1PZ0A 3PVFA 1XUUA 3FEQA 3STFA 3OA3A 3OPSA 4E8DA 4BEUA 3UPMA 4R7WA 4GYKA 1V6UA 1FTXA 1DQWA 2GVGA 3GC2A 1LT7A 5AZ1A 2DW7A 2POZA 2DSVA 1LROA 4LAOA 5FL0A 1F7BA 3N14A 4PZVA 3B0UX 2Y2WA 1D3CA 3USBA 4L1XA 3CC1A 3T05A 3S9IA 4FK9A 3NM3A 3AHYA 1F5ZA 3DCPA 3GSMA 1RH9A 3KOFA 3SY8A 5CG7A 2X2GA 1W3HA 2PP3A 3W7LA 4LSBA 3AAMA 2E25A 3R12A 1IWBA 3AMCA 2A3HA 3KS5A 1XIBA 3P7YA 1L2QA 1I4NA 3SURA 5HA7A 3TXZA 1M6JA 1WB0A 4BK9A 3SEPA 2PGEA 3MSRA 1J0YA 2CIPA 3BG3A 1BTCA 2ZX6A 1R7AA 4QSFA 4GKTA 2W4XA 3O0KA 1WKDA 2JALA 2OLHA 4TVCA 2E5CA 4RNFA 1NIUA 3MB9A 1TPH1 1SU5A 3S0CA 3BLFA 2VFEA 4P7OA 4JGDA 1VJZA 4JTSA 1AMKA 3NL3A 4LCQA 1YX1A 4AZ6A 3EEGA 2E0PA 2BHYA 1HQTA 2FZ8A 4V33A 4YNGA 2CERA 3M47A 1V79A 1PVNA 1E4IA 4ZOAA 4W5ZA 2TMDA 3URBA 1HT6A 2VVNA 5BOOA 2R91A 4EVZA 4IGMA 3UFYA 1SM9A 2VD8A 4W89A 4GWEA 2PTZA 4JHMA 3E2SA 2X7WA 1TELA 4S2CA 2VDHA 4G56A 1XIMA 1IIGA 1JI1A 2Y6ZA 3N9RA 1JXKA 3RMEA 1SFJA 4FA3A 4UMBA 2BVWA 1ZY9A 5HOSA 3VVGA 1KW1A 1JAKA 3JVAA 4QCEA 2VQTA 1RY0A 3H4XA 2TAAA 4PCSA 3QVQA 1OCQA 3W88A 4AZIA 4DYKA 3OLIA 2B7PA 3WLOA 1RR2A 5DMMA 1BXCA 3WUFA 1TV4A 1K7XA 3E9AA 4GOAA 5AHEA 1EKOA 4ZB0A 3C86A 3EOOA 3ALFA 3VGFA 4ZZ9A 2CFFA 1KR1A 5LKYA 5FD0A 2DZXA 4MY1A 2VUYA 3JRKA 3MKKA 4WCJA 1PDYA 4LNCA 1EF2A 3BQ6A 1V6WA 5AKQA 1VH7A 2QZRA 1LP6A 3T42A 1H61A 4GJJA 3DOPA 4IP7A 4JQ4A 5BXRA 1GOOA 4UFJA 1UOKA 4ZTYA 2Z2AA 4Q8NA 3SUSA 5AC6A 3GUWA 4IPNB 1FCVA 1I1XA 3DFYA 4UQAA 3N13A 2D2GA 3KBNA 3ELFA 2ATSA 3H7RA 4I9JA 4HNTA 2GWNA 3RITA 3KCLA 2ZRZA 3VGEA 3L4WA 3FHQA 5K4XA 4OUEA 2NXHA 1S5TA 1LJYA 2PCQA 4GG9A 1D8CA 2BHUA 4TTGA 4UUIA 3C0LA 9XIMA 4B2DA 3O8AA 1Q2RA 3EKZA 2C91A 5D04C 3WFLA 4NP7A 2H9AB 1RLCL 4QCFA 5HUOA 4PSRA 4ZBCA 3B9AA 3W7PA 4OIFA 3UY8A 5JH2A 1P48A 1TVNA 1FCUA 2ZC8A 3S2LA 2GVEA 1TRIA 2J7CA 3A13A 5FKYA 1UH4A 4PUUA 3ZLHA 4AISA 3KRSA 4QITA 3U9IA 3LPFA 3M5ZA 4HNLA 1G4TA 4MDPA 3ZR5A 4M81A 2FGBA 3RM9A 2VVSA 1GVEA 4W7VA 2DSUA 2WANA 4GYJA 4H9YA 2Z29A 1SJCA 1OGGA 2AGTA 3K1DA 4O13A 2ZOXA 1JF6A 2WM1A 3WLPA 3E5PA 4H4IA 2YA1A 2WNQA 1GG1A 2C71A 1JUKA 3FSTA 4TVDA 4CEUC 3LLFA 4A3RA 1OHLA 5I78A 1GKQA 3UWQA 3UNDA 2ZUMA 1V3HA 4MFEA 5DMLA 5EFDA 3A3WA 3NOYA 4QQUA 3TCEA 3TVAA 1XP3A 2BHZA 1M9HA 4XWUA 4GQ0A 3AHZA 4BQ2A 2FZDA 2J4GA 3ZVHA 1UWIA 4EPDC 3CPUA 4D2JA 1AZ2A 4TMCA 1HTIA 4QXIA 2J6XA 1H3GA 3VZZA 4FALA 1XYLA 2XIJA 2YL9A 2FVLA 1Y65A 4CN6A 5AN7A 1RBAA 5DEZA 4PA8A 1S1PA 1M01A 2CHOA 1BHGA 1LRNA 2PODA 4RZ5A 1K9EA 1A5CA 3CB3A 1TV3A 2YA0A 1LTDA 5GJPA 3HPXA 1JUBA 1BG9A 3NUKA 2WPGA 2YLAA 2FMOA 4A8RA 1MW3A 2FZNA 5AHNA 1DXFA 2B0MA 3S5SA 4NZ5A 3QV7A 4WY0A 5FF2A 3NZGA 1YDOA 4PUJA 4N2YA 2OU4A 1VBUA 1XWYA 3CIVA 3RHGA 5FEWA 1UROA 3H26A 1EA9C 4ZO8A 5I2UA 3UVAA 3ITOA 4P7QA 1CDGA 5FI8A 3WZ0E 3G0SA 2HWGA 4IX2A 3PULA 4LCSA 2Q71A 3HBLA 2X1TA 5RUBA 4RNIA 1BGAA 3CUZA 4Q7BA 2R1PA 2ZCGA 3KOYA 4UOZA 3PUOA 4C7GA 1IEWA 4TOQA 1NJJA 4JTQA 1IWAA 3T81A 4W86A 3A4JA 2ZADA 4U28A 4AXNA 1OSEA 4NSBA 1BTMA 3VC6A 2X0SA 2J8TA 3ANVA 2CZDA 5CZJA 4J9JA 2ATMA 3E02A 4HTBA 4DO5A 3SQMA 4XG1A 1FY6A 3S47A 1GONA 4HSOA 8RUCA 3NEVA 1WDQA 2GJLA 3BJFA 3WQ6A 3OZYA 3T8QA 4O0ZA 1XFCA 2Z28A 3A21A 4AF0A 2XWEA 4AB4A 2EPLX 2O7QA 2NLYA 4LW7A 3W1RA 1JXJA 2TRSA 2C16A 2G3NA 3DHFA 5I3KA 1EC7A 1TUFA 2Z1WA 3KL0A 2VCCA 3C2YA 3LXCA 4UTWC 4W85A 2HJPA 4TUFA 2GGIA 1ZSXA 4IP5A 4FIQA 1KWKA 1GK8A 5K4ZA 3I10A 3P14A 2QKFA 2WJZA 1V0KA 4L4LA 2EJ1A 4C6IA 2Q3RA 3B8VA 3CWHA 4EWJA 1U2YA 1EXBA 4WIWA 2VYOA 3WQ4A 1Y5WA 3NYDA 2P3EA 1M3UA 1HUVA 4C7FA 1DWIM 3QFWA 1U83A 1OC7A 2GSJA 3WLIA 4IFRA 3F5KA 1Q6EA 2PDHA 2G3MA 4C6DA 5A95A 3VNMA 3D3AA 2BBFA 3WQ8A 5F1UA 5CGTA 3L9CA 3LM7A 1OFAA 1XJBA 4LRSA 9XIAA 3E0VA 4B5VA 3ZO9A 3UCCA 1V02A 4FEZA 2W62A 1F8MA 3EDEA 3N4EA 4ZSTA 2PLKA 4AW7A 3IJ8A 2WK2A 3SIZA 3CBWA 2CZFA 2J75A 4PB3A 3T0DA 4J35A 1AL8A 2XHYA 2ISFA 3AXKA 2WCSA 2PB1A 4WKFA 3CNYA 3ICJA 1KM3A 4QP0A 1KXVA 3DGBA 4WOQA 2RJHA 3EA1A 1YE4A 4OBRA 4MGGA 4GVFA 5T9CE 3C56A 2Q8LA 2PWVA 4L65A 1AQFA 3KVLA 1FWSA 3HQ1A 1FWDC 4RNJA 3ZM8A 3MPGA 2VCAA 3SZ8A 1YPIA 1TTIA 1WBJA 1MSSA 1E3XA 4X9SA 2Q8XA 4LNYA 3HF3A 3GHUA 1K70A 5L6UA 1C8YA 1WQ5A 4FMVA 3VGGA 1TYGA 1XR2A 4PMYA 3LU2A 1TWZA 3M0VA 3PWGA 1WE5A 4LVFA 3P84A 2IPWA 1DTNA 4FPSA 3Q58A 1NP0A 1I0BA 4W88A 1TJPA 1YDVA 3Q2DA 2BVTA 3BW2A 3MY9A 4RDWA 2QF8A 2NQJA 4NG3A 1FFRA 4P2VA 2B7QA 1E1FA 3IK4A 1QW8A 3T4WA 4E4FA 1FUYA 7CGTA 1WOBA 5CBJA 1PAMA 4J3UA 4AEOA 2WVVA 2WSKA 4UFMA 2Q02A 3KOWA 5E93A 3F4NA 3H2AA 4OKDA 4OV9A 2Y63A 5A6MA 4ASTA 1SMAA 3K46A 1LCOA 3TN6A 3FKRA 4O1DA 1JPKA 1UR2A 1B4KA 1IGWA 3WLRA 4RX0A 3QR3A 2P76A 4H9UA 4GABA 3NSXA 2E5BA 2BY0A 1SZGA 2ZXBA 2BXZA 2FZBA 5LIXX 2FDMA 5F4SA 1JZ6A 1GT8A 1IXOA 3EXTA 2PF0A 1Q4NX 3GVGA 3QYQA 6XIMA 3CTTA 3ITVA 1I8JA 4XKYA 3T2QA 4GI6A 4O10A 2VZUA 5HJLA 3MI6A 4L6OA 3WEOA 5A6JA 1X1NA 4UQ9A 3VNDA 3UA3A 3T7VA 4EX4A 1V6YA 3WJZA 3OLEA 4HA3A 4ICMA 4NXSA 4FF7A 3LXBA 4I6VA 2XM1A 1E6QM 5LYRA 1ADOA 5LGXA 1ISYA 1BLIA 1QDSA 1UR4A 4YTUA 1VBHA 3AZSA 1B5TA 2BASA 1R30A 4FX8A 1YBQA 3VA8A 4UB9A 1VFLA 4FI4A 2VENA 4JFVA 3CQKA 2J7BA 3H12A 5GVJA 3U48A 3CUHA 3NCOA 2QV5A 2D3LA 3FGCB 2QDGA 1KBLA 2XDFA 3QW3A 5FJIA 3RNDA 3KTSA 1XLDA 3ARYA 3D5HA 4DZIA 1PKYA 1ELSA 1TJ0A 5F1VA 3MP5A 2NXIA 1ZHAA 2OGJA 1XIDA 3VC5A 3BK0A 3L5LA 3THUA 2UV8G 2GK1A 2ICSA 3HV9A 4TIMA 4DO6A 3H2OA 2ZKMX 2HXUA 3LNPA 1DJXA 3VOGA 2JQXA 2J9YA 2CPUA 2OYMA 3WQGA 4MAVA 1MFVA 3C2EA 3L4YA 4XZWA 1S3HA 1NOWA 5A1AA 4L6DA 3QEZA 3VD5A 3F2CA 2HS6A 1BF2A 4P7NA 1H7NA 4HCHA 3QMSA 3CPGA 2P0OA 2GQ9A 1QI2A 5AC7A 1OD0A 5XIMA 3M0YA 3PUDA 1U5JA 2EPMX 4JKMA 4M0XA 2QNEA 1BXBA 3VCRA 4Z08A 2PTDA 2C79A 2GGJA 4O54A 5F4WA 4PTWA 4MFDA 3RRXA 2ZZ6A 3UW6A 5A2CA 1GVRA 4NZCA 2YB4A 3W7HA 1ZENA 3N9KA 3QZ6A 2HQAA 4CCCA 3PZUA 1Q6LA 3M46A 3TJLA 2V63A 1WDRA 1E3ZA 1DPMA 1XLGA 1S5VA 4JFTA 3M0HA 4A2RA 4JDYA 1IHIA 2XJ7A 1EO7A 1QW9A 4YYCA 1W1PA 5JBDA 3TEVA 2EO7A 4JYEA 1KGXA 4LUSA 3FAXA 2G8ZA 3SCOA 1XYMA 1Z9AA 1EJVC 2I5QA 3VM5A 1ZCOA 2YCJA 4PB5A 3DFNA 2VDGA 4DXXA 3G1FA 1LWJA 5I7GA 4JOMA 4IUGA 5E70A 2DY3A 1RCXB 4JDBA 5D9MA 3MMDA 2OOGA 3B9EA 5HULA 3W85A 1KLYA 1SSDA 1DJYA 2XGIA 2YKKA 4IF2A 3RLHA 4A22A 1VAHA 4DF2A 3DHDA 5KSWA 5H8PA 3KP1A 3CV7A 5C6MA 2CBUA 5CPMA 4AIEA 4H8NA 1Z7AA 4NF7A 3VM7A 2A0NA 4C6QA 4MDOA 2H90A 4ZQNA 3I7QA 2OX4A 5AB3A 5HJYA 1JRBA 1K6AA 3AS3A 1C7TA 4JTFA 3POCA 2XSXA 1UWAA 4PMUA 2W67A 1R85A 1WXJA 4AZGA 1ISWA 5EL1A 1E4NA 1Q4WA 3UP8A 3EYPA 1WZLA 4WR3A 4QAIA 2R1KA 3LSBA 2VX4A 4MNKA 2NQ9A 3PFRA 2CHNA 5ABHA 1WZAA 4Z1AA 2VHLA 1EHNA 1W3IA 2OO0A 3VDAA 2HBVA 1ALDA 3PZGA 1XD0A 1Y5XA 4FLQA 1ZQ5A 4RLIA 5FJRA 3CM4A 1NWRA 1TA3A 5JBFA 5D2VA 1KV8A 3T2PA 1K8XA 2HK1A 1A0EA 5CGQA 2UY4A 4QDWA 1A3WA 1VBJA 4R53A 4Q7IA 7PTDA 2WWDA 3LHZA 5HINA 5G5IA 1PIIA 3NGJA 2VJXA 4HTYA 3THCA 1V3MA 2VURA 4E38A 2F6UA 1AODA 3R8HA 4KWOA 3O3RA 3LTPA 3DFSA 4ZQMA 4D1IA 4GY1A 3GTXA 3NIYA 5DX7A 2BZNA 3TAKA 4REQA 3GR8A 5TQLA 4GD0A 2ESCA 4QLKA 3S6DA 4N6EA 2G37A 2XU2A 3VNJA 4C5YA 1MI3A 2YPIA 3UZJA 4CNPA 1UP2A 1P6CA 1W1IE 4Q4KA 4YMZA 1QNPA 1QNRA 1LQ2A 1K03A 3SFWA 4HK6A 1K8YA 1Z32X 1L9WA 3DKJA 3ATYA 3SN0A 1TX0A 4XO7A 5DQPA 2DIJA 4RW3A 3R13A 2G0WA 4CD8A 3CUXA 3IUHA 3AS0A 1PE1A 2PLCA 4HPNA 5A69A 1F73A 3TQKA 1WDSA 3AXHA 5HNRA 1EQPA 3UWVA 4F40A 2B7NA 3TU9A 3S2CA 2IKIA 4JTKA 3V5OA 3RU6A 3FDKA 2NVAA 1V0LA 3NZRA 4HMNA 1PWLA 3RX3A 2V2CA 1AA1B 4YVXA 4UTLA 4PCNA 4ZA0A 1DQXA 5I5RA 2QGHA 5BXPA 2YSWA 3CS2A 5MHBA 4US5D 4MWAB 5A6SA 3N2BA 3W81A 4PC8A 3W76A 4U3AA 4F0KA 2I57A 4PUKA 2D0GA 2YBTA 3WJYA 1A5SA 3W86A 3NL2A 3UWYA 4B5UA 3LPPA 1XIFA 1AVAA 3N9SA 1CNVA 5L9FA 3GIPA 3BC9A 2R82A 3UR2A 4EKJA 1NU5A 2O0TA 2MUCA 3E12A 2VC6A 2NQLA 3DUGA 1EGZA 2EGZA 5FIPA 4ROPA 1X1OA 1KQZA 4R5EA 4PBGA 3FAWA 3RG6A 1CXIA 2Y89A 1TZ7A 4Q4OA 4S23A 1E5NA 4GJIA 2BY1A 3QR0A 3H53A 3NZ1A 1JPHA 4QLJA 1HFBA 1BWLA 4A3QA 4WJXA 4PMOA 2QYGA 4MYAA 1W17A 4Y9OA 4QM1A 3BV7A 5EYWA 2QR6A 1RPKA 1BWKA 5HXMA 3CAVA 4NAFB 1XINA 3PF3A 2V5CA 4ENLA 3D3FA 1J6OA 2Z0IA 3G1SA 4H1ZA 4NX5A 3V1PA 2QJIA 3G3MA 3PAJA 3NJ3A 3MYPA 1RSCA 4A29A 2FDSA 3ZT5A 3S5NA 5FL1A 4KMQA 3EWCA 4ICCX 5BRQA 4K7YA 4Q8PA 4NI8A 1OGSA 3SADA 4PRRA 2VFHA 2PI6A 3GLCA 4U2YA 4C6KA 4I6KA 4KCVA 4XUGA 3CLMA 4W5UA 1W9UA 1X6NA 4JL1A 4GIAA 3CO8A 5DXYA 3KFTA 1TFVA 3CQ0A 4DI9A 3ZWSA 4GYPA 1FKXA 1NSJA 1HF6A 1QWKA 4UQBA 5I3DA 2EEXA 5A6LA 1OYBA 1SR9A 3B4UA 2PWGA 3F4DA 3BARA 1X38A 3UCQA 1XLCA 4UMCA 4QDMA 2PCEA 4P8UA 2CU0A 3GAYA 3G18A 5F2IA 3T8LA 4Q8OA 3QQWA 4GZEA 3EOSA 4GZIA 5EA9A 4YTTA 3NM1A 4K3ZA 4GO8A 2IPJA 2E1WA 1F4AA 3COTA 3WDIA 4BA0A 2ISSA 3SCNA 4FNRA 3PBGA 5FF0A 1S2AA 3LHYA 4EPBC 3NQ8A 4GBDA 3XINA 3FK4A 4H7ZA 4K2SA 1R2RA 4PMVA 4M6PA 4MMWA 4BFAA 3C0SA 2HPMA 1TPEA 3KOZA 4WJ8A 2NV1A 3M0IA 4JIHA 3KCJA 4URIA 4UNKA 1JFHA 3DECA 5I24A 1DWJM 1MUCA 3EWBX 4S38A 1TSIA 5HMDA 2Z2BA 2C13A 2XVPA 2ZTJA 4JTIA 4E2DA 4KGLA 2D2OA 3CO4A 3UJSA 4WXZA 2RDXA 1E1CB 2RJGA 5AOUA 3QM3A 4BI5A 2J6VA 3IGXA 1XSKA 3WQEA 3DYOA 5K3VA 1PTDA 3GM8A 3GG0A 1K1DA 5DBUA 3KBSA 3WN6A 1JIBA 2QCFA 3W1QA 2CLPA 1W5QA 3INPA 4JQ1A 3TV8A 3CU2A 4IFOA 4AX7A 3T2OA 5CKSA 1AW2A 1G4PA 2VEKA 4O1AA 4G5DA 1J79A 4LAZA 3W87A 2J13A 4OUIA 1JG9A 4FNSA 1QOQA 2OOFA 1H1YA 4JNZA 1ZRQA 5A8QA 1LL6A 5A2BA 2Y8KA 1VBRA 4U5IA 4UQEA 3VTRA 4DJDC 1W9BM 3PG8A 1ME7A 4MNJA 3MHGA 3A12A 3SCSA 3NZQA 3GW0A 1T5AA 4UFLA 4HNVA 2ACQA 3GFZA 1BQCA 3NL6A 5HNTA 2I14A 4D6DA 2ZRUA 3QTGA 4A2SA 4KF1A 4HN4A 3CMJA 5ABFA 1MDLA 1IF2A 1PS9A 1M7PA 2EXOA 4O11A 3IANA 3KX6A 3VI2A 4H41A 4LGXA 5FOOA 1VLWA 2OKOA 1QK0A 1RQHA 3NVDA 4D9PA 1MZRA 1C8QA 1VYRA 3PJUA 5HQLA 3R79A 4S3BA 1XLBA 2QPUA 1DIOA 3BLOA 4LC8A 3I3DA 2R14A 1GNXA 1ZFJA 3GRIA 3L0GA 4ECLA 5LNSA 5HMEA 1DORA 2YCEA 3N12A 3SCRA 3GXNA 2GJXB 3W9ZA 1V08A 1M7OA 4IQJA 2FGZA 1K9FA 4NJKA 1XLLA 4EE9A 2F8QA 3ARWA 3IJ6A 4TQTA 4OHQA 3GVQA 3QGKC 3CEUA 4PUEA 2INFA 1JDAA 2W6RA 2WHJA 3AIRA 1BVZA 3KDOA 5G1MA 1GZ1A 4X2PA 3AIQA 5TNVA 3VD9A 1TB3A 3AI0A 1WZKA 1GKPA 3REQB 4PH6A 4GQBA 2OMAA 4GACA 2PE4A 3S5OA 3KBWA 1X7FA 2H3DA 5C9WA 4RZBA 5D8WA 2WMGA 2VD9A 3BW3A 4E6MA 1UW9A 3MC5A 4KT2A 3U57A 1PHWA 5H91A 4WXYA 1NVMA 2CXEA 1OCBA 3TWBA 4HNCA 5C54A 3LX9A 3RK8A 3WSUA 3BG5A 3PP7A 4ZODA 3SCPA 3NA8A 1XG4A 3VKKA 3ARSA 5CZSA 1LOQA 4H6RA 2BLEA 5HPCA 1UASA 4LF1A 5D8ZA 5C55A 3GKAA 2WVSA 3ABOA 1KA9F 1C90A 4HNUA 5HR7A 2ZZ5A 1QPQA 4XBKA 1TE1A 3AYTA 1JZ2A 3GFYA 3BV4A 3W6YA 1JYWA 3P82A 4BF7A 3ZXWA 2C18A 2XZ7A 4J1OA 2RDTA 3PZ9A 5EGRA 1SZNA 1TREA 3W7EA 1JCXA 3RXZA 3BOFA 1G1YA 7XIMA 2D23A 1N8IA 1ISXA 3TQVA 1SQ7A 1EC8A 3D6NA 4WX2A 4ONVA 3JU2A 1TV2A 4ML9A 2J25A 4CLMA 4PFHA 1E15A 4DAIA 2XH0A 4JN7A 2BSLA 1P6BA 3QKEA 3ARUA 1RBOB 3GX9A 1EIBA 1KCLA 3UR8A 1HKVA 4IL2A 1B3XA 4XTDA 1FWJC 2JGYA 3TMLA 3S4TA 4WK9A 3S8HA 2VFDA 3CL6A 3UBPC 4QE4A 1WA3A 3AHTA 5HMSA 3BAJA 1J5SA 3N3TA 1QBBA 3B0YA 3N17A 3S83A 3THDA 1PZ2A 1V8EA 3CZLA 1D8WA 1ME9A 3T6CA 3T09A 3B04A 1DVJA 3WLSA 5I02A 3JUGA 4LUTA 3WBWA 1DP0A 1UOZA 1R9ZA 3WL1A 1XIJA 3APYA 3MUAA 1PKNA 1XSJA 4E4UA 3WK0A 2V6AA 1GKRA 2BGQA 5KZEA 3ITLA 4PODA 1UWQA 3ZLGA 3M0KA 4FAMA 1HN1A 3HPFA 4INFA 1IXQA 1K8ZA 4CU7A 2GVYA 2VR5A 1KFLA 2PWFA 1FHUA 2YIHA 2YZRA 3KTCA 3P93A 2J88A 4AD5A 3W22A 4WDTA 5DCDA 4BQ3A 3NXLA 3L21A 1BYCA 2DZAA 2ZC1A 5D32A 1ZGDA 3RGTA 3LRKA 3HMJG 3RCYA 1ZNNA 3T0CA 5AYXA 1OINA 5F4XA 4B90A 3ENLA 3C3NA 1SMDA 3B8DA 4EXAA 4MYXA 1TR9A 2JIWA 1DXIA 4FB7A 5DO8A 1Q6QA 2PP1A 3II1A 3R1ZA 1ADDA 3W26A 4M56A 3PZVA 4QNEA 4DI8A 2X09A 3KS6A 4PMNA 2PC4A 4IM4A 2YXGA 2ZX7A 1A5LC 4ZEPA 3CTLA 1B3YA 4C6PA 4LUIA 4IGSA 3WQFA 1UYQA 3OZMA 3PJXA 1V6VA 3CT7A 3KOXA 1AD4A 2Z4GA 1A5NC 1NARA 3FOKA 1YKWA 1DHKA 3AUJA 3LMZA 5DT7A 2E40A 4PN2A 2VEPA 1NFPA 1G7UA 3RFAA 4B5SA 4BI7A 5CC6A 5CPNA 3W1NA 1MUMA 3FYYA 3NQAA 3WBAA 3G3DA 1T40A 1QW7A 3VIHA 2WV8A 6ENLA 3ANUA 2V9DA 2IKHA 1C93A 2WQPA 3D47A 1AG1O 3NPXA 4F0LA 5CC7A 4PUNA 1A80A 4OECA 1K8CA 5BWFA 2XM2A 2FHFA 4QAWA 3F1QA 3LHUA 1HJVA 3WQOA 3BMWA 3SQLA 3T0BA 4Y96A 3N6HA 4KWVA 4YS1A 1EOMA 3AXIA 4NIRA 2OT1A 2TPSA 2VZVA 3DDMA 3LGEA 3TNBA 4X61A 3W82A 4K68A 3IJDA 3LTYA 3NO1A 1BPLB 1WZMA 3EA3A 3P80A 1JNDA 3QFEA 2P53A 8XIMA 2B81A 3AROA 1NF0A 1EWDA 5FF7A 4KWWA 4P8XA 4QROA 3BLDA 3ZQ9A 1N7KA 2PD9A 2WC3A 1SUXA 4F0RA 4XZMX 2RHGA 2NQZA 3GDTA 4NY2A 3TE9A 3I65A 1Z48A 1SW0A 3BLPX 3QPZA 3V7PA 1P4CA 4D6GA 3VIMA 4YIWA 1CGTA 1JJKA 4WEVX 3G8RA 3SGGA 3CIWA 3I6EA 4JHZA 1NY1A 2NUXA 4BF5A 4Z2LA 1ONEA 2Z26A 1LRTA 1H0GA 3MKCA 3EX4A 4NJGA 4I9TA 3WEMA 2D73A 2EAWA 5LHEA 4Z1DA 2PLJA 2XN2A 3VCCA 1KFKA 1LF1A 3VK5A 3CGTA 5AC5A 3M0ZA 1KBBA 5AYIA 4TXEA 4ROQA 1EA0A 2VKZG 1ZPTA 3CYVA 4PUMA 3PBVA 2QUMA 3KWXA 1UBSA 2AKZA 3VILA 4MKNA 1GOIA 1BFNA 2PAJA 3GVRA 5LNRA 1W5NA 1DIKA 4RDZA 4K8HA 3CB8A 5I3HA 4C60A 2J7HA 3HJZA 1XX1A 1EZWA 1FWAC 1RBLA 2Y5EA 1E1EA 1ZJIA 4RUBA 1GPFA 4J7RA 4DWSC 4HHLA 1PKMA 3UEQA 3SM0A 4CQCA 1MZHA 4DVOA 2P1FA 1JYVA 1QOPA 4XQ6A 4IMGA 1QWGA 2W92A 5ENLA 4IL0A 1TIMA 3VO0A 3KW3A 3LG3A 2G50A 5G2IA 1B1YA 1H41A 4IJRA 3SCWA 1G01A 2DZWA 4GXMA 2PU1A 1BKHA 1MXGA 5ECVA 2QGYA 2R24A 3U5UA 1UQZA 4LXFA 2PWUA 4C6LA 3O2LA 1EFZA 2PGRA 3T1GA 3NPWA 2A3AA 4NNCA 2AGKA 3T0AA 2WB5A 1S39A 3ZSSA 4WSHA 4C1LA 3WK1A 3OQEA 4XAGA 4PTVA 3Q94A 1HKKA 1OYCA 5TF0A 1HNYA 3H7UA 3LERA 1KBIA 1X6UA 5C2CA 3KDNA 4LAMA 5TAOA 1H62A 2DZTA 2OEJA 4JYFA 4FXSA 2Y85A 5A6BD 3N6JA 4LBSA 4HB7A 1J10A 5IOBA 1VB9A 3LGDA 1UB3A 1YADA 2CLIA 3NYZA 3KZPA 4BWLC 3ARVA 3AC0A 2CKSA 3LHTA 3FLUA 4RE0A 3TLQA 4XB3A 3HPZA 4JNYA 1I2NA 1D7KA 1O7AA 3BW4A 1OQFA 2W3ZA 1GVFA 1REQB 2GJNA 3FJ6A 4UTJA 3URAA 2C6QA 5JU6A 3FJLA 3CWOX 4UNLA 2Y1HA 7TIMA 1TRDA 2PS2A 4ZOEA 1O4UA 1JEZA 3TYZA 1KRAC 1ICQA 3GG8A 1W9VA 1RAKA 3ARRA 1WKYA 1UPPA 1YXYA 4O28A 5K9DA 3UXLA 3NTYA 1GW9A 3ITXA 3PK7A 1DXEA 3SGZA 1S38A 3FA4A 2NV9A 2GYIA 3WQWA 3N1AA 3IUIA 1CGYA 4NRRA 4NJHA 3CUJA 4X63A 4UCFA 3AOFA 4MG4A 2BXVA 2PA6A 4EPKA 2CW6A 2HV5A 1ONRA 4CNSA 4M7SA 4K8EA 3CHCA 1UJPA 1Q66A 4PCTA 5HWNA 1JPIA 2EPNA 3W1AA 1JDFA 4W84A 3MA8A 4CQBA 4N9DA 3MW7A 2BVYA 3AWOA 3WF3A 2VL4A 5DCBA 2UY2A 2Y7DA 3F4CA 2V67A 4YVPA 1TPWA 1IGSA 3NSMA 4FOKA 1B2YA 2PDGA 5BZAA 3GXMA 4JIIX 2YBVA 3ITTA 4CEXC 2CLOA 4HA1A 1A49A 4Z0JA 3TFCA 4I7UA 4UTMA 5AC8A 2QJJA 1YPXA 1XDMA 4QHRA 3T0TA 4B4HA 1R3TA 3G0XA 4N9BA 3W2KA 3ZT6A 3L4UA 3NQEA 3LCHA 2PRLA 3MJYA 4J3TA 1Q63A 1UZ1A 3V5CA 4C7DA 3WY1A 3E6EA 4HT3A 4QTGA 5HPOA 3NNTA 2PRMA 3G24A 4MZ8A 1W37A 4L1GA 3ZJ6A 3MO4A 2FKPA 4WZHA 3UG8A 4HGXA 4DF1A 4LBRA 2G96A 3W0KA 1XV8A 2DUXA 2O9RA 3SRFA 2CLKA 2IXVA 2IPFA 4I3GA 4L1WA 3AYSA 7REQB 3WLQA 1DHPA 1V3KA 2WCAA 1VD6A 1MDRA 4IG2B 2ZWYA 3WD4A 5FCZA 2VRJA 4G7EA 5T9BG 4UQCA 4DBUA 2GGEA 1H1ZA 4UOQA 5CSYA 2DIKA 3CQIA 2ZUWA 4XIAA 1K77A 3M0JA 1DJWA 2J9XA 3KRZA 3WNKA 1H5VA 4XK2A 3FFSA 5A6AA 3LQGA 1Q7QA 2I5IA 2QF7A 4EP8C 2D0HA 3KXQA 3UZWA 4C90A 1JCYA 3CXOA 4IMAA 3VXGA 1B3WA 3SFKA 3ONBA 4DJFD 5K7JA 3VX0A 1X97A 3OHMB 1E5JA 1AQHA 3TYUA 3GB6A 4BS0A 1FA2A 3MO7A 3ERPA 2P3ZA 3VPLA 5E9XA 2XFWA 4M3PA 2NT1A 3CQHA 1UR8A 3MZNA 5A94A 3BL3A 4JFUA 3STGA 4AXKA 3PR2A 3QC0A 1T6MA 3G5EA 3GS6A 4AZHA 2RKXA 4L9YA 4WF7A 2VR2A 4LB4A 4FNUA 4GY0A 2V38A 2YJQA 3DZ1A 1DJGA 3QR1A 4M1BA 3WLJA 1QBAA 1ZB5A 4JIEA 2WMJA 3DH7A 1HZYA 1PO9A 2GPTA 3R58A 4TX6A 4JS3A 4EOUA 1OCJA 3B97A 3H21A 1ECQA 2CBIA 1ZS2A 1U1UA 1UUMA 1ONXA 1PUDA 3IACA 4M24A 1ONWA 4ZQPA 2WAGA 1QT1A 1WXZA 5AHMA 2FZMA 3LCLA 2EQDA 2NSOA 2G97A 1A5MC 4OZOA 1J0HA 3T44A 4FOJA 4AY7A 5EKYA 1HJQA 3HFTA 2FPYA 1DIEA 3G1RA 3WYZA 5I0DA 3WLHA 4XKMA 1T41A 2E4TA 1TA3B 2DJLA 2HVOA 1TG7A 3H55A 2CLLA 3IWPA 4KERA 2V68A 3GXIA 3ZSTA 2FGLA 2OZ0A 1EP2A 3IRDA 4JCMA 3VKDA 2ACUA 1W5MA 3QC3A 4B2DD 2QJMA 1G94A 2DZPA 3VD3A 3O7UA 1VFHA 1YE6A 2YXXA 5IXEA 2WKGA 4Z2HA 3AISA 3HQNA 2OR2A 1XL9A 1K9DA 4MPQA 1EF3A 1X8CA 3NQFA 2PDJA 3TQ0A 1JPDX 2HEJA 4AZCB 3GBEA 4ML4A 1H7RA 1MRQA 2Z25A 3O9NA 1W31A 3XISA 3FS2A 4W8LA 6CGTA 4UZSA 3K5XA 1IT8A 1OVDA 4ATLA 4IGNA 3EPMA 4M1RA 2HK0A 3UG4A 1K9TA 5AVNA 2VP8A 1XIGA 3UF9A 5H8MA 2RAGA 1EUAA 4BWLA 1F74A 3KTXA 2P88A 2BWGA 3QSRA 3N2XA 4MB1A 1DWFM 5KINA 3T07A 5DANA 4AYSA 1FP9A 1AD1A 1OX5A 4G8TA 4O8RA 3HB9A 2X05A 3BURA 2OPJA 3H22A 4J4KA 4NAEB 3C61A 3OA5A 3CK5A 2OSWA 4Y2WA 1A5UA 1BSIA 4DJDD 3SAZA 3SRHA 3DIPA 1CB7B 4BHYA 1WXYA 1LWIA 4LUTB 3W1MA 3W84A 4DNHA 4PUDA 1TUXA 2CZ5A 3H54A 3F5JA 4XVDA 2EG6A 3M16A 2V69A 3VIIA 3C8FA 3RJXA 2G5WA 3UY7A 3RO6A 2ZRXA 3UJFA 3LBOA 5DXXA 5C0QA 2QHAA 4QEHA 3NQMA 5CSSA 2WMIB 3EXSA 2FVKA 4HA4A 1N8FA 4QG9A 2WLZA 4DBEA 1CW2A 3CT2A 1J2BA 2FPVA 1P7TA 4NVTA 2YCLB 2XGBA 1EP1A 4GINA 3TW6A 9CGTA 1XI3A 3FV9A 3P0XA 2WMFA 1R2SA 2HNHA 4AD0A 2ACSA 4PEEA 3I4KA 3TC3A 4MKSA 2GL5A 4O52A 2YDQA 4WUIA 4C6MA 1U30A 3N15A 4Q8WA 4KEMA 1VPQA 2WZTA 3BE7A 2DVXA 1E9ZB 3H8AA 1B90A 3DKLA 4ZE4A 2CNCA 3AO0A 3BUVA 4JTHA 4TMBA 3EWXA 4R7OA 1GQJA 3EOUA 1OBAA 2OQYA 5HUPA 2L5HA 3MWAA 4GUIA 4I8DA 5IHRA 1BF6A 3EA2A 5ABGA 2ZA3A 1P1MA 2Q8ZA 2QDEA 3F4WA 5D02A 4JTTA 3G1DA 1W32A 3SIMA 1PHQA 1WDDA 1FX6A 3KWSA 4IJBA 3KBMA 4UFIA 3RR4A 5FAJA 4LT9A 1W3KA 3ZS4A 5DMNA 3OLGA 4O1CA 4XZ9A 4B5NA 3VIOA 1UP0A 3B0XA 2DT1A 1XXXA 1DIDA 4LB3A 4A35A 1UP3A 4NXKA 4MJ2A 3MUIA 2ZRVA 3O1NA 4ATWA 2O4MA 2XVNA 1V6TA 4DRSA 1TPC1 2OEMA 3B03A 3N29A 3N19B 3TC7A 3DG7A 3UPBA 3UT0A 3BWWA 5H2ZA 3HJEA 3MTWA 1YEYA 4R85A 1NEYA 3BSGA 2DH2A 4HSNA 1WOAA 3BSHA 1RA5A 4L6HA 3WDQA 4HMDA 1PCKA 1GOKA 2WWCA 3QPEA 1YIXA 1POKA 2HVNA 6TAAA 3RYSA 3WUEA 1H7OA 1LL4A 3GDLA 2HPIA 3EX2A 4PCFA 3HMCA 2VO5A 3UJ2A 3GYCA 3FCPA 1I60A 3NQ2A 2IXUA 1UWUA 2F38A 3CHDA 1UD8A 4GJ1A 4DJED 4D8LA 1HX0A 3HPSA 4HVXA 1Q6RA 3M6DA 2DEPA 3GU9A 5F2MA 3B9OA 1FH8A 1R7OA 3OIHA 5HQEA 4JIPA 1XPYA 1JZ5A 4KBXA 3UU0A 3MP4A 5C2GA 1QPKA 4IH3A 2Y62A 4JEJA 1NWSA 2BOGX 1DWHM 2B7OA 1ZAIA 4KW2A 1ZJHA 3OQ8A 2F6KA 2DORA 4UMAA 3HA1A 4Z1YA 1V7YA 1WP6A 3IJLA 2D0FA 2XTKA 2HZGA 1C3FA 2WO5A