4FEZA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
316
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant.
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 107
structure length 316
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fezA00
1LP6A 3KVJA 1NAL1 3VFLA 5LNRA 2E1DA 3KX6A 1XBVA 3W83A 2V5BA 3HG3A 1W37A 3S6DA 4MVAA 5G2HA 3TKFA 3CEUA 3JR2A 2O7SA 3W2JA 1QCWA 1YPIA 1YADA 3W85A 2WOQA 3A9IA 3M16A 4GWEA 3KRSA 3G3DA 3JS3A 3PULA 2FJKA 3IV3A 1MEIA 4K8HA 4NZFA 2EAWA 5C5YA 3VNDA 2QDHA 1E51A 3NL5A 4EOUA 5KITA 1I4NA 1AG1O 2ZDRA 3P62A 3B0PA 4XBKA 3WJYA 5D30A 4CNPA 3LTSA 1WAUA 4N6EA 1IIHA 1W31A 3CHVA 2HTMA 3LHVA 4ONVA 4XQ6A 3W1TA 2ZTJA 1P1XA 3TCEA 3QZEA 5FF0A 1IXOA 1RV8A 3DFTA 4LVDA 1LBLA 5J5RA 1ICSA 3AJXA 5HMSA 2BX7A 3S1WA 1TREA 2W79A 4NNAA 4CCCA 3A23A 5D2YA 2ALDA 1YTEA 1C29A 1Z48A 4Y6GA 1KA9F 5HR7A 2NV2A 3M43A 1KFCA 3TQKA 4K36A 1K7XA 2Q3RA 4MZYA 2ZA3A 3UXAA 1P4CA 3CEPA 4HT3A 3TW7A 3T4CA 2Q3OA 1PIIA 1K7EA 3G1DA 4UMAA 1U83A 4BR1A 3P84A 2Y6ZA 2ZRYA 4LTSA 4S2BA 5G2IA 1OYCA 3CU2A 5BMWA 3QRHA 4DBEA 2X2GA 2QUUA 5IBXC 3G0XA 3FYOA 1MEWA 5TIMA 4K8EA 1FWRA 5IM51 3GDMA 4PH6A 4JGDA 4DF0A 6ALDA 4Q33A 4A22A 1H62A 1H7PA 4DEFA 1SZFA 2E09A 2A21A 4I7WA 1H61A 1LOQA 2IQTA 1F6KA 2FTPA 1X1OA 1LORA 2QCEA 4O19A 2FPTA 1H7XA 3LHTA 3BW3A 4PA8A 3C4UA 5HJLA 1ZAIA 3HPXA 1VYPX 1W5MA 4X3ZA 1KW1A 4CQ9A 3TXZA 4R7JA 4M5PA 1F76A 2EPHA 4Z0SA 2C16A 3NG3A 5CZTA 5AOUA 4OT7A 1X8FA 2TPSA 4P61A 2R8WA 3L21A 4ADUA 6TIMA 2ABAA 1VLIA 2CLIA 3IVUA 4K7VA 4NU7A 3NR0A 5EL1A 1W54A 1JCLA 3FJ6A 5CZSA 3L66A 2NLIA 4Z1BA 2NWRA 3STEA 1XBYA 4WY0B 2Z0IA 2VEPA 3ABOA 1FDJA 1TRDA 3NZRA 4ZMGA 3STCA 4NX5A 1VLWA 1ML1A 1H63A 3W3OA 2ISVA 3O6CA 3EWXA 3QC3A 5DY3A 1EUNA 3PUDA 4JTUA 2YFOA 1R2RA 1WBJA 3F03K 1TCDA 1I45A 2C18A 2GVJA 1OX4B 2GVLA 3E49A 3W72A 3NQEA 1W8SA 1FWTA 3P5ZA 1LM1A 5H2ZA 3TC7A 4MKNA 1D3HA 2B7QA 3B4UA 2ZTKA 1QMLA 2A7NA 4RK8A 5AC8A 1QAPA 3B04A 4GUGA 5HQEA 4JXCA 4TIMA 2C14A 3TIMA 3MBFA 2GQ9A 4NVTA 3GXNA 3TH6A 3UWQA 3FJLA 1XBZA 1G7UA 4O11A 3NQ8A 1TTQA 3DFPA 1R2TA 3L9CA 1XUZA 3NQVA 2JGQA 3OEXA 1LOLA 3IEBA 3HMJG 3G8EA 4HPJA 3TV8A 4N2YA 5AYXA 3HBLA 1XI3A 3OBKA 3BV4A 3DI0A 2A4AA 5AHFA 3LCWA 1BKSA 1VYSX 3LERA 5KZDA 3GB6A 3GKAA 3LCXA 2YZRA 1PCKA 3S8HA 2NX3A 1VHCA 1UUMA 4K6AA 5G4EA 1EIXA 2E77A 4HPXA 3O8AA 1P0NA 1G7VA 5FF2A 3IIZA 1H51A 2V2DA 4I9AA 4RZ5A 1OHLA 1Z42A 1ONRA 5HULA 3C61A 5CG7A 5BRBA 1Q6LA 2J9YA 3QPZA 4R34A 2B4GA 1MZHA 4O1CA 4N4PA 5D2XA 4UTUA 3N19B 4MZ1A 1AMKA 5G4WA 4UTWA 4AF0A 4NJJA 4UMCA 1K8YA 5F2IA 3EXRA 2ZBTA 3W76A 2VFHA 1J5TA 3CLMA 4OWGA 3S1XA 4DXVA 1GTHA 2WJZA 3FOKA 4GUFA 3IIOA 1AK5A 1WDWA 2ZA1A 2V8ZA 5K4XA 1GG1A 3L5LA 3PS7A 1IGSA 4TX9A 2YCEA 3USBA 2Y70A 1V5XA 2H6RA 3LCIA 4FIQA 1D9EA 3VI2A 1G4EA 4XKYB 1OFPA 1LZOA 4JTTA 3SFKA 3NQMA 3S9YA 4CCDA 5A5WA 2F84A 4RV8A 3DHFA 3GR7A 5FI8A 4AHPA 3DAQA 3EX6A 5BW6A 1Y0EA 1OX4A 2YR1A 3B03A 1HL2A 3KHJA 4LUIA 1PVNA 4FNPA 3QMTA 3W7PA 1JQVA 5ABTA 1O5XA 3LXAA 5HWJA 1GT8A 3TSMA 1TO3A 2X1UA 5FF7A 1GVRA 3LI0A 3NQAA 3MJYA 5D38A 1TPFA 3W2LA 4IX0A 2CLKA 2YDAA 3STFA 1PE1A 3GYEA 4FIRA 4JDYA 4K7YA 4ADTA 4JYFA 1B4EA 4WUIA 1H7RA 1XFBA 5FEWA 3I7QA 3THQA 1PCWA 3C2EA 2E6FA 1Q6RA 3FFSA 4UR7A 1LLWA 4JTEA 3W9ZA 1FCUA 1XDLA 4G1KA 4C1KA 3EEGA 2YXGA 2XN2A 3CPRA 1TJPA 3VCRA 1H1ZA 3B05A 3GVGA 3W7MA 3ZWSA 1O4UA 3UZJA 1TTJA 3R8RA 4RZ6A 1T8XA 3BLIA 4UFLA 5EMUA 2XN1A 2P1FA 4UTTA 3T40A 4E38A 3IRDA 3SGUA 2JGYA 3M7WA 5D05A 4Q4KA 2WNNA 5CSRA 4O14A 1TPVA 3HB9A 1WXJA 1KFJA 4S2CA 1TPWA 1QPNA 2YGYA 4N9CA 4XUGA 4M6PA 5AC6A 1I2NA 4MLJA 3IIVA 1LBFA 2GOUA 2HS8A 3FEMA 2ZZ3A 2AGKA 4IOTA 1GTEA 4MFDA 4WOQA 2YSWA 3HGSA 3SW6A 1LCOA 5EA9A 3MI2A 1IF2A 5FEXA 1OX6A 4XKYA 3GK0A 1YXYA 1KM3A 4N02A 5L9FA 4M19A 4BWLA 4UTIA 3DFSA 2UV8G 4GE8A 5G1TA 4O4WA 1SUXA 2LLEA 3OHIA 3LLDA 3SI9A 1W3NA 3BG3A 3NDOA 3T7VA 5LGZA 5HUOA 5K2ZA 1BWLA 5L6UA 1C9DA 2CZ5A 2V82A 3N2MA 3LGEA 4LC6A 2CLLA 3FS2A 4QAIA 2VEKA 1WX0A 4EIVA 5KINA 2CLMA 3W1QA 2R91A 4IUOA 4WQ6A 4NZJA 4FX8A 3TJLA 2ZYFA 4O50A 1U5JA 1VHNA 3M5VA 1SFLA 4IX2A 2PRHA 1F05A 4ZQMA 4FXSA 1Q45A 3W87A 3IIPA 3PC0A 5CPOA 4IJBA 4BK9A 1YDVA 3W86A 2A2IA 4NUWA 1SR9A 2E5CA 4FNUA 1W5QA 4FO4A 1W1ZA 1OFOA 3BO9A 4HKPA 4HNUA 4LY8A 2CLFA 3GXPA 3FKKA 3WJZA 2X1RA 4M7SA 3NQFA 3UY7A 1DQXA 4MUZA 3MP3A 1K3UA 2Y62A 2H90A 3MO7A 5K4ZA 3NQCA 4JEQA 2VEIA 4MFEA 3C2RA 3HQ1A 3LXBA 3SECA 2RDUA 3EXSA 2B0MA 3OG3A 1LOSA 1HUVA 3KOFA 3P61A 2QCDB 2AQWA 1KV8A 4UTJA 3SGZA 5AC7A 4MIMA 1TJRA 4H4IA 1Q6QA 2WSQA 3MUXA 1OYAA 4OU1A 1A5AA 1KM1A 3DHDA 5DY2A 3U8GA 4UTKA 1N55A 1KM2A 3N73A 2VFIA 3P8IA 3NZ1A 3QQ0A 1OK6A 5KMYA 3DFQA 1W3IA 2WNQA 4CLMA 3S1VA 3QQ1A 4JTHA 3LCFA 3TMLA 2J27A 1VC4A 1GYNA 2PCQA 4GXMA 4ORIA 1XBXA 3W7IA 4M7TA 4XBSA 3ABQA 4B5NA 5DLCA 3D0CA 3SJ3A 4FX7A 1QOPA 4AXKA 2ZA2A 1NEYA 4GUJA 4RZ4A 5GVJA 3UWUA 4MJZA 4O16A 3UWYA 5LNWA 2HS6A 4TU1A 4L4MA 3OA3A 5F4WA 5CPLA 3N3MA 2QJGA 1B9BA 1ZFJA 1PS9A 2CZEA 1TMHA 1LRTA 3L2IA 1VR6A 1JJKA 4Y90A 1WBHA 5LNSA 3UWVA 4ZQOA 3LV5A 1JCJA 2V0TA 5I3HA 3LBMA 1W5PA 3LCLA 3TSBA 4Y96A 4LT9A 1VCFA 4LU0A 2V2HA 1QO2A 4X2RA 1OVDA 2FFCA 2NX9A 3EKLA 1QWGA 3W7QA 3L0NA 4E2BA 4TMCA 4NXSA 2CZFA 2O7QA 1K8ZA 2E5BA 4C1LA 3WK0A 2V9DA 3R13A 3G1YA 4KWWA 2G96A 2CLHA 2DU2A 1DOSA 1ADOA 3S5YA 1KM6A 2DP3A 2NUXA 1QPOA 4CNNA 2ISSA 1S5VA 3MP5A 1PV8A 1MO0A 4UCGA 5AYYA 2I9EA 5AHEA 3GDRA 4Z0JA 5G1YA 1XUUA 2D73A 2QAFA 2X1TA 2Y63A 2Y7FA 3N2XA 3PAJA 3NNTA 4O57A 4JIPA 4UTTC 1VZWA 1MXSA 1I2RA 2Q8ZA 3GKFA 3GLCA 2OJPA 4ZQCA 3LTYA 3Q2DA 1W56A 3O6DA 1PHQA 3S5NA 1KFEA 4WZHA 3TDFA 3S1UA 1Z44A 1L6SA 1R2SA 4LV9A 1OFQA 5DXXA 1SU5A 2QCCA 3DKJA 3RLUA 1TQJA 4NJKA 3W7GA 5F2LA 3W1RA 4AHQA 3G1XA 1TTIA 3DZ1A 4M6QA 1JCXA 1JVNA 4UIOA 4OHQA 5HINA 2NUWA 1AW5A 3W6YA 1AL7A 1FWWA 2A5HA 5U4NA 3ZFHA 1CW2A 1YLVA 4PL2A 1LDCA 4MJMA 5F2MA 4RLIA 3U6WA 3W2MA 1KBIA 1F7BA 3W70A 1HFBA 4BWLC 2X1SA 2FQIA 1GVFA 1VS1A 1A5SA 4O54A 1L9WA 1N8FA 4A2RA 1B4KA 2Z6IA 4PFMA 4DELA 4N9DA 3NPXA 4O28A 2VEMA 4JY8A 3LHWA 5LZLA 2E6YA 4ORMA 4MYXA 1GOXA 2VXNA 4MLRA 3E9AA 3NAVA 3PY2A 4PC8A 2A0NA 3QMRA 1QNVA 2ISWA 1RQEA 1MSSA 3W7DA 1FX6A 4ALDA 1YDNA 3KVLA 3QW3A 5DBUA 1QO5A 1VCGA 3LTPA 5K9XA 3W7JA 3G8RA 4BF9A 1WYIA 1S5WA 4LWWA 1M7OA 1FCVA 3W1AA 1OFDA 2A1YA 2Y61A 4Q32A 5BOOA 4H3DA 2TSYA 1BWKA 1T96A 3E96A 1FY6A 2EHHA 3MHFA 1JCYA 1KTCA 3DFOA 3CWNA 3NPVA 4P2VA 2GJLA 1KM0A 1XKYA 3PBUA 3PG8A 5D32A 1KV5A 1XC4A 3H55A 2DZSA 2PRLA 1EWDA 3TR2A 4O53A 1YXCA 4WY0F 4OE7A 4U28A 3BK0A 4FNSA 5I3IA 3QEZA 4LS0A 2ATSA 4DF2A 4UFKA 3HJZA 3NL3A 3L5MA 3QJAA 2OMAA 2ABBA 3M44A 2OT1A 4ZQPA 2FLIA 4I7UA 1X1ZA 4O10A 1PHWA 3S5ZA 4DBDA 2GUUA 5TBOA 2XFWA 3NXFA 2ZZ6A 4M6VA 4AEOA 5DCEA 3P81A 1ME9A 3QH2A 1L6WA 1SZGA 1TPC1 4GBUA 1FXQA 4QNWA 4IXXA 3W7RA 4JX6A 3EWYA 4O52A 1W5OA 4HSOA 4JS3A 4YL2A 3INPA 4XZ9A 5G2WA 5CPMA 3KAOA 4N9EA 3C2OA 3GDTA 3F4WA 2R94A 3OVQA 1X6UA 2Y85A 1ZCOA 2OX1A 2QUTA 3HG2A 5DCBA 4Z1CA 3TXVA 5CZJA 1XDMA 1LLZA 3Q37A 1SO6A 3UD6A 5LNUA 2DORA 2Y7EA 3TW6A 5AHMA 3GDKA 3YPIA 1FCBA 1J2WA 1AL8A 3G0SA 5LSMA 2A7PA 2NV1A 2X16A 2QJIA 4WY0A 4NJGA 4HNVA 1CI1A 1EPXA 1SO5A 1O94A 1TPDA 2PE4A 4DPQA 3W1UA 5KZMA 1G4PA 5FF3A 2WSRA 2G5WA 3UNDA 4YCOA 3O1NA 4LRSA 1NVMA 2QCLA 3G0UA 4DO6A 1CX9A 3HPZA 5AHLA 3BPWA 1ZAHA 3BARA 1Q6OA 2VELA 3C3NA 2TRSA 5HUPA 1VJIA 3DBPA 4MPQA 2BTMA 1FBAA 4O8RA 1DBTA 1OYBA 2NXIA 3I7SA 4TMBA 2C13A 4UFJA 5DCDA 5G5IA 1GYLA 1QOQA 4JTFA 3HG5A 4KKXA 4QM1A 3HO8A 3LOTA 3VE9A 4O1AA 1GG0A 4O1BA 3V1PA 5LHFA 4UXDA 3O05A 3JRKA 1G6CA 3MW7A 4OV9A 3WFAA 1OFRA 3TU9A 1LROA 3CIWA 1DVJA 4LRTA 1KLZA 2ZRZA 2GJNA 4JICA 2F7FA 4IPIA 3S42A 3G1AA 3Q58A 5EY5A 3LBCA 2WQPA 5TQLA 1SO4A 5LHEA 4QITA 4WXYA 4PTNA 3G3MA 2ATMA 4AHOA 3LI1A 3EWUA 3M41A 1T99A 2DZWA 4D2JA 5D33A 1TPUA 3ELFA 3LM7A 4GUHA 1SO3A 4ML9A 4UTMA 3CC1A 4XWUA 2ZRWA 4LVGA 4AB4A 2EGZA 3GZ3A 2TMDA 3TK7A 1S5TA 3M0ZA 1VYRA 3P82A 3BG9A 1K02A 3EB2A 3W23A 1JUEA 1JUBA 4A3UA 3UY8A 4IMFA 4RXGA 1YXDA 5AN7A 3KVMA 3IVTA 5KTLA 4LS2A 1NSJA 1WA3A 5F2GA 3BGJA 3BG5A 1YPFA 3G1HA 5LNVA 4QJ1A 3TFCA 5D04C 4DPPA 1A5CA 2QKFA 3HGOA 4N4QA 1T0OA 3PB0A 5E93A 3HF3A 3WJSA 5KZEA 5C54A 3PUEA 1JCNA 1HTIA 1LYXA 1W3TA 3M9YA 4RKAA 3EWZA 3GAKA 4Z1DA 4POCA 5IBXA 3WK1A 1LBMA 1IXPA 3DH7A 4JN6A 1B57A 1D3GA 1S3HA 4ICNA 2J24A 1G67A 5C55A 3EX2A 3F4NA 3DXIA 3HOJA 1V7YA 2P0OA 4GJ1A 1TRIA 1M5WA 4A2SA 4K39A 1QPQA 1I2PA 2FDSA 4Y8FA 4QIUA 1UUOA 4HSNA 2YW3A 5I3KA 1TPB1 3RU6A 1DJQA 5I3GA 1UASA 3EXTA 3RFAA 2BSLA 2J9XA 1EA0A 5SWUA 4IGHA 3P60A 1RQHA 4UNKA 3C0JA 3Q94A 2DZTA 1OF6A 3FA5A 3OVPA 4DO5A 3H54A 3W75A 1JR1A 3LLFA 1FDZA 3N34A 3WK2A 2E5DA 3HG4A 3I65A 3W7HA 2HSAA 4UTLA 3LRMA 3IGXA 5A8GA 1JCMP 2GQAA 3LX9A 4O17A 1JQXA 1BTMA 4BI6A 3W07A 3G1SA 5EKYA 4AWUA 1K7FA 3EX3A 3M5ZA 2W6RA 3N9RA 3UPBA 1O5KA 3QSRA 2TYSA 3H53A 5BMXA 1RPXA 1SFJA 4KFNA 4KFPA 1UJPA 3NYZA 3KRZA 3A24A 4FF7A 4JX5A 4ADSA 2V2CA 3PBVA 3PBWA 3MYPA 3ZS4A 2ZFAA 1JUKA 1I2OA 3R89A 5AHIA 1TQXA 5FF4A 3TQ0A 3LDVA 1KM4A 4JTJA 4OV4A 5E1QA 1B3OA 2EKCA 3PSWA 3LV6A 3ZWTA 3UWZA 3PVFA 1F6PA 4FXRA 1BEUA 3W1NA 5C6MA 1KTNA 4NQ1A 5HWMA 3O07A 4TR9A 2FB2A 3QMSA 3TE9A 5DN1A 4WXZA 4UTWC 3GXTA 1KLYA 1FDYA 2NXHA 3FKRA 5K9CA 3KXQA 1OFBA 4LUJA 3CQ0A 3QW4B 2BLEA 1UB3A 2RHGA 1TB3A 3DI1A 2VFGA 3G24A 3W73A 2VC6A 2FB3A 4MYAA 1JULA 5AFDA 3EWBX 1XXXA 1TV8A 1VQTA 1HG3A 2VENA 1OF8A 3AO0A 1PL9A 1SSGA 5MHBA 1GJPA 4LVBA 1WOAA 3M6YA 3BGGA 5EYWA 2ZZ7A 2RKXA 3OIXA 3I7RA 4FHAA 3W1MA 3QM3A 1H7WA 4GRSA 2WKJA 3BLFA 2FIQA 4KWVA 4MOZA 3V75A 3E02A 2CFFA 3O15A 1Z41A 3LHZA 3QPYA 4FEZA 4JTKA 3I68A 1M6JA 1MEHA 4JD4A 1HO4A 4OGZA 3HIJA 5D2WA 1VGAA 1F74A 5CGQA 5DXYA 3WK3A 1A53A 3NOEA 3GDLA 3NM1A 4AWSA 1TIMA 1N7KA 3HGRA 4JTIA 4FNQA 5E0KA 1O60A 3ATZA 3W74A 3TUUA 2OCZA 1GQNA 1R30A 2H8ZA 1KTBA 2RDWA 4GFSA 3U2OA 4DO4A 4X9SA 3E0IA 3A22A 2Z6JA 1L6YA 1DHPA 2J88A 4R53A 3VE7A 3NQ6A 3LCHA 5AHNA 4UFMA 4CNOA 1SW0A 3O16A 2PC4A 4Z08A 2OZ0A 5F1VA 4YMZA 5T26A 2QCDA 3UXDA 3BLEA 2WV8A 2WNZA 2JKAA 1C8VA 3TAOA 3W7KA 3TAKA 1NF7A 2E6AA 2NXGA 2E68A 3MYOA 3ZR4A 2PURA 1F73A 4IMEA 3CTLA 3T55A 3P67A 5LKYA 2PRMA 3LHYA 1G4SA 3RF9A 3E12A 4HHPA 4GNJA 1ZALA 1TSIA 4H6KA 4Z1AA 2RH9A 2GVGA 1L2UA 4HN4A 3ABSA 3NM3A 3TC6A 4J9JA 3M5XA 2B7PA 3RNDA 3SR7A 3C2VA 2C6QA 1EEPA 4RCXA 2CU0A 3SIZA 1OK4A 1ZENA 3MMTA 2AAMA 3GNNA 4JYDA 5DBTA 1GVSA 2YYUA 4QISA 3PBYA 3MI6A 1XL9A 3LCGA 5D2VA 2VFFA 3C8FA 1TPEA 2Y89A 5CZ0A 3DKLA 1EP2A 1OFAA 1G69A 2KZHA 3NVTA 3PUOA 5D03A 4ZQRA 4Y9AA 4PL1A 4NNCA 4AAJA 2ZZ2A 3UZ5A 2Q8LA 2VFEA 3GIYA 2NZLA 5J5DA 3TSDA 3NL2A 5CPNA 1J4EA 4O13A 2CZDA 5F4XA 2YFNA 3W7OA 3PWAA 2QCGA 4RR4A 2J6XA 5HR6A 4PCFA 1XCFA 4IMCA 3KVKA 2NX1A 3P7YA 2Y88A 5EBUA 2GQ8A 2VFDA 3NEVA 3MHUA 4S1FA 3W1LA 2QUVA 4UUIA 5D2TA 1K03A 2WSYA 1SW7A 5I3FA 3NQ7A 4AF0B 1H1YA 4CQ8A 2BZNA 3QF0A 4N6FA 1YTDA 3UYCA 3MWAA 3B0UX 4BI5A 2A6NA 2ZCGA 4UC5A 1XM3A 3P5YA 3UWWA 3NGJA 4JTLA 1EWEA 1OJXA 1Q3NA 2V5LA 3HGJA 3NL6A 1FWNA 4YLWA 5I3JA 3OVRA 5F4SA 3TQVA 3I6RA 3GAYA 3GNDA 1OFEA 2QR6A 4IXHA 4L4LA 1I2QA 2QF7A 3NO5A 2JKPA 2C15A 1QFEA 3EX1A 2ZZ5A 1ICQA 1K8XA 2WO5A 3O6YX 3R5EA 3IGSA 2BWGA 4E0CA 3UPWA 4UFIA 1RVGA 1LTDA 1SW3A 5DELA 5K3VA 3NQDA 3QFEA 2X30A 2A6LA 2QCHA 3WJXA 3TX9A 2H3DA 3LB0A 1AW1A 4GC4A 3CWOX 1AW2A 1KFLA 4AH7A 4X22A 3PF3A 1UCWA 1NFBA 3KRUA 3L68A 4IMGA 1H60A 1A5BA 2Z2UA 3FLUA 3SZ8A 3G1FA 4OQVA 3C56A 1R47A 5U7SA 4BI7A 3KFTA 5CSSA 4JDBA 3BW4A 1TPH1 3THAA 1WQ5A 3W2UA 3T78A 1H7OA 4O1DA 3B8DA 4LS1A 2I14A 3M1ZA 4O0ZA 2R14A 3MI3A 3NPUA 5BNKA 2E6DA 4K38A 4O0KA 7TIMA 3W1PA 2CLOA 1EP3A 3C6CA 3FYPA 4EF9A 3GR8A 1ME8A 4RJEA 1QR7A 2CW6A 1TV7A 4ZL1A 4LOCA 5AB3A 2W0UA 5CKSA 3R12A 4ZVJA 1TTPA 2V81A 5EPDA 4WJEA 3UQNA 3IIXA 2H3BA 5D37A 4EWND 1SSDA 4K37A 2Y7DA 4LVFA 1H7NA 3STGA 3W1XA 2RFGA 3RK8A 3G22A 2WPBA 4CQAA 4IQLA 4HIBA 3L67A 4HNNA 1FCQA 1X7FA 4RX0A 1YDOA 2QCFA 1R46A 1FQ0A 3W84A 1OX5A 1I8JA 3W2KA 1WV2A 2QJHA 2YX0A 3CIXA 4MZ8A 4YXGA 3RMJA 3W2NA 1KM5A 1KFKA 3DU0A 4JR5A 3G1VA 1VH7A 4JIQA 2JKEA 3TROA 3EWWA 5LGXA 2QAPA 2DZXA 1QDSA 4JY9A 4QSHA 4FNTA 2ZQ0A 3M5YA 4MY1A 4O18A 2QDGA 4LVAA 3EX4A 3LHUA 1ZAJA 2OT0A 3CB8A 2QCNA 3SSJA 1VCVA 3A5FA 2J9ZA 4NJHA 4UNLA 1OABA 3DGRA 1KFBA 2RDTA 2G97A 5FEPA 1GZGA 2B7NA 2ZZ4A 4KFOA 2BXVA 4XTDA 3W7EA 4DQWA 4NJIA 4NX0A 2CLEA 2DZUA 4FX6M 3C2FA 1TV5A 1RD5A 1VPXA 2VOMA 1IIGA 2Z1BA 5AYZA 2G95A 3S5OA 3B06A 3L65A 4UR8A 2C19A 4O4VA 3VKJA 3NQ2A 1IXNA 1YTKA 1DJNA 4IWWA 3S0CA 3G18A 3LRKA 3O63A 4AVFA 3P8JA 4JX4A 1P0KA 4NT0A 1ZJIA 1DV7A 4A29A 1SPQA 3IGUA 1W5NA 3ABRA 5C2XA 3MBDA 1ICPA 2DZVA 3L0GA 2C3ZA 4RXFA 4EF8A 2H8XA 2DJXA 1DORA 2NUYA 5HNRA 4LV4A 4TO8A 4JTSA 4MY9A 1WOBA 1HO1A 3CM4A 4QQ3A 1SZNA 1ZY9A 3EKZA 3L0KA 2ZZ1A 3NA8A 2YW4A 3N9SA 2QCMA 4FNRA 4LC8A 4ZZ9A 2Y7GA 3TNOA 1DQWA 3W7LA 4E2DA 1LRNA 2FPVA 3M47A 4AWTA 4ZQNA 5HWNA 4U4MA 3DENA 5F1UA 4UMBA 1JRBA 1EB3A 4IMDA 1P5BA 4PODA 3TA6A 3B0VC 2FPYA 4WD0A 1EUAA 3C52A 2EF9A 3W22A 1UBSA 3TJXA 1M7PA 1THFD 4JTGA 1W0MA 4NXKA 3NPWA 4GUIA 1ME7A 4W9TA 2A85A 1O95A 2NWSA 4LNYA 3ATYA 4YWIA 1A50A 5KSWA 1FUYA 2V30A 1TYGA 5FEZA 3W7NA 3T44A 3GX9A 2ZRXA 3F1QA 2DZPA 3P80A 2P10A 4WX2A 3W88A 1DL3A 1EX5A 5H91A 2C1HA 4AMAA 4BFAA 4UTHA 2XN0A 4QNEA 2YPIA 4EVZA 1ALDA 3A21A 2DJLA 3L5AA 3A5VA 4HNTA 3CT7A 1DKWA 4NNBA 4CCEA 3R2GA 3ANYA 2HMCA 2JBMA 2CWNA 4YCPA 1KBJA 3BVJA 4I7VA 4MY8A 4JNMA 3PSVA 3P74A 3N14A 2C0AA 4WOZA 3W7CA 4DF1A 5K7JA 4A21A 1NF0A 4XTIA 4JYEA 3K30A 3IVSA 2VKZG 1SQ7A 1H5YA 3PB2A 1F2JA 4UFHA 5FESA 3BW2A 1GEQA 1IXQA 3PM6A 3HPSA 3TFXA 1GVQA 2ZRVA 1ZHAA 2GPTA 1RZMA 1G4TA 1H50A 4O15A 8TIMA 4FB7A 2B7OA 3QYQA 4LW7A 1LRQA 3QSTA 3TMQA 4IPJA 1SZEA 1FWSA 1RR2A 4N9BA 3NQGA 1JRCA 3MHGA 3DFNA 2A7RA 2YYTA 3FIGA 1QPRA 2QEZA 1VRDA 3LRLA 5D02A 3LXCA 4OBTA 3PR2A 3MP4A 4O12A 4PEKA 1RQBA 3WJWA 2I1OA 3O06A 4R33A 5K9DA 2JK2A 3RLVA 1YYAA 3SY5A 1GVOA 3PG9A 1OG0A 1GWJA 1ZNNA 1F5ZA 1FXPA 3W71A 1GPWA 5D09A 2ZRUA 1EP1A
chains in the Genus database with same CATH superfamily
1LP6A 4A3YA 4I8YA 1NAL1 3VMOA 3QLLA 2CESA 3MZNA 1EJTC 2PP3A 2RGMA 3W83A 1W37A 3MZ2A 3I6TA 3S6DA 4IUGA 4A8RA 2FFIA 2OR2A 5GNYA 4DAIA 8CGTA 1VJZA 1V6WA 3SQLA 5IFTA 4P8UA 1JG9A 3PULA 2FJKA 1SMAA 2YL6A 4MWAB 2EAWA 2QDHA 3NOYA 2FVKA 1PX4A 1RY0A 2F6KA 1BGAA 5D30A 4ERAA 1WAUA 2YCLB 4N6EA 2QJNA 1O5RA 3F5KA 3I4KA 1IYXA 3RILA 1IIHA 3LHVA 4ONVA 4XQ6A 4DO7A 3MSDA 2ZTJA 3QZEA 1T8QA 4LVDA 2EO7A 5HA7A 3U57A 4W8AA 5HMSA 1CENA 4YU1A 4ZOEA 3DHUA 4HU0A 5D2YA 1Z48A 3M43A 1KFCA 3M46A 4MMWA 3VGGA 2ZA3A 3UXAA 3N2OA 3KBMA 1FWHC 3TW7A 1JAEA 2OZTA 3HV8A 4DWSC 3B97A 4DHGA 1U83A 3DG3A 3E0LA 3P84A 1F3WA 2HZGA 5G2IA 1HX0A 1G5AA 4ZO8A 4TXEA 3M07A 1OBAA 3G0XA 3VNZA 1BSLA 4V1YA 5TIMA 4NHVA 4HU8A 1B2YA 3AMKA 2NQLA 1TKKA 3TYCA 1H7PA 4GX9A 4GCAA 4FP1A 2E09A 4QGCA 2A21A 5CG0A 5EMLA 4YWSA 1V6YA 2IQTA 2YIHA 3MKCA 3KL5A 1XYFA 3CUGA 2GGIA 1HN1A 3CNYA 3TXZA 1F76A 4WIWA 3TYZA 2XVLA 1E1EA 1E6NA 2EPHA 7A3HA 4TX8A 4B9ZA 4DBUA 1PZ3A 4GFIA 1X8FA 3BE7A 2TPSA 1PYFA 4P61A 5A6TC 4C6JA 1LG1A 6TIMA 3GNOA 3IVUA 4EPDC 2VRQA 3VIGA 4NU7A 3TTEA 2ACQA 3FJ6A 5CZSA 2NLIA 2F6UA 2VEPA 5HDRA 4JTAA 3EMCA 1ML1A 3EDEA 3LN3A 2ZOXA 2ISVA 1A5MC 1H41A 4JTUA 1UPMB 1R2RA 5CH9A 5KZ6A 3TYEA 4GZIA 3QPEA 1TCDA 4AEEA 4DZ5A 1NY1A 3LYEA 2P76A 4B91A 3KZPA 3NQEA 3LA4A 4R7WA 4PSPA 4MKNA 4AY8A 4PTVA 2B7QA 1M9HA 2ZTKA 4E4PA 1QMLA 1QAPA 1CLVA 4JXCA 3WNLA 5C7VA 1XLBA 4NVTA 1MFVA 2W67A 4JL2A 1T5AA 1JIBA 4O11A 1VFTA 1NWSA 4QLJA 3OEXA 3TWAA 3VZZA 3M0VA 4DVOA 3K13A 1XICA 4HPJA 4JCLA 4FR1A 4XD6A 1XI3A 2DEPA 1TA3A 3PFRA 3GKAA 4BJHA 4KW2A 3LCXA 1AQFA 2MANA 2NX3A 4CU6A 5DO8A 4PEEA 2A3BA 3O8AA 1P0NA 2G3JA 5I3DA 1H51A 2V2DA 4I9AA 5JVLA 1V77A 4XZMX 4JNYA 1Q6LA 4GYJA 4KCUA 2OX4A 5D2XA 4UTUA 4JFSA 1O12A 4UTWA 2J4GA 4NJJA 4XIMA 2GJXA 4AC7C 3EXRA 5A94A 4FS9A 4PSRA 2F2KA 1GTHA 2WJZA 4GUFA 2V8ZA 1GG1A 1ZBCA 4Q4MA 4QXIA 4GQRA 1R9YA 3ONBA 2Y70A 4AIUA 4B5WA 1DWIM 3LCIA 4FIQA 4GIEA 4QX4A 1P43A 4XKYB 1QT1A 1R6WA 2ZXAA 3QV8A 4J35A 1CXKA 5A5WA 2GQ3A 1CLXA 3GR7A 4PUNA 3DAQA 2J25A 3BOFA 3EX6A 3W53A 4PMYA 4G8TA 1QW9A 3RLGA 2ZX8A 4P5UA 1GT8A 2O55A 4J1OA 5FF7A 3AWOA 3LI0A 3WQ8A 4ZB0A 5ABFA 3FK4A 5EMYA 3W2LA 3GFXA 3CQHA 2XDFA 1OT1A 1B4EA 4F2TA 3R11A 1H7RA 3VGEA 3I7QA 3THQA 4H2CA 3C2EA 1XRFA 4FI4A 5LXEA 3W9ZA 3DGBA 1MNSA 4DN1A 2AL2A 4G5DA 1KKRA 1FCUA 1XDLA 4ATDA 4PRTA 3GXIA 2YXGA 5BU6A 4JHOA 2R9RA 3GTFA 1DP0A 3S6TA 4W84A 3R8RA 3BLIA 5EMUA 3VDCA 2P1FA 3WG6A 1B3VA 2V3DA 4ROQA 3L4ZA 1FWEC 2I5QA 2GVYA 3RHGA 5CSRA 1W1YA 4O14A 1TPVA 3HB9A 1B0IA 1YRRA 4YTRA 1KFJA 3CUFA 4XUGA 4HK5A 1WZMA 3URQA 4IJCA 5AC6A 3O9NA 3CL7A 3BLDA 1Q6EA 4UR9A 3BSGA 3OIHA 2HS8A 3GWQA 4KCWA 2AGKA 1M7JA 3EOSA 1ISXA 3MV01 4WOQA 1LCOA 1V6UA 2YOCA 3ITCA 1VFMA 3W28A 5A8OA 2PGRA 3WLHA 3PZMA 3N3TA 1XINA 4BWLA 3BSHA 3DFSA 2QS8A 1SYTA 3ZT5A 4O4WA 1SUXA 4HMNA 2LLEA 2CBVA 1W3NA 3BG3A 3WDQA 4C1NA 1RY8A 4TTGA 1Q13A 1C9DA 3DYPA 2CZ5A 4H9VA 1IWBA 1WDQA 4CEXC 1A49A 3M0YA 5IHRA 5AYIA 4QAIA 2ZX5A 2VEKA 1HIZA 3WF1A 5E6YA 5KINA 2CLMA 1E1CB 2R91A 3UG3A 3ARUA 1DQUA 4FX8A 4AIOA 2ZYFA 3EMQA 1MNZA 3BQ5A 4LANA 1U5JA 1VHNA 5CAKA 2VDIA 4E8GA 4IX2A 1F05A 4JFVA 4ZQMA 3VM7A 4FXSA 4K68A 3H70A 3W87A 2VCAA 3IIPA 3PC0A 1ZZMA 5I0DA 1G0CA 3W86A 1QTWA 2E5CA 4J27A 1W1ZA 1ZLPA 2DPEA 3BO9A 5I02A 4HK6A 4HA0A 3GXPA 2PP0A 2XH2A 3EOEA 1G94A 3OOQA 4QP0A 3MO7A 1LQAA 1EZWA 3N15A 3LXBA 3EXSA 3S3GA 5JBEA 3OG3A 4GLEA 1YW1A 3BZGA 1PTDA 1KV8A 4UTJA 3SGZA 5AC7A 4Q8PA 2DFAA 3THUA 1P7TA 2Z7GA 4IL2A 4OU1A 2IKJA 3DHDA 1EJUC 4UTKA 1D7FA 1ZBKA 3NZGA 1KM2A 5DMYA 2VFIA 1DJGA 3LG3A 3AQUA 3M0MA 3GTIA 1W3IA 3MKKA 4LUSA 3SN4A 4CLMA 2JF6A 6PTDA 2CBUA 4GXMA 1VC4A 1GYNA 1AJ2A 3E0WA 2GDVA 4XBSA 4ZENA 4E4FA 3D0CA 3M0KA 2ACUA 2QHAA 1GOKA 2I5IA 3TN6A 1E73M 4RZ4A 4O16A 3UWYA 1S2AA 2HS6A 5HBFA 3DN5A 3ZR6A 1XIHA 1XLFA 3FSTA 2QJGA 1B9BA 2ZXQA 3CB3A 4AX6A 3R4IA 1XKJA 1LRTA 1P6CA 1VR6A 4Y90A 4KRZA 1UKTA 2PSNA 3LV5A 3UBPC 1NELA 2V0TA 5I3HA 1W5PA 5M17A 3WQ5A 1TR1A 1KBLA 2PDHA 3R8HA 4PUDA 4XZLX 4PMVA 1C91A 5HPCA 2V2HA 1QO2A 3EKLA 2FFCA 1RBLA 1JPKA 2VWTA 1GVYA 4BQ5A 1K8ZA 1E6RA 3PPGA 2F61A 2G0WA 3FEQA 1P6BA 3R13A 3SCOA 1ZJHA 2CLHA 5KETA 3BAYA 4CNNA 4D72A 1PV8A 2WJDA 3UNTA 3DFHA 4EWJA 4UCGA 1EKOA 4DJDA 2DIJA 7REQB 5AHEA 4Z0JA 2E25A 2VVNA 2D73A 2X1TA 3PAJA 3NNTA 1W9VA 4O57A 3K2GA 1MXSA 1XIDA 2E0PA 3N4EA 3GLCA 2GSJA 3Q2DA 3S2NA 1JYVA 3A9BA 4HZ8A 1UIOA 5H8PA 1TCMA 1S38A 3GZAA 4UQEA 2WZHA 3DYOA 1TWZA 2VD8A 4DYJA 2PTYA 4AZCA 1Z44A 1L6SA 2GJPA 4LV9A 2OWWA 1OFQA 1SU5A 2QCCA 3DKJA 5CBBA 1TQJA 4I5UA 2F2HA 3UGVA 3DZ1A 2NUWA 3E2QA 2GZXA 4MSSA 3UYIA 4L5ZA 1AL7A 2YL5A 5U4NA 2FH8A 3LM3A 2NV9A 4FALA 4PL2A 1QK2A 3WENA 1KBIA 1F7BA 3WL0A 5FJUA 1GVFA 4IFRA 3WLIA 2Z6IA 1RJRA 3EWDA 4H8VA 3LHWA 5JUVA 3OLGA 3LGGA 1A5NC 2VXNA 4FXJA 5TD4A 5FJPA 3NAVA 3PY2A 3N4AA 1CBGA 1AFSA 2BNJA 1H09A 2A0NA 3IJ7A 3BOXA 1F4HA 1MSSA 3WY1A 5EMJA 3LTPA 1CT5A 1E4IA 2HVOA 1J10A 4BF9A 4Z42C 1M7OA 2D20A 2CHOA 1TV3A 2WZTA 3MC5A 2A1YA 2WMKA 1X7IA 4Q32A 3VCNA 4X2PA 3BWWA 2YCJA 1BWKA 3MHFA 1JCYA 3CWNA 3NPVA 3PBUA 1XKYA 3PG8A 3AYSA 4Q8WA 4PFHA 1E72M 5H8MA 4AEFA 3HQPA 1JYXA 3B0YA 3TR2A 1YXCA 1DIEA 1E56A 1I75A 2PWFA 4OE7A 2OODA 3KLKA 4PMUA 4DWDA 3BK0A 3WIJA 1G9HA 3AMCA 4UFKA 3HJZA 1HW6A 3L5MA 3WD2A 5C9UA 1VBGA 2ABBA 3ES8A 1OCBA 2OXNA 3M44A 3RPTA 2QDDA 3SUTA 1OD0A 2E28A 2XFWA 2J7DA 2ZZ6A 1XSKA 1MUCA 3OZYA 1SZGA 4CEUC 3W7RA 3WDRA 4JS3A 3SB0A 4JHZA 4AC1X 4XZ9A 1QASA 5CPMA 5F7UA 3KAOA 3VOGA 3C2OA 4PULA 4RDZA 3VOIA 3RRAA 1UOKA 1E6PA 3HFYA 1ZCOA 5A6LA 3UD6A 1XRVA 4PMXA 4J2MA 3IANA 4J40A 1FCBA 1GOWA 3G0SA 3IACA 3SY8A 4L6DA 4WY0A 3MSGA 5AECA 1SO5A 1IEIA 4HMCA 3W01A 1TPDA 3BANA 2PE4A 2BB0A 3LU2A 2GYIA 1RBAA 1G4PA 3LEPA 4LPCA 1HJQA 1LT8A 3IWPA 1SZRA 3BPWA 4IG2A 2BY1A 1J01A 3ZYZA 6CGTA 3PPHA 1IQ8A 2WK2A 3P3BA 1FBAA 3VK5A 4CUCA 4TMBA 1GYLA 1MQPA 5T8GA 5A8QA 3HG5A 4EKJA 3VE9A 4ACZB 3VD5A 1B3XA 1GG0A 4O1BA 4NY2A 2NVAA 1VB9A 2FGZA 3JRKA 1HGWA 3ZO9A 1M68A 4EPKA 3CYVA 3CIWA 4LJ3A 2XM1A 3WMBA 4IIGA 1XYBA 2ZRZA 1RLDA 2Z27A 2F7FA 4IPIA 4YN5A 3E0FA 2WQPA 1XW8A 1EBHA 3AXXA 3G3MA 2ATMA 1AQ0A 2WC3A 4MAZA 4KESA 2I7GA 5JIWA 1RBOB 3UR5A 5IRPA 1NP0A 3EOUA 3GFZA 1QNQA 2ZRWA 4GQQA 2TMDA 4Y9PA 3P82A 3BG9A 6REQA 1JUEA 4GXPA 1YMYA 1UP3A 2QPXA 2BOFX 3C0LA 3EMZA 1IT0A 2E1WA 5KTLA 4HPNA 3BGJA 3BLKA 2OEJA 4QJ1A 2GK1B 4J3ZA 4DPPA 2DT0A 4DWSA 3ONCA 4N4QA 2C71A 3WJSA 4OFCA 3F2DA 3RM4A 3E6EA 4YYFA 4RKAA 3M9YA 3GAKA 3GC2A 1J6OA 4G56A 3AXIA 3DIPA 2HPIA 1D3GA 1S3HA 2PDGA 1L8NA 2J24A 3OO2A 3V7PA 3F4NA 4P8VA 2ACRA 4AZ6A 1DJWA 4A2SA 4K39A 2PGFA 4I9MA 1WUEA 4XSMA 2FDSA 4Y8FA 1UUOA 2YW3A 1DJQA 2NLYA 1E9ZB 1EYEA 1UASA 2A3CA 1IR2A 3PZNA 4H8HA 4M1BA 1EA0A 5SWUA 5CPQA 3VFCA 3MCOA 2PLCA 1OF6A 4I90A 2HV5A 3FA5A 5A6SA 3OVPA 4ZR8A 1EC7A 3N34A 3WK2A 1US2A 1UWUA 1TV4A 2CNCA 2E5DA 2G3IA 3HG4A 2ZKMX 1M41A 3LRMA 4AXNA 3P0WA 2OSWA 3OTRA 1BTMA 4BI6A 2CXGA 3QYSA 5EKYA 4A8IA 4Q4QA 4S3KA 4QBXA 2W6RA 3QV6A 1O5KA 4INFA 4EPEC 3MSRA 2FYMA 4WSKA 3H53A 5BMXA 4XAPA 1T41A 3A24A 2ZDSA 1RH9A 1LT7A 3CTTA 3WLTA 5HNUA 2WMIA 1XLMA 4W8LA 2VR5A 4IGNA 3PBWA 1L0PA 3MYPA 1HP4A 4UQ9A 4GINA 2VRKA 3A4XA 4J4KA 1I2OA 5AHIA 3T81A 1DHKA 3DDMA 1O1HA 2ZUNA 3OBEA 5BWAA 1KM4A 4JTJA 3QXBA 1AMYA 4Y2WA 3S5SA 3GNPA 1E6ZA 4UOQA 4AQLA 1UA7A 3N1AA 2DUZA 3GG1A 4TR9A 5I00A 5DN1A 4H00A 4KIEA 1W3LA 3T8QA 1DIDA 1DWAM 3GXTA 1FDYA 5H8UA 5ECVA 3QW4B 2XH0A 2BS9A 2VC6A 4L9XA 4LEQA 3P93A 4AD3A 4Q8QA 4QSFA 1JULA 1Q8AA 2YZ5A 3PJXA 1ISVA 3ZOAA 2VENA 1HJUA 4ERIA 3N17A 1NOUA 4R88A 4LVBA 1WOAA 3BGGA 3TP4A 2RKXA 3I7RA 3NSNA 4FHAA 2WXDM 2DVUA 1H7WA 4GHRA 4KWVA 3VIHA 2DVTA 1CIUA 3AXMA 1GCYA 1CECA 3LENA 5HNNA 3LHZA 3CPUA 1CXHA 3I68A 1M6JA 3SCRA 2O9TA 1HO4A 4YHEA 1F74A 1Q6FA 1F9CA 4O1EA 3NOEA 4PGLA 1VEMA 1FWFC 3PZUA 5I78A 4JTIA 3TUUA 2OCZA 3UG4A 1XGZA 3H7VA 1DE5A 1V0NA 4B3ZA 1R9ZA 3AS0A 3E0IA 3TVAA 4R53A 5FAGA 3R94A 3LCHA 1U1JA 2HNHA 1BHGA 1SW0A 4C7FA 2OZ0A 3WF0A 4YMZA 3RG6A 3VD3A 2QCDA 3UXDA 3BLEA 2WV8A 2HCVA 2WNZA 3WD4A 4LAOA 4US6A 2E68A 3S47A 4QHRA 3WYZA 5CJ5A 3BCFA 4Y7EA 4AD4A 1J0YA 1V03A 3T55A 3RPDA 2VL4A 4F0SA 1Q66A 4LUYA 4MF4A 2X7WA 1TSIA 3AIEA 4QEHA 3ZMRA 2CBIA 3TC6A 3LD5A 4E6MA 4J9JA 2IPGA 3SGGA 3EB4A 1EEPA 4D6GA 1OGSA 1LJYA 2G4JA 3GNNA 4AVOA 1GVSA 4I6KA 4EAMA 4ZO6A 3MI6A 3MU7A 4DBWA 2Y5SA 2D0FA 3ZLFA 1QU4A 3MVIA 1S2TA 3NVTA 1FWCC 2QZRA 5FIPA 4NNCA 4AAJA 3UZ5A 3NURA 3TSDA 3T0CA 1V4YA 3R6IA 3T2QA 3ZJ6A 2CZDA 2YFNA 2G3FA 4PTDA 4UZUA 1CLKA 4NP7A 2GQ8A 3ARQA 3NEVA 4XD5A 3WFZA 4UUIA 5D2TA 3QKZA 4V27A 2ZUTA 3UERA 4QJ4B 1YTDA 2W92A 3EEZA 1EF3A 4UC5A 3P5YA 1DJZA 2GWGA 3QZ6A 1XLEA 1UH3A 3AISA 1ZRQA 3HGJA 2EPLX 3NL6A 3VPLA 4NAFA 2PDKA 3WL1A 3AS1A 2QR6A 4HCDA 1I2QA 5DFAA 1GUVA 2C15A 3CLWA 2ZZ5A 3CT2A 3GBEA 1PWMA 3U3HA 2XIQA 3O3RA 4D6JA 2J8TA 2G37A 2GJRA 3KLLA 5BZAA 1SJCA 1SW3A 4V2XA 5DELA 5HMDA 4G7EA 3QFEA 1AZ2A 1P48A 2WMHA 3KBSA 1RD6A 3SCUA 3TX9A 4GI9A 1HJWA 4GVFA 1AW1A 4MKSA 4E8CA 1CEOA 4AH7A 3GHRA 3GH7A 1EGZA 4R9OA 1OB0A 1H60A 5HNTA 4W85A 1A5BA 2Z2UA 3FLUA 5CEWA 1UZHA 1PO9A 4Z2JA 1EOKA 3C56A 3F5LA 4L80A 3KFTA 3WMSA 4H9MA 3MA8A 4DNMA 3ZIZA 3FGCB 4O0ZA 1XYZA 3SCWA 5BNKA 2FZNA 3BLPX 2BMBA 1GJUA 2BVDA 7TIMA 1E15A 3FYPA 3GR8A 3VILA 4D6HA 1QR7A 1TV7A 5E9AA 4GC3A 4LOCA 2W0UA 3POHA 4PB4A 1TE1A 2V81A 9RUBA 4KH2A 1TUFA 5D37A 4EWND 1H7NA 1VBJA 3FNDA 4YPJA 2I16A 1SFSA 1LLOA 3SSZA 5AC5A 2E67A 2WPBA 4CQAA 4EPBC 1QJWA 1C8XA 4OUEA 2QCFA 2X0SA 1AD1A 3UR2A 3LGDA 1B54A 2QJHA 2QYGA 2WVSA 1V3JA 1R7AA 5IFPA 3RM8A 4H9XA 3DU0A 1LWIA 2MUCA 1VH7A 4JIQA 3TROA 3R0DA 1LWHA 1PJ9A 1BGGA 3AICA 1PTAA 3U0HA 1E0TA 1D3CA 4B2DA 4AISA 4L6OA 1BF6A 3LHUA 3UJSA 2ZUWA 2PDYA 1X8CA 2GUYA 4U2YA 3O6AA 4QAWA 4D1IA 3VUSA 1OABA 3SCSA 3DGRA 1KFBA 2QIWA 1GZGA 2ZZ4A 3GDBA 3NTYA 5GJPA 4FPSA 4P7NA 1Q2SA 4YS1A 2XVNA 4B90A 4NX0A 1XQKA 2EG6A 5A6BA 3GXDA 4A4AA 2CITA 4DNHA 1OC6A 2C19A 3S0CA 1FH7A 1X6NA 2DSZA 2QT3A 3G18A 3RM9A 1UKPA 3O63A 4A6GA 2OTDA 4AVFA 3EWCA 3P8JA 1M1BA 4DZAA 1ZJIA 3PJWA 4A29A 4JQ1A 4GI4A 4ZXLA 3IGUA 4W7UA 3ABRA 4C7DA 3WDIA 1K9FA 3KW3A 1BKHA 3HMCA 5JH2A 1UD4A 2PLMA 4TO8A 4MY9A 3QV9A 1WOBA 1JI1A 1ZY9A 1EQPA 1N8IA 1OG6A 4G9PA 4B4FA 4FNRA 3NSXA 5DMMA 4R3UA 4E2DA 4P7QA 5REQB 4A3RA 3FVMA 2J8GA 2XFYA 4PODA 3TA6A 3R8GA 1U30A 4WD0A 2HPMA 1YBQA 5HK4A 1M03A 3H8AA 4C65A 3A3XA 3OG2A 2WKLA 1HJXA 2WC7A 3TJXA 4JTGA 4NXKA 1BVZA 2NWSA 1Y5WA 5KSWA 3FX4A 4F0RA 2OVLA 4L6HA 4ZCWA 1R3SA 1UKQA 4IIEA 3F1QA 1AZ1A 1DWHM 1EX5A 2IPJA 3LPGA 1DXIA 4AMAA 1S2CA 3LK6A 1FHVA 4QNEA 3PZTA 3BXWA 3L5AA 3A5VA 2WLYA 4J3UA 1WB0A 4F9JA 1POJA 4L1WA 1JPDX 5E9XA 3ANYA 2HISA 2JBMA 4CD8A 2CWNA 3PFMA 3BJFA 3ZR5A 5M2FX 1KBJA 2J7HA 4JNMA 3N14A 2C0AA 5K7JA 3CXOA 4JYEA 2KAUC 2XH7A 3TYBA 1NFPA 2PTDA 3WH6A 3FA3A 4HPGA 2DV0A 1AA1B 1F2JA 5FESA 3BW2A 3N11A 1IXQA 2EJ1A 2XVGA 3TFXA 1GVQA 2ZRVA 1RZMA 1G4TA 1H50A 4MTVA 4FB7A 3QYQA 3QSTA 1HKVA 3DG6A 3NO1A 1YE6A 2TAAA 4N9BA 3NQGA 1B30A 3DFNA 3FIGA 3LRLA 5D02A 2XUCA 1FTXA 1VRXA 4OBTA 3PR2A 4O12A 4URIA 3OGRA 3CASA 2I1OA 2WHMA 4KWOA 5KEZA 2A3HA 3DESA 1OG0A 1FXPA 1C8QA 5D09A 1UA3A 5BROA 1EP1A 4AIBA 5LNRA 3GG0A 2E1DA 2FH6A 1N2VA 5ABHA 2E3ZA 1XBVA 3A64A 3TN4A 3RN6A 3DECA 4MVAA 5G2HA 1A3XA 4HOWA 3SBFA 4HJFA 1E0WA 1QCWA 2GFTA 2WOQA 2ALRA 2OGYA 3A9IA 4DJFD 1XH0A 3N6HA 3KRSA 2OEKA 4OZOA 4K8HA 4PTXA 3TTOA 4NZFA 2OEMA 3H4XA 3VNDA 1E51A 4Q22A 5KITA 1I4NA 1AG1O 3P62A 3GRIA 4XBKA 1TELA 4JPGA 2F38A 4CNPA 3LTSA 4MNMA 3CHVA 3VIJA 2HTMA 3T0TA 1KGXA 2BY2A 1UWAA 1P1XA 4HHHA 1RV8A 2RAGA 4NAEA 5J5RA 4G2DA 2BX7A 2W79A 4CCCA 3AZRA 5TAOA 2PF0A 3A23A 2Z29A 5HATA 4BZYA 1QNRA 3RUBL 3GYCA 2P8CA 4KCVA 3CEPA 3CV6A 3HTWA 3TW9A 3RJXA 1PIIA 3WQPA 1K7EA 3G1DA 1UC5A 4UMAA 2H9AA 4AVNA 1XGDA 2ZRYA 3N2TA 4LTSA 4S2BA 4ZSUA 1OYCA 3CU2A 4DBEA 2X2GA 5XINA 2R1NA 2VGIA 1IZKA 2INFA 2BY0A 1NJJA 5IM51 3U4AA 4Q33A 2EG7A 4A22A 4JIHA 2VJXA 4DEFA 4I7WA 4LYQA 1LOQA 2YB1A 4IQJA 3GR4A 4IQDA 1TA3B 2FPTA 3VGHA 3BW3A 3S46A 4H9YA 3C4UA 4JN7A 3HPXA 1VYPX 4X3ZA 4CQ9A 4U5IA 4V15A 3H2FA 4ZOBA 3TR9A 2JF7A 3B9NA 1AJ0A 2OLAA 2A3EA 2IXUA 1D8CA 3ZT6A 3WDJA 4XZWA 1KWGA 4NF7A 1BYBA 1XC6A 2GJXB 1PDZA 2ABAA 4FLRA 2O92A 1VLIA 2CLIA 5A2BA 4K7VA 3R7MA 1W54A 2WVTA 3L66A 3OPSA 2YLLA 3STEA 4F2BA 2BOEX 2VD9A 4I6VA 1FDJA 1TRDA 1A3HA 4ZMGA 3OYXA 2DY3A 3STCA 2VCCA 5IHSA 1VLWA 1H63A 4KEMA 3QC3A 5DY3A 4MADA 1ZGDA 2YFOA 3IRSA 2D24A 1QI0A 3KBWA 2GVJA 5LA2A 4GH3A 3WUBA 3ZJ8A 1JDEA 3REQA 4QROA 4W5ZA 3NUKA 1LM1A 3TC7A 1RLCL 3N04A 4L61A 1NDYA 3KTXA 3WH7A 1GHRA 4GUGA 1WNOA 2C14A 3MBFA 1REQA 3UWQA 5D9PA 1YNQA 5H6HA 5DX7A 4AD2A 4ENLA 3L9CA 1XUZA 4KEVA 1LOLA 3IEBA 1LWJA 4NL1A 2YBTA 3HMJG 1RA0A 2IPFA 3TV8A 3VNJA 1ESWA 3G6MA 3BV4A 4XVEA 3TOYA 4XG1A 1BKSA 3LERA 5KZDA 1QWKA 1PCKA 2VT0A 1VHCA 3R0UA 4K6AA 1EIXA 4PCNA 1G7VA 5FF2A 4RZ5A 1JPHA 3SM0A 1KR1A 5CG7A 5BRBA 2J9YA 3QPZA 3RJYA 4PCTA 4R34A 1XRSA 3LZ5A 5B7YA 1AMKA 4RDVA 4AF0A 1K8YA 1W91A 4P8WA 4MJ4A 3LSBA 1RSCA 4U33A 4WDWA 1J5TA 3CLMA 4DXVA 1TX0A 3IIOA 4E8DA 5K4XA 1S5NA 4WJXA 5I2UA 3MO4A 4DI9A 1OFPA 4JTTA 2ZX6A 3DBNA 3WD1A 2PB1A 1XYMA 4S3FA 2F84A 3W4RA 2W27A 4AHPA 5BOFA 1VFSA 3CAWA 3GIPA 2OELA 5BW6A 1Y0EA 1OX4A 1HL2A 3KHJA 3OQEA 5HJYA 1PVNA 1GPFA 3W7PA 3T0AA 1O5XA 3BLOA 3WDHA 3GBDA 3IPWA 5FSDC 2X1UA 3WLLA 3NQAA 3FV9A 5D38A 4R27A 3SRHA 3T42A 4MB1A 5C7HA 1PE1A 3GYEA 1J96A 2P3EA 4JFWA 1H1NA 3QHOA 2XIMA 1GVIA 4IZGA 1E3ZA 2V5JA 4PE8A 1MRAA 3Q65A 4BEUA 2ONEA 3UF9A 3TA9A 2I17A 1TJPA 3VCRA 2PDWA 1H1ZA 3B05A 3GVGA 4QG6A 2WWCA 3W7MA 4IIHA 4RZ6A 1T8XA 1VFLA 2GOKA 4A8NA 2XN1A 1YNPA 4UTTA 3WFLA 3ARRA 4E38A 3VA8A 3M7WA 3NDYA 3ITXA 2W61A 3AC0A 5LA0A 4YNGA 3JZEA 4W8BA 1M65A 4QS5A 1TPWA 1QPNA 4WCJA 1XD1A 4XK2A 1GZ1A 1Q4NX 3UP8A 3DG7A 1OC5A 1Q6CA 1JXJA 5TF0A 3FEMA 4ILSA 1EJ7L 1GTEA 3U48A 3HGSA 5D8ZA 4LUSB 2OOGA 1OX6A 2VQTA 3A3WA 1NDWA 4GY1A 1KM3A 5A69A 5JH1A 4S23A 3FJNA 2F6XA 5IXEA 7ENLA 2CZVA 4PRWA 2GL5A 3LLDA 3SI9A 5BYWA 3CMGA 4IISA 1X97A 3RCMA 1C90A 4EP8C 4GVHA 2PAJA 4YTSA 1OCNA 1S5MA 1TG7A 5L6UA 1OY0A 2Y2WA 1PKYA 3N2MA 1VKFA 3FS2A 2CHNA 3RAOA 3B3DA 1WX0A 3W1QA 4IUOA 4NZJA 4U5KA 4DY1A 3LNMA 2OPJA 2OKOA 2YDRA 4O50A 3HJEA 3MSYA 2PRHA 3RCYA 1Q45A 3AIQA 3KS6A 4S3EA 5BOEA 5CQ1A 4IJBA 1MUMA 1PUDA 3AWNA 4NUWA 4FNUA 1W5QA 4FO4A 3ZZ1A 3UJ2A 4O0QA 1KCKA 2EJAA 2CLFA 3WJZA 4M7SA 1HKWA 4M8UA 1R0MA 3UY7A 4MUZA 1QI2A 4AIEA 2H90A 2Y62A 1J0HA 1GORA 5K4ZA 3NQCA 3ITYA 2VEIA 3HQ1A 2IXVA 1FRBA 2BP1A 1RK5A 1MI3A 2B0MA 4M51A 2QVHA 1EL3A 2YDSA 2BDQA 5C9RA 3P61A 1C3FA 1MW0A 1TJRA 3O2LA 2CYGA 1VP5A 1EZ2A 3MUXA 1WDPA 2V6AA 4P8XA 4HCHA 3GTNA 1A5AA 6A3HA 3FN9A 3LUTA 4KGLA 3N73A 1GOMA 2Z1KA 5A6AA 3PN8A 1V3KA 3DFQA 2WNQA 1L6FA 3S1VA 3HM7A 4K1WA 4AZCB 2J27A 4ORIA 2PWEA 3W7IA 3PUGA 2XZ7A 3MMUA 3S6OA 4HA1A 1ZU8A 1GQIA 3EB3A 4AXKA 4LAUA 2ZA2A 3WBEA 4PTWA 5GVJA 3AHYA 1CZ1A 3E1F1 4MJZA 3KOWA 3QC0A 5F4WA 3SY1A 3KL3A 1Q85A 3ARTA 2EBNA 2EQDA 2CZEA 2VZVA 3KBNA 1JJKA 1WBHA 3UWVA 5C8BB 1JCJA 2REQA 3LBMA 3LCLA 2QLYA 4Y96A 4U31A 5T9CE 4LT9A 1VCFA 1E6QM 4C60A 2HXTA 1JZ4A 1KQZA 4P7OA 1OVDA 2NX9A 2ZICA 3W7QA 3L0NA 2CZFA 3S9ZA 1XIFA 4WSJA 4EE9A 4ZE4A 2V9DA 1WKFA 2CBJA 2YL8A 4D6EA 5DT5A 5FSEC 3PPFA 1EDGA 4C7GA 2DU2A 3SCNA 3WNMA 2DP3A 3WQFA 1VPQA 2NUXA 1QPOA 2ISSA 2YXOA 1UYQA 3S9IA 4R7OA 2XSXA 2BY3A 1IT7A 2I9EA 3TYAA 4RE0A 1XUUA 4HGXA 4UOZA 2NT0A 4C6BA 4ZXOA 3A4JA 3RPMA 1VZWA 1F3EA 1QNSA 1IEQA 2Q8ZA 3GKFA 3CUHA 3AS2A 4QE1A 1RAKA 3THCA 4JEJA 2XINA 3S5NA 2YA0A 4WZHA 4Y9NA 1FFQA 4GGHA 3N2BA 3DERA 3PANA 3GU2A 2HROA 2YKKA 2WJFA 5DXXA 4BEQA 4Q3MA 4LAKA 5F2LA 2PDQA 4Q7NA 1TTIA 4UIOA 3WUGA 5HINA 2VO5A 3N13A 1FWWA 2VUYA 2A5HA 4AW7A 1ZTVA 1AH4A 3U6WA 1LQ0A 1EJSC 4BF5A 4BWLC 2X1SA 4HYVA 4O54A 4XISA 3CHCA 4IF2A 1J18A 2Y5EA 3FJ4A 4CGTA 2BGQA 3E5BA 4O28A 3VINA 4JY8A 2E6YA 4MWAE 4MLRA 1R8LA 2AOSA 3IS4A 3E9AA 3UXLA 2YCLA 1SJAA 4PC8A 4YYCA 5M03A 3N2CA 1IEVA 3E2SA 2J6VA 1J9YA 1QNVA 1CGTA 2ISWA 1EDQA 2Z7KA 3DFYA 1FX6A 4ALDA 1YDNA 4CU7A 3QW3A 3W7JA 3CQIA 1S5WA 4GOAA 3W1AA 5LXXA 1OFDA 1UBPC 4S39A 5BOOA 2TSYA 1UC4A 3SAZA 3PTQA 3E96A 1Q2RA 1IT8A 2O4QA 4P2VA 1KM0A 2PP1A 3CZEA 5GJNA 4CNSA 2V5KA 1WPCA 1XC4A 3H55A 1UH4A 4H19A 1U1UA 2BFGA 4HN8A 2IS7A 2PRLA 3SO7A 3VOJA 2QV4A 4U28A 3VOFA 4M81A 1Y8BA 1JNDA 3WBXA 4DF2A 4W89A 2V3EA 3GU1A 3VIPA 2OT1A 4ZQPA 2FLIA 7PTDA 3S5ZA 2FKPA 2GUUA 1UPPA 1GJWA 2DUAA 3KCLA 3NXFA 3WEOA 1EA9C 3ITGA 1ENUA 1RALA 1H3GA 3P81A 1QRQA 3CL6A 3DYMA 1XPYA 1L6WA 1PTGA 1TPC1 4GBUA 3W6MA 4ZFCA 4IXXA 1X39A 3PNZA 2OGJA 2BHUA 4HSOA 3UEQA 3VTRA 5JIPA 2YA2A 3INPA 1Q7QA 4N9EA 3FYYA 3GDTA 2R94A 3WLSA 4QDWA 1X6UA 3QY6A 2CC0A 3MDUA 4GIYA 5B7ZA 3HG2A 4X0NA 4ZB5A 3TXVA 1XHGA 3C5QA 1XDMA 1BSIA 3Q37A 1SO6A 1J8VA 1WZLA 5LNUA 2ACSA 2PCEA 1V0KA 2WCAA 5AHMA 5HJXA 4B4HA 3GDKA 3TLQA 3YPIA 3H2CA 2ZADA 2A7PA 2NV1A 3WQ4A 2GGHA 4XIAA 4HNVA 1CI1A 3H7UA 4ZOCA 1O94A 3IAPA 1TWDA 3CYJA 2VM8A 4H6EA 1ONEA 4LYKA 5BWFA 5FF3A 2G5WA 5CPSA 4EAYA 1CXFA 1POKA 2GDQA 1GHSA 1ZAHA 1Q6OA 4LNCA 5HUPA 4LF2A 4B5VA 5I79A 1Z8AA 4C91A 1IZCA 4LB3A 3V0TA 5G5IA 4H9UA 4KKXA 4GYFA 3ARYA 3HO8A 3LOTA 3WLPA 3V1PA 5LHFA 3O05A 1TUXA 3II1A 2FZMA 4C6EA 5XIMA 3NZPA 1LROA 5DMNA 4LRTA 2WMFA 2WM1A 3ZLGA 4BCEA 4GMEA 3V5OA 1I0DA 1T40A 3SQMA 2O56A 5EY5A 3W37A 1HP5A 3RR1A 1SO4A 3LNPA 5LHEA 1HXJA 4WXYA 3PZVA 4JIRA 3SCVA 3V3WA 2DZWA 5D33A 1FWDC 3ELFA 1SO3A 3CC1A 4XWUA 1XH2A 3EPNA 3H7RA 2XHYA 4AB4A 4LAZA 3RO6A 3M0ZA 4R85A 3W23A 3W81A 3CH0A 4A3UA 3UY8A 2FZ8A 1AVAA 3KVMA 2WAGA 1YIXA 4LCQA 4W86A 1NSJA 3GM8A 3G1HA 5LNVA 1PZ1A 2WHLA 3EDFA 3TFCA 5D04C 4XVDA 3PTKA 4S3AA 1T0OA 5E93A 3T08A 3H24A 5KZEA 3AJ7A 1W9PA 1UMLA 4JFTA 1N82A 1JCNA 1LYXA 4POCA 4DUXA 1E0UA 2ISDA 1B57A 1GOQA 5DQPA 1HNYA 2X0YA 3EX2A 3VZXA 3HOJA 1JF6A 4GJ1A 1TRIA 5BXPA 3EPOA 1U5VA 4CNTA 4UQBA 4F79A 4QIUA 3RU6A 4A3QA 4PRRA 3KOYA 5I3GA 3KM8A 4PUUA 2XWDA 2BSLA 3M0JA 1RQHA 3P60A 4C6DA 4UNKA 3C0JA 1R87A 2DZTA 3WQ6A 4DO5A 3H54A 3WH5A 1GW9A 3VNYA 5C2GA 3I65A 3PTDA 4UTLA 3L2MA 1EGVA 2V68A 1PEZA 1JQXA 4L9ZA 3T07A 3W07A 3H23A 3EGJA 3EOOA 3G1SA 4AWUA 1K7FA 4WKAA 2E7FA 3GW3A 3M5ZA 4S3JA 1JDAA 5LYRA 3UPBA 4GKLA 1KBBA 2XZ9A 3UR7A 1R85A 1RP8A 1XS2A 3EZ4A 4PMJA 4ZGYA 3AIUA 4DLFA 4KFPA 1UJPA 4LALA 3NYZA 3KRZA 5CC7A 3VMPA 3ITVA 1YKWA 4B5TA 2PDBA 2P5NA 4FF7A 4WJ8A 3H22A 1XIGA 3FDGA 3DEQA 1TWSA 3VGDA 1I1XA 3CMFA 3TQ0A 1OADA 4RNFA 5E1QA 3T8LA 2EKCA 3LBOA 3RYSA 4WVXA 4FXRA 2J62A 1KTNA 1QI3A 4NQ1A 1PZ0A 3O07A 2FB2A 3NXLA 2FGBA 1B9ZA 2PI6A 1KLYA 1F8IA 3CHFA 4Z17A 1JGIA 1OFBA 3CQ0A 4PMOA 1UB3A 2RHGA 3TYDA 3AOFA 4GNVA 2VFGA 3G24A 4WGHA 2HK1A 2HK0A 4KF1A 1D7KA 1R9XA 4MYAA 2XGIA 3UXKA 1HVQA 1JPMA 2BASA 3EWBX 1XXXA 1OF8A 2YCKX 3AAMA 4PYSA 1Z89A 3M6YA 3VOCA 3W1MA 4F2UA 2AQVA 4GCXA 4CQDA 2FIQA 3UU0A 3FDKA 3QPYA 4FEZA 5D9OA 1R3RA 5I7GA 1MEHA 3KBJA 4OGZA 4UQAA 1ZJBA 9XIAA 5PTDA 4X9YA 3WK3A 1A53A 1TIMA 1FKXA 4XO6A 1O60A 1GQNA 3MANA 1TWIA 2H8ZA 4K3ZA 3VABA 4GFSA 2NSXA 4DO4A 4X9SA 3A22A 2Z6JA 1DHPA 3NQ6A 1GYMA 3DOPA 4MDPA 2FZBA 4UFMA 3IARA 4LBUA 1XLIA 3RDKA 3VGFA 1ITUA 4NAFB 3N18A 2JKAA 1R3YA 3L7RA 1NF7A 3DHPA 2NXGA 3MYOA 4PMDA 4GGBA 4LFYA 1UWIA 4M82A 4JKLA 3KRBA 3SUVA 3LHYA 4TTUA 4YHGA 3E12A 4HHPA 8RUCA 4G7EB 2IQ0A 3UJFA 1L2UA 3R43A 4HN4A 2CKRA 3M5XA 3GHUA 2C6QA 2GGEA 1LUCA 1ZENA 4DB7A 3MMTA 3NSMA 1J93A 3W27A 1Z6KA 4JYDA 2WSKA 4QISA 3PBYA 3LCGA 1XD0A 5D2VA 4P7LA 1NDVA 2Y89A 3KOZA 3HQNA 3CV7A 2G3MA 1XFCA 2JIWA 2POTA 2KZHA 3B8UA 3PUOA 4PL1A 3LQLA 3AZSA 3U4FA 3MMWA 5J5DA 4JN8A 5F4XA 4KRTA 3W7OA 3PWAA 4AY1A 4Q8OA 1FH9A 2QCGA 1ZPTA 2J6XA 4QG8A 2VTFA 4IMCA 7TAAA 2R1LA 5EBUA 4XD3A 2VFDA 1TVPA 5HANA 1ZL1A 4HTYA 2WSYA 5I3FA 3KOXA 2YB4A 2ZXBA 1RJQA 2DSKA 2ZCGA 2PA6A 4W88A 1W6TA 3UWWA 3BZJA 1H2JA 1R3VA 3NGJA 5MKGA 3WDPP 1QOXA 1FWIC 6XIAA 7REQA 3T0DA 2OYLA 3TQVA 1B5TA 2OYKA 3GNDA 4IXHA 2NVDA 2QF7A 1YQ2A 2JKPA 3EX1A 2XM2A 1K8XA 4KIRA 4E0CA 1QNPA 4OECA 3VD7A 3UPWA 4FOKA 1ZBWA 4RNHA 1RVGA 3XISA 4AZHA 3T4WA 5K3VA 1DE6A 2X30A 2A6LA 1XPGA 1GOOA 3LB0A 1AW2A 4U2ZA 3KZSA 4K1GA 4X22A 4RE2A 3KRUA 4LXFA 5FJJA 4F4RA 3DC0A 3SN1A 3SZ8A 3G1FA 1PKNA 2VC7A 5I09A 1R47A 3LY0A 4KEUA 4BI7A 1TPH1 4J3XA 4O1DA 3B8DA 4LS1A 2I14A 3IK2A 2R14A 4DJED 2E6DA 3NO3A 4WSHA 3PBGA 2HVNA 5HMFA 3W1PA 1P0DA 6ENLA 2YDQA 1XIIA 1ME8A 3AHTA 4RJEA 3QOMA 5AB3A 3KUMA 1TTPA 4M24A 5EPDA 4YIWA 1TWWA 4WJEA 2HE8A 5FA5A 2Z2AA 1SSDA 2I9UA 3STGA 2WM0A 2OFJA 3AHXA 3W26A 1VENA 2PGWA 4HIBA 3L67A 1X7FA 4RE4A 1YDOA 5B80A 2CETA 1OX5A 3W2KA 1V6XA 2PDMA 2YX0A 4YXGA 4Y9OA 3RMJA 4GACA 2PF8A 2ZC1A 5ABGA 5HQMA 4JR5A 4Y9MA 2JKEA 4D9PA 3L23A 5LGXA 3CQKA 3GU9A 4JY9A 4QSHA 3PBMA 2ZQ0A 1ZB5A 4O18A 3RGTA 3C0SA 2OG9A 3EX4A 3TN3A 2OT0A 2QCNA 1FWGC 5EGRA 1I0BA 4M56A 3UZWA 2WMGA 5FEPA 2B7NA 2OZ8A 3AIWA 4PMNA 2BXVA 3M64A 4XTDA 4HK7A 4DZHA 4QDPA 2CLEA 2DZUA 2C0HA 4FK9A 4LAMA 4FX6M 5A6JA 1IIGA 4F0KA 2G95A 4RV3A 1X6LA 4M80A 3ABZA 3NQ2A 3C2YA 3VMNA 1IXNA 1SFTA 4IWWA 3CUZA 1J11A 1K8CA 3BQ6A 3BAXA 3VYLA 2O0TA 1KXTA 3RITA 5C2CA 1WP6A 4RZBA 1DEDA 1M01A 1W5NA 4WF7A 5C2XA 1HL8A 4IICA 3B9DA 3KTSA 2DZVA 3L0GA 2C3ZA 3WQOA 4DUWA 1JGMA 4IIFA 4S3CA 4LV4A 4MKVA 3WF4A 1O1ZA 3N25A 3UA3A 1HO1A 1NP2A 1O6IA 1TJ1A 3EKZA 3L0KA 2FDMA 2W63A 3VAVA 5AZ1A 2Y7GA 4ZZ9A 1ECQA 2JFEX 3TNOA 1PX8A 1S39A 2PUZA 4EXBA 4C6IA 2FPVA 4IIBA 2G8ZA 3M47A 3IJQA 3VNIA 3WH8A 2Q02A 1NTHA 1RPKA 3N6QA 4U4MA 5GNXA 1P5BA 2VURA 2VC5A 2FPYA 3C52A 3W22A 1XCWA 1R3TA 4ACZA 1MW3A 1GQJA 3I3DA 3TLLA 3ZJKA 1M7PA 9XIMA 4QJ5B 2EPNA 1IE7C 3VX0A 3WKZA 3EBVA 4IMAA 4Q4PA 3ATYA 3F2CA 3AXHA 1A50A 1FUYA 3ERPA 3IUDA 5FEZA 4NI3A 3GX9A 4C6LA 2NSOA 4RE3A 1HZYA 3P80A 1U1HA 3WO8A 1GNXA 2XFFA 4BFAA 2WVUA 1JZ2A 4Q4RA 3V4BA 2BVWA 5CBJA 1ALDA 5HQLA 3A21A 4D8ZA 5E6ZA 1NWTA 4NZCA 3SIMA 4CCEA 3R2GA 2HMCA 4KPLA 1F8MA 4WDTA 1QI5A 5D9MA 4HQVA 3HA1A 3WCZA 2DT2A 3PSVA 4Z2HA 4F40A 4ZTXA 3F2BA 4DJFA 4WOZA 4A21A 2P53A 2VDHA 4AUBA 1EPVA 1DWFM 3T2PA 1JD7A 4UFHA 3E5PA 4HP5A 4XO7A 4UCFA 4HMDA 4H1ZA 3SRFA 5M5DA 1ZHAA 3GIQA 3H2MA 4O15A 3ORWA 4O8AA 8TIMA 2QXWA 4R5EA 2G4FA 4WDXA 4H7VA 1RR2A 2NQ5A 4B9YA 2A7RA 2WKGA 2YYTA 4H9ZA 3WLMA 1IHIA 1FP9A 1UD8A 3ZLHA 4PEKA 1BVNP 3ES7A 4Z1YA 5CAHA 4H41A 4UNIA 2ZWZA 2OKTA 3PPCA 1YYAA 3OLDA 1GWJA 1WDDA 1F5ZA 2VZUA 3B8IA 1LF1A 3VKCA 5A6KA 2AL1A 3VFLA 1NM9A 5C70A 3KX6A 2AQOA 3HG3A 3VDGA 3TKFA 3KL0A 3Q67A 3JR2A 2O7SA 2PGEA 1V02A 1YPIA 1YADA 1V02E 3H2NA 2PMQA 2WNWA 3M16A 3M4HA 2QIIA 4RPQA 3T6CA 4J3WA 3JS3A 1JCTA 1MEIA 5C5YA 2DQWA 3USZA 3NL5A 4EOUA 1JAKA 2ZDRA 2ODOA 5CSUA 2CPUA 3WJYA 1CYGA 4WRHA 3KTCA 1W31A 4AU0A 2PZ0A 2O9OA 3W1TA 1AQMA 3TCEA 1LL4A 3O0FA 1E43A 1KO0A 3TZFA 2P8BA 3R79A 1ICSA 2D69A 3S1WA 1TREA 4ATWA 2C91A 1CNVA 2Y8KA 3D3AA 1MW1A 2ALDA 3RX2A 4YTTA 3ITTA 2NV2A 4NIRA 4DLMA 3TQKA 3REQB 2Q3RA 1OZMA 1KCLA 1J0KA 4UB9A 3QY8A 1JL8A 1ZQ5A 4H8UA 2YL9A 2Y6ZA 1KGWA 1H4PA 2BBFA 4TX6A 2QUUA 3FYOA 4ZODA 1YPXA 1K77A 4L4PA 1E4LA 1FWRA 5FKYA 1NDZA 6ALDA 1OGGA 1H62A 1K4GA 1SZFA 5GQBA 3BICA 4HNLA 1H61A 1F6KA 2FTPA 4LCSA 4KETA 1X1OA 1LORA 4GABA 1H7XA 3LHTA 4PA8A 4RNJA 1ONWA 5EBAA 1O66A 1W5MA 1E55A 1KW1A 3BJSA 4M5PA 1FKWA 3CAQA 1KR0A 5DRCA 1XX1A 2QPUA 2PDJA 4Z0SA 2C16A 1TX2A 3NG3A 5CZTA 1Y5VA 1R7OA 3IJIA 4OT7A 3B8VA 3SUSA 1HGYA 2R8WA 3L21A 3QOKA 4UTFA 3ENLA 4WR3A 1O5QA 4C6CA 3NR0A 5EL1A 2XIIA 2VEGA 3H4GA 4Z1BA 2NWRA 1TJ2A 1XBYA 4FXFA 3ZQ9A 4KCTA 1Q65A 2XISA 3R25A 3U2EA 3EWXA 1RVKA 3V35A 1EUNA 5IDIA 3PUDA 1QHOA 1E70M 3U2ZA 3AHZA 5A8MA 2AGTA 3F03K 1BRLA 1OX4B 2GVLA 1UMYA 1SM9A 3W72A 5CJMA 3UWEA 1FWTA 3BOLA 5H2ZA 1XR2A 4HD5A 3B4UA 1V6VA 1AODA 1AUSL 2A7NA 3VIOA 4RK8A 5AC8A 4IPPA 3WN6A 4TIMA 2EKGA 3AI0A 1SGJA 3TH6A 3FJLA 1BQGA 1G7UA 3ITLA 2OU4A 1BPLB 3NQ8A 1TTQA 3DFPA 3B8TA 1TV2A 2A3AA 2JGQA 2PDLA 5C9ZA 4MWAD 1K70A 1V93A 3G8EA 4RW3A 3W29A 2FMNA 1UD2A 3BSMA 5AYXA 2J13A 3PJTA 1XIMA 4ES4A 2A4AA 4QLKA 4NILA 4L7ZA 3KEHA 2VZSA 3S8HA 2VGGA 3H26A 5G4EA 5IDZA 3P2VA 4F9DA 2E77A 4HPXA 3IIZA 3SURA 1Z42A 1TZZA 3C61A 5JU6A 2J7CA 1EYWA 4O1CA 2C8NA 2X1IA 3URBA 2IKIA 5G4WA 1GW1A 4XBJA 1QHPA 5F2IA 1LQ2A 4XB3A 4A05A 2ZBTA 1XCXA 3UA4A 2VFHA 4OWGA 3S1XA 4IHCA 4W7WA 1AK5A 2ZA1A 3L5LA 4TX9A 2YCEA 3USBA 1KRAC 2D23A 1D9EA 3AROA 4OUIA 1LZOA 3NQMA 3LLXA 3P14A 4AZBA 4RV8A 1CTNA 5FI8A 2YR1A 3B03A 4LEFA 4FNPA 3QMTA 1ZJAA 2E8YA 1MRQA 5HWJA 1OT2A 2UBPC 1RXOB 3A4WA 3PTMA 1TPFA 1R38A 4IX0A 1UG6A 5JXQA 2CLKA 1FP8A 2XVPA 1GQLA 3QR3A 4JYFA 1XFBA 5FEWA 3L4UA 4LYPA 3PHAA 3SCPA 1LL7A 1Q6RA 4FOUA 3FFSA 4MG4A 4UR7A 4JTEA 3GQYA 2R82A 4Q4SA 3V1HA 4N7QA 3FGCA 4C1KA 3EEGA 2XN2A 5GNZA 3U7VA 4G1NA 3OZPA 2PWGA 5I77A 1TTJA 3GSMA 3HQOA 3CZLA 3VKKA 3T40A 3IRDA 4BQ3A 1DYSA 3SGUA 2PWUA 4WLCA 4YVVA 4Q4KA 2WNNA 3COTA 1FHLA 4B2DD 1WXJA 4N9CA 3EDKA 4HYRA 7CGTA 3AYTA 4C90A 2FVMA 5CLTA 1I2NA 3AHVA 4MLJA 3R0KA 1MXDA 2GOUA 1PYMA 4MFDA 3SW6A 2YSWA 3SUWA 2OSYA 3CJPA 3WQEA 4FLQA 3MI2A 1IF2A 5FEXA 2W9MA 4N02A 1PIGA 5L9FA 1R86A 4ML4A 1C8YA 2UZ9A 4DJEC 2UV8G 5GPRA 1Q7MA 3AIRA 3OHIA 1EIBA 3NDOA 3T7VA 5LGZA 5HUOA 1XQLA 2X8RA 3M0LA 3J7HA 4IP7A 3LGEA 4LC6A 4OJYA 1PX3A 3W25A 1BQCA 3TJLA 3G1RA 4M6UA 3VIFA 3M5VA 2REQB 1W3KA 4HHLA 5CPOA 5M3WA 4BK9A 1YDVA 2MNRA 4BY3A 1OFOA 3B8WA 3CZ8A 3AMDA 4HNUA 4LY8A 3GUWA 4IH3A 4HMEA 2OQHA 1DQXA 1UKOA 3MP3A 3CO8A 1K3UA 4PMQA 1UROA 1FOBA 3C2RA 1MMFA 3V0UA 4X0VA 4AFYA 2RDUA 3KBVA 2I56A 3WD0A 2YBVA 2DDXA 3D46A 1LOSA 8A3HA 3KOFA 5E70A 1WZKA 2X41A 1W8GA 3CV2A 1JNEA 3VDBA 4H04A 4H4IA 1OYAA 1D2KA 3VKDA 3N4FA 1T7LA 2QVNA 2RJHA 2PBGA 5DY2A 3U8GA 3EA3A 1N55A 3WUFA 4G7FA 2O9PA 4DI8A 4M29A 3P8IA 2HQAA 3NZ1A 4PB5A 3QQ0A 4DXXA 3T2OA 3W82A 4KGJA 3VD4A 3QHMA 2V5CA 4I3GA 3ALGA 3QQ1A 1RA5A 2WPGA 2PCQA 4M7TA 1JZ3A 4QFUA 2DSUA 3URAA 3ABQA 1ZSXA 1OCJA 4DX3A 2J7EA 3SJ3A 1QOPA 3VC5A 2DT1A 1NEYA 3V16A 1XIJA 1D8WA 1P0BA 4DRSA 2J79A 5LNWA 4TU1A 4L4MA 1PSCA 4MPKA 5DRIA 3T1GA 2D1ZA 3ARZA 3GTXA 3VDAA 3N3MA 3N29A 4KBXA 1X1NA 1ZFJA 4QEEA 1JZ5A 1TMHA 4E5TA 2J75A 5LNSA 1UR9A 3TSBA 3SCQA 1E5NA 2GDUA 4JIEA 3MWCA 5CXPA 3M6DA 4PMZA 1VAHA 4E2BA 4JCMA 1DJYA 4NXSA 2VZOA 3MCNA 3ANUA 4RUBA 2E5BA 4C1LA 3WK0A 1ONXA 4UWMA 1ADOA 3S5YA 1KM6A 3NIYA 4OOUA 2Y8UA 1S5VA 1IGWA 1VBHA 2Y5JA 4MB5A 5AYYA 1Q6GA 4NSBA 3HPAA 4AD5A 2QAFA 2Y7FA 1UR1A 4E2OA 4MNJA 4HBKA 4UTTC 1QATA 1I2RA 2WBKA 2BVYA 1WKEA 2OJPA 3LTYA 3L4XA 4IP4A 3ABXA 3UZXA 2HNEA 3MVTA 3VIMA 2QUMA 1H49A 1KFEA 3TDFA 3SCTA 3GUGA 1R2SA 2C79A 1JFXA 3MB9A 4N42A 1A0CA 4MAVA 3W1RA 3G1XA 4LX4A 4PBGA 4M6QA 1JCXA 1JVNA 4OHQA 1AW5A 2J7FA 3ZFHA 1GKRA 1CW2A 3CGTA 1I9CB 3NWRA 1LDCA 2E9MA 2HEJA 3W2MA 3ZVHB 1BFNA 3WD3A 1HFBA 1G01A 4CN4A 5A6MA 1VS1A 3BMVA 1DPMA 1A5SA 4Z2LA 1B4KA 2EEXA 4PFMA 3L4WA 1CGWA 2DUXA 4N9DA 3NPXA 3NFUA 1FH8A 3PZGA 1S1RA 3AMGA 4TVCA 4GI6A 1W1A1 4MDOA 2PU0A 3GG8A 5A3HA 3FCPA 3G2GA 3K46A 1PIFA 1WAWA 3VD9A 1TVLA 5G4HC 3KVLA 5DBUA 3BLLA 1QO5A 1VCGA 3GW0A 1XLKA 2J66A 4DUOA 5HPOA 2P0IA 2Y61A 1KBKA 2ICSA 2EHHA 1KTCA 4PN2A 2GJLA 3JUGA 2ZUUA 5D32A 3MUZ1 1KV5A 1MQRA 4H6QA 2DZSA 3TNBA 4MHBA 1QNOA 1EWDA 3CUXA 4JKKA 4O53A 3MCMA 4KMQA 5CGMA 4FNSA 1VBUA 1J0IA 3QEZA 2W91A 4LS0A 2ATSA 3NL3A 5AYBA 2V67A 3WQCA 2OMAA 2XSBA 1W1VA 5AVHA 5AVNA 1PHWA 4DBDA 3ITOA 1SJBA 2WQDA 4GD0A 4IFKB 3AYVA 1ODZA 1BTCA 3VZYA 3QH2A