4FEZA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
361
structure length
316
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae, deletion mutant.
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 107
structure length 316
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fezA00
2I1OA 1EP3A 3MHFA 1PHQA 3WJZA 3UWUA 4IX0A 2ZZ4A 3CEUA 4JX5A 5D02A 4N4PA 1L6WA 3LCHA 4UFHA 3CM4A 4UTWA 1P1XA 4LVFA 3BW3A 3CT7A 4LTSA 3QPYA 1VC4A 1ADOA 3EEGA 3A22A 3S5NA 2XN0A 2O7SA 1Q3NA 1H7XA 2C15A 5EY5A 2J88A 3TQKA 4RK8A 5CPNA 3NG3A 1TSIA 1W8SA 3A9IA 5FF0A 1WBJA 4Z1AA 1OX6A 3NL3A 2QCFA 2J24A 1DJNA 2FFCA 1TPB1 3PY2A 2V81A 3QMRA 2A5HA 2J9XA 4NJJA 2WO5A 2H90A 1GVSA 3TU9A 4H6KA 4Q33A 2YFOA 1EWEA 4WUIA 3EWBX 1P4CA 3H55A 4GC4A 4POCA 1NEYA 3JS3A 2QDHA 5D04C 5AN7A 5EMUA 3OVRA 1H51A 1Z48A 5I3KA 3TQVA 1T99A 1TYGA 1UUMA 4OHQA 5DY3A 1I4NA 3EX4A 3LCGA 5EPDA 2NWRA 5D37A 4LY8A 3NM1A 4RXFA 4Z1CA 3N34A 1LM1A 3PSWA 1XBVA 3GXTA 1TTIA 4JD4A 3TJXA 3NL2A 1WYIA 3W7HA 4RKAA 4PA8A 3N9RA 1ML1A 3C2EA 4MOZA 1JQXA 2GQ8A 3IV3A 1YTKA 4O1BA 1OYBA 5E1QA 3SGZA 4RLIA 1V5XA 4BF9A 3WFAA 1NVMA 3GXNA 3IGSA 2Q3OA 3HGOA 1LOLA 3GK0A 2A1YA 1W5PA 2AQWA 3PR2A 1TRIA 4O54A 3P5ZA 2WSQA 1H7NA 4JTFA 4UTMA 1JJKA 5G2HA 3I7RA 2WPBA 4MPQA 1F73A 3BLIA 4MYAA 2PC4A 5AHFA 3G18A 4Z0SA 3KRSA 1H1YA 3W75A 3PF3A 1FWNA 1UUOA 3JR2A 1PE1A 1OJXA 1XBXA 5IM51 5D03A 3G1AA 5F4XA 4KFNA 5AC6A 1C9DA 8TIMA 1QAPA 2FPTA 1DV7A 1OF6A 3R8RA 2V82A 1I2PA 4K7VA 4NNBA 4OBTA 3G1SA 2A85A 2FPYA 4O13A 4BK9A 5I3JA 2H3DA 1FWRA 1UB3A 4NJGA 4O14A 3U8GA 4A3UA 5K4XA 1K7EA 4O11A 3RNDA 3BGGA 3QPZA 4JIPA 5EL1A 5KMYA 3DFTA 2QDGA 4NZFA 4A22A 2OX1A 1OFOA 3NL5A 4UMBA 1VZWA 4M6VA 1AK5A 3W73A 2Z6JA 5K9XA 5I3IA 5CSRA 4AHOA 1QOPA 4GRSA 1XFBA 3W1QA 3K30A 3MBDA 4JTGA 2ZRYA 1ONRA 4UTTC 3HBLA 4DPPA 5BNKA 2VKZG 2CWNA 3S42A 3TE9A 4JICA 1G7VA 3QF0A 1YPIA 3MYPA 2B0MA 3W74A 3B0PA 1GYLA 1SW0A 4H3DA 3MP4A 1CI1A 4TU1A 5J5RA 4DELA 1R46A 1TPUA 4MY1A 3W7DA 2ZZ5A 3NDOA 3N14A 1KTBA 3LV6A 1LCOA 1K7XA 3C56A 4O1DA 2EKCA 4DO5A 1R2TA 3W7QA 3GAKA 5DBUA 1Z44A 4KFPA 3ABOA 3ABQA 1W37A 4I7VA 1F6PA 4MYXA 2FLIA 3BVJA 4CLMA 5HINA 4PL2A 3DI0A 2E6DA 3QMSA 1EPXA 3MJYA 2YDAA 4NZJA 1S5VA 2Y85A 1TPDA 4E0CA 3EWZA 1IIGA 1SR9A 2P1FA 1GT8A 1F6KA 3HF3A 4AH7A 4FX8A 3O6YX 4EF9A 3DFNA 2RDTA 3TW7A 3MI6A 2JKEA 1QCWA 3C8FA 1B4KA 2TMDA 1F76A 3PUDA 4WZHA 5CZJA 4O17A 3STFA 1PS9A 1H7WA 1H5YA 4AXKA 2BSLA 3NXFA 3G0SA 3INPA 5G2WA 5G1YA 3NQ6A 2ZTJA 2R91A 3W7OA 2ZDRA 4K37A 4ONVA 1VCVA 4UFLA 5LNSA 2QR6A 1ICPA 2ZRVA 1O5XA 3IGUA 2WSRA 4NUWA 2W6RA 5LNWA 1QPNA 3WJSA 4O28A 3FKRA 1OK6A 2Z6IA 4A21A 3NQ8A 3W07A 5FF2A 5F2IA 2VEIA 4QNEA 4P61A 3QH2A 3ZWSA 4GE8A 3L0KA 3E0IA 2Q3RA 4LWWA 2BX7A 2RDWA 2FB3A 1QOQA 3AO0A 4WXYA 3LXCA 1VHCA 3NZ1A 4OV9A 2VEMA 1OFAA 4UMCA 1QPQA 4XWUA 1CX9A 5K9CA 1GZGA 4UCGA 4L4LA 2WNNA 4FHAA 5A5WA 1AMKA 1O5KA 2E6AA 3EKLA 3G1HA 1K8YA 2ZZ6A 1LTDA 3VNDA 3O1NA 1KM2A 2PRLA 4XBSA 4CQ8A 4JTJA 4UC5A 3GLCA 1QWGA 3OA3A 2HS6A 3GNDA 3UWQA 1KBIA 4Q32A 5LZLA 1HFBA 3N2XA 3MMTA 1N55A 3TMQA 1JUBA 3THQA 3N19B 5C55A 5G2IA 1KFBA 2V2HA 3H54A 2JBMA 1H50A 2DP3A 4LRSA 1YXDA 2V2CA 2VFEA 3W2KA 5IBXC 3TKFA 2DZUA 4LC8A 4BI6A 4WY0B 1HO1A 2HTMA 1ALDA 2ISWA 2X1TA 4O53A 1SSGA 3QW3A 1NAL1 3PULA 1JULA 1D9EA 2F7FA 3LBMA 1BWKA 2EGZA 2NUYA 3QQ0A 1DJQA 2IQTA 3FKKA 4IWWA 5DXYA 2C1HA 5LSMA 5F1UA 1F2JA 2C14A 4X2RA 5K9DA 3GNNA 1A53A 4XKYB 1DOSA 3A5FA 5DCEA 3M44A 3M5VA 1FDYA 3HG2A 4JIQA 4OT7A 1KFLA 2CLHA 4U28A 1YYAA 5H2ZA 3NA8A 5HNRA 2C16A 3P8JA 4NJHA 2FTPA 3TQ0A 4TIMA 3RF9A 3THAA 4MY8A 1TPEA 3IEBA 3BLEA 5L6UA 4YMZA 3PBUA 1FWTA 2HSAA 2Z1BA 1IXQA 2WOQA 3WK0A 4JGDA 5TIMA 5AB3A 4WY0F 4JTHA 1FCUA 3HO8A 1KFJA 3W7JA 3ZWTA 1AW1A 1TIMA 3R89A 3W1AA 3GIYA 1TQJA 3QRHA 1SO3A 3KHJA 3LBCA 4UMAA 2BXVA 2YPIA 5KINA 2DZPA 5C2XA 1F74A 2YZRA 1IGSA 1G69A 1TV7A 1AL8A 3LGEA 1Q6OA 2NXGA 3LV5A 1LYXA 1LBFA 3CEPA 2QKFA 2JGYA 3WJWA 3CWOX 1Q6LA 1O94A 4ORMA 5I3FA 1ME7A 2X1UA 1H63A 2NUXA 3B0UX 3W76A 1X8FA 3LOTA 4I7WA 1WOBA 3M7WA 2PURA 3PAJA 4A29A 3W7KA 1ZY9A 3P5YA 2QEZA 1JCLA 1R47A 3GR7A 2J9YA 5D2VA 4OGZA 3BV4A 1K3UA 3E9AA 3UWZA 1OK4A 4GUGA 2V5BA 3W9ZA 5HR7A 3LRKA 2PRMA 3MI3A 2OT0A 1J5TA 3SGUA 1FY6A 2J9ZA 3QM3A 3WK2A 4GJ1A 4DF2A 3C4UA 4BI7A 1LROA 2ATMA 3LCIA 5LHFA 1G4TA 4PODA 1XCFA 3W2JA 5BMWA 1T8XA 4LRTA 3NQGA 4OQVA 1W5NA 4OE7A 4I9AA 2NX3A 3EX1A 1XC4A 3N3MA 2OMAA 2ZZ2A 4EIVA 1H7OA 2QCMA 4N9EA 2CU0A 1LRNA 3W1NA 1DHPA 3NM3A 1VYRA 1RQBA 3PBVA 1JCXA 2ZA3A 1SFJA 4FNSA 3LTPA 4Z08A 3TA6A 3NR0A 2NUWA 4JTUA 3FS2A 5D2YA 2V2DA 2ZYFA 2DORA 2ZCGA 1A5AA 1I2QA 1ZENA 3I7QA 1ME9A 3EWWA 3LI1A 3W22A 3O06A 3W1MA 4UTLA 1WX0A 4LS0A 5FEWA 6TIMA 1OX5A 1EUAA 4HPXA 1FDJA 3HJZA 1B57A 5TQLA 4JYFA 3VE9A 4NVTA 4KFOA 3LCXA 1GVQA 3QW4B 3P80A 2JGQA 4JTSA 2QCGA 4O1AA 3L5MA 4DO6A 3O05A 4S2CA 3DGRA 3LRMA 1GOXA 4UUIA 1EEPA 4XTIA 4W9TA 5AYYA 5CPOA 4O52A 2EF9A 3EX3A 5E0KA 1TMHA 3FIGA 3AJXA 4DXVA 4YXGA 4GUFA 4RZ4A 1W56A 3HG5A 3DKJA 3OVPA 3C2FA 4K7YA 3IIZA 1WBHA 3ZR4A 3FYPA 2B4GA 3G1VA 1FXQA 1RV8A 1SO4A 2NV1A 5F2LA 4ZZ9A 4GUJA 1MEIA 1O95A 3N9SA 1JQVA 3O63A 3IVUA 4NX5A 4CQAA 3HPSA 2ISSA 2LLEA 1VR6A 1TPFA 4FNTA 4LUIA 1DORA 2FPVA 3M1ZA 3QEZA 1LBMA 2ALDA 1K8ZA 3HGSA 3EX2A 2W0UA 3FJ6A 1TTJA 3PM6A 2NZLA 2CLEA 2DZSA 5DXXA 3M9YA 1JRCA 3LTYA 2B7QA 4CCDA 5DCDA 1D3HA 4JNMA 3H53A 3M5XA 2V5LA 5SWUA 3I65A 5GVJA 4MY9A 1RPXA 1CW2A 1RR2A 2G97A 4K38A 5C6MA 3B8DA 2OJPA 1OHLA 2WNQA 3W7MA 3VCRA 3PBYA 1VLIA 4P2VA 1YDVA 3C2RA 3TMLA 1MO0A 2CZ5A 3USBA 4KKXA 3C61A 1K8XA 3S1WA 3TROA 1W3IA 4FNRA 2A4AA 4LVDA 1OFRA 4IXXA 1KW1A 3GDRA 1HG3A 5DELA 7TIMA 4LS1A 3SR7A 3LHTA 1A5BA 5D33A 5D38A 4FX7A 1IXPA 4WOZA 1SO6A 4IMEA 3W88A 3SECA 3TDFA 3TXVA 4O0KA 4RV8A 4UFIA 4OWGA 5HWMA 4O19A 4IQLA 4YCPA 3TSDA 2ZRUA 3A5VA 2Y89A 3EXTA 3S5OA 4NQ1A 1OG0A 1WOAA 2VC6A 2YX0A 1TTQA 3SY5A 3TFCA 1SO5A 5LNRA 2XFWA 4HNVA 3HMJG 4O4VA 3MHGA 2JKPA 2VEPA 3EX6A 3PWAA 3IIXA 4IMDA 3UD6A 4HN4A 3CLMA 6ALDA 4LT9A 4NJKA 5CKSA 3TCEA 3BW2A 2WJZA 2A6NA 1ME8A 1TQXA 4QJ1A 2DJLA 4YLWA 1R2SA 2H8ZA 4FIQA 4AWSA 4NNCA 1ZCOA 5EYWA 4UTUA 1HUVA 5F4WA 5ABTA 3QZEA 3GAYA 3UWYA 2QUUA 2YSWA 2CLKA 3BARA 1AW2A 2EPHA 5CZ0A 3PUOA 4O16A 3I7SA 4WQ6A 4EWND 2R14A 2A21A 4UFKA 1VH7A 5G5IA 5K2ZA 1A5SA 2Y88A 4ADTA 4WOQA 2D73A 3UNDA 1IIHA 3Q37A 1E51A 5MHBA 1TV5A 4JYDA 4GWEA 3L0NA 3TUUA 3L5LA 4PCFA 3UQNA 4BWLA 1I2RA 4M6PA 1GTEA 2YR1A 3LRLA 3KRZA 3RU6A 3KXQA 3RMJA 1TPVA 2Q8ZA 2ZRWA 3W7PA 1RVGA 2B7PA 3Q58A 3DU0A 3QMTA 4N6EA 4IJBA 5DBTA 1Q6QA 4IX2A 4OU1A 4CNPA 3B0VC 2C18A 3KRUA 4QAIA 3KAOA 1G7UA 3BK0A 3BPWA 3G1FA 5AHEA 2GUUA 1I45A 1GEQA 4TO8A 3DFOA 3MUXA 2F84A 3G8RA 2YYUA 3KVMA 2H3BA 5FF4A 2CLOA 5KSWA 1TTPA 1QO2A 3L66A 3W1TA 4TX9A 3G22A 1I2NA 4UFJA 1TPWA 3C2VA 1THFD 2Y62A 4DEFA 2OZ0A 2QCEA 3MW7A 1RZMA 3MI2A 4ADSA 2XN1A 1ZAJA 1DL3A 2AAMA 3DFQA 1VJIA 1VYSX 3NQCA 4LUJA 4FXSA 1XBYA 2CW6A 3CTLA 3TNOA 5DCBA 3WK3A 1ZAHA 3M16A 1LLZA 1JRBA 4MLJA 4ZQCA 4HHPA 4X9SA 4QQ3A 3SJ3A 2FIQA 4A2SA 3UWWA 2Y6ZA 1QO5A 3ZFHA 3DBPA 4WJEA 2CLFA 2ZFAA 2C3ZA 1OYCA 2ZZ1A 5FI8A 2A2IA 3SI9A 3W7RA 5CSSA 3R2GA 5FEPA 3L9CA 4DF1A 1GVRA 4NT0A 2CLIA 3FYOA 1X7FA 2Z2UA 4G1KA 5AYXA 3G24A 1KM6A 1TCDA 4UNKA 1ZHAA 2VXNA 3W1XA 2QUTA 1UCWA 1P0KA 3UZJA 1OX4B 5HJLA 1KM4A 2ATSA 3TV8A 3ABRA 1XXXA 2A7RA 4YCOA 2G96A 4Y8FA 4NU7A 4NJIA 5D05A 3DFSA 4JTIA 1I2OA 4K8EA 3UWVA 1IF2A 5FEZA 3W7GA 3GKFA 2A7PA 3Q2DA 1LOSA 4AMAA 1NSJA 5LNVA 3TK7A 1X1OA 3NQ2A 1XDLA 3P7YA 2QUVA 4M5PA 4QSHA 5F1VA 1N8FA 1SU5A 4O10A 4D2JA 4O1CA 2GVGA 1PHWA 4AB4A 4JYEA 1W54A 3C6CA 2QAPA 4K6AA 5HR6A 4UTWC 5BW6A 2VFGA 3UXDA 3VFLA 2A0NA 1P5BA 5D09A 3O07A 2E5DA 2YXGA 3CQ0A 4XUGA 3DFPA 1OFQA 1YADA 5EA9A 1L6YA 3EWUA 1LRTA 4IOTA 4JTKA 4JX4A 3HIJA 2GVLA 4PEKA 1GVOA 4UNLA 3W23A 3NO5A 1GG1A 3NPUA 1H7RA 2BTMA 1FCBA 2TRSA 4GUIA 4L4MA 5D30A 4ZQMA 5G4WA 1H7PA 3F4NA 3BG5A 1WXJA 2OCZA 3KOFA 3W1UA 4AAJA 1ZAIA 3B05A 1S5TA 5TBOA 1EUNA 1ZFJA 4EF8A 3PB0A 2Q8LA 2V30A 3MHUA 1RD5A 1BEUA 3QQ1A 3W72A 4AHPA 1S3HA 2Y7DA 3UY8A 3L2IA 3NPWA 1XUUA 3NQFA 4RX0A 1W5OA 1Z42A 1YDOA 1ZJIA 2VOMA 4AF0A 3RFAA 3NQMA 4MIMA 1B3OA 4BR1A 3UPWA 4XKYA 1GQNA 1H60A 4DF0A 2NLIA 5I3HA 4IUOA 3LCLA 1AL7A 2A7NA 1KV8A 1I8JA 3W1LA 1Y0EA 2C19A 5G1TA 5CPMA 2W79A 1XI3A 3CIXA 3FOKA 1TV8A 2QCDB 3GDKA 4Z1DA 3RLUA 2BZNA 1OF8A 3PB2A 5AHLA 3D0CA 3T7VA 4N2YA 5U7SA 1FXPA 1K03A 3P61A 1VRDA 2V0TA 4X3ZA 3A23A 3M43A 5LGXA 1A50A 2JKAA 3BGJA 3W6YA 4CNOA 3F03K 2EAWA 3FFSA 4GFSA 1OVDA 5FESA 1ICSA 1P0NA 2PCQA 4BI5A 1KFEA 1KLZA 2ISVA 4LV4A 5D2XA 2YCEA 2YW3A 1EA0A 1DQWA 3FA5A 1SZNA 4AEOA 1LP6A 1QDSA 3W7CA 1D3GA 3TIMA 1X1ZA 3NPXA 3S8HA 1FCQA 2NV2A 3GDMA 3EXSA 3O8AA 3FJLA 2ABAA 3LXBA 3GZ3A 3HG4A 4FIRA 3IGXA 3S1XA 4PL1A 1L9WA 2TPSA 3GR8A 3LDVA 3F4WA 1FX6A 3LLDA 4UTTA 5FEXA 3NGJA 4E38A 3MP3A 3TAOA 1K7FA 1N7KA 1W5MA 1FDZA 3LHZA 4LV9A 2ZTKA 1KM5A 1DQXA 3B04A 4NX0A 4YWIA 4JDBA 3C52A 2WSYA 1GWJA 5HUPA 4KWWA 4MZYA 3R5EA 1W3TA 3QSTA 2QCCA 1EP1A 1SZEA 2I9EA 1GJPA 3R12A 3G1XA 1JUKA 4M6QA 1KBJA 3G1YA 3NVTA 4K39A 1QNVA 4LNYA 4RXGA 1UBSA 3EB2A 3L68A 4RJEA 4GXMA 3SSJA 1A5CA 3DH7A 5KZMA 3NAVA 4N02A 3O15A 1KM3A 1HO4A 1H61A 1BTMA 1XDMA 2BLEA 1FWWA 1FCVA 4M19A 4N6FA 3S5YA 4E2BA 5HMSA 2E6FA 2DJXA 3EWXA 2BWGA 4IMGA 1AG1O 3NOEA 3L65A 2X16A 3DAQA 2VENA 3DKLA 2DZWA 1YXYA 4LS2A 4WXZA 5CZTA 3P84A 3N2MA 2ZBTA 1XL9A 1O60A 5CZSA 4TMBA 1KTNA 5HWNA 2HS8A 4JY9A 1FBAA 1VCGA 5DY2A 3ZS4A 3B06A 3HGJA 3FLUA 4K36A 1TPH1 1MZHA 1DKWA 3NNTA 4XQ6A 3M0ZA 3UPBA 4UTHA 1WAUA 4IXHA 2VELA 3MYOA 2DZTA 3CIWA 1JR1A 1YTDA 2FJKA 3OG3A 3P60A 4IMFA 1KLYA 2QJIA 3OIXA 1EB3A 1GTHA 5HUOA 3TXZA 3W87A 3CWNA 1FWSA 1G6CA 2WKJA 4QIUA 4ALDA 1OABA 3W85A 4C1LA 2ZRZA 1EWDA 4XBKA 1L2UA 1YLVA 4ZMGA 3OVQA 3PC0A 2ZZ7A 4JTLA 4ZQOA 1KFCA 4Y9AA 3TAKA 5D2WA 3B03A 4LU0A 5T26A 3NQDA 3W84A 4QM1A 1LLWA 1M7OA 3STGA 4UIOA 3DHDA 2RFGA 5F2MA 4HNNA 3MO7A 1C29A 3HOJA 3PSVA 1GG0A 3PG8A 5IBXA 4MUZA 4GNJA 1VCFA 3G3DA 4O57A 2R94A 5AYZA 4JEQA 4QISA 4O4WA 2EHHA 4DQWA 4HIBA 1BKSA 5J5DA 4S1FA 3PUEA 1IXOA 3BO9A 3L0GA 4ZL1A 4JS3A 4O18A 4FEZA 4UR7A 3M5ZA 5D32A 1NFBA 1QR7A 3NL6A 1WQ5A 3GDLA 2YW4A 5EBUA 4JXCA 2NX1A 4ZQNA 3V1PA 3NQEA 4JY8A 3S1UA 3OEXA 3KX6A 3WJXA 3EXRA 3BG9A 3IIVA 1VPXA 4FNPA 1PCWA 4XTDA 1U83A 3W7LA 3UXAA 1XUZA 5K7JA 3LHVA 4HT3A 2HMCA 3IIPA 3KVLA 4K8HA 1GVFA 4EOUA 3GYEA 3NQAA 4UTJA 1TB3A 2FQIA 4CQ9A 1JCJA 2DU2A 1QMLA 3IIOA 3MBFA 4RCXA 4Y6GA 5C5YA 2VFHA 2YGYA 1M6JA 2X1SA 5A8GA 1G4EA 3HG3A 4IPIA 3DI1A 1EIXA 5AOUA 1OFBA 4RR4A 1SW7A 1JCMP 2C0AA 2GOUA 3P8IA 3YPIA 3TSBA 4MJMA 4XZ9A 4DPQA 1T0OA 2V8ZA 4DBDA 3STEA 2Y70A 4DBEA 3SIZA 3MWAA 1NF7A 4ORIA 3E02A 2DZXA 2CLMA 3TX9A 3LXAA 1TPC1 1QFEA 2E1DA 1IXNA 3S6DA 2QCHA 4GBUA 4HKPA 3W7EA 1VLWA 5AHMA 3HB9A 4JDYA 2X2GA 5AHNA 4Z0JA 1G67A 3SW6A 1XBZA 4R34A 4OV4A 1LRQA 3KVJA 3QC3A 5U4NA 4UTKA 1OFDA 4C1KA 3LCWA 5EKYA 5HWJA 3PG9A 3T55A 2GVJA 5AHIA 3R13A 1HTIA 3HQ1A 3PVFA 1QPOA 3LI0A 3JRKA 1VYPX 1MEHA 1TJRA 3W1RA 2Y7EA 1J2WA 3PBWA 2PE4A 3QYQA 2YFNA 4X22A 3TW6A 1LORA 2FDSA 3W86A 3Q94A 3IRDA 1ZNNA 4LOCA 1KM1A 3LHUA 1PVNA 5K3VA 3W7IA 3T4CA 1LBLA 3W2MA 3TC7A 3W2NA 3NZRA 1SZGA 1M5WA 5CGQA 2VFDA 4PTNA 1SPQA 3W2LA 5DN1A 2I14A 3BW4A 2GPTA 2E5CA 2TSYA 2E5BA 4KWVA 4M7TA 1YXCA 2Y63A 4UFMA 3M6YA 1S5WA 2XN2A 3EWYA 4HNUA 1JCYA 4NXSA 2VFFA 4UR8A 2E6YA 3GVGA 4FNUA 3SZ8A 4HSOA 3G0XA 5AFDA 1EX5A 3LHYA 4O15A 3W2UA 3IVSA 1NF0A 1TJPA 3KVKA 4IGHA 1OFEA 3O6CA 1SSDA 2V9DA 1H62A 2RDUA 4RZ5A 4RZ6A 2ZQ0A 3I6RA 2NXHA 2E77A 4UTIA 1MXSA 2OT1A 3T78A 2ZRXA 3B4UA 4HSNA 5F4SA 5F2GA 4R7JA 1KTCA 1M7PA 1KV5A 2Z0IA 4UXDA 1W3NA 3P67A 1MEWA 1VHNA 1G4SA 2P10A 2A6LA 3GKAA 5DLCA 1WV2A 3U2OA 2B7NA 2QCLA 1W31A 1YPFA 3E49A 1FQ0A 3L21A 3L5AA 2NWSA 2RKXA 4AWUA 3WJYA 1JUEA 1LZOA 3P82A 4ML9A 3M5YA 3O6DA 5KZEA 2R8WA 3G8EA 3EKZA 1Q6RA 3VKJA 2P0OA 3DHFA 1F5ZA 4N9DA 1DBTA 1EP2A 4H4IA 1ICQA 1OX4A 4MJZA 1WDWA 4AVFA 3CHVA 4FNQA 5KTLA 2H6RA 3P74A 4MFEA 4O12A 2WV8A 4LW7A 3MP5A 1UASA 4O8RA 5AC7A 3CB8A 5I3GA 3GB6A 3N73A 3TR2A 2GJLA 4LVAA 2CZEA 5K4ZA 3O16A 3TFXA 3CC1A 3LTSA 1LDCA 2QF7A 2VFIA 3TH6A 2CLLA 4WD0A 1HL2A 1JVNA 4WX2A 5KITA 4MZ1A 2ZA2A 3NEVA 3HPXA 3C2OA 1TREA 4R33A 1OFPA 1V7YA 5FF3A 4FXRA 3W83A 1LOQA 4O0ZA 1TRDA 4JN6A 2G5WA 3NPVA 4R53A 3UZ5A 3U6WA 3DENA 5E93A 1F7BA 1Q45A 4Z1BA 3LX9A 4TMCA 3KFTA 4CCCA 4FX6M 4IMCA 3GXPA 4IPJA 4WY0A 1TO3A 4JTEA 1SQ7A 3LERA 3W3OA 3OBKA 1H1ZA 4TR9A 1DVJA 3G3MA 2B7OA 3ATYA 3STCA 2CZDA 3DXIA 1RQHA 2WQPA 1B9BA 1UJPA 3C0JA 3T40A 2ZZ3A 1OYAA 3P81A 4PFMA 1R30A 1SUXA 4ZVJA 4AF0B 3ELFA 2DZVA 2X1RA 3A24A 3C3NA 1GYNA 3TC6A 3RK8A 4HNTA 5BMXA 4ZQRA 3CU2A 2TYSA 1VQTA 5BOOA 4ICNA 4J9JA 3G0UA 1AW5A 1R2RA 3S5ZA 3LHWA 3BLFA 3BG3A 1PIIA 5AC8A 1KM0A 3NQVA 3M41A 3W1PA 4B5NA 5CG7A 1K02A 3LCFA 1PV8A 4Y90A 1X6UA 5FF7A 5KZDA 3M47A 4N9CA 4S2BA 1FUYA 2QCDA 3S9YA 2KZHA 3PS7A 2Y61A 3VE7A 1W0MA 3SFKA 4LVGA 4U4MA 1GPWA 5LHEA 3LLFA 4MVAA 1B4EA 1PCKA 3NYZA 5H91A 3UY7A 1JCNA 3V75A 3ANYA 1L6SA 3FEMA 3CPRA 3QFEA 1C8VA 4DO4A 2CFFA 3ATZA 1O4UA 2PRHA 4Y96A 2C13A 1YDNA 2Y7FA 2FB2A 5L9FA 3GDTA 1WA3A 3NQ7A 3W71A 3G1DA 1VGAA 5C54A 1MSSA 4QNWA 4LC6A 1BWLA 3VI2A 5LGZA 2NX9A 4QITA 3OHIA 3RLVA 2GJNA 2NXIA 1J4EA 3A21A 5D2TA 4BWLC 4PC8A 4Q4KA 4A2RA 2QAFA 3S0CA 2RHGA 4MFDA 2C6QA 3LB0A 1XM3A 2G95A 3TJLA 3W7NA 3IVTA 3GX9A 3HPZA 3LM7A 4FF7A 3T44A 2ABBA 1U5JA 3S1VA 3QJAA 2CZFA 3DZ1A 3TSMA 1G4PA 1QPRA 3E96A 4CCEA 1YTEA 1ZALA 5HULA 1W5QA 3WK1A 1SZFA 5G4EA 3L67A 2AGKA 1Z41A 2GQ9A 5LNUA 4FB7A 2QJGA 4PH6A 4BFAA 3F1QA 2E09A 4N9BA 4O50A 4JTTA 1XKYA 1RQEA 3E12A 1SFLA 4GUHA 4FO4A 3ABSA 3W70A 5CPLA 2O7QA 3P62A 4JX6A 2E68A 4AHQA 4I7UA 5LKYA 1SW3A 4E2DA 2JK2A 4NNAA 2YYTA 2QCNA 1VS1A 3HGRA 4HPJA 1PL9A 4NXKA 2QJHA 4MLRA 4LVBA 2WNZA 4MKNA 4MZ8A 4JR5A 2X30A 4ZQPA 4AWTA 3QSRA 4YL2A 1KA9F 4N4QA 2GQAA 1F05A 5HQEA 5BRBA 2RH9A 2VEKA 2UV8G 4ADUA 4EVZA 2ZA1A 1T96A 2Y7GA 4M7SA 2J6XA 3UYCA 1W1ZA 4CNNA 3I68A 1KFKA 2H8XA 2J27A
chains in the Genus database with same CATH superfamily
3VGEA 5CLTA 5IHSA 2QPSA 1PHQA 4AZ6A 2BVYA 4IX0A 2ZZ4A 1L6WA 3LCHA 3CM4A 2OSWA 4UTWA 2D20A 1JCTA 1P1XA 4LVFA 1H49A 3XISA 3QPYA 1ADOA 3EEGA 3UCDA 3RGTA 3A22A 3N2OA 3R11A 4GZIA 2QF8A 3ME3A 5I00A 3KBVA 1TSIA 5FF0A 4LFYA 3OBEA 4BQ5A 3SURA 1TA3B 4DY1A 3PY2A 3QMRA 2A5HA 2J9XA 4GPNA 3BLDA 4L7ZA 2CESA 2PDCA 4H6KA 3ZVIA 2YFOA 1EWEA 1FWFC 1QT1A 4L6DA 1P1MA 4WUIA 1SR0A 4NAEA 3EWBX 1NDYA 2HBVA 2QVNA 4GC4A 1ESWA 4POCA 2QDHA 4Q4OA 3CS2A 1T99A 1WPCA 2ZX6A 1PIGA 1I4NA 3E0WA 4PMYA 2XIQA 4AD3A 4KMQA 1E71M 1PIFA 3NM1A 5A6MA 4R9XA 1FKXA 5CH9A 3PSWA 2I56A 5FA5A 4A8LA 3RX2A 3W26A 4TTGA 1WYIA 4PA8A 2I17A 3T8LA 3IACA 4O1BA 1OYBA 5ABGA 4S38A 3SGZA 3IS4A 1UD3A 1V5XA 3SFWA 3RCMA 3IGSA 4ACZB 2WSQA 3WDPP 1UD8A 1H7NA 4UTMA 2GUBA 2AL2B 4ICMA 4WKHA 3DYOA 4NYUA 3BLIA 2DFAA 1W9VA 1H1YA 2EJ1A 2DUAA 3W75A 5RUBA 2VNCA 3PF3A 4MM1A 1FWNA 1UUOA 2AOSA 2PDNA 3GIPA 1J0JA 1V6VA 3WD1A 3LSBA 2FPTA 2PDUA 2OYLA 3TZNA 3R8RA 4NNBA 4OBTA 3DG7A 3GH7A 4O13A 3REQA 3I3BA 3S46A 4BK9A 3QTPA 1J0IA 4QJ5B 2X7WA 2ALRA 4O11A 2FHFA 3BGGA 2CBIA 2ZUWA 3DFTA 2QDGA 4A22A 1OFOA 1XH2A 4XAZA 3PPHA 1UC4A 4V15A 3CUZA 5I3IA 1XSJA 5CSRA 4ASTA 3EBVA 3K30A 1RK5A 4PUKA 1ONRA 4WSHA 4MNLA 3RYSA 3GU1A 5HPCA 2CWNA 3S42A 3TE9A 3QF0A 4CKQA 3MYPA 1YNPA 3H4XA 3R1ZA 3VX1A 3W81A 1UKPA 3F5JA 1Q8JA 2EG6A 3QZAA 5J5RA 1GVEA 3FAXA 3NDOA 3WQ4A 1Q13A 3CJPA 3LV6A 4ZODA 1JYXA 2Y2WA 3NXLA 2OGJA 4DZHA 2EKCA 2GVYA 1R2TA 4R27A 3I3DA 1GOMA 1W37A 1S2VA 1AQHA 1R3YA 4X0NA 1HKWA 1F3EA 3QMSA 1EPXA 3E2SA 3RR1A 1TPDA 3DYMA 1IIGA 5HATA 2DT0A 6PTDA 1GT8A 3IK4A 1F6KA 1E4MM 2FGZA 1EO5A 5IXEA 4AH7A 1BVNP 3WF0A 3VK5A 3ARXA 3ZO9A 3RJYA 2TMDA 1F76A 4LJ3A 4UOJA 4O17A 2Z24A 3WLRA 5JBDA 3INPA 4HCLA 5G2WA 2YZ5A 3LM3A 3NQ6A 2IUZA 2R91A 2PA6A 3W7OA 2ZDRA 4K37A 4KESA 3AISA 1VCVA 2PWGA 1CGYA 1UZDA 2ZRVA 2OQYA 2HPMA 1O5XA 3H2CA 1XIDA 4L1GA 4QE1A 5D4YA 3R8HA 1V0KA 4O28A 3PHAA 5FF2A 5F2IA 4QNEA 1WKYA 2DZAA 4PZVA 1KC7A 1RHCA 2O4QA 3MWCA 1V3HA 3DHUA 1ADSA 1JPDX 1OFAA 2IXUA 4PMRA 1CX9A 3CNYA 2OPJA 4GYPC 5D9NA 2HZGA 5A5WA 5M2FX 4LCRA 3UR8A 3CZLA 1OD0A 2GSJA 3VNDA 5BRQA 3U7BA 3SUVA 4JIRA 2VJXA 3GLCA 1QWGA 3GG8A 2G3MA 3T2OA 3UWQA 1KBIA 4Q32A 3NEHA 2W67A 3TMQA 3RUBL 2WSPA 1UG6A 1T40A 2AQOA 4L6HA 2JIWA 3UZZA 3W29A 3FV9A 4LRSA 3MT1A 3H23A 5IBXC 4HA4A 4LC8A 4WKFA 3S6OA 4NKCA 3M0IA 3F7JA 1SSGA 1MQQA 5BU9A 2VX6A 1RVKA 2F7FA 1BWKA 2WVUA 3WDRA 1NOWA 3GTFA 1UD4A 5DXYA 2ZC1A 3SAZA 4QEHA 1F2JA 2C14A 3BMVA 3GNNA 3E38A 3FHQA 3ZLFA 1XRFA 3GZAA 3LU2A 3RU8X 4NIRA 5DCEA 3M44A 3HG2A 4JIQA 4CVUA 4OT7A 4DZ5A 3V0SA 1ZBKA 2FTPA 3QTGA 1TPEA 3IEBA 1TWSA 4YMZA 2J8TA 2Z1VA 2I16A 1IXQA 3WK0A 4M80A 4WY0F 3BJTA 1FCUA 3VNIA 2WHKA 3A4AA 4D6DA 1VBGA 4F3HA 2ZX9A 1SO3A 2JE8A 4UMAA 1WXYA 1J6OA 3XIMA 5M5DA 1P0EA 3LGEA 2INEA 1LYXA 4JQ2A 3HM7A 3IJDA 1EDQA 3RXZA 3QR1A 2JGYA 2MUCA 3AMGA 4MAVA 3VTRA 2X1UA 1JDCA 4ZOEA 4KCWA 3KLLA 2IS7A 3M7WA 2Q71A 1DXFA 3EAUA 4H00A 3W7KA 1ZY9A 4EXAA 2V5CA 1EHNA 1R47A 5D2VA 4OGZA 4YVXA 3BV4A 1TKKA 4F0KA 3NSMA 2GL5A 1OK4A 3TJIA 4QLJA 3R0UA 3LRKA 2HV5A 3L2LA 2PRMA 5XINA 4E2OA 3WDJA 4G8TA 3QM3A 3WK2A 4DF2A 4BI7A 1S3TC 4XAYA 3AHZA 3SCVA 2Y4SA 4FAMA 1JYNA 5EB8A 1T8XA 3BSHA 2EPNA 1W5NA 4OE7A 4HYRA 2XGBA 4IP7A 4EIVA 1H7OA 4YTUA 3TZFA 3GNRA 2VGGA 1RBLA 3ZT6A 3NM3A 3PBVA 4C7FA 2SFPA 1VJZA 1DE6A 2ODOA 4Z08A 3TVAA 4JTUA 3FS2A 4J28A 1Z9AA 5CGTA 4EK7A 1OEPA 2ZCGA 1A5AA 1ONXA 4U3CA 1I2QA 3I7QA 1ME9A 3PJTA 4HB7A 5C9WA 3EWWA 3OODA 4JTRA 4L6OA 1TV3A 1FDJA 3HJZA 2BDQA 5TQLA 4NVTA 1RCQA 3QW4B 2Q09A 4OOZA 2JGQA 1K9TA 3T2PA 2QCGA 1MI3A 3L5MA 4DO6A 4K1GA 4S2CA 4JKMA 3ZT7A 1XHGA 2DW7A 4ZSTA 4XTIA 4W9TA 2WQDA 5AYYA 4O52A 3MQTA 2PZ0A 3LPOA 3CH0A 4YXGA 1UR4A 3FDGA 4JL2A 1DIDA 3IIZA 2OZ3A 2B4GA 3NO3A 1RV8A 2RGLA 1SO4A 1WE5A 4LBRA 1UA3A 1HKMA 3MSYA 3QN3A 2OZTA 4PCTA 3AMDA 3MMDA 2ISSA 4PUJA 4LUIA 2FPVA 3TYDA 1LBMA 4GK8A 1K8ZA 1ITQA 4P8XA 6CGTA 3SCOA 3WLHA 2WZEA 4HQVA 1E0VA 1JRCA 2B7QA 1A3XA 1UD6A 3TTYA 3BSGA 5DCDA 4LCSA 1POKA 2Z4GA 2YDRA 3M5XA 5SWUA 1LL7A 5GVJA 1CW2A 4C6OA 4NAEB 1RR2A 4K38A 3WQWA 4AVNA 1AA1B 3B8DA 4PMNA 2OJPA 4H7VA 1OHLA 3VCRA 3PBYA 1RSCA 3C2RA 3TMLA 3UXKA 3USBA 1R85A 3C61A 4FNRA 3OOQA 3SSZA 1CLKA 1HG3A 3CH9A 4LS1A 1Y7VA 1JYVA 2YA2A 4YU1A 1S2TA 3KZPA 4WOZA 4EPEC 1BRLA 2FZ9A 2PGWA 4KEUA 4UFIA 4G7EB 5HWMA 4O19A 4BA0A 5M1TA 2W66A 2P3ZA 4H6RA 2Y89A 3EXTA 2EBNA 1OG0A 4RUBA 3SY5A 3HMJG 1UMYA 2J47A 3BJSA 3OZMA 2XVNA 4P7OA 3PWAA 1E4LA 1DXEA 2O92A 2PDKA 3UD6A 4HN4A 1G9HA 4LT9A 1MRQA 1R2SA 3UR5A 1VFHA 4QHRA 4AWSA 4NNCA 4UTUA 4IIFA 4JFSA 2QUUA 2CLKA 2YL9A 2DIKA 4PRWA 4AISA 3HV9A 4O16A 4LSBA 4EWND 4UFKA 1DHKA 2E9MA 1PKLA 3REQB 3UG3A 5FL0A 2CITA 2Y88A 4NF7A 2BVTA 1J9YA 2ZIDA 1RH9A 3S4TA 1VFOA 1R87A 4PCFA 1IZCA 3M0VA 1I2RA 1XYLA 3KRZA 2QT3A 4H9TA 2R1KA 3RMJA 2Q8ZA 4AYSA 2ZRWA 4PGLA 1MUWA 3W7PA 3WF2A 3KL3A 3Q58A 3JZEA 3T0DA 5I79A 2NLYA 4M82A 4IX2A 3B0VC 1NARA 4QAIA 3TYUA 1G7UA 3BK0A 4YYCA 3BPWA 1V3JA 1GEQA 2WMKA 2WMJA 3KVMA 5CPSA 1EBHA 3VDCA 4IISA 5C9XA 4XIMA 1TTPA 3L66A 4JNZA 3PZTA 4JFTA 5REQA 4TX9A 3G22A 3U4AA 3WYZA 1M04A 4UFJA 1WZLA 2CCRA 3AYTA 3WNKA 2Y62A 4DEFA 3IUHA 2QCEA 2QV4A 2VR2A 1EC9A 5JXQA 2GYIA 1W2PA 4DHGA 2XN1A 3EA3A 3VNLA 4DAFA 4FXSA 2CW6A 2IPJA 4FOUA 3UJFA 3E5PA 3GTNA 2YL6A 1T41A 5C2CA 2DQXA 4QQ3A 2FIQA 3AUJA 1R0MA 4A2SA 1Z8AA 3UWWA 1FH9A 4WJEA 2ZFAA 4GLEA 5E5CA 3OLEA 1OYCA 2ZZ1A 5CSSA 2VX7A 4LXFA 3R43A 4DF1A 1J96A 2CLIA 1HJQA 4KIEA 1J5SA 1TCDA 1KRAC 1R3TA 2VXNA 2QUTA 3UZJA 2EEXA 4AD4A 1KM4A 5XIAA 2PBGA 2TAAA 5I2UA 4Y8FA 4ACYA 4NJIA 5D05A 3FX4A 4JTQA 4D71A 3UWVA 3W7GA 5I6SA 4JIHA 4AMAA 4HSHA 4GQGA 1X1OA 1P6BA 2RAGA 1ODUA 2QUVA 4QSHA 5F1VA 1SU5A 4OTKA 4D2JA 1HIZA 2GVGA 3BAIA 3QC0A 4JYEA 8XIAA 2QAPA 4AZGA 5DMLA 5BW6A 3UXDA 4AIBA 1P5BA 4FSAA 3GXDA 1D7FA 3DFPA 1L6YA 3L4XA 4IOTA 4JX4A 3VABA 4PEKA 3WQVA 2P0IA 1GG1A 4J4KA 3IJ9A 2EKGA 2TRSA 4GUIA 4DWSD 4ZQMA 1H7PA 3F4NA 4LAZA 3GU9A 3QHNA 4WEVX 2GWGA 4NZ5A 1M68A 1UWQA 4ZGYA 4LCQA 1EUNA 4EF8A 3MHUA 1Q4NX 1ZBCA 3QQ1A 4IIGA 4AHPA 1H0IA 2HXTA 4UR9A 2QNEA 3GU2A 3PJWA 5A6JA 1YDOA 4AF0A 3RFAA 3NQMA 1CCWB 1B3OA 3QVQA 4XKYA 1GQNA 2NVDA 4YVVA 2NLIA 2PLMA 3E0LA 5ABFA 3LCLA 1TVLA 2A7NA 1I8JA 3W1LA 1Y0EA 5CPMA 1XI3A 1K1DA 1NH6A 3LEPA 3H2AA 2PDJA 2BZNA 1OF8A 3CPUA 5C0QA 1VEPA 4N2YA 2WVTA 5U7SA 1FXPA 1V4YA 1JZ4A 1VRDA 7XIMA 4X3ZA 1LJYA 3A23A 5A8PA 4NSBA 4XUYA 2UWFA 2DVXA 3W6YA 2IPGA 3F03K 3WX7A 1I0DA 3A4WA 4TX6A 5E0FA 1KLZA 1PAMA 5D2XA 5T91A 2WPGA 4LUTA 2YW3A 1EA0A 2P8BA 3FA5A 1PZ0A 4HYVA 1Z3NA 4AEOA 3WG6A 1A47A 1D3GA 3S8HA 4IFOA 1R9XA 4CVWA 3GDMA 3FJLA 2ACRA 3LXBA 3CAVA 3HG4A 4PL1A 2YL5A 2E28A 3A3WA 3KL0A 3CUGA 3LLDA 4QE4A 1JL8A 1XIJA 1PTAA 5FEXA 4DI8A 1H09A 1QW9A 4LUSA 4WGXA 2E9LA 4CD8A 1KXHA 4YVPA 2EXOA 4Q8UA 3GXMA 1YE6A 2OLSA 2ZTKA 2DT1A 2X0YA 3EOUA 4L80A 1BQGA 4JDBA 1GWJA 3FA3A 5FJPA 4GVHA 2QCCA 1SZEA 1IHIA 3NIYA 1L8NA 1TIWA 3AZSA 4H8UA 5HXMA 4F9JA 3KUMA 4E8CA 3G1XA 2ICSA 1KBJA 3G1YA 1R6WA 5LA0A 1KQYA 4UQEA 4RJEA 3HZ3A 4GXMA 4Q8PA 5KZMA 4V2XA 1JFXA 1S46A 6XIMA 1XDMA 2BLEA 3VCNA 1FCVA 2XVKA 4M19A 3DFHA 1ELSA 3WNNA 4E2BA 3WLMA 2E6FA 4AY1A 4EPBC 1YBQA 3EWXA 4FA3A 3NOEA 1ECEA 3L65A 2X16A 4H8HA 3DFYA 1W9BM 1YXYA 4RNIA 2CKSA 5CZTA 3D47A 3VM7A 4PMUA 1ADDA 1KTNA 5HWNA 2HS8A 3OPSA 4H2HA 4QBXA 3UFYA 3B06A 3EDJA 4FLRA 1BG4A 3VINA 3FLUA 1DKWA 4F0MA 3P2VA 3U9IA 2GGEA 2J13A 3D5HA 3PFRA 4M3PA 3WUEA 2X2YA 4IMFA 3VGGA 4GYPA 4BJHA 1R9YA 1GVYA 5HUOA 5CBBA 3R58A 2XFYA 3GSMA 5CAKA 2CZVA 4XBKA 2XVPA 2XIBA 3TYBA 4C6DA 2I5IA 2BBFA 3OVQA 1Q7QA 4P8UA 2ZZ7A 4JTLA 1KFCA 4IFRA 3B03A 1E6SM 3STGA 2QDEA 4UIOA 4HNNA 2YLLA 1A80A 1C29A 2QS8A 2D2GA 2YXXA 4DYEA 3HOJA 2WJDA 3LD5A 3ARRA 3PSVA 1DWAM 1GG0A 5IBXA 4GNJA 5I24A 4NG3A 4KRUA 1TG7A 3PTDA 1A5MC 3RLGA 3DDMA 2R1NA 5AYZA 4QISA 2EHHA 4CNSA 4LALA 1BKSA 2VVSA 1JI1A 3M46A 1SYTA 4S1FA 3PUEA 1UR3M 1B3VA 3L0GA 3URQA 4ZL1A 2R82A 3CQHA 2Z1SA 1V77A 3H26A 5JIWA 3RX4A 1BRLB 1UP3A 4AZ5A 1S5NA 4JXCA 2NX1A 4ZO8A 3S1UA 3BG9A 3B8WA 4H9XA 2QJNA 3BUVA 1VPXA 1MUMA 3VA8A 4BF7A 4ZB5A 4QP0A 1EGVA 2HMCA 3KVLA 4K8HA 3USZA 1GVFA 3GYEA 4NZ1A 2DT2A 1TB3A 4GY7A 2FQIA 4RCXA 4AZ7A 1XYZA 2VFHA 1CEOA 2YGYA 1GZJA 4IPIA 1UR8A 3DI1A 1Y5XA 7CGTA 2JFEX 3EDKA 4M29A 3P8IA 1BG9A 3TSBA 3KTSA 3CUXA 4DBDA 3M0LA 2BOGX 5A6BD 1NF7A 4ORIA 3RM4A 3BLLA 4WSJA 2Z27A 1U2YA 3S9IA 1QFEA 2E1DA 3S6DA 1ODZA 2PDBA 1VLWA 4G7FA 5AHMA 2P8CA 3L4UA 4W86A 3ANVA 1RA5A 5AHNA 3SW6A 4QFUA 4OV4A 1LRQA 4Q8NA 2PDPA 4DX3A 3WMCA 4FR1A 3VDHA 5DFAA 3T55A 3ID7A 1BVWA 3OYZA 3PNZA 5DT5A 2FZ8A 1GONA 2Z00A 3QYQA 2Z1XA 1HZYA 3SY8A 2XHYA 3KWXA 3OA5A 3LHUA 4EANA 2WM1A 2QUMA 3DN5A 2J8GA 2D2JA 4US6A 1LBLA 3TC7A 3HPFA 2GFTA 2VFDA 1OCQA 1VD6A 3N6QA 4NASA 1UH2A 2DY3A 1MXDA 1AMYA 2V38A 4FR6A 5DN1A 2NQHA 3VNKA 2E5CA 5REQB 1HGYA 1WUFA 1KR1A 4LYPA 4KWVA 3WLPA 4F0SA 4UFMA 3M6YA 2XN2A 2ESCA 1EJ7L 1JCYA 2EPKX 3GVGA 2PEVA 2WZHA 4FNUA 1K4GA 3L4ZA 2YBVA 1DTNA 5IOBA 4FMVA 3AQUA 3MU7A 4O15A 3TWAA 3KVKA 1OFEA 2W91A 2V9DA 1H62A 2RDUA 2XM2A 3I6RA 1CXIA 4UTIA 1C7SA 1MXSA 3BAXA 4TVUA 2OT1A 3CGTA 3T78A 3AHXA 4ZXLA 4WJXA 1W3NA 5E09A 1MEWA 2FVLA 4B92A 2W27A 3GKAA 1CB2A 1K9FA 1TWIA 2B7NA 2QCLA 3L7RA 4ICCX 3T07A 1K9EA 1RALA 4AWUA 2BY0A 2YCLA 3GW3A 1JUEA 4E2VA 1DYSA 3C2YA 1A5KC 2QGHA 5EBAA 1ZJHA 3EKZA 1Q6RA 3IJ7A 3VKJA 4IZGA 4X60A 4N9DA 4H6EA 1GOWA 4L9ZA 4W7VA 5HMDA 4KWOA 5HNNA 5GJPA 4AVFA 3NSNA 3B9EA 3SB0A 3P74A 1H3GA 3PJXA 5CAHA 3H7VA 5I3GA 5AC7A 1IWAA 1JXJA 1XQLA 3TR2A 3WQPA 1X8CA 2CZEA 1P0BA 2DVUA 5ABHA 3LTSA 2BY1A 4OUIA 2QF7A 3MKCA 1LT8A 2VFIA 3TJ4A 1FOBA 4WD0A 2OOFA 3DG6A 3MS8A 4WX2A 2EG8A 5KITA 2ZA2A 3BOFA 1TREA 3FHAA 1OFPA 2VI0A 2D3NA 1UD2A 1Q85A 1LOQA 4H7CA 3EOLA 2BNJA 3ZZ1A 3DENA 5CG0A 1BHGA 1GCYA 4CCCA 2F61A 4IMCA 2QJMA 4IPJA 4UWMA 3B9DA 4WY0A 1SQ7A 2XIOA 3LERA 3W3OA 4AFYA 3S3GA 5CSUA 1KKRA 2FDMA 3C86A 3IARA 2WQPA 2ZZ3A 2EPMX 3OZPA 2NQ9A 4FLSA 4PFMA 1V6TA 3UU0A 2DDXA 4AF0B 2BVDA 3C3NA 1T5AA 2HQAA 4HBKA 2PODA 3CU2A 2TYSA 1VQTA 1EZ2A 5ABFB 4J9JA 3RPDA 1W91A 2WVSA 1NP0A 4A05A 1UR9A 4MWAA 3CHEA 4RW5A 1TV4A 3M41A 4BF5A 5CG7A 1RXOB 2GGIA 1K02A 4KF1A 3JW7A 1CBGA 2Y8KA 3BSMA 4A4AA 1DJHA 1X6UA 5KZDA 4S2BA 2QCDA 3S9YA 4IPLA 3PS7A 3MMUA 3VE7A 1W0MA 1HJVA 2D0FA 4LVGA 4PTXA 1FWIC 4KRZA 1OG6A 2POTA 3GFXA 4LUTB 1PCKA 1JPIA 3MSGA 3ZYZA 3EPMA 4N42A 1HL9A 3S5SA 1C7TA 3ANYA 4H19A 2XIJA 4Y9PA 4DO4A 1KBKA 4QQUA 2CFFA 1O4UA 2P88A 2PRHA 3QXBA 4HNOA 1NQ6A 2IXVA 3G1DA 1VGAA 5I7GA 1PX4A 1FWHC 5C54A 7REQA 5LGZA 2XPKA 4LUSB 4QITA 3W38A 3LQLA 1J4EA 1EPVA 3QKZA 2RHGA 4YJ5A 3GX9A 4ATLA 4RE0A 3GFZA 1UWUA 3WEOA 2Q02A 1E3XA 1FHVA 4GQ0A 3QJAA 4IF2A 3DZ1A 3TSMA 4UZUA 1V79A 1YTEA 4PE8A 4H1ZA 4ZTXA 1WKDA 2YDQA 2B81A 1XH0A 4REQA 2GJRA 5JH2A 2PCEA 1K6WA 5G4EA 4O1EA 2AGKA 1QI2A 5HMEA 3EB3A 4DBSA 3WQFA 2G0WA 4BFAA 1XKYA 1YBQB 4GUHA 1VBUA 5A6LA 1JPHA 1OGBA 1PO9A 3W70A 5CPLA 2O7QA 5DANA 4HU8A 2G41A 1A5OC 5LKYA 2VR5A 1NELA 2BOEX 2YBUA 1EOMA 3HGRA 4PTDA 4Q4RA 1XSKA 3N12A 1OY0A 2Y24A 4LVBA 1RD6A 3WLOA 2F2HA 4I9JA 2X30A 2E8YA 1TE6A 2GQAA 4HMEA 1V02E 2UV8G 4ADUA 1S2UA 4TTUA 1DQUA 2J6XA 3E0VA 3T08A 1RK6A 3UYCA 4GZEA 2H8XA 1LWHA 2I1OA 1BXNA 5IDZA 1DJXA 3WQOA 4R88A 4D1JA 3WJZA 3UWUA 4H8VA 4J3VA 3OJGA 1M41A 4CU7A 3CEUA 4OIFA 4UFHA 1A5NC 3R8GA 1AD1A 1O5QA 1XX1A 1VC4A 1B3ZA 1IV8A 3S5NA 3WNMA 4E3TA 4QAWA 1MW0A 3CL6A 5FJIA 1H7XA 2AGTA 1W1PA 5EMKA 2QW5A 3NG3A 1W8SA 4C6CA 1F3WA 1WBJA 2QCFA 1DJNA 1TPB1 4B9ZA 3L12A 4NJJA 3HPAA 4RL3A 1OSEA 3PN8A 3IANA 1CGXA 4DUOA 1V8EA 2L5HA 3KDNA 4JHZA 5AN7A 5EMUA 3OVRA 1H51A 5I3KA 5FIPA 5JQ9A 1UUMA 4OHQA 3EX4A 1AZ2A 5D37A 4RNJA 5CZKA 1Q2RA 3N34A 3G5EA 4H01A 2HEJA 3GM8A 1WNOA 1TTIA 4JD4A 4LAUA 3TJXA 4RKAA 1JQXA 2GQ8A 1YTKA 4DJEC 4HU0A 1JNDA 2Z1KA 1XLHA 2E4TA 4BF9A 5ENLA 4M1BA 1LOLA 2A1YA 5HQMA 1TRIA 4KGLA 3L2MA 5G2HA 3G6MA 3M7SA 3BLPX 3CUIA 2PPGA 3VIFA 5AHFA 1DWGM 3G18A 3CZKA 1E1EA 1WDSA 3UGRA 4Q6JA 4XVDA 3ZVHB 3JR2A 4HZ6A 1XBXA 2WK2A 1Z32X 1WB0A 4P5UA 2GDQA 1UIPA 1YW1A 2ACSA 1PUDA 4KQNA 1OF6A 3KEHA 1I2PA 3AMCA 4JN8A 1OZQA 3LMZA 4DXKA 2V67A 3WQ8A 5BXRA 2ZVRA 1HNYA 2QDDA 2XSAA 3DEQA 5KMYA 1KRMA 3GG1A 3U2CA 4NZFA 3CZGA 3NL5A 3B3DA 5DMYA 2EPOA 1RAKA 4M6VA 3UF9A 2Z6JA 4ZOAA 1MW1A 1U22A 3O3RA 1V6WA 1S5MA 1XFBA 1SMAA 3GQYA 2ZRYA 2I5GA 4UTTC 2HROA 3HBLA 1G7VA 4IPNB 3BCJA 1XICA 5DF0A 2WJEA 2O9PA 1SW0A 4TU1A 4P8VA 1HT6A 2CC0A 1R46A 4A3YA 2C7FA 3WDIA 1JDFA 1V93A 3C8NA 3C56A 2Q6ZA 4JKKA 4O1DA 4DO5A 3UG5A 1Z44A 2UBPC 4JBRA 5BXPA 4I7VA 1MWOA 4MYXA 5HINA 3CL8A 2X40A 3MY9A 1E73M 2BHZA 2PD5A 4IG2A 3EWZA 2P1FA 2OXNA 1XGZA 2CPUA 3ZR5A 1PZ1A 4QE5A 2RDTA 3MI6A 3BH4A 2JKEA 2YB4A 2ZOXA 1IEXA 5CZJA 1H5YA 2PWFA 4W8BA 4AXKA 2BSLA 3NXFA 2YCLB 4B3ZA 4HOZA 3AHVA 3PNUA 1RUSA 4OFCA 5LNSA 1IR1A 3UZYA 3MUCA 3UGVA 3IGUA 2WZMA 4NUWA 2W6RA 2CLPA 3AIVA 2ZUNA 3NQ8A 1ZZMA 4P61A 4KCVA 1K70A 1VFSA 4LWWA 1O1HA 2BX7A 4AD0A 1QOQA 3AO0A 4WXYA 3LXCA 1VHCA 1MNZA 3D46A 3GE7A 3QV6A 1QPQA 3MZ2A 3VDGA 1GZGA 4KWSA 3S2LA 1YNQA 4UCGA 4L4LA 3EZ4A 2G3JA 4UB9A 4WLCA 2ZZ6A 2DH2A 2ZADA 1KM2A 3KOYA 4CQ8A 2WYSA 4MAZA 3N3TA 1IEWA 3GC2A 4HZMA 4JAWA 2HS6A 2XU2A 3RCNA 3GNDA 5MKGA 1X38A 3ARUA 1HFBA 3JUGA 3N2XA 3U4FA 3THQA 5C55A 5G2IA 1KFBA 3WLSA 4PCSA 1N82A 4FOJA 2V2HA 1CXEA 1KGXA 1Q6CA 3S1GA 3NZGA 1YXDA 2V2CA 1W1VA 1ZUAX 2ZXQA 4HK7A 4BI6A 4IQDA 4WY0B 3OTRA 1C90A 1ALDA 2ISWA 3QW3A 3UVAA 1JULA 4MB1A 1D9EA 3U2EA 3NUKA 4HVXA 2NUYA 3QQ0A 3FKKA 4FF5A 3HN3A 2QQ6A 2GJPA 5K9DA 1GVIA 2YLAA 3NOYA 3FEQA 3M5VA 4Y8EA 3AU2A 2WW5A 5I23A 5FOOA 2J7HA 4U28A 1HX0A 4C6KA 2C16A 4C6NA 1K9DA 4TIMA 4MY8A 1W3KA 2VC5A 2VWSA 3QPEA 3PANA 5L6UA 4MUPA 1MQPA 3PBUA 1FWTA 2HSAA 2OYKA 2O4MA 3MJMA 4EP8C 5AB3A 4JTHA 1FP9A 1R3QA 4S3JA 3ZJ8A 3W7JA 3BICA 5AC5A 3GS6A 3ZWTA 2FJUB 1AW1A 1PDYA 3GIYA 3QRHA 3KHJA 3KTXA 2BXVA 3MVTA 2DZPA 5C2XA 2Z2AA 1DIEA 1ZSXA 1TV7A 4HNLA 1Q6OA 1X39A 3E74A 2HVNA 3T1GA 1LBFA 2QKFA 3ICJA 1HP4A 1OWQA 1A0EA 1Q6LA 5I3FA 9XIMA 2QVHA 2ZE0A 4B4FA 1H63A 4DJDD 3WLIA 1X8FA 2OWCA 4GQQA 4CQCA 1GOIA 1WOBA 3CO8A 2F8QA 1J0KA 4KS0A 4UQ9A 3HQPA 1K8CA 1UH4A 3B8SA 3P5YA 3NURA 1NOFA 4C1NB 1IGWA 4K2SA 3UWZA 1UZHA 4JIEA 4GUGA 2O9TA 2OT0A 1J5TA 3U57A 3CQKA 2J9ZA 3TCSA 1LLOA 4GJ1A 1BYCA 2BS9A 5LHFA 1W9XA 1G4TA 4C6FA 5AC4A 2PDLA 2OO0A 3S6TA 1XCFA 3MUZ1 3AU6A 3GHTA 4LRTA 3NQGA 3WNPA 2J62A 4IM4A 1CYGA 1ZJAA 4CNUA 4REQB 4JCMA 2ASHA 2NX3A 3EX1A 5JIPA 1PKMA 2ZZ2A 4D8LA 1JZ2A 4LPCA 3RJXA 3W1NA 4RNHA 4IIBA 4JQAA 4WIWA 1JCXA 2ZA3A 1SFJA 2BV9A 1AJ0A 3LTPA 3AHYA 1IR2A 3NR0A 4GIRA 3V16A 2V2DA 2ZYFA 2DORA 3CASA 1ZENA 4ZR8A 4DWDA 4J5NA 3W1MA 3ABXA 2YJQA 4ERIA 5FEWA 2XH0A 3CV7A 3WY1A 1OX5A 4S3BA 4HPXA 1EUAA 2PC8A 7A3HA 3LCXA 1GVQA 5A6KA 2G4JA 2PWUA 3DGRA 3OGVA 3T0AA 3UCCA 5LXEA 3UVIA 1WKFA 5CPOA 1R7OA 2OODA 3EX3A 5E0KA 1TMHA 2VP8A 4D6GA 4DXVA 3OVPA 3DKJA 4F8XA 1JYWA 1QI4A 1M53A 4L56A 3F2CA 2ZX5A 1EGMA 1NM9A 3G1VA 2BASA 4CEUC 2MNRA 4Q8OA 1TZ9A 1MEIA 3CMJA 5IFTA 3O63A 5J8LA 4QGCA 1TVNA 3UNTA 3V5FA 1E56A 4CQAA 5CPTA 2VRQA 1B3WA 4WDXA 4DWSB 1VR6A 5EFFA 5I3DA 3IJQA 3WUGA 3QEZA 3EX2A 3WBXA 1MUCA 2ZDSA 2CLEA 1BYBA 2DZSA 2Z1WA 1B3XA 4US5A 1BYAA 4S3GA 4XSMA 3CPGA 1KCLA 4D6JA 2XTKA 5A8OA 4C5ZA 4MY9A 2REQB 2XVLA 1IZKA 4BQ2A 4RPQA 3R0KA 4W84A 2VZUA 1E55A 1YDVA 3BAYA 1MO0A 4M8UA 4HMDA 1OFRA 3LNMA 5H1WA 4L4PA 3SR7A 2CERA 4IPPA 4HJWA 3O9NA 4C6EA 3SECA 3TDFA 3TXVA 2EJAA 4RV8A 1KFWA 4OWGA 4B3KA 4EXQA 4GG9A 4YCPA 1GOOA 2ZRUA 1X1NA 3AZTA 3VOJA 4NQ1A 4A8NA 2YX0A 1TTQA 1HF6A 4C6PA 1PX8A 4J3UA 1C91A 4YN5A 1CENA 1V08A 2VEPA 5FACA 4ECLA 3IIXA 4IMDA 1OZMA 3CLMA 6ALDA 1UPPA 2WJZA 1ME8A 1SGJA 2WNWA 2W62A 3VZYA 3GAYA 3UWYA 1F9CA 2WB5A 4IIDA 3ZLHA 1MZRA 3GD6A 4JHMA 4Q8QA 1AW2A 1ENUA 5CZ0A 3V18A 3I7SA 3IJIA 3QHMA 4W8AA 4WQ6A 1VH7A 5G5IA 5K2ZA 1FWDC 4EWJA 3PPFA 3WF4A 1YMYA 4TUFA 4KGJA 1A5SA 3Q37A 4DJFC 4AIOA 1E51A 5MHBA 1PTGA 1QNQA 5BRPA 4MTVA 1TV5A 3R4IA 4GWEA 3L0NA 4E4FA 4GVFA 3DECA 3L5LA 1M7XA 1V6XA 3QY8A 3LRLA 3JVAA 1QVBA 2NQLA 4F66A 1I60A 3CHDA 3COTA 3M0JA 2B7PA 3NSXA 3DU0A 2C1IA 3QMTA 5PTDA 1Q6QA 4RZBA 4CNPA 4GIEA 2C18A 4W85A 1KGUA 5CLWA 2AAAA 3RO8A 3VPLA 4A3HA 4WF7A 1EO7A 1A4LA 2GUUA 5AHEA 5BWAA 1E5JA 2Z7GA 1JGMA 1VFFA 2YYUA 4ZSUA 2VO5A 2H3BA 3K13A 5FF4A 2CLOA 1QO2A 3C5QA 1IZJA 3APTA 1O12A 1JZ8A 2HK1A 4ZCWA 1PWMA 3C2VA 2VQUA 4MJ4A 3MW7A 1TVPA 4U2YA 3MI2A 1JZ3A 4BHYA 1ZAJA 1JFHA 1YIXA 4G5DA 1XQKA 3M16A 4MLJA 1LLZA 5BROA 3STPA 3UR2A 4B90A 4I90A 2Y0FA 2Y6ZA 1Q6DA 5XIMA 3PWGA 5DRIA 3MV11 5FI8A 2WCAA 4QG6A 3NZPA 1Q65A 3L9CA 5AYXA 3G24A 2DW6A 1KM6A 4UNKA 4I5UA 3VGDA 4LB4A 1P0KA 1UP0A 4RPPA 5HJLA 2ATSA 3TV8A 4X9YA 3TA9A 1CTNA 5C7HA 1ECQA 2XISA 2J6VA 3Q2DA 3A64A 2R24A 1DJZA 1NU5A 4WVXA 1Q7ZA 1XDLA 4IHCA 1N8FA 4R3UA 1Q6FA 2NVAA 4QEEA 2Q01A 5FAJA 3C6CA 1QRQA 5EMLA 1LL4A 3VFLA 2A0NA 2OYMA 5D09A 3O07A 2PU1A 1DIOA 3SCQA 4Y7EA 1HVXA 2J75A 4DBUA 5MKGB 3EWUA 5FKYA 4L1XA 2WC7A 4FZIA 3R25A 3EDDA 2GLKA 1GEHA 4GO9A 2GJXA 2DZBA 4UNLA 3EOOA 3W23A 3IGHX 1A5LC 1W6TA 4UQAA 1H7RA 3T8QA 1FCBA 3GBDA 1J0YA 1R86A 1FFRA 3CBWA 5GQBA 3BG5A 3OBAA 1LQ0A 1WXJA 1A3HA 4J3ZA 4DJEA 3B05A 1S5TA 3ARZA 3WL0A 4H9VA 1V3IA 1RD5A 1BEUA 1E9YB 3K46A 1OIFA 4UCFA 2WKLA 1XLDA 2DT3A 4LH8A 4JKLA 3EDFA 2X0SA 4UZSA 2JQXA 1B0IA 3GO2A 1ZJIA 4MIMA 4WK9A 1C8XA 2OSXA 3VIJA 3LN3A 1KXTA 4MDPA 2XG9A 1AL7A 3SN1A 1KV8A 4PUEA 5G1TA 1QPKA 2W79A 3CIXA 1HJUA 3GDKA 3RLUA 5BOEA 1UKQA 3ENLA 4J3WA 4ZB2A 2BGSA 2IQ0A 3P61A 1K03A 3ALFA 4EPDC 3C0QA 1Y5VA 4RDZA 4GVGA 1TMLA 4PUUA 3BGJA 4GFSA 2XH2A 5FESA 4KWUA 1ICSA 1P0NA 3KOXA 1XDJA 2VGFA 5C9ZA 4LV4A 4GYJA 1A49A 4JCLA 3N6HA 2WHJA 4J3SA 1ISWA 3I10A 3BCDA 1LP6A 3G2GA 3W27A 1KD0A 4HN8A 3E2RA 1X1ZA 3NPXA 1FCQA 2NV2A 1JDDA 2XIIA 1A5UA 9RUBA 1GK8A 3GR8A 5M17A 4NP7A 4Y9NA 4UTTA 2CHOA 2V69A 2J7DA 4PBGA 2ZVIA 3NGJA 3MP3A 3TAOA 3QY7A 5A6AA 1N7KA 4B2DA 1W5MA 8RUCA 4LV9A 1DQXA 1AQ0A 3C52A 1L8PA 1ZCCA 4KWWA 4MZYA 4JZ5A 1W3TA 3QSTA 1NDWA 1JUKA 1XYMA 1RLCL 5CJNA 3MB9A 4LNYA 1HJXA 1UBSA 3DX5A 3L68A 3SSJA 1A5CA 3SCSA 3DH7A 3NAVA 1D7KA 3URBA 1W1YA 2R1LA 1XIBA 3DGBA 2DJXA 2EPLX 4CNTA 2BWGA 4I8DA 1AG1O 2WANA 4GH3A 3DAQA 5EMJA 3M64A 4NHVA 5EU9A 4LS2A 1Q66A 1VFTA 3G6LA 4NZ4A 1XL9A 4D6EA 3WQEA 4TMBA 4JY9A 1VF8A 5DY2A 2P76A 2W4XA 1Q6GA 5GJNA 3GNPA 3F5LA 9CGTA 3H24A 4K36A 1X7IA 1VBRA 1XW8A 1E0TA 3UPBA 4UTHA 4GCAA 4IXHA 3ARPA 3MYOA 2DZTA 1YTDA 2FJKA 3OG3A 3R7MA 2PDYA 5JU6A 2QJIA 3IJLA 4XG1A 3CWNA 4NYYA 2WKJA 3N2BA 2PP0A 4QIUA 3V5CA 1XPYA 4LY4A 3W85A 3VZZA 1KKOA 4H9UA 5DRCA 2ZKMX 2ZRZA 3HU7A 1EWDA 3SCUA 1L2UA 3KDOA 4ZMGA 3WLNA 4WHBA 4Y9AA 3TAKA 5BCAA 1OT2A 4LU0A 5T26A 1HKVA 4QM1A 1LLWA 2RFGA 5F2MA 3R6IA 4EACA 1UWIA 1J0ZA 1P0DA 1DEDA 1GNXA 3VUPA 3PG8A 4CD7A 5JH1A 2E7FA 4O57A 1L6GA 3MDWA 4JEQA 4F48A 4WDTA 2GDVA 1POJA 1WDQA 3WD2A 4B5WA 3APYA 4UR7A 3MSDA 1QR7A 1AD4A 3IRSA 3NL6A 3OYXA 3NTYA 3W00A 3H21A 1WQ5A 2BXZA 4HK5A 3ZJ7A 3VIPA 4ZQNA 4Z2GA 4C91A 5AZ0A 2RJGA 2ISDA 3LK6A 4FNPA 2YL8A 1PCWA 1U83A 4W7UA 4G7EA 3UXAA 3LHVA 3VC5A 4IH3A 4EOUA 4UTJA 4AIUA 1S38A 4CQ9A 5ECUA 1MW3A 4F2TA 5C5YA 4JIIX 5A8GA 1EIXA 3EPOA 1SW7A 2C0AA 4PMZA 4MJMA 4XZ9A 4MSSA 1T0OA 2V8ZA 3W24A 1EOKA 4TV5A 2PGFA 3E02A 3KS6A 2DZXA 4YWSA 1F3TA 2CLMA 3TX9A 3SN4A 4GI4A 2QMKA 1CXKA 1TPC1 1IXNA 3DBNA 4GBUA 3W7EA 4C6LA 2HBXA 2HRWA 4JDYA 1G67A 5C7VA 4PUWA 1XBZA 4R34A 1XIMA 1LT7A 3KVJA 4RW3A 4YTTA 5A6TC 3WEMA 4Z42C 1IEIA 3LCWA 1OBAA 3VIOA 1RY0A 4ZO9A 3R13A 3FN9A 1HTIA 3HQ1A 3PVFA 1QPOA 1MEHA 1TJRA 3GVWA 3ZJ6A 4X22A 2YFNA 3TW6A 2DGAA 4D1IA 2PD9A 4YTQA 1XINA 4LOCA 4LUYA 4ML4A 4B5TA 1CECA 3OB8A 3W7IA 2PLCA 1LUCB 3T4CA 2DIEA 3NZRA 3N11A 2FTYA 1VEMA 3RRAA 4E5TA 3UZWA 1ZS2A 1DJWA 3RO6A 1JAEA 1YXCA 3VMPA 1XIGA 3W02A 3F4DA 1BLIA 2WBKA 2VD9A 3VKDA 4OECA 4L1WA 4FALA 4HSOA 3DCPA 3A6OA 4IGHA 2ZXBA 3HFYA 2UZ9A 1ONWA 1EBGA 3FDKA 1M03A 1W3LA 4R7JA 3LQGA 3CL7A 1AH4A 1VHNA 1G4SA 1WV2A 5GPRA 2NSXA 1U5HA 1YPFA 2HISA 3L21A 3N29A 3TN5A 3OLIA 4GY0A 4HPNA 2XSBA 3WNOA 1LZOA 2P53A 4ML9A 4XSLA 3RPTA 3M5YA 3VD7A 4R7OA 5LIXX 3EOEA 3APGA 5HNUA 3SM0A 2R8WA 3K4DA 4XAFA 3V3WA 3GWQA 2P0OA 3OG2A 3URNA 1IT0A 3QOKA 1F5ZA 1KQZA 3AXHA 1DBTA 2XYLA 2DSWA 4H4IA 1ICQA 4GNKB 5IHRA 4HU4A 1Q2SA 3SADA 1Z69A 3CHVA 3WQDA 3CUJA 5KTLA 3LZ3A 2WV8A 1CGTA 4DBWA 4LW7A 1P48A 3OZOA 1UASA 4M1RA 6REQA 2OG9A 3VDAA 2GJLA 3FSUA 4G2DA 3TFXA 4GJIA 3SIMA 4FLOA 1CIUA 3WD3A 4XD4A 3MKKA 3NEVA 4C6JA 1JG9A 3T9PA 3C2OA 2GJXB 1TCMA 3S2CA 5FF3A 4FXRA 2WMHA 4O0ZA 3MKVA 2V5DA 3WD0A 1EEXA 3UZ5A 3U6WA 3BE7A 1DPMA 1Q45A 3KFTA 4FX6M 1X97A 3GXPA 4ZFMA 3QY6A 2B7OA 1E72M 4W5ZA 1UJPA 3C0JA 3ZJKA 1OYAA 2R6OA 1QNSA 5DMMA 4IL2A 1R30A 3ELFA 2DZVA 3W6LA 1GW1A 3SO7A 4DUXA 1XP3A 3VM5A 4HNTA 5BMXA 4U10A 1MW2A 4ICNA 4UQCA 4L9XA 1R2RA 3SRFA 3H7RA 3BLFA 3ITOA 1PIIA 3NQVA 3W1PA 4AZCA 5TD4A 1AH3A 2Z25A 4DZIA 2UY2A 2KZHA 3VILA 2IKIA 3E1F1 3M0KA 1CNVA 4DJFA 3NO1A 4B16A 3SFKA 4U4MA 3THUA 2R1PA 1JNEA 3DYPA 5TF0A 1B4EA 2PTYA 1PTDA 1J93A 3B4YA 5H91A 3UY7A 1JCNA 3UA3A 1FP8A 2QIIA 1XIEA 1F4AA 3FEMA 1C8VA 1SJCA 2IPWA 1Q6EA 1RCOB 1YDNA 4DNMA 4ZE4A 3L4VA 2FB2A 1U33A 3RRXA 4F2UA 3W82A 1D3CA 3CV2A 2FFIA 4YPJA 2X7VA 4LC6A 4V1YA 1BWLA 2IQDA 4HCDA 1EDTA 3TN3A 2NX9A 1ZB5A 3ITYA 2GJNA 3A21A 2F2KA 5BYWA 4BWLC 4A2RA 3S0CA 2C6QA 3LB0A 3W7NA 2AL1A 3BZGA 3M0XA 1JPMA 4FF7A 3RN6A 4DZAA 3S1VA 4LANA 4LYKA 3E96A 1EJVC 4M81A 1OD8A 1ZTVA 4C6IA 1ZALA 3F4VA 2PGEA 5HULA 1PXGA 1W5QA 3WK1A 1QUMA 1PSCA 3QKEA 4PMOA 2WHMA 1SZFA 4TX8A 3GH4A 4Z2KA 4FB7A 3N6JA 1SJAA 3L4WA 4JTTA 1J8VA 3E12A 1SFLA 4EAMA 3QQWA 4QJ3B 3VIMA 3P62A 1BF2A 4I5XA 2G4FA 4NNAA 5AYBA 2YYTA 4HPJA 3AUOA 4GBDA 2VT0A 1PL9A 4NXKA 3P3BA 2XH7A 2VX4A 4M56A 1PYMA 1GPFA 5KETA 4AY8A 5LA1A 4YL2A 2IPFA 4N4QA 2W3ZA 4E4PA 1H41A 4F0RA 2RH9A 2ZA1A 2OQLA 1YDYA 3F5KA 2D2OA 4GIAA 1NFPA 1KR0A 4X2PA 4U3AA 3D3FA 2PDIA 5BXSA 4PFHA 2OX4A 3MCMA 4X61A 1KFKA 1ZU8A 1RJPA 2A3BA 1EP3A 3FJNA 1MMFA 1WAWA 3MHFA 4V1XA 5HQLA 1E9LA 1V0LA 4JX5A 5D02A 4PRRA 2CHRA 3NJ3A 2HDJA 2HPIA 1EJXC 1FVPA 1MFVA 2XN0A 1Q3NA 3WH5A 4RV3A 2C15A 3TQKA 4RK8A 4C7DA 3A9IA 3B8TA 1OX6A 3NL3A 2V81A 1ISYA 3TLLA 1EL3A 1UR1A 2WO5A 3TOPA 2H90A 1GVSA 3ABZA 2C79A 4K8GA 2RUSA 5H8MA 1P4CA 6XIAA 1ITUA 1RP9A 2XVGA 1ZRQA 4Q4MA 3JS3A 2BG5A 1Z48A 3EA2A 3TQVA 4DVOA 1TYGA 4JFVA 5DY3A 3RMEA 3LCGA 5EPDA 2NWRA 4LY8A 1HXJA 2HWGA 4Z1CA 2WWCA 1LM1A 1XBVA 4NAFB 4OKDA 3WSUA 1FHLA 3WBWA 3GXTA 4PUDA 3FCPA 3MANA 3NL2A 1ML1A 3C2EA 4MOZA 5A6SA 2P5NA 2QLYA 4MJ2A 2CKRA 4RLIA 2OLAA 5GJMA 3WFAA 1NVMA 3GXNA 3BZJA 2Q3OA 3HGOA 4AX6A 1LF1A 2FZBA 1XCWA 3P5ZA 4O54A 4IL0A 4NRSA 5BU6A 4I6VA 1JJKA 3EKGA 3T4WA 3I7RA 2WPBA 3LG3A 5H8PA 3OGRA 1CGVA 3WEZA 4HA3A 4LQ1A 3S83A 4XISA 5CC6A 5D03A 2I57A 1UWSA 2GOKA 3ARSA 4L4OA 3G1AA 5CJ5A 3TYEA 5AC6A 5E0CA 1R3SA 2V82A 3CQJA 4K7VA 2FKPA 1GHSA 1L6FA 2HNEA 2FPYA 2WCGA 1QTWA 2H3DA 4KIRA 1KGWA 1UB3A 4NJGA 3U8GA 4A3UA 5A8NA 5K4XA 1NWSA 1K7EA 2FVMA 3QPZA 4WSKA 5HA7A 3O2LA 1AK5A 3W73A 2A79A 4HGXA 1J01A 5K9XA 4Q7NA 1EYEA 2NQZA 2XM1A 3POHA 4C6MA 3FY1A 4AHOA 3NDYA 4JTGA 4F40A 1DE5A 5BNKA 7ODCA 3SRDA 2VKZG 1D2KA 2B0MA 3GY1A 3W74A 3MP4A 3NVDA 1PJ9A 2NV9A 5AZ1A 2QYGA 3TONA 1ZP4A 3W7DA 3AXKA 3RR4A 1C93A 1QNRA 1NJJA 3GAKA 5DBUA 1I1XA 1ISVA 5KZ6A 4CLMA 3BVJA 3QFWA 4PL2A 3E6EA 3RLHA 3MJYA 4PSPA 2YDAA 4NZJA 1S5VA 2AKZA 2DUZA 2Y85A 1I0BA 3T09A 1O6IA 1GHRA 1TELA 1UOKA 3SCTA 1SR9A 3AXXA 2HE8A 3KP1A 2VZOA 2DPEA 1B31A 2PU0A 3HF3A 4FX8A 2YCJA 3DFNA 4EF9A 4JNYA 3VMOA 1QK2A 1QCWA 1JEZA 1UR2A 3MA8A 4ZBCA 1UWRA 3C8FA 1HN1A 3PUDA 3STFA 1H7WA 1OM0A 4WRHA 3WLLA 1US2A 2CYGA 2OKTA 1WP6A 4XZWA 4KERA 5G1YA 1PZ3A 2ZTJA 3N4FA 4UFLA 4WCJA 1ICPA 3VCCA 2NW0A 1FWCC 1WDPA 3WFLA 3RILA 2WSRA 3W4RA 1WUEA 5LNWA 1QPNA 3WJSA 3FKRA 4FI4A 1OK6A 2Z6IA 2X0HA 1EKOA 3W07A 3QH2A 1SMDA 3ZWSA 3LUTA 4GE8A 3E0IA 1R3VA 1R9ZA 4JHOA 2FB3A 3V0TA 3NZ1A 4OV9A 4HHMA 4UMCA 3WBAA 3QV7A 5K9CA 2J4GA 6REQB 4QLKA 4XZIA 4A3RA 2F6XA 4FHAA 4GCXA 1AMKA 1O5KA 1ITCA 4GGBA 4LBSA 1LTDA 3O6AA 3O1NA 1E5NA 2Q8XA 4XBSA 3QGVA 4GH1A 4D9PA 4UC5A 4JL1A 5LZLA 4DWSC 1ISXA 2D24A 3MMTA 4P7NA 4CEXC 3H54A 3WO8A 2JBMA 2VFEA 2E67A 3W2KA 1FWJC 1AVAA 5LIWX 1KXVA 4Q22A 2HTMA 4GMEA 4KH2A 3WIJA 3B40A 2X1TA 3ANUA 2JIEA 3ITLA 3LBMA 2P50A 4DM2A 2EGZA 4GA8A 1RY8A 3RHGA 1KO0A 3UEQA 1VJSA 4HHLA 1MFUA 4X2RA 5GNXA 3TYCA 1A53A 4IGNA 1ZQ5A 2OEMA 2CXEA 3A5FA 1V6UA 1E6ZA 4ZB0A 4YNGA 2E0PA 1KFLA 2CLHA 3LPPA 3NA8A 4PR4A 3QBUA 4NJHA 8XIMA 3TQ0A 3RF9A 3C0LA 3ALGA 2PSNA 5CC5A 3AMLA 4X63A 3MC5A 1VIZA 2OLHA 4AZCB 4XZHA 3MUIA 3L23A 3OP2A 4JGDA 5TIMA 2EG7A 2WM0A 2X05A 3N13A 1KFJA 3AOFA 4ZOBA 3VKKA 5CEWA 2XWDA 2FZNA 5A1AA 1TIMA 2JALA 3VOIA 1GOKA 3BOXA 2FVKA 1SJDA 3TC3A 3LBCA 5MF5A 2YPIA 5KINA 4JPGA 1F74A 2YZRA 4W88A 4S3AA 2NXGA 3LV5A 3VX0A 3RIKA 3WJWA 3CWOX 1O94A 1NIUA 1NWTA 2HJPA 4IFKB 1BXBA 4HP5A 1H0GA 3JU2A 3AIQA 1RBAA 2NUXA 3B0UX 3W76A 4AC1X 2FMNA 4AD2A 3PAJA 4M51A 1JCLA 4MDOA 3GR7A 2J9YA 4CQBA 3B9OA 4U31A 4JFUA 1E0XA 2V5BA 4C60A 3W9ZA 2V6AA 3MI3A 3B9NA 3SGUA 3CXOA 2GGHA 2ATMA 3LCIA 3OIHA 4PODA 4B5SA 3W2JA 3IPWA 5BMWA 4D6CA 1E70M 4ENLA 3VNMA 2PF0A 2VCCA 1XC4A 3N3MA 2OMAA 3UETA 1FH8A 1LRNA 1DHPA 1VYRA 3A9BA 4CN6A 3HURA 3PAOA 6ENLA 4FNSA 1JGIA 3H22A 3SUWA 3TA6A 1ZGDA 5D2YA 2PTXA 4Z2LA 3MTWA 2GZXA 1R3RA 4DI9A 4D72A 3W22A 3O06A 4UTLA 4GJJA 1WX0A 4LS0A 6TIMA 3O0FA 1TR1A 4GXPA 1EXPA 4JYFA 4KFOA 1FRBA 4JTDA 1N8WA 3KOZA 1GOXA 3LRMA 3CQIA 3TTOA 3V1HA 1TMQA 5AVHA 1B3YA 2EF9A 3CMFA 3AJXA 2PP1A 1US0A 2A3HA 1W56A 3HG5A 3ES7A 3OVGA 3KCJA 3WMLA 2VDGA 1Z89A 2F6UA 4TVCA 3VOGA 2XIMA 3IVUA 4NX5A 4PMXA 3HQOA 3FW6A 2D69A 3P0XA 1AQFA 1DORA 3M1ZA 4W93A 1N2VA 1EH9A 2ALDA 3HGSA 4ATWA 1S1RA 3ZQ9A 1TTJA 1W2VA 3PM6A 2RGMA 1IYXA 3RPMA 4B15A 4XVEA 3M9YA 4IT1A 1VP5A 2WZTA 3AAMA 4FP1A 3ZIZA 1PBGA 1W1TA 4CCDA 1CT5A 3PZIA 4JNMA 1GUVA 5BWFA 2V5LA 4L5ZA 1RPXA 2BMBA 1BGGA 2G97A 5C6MA 3RAOA 4HMNA 2INZA 3AJ7A 1R7AA 1E0WA 3OGSA 2YCKX 3M4HA 1B5TA 1VLIA 2A3CA 5CXPA 1V0MA 2CZ5A 3ITVA 1O7AA 1W3IA 3GDRA 3TN4A 2HVOA 4XZLX 2GGJA 3LHTA 5C2GA 4HJFA 4IMEA 3W88A 4O0KA 2A3AA 3UW6A 3WF3A 1F4HA 4RE4A 3I4KA 4IQLA 3A5VA 3T2QA 2PDMA 3S5OA 2WMIA 5D9MA 4V33A 4MNJA 1WOAA 2VC6A 3GHRA 4S3KA 1FWGC 3TFCA 1DWIM 5LNRA 1PB0A 4O4VA 1TX0A 1JDAA 2G3FA 1G0CA 3QGAC 4W7WA 3WH9A 2JKPA 5EMYA 3FGCA 1EYWA 3GXIA 3TCEA 3BW2A 1M65A 2OB3A 1TQXA 2DJLA 3DERA 4GO8A 3E5BA 1MVYA 1W8GA 3OQEA 2H8ZA 4FIQA 1ZCOA 3GNOA 1BSLA 4JOMA 1HUVA 1XLKA 3QZEA 2WLYA 2YSWA 4DUVA 4HOWA 2PBOA 3NWRA 3ZVHA 2EPHA 2VCAA 4BZYA 4LNCA 3SBFA 3PUOA 2A21A 1TWDA 1XRSA 2PWHA 3GG0A 3UNDA 5LIUX 4AG0A 3AC0A 3T0TA 4XO7A 1GQIA 2IKJA 2BHYA 3ZOAA 3RM8A 4JYDA 1VAHA 4FLQA 3W25A 4LAOA 2DUXA 2C1GA 2CNCA 3UQNA 1Y5WA 1B54A 4BWLA 2WSKA 3FVMA 3AS3A 3RU6A 3TQPA 4BQ4A 1FWEC 1XCXA 3N9KA 1RVGA 3ITTA 1QW7A 4H04A 2CXGA 3ARQA 5HOSA 3KRUA 4A8RA 4PB5A 3G1FA 1IWBA 3ISIX 1I45A 4TO8A 1OCJA 3G8RA 3OW1A 4CD6A 1ISZA 1QXLA 3KBJA 3CO4A 1IT7A 3ZLGA 3PFMA 1DP0A 4YTSA 3W1TA 5FD0A 3NZQA 3BQ6A 4J2MA 1RJRA 4QDWA 1THFD 1XIHA 2OZ0A 1RZMA 5CQ1A 4E8DA 2AAMA 1XFCA 3SQMA 3L4TA 4PTVA 2VC7A 1EXBA 1V3LA 3WK3A 1ZAHA 1JRBA 4ZQCA 4HHPA 3KBNA 3SJ3A 3ARTA 1QO5A 3DBPA 3GVVA 5I0DA 3CV1A 3SI9A 3Q67A 1UQYA 3R2GA 1BQCA 4OVXA 4NT0A 3FYOA 1X7FA 3UP8A