2A6NA

Dihydrodipicolinate synthase (e. coli)- mutant r138a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSATGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of Arginine 138 in the Catalysis and Regulation of Escherichia coli Dihydrodipicolinate Synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a6nA00
3IIVA 5U4NA 1K8ZA 4XKYB 5CZSA 4IWWA 2F7FA 2J6XA 2QEZA 1P1XA 5D2YA 4HNUA 3HGOA 4TMCA 5AB3A 1V7YA 3VCRA 4H3DA 4O16A 1KBJA 3KXQA 4G1KA 4O1BA 1NF7A 3IIZA 4MJZA 2E68A 4JD4A 2H6RA 4WY0F 4IMDA 5LGXA 4MFDA 3PB0A 3W2LA 1OFRA 1VLWA 5AHNA 1T99A 4CNPA 1R2RA 4Q32A 2EHHA 3GXPA 4NQ1A 1QCWA 1TPWA 3V1PA 5KINA 1SFJA 1TTQA 5LSMA 1HO1A 1H60A 3PSWA 2VFFA 3F4WA 4A2RA 4NZFA 4L4MA 1VC4A 3F1QA 2X1TA 3N19B 4NU7A 5KZMA 4FX7A 1GT8A 1QPOA 3KRSA 1KM6A 1I45A 1LBFA 2YYUA 3NPWA 2CZDA 5A8GA 4O12A 1R2TA 3P81A 2ZA2A 3ZFHA 4LNYA 3A24A 4O13A 1VCVA 3NQVA 1JCNA 3W2UA 1D3GA 3O8AA 1OYCA 4RKAA 4ADTA 2YW4A 2ZCGA 4UTIA 3P5YA 3EWZA 5A5WA 3HMJG 3BGGA 5LNWA 5LKYA 1FDZA 5TIMA 3PUEA 1XBYA 2DZVA 2Y70A 1HFBA 5D04C 2G5WA 3GZ3A 1B4EA 4AF0A 4O1DA 4LOCA 1OF8A 4JX5A 2C6QA 2YXGA 3FA5A 1O4UA 3EWYA 4N9BA 3G1FA 5D2XA 3B04A 1JCYA 3S42A 4S2BA 3SGZA 3I7RA 1XI3A 3NQ8A 4Z1CA 3FYPA 1ICQA 4KFNA 4JTFA 3PBVA 4Y9AA 3LHYA 3FYOA 1W5OA 1G4PA 5DY3A 3LI0A 2YX0A 1N7KA 2OCZA 5K9CA 5EBUA 3C0JA 1K8XA 2CLOA 4JEQA 4K39A 3W3OA 3GDRA 4Y90A 4M7SA 2CLEA 1I2PA 5BW6A 4B5NA 5LGZA 5TQLA 1U83A 3QMTA 2GJNA 1WQ5A 3W7RA 4BI5A 4R34A 2GJLA 3ANYA 5BRBA 4LVFA 3MHFA 4FNRA 1PIIA 1VQTA 1SO4A 2I9EA 2Y85A 1PE1A 2Y7GA 2RDWA 4CCEA 4HT3A 4O52A 4JX6A 4OV9A 4EIVA 3OG3A 3M44A 1IF2A 3BV4A 3L21A 4R7JA 3PC0A 2AGKA 5DXXA 5DY2A 4TIMA 4ZVJA 4FNTA 3HO8A 1SR9A 4GUJA 1VCFA 1YYAA 3GIYA 4IXHA 1JQXA 4JTTA 1KM2A 3P82A 3A5VA 3LHWA 4FHAA 2A85A 4R53A 3N73A 2ABBA 4YXGA 3QFEA 2ATSA 3P74A 4LY8A 1JUBA 4NJIA 4M19A 3BW2A 1TSIA 1B4KA 1LBLA 4RZ4A 2DP3A 3WK3A 1GVRA 1TO3A 1OFEA 1KLYA 1J4EA 3S1WA 1R46A 4NJJA 2FLIA 2ZYFA 4JN6A 1S3HA 3OHIA 3H53A 3HJZA 3N34A 1KFCA 3DENA 2A6LA 2ZDRA 2E6DA 3W1QA 3HF3A 2C13A 5BMWA 1KA9F 3NG3A 1YPIA 4EWND 3STGA 4QNWA 4XBKA 1HTIA 4IMGA 5I3GA 3TH6A 3ZR4A 3LLFA 1ALDA 5TBOA 1SFLA 2RDTA 2I14A 4IX2A 4C1KA 1G6CA 3DFQA 3INPA 4P2VA 4CLMA 1VS1A 1YTKA 4PC8A 5I3KA 1XUUA 2WSQA 1A53A 2HTMA 1MEWA 1SW3A 4I7VA 3W73A 4XWUA 2ALDA 3W2NA 1JCLA 1EX5A 2V8ZA 3PS7A 5AC7A 2QCLA 4PL1A 4QAIA 3NPXA 3O07A 4K7VA 3FJLA 3C2RA 2QAFA 4HPJA 4MPQA 5FEXA 3IGXA 3UWZA 5D09A 2Q3RA 4A29A 2RH9A 3DZ1A 3SW6A 4MY8A 2QCGA 2QR6A 3LV6A 4MY1A 4LS1A 1L2UA 1YLVA 4CQAA 3HG4A 1SPQA 3LM7A 4O0ZA 3LHUA 5D32A 4JTIA 4LWWA 1THFD 1H51A 3W07A 2E5BA 3NQDA 4LTSA 2GVGA 3W1RA 3DFOA 5LHFA 3W86A 1LTDA 1TRIA 4AB4A 5IBXC 5DBUA 4HNNA 3W71A 2NUYA 3TUUA 3M5YA 4E0CA 1CW2A 4ALDA 4LV9A 3C52A 1RV8A 4K38A 4M6VA 3G1VA 2CZFA 3NL2A 1YXYA 3NQAA 4DF1A 5D30A 4BI6A 2NLIA 3STFA 4GUIA 1AG1O 3CT7A 5AC6A 2CFFA 1N55A 2QDHA 1UASA 3DXIA 4A3UA 3ATZA 4O28A 1Z48A 5DLCA 1PVNA 1H7RA 3TKFA 3CB8A 5D02A 1HUVA 3GAKA 4AHQA 3GXTA 3LRMA 5K2ZA 3QF0A 1D3HA 5CZ0A 2ISVA 1Q6RA 2R8WA 2ZTKA 3B06A 3USBA 3NZRA 5BMXA 1G7VA 1GG1A 2H90A 1AK5A 3FFSA 3TQ0A 3VNDA 1MEIA 3M7WA 1RQHA 1LOSA 4HHPA 5LNRA 2WSRA 2Q8ZA 3LTPA 5KZDA 3C2OA 1PHQA 1QDSA 3G1XA 4PH6A 4YMZA 5LHEA 3P67A 2OT1A 5DCDA 1LRNA 2QCEA 1XCFA 2WPBA 2QJIA 4IMFA 1ADOA 4WZHA 2YFOA 2B7OA 1W5PA 3F4NA 1YXCA 3W7DA 1KTCA 1W56A 3N2MA 4WXYA 2BTMA 4GBUA 4YWIA 2WNQA 4JTSA 3SGUA 4JNMA 1MO0A 3UWQA 2QJHA 4TU1A 3HPZA 4Y8FA 1JCMP 2HSAA 1W5MA 1GTEA 3S6DA 4AHPA 1YTDA 4NXKA 4Z1BA 1C29A 2BLEA 4UNLA 1K03A 3AO0A 5F4XA 4MY9A 4M6QA 2NX1A 3C4UA 1K7XA 3GR7A 2NXHA 3L2IA 3SIZA 5KMYA 4ZMGA 3MHGA 3W83A 3QH2A 2DZUA 1XBXA 1TV7A 3OIXA 1ICSA 1P0NA 1G69A 3G8EA 3B4UA 3TXZA 3TV8A 1DQWA 1ME7A 2PE4A 5E1QA 1GYLA 1GTHA 4Z08A 4AVFA 3S5OA 4ZQCA 2VXNA 1I2QA 2DZTA 1SO5A 2VFEA 3TIMA 3NNTA 2IQTA 4A22A 4MFEA 5DBTA 3HBLA 1TJRA 2G95A 3W2JA 2EPHA 4ONVA 4O14A 1WOAA 2A4AA 1YXDA 1TB3A 3N9RA 5EA9A 3WJSA 1FDYA 3W1PA 1S5TA 3F03K 1QNVA 3MBFA 1YTEA 1FY6A 4JTJA 2GQ8A 3W23A 2P10A 4JIQA 3TW6A 1DJNA 2VFDA 1FXQA 2QCMA 1OJXA 4U28A 4ICNA 3DKJA 2R14A 2WKJA 2A0NA 2YW3A 3PY2A 3TJXA 5KITA 1GVSA 1GPWA 4OE7A 5I3JA 3L0GA 1KM3A 1ZNNA 3DFNA 2F84A 3TW7A 3HOJA 5C55A 4QSHA 4DBDA 1X7FA 4Z1DA 4RLIA 3S1UA 4PCFA 4IXXA 2TMDA 4MLJA 2ZRVA 1VCGA 4MKNA 1W0MA 3P62A 4A2SA 3E9AA 3TAKA 3GNDA 4AWUA 4UTLA 1OFOA 4OBTA 4CQ9A 1Z42A 1VHNA 3EX3A 2FPVA 3QQ0A 5KTLA 1OF6A 2LLEA 5LNVA 4UR7A 3W2MA 3M0ZA 1KTNA 1WDWA 1L6YA 1H7NA 2Y6ZA 4BFAA 4WQ6A 1JUKA 1FCBA 3TC7A 3TR2A 4W9TA 1HL2A 1Q6LA 1T0OA 3P8IA 3RLUA 4YCOA 1TQJA 3W7LA 2Y7EA 3MW7A 5MHBA 3W7OA 2V0TA 5J5DA 1CX9A 3HGSA 4N6EA 2QKFA 3PB2A 3TK7A 1I4NA 4UFJA 5EPDA 1AW1A 3SY5A 3I7SA 2Y88A 4YLWA 3NM1A 1FDJA 1DJQA 3RFAA 5LNUA 1EEPA 3WJZA 3HQ1A 3UY7A 1W3NA 2B7PA 3CTLA 1OX4A 1KFBA 2VELA 2NWRA 4Z0SA 4YCPA 4AWSA 4ZQPA 1HO4A 4CCCA 1QPNA 4ORMA 1TPDA 4FXRA 2CZ5A 2WSYA 2CLFA 5DELA 3R13A 4NJKA 1SZFA 3VI2A 3PUOA 5F2MA 3UWWA 3DGRA 1YDNA 3GDKA 3R12A 5HUPA 1SSGA 2TSYA 2HS6A 4WD0A 4NNBA 3E02A 4J9JA 3PAJA 3M47A 3RF9A 3QEZA 2EAWA 4NXSA 4FB7A 1TCDA 2G97A 2CLHA 1L9WA 3W7HA 2Z1BA 1ICPA 2ZZ1A 2QCDB 3NL3A 3NPUA 3KOFA 4XTDA 3PVFA 1Q3NA 3O6CA 3R2GA 5FEWA 3TC6A 2DZXA 1RQEA 3LERA 1L6SA 4UTKA 4XQ6A 4LW7A 3HPXA 4XUGA 5D2WA 2CZEA 2PC4A 5KSWA 4LC8A 3HG3A 4QISA 4K8EA 1TREA 3KVKA 1U5JA 1OFPA 3EX2A 3SR7A 4JTLA 5FESA 5CPOA 1K7EA 4NX0A 1TPC1 2YPIA 4WX2A 2FDSA 4JTUA 4IMCA 4QQ3A 3VE7A 1R30A 5CKSA 2C16A 3DBPA 1VR6A 5F1UA 3GB6A 2B7QA 1H7XA 4O1CA 3U2OA 3GYEA 2XN1A 1SU5A 4CNOA 4JDYA 4S1FA 2OT0A 4DO5A 1F5ZA 7TIMA 3KVMA 3NEVA 5HWMA 1L6WA 1J2WA 3W75A 1TPVA 3W88A 4H6KA 3Q94A 1XXXA 4WY0A 3B0UX 1EWEA 3BW4A 3CU2A 2YFNA 1LROA 4FNUA 3UZ5A 1GWJA 1T96A 3UY8A 5FF0A 3HIJA 3NO5A 2GOUA 5EMUA 3W1UA 3TDFA 1VJIA 2CWNA 4HKPA 4ZQNA 1QOQA 5EY5A 2ZZ6A 3ZS4A 3DAQA 1TPEA 1H7WA 1IIGA 2QCHA 4JYFA 1K7FA 1OFDA 1Z44A 1X8FA 3EX4A 1FWWA 1XM3A 3P80A 3M5VA 4IMEA 3L5LA 1ZJIA 1TTJA 2V5BA 4DO6A 2JKPA 5EKYA 2W0UA 1IXOA 1MXSA 4AHOA 1OABA 3G1SA 1W1ZA 4N4QA 4N9DA 2DORA 5FEPA 3UWYA 1OHLA 3RK8A 3TNOA 2ZRYA 3NQFA 5AC8A 1H50A 4RXGA 2FPTA 1B9BA 1SO3A 4Q33A 5DN1A 1G7UA 3LOTA 3R5EA 2NV1A 2BXVA 4MZ1A 3A5FA 5KZEA 1RR2A 1X1OA 3M41A 1EP3A 2EF9A 1O5KA 3D0CA 2RFGA 1FBAA 2EGZA 1OYAA 5D05A 4BWLA 4LV4A 1KM4A 1NAL1 3LCWA 2QDGA 3W1LA 3P61A 4IQLA 3WFAA 1ZENA 4AH7A 4FNQA 3W2KA 3G22A 2JK2A 3SI9A 1SQ7A 3MWAA 1ML1A 3BVJA 1FCVA 2DZSA 4AXKA 1WXJA 5G5IA 2E77A 4LC6A 3UWUA 3W1MA 4OWGA 3TX9A 3LCXA 1F73A 1XC4A 4O11A 3O06A 2X1RA 3IIOA 1KBIA 4O17A 4UTJA 3IV3A 4WY0B 3O15A 3A21A 4I9AA 4Y6GA 2C0AA 4N2YA 3PWAA 3Q2DA 4DBEA 2X1UA 3QMRA 4IOTA 4LUJA 2UV8G 1I2OA 4MYAA 3C2EA 2AAMA 3IVUA 5G2WA 1OFQA 4HSNA 4NNAA 1B3OA 5FI8A 1Q6QA 1LLWA 5AHLA 1LRQA 3B8DA 2V2HA 1W54A 3B0PA 3CQ0A 2YCEA 1FWNA 3CWNA 4IX0A 4PFMA 2QUVA 5D03A 2YDAA 4UTTA 2ZA3A 3NQ6A 2ZZ2A 3ZWSA 2ZZ5A 4O10A 3NA8A 1ZY9A 3BLEA 1G4SA 4ZZ9A 1Q45A 4ZL1A 3HGJA 2NWSA 3EWBX 2R91A 1C9DA 2NZLA 3IIXA 2FTPA 2KZHA 3G24A 3CEUA 1XDLA 2O7QA 3O05A 3NQ7A 4IGHA 3HGRA 2H3BA 4AMAA 2E1DA 1W8SA 5AHIA 1W5QA 4O15A 3GDMA 2BX7A 3ABOA 4GE8A 1TV8A 4ORIA 2E09A 5K7JA 3A23A 4NVTA 3BLIA 4XTIA 4DPQA 2RHGA 1XDMA 1OVDA 4M6PA 3QSTA 1EUNA 4K8HA 4LRTA 2YR1A 1OYBA 3P5ZA 5C2XA 1DBTA 1JQVA 4UR8A 4BR1A 2ZRWA 4HPXA 5K3VA 1VYRA 4N4PA 4I7WA 4TMBA 4UNKA 1LORA 1JCXA 1LDCA 3KAOA 1AW2A 5AYZA 3PBYA 3L67A 3PSVA 5H2ZA 3TSMA 3B0VC 2P0OA 3CC1A 4JGDA 2JGQA 5G4EA 1H7PA 1SW0A 4GFSA 3PUDA 1SUXA 5D2TA 4RR4A 1YDVA 3B05A 3W85A 2Z0IA 1ZCOA 5AFDA 3LX9A 4K7YA 4FO4A 1W3TA 4UMBA 4QM1A 4GJ1A 2QCCA 2WO5A 3H55A 4A21A 5CSRA 4OU1A 5D2VA 3BGJA 3GX9A 3W7PA 3R8RA 2DZPA 2FB2A 3OBKA 2DJXA 4JXCA 1W3IA 2PCQA 3FIGA 3JS3A 1UCWA 4N02A 5IM51 1FUYA 4MZ8A 2Y61A 3RU6A 1X6UA 1AW5A 1QAPA 1LLZA 4ML9A 8TIMA 4FX8A 4JTEA 4IPJA 4WOZA 3I6RA 1I8JA 3GAYA 3NZ1A 2ZA1A 4GUFA 1NEYA 4UMAA 1TPFA 4ZQOA 1OFAA 3C2VA 1F05A 1RVGA 2XN2A 3PBUA 1JCJA 1KM1A 2B4GA 1M6JA 2G96A 1YDOA 1VYPX 1K02A 5G2IA 1JRBA 4RZ6A 4MUZA 4NZJA 2BWGA 2NXGA 5L9FA 2ZRZA 3DI1A 4O54A 4FEZA 3NQCA 1H63A 3Q37A 3O63A 2XFWA 1F74A 3BG9A 4UTTC 4LU0A 1GVOA 1MSSA 3V75A 1WA3A 3BARA 4I7UA 4UXDA 3TXVA 2A7NA 5G4WA 2VENA 3MJYA 1WYIA 1I2NA 3NYZA 1FWTA 3A22A 3NQ2A 4ZQRA 4GRSA 3P7YA 4X3ZA 4E38A 2QUTA 3M43A 3N3MA 1IXPA 3TSDA 4JYEA 5C54A 2PRMA 4MZYA 2A1YA 2NXIA 3MP5A 2YZRA 3LTSA 3GR8A 4PEKA 1TPUA 3G1HA 3W1AA 3TMQA 1O5XA 3EKLA 4OHQA 3MP3A 3N9SA 3PR2A 1H1YA 2Z6JA 3W7CA 3STCA 2HMCA 3EEGA 4KKXA 1XL9A 4RV8A 1G4EA 4RX0A 3C8FA 3CM4A 4ZQMA 1GZGA 2E6FA 3QM3A 2VEIA 1SW7A 2VEPA 4FX6M 4O8RA 3JRKA 3MHUA 3IVSA 1H1ZA 4O57A 2FIQA 2R94A 2X16A 3THAA 1IXNA 4HSOA 2Q8LA 4Y96A 2ABAA 3FOKA 5GVJA 4DF0A 1IXQA 2Z2UA 4FIQA 4RJEA 3DHFA 3G18A 3OA3A 2QCFA 2JKAA 3LHTA 1MZHA 2Q3OA 1XBZA 6ALDA 1VLIA 4WUIA 3UNDA 1LCOA 2WOQA 1SO6A 2WNNA 3DI0A 2Y89A 5LZLA 1OX5A 5CG7A 1V5XA 5HR7A 4JTHA 1DVJA 2WJZA 3K30A 4QJ1A 4DO4A 3W9ZA 2CU0A 3NXFA 4YL2A 2FB3A 2J88A 2A6NA 3SJ3A 1F6KA 1H62A 1D9EA 5HNRA 1BWKA 5D38A 5DXYA 1JJKA 3LXAA 4HIBA 1QFEA 3LGEA 1KFJA 1ONRA 3W22A 2ATMA 3R89A 1PCWA 5HJLA 2J24A 5CZTA 2OZ0A 4X2RA 5F1VA 3ABRA 4MOZA 1J5TA 3S0CA 1TPH1 1LP6A 3CHVA 2YGYA 5IBXA 3W7NA 3L0NA 1TTIA 5AHFA 5FF4A 3LCHA 3UQNA 2X2GA 2DJLA 2BZNA 4FF7A 5K9XA 1FCUA 1DL3A 3TE9A 1NSJA 4NUWA 1QO5A 5BNKA 3KVJA 1PL9A 5AYXA 3L9CA 5F4WA 1OK4A 3KX6A 4C1LA 1H5YA 4U4MA 4X22A 4XBSA 3BO9A 5CGQA 1JUEA 4JY9A 2JGYA 3S9YA 4BF9A 3O1NA 5AHEA 4UTMA 3P84A 4WXZA 4O18A 3IGUA 2C3ZA 1TYGA 1GVQA 3T55A 3W7JA 1S5VA 2I1OA 2Y63A 5HR6A 1VHCA 2GQAA 1SSDA 3UZJA 2ZRUA 3LCFA 1AL8A 3BK0A 3EXTA 2FQIA 1LBMA 1QR7A 3CEPA 3Q58A 1C8VA 1OK6A 3LCLA 3ABSA 1MEHA 4N9CA 1K3UA 3NL5A 2A7RA 2Y62A 4R33A 3S1XA 4PODA 1P5BA 1KTBA 2A21A 3T40A 1A5AA 2WV8A 2QF7A 4DPPA 4E2DA 5BOOA 3C3NA 1CI1A 1VPXA 3QYQA 1XBVA 5EL1A 3QMSA 4IJBA 3W74A 1PCKA 4HN4A 3A9IA 3BG3A 1E51A 3M1ZA 5FF3A 3VE9A 3EB2A 3EXSA 4QIUA 1DV7A 4UTUA 1X1ZA 5DCEA 4NJHA 1O60A 3MI3A 3DFTA 4TX9A 1ZHAA 3I68A 5AYYA 3U6WA 3PM6A 2E5CA 1TTPA 1EP1A 3W76A 1EA0A 2ISWA 3DFPA 1TQXA 2GUUA 3LXBA 1KM5A 3TCEA 3W70A 3WJYA 1LRTA 3UXAA 3W1XA 5G1TA 1FQ0A 3L5AA 4UCGA 5G2HA 2V5LA 1G4TA 3O16A 2PURA 3TAOA 4EF8A 2EKCA 4DELA 4O50A 3W72A 3E12A 2V9DA 1VH7A 5HWNA 1BKSA 3LI1A 5C6MA 1DHPA 4RK8A 2QCNA 3LV5A 3NVTA 1EWDA 1XKYA 2ZQ0A 3E49A 3EKZA 3IGSA 3PG8A 3P60A 5HUOA 5LNSA 3WJXA 2VKZG 2CLIA 3TFXA 2X30A 3GKFA 5AN7A 2XN0A 5AHMA 2ZFAA 3MP4A 3W7MA 3GNNA 2A5HA 2B0MA 4JTGA 3T78A 2P1FA 2C15A 1F6PA 1VZWA 3QPYA 3NOEA 3FLUA 3FKRA 1R47A 2D73A 3QZEA 4LUIA 1M7PA 2O7SA 1QMLA 2A2IA 3QSRA 4TR9A 1GYNA 4ADSA 5C5YA 1DKWA 2QJGA 4JS3A 3YPIA 3G3MA 3S1VA 3IVTA 4S2CA 3FEMA 2V30A 4P61A 1QO2A 4TO8A 1B57A 3LTYA 3QC3A 4UTWC 4LVAA 3C2FA 2RDUA 4E2BA 3LRKA 5CPLA 4GXMA 1RZMA 1GOXA 1EIXA 2AQWA 4H4IA 2J27A 3PG9A 1KW1A 3QRHA 3QW3A 2ISSA 1K8YA 4NX5A 2FJKA 3W7EA 4NNCA 3E96A 4HNTA 3DKLA 3TQVA 1TRDA 5K4XA 2FFCA 3LHZA 3WJWA 1FWSA 5H91A 2TRSA 2Y7FA 5HQEA 1EB3A 4POCA 4O19A 1TMHA 4LT9A 1KM0A 4HNVA 1BWLA 2H8XA 2V81A 2H3DA 3G8RA 2J9YA 3W7KA 3PBWA 4O4WA 1EUAA 5EYWA 5FEZA 4UFIA 1OG0A 2DU2A 4IPIA 1IGSA 4OT7A 3SECA 5ABTA 4JX4A 3UWVA 3T7VA 3W1NA 4QITA 1UUOA 3LB0A 3CPRA 2V82A 2BSLA 1VGAA 3WK2A 3UXDA 4XKYA 2J9XA 4Z1AA 4Z0JA 3MBDA 3BG5A 3NM3A 4M7TA 4FXSA 2C1HA 3L0KA 1P0KA 3NPVA 3TU9A 1SZNA 3W7QA 3THQA 3CWOX 2Z6IA 3TJLA 1S5WA 4CQ8A 2VEKA 3GLCA 1DQXA 5F2GA 5J5RA 1G67A 1WX0A 4BI7A 1FXPA 4DQWA 2CLKA 3GVGA 1WOBA 2VEMA 4AWTA 3NGJA 3SZ8A 4DF2A 3HB9A 2FPYA 5F2LA 3M9YA 3EWXA 3C6CA 3NR0A 3B03A 1I2RA 5I3HA 4O53A 3LXCA 2YSWA 4L4LA 3LHVA 3G1DA 3S5NA 3M6YA 3TROA 3W6YA 2ZZ7A 1TV5A 1WAUA 1A5CA 3G0XA 5AOUA 3W87A 3IEBA 3KRUA 3O6DA 1LZOA 3TA6A 3WK0A 3QW4B 3NQEA 2W79A 3AJXA 3FKKA 3N14A 3M5XA 3OVQA 4D2JA 2QAPA 4AAJA 4FIRA 3DHDA 1KFKA 1P4CA 3SSJA 1FCQA 2HS8A 1ME9A 1WV2A 1YADA 1FX6A 2H8ZA 3T44A 3GKAA 5D33A 3GDTA 4RZ5A 3G1YA 4PTNA 3EWUA 3UYCA 1LOLA 1GVFA 2E6AA 1H61A 1TPB1 2CLMA 4KWVA 3S5YA 4EOUA 3ZWTA 4RCXA 4WJEA 3RLVA 3W1TA 1WBJA 1O94A 5U7SA 4UFLA 3EWWA 3BLFA 3LBCA 4UTWA 2ZTJA 4X9SA 4UFMA 4QNEA 1W5NA 1GEQA 1AMKA 5DCBA 4JR5A 3N2XA 4MIMA 3BW3A 1XUZA 3BPWA 3VFLA 4EF9A 2CW6A 1KV5A 3SFKA 3TSBA 1PS9A 3CIXA 4OQVA 2OJPA 4IUOA 3G0SA 3HPSA 1NF0A 5E93A 2C14A 3DFSA 3KRZA 1Z41A 3HG2A 4GUHA 3GDLA 2VOMA 1ME8A 4KFOA 3LRLA 5CPMA 2OX1A 3EX1A 5D37A 2PRLA 1LYXA 1Q6OA 4K6AA 3RNDA 3DH7A 3ATYA 4MLRA 4BK9A 3H54A 2NUWA 3NAVA 2A7PA 2VC6A 4UTHA 3I65A 2ZZ4A 4AF0B 1GG0A 5I3IA 3S5ZA 2YYTA 3QJAA 4GC4A 3QQ1A 3NQGA 5FF2A 3LCIA 3MMTA 4LVBA 4O1AA 5CSSA 1R2SA 3IRDA 3S8HA 3ABQA 4RXFA 3RMJA 3WK1A 1BTMA 4LS2A 4OGZA 1IIHA 1OX4B 1RD5A 1JR1A 3C61A 5FF7A 4XZ9A 4ADUA 2B7NA 2NX9A 1OFBA 2QCDA 3U8GA 3O6YX 2C19A 1LOQA 3TQKA 1JULA 3W84A 3EX6A 1QPRA 3LDVA 4UFHA 3OEXA 3MYPA 4O4VA 1A5BA 4AEOA 5K4ZA 4LRSA 3P8JA 1GQNA 2CLLA 1KFEA 4JY8A 5SWUA 2ZRXA 4LVGA 4FNPA 3MYOA 1PHWA 4JTKA 3G1AA 4NJGA 4PA8A 4UIOA 1NFBA 2V2DA 1A5SA 1KV8A 2GQ9A 2TYSA 4GWEA 1ZAIA 1ZALA 3UD6A 1RQBA 3C56A 1KLZA 1SZGA 3CLMA 1M7OA 2E5DA 4UFKA 1O95A 3MI6A 3OVPA 1PV8A 4JDBA 5HULA 3W7IA 2X1SA 3NQMA 4FNSA 5CZJA 2OMAA 4NT0A 1T8XA 1WBHA 4LS0A 3QPZA 2VFIA 3UPBA 5K9DA 2DZWA 1SZEA 1LM1A 3VKJA 4WOQA 4N9EA 1F7BA 3T4CA 3G0UA 3CIWA 1UUMA 2VFHA 1ZAHA 1ZFJA 2J9ZA 3LCGA 4MVAA 3FJ6A 2JKEA 4UUIA 1HG3A 3LBMA 1VYSX 1H7OA 3M16A 4JIPA 4UMCA 4K36A 2V2CA 4CNNA 1QWGA 1KFLA 3ELFA 2ZZ3A 1GJPA 6TIMA 2JBMA 4DXVA 2WNZA 4GNJA 3MUXA 2WQPA 3TMLA 1TIMA 5I3FA 3NL6A 5CPNA 2PRHA 3L68A 3L65A 3HG5A 1EPXA 4O0KA 2VFGA 1W37A 1Y0EA 4M5PA 1BEUA 5F4SA 1F2JA 3L66A 2Y7DA 4JYDA 4BWLC 3STEA 5L6UA 3E0IA 3OVRA 2GVLA 5HINA 1F76A 2E6YA 4DEFA 2ZBTA 1ZAJA 4OV4A 1AL7A 3G3DA 2NUXA 3PULA 5F2IA 4Q4KA 2NX3A 1VRDA 3MI2A 1UB3A 1OX6A 3I7QA 3GXNA 3KVLA 3PF3A 4EVZA 2RKXA 3DU0A 5HWJA 4KWWA 1XFBA 1FWRA 2W6RA 3FS2A 3L5MA 3MO7A 2TPSA 4KFPA 1A50A 3KHJA 3M5ZA 4JICA 1YPFA 4N6FA 1NVMA 4LVDA 5HMSA 4MJMA 3IIPA 3GK0A 1DORA 1JVNA 1JRCA 1W31A 2C18A 3NDOA 4MYXA 3LLDA 1M5WA 2GPTA 4K37A 4PL2A 3TFCA 1DOSA 4GUGA 2NV2A 3KFTA 1TJPA 5T26A 1RPXA 1QPQA 5E0KA 3JR2A 1QOPA 1N8FA 3W7GA 2GVJA 1EP2A 5G1YA 3UPWA 4CCDA 1UJPA 3EXRA 2QUUA 4UC5A 1UBSA
chains in the Genus database with same CATH superfamily
3IIVA 1BXNA 2X7WA 3B0YA 5CZSA 5BXRA 3AMDA 1Q6FA 2QV5A 2F7FA 3WF1A 3DHUA 1P1XA 4JTCA 5E9XA 4N0RA 4F0SA 1V7YA 2ZUSA 3VCRA 1HT6A 3TWAA 4O16A 3KXQA 4G1KA 3TVAA 2QXWA 5DX7A 3FAXA 3VNJA 3NURA 3BAKA 3WMBA 1PDYA 4IMDA 4NP7A 5LGXA 4RW3A 2WJFA 3PB0A 3KTCA 1W91A 4JCLA 3SCPA 4NQ1A 1VP5A 4HK7A 2OZ8A 1HO1A 2PLMA 3M0XA 3F4WA 4A2RA 3NCOA 4LF1A 3MSYA 2ZADA 2W3ZA 4TUFA 4C5YA 3N19B 3JW7A 1WCGA 4FX7A 1GT8A 5TNVA 4GC3A 2BG5A 1Q4WA 5JXQA 3MV01 1XRFA 1WKEA 4WGHA 3ZJKA 1J01A 4GYJA 4AVNA 3QPEA 2BGQA 3T07A 4KIEA 3WF0A 4LBUA 1JCNA 4P8VA 2VVNA 4DI9A 2YL8A 3W2UA 3WFZA 2ACSA 4BHYA 3O8AA 1OYCA 1DJZA 4RZBA 1KXVA 4GO8A 3LLXA 4UTIA 2ESCA 3EWZA 4XZHA 1UWTA 1NOUA 2GGJA 5LNWA 4QSFA 5TD4A 4GXPA 4QQUA 1FDZA 5TIMA 1XBYA 2Y70A 2G5WA 5C9XA 1B4EA 4LUSA 4LYPA 1OF8A 2C6QA 3FA5A 2FZBA 3WNKA 3G1FA 1GJUA 3GH4A 2VRKA 1ICQA 2X0HA 1J0HA 3NTYA 4LAKA 1G4PA 5A6JA 3SCOA 2D23A 3KL0A 3C0JA 1K8XA 3WL0A 3SQMA 3W3OA 1IEVA 1HP4A 4M7SA 4PB4A 1WB0A 1I2PA 4B5NA 5LGZA 5ECUA 1U83A 1TG7A 1A0EA 3RR4A 1KCXA 3W7RA 4R34A 2XGIA 3F5LA 4NZ5A 3NO3A 3RPMA 4FNRA 2I9EA 3UA4A 4A8LA 1HGYA 4O52A 4EIVA 4J4KA 3OG3A 3L21A 4EP8C 3PC0A 4BQ5A 5DY2A 4ZVJA 3WDRA 1VCFA 5DEZA 1ZBWA 4IIBA 4LEFA 4IXHA 4PSRA 1PKNA 1KM2A 2JE8A 3B4YA 3UR2A 3P82A 2CKRA 3KL3A 4G7EB 1R3VA 1XLBA 1XYAA 2WCSA 3W29A 2J78A 4QDWA 4BQ3A 1JUBA 4M19A 3BW2A 1B4KA 2UY4A 4RZ4A 2DP3A 3WK3A 3V0TA 1EDTA 1J4EA 1UIOA 4NJJA 4B91A 4JN6A 1A5UA 4Z2LA 2FGBA 3OHIA 1E0VA 4IL0A 3HJZA 3UXLA 3AC0A 4UR9A 4KWSA 2A6LA 2E6DA 5H1WA 7ODCA 1LT7A 4KGJA 3OOQA 4LGXA 1KA9F 1E4LA 3STGA 2E4TA 4IMGA 1EXPA 1VBGA 2PDLA 1DWJM 3LQLA 4FSAA 4IL2A 1YTKA 1TA3A 3MDWA 2HTMA 2PDGA 5T9BG 1MEWA 4PCNA 1YQ2A 4XWUA 1JCLA 2QCLA 4AU0A 4K7VA 3C2RA 2CITA 2HE8A 3MWCA 1V02A 5ABFA 3C3UA 2G3MA 2VRQA 3S1GA 3SW6A 4MY8A 3LV6A 4CQAA 3VGFA 3HG4A 1GOQA 4AY1A 3LU2A 1J0IA 2J8TA 3LM7A 3DERA 1H51A 2EEXA 3NQDA 4FP1A 5A6MA 1Z8AA 4MNKA 3I10A 3XIMA 3VMNA 3S6OA 3UG4A 4J1OA 3W71A 3U2ZA 4JBRA 1XKJA 5GJPA 1GONA 4E0CA 1CW2A 1RV8A 2JF6A 4F0MA 2WC4A 3WNPA 3OA5A 4BI6A 4GUIA 3CT7A 5JH2A 5AC6A 1UUQA 1N55A 2QDHA 3HURA 4JFTA 5AZ1A 1Z48A 4MJ2A 2YIHA 4JFWA 1W8GA 3GXTA 1D3HA 1DWAM 3AHZA 2ISVA 2R8WA 1DJXA 2E9LA 3AYSA 2H90A 3RR1A 4DJEC 1MEIA 1X6NA 3GWQA 4CUCA 1RQHA 3DBNA 4HHPA 1MUMA 2Q8ZA 3LTPA 5KZDA 3S2NA 3C2OA 4IFKA 4HZMA 4XD4A 5B7YA 3FXYA 1LRNA 4KEZA 2WPBA 4U2YA 3SJNA 5A6LA 4M8UA 1REQB 1ADOA 2PGWA 4HNLA 4WZHA 1W5PA 4OOZA 2YL5A 3ZT5A 3KEHA 1YXCA 1KTCA 2WNQA 4JTSA 5EGRA 4JNMA 2PWVA 2QJHA 4S3GA 2EPMX 1W5MA 1GTEA 3CQIA 1P7TA 5LIYX 2VEGA 4NXKA 2NQJA 1XLLA 4Z1BA 3RHGA 3IJ6A 2OU4A 1YRRA 3TTOA 4BKNA 5KMYA 5T91A 4ZMGA 2D69A 2DZUA 4IZGA 1XBXA 2X7VA 3VKKA 4D8AA 3G8EA 3SN4A 3R6IA 2F6XA 1AFSA 3NZPA 1V7AA 2DSZA 4HA4A 3SCTA 4HU0A 5FA5A 3UCQA 4LYQA 6ENLA 3WBYA 2IQTA 1UJQA 3W2JA 3M0HA 2EPHA 3VK5A 1YXDA 3N9RA 1GHSA 5EA9A 3RAOA 4GX9A 2E9BA 3REQB 4LANA 2GQ8A 2W61A 4JIIX 4QCFA 3GG0A 1ZS2A 2VFDA 3WQOA 2GFTA 4ICNA 1AA1B 2G4FA 2WKJA 4FLQA 1VFFA 3ZYZA 1C8QA 4HYWA 1TUFA 3L0GA 4ZFCA 2GJPA 4AW7A 2F84A 2QJNA 2DUZA 5C55A 4TVDA 4KEVA 1HJSA 1W6TA 4D71A 4A8IA 4IF2A 2FTYA 4IXXA 2YXOA 1V6XA 2TMDA 2A3BA 4MUPA 4MLJA 4HU4A 4GGBA 1W0MA 4A2SA 5HMDA 5T8GA 3BZJA 1E56A 1Z42A 3H2OA 2WVUA 4HA0A 3ID7A 3W2MA 1WDWA 4WQ6A 4MPKA 3TR2A 1B30A 4W9TA 3VDAA 3O7UA 1OCJA 3ZQ9A 3OZPA 1TQJA 3OODA 2VR2A 3CLWA 3SB0A 3BQ5A 4QG9A 2OQYA 2V0TA 3ALGA 3F4VA 1Q5MA 3TK7A 2HWGA 4J3TA 4UFJA 2OEMA 1PJ9A 4M0XA 1AW1A 3SY5A 4YLWA 3RFAA 3CHCA 4MG4A 3AYRA 3HQ1A 3UY7A 2B7PA 2G8ZA 4A8RA 1O1ZA 4YCPA 3RILA 3VOIA 2BOFX 4CCCA 1QPNA 4U10A 1RBOB 1EBHA 2CZ5A 2CLFA 1N82A 5DELA 2XFFA 4IFRA 4HMDA 1WKDA 1MW2A 3UZWA 3UWWA 2GSHA 4MSSA 2WVVA 3GDKA 1UOZA 2OOFA 3OZOA 1SSGA 2BV9A 4JN8A 1DJHA 4WD0A 4AIEA 2G3NA 3FA3A 3PAJA 4NXSA 4LUSB 4FB7A 1TCDA 4DUXA 3OIHA 1CXLA 2ZZ1A 3CUZA 2XIBA 3KOFA 4QFUA 1S39A 1Q3NA 1UD8A 1V6TA 4UTKA 5CPQA 3VX1A 4I6KA 2WHKA 4LC8A 5GJNA 4QISA 5FAGA 3S9ZA 2XHYA 1U5JA 2WNWA 5FESA 5CPOA 4JIEA 1K7EA 1LJYA 2DW7A 4WX2A 4JTUA 4JIHA 3VE7A 1GK8A 2EJ1A 4EX4A 4GVHA 2Y0FA 4I9MA 4MAVA 2BY0A 3D47A 3GB6A 2B7QA 3QR3A 3S3GA 4CNOA 1SU5A 2HE5A 5A8OA 4S1FA 6TAAA 3KVMA 3NEVA 5D9NA 2J7BA 5J04A 3W75A 2WSPA 5M5DA 1F9CA 1OIFA 3Q94A 4WY0A 4C6LA 4ERAA 4JZ5A 1EWEA 4FNUA 1GWJA 1W3JA 3NEHA 1BYBA 3R8GA 1SJCA 1ZP4A 3PK7A 4ZQNA 2W67A 1TV2A 5M3WA 1CWYA 1H7WA 2QCHA 1X8FA 3PBGA 1FWWA 5LIXX 3GVWA 4IMEA 1R9XA 3MSDA 4Q8QA 1TTJA 1PX8A 5EKYA 1OABA 3AOFA 3AIVA 3G1SA 2PDKA 1CENA 2V69A 4DNMA 4N9DA 4RPQA 3UWYA 3NQFA 3QGVA 5BXSA 1UP3A 4RXGA 5EMKA 1TMLA 1B9BA 3WNNA 3QY7A 1QHPA 4GI6A 4JQ2A 3CZKA 3A5FA 2AL1A 1B3VA 1EJUC 3GXDA 3SCSA 2EGZA 3MUY1 1NAL1 4W88A 3LCWA 3FGCB 3W1LA 1VBJA 4CD6A 4DWSC 3PPCA 1ZENA 4FNQA 3FJNA 3MWAA 1FCVA 2DZSA 4E4UA 1MDLA 2OZ3A 4LC6A 3UWUA 3TX9A 5CCZA 1F73A 4S3EA 2HNEA 5HJXA 3E2RA 1JGMA 3O06A 2X1RA 4E4FA 1KBIA 4UTJA 5EMLA 3PWAA 3H4GA 4DBEA 3SQLA 4HN8A 2UV8G 1I2OA 2XM1A 3C2EA 1E72M 5G2WA 4HSNA 1E1CA 4NNAA 3TONA 1EYWA 1LRQA 3B8DA 1J11A 3ITXA 1W9XA 1CGUA 1FWNA 4PFMA 3II1A 2GSJA 3N4AA 3N18A 3OYZA 1ZY9A 2PAJA 1QHOA 3BLEA 5C8BB 1VPYA 3UG3A 2NWSA 3EWBX 1OG6A 2R91A 1C9DA 1I60A 1BVNP 3W24A 3A4XA 1X97A 5BRPA 3N9KA 2O7QA 2MUCA 4PMUA 4Q8OA 4GBDA 2ACQA 3GDMA 3UXIA 4GE8A 4QG8A 3CV2A 2E09A 2PDHA 2WK2A 3A23A 4GA8A 4NIRA 4S3KA 3TNBA 2R6OA 1W9UA 3QSTA 3ARVA 4UTFA 1TWWA 4GI4A 2OGJA 5C2XA 1H41A 3T1GA 3Q65A 3WQFA 3CV7A 1I1XA 2Y8UA 3G2GA 2WZTA 1LORA 5H8MA 1LDCA 3KAOA 1NM9A 1NY1A 3U5YA 1VBHA 3PSVA 2YLLA 1IEIA 3BCDA 2P0OA 3P6LA 2JGQA 1EHAA 3MVTA 3AQUA 3BLDA 3SCRA 1FH9A 4GFSA 2QHAA 1SUXA 4RR4A 1YDVA 3B05A 2Z0IA 2YCKX 5AFDA 3WBXA 2HEJA 4FO4A 1W3TA 3VC6A 2E3ZA 1Q6GA 2VHLA 3L4XA 4UMBA 4GH3A 4C60A 4GJ1A 2WO5A 3CIVA 1MQQA 3KCOA 2BHUA 1MW3A 2HVMA 2ZUWA 3OBKA 4X63A 1LL6A 3RRXA 3KRBA 3JS3A 5AKQA 3G5EA 1M53A 2PWHA 3RO6A 4N02A 5IM51 3RU8X 1O6IA 1RCQA 4UQEA 4H19A 3LGDA 1QAPA 3AMGA 8TIMA 4ML9A 4U5KA 1A3HA 4IPJA 4JTEA 3I6RA 4HZ7A 1JYNA 1ONEA 1RBAA 4L6DA 1W3KA 4ZQOA 4L9YA 1TFVA 3VD5A 1F05A 4WF7A 2XN2A 4EPEC 3K1DA 1UW9A 3OTRA 4RZ6A 3S2CA 4MUZA 2ZRZA 2BGSA 1CXIA 4O54A 2WXDM 1NARA 3Q37A 2XFWA 2D1ZA 4V2XA 3WD0A 1F74A 4FLRA 4JFSA 3GBEA 1WA3A 4PSPA 3TXVA 2VENA 3WUEA 2I9UA 1WYIA 3NYZA 4F9DA 4E38A 2DIKA 4CVWA 3NSMA 1U5HA 1EO5A 4DN1A 1EGVA 5CJ5A 1XSJA 3AYTA 3EOOA 4MZYA 2A1YA 3GR8A 4PEKA 3VDGA 3WELA 3AS0A 8CGTA 1B90A 4LAUA 1JZ7A 4MB5A 3NGFA 4IP4A 2BDQA 4IG2A 3CZEA 3N9SA 2HVOA 5FCZA 1UKQA 3H2CA 4Q7NA 2Z6JA 3STCA 4NSBA 1D2KA 1G4EA 4FOUA 4GYPC 2J62A 4GMEA 1AH0A 1OC7A 3TWBA 3GC4A 2VEPA 3WLQA 4FX6M 3WQ6A 1A0CA 3AJ7A 2BVWA 2J7DA 1H1ZA 2PF8A 5ABFB 2V5JA 4O57A 2FIQA 1LLOA 2R94A 1F8IA 5EFFA 3NOYA 5GVJA 4WKFA 3PJUA 5FJJA 1H49A 2XUCA 1S46A 5IRPA 4IGMA 3RLHA 2JKAA 2VC9A 1HX0A 4WUIA 4MF4A 4ZXOA 2WNNA 4F4RA 5LZLA 1OX5A 2GGGA 1CGYA 2WW5A 3OLDA 1KD0A 3W9ZA 2CU0A 3NXFA 3AZTA 3KBJA 3B9NA 3BJFA 1OC6A 3PN8A 4FA3A 4DYJA 1D9EA 5HNRA 1BWKA 5DXYA 1UD2A 4M80A 3KTXA 3QY8A 4RE3A 4LUYA 3MKKA 4I90A 1E3ZA 1KFJA 1CCWB 5EFDA 1QWKA 5D8ZA 1UG6A 3VUPA 3FK4A 5CZTA 2UWFA 4PRRA 1RJQA 5ENLA 1OM0A 1LP6A 4FK9A 2QJMA 1R7AA 3L0NA 5FF4A 2VUYA 2HDJA 1OIMA 4PBGA 2Z25A 1EO7A 2WZMA 3HM7A 1FCUA 1DL3A 1NSJA 1PIFA 1XRTA 3ES7A 1OK4A 3S47A 4B16A 2E8ZA 2JGYA 3IJDA 1LWHA 2HBXA 4UTMA 4O18A 3IGUA 5DO8A 4H6QA 3VABA 3UZJA 4M56A 4MTVA 5C9WA 1R5YA 1AL8A 1Q8JA 5C9RA 3CEPA 3R0UA 4R7WA 3RXZA 3LCLA 4GCXA 2GGIA 3EOUA 4ZB5A 3ZXWA 4EXQA 2J8FA 2A7RA 4R33A 3M0JA 1A5AA 1TVNA 2WV8A 5REQA 1VPQA 3BG3A 1YHTA 3M0VA 3VE9A 3KCJA 4QG6A 2XISA 3NFUA 1SFSA 4H9UA 1O60A 3MI3A 5AYYA 1I75A 1TTPA 2QS8A 2VUNA 2ISWA 3M07A 3RX3A 3TCEA 3W70A 2XGBA 1AJ0A 1WDQA 5G1TA 1FQ0A 5G2HA 3WQPA 2ADAA 1G4TA 4AIOA 3O16A 4Q8PA 4EF8A 3E12A 3T4WA 3PJXA 5C6MA 1S38A 3BLPX 3SCVA 3E49A 2ZQ0A 3EKZA 2OB3A 1U1HA 1NWRA 3RCNA 1J0ZA 4CNTA 4KGLA 2FMNA 3W37A 3TZFA 2CLIA 3SCNA 3BGAA 2X30A 1ZU8A 3W7MA 3VO0A 1HKJA 2B0MA 4JTGA 3LNPA 4TV5A 4W8AA 1K9DA 1ONWA 4GNKB 1R47A 1RXOB 3KE0A 4DBUA 2IXVA 2BHYA 4JS3A 1LWIA 4KIRA 5A94A 1B57A 3LTYA 1CXKA 4UTWC 4H04A 4LVAA 4IP7A 3WQDA 4E2BA 4C91A 3LRKA 3DESA 1T8QA 3GVQA 1HKKA 2GQ3A 1EIXA 3GXMA 2AQWA 3DFYA 3CZLA 4BS0A 5HDRA 2PSNA 1XLJA 3QRHA 6PTDA 3T2OA 1K8YA 4F8XA 2YCJA 3OHMB 4WJXA 1R8LA 2ZVIA 2QUNA 1Q7QA 4DHGA 4OFCA 1BWVA 5HQEA 5A8PA 2WLZA 4HNVA 4D6GA 2QT3A 3PBWA 4PBEA 2VX7A 1OG0A 4IPIA 4QXIA 4ZTXA 1E1FA 4OT7A 1A5NC 4JX4A 3W1NA 4QITA 2BSLA 1NDYA 2IS7A 4PMDA 4YJ5A 2I5GA 3AIEA 6REQB 4MWAB 8XIAA 4M7TA 4F66A 1P0KA 4OZOA 5FAJA 4MADA 1R87A 1YDYA 1IZCA 4C65A 1DQXA 5J5RA 1WX0A 1S3TC 5CC3A 1S5MA 4KEUA 4NI3A 3VNIA 3GVGA 5FJRA 1LL7A 1ZUAX 3AMLA 2VEMA 1GCYA 3NGJA 1A4LA 4Y9PA 1IZKA 3T8LA 3HB9A 5F2LA 4KRZA 3NR0A 3B03A 3IK2A 3WN6A 5I3HA 3CHFA 2A3AA 5JIWA 3MSRA 4L4LA 2GK1A 4FMVA 3G1DA 1A3WA 4QCEA 3WH5A 2XSXA 1TV5A 1WAUA 1A5CA 3P93A 5AOUA 1YBQB 2GDQA 4ZBCA 2DSWA 4UOZA 3DGBA 3TTQA 4IISA 1SYTA 3AJXA 3LPPA 4C6IA 2ACRA 4AQLA 3V0UA 3DHDA 1KFKA 1P4CA 5HK4A 3SSJA 3UZYA 1WV2A 2EPNA 2E25A 3FHQA 3L2LA 5D33A 3PFRA 1WDPA 1QT1A 2HK1A 2OFJA 5DT5A 3UYCA 2W5FA 2CLMA 4EOUA 2YCIX 3PAOA 4E8CA 1EJVC 4DUWA 2UY3A 4WJEA 4X60A 1K9FA 3NIYA 2YB4A 3BLFA 4UTWA 3RM9A 2HV5A 2DT1A 3B8IA 3BW3A 4DZ5A 3VFLA 1KV5A 1IV8A 1PS9A 3V16A 3SUUA 3T2PA 4IUOA 4XX6A 1H11A 4W8BA 5BYWA 1PYMA 3GDLA 4KFOA 3LRLA 3FW6A 3IJ9A 2OX1A 3EX1A 4B3KA 4BK9A 4MLRA 3ATYA 3H54A 2DT2A 4GVFA 4DLMA 1V0LA 1J2BA 2DUXA 4UTHA 3V7PA 3S5ZA 4QEHA 4PMQA 3R8HA 3I3BA 4L7ZA 1KBBA 4DIAA 4LVBA 4O1AA 2A3EA 1VRXA 3GFYA 1F3EA 4ZGYA 2PDMA 3KWSA 4KPLA 4CD8A 1UZ1A 3WK1A 1BTMA 4Y7EA 4XZ9A 4EXAA 1OFBA 2QCDA 3GHSA 1QATA 3IRSA 3K4DA 4HOXA 3B9EA 1LOQA 3U4FA 1AD4A 1IT0A 1F6YA 4B3LA 4UFHA 3JZEA 2WSKA 4NRRA 3XISA 4AD2A 2CLLA 1EOKA 2ZRXA 5FJPA 1B3WA 4F3HA 2J6VA 1DYSA 4GPNA 3WD2A 2GQ9A 2TYSA 4GWEA 1OT1A 4E3TA 2Q09A 1XYLA 1ZAIA 3UD6A 3HFYA 3UCDA 3KOWA 1DIDA 3C56A 4Q8VA 5IHSA 1VJZA 3MI6A 3OVPA 4YVVA 1ZJHA 5H8UA 3W7IA 4MWAD 3NQMA 2AAAA 2DY3A 4NT0A 3MMDA 4LS0A 2D0GA 1SMDA 2VFIA 3QPZA 4PMVA 4K1GA 2ZUMA 4P8UA 1JZ4A 3CIWA 3ITOA 1UUMA 2CERA 3VIKA 2JKEA 2PDXA 4INFA 3LBMA 5AVHA 1CLKA 4UMCA 1KCZA 3H7RA 1B54A 3L4WA 3GSMA 1GJPA 3P0XA 4PN2A 3VIMA 3TMLA 3IV8A 3KTSA 3NL6A 1MW1A 1TJ1A 4XZMX 3L68A 1SZRA 2Y5JA 3W4RA 2J13A 4D6CA 3GU2A 1TWZA 4M5PA 2PLCA 2PDCA 2CBJA 1VF8A 4BWLC 2VX4A 3OVRA 1F76A 1T5AA 1RLDA 1ZAJA 4Q22A 3SUVA 2NUXA 2Y4SA 3VMOA 4W93A 5LXXA 2NX3A 1NP2A 3ONCA 1C8XA 1OX6A 3VOGA 5A95A 3MCNA 4JQ1A 2DIJA 4EVZA 2RKXA 3IJIA 8A3HA 3DU0A 1MNZA 1WZLA 4A3HA 1FWRA 5E09A 4WSHA 2TPSA 5HNUA 3VD4A 2IKIA 1EH9A 4MJMA 1UKOA 3GK0A 1DORA 1JRCA 2C18A 2MNRA 4B2DD 4P8XA 1KBLA 1A47A 4PL2A 1RPXA 3H2EA 5DRIA 1EP2A 5G1YA 1UJPA 4UC5A 5M17A 3ENLA 3T6CA 3U57A 1R3YA 5B80A 4H00A 2QEZA 3KLLA 2QQ6A 5D2YA 4HNUA 5AB3A 1UH3A 4H3DA 3A13A 3USZA 3OB8A 4MJZA 4CKQA 1PO9A 2WQDA 3CASA 2EG8A 2WVTA 4MFDA 1GVIA 1NIUA 5ABEA 2R1MA 4CNPA 4MHBA 1R2RA 4A35A 2NQLA 3HTWA 3GXPA 3PUGA 4FXJA 2WBKA 5KINA 1TPWA 1SFJA 1TTQA 4JOMA 2FH8A 4IHCA 3PSWA 4ZFMA 5BU9A 2CHRA 5IFPA 1Y65A 4W86A 1YEYA 4PMYA 4YTQA 3LG3A 1GHRA 2OX4A 2PB1A 3LUTA 4PR4A 1QPOA 4MWAE 3HQNA 1I45A 1BG9A 3A47A 2WYSA 1MW0A 2VGGA 1VEOA 3NPWA 4NY2A 3ABZA 1R2TA 4O12A 3ZR6A 2OSYA 1VFLA 4DJDC 5IFTA 2I17A 4ACZA 4ADTA 4RV3A 2YW4A 3MUIA 3P5YA 1Q6DA 4XZWA 1LQ2A 3HMJG 5JUVA 3SN1A 1WNOA 5LKYA 2CBIA 2BXYA 4H8NA 1A5KC 1IZJA 3VZYA 1UC4A 4Z1YA 3WYZA 3GZ3A 2VMFA 2XG9A 2W91A 4KCUA 4JX5A 1GVEA 4FALA 3EWYA 5D2XA 2BBFA 3WQEA 1JCYA 1MXDA 1ZRQA 3I7RA 1XI3A 3NQ8A 5LIWX 4H7ZA 1YNPA 3EPNA 4Y9AA 3CQKA 3HPAA 3FYOA 3O2LA 3BLKA 4QGCA 2ZUUA 5DY3A 2YX0A 4TV6A 1N7KA 1XJBA 4G6CA 2OEKA 1RH9A 3UJEA 4K39A 4JHZA 2CLEA 1W9VA 5BW6A 4H9VA 4ACZB 5TQLA 3QMTA 3BDKA 1WQ5A 4BI5A 3ANYA 4LVFA 3MHFA 4QJ4B 1VQTA 4V15A 1C92A 4HT3A 2PEVA 3BV4A 1U1JA 4R7JA 3EWDA 4JHMA 4C5ZA 2EQDA 2JALA 3HO8A 3WH6A 2HQAA 3EA3A 5FSDC 3C0LA 1FVPA 3TLLA 4D1JA 4LCQA 2A85A 2BFGA 1JI2A 4YXGA 3QFEA 1S2TA 4LY8A 2DZAA 1XF0A 1RJPA 4X0NA 4PYSA 1BRLB 1W3LA 1QTWA 1XIMA 2Z24A 1XISA 1R46A 4G7FA 2FLIA 4H9XA 3B9DA 3H4XA 2QPXA 4CNUA 1E71M 1S3HA 4L80A 3DENA 4MGGA 3OO2A 1POKA 5HAOA 1UR9A 4KWUA 4IP5A 3N4EA 4BZYA 3WBEA 1YPIA 3N2TA 4EWND 4D8LA 4QNWA 1FWBC 1HTIA 3EA1A 4MAZA 1RCOB 3CNYA 4ILSA 1ALDA 5TBOA 2G37A 3UG8A 1SFLA 4C1KA 3QV6A 1ZQ5A 1G6CA 1PPIA 4CLMA 4PC8A 2WSQA 1A4MA 1A53A 1N8IA 5FJTA 3W73A 2ALDA 5IHRA 5HJYA 4PL1A 4QAIA 3NPXA 3AXMA 3FJLA 3L4YA 2PP0A 2QAFA 4DWSB 5BROA 1XV8A 2Q3RA 4DJFA 2QCGA 2QR6A 4MY1A 4JQAA 1L2UA 1YLVA 3LNMA 5AYBA 3DYOA 2W92A 4O0ZA 1GOKA 3QLDA 4J28A 3LZ3A 5I0DA 4XISA 3W1RA 4I5UA 3AXIA 5LHFA 3W86A 5IBXC 1FWEC 5DBUA 1ODUA 4H83A 1CTNA 4H6EA 4HNNA 1G0CA 3BL3A 1RCXB 4KCTA 2ZXDA 4LSBA 3AIBA 3H26A 4C6JA 4M6VA 3G1VA 2DVXA 4C7FA 3BCJA 3PZIA 1C90A 3NQAA 3STFA 1AG1O 3EWCA 5GJMA 3DXIA 4OJYA 4A3UA 5I23A 1JAEA 3NXLA 4O28A 1KO0A 5DLCA 1H7RA 1FWHC 3EMQA 3CB8A 1HUVA 3GAKA 4HHMA 3LRMA 1V93A 3E5BA 2ZTKA 2HROA 4GIRA 4XO6A 3NZRA 1B3XA 2AMGA 4KMQA 2RUSA 4GQRA 5LA1A 3VNDA 3TQ0A 2D0FA 5FJIA 3OZMA 3Q4DA 3K5XA 4JFUA 3M7WA 4CN4A 4XKMA 3CL7A 3VD9A 4OTKA 4YMZA 1NDZA 5LHEA 2OOGA 3F5JA 5MKGA 1T41A 3CZ8A 3ITTA 5BOFA 2XZ7A 3MKCA 1KGXA 2OT1A 4XD3A 1KB3A 1XCFA 1B9ZA 1PWMA 4IMFA 2X41A 2YFOA 2B7OA 2W27A 4A3YA 2XSAA 3CUHA 1D7FA 1MXGA 3B8UA 4ACYA 4WXYA 4GBUA 4MKVA 2QVNA 3UWQA 4TU1A 3KWXA 1UROA 1YTDA 2NSOA 1K03A 4Q7BA 5CPTA 5F4XA 4MY9A 4M6QA 3C4UA 3WF4A 2QVHA 3SIZA 3AROA 3K4AA 3MQTA 1DP0A 4AZBA 3OIXA 3VOJA 4YN5A 1G69A 4AWEA 3TXZA 3BJTA 4GX8A 3TV8A 2FJUB 3PBMA 3U0HA 1YMYA 1ME7A 2PE4A 5E1QA 1GTHA 5G1MA 4WIWA 3S5OA 2VXNA 3I4EA 1SO5A 2C71A 1OQFA 3PZNA 4IIEA 3TIMA 3NNTA 1Q8AA 4MFEA 1UPMB 1TJRA 1JYVA 2V68A 4ONVA 1O5RA 3AI0A 4O14A 2NVCA 2ZICA 2E1WA 5E0FA 3W1PA 2OTDA 1R3WA 4JHOA 1A49A 4Q6JA 4BA0A 3V0SA 3W23A 5C7HA 3QR1A 4R3UA 4JKLA 3GHRA 2GK1B 1CECA 4GGHA 4C6EA 3E0LA 2EPKX 1AVAA 2FKPA 2CZVA 2QCMA 3IARA 1OJXA 4ZR8A 5C7VA 1OGGA 3DKJA 1V3JA 3HQOA 2A0NA 1JPDX 4NF7A 3TJXA 1GVSA 3DFHA 4OE7A 4PEEA 3C0SA 1KM3A 1FKWA 1ZNNA 2XIQA 5I7GA 2WKLA 3PTQA 3DFNA 3HOJA 1XR2A 4QSHA 4DBDA 4L9XA 2A3LA 1IWBA 4Z1DA 3SFWA 3T0BA 2NT1A 1VCGA 3QGAC 3E9AA 3GNDA 2NQ5A 1OFOA 2C91A 2FZ9A 5ECVA 2D3NA 4K68A 2FPVA 3OP2A 5KTLA 1XSIA 4ZB2A 2ZUNA 3M0ZA 5LYRA 1L6YA 1H7NA 3E0VA 3TC7A 4PCPA 1HL2A 3V5OA 2XWDA 5H8PA 4NZ1A 2YZ5A 4AZ7A 2Y7EA 1ODZA 3IUDA 4HTYA 4LAMA 1W2VA 3W7OA 5J5DA 4DNHA 3OGRA 1NDWA 1W1B1 2OGYA 2QKFA 1UKTA 4DYEA 1V51A 1KXHA 3VCCA 5EPDA 4MWAC 3GW3A 1U5VA 3LPOA 4PRWA 1FDJA 4PUEA 3WJZA 3VDHA 1KFBA 2NWRA 1F07A 4AWSA 4ZQPA 4XSLA 4W7VA 4ORMA 1DJYA 1Y5VA 1QNQA 4FXRA 4FI4A 1SZFA 3BMWA 3L2MA 1FWGC 5F2MA 3DGRA 2D22A 4GY7A 3R12A 3PHAA 3OW1A 5HUPA 4LAOA 5IXEA 1U33A 3VNMA 2HS6A 3BTNA 4NNBA 4A8NA 3BAJA 4J9JA 2ALRA 4IIGA 3M47A 4ZE5A 2I7GA 1JFHA 1UIPA 2F2HA 1HL9A 1E40A 4CN6A 2CLHA 3F4DA 4K8GA 3HQPA 2Z1BA 2QCDB 3SEPA 1FKXA 4GACA 3O6CA 3R2GA 1M68A 3ZO9A 2WC7A 1RQEA 1XCWA 2R1NA 1L6SA 1VBUA 1L6GA 4IH3A 5D2WA 2PC4A 3WMSA 1GOOA 3H8AA 3HG3A 3TYCA 1EJ7L 1TREA 2HXUA 2P76A 3KVKA 3SR7A 4J40A 1FWIC 4AD5A 4XG1A 2HNHA 2YPIA 1BXBA 2FDSA 1KQZA 4AYGA 1P6CA 3K8KA 1C7TA 1VR6A 3DDMA 5F1UA 4EPKA 4O1CA 1OT2A 3GYEA 4JDYA 5H6HA 4BEQA 2OWWA 5HWMA 2BODX 3BLOA 1Q66A 5DMYA 3E2SA 3TCSA 1TPVA 1IE7C 3BW4A 3CU2A 1EDQA 1ISWA 2R9RA 5EMUA 3W1UA 3EB3A 1VJIA 4HKPA 1QOQA 2ZZ6A 3DAQA 1OFDA 1Z44A 2GWGA 2Y2WA 3R43A 3KZSA 5A6BA 3RG6A 3VOCA 5FOOA 1XM3A 3P80A 2XVLA 2NLYA 2JIEA 2VGBA 2JKPA 3VFCA 3O0KA 2POTA 4GZEA 4AMCA 4QLKA 4L6OA 4GIEA 2IW0A 3RK8A 1MNSA 1XRVA 3TNOA 1V6YA 3H7UA 4EK7A 2OVLA 1H50A 4GZIA 4C90A 4Y2WA 1XIBA 1G7UA 2WAGA 2CCRA 1E9YB 1ADDA 3LOTA 4GY1A 5DN1A 2BXVA 4MZ1A 4Q4RA 3CS2A 2OQHA 1E9IA 4HMNA 3GQYA 3H23A 2GL5A 1B3ZA 2EF9A 1FBAA 5D05A 1KM4A 3LK6A 2WCGA 4US5A 2POZA 2QDGA 1BG4A 1BQGA 1HNYA 4IQLA 3WFAA 4AH7A 3W2KA 3G22A 3BVJA 1IWAA 1PWLA 1ZPTA 4AXKA 1JZ5A 2WLYA 1JYWA 1WXJA 2E77A 1OCQA 3WLIA 1ZBKA 4BF5A 4AD3A 3LCXA 4HPGA 1MRQA 1XC4A 4AG0A 1JDEA 4O17A 3IV3A 3O15A 4I9AA 4Y6GA 4ATWA 4ZO8A 1FWFC 4ERIA 4JPGA 2XZ9A 3MT1A 1GW9A 2WHJA 4LUJA 1WAWA 1UKSA 3QYSA 1O66A 3WLRA 3TJIA 5FI8A 5AHLA 2FZ8A 2WMHA 1DXEA 3CV1A 3W81A 1XYZA 3QHOA 3CQ0A 4I5XA 3VNLA 3FVMA 1BHGA 4IX0A 2QUVA 3WUBA 1RY8A 3UESA 3LMYA 4HK5A 3ZWSA 2ZZ5A 3NA8A 2P50A 3TYUA 4ZZ9A 1IWPA 1J6PA 2NZLA 3SIMA 2FTPA 1PZ1A 2CXGA 2KZHA 3EDKA 1XS2A 2HCVA 3HGRA 4IGHA 4W7UA 3HV9A 4O15A 3ABOA 4QR6A 1RPKA 1L6FA 4ORIA 1NOWA 3PZMA 3D6NA 1OVDA 4K8HA 4LRTA 2YR1A 4LQ1A 4ERGA 4I3GA 1VYRA 1ZJAA 2IPFA 4UNKA 4E4PA 4GYKA 1AW2A 4YS1A 5AYZA 1V0MA 3WQ4A 3PBYA 3U4AA 3B0VC 1CLVA 2YB1A 3P3BA 3RX4A 3CC1A 4JGDA 1P0BA 7CGTA 5G4EA 3ARRA 4D72A 3KBNA 2GJXA 3PUDA 4PTDA 3GVRA 3MUCA 2I5IA 3UZZA 1EQCA 3LENA 2XIMA 1M7JA 2QCCA 3H55A 3BMVA 4OU1A 1PEZA 3BGJA 3GX9A 3BQ6A 3SSZA 2DZPA 2WVVB 4JXCA 3MPGA 1UZDA 1BF2A 3FDGA 5G4HC 3QHNA 3RU6A 1X6UA 3GYCA 1MFVA 3UWEA 4C6KA 3VZZA 1Y5XA 1I8JA 4GUFA 1TPFA 4DJDA 3LZ5A 1AD1A 4B5SA 3PBUA 3GVVA 1JCJA 3WQGA 5T9CE 1ISXA 1K02A 3AWNA 1BLIA 1XYCA 2YCLA 2WMKA 3DEQA 1UR4A 4XVEA 2XVGA 1GVOA 4GJIA 3V75A 2BMBA 4UXDA 4EAMA 1XICA 5D4YA 1I2NA 1UYQA 3H24A 3A22A 4ZQRA 2OKOA 3P7YA 3TN6A 4ZENA 4X3ZA 4DX3A 3N3MA 9CGTA 3E1F1 4R9OA 2NXIA 5D9MA 1HGWA 3LTSA 1UC5A 2PODA 1MDRA 3BURA 4V1YA 3AMCA 2VDHA 3UJFA 3EKLA 1PTAA 1QU4A 3FJ4A 3CH0A 4B90A 3MP3A 4QTGA 3PTKA 1F4AA 1OCNA 1UZ4A 3VIGA 4AZHA 3EEGA 4KKXA 4RV8A 1RSCA 1GZ1A 3JVAA 2J8GA 4RX0A 5C2GA 1U1UA 2VDIA 2BS9A 3QM3A 4O8RA 3LPFA 3UR8A 3R4IA 1SFTA 3THAA 1K77A 4OIFA 4KCVA 3FOKA 1XLIA 3PANA 2Z2UA 1EDGA 4FIQA 4RJEA 4UNIA 5E9AA 2PTXA 4L1WA 3G18A 3OA3A 2P88A 3WLSA 3SRDA 3KDOA 1VLIA 1LCOA 2A3CA 4HSHA 1SO6A 3TJ4A 5HNTA 5CG7A 3U7VA 5CXPA 3ECQA 2F6KA 2HJPA 1NDVA 3WF3A 4JTHA 2QYGA 4IIDA 4DLFA 4R27A 4YL2A 2V3FA 2FB3A 2J88A 1F6KA 1AJZA 3ARXA 3WENA 2Z1XA 4FF5A 2Z4GA 3BCFA 2Y24A 1ONRA 3W22A 4UOQA 3MMUA 2YLAA 3GTXA 3EA2A 4HJFA 1J5TA 4LY4A 3CHVA 2JQXA 2ZX6A 4Y9MA 2WWDA 3GUGA 3LCHA 3HFTA 4MJ4A 4FF7A 3AICA 1CB7B 3APGA 3OGSA 3CYVA 4C1NB 5BNKA 1PL9A 2P8CA 5F4WA 4IFOA 1H5YA 1JD9A 1A0DA 4U4MA 4X22A 5CGQA 4HB7A 1QW9A 5AHEA 2D20A 2Q02A 2GJRA 2GSEA 2PDWA 4WVXA 4EKJA 4HCHA 1TYGA 4IPLA 3RMEA 1S5VA 2I1OA 3MA8A 1EZ2A 4WKAA 3ABSA 3OZYA 1P48A 2REQB 3NL5A 1KFWA 3VKBA 4PODA 1P5BA 1CXHA 3MC5A 1HJWA 3T40A 3ZIZA 4PUJA 1M65A 3OBAA 2AOSA 4IJBA 1PCKA 2Q6ZA 4HN4A 3A9IA 3CH9A 4AY8A 3VKDA 3WH8A 4US6A 3M1ZA 3SDOA 5E70A 1DV7A 4Z2GA 4NJHA 4R85A 2AKZA 3DFTA 4TX9A 4UBPC 1WXYA 1S2AA 4ZB0A 1ZBVA 2J74A 3WY1A 3PM6A 2I57A 1EP1A 1G1YA 1O1HA 4M1BA 3W76A 3H2AA 2VX6A 2DSUA 1HKVA 2GUUA 3LXBA 3TTYA 1JG9A 3BOLA 4L61A 1KM5A 1LRTA 3ISIX 3UA3A 3AS1A 3UXAA 3L5AA 1ITXA 2V5LA 2CHNA 1I1WA 3AIWA 3WEOA 4IGSA 3TR9A 2EKCA 4JL1A 3VOFA 5HWNA 4CQDA 3LV5A 3NVTA 3W6MA 5AC5A 2ZUTA 1P6WA 3ITLA 3SCWA 3LA4A 4NASA 3N11A 3GS6A 3TFXA 4KF1A 4CD4A 2XN0A 2C1IA 3UU0A 4Y8EA 3AFBA 5AHMA 3MP4A 2YL9A 3GNNA 5TAOA 2P1FA 2AKMA 3ME3A 2VGFA 3QPYA 3NOEA 3FLUA 3FKRA 1EGZA 4ML4A 1R3SA 4ZSTA 1QMLA 1XX1A 1HVXA 1E1EA 1Q2RA 2DFAA 3FEMA 3QZ6A 1QO2A 1XD1A 3RJXA 3QC3A 1E4IA 1NQKA 3A4JA 2PWUA 5BOEA 5CPLA 1K4GA 3PG9A 4B5TA 1BVWA 2TODA 5I5RA 4GK8A 4RNIA 1KW1A 4FOKA 3QW3A 2BP1A 2ISSA 2GVYA 2FJKA 3LHZA 4RDYA 1QNSA 4DM2A 3KOYA 2TRSA 3V1HA 4POCA 1KCLA 3FYYA 2H8XA 2H3DA 3KS6A 3TN5A 3W7KA 3VNYA 1BAGA 3SUWA 4PRTA 5FEZA 4UFIA 2DU2A 1IGSA 2NQHA 5ABTA 1I9CB 4HPNA 1XCXA 5CAKA 3AYVA 3LB0A 3VGBA 3WK2A 4PB5A 3VCNA 1IHIA 3UXDA 1EF3A 5HBFA 4MDPA 3L4VA 4GYFA 3DC8A 4WKHA 4X2PA 3CPUA 1YE4A 4E8GA 3NPVA 5E0CA 3THQA 3CWOX 5LIKX 3K8MA 3CJPA 3WQ8A 5F2GA 3RCYA 2PPGA 5FIPA 4FLOA 4AWTA 6XIAA 3SZ8A 2ZXBA 3SRHA 3WDQA 4DF2A 1TIWA 4S3BA 3M9YA 3EWXA 3C6CA 3GO2A 4A3QA 1I2RA 4HCLA 4M3PA 3AALA 4TTGA 3M6YA 1H2JA 1Y7VA 4DJFC 1SVDA 3G0XA 3W87A 3E0FA 3O6DA 3TA6A 2PGEA 3QW4B 3WQVA 3GE7A 1OGBA 3N14A 3A12A 4D2JA 1EFZA 2QAPA 4ZOEA 1YPXA 1FCQA 3GC5A 1JYXA 1ME9A 1YADA 1W9PA 3T44A 3GDTA 2XGZA 1EJXC 4DWSD 1E73M 1H61A 3S5YA 1TMQA 3ANUA 1HL8A 2QV4A 4RCXA 2WB5A 1UR1A 2Z7KA 3W1TA 1WBJA 3W6LA 3LBCA 4A4AA 2ZTJA 4Q4MA 3VGDA 2ZIDA 1RA0A 3EPOA 5M1TA 1PTDA 4QNEA 3V5FA 3K8LA 4MIMA 1EC9A 4F40A 1XLKA 2QMKA 3CTTA 5I06A 1X7IA 3CO4A 1OWQA 4OQVA 2OJPA 3WLTA 5E93A 4L4PA 4RW5A 2VOMA 3A6OA 5CPMA 3LS9A 5D37A 2VZTA 2PRLA 4H1ZA 1LYXA 1JNEA 3LYEA 4OKDA 2NUWA 2XVNA 2MANA 3V36A 1K1DA 3S9IA 4JQ3A 1K4HA 3QQ1A 5FF2A 2ICSA 1DTNA 4X61A 4AEFA 3IRDA 3KCLA 3S8HA 2XFRA 4KCWA 2EXOA 1TR9A 4RXFA 2VT0A 3B97A 3RMJA 4LS2A 4OGZA 3ALFA 1OX4B 2IXUA 4ADUA 1BFNA 2GZXA 1JPHA 5I07A 3O6YX 1PX3A 3TQKA 3BXWA 3EX6A 1QPRA 3LDVA 1F3TA 4XIMA 4L9ZA 4HA3A 1E6SM 2PBOA 3ZJ7A 5K4ZA 2YA0A 4V33A 1UWQA 3URQA 1GQNA 4WSJA 3D46A 1RP8A 2ZWYA 3RLGA 1PHWA 4JTKA 4GISA 2AMXA 4MNJA 4TQTA 1ISZA 4UIOA 2OYMA 3ICJA 3T9PA 1JDAA 2V2DA 2CHOA 4H9MA 1KV8A 2AQOA 2QF8A 4NAEB 3VXGA 2Z28A 2YA2A 3OG2A 1HJXA 4D6DA 1SZGA 3SRFA 3T8QA 2I5QA 2GVEA 3ARPA 2X1SA 3ZT7A 4FNSA 1WBHA 2VRJA 5K9DA 1NFGA 2X05A 4N9EA 1TCMA 7TAAA 3LSBA 1GOMA 4AXNA 4GD0A 5GNZA 2VFHA 1ZAHA 4JIPA 4AUBA 4LBRA 1QWGA 4QLJA 3WD4A 4QDPA 2F2KA 5DMMA 1PB0A 1S1RA 2JBMA 2HK0A 2YXXA 1EKOA 1O12A 4DXVA 4DY1A 3N2OA 2QJJA 5JBFA 5A6AA 1JXKA 2UY5A 3GUWA 3S5SA 3GIPA 5I3FA 3N29A 5CPNA 6XIMA 3V18A 4CCZA 1W37A 1ECEA 1P7TB 1JIBA 3GU9A 3L66A 1TELA 4PBFA 5L6UA 2IQ0A 5HINA 4PTVA 1VFHA 4OV4A 2FZDA 4DWSA 1EIBA 1TVPA 2PDFA 3U2EA 1G94A 1QI4A 3GXNA 2VNCA 1JDFA 2VQTA 4XAZA 4KWWA 4M81A 4MWAA 1A50A 4I9TA 1U30A 1C93A 1J0JA 3KHJA 4PUMA 2RGLA 1Q7ZA 4JICA 4N6FA 1NVMA 3MKVA 3RPDA 2Y5EA 4GKLA 1EJSC 1X96A 4CEUC 4MB1A 1M5WA 4B5UA 3U7BA 1S1PA 2VWTA 3AS3A 3WDPP 4GUGA 2NV2A 1NP0A 5E0KA 1CIUA 1XDJA 2P3ZA 1N8FA 2GVJA 4Z2IA 2VOTA 4CCDA 4LPCA 2CPUA 1SQ7A 2OYLA 5U4NA 1K8ZA 4XKYB 4IWWA 4YTUA 4AD4A 2J6XA 3HGOA 4TMCA 3UP8A 3CT2A 1KBJA 4O1BA 4OVXA 1E6RA 1NWUA 2DQXA 2NQZA 4JD4A 4ZSUA 4WY0F 3AU2A 3W2LA 3WQCA 1DQUA 4HHLA 1VLWA 2PS2A 3E2VA 4Q32A 4ZOCA 2EHHA 5D8WA 1VBRA 3SBFA 1QCWA 4ZA0A 1E9ZB 1JF5A 1RLCL 3TTEA 4HOZA 2VFFA 1VENA 4NZFA 1E0TA 4IPNB 1VC4A 1XIJA 4NU7A 5KZMA 3EDEA 4S3AA 1GQIA 3C2YA 3EB4A 2NVDA 5A2CA 1FH8A 1CNVA 2F9RA 4MM1A 1E6QM 2CZDA 5A8GA 4HNOA 3P81A 4LNYA 4EANA 3A24A 3NQVA 1SJBA 3S46A 4R9XA 2OELA 2OWCA 4FOJA 4ZEPA 4Q8NA 3NSNA 2ZCGA 1TE1A 2IPJA 3QV9A 1P1MA 2DZBA 1UWUA 2ZX8A 5E6ZA 2PDNA 3PUEA 1ZGDA 3O0FA 1HFBA 1D8CA 4AF0A 3M6DA 4O1DA 4LOCA 4QP0A 4H7CA 1K9EA 1V77A 4CQCA 5JVLA 1EQPA 1O4UA 4N9BA 5D9OA 1EF2A 3THDA 4GI9A 2NVAA 3UG5A 4Z1CA 2BVTA 3PZ9A 1X38A 2WVSA 4WRHA 3LI0A 3URBA 3A4AA 3T42A 4P5UA 2CYGA 5A69A 3UJRA 5K9CA 1QI3A 4JEQA 2QIWA 4AIBA 4Y90A 3TQPA 3R1ZA 3OGVA 1LWJA 4GQBA 2GJNA 5CSUA 3BOFA 3FY1A 1NH6A 1E4NA 1SO4A 2Y85A 1PE1A 4CCEA 1PIGA 4OV9A 1JXJA 1ONXA 1IF2A 3A64A 2HXTA 2AGKA 5DXXA 4PZVA 4C1NA 4TIMA 1EJTC 3EOSA 1CXEA 4GUJA 4LAZA 1YYAA 1QNOA 3VZXA 4AISA 2BOGX 1M04A 3KZPA 1FWDC 3RJYA 2E67A 1BF6A 3N73A 3R11A 3TN4A 3E5PA 1R38A 4HBKA 2PA6A 3P74A 5JH1A 1JL8A 3CUGA 4A05A 1TSIA 3NJ3A 1FHVA 1GQLA 2W66A 1QHZA 4PE8A 3PNZA 1XQKA 2J25A 4W85A 1SMAA 1C91A 1WPCA 1TO3A 1OFEA 3IJQA 3S1WA 1GUVA 2QPUA 1CXFA 3N34A 2X40A 4Z17A 3W1QA 1AUSL 4UWMA 5B7ZA 3AZRA 2I14A 3L12A 3INPA 4P2VA 4REQA 1WO2A 4GQGA 2E9MA 4FPSA 5I3KA 1MFUA 1XUUA 2PBGA 2QDEA 2VR4A 1SW3A 4I7VA 1MQPA 3W2NA 1CYGA 2ZC8A 3WLMA 2V8ZA 3BMXA 3PS7A 5AC7A 2VJXA 2YL6A 4HPJA 4MPQA 2VR5A 3UWZA 5D09A 2BXZA 4AZCB 1W1A1 1XINA 3QV7A 1DE5A 4A29A 2RH9A 3DZ1A 3LEPA 4LS1A 4B9ZA 4PMOA 5D32A 4LWWA 3K2GA 3RGTA 3VIFA 2E5BA 2PDJA 2WC3A 2XIJA 1BGAA 2GVGA 1U22A 4ZO9A 4ROPA 1T7LA 1TRIA 4HZ8A 2YDQA 3EOLA 2C1GA 3A9BA 4HCDA 2VEFA 1EPVA 2CBUA 1QXLA 3VVGA 4ALDA 4RDZA 2PI6A 4W5UA 3H2MA 3GHUA 3C52A 4K38A 3CL6A 2CZFA 1YXYA 1Q7MA 3WLHA 4DF1A 5D30A 2NLIA 3GHTA 2CFFA 1GKRA 3CHDA 1UASA 2ZOXA 3NVDA 1RVKA 3ATZA 3EBVA 2DEPA 3HPFA 5D02A 4AHQA 3ZMRA 5K2ZA 3UFYA 3QF0A 1Q6RA 2VD9A 2OKTA 1G7VA 4UQCA 2ZX9A 1AK5A 1UOKA 1HP5A 4TOQA 4J3VA 2WSRA 1EL3A 3RCMA 5HANA 4GNVA 1QDSA 3BE7A 3W53A 4PH6A 4Y9NA 1EXBA 3VC5A 3DOPA 5DCDA 1JZ6A 2QCEA 3CV6A 1X1NA 2FMOA 2J47A 3FNDA 1PX4A 1D8WA 1W2PA 4HMCA 2G50A 3F4NA 1EA9C 3W7DA 1W56A 5HPCA 3N2MA 2BTMA 2ZVRA 1XIFA 5HA7A 4Y8FA 2HSAA 2OYKA 3S6DA 1KKOA 2DT3A 4UNLA 1XLMA 1W9DM 4KBXA 4GY0A 1K7XA 3CQJA 3GR7A 4HHHA 2NXHA 4H8VA 3WLOA 4RL3A 3MHGA 3IJLA 3W83A 3QH2A 2FFIA 3IGHX 1GGOA 5CG0A 1TV7A 5I09A 1ICSA 2PMQA 3TTSA 3B4UA 4H8HA 5FJUA 1GYLA 1J0YA 3DHPA 4WDTA 4Z08A 3THCA 2O92A 2PDIA 3N6QA 4ZQCA 1I2QA 1KRAC 3VA8A 4OOUA 1Q4NX 3TYDA 3L7RA 2YDSA 2G95A 1JPIA 3T81A 2FVKA 1QPKA 3BJSA 1K70A 4IUGA 1TB3A 1UD4A 3HJEA 1FDYA 1S5TA 5LIUX 3F03K 5ABGA 1QNVA 1T6MA 3MBFA 1FY6A 3PPGA 1IT7A 4JTJA 2TAAA 4JIQA 4XO7A 1DJNA 2P5NA 1FXQA 1X98A 2GGEA 4UQAA 4U28A 2R14A 2Z26A 2O55A 2P3EA 1GPWA 1KKRA 3UT0A 3P0WA 1K9TA 3I6EA 2PLJA 3QXBA 2OWXA 3OBEA 3LGGA 3H4WA 2WPGA 4J3SA 3CUFA 3SGGA 3BICA 3TW7A 5I3DA 4J3WA 3BUVA 3SCQA 2C7FA 4E8DA 3GG1A 3S1UA 4PCFA 1DIEA 4P7LA 2VCBA 2ZRVA 4MKNA 4S3CA 3TAKA 4IG2B 5GNXA 2R1PA 4OBTA 3WMCA 1DXFA 1VHNA 3WNOA 3QQ0A 1J0KA 2LLEA 6A3HA 4UR7A 1KTNA 2DH3A 3MV11 4XZIA 2V6AA 2Y6ZA 4BFAA 3L23A 1JUKA 1FCBA 1GZJA 1VEMA 1ZP3A 3P8IA 1R9ZA 4YCOA 1JAKA 1XRSA 3W7LA 3MW7A 1UMYA 3HGSA 3NUKA 1GJWA 5C9UA 5HXMA 2NV9A 2EPLX 3I7SA 2Y88A 3A4WA 3NM1A 1DJQA 1FFRA 1W3NA 1OX4A 3WNMA 2NQ9A 4KW2A 4JAWA 4AZIA 3B0XA 3FA4A 4PMZA 1CGWA 1TPDA 1XGEA 3UERA 2D3LA 2G0WA 4NJKA 1A5OC 3VI2A 1AODA 4HYRA 1YDNA 1XPYA 2FZNA 3N3TA 3K1GA 2TSYA 6CGTA 1NELA 4HA1A 3RF9A 1J9YA 3QEZA 3KBSA 1XLHA 2EAWA 2E7FA 1C7SA 1CEOA 1L9WA 3ITGA 1ICPA 2D2OA 3NL3A 1XHGA 3PVFA 1LF1A 5GNYA 1M01A 3L4TA 3SN0A 3TC6A 1UP2A 4PFHA 4BF7A 1Q13A 2D0HA 4ZCWA 4LW7A 3HPXA 2CZEA 5KSWA 3MVIA 3GG7A 1HW6A 2EJAA 4K8EA 2DVTA 3QLLA 3T09A 5I00A 2Z1SA 1EOMA 1OFPA 3EX2A 4DB7A 1LUCB 4YVPA 2DSVA 1O5QA 3KBWA 4A6GA 2BGNE 4PUKA 1TV3A 3VUSA 1R30A 5CKSA 3CL8A 3BAIA 3IK4A 2JF7A 2C16A 3DBPA 1KQYA 2XN1A 4H01A 4QBXA 4DO5A 4CGTA 2EO7A 2YJQA 1L6WA 3AHVA 3QN3A 4WDUA 2E0PA 1US2A 3N1AA 4AZ6A 2VX5A 4H6KA 1XXXA 4XZLX 1LROA 4XK2A 1VFOA 1T96A 1CPUA 5FF0A 3HIJA 3NO5A 4LNCA 2D2HA 4XUYA 1EX1A 4E2OA 3PJTA 4QE1A 5FD0A 1TPEA 2CESA 4LF2A 3R0KA 2QLYA 5REQB 1K7FA 4JTQA 2XINA 3ZZ1A 1WXZA 1B0IA 1KXQA 3M5VA 4DO6A 1IXOA 4AHOA 3C0QA 1W1ZA 4N4QA 3S2MA 3WEZA 1OHLA 3HN3A 2ZRYA 1E6NA 5AC8A 2YKKA 1MRAA 2PD9A 3IACA 1F61A 2VC5A 4S3FA 3ARWA 2NV1A 1FH7A 1SJAA 2I16A 1CZ1A 4XIAA 2OLSA 1X1OA 1E1CB 1EP3A 1VD6A 3D0CA 3TA9A 2ONEA 1UQYA 4MB3A 4PUWA 1E9LA 4GCAA 2NT0A 1KR1A 4LV4A 5LXEA 4GLEA 4ZODA 2O56A 3CO8A 3EZ4A 4B15A 2RGMA 3P61A 3CUIA 2IKJA 5XIMA 3ZLHA 3SI9A 4GJJA 1ML1A 4HZ6A 1W1VA 5G5IA 3CMFA 1IEQA 4B3ZA 1ZSXA 4OWGA 1M03A 1UR8A 2GWNA 2OPJA 5DRCA 3G6MA 1OB0A 3IIOA 3CK5A 3STPA 2DPEA 1XLCA 3QZAA 4N2YA 1B3YA 3F2BA 5I2UA 3Q2DA 1MVYA 4REQB 4CU8A 2BY2A 2X1UA 3T0AA 3VDCA 4MYAA 3IVUA 2O4MA 1FHLA 1B3OA 4W7WA 3M4HA 1O68A 4MMWA 1EEXA 2V2HA 3B0PA 4S39A 2YCEA 1BTCA 3CWNA 4D6EA 5D03A 1QNPA 2Z1WA 3N13A 2ISDA 2ZA3A 2ZZ2A 3IANA 4O10A 3H7VA 3WNLA 3KS5A 3F7JA 3B8SA 4ZL1A 3BANA 4DXXA 1QASA 2QULA 3IIXA 3DX5A 2F38A 2GYIA 3G24A 3CEUA 1XDLA 4QS5A 3O05A 4AMAA 3W02A 2VTFA 1W5QA 3FSUA 3H2NA 4LEQA 1TV8A 2BVDA 1IYXA 5K7JA 4NVTA 3BLIA 5KZ6A 3F4CA 1PKLA 2RHGA 1B31A 1XDMA 2CLPA 4M6PA 1EUNA 5CH9A 3P5ZA 1XWYA 4BR1A 4HPXA 4C6QA 4TMBA 3WDIA 1QBBA 1JCXA 3O3RA 1OINA 2CXEA 4D6IA 3L67A 5H2ZA 3TSMA 5CC7A 3QV8A 1HJQA 2XWEA 3BAXA 3TW9A 1H7PA 4XAFA 5JBDA 3I4KA 5D2TA 3W85A 2VI0A 3WZ0E 2OR2A 1ZCOA 4U33A 3LX9A 4K7YA 2ZC1A 3LY0A