2A6NA

Dihydrodipicolinate synthase (e. coli)- mutant r138a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSATGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Role of Arginine 138 in the Catalysis and Regulation of Escherichia coli Dihydrodipicolinate Synthase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a6nA00
3NO5A 1BKSA 3DI1A 3NL3A 1S5TA 3T55A 2YYUA 4LS1A 5K2ZA 2TRSA 2TSYA 1JCMP 3E96A 4FX8A 2ZYFA 4N4QA 5HMSA 1DHPA 2RDUA 1JUEA 1GT8A 1SZEA 3NQMA 3CU2A 1LRNA 4E38A 6TIMA 1SPQA 4UTHA 3IIVA 4M7SA 2D73A 5HWMA 2HMCA 3PB2A 2WO5A 1W5QA 4O53A 2Z1BA 1F74A 5I3JA 1EP1A 4DQWA 4FNPA 1JUKA 1LBFA 1LOQA 4HN4A 1K02A 2J6XA 5G2IA 4A21A 1KTCA 3PUDA 3TAKA 3R13A 4K7YA 3FOKA 3W7IA 1VYRA 5BW6A 3B4UA 1YXCA 3MP4A 3BLIA 4UR7A 5CPOA 5AN7A 2FTPA 5AB3A 1P0KA 2NX9A 3L5AA 1Q6LA 3S0CA 3W2KA 2CLIA 1F76A 1LDCA 4ADTA 2A5HA 5HR7A 3G1DA 2GVLA 3KRSA 1FX6A 3QMSA 5KZDA 2V2DA 3LHUA 1DBTA 3C2OA 1OVDA 5CPMA 3HG2A 1L6SA 4PA8A 1FWNA 4HNTA 1TREA 3HO8A 3F03K 3NM3A 2I1OA 3PR2A 5C55A 4NVTA 2QCNA 3O15A 4OE7A 5K3VA 3TMLA 3VFLA 1TPDA 3TFCA 2RDTA 5CZSA 3A21A 2V9DA 5E93A 4CNNA 3P7YA 4Y96A 1JRCA 3ATYA 3C3NA 2ZRYA 4WUIA 1K7XA 2B7QA 2YCEA 3LHTA 3GXPA 1WBHA 1XDMA 4Z0JA 3UY8A 3WJZA 4N02A 4JY9A 1EUAA 1AL8A 4UCGA 1ZENA 4PODA 4PEKA 3TC7A 4R33A 1DQWA 3CIWA 5DXXA 2X1TA 3B0PA 4N9CA 4R53A 1N7KA 1WAUA 3KRZA 3STFA 1UUMA 2DZSA 1T99A 1CI1A 1SZNA 3QRHA 5D04C 2YFNA 4O10A 4ALDA 4GUIA 3W76A 3JRKA 4K36A 3DFOA 4ZQOA 3ABOA 1W54A 2CLHA 1TTPA 1KFEA 1KLZA 1I2PA 4O12A 1YDNA 2HSAA 1G4PA 1OYCA 2NX1A 1T0OA 4X9SA 4HNUA 4GUFA 4BWLA 1O5XA 2WKJA 3UZJA 4E2BA 1W0MA 1FXQA 1AMKA 4UMBA 5LNVA 2CZFA 1C29A 4IPIA 1FDYA 3NL2A 2EKCA 3QW3A 1GOXA 5AYZA 1OX5A 1EWDA 1YTKA 4YCPA 2QJHA 4AF0B 2NV1A 4O11A 1YDOA 3UXDA 4AEOA 4NNAA 3PWAA 3LV6A 2WV8A 5H91A 1NSJA 5HJLA 2CWNA 3EKZA 3USBA 5KZEA 1KW1A 3TXZA 3WJWA 3W7RA 1TPH1 4JXCA 1XM3A 1YADA 4WY0B 3UQNA 3STGA 1F05A 2WNZA 1GWJA 4J9JA 4OQVA 5G2WA 3W7OA 3RU6A 1NVMA 2FB3A 1ZCOA 3M6YA 4ZQMA 1B3OA 3G22A 3GKAA 3BW2A 3P5ZA 3DKLA 2GOUA 4JYFA 4E0CA 5HINA 1KFKA 4AB4A 5BMXA 4ORIA 1GZGA 1SO3A 2EPHA 2F7FA 2R94A 4O50A 3NDOA 1O60A 4RJEA 4JTEA 3LTSA 5J5RA 5F4SA 3W7QA 4UTMA 1QPQA 3W84A 1YYAA 3SIZA 5A8GA 4GUJA 4RLIA 2PRHA 2YDAA 3GB6A 4R34A 3U2OA 2W79A 2OT0A 4PTNA 4IX0A 2TPSA 3M7WA 3O1NA 2DP3A 1PV8A 1KM3A 2H8ZA 3MP3A 4I7VA 2VFIA 3RFAA 3MJYA 5G4WA 1A5BA 2A2IA 2FB2A 5ABTA 2QCMA 2W6RA 1VLIA 3BG5A 7TIMA 2OMAA 4UR8A 4ZQRA 1W5NA 3M5XA 4UNKA 2PRLA 2RDWA 3P60A 2CFFA 1ICQA 3G18A 3WJSA 2A7NA 1OFAA 1RQEA 3B03A 5DY2A 1Y0EA 3GDRA 2VFFA 1TQJA 1F2JA 3GVGA 4GE8A 1H7NA 5KINA 2Y89A 2Z0IA 2QCFA 3M5YA 2NWRA 2C18A 3CB8A 4NUWA 1H7WA 2BXVA 1F5ZA 1WX0A 1GTEA 1Q6RA 1YPIA 5AHNA 5DCDA 3ABRA 1ZY9A 2AGKA 5D2TA 5L6UA 5H2ZA 4M6PA 2YFOA 4HNNA 3RMJA 1KM4A 1LBLA 1H51A 4FNQA 4QNWA 3LCGA 2FFCA 2ZFAA 4WOQA 1ALDA 4BR1A 1W3NA 4XWUA 4I7UA 3L21A 5EPDA 3NL6A 1WA3A 3LERA 3PSWA 3WJYA 2Y62A 3MHFA 3S5NA 1PHQA 3CEPA 1Z41A 4JTJA 5I3IA 5F1UA 4FNTA 3DFNA 3W1UA 4ADSA 4O19A 4C1LA 3W70A 3QF0A 1AK5A 1FCVA 5EL1A 1TTJA 3NQAA 4N2YA 3TROA 3UZ5A 1XL9A 1OYAA 4O28A 1O95A 2Y7DA 3P67A 1H1YA 2C19A 2QCHA 2Y7EA 4LRSA 1FDZA 4MZ1A 1Q3NA 4Z0SA 2R8WA 1KTBA 1PS9A 1KM6A 3TJLA 1FWWA 3H53A 2NX3A 1Q45A 4LVAA 4LW7A 2V2CA 1I2NA 4DPQA 4P2VA 3QMTA 1QPOA 1TPB1 3INPA 1G4TA 3PULA 3TXVA 3GKFA 4IGHA 2RH9A 4O52A 3TMQA 3NOEA 2V2HA 1OF6A 1NF7A 2DZUA 4K37A 3GZ3A 4NJGA 4UUIA 4Z1DA 3C4UA 4GNJA 1OFBA 2YSWA 3GDMA 1X1OA 3S6DA 1BEUA 1K8ZA 1E51A 3O07A 1IF2A 4LVDA 5D2WA 5CZTA 4K8HA 4H3DA 4JTIA 3H55A 1JCLA 3PSVA 1HL2A 3NQ7A 1AL7A 4O0KA 4M7TA 4K6AA 4MKNA 2ZZ6A 4FXRA 3CEUA 1JJKA 2WNNA 4Y8FA 1MO0A 4W9TA 3QJAA 4UC5A 1V5XA 5LHEA 3W2UA 3Q94A 1B4KA 4X2RA 4YLWA 2EGZA 1Z44A 3QFEA 5TIMA 3VKJA 4UTWA 1OHLA 4LY8A 3MUXA 3NVTA 1R2SA 4M19A 3W22A 4HSOA 1ZNNA 3NQGA 2Q3OA 5EY5A 1I45A 1HG3A 1WBJA 1RVGA 1YPFA 4FNSA 4OT7A 3OBKA 1D3HA 4GBUA 3P62A 4O0ZA 1JRBA 2NXGA 2C14A 2VEPA 3KOFA 1MZHA 2OJPA 1KLYA 1JQXA 1C8VA 1TV8A 2NZLA 4KWVA 1I4NA 1ICPA 4PCFA 2QJGA 3TE9A 3CWOX 4JTLA 4BI7A 2Y7GA 5FF2A 3SI9A 5L9FA 3HQ1A 4OBTA 2V82A 3B05A 3EXTA 1XBYA 3V75A 2QUUA 2NLIA 3ZWSA 3LBCA 4IMDA 3TIMA 5LNUA 2Q3RA 4C1KA 2JK2A 3QMRA 1XCFA 2QDGA 4H6KA 5FF4A 5F2GA 3PG9A 3E12A 2E6YA 1QPNA 3RNDA 3LCFA 4UXDA 1XI3A 3CHVA 4JTKA 3N9SA 4QAIA 4HHPA 1XUUA 2YGYA 2QAFA 5K9XA 4AF0A 4O13A 4TMCA 5LGXA 3PG8A 5IM51 1HUVA 3W7JA 3EWUA 1SQ7A 3SJ3A 2YR1A 1TCDA 3M1ZA 1ME8A 3BV4A 3WJXA 2VENA 3M5VA 1FUYA 4WY0A 2E5CA 3ANYA 1OFRA 1TPEA 5C54A 1Q6QA 1VRDA 2C13A 2X2GA 4HPJA 3WK2A 4NXKA 4NZJA 1RD5A 3S5ZA 2CLMA 1G7VA 2G96A 1TV5A 1LLZA 4JS3A 3LRKA 2A7RA 4ZL1A 3W2MA 4A2SA 4KWWA 1I2QA 2DZXA 2Y88A 3DXIA 2Q8ZA 3M44A 3HMJG 1OFPA 2VELA 2G5WA 3E49A 5DY3A 3EXSA 1SU5A 3TFXA 1EWEA 3M47A 4MPQA 1CW2A 2QJIA 2QKFA 4JICA 3W1NA 3A5VA 1W1ZA 4FHAA 3BW3A 3CLMA 3HPZA 3FKRA 4IJBA 2JBMA 1OX4B 4AH7A 5FF0A 3UYCA 3LRLA 4ADUA 4YMZA 2UV8G 3LXAA 5FEZA 3P82A 1EUNA 4XTIA 1VCVA 2JKAA 3HOJA 1EA0A 3G3MA 3SSJA 4UFHA 4MYXA 2VEIA 5F4XA 1XBZA 4O1DA 3SGUA 1KFLA 3YPIA 3MBFA 1XDLA 3C61A 5LZLA 5DELA 2G95A 1ADOA 2Y6ZA 1A5SA 4MFDA 5AC8A 3DFPA 4XBKA 3LI0A 4K38A 4MOZA 2Y85A 3ABQA 3C2EA 3P74A 3PBVA 5HR6A 3KRUA 5LKYA 2BZNA 2V5BA 2NWSA 2GVGA 2ZZ3A 4O1CA 1FWSA 4NX5A 4HT3A 3QQ0A 3CIXA 2NUXA 3MI6A 2ZRVA 5BRBA 1ZJIA 1EIXA 3TR2A 4MYAA 2QCLA 4IMEA 1VQTA 3LXCA 5G1TA 3W87A 3LTYA 2WQPA 2CLEA 3BW4A 3W7GA 3PUOA 5TBOA 4RR4A 4LVFA 3TSMA 3LBMA 4UTTA 4LS0A 4HSNA 1R30A 1N55A 3C6CA 4D2JA 3GR8A 2YYTA 1A53A 4OV9A 2J88A 4NNCA 3WFAA 3I6RA 1K7EA 2C16A 4AHPA 3ZS4A 5D2XA 3LLFA 3LB0A 4XKYB 3G0SA 3FFSA 3G1XA 2PC4A 4LTSA 1K03A 1NAL1 2EF9A 2CZEA 3O6CA 4XUGA 2I14A 1DL3A 1Z48A 1L2UA 5TQLA 2HS6A 3OVQA 1X1ZA 2EHHA 3LHYA 3W74A 4DF0A 3LHWA 3EX6A 3M41A 5C2XA 4LNYA 5DN1A 1P4CA 2ZZ4A 4RK8A 2E09A 4FB7A 4QSHA 1LM1A 4O57A 1PL9A 2I9EA 3DI0A 3KXQA 1FBAA 1TTIA 3NEVA 4MFEA 1ZAIA 3A23A 3I7QA 2P0OA 4YWIA 1R47A 3HG5A 3RF9A 5U7SA 1L9WA 3UWZA 4EOUA 2CZDA 2KZHA 4XZ9A 4FEZA 3O05A 3VCRA 3GLCA 3IVSA 4ZQCA 3GX9A 4LS2A 1SW0A 1NEYA 3UWYA 3MYOA 4IOTA 1S5WA 3N73A 3TW6A 2Q8LA 1J4EA 1GG0A 4S2BA 5F2IA 2WSQA 3P80A 2C1HA 2A0NA 1EX5A 1DORA 1SSGA 4YXGA 5E0KA 3A22A 4CCDA 4OV4A 3B06A 3FYOA 5DXYA 4RXGA 3GXTA 5I3KA 5F2LA 4QITA 3NPWA 4IXXA 4WOZA 3GIYA 3HPSA 1LP6A 3I68A 4YCOA 2X16A 1AW1A 1A5AA 1SO6A 3GDLA 3NR0A 3LM7A 2J24A 4BF9A 1IXNA 3SY5A 3QPYA 5I3GA 1TJRA 2H8XA 4A2RA 4LWWA 5LHFA 1GG1A 1HO1A 4A29A 4HNVA 1O94A 3NQEA 1XBXA 1VS1A 5D09A 3THQA 2WOQA 1RPXA 4OWGA 2ZA2A 2PCQA 2GUUA 5D33A 4OGZA 1H7XA 3R8RA 1VR6A 1IXPA 4JTHA 3R2GA 2VOMA 4JX4A 3ZR4A 3HJZA 2VFHA 1JCXA 3NQ6A 3NAVA 1OFDA 2ZRZA 1UASA 2H90A 1F73A 3NQFA 3DFQA 4MVAA 4M6VA 2FQIA 2NV2A 4PFMA 1HO4A 5DBTA 3DH7A 4N9DA 5EBUA 2E6FA 3UPWA 1OK4A 1HFBA 2ZZ7A 5KSWA 1QO5A 4Y6GA 5C5YA 2A4AA 4DEFA 1J2WA 5CSSA 3NQDA 2NXHA 3IIXA 3CPRA 3D0CA 5G2HA 3O6DA 2Y61A 1NFBA 2DJLA 3RK8A 4DELA 4LU0A 3LCHA 2H3BA 2J9YA 2ISWA 3I7RA 5CPNA 4DXVA 3QZEA 3BVJA 1VPXA 4AAJA 3WK0A 1KFBA 3B0UX 4LUJA 2DJXA 2OZ0A 1GYNA 2CW6A 4CNOA 1TJPA 1ZHAA 3RLUA 3W7EA 3P61A 2QF7A 2E6DA 1GVRA 1H62A 2XN0A 4GUGA 4U4MA 4EIVA 2YX0A 3EX3A 4AWSA 2JKEA 4FX6M 3TA6A 1W56A 2V30A 3IIOA 3L2IA 3LX9A 4QIUA 4QJ1A 3KVJA 4LT9A 3EEGA 1SFLA 4DF1A 2A85A 1TB3A 2A6LA 3NM1A 5AHMA 4NQ1A 4O1AA 3W2LA 3A5FA 1GEQA 3C2FA 2B7NA 1KBIA 1B4EA 3SZ8A 3LHVA 4WX2A 4TO8A 3W7HA 2GQAA 3HG3A 4CLMA 4ONVA 1QMLA 3DAQA 2VEKA 3FA5A 4UTKA 3PBWA 4LC6A 2Y70A 3NQ2A 2V5LA 3I7SA 3L65A 3HIJA 4NX0A 1W5PA 5U4NA 2FDSA 3W7PA 2X1SA 4NZFA 3W2NA 1ME7A 2E68A 2OX1A 4NU7A 3QW4B 3W07A 1OX4A 1TSIA 4BFAA 3IGUA 2PURA 3G24A 1I2OA 2GPTA 2ZA1A 1DJNA 4ML9A 3U6WA 1VCGA 3Q2DA 4M6QA 1SFJA 2CLOA 1TQXA 2QCDB 4UMAA 4XQ6A 1QDSA 1VZWA 3STEA 1XFBA 1DJQA 1RQBA 3IIZA 3UWQA 3W3OA 4HIBA 3UWUA 5EKYA 3Q37A 3QEZA 1LZOA 4N6EA 2VFGA 3IIPA 4DPPA 4H4IA 3FYPA 4WXYA 1WXJA 3EX4A 3L68A 3S42A 3B8DA 1TPUA 1SSDA 2BWGA 5FI8A 4WY0F 1N8FA 1UCWA 2CZ5A 5T26A 3HGRA 3N3MA 1XBVA 2E1DA 2G97A 4EF9A 1O4UA 1VLWA 1GPWA 1KM5A 5K9CA 4NJJA 3W7MA 4O8RA 3MI3A 3QSTA 3DENA 1K3UA 3LRMA 3NL5A 4AXKA 1IGSA 4IMCA 2RKXA 4IWWA 2RHGA 3BPWA 3FLUA 4A22A 2RFGA 1GJPA 1V7YA 4X22A 2QCEA 4UTWC 4KFPA 2AAMA 2NUYA 3LCLA 4XKYA 4UMCA 1JCNA 3AO0A 1OFOA 2WSRA 1ONRA 4Z1CA 3M5ZA 4ORMA 5A5WA 3W85A 1XUZA 5HNRA 1FCUA 1G7UA 1AW5A 4NNBA 1KM2A 4MLJA 4HPXA 5FF3A 3G1FA 5D38A 3W2JA 3C2VA 4E2DA 3S5OA 2QUVA 1H7RA 2ISSA 1KV5A 3TK7A 2A1YA 4O16A 1X7FA 2NXIA 3OHIA 3UWWA 1VHNA 3PM6A 2DZPA 1NF0A 1H50A 1WV2A 3NQ8A 1FCQA 5D37A 5BNKA 1PVNA 3LI1A 5D03A 1MXSA 3NZ1A 4JD4A 3HB9A 3O16A 1SO5A 3GAKA 5DCEA 1G69A 2QAPA 4Q33A 3QC3A 4IMGA 4O18A 1QPRA 3W1AA 1MEHA 1OABA 3T4CA 2WJZA 1YTEA 2FLIA 3L5MA 3KAOA 2DU2A 4LVGA 2P10A 2Z6JA 1AG1O 1XXXA 1VCFA 3THAA 5K4XA 3BG3A 3TCEA 2ATSA 3Q58A 6ALDA 1X6UA 2PE4A 3QH2A 3PF3A 4PL1A 4L4MA 1KFCA 3CM4A 4Q32A 5CKSA 4NJIA 3UY7A 1THFD 3MP5A 1G4SA 5EYWA 2E5DA 3N2MA 3M16A 3LCXA 3F4NA 3BLFA 3M9YA 4GC4A 2R91A 4LVBA 1MSSA 4QM1A 4RCXA 1OFEA 3MYPA 4I7WA 4N9BA 5HUOA 3C0JA 1R46A 5HUPA 1TPWA 3PY2A 3BGJA 4BI6A 1GVQA 3E0IA 1HTIA 4TU1A 4ICNA 4K39A 5IBXC 1KTNA 1YTDA 5FEXA 3W1XA 2JGYA 3W1MA 4AWTA 4IX2A 3PB0A 3OVPA 4TR9A 2FPTA 3TKFA 1Q6OA 1EB3A 4OU1A 3TC6A 4O4WA 4UIOA 5D2VA 1KA9F 3P8JA 2OT1A 3LDVA 2Y7FA 3CT7A 3S1XA 5AOUA 4AVFA 2ZZ5A 1CX9A 3PS7A 3MHUA 5AC6A 2J27A 3OA3A 1LLWA 1BTMA 1FCBA 3IEBA 3QM3A 2A7PA 1LOSA 3DFSA 3W1RA 2F84A 4QNEA 2FPYA 3KHJA 5D32A 5CG7A 2BLEA 2ZRUA 4UFLA 5BOOA 3GAYA 3ZWTA 3G8RA 3G1AA 4AHOA 3CTLA 4K7VA 3L67A 1PCKA 3NZRA 1WDWA 2YZRA 3CC1A 2ISVA 3HG4A 3G1HA 3G1VA 5HQEA 2CLLA 4DO6A 2VKZG 1JQVA 4IUOA 3E9AA 4JX5A 3C2RA 1H63A 4MIMA 4WD0A 4UTJA 2ZZ2A 1TV7A 3SECA 4JIPA 3N34A 4UTTC 4MY8A 2BSLA 3G1SA 2WSYA 2BTMA 3WK3A 1JCYA 1QR7A 3S9YA 2DZTA 1PE1A 4WQ6A 4A3UA 4EVZA 2YPIA 5AC7A 1YLVA 3A9IA 3ATZA 1LRTA 3EWWA 1H60A 2H3DA 3BARA 4O1BA 1LTDA 3W75A 4JN6A 2FJKA 1VYSX 4CCCA 3O8AA 4IMFA 2DZWA 4JY8A 1TPC1 3QQ1A 5KZMA 2VFEA 3MWAA 3G1YA 4UTUA 1IIGA 3N19B 8TIMA 3TV8A 5AHEA 3W86A 4GJ1A 3LTPA 2WNQA 3U8GA 1AW2A 1VJIA 1X8FA 1UJPA 2R14A 2GVJA 2V81A 3SW6A 5FEPA 5K9DA 1WYIA 5AFDA 1SW7A 4AWUA 4CCEA 3UD6A 1U83A 3L0KA 3DKJA 2VEMA 3W7CA 3TAOA 1FY6A 3W72A 3EB2A 4XBSA 3LGEA 2GQ8A 5LNWA 1W5MA 3MHGA 4DBEA 2GQ9A 1I8JA 4RXFA 1YXYA 3KVLA 3S1UA 3QSRA 5CGQA 3GDTA 3JR2A 1H5YA 4DF2A 2ZQ0A 2C15A 5FF7A 2P1FA 3L5LA 1QO2A 1A50A 2QCDA 2Y63A 5DBUA 1TIMA 3V1PA 3EKLA 5F4WA 2B7OA 1SZFA 5HWNA 3DGRA 3SFKA 1PHWA 3L9CA 3A24A 4CQAA 5FESA 1GVFA 1KM0A 3HF3A 3FJ6A 3TU9A 5G5IA 4N4PA 1BWKA 3QYQA 5SWUA 4O4VA 1B57A 4N9EA 4BWLC 1QNVA 4BI5A 1ME9A 3S5YA 1S3HA 1KFJA 2CU0A 2H6RA 1XKYA 1RQHA 3IV3A 4JTFA 5KITA 1W37A 1WOBA 1YXDA 5C6MA 3OIXA 3TUUA 1EP2A 4TMBA 4Z08A 3W71A 1QCWA 1GVOA 4JYDA 1ZAJA 3W7KA 3HPXA 4PH6A 4RX0A 3GXNA 4KFOA 3BO9A 3FJLA 3OEXA 4JEQA 1RZMA 2LLEA 4M5PA 4OHQA 4FNRA 3HGJA 1P1XA 2ZTKA 3OVRA 3GYEA 4MZYA 1LCOA 3FS2A 1SUXA 4GFSA 3W9ZA 3FEMA 4O17A 4ZZ9A 3BLEA 4ZVJA 4RZ6A 3S1WA 1LROA 4U28A 1KBJA 1YDVA 3P5YA 2VC6A 4ZQNA 1UUOA 2QEZA 4Y90A 5DLCA 5AYYA 1FWTA 1SR9A 3G3DA 3IVUA 4MY9A 4UTLA 3LXBA 4JTSA 4MJZA 2XN1A 1F6PA 3L0GA 1TYGA 5AHLA 3B04A 2PRMA 3QPZA 4S2CA 1QOPA 2QDHA 3KVKA 3GR7A 2C6QA 1QOQA 1TTQA 4RKAA 1TRIA 4LOCA 4IPJA 1VH7A 3UWVA 4QISA 5D05A 1JCJA 3M0ZA 1BWLA 2ZA3A 3L66A 4EF8A 1DKWA 4XTDA 3C56A 2OCZA 4IQLA 1T8XA 4JTTA 2ZDRA 1VHCA 1H1ZA 3NQCA 5LNRA 4GXMA 1D3GA 3S8HA 3W88A 1S5VA 1OFQA 2YXGA 4UNLA 1G4EA 3KVMA 1H7PA 1UB3A 4MZ8A 3MI2A 3VE7A 5EA9A 2EAWA 5FEWA 4Q4KA 3BK0A 4FF7A 3IRDA 4G1KA 3LLDA 3W7NA 2X1RA 3NXFA 1JUBA 1L6YA 5CSRA 5I3FA 3MMTA 5KTLA 4JNMA 5HULA 3TH6A 1P5BA 1J5TA 1TPFA 3EWYA 4MUZA 1RR2A 3AJXA 3W1TA 4AMAA 4L4LA 3P84A 3LHZA 2ATMA 2QUTA 3I65A 1F7BA 2TMDA 4ZMGA 4NT0A 5DCBA 3T44A 2X30A 3EWZA 1OF8A 3T7VA 1LRQA 1RV8A 2JGQA 4GWEA 3NPUA 2GJNA 4N6FA 5F1VA 4CNPA 3EWBX 2B4GA 1K7FA 1M6JA 2W0UA 4JDYA 4LRTA 3W6YA 1UBSA 2YW3A 5D2YA 4Y9AA 1SW3A 2BX7A 2ZZ1A 2B7PA 3VE9A 3EWXA 4DO5A 4FX7A 3L0NA 4JTUA 3S1VA 1TRDA 3WK1A 5AYXA 5BMWA 4UFMA 4MJMA 3FKKA 4MY1A 1R2TA 2YW4A 3LOTA 3DHFA 1R2RA 3IGSA 1SZGA 5D30A 3DHDA 1VC4A 2CLFA 1DOSA 3N14A 2JKPA 4O14A 4IXHA 1H61A 3LCWA 3TSBA 3SGZA 1P0NA 4FO4A 2FPVA 3NPXA 3GDKA 1MEWA 3JS3A 4LV9A 3W73A 4UTIA 4FXSA 4RV8A 3NA8A 4JTGA 1OG0A 3EX2A 3C8FA 3VNDA 1MEIA 1EP3A 3K30A 4NJHA 3W1QA 2ZCGA 1OJXA 3TW7A 3PC0A 1G6CA 1G67A 4JYEA 2E5BA 3HBLA 1WQ5A 1GVSA 3TQVA 3TJXA 3NPVA 3UNDA 1FDJA 1GYLA 2IQTA 3NGJA 3G0XA 1IXOA 2A6NA 2C3ZA 4K8EA 3GNNA 3UPBA 4POCA 4NXSA 5KMYA 3H54A 2NUWA 1U5JA 3O06A 4I9AA 3UXAA 3BGGA 1OX6A 1VYPX 3LCIA 5CPLA 3NNTA 1C9DA 3R5EA 1LBMA 5LSMA 1W31A 2VXNA 3HGOA 4PC8A 1KM1A 2ABBA 3F4WA 1M7OA 4QQ3A 1EEPA 4UFIA 2QR6A 4NJKA 3E02A 3C52A 5E1QA 1DVJA 5G4EA 2B0MA 1JULA 4CQ9A 1LORA 3ABSA 4LUIA 4WXZA 5CZJA 1DQXA 2ALDA 4DO4A 3PBYA 2ZBTA 1I2RA 3MO7A 1DV7A 2HS8A 4HKPA 4O54A 2FIQA 5I3HA 3IGXA 1ML1A 1FXPA 2HTMA 1PIIA 4MLRA 2AQWA 3RLVA 1O5KA 3W7DA 4WJEA 1M5WA 2O7QA 5D02A 1Z42A 3IVTA 2V8ZA 3R89A 1VGAA 1W5OA 1H7OA 4JGDA 4UFKA 3T78A 4P61A 2GJLA 2ZRWA 3DZ1A 3W1PA 3W7LA 3PBUA 3OG3A 1GQNA 1QWGA 5G1YA 4X3ZA 4JDBA 2X1UA 3TDFA 5K7JA 3TX9A 5MHBA 1M7PA 4GUHA 3KX6A 3O63A 4GRSA 5K4ZA 3TNOA 3SR7A 1B9BA 3HGSA 3MW7A 2ZRXA 1IIHA 4AHQA 1D9EA 5F2MA 3FIGA 3G8EA 5J5DA 4LC8A 4FIRA 1K8YA 1GTHA 3STCA 2CLKA 1L6WA 1W8SA 2XFWA 1OYBA 3BG9A 2ZTJA 4LV4A 4PL2A 3LV5A 4Z1AA 2Z2UA 5LGZA 1ZFJA 3P81A 4JR5A 3MBDA 3DBPA 3EXRA 4WZHA 4TX9A 5AHIA 3TQKA 4TIMA 4KKXA 3CQ0A 1ICSA 1JVNA 3W83A 3KFTA 3GNDA 3TQ0A 4DBDA 3N9RA 2Z6IA 1QFEA 2QCCA 3T40A 2J9ZA 1JR1A 3P8IA 3PVFA 3R12A 2A21A 4KFNA 3W23A 2XN2A 1T96A 4FIQA 1QAPA 4R7JA 1W3TA 1LOLA 2O7SA 4ZQPA 2QCGA 1TO3A 5AHFA 4O15A 4Z1BA 4BK9A 5EMUA 1W3IA 4RZ5A 5GVJA 2ABAA 1FWRA 4JX6A 1LYXA 2E77A 3NYZA 1A5CA 1SO4A 1ZAHA 3NQVA 5CZ0A 3NG3A 3B0VC 3F1QA 1KV8A 4B5NA 1ZALA 4CQ8A 3GK0A 3ZFHA 1PCWA 2J9XA 2VFDA 4YL2A 1K8XA 2E6AA 1IXQA 4S1FA 4UFJA 3N2XA 5HWJA 3W1LA 3EX1A 4RZ4A 4JIQA 2DZVA 1EPXA 5IBXA 3TSDA 3DFTA 3ELFA 3DU0A 1TPVA 1XC4A 1TMHA 3O6YX 3CWNA 1OK6A 2V0TA 2DORA 1F6KA 1WOAA 1FQ0A 3PAJA 3M43A 3VI2A 4FNUA 3PUEA 2TYSA 5LNSA 3G0UA 2C0AA 2WPBA 4EWND
chains in the Genus database with same CATH superfamily
1CXLA 3DI1A 3T55A 5K2ZA 4LS1A 2XFYA 3DFHA 2TRSA 1MYRA 3E38A 2E25A 4GH3A 4N4QA 5A6BD 2RDUA 2X0HA 1CT5A 2XSAA 1XSJA 1JUEA 1GT8A 3C0QA 3U0HA 4E38A 5I02A 2WCGA 1PTAA 3IIVA 4BY3A 2W66A 4JTAA 4O53A 1UJQA 1F74A 5I3JA 5CAHA 1D7FA 4FNPA 1O66A 2NT1A 2HXTA 1HW6A 2GK1B 3TONA 4HN4A 3EOSA 3PANA 4A21A 4DB7A 2OQYA 3R10A 4D6GA 1V6TA 2BGNE 4MG4A 3BANA 3SY8A 2CWXA 2ZUUA 1H4PA 1UQZA 2NX9A 3IK4A 3RYSA 1F76A 1LDCA 3T2OA 3PNUA 4HNCA 1IZJA 1BD0A 4LPCA 3QMSA 2OYMA 2V2DA 2V5KA 3VU2A 5C0QA 1OVDA 3HG2A 1H1NA 1UR3M 3HO8A 3F03K 3NM3A 3SAZA 4NVTA 1NDVA 1R5YA 5A8MA 4OE7A 3VFLA 3OO2A 3HFYA 4XD6A 3C3UA 1ZTVA 5CZSA 5E93A 4B92A 3GFYA 2NQLA 4FLOA 3HPAA 1FOBA 2B7QA 4P7RA 2YCEA 4XB3A 4Z0JA 4JY9A 4UCGA 3A4WA 2QQ6A 4PEKA 2GJXB 3QR1A 4UOZA 1DQWA 2XM2A 4LNCA 3M0JA 1M68A 4N9CA 4R53A 1P7TB 1I1WA 1CI1A 2Y0FA 3QRHA 3KS6A 2W92A 4GUIA 1XIMA 4EPEC 1VFOA 3W76A 3V5CA 1K70A 4MWAE 4ZOBA 2QDEA 1V6WA 1I9CB 1QXLA 4MAZA 4AWEA 5EMLA 1EOMA 1G4PA 1GOOA 1QK0A 2NX1A 1T0OA 4XAGA 3AICA 1O5XA 1W9PA 2WKJA 3LNPA 3SEPA 4A4AA 4E2BA 1GVIA 4BKNA 3ABZA 1FTXA 4B16A 1FDYA 2EKCA 1H11A 1OX5A 1EWDA 1HVQA 4NI3A 2QJHA 2WVVB 2QPSA 4AF0B 4HP5A 4IIGA 4NNAA 3PWAA 1NSJA 1KWKA 2PI6A 3QR3A 4WHBA 4KEMA 3WJWA 5BRQA 3T2PA 4GINA 3PJXA 4AD5A 1PWMA 3UQNA 2WNZA 3K4DA 3UF9A 4J9JA 5CQ1A 5M17A 3RU6A 3C86A 2VHLA 1ZCOA 4JFTA 4JIHA 3QLDA 2QS8A 3QZAA 5HAOA 4IIEA 4K2SA 4AB4A 4ORIA 1XLDA 3M0LA 2EPHA 2DUXA 3UT0A 3NDOA 4HMNA 1O60A 5A6LA 1VJZA 2G41A 2QVNA 4P8VA 3W7QA 1CGWA 2OEKA 4PCTA 4RLIA 1ZP3A 2PRHA 2MUCA 2W79A 3GWQA 5IRPA 1GKQA 3PWIA 1DQUA 2BHYA 3RIKA 4LSBA 1A5BA 2A2IA 1V0KA 2W6RA 1TWSA 2OMAA 3E74A 4UNKA 3M5XA 4EE9A 3R6IA 3P14A 3P60A 3MV01 2A7NA 1RCOB 1OIMA 5DY2A 1LQ2A 3UJ2A 4DZ5A 2VFFA 3ARUA 4QTGA 5AC5A 4LBUA 3GVGA 3KOWA 5KINA 5JBEA 2WLZA 4LUYA 2NWRA 4XZHA 2DDXA 3KP1A 4IIBA 4X63A 2NQZA 3ABRA 5D2TA 7PTDA 1LBLA 3KRBA 4FNQA 4QNWA 3UGRA 1E6SM 1A3XA 4WOQA 4BR1A 1H3GA 4A8IA 4X9YA 3WJYA 2Y62A 2Z25A 1PHQA 1Z41A 4AEFA 4H7VA 4IPNB 3GHUA 5C7VA 3PTDA 4FNTA 1GZ1A 2BS9A 1FCVA 1TTJA 4GX8A 4UZUA 3NQAA 2DSWA 3TROA 1XL9A 3PP7A 4FF5A 5EB8A 1O95A 4LRSA 2Y7EA 3EDEA 4RNIA 2DIJA 3MSRA 4PTXA 4Y9PA 3CT2A 1R6WA 1KTBA 2XGIA 4PFHA 3U57A 1ZBVA 1FA2A 2D23A 3QMTA 3W00A 1BG4A 1RLDA 1QOXA 4IGHA 2RH9A 1VFMA 3ZQ9A 2NV9A 3F2BA 1OF6A 4GKLA 3UR5A 1L6GA 3AIWA 4WRHA 2WJEA 3C4UA 5CCZA 1DHKA 4O0QA 5A6KA 4W88A 3THCA 1AD4A 4URIA 3DG6A 2VURA 5CZTA 4K8HA 2Z4GA 3MO4A 2BXYA 2A79A 1W1PA 4D6EA 1HL2A 1V8EA 5IDZA 3GY1A 4O0KA 4AD2A 2QGHA 2PUZA 4M7TA 1CZ1A 3UPMA 1JJKA 2WNNA 1BYDA 1MO0A 5E09A 3OGSA 2GLKA 3QJAA 3TLQA 5LHEA 2HBXA 4FAMA 3W2UA 3IJ6A 4YLWA 3FAWA 1Z44A 4QROA 3VKJA 5J04A 3T08A 2I5QA 2Y8VA 1CGXA 4HSOA 2ESCA 5A6SA 2PP1A 3TN3A 1WBJA 1DIDA 5ABGA 1YPFA 4NZ3A 1U30A 3M6DA 4H8UA 1NU5A 1OADA 4O0ZA 2NXGA 2C14A 2VEPA 1HKWA 3WL1A 2NZLA 3K2GA 2X7VA 5LIYX 3TE9A 4JTLA 2V82A 4EXAA 5XINA 1XBYA 5LIXX 4QDWA 4HCDA 1NWUA 2WC4A 4AIBA 1XSIA 1F3XA 4QSFA 1XCFA 1DXIA 4YTUA 4U2YA 3PG9A 3E12A 3EA3A 3LCFA 1XI3A 1T7LA 4QEEA 4XO7A 1XYZA 3OODA 3WF2A 3PPCA 1JDDA 5MKGA 2YGYA 5FACA 4I6KA 5EFFA 1DJXA 3OLEA 3PG8A 4WJ8A 5LGXA 3EWUA 3BTNA 1R3SA 1SQ7A 3ZSSA 1HKKA 4AFYA 3BV4A 4MADA 4DY1A 2E5CA 1Q6QA 1VRDA 2C13A 2X2GA 3KE0A 4HPJA 4W89A 3WK2A 1GHRA 4NZJA 4H7ZA 4EXBA 4DUOA 3TYCA 3T8LA 1M04A 1LLZA 1KXTA 3GDBA 3H70A 2HZGA 3VX1A 2V5JA 4HHLA 1UWQA 3E49A 5HQMA 1UKQA 1SU5A 3F4CA 3JW7A 3RITA 3M47A 2QJIA 4RPQA 2P50A 3CV1A 4J3TA 3LSCA 2CETA 2QYGA 1Q6FA 4PUUA 3H7RA 3LPGA 4C6JA 4QP0A 3WLRA 4AH7A 3IJ7A 3WH9A 3MCOA 3P93A 2Z1WA 3BAKA 1EPVA 4F4RA 3KBJA 1FKWA 5FEZA 3T0TA 3P82A 4Z42C 1OT2A 2BY2A 3AI0A 3HOJA 1AZ2A 1EA0A 3OHMB 4P8UA 5BWAA 1KFLA 1MDLA 3AISA 3C61A 3QZ6A 1NDZA 3OOQA 4XBKA 3LI0A 1PTDA 3F7JA 1DWIM 3VMOA 5HR6A 1G5AA 4D9PA 3RN6A 1MQRA 1V4YA 1TELA 1XG4A 1C92A 1MNZA 4NX5A 4L80A 1B3ZA 4PMNA 3A13A 1ZJIA 2REQA 4MYAA 2QCLA 3VGFA 4IMEA 1VQTA 1RCQA 4ATDA 1MQPA 4XKMA 2WC7A 3PUOA 4RR4A 3TSMA 4UTTA 1US3A 3AYRA 3F5LA 4HSNA 1A53A 4OV9A 5HA7A 2QJNA 1JZ8A 1HGYA 5M5DA 3AXHA 5CC5A 6ENLA 1E6ZA 4YTTA 3UZXA 4AZBA 2BFGA 4DO7A 1G1YA 4DX3A 2CZEA 4W93A 1NWTA 5AVNA 2PDQA 1J0ZA 1L2UA 1VFFA 2HS6A 2HJPA 3NXLA 3OVQA 1Q7ZA 3VOGA 4DF0A 2DEPA 7REQA 3LHWA 3M41A 4LNYA 5DN1A 4FB7A 1UQYA 4IGNA 4Q8VA 4PUJA 3OQ8A 3DI0A 1JDFA 2WMFA 5EBAA 1MUCA 2X1IA 3BOXA 4MFEA 2I16A 1VB9A 2J78A 1OWQA 2DZBA 2Y8KA 3UWZA 4PULA 4EOUA 1PJ9A 5FKYA 2BBFA 3LA4A 3NWRA 3VCRA 4ZQCA 3AMGA 4WSJA 2VC9A 3T42A 3P6LA 3W27A 3H2FA 1B3YA 3BAWA 2FHFA 3ZZ1A 3KW3A 1H0GA 1GG0A 4S2BA 5F2IA 3HQOA 3WH5A 1ZUAX 3P80A 2YCJA 3BJFA 3WUFA 3RR1A 3PHAA 5E6ZA 4OV4A 1HGWA 3DCPA 3B06A 4YVPA 4IXXA 3GIYA 2J4GA 2VJXA 2GL5A 4LAMA 4BF9A 2PDFA 3SCTA 3N6QA 2H8XA 1V3LA 4A2RA 4C6PA 4A29A 4HNVA 2V69A 1U2YA 1ISWA 5D09A 3TOYA 4OWGA 1XF0A 2PCQA 2E8ZA 3R8RA 3WDRA 1IXPA 1OT1A 3D5HA 3R2GA 2BDQA 4V28A 1OFDA 3ITXA 1TKKA 4MVAA 2FQIA 4JN8A 4PFMA 4GA8A 1DTNA 3OBEA 3T09A 5C5YA 5E70A 1ZJBA 1K77A 3FN9A 3NQDA 4PUWA 5G2HA 2I7GA 2DJLA 1ZS2A 2VEFA 2QXWA 3RK8A 4NILA 2H3BA 2ISWA 3BVJA 3IUIA 1VPXA 3B0XA 1EIBA 3B0UX 1SM9A 3CGTA 3EOUA 1XGEA 4DXXA 1FFRA 1TZZA 2PDGA 1JIBA 3W7EA 1TJ1A 4DHGA 3TN5A 1FFQA 3VCCA 3NCOA 4MGGA 2Z24A 1I0DA 4GUGA 1WAWA 2YXOA 3EX3A 4C6KA 1W56A 2V30A 1JFXA 3PPHA 4C6IA 3LX9A 3KVJA 4DF1A 2ALRA 2WK2A 3UGVA 1TB3A 2FTWA 2A6LA 1XQKA 3A5FA 3LQLA 1XRTA 2Z7GA 2JFEX 1YDYA 4R27A 4WX2A 3W7HA 2VZUA 3FA5A 4UTKA 3PBWA 2Y70A 3LPPA 3VDAA 3NQ2A 3JZEA 3PTQA 1W5PA 2FDSA 1ME7A 1ADDA 1O1ZA 5ECUA 4BFAA 3H7UA 3IGUA 2PURA 3G24A 3OLDA 4FS9A 4L65A 2VP8A 4UTFA 1DJNA 4ML9A 3Q2DA 3W53A 1K1DA 3UFYA 4UMAA 1TUXA 2WZMA 1QDSA 1T6MA 4GQRA 3FY1A 4DXKA 3IRSA 1RQBA 1EDTA 1XKJA 4NY2A 3W3OA 5EKYA 1JFHA 1XIHA 2IXVA 3C2YA 3IIPA 2NSXA 1WZMA 1JXJA 1MI3A 3S42A 3EX4A 2FJUB 2OOGA 5I24A 1SSDA 3EPNA 3SB0A 3CQJA 2CZ5A 2A3EA 3UJEA 4OOZA 1K9TA 1GPWA 1KM5A 2XH4A 2FTYA 3ES7A 4EP8C 1JI1A 1IWBA 3BLLA 3V3WA 5A95A 3EA2A 2ZUTA 4TUFA 4IMCA 2RKXA 3N13A 1TE6A 1HJUA 2BHZA 1PB0A 1V7YA 4X22A 4KFPA 5HATA 3PZNA 5FCZA 3IGHX 1XH1A 3AMKA 4Q3MA 1A0EA 1OFOA 2WSRA 2WW5A 1ONRA 1TVPA 2YXXA 3TYEA 5HNRA 1AW5A 4H9YA 4IP5A 4XIAA 4HPXA 2BOGX 1MRQA 3G1FA 3W2JA 1P43A 3TTOA 3S5OA 3NQBA 4LALA 1V3IA 2WZTA 3RG6A 3PM6A 4LX4A 1NF0A 1H50A 3APYA 1DPMA 1FCQA 3OG2A 5D37A 3APGA 1MXSA 1QJWA 3NZ1A 4HA4A 3HB9A 3O16A 3B8SA 2HNHA 3TZFA 4DN1A 4FOKA 2JALA 2FLIA 3GNPA 3KAOA 3WLKX 2DU2A 2UWFA 4AW7A 4A3RA 4AY8A 4ZEPA 3MMWA 5B80A 3Q58A 4QLLA 2PB1A 5CC7A 2PWVA 1NJJA 3QH2A 3ANUA 4PL1A 5CKSA 3GXMA 3MP5A 3WD3A 1E3ZA 3M16A 3WELA 3S4TA 2I56A 3WN6A 2CESA 5D9OA 4RCXA 3FNDA 2Y24A 2BHUA 1W1TA 1XLAA 2RAGA 2AMXA 2WVSA 1HX0A 1UR9A 2GSEA 1GVQA 4TU1A 1KTNA 3FSTA 1YTDA 3S2CA 3NZQA 4RNJA 4KS0A 3W1MA 3ZJ8A 4AWTA 4PMUA 5CJNA 1UR8A 3LY0A 4PUNA 2PDUA 3H2MA 3SGGA 3MUAA 3TC6A 3GBDA 3ARZA 3P8JA 3S1XA 4AVFA 2P8CA 4CD6A 2FDMA 1CX9A 2FZ8A 2CZVA 2PCEA 3MHUA 5AC6A 4BQ5A 1LLWA 3MMDA 3QM3A 3HV9A 3IJLA 3FV9A 1UP2A 2FPYA 1UMLA 3L4YA 2BLEA 5BOOA 3GAYA 3G8RA 4TX8A 1IE7C 4AHOA 1VBGA 4OBRA 2D2JA 2VWTA 3OVGA 2UZ9A 3L67A 5E0FA 1WDWA 1K8CA 3W01A 1E0UA 4JFVA 4MKVA 4EXQA 3WBAA 4DO6A 5FA5A 3KL3A 1CLXA 4KQNA 2NQ5A 4JX5A 3ZLFA 1Y5XA 1XLMA 1S39A 2EQDA 3H8AA 4V27A 3TCSA 2VGIA 3ARRA 2ZZ2A 3CL6A 5HPOA 2D0FA 1Z6KA 1M7XA 4FLQA 1R8LA 4NI8A 2WSYA 2H3DA 4RDVA 3BARA 3BLDA 1Y65A 4L6DA 2FJKA 1VYSX 5DMMA 2GWGA 4UR9A 1HNYA 2DZWA 1N8IA 4JY8A 3SUUA 1NH6A 5C70A 4WCJA 1IQ8A 3G1YA 3UR7A 3VOFA 3U8GA 3R79A 1E9IA 1S2UA 3AS3A 3W24A 4DYEA 3EOOA 3B9OA 2ZE3A 4IG2B 1NOFA 3GS6A 2X40A 5DANA 4JNYA 1TV2A 4GY1A 1WB0A 2VEMA 3W7CA 1BXBA 3EB2A 5FOOA 4L64A 4PMVA 4DBEA 1FRBA 4OOUA 4RXFA 5D9MA 1YXYA 3EGJA 3S1UA 3GG1A 2E40A 3JR2A 2ZQ0A 1NQKA 3CASA 1LT7A 1UKTA 1QO2A 1JPKA 5DBUA 4DAIA 3V1PA 3S2LA 4UQDA 1M41A 3E2SA 3TWAA 1GVFA 3HF3A 3TU9A 4KWOA 4N4PA 5BYWA 1IEVA 4I9JA 1XLJA 4BWLC 1QNVA 3OZMA 1ME9A 1BVZA 1XKYA 2BVWA 1W37A 1WOBA 5REQB 2VQUA 1YXDA 6A3HA 6REQB 1EP2A 4LBRA 5BCAA 2J7EA 1TX0A 5LA2A 4AX6A 1FH9A 4B5TA 2PTZA 4KFOA 4WLCA 2CBVA 4MNMA 3WNMA 2ACQA 4M5PA 1Q6GA 3HGJA 4GXPA 1GQKA 3GYEA 4MZYA 1LCOA 3FS2A 3W9ZA 3FEMA 3LK6A 5M3WA 4U28A 3P5YA 4C90A 1UUOA 5DLCA 1ECQA 1HXJA 3IVUA 4MY9A 4H41A 1CYGA 1TYGA 5AHLA 3B0YA 3S9IA 1JD7A 4PMXA 4E8DA 2B31A 4S2CA 2QDHA 1TTQA 1TRIA 3MANA 1HJVA 4QISA 3QYSA 3CHEA 5D05A 1JCJA 3DYMA 2D24A 3PFRA 2JF6A 2YDRA 3C56A 4JTTA 1VHCA 1H1ZA 1XIDA 1D3GA 3NDYA 1G4EA 4U2ZA 3VE7A 4Q4KA 3R11A 4G1KA 4JOMA 3CL7A 3NXFA 2QJMA 4CQBA 3WQOA 2X09A 4LQ1A 1AQMA 3FHQA 2CYGA 1G0CA 3PZMA 4ICMA 3G2GA 2O92A 4D6CA 1SYTA 3F2DA 3W1TA 4AMAA 4DUWA 4HK6A 4PSRA 4X0VA 4D1IA 4R3UA 4IP4A 3AYVA 1OC6A 1XSKA 4ZFMA 2ATMA 2YKKA 3GH7A 4E6MA 2WCAA 3HQPA 4NT0A 2XH0A 3EWZA 3WQCA 3R8HA 3JVAA 4C6DA 3APTA 4N6FA 3NTYA 3MVTA 3LBOA 4FZIA 1K7FA 3VDCA 4JDYA 3GNRA 3V0TA 2F9RA 4LY4A 3VE9A 4XZMX 4PMDA 1KRMA 4EPKA 4MJ2A 3WK1A 5AYXA 3K8LA 5BMWA 4MJMA 3FKKA 1R3YA 4MY1A 1Z3NA 2PFHA 1SZGA 5D30A 3DHDA 1LQ0A 1W9BM 4IXHA 4XO6A 3SGZA 4FO4A 4PMOA 3FAXA 3JS3A 3W73A 4UTIA 4RNFA 4KWSA 1OG0A 3C8FA 3WF3A 2PGRA 5I03A 1BYAA 1MEIA 1PKLA 4NJHA 1VPQA 3U5YA 3PC0A 2X7WA 5CEWA 1XLKA 1G6CA 2VD8A 1ZP4A 4ZOAA 3HBLA 3UZZA 3WBXA 4S3CA 3WFZA 1M01A 1WP6A 1XS2A 2G50A 4LFYA 1U33A 2ZX9A 2ZX6A 5DEZA 4PE8A 1UD5A 5I79A 2F2KA 1HJWA 3QXBA 1U5JA 4I9AA 3UXAA 1WKYA 4N7QA 3WFLA 2QPUA 5CPLA 3NNTA 3DIPA 4C6FA 5LSMA 1W31A 1RAKA 2PGFA 1PX4A 3F4WA 1M7OA 1Y8BA 3GVRA 3F5JA 2WM1A 3E02A 1QWKA 2W61A 2HRWA 3W26A 1JULA 1LORA 3ABSA 4CNTA 1JZ4A 4ZA0A 3ME3A 4DO4A 4KIEA 3T81A 4G7FA 1A3WA 3AIRA 2AOSA 4O54A 5JMUA 2WMHA 4MLRA 2W9MA 1JF5A 1A5UA 1O5KA 2VZTA 4GY7A 3ZO9A 2PU0A 1M1BA 2O7QA 4H83A 1Z42A 2V8ZA 2WVTA 1J96A 1XYCA 3U2EA 2C1GA 1W5OA 4JGDA 4L6OA 2XIOA 2QT3A 3TYAA 2H9AB 2QVHA 4GO8A 4CD5A 4LYQA 1UR4A 1E0TA 3DZ1A 2HWGA 3KDOA 3USZA 4XUYA 4GCXA 3N29A 1LT8A 4LCRA 2DGAA 2PWGA 3SN0A 2YLLA 3GVQA 1TR9A 4J2PA 1DJIA 1XR2A 1EDQA 4GG9A 4B15A 2XTKA 4L9YA 3O63A 1UR1A 4H9MA 3MW7A 2ZRXA 4RDWA 4D71A 1WKEA 4FPSA 2Z1KA 3KEHA 2GGEA 4JZ5A 3ONCA 4RE0A 1SMAA 3MCNA 3CQIA 4BJHA 1PYFA 4J3WA 1JG9A 4I3GA 1K8YA 1ITXA 2CLKA 4UNIA 1QW9A 4QE4A 3W81A 2PD9A 4LV4A 4ICCX 1FHVA 1OCJA 1H49A 2FZDA 2PWHA 4JR5A 3DBPA 1HN1A 3EXRA 4F0HA 2NVDA 1FWDC 1PPIA 4TIMA 3SQMA 2POZA 3CQ0A 3ID7A 1J0KA 2Z29A 2PGWA 3QGKC 2OKTA 3P8IA 4QFUA 2A21A 2GDVA 3CH0A 3HM7A 2ZDSA 3HMCA 4US5D 1W3TA 3RM9A 3BJTA 3THUA 4ZQPA 4O1FA 2QCGA 4U5KA 1W3IA 4A3HA 4XZWA 4JX6A 1ELSA 3WH6A 2IW0A 1KV8A 4B5NA 5JH1A 2WWCA 4CQ8A 3GK0A 4AZIA 1PCWA 4YL2A 1K8XA 3VD5A 3CO8A 3N2XA 2OELA 4RZBA 3OZOA 4PUKA 1KGUA 3GXIA 3TLLA 2DZVA 4GNVA 1EPXA 2DVXA 3WNPA 3U48A 1UH4A 3VINA 2V38A 3UVAA 3FA3A 1POKA 3O6YX 4QGCA 4MNKA 3COTA 3GU1A 2DORA 1VFUA 1F6KA 1WOAA 2WLYA 4B5WA 2HPMA 1KRAC 1V03A 3XINA 1Q5MA 2XWEA 1RVKA 4P8XA 2BMBA 5CGTA 2QV5A 3AROA 4UZSA 4FX8A 2ZYFA 2VEGA 1DHPA 1SZEA 1EL3A 3CU2A 1LRNA 1SPQA 2YL5A 4EACA 4M7SA 2D73A 5HWMA 1XLHA 5LIUX 2PDYA 3I3EA 1W6TA 4AMCA 2Z1BA 4GH1A 3AUJA 5M1TA 2VR5A 4WJXA 1JUKA 1CXEA 3ARSA 1ZZMA 5BROA 1SR0A 2J6XA 1JYNA 1GOIA 2DQXA 4C6EA 5G2IA 2QULA 1KTCA 4QCEA 3PUDA 1WKDA 3TAKA 5A6JA 3FOKA 1VYRA 3B4UA 3LMZA 3MP4A 3QV8A 2FTPA 1X1NA 2D2HA 3T4WA 3IUDA 3S0CA 2MNRA 2CLIA 3W2KA 2O9RA 1E6PA 1XRVA 1VPYA 2A5HA 3CUZA 4KGLA 2VX5A 3DYOA 3KRSA 3KS5A 3TP4A 1DBTA 1L6SA 4RUBA 1TREA 1UWIA 2I1OA 1W2VA 2D69A 1RUSA 3B97A 5DMLA 3SRFA 1TCMA 2AKZA 3TFCA 3PZTA 3MKCA 1UZHA 4Y96A 4YTQA 1PZ0A 3ATYA 1K7XA 1GW9A 2F38A 3GXPA 1XDMA 1YIXA 1AL8A 4V15A 1E3XA 3AMCA 3LZ5A 4YHGA 2EO7A 3CIWA 2VC5A 5DXXA 3BLPX 4PCNA 3B0PA 1N7KA 4CEXC 2XHYA 3STFA 1UUMA 1SZNA 3ZIZA 4AVOA 2PWUA 1D7KA 1GW1A 4EPBC 3TTQA 4K36A 4ZQOA 1W54A 1R9YA 1MFUA 2ASHA 1KLZA 1XIIA 2IKIA 4JFSA 3UG3A 1R86A 2WKLA 4HNUA 2P5NA 4GUFA 4ASTA 4BWLA 3UZJA 1W0MA 3U5UA 1IT0A 1AMKA 4B2DD 5LNVA 7A3HA 1C29A 1POJA 2V3EA 2OX4A 4JHOA 5MKGB 2QDDA 1O5QA 1YTKA 1XJBA 1YE4A 2NV1A 4DBWA 4L9XA 1YDOA 4GJJA 3BSGA 1R3WA 5H91A 1E5JA 1TPH1 1U1JA 4JXCA 1TZ9A 4AD3A 4ZE5A 1F05A 3BAXA 1GWJA 4LEQA 5G2WA 2HDJA 3PJWA 1NVMA 4E3TA 2DH3A 5A6AA 4ZQMA 3RDKA 3BW2A 3DKLA 1Z7AA 2GOUA 4GJIA 4TVCA 2GSJA 4E0CA 1C9WA 5HINA 1KFKA 2WZHA 4S3EA 5BMXA 1GZGA 2EBNA 9RUBA 2XWDA 4YWSA 1QPQA 4B3ZA 5H8UA 1KCXA 3A4XA 4GUJA 3E1F1 3UW6A 5DRCA 3RPDA 2OT0A 3CV2A 3O1NA 2DP3A 1VKFA 4B5XA 1E40A 1PV8A 1SFTA 1KM3A 4HJFA 4CVUA 3HTWA 8CGTA 3J7HA 5MF5A 4NAEA 5ABTA 1R0MA 1J10A 1C93A 5JUVA 3H2EA 1PDYA 3WBEA 2RDWA 3G18A 1Y0EA 3GDRA 3WLHA 4PB5A 1TQJA 2REQB 4GE8A 2Y89A 3V18A 4PBEA 2QCFA 5I5RA 4GY0A 2C18A 3CB8A 1ISYA 1XIGA 1YE6A 1F5ZA 4Z2LA 1E4IA 1P1MA 5AHNA 3FDKA 4ZB5A 1MFVA 4HNNA 2VNCA 3RMJA 1KM4A 4Q6JA 3IJIA 3H21A 3KL5A 2FFCA 5DFAA 1W3NA 4WGHA 4XWUA 3ICJA 4I7UA 3W82A 3BMXA 3O7UA 1PDZA 4ROQA 2OSXA 2P76A 3MHFA 2PTDA 3CEPA 4JTJA 1V3HA 1J12A 5F1UA 1Z89A 1ESWA 1UROA 4ADSA 3ZJ7A 4HVXA 3VX0A 3ISIX 3W70A 1AK5A 5EL1A 7REQB 4JFWA 3ITCA 1ZCCA 3UZ5A 1TA3A 2Y7DA 3P67A 3CZJA 4JQ3A 2W5FA 1FDZA 3H23A 5FAJA 4MZ1A 2D2OA 3SCNA 1XD0A 1JZ3A 2J79A 4AIEA 4MTVA 1DE6A 1PS9A 3LLXA 1FWWA 5DMYA 4ZB0A 2NX3A 3FGCA 3UESA 4LW7A 3H2CA 5M03A 1I2NA 4TOQA 1BTCA 1QPOA 1VAHA 3TXVA 3TZNA 3SCWA 4O52A 4ZTXA 2DZUA 1Q8JA 4K37A 2ZC1A 1JAKA 2PDHA 1IZCA 2PEVA 1A5LC 3LNMA 2E28A 5I3DA 1OFBA 2ZX5A 3S6DA 1K8ZA 1IF2A 4LVDA 4ATWA 1FWEC 3VNLA 4GVIA 1LF1A 1UH2A 3IAQA 4RE3A 1KO0A 5I6SA 4IQDA 5M2FX 1E70M 1E9LA 4C7DA 4EK7A 5C9RA 1V08A 1J8VA 1Z8AA 2PZNA 3DOPA 3QHNA 3GFZA 4Y8FA 3FA4A 5T9BG 4UC5A 1PYMA 2OODA 1UOKA 2XIQA 4X2RA 3QFEA 3WLSA 1OHLA 4LY8A 3MUXA 4C5YA 3NVTA 3TEVA 5A3HA 4JTCA 4M19A 4GBDA 3O0KA 2Q3OA 1EYEA 1HG3A 1MDRA 4OUIA 1RVGA 3DC8A 2E8YA 2NQ9A 1D3HA 3WX7A 3AXXA 3B8UA 2UY4A 3AMDA 4Q8OA 4O8AA 1MZHA 1JQXA 3FHAA 2G3JA 2EPLX 1GGOA 1ICPA 1UD8A 3GC4A 3CWOX 3CUFA 4PRWA 5HANA 2Y7GA 3FEQA 4BI7A 3WEMA 3SI9A 3REQA 5L9FA 1OD0A 1LL7A 1PAMA 2DVUA 4JHMA 3EXTA 3V75A 3EB4A 2ONEA 5A8NA 3LBCA 3M0IA 4IMDA 1EC8A 3CH9A 4WGXA 2JK2A 1CCWB 5JVLA 4HU0A 3VNMA 2E6YA 4KRUA 3D46A 3N3TA 2BODX 3IJ9A 4JTKA 2NSOA 4HHPA 1XUUA 2QAFA 5K9XA 4GYKA 1NFGA 4O13A 1MRAA 4DUVA 3SJ3A 3EOLA 3OA5A 1TE1A 2YL9A 4QJ5B 5C9XA 4BF7A 1GOWA 2PWEA 4US5A 4D6JA 1FUYA 1UWUA 4WY0A 1BRLB 4GIEA 4E4FA 3ANYA 1K4GA 1OFRA 3BAIA 3LZ3A 3P0WA 2BVTA 3G6MA 4NXKA 2CLMA 5JBDA 3TTSA 2XINA 1G7VA 3NFUA 2G96A 4JS3A 3U4AA 1SGJA 3W2MA 4KWWA 2DZXA 3DXIA 2Q8ZA 3N04A 3LSBA 2VELA 3EXSA 2VGBA 2FZ9A 4KT2A 1CW2A 3AIVA 2GGJA 4Q4MA 2QKFA 4QRNA 3W1NA 3A5VA 2CKSA 1UW9A 3HPZA 3UR8A 3AHZA 4MPKA 3VKBA 4IJBA 1A5KC 3K4WA 3NEHA 1XRSA 2DT0A 5FF0A 1KRCC 3UYCA 3LRLA 1RK6A 3QKEA 1F3EA 4YMZA 3LXAA 4MMWA 1CB7B 5C8BB 1EUNA 4FI4A 4CN1A 3MT1A 3SSJA 4UFHA 4MYXA 5F4XA 3SGUA 1YEYA 1XDLA 2Y6ZA 1A5SA 4MFDA 3ZXWA 2ZWZA 3T0BA 2VUYA 2Y85A 1XLIA 1S2WA 3P74A 2NT0A 4JCLA 5CC6A 4AZCB 3KRUA 1UD4A 1E0VA 4TTGA 2NWSA 2GVGA 2ZZ3A 4O1CA 1FWSA 3CIXA 4NSBA 3TR9A 3GUWA 3TR2A 2CC0A 2PDIA 3VGDA 3FVMA 2WPGA 1T40A 2I57A 3VTRA 4DUXA 3ITGA 1K9DA 5A6TC 3BW4A 3SCRA 3W7GA 1W3LA 1JD9A 1N55A 4OFCA 4Q8MA 3TJ4A 3GR8A 1W1IE 4H9TA 1PZ3A 4ZO9A 3I6RA 1K7EA 3D47A 3M0KA 5DO8A 4R7WA 4AHPA 5D2XA 4HD5A 4BZYA 4F3HA 3VOCA 3VKKA 4LTSA 2V5DA 2EF9A 3QOMA 3BAYA 4L4PA 1E72M 2Q02A 4UWMA 4PUDA 4KESA 1EO5A 2GDQA 3VOHA 3LHYA 3RO8A 1ONXA 3WLQA 3TQPA 2E09A 1LM1A 3WO8A 3FDGA 1PL9A 2QNEA 2PTYA 1FBAA 5PTDA 3NEVA 1ZAIA 4YWIA 3ZT5A 4JIIX 1R47A 1QNOA 5I0DA 3H12A 2ISDA 2BGSA 5EMYA 3GG8A 2KZHA 1YBQA 3U7BA 4XZ9A 4FEZA 3II1A 3IVSA 3R58A 4GI6A 4LS2A 1NARA 5CXPA 4U33A 3FCPA 4GZ7A 5HQLA 4Y9NA 3UWYA 3A3XA 1S5WA 3R1ZA 3TW6A 2BGQA 1EX1A 4CU8A 5DMNA 2ZIDA 3WD0A 3QHMA 1SSGA 5E0KA 3A22A 1E4MM 1XYBA 4YTSA 3GH4A 1EYWA 5DXYA 2F6KA 3A47A 3HPSA 1EXBA 1LP6A 1QNQA 2O55A 3LN3A 4F9DA 3S9ZA 1AW1A 3MUZ1 4F0SA 6CGTA 3WQ8A 4MNJA 1IXNA 1XYFA 3LMYA 4H8NA 2G0WA 1HO1A 4ZO8A 1XBXA 3KBVA 3UNTA 4YVVA 2D3LA 2ZA2A 1SMDA 3K8KA 1E71M 4L1XA 4UCFA 4XISA 1E6RA 4JTHA 3HJZA 1MNSA 3NQ6A 1B0IA 4LUTA 5I06A 2Z26A 4G9PA 3PNZA 5HNTA 1M65A 3QQWA 5DBTA 3DH7A 3E3HA 4N9DA 5EBUA 2E6FA 1W17A 1OK4A 3F5KA 1HFBA 2ZZ7A 4Y6GA 3A9BA 2A4AA 4H1ZA 2NXHA 2FZBA 3CPRA 1NFBA 3CUXA 3QLLA 1UKPA 3PZUA 2V5CA 2C8NA 3LCHA 2J47A 5TAOA 3I7RA 4Q7IA 1WDDA 5AZ0A 1KFWA 5BXRA 1GYNA 2CW6A 4RDYA 3N4AA 3U7VA 2IQ0A 1IWPA 2WJFA 3TTYA 4C1NA 4D6IA 4YS1A 5AYBA 1ENUA 4F9JA 4XK2A 4PTWA 3UWEA 1B31A 2JKEA 4FX6M 3TA6A 4AYSA 2ZXQA 2VX7A 1S5NA 1SFLA 1DJZA 1MUWA 3BOFA 1RJPA 3RU8X 3RPTA 3C2FA 2B7NA 1B4EA 3CAQA 3WLNA 2GQAA 1UR2A 4ONVA 3DAQA 3DERA 4LC6A 1PEZA 2XPKA 3HIJA 3SUTA 5U4NA 3KDNA 3B8VA 2OQHA 2X1SA 3VO0A 1DE5A 1S2TA 2HCVA 2J25A 3ERPA 4GD0A 1IHIA 1N82A 4NU7A 2C71A 1MVYA 2ZWYA 1J01A 3AHVA 3V4BA 1QBAA 2GDUA 1VCGA 4M6QA 2CLOA 2ACRA 2XIBA 1VZWA 3P3BA 4DBUA 4UB9A 2Z2BA 3U4FA 2HNEA 1WUFA 4HIBA 3UWUA 1WE5A 3QEZA 3CQKA 2VFGA 4DPPA 3T05A 4PMYA 4H4IA 4QDPA 3FYPA 1LJYA 4K8GA 5JXQA 1WXJA 1FP8A 3L68A 3B8DA 2HK0A 2VRKA 3AWNA 2BWGA 1V3KA 5FI8A 4LYPA 7ODCA 1N8FA 1UCWA 1VEMA 3F2CA 3WD1A 3KWXA 1FWGC 1PKMA 2ON3A 5G1MA 1O4UA 1XRFA 4PN2A 3N1AA 4PCPA 3W7MA 2INFA 3MI3A 1F4HA 3DENA 5FJUA 3LRMA 1JPIA 3NDZA 3KZPA 2RHGA 3RCNA 3GR4A 2CITA 2RFGA 1GJPA 2GGGA 4PMZA 1DWGM 2QCEA 1ODUA 2AAMA 3VILA 3LCLA 3GHSA 4XKYA 4UMCA 1JCNA 1WNOA 4R88A 1X39A 3ITTA 4MSSA 4Z1CA 5TF0A 3W85A 2P3ZA 4ATLA 2WC3A 1TMQA 1G7UA 1Q63A 3AC0A 5D38A 4N42A 3C2VA 5IHRA 5G4HC 1K6AA 2ISSA 1KV5A 1KXVA 4WKHA 4D8ZA 2A1YA 4O16A 4WDTA 4MB5A 3BWWA 1X7FA 3KOXA 5E9AA 3ZJ6A 2W91A 2FZNA 2I5IA 8A3HA 1SO5A 2POTA 3K13A 4LAUA 1J5SA 3MU7A 4FLSA 1QPRA 3W1AA 1V3JA 1MEHA 2WJZA 3L5MA 3O0FA 5HOSA 3E2VA 2Z6JA 1AG1O 1XXXA 2GOKA 2ZC8A 3H26A 1S2CA 1E9YB 5KZ6A 1NTHA 4R7OA 1IGWA 4Q8QA 1VFHA 4KCTA 2VVSA 4A6GA 4L4MA 3UY7A 4NJIA 1R38A 1GNXA 1AQFA 1B9ZA 1A4MA 1W1VA 3N2MA 2V63A 3B8TA 2FZMA 3XISA 3F4NA 1X8CA 3M9YA 4GC4A 4QM1A 3QY6A 5BXTA 1R3TA 2HXUA 3MYPA 4I7WA 4W87A 3C0JA 4GZJA 4TVDA 2C91A 2OKOA 3BGJA 3E0IA 1HTIA 1ODZA 4ICNA 1E56A 4RPPA 4IP7A 2JGYA 2YOCA 3PB0A 1T5AA 2FPTA 1D8CA 3OZYA 4J4KA 1QI5A 2DY3A 2X05A 4XSLA 3PZIA 4O4WA 4UIOA 5D2VA 3BZJA 2VR4A 1LL6A 3IEBA 1BTMA 1FCBA 3OA3A 1XIEA 4QLKA 5I07A 1RSCA 2I9UA 4CNSA 1DEDA 4QNEA 3VD9A 1A0DA 3KOYA 4NYYA 1GJUA 2YA0A 3KHJA 3KUMA 3G1AA 1PTGA 3BGAA 1J6PA 3S2NA 4K7VA 1HKIA 2A3BA 2IPJA 3WBWA 2ISVA 4XAZA 2ZKMX 4M81A 3G1VA 3T0CA 3AS1A 5EGRA 2I5GA 3ZVIA 1JQVA 4IUOA 1GPFA 4PSPA 3E9AA 1UIOA 1BKHA 1H63A 8XIMA 3Q45A 1TV7A 3BURA 4Q7NA 3SECA 4BEUA 4XAFA 3AJ7A 3N34A 4UTTC 3I10A 4MY8A 2BSLA 1GQJA 3BCFA 1JZ6A 3PK7A 1JCYA 1QR7A 4WQ6A 4A3UA 4EVZA 4LANA 2CERA 1LRTA 5I23A 3CMFA 1LTDA 3W75A 4W4QA 3KTCA 1TPC1 3QQ1A 3MKKA 2V67A 4UTUA 1JI2A 1IIGA 5AHEA 4BQ3A 1AW2A 1VJIA 1UJPA 3DHUA 3A6OA 3SW6A 1WYIA 3PUGA 4S3DA 3QN3A 3HQNA 4CCEA 1UPMB 4V1XA 4MWAA 3UD6A 3L0KA 4WSHA 3PJUA 4JPGA 4GQ0A 4EKJA 4IH3A 5LNWA 3MHGA 1AD1A 1J0YA 4QJ4B 3QSRA 1H5YA 3LGGA 2G8ZA 2P1FA 1XLGA 1ZJAA 1TIMA 3S2MA 3EKLA 1SZFA 1XICA 3SFKA 1E6NA 3JU2A 3A24A 4FP1A 3E5PA 5HJXA 5G5IA 2GSHA 3QYQA 3TTEA 3CAVA 3S3GA 4O4VA 4B9ZA 3WBYA 4JHZA 1QHZA 1B57A 4N9EA 1XLBA 3WNKA 1KFJA 1E43A 3V0UA 4HTBA 4G56A 1DJYA 3OIXA 1QU4A 3UZWA 4TMBA 1W3HA 3W71A 1OIFA 2ZOXA 3HPXA 3Q67A 1AUSL 4PH6A 4CGTA 1RY0A 1B3WA 1OC7A 2HV5A 4JEQA 1RZMA 4LAKA 2LLEA 4HMEA 4L5ZA 3V16A 1P1XA 4J7RA 3B4YA 4GFSA 1QI3A 1V79A 1Q7QA 1F9CA 3BLEA 3ENLA 3GIPA 3S1WA 4XAYA 2BNJA 4ZQNA 3FSUA 2QF8A 4Y90A 4ZTYA 2ZXAA 5AYYA 1FWTA 1SR9A 3G3DA 1ZL1A 2D0HA 3L23A 4C6MA 1F6PA 3L0GA 1TVNA 4L6HA 1XP3A 3B04A 3TYZA 4RW3A 4H9ZA 3VKAA 3GR7A 2JE8A 4RKAA 1OZQA 2V3GA 1P6BA 1IT7A 1MXGA 2VDIA 5LIWX 4HOWA 2OCZA 4IQLA 3ZLGA 2Y2WA 4B91A 2ZDRA 3PFMA 3CYJA 5LNRA 4GXMA 1J11A 4IFKA 1HF6A 1VIWA 2XVLA 1OFQA 1UC5A 3KVMA 1UB3A 4MZ8A 3MI2A 1WZKA 4AC1X 2EAWA 4FF7A 5C2GA 1NP0A 5AZ1A 1E0XA 1EA9C 3EWCA 4QJ3B 5CSRA 5I3FA 1KQYA 4JNMA 1E6XM 4F0MA 3N17A 4GI9A 4PMRA 1RR2A 5AC4A 3AJXA 5HJYA 1RH9A 3OP2A 5IHSA 2QUTA 4DI8A 4RE4A 4KF1A 3HA1A 3T44A 4IISA 4ZOEA 2JGQA 3B40A 1Q6DA 5JU6A 4CNPA 3EWBX 4TVUA 1B30A 1OINA 2GGIA 3R25A 4YYCA 4F8XA 1VJSA 1F3TA 1YW1A 1IEQA 3BAJA 1SW3A 2ZZ1A 5BXSA 3VXGA 1UD2A 2O9TA 4DO5A 4JAWA 1AJ0A 1I60A 5AVHA 1CECA 4UFMA 4JTDA 2JEQA 4E4PA 1R2RA 3E0WA 1C7TA 1VC4A 2Z27A 1DOSA 2JKPA 4O14A 4AISA 5F7UA 4OVXA 1H61A 2AQVA 3LCWA 3UEQA 3RX2A 5FSDC 1P0NA 2FPVA 4U3AA 4BF5A 3GDKA 3KCJA 3CZEA 2EPNA 1KRBC 1MW3A 4C6NA 4RV8A 4HZ8A 4JTGA 3EX2A 9CGTA 1EP3A 3W1QA 3UXIA 2ZCGA 1C8YA 3VOIA 2QPXA 4JYEA 2R1KA 1WQ5A 4Q4OA 1GVSA 4F79A 1V7AA 2C0HA 2WAGA 3UNDA 2QUMA 2PF8A 4I5XA 3NGJA 3G0XA 4Y7EA 2Q71A 3GNNA 4PB3A 4GQBA 3UPBA 2O9OA 1GORA 4POCA 5E5CA 4Y2WA 4C60A 4ROPA 5A6MA 2NUWA 3SM0A 1VYPX 4F40A 3WLPA 3R5EA 1LBMA 5HNNA 1DJWA 2WKGA 4WKFA 2VXNA 4PC8A 5FJIA 2ZICA 3E0LA 4PZVA 4WKAA 2V6AA 2JIWA 2OXNA 1QHPA 3RRXA 4BHYA 1S3TC 2PODA 2XGBA 1Y5WA 5A8OA 3DN5A 1DQXA 1ZJHA 2ACUA 3S5SA 5LA0A 1LG2A 5I3HA 3IGXA 7ENLA 1ML1A 4ZFCA 3GHRA 1FXPA 2HTMA 3RLVA 4DNMA 1T8QA 5A8QA 3EB3A 3DECA 3W7DA 4WJEA 1M5WA 1ISZA 3R0UA 3IUHA 3VIHA 1CEOA 5BU9A 4NG3A 1H7OA 4IT1A 4UFKA 3A3WA 4H6RA 1UKOA 2X0YA 2YDQA 1BG9A 1IWAA 3GSMA 3W1PA 4D72A 2P53A 4J3VA 4O1EA 1OGGA 3WLTA 1EC9A 4MKSA 1GVYA 4WR3A 2WHJA 2CLPA 1UBPC 4C7FA 4CN4A 3CPGA 3KX6A 1DWJM 2CXGA 4GRSA 5K4ZA 3A12A 1XPYA 3HGSA 3AZTA 1IIHA 4AHQA 1NIUA 4I9TA 3CNYA 2G3FA 6XIMA 2QGYA 1TMLA 4JIEA 1FWBC 5H8PA 4FIRA 1F61A 1GTHA 1PX3A 2W3ZA 2UBPC 1JAEA 3GW3A 1W8SA 2XFWA 2VRJA 1OYBA 3BG9A 3L4UA 5LGZA 4DAFA 3MBDA 3L2LA 4HBKA 4TX9A 3V7PA 4ENLA 4C5ZA 1ISXA 4Q8NA 2PP3A 3W83A 5BOEA 3M46A 1UYQA 4NAEB 3GNDA 4RE2A 3N9RA 5CC3A 3QTGA 1QFEA 7CGTA 2QCCA 3LYEA 3PVFA 3T40A 1M03A 2FGZA 1JF6A 3NUKA 1AVAA 1EQPA 3W29A 4R7JA 4KMQA 2O7SA 3H6OA 3E6EA 4GI8A 1TO3A 2F61A 3QKZA 4BK9A 3VNKA 1F07A 1SJAA 5GVJA 1FWRA 4I8DA 1LYXA 1QI0A 1A5CA 1ZAHA 2IPWA 2Z1VA 5C9ZA 3EEZA 3NG3A 3N6HA 2P8BA 4PBFA 1SVDA 3VGEA 4UFJA 2WMKA 4OECA 2OPJA 1R7OA 4H2HA 1QW8A 3RRAA 4GXWA 1Y5VA 3VABA 1C8QA 3DU0A 3WQEA 1S2AA 2QUNA 5ABFA 8XIAA 1XX1A 2PDNA 1OK6A 2PBOA 3MSDA 2Y8UA 4PR4A 2FFIA 3WF4A 4UQEA 1FQ0A 1BAGA 3PAJA 3WL0A 3M43A 5JIWA 3MSGA 3PUEA 2VOTA 5LNSA 2R6OA 2WPBA 2X0SA 2BOEX 4MAVA 3GUGA 1TA3B 4P7NA 1BKSA 1FP9A 3NL3A 1S5TA 4IFRA 2YYUA 4JEJA 2TSYA 1UH3A 4ZO7A 1JCMP 3E96A 5HMSA 4LGXA 3L2MA 3TA9A 4PUMA 3FGCB 4PMQA 2YLAA 1EGMA 6TIMA 1ZRQA 5HDRA 2HMCA 3PB2A 3TW9A 2WO5A 1W5QA 1DIKA 3C8NA 1EP1A 3NZGA 2PU1A 4R85A 2DUAA 3UXKA 4DQWA 1QNRA 2FGLA 3EBVA 1E1CB 4S3FA 4J27A 1K02A 4IL0A 3ARPA 3R13A 1NELA 3W7IA 1I0BA 1YXCA 4UR7A 2IKGA 2VTFA 1P0KA 1Q6LA 3ZLHA 4AVNA 4ADTA 5HR7A 4QG9A 3G1DA 3M4HA 1AJZA 2GVLA 1BLIA 3C2OA 3SO7A 4DRSA 1FWNA 1FVPA 5C55A 3PR2A 4KEUA 2QCNA 1BSLA 3O15A 5K3VA 1UOZA 3TMLA 1TPDA 2RDTA 2V9DA 2VMFA 2WJDA 2ZRYA 3LHTA 3ALFA 4GIYA 3UY8A 3WJZA 4N02A 1ZENA 3Q4DA 4K1GA 2PP0A 3TC7A 5LA1A 4R33A 4I8YA 3AUOA 1NOWA 1D3CA 1YQ2A 1WAUA 1AODA 2DZSA 1BVWA 3HN3A 5D04C 4O10A 1UD3A 1UC4A 1UZ1A 3JRKA 4IICA 3REQB 3WQ5A 3PPGA 1UD6A 3DFOA 3ABOA 3PN8A 2CLHA 1TTPA 2WBGA 1KFEA 3UA3A 4S38A 4JQ4A 4O12A 3CS2A 1YDNA 1M7JA 2HSAA 4R9XA 1FHDA 1IEWA 4ILSA 1OYCA 1UKSA 4X9SA 4DZAA 3ARYA 4MB3A 2CZFA 4H9VA 3ZOAA 4QE1A 2YCIX 4UQ9A 3QW3A 1GOXA 5AYZA 1E5NA 2Z1XA 4YCPA 2R24A 3LG3A 4O11A 3T1GA 3UXDA 4AEOA 3LV6A 3STPA 4D8AA 2WV8A 3B9EA 2CWNA 3EKZA 3USBA 1W9VA 3A3HA 1XM3A 1YADA 2DSVA 4WY0B 2E0PA 4OQVA 3W7OA 3CL8A 3WQ4A 3PZ9A 2FB3A 2ZVIA 3M6YA 1B3OA 4I5UA 3G22A 3CZ8A 4H2CA 2RJGA 3P5ZA 2FGBA 4JYFA 3KLKA 4GO9A 4L1GA 3RM8A 1GOMA 1GEHA 1PO9A 3ALGA 3BMWA 2W62A 3KCOA 3K5XA 3GNXA 3AAMA 1SO3A 3VZXA 5FAGA 1G94A 4GIAA 3LTSA 9XIAA 2ZUNA 5J5RA 5F4SA 4UTMA 3BC9A 1YYAA 1XYMA 2VYOA 3SIZA 4Y9MA 5A8GA 1O12A 3AALA 3GB6A 1TV4A 4R34A 4QQUA 3U2OA 1O5RA 3ITOA 4IX0A 4PTNA 2HK1A 4R9OA 3M7WA 3MP3A 3RFAA 3MJYA 4HJWA 3ZR6A 2XISA 4CKQA 5HBFA 4H8VA 2J7HA 3VMNA 5GJPA 1VLIA 3BG5A 4UR8A 4BA0A 2PRLA 2CFFA 3WJSA 3UR2A 1EJVC 3B03A 1MW1A 2TAAA 4KGJA 3GU9A 3W37A 4AZGA 4M56A 1H7NA 2NLYA 4DWSA 3AWOA 2RJHA 2RGLA 2Z0IA 3M5YA 4NUWA 1H7WA 2D0GA 1WX0A 1YPIA 4GVHA 5DCDA 2AGKA 6TAAA 3G6LA 3N12A 3MZNA 5H2ZA 4M6PA 3L4ZA 3LCGA 2ZFAA 1ALDA 3ECQA 3R8GA 4HU4A 2J66A 3MA8A 1W9XA 3L21A 3NL6A 3ARQA 1WA3A 1OM0A 3PSWA 5CSUA 3S5NA 1DTUA 2R1NA 4XD3A 2ZUMA 3GO2A 3DFNA 3CWHA 3W1UA 3SY1A 1TG7A 2QIIA 3QF0A 5EMJA 4LF1A 5DT5A 4N2YA 1LQAA 3RMEA 3M0VA 1H1YA 2QCHA 1UZDA 4REQA 4TX6A 1Q3NA 4Z0SA 3FX4A 3PWGA 2YZ5A 3TJLA 4LJ3A 3H53A 4KWUA 1YBQB 1Q45A 4N0RA 2V2CA 4P2VA 1TPB1 4DWDA 1TIWA 1G4TA 3BQ6A 1YX1A 3N18A 2R1LA 3PULA 2DT2A 4MM1A 5DT7A 1CENA 3NOEA 2V2HA 4WDXA 2QZRA 1NF7A 4DJDA 4US6A 2YSWA 1A80A 5EFDA 3GDMA 3WDHA 1X1OA 1BHGA 4DI9A 4IG2A 1BEUA 1E51A 5D2WA 2DIKA 4H3DA 4JTIA 3H55A 3EMQA 3CLWA 4GIRA 4KEVA 3PBMA 4F66A 2D2GA 2XIJA 4JL2A 3MVIA 3NQ7A 3AS2A 3N15A 5C7HA 4K6AA 4MKNA 2D1ZA 4E3VA 2E3ZA 3M64A 3SUWA 3WQ6A 2A3LA 3CEUA 3AU6A 4YYFA 4Z2IA 3FK4A 3Q94A 5CJMA 5TIMA 4UTWA 3CIVA 1R2SA 1AQHA 3TOPA 1ZNNA 5EY5A 4D8LA 3BJSA 5A94A 1I45A 1T41A 1KBBA 1PUDA 1B1YA 3SSZA 3LEPA 4A05A 4FNSA 2XFRA 1JEZA 3OBKA 4GBUA 5J8LA 4LUTB 4W85A 5CPSA 1WO2A 3AU2A 3DG7A 4M82A 1KLYA 1TV8A 1C8VA 4X0NA 1XWYA 2QJGA 3KTSA 4Z2HA 2ODOA 4Z2JA 4TQTA 1BYCA 3HQ1A 4PYSA 3CHFA 4Z2KA 2QUUA 4W8AA 2NLIA 3ZWSA 5H8MA 3TIMA 2Q3RA 1J0HA 2EJ1A 4GYPA 4HU3A 3RNDA 4UXDA 3NSMA 4QAIA 4C1NB 1A5OC 4J28A 4XVDA 4TMCA 1HUVA 3W7JA 2B81A 3UZYA 1EGVA 3RLGA 2YR1A 2ZUWA 1TCDA 3M1ZA 4PCSA 1ME8A 3QGAC 3WJXA 2VENA 3M5VA 1ITQA 2GYIA 3VC6A 2VM8A 4AYGA 1L8PA 4PMJA 1JPHA 1TPEA 5C54A 3SDOA 3GM8A 1RD5A 4M29A 4WSKA 2GJPA 4G8TA 3S5ZA 1HZYA 1KB3A 1EJSC 2A7RA 5FSEC 4A2SA 1NQ6A 3M44A 3HMJG 3T0AA 3ABXA 2PC8A 4IIHA 1EWEA 5I7GA 1OQFA 4GHRA 4H9XA 3CZKA 4V2XA 5GJMA 3UETA 4FHAA 3BW3A 3FKRA 3EMZA 3DUGA 5DQPA 3CBWA 3ITYA 3SN1A 2Q8XA 4CU6A 2PDKA 4XTIA 4AZ6A 4HB7A 1E4NA 2JKAA 3HU7A 3SUVA 1PZ2A 4YN5A 3EDFA 4KIRA 3E5BA 2VEIA 1ZQ5A 3YPIA 3MBFA 2G95A 4MOZA 4ZBCA 4AIUA 1A49A 5FD0A 5ENLA 2BZNA 2V5BA 1E55A 3W6MA 2HROA 4MF4A 4HT3A 3EAUA 3QQ0A 2CCRA 4V1YA 2ZRVA 5BRBA 1EIXA 5GPRA 3CZLA 2AKMA 5G1TA 3W87A 1U5HA 3LTYA 2CLEA 2XG9A 2XZ7A 1UP0A 5TBOA 2GZXA 4LVFA 4LS0A 2FHCA 1R30A 4FOJA 2GJRA 4DJFC 3TYUA 3C0SA 3C6CA 4CD7A 4D2JA 1PIFA 4NNCA 2J7GA 3WFAA 1RXOB 4C6QA 1HJXA 2CHOA 4M6UA 1QK2A 1XLFA 4XKYB 3G0SA 4Q6XA 4AEEA 2PC4A 4B5UA 2WBKA 4XUGA 6XIAA 2I14A 1DL3A 2J77A 4DJFD 2PLMA 2YCLA 1W9UA 3OU8A 5D8ZA 5TQLA 3UERA 4AU0A 2O4MA 4QR6A 1X1ZA 2EHHA 2YB1A 3W74A 2OLAA 3VYLA 1NM9A 2W27A 3PZOA 5C2XA 4BQ4A 1P4CA 4RK8A 4HNLA 1NFPA 3OLIA 4O57A 1SJCA 4GX9A 1BSIA 1RJRA 3AYSA 1TTIA 3A23A 3VNZA 2CEQA 2WZIA 4KETA 3URQA 3RF9A 3P0XA 2A3CA 3H4XA 1HVXA 2X42A 1EF2A 2PBGA 2CZDA 3RHGA 5JIPA 3O05A 1R9XA 4Q4SA 1JZ2A 1NEYA 1V93A 3TWBA 4FMVA 3ZYZA 1CPUA 4AX7A 4IOTA 4HK5A 3N73A 2Q8LA 1W1A1 2PWDA 1J4EA 3O9NA 2WSQA 3ORWA 2BP1A 2C1HA 3UVIA 4UQAA 1GOQA 2OO0A 2VZSA 3DGBA 4JTQA 2EG6A 3GXTA 5I3KA 3QTPA 5F2LA 3WDJA 2E67A 4QITA 4HHHA 2H9AA 3WYZA 1A5AA 1SO6A 5B7ZA 4UBPC 3NR0A 5A69A 3T07A 2J24A 3SY5A 1E1FA 3XIMA 1TJRA 1LUCA 4LWWA 1GG1A 1WDSA 3BDKA 1KNWA 3VCNA 1UP3A 2WOQA 1RPXA 3GU2A 4HPNA 4DLMA 2X2YA 3RJYA 4J3XA 2YA1A 1H7XA 3AMLA 1YHTA 5IOBA 1VR6A 3BLOA 4LUSA 1J2BA 4GLEA 1XV8A 4JX4A 2VFHA 4RV3A 1JCXA 1HP5A 2ZRZA 1UASA 1WDQA 3GTIA 3VNYA 2H90A 1F73A 2AL2B 3THDA 3NQFA 2FH6A 4M6VA 2NV2A 1HO4A 3WLIA 5KSWA 3CYVA 5CSSA 4IJRA 2QW5A 3IIXA 1K9EA 3D0CA 1Q6EA 3NOYA 3A4AA 1VEOA 2HQAA 3W4RA 4DELA 3SQLA 2E1WA 2J9YA 4J35A 2G4FA 4DXVA 3QZEA 1KFBA 2BB0A 1HL8A 4LUJA 3AHYA 4PTVA 2DJXA 4HMCA 2OZ0A 2QIWA 4CNOA 1TJPA 2D20A