2A6NA

Dihydrodipicolinate synthase (e. coli)- mutant r138a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSATGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title Role of Arginine 138 in the Catalysis and Regulation of Escherichia coli Dihydrodipicolinate Synthase.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2005-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a6nA00
2ISVA 3I7QA 1FXQA 3KFTA 4IPIA 3MJYA 2ATSA 2BX7A 3G24A 2VEMA 3PUEA 3CEUA 4UTTC 1IGSA 3G22A 4XZ9A 2DJXA 3C8FA 4N2YA 3PUDA 2QDHA 5EYWA 1G4PA 3N9SA 3NZRA 3UZJA 2C16A 4GJ1A 2PURA 1JQXA 4LC6A 2JKPA 3W1TA 1W3TA 1XUZA 2AAMA 3W7GA 3VNDA 3BLEA 4N9BA 3LTYA 2ALDA 2CW6A 2OJPA 5CZTA 3S9YA 1H60A 3O1NA 5C54A 3FS2A 3L0GA 3KRZA 1X1OA 5U4NA 1ICQA 1AMKA 3NPXA 1P4CA 1EWEA 3NQ6A 4HSOA 1FWSA 1KM2A 4AHPA 1EP2A 4E38A 3O15A 1W31A 3GDMA 3HPXA 3Q37A 2GJNA 3H53A 3RLUA 4KFOA 3K30A 4UR7A 4AHQA 5AYXA 1QPNA 4MJMA 3LHYA 3W88A 2GVLA 5CG7A 2B7QA 4Y9AA 2H8ZA 3QMSA 1KTBA 3ZFHA 5F2MA 2WSQA 3P5ZA 2TRSA 2ZRUA 1ME9A 1JCXA 1K8XA 4L4MA 4O13A 1ONRA 1LBFA 3NR0A 1O5XA 1VHCA 2ZA2A 5KITA 1QPOA 2HS8A 3UD6A 4JTJA 4UR8A 2DZWA 3G8RA 2FFCA 3G1DA 4UTUA 3LHZA 4JX5A 5CPNA 5G4WA 1GWJA 3GYEA 3NQ7A 5DELA 4BR1A 5D04C 1OFOA 5IBXA 3IIPA 4K39A 1GZGA 4LY8A 3D0CA 1V7YA 2ZYFA 4LS0A 4DF0A 3TXVA 3UWVA 4JDBA 1L6WA 4FHAA 4EF9A 1Z44A 4WY0B 5FF4A 3EWWA 1ME7A 4H6KA 3EX2A 5AC7A 1AW1A 1L9WA 1SUXA 1VH7A 3LOTA 5F1UA 2WV8A 5DLCA 3W1XA 2CWNA 2QUTA 1SW0A 1YPFA 4XBKA 4GNJA 2QCLA 1W5PA 4A21A 3DFOA 2Y7EA 2JK2A 2WNQA 1TV7A 1LZOA 2E5BA 3I7SA 3IGSA 4AF0A 1SFJA 1T8XA 2QCCA 4Z0SA 1EP3A 1P0NA 4O1AA 4ZMGA 2CZFA 2QJIA 5FEPA 2WOQA 1JJKA 4UCGA 1F76A 4Q4KA 4ZQPA 4NJHA 2GQAA 3A5VA 1OX5A 2R8WA 2ZDRA 3VE9A 3QMRA 3OIXA 4IXXA 3EX4A 3S0CA 4HHPA 1LRTA 2E5DA 1VJIA 4H4IA 2PRMA 2BLEA 4ICNA 2Q8ZA 4RCXA 4EWND 1Q6OA 1FQ0A 4K38A 3DU0A 2ZTKA 2NX9A 1X1ZA 1RD5A 3WK2A 2OCZA 3V1PA 4H3DA 1KA9F 4E0CA 3TFXA 1L6SA 3PG8A 1SQ7A 8TIMA 3HGSA 2Z6IA 1KW1A 4DPPA 1FWWA 4N9DA 2EKCA 1MEWA 3INPA 4UNKA 2CLMA 3WJZA 4EOUA 3VI2A 1AK5A 3ABQA 4DBDA 5CZJA 3PULA 3IGUA 2E09A 2DU2A 3BG3A 1SFLA 3KVMA 1DQXA 1H1ZA 1PE1A 5BMWA 3TX9A 3ABOA 3W1LA 2Q3OA 1Q45A 3QFEA 4NNCA 4XBSA 3GDKA 1EX5A 1NSJA 3QF0A 3R12A 4GC4A 5DN1A 4PFMA 1K7FA 4FIRA 4ZQMA 1BTMA 3W2NA 2CU0A 3L0KA 2EF9A 4O4WA 4AEOA 1O5KA 2GOUA 3R2GA 4A3UA 3UQNA 1I2RA 4Q32A 1I2PA 3KVJA 2ZZ4A 1R2TA 3KRSA 3PBWA 3HOJA 3W7MA 3CEPA 2EHHA 4MIMA 1WOAA 4WY0F 3B03A 4O52A 3L66A 1VHNA 4AXKA 3SJ3A 1BKSA 5LHFA 1KTCA 4Z1CA 3W86A 3UY7A 3RFAA 3LHVA 1YXDA 3W7LA 4O15A 4YXGA 4LVGA 3STEA 2ZZ7A 4JTEA 3A22A 3SR7A 1H63A 3LCHA 2CLEA 5I3JA 3B8DA 2CLIA 4JR5A 1KFBA 3ATZA 2H3DA 3DFTA 2X1TA 3WJYA 4HIBA 1LRNA 3QYQA 2VFDA 2OMAA 4C1LA 2XN2A 4U4MA 2QEZA 3G8EA 5E93A 2NXGA 1CI1A 4AF0B 3W6YA 1YADA 1G6CA 2IQTA 4LV9A 1YDOA 4HPJA 1WBHA 1I8JA 2ZCGA 4K7YA 3W2MA 4LRTA 1UJPA 4GWEA 1F05A 2YW3A 4NNAA 5HQEA 1LROA 4UFMA 4IUOA 1SZNA 3CPRA 3LM7A 1V5XA 1OX4A 3QSTA 3BGJA 3LV6A 3B06A 1F6KA 4CQ8A 1L2UA 1NF0A 4EVZA 3NPUA 1YXCA 3W7DA 3U8GA 3GXNA 1MO0A 1FCUA 3NQ2A 4WQ6A 3HGRA 3DI0A 3W7CA 5K9CA 2EAWA 1Z48A 5DBUA 4I9AA 4UTLA 1TQJA 3EKLA 2NWSA 1AG1O 4PL2A 3NL5A 1B4EA 2YZRA 1G4EA 4IGHA 1OFRA 1EP1A 1GOXA 1XL9A 1AW2A 3GNNA 3CHVA 4K36A 1DVJA 3BPWA 3TK7A 4MPQA 2V0TA 4A29A 1FDZA 3LTPA 5DBTA 4UTHA 3G1YA 2J24A 3GDLA 4O16A 4KKXA 3GZ3A 3E02A 4GXMA 3MHFA 4NX0A 4NZFA 1G4TA 2TPSA 4HSNA 3HB9A 3B05A 4Y8FA 2OT1A 2NX3A 2P1FA 5D2WA 4PODA 3PR2A 4RKAA 2C15A 2DZVA 2JGQA 3W7NA 4UFKA 4Y6GA 3NO5A 3GK0A 3G18A 1ZALA 3ZR4A 3MP4A 1XCFA 4PEKA 5F4SA 4N4QA 4YMZA 3W87A 1EA0A 4BF9A 2XFWA 2O7QA 1GVRA 1SO5A 2PRLA 4JN6A 4R33A 5G4EA 3BVJA 2B7NA 3JS3A 1I2OA 1Z42A 3PBVA 1B9BA 1LLWA 5I3IA 2WSRA 2W79A 4M6VA 1SZFA 3HG5A 5D05A 4OGZA 3T78A 2ABBA 1FCBA 1WQ5A 4UUIA 3NZ1A 3Q58A 1KFKA 5C55A 3P60A 4JTLA 4UTMA 3CQ0A 3KRUA 2CLHA 4CNPA 4ADUA 3W7QA 3THAA 5MHBA 3BV4A 1XUUA 3THQA 3NQCA 4N6FA 4IMCA 4RXGA 3DFNA 3G1FA 1OABA 3KXQA 5DCBA 2BWGA 4IMDA 2I1OA 2G95A 3FOKA 5FF2A 2A1YA 4KFPA 3A5FA 2FPTA 1PS9A 3BLIA 3PUOA 4LNYA 3P74A 3B04A 4AAJA 2C1HA 2GPTA 2Y63A 2J88A 2V5LA 4Z1BA 1XI3A 3BW3A 1VGAA 2ZTJA 3P62A 2VKZG 5F4WA 5AC8A 5DXYA 2V9DA 4MY8A 3NPWA 1PHWA 2PCQA 1TCDA 3NL2A 1DJNA 1GT8A 4LW7A 4O18A 3GR7A 2YXGA 3G0XA 3NQAA 2NXIA 5EPDA 1WYIA 1VCVA 4ORIA 1MEHA 1OX4B 4ADSA 6ALDA 1D3GA 3KHJA 2NZLA 4JIPA 3TAKA 2A0NA 3TFCA 3LCLA 5BNKA 3WK3A 2Y62A 1TMHA 1TTJA 4RXFA 2Y7FA 4IX2A 3R8RA 2FPYA 2DZXA 1JUKA 3FLUA 1QCWA 1TTIA 2V8ZA 1U83A 3C3NA 5EBUA 1WBJA 4WY0A 5AHNA 4O1BA 3PB2A 1OK4A 1VQTA 3LCWA 3GKAA 2Y7GA 2VEIA 3LX9A 3BLFA 5G2WA 3N2MA 5BRBA 4K8EA 1OFAA 5EL1A 1GYNA 1G67A 2X2GA 2VEPA 3N34A 4HNTA 4NXSA 4JIQA 3M7WA 1KV5A 5EA9A 4RR4A 3CC1A 2FQIA 3S6DA 3TE9A 3V75A 1LCOA 3TU9A 3TAOA 1BEUA 5FEZA 4JXCA 5LNSA 4GUJA 4UNLA 2E6DA 3L5MA 1VRDA 3YPIA 2CZEA 4WZHA 5K7JA 2D73A 1FCVA 5D2VA 4TIMA 1OFDA 1N8FA 3DKLA 3N3MA 1LOSA 4NVTA 1LBLA 3SGZA 1MEIA 1MXSA 1FX6A 3LERA 4NZJA 4MLRA 4XQ6A 3O06A 1O60A 2H3BA 1TPVA 3UPWA 3EWZA 3EXSA 2ZBTA 3P67A 3W07A 3Q94A 4MYXA 1L6YA 3T40A 1VCGA 4NNBA 4ZQRA 5HINA 4TO8A 4JTFA 3BW4A 3W7KA 3EKZA 3MI3A 4JTUA 3TW6A 2B7OA 1SPQA 2QKFA 1LOLA 3P7YA 5K4XA 4Z08A 2ZRYA 5T26A 1SU5A 1DKWA 5KZMA 3LRLA 2JBMA 3PS7A 3MWAA 4DO5A 1OYCA 4FX8A 2ZZ6A 1OG0A 1MSSA 5CSSA 1QO5A 4OT7A 3CT7A 3TUUA 1O95A 1P0KA 4U28A 4JTHA 4O57A 2QCGA 1BWKA 4POCA 1IF2A 2OZ0A 2Z0IA 2RHGA 1HFBA 4JYFA 1KM5A 3EWYA 1ZCOA 4P2VA 1R30A 2Y61A 3M43A 5D2YA 4IWWA 4N9CA 1PL9A 2C14A 4XWUA 3EX6A 3DENA 1KLYA 1PHQA 1K8YA 3QPZA 4LUIA 1C8VA 2Y70A 1FWTA 1UBSA 3HJZA 3M16A 5F2IA 3NL3A 3SFKA 3TQKA 1D3HA 3G1VA 2ZA3A 3LRMA 4GUGA 1GG1A 4LVFA 4MUZA 4BI6A 3MBFA 4X22A 1TO3A 1OX6A 4JICA 3P61A 5G2IA 5D33A 1DOSA 4XUGA 3NYZA 2VFIA 3G1SA 3BK0A 1WDWA 3PVFA 2WPBA 1TYGA 4NT0A 1GG0A 1TV8A 3NA8A 4K37A 3PAJA 1ALDA 4PH6A 4NX5A 1XXXA 2VFFA 1KBIA 3CLMA 1OYAA 4ML9A 3UWWA 2GQ8A 4OU1A 3BARA 3W1UA 4GUIA 4Y90A 3PSWA 3W83A 1GVQA 1XM3A 1I2QA 3CWOX 3P82A 2JGYA 1UASA 3IIZA 3SSJA 3LCGA 3PG9A 4MYAA 4Q33A 1IIGA 2YYTA 3C52A 2NUWA 3LCIA 3ZWSA 1WA3A 5F4XA 3CU2A 4RLIA 1W5MA 3WJSA 3ELFA 3E12A 1M7OA 1F6PA 2J9ZA 3UXAA 3C2VA 3UWYA 4AMAA 2ZA1A 2FPVA 4JX6A 1RZMA 5HNRA 1SR9A 3MYPA 4GBUA 1OK6A 2Y6ZA 4MLJA 1A50A 4O50A 4Z1AA 3MO7A 1TB3A 4O4VA 1JCNA 7TIMA 3CIXA 2W0UA 1JRBA 3W74A 4GRSA 1M5WA 4RZ6A 4FX7A 3RU6A 4BI7A 3W7OA 4A2SA 2GUUA 1LRQA 3CIWA 4HPXA 2BTMA 3LHUA 5FF7A 3LGEA 2QAPA 3BG5A 1FCQA 4JEQA 3LRKA 3W7JA 2V2CA 4KFNA 4GUFA 1HO4A 1ZFJA 3IRDA 3AO0A 3TNOA 2NLIA 2XN1A 3F4NA 4LS2A 2A4AA 3L68A 4IPJA 3S1VA 5K2ZA 3QC3A 3W72A 3BG9A 1D9EA 3NOEA 1H62A 2R14A 3QQ1A 4R34A 2ZQ0A 3PM6A 2WKJA 1GQNA 3QSRA 4MZYA 1FUYA 3B0UX 4FNQA 3W7RA 1KM4A 5FF0A 1R46A 3PSVA 3TQ0A 1KTNA 1UB3A 1EB3A 1VYPX 5CSRA 3MHUA 4O17A 2PC4A 2R91A 1H7RA 2QJHA 2PE4A 1XBVA 4FNRA 1W5OA 2VEKA 3CB8A 3TSDA 4Z0JA 1S3HA 2ZRVA 3LBCA 3W1NA 2JKAA 2Y7DA 1YDNA 4FXSA 1NEYA 3KVLA 3TC7A 2DJLA 1IXNA 1G7UA 3MYOA 4QNEA 3LB0A 1KFEA 5GVJA 1XDLA 1YTDA 4E2DA 1W5NA 1RV8A 4KWVA 4KWWA 4M7SA 2ABAA 2B7PA 4TU1A 5KSWA 3IVUA 1KBJA 4UXDA 2CLKA 1EPXA 3PBUA 2XN0A 4GFSA 3MP5A 3W7PA 5BW6A 2DP3A 1KM0A 3GR8A 1QNVA 2X30A 1IXOA 3PC0A 3ZWTA 3U6WA 1QPQA 3SW6A 2X1UA 3W23A 4W9TA 3FKKA 3HG4A 3EXTA 4O8RA 4LU0A 1WAUA 1ADOA 3QPYA 1IIHA 4LVDA 1I2NA 1DQWA 3DH7A 3R13A 5KZEA 3LCFA 3GX9A 4UMBA 4JX4A 1RQBA 2E6FA 1S5WA 2Z6JA 2WQPA 4DO4A 4UTKA 1ZAIA 4QM1A 4DPQA 4WXZA 4YL2A 4DEFA 4K7VA 5LZLA 4CQAA 1VLIA 3G1AA 2FJKA 2QCNA 3DFQA 2LLEA 4RX0A 4RK8A 1TPB1 3TV8A 3DXIA 3C2EA 3IGXA 3M0ZA 4XKYA 4XTDA 2Y89A 3I6RA 2CZ5A 3F1QA 5AHLA 4GE8A 3E9AA 3LHWA 4CCEA 1GVFA 1XBXA 4J9JA 3P80A 3FYOA 5I3FA 1ZAHA 4UTIA 1X7FA 5LGZA 4ONVA 2QR6A 3LBMA 4DELA 3L0NA 4ZQNA 4FNPA 5I3HA 2ISWA 5FESA 1PCKA 5IM51 2DORA 4FNSA 1KFLA 3OBKA 1HUVA 3BGGA 5HULA 3SGUA 1YPIA 2GQ9A 1JCJA 2ZRWA 3TROA 3G0SA 5D30A 2RDWA 5IBXC 4JNMA 3QM3A 2F7FA 1QFEA 5EMUA 1SO6A 4L4LA 1OFEA 3SECA 3S1XA 4TR9A 3TJLA 2C13A 1LORA 1W54A 2QAFA 3TSMA 5G5IA 3UY8A 2NV2A 1GVSA 4UFHA 1CX9A 3MMTA 4O12A 1IXPA 2CLLA 2B0MA 1C9DA 4WOQA 1KV8A 4JD4A 4YLWA 3NQFA 1F74A 3VFLA 4ZQOA 4HNUA 2JKEA 5G1YA 1H5YA 4DQWA 1YXYA 1J4EA 4CCDA 4JYEA 1FDYA 3O16A 3UZ5A 2YR1A 2C6QA 3B0PA 1A5BA 1K8ZA 1SSDA 1OFQA 3EX3A 5U7SA 4A2RA 3MHGA 1Q6LA 4NQ1A 2YCEA 4HKPA 2A6NA 3NL6A 3S1WA 4B5NA 5HWMA 1OYBA 1LTDA 3L9CA 3ATYA 1OHLA 3NQGA 4TMBA 5LHEA 4BK9A 5AHFA 1SZGA 4S2CA 4IMFA 4CCCA 3W7HA 3DBPA 4LTSA 3HGJA 2X1RA 2H90A 2ZZ5A 3BW2A 1A5SA 4ORMA 1P5BA 3ANYA 5LNVA 1N7KA 3MW7A 1M6JA 2A7NA 5DY2A 3B0VC 1HL2A 4FEZA 1M7PA 4UMCA 1LBMA 1Q3NA 3TMQA 4EF8A 3DAQA 2Q8LA 3I7RA 3G3MA 4O54A 1Q6QA 5AN7A 1CW2A 1W3IA 3FJ6A 2H6RA 3MBDA 1UCWA 1W56A 4Y96A 4RZ5A 3MI6A 4O53A 3DHFA 2A85A 3E0IA 2Z2UA 1T0OA 4M7TA 3LXBA 2G5WA 4UC5A 1K7XA 1ML1A 1YDVA 2QUVA 2DZSA 3M5YA 5G1TA 4CNOA 1DBTA 2FLIA 3WFAA 5CPLA 3S5NA 3PWAA 1JCLA 1OVDA 4IMGA 4MJZA 3C2OA 1DV7A 5F2LA 1TPDA 4O28A 1WXJA 4NXKA 1G69A 3S8HA 4XKYB 4OWGA 3TDFA 1TREA 1ZHAA 3W73A 5AFDA 3KAOA 2YFNA 3U2OA 3HG3A 3C6CA 3W2LA 4IOTA 2FB3A 3P5YA 1I4NA 2H8XA 4BI5A 4BWLA 4S2BA 1OF8A 1XKYA 4WXYA 4OQVA 3VKJA 1LYXA 4PA8A 2VENA 1FWRA 3WK1A 5AYZA 1TQXA 2VC6A 3IVSA 2A6LA 3S5OA 1B3OA 3P84A 3JR2A 3PY2A 1J2WA 2HMCA 3HMJG 4OE7A 1I45A 3W1PA 4LVBA 5LNUA 3M5XA 3AJXA 3L21A 3QJAA 4IQLA 4LRSA 3ABSA 2NV1A 2TMDA 1RR2A 4A22A 2DZTA 5L6UA 3F4WA 1FY6A 5F1VA 3W1RA 5G2HA 3WJXA 3M44A 5K4ZA 1LLZA 3NQ8A 3N9RA 3DHDA 4CQ9A 4N02A 3TA6A 3P8JA 3OVPA 1JUEA 3ZS4A 3TQVA 1TPWA 3LCXA 5HWJA 1P1XA 5AHEA 1BWLA 1R47A 2A21A 1H50A 3G3DA 5HUPA 4YWIA 3W85A 3M5VA 4G1KA 3QRHA 2BSLA 4M19A 1YTKA 5AHMA 3MP3A 2QCEA 5J5RA 1JR1A 1ICSA 5HR6A 5KZDA 3GB6A 3S1UA 4QQ3A 5K9XA 3ABRA 4M5PA 1EUNA 4DF2A 2BXVA 3M41A 3GNDA 1RQEA 2ZFAA 2W6RA 1JQVA 1VLWA 1VPXA 4LWWA 4FNTA 1EIXA 1JCMP 5HUOA 4MVAA 3QMTA 4NJJA 1ICPA 4NJIA 1TPUA 4N6EA 5CPOA 4DF1A 4QAIA 1ZY9A 3TJXA 1QOQA 1VS1A 3GLCA 2A5HA 1DL3A 2ZRZA 3NNTA 3W75A 5CZ0A 4JGDA 1VZWA 2FIQA 1S5VA 4O1CA 3GAKA 4C1KA 1W8SA 2F84A 4IXHA 1KLZA 3LXAA 3OA3A 4HNVA 2Y88A 2ATMA 3TIMA 1GTHA 2YDAA 3CWNA 3O07A 2RKXA 2NXHA 1F2JA 1TJRA 2C3ZA 1LOQA 3G0UA 3NM1A 5C6MA 5BMXA 3DGRA 2QCDA 3TXZA 5ABTA 1SW3A 4JYDA 4UFIA 2B4GA 3NGJA 2WO5A 3Q2DA 2A7RA 5FF3A 3A23A 3IIXA 2OX1A 1WX0A 4PC8A 4WJEA 3WK0A 4JS3A 3HGOA 5AHIA 1JVNA 1ZNNA 3NVTA 1NAL1 4LS1A 4HN4A 3H54A 1A53A 1QDSA 4R53A 1EWDA 4MFDA 2RFGA 1JCYA 1AW5A 2V82A 1KM1A 3M9YA 5BOOA 4OBTA 3DKJA 1FBAA 1TTQA 3W9ZA 3FFSA 2YFOA 3GDTA 4LOCA 2NWRA 1J5TA 3NPVA 3STCA 3NG3A 1VYRA 1U5JA 4UFJA 2ZZ2A 1SW7A 2V5BA 3OHIA 3W2UA 5HJLA 3HQ1A 3QH2A 4O14A 3LV5A 1G4SA 2DZUA 4LV4A 4X9SA 3IVTA 5E1QA 3T55A 3UXDA 4FB7A 3T7VA 3W1AA 3EX1A 3O8AA 2E5CA 1B4KA 4D2JA 3HPSA 2J9YA 5C2XA 1OFPA 3E49A 4QITA 1XDMA 5FEWA 2E6YA 3G1XA 1QOPA 5DCEA 3SZ8A 1T96A 3L67A 4CNNA 2ZRXA 3O6DA 3NXFA 1FDJA 4IX0A 3BO9A 5KMYA 3G1HA 3EWBX 3QZEA 3PF3A 2DZPA 4CLMA 2HSAA 1TIMA 1GTEA 3CTLA 3LTSA 3KVKA 1PV8A 2QF7A 3SI9A 3UWQA 2VFHA 2VFEA 1VYSX 5LNRA 2E1DA 3EWXA 4JTTA 2VELA 4JY8A 1PCWA 2OT0A 2AQWA 4HT3A 2CZDA 3F03K 1QAPA 1ZAJA 3FIGA 4E2BA 2ISSA 3N19B 1VR6A 4WOZA 4YCOA 3LDVA 4PCFA 1TJPA 4OHQA 4QSHA 2X1SA 4MY1A 1O94A 5FI8A 3L5LA 5I3KA 4NJKA 4BWLC 3STFA 2V81A 5H2ZA 3O6CA 1W37A 3W22A 4PTNA 1W1ZA 5CKSA 5CZSA 5AOUA 1TSIA 4I7VA 4FXRA 3HG2A 3C2RA 2QCMA 3OG3A 4YCPA 2V2DA 5L9FA 4Z1DA 3W84A 1JRCA 4LUJA 1OF6A 1WOBA 3GXTA 3EWUA 4JY9A 4O0ZA 1H1YA 2QCDB 3LLFA 5D38A 2FTPA 2I9EA 2R94A 1JULA 3TCEA 2UV8G 1K03A 1Z41A 1OFBA 2J6XA 2WJZA 5EKYA 1XBZA 1S5TA 1VCFA 5D37A 4DO6A 4O1DA 1R2RA 2RH9A 1PVNA 4K6AA 1KFCA 4IJBA 2YSWA 1NVMA 1W3NA 2QCHA 4DBEA 5D09A 1YLVA 1R2SA 3SY5A 4S1FA 1TRDA 1NF7A 3OEXA 4IMEA 2FB2A 4JTIA 4NU7A 1LM1A 3NQEA 3PBYA 5KTLA 3C56A 1G7VA 4O10A 1HO1A 4LC8A 1H51A 5SWUA 2V30A 4JTKA 5AYYA 3NEVA 4AHOA 1ZENA 1H7NA 2CLOA 5TIMA 3STGA 1TPH1 1SO4A 1B57A 3P81A 4JTGA 3QW4B 3DZ1A 4UTWA 2CLFA 3E96A 1UUOA 5D2TA 1MZHA 3GXPA 1LP6A 2FDSA 4R7JA 3TC6A 1F7BA 3NM3A 4AWUA 1A5CA 3HPZA 3W1QA 2VFGA 1H7PA 3VE7A 1DORA 1C29A 1AL8A 5FEXA 3UNDA 4RJEA 3VCRA 4GUHA 2RDUA 1YTEA 4UTTA 3W1MA 1XBYA 4ZZ9A 4ZQCA 3L2IA 1QPRA 4O19A 1H7WA 3W7EA 3S5ZA 4X3ZA 1QWGA 1ZJIA 2RDTA 2E68A 3A9IA 3OVQA 4FNUA 1FXPA 1SZEA 1QMLA 5DCDA 1F5ZA 3C2FA 5D32A 1OJXA 3OVRA 2WNZA 1K7EA 3W2KA 1XFBA 3NDOA 3RLVA 4JTSA 2WSYA 2TYSA 1QO2A 3RF9A 5I3GA 2GVJA 5AB3A 3DFPA 4LT9A 4DXVA 3TH6A 2AGKA 4QJ1A 4XTIA 5H91A 1UUMA 5DY3A 2O7SA 2ZZ1A 1Q6RA 5LSMA 3W7IA 3MUXA 3R5EA 2YX0A 3LLDA 2G97A 1E51A 3M6YA 3EEGA 1F73A 2QUUA 3NQMA 3NQDA 4MZ8A 3M47A 6TIMA 5TBOA 3TSBA 1WV2A 2P0OA 2TSYA 2Y85A 3W71A 4X2RA 2VOMA 3W2JA 4TMCA 4UTJA 3FKRA 3GAYA 5LKYA 2A7PA 2V2HA 3FYPA 5C5YA 2E6AA 4EIVA 3FJLA 3IV3A 3LHTA 1T99A 2YPIA 1K02A 4O0KA 2G96A 1TTPA 3LI0A 1EEPA 1KFJA 3UWZA 3W70A 2C18A 3I68A 4WD0A 4TX9A 4PL1A 3WJWA 3RMJA 4FF7A 4AWTA 3QW3A 2A2IA 4BFAA 3O63A 4FX6M 4RV8A 1FWNA 1LDCA 5E0KA 3GIYA 1W0MA 4WUIA 1RQHA 2QJGA 4FIQA 2P10A 4O11A 3W76A 2KZHA 3N73A 1YYAA 2NX1A 4UMAA 1TPEA 5D2XA 5D03A 3H55A 1H7OA 1GEQA 5TQLA 2Q3RA 3GVGA 4I7UA 4ADTA 2BZNA 2Z1BA 4HNNA 1X6UA 2PRHA 5EY5A 2EPHA 1H61A 5DXXA 2YYUA 4WX2A 3R89A 4QNWA 4I7WA 2YGYA 1HG3A 5F2GA 3P8IA 1GPWA 2QDGA 1JUBA 3UWUA 4FO4A 4MOZA 1K3UA 4MFEA 3M5ZA 3HF3A 2E77A 1VC4A 2EGZA 3A24A 3C0JA 4QISA 3O05A 1PIIA 2VXNA 3JRKA 2WNNA 3TKFA 3FA5A 5KINA 5HR7A 1TRIA 1X8FA 3N2XA 4M6QA 3USBA 1GVOA 3QEZA 1GJPA 4UFLA 4ALDA 1THFD 1TPC1 1ME8A 3HIJA 2HS6A 4AH7A 3A21A 3UYCA 3DFSA 4JDYA 4RZ4A 5CPMA 5HMSA 4AB4A 2J27A 1SO3A 4MY9A 4QIUA 3N14A 1AL7A 3SIZA 3UPBA 1QR7A 2NUYA 3O6YX 4ZL1A 4AWSA 5K3VA 1O4UA 1DJQA 1H7XA 4N9EA 1GYLA 4OV4A 3S42A 3TR2A 4AVFA 4OV9A 3EXRA 3I65A 1HTIA 5LNWA 1SSGA 2CFFA 3B4UA 3KX6A 2J9XA 3LI1A 1TV5A 3M1ZA 4K8HA 5CGQA 5A8GA 1XC4A 1NFBA 3C61A 2I14A 3KOFA 1Y0EA 3RK8A 3C4UA 4M6PA 3PB0A 5AC6A 2QCFA 5K9DA 1A5AA 1DHPA 1TPFA 2HTMA 4ZVJA 3LXCA 4MZ1A 3GKFA 1IXQA 3T4CA 3MI2A 3RNDA 4LVAA 2C0AA 1KM6A 4MKNA 2YW4A 5J5DA 3IIOA 1W5QA 5D02A 3DI1A 3QQ0A 3HO8A 1RVGA 2NUXA 2X16A 2C19A 1RPXA 3FEMA 5A5WA 3GDRA 5LGXA 2GJLA 3L65A 3NQVA 3IIVA 3CM4A 1EUAA 1KM3A 3T44A 4UTWC 4NUWA 3TMLA 5HWNA 2GVGA 3TW7A 3NAVA 3HBLA 2ZZ3A 3EB2A 3L5AA 4P61A 3IEBA 4NJGA 3S5YA 3W3OA 4UIOA 1N55A 4N4PA
chains in the Genus database with same CATH superfamily
4XBJA 4B92A 1FXQA 3KFTA 4IPIA 1XRFA 3CEUA 1IGSA 2DJXA 3C8FA 4LAOA 4DJFD 4ZEPA 3UZJA 2C16A 1ZLPA 4LCQA 4GJ1A 1EZWA 2QW5A 1IV8A 2JKPA 3CYVA 4GG9A 4B3LA 4WGHA 3BLEA 4N9BA 2ALDA 1R3TA 2CW6A 5CZTA 4NAEA 1H60A 3O1NA 5M17A 4LBRA 1E0TA 3NPXA 2DPEA 3NQ6A 4AHPA 4B9YA 1YBQB 3GDMA 3Q37A 3T9PA 3RLUA 4KFOA 3K30A 3Q67A 3ABXA 4L1GA 1FWHC 2VCAA 3GU9A 3LHYA 1XSJA 2GVLA 1A4LA 2HZGA 4X9YA 1CCWB 1KTBA 2GK1A 5CGMA 3IK4A 1ME9A 1XIBA 1IEXA 1JCXA 3BSHA 1DWGM 1EL3A 3NR0A 4CKQA 3WD3A 1O5XA 2J7HA 2ZA2A 4PTXA 4JTJA 2DZWA 3E2VA 5CC3A 1FTXA 3RPDA 3G1DA 4JX5A 5G4WA 5LA2A 2ZC1A 1KXHA 3RXZA 4PUDA 5EMYA 4BR1A 5CAHA 1OFOA 1LUCA 1GZGA 2JF7A 4LY8A 3D0CA 4JTRA 3EDFA 3L4VA 3M0HA 4JDBA 1L6WA 4PMOA 4MWAD 3TTSA 4WY0B 3EWWA 1D7KA 3KWXA 1D2KA 2OOFA 1SUXA 1VH7A 2HBXA 1F3TA 4N42A 4MNJA 1CXKA 3W1XA 4E8CA 2QUTA 4GNJA 3CZKA 2Y7EA 4FAMA 2JK2A 2P3EA 1TV7A 3I7SA 3IGSA 4ZXOA 1SFJA 4B2DA 3H70A 1E9YB 1KWGA 4FK9A 2NVDA 4ZSTA 2X09A 1DPMA 1REQB 4LCRA 2CZFA 1BD0A 3CV2A 2WOQA 4TTGA 4UCGA 3TJ4A 4Q4KA 3BC9A 4IJCA 5IHSA 2GQAA 1WZKA 2R8WA 3VE9A 4G7EB 4MB1A 3EX4A 4YTQA 4B3ZA 1EJWC 3AYRA 2DIJA 1LRTA 4OTKA 3WG6A 4W85A 1P7TA 1TWSA 1VJIA 1NOUA 4J5NA 1VD6A 2Q8ZA 1JI2A 1YNYA 3R58A 4HVXA 4K38A 4H01A 3AIWA 3C5QA 3PJWA 4GYPA 2DZAA 1RD5A 2OCZA 3VMPA 3V1PA 4NHVA 1RK5A 1UR0A 2BVYA 2PTWA 4IFRA 3PG8A 1H4PA 2WMGA 3QGAC 3HGSA 3PAOA 4LF1A 3HPFA 4JFSA 4ZBCA 4N9DA 3INPA 2CLMA 1N8IA 1UQZA 3U48A 4NAEB 4DBDA 4GIYA 3PULA 4IF2A 1QI4A 3IGUA 2PI6A 2E09A 1UKSA 2DU2A 1DQXA 4H00A 4GZJA 3SURA 1XH1A 3LSBA 2Q3OA 2FMOA 4UBPC 3QFEA 3N2TA 1T5AA 4ZQMA 1BTMA 3L0KA 2GK1B 4O4WA 3WN6A 1PX8A 3T0AA 3B8WA 3I6EA 2HK1A 4Q32A 5EFDA 3WH9A 4ZE5A 5CSYA 3WDIA 1R2TA 4XZLX 1VRXA 4C6KA 4AZ5A 2EHHA 4G2DA 6XIMA 4WY0F 3L66A 3A64A 4YHGA 4JTAA 1E1EA 1LUCB 3UY7A 3LHVA 4GI4A 2OLSA 1YXDA 2XFFA 3W53A 3STEA 1GQIA 1O5QA 1FKWA 2J7FA 3VIJA 2QYGA 1NY1A 2V69A 3OP2A 3RM4A 1KFBA 3QKZA 3CO4A 2OEKA 2H3DA 1E6NA 4ECLA 1XIGA 4ERIA 5CJNA 2VFDA 5FJTA 2XN2A 3H7RA 4ROPA 3N29A 3AALA 1Q6CA 4CQBA 3AZSA 1VBHA 2UBPC 1S46A 4HPJA 2ZCGA 4HQVA 5C9RA 1BGGA 3LYEA 1F4AA 4XO6A 3KZPA 1EJRC 1P7TB 2PLMA 3BJFA 2Z26A 4UFMA 3ALGA 1UD4A 4IUOA 1SZNA 1F6KA 1V4YA 4JQ3A 2HVMA 1JFXA 1EGMA 4W4QA 3GXNA 3WENA 3NQ2A 4JFWA 3V18A 2EAWA 3T6CA 1Z48A 4WCJA 4GC3A 5DBUA 3GRIA 1SYTA 4GZEA 4CQDA 1B31A 2NWSA 4EXQA 4J1OA 5FCZA 3NL5A 1B4EA 4HOZA 1G4EA 2CESA 1QI3A 3WF2A 1TJ2A 1GOXA 2E8YA 1MNZA 1XL9A 1GORA 2V0TA 2YCJA 1FDZA 2PDIA 3LEPA 4AIBA 4UTHA 1UOZA 4FLSA 1QW8A 4M81A 3WBWA 3BJSA 4NZFA 2EJ1A 3G2GA 4Y8FA 3CZEA 5CJMA 1OZMA 4BF5A 3BCFA 4H8UA 1UA7A 2P53A 2C1IA 3GNPA 2YCIX 1XYAA 4TTUA 4HA4A 4X63A 5FOOA 3BVJA 3KOWA 5FL1A 4HHMA 1SZFA 5D05A 3ZVIA 2HXTA 4OGZA 3N15A 4A4AA 4MB4A 4UUIA 1CTNA 5FJUA 4C6MA 3CQ0A 4CNPA 3Q4DA 2ZICA 4ADUA 3THAA 2Q01A 3BV4A 4LNCA 2DZBA 3WBEA 3NQCA 1UIOA 4Y8EA 4GBDA 5DCBA 2I16A 2BWGA 3RJXA 3LG3A 1I0BA 1L6FA 4MNLA 3CZJA 1M7JA 4WDTA 2A1YA 1K6WA 3A5FA 3BCDA 2O9RA 1PS9A 7XIMA 3BLIA 1TVPA 1FWEC 5DT7A 3P74A 2BVWA 3B04A 5B7ZA 2J79A 4TVDA 4B5WA 4XIAA 3WD1A 3W25A 3S1GA 3M0KA 3D47A 1TKKA 5AC8A 2G3IA 3W81A 3ZO9A 3TQPA 4CN1A 3TEVA 4HSHA 2V9DA 1KB3A 1WUFA 3NL2A 2C1GA 1EKOA 1GT8A 3BOXA 2BGSA 2Y8KA 2YXGA 3WQGA 4ZFCA 2NXIA 5EPDA 3H21A 2PP0A 4IJRA 2OYMA 5CC5A 1D3GA 1XIFA 2C0HA 4AWEA 1C92A 2WC3A 3OLEA 4LXFA 3LCLA 3ARQA 4U3CA 3PTQA 5DFAA 4HBKA 1DE6A 2V8ZA 2BVDA 1WDRA 1A5LC 1JZ8A 1WBJA 1NWRA 1OK4A 3PJXA 3LCWA 3GKAA 1UWIA 2VEIA 5G2WA 3N2MA 3A47A 3ANUA 2AL1A 3DHPA 5EL1A 4BS0A 3ITTA 4DAIA 3FAWA 4B5VA 1RJQA 2X2GA 3N4FA 2VEPA 1H1NA 5J04A 4NXSA 2XYLA 1KV5A 5EA9A 4HZMA 2OWCA 2XUCA 1W3KA 3V75A 1UWQA 3TU9A 3HFTA 1GZJA 4UNLA 3NO1A 3CV6A 5D2VA 2GLKA 2PWVA 3DKLA 4Z2LA 1UPMB 2SFPA 2QVNA 2VZOA 3ZT6A 2G8ZA 1OCNA 5FJOA 4TQTA 1QK0A 2G4FA 4YVVA 1O6IA 4E2VA 1ZP3A 1V3KA 1KCXA 2ZBTA 5HQLA 3Q94A 1L6YA 3APTA 1V6WA 2PAJA 3ID7A 3FX4A 1VCGA 4NNBA 2Z7GA 4JTFA 4PEEA 1LL6A 5T91A 2JEQA 2O4QA 1BG9A 1VEMA 4G56A 2QKFA 1LOLA 1OADA 3P7YA 4Z08A 4F0HA 5IXEA 1DKWA 3E5BA 1F3XA 5KZMA 3LRLA 4REQA 3MWAA 3CL7A 4DO5A 1OYCA 4FX8A 2ZZ6A 1MSSA 1S3TC 4GXWA 1QO5A 1KR0A 3VX1A 3TUUA 3RG6A 4O57A 3W29A 2QCGA 4POCA 1EDTA 2PWFA 2Z0IA 3IRSA 2WSPA 2RHGA 4JYFA 2DEPA 3VKDA 2PDQA 1J9YA 5A1AA 3M43A 4N9CA 4XWUA 4F0KA 4NZCA 5I09A 4LH8A 3DENA 3WH6A 2YBUA 1PHQA 1A49A 3TTEA 3UCDA 1FWTA 4BQ4A 1MW1A 3G1VA 2ZA3A 3G6LA 4GUGA 4D71A 4JICA 5CSUA 3GYCA 1OC6A 3P61A 1UOKA 5G2IA 4GFIA 1S2WA 4GIAA 3H2EA 3NJ3A 1KRMA 1OQFA 4XUGA 2HNHA 3BICA 3RDKA 1TVNA 3BLLA 2VX5A 4XZIA 1TV2A 3FAXA 4R88A 1DWJM 1TV8A 2WHLA 4PZVA 3FVDA 1W17A 4MNKA 1EHAA 4NX5A 1XXXA 1KBIA 1XWYA 1K4HA 4XB3A 3BARA 4JHZA 3EAUA 3PSWA 3CHFA 3CWOX 1UASA 3VCCA 5HJYA 4XG1A 3SSJA 1CGTA 1I60A 4WKAA 3CU2A 1KR1A 1W3HA 4PUUA 1M7OA 2J9ZA 1V0KA 3C2VA 3UWYA 4AMAA 1ZBKA 1XDJA 1DJZA 4B4FA 1BGAA 4GVGA 1YNPA 2Q02A 5HNUA 2Y6ZA 4MLJA 1A50A 4Z1AA 3MO7A 3E5PA 1JCNA 2VMFA 4W8BA 4HJWA 1W9PA 1DWHM 3W74A 3DG6A 3MO4A 1RA0A 2FZ9A 3RU6A 2VWTA 2A3HA 4X61A 3VC6A 4YYCA 3LHUA 5FF7A 2QAPA 1Z89A 2FYMA 1GQKA 4P5UA 4KFNA 5JUVA 1HO4A 3RJYA 3EOLA 2NLIA 2PU0A 2A4AA 1BLIA 3L68A 4IPJA 3QV7A 4B5TA 3QC3A 4WF7A 4BF7A 3BQ5A 1A4MA 4REQB 5DEZA 2PDMA 2R14A 3WLRA 4D6GA 3KCLA 2DSUA 3PM6A 2WKJA 1GQNA 3B0UX 2XJ7A 4H6EA 1KM4A 1XQLA 5FF0A 4A8IA 5CSRA 3F5LA 2R91A 1NFPA 4F0RA 2NQHA 1W5OA 2VEKA 3PN8A 3TSDA 4OZOA 1E5JA 2ZRVA 2GGIA 3W1NA 4MSSA 1H0IA 1HKJA 4I6KA 4RNJA 4CU8A 2DJLA 2IW0A 1GYMA 2VP8A 1G7UA 2PDFA 2PDNA 1UH3A 1SFSA 1XDLA 4E2DA 3IJ7A 2J8FA 3T0CA 3F2CA 1AVAA 1JIBA 2YDQA 4UXDA 1UWTA 2CWXA 1EPXA 1TFVA 2FZBA 4HD5A 4OFCA 2EPLX 2DP3A 1KM0A 3GR8A 3UJRA 4TVCA 3PC0A 1O1ZA 1RAKA 4W9TA 1CDGA 3FKKA 3FSUA 3TTQA 3GTIA 2AGTA 5LA0A 1UD3A 4LU0A 3STPA 2ALRA 3HQOA 1IIHA 5H1WA 2W4XA 1DQWA 4C65A 3DH7A 4GZ7A 2A3AA 3GX9A 1NWSA 1ZAIA 4QM1A 4DPQA 4YL2A 1KRAC 3G1AA 1U5VA 2FJKA 4H7ZA 2QCNA 2OEJA 3DFQA 3J7HA 1TPB1 3TV8A 2YB4A 3ITOA 5E0CA 4XTDA 2BP1A 2PDJA 2CZ5A 1QHPA 3F1QA 3WQVA 3WBXA 3LHWA 4J9JA 2I57A 3GFXA 4H9UA 1CB7B 2QR6A 1I1WA 4ZQNA 4FNPA 4NY2A 5IM51 4I9JA 2I9UA 1VEPA 1KFLA 1HUVA 4TXEA 5HULA 3E0WA 1YPIA 3OZYA 1MZRA 1NARA 1H41A 4PTDA 3QM3A 3WO8A 5EMUA 3ITVA 2OEMA 4TR9A 1LORA 4W88A 1VIZA 3SGGA 2QAFA 5G5IA 1GVSA 4C6DA 2FH6A 1IXPA 3EMCA 1C9DA 4AG0A 4YLWA 5GQBA 4PBGA 4ZQOA 1H5YA 3ALFA 1UR8A 4JYEA 5DRIA 3AS2A 4E6MA 2VR4A 5XIMA 2C6QA 4GD0A 2QPXA 3CQHA 1S2TA 1OFQA 1AQ0A 3NL6A 1QU4A 5HWMA 1FHDA 3L9CA 2INFA 4TMBA 1KGWA 2DIKA 3WQFA 3MUZ1 4S2CA 3R6IA 1IZCA 4AD2A 3S2NA 1FWFC 1UH2A 1A5SA 3ARYA 5LNVA 4P7NA 3WF3A 4TV6A 1M6JA 3WD4A 1XLIA 5DY2A 4AISA 3B0VC 1HL2A 4HJFA 3ZR5A 1PX4A 1ZZMA 1ZS2A 1Q3NA 3TMQA 3DAQA 4RE0A 2J7DA 5AN7A 1IWPA 4HNLA 4IUGA 1UCWA 4O53A 3UGRA 4IQJA 2VDGA 1K7XA 3RM8A 1YDVA 2QUVA 1YHTA 2WXDM 3RO8A 5CPLA 1GW9A 1QOXA 2IKJA 5HXMA 1R9YA 1DV7A 5F2LA 2PWGA 1YRRA 3VD3A 1GW1A 3OIHA 1TREA 4HU8A 3EDJA 1WAWA 2XH0A 2YFNA 3HG3A 3C6CA 4LBSA 4IOTA 1CPUA 1OZQA 4G6CA 2QPUA 3IACA 4BI5A 3PPGA 1OF8A 4WXYA 1LYXA 3N4AA 4PA8A 4O1FA 5AYZA 1TQXA 3RYSA 1W1A1 3HQPA 1OGGA 2A6LA 3P84A 4M3PA 1J2WA 2OQYA 1E9ZB 1I45A 3ME3A 3VCNA 5LNUA 2DQXA 1V6XA 4LRSA 1I75A 1KXTA 1RR2A 2DZTA 1UYQA 3F4WA 5F1VA 4C6CA 4ZTYA 2Z1XA 4AEFA 2ONEA 3NUKA 3M44A 3GH5A 5E0FA 3WUFA 2PDXA 4QROA 1M65A 3LENA 3DCPA 1U2YA 2JIWA 4N02A 3TA6A 3OVPA 1JUEA 3UA4A 4KEVA 3RCYA 2J7BA 3HN3A 3GY1A 3U5YA 3LCXA 5HWJA 4DZIA 2QZRA 4V28A 4KGLA 4ENLA 2BY3A 8RUCA 5BOFA 1EC7A 2VQTA 3W85A 1AJ0A 1RP8A 4EXAA 1ODZA 2BSLA 1ICSA 5JIPA 1UR4A 1GOWA 4I5XA 5K9XA 5LIKX 5RUBA 4MB5A 2VZSA 3M41A 3SIMA 3PBGA 4LF2A 3LZ3A 3UW6A 4AD1A 2V3GA 1ICPA 1BYDA 4QAIA 1CNVA 2XM2A 1DL3A 5CZ0A 4F2UA 3O2LA 4PUMA 4C1KA 1ZU8A 2PTYA 1F3EA 5HA7A 3LXAA 1L8NA 4B5XA 3TIMA 1GTHA 3R94A 3KE0A 2DW6A 1JD7A 3CUFA 3B9OA 2ZUTA 3RAOA 2RKXA 4AZHA 2NXHA 3SN0A 1TJRA 2VX6A 2OGYA 3H7VA 2HROA 2PDHA 2ZKMX 3NM1A 1QHOA 5C6MA 5BMXA 3DGRA 3EOSA 3K8MA 1SW3A 4JYDA 3NGJA 1ONXA 4PUNA 2A7RA 2J75A 1WX0A 3DC0A 1UG6A 2DT0A 1M9HA 3GNOA 4CU6A 3KEHA 3RITA 4Q8OA 1E3ZA 4XSLA 4XZBA 3WMLA 3TZNA 5HQMA 2C91A 3GHTA 1EWDA 3I4KA 2XGZA 4LY4A 1W1B1 5ABHA 1AW5A 3M64A 4J2MA 4OKDA 4EK7A 1KM1A 3U5UA 1N8WA 2O9OA 5AECA 4OBTA 1Z69A 3AMLA 1TTQA 1YX1A 4XD4A 3W9ZA 4XD3A 2IPFA 1O1HA 3NG3A 2YLLA 3OHIA 2D22A 2WBGA 3HM7A 3IVTA 2CBUA 1KXQA 1UJQA 3UXDA 1PAMA 2CC0A 4J3TA 3EX1A 4HK6A 2ASHA 1IWAA 1SMDA 4QITA 2JEPA 2QMJA 5AVHA 3GW0A 5DCEA 3SZ8A 1V02A 2IPWA 1E6QM 4IP7A 5C9UA 4LYQA 1NWUA 1BKHA 1J11A 1FDJA 1AUSL 3BO9A 5KMYA 3QFWA 2DZPA 1R7OA 1WDSA 4A3HA 3VDCA 5DMMA 1NWTA 1GTEA 1JZ7A 1XSIA 5IOBA 2QF7A 4KMQA 1NM9A 2VFHA 3CJPA 9CGTA 1CGXA 2E1DA 3EWXA 3PTMA 3BV7A 4PR4A 4MPKA 2ANUA 2J62A 1QAPA 3JU2A 2QLYA 3AWNA 3KHDA 2INZA 3N19B 4OOZA 1MI3A 3N4EA 4MY1A 4S3JA 1O94A 1L6GA 4DNMA 5FI8A 3L5LA 4BWLC 4Q7IA 1MQPA 2PWEA 2R1KA 4GCAA 3STFA 3B9NA 1HJWA 3MCMA 4PTNA 3CBWA 5CKSA 4AX6A 2YL6A 4FXRA 5HMFA 3SFWA 3W84A 3GIPA 3RN6A 4E5TA 3WNKA 3ZMRA 2VOTA 3WD2A 1AODA 3VU2A 4NI8A 3WQ4A 2X2YA 3TCEA 2WJZA 3THCA 9XIAA 3K4DA 1BQCA 3S2MA 4C6OA 3CQKA 4K6AA 1W3NA 2QCHA 5HMDA 4DBEA 1ONEA 1XYCA 2EJAA 3T81A 3WMSA 1TRDA 3FVMA 4I8DA 3T0DA 5KTLA 1G7VA 4O10A 1HO1A 1FOBA 1H51A 4JTKA 2WM1A 3LGDA 5IRPA 3ARWA 4AHOA 2Y1HA 1TPH1 1SO4A 2ZOXA 5CH9A 3E96A 2GJRA 4X0NA 3GXPA 2VZTA 2Q6ZA 2QDEA 3RGTA 1C90A 1KQZA 3HPZA 1H7PA 2IMRA 4MNMA 4LAMA 1XLFA 3UNDA 1XBYA 4ZQCA 1V03A 3RX3A 3MA8A 4F0MA 2QMKA 1QPRA 4O19A 1H7WA 3W7EA 1V3JA 1QWGA 3L4TA 4ZOAA 4F2BA 4BZYA 3M0IA 4MG4A 1SZEA 4IG2A 3OVRA 1K7EA 1NQKA 3USZA 1M04A 4JTSA 2WSYA 4BY3A 3H12A 3R0DA 1UD8A 3WDHA 4LT9A 4XTIA 4F9JA 1UUMA 2GWNA 2O7SA 2NVCA 4F2TA 5LSMA 3MUXA 2YOCA 2G97A 3PZQA 1CECA 1A80A 1F73A 2QUUA 2Y24A 4MZ8A 3ORWA 4C7FA 3E0LA 6TIMA 3T2QA 1WV2A 4IP4A 3PWIA 3FV9A 4GO8A 2Y85A 3W71A 4X2RA 3W2JA 3LD5A 1TELA 1T40A 4D8LA 1T8QA 1EYWA 4GQRA 4CGTA 2A7PA 3A3XA 5KZ6A 5C5YA 3B9AA 3HQNA 2AAAA 3FJLA 3MDUA 3OJGA 3IV3A 1OCQA 5KEZA 1T99A 2YPIA 4MAZA 4HYWA 2YBTA 2G96A 3BDKA 4L56A 4RL3A 3W70A 2C18A 3I68A 2E40A 1QNSA 3LN3A 2TODA 3T8LA 4FF7A 4XAFA 4LYPA 4RV8A 1XKJA 1XIMA 5C0QA 1RQHA 2XVNA 1ZJAA 4O11A 5I00A 2KZHA 3N73A 1YYAA 4S3CA 2YL5A 2AKMA 2VVNA 2G3JA 2WK2A 3H22A 2DSZA 5GJMA 1UP2A 2Z1BA 3EWCA 1H61A 2O55A 2CKRA 4QNWA 2XZ9A 3OG2A 2Z7KA 3UZWA 2ZXDA 4I3GA 1JUBA 3R10A 4KRUA 3UWUA 4JQ2A 4Q3MA 1IE7C 1FWJC 3DDMA 1MWOA 4DZ5A 3BUVA 4PMJA 4JOMA 2W66A 4IIGA 2VXNA 1V7AA 3LMYA 3UPMA 1WKEA 3VM5A 2WHJA 1ADDA 3NSMA 1OY0A 3M0JA 1TRIA 4CUCA 3PPCA 1Z7AA 4M6QA 3CUHA 1U1HA 1ZP4A 4ZTXA 1ME8A 4IG2B 3OZOA 4RZ4A 4TOQA 1IEWA 1Q2RA 2BFGA 2BY1A 4QIUA 4H19A 2OGJA 3SIZA 1QR7A 3O6YX 1S2AA 2XIBA 3WUGA 4WJXA 3VPLA 3S42A 4AVFA 1SSGA 2CFFA 2J9XA 3LI1A 4ES4A 2WZEA 3ARUA 4R5EA 2XGBA 5CGQA 1NIUA 1E1CA 2G3FA 3AIEA 3C61A 2I14A 4DUVA 3FDKA 3BZGA 4OUEA 4AD3A 2OB3A 2YA0A 3W6LA 3CAWA 1DHPA 4ZVJA 4M56A 3MI2A 1PB0A 1KM6A 2YW4A 3QGVA 4NZ4A 3RIKA 3CO8A 3DI1A 3QR3A 5HK4A 3TLQA 3UXLA 3HO8A 1RVGA 1EIBA 3CUZA 3AISA 3DHUA 1R3RA 4DYEA 1EUAA 3ZT5A 2BVTA 5M1TA 4H8NA 3WNLA 1DE5A 3EPOA 3TMLA 5HWNA 3TW7A 1NTHA 4P61A 3L5AA 3AIQA 1DXIA 4OOUA 2PDYA 4F66A 5LA1A 3I10A 4N4PA 2PZ0A 3GSMA 4UTFA 2ISVA 4LAKA 2BX7A 4O0QA 1AZ1A 3PUEA 4XZ9A 1S1PA 2QDDA 3N9SA 3NZRA 4HCLA 3GVWA 2F61A 3WBYA 1EEXA 2OYKA 2VCBA 3CNYA 4GI8A 1GKRA 4L9ZA 1W3TA 1JZ4A 3VNDA 1RY8A 4QG8A 3S9YA 1NELA 5C54A 2H9AA 3FS2A 1X1OA 5I77A 4RV3A 1YPXA 1KM2A 4E38A 3O15A 2WMFA 2CHRA 3UYIA 2XU2A 3GXFA 3CAQA 5AYXA 4YS1A 4MJMA 3RPMA 4QLKA 3W88A 2PZNA 2D2OA 5CG7A 2B7QA 4Q7NA 4Y9AA 4M6UA 1WNOA 2WCGA 1TJ0A 3ZFHA 5F2MA 3WQOA 3C8NA 4LUSA 1K8XA 4L4MA 3GC2A 1ZB5A 5I23A 2EG6A 4LX4A 3S2CA 3G8RA 1A47A 5C7HA 1JFHA 3OGSA 3PNZA 5AC4A 2X0YA 3NQ7A 5DELA 3PTKA 5IBXA 3IIPA 3VA8A 2ZYFA 3HU7A 1E1CB 3TXVA 4LAZA 1A3WA 1A0DA 4FHAA 4EF9A 1Z44A 5FF4A 1BPLB 4H6KA 3EX2A 5AC7A 1AW1A 4H9MA 1QT1A 3BAYA 2YKKA 2NSXA 4DRSA 3LOTA 4N7QA 2E7FA 1GEHA 5DLCA 2CWNA 3ZJKA 1SW0A 1YPFA 4C91A 1VFLA 1WKDA 3DFOA 1JZ5A 1LZOA 3UCCA 1H09A 4HA3A 4AF0A 2QCCA 5I79A 4H9ZA 3CTTA 4Z0SA 1EP3A 1P0NA 1T6MA 5AC5A 3ZR6A 4QS6A 3WH5A 2GJPA 4ZMGA 2QJIA 5FEPA 1F76A 4QRNA 4UQ9A 4AFYA 4NJHA 1XINA 4FS9A 3UR8A 2V67A 4HHPA 3TLLA 1YQ2A 1I1XA 3QGKC 4H4IA 5D4YA 2BLEA 4ICNA 2ZUUA 4EWND 1FQ0A 1RCXB 4PCSA 3QOKA 5BWAA 4JN8A 3RHGA 4H3DA 4E0CA 4PUEA 4XX6A 3R8HA 1E6RA 4CCZA 4J40A 4YIWA 4DWDA 1KW1A 4Q8PA 4IGSA 1MEWA 1TMLA 3VI2A 2VDIA 1AK5A 3ABQA 2XDFA 5CZJA 2H9AB 3HMCA 1SFLA 1H1ZA 2YXXA 3EOEA 4YJ5A 3ABOA 4O1EA 3QTPA 3W1LA 3UG5A 1R0MA 1TUXA 3AMGA 3WF4A 4GCXA 1V3LA 3TN5A 1KKRA 3I3DA 2XSXA 3MMUA 3W2NA 4CD7A 2FGLA 1Y5WA 4AEOA 1O5KA 3ARZA 2GOUA 2Y5JA 1WDQA 3R2GA 4WLCA 1QNOA 3UQNA 3SCQA 4LUSB 3TCSA 2WWCA 1I2PA 3KVJA 4FOKA 1DJIA 4Z1YA 2PSNA 4IZGA 3HOJA 2VR5A 1GQLA 4GZIA 2F6XA 3CXOA 4ACYA 2NQZA 4DYJA 1BKSA 4IHCA 3M7SA 4KWOA 4O15A 4YXGA 4LALA 2O9TA 2ZZ7A 3FEQA 3LUTA 1H63A 4JKMA 3B8DA 3AHXA 2XINA 5GJPA 3ATZA 3DFTA 2X1TA 1TA3A 1D7FA 4HIBA 3JUGA 2OMAA 3M0YA 3ZIZA 4U4MA 2QEZA 3G8EA 5E93A 2NXGA 2PLKA 4RW3A 1CI1A 4AF0B 3L4XA 3H6OA 4Z2JA 2V5JA 3H2CA 3GO2A 3R0KA 1XLEA 2VO5A 1RUSA 5I03A 4LV9A 1EGVA 3UNTA 3K4WA 1WBHA 5A8PA 1Q8JA 1ECQA 4K7YA 4W7UA 3NFUA 1P6CA 4LRTA 3CV7A 3WEZA 4EP8C 1F05A 3WF0A 4A35A 4NNAA 1C9WA 5HQEA 4AZCA 4C6BA 1V5XA 3U9IA 5DT5A 4GY1A 5TNVA 3QSTA 3GHUA 2IPGA 3OHMB 3NEHA 1GKQA 1L2UA 4EVZA 4Q6JA 3U8GA 2ZADA 3KBJA 5C71A 2VGFA 3NSNA 3PPHA 3GHRA 4FP1A 4MB3A 5K9CA 4DJDD 4HNOA 1JPHA 4I9AA 3BAWA 3AXKA 4UTLA 1TQJA 1F8MA 2G3MA 2YZRA 3FJ4A 5HNNA 3SRFA 1EP1A 3QXBA 1AW2A 3RRAA 4K36A 3DYMA 3AHTA 4MPQA 4D8ZA 4RDVA 5A6AA 3KL0A 1BYAA 5DBTA 3EOUA 3GFZA 1R6WA 4W7VA 4O16A 1W32A 4KKXA 3E02A 1YIXA 4GXMA 4NIRA 2J6VA 4HSNA 4WKHA 4YYFA 2OT1A 4NSBA 2NX3A 5D2WA 1V8EA 3PR2A 1PJ9A 2C15A 3ARSA 3BH4A 4Q4QA 4UFKA 4Y6GA 3PJUA 2C8NA 1MFUA 1ZALA 4FXFA 3QZAA 2J4GA 1EA0A 4JFVA 1B0IA 4HTBA 1GVRA 3WQ6A 4JN6A 3TR9A 5G4EA 2R82A 3JS3A 1I2OA 2D3LA 5BZAA 5JMUA 1LLWA 5I3IA 1ENUA 4FLRA 4F3HA 3HG5A 2FKPA 1JYVA 1JGMA 2QGYA 6XIAA 2EQDA 3P60A 3MKKA 4UTMA 3WQEA 2CLHA 5A8QA 3T4WA 3RX4A 1GUVA 5H8PA 3C0SA 5MHBA 4GY0A 1K6AA 3OB8A 4N6FA 2W27A 4W93A 4L6HA 3T1GA 4HNCA 3DFNA 3GBDA 1BF6A 3KXQA 1YE6A 3S4TA 1GONA 5CC6A 4KFPA 4J3SA 1X39A 3CWHA 1SM9A 1TWIA 4NZ5A 1DIEA 2DUAA 2Y63A 2J88A 5E70A 3MUIA 2XIMA 1VGAA 2ICSA 2A3BA 2PS2A 2ZTJA 4QBXA 2DSKA 1WUEA 1KC7A 5F4WA 4XK2A 5DXYA 4NRRA 1HJSA 1TCDA 1DJNA 3G0XA 2R9RA 4GJIA 3PFMA 4PTVA 4AZCB 3GNXA 4ADSA 3H2OA 1EDGA 5JU6A 3O0FA 3WK3A 3KL5A 1EGZA 1M03A 2VT0A 3NTYA 3R8RA 2DZXA 1ISWA 3WX7A 4KEMA 3TYAA 3UBPC 1U83A 3C3NA 5AHNA 4NI3A 4NKCA 3CGTA 3CL6A 2XHYA 2WZHA 2ZUVA 1GYNA 4Q8NA 5CJ5A 1CT5A 4R3UA 2J78A 3N34A 1HT6A 1DJXA 4A8LA 3S6DA 1PWMA 3TE9A 1LCOA 3WBAA 1BEUA 1VPQA 5LNSA 4GUJA 2E6DA 4PUJA 3YPIA 4WZHA 2D73A 3OLIA 4KETA 2OKTA 4TIMA 3MZNA 1N8FA 2OQHA 5I2UA 1PTDA 1LOSA 4NVTA 1LBLA 1VFOA 2UY2A 2FZDA 1E9LA 4XZNX 1DEDA 1MXSA 4MLRA 3L4YA 4S3BA 3SBFA 2H3BA 1TPVA 4M8UA 1XS2A 1G01A 1H5VA 4K68A 2VUNA 3EXSA 1LQ2A 3MJMA 4ZGYA 1WDPA 4ZQRA 4ZOBA 5BXRA 1SGJA 4PN2A 2I5GA 3EKZA 1XYFA 3NURA 1L8PA 3GR4A 1HJUA 4CNTA 3TW6A 2B7OA 1V6UA 1FH8A 1QNRA 2ZRYA 3A4XA 5T26A 1IT0A 2J25A 1TIWA 5CSSA 1HP5A 2PDUA 1UD2A 3U57A 1R3VA 3VOGA 5A6MA 4C6EA 3W0KA 4QG9A 2WVSA 1V3MA 1IF2A 3LPPA 3JVAA 5H6HA 1HFBA 1KM5A 3W27A 4AX7A 5I0DA 1GVIA 4MKSA 2FHCA 4P2VA 1Q7QA 1R30A 4WDUA 1EOMA 4M1BA 4QFUA 3VC5A 3EX6A 4HCDA 4W7WA 3KM8A 1TX2A 4PMVA 1C8VA 1UBSA 3SFKA 3M16A 1D3HA 4LVFA 4MUZA 1B3YA 2R24A 1OX6A 1XYZA 4CVUA 3IJDA 1DOSA 3NYZA 1NOFA 1WDWA 2WPBA 2GSHA 1R5YA 5JVLA 4Q7BA 3VKCA 2PBOA 4K37A 4Y9NA 4PH6A 4IIHA 2VFFA 3QN3A 1OC5A 1YEYA 1OYAA 3AFBA 4OU1A 3CQIA 4EWJA 3IUDA 3W1UA 3LK6A 4B4HA 3CUGA 3W83A 1GVQA 3IIZA 1UMLA 3PG9A 2YYTA 3C52A 2NUWA 2P8BA 4H41A 3UVAA 3A13A 1W5MA 4AIOA 1R85A 4MAVA 4D6HA 1BSLA 4H6QA 1F9CA 4FR6A 4JX6A 3I4EA 3MYPA 3ZYZA 4M0XA 4JTDA 5BXSA 4GACA 1I6NA 3CAVA 4O4VA 7TIMA 3CIXA 1HVQA 1JRBA 1UQYA 1E0VA 3WNPA 1M5WA 1XRTA 4FX7A 4PGLA 3I3EA 3SADA 2GUUA 1LRQA 1V6VA 1FCQA 4BEUA 5TD4A 3CHEA 4GUFA 4E3TA 4AC7C 1ZFJA 3IRDA 3AO0A 3SSZA 1UWRA 2XN1A 1M1BA 4H9XA 4LS2A 4F8XA 3S1VA 5K2ZA 1EJSC 3W72A 3A6OA 4FMVA 4JIEA 2WWDA 4AZIA 1Q6FA 4DJFC 3VOIA 5CG0A 1TG7A 1K77A 4KGJA 2GGJA 5EGRA 3DG7A 1E4MM 1U5HA 2QJHA 1XH0A 1JNDA 1XBVA 1CZ1A 4BJHA 3GUWA 3UERA 1WZAA 3A9BA 3LBCA 3U2EA 1ZPTA 2JKAA 3CHDA 1YDNA 1KD0A 2FZMA 2OLAA 4FXSA 3II1A 4TX8A 2ZUMA 5FAGA 3KVLA 3TC7A 3T08A 4EPBC 4M82A 5HAOA 4H1ZA 1A0CA 1NDZA 2VEGA 4LSBA 1H49A 1KFEA 1LLOA 4HMCA 1YTDA 1Y5XA 3JW7A 1RV8A 2ABAA 2X7WA 4GISA 4TU1A 1TR9A 1UW9A 3N2OA 3IVUA 1T7LA 1KBJA 2DIEA 2OPJA 2XN0A 4HHHA 4GFSA 3MP5A 3W7PA 1UP3A 4FF5A 3LQLA 3RLHA 3AXIA 1QNVA 1XCXA 1XIEA 3F4CA 4L5ZA 1J18A 4ML4A 3BMVA 3U6WA 3SW6A 5T9CE 4AYSA 3GVVA 4IFKA 1Q2SA 4RZBA 1W9DM 2CHNA 4HPHA 2BOFX 4DIAA 5CLWA 1IR2A 5KZEA 4MWAC 3K13A 4JX4A 1RQBA 2PDBA 4DO4A 4UTKA 3WLIA 3C0LA 3UEQA 5I07A 5I78A 4RK8A 2EPOA 3C2EA 2X41A 2Y89A 1HKKA 5AHLA 4GE8A 4B91A 3E9AA 4A8NA 4CCEA 1JF6A 4MDOA 4Z17A 1UA3A 3FYOA 5I3FA 1ZAHA 1JPDX 4UTIA 1X7FA 5LIYX 4ONVA 4F0LA 4NG3A 4PTWA 4DVOA 1OIFA 2ISWA 4AEEA 3KCJA 3VUSA 1EQCA 5D30A 2FTWA 1EPVA 2F7FA 3H2MA 2QJJA 1B3WA 1OFEA 2CZVA 3U2CA 2BXZA 2VL4A 1W54A 4C1NA 2VRQA 4UFHA 3APGA 4H7VA 3ABZA 2J74A 4FSAA 3VNYA 4HNUA 2JKEA 4DQWA 3V0UA 1FDYA 2QUMA 2YR1A 1WZLA 5CGTA 5GPRA 1A5BA 1K8ZA 2PTZA 1SSDA 3KLLA 5U7SA 5LIXX 6TAAA 1Q6LA 4E3VA 3P3BA 2Y8UA 3F4VA 1OYBA 1LTDA 4HCHA 3NQGA 3MMWA 2PD5A 4CD6A 2WLYA 3VO0A 1JGIA 1SZGA 4IMFA 3W7HA 3R79A 2E9BA 4AMCA 4R7WA 3BW2A 2OFJA 1GVEA 3E0FA 2B31A 3ANYA 1FWGC 2Z2BA 7ENLA 5BXTA 1Q5MA 3DYPA 4IFKB 5CQ1A 4UMCA 1LBMA 1RLDA 1E9IA 2WKGA 2WC7A 4HMNA 1XICA 3N25A 2RUSA 4ZXLA 1R3WA 4Q8QA 1XW8A 1LQAA 4LUYA 2CIPA 3CUXA 3MVIA 4RZ5A 4C60A 5A2BA 1XV8A 2XIIA 1T0OA 3M5YA 3AZTA 3VINA 3ECQA 3GTHA 4PSRA 1POKA 3WNOA 1A5NC 3L4ZA 3PJTA 4O28A 7A3HA 4NXKA 3S8HA 3IJ9A 4XO7A 1ADSA 1BVZA 4OWGA 3TDFA 3W73A 1ZL1A 1XPYA 2QVHA 1OG6A 3A3WA 5LYRA 3W2LA 3ONBA 2HE8A 4AIEA 2HISA 1JPIA 3GS6A 2H8XA 4BWLA 4S2BA 4OQVA 1FWRA 1GK8A 4I9TA 3CUJA 3PZIA 4L64A 3KOXA 2VC6A 3IVSA 3SCTA 5BCAA 1B3OA 3JR2A 2OO6A 5HDRA 3CUIA 2HMCA 5FSDC 1BWVA 1PZ0A 1EJTC 3W1PA 3M5XA 3UXKA 3WLOA 1TJ1A 3L21A 4J3ZA 4IQLA 1W6TA 3ABSA 4TVUA 1PZ3A 2XTKA 2TMDA 3NO3A 5L6UA 1FY6A 4IQEA 3W1RA 5G2HA 3WJXA 3ZJ7A 4XD6A 3T2OA 5K4ZA 3OVGA 2Z24A 3C2YA 1JNEA 1Q65A 4WSKA 3P8JA 2PDPA 3V16A 5AZ1A 4WGXA 5E9XA 1R47A 2A21A 1O66A 1V02E 3E2SA 2GFTA 5HUPA 3M5VA 4G1KA 1E4IA 3WLSA 5C2GA 2P88A 3OGVA 2QUNA 1JR1A 4QXIA 3GB6A 2NQLA 1GVYA 3S1UA 4WK9A 1F4HA 4GYFA 2Z1WA 3ABRA 8XIAA 4F79A 1XD0A 1ZJHA 1PTAA 4I6VA 2BGQA 1VLWA 4LWWA 2VX4A 4LUTA 1JCMP 3BGAA 4NJJA 4NJIA 5CPOA 4DF1A 4V15A 3TJXA 1G0CA 3NNTA 4P8WA 1VZWA 2FIQA 2XISA 1W8SA 1ISYA 3TYBA 2F84A 3ENLA 1TWZA 4UOJA 4MMWA 3WUBA 4HNVA 2X1IA 3O3RA 1ZGDA 1JAEA 1EJ7L 2D3NA 2YDAA 3AHZA 1F2JA 4HN8A 3IAPA 1LOQA 2ACSA 2V5KA 2EPMX 3K2GA 3ZOAA 1M68A 2PB1A 2EKGA 2WO5A 4AZBA 3Q2DA 5FSEC 1YKWA 3A23A 4J4KA 3GDBA 1EA9C 4JS3A 3HGOA 1VFMA 1ZNNA 1NAL1 1S2UA 4QGCA 1QW7A 3A3HA 4DN1A 3HJEA 3O6AA 1A53A 4AQLA 1QDSA 2VD9A 4R53A 1EOKA 3CQJA 4LQ1A 4B5UA 1Q8AA 5B7YA 2V82A 1B2YA 3M9YA 1CXEA 3BMWA 5DX7A 4Z2KA 4LB3A 5CZKA 5BOOA 4LAUA 4PMYA 1A5UA 3KDOA 1FBAA 3AU2A 5HMEA 5CPQA 3FFSA 1JDDA 3NPVA 1J5TA 2NWRA 4OVXA 3STCA 4ZOEA 4UOQA 1U5JA 2D20A 4ZB0A 1E6ZA 2V5BA 1E43A 4Q8VA 1V0MA 3HQ1A 2NQJA 1G4SA 4X9SA 5E1QA 4FB7A 2A79A 3W1AA 3W82A 3V3WA 1B4KA 3L2MA 4ATDA 3HPSA 1OFPA 3E49A 4UZSA 3N6QA 1QOPA 2V5CA 2Q71A 3V0SA 3SUTA 4A05A 3L67A 4CNNA 1JDAA 3LPOA 3O6DA 4HZ8A 5C9ZA 1PKNA 4GQ0A 3EWBX 3PF3A 1W2PA 3DBNA 4QEHA 4E4UA 3LTSA 1PV8A 3SI9A 3UWQA 5M2FX 4FLQA 4JQ4A 4EX4A 1VYSX 5KETA 4XAYA 4JTTA 4WVXA 2JE8A 2VELA 4DXKA 3AHYA 1BYCA 4HHLA 1X1NA 4QTGA 1U1JA 4OIFA 1QBBA 1ZAJA 4AD4A 4LUTB 2GOKA 2ISSA 1EQPA 4ZO9A 3LDVA 3QTGA 4PCFA 4WIWA 3QR1A 1XLMA 3ICJA 2Z2AA 2IKGA 1W37A 2UWFA 3NDZA 5CZSA 2IS7A 4B2DD 3H2NA 3T8QA 4YCPA 1Z6KA 2V2DA 4M80A 3HTWA 4GYJA 1JYNA 1JRCA 4LUJA 5J8LA 5H8MA 4JAWA 3BAIA 4JY9A 1UZ4A 4O0ZA 3LLFA 3MUCA 2UV8G 3LU2A 1Z41A 5EKYA 2BHYA 1XBZA 3IK2A 5D37A 2RH9A 3BLKA 2GYIA 3G5EA 2WHKA 3FN9A 4WHBA 5GNZA 1NVMA 4ERAA 3D5HA 2KX9A 1R2SA 2ZDSA 1W9XA 3BQ6A 2O92A 2WVTA 1NF7A 4IMEA 4P7RA 4HP5A 1B9ZA 8CGTA 3GE7A 4C6PA 4JCMA 2BDQA 1IWBA 4LC8A 4JIRA 2HEJA 1H7NA 1XCWA 3P81A 5MF5A 1PPIA 1MZHA 2POZA 2VJXA 1C8QA 1LP6A 3T07A 2FDSA 5CAKA 1F7BA 3FSTA 1RBLA 1A5CA 4QJ4B 4RNHA 3UF9A 3IS4A 3A12A 4HU0A 1HKVA 1DORA 1C29A 3MU7A 1AL8A 4RJEA 3VCRA 1DWIM 4ZZ9A 3L2IA 3S5ZA 1ZJIA 2RDTA 3N04A 5A69A 3A9IA 1E0WA 1AH4A 4NL1A 1FWDC 5D32A 2AMGA 2FFIA 1OJXA 2P8CA 3R25A 4L6OA 1XFBA 3RLVA 3M0LA 2TYSA 4EAMA 1U22A 5I3GA 3RF9A 3F5KA 1D3CA 3DGBA 3CASA 4D72A 3VDGA 3VOJA 5H91A 4CNUA 4OUIA 2ZX8A 2ZZ1A 1LL4A 3LLDA 1E51A 3M6YA 4ICCX 1GJUA 3W38A 1MYRA 3NQDA 3GU1A 3MKCA 1D8WA 5TBOA 3AXHA 5G1MA 2IUZA 2V3EA 1HXJA 4GIEA 5EBAA 1JYWA 4QE5A 2DVXA 4PYSA 2D24A 4TMCA 3VOHA 4UTJA 3FKRA 1EZ2A 3GAYA 5LKYA 1FWBC 3D46A 4HOWA 1Z9AA 3LHTA 1IZKA 4YVPA 4WD0A 1FFRA 3N3TA 2A2IA 1ITUA 2HPMA 5E0KA 2HPIA 4AY1A 1QATA 4UMAA 4R85A 2D0HA 3AMDA 3NVDA 1TPEA 1AH0A 2Q3RA 2ZX5A 3QY7A 1P0EA 2XIOA 1X6UA 2WHMA 2YYUA 4IISA 3EPNA 4WX2A 5I02A 3WELA 1FVPA 1UZ1A 4EPEC 3CMJA 4MOZA 4V27A 4D9PA 4JHOA 1NDWA 3HV9A 4U2YA 1JZ6A 3M5ZA 3A24A 2XFYA 3C0JA 1M41A 2VVSA 3JRKA 2R1NA 1RBOB 3TN3A 5KINA 2MUCA 1JPKA 3B0XA 1GJPA 3L2LA 3CMFA 1TUFA 2HS6A 3WQWA 4AH7A 2QNEA 3DFSA 3UYCA 1SO3A 3WQDA 1CGUA 3CS2A 4DM2A 3UPBA 3BZJA 3BAXA 2NUYA 5FJRA 4YTTA 3L23A 4QE1A 2PDLA 1DJQA 1H7XA 1LG1A 1GYLA 4N9EA 4OV4A 1VP5A 1XRVA 3PZUA 2YJQA 2G37A 3EXRA 2G4JA 1Z32X 5LNWA 4DXXA 4MM1A 1TV5A 3B4YA 3M1ZA 4K8HA 3UZXA 2ZWYA 1C93A 1W91A 1XC4A 1NFBA 1V51A 4EPDC 2IPJA 4M6PA 1ITCA 1ELSA 1V08A 1TPFA 2HTMA 2HVNA 3GKFA 3UJSA 4LVAA 3WD0A 3WLKX 5J5DA 3IIOA 1W5QA 3QQ0A 4H6RA 4IL0A 1HIZA 3UJ2A 1I9CB 3CM4A 1KWKA 3KZSA 4GQGA 1KM3A 4GOAA 4UTWC 2ADAA 1PIFA 4Y2WA 2PMQA 1JDEA 5I7GA 2GVGA 3VZZA 1R38A 3MPGA 3QKEA 4NJGA 3L12A 3S5YA 4BKNA 4RNIA 2OXNA 2HBVA 1X6LA 3B97A 3BOFA 2WVVA 3L4WA 4Z42C 3N13A 1E73M 2ATSA 3G24A 2VR2A 1TR1A 4QP0A 4IP5A 3DYOA 4N2YA 3PUDA 3KBVA 2QDHA 5EYWA 2O0TA 3ZZ1A 1XP3A 1E0XA 1JQXA 2IQ0A 4LC6A 3U4AA 1GQJA 3W1TA 1XUZA 3OLGA 3MCNA 3W7GA 3LTYA 3SB0A 3UR2A 2OJPA 4PSPA 3KRZA 3CAKA 2AMXA 1XH2A 1ICQA 1XR2A 1AMKA 2PDCA 3VKBA 5E09A 1P4CA 4HSOA 1FWSA 1EP2A 1W31A 4RPQA 4DB7A 1HVXA 3HPXA 1QRQA 4H7CA 4UNIA 1WXYA 1SMAA 1NOWA 1XLLA 2PUZA 3TNBA 2H8ZA 3QMSA 4INFA 1Y8BA 2WSQA 3P5ZA 2TRSA 2ZRUA 3QY8A 2I17A 4WRHA 4O13A 3CPGA 3TONA 2PWDA 4XAPA 4UTUA 4AZGA 5CPNA 5CPTA 3UESA 1XD1A 2ACRA 1HQTA 3KOYA 4H9TA 3DEQA 4K39A 1AH3A 1V7YA 2ZUSA 3OYZA 4XKMA 5D9NA 1DIOA 2A3CA 1SZRA 2PU1A 3H4WA 1VFFA 2PTXA 2PWUA 1CGWA 2C79A 2WV8A 4P7LA 3RCMA 3PNUA 4KPLA 4XBKA 3MMDA 2QCLA 4NYUA 4A21A 2PWHA 3BAJA 4I5RA 1DJHA 1MW0A 1E56A 2E5BA 1T8XA 5H8UA 4O1AA 3HURA 3KP1A 1B30A 1RHCA 2VHLA 3JZEA 4ZQPA 2Z28A 2WMHA 6ENLA 3Q45A 3GVRA 1PKYA 2GGHA 1OX5A 2ZDRA 4K1WA 1CXLA 5BU6A 3IANA 5HJXA 1TZ7A 3VKAA 4QCFA 2PRMA 4HZ6A 2WVVB 1B5TA 4RCXA 2PEVA 1Q6OA 5EB8A 5JBDA 3BE7A 2NX9A 5A6BA 4R9OA 1RJRA 3TW9A 2QV5A 1IZJA 1Q4NX 2XSBA 1KA9F 3TFXA 4WKFA 1L6SA 4A3YA 3LQGA 1SQ7A 2NV9A 2VGGA 3GG8A 4EPKA 4DPPA 5FJPA 2PF0A 2EKCA 2CETA 4UNKA 1QWKA 5BOEA 1UWAA 4KWUA 3VIOA 2V3DA 1ISZA 3D3FA 3FDGA 4QLLA 4HA1A 2RJHA 2PFHA 3WDPP 1CLKA 4E4PA 4D6CA 5BMWA 5A6TC 3TX9A 3CT2A 4S39A 4RUBA 2BHUA 3S5SA 1EX5A 3R12A 3QF0A 2UY3A 4GC4A 3W6MA 1MUWA 3GTXA 3POCA 4FIRA 1XX1A 1Q6EA 3THUA 4DWSC 4S3DA 1P0DA 2EF9A 3HFYA 3AU6A 4A3UA 1G9HA 1I2RA 3SDOA 3SCPA 3RR4A 5LXEA 1EDQA 4GX9A 1RBAA 3KRSA 1J0KA 3W7MA 4PBFA 4S3KA 3E0VA 1MRAA 4CD4A 1WO2A 3QQWA 2QJNA 3CB3A 3B03A 3WLLA 4GGHA 1VHNA 4AXKA 3SJ3A 3RMEA 3A4AA 5LHFA 1KTCA 3W86A 1W1IE 2GSJA 5E6YA 2ISDA 4GNKB 4KCUA 1NU5A 3APYA 4BQ5A 3V5FA 1CENA 5FACA 4JTEA 3SR7A 3LCHA 1PYFA 2CLIA 4RE2A 4DYKA 3ARTA 3PZ9A 4J3WA 1E40A 1LRNA 3QYQA 3KBWA 1CLVA 1K9FA 3XISA 3KW3A 4PULA 1QNPA 2BBFA 2WAGA 2OSWA 3LA4A 3W6YA 1UR3M 1G6CA 1UPPA 3U0HA 1YDOA 1FHLA 2VNCA 5EFFA 3W2MA 5JXQA 2OSXA 5CXPA 2PODA 2YW3A 3CPRA 1OX4A 4HYVA 3BGJA 3B06A 1ESWA 4CQ8A 2J77A 5LIWX 1MO0A 4L1WA 4KQNA 2W61A 3HGRA 3DI0A 3DUGA 4WQ6A 4GO9A 3W7CA 4AZ7A 3R7MA 4AW7A 3EKLA 2VRJA 2CXEA 1N82A 1XFCA 4JNYA 3WF1A 4B90A 2VC7A 1LWIA 1CGVA 3GNNA 3CHVA 5A2AA 1DVJA 1CEOA 1BYBA 1P48A 4KEUA 1PIGA 3C0QA 3LTPA 4K1GA 3GXIA 3CPUA 4TUFA 5A8OA 4OBRA 1WPCA 2ZC8A 4PMDA 1QPKA 3MC5A 3MHFA 4NX0A 3HB9A 4IIEA 4D6JA 4DZAA 2P1FA 3URNA 4CEXC 3VYLA 3TYDA 4EANA 2JGQA 2DZVA 2PBGA 3NO5A 3GK0A 3G18A 3MP4A 1XCFA 5F4SA 4YMZA 1UBPC 3W87A 2OKOA 1RD6A 3SRKA 1DJYA 3AMCA 1J01A 1SO5A 2PRLA 1V93A 3PBVA 1F3WA 1B9BA 2WSRA 4M6VA 3T78A 4D1IA 3VGGA 3Q58A 4JTLA 4KCWA 1R87A 3A4WA 3KRUA 3ARVA 2VUYA 3THQA 3N9KA 3GG7A 2WMJA 3VD5A 4IMCA 3WUEA 1AJ2A 4RXGA 3TOYA 4A3QA 3G1FA 1OABA 4QHRA 4BQ3A 3R1ZA 4JTCA 4PMZA 2FPTA 3TA9A 3B8VA 3UA3A 3PUOA 4N0RA 2WC4A 2X05A 3WKZA 4Z1BA 1XI3A 4PCTA 4E2OA 3WH8A 2VEFA 3BW3A 1KRCC 2VKZG 1OM0A 3QLDA 5HATA 2ZWZA 4QX4A 4NP7A 4BCEA 1PHWA 2PCQA 3BLDA 1WYIA 3U2ZA 2BGNE 1VCVA 5BU9A 3N1AA 4ORIA 1UR1A 1MEHA 1OX4B 3KHJA 4D6EA 4AZ6A 1SFTA 4JIPA 1JXJA 2A0NA 3OBEA 4H8VA 3TFCA 1SVDA 2Y62A 1TMHA 1TTJA 1UH4A 3ARXA 3TVAA 1J6OA 2Y7FA 3E2RA 4IX2A 4DJFA 3TJIA 4HOXA 2Y0FA 3Q65A 5EBUA 4WY0A 5BYWA 4O1BA 3LNPA 3PB2A 2GDUA 1VQTA 2PDKA 2Y7GA 1V6TA 5BRBA 3DERA 1OCJA 4LYKA 4A3RA 5PTDA 1G67A 3EKGA 3RR1A 1HJXA 4HNTA 3M7WA 3OQ8A 1RY0A 4RR4A 3VKKA 4KESA 1QW9A 3CC1A 2FQIA 3ZLHA 3TAOA 5FEZA 2TAAA 3V1HA 3L5MA 1RPKA 5K7JA 1FCVA 3B9DA 4L80A 1CYGA 4I90A 9XIMA 4J28A 4BHYA 5A6SA 3N3MA 3SGZA 3SCRA 3POHA 3LERA 3URBA 1QI5A 4XQ6A 3UR7A 1O60A 4C6IA 3FYYA 2R1MA 3CLWA 4NZ1A 2OU4A 1YE4A 2VZUA 2GJXA 3P67A 2GL5A 1W1TA 3T40A 1V79A 3AIBA 4B15A 5HINA 2FMNA 4TO8A 3W7KA 1QBAA 1US0A 3KRBA 1GHSA 3MI3A 4JTUA 3VABA 4ZFMA 1SPQA 1FHVA 3UZZA 4F0SA 4MWAA 2WMIA 1XIHA 1NP0A 1MDRA 3PS7A 1RALA 3VMOA 5CCZA 1OG0A 3VNLA 4CD8A 3QBUA 4ZCWA 4OT7A 3TYUA 1F6YA 3MCOA 2F6UA 3BL3A 1O95A 3P2VA 4C90A 1P0KA 4U28A 4JTHA 3P0XA 4AY7A 2MANA 1HNYA 3AQUA 3VDHA 2OZ0A 4MKVA 1JZ3A 3O9NA 1PZ1A 4E8GA 3P6LA 2ZXQA 1LL7A 4W5ZA 5D2YA 1AQMA 1KLYA 1K8YA 4PCNA 3QHOA 1I0DA 3AZRA 3TQKA 5F2IA 3NL3A 4FOUA 3LRMA 4V1YA 4AVNA 1P0BA 3EMQA 2IKHA 4X22A 4UZUA 2OR2A 1FA2A 3VDAA 3PBMA 2PTDA 2VFIA 3TN4A 5ENLA 3PVFA 4P8VA 4NT0A 4IQDA 3PPFA 3NA8A 3QY6A 2OODA 3VIKA 1ALDA 1HKWA 1JL8A 3CLMA 3BLOA 4ML9A 2J8TA 2GQ8A 2FGBA 3OTRA 3H4GA 3M0VA 4Y90A 3VUPA 1XM3A 1I2QA 3P82A 2JGYA 2VTFA 1R3QA 3GUGA 1MQRA 4KCVA 3LCGA 4MYAA 4Q33A 1CB2A 3SUSA 3N11A 3PZTA 3LCIA 3ZWSA 2DVTA 5F4XA 2BOEX 4RLIA 3WJSA 3ELFA 3E12A 1F6PA 3GXDA 3K5XA 3TWBA 1OGBA 1QUMA 4ZO6A 3PZMA 1RA5A 1RZMA 3W00A 4GBUA 1OK6A 2GGGA 2OZTA 4O50A 1TB3A 2P3ZA 3SCOA 4GRSA 5DQPA 2GJXB 5LIUX 3EDKA 4RZ6A 4BI7A 3W7OA 3WZ0E 3CIWA 1KNWA 2BTMA 4V1XA 3LGEA 3SCSA 5EMMA 4JEQA 4UWMA 3LRKA 2W3ZA 3FCPA 1G94A 1EH9A 3TNOA 3F4NA 3RPTA 4MWAB 2WB5A 2WMIB 3BG9A 1SJCA 1D9EA 5AYIA 5M5DA 1H62A 1S39A 1E4NA 3KBMA 3GH4A 4R34A 2ZQ0A 1LWJA 4MZYA 2POTA 3QSRA 1E6SM 4OJYA 1FUYA 4FNQA 3MQTA 1R46A 3PSVA 2CEQA 1KTNA 1MUMA 3MHUA 4O17A 1XC6A 2PC4A 4PCPA 3XIMA 2JALA 1PYMA 4FNRA 3CB8A 4Z0JA 2D2GA 5M3WA 3AYSA 1S3HA 1OINA 1GOKA 1A5OC 2Y7DA 5ECVA 4P8UA 3VIIA 1NEYA 1IXNA 4H8HA 3MYOA 1EBHA 4QNEA 4AD5A 1AD1A 1MQQA 4QEEA 2WW5A 5DMNA 1VEOA 2J7CA 4ZE4A 1XLDA 5IHRA 4KWWA 1CXF