2ISSA

Structure of the plp synthase holoenzyme from thermotoga maritima
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
281
structure length
281
Chain Sequence
HMEIKKGTWIIKKGFAEMFKGGVIMDVTSAEQAKIAEEAGAVAVMALERVPADIRKEGGVARMASIAKIREIMEAVSIPVMAKVRIGHIAEAKILEELGVDFIDESEVLTPADDRFHINKHEFKVPFVCGARDLGEALRRIAEGAAMIRTKGEAGTGNVVEAVKHMRRVMEQIKQVTKMEDEELVAYGKEIGAPVELLREVKRLGRLPVVNFAAGGVATPADAALMMMLGADGVFVGSGIFKSKDPRKMAKAMVLAVTYWDNPRILLKISEDIGEPMRGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal biosynthesis lyase pdxS
publication title Structural Insights into the Mechanism of the PLP Synthase Holoenzyme from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase, transferase
total genus 94
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2issA00
3SGUA 4ZQOA 1TV8A 3OEXA 1KM1A 3TROA 3A5FA 5TIMA 1TMHA 3HGRA 2NUYA 1LYXA 3ATYA 2C15A 4GE8A 3M5VA 3HPZA 1LBLA 3KRSA 3NG3A 5C54A 4Y96A 4N02A 1SQ7A 5KZMA 1N55A 4O12A 1XUZA 5CZSA 3H53A 4O1DA 4UNLA 1KM6A 1PS9A 1WQ5A 2D73A 5GVJA 1ICQA 2QF7A 1A5CA 3P62A 4O1AA 3LM7A 1F2JA 2TPSA 3GKAA 4HHPA 3TJLA 5D30A 3PSVA 3P74A 4XWUA 1F6KA 1GWJA 2VFIA 2EGZA 3LTYA 3O63A 4Z1BA 3KFTA 3W7JA 3UWVA 5EMUA 4OGZA 1G6CA 5G4WA 1N8FA 1UCWA 1TIMA 4UTMA 4LUJA 4LVAA 5AC7A 3BV4A 4FNRA 2QKFA 3M47A 3W3OA 4FIQA 3TCEA 5TQLA 2ZZ7A 4BI5A 3QQ0A 1W5QA 2DORA 4UTIA 4LU0A 2ZRXA 4QSHA 2PRLA 4R33A 1T0OA 3CPRA 4JTLA 2V2CA 3ABQA 3GDRA 1ZFJA 1EWDA 1R46A 3STCA 2RFGA 1DJQA 1OFRA 1XKYA 3I7QA 4UMBA 3W1TA 4GUHA 2ZRWA 3MI6A 2WJZA 2YXGA 5G1TA 3S8HA 1QO2A 1P1XA 5DXYA 1LRNA 1WA3A 1H7RA 3PBUA 4N9CA 4K8EA 4AF0A 2WNNA 3QSRA 4LC6A 3HGOA 3NO5A 4RK8A 5FF4A 4K38A 3LCGA 3LHUA 3O07A 4LY8A 5J5DA 3CC1A 1J4EA 4AEOA 3L0KA 4BI7A 1K3UA 3QW4B 3NPWA 2CWNA 3N19B 3C2FA 5E93A 1LORA 4FNQA 4EVZA 4HNTA 1X1ZA 3H54A 3SI9A 2QEZA 3LI1A 2G96A 3SJ3A 2GOUA 5DN1A 4GRSA 2V5BA 4PL2A 5K4XA 3DFPA 5LGZA 2V2DA 4GUFA 3WJXA 3UZ5A 3EWXA 1ZHAA 1B3OA 4HNUA 2H90A 1TV7A 4JN6A 4WD0A 3W7CA 2ZZ2A 4RZ4A 1GEQA 3TK7A 1I8JA 1QMLA 4UFJA 2OT1A 4FHAA 4JTTA 1BTMA 4O8RA 4RX0A 5H91A 1I2OA 2A7RA 5SWUA 5L6UA 3W7RA 4JTHA 3OIXA 3WJSA 1JRBA 4FNSA 3A21A 5AHMA 2GQAA 5AHNA 5K9CA 2E6YA 2Z6IA 3YPIA 4XKYB 5EYWA 2ZRZA 1WBHA 3VFLA 3TSBA 1CX9A 3GDTA 1BWLA 2BLEA 3TKFA 5D09A 1KFJA 2C18A 3TMLA 2WNZA 3R13A 4U4MA 3TH6A 4FB7A 4CNNA 1GJPA 4NJKA 4UXDA 1G4SA 4GC4A 3DH7A 1A50A 3EWUA 1KLYA 4CQAA 3W1QA 2FB3A 5CZ0A 4KFPA 4UCGA 1VCGA 1FBAA 3SGZA 1MEHA 2TSYA 5LSMA 1QCWA 3ABRA 3MBDA 3GR8A 3HPXA 1FCUA 3M43A 4UC5A 4WX2A 2V8ZA 3C61A 2QJIA 1S5VA 2CLIA 1THFD 3A23A 3PUOA 3HGSA 2Y7FA 5D2TA 2QAPA 3R8RA 1YADA 3C56A 1XDMA 5CKSA 1UUOA 3QF0A 4WY0A 1YPFA 5AYXA 1O60A 3RLVA 3R89A 1V5XA 2GQ9A 1JCLA 1EX5A 1JCYA 2BXVA 2WQPA 3KVMA 4WOQA 4ZZ9A 4NXSA 1SSDA 3MMTA 4HPXA 3DZ1A 3OHIA 1XL9A 3C2RA 3VE7A 5KITA 2NLIA 4UTWA 5D38A 4M6PA 1W54A 3EX2A 5HINA 4HPJA 2C6QA 3LLFA 3P84A 4JGDA 5FEXA 4YMZA 1DV7A 1NF7A 1SFJA 2C19A 4O1CA 5CPLA 5LZLA 3EB2A 2FJKA 3SECA 3UD6A 1B9BA 2WO5A 3QMTA 5KZDA 2B0MA 4DF1A 2GJLA 4MYXA 3DFTA 1Z48A 2C0AA 4E0CA 3G22A 3PY2A 4PTNA 2NXIA 2QCMA 4R53A 1KV5A 2NV1A 4GFSA 5AN7A 3QMRA 2Y6ZA 4R34A 5C5YA 3NR0A 3EX4A 3G1DA 2WV8A 4M6VA 2Z2UA 3K30A 1LM1A 3EWWA 5DCDA 3W84A 1TTJA 1MO0A 3DU0A 3UWYA 1GG1A 3L5AA 4ADUA 3V75A 5D2WA 4UTWC 1DJNA 3P5ZA 4PEKA 1VLWA 1LLWA 4FX8A 2ZZ3A 4EWND 1ONRA 1K8ZA 1OJXA 5LGXA 3L0GA 3IV3A 2R8WA 4MY1A 3OVPA 3SIZA 3RF9A 4N2YA 2GPTA 1ZAIA 2PRHA 2QCLA 1JUBA 3FYOA 3W7KA 4A22A 1OYBA 3LV6A 1FXQA 3C2VA 1YTDA 3LXCA 3T78A 4H3DA 3HGJA 4OWGA 4O0KA 3NQDA 1ZY9A 3BLEA 1NVMA 5DY2A 3G1XA 4DBDA 4RR4A 3DI0A 1VYRA 3R2GA 4JTEA 2ZDRA 3TQVA 3D0CA 1Z41A 4UR7A 2GVJA 1SO4A 2JGQA 2ALDA 2CW6A 1J2WA 3BGJA 1EUNA 3NQCA 2E6DA 2QUUA 2YFNA 3M5YA 5F1VA 3CWNA 1M7OA 1ZAHA 1W1ZA 2DJLA 4LVFA 5EKYA 4LUIA 3T40A 5D04C 5U4NA 4N9EA 3I7SA 2X1UA 4QIUA 1KM5A 5EA9A 2P1FA 3S42A 5F4XA 4JICA 3B04A 3BGGA 4E2BA 1PE1A 1VR6A 3B4UA 3TSMA 3NQVA 4XQ6A 2QCNA 1UUMA 3USBA 5BNKA 4N4PA 1AW1A 1K8YA 4UTJA 3GVGA 1RPXA 4AWTA 3NQMA 4KKXA 4K36A 2CU0A 3N34A 1F76A 4PCFA 2FQIA 2C13A 5DELA 3TC7A 1ICSA 1FDZA 5FF3A 6TIMA 2QCHA 4DQWA 3L21A 1PL9A 4HSOA 3BG5A 4M5PA 3MYPA 1XXXA 2JKAA 4EIVA 2CLLA 1LCOA 4XZ9A 1F5ZA 3THQA 4NNCA 1G7UA 3ANYA 2YW3A 3BO9A 3UY7A 4ICNA 2G95A 5AHIA 4IGHA 4MVAA 3W73A 3RK8A 2B7QA 5FEZA 3W7IA 3P60A 1GT8A 3HG5A 3WJWA 4O16A 1EP3A 1RV8A 1OG0A 2YYUA 5D32A 4N6EA 5AYZA 1G4PA 1H5YA 3UXAA 2ATMA 2VEPA 2Y88A 3IVUA 3G8RA 1DQWA 4O19A 5DCBA 4JS3A 3G8EA 1WV2A 1FWTA 5F2LA 4ZL1A 3P8JA 2Y7DA 4H4IA 3W1UA 2E5BA 3NDOA 3FS2A 3M5XA 1I2RA 3BVJA 1OFPA 4PA8A 4C1LA 2V81A 1K03A 1YXCA 1LBMA 2XN2A 1KM4A 1HL2A 4IMFA 1Z42A 1X1OA 2WNQA 1V7YA 1QPNA 1ZJIA 3INPA 1I2NA 2Q3OA 4ZQMA 4HIBA 3C2OA 1VRDA 4LVBA 5TBOA 3IGSA 2E6AA 3B06A 1TRDA 2B4GA 1GOXA 3ABOA 5C2XA 5E1QA 5DLCA 2WKJA 3IIZA 3QEZA 1WDWA 1PIIA 5AHLA 4S2CA 1D9EA 3TFXA 4N9BA 1SO5A 1TCDA 5F1UA 3EX1A 3E02A 4NNBA 3M16A 3SR7A 1O4UA 3CM4A 3L67A 4S2BA 3CEPA 1EP2A 1R2RA 4JTIA 1N7KA 1XFBA 4DPQA 5KMYA 4Q33A 3TUUA 2RHGA 3NM3A 3W2MA 2A0NA 4POCA 1K8XA 4JTFA 2A6LA 1LTDA 4IUOA 2J24A 3G1HA 3EX6A 5F4WA 1TTPA 4AMAA 2ZA2A 1TPC1 3CLMA 1WOBA 4JYEA 2EAWA 3KXQA 3OVRA 3UPBA 4WXZA 3W7MA 2ISSA 3THAA 4TX9A 3RMJA 3W7OA 1F05A 3I68A 4I9AA 4ONVA 3L66A 3DKJA 4WZHA 3TC6A 4A29A 4GUJA 3TXVA 3NZ1A 2V5LA 2E77A 3EEGA 4LRSA 4EOUA 3FEMA 1TB3A 3W2KA 3E0IA 2V0TA 1T96A 5IBXA 1OX6A 3W7HA 3T7VA 4MZ1A 1GYNA 1ME8A 3NM1A 2DZVA 3DKLA 4QM1A 3CU2A 1W3NA 3CTLA 4JX5A 4HKPA 4K7VA 3W75A 1O94A 2V82A 1NF0A 3LBCA 4QNWA 1TTIA 5AB3A 1SUXA 4JX6A 2ZBTA 3L0NA 4NQ1A 3TQ0A 3M9YA 2R14A 4AWSA 4DBEA 5IM51 1LROA 3BARA 2DP3A 4OV9A 4I7UA 1W5NA 3I7RA 2QJHA 1GVOA 3P67A 1JR1A 2FFCA 2YX0A 1TTQA 3TXZA 3QQ1A 3SFKA 3NQ7A 3MYOA 4O28A 1OF8A 1R2TA 4JTUA 3W1LA 5IBXC 1AL7A 1IXNA 2A5HA 1TREA 1OK4A 1OFDA 3N3MA 4NT0A 2GVLA 5CZJA 4TMCA 2CLKA 3N2MA 1SPQA 2I1OA 4FXSA 2QR6A 4Z1CA 1B4EA 2QUVA 1ME9A 4XKYA 3G1SA 2Z1BA 2C14A 3G1VA 2VXNA 2JGYA 1SFLA 4K37A 4ZVJA 4IXHA 5CPNA 1KLZA 4FNUA 4DXVA 5A5WA 2OJPA 3TFCA 5FESA 1QO5A 1L6SA 3ZS4A 3OA3A 4DF0A 1VH7A 3W23A 3DI1A 1U5JA 3VCRA 2X1SA 2A6NA 1TO3A 4BK9A 1G67A 1JCMP 3B03A 5AHFA 4ADTA 4Q32A 2IQTA 3MBFA 1S3HA 3S5YA 3M1ZA 1R2SA 3JR2A 1WAUA 2CLMA 4CCDA 4PODA 1H1ZA 3R12A 3KVLA 1OK6A 3G0XA 3PBWA 3UWWA 4OHQA 5F4SA 3LLDA 1DL3A 3LHYA 3EXRA 3GR7A 5AYYA 3BG9A 4TR9A 4WJEA 3ZR4A 2VFFA 1GZGA 3WJZA 5HR7A 2PCQA 2XN1A 2TRSA 5D2VA 5HQEA 3LDVA 4O15A 5C55A 1W3IA 5C6MA 3OVQA 2RDTA 1YYAA 4YXGA 3GZ3A 4IJBA 1RQEA 4GXMA 2QJGA 4O13A 3Q2DA 2OCZA 3PAJA 2NXHA 1H51A 3S1UA 1DQXA 4QQ3A 2Y70A 4Z08A 1ADOA 3JS3A 4JY8A 3PF3A 1XI3A 3M41A 3Q94A 1OX5A 3W1XA 3SZ8A 1CI1A 1QOQA 4AAJA 3S9YA 2BSLA 4PC8A 4ADSA 3R5EA 1QNVA 3PVFA 3CIXA 5HUOA 1B4KA 1JQVA 2YYTA 1RVGA 4FX6M 1LP6A 4FEZA 3NQ6A 3IGUA 4DEFA 4KFOA 3TDFA 2VFHA 3IGXA 4NXKA 1H1YA 2BTMA 3TE9A 3EWZA 2ZYFA 1GVFA 4JNMA 2HS6A 4UFIA 1SO3A 1RQBA 1DVJA 1A5SA 2Y63A 1VCVA 1VJIA 5FI8A 3TW6A 2LLEA 1P4CA 3FYPA 3HIJA 4MJMA 2WSRA 3TU9A 1W0MA 4FX7A 1HG3A 2X2GA 3LRMA 3L5LA 2CLOA 4UFMA 4Q4KA 4JYDA 1TPVA 2A7PA 1A53A 1FY6A 3NAVA 1G4TA 1PVNA 4LVGA 4UTUA 3HG4A 2EF9A 4DPPA 4NZFA 3PG9A 3FIGA 2PC4A 1VS1A 1TV5A 1GPWA 1NFBA 4BFAA 3UWUA 2YSWA 3LHTA 5LNWA 5EBUA 4Y8FA 3PG8A 4NJIA 2QUTA 3STFA 2YZRA 1ZALA 2VFEA 4IMEA 1G4EA 1UBSA 3CIWA 3FFSA 4YWIA 2A7NA 4B5NA 1OYCA 1QDSA 1W31A 3PUDA 4GUIA 4IQLA 5DBUA 4NJJA 1RZMA 2VELA 1F73A 4LVDA 3TJXA 3MP5A 5F2MA 3FJ6A 3TIMA 1XBYA 3G3MA 3W86A 3I65A 2H8XA 1FCQA 2CZEA 1UJPA 3UWQA 2YDAA 1DKWA 1MEWA 1SO6A 3AJXA 2YW4A 2A85A 3MHUA 3S5ZA 4O57A 3P5YA 1KFLA 4NUWA 3FKKA 3EXTA 3WK0A 4O4WA 3CT7A 2G5WA 4N6FA 4GWEA 3F1QA 4O50A 1AW5A 3B05A 4IMCA 5KSWA 3W7NA 4CCCA 2JK2A 1VGAA 3UWZA 3V1PA 2GVGA 4MKNA 2WSYA 4A2RA 3DAQA 3PB0A 4E38A 3NYZA 1MEIA 3OBKA 3G1YA 4K7YA 2Z0IA 4RZ6A 4BF9A 4IMDA 4JR5A 3M5ZA 4LC8A 5E0KA 1H63A 1I2PA 1EIXA 2V9DA 3RFAA 5U7SA 3HO8A 2ZZ1A 4HNVA 2NUWA 4O54A 2HMCA 3S6DA 2QCGA 4A21A 3C4UA 3L5MA 1HO1A 4BWLA 3GNDA 5K3VA 5H2ZA 5BW6A 1L2UA 2NWSA 3TAOA 4HN4A 5LNVA 1YXDA 3B0VC 3ABSA 3CWOX 4TO8A 3I6RA 1VPXA 4RLIA 3W2LA 2CZDA 3W88A 5G2WA 1P0NA 4EF8A 3LXBA 4IWWA 3GDMA 2J9YA 5G1YA 3LI0A 3KAOA 1JQXA 3G1AA 5AOUA 2V2HA 3P80A 1FUYA 3W7LA 2O7QA 3BW4A 5D33A 5G4EA 1TSIA 3AO0A 2OT0A 1TPFA 4YCPA 1WBJA 3C6CA 3G1FA 3NL2A 1TPWA 1HUVA 3BPWA 2NWRA 2TMDA 4A3UA 1C9DA 4K39A 3TMQA 4DF2A 3PS7A 2GQ8A 1KTCA 1T8XA 1S5WA 1F74A 2W0UA 4E2DA 3EWBX 3CEUA 3GKFA 1YXYA 4IPIA 5D2YA 3GXTA 4JTKA 3BW3A 5LHFA 2AAMA 4BWLC 5D2XA 2VC6A 2FPVA 3OG3A 3GXPA 2JKEA 3FA5A 1TRIA 1Z44A 4OBTA 2EPHA 3P82A 1EPXA 5KTLA 4IPJA 3IIXA 4ZMGA 2QCDB 4ZQPA 3W2UA 1S5TA 4K6AA 2FTPA 4OQVA 4A2SA 3O06A 2AGKA 4M19A 4S1FA 3L9CA 2ATSA 2W79A 4NX0A 1KM2A 2ZZ4A 4RXFA 3EWYA 4W9TA 1JCNA 3E49A 4XBKA 4DO6A 4FO4A 3QRHA 4MYAA 1KFEA 3FLUA 1JVNA 5K2ZA 4NJHA 2E5DA 2RH9A 4JDBA 1L6WA 1CW2A 3WK2A 3NL5A 1TPH1 1OX4B 4UMAA 2NZLA 2Y89A 4O0ZA 3GYEA 3HG3A 3LTSA 3IIOA 2ZQ0A 3VI2A 1M7PA 2ISVA 5CSSA 1O5KA 1KM0A 2J6XA 3E9AA 5I3KA 4ORMA 1P5BA 1ZCOA 3STGA 1MXSA 3WJYA 1FQ0A 1F7BA 1GQNA 3CQ0A 3HPSA 1D3HA 1H60A 4BR1A 3PB2A 2VKZG 5K4ZA 1JJKA 2QCFA 3NGJA 1FCVA 3KVKA 3N2XA 5HJLA 1HFBA 4ZQCA 4ZQNA 3MUXA 3W6YA 1HTIA 3LERA 1R47A 2E6FA 4XTIA 3MHGA 1IXPA 2HSAA 5HUPA 4UFLA 4CQ9A 3GK0A 2OZ0A 3S1WA 2RDUA 1M5WA 4LW7A 1IF2A 3LX9A 3UYCA 2WOQA 2VOMA 4AHQA 1TPDA 1KFBA 1KFKA 4O14A 2ZZ5A 4GUGA 2Q8LA 3O05A 4ALDA 4FXRA 1VLIA 3A24A 3VNDA 2FPTA 2NX1A 1I2QA 1Y0EA 2FB2A 1SSGA 3IIPA 4L4LA 1FDYA 2Q8ZA 1BKSA 1Q6RA 1M6JA 2Y7GA 4X3ZA 2E09A 3STEA 5KZEA 1QAPA 2PURA 2E1DA 2VEMA 4GBUA 3U8GA 3GIYA 3EX3A 4O52A 4CNOA 4UUIA 3W7QA 3MO7A 1AW2A 3W87A 1B57A 5LKYA 4LOCA 2ZRUA 3LTPA 3QFEA 3FOKA 3NEVA 1L6YA 2JBMA 3W07A 5HNRA 4UTHA 5K9DA 3PBYA 4NVTA 3S1XA 1G69A 3M7WA 3MI3A 3BLFA 3W7EA 4ML9A 2FDSA 3TSDA 1VHCA 4Z0JA 2QCEA 1SR9A 3HJZA 1P0KA 4JTGA 4XTDA 3LGEA 3N14A 2HTMA 1QFEA 3TA6A 1RD5A 5FF7A 2QDGA 5DBTA 4QNEA 2EHHA 4M6QA 3HMJG 3CHVA 3F03K 4KWWA 3W1RA 4UFHA 5AHEA 1EB3A 1GTHA 1W5OA 2A21A 2GJNA 2GUUA 4JYFA 4YLWA 3S1VA 4LT9A 4MIMA 2A4AA 1O5XA 1VCFA 3H55A 4Z1AA 3B0PA 3UQNA 1OFQA 3F4WA 1A5AA 3MW7A 1E51A 1I4NA 4MFDA 3U6WA 3E12A 4LS0A 3G0SA 4K8HA 3Q58A 4MLRA 4QITA 3BLIA 3W9ZA 3O1NA 1VHNA 4JTSA 3PBVA 5I3IA 1EA0A 1OABA 4RXGA 4NU7A 3NA8A 5G2HA 3W1MA 3KOFA 5LNSA 3W85A 3PM6A 2XFWA 4H6KA 1ME7A 3UPWA 3A5VA 5DXXA 1SW7A 2P0OA 3EXSA 3IVSA 2UV8G 1OF6A 3NQEA 3IIVA 3G3DA 3PSWA 1GVRA 3T44A 3PULA 3LCXA 1WOAA 1EEPA 4LTSA 1J5TA 1QPRA 3NOEA 3QZEA 1LZOA 1NAL1 2DZXA 4LRTA 3NVTA 5EY5A 3RU6A 2NUXA 4TIMA 3QJAA 3MI2A 3T4CA 4JXCA 5I3HA 4CNPA 3QW3A 3S0CA 1SU5A 5LHEA 1FDJA 3KX6A 4HT3A 3DFNA 3O6YX 4NX5A 1TPB1 2YR1A 2ZTKA 1OYAA 4PL1A 2J9XA 1WYIA 1FWRA 3PUEA 3GAKA 3NL3A 4M7TA 3GB6A 2Z6JA 3IVTA 4UIOA 4I7WA 4WOZA 4MUZA 5I3GA 3MWAA 4MPQA 2DZTA 1F6PA 4AWUA 1W37A 3TV8A 5I3FA 1H61A 3P81A 4WY0F 3BW2A 3NQ2A 1SZFA 1SZEA 1D3GA 2ZTJA 3LV5A 4UNKA 3LOTA 1NSJA 3UZJA 1XM3A 4CCEA 1ML1A 1QPOA 1FWNA 1LOSA 1A5BA 1ZAJA 5F2GA 4Y6GA 2BWGA 1VYPX 2ABBA 1BWKA 4GJ1A 1Q3NA 1W8SA 2X1RA 1LBFA 2H3BA 1RQHA 2ZRYA 1XUUA 1I45A 3N9RA 1ZNNA 3T55A 1KW1A 3BG3A 3DBPA 2YCEA 1C29A 1K7FA 3RLUA 1QOPA 2NV2A 4X9SA 4ZQRA 3LB0A 4OT7A 1PHWA 4DO4A 3W76A 5DY3A 3UNDA 1QWGA 2Q3RA 3JRKA 3QMSA 1YLVA 4QJ1A 3NPVA 1QPQA 2VFGA 3LHZA 3O6CA 2CFFA 3NL6A 2DZWA 3PWAA 4MFEA 3DGRA 1YDVA 2TYSA 2VEKA 3L2IA 5HWMA 5LNRA 4MZYA 1G7VA 2ABAA 4NZJA 3O6DA 4FNTA 3LXAA 1NEYA 4ORIA 1Q6OA 3UY8A 3GAYA 5BMWA 5CPMA 1RR2A 5HWJA 3G0UA 1YTEA 1LRQA 1VQTA 5K9XA 2CZFA 4P61A 2X1TA 4JDYA 1VZWA 5EPDA 3NQFA 1W5PA 2JKPA 3QYQA 1JULA 3W7DA 1KBIA 3LCLA 4AF0B 1UB3A 2FPYA 2X16A 6ALDA 3M0ZA 2O7SA 1H7XA 4MOZA 3DHDA 4O11A 4FF7A 2B7NA 3HQ1A 1K02A 1HO4A 3M6YA 5HULA 1GVSA 4O4VA 2W6RA 3W7PA 1K7XA 4LWWA 4N9DA 4O18A 5T26A 3MJYA 3C52A 3HF3A 5FEWA 4OV4A 3SSJA 3HOJA 3MHFA 3DHFA 2AQWA 1C8VA 3P7YA 3O8AA 3A9IA 2DZUA 4LS1A 4YL2A 1AMKA 2A1YA 1MSSA 4AVFA 4IXXA 3NXFA 3KHJA 4PFMA 1XBZA 1JRCA 2ISWA 4GNJA 1YTKA 3S5OA 3W1AA 1H50A 1SZNA 2WPBA 5CGQA 3N9SA 1H7PA 2J9ZA 3MP4A 1H7OA 3NQGA 3U2OA 2DZSA 2F84A 2YGYA 1IIGA 1MZHA 1X8FA 3NZRA 4IX2A 5FF2A 4MY8A 1KBJA 4N4QA 5ABTA 3QPZA 1ALDA 3ZFHA 5K7JA 4JD4A 4IOTA 1ZENA 5CZTA 4MLJA 4RV8A 2R91A 1AG1O 4U28A 1YDOA 4LNYA 3DFQA 5AFDA 1IGSA 1TQXA 2ZCGA 2BX7A 3B0UX 1T99A 2DZPA 4I7VA 4YCOA 4AB4A 2DJXA 3W83A 5F2IA 5HMSA 2F7FA 4UTTA 1LRTA 2OX1A 1H7NA 4UTKA 4HSNA 1UASA 4J9JA 4JTJA 1X7FA 3LCFA 5BOOA 3P8IA 4AH7A 4JIPA 1SW0A 2E5CA 2QCDA 4JY9A 4L4MA 3B8DA 3DFOA 3ELFA 1DORA 1H7WA 4KWVA 1PHQA 5D03A 3ZWTA 4WY0B 3HBLA 2H6RA 2R94A 1VYSX 1KA9F 3IRDA 4O1BA 1TPUA 3E96A 2KZHA 5D37A 2NXGA 1GTEA 1QR7A 2H3DA 3W74A 4C1KA 1GYLA 4EF9A 1FXPA 1FWSA 3TAKA 2VEIA 2G97A 3UXDA 1TYGA 1OX4A 4UMCA 1FWWA 1Q6LA 4UFKA 4TU1A 2Y85A 3G24A 1IIHA 2Y62A 4JEQA 2XN0A 5LNUA 4UTTC 2I14A 1PCWA 5G5IA 3WK3A 5CSRA 1OFEA 4LV9A 3C2EA 7TIMA 3TR2A 3ATZA 1GVQA 3FJLA 1XCFA 2FIQA 3LHVA 4Z1DA 3DENA 3NQ8A 3M44A 4Y9AA 5FF0A 4CQ8A 3NPUA 3HB9A 1WX0A 2RDWA 1O95A 2BZNA 2Y7EA 4XBSA 3GNNA 3TQKA 1TJRA 1ICPA 2J88A 2C3ZA 3VE9A 2CLEA 1KM3A 5KINA 1XBVA 3QM3A 4D2JA 2QAFA 3DFSA 3C8FA 3QH2A 3RNDA 1IXQA 2ZRVA 2E68A 3IEBA 1EUAA 1LLZA 4FIRA 1BEUA 3GXNA 4CLMA 4M7SA 3GDLA 3PR2A 3GDKA 4MJZA 1XDLA 3C0JA 1DOSA 1PCKA 2ZA3A 3W1NA 3LCWA 1AL8A 3LBMA 3Q37A 3W2JA 1LOLA 1W56A 3NNTA 1AK5A 2WSQA 4KFNA 5EL1A 3DXIA 4DO5A 3TX9A 4TMBA 4RKAA 4DELA 1KTNA 3C3NA 4OE7A 4IMGA 3W70A 5A8GA 2CLHA 1FX6A 3FKRA 1KTBA 3QC3A 4OU1A 3KRUA 4JIQA 5HWNA 5J5RA 1TQJA 5CPOA 4AHOA 1EP1A 2ZZ6A 4Y90A 2HS8A 1JUKA 3QSTA 5I3JA 1L9WA 5AC8A 4LS2A 1OHLA 1OFAA 1JCJA 5CG7A 3ZWSA 5DCEA 3NQAA 3O15A 3VKJA 4AHPA 1OVDA 2C1HA 3GX9A 3TW7A 3W1PA 5FEPA 1JUEA 1KFCA 1VC4A 2B7PA 1KV8A 4QAIA 2VFDA 2YFOA 4X22A 2V30A 3EKLA 4LV4A 1R30A 1XBXA 5MHBA 2QCCA 4X2RA 4WUIA 2H8ZA 3LRKA 1IXOA 3SY5A 2B7OA 3CB8A 5G2IA 1SZGA 4JX4A 2OMAA 3HG2A 4MY9A 1OFBA 2YPIA 1K7EA 3PC0A 1XC4A 4UR8A 4O10A 1SW3A 3LCIA 3KVJA 3W72A 1FCBA 1Q6QA 2J27A 1DBTA 1LOQA 4FNPA 4QISA 4RCXA 2P10A 3TNOA 1EWEA 2ZFAA 4G1KA 3EKZA 4AXKA 3W22A 2RKXA 2CLFA 3GLCA 4P2VA 3MP3A 3A22A 3F4NA 1H62A 2X30A 4O17A 2VENA 1DHPA 3KRZA 3LCHA 4WQ6A 3O16A 2C16A 3P61A 4BI6A 2NX3A 3G18A 1OFOA 4MZ8A 1PV8A 3W7GA 2CZ5A 4NJGA 4IX0A 5D02A 1TJPA 3LRLA 5AC6A 3W71A 4Z0SA 2PE4A 2PRMA 3QPYA 4R7JA 3S5NA 2Y61A 5L9FA 5HR6A 4WXYA 3WK1A 1YDNA 3WFAA 1LDCA 2DU2A 1W3TA 4O53A 3N73A 4HNNA 2EKCA 4NNAA 2NX9A 4XUGA 8TIMA 3NPXA 1Q45A 4RJEA 4UTLA 5D05A 1TPEA 1GG0A 3L68A 1YPIA 1JCXA 3L65A 4PH6A 2FLIA 2ZA1A 5BMXA 3W2NA 1W5MA 3LHWA 2I9EA 2A2IA 1X6UA 1U83A 3SW6A 1WXJA 2QDHA 5BRBA 4RZ5A 3BK0A
chains in the Genus database with same CATH superfamily
2ISDA 3SGUA 1D7FA 3LA4A 1ONXA 1GZJA 1KM1A 2ZWYA 3A5FA 1CZ1A 1GQLA 2C0HA 1TMHA 3MDUA 4GE8A 3CT2A 3P14A 4DI8A 3M5VA 4KEVA 1VPQA 3KRSA 1LQ0A 3D6NA 4N02A 4EPBC 1SQ7A 4O12A 1BHGA 3Q45A 3PZOA 3H53A 4O1DA 1KM6A 1JDAA 3WY1A 2QF7A 1A5CA 1ITQA 2V3FA 4CVWA 4W87A 3LM7A 1F2JA 2GWNA 3A4AA 4HHPA 2QHAA 3ZLGA 3UG3A 3KLLA 3P74A 5I23A 1F6KA 4NRRA 1GWJA 3P0XA 3DHUA 4G9PA 3KW3A 4Z1BA 3GTFA 2CKSA 2VQUA 1ISZA 4L1WA 5G4WA 3L4VA 2F6XA 3RAOA 4UTMA 4ZXLA 3A4WA 3PZVA 1SMDA 3FVMA 1YNQA 3S2CA 3W53A 2WSPA 2QKFA 1W32A 3FX4A 4DHGA 2I57A 3ALGA 5C0QA 3TCEA 1IWPA 2WMGA 2DORA 2OKOA 4UTIA 1X96A 4QSHA 2PDBA 3PAOA 4R33A 4W86A 1UP2A 1T0OA 4PMDA 3GDRA 1ZFJA 4QP0A 4B5TA 2AL1A 3STCA 2RFGA 3W1TA 2YL5A 3VIKA 4GQQA 1T8QA 3BCFA 2YXGA 2GWGA 5G1TA 4WGHA 5DXYA 4HK7A 1LRNA 1WA3A 1H7RA 4N9CA 4K8EA 1EH9A 4AF0A 5FJTA 4LC6A 1QOXA 1AQHA 4QCEA 7XIMA 5FF4A 3VUSA 4K38A 3LHUA 1RXOB 1J4EA 4AEOA 3L0KA 4KEUA 3QW4B 2NV9A 4EXAA 1V3IA 3IS4A 3MDWA 1Q65A 1RPKA 1WP6A 2WMIB 2UY3A 4NI8A 1X1ZA 3RLHA 3LI1A 3SJ3A 5DN1A 4LXFA 3SN1A 3PTKA 4ZENA 5LGZA 3WJXA 1E6SM 3UZ5A 2H90A 3VIOA 3WUEA 4DJEC 4FOJA 4PTMA 3NDYA 2Y5JA 3F5LA 5T91A 4RZ4A 4AD1A 1VEMA 2E9LA 1TV3A 2XINA 1ITUA 1BTMA 4RX0A 3TYEA 3OIXA 2XFYA 1WDSA 2BS9A 1K4GA 4B5WA 2C91A 5K9CA 3GYCA 1J9YA 1VPYA 5AVNA 3VNIA 2GLKA 2ZRZA 4E3VA 1AZ2A 1XHGA 1V51A 3TKFA 3Q4DA 5D09A 3R13A 2PZNA 4FB7A 4NJKA 4UXDA 1NIUA 2J25A 3E74A 3EWUA 1R3WA 4KFPA 5FAJA 3WFLA 1R38A 1MEHA 3V5FA 3MBDA 1O7AA 1EJSC 3ZR5A 4OOZA 4CD6A 1S5VA 2CLIA 2OO6A 1RJRA 3A23A 4RDVA 5D2TA 2QAPA 4G1NA 4GH1A 4EE9A 3C56A 1XDMA 4WDUA 4A05A 5CCZA 1O60A 2YKKA 3UERA 3MV11 4LJ3A 2GQ9A 1JG9A 1EX5A 5CJNA 5I7GA 4WOQA 5EBAA 3DZ1A 4PUJA 3R7MA 3AWNA 3TVAA 4PUMA 3EA1A 3EX2A 1ZCCA 5HINA 2POTA 2XPKA 4HPJA 3P84A 1AUSL 1NF7A 2C19A 4L64A 1OSEA 3EB2A 4PCPA 2WO5A 5LIUX 5KZDA 4ZR8A 4QFUA 4DJDD 3AFBA 4MYXA 1MQRA 3TYZA 4ZA0A 3G22A 1TVNA 1B2YA 4H9XA 4C6IA 3WLSA 5AN7A 4OZOA 5C9WA 1AD4A 2CITA 5DRIA 3IARA 5FAGA 2Y6ZA 4R34A 4Q4MA 5JU6A 4G56A 2OLHA 3S2JA 1HN1A 3U7VA 4AZ6A 1AJ0A 1XIMA 3EWWA 5A8OA 3DU0A 1GG1A 4WEVX 5D2WA 4UTWC 3P5ZA 2PA6A 4N7QA 1E56A 2HK0A 4KQNA 1JDFA 4LGXA 4ZE4A 3L0GA 2R8WA 2WM1A 3GIPA 4E4PA 4US5A 1TR1A 2X0YA 1E1EA 2E8YA 3OVPA 2OOGA 3DIPA 4QLJA 4GPNA 3CV6A 4IP5A 1BG9A 2AMGA 2YLLA 3VDCA 1ZAIA 3SCOA 3FYOA 1FXQA 2RGLA 3AQUA 1E3XA 3T78A 4H3DA 1EDQA 1JL8A 1RCOB 2VR4A 3BLEA 1NVMA 2HDJA 3AS1A 4DBDA 4MWAC 3EAUA 5CQ1A 4AIOA 2PBGA 4UOJA 4DX3A 5BU6A 3WEMA 1J2WA 3NQCA 1EA9C 2CNCA 5BCAA 2E6DA 3E5BA 2ZC8A 2YFNA 3M5YA 1ZAHA 2DJLA 1W1ZA 2V6AA 3T40A 5D04C 2FH6A 5U4NA 5HJXA 4N9EA 5ABGA 3I7SA 3UETA 1KM5A 3WN6A 2ZUWA 1XG3A 5CJ5A 3H2EA 4DWSD 2PWGA 1C8YA 1VR6A 3NQVA 3K13A 1VFMA 1UR8A 4XZNX 1BXBA 1LWHA 4N4PA 2R6OA 4UTJA 3GVGA 1YBQA 4AWTA 1LG1A 1UKTA 3NQMA 1P6BA 3H4GA 6PTDA 3E3HA 4IT1A 4GABA 3BICA 3POCA 4D1IA 3IPWA 3V0UA 1GOWA 1GQIA 4YIWA 6TIMA 1WZAA 3L21A 3RX2A 4FLQA 2NT1A 4QE1A 1E6RA 4XZ9A 4NNCA 4JKMA 2AOSA 4MVAA 3DYMA 1PKNA 3RK8A 2B7QA 4XZBA 1GT8A 3SRDA 4O16A 4X0VA 5JUVA 3A47A 4N6EA 3SCVA 3IACA 5C9ZA 3MSRA 1G4PA 2ATMA 4D6FA 1XQLA 3BLDA 1F8IA 3ITCA 6TAAA 1ITCA 1O1ZA 3G8EA 4ZL1A 3RPDA 4ERGA 1KRBC 1US0A 3MUY1 3RM9A 4MF4A 4DZAA 5A6AA 3BVJA 2HVNA 4PA8A 2V81A 4EPDC 1V3JA 2WVSA 1LBMA 1KM4A 4MNMA 1X98A 2PF8A 4MG4A 3UW6A 2ACRA 1X1OA 2WNQA 3O3RA 1QPNA 1ZJIA 3EMCA 4AEEA 3INPA 2J4GA 1I2NA 4A3RA 3VIFA 3LZ3A 3MMDA 3APTA 2O92A 2E6AA 2Y2WA 4IFOA 1OD0A 5C2XA 5E1QA 5D9NA 1S2TA 3ZVHA 2XIMA 3FDGA 4GQGA 3UJEA 2KX9A 1FA2A 3DCPA 3H2CA 4NNBA 3FGCB 4O1EA 5DMNA 3UA4A 4Z17A 2EKGA 3VCCA 1R2RA 4D6DA 4XVEA 3S1GA 3S4TA 1XFBA 1P48A 3TUUA 3UBPC 4I8DA 2J62A 1XYLA 4IUOA 2JFEX 3QV8A 1GORA 4Y7EA 1POKA 4S3CA 4JYEA 3KXQA 2QIIA 4PRRA 3UPBA 2ZUSA 1XPYA 4WXZA 2VJXA 1QK2A 3I68A 4LF1A 1CLXA 3WYZA 3ALFA 3GRIA 1YRRA 3NZ1A 2GZXA 4LRSA 4QDWA 3FEMA 3IUIA 2XUCA 3E0IA 3W2KA 2PDQA 1ZSXA 1OX6A 3T7VA 3ME3A 9XIAA 3ES7A 3NM1A 3MUAA 3VNJA 3WNKA 2PU0A 2DZVA 3DKLA 2YL9A 2ESCA 3CTLA 3EOOA 1NP2A 3O9NA 4KH2A 4HKPA 1O94A 1GKPA 2WSKA 2OSWA 1OQFA 3HM7A 2WJDA 3B0YA 4ENLA 2BMBA 2HPMA 1SUXA 4JX6A 3IUDA 3TQ0A 2R14A 1BQCA 4GY0A 1IR2A 5IM51 1Q13A 2Y0FA 3BARA 4OUEA 2DP3A 1UWAA 3IUHA 1XJBA 1UR1A 4YVVA 2HBVA 1MUWA 4PMXA 4XVDA 4NKCA 2XDFA 1TTQA 3TXZA 2VO5A 2NVDA 4CD8A 1XLHA 2XFRA 3T0AA 3MO4A 4RPPA 5IBXC 3N13A 2DW6A 5CZJA 4TMCA 2DH2A 1SPQA 2I1OA 1B4EA 2QUVA 1E4IA 4XKYA 2C14A 3G1VA 2VXNA 4B5SA 1DTUA 1BFNA 4GYPA 1AJZA 2XYLA 3EEZA 3D47A 3ITGA 3LZ5A 4JN8A 3TFCA 1GHRA 5CXPA 1IE7C 3OA3A 3S47A 1VH7A 1TIWA 1JAEA 3VCRA 2J7HA 1TO3A 4D6HA 3LNMA 2I5QA 4ADTA 4H19A 1TWWA 1EOMA 2GYIA 1S3HA 4ROQA 4QAWA 1AZ1A 3WQEA 4H7ZA 4PODA 4H9VA 3ISIX 4HZ7A 3W24A 2XIJA 4XV0A 3B9EA 5F4SA 3MCOA 3N4FA 1E9LA 2XH7A 5AYYA 2PTYA 3BG9A 4HMCA 5I5RA 5D2VA 1Q66A 1J12A 4FAMA 2RDTA 3GY1A 3GZ3A 4IJBA 1MXGA 1RQEA 3UXIA 1VFFA 2OCZA 3PAJA 4GX8A 1CIUA 1H51A 1LLOA 1V3HA 3JS3A 3PF3A 4WVXA 1FWAC 3U5YA 3Q94A 3SZ8A 3CWHA 3PJUA 4DVOA 3ZZ1A 1MWOA 3RX3A 5A8MA 3TYAA 3LYEA 1CGWA 4E8DA 1JQVA 3SAZA 1I0BA 1XV8A 4HNOA 4ICMA 3WNLA 2PP3A 4XZWA 3IGXA 3EWZA 4C91A 2HS6A 1RQBA 5HK4A 1F3XA 1VCVA 4LUTB 3HIJA 2WBGA 5D9PA 3TU9A 1W0MA 2DVUA 4XSLA 3P6LA 4RE4A 1R9XA 3HQOA 3LRMA 4S3FA 1NU5A 2CLOA 1OIFA 2Z00A 1FY6A 3HG4A 1OEPA 3HZ3A 5D9MA 1V7AA 1YX1A 1VS1A 1S1RA 5KETA 2YSWA 2GFTA 4Y8FA 3PG8A 2QUTA 4LAOA 2YZRA 4XZLX 2VDIA 1G4EA 1V02A 1F07A 2A7NA 3WF1A 2PF0A 3WH7A 4B5NA 1OYCA 5DBUA 3N2BA 1HXJA 4BCEA 4HPHA 3MSYA 3ANUA 3WDIA 3TIMA 1XBYA 1L0PA 2X1IA 1F3EA 1R6WA 1UJPA 2ZC1A 1MW2A 1BLIA 3GXFA 3P5YA 1GKRA 2I16A 2XJ7A 2GVYA 4PCSA 1XLCA 3UXLA 3L4YA 3R58A 3SB0A 3B8UA 5KSWA 1GGOA 1MYRA 3QHNA 3POHA 3DAQA 1YNYA 3NYZA 2YDSA 3OBKA 3G1YA 4K7YA 2QPSA 4WF7A 1O66A 1I2PA 2Y8VA 4GCXA 4V33A 3BAYA 4PTVA 2W27A 4ZODA 1EX1A 3HO8A 2BHYA 4WJ8A 4HNVA 2EG6A 4O54A 3K46A 3S6DA 3CH9A 3VTRA 1XLKA 5MKGB 2Q8XA 3OZYA 1TVPA 3GNDA 1F6YA 1L2UA 2VVNA 1TX0A 2OFJA 5LNVA 1YXDA 1EGVA 1UPMB 2CXEA 3B0VC 4TO8A 3W2LA 4A8LA 1KQYA 3E0VA 3TTYA 3ARXA 3W88A 4EF8A 5HAOA 3GDMA 2DT3A 3LI0A 4DYJA 5T8GA 3H24A 2EG7A 2MANA 1WB0A 5E0FA 4KW2A 2OT0A 4HJWA 4MUPA 1TPWA 1H41A 3BPWA 3GG8A 2NWRA 1V93A 4ZFCA 4A3UA 2D69A 1C9DA 4K39A 3PS7A 1T8XA 3PTMA 1BRLB 5CEWA 2G50A 4IPIA 3WQVA 2WYSA 4DNHA 2JKEA 3TN3A 4D6IA 1TRIA 3WLQA 4HN8A 1Z44A 4JTCA 1UWQA 1XYBA 1BGGA 4OBTA 4H83A 1EPXA 3ITLA 4IPJA 3CV2A 4F40A 3CZ8A 4JFSA 4A2SA 3O06A 1QNQA 1QW8A 1NOUA 1S3TC 2AGKA 4M19A 4S1FA 2W79A 4OECA 3WDJA 4ZB0A 3ZM8A 4HPGA 3AXKA 4PMVA 3E49A 4DYKA 4EX4A 3UG4A 3QRHA 3E0FA 1KCLA 2WHKA 1S2WA 4J3XA 4A35A 1L6WA 3WQFA 1IZKA 1TPH1 4UMAA 2VZOA 3EKGA 3GYEA 2OODA 2VZUA 1M7PA 4BF7A 5TF0A 2J6XA 1CXEA 3IJ6A 1P5BA 1ZCOA 3WL0A 4ZO6A 4RNJA 1D3HA 2WMHA 2QF8A 3VX1A 1JJKA 1Y7VA 3NGJA 5BWAA 1HFBA 4ZQNA 3MUXA 3W6YA 4K8GA 3W25A 2NSOA 3MS8A 1R47A 3WLIA 4TVDA 5E0CA 3UCQA 4DM2A 3GTHA 3MHGA 2BXZA 2OZ0A 3B8VA 1IF2A 3UYCA 2WOQA 2NQHA 4PBEA 1J0ZA 1D8CA 1L2QA 3ABZA 3K4WA 4AHQA 1YW1A 2I56A 4O14A 3FAXA 2ZZ5A 3COTA 4GXPA 1RH9A 1NDWA 4H01A 1VLIA 5I03A 2FPTA 2NX1A 2FB2A 3IIPA 3GXDA 2Q8ZA 2FHCA 4IQDA 3EA3A 3N3TA 1GZ1A 1E6QM 1OT1A 4CNOA 1EC9A 1B31A 2ZRUA 3QFEA 3L23A 1AQ0A 3NEVA 5K9DA 3PBYA 4AUBA 3GU9A 3S9ZA 3M7WA 2GK1B 4ML9A 3E1F1 1TE6A 3TSDA 4IJRA 2QCEA 3HJZA 4JTGA 1KCZA 4MNKA 2YDRA 3L4TA 4PUWA 5FF7A 5DBTA 4QNEA 2CCRA 1KC7A 2I9UA 3F03K 4QGCA 1B30A 2WWCA 3I3BA 3W1RA 4P7QA 4UFHA 4MJ2A 1JDEA 1AQMA 3VNLA 3WLPA 1W5OA 4DUVA 2GJNA 4KWUA 3FJ4A 4CCZA 4YLWA 4MIMA 5A8QA 4Z1AA 2J7DA 3AU2A 1OFQA 4CGTA 1F3TA 3Q58A 3FSTA 1K70A 4E6MA 2Z2BA 4JEJA 3O1NA 2PCEA 1OABA 5E5CA 4NU7A 2GOKA 3QR3A 3W1MA 5HBFA 2OPJA 2PLJA 5A94A 3W85A 4DJFA 2BOEX 4H6KA 3UPWA 3A5VA 1XYMA 1EPVA 3CXOA 3EXSA 2UV8G 4ZCWA 1KB3A 1OF6A 3NQEA 4P8XA 1WOAA 4HZ8A 2CBVA 4GQ0A 5A6KA 2PDKA 1EEPA 1XG4A 2R1NA 4LTSA 5M2FX 1XR2A 1J5TA 3ONBA 3TTOA 3ZJ6A 3S2LA 2IKHA 5EY5A 4TIMA 4Z2GA 2DFAA 4GD0A 3T4CA 4JXCA 5I3HA 4W5UA 2XFFA 3S0CA 3G5EA 2PTZA 5LHEA 4HZMA 3KX6A 4QXIA 2W61A 3O6YX 3BURA 1U30A 2IKGA 3WQPA 4LFYA 1OYAA 1WYIA 2X0HA 4OIFA 4M7TA 3GB6A 4ICCX 3WIJA 4UIOA 3AHYA 2V5DA 4QRNA 5I3GA 3SCNA 1OWQA 3MWAA 4MPQA 4GI8A 2R1LA 4AWUA 4AZHA 4NAFA 1VBGA 4WCJA 4WRHA 1H61A 9CGTA 4F66A 2J8TA 2WCGA 2UY2A 3KTSA 4MGGA 1D3GA 3LV5A 2BGSA 4UBPC 3WF2A 3LOTA 1NSJA 2VD9A 1XM3A 1ML1A 4GLEA 1TUXA 2PEVA 4J2MA 5I78A 1ZAJA 2HBXA 3VMOA 2BOFX 1BWKA 1YPXA 4X2PA 1FOBA 1XUUA 1H4PA 4M82A 2WHLA 3PN8A 4HA0A 1V79A 3UPMA 1C29A 4RUBA 3CZLA 4AISA 1QOPA 1PDZA 5JIWA 4OT7A 1JYWA 3TLLA 1PO9A 3GXIA 4FS9A 4LYKA 3W76A 5DY3A 3UNDA 4DBUA 4NZ4A 4QJ1A 2CFFA 3PWAA 3F4VA 4IIFA 4MFEA 4C7DA 1YDVA 3URAA 3WD2A 4MZYA 3OG2A 4X0NA 2ABAA 4NZJA 1PIFA 4FNTA 4NAFB 1Q6OA 3IJ7A 1ISYA 3GAYA 5CPMA 1RR2A 3GW3A 5HATA 1VQTA 3VOGA 3SCRA 1VZWA 3AROA 1IZCA 3EGJA 3LCLA 1C9WA 2O56A 3VDBA 2X16A 1Q4NX 1QBAA 4ZTXA 3I10A 3WLKX 1NM9A 3HQ1A 2R1KA 4JQ1A 4IZGA 3FSUA 2W6RA 2Y8UA 1ZPTA 1FHDA 1NWUA 3MKCA 1ZJHA 1WCGA 1DTNA 2R1MA 1I1XA 3N6JA 3HF3A 5FEWA 5LA0A 4W7VA 3SSJA 3DDMA 1M68A 4FMVA 5LA2A 2RJGA 5AZ1A 3O8AA 3AMKA 2IPFA 4XAYA 1AMKA 4QDMA 3OYXA 1J0KA 3NXFA 4A8IA 3APYA 3KM8A 1XBZA 2ISWA 4I6VA 4HVXA 1YTKA 5MF5A 1H50A 1E1FA 2INEA 2J9ZA 3MP4A 2J8GA 1IIGA 1U2YA 2WMFA 5FF2A 4MY8A 4DZ5A 1KBJA 4D72A 5ABTA 3QPZA 1ALDA 2WZIA 5K7JA 3RR4A 1VIZA 3WX7A 1UA7A 2XSXA 3THCA 4RV8A 4GQBA 3DFQA 1FP9A 5AFDA 1IGSA 3FW6A 2W5FA 1XIIA 2BX7A 4GVHA 1T99A 4UB9A 1BXCA 3MMUA 3OGRA 5F2IA 5DMMA 3WH5A 3SN4A 4H7CA 3ARTA 1H7NA 4V15A 1TZZA 4HSNA 1RBOB 2YA0A 1M41A 1XYZA 3LCFA 5BOOA 2V3DA 3MY9A 1N8WA 3J7HA 1ISXA 1H7WA 2F8QA 3GG7A 4KWVA 1MFUA 4J3UA 2YB1A 4KESA 3WF3A 1US3A 5T9BG 2KZHA 1JDDA 2NXGA 2Y24A 2AKMA 5EU9A 2H3DA 4IIDA 1GYLA 4I90A 1HJUA 3BL3A 1BYCA 1DXIA 1FWWA 2B81A 4E3TA 4TU1A 2Y85A 2V5JA 3KOXA 1IIHA 5CSRA 3WK3A 3M6DA 4ATWA 3BGAA 3ATZA 3GC2A 2FIQA 3I3DA 4HMNA 4N0RA 4E4UA 4B3LA 3NPUA 3RITA 1C7SA 1EJ7L 4LSBA 4ATDA 3N6QA 4JTDA 1L6GA 1ICPA 4W8AA 1R87A 3TYBA 3QM3A 4NG3A 3SDOA 3DFSA 1IXQA 2ZRVA 1PTGA 1Q7QA 1ECQA 1Z89A 1LLZA 4KGJA 4M7SA 3F2DA 3C0JA 2GGHA 1DOSA 1LOLA 2OO0A 1TA3A 4IISA 3TX9A 4OE7A 1SFSA 4S39A 1FX6A 2OR2A 4JIQA 3NUKA 3CUJA 1Z32X 1EP1A 4Y90A 2QJMA 1L9WA 1JCJA 2Z1SA 2J6VA 2GJXA 3NQAA 3HA1A 3O15A 4HHMA 2VCAA 4S3EA 3VKJA 4AHPA 2C1HA 3W1PA 1JUEA 1KXVA 1W3KA 4H9ZA 1KV8A 4TX6A 3E2SA 4X22A 1G0CA 4EACA 2W63A 1R30A 4HGXA 2EPMX 2QCCA 4X2RA 4WUIA 2H8ZA 3R1ZA 4DWSB 5A6BD 3M0IA 4QROA 3CB8A 3TCSA 1F8MA 1K7EA 2Z29A 4C6LA 3TN4A 3DC8A 2PLKA 3CQKA 2BODX 2J27A 4DUXA 4QISA 2P10A 4R27A 1EWEA 1XLJA 1E1CA 1GOQA 4QG8A 3W22A 1XIDA 1X97A 3MP3A 3A22A 3F4NA 2X30A 1HX0A 3I6TA 3UG8A 4DY1A 1EHNA 3OGVA 4W4QA 1O1HA 3P61A 2NX3A 1OFOA 4MZ8A 3A13A 4DZIA 4H6QA 4NJGA 2XWDA 1Q7ZA 3WUBA 1JPDX 1TJPA 2GQ3A 3DEQA 4J2PA 2D1ZA 2Y61A 1YDNA 3WFAA 1W3TA 4NIRA 2P8BA 3QVQA 4EWJA 1JZ5A 2BFGA 3C2YA 1TPEA 1UD6A 6REQA 1YPIA 1UIOA 2FLIA 3K4DA 2PS2A 1W5MA 1X6UA 1U83A 3SW6A 1HKWA 5BRBA 1UQZA 3FYYA 1BVZA 3CZKA 1TV8A 3OEXA 2OWWA 1WDPA 1L8NA 4ZTYA 3TROA 5LIKX 1ADDA 1UUQA 1KBBA 3JU2A 1WKFA 5M5DA 1LYXA 4RW5A 4BEUA 3AXIA 5C54A 1N55A 1CDGA 1UP0A 3KDNA 2Z27A 1P7TB 1E0XA 4UNLA 4UZUA 4WDXA 3PFMA 1PS9A 1WQ5A 3WQ5A 5GVJA 1M65A 4U3AA 3UJRA 3RO6A 1GPFA 4PBFA 2ON3A 4IIHA 5D30A 4IL2A 1K8CA 3FDKA 3D5HA 2VFIA 4OTKA 2BOGX 4OGZA 1EGZA 3SQSA 3A3WA 4PUDA 4FNRA 5DF0A 3GC4A 1NWSA 1AODA 4Q8UA 2INZA 5A8PA 2XTKA 2D2JA 3I4EA 1MQPA 1H5VA 2BY3A 3CPRA 3ABQA 4JTLA 4PN2A 3WDHA 2PDJA 4PUKA 3IJDA 4RE3A 4DN1A 1DJQA 3S5SA 4LYRA 2PDCA 3SY1A 4GUHA 7PTDA 3GC5A 4X9YA 3MI6A 2ZUUA 4DUOA 1QO2A 1RJPA 3ZLHA 3U4AA 3TLQA 1C90A 2FYMA 2WNNA 5I07A 3HGOA 4Q4RA 1ZJAA 4K68A 3ZT6A 3RN6A 5DX7A 4AZIA 4LY8A 5CAKA 4F9JA 3W81A 3CYJA 5E93A 3G1RA 2P8CA 4EVZA 1OCBA 3SI9A 2F38A 4GOAA 4G7EA 2ZX8A 2GGEA 4GRSA 4GVGA 3MUIA 4Q8MA 3WD0A 2V5BA 5I2UA 4UOQA 2J13A 1R3SA 1J0JA 4GUFA 5ABEA 1B3OA 4IL0A 4WHBA 3OLEA 3S6TA 3K5XA 1HNYA 4WD0A 1BG4A 3W02A 1GEQA 5BYWA 2EJ1A 5AYBA 4CEUC 1ENUA 2IQDA 4UQCA 4O8RA 5H91A 2XM1A 4D8AA 1TG7A 4G2DA 3W4RA 1JRBA 1A0CA 4FNSA 3T07A 2NQ9A 1TX2A 5DO8A 2BNJA 3VCNA 5EYWA 1WBHA 4NAEA 4XX6A 3GDTA 3VOJA 3HFYA 1RP8A 3TMLA 1FHVA 3ARYA 5A6JA 4GC4A 1ONEA 1HGYA 3NTYA 4CQAA 3W1QA 4FR6A 1WXZA 3ZQ9A 1FH9A 1MW3A 1CGYA 5CZ0A 4XIMA 4C6EA 1DWIM 2VGFA 1FBAA 2PDUA 1QCWA 4D6JA 3EOUA 4G7EB 1I75A 4Q4SA 3C61A 3HGSA 1XINA 5FA5A 3HV8A 3R8RA 1C8XA 7REQA 5B80A 1YADA 2PTWA 3QF0A 3GFYA 1AMYA 4WY0A 1YPFA 3AS2A 3ICJA 1V5XA 4LUYA 1JCYA 1IT8A 2BXVA 2E67A 3DBNA 4NXSA 1SSDA 4HPXA 3OHIA 2X42A 3C2RA 3VE7A 2PD5A 5KITA 4M6PA 1S5MA 1A49A 4NY2A 2FDMA 1BKHA 4NAEB 5FEXA 1A80A 1SFJA 3AYRA 4UR9A 3UD6A 1B9BA 1EXBA 4ZB5A 3QMTA 3FHAA 3BQ5A 2GVEA 3I4KA 3CZEA 1W91A 2PB1A 3AALA 3R0UA 3DFTA 4C6CA 1Z48A 2VZTA 2J79A 4YTQA 4PTNA 2NXIA 2NV1A 4U31A 3QMRA 5C5YA 8RUCA 3GZAA 1RSCA 2WV8A 4M6VA 3CLWA 2VGGA 2CBUA 3W84A 4MB3A 3E2VA 3FEQA 3UWYA 3L5AA 4ADUA 3ARUA 1DJNA 4KMQA 4RZBA 2ZZ3A 1ONRA 1G01A 2ZE0A 5LGXA 4M8UA 4HK6A 2CETA 5A2CA 2HNEA 4AQLA 1HF6A 2W9MA 1ZRQA 4PR4A 3SIZA 4PUNA 3IRSA 4US5D 4ZOAA 3QQWA 1JUBA 3KZPA 3W7KA 4A22A 4XD3A 1EKOA 3HPAA 3W28A 1UKSA 1W1TA 4O0KA 3NQDA 4YS1A 3LM3A 3REQA 3WLJA 1VYRA 3WZ0E 2ZDRA 4HA3A 1F3WA 3TQVA 4L6HA 4LAZA 2ICSA 4UTFA 2ALDA 1P0EA 4B3ZA 4XO7A 2QUUA 1E0VA 5F1VA 3N6HA 5G4HC 3AIQA 3ERPA 2X05A 4LCRA 4M80A 4HA1A 5EA9A 3T1GA 5F4XA 3U9IA 4JICA 4PEEA 4WDTA 3RCYA 4M6UA 3B4UA 3TSMA 5GJPA 3VA8A 4XQ6A 1NDZA 3U3HA 1UUMA 3USBA 2CEQA 1LG2A 1J6PA 3UNTA 5BNKA 3H7VA 1K8YA 1RPXA 1K77A 4KKXA 4J3WA 3N34A 1V6VA 3TZNA 2OOFA 2FQIA 2OLAA 2C13A 5DELA 1PYMA 4UCFA 2VI0A 3UR2A 3L4ZA 3WLRA 4DQWA 4PULA 3PZUA 2CYGA 4EIVA 2JKAA 4DXXA 2Z4GA 3H2AA 1LCOA 3V16A 1QW9A 1F5ZA 1R3RA 3THQA 4F0MA 5E70A 2OLSA 1HJVA 5FEZA 4F2TA 1PTDA 1RV8A 1OG0A 2YYUA 5D32A 4V1XA 5AYZA 3UXAA 1GOOA 2Y88A 3IVUA 1DQWA 3KBWA 4JS3A 1WV2A 1EC8A 4B15A 5F2LA 2X0SA 4F4RA 1HL8A 3VXGA 4H4IA 3NDOA 4IP4A 2YXXA 2WZEA 2WM0A 1E5NA 1K03A 1YXCA 4W84A 1GHSA 2DIEA 4IMFA 2WMKA 4ZSUA 1V7YA 1B0IA 1XLLA 1B3WA 3AUOA 1XLDA 1IV8A 2IPGA 2Q3OA 3VNYA 4HIBA 1VRDA 1ISWA 4H00A 5TBOA 3IGSA 4M1RA 5KEZA 2DQWA 2B4GA 3ABXA 5DRCA 3ABOA 3VIGA 1PX3A 5DLCA 3QEZA 3IIZA 4M3PA 1WDWA 4L4PA 1UD5A 1TCDA 2HQAA 2GJRA 2FGBA 3EX1A 4GIYA 3E02A 4CKQA 5CPTA 1PX8A 2REQB 3CM4A 2ACUA 1BXNA 4MDOA 1EP2A 1DWGM 1QWKA 3S6OA 2DH3A 4DYEA 4P7LA 1QT1A 2ZDSA 4DPQA 4Q33A 4JPGA 2RHGA 3NM3A 4RDWA 4JTFA 2A6LA 3DG3A 2WB5A 3W26A 3GG1A 3GR4A 1TCMA 1QATA 1TPC1 2ZA2A 1EEXA 3CLMA 4GBDA 3OVRA 1FKWA 1ZZMA 3AIVA 3OVGA 2ISSA 3RMJA 1F05A 4W7WA 4I9AA 4FZIA 3VILA 1X39A 1ZB5A 4PB4A 2VTFA 2PD9A 3GHSA 1UBPC 2PTDA 1CXLA 4B5VA 2CLPA 1PTAA 2E77A 1XIGA 1LL6A 2V67A 3QLDA 2QVNA 1HP4A 2V0TA 3E2RA 4NYUA 4MZ1A 4L5ZA 3QKEA 3OODA 3KL0A 3E0WA 2POZA 1OC5A 1X1NA 3B0XA 1RY0A 3E0LA 4K7VA 3W75A 3AJ7A 3LBCA 3SRFA 5AC4A 5AB3A 3U48A 2ZBTA 3M9YA 6XIMA 4HD5A 4AWSA 4DO7A 1LF1A 2NW0A 2J7GA 4OV9A 2QJHA 3VIPA 4R7OA 4YTTA 5B7YA 9RUBA 1LT8A 2YX0A 3WKZA 4WR3A 1R86A 4MADA 3SFKA 5T9CE 1UMLA 3UZZA 1ZTVA 1CWYA 1N8IA 4JTUA 4C6QA 2GVLA 3IJ9A 1NQKA 2QNEA 4WGXA 1ONWA 1FVPA 4L9XA 4DJEA 3NSNA 5G1MA 2G37A 4FXSA 3AXXA 2WKGA 4Z1CA 1VFUA 3WD4A 1JZ3A 4D8ZA 3VM7A 4ZVJA 4IXHA 2G3MA 5CPNA 3TC3A 4FNUA 3OQ8A 5A5WA 3NGFA 4GQRA 1JXJA 3ZS4A 1UWSA 4HCLA 4OJYA 4ZO8A 3R94A 2A6NA 1W1B1 3CO4A 1Z6KA 3B03A 3GHRA 2FZDA 5HPCA 4V1YA 2IQTA 4KRZA 1K4HA 3M1ZA 1R2SA 3JR2A 3UCDA 4CCDA 2WWDA 4XG1A 1JXKA 4Q8VA 3UWWA 1MVYA 3LLDA 1MUCA 3EXRA 4NHVA 1W2VA 3QR0A 4WSJA 3SUVA 3WJZA 5C9XA 2XN1A 2TRSA 3OQEA 2NVCA 1WKEA 3T8LA 3OVQA 1P43A 1C91A 1YYAA 2E25A 5HNUA 1OCNA 2EG8A 4B4FA 1XWYA 3AI0A 1QASA 4GXMA 5A3HA 3Q2DA 2FTYA 5GNXA 4HB7A 4PCTA 4QQ3A 2Y70A 3XISA 2VT0A 4JY8A 1XI3A 2BVWA 1OX5A 3W1XA 1CI1A 4AAJA 1K9EA 2WHJA 1JI2A 4ADSA 3R5EA 3PZQA 2C1IA 4DBWA 3QTPA 3WENA 4H6EA 2YYTA 1RVGA 3NQ6A 3IGUA 2VFHA 2PBOA 4ZGYA 5LIYX 3U7BA 4LUSB 2FMOA 3H23A 1LT7A 1SO3A 3BSMA 2QQ6A 2Y63A 7ENLA 1JF5A 4D6CA 3BAJA 5FI8A 2HCVA 4MJMA 3LUTA 3WQOA 5M17A 4GO8A 2VZSA 4FX7A 3T08A 1CXKA 1LWJA 1MMFA 2WC4A 3L5LA 2FFIA 1SYTA 2A3BA 5FD0A 4LEQA 1G4TA 2EF9A 4NZFA 1A5UA 4LYQA 3H7RA 5EGRA 4BFAA 1GVEA 2WC7A 3NVDA 4B90A 5LNWA 1QNOA 3BTNA 1DJHA 3STFA 1E5JA 1ZP4A 1UH2A 2VFEA 1UBSA 5EMJA 3CIWA 3FFSA 1TKKA 3QV6A 1QDSA 1W31A 3PUDA 3AIBA 3QY7A 3T9PA 4NJJA 3AU6A 4LBUA 1FWHC 4LVDA 3D3FA 3RHGA 3MP5A 3TJXA 4AIEA 4Q6XA 1CXFA 1S5NA 3N15A 2PODA 3LNPA 3W86A 4AZCA 3I65A 2H8XA 1FCQA 1LQAA 2CZEA 1SO6A 2A85A 3MHUA 1Q2SA 1KFLA 1MI3A 4C6OA 3FKKA 2AQVA 3TWAA 4GJJA 4MWAA 5HPOA 2ZX7A 4N6FA 4O50A 1AW5A 3AMDA 4IMCA 4OUIA 2WVUA 3WQ6A 4KF1A 4CCCA 2JK2A 4AD4A 3VD7A 2ZX5A 1IHIA 4A2RA 3T4WA 4MHBA 2YBUA 1RALA 4RZ6A 3SUWA 1H63A 1EIXA 4AIBA 1S2AA 3RFAA 1PZ1A 4M29A 5U7SA 5J04A 4ACZA 3H12A 4A21A 3M0MA 1JAKA 3VZZA 4YPJA 5BW6A 4MB4A 2YCLA 4URIA 1SZRA 1VPXA 4U5IA 3QYSA 4PUUA 3QGKC 3LXBA 4IWWA 4WKAA 5ENLA 5G1YA 3G1AA 5AOUA 2V2HA 1FUYA 2O0TA 2O7QA 4QS5A 2MUCA 5EB8A 1TSIA 3AO0A 3ECQA 1E40A 4YCPA 3KL3A 2P0IA 2HPIA 5IDIA 1E3ZA 1HUVA 3MKVA 3BSGA 1PKLA 2DZAA 2TMDA 4XZHA 6XIAA 2GQ8A 1KTCA 2W0UA 3EWBX 2DY3A 3V0SA 4AY1A 1G94A 3WD1A 2VVSA 4JTKA 4AZBA 3BW3A 4IIEA 1U5VA 1UZ1A 2FZBA 3NIYA 5D2XA 4AW7A 2A3HA 4GGHA 1PX4A 2J7CA 5CGMA 2XSAA 3FA5A 4PYSA 3K4AA 2EPHA 1VBHA 4RE0A 2ZUTA 4AU0A 2QCDB 1GNXA 5FJIA 4K6AA 4OQVA 5BRQA 4W8BA 2TAAA 2ATSA 1BQGA 2PDPA 5JQ9A 4NX0A 2YCLB 1FWIC 2WVVB 4PBGA 4XBKA 1C8QA 1KFEA 2UWFA 3V4BA 1BYDA 1BVNP 3IJLA 4JTQA 1LJYA 3WK2A 3NL5A 1EYEA 4H7VA 5HDRA 2ZKMX 3K8KA 1OX4B 3P0WA 1NDYA 3R4IA 3SRKA 1X6NA 2ZQ0A 3VI2A 2ISVA 5CSSA 2W66A 1KM0A 2XSBA 2OGYA 1CCWB 1XDJA 3ITYA 4LB4A 3AHVA 4AMCA 3OTRA 2G41A 3ARZA 1XW8A 4DUWA 4AZGA 4ECLA 1YMYA 4BR1A 2VKZG 5K4ZA 4ZBCA 1XIEA 4Y2WA 2QCFA 1V3LA 3KVKA 5HJLA 3DX5A 2E9BA 1W9XA 1U1JA 1E6XM 5DT5A 1LQ2A 1IXPA 4UFLA 2ZICA 1M5WA 3LX9A 1HT6A 3M7SA 1HKMA 3MCMA 2XGBA 3UGVA 4ERIA 3F4DA 1KO0A 4GUGA 3H2FA 4ALDA 1OBAA 4FXRA 4GY7A 1Y0EA 4KRUA 1SSGA 4L4LA 4REQA 1GVYA 1Q6RA 4JKKA 1K6WA 1FRBA 2PURA 3OB8A 3U8GA 4E2OA 4O52A 5JMUA 3AUJA 1KWGA 2RUSA 2QMJA 1J96A 3W87A 1NTHA 5LKYA 3BMXA 3R0KA 4LOCA 3QFWA 2JBMA 1PDYA 1B3ZA 1VEPA 4NVTA 2UBPC 4OBSA 3G77A 2VNCA 2X40A 3ZR6A 3MI3A 1UWIA 4C6JA 3W7EA 2WZTA 4DNMA 2Z1XA 2D2HA 4WKFA 1ZBKA 2I5IA 3CASA 1JYXA 1VHCA 3EDEA 4XTDA 3H26A 4DLFA 1C7TA 2IMRA 2QDGA 2RGMA 1WKYA 2O4MA 3FA3A 3M0JA 3W0KA 4NZCA 2EHHA 4M6QA 4HOZA 3HPFA 2QJJA 4QHRA 2QLYA 2W67A 2A21A 2FMNA 3CUXA 4KS0A 3S1VA 1J18A 2UY4A 3R43A 2OWCA 4XAPA 2XM2A 3AOFA 3F4WA 1A5AA 2P88A 2YA2A 4MFDA 3U6WA 5BOEA 1X8CA 4RDYA 4QITA 3WUFA 3BLIA 2VWSA 1UD4A 3W9ZA 1D7KA 5I3IA 3NOYA 4L1XA 1EA0A 4IG2B 4GMEA 3CGTA 2PDLA 3PM6A 4GI6A 1ME7A 3OBAA 3IVSA 3OHMB 5BROA 4DJFD 4F3HA 3C0QA 1GVRA 3BV7A 3PULA 5A8NA 3F5JA 3K8MA 3GH7A 1KGUA 4DIAA 3NOEA 5REQA 1PAMA 1GW1A 4LRTA 1HIZA 3T05A 1SU5A 4LCSA 1FDJA 4KIEA 2JEPA 2Q01A 1O5QA 3KZSA 2J9XA 5H8PA 1FWRA 4DZHA 2VDGA 3IVTA 1DJIA 4FOKA 1DXFA 4MUZA 1U1HA 1V77A 1QXLA 3AZSA 4YYCA 4AD3A 1J11A 1Y5VA 1W37A 4EAMA 2MNRA 1UYQA 2Y5EA 4QDPA 3UJ2A 3BW2A 2ZTJA 3CHDA 4UNKA 4UZSA 3UZJA 1OCQA 3EDDA 4CCEA 4HBKA 3WLOA 1QPOA 2QUMA 3PZ9A 1DXEA 1FWNA 4J40A 2DGAA 4Y6GA 1VYPX 4HA4A 2OSYA 3LPPA 2J7EA 3GNXA 2XVLA 1LBFA 2AAAA 1RQHA 3EOSA 3B9DA 5EFFA 3MT1A 1C3FA 3ZIZA 3N18A 1I45A 1ZNNA 3CBWA 4MAZA 5M03A 4Q8TA 3T55A 2BP1A 3PJTA 4HP5A 3WBXA 1K7FA 3RLUA 1S38A 2ZX9A 1MQQA 1NJJA 2X7WA 3AISA 3ARQA 1US2A 1QU4A 2D20A 2FGZA 4DO4A 4AZ7A 2Q02A 3DUGA 1REQA 4Q4PA 1UZHA 1E72M 3O6CA 1PZ0A 3PZIA 1Q85A 2XHYA 3WELA 3FNDA 1NQ6A 3ZMRA 1UH3A 1NY1A 2VEKA 2O55A 3TN6A 5BMWA 1XISA 1OB0A 1YTEA 4P61A 3V0TA 3AXHA 1XGEA 3TYUA 4D6GA 5EPDA 4D71A 3GTXA 4W7UA 4DLMA 2X7VA 1SVDA 4AF0B 1WZKA 1KGXA 2FPYA 2PWHA 1TV4A 3IAPA 3C8NA 3EDFA 4GZIA 1I1WA 2IKJA 1WZLA 2B7NA 1K02A 1HO4A 5HULA 4GX9A 3F2CA 1Q6DA 2BGQA 4O4VA 2IPJA 3W7PA 3RUBL 3RPMA 4O18A 4DRSA 3MV01 5CBBA 2JIEA 2EJAA 3MJYA 2AGTA 4OV4A 4U2YA 4ASTA 2AL2A 4R5EA 3DHFA 1XH0A 2AQWA 1C8VA 3WO8A 1QUMA 4OKDA 1REQB 3A9IA 2I7GA 4LS1A 1VKFA 4YL2A 1MSSA 4JKLA 4F0SA 2WJEA 4J3VA 3KHJA 1TZ7A 1LUCA 3II1A 1JRCA 2W91A 3ITXA 3S5OA 3W1AA 1X38A 1BYAA 4HU8A 3LQGA 5CGQA 4IIGA 3N9SA 1H7PA 3U2OA 1X8FA 4Z2LA 1ZGDA 3ORWA 5FSDC 4LX4A 4JD4A 4GKTA 3AICA 4IOTA 4U28A 5DFAA 4A3QA 1EYWA 3OA5A 3M64A 4D8LA 1UR2A 3VX0A 1Z9AA 4B5XA 1JFXA 3MANA 5CSUA 3B0UX 2VRJA 2WVTA 4CQDA 2DZPA 1V03A 5XIMA 4FLRA 2F7FA 1ADSA 4UTTA 1LRTA 5I24A 2OX1A 2WC3A 2QT3A 3EBVA 1UASA 2G3NA 4JQAA 4J9JA 3ITOA 4ILSA 1X7FA 2YBVA 3P8IA 4LYPA 3UJSA 1W1PA 4AEFA 1BWVA 4JIRA 4IFKA 4JQ3A 3UF9A 4GK8A 2ZX6A 4J28A 5FOOA 4DJDC 3CL7A 1UR3M 2J77A 1Q5MA 3ARVA 4EF9A 3FHQA 3R10A 1FXPA 1FWSA 4QG6A 3TAKA 4ROPA 1OG6A 2G97A 3UXDA 1TYGA 3BZJA 1HKVA 1GOMA 2EXOA 1VB9A 4QTGA 4JEQA 4KETA 2XN0A 1CB2A 1FWFC 2G4FA 3W29A 1PCWA 2H9AA 1OFEA 1A5LC 3C2EA 3TR2A 1XCFA 3LHVA 2QDEA 2EBNA 4I9TA 3NQ8A 3M44A 2VEFA 4Q7BA 3TYCA 1J0HA 3GQYA 2X09A 2BZNA 2VX5A 2Y7EA 1BD0A 3VPLA 4XAFA 4XBSA 1J5SA 2PSNA 4PUEA 4MKVA 3WMCA 4EK7A 1XBVA 1E15A 4E8CA 3SIMA 2XH0A 2QAFA 4FXFA 3NZPA 7TAAA 3L4WA 2E68A 1EUAA 3MCNA 4CLMA 3GDLA 2EPLX 4MJZA 4XB3A 4FOUA 3Q37A 3CO8A 1W56A 4I9MA 1AK5A 2WSQA 4IQEA 4DO5A 2VZVA 3PBGA 4RKAA 1KTNA 3PJXA 3W70A 4XISA 1RJQA 4JTRA 3FKRA 3QC3A 5HWNA 2QMKA 1TQJA 5CPOA 1NOWA 3B4YA 2HS8A 1Z3NA 1Z8AA 2XZ9A 5AC8A 5JIPA 3CUHA 2PTXA 4DWSC 1T7LA 3VZYA 1W1YA 3DHPA 4HOWA 5FEPA 1KFCA 2ZWZA 1VC4A 4PMNA 4V27A 2PZ0A 4QAIA 2PWFA 1IT7A 2F9RA 3D46A 1ZBCA 3W27A 1IXOA 1SZGA 2CIPA 2DVTA 3JUGA 1OFBA 2YPIA 3IJIA 1XRSA 3NZGA 2QW5A 3PC0A 4ZO9A 3TW9A 3W72A 4FI4A 1DBTA 1YBQB 4FNPA 4RCXA 2ZFAA 4G1KA 3CZJA 3AWOA 3CAVA 1EJWC 4P2VA 1X7IA 4O17A 3NZQA 3E2QA 1W1VA 1DHPA 3KRZA 3L2MA 5HA7A 1UKOA 2GL5A 3G18A 1PWLA 3W7GA 2CZ5A 1E0TA 2HVOA 5D02A 1FHUA 1IEWA 4Q7IA 3QPYA 4R7JA 3S5NA 2PWEA 3OBEA 3AIWA 1LDCA 4GKLA 1DWJM 2DU2A 4FA3A 3MB9A 1V3MA 2B31A 4KWOA 5IFTA 3WQ4A 5AECA 3QBUA 1H1NA 5D05A 5GNZA 3RRAA 1IR1A 1O6IA 1PYFA 4PH6A 2JF6A 1W9PA 3WLHA 2XVNA 2I9EA 4BY3A 4D9PA 4F0HA 4Z2HA 1Q2RA 3CV7A 3GDBA 1KQZA 4Q8QA 2OYLA 1DIKA 3RU8X 2WCAA 3WBAA 1EZ2A 3KBMA 1ZL1A 3UFYA 5TIMA 2PGFA 3HGRA 3RYSA 2VP8A 3ATYA 3HPZA 1LBLA 1PPIA 1PXGA 4Y96A 4IHCA 1J79A 5RUBA 1MDLA 4JIHA 1XUZA 3NWRA 1WDDA 1CLVA 2VR2A 1HJXA 3KWSA 1BTCA 1CNVA 1M7XA 3ZVHB 2NQJA 1XICA 2TPSA 3TJLA 1RA5A 4N42A 4U5KA 1V0NA 3UCCA 4CNTA 2EGZA 3LTYA 1TMLA 2OTDA 3ITTA 3W7JA 5EMUA 4K1GA 3PZGA 1UR9A 1G6CA 1UCWA 5CBIA 4LUJA 4LVAA 2GSHA 4GACA 5AC7A 5I06A 3THUA 3GVVA 3WLNA 3DYOA 1ZLPA 4GNKB 3VNMA 4J35A 3HJEA 3W3OA 5A95A 4FIQA 4ZOCA 1XFCA 2ZOXA 2ZZ7A 1W5QA 4YTUA 2PRLA 5D8ZA 3VGDA 4HTYA 2V2CA 3UZYA 3QV7A 3VAVA 3EDJA 3NSMA 1EWDA 1R46A 4J7RA 1XKYA 4LH8A 3I7QA 4UMBA 3OLIA 2X2YA 1W17A 4NZ3A 5BWFA 2ZRWA 3AMLA 2QDDA 2WJZA 4PTDA 2JF7A 1P1XA 1DE5A 2BV9A 3PBUA 2PP0A 5E9XA 4H9UA 2XVPA 1RBLA 3RJYA 1KD0A 3LCGA 4TXEA 3URNA 3CC1A 4JHZA 4BI7A 2ZVIA 3VKAA 3NPWA 3N19B 1CGVA 3EOEA 1W6TA 4HNTA 4BA0A 4GVFA 3GU2A 2G96A 2GOUA 4QJ4B 1XYCA 1PKMA 4PL2A 3RCNA 2ADAA 1NWRA 5K4XA 1JI1A 3DFPA 4H2CA 1Z69A 3VIIA 3HV9A 1TV7A 2D3LA 3SCUA 4PTXA 3ZT5A 2ZZ2A 2A3AA 3TP4A 2QGHA 1KRMA 3TK7A 1XRTA 5CZKA 1I8JA 3TZFA 2OT1A 4FHAA 1I2OA 2A7RA 3W7RA 1DIDA 3WJSA 3UG5A 3RM4A 3A21A 5AHMA 1KWKA 2GQAA 4S3KA 1TV2A 3G6LA 1G1YA 3YPIA 4XKYB 3CAQA 3TWBA 1CX9A 4KRTA 3AZTA 2BLEA 1JNDA 5AVHA 5IHSA 1U33A 1VAHA 2C18A 2WNZA 3SSZA 4U4MA 1E6ZA 4CNNA 3MMWA 2ZVRA 1G4SA 1A50A 3N29A 3FV9A 2FZMA 3NJ3A 1UZ4A 2PDHA 3KBVA 4K1WA 5A6TC 3VD5A 1KXTA 1VCGA 1MDRA 3ABRA 3NXLA 3S83A 4UC5A 1GJUA 1Y65A 2QJIA 4UQEA 4HU4A 3PUOA 2Y7FA 1MXDA 2D3NA 1A3HA 1UUOA 3GW0A 4P8VA 4QLKA 4AZ5A 3ZO9A 3MUZ1 4Q8PA 4JL1A 1UROA 1V0LA 1AH3A 1JCLA 2WQPA 3KVMA 4AYSA 3CH0A 3MMTA 1DJYA 1XL9A 2PDWA 3ARSA 2NLIA 1W54A 3U0HA 3EDKA 2WXDM 1M7JA 2C6QA 4PMYA 1XD1A 3T0DA 4JGDA 4YMZA 4IFRA 4Y8EA 4O1CA 4QEEA 5LZLA 1V0KA 4Q8WA 2B0MA 4FXJA 1RLDA 1P0BA 4J3ZA 1ZS2A 4DF1A 3SFWA 4IPPA 1E9YB 4E0CA 1WDRA 2QPXA 2QCMA 3VIJA 4AD5A 1KV5A 4ZO7A 4GFSA 2E1WA 2VCBA 2J74A 3DN5A 3NR0A 4B5UA 3G1DA 1LM1A 1AH0A 3BXWA 5CC5A 1M01A 5DCDA 4M81A 1TTJA 1MO0A 4TVUA 3R8GA 3CHEA 4PEKA 1UIPA 2QIWA 1WPCA 1VLWA 3XIMA 3GBEA 1LLWA 4FX8A 4EWND 1K8ZA 4C7GA 1OJXA 1L6FA 1P6CA 3NO1A 4JNYA 4I5XA 3DFHA 2UZ9A 1D2KA 3RF9A 4N2YA 3L7RA 2GPTA 1W8GA 2Y4SA 3PZMA 1H3GA 1OYBA 4BJHA 3C2VA 1YTDA 4AVOA 3LXCA 3H2OA 1K9DA 4NSBA 3R79A 4OWGA 1SJAA 5DY2A 4ZOEA 3G1XA 3ZLFA 3DI0A 3R2GA 4JTEA 1UC5A 3D0CA 2GVJA 1SO4A 3VKKA 4AG0A 3BGJA 2C8NA 1K6AA 5EKYA 3T42A 1KFWA 3NFUA 3WBEA 1EBHA 4QIUA 3MZ2A 2HXUA 1WNOA 4FLSA 5HNTA 2GJPA 3B04A 3BGGA 4E2BA 2WAGA 2BXYA 2ZXBA 2C1GA 1UA3A 3VKCA 1M9HA 2CU0A 4C90A 1VBUA 1EJRC 3TC7A 3SADA 1ICSA 1FDZA 4KIRA 3OW1A 1CEOA 1PL9A 4YHGA 3H2MA 2ZUMA 4L6OA 3UGRA 3VMPA 3BG5A 3C0SA 3FN9A 2CLLA 1EF3A 2C79A 3ANYA 3UY7A 2YW3A 4Y9NA 2G95A 5AHIA 4ZOBA 4IGHA 2BG5A 3W73A 3P60A 3GNPA 3HG5A 4L61A 3WJWA 4QCFA 1EP3A 3W37A 3LQLA 2VEPA 3GVWA 4O19A 1SMAA 5ABFA 4QEHA 3P8JA 3SGGA 2V5CA 2Y7DA 3GIQA 1ISVA 2JQXA 3SUUA 3AXMA 3M5XA 1PZ2A 3WNNA 1I2RA 1VFSA 3W00A 4C1LA 3IAQA 3CUFA 1GKQA 1HL2A 1Z42A 2VHLA 5EMLA 3JW7A 4HU3A 2WNWA 1DHKA 1UW9A 3WMSA 4ZQMA 3UZWA 3C2OA 3ITVA 8XIAA 1CGUA 1JGIA 3CNYA 1TRDA 4XBJA 1VD6A 1DJXA 3WBYA 1WZMA 2WKJA 1XD0A 1D9EA 3TFXA 1E4LA 4C6NA 4ZB2A 2PDGA 3CPGA 4GCAA 2BVDA 2Z7GA 1UOKA 4ZXOA 3CEPA 2RAGA 3WF4A 5PTDA 3KOYA 1VFLA 1GQKA 3W6LA 4WSKA 3W2MA 4POCA 1A3WA 4LALA 3G1HA 1TTPA 4AD0A 1UC4A 2IQ0A 3IANA 2EAWA 4H6RA 1QK0A 3A4JA 1CT5A 4GI4A 3THAA 1EQCA 4ZFMA 3H22A 4ONVA 4WZHA 3ES8A 3TC6A 3MZNA 1LL4A 1XIJA 3GWQA 1DWAM 3M0VA 2V5LA 3EPMA 4EOUA 4O8AA 4Q3MA 4CD7A 3T09A 2HVMA 4FSAA 1TB3A 2VM8A 2JE8A 2V69A 2NSXA 1RVKA 1QHPA 3N11A 1GYNA 3U2CA 4GGBA 1EJTC 1XKJA 3LN3A 2E8ZA 4QM1A 3CU2A 3CS2A 1O12A 1QVBA 2D2OA 1AVAA 1GCYA 1VF8A 3FXYA 2WMIA 4WKHA 1XC6A 1TTIA 4NQ1A 3L0NA 1UWUA 3KL5A 4DAFA 4DBEA 4W8LA 3LSBA 1LROA 4I7UA 3O7UA 3ZJKA 4LBSA 1TJ1A 1S2UA 2FFCA 3PUGA 2GDVA 1GW9A 4B9ZA 3WLTA 3NQ7A 3MYOA 4O28A 1TR9A 3K8LA 3HMCA 4AY7A 1OF8A 2HROA 4NASA 2PWVA 1AL7A 1IXNA 2A5HA 3U2ZA 1TREA 1OK4A 1XLEA 1W2PA 3N3MA 1CTNA 3K1GA 1VRXA 4NT0A 1EL3A 1S2CA 1W9DM 2CLKA 4GFIA 5EFDA 2XG9A 4DJED 2Z1BA 1B3VA 2BY0A 2GGJA 4U33A 4DAIA 5BXPA 2R24A 4K37A 1R3TA 1KLZA 3LMYA 2F2HA 2OJPA 3BAXA 2VGBA 5FESA 4QG9A 4AC1X 2R9RA 1BAGA 3FA4A 2J66A 3DI1A 1U5JA 1QI2A 4YWSA 4BK9A 1G67A 5H6HA 1RK6A 2RJHA 3BMWA 3MBFA 4LNCA 2BVYA 1XLIA 3S5YA 3T6CA 1WAUA 2CLMA 5JBFA 1H1ZA 3R12A 4Y9OA 1XSIA 1WO2A 3GD6A 3KVLA 2WBKA 2GDUA 4P7NA 3KOWA 3PBWA 3AC0A 4OHQA 1KKRA 1M1BA 2DSVA 1DL3A 1V3KA 3LHYA 3QV9A 2HRWA 1KBLA 3M0HA 1T5AA 5JBEA 1J10A 4WJEA 3ZR4A 2VFFA 1GZGA 3OZMA 1PWMA 3BJSA 5HR7A 2PCQA 5FCZA 2WZHA 3LDVA 4O15A 3EWCA 1W3IA 5C6MA 3R11A 3P93A 4YXGA 3IK2A 2W3ZA 2PU1A 4J1OA 1FHLA 3I3EA 3S1UA 5I3DA 2YCKX 5A2AA 4GNVA 4MM1A 3S9YA 1QOQA 1I9CB 2PAJA 5J8LA 2BSLA 4PC8A 5HUOA 4FX6M 1LP6A 2DDXA 3F7JA 3H21A 5AYIA 4KFOA 3GTIA 4NILA 5BRPA 3TDFA 4G5DA 4P8WA 4QR6A 1QHZA 3SY8A 1R8LA 6ENLA 4NXKA 3GUWA 1H1YA 1M53A 4Q7NA 3WQCA 3PNZA 4W5ZA 1DVJA 4HJFA 2UY5A 2DSWA 5C71A 1A4LA 1O5RA 2WZMA 3ID7A 3WEOA 2WSRA 1OC7A 2ZIDA 3LS9A 3GE7A 2YDQA 5BXTA 3N04A 1NFPA 1A5OC 4A4AA 2GGGA 4B4HA 4JYDA 1A53A 3NAVA 4GXWA 4LVGA 3ONCA 4DPPA 3FIGA 1T40A 4A6GA 1EJUC 2BDQA 3V36A 1J8VA 2PPGA 1JFHA 1F9CA 4TQTA 2Z2AA 3LHTA 5EBUA 1KCXA 4NJIA 1CB7B 2ZUVA 2J7FA 1ZALA 3TR9A 5TAOA 4AD2A 3VO0A 2OQLA 3LGDA 3CAWA 4GUIA 2WLZA 3BANA 1RZMA 1F73A 4X61A 4FR1A 3WQ8A 1E9ZB