2ISSA

Structure of the plp synthase holoenzyme from thermotoga maritima
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
281
structure length
281
Chain Sequence
HMEIKKGTWIIKKGFAEMFKGGVIMDVTSAEQAKIAEEAGAVAVMALERVPADIRKEGGVARMASIAKIREIMEAVSIPVMAKVRIGHIAEAKILEELGVDFIDESEVLTPADDRFHINKHEFKVPFVCGARDLGEALRRIAEGAAMIRTKGEAGTGNVVEAVKHMRRVMEQIKQVTKMEDEELVAYGKEIGAPVELLREVKRLGRLPVVNFAAGGVATPADAALMMMLGADGVFVGSGIFKSKDPRKMAKAMVLAVTYWDNPRILLKISEDIGEPMRGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase, transferase
molecule keywords Pyridoxal biosynthesis lyase pdxS
publication title Structural Insights into the Mechanism of the PLP Synthase Holoenzyme from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
total genus 94
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2issA00
3TC6A 3G3MA 3LXCA 5D37A 4FNQA 3S8HA 5HWNA 3MYOA 4I7WA 1A5BA 4B5NA 1GVFA 2DORA 5C2XA 1TTIA 4RZ6A 1O60A 1OK4A 3RU6A 3QEZA 4ALDA 1B57A 2BXVA 3W84A 4P61A 4EOUA 1VQTA 3ZFHA 3L0NA 2OMAA 1EX5A 4I7VA 4E2DA 1FQ0A 1LBMA 1QAPA 1ZALA 3CWNA 2X2GA 2Q8LA 3TU9A 5AB3A 1N7KA 2B7NA 3BO9A 2JKPA 2WV8A 1SR9A 5FF7A 4DO4A 1HG3A 1OFBA 1LRNA 1XXXA 1F6PA 3HPZA 1EWEA 3TW6A 1C29A 1LORA 3HQ1A 2C3ZA 1Z42A 2NXGA 1SO5A 1OG0A 4LW7A 1W31A 1LOSA 5AC8A 1WA3A 3BGGA 5HNRA 1T96A 1ICQA 1VHNA 1GTEA 1KV5A 2VFEA 1KM6A 3BG5A 1NAL1 3P62A 3S1XA 1HO4A 4K6AA 3W2NA 2ZCGA 2ABBA 3CEUA 3QPZA 5BMWA 4AHOA 4EWND 1TO3A 4BWLC 1DVJA 5D32A 3Q37A 1MO0A 2CLOA 3TFXA 3TE9A 5T26A 3LTYA 4CNNA 4MY9A 1N8FA 1O95A 3W7LA 5FEZA 2V9DA 1JCYA 3SECA 3CQ0A 1S5VA 2A5HA 1QPRA 3M5VA 4O50A 3A5VA 4KWVA 3O16A 3NL3A 4XZ9A 4GUFA 3P60A 2ZZ7A 3HBLA 3HIJA 3P82A 5D09A 4YLWA 2GUUA 3GKFA 5KZDA 2BTMA 1B4EA 2ZRYA 3CPRA 1OK6A 3E96A 3T44A 4TU1A 3UZJA 1KTNA 4NNAA 2R8WA 1DORA 2A2IA 5DCBA 3GXPA 2ZQ0A 3U6WA 4UMAA 3C2RA 3QYQA 2QCDA 3T78A 3SJ3A 2I14A 3W2JA 5KZMA 5TBOA 1ME7A 4OV9A 3PSVA 3UZ5A 4PCFA 3W85A 1UBSA 1AW5A 3TAOA 3SIZA 3DGRA 2JKAA 4MYXA 5G1TA 4WQ6A 3WJZA 1QO5A 5FF2A 2ABAA 4JTSA 2AAMA 1AMKA 3NQFA 4JTUA 4XKYA 5J5RA 1VYRA 5DCEA 1SFJA 1EPXA 3E0IA 4DF0A 3LOTA 3DBPA 1GTHA 1YXCA 3LHWA 5CG7A 2AGKA 3TAKA 1GPWA 3TSBA 4GE8A 3B0UX 3MHUA 3TX9A 2VFFA 3QH2A 4DF2A 1SO3A 3FKKA 3KAOA 3S5YA 4N9DA 4JEQA 1TPH1 2Y85A 1D3GA 4TMCA 1JCXA 2Z1BA 2E68A 1UCWA 3CIXA 5CZSA 1JQVA 5HQEA 5AFDA 5AHFA 1Y0EA 4UTLA 4K7VA 3I7QA 4Q4KA 2YR1A 3TA6A 3MP4A 4MZ1A 3DZ1A 4WZHA 5D33A 2E77A 3LHVA 4LY8A 4N6FA 2D73A 3KRUA 4XTDA 4X9SA 3TFCA 1VCGA 3EX3A 3EXTA 5EA9A 3DFOA 3UWYA 3R12A 1DKWA 5LNRA 3E12A 1A5CA 5LGXA 3B4UA 2E6AA 2ZRZA 5K4XA 4H6KA 3LRLA 2EGZA 4IUOA 5AYZA 3HG2A 2E6DA 3BLIA 3EWBX 1W56A 1ZAIA 5AYXA 4BK9A 4UC5A 1ME8A 3GXNA 3DXIA 2EPHA 3W1NA 2DU2A 2VFGA 1XC4A 3UQNA 4AF0B 3W1TA 2WPBA 2WNQA 4JY9A 3TXZA 3BGJA 4X2RA 1TPUA 4RKAA 2JBMA 3ANYA 3G3DA 3THQA 4IMCA 5KTLA 3M5YA 3P7YA 3SSJA 3S1WA 3L65A 1I2RA 3NAVA 1TPC1 3NR0A 4MZ8A 5K4ZA 3HMJG 4ZZ9A 4Q32A 4CQ9A 1P0NA 2ISVA 3PY2A 3M44A 4O54A 2J24A 1KFCA 3I7SA 1ICSA 4KFNA 3G24A 1TV7A 3C3NA 3QFEA 1NVMA 3UY8A 1JR1A 5DELA 2B7PA 2ZRUA 4RJEA 3F4NA 3N3MA 1K02A 3DFNA 1FDYA 1FWWA 1XCFA 4IGHA 3G1VA 4HPJA 5F2GA 2WJZA 1KLYA 4DPPA 3ABQA 1IXOA 4O14A 3TKFA 4RLIA 3NL2A 4NXSA 3W7IA 4WY0B 5IBXC 1AL8A 2RHGA 1AW2A 4DQWA 4HIBA 3PULA 4GUGA 3LBMA 3HPSA 2DZWA 3EX4A 3GNDA 1WQ5A 3BLEA 2GQ9A 3BG9A 3MW7A 3NXFA 4WXYA 3TQVA 3W86A 4ZMGA 5J5DA 5C5YA 4ICNA 1K7FA 2YXGA 5LZLA 3AJXA 1XM3A 5KMYA 3FS2A 2TYSA 4YXGA 3L5MA 1F73A 1P5BA 1W37A 4ONVA 3UYCA 4H4IA 4LVGA 2VFIA 5EY5A 3P81A 1TIMA 4GUJA 2PE4A 3W7RA 3QMTA 1DOSA 3MP3A 3DFPA 4DBDA 1OX4A 4UTTC 3W1MA 4JD4A 3STGA 5BW6A 1FUYA 1H63A 1G67A 3SY5A 2GVGA 4DO6A 1A50A 3LTSA 3HGSA 3U8GA 4FIRA 1AL7A 1RD5A 4Z0SA 2RFGA 3SR7A 1OHLA 3PG8A 2WSYA 1DJQA 3QM3A 2X30A 2OZ0A 4ZQOA 3B05A 3HG3A 3DI1A 4NU7A 5BNKA 1I4NA 1O4UA 5KZEA 2C0AA 1TREA 3HGOA 3LXBA 2C13A 3LX9A 3W88A 1RQEA 2VEIA 3W7MA 2QAFA 1IIGA 3PBVA 4XBSA 2Y6ZA 1OVDA 3MBDA 4LT9A 1JULA 1RR2A 1XBZA 3TV8A 2ZRVA 3NQ6A 1VR6A 4A3UA 1G4TA 3RNDA 3DENA 3GX9A 1VHCA 3F03K 3GDRA 4CQAA 3TDFA 3P80A 4FX6M 1WOBA 1LRTA 3V75A 3W2UA 4O4WA 1O5KA 2GVJA 2PC4A 2V5BA 3FIGA 4UTWA 1PIIA 2DZUA 1SW3A 1GVQA 3TJLA 3HGRA 3G1YA 2ZFAA 2QCGA 3GR7A 4UNKA 5DY2A 3TMQA 1TPEA 2HTMA 1MZHA 4GXMA 4W9TA 4OE7A 1OFDA 3WJYA 1X8FA 1C8VA 3WK0A 3P8IA 5AYYA 2RDUA 3G0UA 5E93A 3W7JA 2RDWA 4WXZA 1FBAA 3O1NA 3L66A 3FA5A 2E5BA 3GKAA 3EWXA 1RQBA 3IGUA 4JICA 1BWKA 2IQTA 3W2LA 2CLFA 4L4LA 1W8SA 1SZGA 1W0MA 3Q2DA 1THFD 2YPIA 5I3GA 1SW0A 1U83A 2CLLA 4POCA 4QAIA 5HUOA 5SWUA 5HJLA 1JCMP 3P84A 3LBCA 1RQHA 4NJHA 5LGZA 2TPSA 1YYAA 1DBTA 1W3IA 2ZZ6A 1K7EA 1NSJA 5LSMA 1TTQA 3L67A 2OT1A 3USBA 1GYLA 4JTKA 5F1UA 1HTIA 2Q3RA 1X1ZA 2NV1A 3A5FA 1S3HA 6ALDA 1V7YA 4Y6GA 4WD0A 3EX2A 2Z2UA 4QJ1A 4DELA 1IXQA 2BWGA 1LYXA 3LCWA 5LHFA 4IPIA 3CU2A 1I45A 1GG0A 2FLIA 3W1PA 2QUTA 3EXSA 5EKYA 5A5WA 1PVNA 1PHQA 2QEZA 4HNTA 4MFEA 2GPTA 1H7XA 3CHVA 1QMLA 3S5ZA 3JS3A 4IX0A 3C2FA 3HGJA 1XI3A 1Z44A 3DKLA 5CPLA 4CQ8A 3M43A 2WO5A 3VI2A 4I9AA 4ZQMA 1O94A 3G1SA 1QNVA 4O28A 1LRQA 3EB2A 2V30A 4O16A 1VGAA 1SSDA 4C1LA 3I7RA 3W2MA 3NDOA 1GVRA 1KFBA 4FF7A 3IGSA 1BTMA 1KV8A 1JCNA 4K7YA 5FEPA 5C55A 5F2IA 3WJSA 3CTLA 3NOEA 1G4EA 2ZA1A 1C9DA 3RFAA 1JCLA 4O1DA 1VPXA 1ZY9A 1FWSA 4K37A 1NEYA 2J9YA 4UMCA 1V5XA 3DKJA 5EBUA 3W23A 1YDOA 3W70A 5EPDA 2CLKA 1TB3A 4MYAA 3EX1A 4N4PA 3L2IA 4M6QA 4MOZA 2CZDA 1U5JA 2ISWA 3W22A 1OX6A 1LROA 3FLUA 3C61A 2QCFA 3W7HA 3W7GA 4FNRA 3TXVA 2WSQA 1T8XA 3A9IA 3N14A 1OJXA 2ZZ3A 4UFJA 3F1QA 4GUHA 1JJKA 1JQXA 1IXPA 4DPQA 4IOTA 2QCHA 5CSSA 2F84A 3LV6A 3BW4A 1JUEA 1S5TA 2B4GA 3LCGA 3CC1A 2Y7DA 4AWUA 4YCPA 2E5DA 2B0MA 5G1YA 4ZQCA 4Y9AA 5CZJA 3P61A 4P2VA 4PL2A 2A7RA 4JGDA 1TPWA 1KW1A 3L9CA 1SU5A 4JTHA 4ORIA 3N34A 4QITA 3P67A 5AC6A 4L4MA 2ZZ4A 1TQJA 1KM2A 3LERA 1I2OA 2OX1A 3HPXA 2ATSA 4K39A 4A21A 4A2SA 4UTJA 1ONRA 1HUVA 3OHIA 4ZVJA 4ADTA 2BSLA 3IGXA 1BWLA 3EXRA 1HFBA 1EIXA 5F4SA 4XBKA 1RV8A 2GQAA 1W5QA 3W75A 4QM1A 4MY1A 5TQLA 1FDZA 1N55A 4Y96A 3QMSA 1GT8A 4LOCA 3M47A 2FB2A 1H5YA 1HL2A 4Z0JA 1T0OA 1SQ7A 4JYEA 3G8EA 5L9FA 5C54A 1YPFA 4HHPA 5K9XA 1PS9A 1OFRA 2Y7GA 2C1HA 3VNDA 1OF6A 2ALDA 5DXXA 1QPOA 3KRSA 4KWWA 1LDCA 3BK0A 2ZZ5A 2DZTA 4O4VA 4NX0A 3PVFA 5E1QA 1QOPA 3M16A 1MEIA 2VELA 1EEPA 1PV8A 2VKZG 4TX9A 1H62A 2WNZA 3HF3A 5DBUA 5G2IA 4UTMA 3KXQA 4Z1CA 3SFKA 1EUAA 2V81A 4LC6A 1RZMA 4QNWA 5K9CA 2A7PA 3C2EA 3M7WA 4UNLA 1XL9A 3HOJA 3P8JA 4JX6A 4OGZA 4NJKA 3OIXA 4N4QA 3G0XA 3LRMA 4O57A 1QOQA 5KINA 2QCEA 3L5LA 4NJGA 1ALDA 1IIHA 4UTIA 2NZLA 3SGUA 4UUIA 3STCA 3BW3A 3TC7A 3GAKA 1R30A 3OVQA 1ZHAA 4QISA 3W1XA 7TIMA 1J2WA 2OJPA 3NM3A 3C6CA 2QJGA 4IXHA 4JR5A 2PRLA 3C8FA 3M1ZA 4WJEA 4UMBA 3GNNA 2A1YA 5G4EA 4MLRA 5K7JA 1Z41A 2CW6A 3STEA 4HNVA 3O63A 1VLIA 1W1ZA 3W7OA 3PM6A 2Y88A 2CFFA 1GVSA 1B3OA 5D05A 2JKEA 2FPTA 1XUZA 5DCDA 3ELFA 4IPJA 1ME9A 3GR8A 1TPDA 3N73A 5D2WA 3E02A 4NZFA 2W6RA 5LNWA 3M5ZA 1YXDA 4I7UA 3W1QA 1W5NA 1OFAA 3EEGA 3N19B 4UFLA 1IF2A 2A6LA 4JTTA 3NPUA 4KFPA 3U2OA 1G7VA 5D02A 1OABA 3NQDA 4N2YA 4AWSA 3PS7A 5F4XA 2YGYA 3N2XA 4IQLA 1GEQA 3RLVA 4RCXA 4M7SA 2JK2A 3GXTA 5G2HA 3R8RA 1GJPA 1TRDA 1F05A 3UPBA 1XDMA 3KVLA 4NUWA 4X3ZA 2HS6A 2WQPA 3B8DA 5A8GA 1W5PA 4MJMA 3NO5A 3DU0A 1M7OA 3I65A 4WOQA 2RH9A 2J6XA 2VFDA 4A2RA 4MJZA 1SO6A 1R2TA 1P4CA 3NZ1A 4UXDA 4K36A 5BMXA 1EP1A 4JTGA 2ATMA 3B03A 4FXRA 5HWMA 1XBYA 1DHPA 3W74A 5FF3A 3C2VA 3M0ZA 3GVGA 4AH7A 3C52A 1KTCA 3PAJA 4OHQA 5AC7A 1Q6OA 4NNBA 1QPQA 3K30A 5K9DA 1WYIA 2GOUA 3IIVA 4LVDA 3S1UA 3NM1A 4GJ1A 3TSMA 5AHLA 4IJBA 3T40A 1QO2A 2V5LA 1F6KA 3A24A 1PHWA 3LB0A 4MPQA 2GJLA 2GJNA 1JCJA 5DXYA 5FEWA 1VYPX 5HINA 4E38A 2WKJA 3NVTA 4FB7A 3LCIA 3B0PA 4WOZA 1NFBA 4UFKA 3TROA 3RLUA 5KSWA 1K3UA 2TRSA 1YADA 1WDWA 3WK2A 4RK8A 3LI0A 4ADSA 1H1YA 3TMLA 4JXCA 4MIMA 1K8YA 3R5EA 3W9ZA 1WAUA 3DFSA 1PL9A 2C6QA 3LRKA 1MEHA 2YW4A 4K8EA 3B04A 4UR8A 4NJIA 3B06A 1SZNA 3LV5A 3O05A 5TIMA 4OQVA 3Q94A 3S5NA 4O11A 4FEZA 1YTDA 4HN4A 4BI5A 1KM5A 1UB3A 2VXNA 1BKSA 3PG9A 4JIQA 2X1UA 2YFNA 4NQ1A 4PODA 3DI0A 3QPYA 1OYAA 1UUOA 2I1OA 4IWWA 3QQ1A 4GFSA 1TMHA 4EF9A 4A29A 3MP5A 5AOUA 3WJXA 2QCCA 5AHEA 3UWVA 4HSNA 4BF9A 3MBFA 4IXXA 5DN1A 4Z1BA 5CSRA 2EF9A 1QCWA 4DEFA 5G5IA 2Q8ZA 1TJRA 2C15A 1A5SA 2ZYFA 3C0JA 3NL5A 1SW7A 1KM1A 2ZTKA 4EIVA 2EAWA 1OX5A 4TIMA 1FWRA 4J9JA 2O7QA 2E09A 5CGQA 4LRTA 3KVMA 3UXDA 2NUYA 3EX6A 3N2MA 4JTJA 1XBXA 1FXQA 2HS8A 1X1OA 4FHAA 3R2GA 3ATYA 5F2MA 3O6DA 4LS2A 3PSWA 8TIMA 1OYBA 2TMDA 3DHFA 4BFAA 4BWLA 2DZSA 2XN0A 3TJXA 3UXAA 4HSOA 3S1VA 1H7RA 2J9XA 3GDKA 3S42A 4O18A 2Y70A 3KVJA 1WX0A 1AW1A 2QCDB 1CX9A 3T4CA 2H8XA 1VLWA 1TPB1 4O13A 4LVAA 4O17A 3C56A 2UV8G 1WBJA 5DY3A 1E51A 1K8XA 3TSDA 3NZRA 2G95A 4O1AA 6TIMA 3R13A 4PH6A 3W1LA 2EKCA 2E1DA 3ZWTA 4JYFA 4RZ5A 3O07A 4WX2A 1ZAHA 3M41A 4ADUA 3IRDA 3GZ3A 1TYGA 4GNJA 1G4SA 2Z0IA 1GG1A 3D0CA 3UD6A 3ABRA 3PR2A 4PC8A 4EVZA 4JY8A 2QKFA 3KFTA 5ABTA 3QJAA 4FNTA 1X7FA 3S0CA 3NYZA 4UTKA 4HNNA 1H7PA 4LNYA 1QR7A 2R94A 4R7JA 3TNOA 5BOOA 4NVTA 2GQ8A 4JS3A 4G1KA 1W5MA 3TIMA 1S5WA 1TJPA 4CNOA 3NPVA 2VOMA 4RX0A 1IGSA 5KITA 1DL3A 3ZS4A 2Y89A 1JRBA 1VRDA 3HG5A 1YDVA 5I3JA 1XBVA 2C18A 4AMAA 1L6YA 2OT0A 3O6CA 1SSGA 5EYWA 2A21A 2DP3A 1R46A 1JRCA 4U4MA 3VE7A 5FESA 4IMDA 2R91A 4O1BA 1Q45A 3UWQA 3NG3A 3QF0A 4LS1A 5GVJA 1H7OA 4MY8A 5I3IA 1D3HA 2Z6JA 1TPVA 2WOQA 1MXSA 4CCCA 2BX7A 2C14A 2P0OA 3WJWA 3GK0A 3NQ7A 4M6VA 1F7BA 1QPNA 3LHTA 3EWYA 4UIOA 3OVRA 3PB2A 5D2TA 3BG3A 1SZEA 1X6UA 1MEWA 3G8RA 4O15A 4MZYA 3W1UA 2HMCA 1I8JA 2F7FA 3TW7A 1Q3NA 2X1TA 1M7PA 3M6YA 2QDHA 5AHIA 5HULA 4XUGA 1JVNA 5DLCA 1K7XA 2DZXA 3I68A 5HUPA 4O19A 5D30A 2ZRWA 1P0KA 4CCDA 1LZOA 1H61A 1AK5A 5U4NA 3DAQA 2YSWA 1WV2A 2XN1A 1LP6A 2NXHA 3GAYA 3ATZA 3LTPA 4NT0A 3BW2A 1VYSX 4PFMA 2G97A 3O06A 5LNVA 1DV7A 2QUVA 4TR9A 3SGZA 3L68A 2H6RA 4M7TA 4AF0A 1LBFA 2NXIA 1ZNNA 2Y62A 4O0ZA 5DBTA 1F5ZA 4M5PA 3EKLA 1PCKA 4QSHA 2CZ5A 2FJKA 3PC0A 4FX7A 2X1SA 5LHEA 3QMRA 4FO4A 4IMEA 4AHQA 3W6YA 3KVKA 2DJXA 2J27A 4LVBA 2J88A 4UFMA 1ADOA 1WOAA 5AN7A 3BV4A 2DZPA 1MSSA 4Y90A 3NEVA 3ABSA 2V2HA 1B4KA 1GWJA 1TRIA 4QQ3A 5CZTA 2H3BA 2NX1A 4FNPA 3IVUA 1KFJA 3NQAA 3KHJA 1YXYA 1H51A 2JGYA 1G7UA 3IIOA 1RPXA 3FFSA 1KBIA 3W71A 3MMTA 4YWIA 2A6NA 3N9SA 5E0KA 1LCOA 4LWWA 3E9AA 1KM4A 2VFHA 2PRMA 3MO7A 4RXGA 1O5XA 1L9WA 4WY0A 5CPNA 1DQXA 1OX4B 3H53A 1LLZA 3JRKA 3RMJA 3W73A 1W3TA 4K38A 5IBXA 3GB6A 1VCVA 3H54A 3PBUA 2QCMA 2PURA 3GDMA 2C16A 2NX3A 1G69A 2FDSA 4JTLA 5FF4A 2G5WA 1LOQA 1R2SA 3GYEA 4DBEA 1FCBA 3IIXA 3L0KA 3TK7A 4GC4A 3HB9A 3CWOX 1YTEA 4PA8A 4BI7A 2Y7EA 1TTJA 1TV5A 1EUNA 3QRHA 3I6RA 2R14A 4AXKA 3W76A 4UTTA 3P5YA 1FCUA 5D2YA 1CI1A 4MUZA 4S2BA 1A53A 3DH7A 5AHNA 1JUBA 2JGQA 3G22A 3QZEA 2RDTA 2TSYA 2BZNA 2NV2A 4CNPA 3LDVA 3R89A 4AB4A 5HWJA 4PTNA 4HT3A 1DQWA 1F74A 2X1RA 4ZQRA 1I2QA 4UTWC 3OVPA 1H1ZA 1F76A 2CZFA 2YX0A 4AWTA 5D03A 4O12A 1EA0A 2BLEA 4UFHA 3TH6A 3W07A 1KM3A 1VZWA 2YYUA 3P5ZA 3LCHA 3G1DA 1ZFJA 2YDAA 4M19A 3RK8A 3NGJA 2H3DA 4AVFA 2FB3A 2NUWA 2H90A 1QWGA 4E2BA 5D38A 1Q6RA 2E6YA 3FYPA 3G1XA 3O8AA 4LUJA 1PCWA 4IMGA 1SO4A 3WK1A 4Z1DA 1ZENA 4LV9A 3LGEA 3CIWA 5D2VA 1FY6A 3T55A 3UNDA 2VEMA 4R53A 3GDTA 5L6UA 4LVFA 3W7NA 4LC8A 3E49A 1CW2A 5D2XA 3CM4A 4FX8A 3V1PA 2C19A 4JTEA 2VEPA 3INPA 3PUOA 3H55A 4ZQPA 3UWZA 1KBJA 3G1AA 4HKPA 5K3VA 2B7OA 4JNMA 4ORMA 1FX6A 3GLCA 4DXVA 2XN2A 4JTIA 3NQ8A 5CPOA 2QUUA 1L6SA 1Q6LA 1YTKA 3P74A 3UWUA 1SFLA 1EB3A 2Y61A 2YZRA 2XFWA 2Z6IA 2G96A 4R34A 3LM7A 1G4PA 4NX5A 3UY7A 4PL1A 5G2WA 3VE9A 1LM1A 3ABOA 3DFTA 4OBTA 3QSRA 3YPIA 5LNSA 3CEPA 4LTSA 3VFLA 3NQVA 1XKYA 4KKXA 1TV8A 3PF3A 3QSTA 4RV8A 3KX6A 3DHDA 3EWZA 1EWDA 2CLMA 3DFQA 4O8RA 3NPWA 5CZ0A 2AQWA 3PUEA 2CZEA 2FQIA 2YCEA 3THAA 4LU0A 3IVTA 3CT7A 3UPWA 4ZQNA 3F4WA 3LI1A 5F2LA 2V82A 4A22A 1ZCOA 4ZL1A 4MFDA 1GZGA 4WUIA 3BPWA 1ML1A 1OFQA 3PUDA 3LCFA 2DJLA 1OFPA 2NWRA 1Z48A 2QR6A 4MVAA 3NPXA 4XTIA 1KTBA 5H2ZA 2FIQA 3NA8A 1W5OA 3RF9A 1TQXA 3ZWSA 5U7SA 4M6PA 4JX4A 4UTUA 3MI6A 5EL1A 3WFAA 2A0NA 5G4WA 1F2JA 2YYTA 2ZA2A 3NQCA 4C1KA 2QCNA 2ZRXA 3GDLA 3SZ8A 4YL2A 5BRBA 3LCXA 3W7QA 1VCFA 2QCLA 3PBWA 4CLMA 4S1FA 2E5CA 4N9CA 3QC3A 2W0UA 1EP3A 2YFOA 4QIUA 4JTFA 1VH7A 1H60A 2VC6A 1W54A 1KFLA 4TMBA 2ZZ2A 2PCQA 1KLZA 2QJHA 4WY0F 1TSIA 5K2ZA 4N6EA 4H3DA 2P1FA 2A7NA 1H50A 4QNEA 2EHHA 3IIZA 3NQ2A 3N9RA 1OYCA 5D04C 4XWUA 3QW3A 4N02A 1FDJA 1FWNA 3ZR4A 2ZA3A 4UFIA 2GVLA 4HPXA 5F1VA 2QAPA 4S2CA 1H7WA 1YLVA 3T7VA 1NF7A 3SI9A 4DO5A 4LUIA 3NL6A 3PWAA 5FI8A 3OBKA 4MKNA 1OFOA 1P1XA 3LLFA 5FEXA 4NNCA 2YW3A 4NXKA 1I2NA 2VENA 1Q6QA 4OT7A 1LBLA 2CWNA 5LNUA 3LXAA 4LRSA 1J5TA 3BARA 5CPMA 4HNUA 2X16A 1GYNA 2FTPA 3G1HA 3NQGA 2VEKA 4JYDA 4RR4A 3EWWA 4LS0A 4FNSA 4JDBA 4RXFA 2FPYA 4O10A 4R33A 4BI6A 1FCQA 3VKJA 3PB0A 4OU1A 1YPIA 2O7SA 1SPQA 1B9BA 3TUUA 1XFBA 2J9ZA 4Y8FA 4YCOA 3NQMA 4ML9A 3W2KA 1T99A 3FJ6A 2ZBTA 3IIPA 3NQEA 2QJIA 4JX5A 3QQ0A 1I2PA 5MHBA 3MYPA 1XUUA 3VCRA 4UTHA 3MHFA 3W87A 1VS1A 3FYOA 4O53A 1LLWA 4PEKA 5F4WA 2NX9A 3G18A 3W7CA 4O52A 3CB8A 2Q3OA 1LOLA 4FIQA 3HJZA 3C2OA 4BR1A 1ZJIA 1PE1A 5CKSA 4AAJA 2DZVA 3OEXA 2V0TA 3HO8A 5I3KA 4D2JA 5I3HA 2CU0A 1OF8A 1K8ZA 3OA3A 2P10A 1QFEA 4NJJA 2WNNA 1HO1A 1R2RA 3EWUA 3FEMA 3G0SA 4N9EA 4U28A 3GIYA 4N9BA 3FKRA 1KFKA 3TQ0A 1SUXA 4O0KA 3HG4A 1ZAJA 4LV4A 2RKXA 1H7NA 3L21A 4XQ6A 3W7KA 1J4EA 1L2UA 1SZFA 2OCZA 2Y7FA 1QDSA 5I3FA 4Q33A 1TTPA 2E6FA 4JIPA 4XKYB 4GWEA 2WSRA 3MJYA 1JUKA 5HR6A 3KRZA 4AHPA 2KZHA 1RVGA 2CLEA 2B7QA 3A21A 5AHMA 1A5AA 2Y63A 1OFEA 1TCDA 1WBHA 3BVJA 3TQKA 1K03A 2ISSA 3W72A 4AEOA 1ICPA 3KOFA 3PBYA 1FWTA 3A23A 5C6MA 4UR7A 4RZ4A 3L0GA 3L5AA 3JR2A 5LKYA 3LHUA 2HSAA 2QDGA 4FXSA 5H91A 1VJIA 1XDLA 2NLIA 4EF8A 4MLJA 1D9EA 3B0VC 2CLHA 4DF1A 1DJNA 4GUIA 1AG1O 3W1RA 3WK3A 4FNUA 1BEUA 3S6DA 3BLFA 5HR7A 1KFEA 1GQNA 2QF7A 3MUXA 3W7EA 4JN6A 5IM51 3TR2A 3IVSA 3UWWA 3LCLA 4TO8A 3MI2A 2FFCA 3MHGA 3OG3A 5FF0A 3MI3A 3MWAA 3A22A 4K8HA 3TCEA 1M6JA 2PRHA 1KA9F 1KM0A 2V2DA 2V8ZA 4JDYA 2LLEA 3W3OA 4GRSA 1EP2A 4Z1AA 1WXJA 4GBUA 4OV4A 5HMSA 2NUXA 2H8ZA 3IV3A 1FXPA 3IEBA 3LHYA 2I9EA 3LHZA 1R47A 1VC4A 3W1AA 1GOXA 1UJPA 1YDNA 3M5XA 2FPVA 1IXNA 4Z08A 4UCGA 4YMZA 4OWGA 1TPFA 3O6YX 3S9YA 4KFOA 2A85A 3STFA 4O1CA 4NZJA 3NNTA 2V2CA 3M9YA 1G6CA 1UASA 3W83A 3C4UA 3FJLA 2ZZ1A 4E0CA 1UUMA 3FOKA 3SW6A 1LTDA 3LLDA 3W7DA 1FCVA 4X22A 2ZTJA 3S5OA 3AO0A 2A4AA 2NWSA 1M5WA 3Q58A 4IMFA 2CLIA 1GVOA 2W79A 5EMUA 3G1FA 3W7PA 3EKZA 3CLMA 4CCEA 3O15A 3QW4B 2ZDRA 1NF0A 1W3NA 1L6WA 4IX2A
chains in the Genus database with same CATH superfamily
1QPKA 3TC6A 4BEQA 4GCAA 1UW9A 3OYXA 2DVUA 2VVSA 3OU8A 3MYOA 4JOMA 4B5NA 3FJ4A 2I9UA 1O60A 2W3ZA 3QEZA 2TAAA 3N6QA 4ALDA 1ESWA 1FHLA 2W67A 2BXVA 3L0NA 1ZB5A 3P93A 5CPTA 3GXDA 2OMAA 4I7VA 2Y8VA 3JZUA 1LBMA 3FSTA 1ZALA 1CEOA 2G4FA 2OEKA 5AB3A 1N7KA 2P76A 2Y5JA 4I90A 4QEEA 1XXXA 1LRNA 2EJAA 4HMNA 2QVNA 4WR3A 2XINA 3TW6A 1C29A 4LYQA 3HQ1A 1Q65A 4Z2IA 1OG0A 1W31A 3BLPX 1LOSA 2QLYA 1WA3A 2WZTA 1OM0A 3BGGA 3SQMA 1UKPA 1X7IA 1KM6A 1KC7A 1GEHA 1DXEA 1XSJA 3L4YA 4PB3A 3NZGA 3T09A 2AKZA 1NAL1 3S1XA 4K6AA 3W2NA 2WLZA 5BOFA 4BWLC 1DVJA 3MSDA 3FHAA 5D32A 4WDXA 3GC2A 2PDCA 1QNSA 3Q37A 4HA0A 4PYSA 3QKEA 1FVPA 2HROA 1GUVA 3W7LA 5A69A 3ONCA 2V9DA 3WEMA 4Q4MA 3MJMA 4QE4A 2YLLA 4D6HA 4GIRA 4KWVA 3B8UA 3CNYA 4XZ9A 1XH0A 5D09A 3TN3A 2AGTA 4YLWA 3GKFA 1V0LA 5KZDA 4AD2A 2BTMA 1MUMA 2PDBA 1DWAM 4TU1A 2O4QA 3QQWA 1X1NA 1DORA 2D23A 2A2IA 3OW1A 4G5DA 4UQAA 3U6WA 2A3CA 3RX3A 1CPUA 1XIDA 3W2JA 5A95A 5JVLA 1H3GA 1IEXA 4HMCA 4OV9A 2HXTA 2ZE3A 4C6JA 1YW1A 3DGRA 4LBSA 3L23A 2YCLB 2JF7A 1JIBA 1L8NA 1Q6EA 3VINA 3B9DA 1W1B1 1K9FA 3H12A 5J5RA 3DDMA 4IQDA 3WUEA 4DF0A 1U1UA 2PLMA 4H9ZA 5HJXA 3LHWA 4IL0A 2HJPA 3TAKA 3CL6A 2J79A 3IWPA 1GPWA 5FD0A 4JKMA 3MHUA 1UUQA 3E5PA 3W38A 1NWRA 5GNZA 1E6RA 2BVYA 4N9DA 1FWDC 2Y85A 2E68A 3JU2A 4L9XA 2XUCA 1NU5A 3SB0A 5CZSA 1E1CA 4NSBA 4PBGA 1BF2A 1PAMA 1QWKA 3MP4A 3CTTA 3SCOA 2PF8A 3LHVA 4LY8A 2D73A 1CT5A 3OLEA 3BV7A 4W8AA 5GQBA 1XLCA 1V3KA 2V63A 4UWMA 1PTGA 3DFOA 3F7JA 1ISZA 2BHYA 3HQOA 3GVQA 3UWYA 4JTAA 5IHSA 4GGBA 4GY0A 1EJWC 5LGXA 1CENA 3DCPA 3HG2A 4D6CA 1QK0A 4S3AA 1EL3A 5D9PA 3CUFA 3EWBX 1XIHA 4BK9A 1W17A 2R6OA 1ME8A 1ZPTA 3DXIA 2EPHA 3II1A 1K9DA 1M01A 2BVDA 4DBWA 2HE8A 4D71A 1DE5A 2WPBA 1UD4A 5GNXA 3TXZA 3OOQA 3AC0A 3QZAA 3ANYA 4YVXA 2WBKA 3ZJ8A 3M5YA 3SSJA 4MB5A 4PMNA 4EAYA 1V03A 5IXEA 4Q32A 2ACUA 2ISVA 3PY2A 5H8UA 4O54A 1XG4A 3LQGA 4W4QA 3I7SA 4F48A 4KFNA 2INZA 2VOTA 3QFEA 2XIMA 4BF5A 1V0MA 7REQB 1NVMA 1ZZMA 5T8GA 2PS2A 5DELA 1JPHA 4H2HA 2CETA 3G1VA 3MTWA 2PGFA 4PMJA 4GQBA 1IXOA 4F66A 2PCEA 4WY0B 5IBXC 4L7ZA 1AL8A 1QW9A 2DIKA 2PP1A 5FACA 1AW2A 4DQWA 1NDYA 5ABFA 4GUGA 1AH3A 4LANA 4PMRA 5EMYA 2CZVA 4WXYA 4QP0A 1IZJA 5KMYA 2A3AA 3FS2A 3IJ9A 4IIEA 2TYSA 3L5MA 3GNRA 1S5MA 1W37A 1R3SA 3T81A 4LVGA 4MDOA 4GUJA 2PE4A 2E9MA 1SM9A 4DBDA 3STGA 2Z00A 1EXPA 1H63A 3WDRA 1PX8A 4DO6A 1EDGA 3HGSA 3GZAA 1AL7A 1N2VA 1RD5A 4ERAA 4PTMA 1ZSXA 1J0ZA 2D2JA 2WSYA 1DJQA 1S3TC 3U4FA 1U5VA 4ZQOA 4AU0A 1UR1A 1ADDA 4NU7A 4XVEA 5KZEA 3LXBA 1R5YA 1F6YA 1XHGA 3W81A 3PPCA 4OOUA 3PTMA 4LAMA 2ZOXA 4RE0A 1RQEA 1EHAA 1IIGA 2Y6ZA 5CAKA 1OVDA 4HYWA 4CD7A 3DIPA 1W6TA 3S2CA 1G4TA 3DENA 1JZ2A 1I75A 1UH3A 5E5CA 4CQAA 2EBNA 5CC7A 5J04A 4DN1A 3V75A 3U7BA 4NZ3A 4UTWA 2DZUA 4XISA 4M1BA 5JQ9A 1GVQA 3B9EA 2ZFAA 1QTWA 3H70A 3EGJA 3TMQA 1TPEA 2HTMA 3E74A 4X9YA 4W9TA 2DEPA 2WAGA 7TAAA 1TCMA 2RDUA 1AD1A 3G0UA 5LIXX 2QF8A 3L4WA 3ECQA 1GOIA 3SBFA 1FBAA 2E5BA 3MKCA 2J77A 3VNJA 1RQBA 3OJGA 4JICA 1QI5A 2FZ9A 3VK5A 1SMDA 2CLFA 2ZX7A 4H01A 4L4LA 5EFFA 1RCOB 1RCQA 3Q2DA 4QAIA 2CNCA 5HUOA 4YVVA 5HJLA 2E9BA 3VC5A 5LGZA 2G3MA 4MKSA 5LSMA 5HNUA 5F1UA 1EDQA 1HTIA 4PMXA 2NV1A 6ALDA 1V7YA 4WD0A 2Z2UA 3VD7A 2POZA 4GIEA 1IXQA 1UIPA 4IPIA 4V1XA 2FLIA 1GG0A 3CXOA 1B3ZA 5A5WA 3HFYA 1PHQA 3URNA 4JTDA 4HNTA 1JI2A 2GPTA 3NIYA 5A6TC 4DJDA 1A5LC 4FR6A 3DKLA 2XG9A 3M43A 1P0EA 3N6JA 3QV7A 3VI2A 2Y4SA 3CGTA 1QNVA 4GZJA 2C8NA 1SSDA 4C1LA 3DBNA 3LENA 4QG6A 1GVRA 3CB3A 3FDKA 4G1NA 1KV8A 5FEPA 2VGIA 4AIEA 2PDMA 3HPFA 3WBAA 1DJGA 3T05A 4O1DA 1CCWB 5DMYA 3AUOA 1U1HA 4U33A 5EBUA 4YTQA 1YDOA 4LQ1A 3VD4A 3OBEA 1TB3A 4MYAA 3R94A 2A3BA 4JL1A 3CHDA 1U5JA 2ISWA 3WBYA 2PC8A 3ARQA 3VNIA 3CUHA 3OGVA 1OX6A 4YYFA 2RJGA 4WGXA 3BMVA 3FLUA 1FWEC 3W7HA 4UFJA 3O9NA 4GUHA 1JQXA 4PE8A 1US2A 4DPQA 4IOTA 5CSSA 1MQRA 3T0CA 3BW4A 3CC1A 3GVVA 4AWUA 4REQA 5G1YA 4ZQCA 1XJBA 3P61A 2XIQA 4KRTA 4P2VA 4IPLA 2A7RA 4XV0A 1O12A 1TPWA 4FLRA 3LPFA 3IACA 2XSAA 1WO2A 3T2PA 4ORIA 1WE5A 3N34A 4EXAA 4R27A 3QXBA 3WH5A 1I2OA 2OX1A 2ATSA 3RCNA 3ZO9A 4A21A 2W61A 1RP9A 1HUVA 4J1OA 4ZVJA 3PJWA 1GONA 1JL8A 3HQNA 2GK1B 3WF0A 4DNMA 4P7NA 1QHOA 4ZCWA 3ISIX 6A3HA 1IHIA 2ZXBA 4HA3A 3M47A 3NDYA 2EG6A 4KBXA 5C7HA 1AQ0A 2IQDA 1SQ7A 4GIYA 1F8MA 3H23A 2C1HA 2PF0A 2XM1A 5DXXA 1QPOA 3CQKA 1MFVA 1OBAA 3BK0A 2ZZ5A 3PVFA 1B3YA 5E1QA 1XYMA 3CAVA 1H11A 5C9ZA 3KXQA 5KZ6A 3CS2A 4N7QA 1TX2A 5EFDA 3SGGA 5GPRA 1DWFM 3QC0A 2V81A 1AQHA 3C8NA 3CUIA 2QNEA 5K9CA 2A7PA 4IFKB 1O6IA 4TTUA 4UNLA 2WLYA 3K8KA 1TV2A 4JX6A 4NJKA 2QCEA 3L5LA 1ALDA 2NZLA 1ZHAA 4NI8A 4QISA 3W1XA 7TIMA 4ZOAA 4MMWA 4J2MA 4GO9A 2QJGA 4JR5A 1GHRA 3VNLA 4KEUA 1JNEA 2GJRA 4PBEA 3KS5A 2HWGA 1JPIA 4L6DA 1HIZA 3N2BA 1XV8A 1GVEA 1VLIA 1W1ZA 1XIFA 2FMOA 3PANA 1EGMA 3ELFA 3VIJA 1ME9A 4RE2A 4ZB0A 5D2WA 4B4HA 1O5RA 1Z6KA 5LNWA 1TR1A 2HK1A 1YXDA 2X7VA 1FWJC 3EEGA 3N19B 4UFLA 3UF9A 2WVVA 3NPUA 4KFPA 2P53A 5D02A 3GBEA 3ARWA 1WDRA 3N2XA 1GEQA 1RAKA 4M80A 3KL0A 4H7CA 3ITLA 1GJPA 1TRDA 2F6KA 3UPBA 3VKKA 4WDTA 4IGNA 3EOUA 1W1PA 3QKZA 1EJ7L 3TA9A 3NO5A 1M7OA 1DWIM 3I65A 1F61A 3L2LA 1P4CA 5AYBA 1CGWA 3A3WA 3EDFA 3BCDA 1XBYA 2VHLA 5GNYA 3W74A 2G3JA 4D8LA 3R43A 2ONEA 4G7FA 3UESA 9RUBA 3C52A 3WH9A 4OHQA 1SGJA 2EPKX 1LQ2A 3K30A 3UR2A 5K9DA 5AZ1A 1QI4A 3IIVA 4BQ2A 1K77A 2J8TA 2XH7A 3S1UA 5EMMA 1KNWA 4GJ1A 3TSMA 4IJBA 3T40A 1Q6GA 1EO5A 3UJRA 1PHWA 3LB0A 3SCQA 1JCJA 4DUXA 2DDXA 2OSWA 2WKJA 3B0PA 3FSUA 3KOYA 1CGXA 3RLUA 5KSWA 2XISA 3SQLA 3VGHA 2E4TA 5IDIA 1UZHA 4ADSA 1W3LA 2GZXA 2VM8A 1H1YA 3FXGA 2YBVA 2KAUC 4MIMA 1K8YA 3R5EA 4W7UA 3W9ZA 1HKIA 3DFSA 4L4PA 1JNDA 3EDKA 1XRVA 1QHPA 3AFBA 3A4AA 1GZ1A 1RUSA 3MZ2A 3WFZA 5JUVA 2Q09A 2VXNA 3PZIA 4LBRA 2X1UA 3FDGA 1VBUA 4WIWA 4AZHA 3VOGA 3FGCB 4U5KA 5AOUA 2WXDM 3KUMA 3WJXA 2VEFA 1JAKA 4QDWA 2AL2B 2AL1A 1W2VA 4IXXA 1TX0A 3W37A 1XG3A 4Z1BA 4CU8A 3VDHA 1UWTA 3MDWA 5CSRA 2EF9A 2Y8KA 1XICA 2YJQA 1TJRA 1XS2A 3EZ4A 4F9DA 2VGGA 4HD5A 3KVMA 3LY0A 3UXDA 3WUGA 1VRXA 4QLJA 2NUYA 3N2MA 4UR9A 1XBXA 1FA2A 5FJPA 4FHAA 3R2GA 2J62A 3ATYA 3C2YA 5F2MA 3O6DA 3UXIA 1GKPA 2GL5A 8TIMA 5B80A 2XN0A 2Z2AA 3TJXA 2HCVA 4H04A 2WZIA 4GINA 4C5YA 1E6ZA 3V36A 3SO7A 3B4YA 1LWHA 2QCDB 3GR4A 3WLHA 2DGAA 3CV7A 1FKWA 4YIWA 3C0QA 4LVAA 2NLYA 2UV8G 1C92A 1WBJA 4O1AA 1V7AA 3TYZA 3R13A 2EKCA 2FZMA 2Z1XA 3M41A 2Z7GA 4ADUA 1K4HA 2A3LA 1Q8JA 3ANUA 2Z0IA 1B31A 4UZUA 1UPPA 5BXRA 1BPLB 1ELSA 3PR2A 3UZYA 1Q2SA 1CDGA 3MKKA 4J3UA 1FH7A 1UP2A 4HNNA 4HP5A 1H7PA 4LNYA 1BXNA 1GGOA 1QR7A 2R94A 1K70A 1KRCC 4JS3A 2F38A 3TIMA 1TJPA 3K5XA 3WDQA 2VOMA 2XIBA 1IGSA 2D0HA 5KITA 4DXXA 4AD0A 1VRDA 3HG5A 4FOKA 4GABA 1XBVA 2C18A 4CN6A 1Q4WA 4DWSB 2GGEA 2VCBA 1M41A 3ZT5A 5EYWA 4QFUA 3CZEA 2DP3A 1A49A 1JRCA 3ZT6A 3VE7A 4C6MA 1DQUA 4IMDA 4GI6A 2R91A 4LH8A 4P7LA 1QW8A 3UWQA 4LS1A 3QF0A 1BXBA 2ZUVA 2J7CA 4J35A 1H7OA 4XZNX 1TPVA 4L1WA 2WOQA 4CCCA 3LNMA 1S2TA 1NELA 3GK0A 1KRBC 5CC5A 2C71A 2WCSA 4UIOA 3OVRA 1TWDA 3BG3A 1X6UA 1E1EA 2X0SA 3G8RA 3GO2A 1Q3NA 3M4HA 3N2TA 5AHIA 4B15A 3R0KA 3TTOA 1K7XA 2HNEA 3I68A 4HYRA 3QR1A 5HUPA 4O19A 4CCDA 1PWMA 1AK5A 1I1XA 3LUTA 2YSWA 4AY8A 4IGSA 3LA4A 4JIHA 2HNHA 1QATA 7ENLA 5D8ZA 2G97A 1EOKA 3K1DA 5A6KA 3WENA 1QVBA 3O06A 1DV7A 1W1IE 2QUVA 4TR9A 3SGZA 1ISVA 1MQQA 1LBFA 3UPMA 1R3WA 1ZNNA 4O0ZA 3GVRA 1F5ZA 5LXXA 4M5PA 3PC0A 2X1SA 5LHEA 3N4FA 1Q13A 2WVSA 4IL2A 3WDIA 3KVKA 5I07A 2OO6A 2J27A 3NTYA 1EC9A 1ADOA 3FN9A 1O66A 4IFOA 3NEVA 4GISA 1AJ0A 2V2HA 3B0YA 1IR2A 1BYDA 4U10A 3IVUA 1RA0A 4ASTA 3NQAA 1YXYA 4GVGA 1H51A 3OA5A 2EPMX 1G7UA 4WVXA 1QI3A 1KBIA 1TWIA 4M6UA 1J0HA 5A94A 1S5NA 1ZRQA 2A6NA 3N9SA 4QTGA 5E0KA 4LWWA 4RE3A 4L9ZA 3UFYA 4WY0A 1OX4B 3DC8A 1XKJA 1JPKA 4K38A 1EQCA 1JZ3A 1TZ9A 3JW7A 2GGJA 2ZUWA 4ICMA 3EOLA 4HPGA 2ZADA 3MDUA 5FF4A 3KBWA 4EK7A 4V2XA 5DMNA 5M2FX 3S46A 1FTXA 4RW5A 1ITUA 1FCBA 1XLFA 1NOWA 4PA8A 3HMCA 2Y7EA 3RU8X 4JQ4A 4AC7C 1NOUA 4R9OA 1RVKA 3P5YA 1FCUA 2VZUA 3QZEA 2RDTA 2NV2A 4LUYA 1L6GA 1F74A 4J3TA 4ZQRA 4JFWA 3OVPA 2YOCA 5I5RA 1ONEA 4ZOEA 2VDHA 1EA0A 1NJJA 4UFHA 4GPNA 3RRXA 1VZWA 2YYUA 4OTKA 1EJUC 1BQGA 2YDAA 3H2FA 1ZQ5A 2FB3A 2H90A 2XVPA 1Q6RA 4B3ZA 4DM2A 4LUJA 1PCWA 3A6OA 5C9WA 3WK1A 3LGEA 2VEMA 2IKGA 3O6AA 3RITA 1O5QA 2QDDA 3W7NA 2BBFA 4QS6A 4QCEA 2VEPA 3OO2A 1GOQA 3UWZA 4AZ7A 2IPFA 1F07A 1TJ2A 3G1AA 4HKPA 3U5YA 4JNMA 1L6FA 2EJ1A 4DXVA 4A05A 2CWXA 2PDXA 5CH9A 5CPOA 1VBRA 4IGMA 1YTKA 3H7VA 2CBVA 3R11A 1EB3A 2Y61A 3V16A 2WMFA 2Z6IA 2G96A 2PP0A 3DFTA 3QSRA 3QFWA 3VOCA 2RDXA 2DZAA 1HGYA 4L56A 3QSTA 4HNLA 4W8BA 4RV8A 3KX6A 1F8IA 4DJEA 1EH9A 2PDJA 3B40A 3PUEA 1MRQA 4PMDA 3UZXA 1MQPA 3IVTA 3UPWA 4ZQNA 5F2LA 2V82A 5GJPA 4WF7A 3PJTA 4MFDA 3JVAA 1GZGA 3KBMA 4QQUA 4LAOA 1ML1A 2OEMA 3TYEA 1IEWA 3LCFA 5B7YA 3IJQA 1OY0A 2NWRA 2D69A 3KBVA 3NPXA 4MNMA 4AXNA 3IJ6A 3MI6A 3ALGA 4LAUA 2YYTA 3NQCA 1YBQB 4H8VA 4LUTB 3GH7A 3QC3A 2W0UA 3I10A 2X40A 1CXFA 2PMQA 1WKYA 1ADSA 1FHUA 3PZVA 1KLZA 2QJHA 3AWOA 1UWIA 3N9RA 3VXGA 3TP4A 2IUZA 2HDJA 3WMCA 4FOJA 4BEUA 2ZA3A 3S4TA 5F1VA 2QAPA 4S2CA 1H7WA 3ITCA 2F2HA 4LUIA 4LPCA 1OFOA 3FVDA 1P1XA 1XCXA 1XINA 3SN0A 1XYCA 4JFVA 5LNUA 4JQ3A 1E0VA 4GC3A 2UY4A 3RDKA 4JYDA 1GVIA 2QT3A 4LS0A 3H7UA 3AI0A 2FPYA 2BOEX 1FCQA 1Z3NA 3VKJA 3PB0A 4Z1YA 1SPQA 1B9BA 3TUUA 1KXTA 2PEVA 2CBUA 1Z8AA 4YCOA 1JYNA 4AC1X 3MANA 2FFIA 4H9TA 1S1PA 3NQEA 2QJIA 4LYKA 4JX5A 4R7WA 3QQ0A 2WJEA 2BGSA 3WQPA 1JCTA 1PB0A 3FYOA 4W5ZA 1P43A 3GHSA 1EJTC 4BR1A 4XAFA 2DZVA 2V0TA 4D2JA 4CNSA 2RUSA 1K8ZA 3OA3A 4MWAB 2WNNA 4Q4OA 5BXSA 1ONWA 1R9YA 1UR4A 4XAPA 4U28A 1HKMA 1KXHA 3GIYA 4N9BA 4J3VA 1VIZA 3ERPA 2PLJA 4G9PA 1ZAJA 1Z9AA 4LV4A 4BKNA 2RKXA 1H7NA 3W7KA 1J4EA 1ZBCA 1SZFA 1O7AA 2OCZA 2Y8UA 1QDSA 1WUEA 3A64A 4Q33A 4GHRA 2E6FA 5I09A 4JIPA 4XKYB 3K13A 4GWEA 1X6NA 4IP4A 3LZ5A 2WSRA 2JIWA 3AS3A 4GYKA 1KD0A 3F4CA 1E72M 1OFEA 4IIFA 8CGTA 3H24A 4AEOA 2ACRA 3PBYA 1V6YA 3A23A 3ZR5A 1TUXA 3MCOA 3GUWA 3L5AA 2OQHA 1AD4A 2QDGA 1AQFA 1IEQA 3PNUA 4WCJA 2FJUB 4E4UA 4HNOA 1R9XA 3AHVA 1PKMA 1G1YA 4TV5A 3K8LA 3GTIA 4H9MA 3O2LA 3EPNA 3MUXA 3UERA 1JPDX 3IVSA 1K8CA 4TO8A 3JUGA 2RGMA 4AZ6A 5HNNA 3A22A 2KX9A 3TCEA 3NGFA 1KA9F 2V8ZA 4KEZA 2WHMA 3T9PA 1WXJA 4UQDA 1FH8A 5JH1A 1UBPC 2OZ8A 3LHYA 4CN1A 3E0VA 2I9EA 1JYVA 3LHZA 1R47A 1Q7ZA 4MJ4A 4X0VA 1UJPA 1YDNA 3M0JA 2FPVA 2YCJA 3VO0A 1KBBA 4JQ2A 3M6DA 1TA3A 1AH0A 1DYSA 4NZJA 4FALA 1PKYA 3NNTA 4ZTXA 3UG3A 1UASA 5DT5A 1V93A 2D20A 3FOKA 4HN8A 1LTDA 3W7DA 2IPGA 4X22A 2I5GA 1QBBA 3ALFA 2BY3A 3TZNA 2ZXDA 4BCEA 4L1GA 1PBGA 2A4AA 1F3XA 4P7RA 3TTEA 1M5WA 4DJFA 4QGCA 2CLIA 2W79A 4Q4SA 3G1FA 1AMYA 4CCEA 1NOFA 3N9KA 1QXLA 3O15A 1AUSL 3AIWA 1SJBA 1L6WA 4IX2A 3G3MA 1UJQA 4IIDA 3S8HA 1HKJA 2ZXAA 1KXVA 1D3CA 1JXJA 1T40A 3WELA 3OHMB 2W91A 4RZ6A 2P88A 4JEJA 4FSAA 3W84A 1V3JA 1VQTA 5LIUX 2J74A 2CEQA 4HJWA 2CITA 2XU2A 4HMDA 1QAPA 5C9UA 5A2AA 1E55A 2X2GA 2Q8LA 1CTNA 1W8GA 9XIAA 1SR9A 5FF7A 4DO4A 1HG3A 3N11A 1OFBA 1F6PA 3HPZA 3WNNA 2OODA 4DJFD 1RH9A 2Y5SA 1SO5A 5HNRA 4LCSA 2J7BA 2QIWA 2X2YA 2I5QA 4ZA0A 1XLIA 3BG5A 3LNPA 3NZPA 3M46A 3QGAC 4JAWA 1HO4A 3BMXA 2ZCGA 2ABBA 3JZEA 1V08A 1C8QA 4EWND 2OO0A 4E2OA 5LXEA 2W66A 1MO0A 2J75A 1LQ0A 1VPQA 1V6VA 3TN5A 3GXFA 1V0KA 5DX7A 5FEZA 5FL0A 3MU7A 1PX4A 1DWHM 2V5CA 3KZPA 1S5VA 2A5HA 5DEZA 5LYRA 2O0TA 2B81A 4ZENA 4GUFA 2ZZ7A 2R1LA 1PZ3A 4RE4A 1RK6A 1UKOA 2GUUA 2P8BA 3LG3A 3CPRA 3A3XA 1EZ2A 4NNAA 4DUOA 1EO7A 4XIAA 1PKNA 3B0XA 2Y24A 2Z1WA 3GXPA 4LB3A 1C8YA 1TV4A 2ZQ0A 1NDVA 4HYVA 2QCDA 3T78A 1UWRA 1J8VA 4I6KA 1D2KA 4KGJA 4CN4A 4LEFA 2ZUNA 2OVLA 3UZ5A 1G9HA 1AW5A 3D3FA 1A5KC 1PDZA 4JTSA 2AAMA 4GYPC 1WZMA 3NQFA 4JTUA 4HOWA 3AU6A 3BC9A 2P3EA 2Y5EA 3VAVA 1XIMA 1RCXB 2E0PA 1E71M 4LCQA 1EPXA 3VNYA 2NT0A 3LOTA 2X0HA 3DBPA 1YXCA 4RW3A 1XRSA 2WJFA 1YNPA 3BQ5A 2ISFA 4E4FA 4GQRA 4GVIA 3TSBA 1D7KA 1E0WA 2FH6A 2DSVA 2VFFA 4Z2KA 4JEQA 4L1XA 3E2SA 1D3GA 2XM2A 1UP0A 4ERIA 2Z1BA 5CCZA 3VU2A 5AFDA 4MDPA 4DWSA 3R0UA 5AHFA 3MV11 3IK4A 3GHTA 4JBRA 3W28A 1GK8A 3TA6A 4AY7A 4WZHA 2E77A 4TTGA 3SJNA 9XIMA 2XIIA 2WMIA 3SUSA 3U0HA 1XYAA 3IGHX 3R12A 1AFSA 1UYQA 1DKWA 2PTYA 3T8LA 5LNRA 1A5CA 1SJCA 3T42A 3VNMA 2E6AA 1KO0A 4H6KA 4IUOA 1XYFA 1UR9A 1PUDA 3QR3A 4QJ4B 4GACA 1W56A 5FIPA 1V79A 5LA2A 2WB5A 4XVDA 2DU2A 4DUWA 2ZWZA 1XC4A 3W1TA 4PSRA 1ODUA 1FHDA 3BGJA 4WKHA 3N29A 3BWWA 3THQA 4C6IA 5KTLA 1DPMA 3GHUA 4DWSD 2NQ5A 4DHGA 1R8LA 1LT7A 4ZZ9A 4GXPA 4GKTA 3ICJA 3M44A 3REQB 4GGHA 5FKYA 1KFCA 2CIPA 3LMYA 4HTBA 2E67A 2WQDA 3EKGA 1NIUA 3GNPA 4NRRA 5A6SA 5DO8A 3KDNA 1ZU8A 4KRZA 1HN1A 3K4WA 3VGEA 2ZRUA 3F4NA 1HKKA 3ITOA 3N3MA 1K02A 1FWWA 1NP2A 4MB1A 1XCFA 4HPJA 4ATDA 2WJZA 4XZBA 4DPPA 3ABQA 1R3VA 4O14A 3TKFA 3VD5A 4MNJA 4KPLA 2VZOA 3BGAA 3NVDA 3AIBA 4OUIA 1IZKA 2WC4A 2FZ8A 4EXQA 3DG3A 2J7HA 4H8NA 2HVMA 3GNDA 3F2CA 2GQ9A 1K9TA 3NXFA 4W93A 3TQVA 3W86A 4ZMGA 5C5YA 4O0QA 1K7FA 2YXGA 3AJXA 5E6ZA 4YXGA 2YL9A 1F73A 3WLKX 1P5BA 1IWAA 4ONVA 3UYCA 3SRHA 5EY5A 4MGGA 3MUZ1 4IQEA 2H9AB 3MP3A 3K46A 1OX4A 1OD8A 1OD0A 4UTTC 1E73M 3GC5A 2BP1A 5A6AA 3PTQA 5BW6A 5C70A 1P1MA 3THCA 3R0DA 5C2GA 4E4PA 4J40A 2VZSA 3U8GA 4W7VA 3FK4A 3KWXA 4Z0SA 3RO8A 1OHLA 3PFMA 3PG8A 3SEPA 3TLQA 3S6OA 2VNCA 1V4YA 3QPEA 3EMCA 2C0AA 1TREA 2ZIDA 3HGOA 2FVLA 1WZAA 3LX9A 5T9CE 1OT2A 4U5IA 3SUUA 3C5QA 4A4AA 1VJZA 4XBSA 1Y5WA 4KEVA 3MBDA 1CLXA 1XBZA 4DYKA 1J93A 3VX0A 4A3UA 1IR1A 1TWWA 3RNDA 2BXYA 1KKOA 4FX6M 4HCLA 5CJNA 3TOPA 2YCKX 4NAEA 1J6PA 4O4WA 2BHZA 1B30A 2GVJA 2PC4A 3RHGA 1PIIA 1WCGA 3TJLA 3HGRA 4GQGA 3A13A 1PSCA 3G1YA 4Z17A 2XH4A 4MHBA 1MZHA 2AQVA 1V3IA 4OE7A 3W29A 1MDRA 1OFDA 3MV01 3WK0A 3P8IA 3WEOA 1D8WA 4W87A 1GOKA 1AJZA 2J4GA 4K68A 4E2VA 4XZLX 1Q8AA 2RDWA 2DT2A 3TONA 3ZR6A 1JYWA 1NWTA 3GKAA 3EWXA 1NWUA 1TR9A 3IGUA 2IW0A 1BWKA 1KBKA 4XBJA 3K1GA 1B0IA 1PYFA 1W8SA 4LFYA 3UA4A 1CZ1A 1QK2A 1PEZA 1SZGA 4UCFA 2YPIA 1U83A 2WBGA 1OB0A 3DOPA 1JCMP 3DYMA 3P84A 4NJHA 1RXOB 1CGYA 1ECQA 1UR0A 1NSJA 2PUZA 2F6XA 3HN3A 1XLKA 3USBA 2DUAA 5HXMA 1EIBA 4YTSA 1K4GA 3A5FA 3HPAA 3I3EA 2PU0A 1S3HA 1JZ8A 1VFOA 4Y6GA 1DP0A 2ZDSA 4IP5A 3EX2A 4QJ1A 1LYXA 5LHFA 1OGBA 3CU2A 1I45A 4Q22A 1XGZA 2XFRA 5EKYA 2QEZA 1ZBVA 4D6EA 3AIVA 3CHVA 1BG4A 1QMLA 3AZTA 2NQLA 4IX0A 4ZQMA 1W9UA 1O94A 2Y0FA 3AQUA 3G1SA 4GD0A 1LRQA 3RCYA 4DZHA 4PB5A 3BAKA 4NZ4A 5IHRA 1UC5A 3GNOA 2CXGA 3IANA 4FF7A 2PDPA 4BQ5A 4Z2HA 1JCNA 1G4EA 1WP6A 2WZEA 3RFAA 1JCLA 2WMHA 1VPXA 4CU6A 1FWSA 1NEYA 1YBQA 2J7EA 2FZDA 1RA5A 4O1FA 2CLKA 4N4PA 3EX1A 3L2IA 2CZDA 4PR4A 3V7PA 2G8ZA 2CLPA 3ITVA 2DY3A 1LROA 3KS6A 1EF3A 4LF1A 1BYBA 2DSZA 3MQTA 4F3HA 2F84A 2B4GA 3LCGA 3XISA 2Y7DA 4L6OA 4YCPA 2E5DA 3DESA 3UT0A 4Y9AA 4PL2A 4Q8TA 1XDJA 1XLHA 1PIFA 1UWQA 1KW1A 2G50A 5AZ0A 3WEZA 2WHLA 4KMQA 4BZYA 4QITA 3P67A 1I6NA 5AC6A 5E9XA 2O9RA 2ZZ4A 3LERA 3Q45A 1V77A 2D22A 4A2SA 4UTJA 3GM8A 3RGTA 3R10A 3TR9A 4EE9A 4V33A 2G3IA 4B3KA 2BSLA 3EXRA 1HFBA 3GTHA 1BD0A 3GG1A 1RV8A 1RJPA 3W75A 1C7SA 5TQLA 3QMSA 1GT8A 3V0TA 2OZTA 2FB2A 3B9OA 3G8EA 2X0YA 1BYCA 3A4XA 4QE1A 5K9XA 1OFRA 1BRLB 2W5FA 3VNDA 1OF6A 1A5MC 1E4IA 2ALDA 2J7DA 2BOFX 3KZSA 3UA3A 3KRSA 3H22A 1W2PA 1EC8A 2DZTA 3EWCA 1UKTA 3RPTA 2GUBA 1QOPA 3M16A 4DRSA 3KCJA 5B7ZA 1H62A 3HF3A 5DBUA 4EXBA 3MMWA 1VFUA 3WFLA 3GW3A 5HBFA 2ACQA 3C3UA 4MM1A 1R9ZA 5JXQA 4HA4A 4DI9A 4MWAA 2DIEA 2AOSA 3M7WA 2XWEA 3WDPP 4ZFCA 5EB8A 3WD3A 4XZHA 1YIXA 1EKOA 4D8ZA 5KINA 4UTIA 1FKXA 3NDZA 4PUKA 3SGUA 4TVDA 3STCA 3UWEA 1OZQA 4B4FA 3DHPA 2VQTA 3NM3A 3O0KA 1RPKA 3M1ZA 4WJEA 4UMBA 5G4EA 4XSMA 1H09A 3WLSA 1S1RA 3UJEA 4IICA 2Y88A 1GVSA 2JKEA 2FPTA 4PUDA 1UH4A 3F2DA 1TPDA 3N73A 4OOZA 4WSJA 3ES7A 3BDKA 1JZ5A 4IH3A 3E02A 4NZFA 1MDLA 3SFWA 4A3YA 3CZGA 3M5ZA 4OVXA 4F0RA 3W1QA 1VEMA 4DBUA 4AEFA 1L2QA 5IOBA 1DHKA 3OGRA 3U2OA 1G7VA 4E8DA 3CMFA 4N2YA 5D9MA 5I3DA 2FHCA 5F4XA 2DT0A 1E56A 3GXTA 3R8RA 5G2HA 2PDLA 1R3QA 3RCMA 4NUWA 3LEPA 4X3ZA 4NZ1A 3DU0A 4WKAA 2J6XA 4A2RA 4MJZA 3IJ8A 3EDDA 1KXQA 1P48A 5BMXA 3CYVA 4C6NA 2ATMA 3B03A 3OQ8A 4N0RA 2W92A 1ZP4A 3S1GA 4DYJA 3M0ZA 4I8DA 3GVGA 2ASHA 2X09A 3LU2A 2NQJA 1KTCA 3EDEA 4ZE5A 2WHKA 4NNBA 4E3VA 1TG7A 3NM1A 3TYBA 3MVIA 3BCFA 3F5JA 3E1F1 1QO2A 5CBJA 3A24A 1JGMA 2GJLA 4IM4A 2GJNA 2F2KA 2GDUA 4KCWA 3ZYZA 4FB7A 1NFBA 2DQWA 5JMUA 2DFAA 3TROA 4IPNB 4ZO8A 3PAOA 4J27A 5HNTA 1WDWA 1J2BA 2EPNA 3U2CA 3BCJA 3NWRA 3WLOA 3TMLA 3I3DA 4KERA 3CHCA 1WAUA 3N15A 1PL9A 2C6QA 1MEHA 4K8EA 1HZYA 3ABZA 5CJMA 3RM8A 3WBXA 4B9YA 3O05A 2BVWA 3VGDA 4OQVA 2PI6A 4CU7A 3WLMA 1NDZA 4O11A 3WN6A 4CNTA 4HN4A 1ODZA 4MNLA 1A4LA 1RK5A 4GQQA 3DG6A 2OYKA 1OYAA 3CV1A 4C7GA 1R86A 3QQ1A 3MT1A 4JKKA 1UIOA 4A29A 2QCCA 5IDZA 4V27A 1Q7QA 3UWVA 3CHEA 2O56A 3IV8A 2VDIA 2C15A 2ZYFA 8XIMA 3C0JA 3SN4A 5LA1A 1CXIA 3NL5A 1SW7A 1KM1A 1OX5A 4J9JA 4P7OA 2O7QA 2E09A 5CGQA 2V5JA 1H2JA 4GG9A 5CLWA 1AQMA 1U22A 3A4JA 2CXEA 1X1OA 3PPGA 4LALA 4B5UA 3NZQA 1BWVA 4JFUA 3PSWA 3BAJA 2VRKA 4TUFA 2DZSA 3UXAA 3AXKA 3S1VA 2J9XA 3GDKA 3KVJA 1WX0A 4C6EA 2H8XA 4ZTYA 1VLWA 3SCRA 1TPB1 1YX1A 4O17A 3C56A 5DY3A 3WLTA 3EPMA 4GMEA 1YE6A 4PH6A 2E1DA 2NW0A 3GY1A 4WX2A 4V15A 3APYA 3M0MA 5CBBA 3THDA 3IRDA 4G8TA 3WLJA 1AH4A 1TYGA 4GNJA 1G4SA 4P8XA 4L9YA 1T41A 3KFTA 4R5EA 4AD4A 1OC7A 1KR1A 4UTKA 4R7JA 1GQIA 2I7GA 1KB3A 3RXZA 3OLIA 1W5MA 2O9PA 3NPVA 1EFZA 1ITXA 3NUKA 4D8AA 2PB1A 3EOOA 5DMMA 3AHZA 3WQFA 4YJ5A 1I1WA 3ARPA 2A21A 1PYMA 4ACZB 4DXKA 4DBSA 2MUCA 3QV8A 3IJLA 3OZOA 3MC5A 3TYAA 2YDSA 3VA8A 4W5UA 3MMUA 1XP3A 4MY8A 1D3HA 4F4RA 1MXSA 2AAAA 3UCQA 2C14A 1HF6A 2P0OA 3RJYA 3V5OA 3KL3A 1F7BA 3EWYA 3PB2A 4DAFA 2OPJA 1SZEA 5AKQA 2EQDA 3TW9A 1OCNA 5REQB 4MZYA 2Q71A 2OLAA 2WSKA 2F7FA 3HJEA 3TW7A 1VJSA 4PMVA 3M6YA 5KETA 2ZUUA 5HULA 2YIHA 1U5HA 2DZXA 8A3HA 1P0KA 3ZQ9A 1LZOA 3AYRA 1H5VA 1WV2A 2XN1A 2HRWA 1JGIA 2VI0A 3LTPA 4NT0A 4LUSB 2WWCA 3PHAA 5LIWX 1XF0A 4LCRA 2H6RA 1P0DA 4I5UA 1I60A 3GD6A 2VL4A 3OVGA 2FMNA 4B2DA 3EKLA 3V4BA 4QSHA 2FJKA 1VF8A 4F0LA 3FV9A 3LPGA 2F6UA 4ECLA 1PDYA 3ZOAA 3ME3A 5AN7A 2DZPA 1MSSA 4M0XA 3REQA 3LYEA 1F4AA 5AC5A 1GWJA 2E40A 2Z25A 3WSUA 2H3BA 2ZVIA 1UG6A 3PZTA 3PZGA 4Q7NA 3BLDA 3MB9A 1W1A1 4TX6A 1KCXA 3HFTA 4MWAE 1RPXA 3FFSA 2QJMA 3QHNA 3MMTA 2XVKA 3T0TA 2OWWA 3L12A 1IT8A 2PRMA 4RXGA 1O5XA 1L9WA 1KFWA 3CL7A 5CPNA 2QMKA 1DQXA 2NVDA 5JIPA 3CO8A 3H53A 2VGFA 3JRKA 2GWGA 5BOEA 4EPEC 3GB6A 1IWBA 2WJDA 2QMJA 1H4PA 4QG8A 2C16A 2NX3A 1GW1A 3OPSA 1B9ZA 1MUCA 5D9OA 2P8CA 3BL3A 3GYEA 3PZUA 3LPPA 1Q63A 3WQWA 2NVCA 4RPQA 3WQ6A 2YDRA 1QI2A 2VC5A 2GWNA 3S2JA 2P50A 4AQLA 3LN3A 1JXKA 2POTA 1TV5A 2NV9A 3I6RA 3ZLFA 4J28A 2Z1KA 5D2YA 1CI1A 3DH7A 5AHNA 1JUBA 3ZXWA 2JGQA 3L4VA 2TSYA 4CNPA 4AB4A 3R89A 3STPA 1DQWA 1CWYA 3MA8A 4RDVA 5FJOA 1I2QA 4UTWC 2CZFA 1LQAA 2YX0A 4AWTA 4FP1A 2HE5A 3O0FA 3TH6A 3HTWA 3H2OA 1KM3A 3NSXA 3P5ZA 3ABXA 1SZRA 3ZMRA 1M3UA 5XIMA 5EMJA 4M24A 3G1XA 2E6YA 1QNPA 4DZAA 5IFPA 2VX6A 2ZE0A 4UQCA 4MJ2A 1WPCA 3CIWA 3GTXA 3N2OA 3WZ0E 4J3XA 4CKQA 3GDTA 4Z2LA 5L6UA 3V35A 4LC8A 3USZA 3E49A 5D2XA 3CM4A 1N8IA 4JTEA 3T07A 2PTDA 5K3VA 2B7OA 1VENA 3GLCA 3BXWA 3MCMA 4AIOA 3M0HA 4JTIA 3W26A 4A8RA 1L6SA 4DB7A 3P74A 4S3CA 3RIKA 2GVYA 4C6OA 3I4EA 4PUMA 3MMDA 4NX5A 3UY7A 2PDGA 2PWDA 2PBOA 1R0MA 4OBTA 4Q4PA 5LNSA 3VFLA 4LTSA 1XKYA 4KKXA 4ERGA 3LGDA 1EWDA 4DJDC 1W1TA 5CZ0A 4EPBC 2D0FA 2AQWA 3UYIA 2CZEA 2FQIA 2YCEA 3L2MA 4XZWA 1YQ2A 3THAA 4LU0A 3CT7A 4M51A 3H2NA 4YYCA 1U33A 3F4WA 4EX4A 1A0CA 3ZM8A 4GQ0A 4EWJA 4MB4A 4IG2B 1GOOA 2DJLA 2BY0A 1OFPA 1UR2A 4MVAA 1NFGA 5H2ZA 2FIQA 1ISXA 3RF9A 3MCNA 2VCCA 3WQCA 5ABEA 3I6TA 4JX4A 4UTUA 5KEZA 2ZA2A 3CQJA 2ZUMA 2ZRXA 3CAQA 4HZMA 3GG8A 2VRQA 2D2OA 2QCLA 3PBWA 4CLMA 2R1KA 2YFOA 3IJIA 4KCVA 1VH7A 1H60A 1M03A 2VUNA 2PCQA 1H0GA 2X1IA 3UBPC 1TSIA 5K2ZA 3B8TA 4AZBA 5CC3A 1A4MA 3IIZA 4PULA 4HCDA 4GLEA 3D3AA 4LY4A 5D04C 3W02A 2YCIX 4N02A 3WD4A 3FHQA 3ZR4A 1BAGA 3AWNA 1HL8A 1UWSA 3S2NA 1UZDA 1LT8A 2OX4A 5FI8A 3WKZA 1JD7A 5H6HA 2UWFA 5FEXA 3BJFA 1BXCA 4KRUA 1Q6QA 3ZJKA 1JG9A 2CWNA 3B9AA 1J5TA 3BARA 4HNUA 4C60A 3MUCA 2X8RA 3EWWA 4RXFA 4JDBA 4O10A 2I5IA 4R33A 5CGMA 4BI6A 1BGGA 1AODA 1TKKA 4UQ9A 1XFBA 2J9ZA 2G3FA 2DW6A 1HX0A 3W2KA 1V6WA 1T99A 3QYSA 1ZP3A 2PU1A 4NYUA 4JNZA 5MHBA 3VCRA 3MHFA 2VT0A 2DT3A 1LLWA 4PEKA 5F4WA 2NX9A 2OOGA 3G18A 3GWQA 1VIWA 3WQGA 3V0UA 1IYXA 3CB8A 3CK5A 3C2OA 3KCOA 1FWCC 3ITXA 1PE1A 4L61A 4AAJA 3BUVA 2UY2A 1OSEA 2YZ5A 3OEXA 1UMLA 3QGVA 3TWAA 5I3KA 5I3HA 1RLCL 1OF8A 2A3EA 2P10A 2RJHA 4NJJA 1HO1A 4Q6XA 4CQCA 3FEMA 3FYYA 4FZIA 1EQPA 3PTDA 3RX2A 1MI3A 1GNXA 3FKRA 1KFKA 1E9ZB 3TQ0A 1SUXA 3HG4A 4ILSA 4FLOA 1XH2A 1H49A 1J9YA 4C65A 1L2UA 2YXXA 4UQBA 2Y7FA 4NF7A 4ICCX 4WJXA 3MJYA 2HISA 1JUKA 1DIKA 2R82A 4AHPA 1A0EA 4HOZA 2B7QA 2UY3A 1KCLA 3KL5A 1GKQA 1UOKA 1TCDA 1WBHA 3BVJA 4XB3A 2GVEA 1ICPA 3KOFA 2ZKMX 2R1NA 5DMLA 4EAMA 3JR2A 5D9NA 4GY1A 3D6NA 4FXSA 4B92A 4Z2GA 2J25A 5DQPA 4MLJA 3WMLA 1D9EA 1P6CA 4US6A 3P3BA 3WH7A 4K3ZA 4GUIA 3I3BA 3W1RA 3S9ZA 1S2VA 1BEUA 4FNUA 3U9IA 1N82A 1B1YA 2QDEA 3W7EA 1Q6CA 5IM51 2YL5A 4PN2A 4M8UA 3L4TA 2PWVA 3MI2A 3OG3A 5FF0A 1RY8A 3OB8A 3WDHA 4Z2JA 3EOEA 5A6MA 3SRFA 3U2EA 1KM0A 2V2DA 3TCSA 4D6GA 3AMKA 2VC7A 4JN8A 3ZT7A 2H8ZA 3T2OA 3IEBA 3UJSA 4XSLA 3G6LA 4DAIA 2GJPA 1WNOA 2PTXA 4FOUA 1DIEA 3KCLA 4K1GA 3O6YX 1MNZA 4EACA 4KFOA 4GYFA 4O1CA 3NQBA 1UZ1A 2L5HA 2CHOA 4Q8PA 5TD4A 3K8MA 3TYUA 2ZZ1A 1UUMA 4GFIA 2P0IA 4AVNA 4PUJA 1JZ7A 4IJRA 5F7UA 2NWSA 2I17A 4Y2WA 2D24A 2VUYA 3EBVA 3WNKA 3EKZA 1DE6A 1UD6A 3UJFA 1VFSA 2ZDRA 3QW4B 1QI0A 2DH3A 4L4OA 3LXCA 2CHRA 3H4GA 5D37A 4OFCA 1FHVA 5FL1A 1Q5MA 3SURA 4I6VA 3U3HA 1UD5A 3SM0A 2PODA 4AZCA 1TE1A 1GVFA 4NZCA 3W25A 2FTWA 2DORA 5FCZA 1TTIA 3LM3A 3RU6A 2IPWA 3GU1A 2FGBA 4P61A 4QR6A 4EOUA 3K2GA 3TC3A 1EX5A 3KOXA 4DJDD 3U2ZA 4A8NA 3CWNA 1YMYA 4F8XA 2G41A 3BO9A 3G6MA 3RYSA 5RUBA 2IKHA 4PB4A 3BSGA 2XZ9A 2V38A 3SQSA 1B2YA 1LORA 2C3ZA 3H6OA 1MXDA 4PCNA 4D1IA 2NXGA 1PZ1A 5AC8A 1VP5A 3GTNA 3RN6A 1ICQA 1BYAA 3ZVIA 2VFEA 3QVQA 1FRBA 3GG7A 3ZSTA 4KQNA 4ZO7A 4S3KA 1S2CA 2J6VA 3UZWA 3P62A 5FA5A 3CEUA 2VX4A 5EGRA 2Y1HA 2JALA 1XIBA 4AHOA 5A8QA 1TO3A 1KGUA 1GYMA 1M1BA 2ACSA 4LSBA 2CLOA 2EO7A 4MY9A 5HDRA 1O95A 4OIFA 4GIAA 1X8CA 3SECA 3CQ0A 3IJ7A 4JFTA 3PZ9A 3TTYA 1JEZA 3M5VA 3A5VA 4ZBCA 1LWIA 3P60A 4CD8A 3HIJA 3P82A 3KBSA 2ZRYA 3A3HA 1OK6A 1Y8BA 3GE7A 3E96A 1TVNA 3S9IA 5G1MA 1KTNA 5A6JA 4E5TA 4F0SA 2W9MA 4ROPA 5DCBA 3U4AA 4UMAA 4JCLA 4QDPA 3QY6A 1J11A 2PDQA 4R9XA 1JDAA 3BAYA 4PTDA 3GVWA 5TBOA 4S39A 3PSVA 3BLOA 1R6WA 1UBSA 4QDMA 3CYJA 3TAOA 4ATWA 2SFPA 4MYXA 3W6LA 5G1TA 5FF2A 3WG6A 2PLCA 4C91A 3VGBA 4H6QA 1A3HA 4RNHA 4PMQA 1W3HA 3HV9A 1BLIA 1BTCA 1V0NA 2F8QA 5ABHA 1VYRA 5DCEA 4AD5A 3E0IA 2BNJA 2FTYA 4PMOA 1JDDA 1DJZA 3DFYA 1GOWA 4HOXA 3W27A 3B0UX 4JIRA 6TAAA 3RLGA 3CIXA 2IMRA 5E09A 1JQVA 1CB7B 1V02A 3VMNA 3SY8A 3F5KA 3VIIA 2Z29A 4AD3A 3UETA 1Y0EA 4UBPC 4K7VA 3I7QA 4Q4KA 2YR1A 2PBGA 3PWIA 1FP9A 4NP7A 4A8IA 4ACYA 1XPYA 1O1ZA 3BSHA 5D33A 4N6FA 3KRUA 4ES4A 4X9SA 2PDUA 3TFCA 1VCGA 5FAGA 4C6KA 2DSWA 3EX3A 3EXTA 5EA9A 3E0WA 3V18A 1M7XA 1PTAA 1V6XA 3E12A 1NH6A 4M82A 1XQLA 3B4UA 1TIWA 4QS5A 2BG5A 3LRLA 2EGZA 5AYZA 2E6DA 3BLIA 1XRTA 3P0WA 5AYXA 1RJRA 1MFUA 2UY5A 3GXNA 5REQA 3W1NA 3N4EA 4AX7A 4TVCA 2VFGA 3SDOA 1HL9A 1HQTA 3UQNA 4AF0B 4C6CA 4X2RA 3H2AA 4IMCA 3S1WA 1QU4A 3L65A 1I2RA 3NAVA 2OGJA 4MZ8A 5K4ZA 3WMSA 3FY1A 2OZ3A 2HVNA 4P5UA 4CQ9A 1P0NA 4ZXOA 1D7FA 3FX4A 1OC5A 2J24A 4X60A 1ICSA 3G24A 1TV7A 3VOIA 1VKFA 2JIEA 5A8PA 3EAUA 3IRSA 4PUNA 4CQDA 1KCKA 3CPGA 4RJEA 3DFNA 3WDJA 4IGHA 4GZIA 3GS6A 3NJ3A 2VGBA 1O68A 3QLLA 1BVZA 1WZKA 4RLIA 4NXSA 5C8BB 3VNZA 4HIBA 2XFYA 2YL6A 2DZWA 3HPSA 3LBMA 1WQ5A 3BLEA 3MW7A 4AZ5A 5J5DA 4ICNA 5LZLA 1XM3A 2BDQA 1KWKA 2OFJA 4PRWA 4TQTA 4H4IA 1U30A 4XD3A 4I9TA 4HHHA 1FH9A 1W9PA 1MW0A 3ARZA 1B5TA 2O9OA 3QOKA 4UNIA 3DFPA 2V3EA 3VABA 5I0DA 3W1MA 3H21A 1FUYA 3SUWA 1G67A 2GVGA 3ANVA 3GFXA 1XLEA 2AMGA 2XZ7A 4FIRA 2PA6A 3BLKA 2RFGA 1H41A 1UQZA 5D8WA 3QM3A 2X30A 3MPGA 3B05A 3HG3A 4H9YA 4KWOA 5BNKA 1O4UA 3AJ7A 3NSNA 4BHYA 2C13A 4XD6A 4CNUA 4ZOCA 1RSCA 3W7MA 3NURA 2QAFA 4M81A 3WLRA 3ITYA 1EA9C 3PBVA 3O7UA 3ES8A 1OADA 3KEHA 4LT9A 1RR2A 3TV8A 3NQ6A 3UVAA 1JF5A 4R88A 4NHVA 1VHCA 3GDRA 3TDFA 1WOBA 3W2UA 2GDQA 2XGZA 2HVOA 4D6FA 4Y8EA 1MZRA 1LG2A 3MZNA 3GIPA 3M64A 1VFMA 3KM8A 1SW3A 4DLMA 1R87A 2QCGA 3GR7A 1VBHA 1XIGA 4NZ5A 1XGDA 4X0NA 3WJYA 1X8FA 1C8VA 2WNWA 2QJJA 1D8CA 2IPJA 5AYYA 3FCPA 5E93A 2OLHA 4QLLA 4YVPA 4WXZA 5I7GA 3PBMA 3O1NA 3FA5A 1DIDA 1LF1A 3KBNA 2FHBA 2IQTA 4E3TA 3WQVA 2IKJA 2D2GA 2PP3A 4P8UA 3S6TA 2WKLA 5AVHA 2YCLA 1W0MA 2CLLA 4POCA 1P6WA 4DJEC 5SWUA 4AWEA 4D6JA 2QPUA 4MSSA 2TPSA 1GOMA 4CD4A 1W3IA 2XSXA 3WX7A 1K7EA 2WCGA 3L67A 2HPIA 2Q3RA 1X1ZA 2WVUA 3ITTA 3GXIA 4QJ5B 1MXGA 1PKLA 5JU6A 3AZRA 3PZMA 5XIAA 4MF4A 2BWGA 3BTNA 3WLLA 2QUTA 3EXSA 1SJAA 4KEMA 1PVNA 1UWUA 1R3YA 3AYTA 3S2LA 4BJHA 1H7XA 1KWGA 3S5ZA 1AZ2A 3C2FA 3HGJA 1XI3A 1Z44A 4CQ8A 1YRRA 2VQUA 3RPDA 3UR8A 4PFHA 4JPGA 2BY1A 1LG1A 4O28A 3EB2A 1E9YB 4YHEA 3AALA 4B91A 3I7RA 3VVGA 4DO7A 2O4MA 4OJYA 1RHCA 2EG7A 4HZ8A 1CECA 3WJSA 1K6WA 4ENLA 5I77A 3CTLA 4NY2A 4PBFA 4HPHA 1C9DA 3VNKA 5BZAA 3AROA 1UR3M 1OIMA 1ZY9A 2J9YA 3W23A 3WF2A 3W70A 1MWOA 2OB3A 5EPDA 4Q7BA 3WMBA 3S5SA 4M6QA 1QOXA 4M29A 3W22A 1B54A 2V6AA 3HV8A 1FFQA 3URAA 4OBSA 2QGYA 5HOSA 3VIFA 1HJUA 3MUIA 3GH5A 3C61A 2QCFA 2RAGA 1IT0A 3W7GA 4FNRA 5M5DA 3TXVA 3GU2A 3A9IA 3N14A 1OJXA 2ZZ3A 3SCVA 2WMGA 1JJKA 1IXPA 5HMFA 5DANA 3LV6A 1JUEA 1S5TA 2R1PA 1A47A 3CV2A 5AECA 7REQA 1R7OA 1DWGM 3NEHA 3AHTA 4JGDA 2BY2A 1MW3A 2WC7A 4LEQA 3B8IA 4FLSA 5C0QA 4JTHA 4KWUA 4DZ5A 3WQEA 4L4MA 1TQJA 2V5DA 4AIUA 1GPFA 1KM2A 4HA1A 1LL7A 4K39A 5FJRA 2VX5A 1ONRA 4JQ1A 2W63A 3ARVA 4ADTA 3SCNA 3L7RA 1NQ6A 1XH1A 1BWLA 4HNCA 1EGZA 1ZCCA 2J8FA 3QTPA 2GQAA 6PTDA 2HV5A 2YL8A 1FDZA 3GUGA 4EPKA 1XSIA 3H7RA 2EPLX 1H5YA 1HL2A 1UKSA 6REQB 6XIAA 3VOHA 1AA1B 1T0OA 2QIIA 2FGLA 5FJTA 4JYEA 5L9FA 1YPFA 4HK5A 2Y7GA 1QASA 4AZIA 4DX3A 1SFSA 1JZ4A 1IEIA 2QVHA 4FR1A 2FZBA 1V02E 2WWDA 2VKZG 4TX9A 4PGLA 5BWFA 1AVAA 2WNZA 4IFRA 5G2IA 3TTSA 3WQ4A 5AY7A 3M0KA 3WY1A 4BA0A 3EEZA 2ZVRA 3MSYA 4Z1CA 3SFKA 1EUAA 3HZ3A 1XLDA 1EXBA 4Q8MA 2CCRA 2NQZA 5ECUA 3CPUA 3C2EA 4QROA 1OCBA 1QJWA 3TEVA 3NFUA 4W7WA 3VCCA 4OGZA 2DT1A 3VKBA 3G0XA 2PPGA 2BGQA 4HTYA 2DIJA 1QOQA 3BJTA 3XINA 3BW3A 3T0DA 1R30A 3OVQA 1ITQA 1J2WA 2OJPA 4ZO6A 3U7VA 3C6CA 4HGXA 2HXUA 3C8FA 1OGGA 2QPSA 1YPXA 2A1YA 2Y2WA 4IZGA 3H2MA 4MLRA 5K7JA 4U3CA 1WXZA 2VCAA 3AS2A 4GKLA 2PGRA 3O63A 5HATA 3RM4A 3W7OA 2CFFA 3DYOA 1B3OA 1XUZA 3P14A 4HPNA 1Q7MA 3VDAA 3T08A 4OBRA 3OG2A 1P6BA 1XGEA 3RM9A 2CESA 4CQBA 3WUFA 3KOZA 4DM1A 2NQ9A 3R6IA 3GRIA 4I7UA 4D9PA 1OFAA 4PRRA 2A6LA 4JTTA 2QS8A 3MKVA 2OYLA 4FXJA 1IV8A 1OABA 1HNYA 3NQDA 1CGUA 4AWSA 3PS7A 1EJVC 2YGYA 4IQLA 4RCXA 4M7SA 2PFHA 5C7VA 1TMQA 1F05A 2VO5A 3BE7A 2YA1A 3L4ZA 1JYXA 3ZIZA 3CAWA 1XDMA 3B8DA 3AIRA 4C7DA 2J7FA 3RRAA 3HA1A 5HPOA 5CPSA 2VFDA 3KTSA 5HMDA 2O92A 1R2TA 1J12A 1W1VA 4K36A 1DTUA 1E9LA 1WAWA 1FWHC 4MAVA 4MNKA 3TJIA 4DJFC 4FXRA 1DHPA 5FF3A 4U2YA 4WK9A 4QCFA 4IHCA 3PAJA 4KIEA 2GSJA 3H26A 1Q6OA 2NQHA 1WYIA 4ZXLA