3F7JA

B.subtilis yvgn
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
276
structure length
276
Chain Sequence
MPTSLKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDERVGPNPDELLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YvgN protein
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 107
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.1.1.283: Methylglyoxal reductase (NADPH).
pdb deposition date 2008-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3f7jA00
4H7CA 5M2FX 3BCJA 4JIHA 2DUZA 4GCAA 3GHSA 1HQTA 1MZRA 4IJRA 5HNTA 3CV6A 2PDMA 3LQLA 5HNUA 5LIUX 1Z89A 1SM9A 2IKGA 3R58A 1EXBA 3KRBA 2R9RA 4FAMA 2IKHA 1PWLA 3H4GA 4LAUA 4LB4A 3WBXA 5LIYX 2J8TA 4OTKA 2PDYA 4L1WA 4ZFCA 2HVOA 3Q67A 4JQ1A 4XZLX 2PDFA 2IQ0A 4FALA 3CV7A 1S2AA 3V0SA 4XO6A 3WG6A 4PUUA 2PEVA 3T42A 3LN3A 1Z3NA 4DBWA 4NKCA 2PZNA 4IGSA 1ZQ5A 4PR4A 2FZBA 3EB3A 3RX3A 2HE5A 1T41A 2PDLA 3GUGA 4JQ2A 2P5NA 1OG6A 2PDGA 3EAUA 2BP1A 3N6QA 5AZ1A 3BURA 2IPWA 1Z8AA 4XZNX 3G1RA 2AGTA 2IKJA 1HW6A 2ACUA 4PRTA 1IHIA 1ZUAX 3UZYA 3LZ5A 4XZHA 3MB9A 4GQ0A 3S3GA 1J96A 3EB4A 4ASTA 2FZ8A 3LEPA 3UG8A 4Q3MA 3WBWA 1VP5A 5HA7A 4PMJA 1MI3A 4WDXA 2PDPA 1YE6A 3GHTA 2BGQA 4GIEA 1PZ1A 3FJNA 2CLPA 1Q5MA 2PDIA 2BGSA 5JH2A 3R6IA 4DZ5A 3RX2A 3P2VA 3N2TA 2PD9A 4WDUA 3CAQA 4DBUA 1X98A 3WCZA 4EXBA 2IPGA 4PRRA 3WBYA 1R38A 1S1RA 4WDWA 3F7JA 1PZ0A 2PDBA 1UR3M 1VBJA 3R8HA 2INEA 2ALRA 3ERPA 4R9OA 1GVEA 4YVXA 3V35A 3UZZA 4Q7BA 4HBKA 4JTQA 3QKZA 2F38A 4LAZA 1XJBA 2ACSA 3UP8A 1S2CA 1AH4A 2PDXA 1XGDA 1ZGDA 3G5EA 1QWKA 4YVVA 3VXGA 4XVEA 2C91A 4GA8A 1ZSXA 3B3DA 4ICCX 4DBSA 4XAPA 1EF3A 2DV0A 2VDGA 1Q13A 1JEZA 1YNPA 2HVNA 3UZXA 2F2KA 4FA3A 1RALA 3LUTA 1K8CA 1AH0A 3UGRA 4JQ4A 1LQAA 3GHUA 3UYIA 1RY8A 2PDNA 3M64A 4RPQA 1AFSA 2PF8A 1S1PA 3C3UA 4JTDA 4G5DA 3COTA 4WGHA 4QXIA 3LD5A 4YU1A 4JTCA 1C9WA 3BV7A 1PWMA 4WRHA 2IS7A 2PFHA 1Z9AA 2NVDA 2HE8A 3UZWA 4XK2A 4H8NA 3CMFA 4AUBA 4GQGA 4PUWA 3R94A 3DN5A 3H7RA 4L1XA 1M9HA 4WDTA 3R7MA 5LIWX 1EKOA 4JIRA 2PDKA 4IJCA 4JQAA 1LWIA 4LB3A 2HEJA 3BUVA 1A80A 4JQ3A 3LBOA 2A79A 1EL3A 4HMNA 1XF0A 2FVLA 4XVDA 2PDWA 3RX4A 3MC5A 4QR6A 2PD5A 3R43A 4LBSA 2IPJA 1US0A 4GACA 3R8GA 3LZ3A 4LBRA 2IQDA 4JTRA 4QBXA 4XZMX 1AZ1A 3M0IA 2I17A 1AH3A 2PDUA 3NTYA 3FX4A 2IKIA 1IEIA 2PDQA 4EXAA 1X97A 4MHBA 4XO7A 4QX4A 3M4HA 3V0TA 1PYFA 3UWEA 2PDHA 3V0UA 2FGBA 3H7UA 3CASA 2IPFA 1ADSA 5DANA 2HDJA 4F40A 4YVPA 5AZ0A 1FRBA 3V36A 3CAVA 2INZA 3GHRA 2PDJA 2ISFA 4YS1A 2HV5A 2FZDA 3LENA 2WZMA 3Q65A 1RY0A 2I16A 3LNMA 2ACRA 1MRQA 4JTAA 5JH1A 2NVCA 4I5XA 3O3RA 3LQGA 5KETA 2R24A 2FZ9A 2WZTA 1T40A 3ONCA 5C7HA 2QXWA 2DUXA 2ACQA 3O0KA 4WEVX 1YE4A 1YNQA 4GABA 4XZIA 3UFYA 5LIKX 4FZIA 3ONBA 1AZ2A 3U2CA 5LIXX 3D3FA 1X96A 1QRQA 2PDCA 3DOPA 4JIIX
chains in the Genus database with same CATH superfamily
4REQB 1NELA 3BCJA 2INFA 4JIHA 4O0QA 4R53A 4Z2KA 3VZXA 5U7SA 1JPDX 3MANA 3G22A 4O57A 3T0DA 4XIMA 4LNCA 2X2GA 5TAOA 1JJKA 1VIZA 4R7OA 3UYCA 4UCFA 4LF2A 4BI6A 1H11A 2XIIA 1E5JA 2NV2A 2J8TA 7TIMA 4JIQA 1FH7A 3TN3A 4CQBA 4ZFCA 2Z2BA 2HTMA 5A8GA 1KM2A 1IXOA 4FALA 4F2TA 2FJUB 3PZIA 4O52A 3N9SA 1E70M 1HF6A 1AW2A 1M04A 2E09A 4B5TA 3KVLA 5CG0A 1MVYA 4PYSA 1N8WA 1B0IA 3BANA 3GK0A 2DPEA 1T41A 1XYZA 5MHBA 1V79A 1V3LA 3WELA 1QPOA 3AIEA 4P7OA 3H2FA 1JUBA 3B9NA 3AU6A 1EFZA 1FCQA 2RDXA 5D05A 4OVXA 2OQLA 4GUIA 1A0EA 1SO6A 3EWZA 2XISA 2DZUA 1HW6A 4GZJA 3UETA 2CFFA 1MXDA 1VGAA 4Q4OA 3LZ5A 4BHYA 1BHGA 1OYBA 2ZOXA 1CPUA 1K1DA 4CU6A 1VFLA 3B8SA 1QBBA 1F07A 5HA7A 1TV2A 3ZIZA 4QJ1A 1LYXA 1UD2A 1C7SA 1Z32X 1EUNA 2FLIA 2PDPA 3BJFA 3VNLA 1BYCA 3LK6A 5A95A 1K7XA 3ZJKA 3IUIA 2F6KA 3WIJA 3CPRA 4UQCA 1KGWA 3UCDA 3NQAA 1V5XA 2V3EA 2G8ZA 1RR2A 1ISWA 2PWGA 3STEA 2X1SA 5K4XA 1GQJA 1BVWA 2J9XA 3OW1A 1AW5A 4HHHA 3H53A 4JX4A 5BXTA 4O4VA 2Y0FA 2H90A 5MF5A 3VX1A 1PE1A 3R8HA 4JICA 4D6DA 4UNLA 4TMBA 5D30A 3VIKA 1EDTA 3ERPA 5FCZA 3QMTA 1HVXA 3TTEA 3QYQA 3G8EA 1XJBA 2VM8A 1SW0A 1GWJA 1NFPA 4DHGA 2ACSA 7A3HA 1XICA 3AMGA 3DECA 5HQMA 3MUCA 5EPDA 1POKA 1V3IA 3R0UA 3BLFA 1Q63A 3VK5A 3WQEA 2GGGA 3W24A 2E25A 3R10A 4TXEA 3ABZA 5B80A 2PP3A 3ZR4A 3QC3A 3L66A 2G41A 3UYIA 4NJIA 4JIEA 1A50A 2J7EA 1V0NA 1W5PA 1S2VA 3FSUA 4XD6A 3RJXA 2YL6A 1F3XA 1ONEA 2E4TA 3O1NA 4MYXA 2XVKA 3W7NA 4ZCWA 2ATMA 3WBEA 3NPXA 1IT0A 2Y7EA 2HCVA 3GWQA 4JX5A 4CLMA 4CQCA 4DZAA 5HJXA 3ARPA 4JYFA 5A6LA 2ZZ4A 2CBIA 4OQVA 1DHPA 4UBPC 1QAPA 3IVTA 1TTQA 3P7YA 1QNVA 1VBGA 3LDVA 5LIWX 2VX5A 2QDHA 5JXQA 1LWJA 5E6ZA 2VJXA 4Z1YA 1A4MA 1OFQA 2XN2A 2WKJA 2ESCA 3PTMA 4KWOA 1AQFA 2OZTA 3DI0A 4US5D 4GC3A 3CWHA 2WC4A 4M5PA 4DPQA 1K8ZA 1CI1A 3WJYA 2PDWA 1WUFA 1BYDA 3W6LA 3TLLA 4YL2A 3AHTA 4QE5A 2H3DA 5D2XA 5BWFA 4U4MA 2PB1A 1R9ZA 2F7FA 5E0CA 3AALA 4JTRA 1RAKA 1H7XA 3WQVA 3GR7A 4GQQA 1LUCB 3ITGA 3ORWA 1S2WA 3H70A 2H9AA 3LCXA 3FHAA 2VQTA 4MGGA 5BRQA 2WNNA 3VE9A 4H9ZA 3WLOA 4LW7A 4K68A 3HN3A 4DI8A 1XIBA 4BZYA 4DBEA 5CC3A 3MBFA 3NURA 3GTNA 3I6TA 3R25A 3QHNA 4MKSA 3ABXA 4PMRA 1LQ0A 3MO4A 5AYYA 3IJLA 3EEZA 5A8PA 2Z1BA 3SRHA 1JG9A 2ALDA 3P5ZA 2YGYA 4Q7NA 1U30A 2XSBA 2CETA 1VIWA 4ATLA 2D3NA 1HP5A 1RP9A 3WLKX 2ZX5A 3CZLA 3MSGA 4UQ9A 3FVDA 3TA6A 2FH8A 5HDRA 3VOFA 2WC3A 2WHJA 4XAFA 3O0KA 3VGHA 3MPGA 3P62A 1YBQA 5AHLA 1OD0A 4S39A 1PIIA 4Q8MA 2G0WA 1PHQA 1WZKA 4DUVA 5D8WA 1R85A 4BQ4A 1LM1A 1R3WA 4WOQA 1DWHM 2YPIA 4BWLA 5AYXA 3V5OA 1V7AA 3EWWA 2E5CA 1QOPA 3ARTA 5CKSA 3ZS4A 4S3GA 1DP0A 2GGHA 3E74A 4QAWA 3TYCA 1ISZA 1GG1A 1UH2A 3M44A 3OBKA 4MIMA 1SM9A 3W7MA 5FI8A 3UR5A 4L61A 1IWBA 2G5WA 4LB4A 1NFBA 2HQAA 2HZGA 5REQA 3APTA 3CUJA 3QMRA 1VF8A 4F3HA 3TQ0A 2A4AA 2JE8A 3PPFA 3TYZA 1OJXA 3FEQA 3E0VA 3PFMA 1QUMA 4HA4A 4CNOA 1WXZA 3T42A 3HOJA 1TR1A 2Q3OA 4B92A 5ENLA 1EBGA 1E5NA 2PZNA 3NZRA 4PR4A 3DG6A 2FZBA 3RX3A 3EWUA 1E56A 1GNXA 3T08A 3U7BA 1F61A 4OE7A 4UMBA 4FXJA 1BF2A 3ZJ8A 1WP6A 3S1XA 2V2HA 5PTDA 4J3UA 1R3YA 3BOXA 1JI1A 4XV0A 3M0VA 2BP1A 3M5VA 4GH3A 4HN8A 2IPWA 4NJGA 1Z8AA 4F0SA 1V7YA 1DXFA 3CL8A 3UZYA 5KMYA 2WBKA 4H9XA 3BPWA 1M5WA 4XQ6A 4YIWA 3MV11 4Q3MA 1OB0A 5D33A 5DXXA 4CVUA 1E6RA 1TUFA 3FS2A 3GAYA 3THAA 3P3BA 2XIBA 2WHKA 4M24A 3JZEA 3BDKA 1PZ1A 4KEUA 1SR9A 2CLPA 1H62A 1EQCA 3IJ9A 3S2MA 3RX2A 1S3HA 1FA2A 1RXOB 1TJRA 2G3IA 2V2DA 1G4SA 4B2DA 3TX9A 1NP2A 2NX9A 5M17A 3KOXA 1H51A 5C9WA 4IP7A 3OQEA 5D38A 5FL0A 4M0XA 5EMMA 3MMUA 3F7JA 2VWSA 1XDMA 2VFEA 3L2IA 4RUBA 1XIEA 3WJXA 3HGSA 3MSYA 3BICA 2DDXA 3TZNA 3NQGA 5DT5A 2A3EA 3K4DA 5EMLA 2CLMA 2NXGA 1QI2A 3UBPC 3OIHA 3KCLA 1XGDA 3TQPA 3FAWA 5FJRA 4H9VA 3VCRA 1EJSC 2BMBA 3KTSA 4W7VA 3WH7A 4NZ5A 4QAIA 3WQGA 5EB8A 3UJEA 3MCOA 1LT7A 3M7WA 2V63A 4D2JA 1SZNA 1J0KA 4IL0A 3OZMA 1L0PA 3E6EA 4QS6A 5I78A 3M5XA 4P7NA 3NJ3A 4DYEA 1B54A 5AHEA 4FLQA 4A2SA 4KRUA 1AFSA 2TPSA 4NHVA 2IQTA 2NLIA 3ZMRA 3NIYA 1B57A 1GT8A 3G1AA 5HPCA 1E3XA 4S3AA 4H9UA 3W88A 4P8XA 1PWMA 3LLXA 4XAYA 1GGOA 3TQVA 2OG9A 1R3QA 2NVDA 4RE0A 1UWIA 4ZGYA 2XH2A 2P10A 2BY3A 4LRTA 4B4HA 3AQUA 2GVLA 1E72M 4UMCA 4J3WA 5HPOA 4TV5A 1KCXA 1V3HA 3OGSA 2CLHA 1BYAA 1KFBA 3B0PA 2BGNE 2F2HA 1EHNA 3BMVA 5CGMA 1UR0A 3NQ6A 4JIRA 1S38A 3SY8A 2CPUA 2WVSA 4NZFA 4WSKA 1B9ZA 2E8ZA 3ARVA 5KITA 1BLIA 1C92A 3W1AA 4IFRA 4MYAA 2TRSA 1WDSA 3AYSA 2WMJA 3AYTA 1TPUA 2YL8A 1V03A 4FXRA 2PWHA 3PBYA 2D73A 2VEKA 1RZMA 3BAJA 1XM3A 2OEMA 3ITVA 3B8TA 1JQVA 1RA5A 3U3HA 2ZKMX 4LU0A 4PUKA 3ZVHA 5LHFA 4Z2HA 2BFGA 3NO1A 4R27A 4EK7A 3E2QA 1GKRA 4A22A 1US0A 3AIBA 3CQIA 3M5ZA 1KM0A 2QCMA 3WUEA 4J3ZA 2QPSA 2ANUA 2YBTA 3TOPA 3BAWA 2IQDA 2GQ8A 4HNTA 3KDNA 3S2CA 3GXPA 3TE9A 3CZGA 3M0IA 2IW0A 4Q8QA 4NJJA 1SMDA 1W5NA 2AAMA 3T40A 1VD6A 2D69A 4IMFA 1W9BM 1ZALA 1ZPTA 2ICSA 1CXLA 3GU2A 4D1IA 3VINA 2W3ZA 3WX7A 2EBNA 1W9PA 4XO7A 3VIFA 1FOBA 1PYFA 3WH8A 3UWEA 4KRZA 5A69A 3DAQA 3D47A 1KFEA 3VOHA 3W9ZA 2A3CA 3FLUA 1KV8A 5GJNA 3W1RA 3U8GA 4RXGA 2POTA 5FEWA 4E2VA 5CZ0A 1LJYA 1RJRA 3N34A 3VM7A 3TTQA 1A5CA 1OGBA 1SPQA 3THQA 1L8NA 2Z2UA 4M81A 1MRQA 3LYEA 4Y6GA 1G4TA 1TJ0A 4B90A 1OT2A 2G97A 4CCEA 1EGZA 2QUUA 3LPPA 5KZ6A 2YL5A 4GGBA 4K36A 3VKJA 1FKWA 3S0CA 2OZ3A 3THDA 4DJDA 1SJDA 4PN2A 5AOUA 3S47A 3FGCB 2REQA 1JIBA 1R7OA 2OX1A 4N42A 1KBJA 3ZLFA 3DX5A 4EE9A 1SR0A 4L6HA 5EGRA 3SSZA 1OGSA 4MNLA 4J5NA 2Z1SA 2PWVA 1BGAA 4KCVA 2HS8A 2NX3A 4MB4A 3SZ8A 1QRQA 2VHLA 3DHFA 3OVQA 3DOPA 3VIHA 3CAKA 1W31A 2PODA 4Q7IA 1MZRA 3H2CA 3RDKA 1PKLA 3DFTA 2GWGA 3LCGA 4LAUA 1YNYA 3G18A 1SSDA 3F4NA 4ACZA 1N7KA 1UB3A 1X6LA 3UNTA 3HIJA 2Z0IA 1W1A1 4MJZA 2PDFA 3QPZA 5AYIA 2J74A 2FPTA 4OV9A 3VPLA 3WG6A 2WMIA 2HK1A 3IPWA 5IRPA 4ZQRA 4AMCA 6ENLA 1RUSA 2JQXA 4ZSTA 4X2RA 4OU1A 3PF3A 2DSZA 2ZBTA 2WCGA 4HK5A 4LVFA 2YA2A 6XIMA 1OFEA 3N2OA 4JOMA 5F1VA 3LS9A 4QITA 4HTYA 3AWNA 1K6WA 1ZJBA 5BROA 4IH3A 2ZXAA 2OXNA 4UTLA 1VYSX 1FWFC 3N6QA 3H4WA 4FX8A 3K8MA 2WQDA 2XN0A 5JIPA 3SRDA 2OR2A 3O6AA 3K30A 1WE5A 1RPKA 4UQDA 1NDVA 3PK7A 3DFOA 4QROA 2PUZA 4E3VA 4UCGA 2XFRA 1PDZA 1ZY9A 2XIMA 4LUSA 4E38A 3GNOA 4GXWA 3AXXA 4QHRA 4HPJA 4HSNA 1IR2A 2QV5A 2WSYA 3VO0A 3W22A 1GW1A 6PTDA 3FJNA 2AL1A 1EQPA 3TJXA 3CMJA 3TKFA 5TBOA 2ZUWA 4EX4A 2XSXA 2BDQA 3VNZA 5F2LA 3R13A 2VVNA 3WNMA 1ME9A 4DO7A 3DFYA 4H6RA 1P1MA 3OLDA 1CXKA 1A47A 1Y8BA 4PCFA 4MNJA 1CLXA 3GVWA 2XVGA 1RBLA 2CKSA 3QZ6A 1LRQA 4YVXA 4C7FA 4IIHA 3LU2A 3CHEA 3IJ6A 3GU9A 2OOGA 1UIPA 1UKOA 1XWYA 3WH9A 3W2KA 1YTDA 3SCWA 3V5FA 1XRSA 2P8BA 2V68A 3AUJA 5BRBA 2A7PA 3N13A 1PPIA 3O63A 4KGLA 4Q32A 4ICCX 4ZQMA 2QUMA 1OX5A 4F0MA 1EZWA 2DV0A 1KD0A 2CZVA 3LB0A 2HVNA 2QGHA 1YRRA 3WF0A 5IXEA 5D03A 3KL3A 3M6DA 4J1OA 3L12A 4I5UA 3NL5A 4CNNA 3FJ4A 4FI4A 1BG9A 2WPGA 3G0XA 3SY1A 3LBCA 3COTA 4WGHA 3D46A 3MI6A 1MQRA 3DI1A 2NWSA 4IPJA 1C9WA 2J7DA 2DZAA 2C6QA 3BV7A 3N4AA 1KWGA 3GM8A 3UEQA 3ZT7A 3EPOA 1R46A 4H9MA 1DBTA 3M0ZA 3CV1A 3R8RA 4RE4A 1CIUA 4BF9A 5LSMA 2QUVA 5C6MA 2R82A 5BWAA 3MTWA 5CBJA 2OODA 1A5SA 3NOEA 3EOOA 3DGBA 3LPOA 3VAVA 2C16A 3DERA 4YYFA 1EKOA 2Z1VA 4S2CA 1G69A 2ZUSA 4WIWA 1JL8A 4YNGA 1F05A 2XZ7A 3OGVA 2HEJA 3BUVA 3WLRA 2QLYA 5F2GA 4QLJA 4M19A 2Y8VA 1H63A 1EZ2A 3DYMA 3AZSA 2XZ9A 3E0FA 5CC6A 5I3JA 1U5HA 1UWRA 1DJNA 1GOQA 1OCQA 3WEOA 3BO9A 3GLCA 3M46A 3W7PA 4GNJA 1BWVA 3U57A 2YKKA 3GS6A 1TWSA 1YPIA 2Y5SA 4MZYA 3TDFA 1AQMA 4PCNA 1ODZA 3BSGA 3L21A 3R43A 2IPJA 4M29A 3T9PA 4C6BA 1HGYA 1LROA 1DIEA 1QFEA 2Q71A 1EUAA 2YL9A 1EJTC 1H2JA 4AMAA 2GVGA 4G56A 1M7OA 1NM9A 3WN6A 2OLHA 4GD0A 3QV6A 1M53A 2DSWA 4GNKB 4K6AA 3C0QA 5DMLA 4FXSA 4O19A 5CSSA 2VYOA 3KVJA 3NTYA 4UQBA 2I57A 4JKKA 3V75A 2R94A 2IKIA 3PPGA 2ZC1A 2PDQA 3N12A 5CPMA 3SSJA 3N15A 3PZQA 1O60A 3BG9A 2WK2A 1VPYA 3OZPA 3WF4A 1OK4A 2OELA 3H7UA 3ES8A 4WZHA 1P48A 5LA2A 3N3TA 3E2RA 4LC8A 5BW6A 2WHLA 1E4LA 3I65A 1S39A 1XFBA 2ZE3A 4YS1A 2V67A 3WQ6A 2ASHA 1MXGA 3BGJA 3P6LA 4JTSA 3KEHA 3CEPA 3RRXA 2E67A 2YCJA 3HMJG 1Q85A 4I9AA 1PJ9A 4MLRA 1AW1A 3MHGA 1VFFA 1D2KA 2X16A 3IEBA 4G9PA 3P8JA 4AD2A 1UROA 1ONRA 1UR2A 1F4AA 3W2NA 4IMDA 4A29A 3MCNA 4H04A 4M7TA 3G1XA 2ZZ2A 4O1CA 1NH6A 5GQBA 5D02A 4RZBA 3WLQA 3VD7A 4QTGA 4UB9A 1MQQA 4GZ7A 1KLZA 3T09A 3UVIA 2YSWA 5H8UA 3MSDA 1P0KA 2E5BA 1F2JA 4CEUC 3GY1A 1NY1A 2PE4A 2GFTA 3EWDA 3UU0A 3V4BA 2VUYA 4TIMA 5IM51 2YXOA 1KTBA 5HNUA 5LIUX 3UWVA 1UH3A 3GBEA 5DN1A 4UWMA 2O4MA 2BHYA 5AYBA 1DL3A 2WLYA 3NQ2A 1U2YA 4HU0A 5HNRA 1PZ3A 1E9YB 4JQ1A 3ZT5A 4KFNA 4ILSA 2IQ0A 3M16A 3P61A 4Q22A 4JR5A 4PUNA 2OWWA 4LF1A 2OTDA 2OZ8A 2WWDA 2G96A 1JNDA 3MVIA 3OBEA 1VFSA 1SW7A 3GU1A 2PU0A 5BU6A 4NKCA 2NQZA 4Z2GA 2YA0A 1ZQ5A 4TOQA 3ABSA 2VGBA 1CLKA 4PA8A 4D6GA 3FXGA 2ZX8A 2Y70A 3MW7A 1DIKA 1XH1A 1O94A 2WMHA 4EAYA 4REQA 1A5LC 4EF8A 1NDYA 3WQWA 1OFPA 3LHUA 4N7QA 1OYAA 5ABEA 1KKRA 4JNZA 2XH0A 2UY4A 3I3EA 3OZYA 3U48A 3MMDA 3ARQA 1VENA 3MU7A 1IHIA 3T07A 2B0MA 3REQB 3MB9A 2WZIA 5JMUA 3CL7A 1Z7AA 4IUGA 2O9RA 4ASTA 3CQHA 4DM1A 2ZRUA 4MZ1A 4MWAE 3EX2A 3TP4A 1WDPA 2GVEA 4K8HA 2V9DA 2VFGA 3EKGA 2BG5A 1UOZA 4Y9AA 2BODX 1XG3A 2IXUA 4GIEA 2V5DA 1E9LA 3QLLA 2J7CA 4D8LA 3EWYA 1EJ7L 3LSBA 1MNZA 4DJED 3AZRA 3KVKA 4GI8A 1JF5A 2Z2AA 3B9DA 1WXYA 3F4CA 3SBFA 4W8LA 3RGTA 3S1UA 3M0HA 4DBUA 1XSKA 3OU8A 1PX4A 3HG5A 4PRRA 1PBGA 1R38A 2BVTA 1VHNA 4E4FA 2QKFA 3MY9A 3M41A 2J4GA 1LRTA 1A3WA 4J9JA 1TX0A 1Q66A 1H61A 3LXAA 1WUEA 1XPYA 2R1PA 1V8EA 4AXKA 4GWEA 2ZRYA 4FR1A 2BHZA 1XBXA 4UFHA 3KBSA 3NSXA 2FDSA 2PP1A 3GB6A 3W71A 1HNYA 3G5EA 1OY0A 3POHA 2VC7A 1S5TA 1UWUA 4GA8A 4RZ5A 1RHCA 1FWWA 5FD0A 3KP0A 1PAMA 1JAKA 3M6YA 4MB5A 3LGGA 4GCXA 1TV5A 3W7GA 1MUWA 4JTLA 1K8CA 4AZHA 3VYLA 1LQAA 1AMYA 4W4QA 1EIBA 4GNVA 1LG2A 5EBUA 1FCBA 1S1PA 4IPPA 2UWFA 2Z7GA 4JFTA 3T2OA 5AC6A 1KC7A 4AZ6A 1HJUA 1Q65A 3G3DA 3GDRA 4UTWC 4PCSA 5HWMA 2FB3A 3BL3A 4J2MA 1RSCA 2BY1A 1TPFA 1EPXA 1KM6A 3BARA 4CQDA 4LVBA 1U1HA 2GOKA 3MUZ1 3DKLA 3W2MA 2OCZA 1XSIA 1KRMA 1B90A 3H7RA 3GR8A 4CN6A 3HG2A 1HTIA 3MA8A 4NT0A 5D9OA 3W2JA 1ISVA 1GZGA 2BLEA 1TVLA 3QSTA 1CGVA 3TONA 4EXQA 4MAVA 4BQ3A 2YCIX 1DWIM 1F3EA 3I7RA 3KL0A 1JYNA 3IIOA 3NSMA 4TO8A 2Q3RA 1V93A 4PUEA 1TWIA 5C9RA 3ITCA 4XKYA 2Q8XA 4CNSA 3W7JA 2JKPA 4K1WA 3APGA 3DBPA 2EPHA 4MB1A 2FIQA 5K9DA 4LCQA 1GK8A 2VX6A 1TSIA 3MKVA 3S5SA 4TMCA 1DQXA 2VRKA 4JL1A 4QISA 5E9AA 1JZ4A 2DZPA 4TTGA 2YZ5A 2ZZ3A 2QJMA 3RK8A 1YPXA 1XDLA 4Z42C 3IGSA 4DWSD 5BMWA 1Q6CA 1KXTA 4C6LA 3TUUA 1AH3A 3UXIA 2FVMA 4HIBA 4BQ5A 3H2OA 4W93A 4M1BA 3L4UA 4EXAA 4ERAA 1QI3A 1AL8A 4F0LA 4CCCA 1LOLA 3EOUA 2HNHA 5LXEA 1P0EA 3TJLA 3WNKA 1A5OC 1O5KA 3CWOX 1CNVA 4OUEA 1AA1B 2EG8A 2Q09A 3GTHA 1P1XA 2NVAA 2WSQA 1CENA 2ISFA 2OWCA 1A53A 3D0CA 1EXPA 2WZMA 3EA2A 1PTDA 3RILA 1XLMA 1CXEA 1YX1A 2VX4A 3RMJA 3P74A 3P0XA 2QCLA 1CECA 4FF5A 4F79A 3EYPA 2V5BA 2VURA 2NVCA 4DVOA 4BJHA 1FDYA 3E49A 1LUCA 1I4NA 3LHWA 4UR9A 5EL1A 1I2OA 1QNRA 4KIRA 3ONCA 5HAOA 1C29A 1NDWA 3OVRA 4LX4A 1ZRQA 3STGA 4B5NA 3G3MA 2QW5A 4U5KA 4GYFA 4JIPA 1UJPA 4GC4A 2CITA 1ITCA 1XLBA 1DVJA 2J75A 2CW6A 2WPBA 2J9YA 1EJUC 1UMYA 2Q01A 1EBHA 3SDOA 4NASA 4PEEA 2CESA 3S4TA 3RAOA 2NT1A 3C5QA 3Q45A 3K4AA 4HMDA 1L9WA 4FK9A 4MFDA 1EXBA 1XIJA 3GG1A 2IKHA 4W84A 1TIMA 4JHOA 4UZSA 2ZX9A 1JZ5A 3L4VA 4AU0A 1I2QA 2RDTA 3WBXA 3R11A 1B30A 3AOFA 3GXNA 3MUY1 3L7RA 1DYSA 4F0RA 2XIJA 2WJDA 2VDHA 4W89A 5DCEA 2PRMA 3HG4A 2EG7A 4S3DA 1P6CA 3LN3A 1M03A 2MANA 3KHJA 3OOQA 3UGVA 2WVTA 2VGFA 2PWUA 4V1XA 4GZIA 3A5FA 5BU9A 2PAJA 1A5KC 1UP3A 3NM1A 3UJ2A 2Z24A 5AC7A 4D8AA 2HS6A 2PDLA 3V5CA 1E71M 1EYEA 2J66A 5A6SA 1I0DA 3S5OA 3E12A 2HWGA 3EAUA 4KT2A 5H6HA 3PB2A 3B9AA 5EMJA 5C2CA 4LS0A 4NRSA 2OB3A 4N9DA 1J4EA 4F8XA 2ZXDA 2IKJA 1I8JA 3IJQA 1H7NA 4IPIA 2GSEA 3W7DA 4DQWA 4B5XA 3E02A 4LTSA 4GKTA 2W27A 3GC2A 4W85A 3LLFA 2VDIA 7ENLA 1UCWA 3XIMA 3G0SA 1VFTA 3V16A 1ZAIA 1JRCA 1V3JA 1DPMA 1SMAA 4UTWA 3ZJ7A 4AH7A 1ZCCA 3ISIX 4GI6A 3N2TA 2FJKA 1GOXA 1UC5A 2DSUA 2I56A 1ZLPA 4XBJA 2V5CA 1TR9A 2V5KA 4PMYA 5I79A 4G6CA 4RDYA 1DXEA 2IPGA 3TLQA 1XGZA 3A22A 1N55A 1CGTA 4AYSA 3OODA 1I2PA 5HWJA 3SCQA 3W75A 4NI8A 4PMDA 1PV8A 4EPDC 3RJYA 4Q4PA 2ZXQA 3N14A 5KTLA 3F03K 2ZXBA 3W02A 3UP8A 5GNXA 4I8DA 4KCUA 4M6UA 1W5MA 4GUJA 1JCXA 2GJNA 2AL2B 3UA4A 1UBPC 3TROA 4FOUA 3VXGA 3SGGA 3PHAA 4GI4A 3DC0A 3ZZ1A 1GVIA 3KS5A 2C91A 3ANYA 1BVNP 4H6KA 2Y62A 3T81A 2F2KA 5AVNA 1FHUA 1K7FA 3W83A 1I1XA 3USZA 3WD4A 4XISA 4GVGA 3STPA 4QCEA 2HSAA 3C3UA 3I7SA 5I3HA 2A6NA 1KBBA 3TVAA 1YHTA 5J5DA 4ZOCA 2PTDA 1CGYA 2VFIA 4V1YA 3Q94A 2FPVA 2RAGA 1EX1A 1BD0A 3R1ZA 4WRHA 2CHRA 2E8YA 3HMCA 3UJSA 3WUFA 4PODA 4ZE4A 1UKTA 5IFTA 3SN4A 1EX5A 2C0AA 4B5WA 1VPXA 4Z17A 1JYXA 3CH9A 4LALA 3F5LA 1V3MA 4JCMA 1MW3A 1OT1A 4IX0A 1OINA 1AD1A 1KNWA 2W92A 4PULA 4GISA 3WLNA 2XM2A 2WKLA 3R7MA 3W84A 2VFDA 2XDFA 2HBXA 3WLMA 2POZA 2ZA1A 3HFYA 4G8TA 3FKRA 4D72A 3S42A 1KXVA 1TPEA 2PTWA 1J0JA 3CTLA 1J5TA 3DFQA 3TU9A 1JCNA 4GUGA 3NQBA 1QOXA 5FF0A 2OZ0A 2DT0A 3GC5A 3CBWA 2Z6IA 1S3TC 3G1VA 2YOCA 1ZJIA 3VC6A 1VHCA 4C1KA 3LZ3A 3QFEA 4LBRA 2CLIA 4E4PA 1EIXA 1TE1A 1UIOA 1HJXA 3GXIA 4POCA 1B31A 3SUTA 3R89A 4S1FA 4GVHA 1ESWA 4C6EA 3H2MA 3NDZA 4MKNA 1P6WA 1YTKA 3EA3A 5XIAA 4KERA 3TXVA 3TQKA 3RLUA 3IRDA 2NSXA 4DO4A 4R9XA 3LI0A 3E5BA 1LL4A 5K3VA 1R9YA 2E28A 2DVUA 3MCMA 3BTNA 4O8RA 1B3OA 4PBEA 4ZE5A 3CASA 2EF9A 4KQNA 2XG9A 4AFYA 4HGXA 3EGJA 2PGWA 1FVPA 1C8XA 5FL1A 4GMEA 1J9YA 3FKKA 2ZRWA 1SW3A 1W3TA 4IICA 3IVUA 1S5VA 3KHDA 4DEFA 2ACRA 1JUEA 2PURA 4KF1A 1HKWA 3UWUA 1EH9A 4JZ5A 1WKFA 3VDHA 1XYFA 4ML9A 2JIEA 3I6RA 2AQOA 2Y2WA 3K2GA 3FCPA 2DUXA 2O9TA 4W9TA 3H7VA 3MP3A 4ORMA 2QIIA 3TW6A 3RU8X 5G4WA 1MUCA 1T99A 6REQB 3W1TA 3PSWA 5J04A 4Y2WA 5I23A 3AIQA 2Y63A 3CEUA 4DNMA 1WAWA 4ADTA 2H6RA 4PEKA 1TVNA 3HPAA 5CPNA 4YWSA 5HNTA 4AVFA 2WW5A 1PTAA 1FUYA 2Y88A 1XL9A 4N4QA 1ITXA 2CCRA 3C0JA 3W7HA 3W2LA 5T9CE 4HU4A 1K4GA 3WMLA 3ZQ9A 5GPRA 3W00A 1SJBA 2PDYA 3M0XA 4L1WA 1VCVA 4MOZA 4GJIA 4K7VA 3NG3A 4XZLX 5C9XA 3QKEA 1GHRA 1YIXA 3FGCA 1HJVA 4CD5A 1OGGA 4Z0JA 3GG0A 1W1ZA 1KTNA 2YZRA 4M7SA 1OWQA 3C52A 3PUGA 2YLLA 3IJ7A 1O5QA 1XS2A 2VC5A 3SCUA 4D8ZA 1AODA 3T78A 2X7VA 5C2GA 4M1RA 4WD0A 3K13A 4FO4A 2XGIA 1UPPA 1TTIA 5IHSA 2GGIA 3CYVA 5CLWA 3GDLA 3P93A 4GIYA 3VIPA 5LNWA 4CQ9A 1WO2A 2W67A 8CGTA 3TNBA 2EAWA 1BG4A 3BLOA 3HF3A 1HZYA 3LBMA 4L4OA 1I9CB 1P0DA 1RCOB 2LLEA 1EP2A 1JPKA 3EMZA 4QSHA 1XUUA 4QG6A 4O0ZA 1W9UA 1SVDA 1BKSA 4NNCA 3AZTA 4QDWA 2GJRA 2A85A 1XYMA 1TPVA 2WJEA 3MV01 5A6KA 2ZZ1A 4QDPA 5LA0A 1HX0A 1EC8A 3WJSA 2CLKA 4Z2LA 4N02A 1F3WA 5TF0A 1T0OA 3R0DA 4PB4A 3PJXA 3EOSA 2CZDA 4CD8A 3L5MA 1S1RA 5SWUA 2X8RA 1WDQA 3M47A 3LTPA 3O9NA 3ECQA 3N4FA 3PNUA 3RXZA 3WFAA 1Q7QA 3GUWA 3SQSA 2Y7GA 2VRJA 4RCXA 2F8QA 4JTQA 2WB5A 1ZU8A 4C6CA 3CZKA 4RW3A 3I10A 3NO3A 2DORA 2BZNA 5FEPA 3HQNA 4XD4A 1Q7MA 3CUGA 3UXAA 1H50A 1K03A 3AYRA 3BG3A 1IZCA 5KZDA 2J7BA 3E1F1 3V18A 4RDVA 1V08A 3UZ5A 3O0FA 3EWBX 3KP1A 4ZR8A 3TJIA 1AH0A 1LG1A 4URIA 3NQEA 3QOKA 3TIMA 5D8ZA 3TMQA 1RY8A 1FX6A 4LVGA 2PDNA 2YFNA 5A5WA 2P0OA 4WUIA 5B7YA 4F48A 1GHSA 4J3XA 3WNOA 3FXYA 3O6DA 5H2ZA 4DUXA 3GDTA 4JGDA 1THFD 1FWJC 5C2XA 1BGGA 2HE8A 1WQ5A 1N8FA 1EO7A 3HV9A 2J6VA 4GHRA 4GRSA 1L2UA 5M3WA 3P60A 2O0TA 4PMVA 5D32A 4D9PA 2WMGA 3QEZA 4ZQCA 3QGAC 3G6MA 1J11A 2B7OA 3PWIA 2XFWA 3B9OA 3VKKA 1V6TA 1IZJA 1VH7A 4IJCA 2R6OA 2VR5A 1TCMA 1ITUA 3SECA 2YCKX 3DENA 3GC4A 4ZOBA 3WF2A 2XWEA 3IANA 3W1LA 3ZR5A 4FLSA 3N19B 3DDMA 2A79A 2HROA 1I2RA 3UWWA 1IZKA 1QWGA 5EYWA 2A21A 1SFLA 3DFHA 2C79A 3AHVA 5DMNA 4DB7A 2QVNA 3KLKA 3MC5A 4IQLA 4DXVA 2ZUVA 2QJGA 3N11A 3EPNA 3F2BA 4UXDA 4DM2A 4EPKA 4CU8A 1EP3A 2CZEA 2NZLA 2VEFA 1O95A 5A94A 2UY2A 3AXIA 4FB7A 2O9OA 3DGRA 5BYWA 1Q6GA 1OFRA 1F5ZA 4AQLA 4CN1A 4BI7A 2ZA2A 2I17A 2OEKA 3BMWA 2VKZG 3UR7A 4X0VA 4QEEA 3LX9A 2DZWA 4HYRA 5AN7A 3ABOA 3DFSA 1IEIA 3DUGA 4JEQA 4MHBA 1M7XA 1KFLA 1LLOA 3SUWA 4Z1BA 5CSUA 2EPMX 2J7GA 1V6WA 1IEQA 1OBAA 3WF1A 2KX9A 2BOEX 1W3KA 1ISYA 4LGXA 3LY0A 2G3FA 1J5SA 2PDJA 3TV8A 3WEZA 4GH1A 1J12A 1KR1A 2P3ZA 4K3ZA 4H7ZA 4KEZA 4MWAC 1XYCA 1J0YA 5JH1A 1JDCA 3T2QA 1Y5WA 5AFDA 2V2CA 1XHGA 8XIMA 1W2VA 3EXRA 2OQHA 3KCJA 3EDKA 2JEPA 2VOTA 3VD4A 4GY0A 4JX6A 3VD5A 3PS7A 2Y8KA 1HKJA 2V38A 2V6AA 4EACA 1DV7A 4C6FA 3B9EA 3PG8A 5I02A 3SM0A 3ONBA 3U2CA 2ZQ0A 4L4MA 3K5XA 1QHZA 1ZAJA 4AWTA 1OF6A 4AISA 3JZUA 2ZUMA 3KZSA 2Q8LA 1XLFA 2O7SA 2OT1A 3GHSA 3QPYA 3VGDA 3LHTA 3P67A 1JGIA 2PDMA 1J2BA 4NY2A 2NUXA 5TNVA 3TSDA 4LAKA 1QASA 5M5DA 3PTDA 2WVUA 3IARA 3C2FA 2GQ3A 4OBTA 5I06A 4RZ6A 2J13A 2XTKA 3CU2A 1ZJHA 5A8MA 1FWGC 3VGGA 1JUKA 1X38A 4TR9A 1S2AA 3BW2A 1UQYA 1H60A 2FB2A 5FSEC 3FAXA 1XH0A 1NOWA 2J25A 4KWSA 5DBUA 2FZNA 3ARWA 3W70A 2XGZA 5DXYA 4DBWA 1TYGA 3E5PA 1IT7A 1KBKA 4MUPA 4RDWA 4IT1A 1F8IA 3JU2A 1WBJA 1EDQA 4JQ2A 2BX7A 1D7KA 3ANUA 2P5NA 4PGLA 4RNFA 4E5TA 3DBNA 1T7LA 5E6YA 1I45A 2Y6ZA 2X05A 3DH7A 3NL6A 1F3TA 4NNBA 3L4YA 1OFBA 3ATYA 1FH9A 3RF9A 1G7VA 5AC4A 4HD5A 3OZOA 2L5HA 5EA9A 1JZ6A 1BXBA 3VNIA 1M01A 2PZ0A 4GJ1A 2FZ8A 1ZTVA 2VTFA 2G3MA 4O16A 4C1NB 3ZOAA 3KBWA 4UZUA 1W8GA 7CGTA 1XKJA 5HXMA 3WNPA 4UR7A 3BC9A 3GHTA 1QPNA 3WL0A 4XBSA 1DJZA 2JALA 4QG8A 3SQMA 1TV3A 3SCPA 2OKTA 5JH2A 1QNSA 1H7WA 4DZ5A 2QUNA 3OQ8A 3B06A 3VKAA 4WDUA 3WQ4A 4OHQA 1MW2A 5I3DA 3CIWA 2J79A 3HTWA 2ATSA 4H8VA 4IGMA 1AQ0A 2WOQA 5D2TA 1JFXA 2CEQA 2B7PA 3N18A 3N4EA 2R1KA 4AIOA 3C3NA 4YWIA 5D04C 2YW3A 1MXSA 4C6QA 3REQA 1SJAA 3RM9A 3UW6A 1HO1A 4MWAD 2ZTJA 1W3HA 1GVEA 3BZGA 3G1DA 2D0HA 1M6JA 2X1IA 4WOZA 5I3GA 1XD0A 3W2UA 2AQWA 1C8VA 3PSVA 1FWDC 4ECLA 4MM1A 2V82A 4AWUA 1CGXA 2C3ZA 3GVVA 1UA3A 2QZRA 2Y5JA 2G3NA 3FDGA 4HSOA 2QF8A 1WAUA 4I3GA 1YEYA 4CQAA 3H22A 5G4EA 4EANA 4MKVA 2J6XA 1TUXA 4PTDA 2E1DA 3TEVA 1Q8AA 1G9HA 4DAIA 1IXNA 4RXFA 3KS6A 1U5VA 1YW1A 2IUZA 1DJYA 2GVYA 4H2HA 1HKIA 3H23A 5AYZA 4MG4A 1QPRA 4YU1A 1IE7C 3I4KA 3MVTA 4UIOA 3AS3A 3L65A 1PXGA 3NYDA 4MAZA 3OPSA 3AMKA 1PSCA 1DWFM 2QCGA 4K37A 2Y7DA 1ODUA 3BOFA 1Q2RA 1MFUA 3MSRA 2EKGA 3DN5A 2P76A 2FKPA 4A8RA 5G2WA 3KOFA 4DX3A 3NWRA 3DU0A 4M82A 4AD1A 3JW7A 2P8CA 1EJWC 4I9JA 3QM3A 1TV8A 4IMAA 3A4XA 1W91A 1TZ9A 2CHOA 2X1UA 3MUAA 1XQLA 2JIWA 3FEMA 1GVSA 1A0CA 3R0KA 1H09A 1VYPX 5KEZA 3BQ6A 1HKVA 5GVJA 2YIHA 4DY1A 3KTXA 4Y8EA 1XF0A 3HURA 1E6SM 4MWAA 3OG3A 4AZGA 2C1HA 4AWEA 3IIPA 1FWBC 4AD4A 2VMFA 2D1ZA 1TMLA 3SJNA 1Z48A 1B3XA 2RGMA 4XUYA 5I3IA 4INFA 4RV3A 2PWFA 4LCSA 2XH7A 4DLFA 5C7VA 1RBOB 5D4YA 3UWZA 1LBFA 4PTMA 3T6CA 2VP8A 1JAEA 3AROA 2WNQA 2UY5A 2EQDA 4PCTA 4UTKA 4IJBA 4O54A 5F2IA 5RUBA 3PANA 1FWSA 5BCAA 1SZGA 1TWDA 1U5JA 3OLGA 3A23A 4IFKA 1E1CB 4V33A 2OLSA 5I6SA 4NXSA 3GYEA 4HSHA 5A3HA 1ADSA 3GR4A 2PLKA 4HPGA 4MJ4A 1P0NA 1KFCA 1GQLA 4YVPA 2J24A 4WXZA 1ICSA 1G4EA 2NT0A 3VA8A 3FV9A 4AVNA 3PC0A 3JR2A 3QR0A 1JCLA 1VJIA 1XW8A 5LNVA 1PTGA 4HA0A 5TIMA 1GJPA 3CUHA 3HJEA 4BWLC 1GJWA 1M1BA 4MNKA 3U2OA 3NUKA 3KOWA 2VFHA 4C7DA 1C7TA 3GG8A 4UC5A 3LCLA 1SGJA 1T40A 1DQUA 4NQ1A 1UR8A 1X8CA 2Z7KA 4AZBA 1WCGA 3A4JA 3ICJA 3L2LA 2J27A 1OCBA 3H8AA 4RDZA 1MUMA 3B8DA 3CPUA 3PUDA 4HZMA 3DFPA 1DWAM 1UQZA 3GNRA 3QQWA 4GXPA 3W26A 2WMKA 5AHNA 5DMYA 4WLCA 1WDWA 3DZ1A 5HR6A 4LS1A 4JIIX 1WA3A 3GVGA 2PPGA 4HVXA 2WYSA 4ADSA 2DUZA 1NWUA 3WUGA 2B4GA 1QI0A 2DY3A 3VKCA 1BRLA 1EC9A 3LCFA 1G4PA 1XLEA 4O0KA 3WDJA 3HPSA 3KL5A 3B4UA 2HPMA 1SUXA 3CB8A 4DXKA 4Y7EA 2OT0A 4DRSA 3QV9A 5CBIA 4KW2A 1LBMA 4C1LA 3KRSA 1LP6A 2GJXB 5CGTA 1GVYA 3DXIA 2FMNA 4QGCA 3SIZA 1GJUA 2YFOA 2Y4SA 1Y7VA 3B40A 2TSYA 1O6IA 4JS3A 4B3LA 1WOAA 2W66A 4IZGA 3JUGA 5I03A 4L4PA 1BQCA 5EKYA 2J88A 2EGZA 1JF6A 5IFPA 1YBQB 3VOCA 3KX6A 1VS1A 3E0WA 4GPNA 2PTXA 4IL2A 1EHAA 2G37A 1V02E 2DZTA 5D2YA 2I14A 2IXVA 4NAEB 3BAXA 1IT8A 3GUGA 3RPTA 3A21A 1RCQA 3GDBA 3ITTA 2VZUA 2QCCA 4A35A 3GQYA 3IACA 1L6WA 3H6OA 2GSJA 1ZJAA 4UOJA 4HNOA 4I7UA 1JQXA 3SUUA 4A6GA 3G1RA 2AGTA 5CAKA 5T91A 4HNCA 1Q4WA 1RQEA 1N82A 2OMAA 1HT6A 1B4KA 3TK7A 3TSBA 3WQ8A 1J96A 3S5YA 3S2LA 1K7EA 4ZFMA 1R3SA 3PBGA 3PB0A 3AXMA 2UV8G 5K7JA 1K70A 2V5JA 2EXOA 5K2ZA 4LY4A 4BA0A 4XTDA 2PC8A 3KBNA 1AK5A 4IPNB 3WZ0E 4JTJA 3VC5A 2QDEA 1W3IA 1UG6A 3R6IA 3WLHA 1H7PA 1XIFA 2PP0A 2XFFA 3LTSA 1IGWA 4IGNA 4WY0F 3T2PA 4GQRA 2G3JA 1BVZA 3I3DA 3GD6A 1W5QA 4PE8A 2GZXA 2HISA 4EVZA 3R2GA 4MTVA 2A3HA 1PZ0A 1UR3M 4H2CA 1VBJA 4GE8A 4ZXOA 2ALRA 1W1IE 5D9MA 3VE7A 3WDRA 3I6EA 1TO3A 3OEXA 4LAZA 1C3FA 1TA3B 4H1ZA 1QNOA 2JKEA 5IBXC 4ML4A 2E68A 3DESA 1LTDA 5AB3A 1Y5VA 2W9MA 2AMGA 2ISDA 5C54A 1SO4A 2E6AA 1FQ0A 1XLAA 4IQEA 3QZAA 4P5UA 3TWAA 3UR2A 1IEVA 1NJJA 4JEJA 1DWGM 2I1OA 4QNEA 3SCTA 1UZ1A 3O2LA 3CT2A 5LZLA 1A5MC 2PF8A 3W7KA 3W87A 4IPLA 1OABA 3E2SA 2FTYA 2YW4A 2XN1A 3WDIA 1W3LA 3T44A 1NQ6A 2QDDA 1LL6A 3ARRA 3S46A 3R4IA 1K9EA 1XDJA 4Q4MA 4Z2IA 3L23A 1NF7A 2E9MA 4HQVA 5F1UA 2ON3A 2AL2A 4JN8A 4JCLA 1EO5A 2R1MA 1ZFJA 3GXMA 2ZZ5A 1XQKA 1OSEA 4J35A 4AHOA 4JTFA 4M6VA 2RUSA 3HQ1A 2SFPA 3RMEA 3UCCA 2WVVA 3RLGA 4HNVA 2W5FA 1GKPA 4A3UA 2WV8A 2FHCA 4UTHA 4BF5A 3PJUA 3ZM8A 2GUUA 1IXQA 1H1NA 2V3FA 2YDSA 3W1MA 1UASA 3ME3A 3QR3A 5HJYA 3HV8A 3DIPA 5H8MA 4XVDA 3XISA 4EPBC 4A3RA 3TYUA 1E0TA 1TCDA 3CIXA 2NV9A 2QR6A 1KFWA 2B81A 3IJDA 3WLLA 5I7GA 5KZMA 5HOSA 1K9FA 1LL7A 2PA6A 4MY8A 2PC4A 4FXFA 4A8LA 2R14A 2YCLB 4B2DD 3RUBL 3MYPA 5J8LA 4GLEA 4XAZA 4E8CA 1VEMA 4A05A 4XZMX 1DJHA 4MFEA 5H91A 3L4ZA 3CH0A 2DUAA 3SCOA 1US2A 1J0HA 2XGBA 3Q58A 2A3LA 3DHDA 5ABFB 5I07A 4JDYA 2RH9A 3TAKA 2VR4A 4CUCA 3T05A 1JXJA 1SJCA 1W32A 3A3HA 1U33A 2ZFAA 3U0HA 3W1QA 4L6OA 2A6LA 1NIUA 2Z6JA 2F6XA 3RR1A 2PDHA 4C6KA 3OA5A 2GUYA 4DJDC 3BMXA 3BAIA 1TPWA 3A12A 1Q6DA 2W4XA 4BS0A 1FWNA 1W56A 3MWCA 4LVAA 4WKHA 4I9TA 4ZOEA 5HNNA 2BASA 2PGEA 5G5IA 2FMOA 3KUMA 2AGKA 1RY0A 2RHGA 3STCA 1W2PA 1EA9C 2FVKA 5FAJA 1QT1A 2A0NA 1QK2A 4S3BA 4WSHA 4ZO6A 1KFKA 4Y8FA 1LRNA 3N9RA 1AJ2A 4AZCB 1GVQA 1CYGA 1R0MA 3OG2A 1L6FA 3ZVIA 1FWTA 4U33A 1JYWA 4A3YA 3RPMA 1O5XA 3PVFA 3SGUA 2A7NA 3W23A 2ACQA 5CSYA 1TELA 2OWXA 4RL3A 1OFOA 4DF1A 1YE4A 3ARXA 3EXTA 4GABA 3T4CA 3OTRA 3W0KA 1RK5A 1DE5A 4JFUA 3QW4B 1NWRA 4J28A 1X96A 3PBVA 5CJ5A 3QTGA 3ENLA 3GZAA 1XV8A 3L0KA 1K9DA 3NM3A 2VOMA 1US3A 4O1BA 2DSVA 1NSJA 3B8UA 4C5YA 2EPOA 4LCRA 2QCDA 3GFXA 3VDGA 1QHOA 3NZPA 4H19A 1UP2A 3FVMA 1HKKA 3LOTA 4H41A 3GH5A 3NVDA 3ZXWA 4UUIA 4FAMA 1EOMA 3HM7A 3HGRA 1J10A 2CZFA 2HXTA 4O10A 4ZMGA 1DJXA 2REQB 3ZO9A 4PMXA 3P80A 4K8GA 4EPEC 5A2CA 1UR1A 3P8IA 4ACYA 4YN5A 1J2WA 1MZHA 1P4CA 4XBKA 3WFLA 2YXXA 6REQA 2WWCA 4QQUA 2OOFA 4IGHA 1WXJA 1Z69A 1T5AA 3D5HA 5DT7A 3CLMA 3T1GA 2ZUNA 3AMDA 1W8SA 2GQ9A 4ZQNA 4IMEA 1DXIA 3M0MA 3NQ7A 4UOZA 4UNIA 1KW1A 5IBXA 3IJIA 3VFLA 3IIZA 1C9DA 2B7NA 3PG9A 3LSCA 3WQOA 4IIEA 2VUNA 2CXEA 5L6UA 2UBPC 3IRSA 5LNSA 3C4UA 3PJWA 3QGKC 1WBHA 5T8GA 4UR8A 3S3GA 2OLAA 3E0LA 3ZLGA 2YBUA 3HO8A 3E38A 5FAGA 1OCJA 2WMIB 4UTJA 1MW0A 5JBDA 2Q6ZA 1TPH1 4YHEA 5FJIA 4GFSA 5ECUA 3W27A 1RLDA 3TAOA 2PDIA 3AIRA 4X0NA 3S9ZA 1ZBVA 4NRRA 4GVFA 1E55A 3ARYA 3PZ9A 4JXCA 2VR2A 4DJDD 4BKNA 2V69A 3CAQA 1TQJA 4PMQA 1OC5A 2PWEA 1PKYA 1GOKA 1UZ4A 4L56A 3LV6A 4QM1A 1GPWA 4PTNA 2I9EA 2V5LA 4RLIA 1LQ2A 4UQAA 3PFRA 1DQWA 5CZSA 4HOXA 4UTUA 5LKYA 2ZX6A 4KBXA 2EEXA 1HXJA 1UD6A 3MZ2A 2WXDM 4Q8NA 4LXFA 4XSLA 2W61A 1JDFA 3KBJA 2VZSA 3BAYA 4JTHA 4GO8A 3W53A 2JEQA 3MT1A 4UTMA 3UZXA 5C70A 2GK1B 3W7QA 3N2BA 4ZTYA 3UGRA 5A6TC 4KS0A 4Y90A 4IG2A 3GTFA 1OFDA 2DZVA 4BR1A 1DJIA 1UUQA 4DYKA 3M0KA 3VCNA 3VOJA 3OIXA 1A49A 1TV7A 2CKRA 4X3ZA 4FNTA 3RHGA 1YQ2A 2VQUA 3FW6A 1XLJA 4P2VA 1E73M 3F4VA 4PTXA 4P8WA 1TV4A 4OBSA 2OEJA 2DEPA 3M1ZA 4AHPA 1VJSA 4RX0A 3IK4A 3BLPX 4RW5A 5LYRA 2GYIA 1FCVA 1TRDA 1E3ZA 5DLCA 3QQ1A 4J27A 3GH7A 1QK0A 5LHEA 2BTMA 4L1XA 4I6KA 4AY8A 4FX7A 3NQFA 3QTPA 4WGXA 2OKOA 4WDTA 4WQ6A 5E1QA 1XPGA 1C93A 3URBA 3A9IA 2CU0A 4H3DA 2PDKA 4LVDA 3VM5A 4IMGA 2XHYA 4HCLA 3CUZA 5HANA 2YDRA 1UKPA 4UNKA 3CL6A 4JD4A 3DKJA 1KQYA 3QQ0A 3AMLA 2E6YA 3KW3A 3DEQA 4DUOA 3FA4A 4ZQPA 1IR1A 2A7RA 4BEQA 4AAJA 2QYGA 2DH2A 3ITXA 4CU7A 2YYTA 2VCBA 2Z26A 1XLCA 2G50A 1MEWA 3P81A 2DT2A 2FH6A 5HINA 4NL1A 3A6OA 4GUHA 4RE3A 3UZJA 3VFCA 3F2DA 4QBXA 1XD1A 1I75A 1KRCC 1W1YA 1LF1A 4LUTB 2VI0A 2PDUA 3JRKA 1E40A 1SZFA 5T9BG 3BAKA 1QR7A 2OYMA 4PMNA 2PCQA 1BSLA 4KETA 4JFSA 3VZZA 3VUSA 5HBFA 1BF6A 1XLDA 1XC4A 3GKAA 3V0TA 5DFAA 4J3SA 2FGBA 5CC7A 1FH8A 3IK2A 4MMWA 4FOKA 1JDAA 2DIEA 3OVPA 1DORA 2NWRA 3H26A 3EXSA 3CMGA 2VZTA 7REQB 3GHRA 3PBWA 1XLHA 1FDJA 4TU1A 3C61A 3TN4A 5M03A 1LT8A 1L6GA 2WNZA 1EYWA 4NAFB 4WSJA 1B3WA 2HVMA 1O12A 4PB5A 1Z44A 3FJ6A 1UPMB 4NYYA 2E9BA 4ERGA 4O1FA 2WHMA 4HHPA 4HK6A 4ROPA 4GUFA 4DLMA 1XLKA 5DX7A 3MI3A 3B0UX 1YMYA 3TWBA 4WEVX 1Q6RA 3NXFA 1YNQA 3C56A 5I00A 3LM7A 3UPBA 3BE7A 2VELA 2WKGA 4PUMA 1WZAA 4DIAA 1ZZMA 3NZGA 3SRFA 4I7VA 1F6KA 3MKCA 3ABRA 4NSBA 4HNLA 5B7ZA 4ZL1A 4D6HA 1IGSA 4KPLA 2VD8A 3S5NA 3S1GA 1AMKA 1CXIA 3LHZA 5IDIA 5CC5A 1P7TB 1IV8A 3R58A 1YXCA 4L6DA 2QCEA 3C86A 3IVSA 4Y9PA 2QULA 1G94A 5A2BA 5D37A 4QS5A 4PMUA 1GPFA 3R79A 3AWOA 3MP5A 1Z6KA 2BOGX 2I5GA 1QHPA 1J6OA 1EJVC 1LCOA 1CT5A 3G1HA 3L67A 1M7PA 3DG7A 4XSMA 1WDDA 4Z0SA 3LA4A 2PEVA 4GXMA 4OUIA 2D3LA 3MMTA 4EWJA 2Z4GA 1MEHA 3EB3A 2QCNA 3W7OA 1UUMA 3TCSA 3B03A 2GGJA 1H3GA 3RIKA 2V8ZA 1E4MM 4S3CA 4BEUA 4HOWA 4M56A 1O4UA 1M41A 3N1AA 3PTQA 2ISSA 1DJWA 3N2XA 3A5VA 1E6QM 2ZIDA 1CCWB 4XZNX 3GXFA 1UUOA 3E3HA 2O4QA 1K9TA 4CNUA 3GDKA 3IJ8A 2ZZ6A 4QLKA 1IYXA 3QFWA 5BOFA 4HU3A 1JZ8A 1R5YA 1CTNA 3LEPA 2D0GA 1H0IA 2OFJA 4ZSUA 1M65A 4I8YA 2CERA 3USBA 1DHKA 2MUCA 3WK1A 2PF0A 3GNDA 4JTGA 2BV9A 1W6TA 2VFFA 3FN9A 4MADA 2ABBA 3SIMA 5CSRA 1QI4A 4DXXA 1VBUA 2I9UA 1P6BA 3T8QA 4R7WA 3RO6A 4YPJA 4W8AA 3AHYA 1ZP3A 4O8AA 4OV4A 2GDUA 2PD9A 2I5IA 3UF9A 4QEHA 1EB3A 1NOFA 3WCZA 3A3WA 3ID7A 5CZKA 4QJ4B 1JULA 4EXBA 2JGQA 3TW7A 3FDKA 3B0XA 2ONEA 4WK9A 4DO6A 1XH2A 1OYCA 5DY2A 1QO5A 4FMVA 5FF3A 3SEPA 1GYMA 1A0DA 4E8DA 2D24A 1EEXA 4YCPA 5CAHA 1ELSA 3NOYA 1NWTA 3HGJA 2BVWA 1Q2SA 2GL5A 3EX6A 1W37A 5GJMA 1FHLA 2PRLA 4C1NA 4CN4A 4WHBA 3KTCA 5HULA 4P8VA 1VQTA 4YVVA 3CZJA 1IEXA 2QIWA 4YLWA 3B3DA 1F6PA 1QTWA 1BAGA 1E0UA 3U5YA 1Q3NA 4S3KA 3O16A 3T8LA 1DTNA 1T8QA 4HCHA 1OK6A 3RLVA 5ECVA 4GG9A 5FJUA 3KXQA 4F66A 3UWYA 4WVXA 4XWUA 5AC8A 2BWGA 1P0BA 3W3OA 4IQJA 1E15A 5F7UA 2C13A 3A13A 3KBMA 3ALGA 1ME8A 4JN7A 2WMFA 1EWEA 1KM5A 4NP7A 1OC6A 4ZENA 2YXGA 1SSGA 2X41A 2KZHA 4S3EA 3CMFA 3QV8A 2PTYA 1KCZA 1JD9A 3UQNA 3PM6A 4DN1A 2I7GA 1JR1A 2D2HA 1CB7B 4QJ5B 1UWTA 3HPXA 4KFOA 1X6NA 3T0BA 1M3UA 2XVPA 5C8BB 5FA5A 3LBOA 4WJEA 2BXYA 4Z1AA 4HPNA 1JXKA 2R91A 3PAJA 1V6UA 2HBVA 4IUOA 1JPHA 4FIQA 1PCKA 3S8HA 3QV7A 1VAHA 3TTOA 1EDGA 4AC1X 1X1NA 4NZ4A 3R8GA 3MBDA 4W5ZA 5BOEA 2A1YA 3UY8A 3LRLA 1E43A 2P50A 1H7RA 3N2CA 1AZ1A 1W5OA 2CXGA 5M1TA 1UA7A 1VFOA 3RCYA 2PGRA 4MLJA 2AMXA 1YDVA 3A47A 4GO9A 2PCEA 3U6WA 3AMCA 3CAWA 5FSDC 3VVGA 1E4NA 1GCYA 5CCZA 1CWYA 2H3BA 4HN4A 4I6VA 3BLDA 1C91A 3RNDA 4AXNA 4XKYB 4LWWA 3NDYA 1T6MA 1ICPA 4C65A 5ABHA 5AZ0A 2PLJA 1FRBA 4MVAA 4DF0A 2QPXA 2ZADA 2WO5A 4AZ7A 4IHCA 2D2OA 4UTFA 2XJ7A 1H5YA 1FWEC 1GVOA 2F6UA 4OKDA 3S2JA 1ZENA 4N9EA 5JIWA 3VMNA 4ZVJA 1GZ1A 4UOQA 5D9NA 4KH2A 4D1JA 2YLAA 3G1SA 1VCGA 1OG0A 4L65A 2WZEA 5G1MA 4ZO8A 2GQAA 2WZTA 1ZB5A 1ML1A 5U4NA 3BJTA 1J0IA 2VX7A 1YPFA 1NOUA 2EPLX 4OOUA 1VBRA 4WR3A 5LGXA 4A8IA 4MJMA 3QVQA 2XPKA 3KWSA 1FHVA 3UERA 3GIYA 5C55A 1E1CA 3KE0A 1AZ2A 3QZEA 4WJ8A 4Z1CA 4B3ZA 5JBEA 3GAKA 2PDCA 4EF9A 1OFAA 3QY8A 5M2FX 4IXHA 3URAA 2BXVA 4GX8A 4C91A 1HQTA 4J4KA 4E4UA 4R5EA 3NZ1A 3LQLA 1VYRA 2VEIA 3LCHA 1X1ZA 2IKGA 2FZMA 5DY3A 3SUSA 2R9RA 3KOZA 3VIMA 4N4PA 1PL9A 3VIIA 3CHDA 3QY6A 4JKLA 5IHRA 2W63A 3WSUA 1AD4A 2Z00A 4NXKA 3SCSA 2BVDA 3Q67A 4GQBA 3ARZA 1GOIA 3W1UA 4IP5A 4PUUA 4YYCA 1HGWA 3C0SA 1VPQA 1XI3A 4E2OA 3EWXA 1OHLA 4MZ8A 4IGSA 3KAOA 4LFYA 2V3DA 3PR2A 4YMZA 1JDEA 1ME7A 3MDUA 3EBVA 1EOKA 4JAWA 2Y5EA 1HL9A 3H54A 3TCEA 5A2AA 4QE4A 1QNQA 3CUIA 1KCKA 3L9CA 3W25A 3ZJ6A 2O9PA 1GONA 1V4YA 4DWSB 3H4XA 4LSBA 1PS9A 3N3MA 4TVUA 3NPUA 3BVJA 2W6RA 1NU5A 2OX4A 3LHYA 1OVDA 2GJXA 2D0FA 4O1EA 1FFRA 4JYEA 2KAUC 4ZB5A 4R85A 2BY0A 4JTTA 1R87A 4L7ZA 1XBVA 2WSRA 4IOTA 1XFCA 2OQYA 4PC8A 3QC0A 4IF2A 3VCCA 4US5A 1YE6A 1HJQA 2W62A 2ZRVA 1QXLA 3H55A 2C0HA 5CBBA 2ISWA 1TTPA 4CD7A 2VT0A 2E1WA 4X61A 1JI2A 1NTHA 3GNXA 3MMWA 1H0GA 3NEVA 2FFIA 3DFNA 4NAEA 1JZ2A 3IAPA 3ARSA 3QR1A 3C2YA 3U4AA 1E6ZA 1RP8A 1VFMA 5CPSA 1E1FA 1AG1O 2ZCGA 3LRMA 1E0XA 1YDNA 2IMRA 4QQ3A 2OYLA 1RVKA 1KTCA 1H1ZA 2D22A 3TFCA 2DVXA 1JD7A 2C7FA 4G7EB 3MS8A 5DQPA 1D3CA 3PUOA 4YTRA 4Q7BA 2ZYFA 2F38A 1A5BA 4DELA 4D6JA 1FFQA 4IMCA 4QP0A 1LBLA 3S9YA 1ZGDA 2QJNA 3L0NA 5DCDA 4XVEA 4JDBA 4H8UA 1D8CA 4XAPA 4PUDA 1W1TA 2WCSA 2RJGA 2ABAA 3UD6A 3VNYA 3TR9A 5DBTA 5BMXA 1NWSA 2VL4A 2F84A 2P88A 4P7LA 3WD2A 4U28A 1O1ZA 3EZ4A 3S83A 1UH4A 1GQNA 1IIHA 3FA5A 1UD4A 2FHFA 3ITYA 1X1OA 3M64A 3SY5A 1R3RA 3O6CA 2FQIA 2D23A 3IWPA 4TX8A 4S3FA 3KDOA 1UWQA 2OGJA 3FOKA 1T96A 4XTIA 3EMCA 1J01A 9RUBA 5CGQA 3URQA 4GJJA 1Z41A 3AS0A 2TODA 4L4LA 1QDSA 1TA3A 4H8NA 1PKMA 4O28A 4GQGA 3RN6A 4GFIA 3U5UA 4CD4A 1V02A 5G2HA 1T8XA 1W3JA 3OLEA 3K1DA 4F0HA 3O06A 3QW3A 1TFVA 3LERA 4RNIA 5DO8A 5AHFA 1B5TA 2AQVA 4JTUA 3NGJA 3P5YA 1Q7ZA 3B97A 1Q6OA 1RK6A 4N6EA 1LWIA 2GUBA 1YTEA 3PZTA 4HNUA 2JK2A 2XIOA 3WDQA 2A3AA 1RQHA 1Y65A 1SFJA 2XYLA 4CNTA 1NARA 1CLVA 3XINA 2EJAA 3UXDA 4QR6A 1Q6LA 2C18A 1A5NC 1V51A 4IX2A 3BSHA 4IIDA 4ZZ9A 1KM4A 3CC1A 3TA9A 3W73A 1EEPA 4LAOA 2AKZA 3Q37A 4Y9OA 8XIAA 3GE7A 2E5DA 5H8PA 1HO4A 2CLLA 4R88A 4RNHA 2VRQA 1WOBA 3GX9A 4G7FA 1EGVA 3BOLA 4WXYA 4XX6A 2WSPA 3MHFA 1UWAA 3V1PA 2E77A 3Q2DA 5CG7A 2YX0A 1NDZA 1UD3A 4XB3A 3VABA 3NL2A 2Q02A 1YDOA 1MW1A 1BPLB 3WQPA 1DTUA 1QATA 4J40A 3ZWSA 2RJHA 1H41A 4PTVA 2QEZA 3K46A 2GGEA 4AEFA 3SQLA 1DE6A 1ZL1A 2BNJA 3HQPA 4L64A 4OGZA 5F4XA 2FZDA 3LENA 2YCLA 3NZQA 1TE6A 1XP3A 5K4ZA 2ZWZA 3RRAA 4HJWA 4L80A 2PS2A 3MHUA 1RJPA 1E4IA 1QOQA 1R3TA 4WY0B 5D2VA 1F8MA 2ODOA 1JCYA 4NU7A 3ITLA 4BFAA 1XYAA 3ZT6A 3FNDA 2B31A 2NQHA 2TAAA 5CQ1A 5ABFA 3AYVA 3CPGA 3TTYA 1D9EA 2EKCA 4LUJA 4CVWA 4M80A 2H8XA 1J93A 3NQCA 3PZGA 1S2UA 3ES7A 4FX6M 3PWGA 3W6YA 1JCTA 3QXBA 1BWLA 4E3TA 3MQTA 1IWAA 3A64A 5FKYA 5LIXX 4F9DA 5F2MA 4CKQA 2GWNA 3WLJA 3BXWA 3SCVA 4NUWA 4IJRA 2Y8UA 2FYMA 3KRZA 3TYDA 1BKHA 4FNUA 1W1PA 3K8KA 2GPTA 3H2AA 4WX2A 1ISXA 3H4GA 3AIUA 3ATZA 3ZLHA 4AZCA 3SCRA 4PFMA 1J8VA 4S2BA 4AZ5A 4X9SA 5CPOA 4O18A 2PMQA 3TR2A 1KGUA 2RKXA 4FF7A 3E9AA 1OIMA 3PPCA 4XD3A 4ZQOA 4GK8A 3A24A 5FJTA 4OT7A 2E6DA 2BVYA 1BTCA 1XIHA 2JKAA 2WJZA 2Z1WA 1KBLA 4H01A 4DF2A 1OX4B 3L5AA 1J6PA 5XIMA 4HHMA 1D7FA 3GFZA 5ABGA 4A3HA 4Q4SA 1UW9A 3C0LA 3RG6A 3AU2A 1OADA 2EG6A 1UP0A 4NZCA 5FACA 5AZ1A 3C8FA 3HU7A 4W86A 4AD5A 5CJMA 2BS9A 1XLLA 4FR6A 4AD3A 1BQGA 5A6JA 4H6EA 3TW9A 4U31A 4RR4A 3AC0A 3CGTA 2QUTA 1EPVA 2D2GA 4WCJA 1E1EA 3E2VA 3GG7A 1WNOA 4WDXA 3LLDA 1V6XA 3FYYA 3LCWA 2OYKA 2VCCA 2BGQA 3AHXA 4AEEA 1CB2A 1HJSA 3GW0A 4OOZA 3W37A 4O13A 4P7QA 2BGSA 4TX9A 1XG4A 1XBYA 1JVNA 4DZIA 4GYJA 4U2ZA 9CGTA 3CJPA 1RA0A 4Z1DA 4F2UA 1GVFA 2YBVA 2QF7A 2VD9A 2OSWA 1MDRA 4WDWA 3UJFA 4BCEA 2PDBA 3MJMA 2INEA 1P43A 1UZHA 1TPC1 1N8IA 4GIRA 2QHAA 4KWUA 1ADOA 1HUVA 1UHVA 4AZIA 2FTPA 3V3WA 4HBKA 3BLKA 2EJ1A 3OHIA 3L68A 5CH9A 4TVDA 2VWTA 1HL8A 3CQKA 4MSSA 5G1YA 2PDXA 5A8OA 4A8NA 1NQKA 3PN8A 3GTXA 4O1AA 4ICMA 3WDPP 4M51A 3VNDA 3KM8A 3O7UA 3B8VA 4M6PA 1GEQA 4TTUA 1XBZA 3LUTA 4TQTA 4AIUA 4V2XA 2FFCA 3CHCA 2J8FA 1E0WA 3IIXA 4AW7A 4YXGA 4HYVA 3H21A 3NPVA 4ES4A 4HA1A 1H7OA 1OF8A 1BWKA 1KBIA 3LHVA 1G01A 5CPTA 3KZPA 1G1YA 2ZUUA 4M6QA 2BY2A 3TJ4A 3IV3A 4LBUA 2DQWA 3N73A 1H5VA 1Z9AA 1YDYA 3WL1A 4DI9A 5EY5A 1K8YA 2YB4A 3UZWA 2FHBA 3PULA 1H49A 3VX0A 1PO9A 4C7GA 3GZ3A 3R94A 4CEXC 1QMLA 3JVAA 1BFNA 1XIGA 3IV8A 1M9HA 3LTYA 4FEZA 4IIGA 5CXPA 1UWSA 1I2NA 4DUWA 2E7FA 4MY9A 2ZICA 2GK1A 4FNRA 1QO2A 3LI1A 3TYEA 3SFWA 3UESA 4LYQA 1F74A 3APYA 4JQ3A 4RJEA 4HNNA 2C14A 4J7RA 2RDUA 4N9CA 2QQ6A 4QG9A 3RX4A 2OVLA 1KRAC 4RPPA 2Z29A 4DO5A 1PVNA 3TTSA 3W01A 3SW6A 4GACA 5HMFA 3G6LA 2VZVA 2O56A 2ZUTA 2NUYA 2WCAA 5AECA 4F2BA 5I3KA 4FPSA 4O15A 4Q4QA 3LGDA 2F61A 2VGGA 1B4EA 1TX2A 1S5NA 1ENUA 3VKBA 3IS4A 1TB3A 3INPA 2DT1A 4CD6A 1LDCA 5H1WA 3QPEA 1BEUA 4B4FA 1VBHA 2DP3A 1SO5A 3R5EA 4DBDA 2JFEX 3GTIA 1EJRC 1XCWA 4DWDA 2EPNA 5BXSA 4FP1A 3BLLA 1QCWA 3V0UA 1UJQA 2CYGA 1VR6A 4OIFA 5HQLA 3TZFA 2JGYA 4W87A 1TMQA 1RQBA 3A4WA 1HKMA 4JPGA 3WD1A 2HDJA 1TG7A 1ONWA 2WC7A 5D2WA 3RCNA 4QSFA 2O92A 1HIZA 2CHNA 4Z08A 4L1GA 3NQVA 5GNZA 3EDEA 3EPMA 3EKLA 3W81A 4KGJA 2I16A 3LNMA 1F7BA 3IUDA 2VXNA 3GDMA 1GUVA 4KRTA 2FPYA 2GSHA 2G95A 2R24A 5JQ9A 3TFXA 3G24A 4LUTA 1FP8A 1FDZA 3I68A 1W9VA 3FA3A 5A1AA 5D9PA 1VFHA 1TJ1A 3PZUA 3NAVA 5FEZA 4LPCA 3W7CA 4AEOA 6TIMA 3DG3A 1I1WA 4GBUA 2Y61A 6TAAA 1POJA 4FZIA 1GYLA 1O7AA 3MUIA 1XIMA 4D71A 2CWXA 3CYJA 3W7RA 5I2UA 1FY6A 1VFUA 3QN3A 4GI9A 3PY2A 5ABTA 5JVLA 4Y9MA 5TQLA 7REQA 1OIFA 2P53A 4GCAA 3SN0A 4W8BA 4LEQA 2PBGA 3TYAA 3GXTA 2WZHA 4Y96A 3S6DA 3QMSA 3C8NA 1YXDA 3N6JA 1ZAHA 4PCPA 3W38A 4NAFA 2QDGA 1LLWA 3GO2A 1Q4NX 4OTKA 1K02A 3RM4A 1YXYA 2QAPA 4DYJA 2DT3A 3MO7A 4RE2A 4UFIA 3K4WA 1UC4A 1QVBA 2DU2A 3WLPA 1GOOA 1A3XA 1CEOA 3W74A 1V77A 3DCPA 4DJEC 3EDFA 1PUDA 1XIDA 3BLIA 4GY7A 4US6A 2ZC8A 4X63A 3IIVA 4AHQA 2D20A 1K4HA 3B0VC 3VNKA 1C8QA 1AJZA 4A2RA 2WM0A 4O4WA 2XUCA 3VIOA 1H1YA 1B3VA 3AHZA 2WLZA 4AF0B 3A3XA 4CCDA 3WMBA 4Z2JA 3EX1A 4Q8PA 1CZ1A 3WO8A 3VMOA 3M0JA 2P1FA 3PZMA 3SJ3A 1P7TA 1TWWA 4OZOA 1W1B1 3E96A 3T55A 3V7PA 1A5UA 3VGBA 4RK8A 3EDJA 5A6MA 3SI9A 1ZUAX 3O8AA 5HMSA 3VKDA 3STFA 2OU4A 3WQFA 4Q4KA 2J47A 2DIKA 4ZA0A 3IUHA 4U3AA 3O07A 2J7FA 5A8NA 4PMJA 4HZ6A 2DVTA 2E40A 4MJ2A 5KSWA 3AJ7A 4W5UA 4HCDA 2B7QA 2HPIA 3EMQA 4A3QA 1GG0A 2DW6A 1ZCOA 1I0BA 4Y9NA 3CLWA 4MNMA 3C6CA 3BW4A 4B9YA 3NPWA 3VDBA 4HPXA 4ZTXA 4KCTA 4XZWA 1BTMA 2CBVA 4LH8A 2Z28A 3UPMA 4B5VA 3QHMA 1VJZA 3W7EA 3HJZA 4CNPA 3MUXA 1HFBA 3SFKA 3P0WA 4R9OA 3M0YA 3FIGA 1Q45A 9XIMA 1ALDA 1PIGA 4UFMA 8TIMA 2R1LA 4CGTA 3WD3A 1S2CA 1PHWA 2QV4A 4V15A 1AH4A 2ZZ7A 3UG3A 2X30A 4DJFC 4U5IA 4MDOA 4BQ2A 2MNRA 3HG3A 2BB0A 1A4LA 3M5YA 1XXXA 2A2IA 5FOOA 3EX4A 4HB7A 4OFCA 1FP9A 3E0IA 3N29A 4JQ4A 2FGZA 1KXHA 1E6XM 4M3PA 3F1QA 3GSMA 1SFTA 1CXFA 1SU5A 2FGLA 4G5DA 3S6TA 5A6AA 1LOQA 1GQKA 4NF7A 3S5ZA 5E0FA 1O1HA 1Q8JA 1X8FA 5C5YA 4LC6A 3THUA 1TJPA 4QJ3B 1R2RA 2DZSA 1E51A 2QJIA 4HMEA 2VCAA 1JPMA 1FCUA 4JL2A 1ECEA 3NR0A 1MRAA 1PX8A 3ALFA 4OWGA 4DWSC 4OBRA 3KFTA 1REQB 7PTDA 1TJ2A 3SGZA 2RDWA 2V81A 4N6FA 4X22A 4AB4A 5BNKA 1ADDA 5AY7A 4Q33A 3O05A 4MPKA 1V6YA 2E3ZA 4GX9A 3CUXA 1BXNA 4H9TA 5GNYA 4LB3A 1TZ7A 4JBRA 3WK3A 3W29A 4I7WA 1A80A 2NQ9A 4R3UA 2QT3A 4PB3A 1Q6QA 4Q4RA 1AVAA 1EL3A 4HMNA 5AC5A 4NVTA 4YTQA 3N6HA 2DJXA 1GQIA 1XYBA 3GVRA 1OD8A 4RV8A 2XVNA 2WM1A 4GVIA 4XG1A 3KVMA 4K8EA 3G8RA 3G1YA 3KRUA 3U2ZA 4FS9A 3VTRA 4DAFA 2O7QA 4NYUA 4X2PA 4ERIA 1JZ7A 3PWAA 4GYKA 4LY8A 4NIRA 5G2IA 1ZHAA 3PAOA 1KGXA 4L9YA 1KO0A 1F76A 1KM1A 3WNNA 3AFBA 5MKGB 1QBAA 1VEOA 1X97A 1K77A 1WKYA 3O15A 1EC7A 3M4HA 1X7FA 3NFUA 2X0HA 2V30A 1GYNA 4A21A 4MWAB 2ZRZA 1L6SA 1OC7A 4D6FA 4Q8UA 1E0VA 3V36A 3CAVA 4NX5A 1B3YA 3VDAA 3UA3A 5AHMA 2ZDRA 3GNNA 2GLKA 2G4FA 1XCFA 4GY1A 4HJFA 4HT3A 2C71A 4IQDA 4C6MA 1J79A 4GGHA 2XSAA 1UD8A 5E9XA 3BJSA 4DJEA 1MYRA 4JNMA 2VEGA 4PTWA 3B8WA 2FZ9A 4DJFD 3CQJA 3TNOA 2DZBA 1U22A 4B15A 3GIQA 4TV6A 3OGRA 3NEHA 3C2OA 1KV5A 5L9FA 3GFYA 1PIFA 3LMYA 4BI5A 3WJZA 1FWAC 2F9RA 3BH4A 3PBMA 3OYXA 2C8NA 1XYLA 4XZIA 3CNYA 3CTTA 2Y85A 2P0IA 4HZ7A 1J0ZA 4JY8A 5KINA 3W1PA 4IFKB 1VLWA 5FF7A 4KESA 4UMAA 3G77A 3HPFA 4PH6A 4B91A 1UD5A 2GOUA 3ZYZA 3C2RA 1UR9A 2VNCA 4R33A 3VUPA 4JTKA 4L9ZA 1B9BA 2DH3A 3CV6A 1MMFA 1W1VA 5CEWA 1XIIA 3W1XA 2OJPA 1PKNA 2VC6A 4GIAA 2YCEA 3VU2A 4QLLA 1YLVA 5HUOA 4AY7A 1XUZA 3NQMA 2GDVA 3B04A 1VCFA 3ELFA 1WZMA 3CQ0A 2J9ZA 2PTZA 4C6IA 3V0SA 4XO6A 3F5JA 4HOZA 4LOCA 5C9ZA 3OO2A 2ZRXA 5LGZA 1R9XA 1FXPA 4O14A 1W17A 1UYQA 2HJPA 4HK7A 3PPHA 5AKQA 1UKQA 2YDAA 1CGWA 3PBUA 3FK4A 3B4YA 2NX1A 4IXXA 1L8PA 3P82A 4JY9A 2NQLA 1OG6A 3UNDA 1CXHA 2XU2A 1BRLB 3AO0A 1DJGA 1YADA 5FF2A 3VDCA 1R86A 1ONXA 3WK0A 4YHGA 4DJFA 2WANA 1PB0A 1SFSA 4LANA 5F4SA 3TN6A 4QE1A 4CCZA 3AI0A 7XIMA 4P7RA 3SN1A 4YTTA 1TIWA 3WLTA 1LOSA 3L0GA 3U9IA 4IIFA 3ZSSA 3TC3A 1TQXA 2CBUA 5I5RA 4RKAA 4MB3A 2Z27A 4NG3A 3WQ5A 1HG3A 4J3TA 2X09A 1X7IA 1JDDA 3B8IA 4ROQA 5DF0A 2PGFA 5JBFA 3GYCA 3P2VA 3CZEA 4W88A 1K6AA 1IQ8A 4NZ1A 5E93A 3F2CA 3HZ3A 3H2NA 1A5AA 4AIBA 1X98A 1XKYA 1WX0A 2OSXA 4ICNA 3M9YA 4V27A 4HKPA 4NZ3A 2TYSA 3WBYA 3AXHA 3W1NA 4W7WA 1HJWA 4JTIA 4ZO7A 4DWSA 2BOFX 1KA9F 5I0DA 5FEXA 1TKKA 4N0RA 1WPCA 3LXCA 4LYRA 4OECA 2NW0A 4LEFA 2Z1KA 2BSLA 3M0LA 8A3HA 3WBAA 1V6VA 1QWKA 4H8HA 4BF7A 4TVCA 3N9KA 1RVGA 2X0SA 5A8QA 4FNSA 4O1DA 2ZVRA 2VDGA 4D6IA 3OHMB 1JEZA 2VENA 3K1GA 4AD0A 4LRSA 4B9ZA 5AVHA 1OQFA 4GYPC 3EB2A 3QBUA 4KWVA 5CZTA 3EKZA 4I90A 3LM3A 3GHUA 2J62A 2Y1HA 2WQPA 3DHPA 1ZP4A 5A6BD 3OP2A 4JTDA 1O5RA 2J78A 1PYMA 4QXIA 1MQPA 3LD5A 4LUIA 4G7EA 2ZTKA 2IS7A 1FBAA 4W7UA 4XIAA 3WNLA 3WK2A 4U10A 4RZ4A 4Q6XA 1QU4A 4XK2A 3JS3A 3CV2A 2DFAA 3CXOA 4WKAA 3VD3A 1RD5A 3ZSTA 1NFGA 1CW2A 3U7VA 2H9AB 3M43A 4D6CA 4CQ8A 3ARUA 2G4JA 3QJAA 4IIBA 3YPIA 4M8UA 4FSAA 4RNJA 1WDRA 4FNPA 4XUGA 3PP7A 3MKKA 1X6UA 1CDGA 3LCIA 1SQ7A 5D09A 3RCMA 4F0KA 1GKQA 4JFWA 1D3GA 4LJ3A 3VMPA 3NCOA 4LQ1A 5JU6A 2X42A 1NEYA 4HHLA 2E9LA 5CPQA 3CHFA 5AHIA 4DNHA 3WD0A 1YYAA 3H12A 3W72A 3W82A 4WJXA 1OM0A 1G67A 3OBAA 3KLLA 4PUJA 1Q6FA 3RO8A 1EGMA 3HPZA 1MFVA 1OCNA 4NI3A 2NXIA 2WVVB 3CT7A 3MWAA 4JKMA 1XCXA 5A6BA 1ZBWA 4LAMA 2D2JA 3WH5A 1UBSA 3DYPA 2J77A 3UR8A 4MUZA 2Z1XA 3H2EA 4WF7A 1FXQA 3J7HA 1J18A 5FESA 1VZWA 3NQDA 2VZOA 2IPFA 4O17A 5DELA 3WFZA 2DZXA 2DIJA 4ATWA 3AIVA 3TOYA 1HP4A 2XVLA 1R47A 3CM4A 3D3AA 2R8WA 2INZA 1QW9A 4AG0A 3QYSA 3QOMA 4A4AA 4FLRA 3T0CA 3FY1A 1QPQA 3BGAA 3EWCA 3Q65A 2YA1A 3S9IA 1V0LA 4G1NA 4I5XA 3SADA 2EPKX 4QFUA 3EEGA 1MWOA 1W0MA 2Y7FA 5KETA 3C2VA 4J3VA 2HK0A 3PTKA 3OLIA 5REQB 4H83A 4O50A 2NSOA 3WY1A 5CZJA 5I09A 2C19A 3VOIA 3AJXA 5CLTA 1OX6A 4XZBA 1ITQA 1FHDA 4S23A 8RUCA 1HN1A 1LWHA 4LV4A 3M7SA 4F4RA 2WAGA 2ZE0A 1RLCL 2Y89A 3WDHA 7ODCA 1S5WA 2Q8ZA 3D3FA 3QH2A 4Q8TA 4E8GA 4J2PA 3SCNA 2CLEA 5E09A 4H7CA 1EP1A 4K1GA 3O6YX 4E6MA 3M07A 4KFPA 1NP0A 1WB0A 4YTUA 1QJWA 5LNUA 2X0YA 3KRBA 1CX9A 1GW9A 4HA3A 1PWLA 1XRTA 3OYZA 4FNQA 3C2EA 4WY0A 5HR7A 4PL2A 3MI2A 4KMQA 3GNPA 5C71A 3MP4A 2BHUA 6ALDA 2HMCA 5KZEA 3RITA 3FYPA 3MDWA 4ZOAA 2W91A 3URNA 2CLOA 1XR2A 2HVOA 1W9DM 4HMCA 5LA1A 2X2YA 3H24A 5FJOA 2BXZA 1EJXC 3PZVA 5K9XA 5HWNA 1DEDA 3BLEA