3F7JA

B.subtilis yvgn
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
276
structure length
276
Chain Sequence
MPTSLKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDERVGPNPDELLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords YvgN protein
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 107
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.1.1.283: Methylglyoxal reductase (NADPH).
pdb deposition date 2008-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3f7jA00
3M4HA 3DOPA 4EXAA 2IQDA 3O3RA 3UWEA 1PZ1A 2HVOA 3UP8A 3V0UA 4L1XA 4DBWA 1AFSA 2PD5A 4DZ5A 1GVEA 3V0TA 2PF8A 1M9HA 1Z89A 3V35A 3FJNA 4WEVX 3CAQA 1Z3NA 3CMFA 4JIIX 4YU1A 3UFYA 2HV5A 2HE8A 2FZ9A 3UG8A 3EAUA 1YNPA 1A80A 4FZIA 3UZWA 4ICCX 4PRTA 3V36A 3GHTA 2ALRA 3ERPA 2FZ8A 1MRQA 2PDCA 2PDBA 4JTAA 1MI3A 3GUGA 3N2TA 4JQ3A 2IPFA 3U2CA 3WBYA 2IS7A 4F40A 1Z9AA 3GHSA 2BGSA 4JQAA 4PR4A 2IKIA 1Q5MA 2PDQA 4G5DA 2A79A 3LD5A 1XJBA 1MZRA 3VXGA 2VDGA 4DBUA 2NVCA 1ZQ5A 3LQGA 4JTRA 1PWLA 3R43A 3MB9A 2C91A 4XVDA 5LIWX 3CV6A 4H7CA 4YVPA 4JTQA 4R9OA 4XZMX 2ACSA 2FZDA 3S3GA 1OG6A 3H7UA 3R58A 3LBOA 2WZMA 1X96A 2ACQA 2PDXA 3UGRA 3LQLA 5DANA 2FGBA 5JH2A 1Z8AA 2IPWA 1YNQA 2IKGA 4WDUA 1RY8A 2HEJA 1EL3A 3V0SA 2IKJA 2DV0A 2PDYA 4MHBA 2PDWA 4Q3MA 3H7RA 4HBKA 4GACA 5AZ0A 3WBXA 3RX3A 2PFHA 3ONCA 2PDFA 2PDMA 4FA3A 2NVDA 4JIRA 1S1PA 2INEA 4LAUA 4NKCA 3LNMA 5HNUA 4LBSA 1QRQA 4PUUA 4GQ0A 2PDJA 1Q13A 2INZA 2ISFA 1VBJA 4IGSA 4JQ4A 3Q65A 2ACRA 3EB4A 4OTKA 3ONBA 1EXBA 1YE4A 3UZZA 2PZNA 4I5XA 3BUVA 2BGQA 2I17A 1PYFA 4XZNX 3BCJA 4AUBA 3CAVA 1LWIA 1XF0A 1J96A 1X97A 5LIXX 5M2FX 3FX4A 3MC5A 3CASA 2FZBA 4IJRA 1JEZA 3LZ5A 4GABA 5HA7A 4YVVA 4L1WA 4QXIA 2PDPA 1AH3A 3LENA 1HQTA 3LEPA 1AH4A 2HE5A 1EKOA 4PUWA 1T40A 3RX2A 4QX4A 1X98A 2DUZA 2ACUA 2IQ0A 3D3FA 2PDLA 2PDUA 3WG6A 2FVLA 3O0KA 4ZFCA 4HMNA 4GIEA 2BP1A 2CLPA 4Q7BA 2QXWA 1XGDA 3CV7A 4XZLX 4GA8A 1RALA 1ZGDA 2PDGA 1K8CA 1EF3A 1FRBA 1S1RA 4YVXA 3UZYA 1ADSA 1SM9A 1T41A 3F7JA 2HDJA 3NTYA 4LB4A 4QBXA 3BV7A 4LAZA 1YE6A 4PMJA 4WDWA 3LUTA 1PWMA 1US0A 1ZSXA 3M0IA 4GCAA 3B3DA 3WBWA 3UZXA 1R38A 1HW6A 3G5EA 2P5NA 4WGHA 3GHRA 4XAPA 4XO7A 2R9RA 2HVNA 1AZ2A 1UR3M 4XO6A 1VP5A 2AGTA 4XVEA 4XK2A 3P2VA 4FAMA 3R8GA 3M64A 3R7MA 3T42A 3LN3A 1S2CA 4FALA 3DN5A 4H8NA 4YS1A 4EXBA 2I16A 2IKHA 2PDNA 3R8HA 2IPJA 2PD9A 3H4GA 4JIHA 2DUXA 4QR6A 4DBSA 3UYIA 2F38A 4RPQA 1C9WA 1IEIA 2PDKA 1AH0A 4JQ1A 2WZTA 5HNTA 2F2KA 5JH1A 1IHIA 2R24A 3EB3A 2J8TA 3KRBA 4XZIA 5LIUX 4LBRA 3WCZA 3LZ3A 4GQGA 3Q67A 1ZUAX 4IJCA 4WDTA 4XZHA 4JTDA 5KETA 2PDHA 4PRRA 3G1RA 5C7HA 2PEVA 4LB3A 3BURA 4WDXA 3N6QA 4JQ2A 3C3UA 4ASTA 3GHUA 1PZ0A 3COTA 2IPGA 3QKZA 3R6IA 1LQAA 4JTCA 5LIKX 3R94A 3RX4A 1QWKA 2PDIA 5AZ1A 5LIYX 1S2AA 4WRHA 1AZ1A 1RY0A
chains in the Genus database with same CATH superfamily
4LC8A 1EFZA 1F2JA 4BWLC 3RLHA 2HVOA 2WLZA 2PPGA 3QH2A 1NAL1 4DY1A 4OU1A 3M43A 4P5UA 1A5UA 2NX1A 1KRBC 2PF8A 3H2NA 1RVGA 4PCTA 4RNJA 4XD6A 5A6TC 6ENLA 4FNQA 1TPC1 1O60A 3VD7A 3KDOA 4F66A 3ATYA 4IFKA 1W54A 2CWXA 2YFNA 5EMYA 1BG4A 4LT9A 3EAUA 3QFEA 4HHHA 1UG6A 3GK0A 3LCXA 3RPTA 2ZWZA 3GHTA 2VWSA 4Y90A 1WUEA 1DIKA 2VX7A 2WB5A 5FL0A 1CW2A 1O12A 3WNKA 4GH1A 1VJIA 2XHYA 4RW5A 1G4EA 5I3FA 1RJQA 5TF0A 3OOQA 3SFKA 1XYZA 3TJLA 1Q45A 1SSDA 1F5ZA 2CLKA 3VKBA 4H9UA 1X6UA 2PDQA 3PJWA 3GSMA 3SGGA 1KKRA 3V7PA 4M1BA 3L0GA 3KRSA 1DQUA 3QY6A 2PWDA 3GG1A 3A5FA 4YTQA 1UKOA 4B5WA 3BSMA 2D23A 4NIRA 4H4IA 2IUZA 5K3VA 3UA3A 4HMDA 4LEFA 3GDLA 2Q3OA 3H7UA 4OUIA 3NDZA 5HAOA 4XAZA 1X96A 4HHPA 2GSJA 4WY0B 5A69A 9XIAA 2X2YA 2R6OA 1SVDA 4F3HA 4P7QA 3CB8A 2QUMA 2HEJA 2Z6JA 4AY8A 4M6PA 4QG9A 2ESCA 3PZGA 4KERA 4O0ZA 2ZRWA 4WY0F 5J5RA 4EACA 3BOFA 4YTRA 1LJYA 3THQA 4UCGA 3C2RA 3NUKA 2HXUA 3BZJA 4LJ3A 3R79A 3G8EA 1V6XA 4K6AA 1UMLA 4CUCA 1J9YA 2V2CA 4FNRA 3P61A 1X7FA 3GYCA 1E4NA 2R8WA 4FA3A 2P1FA 4LRTA 5F2IA 3WENA 3WK0A 1A5OC 1E40A 1LG2A 4DI8A 2YL5A 1R9ZA 2RHGA 2P50A 2DGAA 4LH8A 4AHQA 1EZWA 4OTKA 2CETA 1OIMA 2CZ5A 1A53A 3N25A 4AQLA 4ZOBA 1KGWA 2IXUA 4B90A 5BYWA 2XZ9A 3HG4A 1TA3B 2XU2A 2YPIA 1PYFA 4B15A 1MEIA 1UUQA 3UG4A 2C13A 2GGIA 1VEMA 4IIGA 2XFYA 4GWEA 4K8HA 5I09A 1H0IA 1XINA 2Z29A 4PMVA 3W1NA 2NVAA 3RF9A 1E1EA 1GOIA 1L6WA 3QV8A 3QJAA 3LBCA 3DU0A 4GABA 5CSRA 4G7EB 3WSUA 2NWRA 3A23A 4B16A 1JAEA 2AQWA 1PS9A 5J5DA 3IJIA 4UTMA 4OIFA 1XDJA 1OFAA 1LROA 3P0XA 4IP5A 4RDYA 4CEXC 1SO3A 1O5XA 5JBDA 1G4PA 1ML1A 1J0JA 3M0HA 5FF0A 1WB0A 5A2AA 1Q85A 1TV2A 4CNNA 4KETA 1W8SA 2X1RA 2ZC1A 3BW2A 2DU2A 3QV7A 5G4EA 1SO6A 1E6RA 4LWWA 1YQ2A 3C61A 1H7WA 1LF1A 2GJRA 1OFPA 3I4EA 1JYXA 3QR1A 1XLIA 4EX4A 1TWIA 4K1WA 2PODA 4P7OA 3P5YA 1UIPA 4GCAA 1MW0A 3TC6A 3OZOA 2Z2AA 3WBWA 3VIMA 4RNIA 3PZQA 4WZHA 2CZFA 3TH6A 4UQ9A 2WMFA 2QDHA 2J25A 1OFQA 1IZKA 1DIDA 3WNLA 4IPJA 4MJZA 4MYXA 4FAMA 1VBGA 3R8GA 1K03A 3LHWA 4CU6A 4MMWA 1ZAJA 1CPUA 2PD9A 5FJUA 4QSHA 5CXPA 3U3HA 2ABBA 3NOEA 3LTYA 2FJUB 4Q8NA 2F38A 1KBIA 4FXSA 1O94A 1C7TA 4LUTB 3W27A 4HN8A 4C6JA 2EPLX 4DI9A 1XD0A 5M1TA 2R24A 4JTUA 5LIUX 4HSNA 3MSDA 3KL0A 2W91A 3RMEA 3S5YA 3TYUA 5DY2A 2TAAA 1E1CA 4W7VA 1PDYA 4LUIA 3DH7A 3UR7A 3NSMA 4OUEA 1JJKA 5D05A 2ZTJA 4RKAA 2Z1WA 3G1RA 1J11A 1ZJAA 1AL8A 4LB3A 1CGVA 4TIMA 4GK8A 1W5NA 1EQPA 1BWVA 3F5JA 3AFBA 3M5XA 5LIKX 3E5BA 1HL8A 3TOPA 3WJZA 4ZQOA 1T0OA 1P48A 3IEBA 4LUYA 1HXJA 4JTTA 1H41A 1EJXC 1TIMA 2ISWA 1HFBA 1N82A 3WQGA 3CQIA 2YL6A 2QVNA 4P2VA 2DVXA 2VL4A 3PZIA 4Y9AA 4XD4A 2WMGA 3V0UA 4IF2A 4JX4A 4DJED 1E43A 1PPIA 3FCPA 2GL5A 5DELA 3EXSA 2FZMA 1T5AA 1XIHA 1UZ4A 3AQUA 4I3GA 1JZ5A 3F4CA 3ZIZA 2E3ZA 4UTHA 2OO6A 2RFGA 1TSIA 3PG9A 2C6QA 2Q8XA 4BR1A 4YTSA 4ROQA 2ICSA 1U33A 1JYVA 3UG8A 2AQVA 2HPIA 3TTSA 3BW4A 2IXVA 3SAZA 3A6OA 2ZDSA 5EBUA 1GOQA 1TO3A 4B3ZA 3EXRA 3LHTA 1CXLA 3XISA 3VFCA 1HGWA 1XYBA 1NU5A 3GY1A 3B97A 4C5YA 3PULA 4RCXA 3B0YA 3KBNA 2OWXA 3WK1A 3LCGA 5GQBA 3GKFA 4F40A 3GVQA 4GD0A 2V67A 1Y5VA 1J6PA 3EMCA 5C9ZA 1LORA 1LP6A 3TQKA 1OIFA 2WCAA 4XBJA 4HHLA 3LD5A 2A6NA 3VNYA 1VD6A 4GNJA 4AMCA 3FLUA 5BRQA 4CNSA 4GHRA 1J79A 3UW6A 2ZADA 5FACA 4LV9A 1LBMA 5CJ5A 5FIPA 3S1XA 4UTLA 4IJBA 1DXFA 5HMEA 2BVYA 4R9OA 4F48A 2HZGA 3PJXA 4QE1A 3S2CA 1GVQA 4CU8A 2EJ1A 1D8WA 3GVVA 5HMDA 3W76A 1NM9A 1POJA 4JL2A 3EX4A 1XYLA 4US5A 2H3DA 2DP3A 2FGBA 1D3GA 1S5NA 4ZO6A 2OCZA 5J04A 3NYZA 2HVMA 3SQSA 2V5LA 3UWYA 2BLEA 1L2UA 3LRKA 3AWOA 3ZLGA 3NQMA 3U0HA 3LHZA 3POCA 3EOOA 3B8VA 1TZ9A 3S9ZA 1FWNA 1YEYA 2PCEA 4PN2A 1WXZA 3N9KA 2PDWA 5T8GA 2MANA 2Y70A 2BODX 3H7RA 6PTDA 3ENLA 4PBFA 3W7OA 1C92A 4LOCA 3VTRA 5E0CA 1YADA 3RX3A 1BGGA 2WSPA 4DM1A 4Y8FA 3O2LA 3EEZA 3IJ6A 3OHMB 4LBSA 1QRQA 1MW2A 1D9EA 2EAWA 4XAYA 3L66A 4QE4A 3MMDA 3T81A 1VBJA 4IGSA 2OJPA 2HJPA 3BLEA 3M0KA 3SRFA 4DUOA 3RM4A 2PA6A 3TCEA 1WCGA 3AS0A 4PUKA 1GTHA 4O53A 5HJLA 4RLIA 1GPWA 1TELA 1ICQA 3SQLA 4HHMA 2OX4A 5DT7A 4KGJA 3UXDA 1QNVA 3K46A 5G1MA 5EKYA 3WLHA 3PUEA 3BCJA 4BZYA 3CAVA 1KGXA 2WNZA 1TTJA 3GYEA 2VENA 3SCQA 1ME8A 1J4EA 1IXQA 4GYPC 4PMQA 1XFCA 3Q4DA 8CGTA 4FR1A 2NSXA 4NJJA 2Q09A 3W83A 4MJMA 2J7EA 1R3SA 5A6BD 2NLIA 1ONWA 3KS5A 4GZIA 1N8WA 9XIMA 3ZO9A 4CQ8A 1FKWA 1FA2A 4D71A 2BY0A 2PS2A 1P0DA 5E09A 2DUZA 3GU2A 3GH5A 1UWQA 2YSWA 2OSYA 4DO7A 4KH2A 2AL2A 4UTFA 2QHAA 2OFJA 5A1AA 1KFWA 3B8SA 4FIRA 3RITA 3T9PA 4WSJA 2PGRA 4ECLA 4CEUC 4IP7A 1JDAA 2OMAA 4A3HA 3QGVA 2PWFA 2ZC8A 4FOUA 3OA5A 1A3XA 3OGVA 3OO2A 1ELSA 1WNOA 3PB2A 1UC4A 3TV8A 1ADSA 3FOKA 3TA9A 4IX2A 2EPKX 1SM9A 3LI1A 2OYKA 5GNZA 2A1YA 5CC3A 1XDLA 1W9DM 2QPUA 2B7NA 2F8QA 3HOJA 4M6UA 4C1NB 4PMYA 2PP1A 1J5TA 1VFMA 1U5JA 4C6DA 4QNWA 3NQGA 3SUVA 3ANVA 1M04A 4KWVA 2OO0A 1NWRA 2WSYA 4GUIA 3S6TA 3SBFA 4QHRA 3L5LA 3V1HA 3OQEA 2PC8A 3U9IA 1TR9A 3UJ2A 1E9YB 1F74A 4QITA 4GVHA 3WYZA 2PAJA 4FLQA 4BFAA 4Q7IA 5U7SA 4HKPA 3E02A 3T0CA 1JNEA 4N9BA 1PL9A 1XCWA 1I0DA 4HA0A 3P2VA 3VILA 4W7WA 1QI2A 3UETA 3T40A 2BHYA 1H49A 3FK4A 5BU6A 1HVQA 1W32A 2IPJA 1XW8A 1DEDA 1FDJA 3GTIA 1QHPA 3U48A 4OJYA 1HJQA 3LX9A 2YOCA 1TWWA 3W2NA 1C9WA 3W53A 1XX1A 3KVJA 1PHWA 4ZQPA 2OX1A 3WLKX 1VCFA 2XUCA 1JYWA 3T44A 3GDBA 4HPNA 4FK9A 4YCOA 3GU9A 1QNOA 3W86A 5FEWA 3U4FA 2Z1SA 4GINA 3GAKA 1A5MC 3EWWA 3J7HA 4V2XA 1CI1A 4MFDA 4KWSA 3RLVA 4JTDA 4DELA 1H63A 3R4IA 3VVGA 5A8QA 3EWBX 4GZEA 3G77A 4XQ6A 1UC5A 2YXOA 4JFTA 1CXEA 1R87A 1PAMA 2E09A 2ZZ1A 1GONA 1U30A 5C2XA 7XIMA 4KFNA 4XIAA 1BGAA 1Z32X 1KO0A 3PR2A 3WELA 3S9IA 2VEIA 4GXWA 1HTIA 5I3GA 2QJIA 4ZOAA 1RY0A 2CEQA 2E67A 5HMSA 2RAGA 1JVNA 2JIEA 3WD3A 4ZGYA 1QFEA 1Q65A 4LRSA 1W6TA 1LL6A 1FCVA 2NUWA 4AHPA 3HG3A 3SCRA 4G2DA 2CU0A 3CWNA 3MO7A 5CPNA 1Q66A 1M9HA 5CC5A 2FMNA 5H8UA 3OQ8A 5FF4A 4N9CA 1FP9A 4IOTA 2VC5A 2ZYFA 3CWOX 3MPGA 1YNPA 3HURA 1EQCA 2C8NA 4N02A 3OG2A 3VD9A 4P8VA 4HNNA 3UXLA 3V36A 2CLMA 5FAGA 3B06A 4I5UA 1FH9A 4JKKA 1Q4WA 3TW7A 4FNPA 2YBVA 1NOFA 3WBYA 2IS7A 1GYLA 3VM7A 1G0CA 1MEHA 7REQA 3VOJA 3SADA 4S3CA 4JQAA 3ARVA 3DIPA 2WHJA 1FWBC 1GEQA 2ZIDA 1YLVA 2D3LA 2ZXQA 4G5DA 3IJ8A 1LL4A 1H61A 1TV3A 1QNQA 3UPMA 2AGKA 3AYRA 3U4AA 1TZ7A 1ISYA 3ZLFA 4ZZ9A 3SN0A 2JIWA 4H01A 4EE9A 4GO9A 3HPAA 4IPIA 1DBTA 1OX4A 2Q3RA 4LC6A 3BO9A 5D30A 3WJSA 4QGCA 3TYDA 3NGJA 2WZMA 5FJPA 1PIFA 1RPXA 3RCNA 4TTUA 4MZ1A 1KFEA 3O05A 4CCZA 4R27A 2ZX5A 3MUCA 1M41A 4HNCA 1TPEA 3QPYA 5D9MA 3N11A 3W82A 2WMIA 3CO4A 1I0BA 2A3EA 4UFLA 4PH6A 1IT0A 2NQ9A 5E6ZA 5AYYA 1W3JA 3WQCA 3ONCA 3PZOA 4KIEA 1FCQA 4LS2A 3A3XA 4QEEA 3WDHA 4AVOA 1KTNA 4YN5A 3CIWA 3LMZA 3P6LA 1W1TA 2D20A 4UFMA 1PKMA 3K4WA 1TZZA 4DIAA 2V30A 3OA3A 3S42A 2PWUA 2POTA 2DPEA 4EF9A 1XDMA 4C90A 4J9JA 5F4SA 2BGQA 1OVDA 3ZR6A 1V51A 2ZZ4A 4XZNX 3B0PA 1LWIA 5I00A 5E6YA 3S2JA 1LZOA 4PC8A 2BXYA 4LNCA 1UWAA 2F6UA 4UQDA 1OD0A 3CASA 3GG8A 5G4WA 5DEZA 1Q6FA 1TPWA 4EK7A 4JOMA 2VELA 1EOMA 5HDRA 3EXTA 1RCQA 2WHMA 1VEOA 3HB9A 5FL1A 1UBPC 2PDPA 4AZCA 2YBTA 4ILSA 3LEPA 1EKOA 2Y1HA 2X0YA 3REQB 5FJJA 2CZVA 1XGEA 5AC4A 4GUHA 5HXMA 3BCDA 4R7JA 1DTNA 1UD4A 1I75A 2DW6A 3T0AA 4W8LA 3PAOA 2CYGA 1K7XA 1JCTA 4Y9PA 1ADOA 5KZ6A 4WGXA 2NQLA 3D3FA 2WAGA 1I8JA 4M82A 3CHVA 5TNVA 5L9FA 4TVDA 5BMWA 4YMZA 4WUIA 1WQ5A 2C71A 3MYPA 3MCOA 2WNNA 1XGDA 3CV7A 4S3GA 1XIIA 2XSXA 4QAIA 4K36A 4UNLA 3PJTA 1JDFA 2VZOA 1V0MA 1JIBA 3TTYA 3DGRA 3GQYA 2XN2A 3SB0A 3KBVA 3W7HA 1I2QA 1ME7A 5BNKA 2VD8A 4KCWA 4TV6A 4PCSA 1FWFC 3EWYA 3E2SA 3IVUA 3W7NA 3KHDA 2PB1A 1HN1A 3BAWA 3UNTA 4UTUA 4ZQMA 4I9TA 2ZZ3A 1KXVA 1WPCA 3S2LA 2VEGA 1EBHA 2GWGA 2VZSA 2FPTA 2E4TA 4K7VA 4XAPA 3FW6A 1M1BA 5RUBA 3AUJA 3E0FA 4JHOA 3VM5A 4Z2GA 1M5WA 1TFVA 3MDWA 3UWUA 1E0WA 1DXIA 4JGDA 3QBUA 4BHYA 2X1IA 2FIQA 3DN5A 2JF6A 3ZLHA 4UMAA 2DUAA 4JCLA 1UKSA 4EXBA 4NZ1A 1TX0A 3NQDA 4K3ZA 1KFKA 4G1KA 1PTAA 3GNRA 4HCHA 1REQB 2DUXA 4U28A 4H2CA 2H8ZA 1I45A 5M3WA 1IR2A 2VVNA 3QV6A 3DENA 4IICA 1S3HA 4M6QA 1F7BA 4JQ1A 5JH1A 2C19A 1R3QA 4LF2A 5CLTA 2YLLA 3AOFA 1JDDA 2WSRA 1AK5A 2G37A 1H3GA 4ZE4A 3CT2A 1LDCA 1CENA 3Q37A 4HNOA 2AKMA 4QLJA 5DY3A 4PB4A 5LNWA 1MQPA 2Y5JA 2GZXA 4FXJA 1T7LA 3KOZA 4A21A 4ML9A 4C6IA 3QKZA 1LQAA 2WANA 3R94A 3R1ZA 1M7PA 3WLRA 5FF7A 2Y62A 4C6BA 4MDPA 1SSGA 1XUZA 1UJQA 1QPNA 2Z2UA 1O95A 3HJEA 5FJIA 2V68A 4F79A 4G56A 2IQDA 3M16A 1TB3A 4W5UA 4TMCA 4MWAA 4RK8A 2HS6A 2DSZA 3UJFA 2WCSA 4DZ5A 1RA5A 3N3TA 2PRMA 2OVLA 3ITYA 1HJXA 4Q7NA 2O7QA 1UR1A 3DGBA 4F9DA 5D09A 3TEVA 4JIIX 3LCFA 4PUNA 1Q4NX 4O8RA 1RBOB 1YDNA 3NURA 4UB9A 1AODA 4GNKB 4PSPA 1F3EA 4LTSA 3DFNA 4U2YA 2QJMA 4PRWA 2VFDA 1W9BM 4HZ6A 3STGA 3GZ3A 4M3PA 4O57A 1FCUA 1H5VA 4O28A 3OU8A 4JTAA 2Z1VA 1KWKA 4A8RA 3EDJA 2VFIA 4WXZA 1O5QA 3A3WA 3LPOA 3NQ2A 5IHSA 3CC1A 2BBFA 5ABTA 4R85A 3MQTA 3CEPA 3VGFA 1OCBA 1DP0A 2FQIA 1Q5MA 2ZX9A 3TSMA 3NO3A 4I7UA 1TPDA 3CQHA 1GEHA 1FY6A 2ZXBA 2G41A 4BA0A 3LERA 2BS9A 3G1XA 4RE0A 2QQ6A 3HPXA 2C91A 3SO7A 1R3RA 4KEUA 3H22A 4IMDA 1NARA 4XZMX 2UY5A 1WDSA 4L6HA 2WXDM 3IJLA 3C3NA 1F4AA 3VIKA 3D3AA 4NQ1A 1KM1A 4NNAA 1YX1A 3MWCA 1J93A 3W7DA 3C2YA 3TZFA 5D2XA 1KD0A 2PLKA 3UF9A 3EWDA 4C1LA 4IPPA 3DYOA 2C18A 2VR2A 3RPDA 2UWFA 4UWMA 3V0SA 2QZRA 4DN1A 5AYBA 5DO8A 4HOXA 4AD5A 1J2BA 1FQ0A 4M7TA 2XTKA 1OY0A 5DN1A 1JQVA 1LBLA 2XSBA 5I77A 2HPMA 2POZA 4XB3A 3B9EA 4L4LA 3FJLA 2OU4A 1AMYA 5A6JA 1UR2A 1S1PA 2I57A 5EFDA 4DZHA 2WZEA 4AD0A 4DZAA 4CN1A 1PKLA 4W8AA 4H1ZA 3P8JA 1DJGA 1P7TA 2J8GA 7TIMA 3T7VA 1QI5A 1Z41A 5EMLA 1A5CA 2DIKA 1TE1A 4RXGA 4ADUA 4AF0B 1W9VA 3TYEA 2FGLA 4CD6A 4KCTA 4DJFD 1ME9A 1X1OA 3OLDA 5DMYA 1UH4A 1VLWA 4C6QA 4EPBC 2VZUA 1EJSC 3EDEA 4V1YA 4H9TA 4WJ8A 4X0NA 5G2HA 4HU0A 5H8MA 2FZBA 1JCXA 5CKSA 3S1UA 2ZDRA 3ZT5A 3VYLA 3DECA 4CNPA 3CPUA 1TE6A 3KFTA 3AIRA 2FFCA 4AX7A 3LHVA 3WNPA 3ITTA 2FJKA 2JQXA 2J4GA 1T8XA 5EMKA 2VJXA 2CCRA 1B9BA 4V27A 1OFDA 1E4IA 3K8KA 4GQRA 2FTPA 1C9DA 4JY8A 2QUVA 3GIPA 3VD4A 2OT0A 2FVLA 4F4RA 5GVJA 3CIXA 3IIZA 3FV9A 3ITLA 1V4YA 2ASHA 3TFXA 1E6ZA 3LXCA 1U5HA 1ZJIA 4HJWA 1M7JA 3IARA 1VIZA 3L9CA 2FPYA 1KR0A 3HQ1A 3BLFA 1K8CA 4W93A 2ZUTA 1EF3A 4GXPA 3GG0A 1WZMA 4XAFA 3RUBL 2OB3A 4AIBA 3F7JA 4TXEA 3NTYA 1LRQA 4ZVJA 1ZL1A 2YYTA 4XTDA 1CXFA 1Z7AA 2XIIA 1WBHA 3DHDA 1KQZA 3SSJA 1BSIA 2PWHA 3MT1A 1W1PA 3HV9A 4KFPA 1UKPA 2PF0A 2XFFA 1TTQA 4ZFMA 3CUXA 2Z1XA 1OABA 1BFNA 2OQLA 2RH9A 3LHYA 1MFUA 1K4HA 4GFSA 4F8XA 1CCWB 4U5IA 3CUJA 2XISA 3B8TA 4L80A 4UCFA 3UPWA 1K70A 3F4VA 3ZSTA 1XLCA 2P0IA 2J9YA 1JUKA 3GXNA 1W5OA 1XLEA 2HISA 1DJXA 4F0RA 4N0RA 5I78A 3R8HA 3VNKA 2YDQA 3HPSA 1S39A 3ZWTA 3IAQA 3KTSA 1AJ0A 3FN9A 5A5WA 5XIMA 1OFRA 4EOUA 2A7NA 1W3TA 2F2KA 3B03A 1LLZA 2V5BA 1ZY9A 4XKYA 5CQ1A 3AMDA 4GRSA 1X8FA 3NR0A 1VFUA 3Q67A 3JU2A 3W01A 1CGWA 4YWIA 3KZSA 1PB0A 3GS6A 4WDTA 4FB7A 2GQ9A 3F5KA 2NXIA 3CEUA 4PRRA 3VNLA 5IM51 2VZTA 4Q8WA 1UB3A 1MUMA 3F4WA 2EKCA 4S3BA 2Z25A 1J18A 2QULA 1IYXA 3N6QA 3USZA 1OGSA 4ZENA 3GVWA 3R6IA 4AZ5A 2ZZ5A 3OPSA 3OZPA 4TX6A 5D2YA 4QJ4B 3NQ6A 4X60A 3UT0A 4P7RA 5FCZA 4ZO7A 3FS2A 4WRHA 4B92A 4IP4A 3NEVA 1C90A 1NFPA 1K9FA 6TIMA 1Y8BA 3UP8A 5BRPA 4KQNA 2BOFX 2EEXA 4GYKA 5HOSA 1PV8A 3CAKA 4N42A 4I9AA 2PD5A 3K1DA 3QMTA 1GWJA 1KFLA 1XLAA 4MY9A 4WEVX 3H6OA 1Z3NA 4YU1A 5AYXA 3TC3A 1VRXA 2YDAA 2QR6A 3G3MA 3WBAA 3V5CA 5GNXA 3N6JA 5T91A 4JDBA 3GAYA 4YPJA 3ES7A 2V5JA 1FXPA 5IFTA 2PRLA 2V9DA 2QJHA 3TX9A 4CQAA 3FAWA 2QKFA 3LBMA 2IW0A 1H7OA 4K39A 1XBZA 2ZRVA 3W7KA 5DXYA 2P76A 2ON3A 3RPMA 3B9OA 3IUIA 5DBUA 3AICA 1WOAA 5H6HA 4Q4PA 4NI8A 2W6RA 3C0JA 1S2VA 5HWJA 3KRUA 1RCXB 4L6OA 1VPXA 3K2GA 3LYEA 4DWSA 1F6YA 1KGUA 3EGJA 3DFQA 3U5YA 2KAUC 4GY0A 3W7GA 4E8CA 5KEZA 1V3HA 2DJLA 4YJ5A 2PWEA 1G5AA 5DCBA 1TYGA 2VURA 3AYVA 3DKJA 4H7CA 1YPFA 1P0KA 3W6MA 1UOZA 3VI2A 3AJXA 1R3YA 2QCEA 3PUGA 3RK8A 4FOKA 1S38A 2FHCA 5D2WA 2X30A 3RRXA 1MDLA 1POKA 2XSAA 1QO5A 1GK8A 2XFRA 1GKQA 3AS3A 3MUY1 4DF1A 5DANA 4ERIA 1I2NA 4NP7A 1QPOA 1YNQA 3PZUA 3DG6A 1NQKA 2AAAA 4NY2A 4HA4A 1GCYA 1I60A 5G2WA 3G1VA 1MO0A 1G67A 1XD1A 3H23A 4ZBCA 4BF7A 1JCLA 1ENUA 3NQCA 3M0ZA 2TMDA 1S2UA 4CQDA 4IPLA 5BOOA 1XCXA 1V0NA 4E4PA 3MSYA 1HJSA 1Q2RA 1S2TA 3C0SA 3EOEA 4KESA 1V08A 2XN0A 4JIRA 3WF4A 3K5XA 1A5AA 4AXNA 4KT2A 2PDJA 2ISFA 5ECVA 4MZ8A 3I7QA 3PP7A 3RO6A 4JQ4A 2VQTA 3PZVA 4HYRA 3OGRA 1GORA 4HOWA 2F9RA 4Z1CA 1ICSA 4C6NA 3TU9A 2H8XA 1EGMA 4DUVA 4KRZA 3GTXA 6REQA 2FB2A 4J3TA 4X63A 1DL3A 2NT1A 5BMXA 1HNYA 1MWOA 1UJPA 3VIOA 2NX9A 5BOEA 5TD4A 3VZYA 1UR4A 3GDTA 4GJ1A 1DKWA 2E5BA 1J96A 8XIAA 1LWJA 4JTKA 5M2FX 2V82A 1UWIA 4IJRA 3QLLA 3F1QA 3L12A 3IVTA 1JCYA 2NV1A 3LTSA 4RX0A 3KUMA 1Q7ZA 1PYMA 4JEQA 1R6WA 4QE5A 1MMFA 3LGGA 2V5DA 2WYSA 4KRUA 3JW7A 1HQTA 3QC0A 5MHBA 5G1TA 2HE5A 4O1BA 2YLAA 5HANA 4CN6A 5D2TA 3T0TA 1B1YA 2DVUA 2VEPA 3ME3A 1WKFA 1X1ZA 5CBJA 3CO8A 3MU7A 3G24A 1B3YA 3WLJA 1ZBVA 2OELA 4J1OA 3W1XA 3I3DA 1NVMA 3EX3A 3H12A 3SCUA 3TYCA 1CGUA 1E0VA 2XWEA 2QXWA 3ABXA 1GQIA 5IXEA 3OGSA 3JR2A 5AVNA 2FHBA 1CTNA 4PMOA 2NW0A 4AWEA 3B9AA 1NTHA 4NZJA 3OODA 3UJRA 4GXMA 1OB0A 5DCEA 4HT3A 4HK7A 4Z0JA 1KM3A 1OHLA 2HS8A 3D47A 1L0PA 1YE6A 1B3XA 4NUWA 5K7JA 2GK1A 1AQ0A 3IJ7A 3LNPA 3OW1A 1VPQA 3G5EA 5I02A 3ARZA 4JYDA 3LM3A 3PK7A 4K37A 5BZAA 5A8MA 2CLFA 1L8PA 3NSXA 5G2IA 3UEQA 3O9NA 4ZO8A 1VQTA 5F1UA 4DQWA 2CC0A 2R14A 3NQAA 1X38A 1WZAA 1MW3A 4MWAC 1SU5A 1Q7QA 1OGBA 4JIHA 4MAZA 4IPNB 4AWSA 4AXKA 3ISIX 4GQBA 1K6WA 1PIGA 1RQBA 4UFHA 3ARQA 1P5BA 1OM0A 4NASA 2XIJA 4AD2A 1DV7A 4KS0A 4Z2KA 2QGYA 1TJPA 1OBAA 4YTTA 1RZMA 4GI9A 3WCZA 4FHAA 2YW4A 1XG3A 4QQUA 3H8AA 4ZQRA 1ITXA 3ALFA 4WK9A 3T1GA 3IAPA 2QJNA 1UA3A 2PDHA 3LV6A 4JNMA 4L5ZA 5C6MA 3GH7A 2Y7DA 5BWFA 4R34A 1U83A 1TKKA 2O0TA 5C8BB 4ACZB 1GQKA 3CLMA 5HR7A 3THDA 4D9PA 2VTFA 4HQVA 3CIVA 1EGZA 5DFAA 3VUPA 4FF5A 4BS0A 3FNDA 3RX4A 4RXFA 5AC6A 3U2ZA 3IPWA 4QJ1A 3V75A 2HTMA 3LXBA 1HO1A 4C6KA 5IOBA 1M01A 3VKDA 4AYSA 4G6CA 5K4XA 4PMNA 1BF6A 3O3RA 4IMGA 2QAFA 4JN8A 4ZQNA 4DBWA 3CAWA 4OHQA 3ZT7A 3GC2A 3TQ0A 2JE8A 4FXFA 4EAYA 2WC7A 2VRQA 1GG1A 4L9XA 3CAQA 4DYJA 3ICJA 4UQBA 3L4ZA 3WH9A 1TPB1 3M6DA 1W9PA 4W86A 3MY9A 2CWNA 4JAWA 4GOAA 3L4TA 3FKKA 1W3IA 5I5RA 2ISSA 4L65A 4X0VA 1HGYA 4DUXA 3P14A 1UZDA 4TV5A 2WZHA 3NAVA 4E4UA 1JZ2A 4HNUA 1FDZA 3CV2A 4XX6A 4G9PA 5CEWA 3LY0A 1UHVA 4KEVA 1TWDA 2BGSA 1YBQB 1QNSA 3E12A 1DTUA 1R5YA 1R7OA 4LVFA 3SCVA 4JD4A 1NF0A 3L4VA 3QSRA 1RCOB 2CPUA 2PI6A 4LUSA 1EIBA 3HG2A 2JBMA 2G3IA 5HK4A 3RG6A 3NGFA 1XJBA 2O7SA 3VXGA 5HQEA 1KFJA 3CWHA 1ZQ5A 1QPRA 1YXDA 2WM0A 4W5ZA 5D33A 3MB9A 4MNMA 4UQCA 3T05A 4DAIA 3CV6A 5F2MA 4Z2HA 1FKXA 1ZP4A 1V93A 4JTQA 5TIMA 2FKPA 2P0OA 3RM8A 3UR2A 3VABA 3IK2A 1JPIA 3M44A 3NQVA 1AJ2A 2PU1A 1GUVA 3SI9A 3NZGA 1W31A 1TTIA 2QT3A 1GVYA 4NAEA 3LGEA 1XBVA 1IGSA 2VOMA 5LKYA 3VE9A 3RJXA 2WBKA 2CBJA 2DZWA 2PTDA 2VD9A 2IKJA 5D03A 1J5SA 1E6QM 3LCHA 1XLKA 1H1ZA 4GVFA 3YPIA 3MA8A 3VX0A 2G95A 1VFSA 5DXXA 4JNZA 3NA8A 3N4AA 3PZNA 1Q63A 1VEPA 4PTDA 3OLEA 1XLHA 1F76A 5CZTA 3WK2A 4LY8A 4B5XA 3CQJA 1OCQA 1J2WA 1XQLA 4O19A 4AH7A 1GW1A 5CGQA 4GQ0A 4F0LA 4LAMA 2PMQA 3WF0A 3BC9A 3TIMA 5EMMA 3GFZA 4GO8A 3Q65A 4QS6A 1K9TA 4J3VA 3S5NA 2YGYA 1ZALA 1HKKA 3CZEA 2GK1B 2XVLA 1GQNA 2XJ7A 3NDYA 1NOWA 3QVQA 4A2RA 4I5XA 1QK2A 3LCIA 4H7VA 3ZFHA 3I4KA 3UR8A 1CXIA 4O18A 3HZ3A 3BZGA 4CD8A 2VI0A 5FSEC 2FTWA 4KGLA 8A3HA 1A5SA 1XF0A 1IXOA 3WQ4A 2WMJA 5LIXX 1VCVA 1IT8A 4A3YA 4HZ7A 4D6GA 3AO0A 3FIGA 4MGGA 1E15A 3CU2A 5EY5A 4WQ6A 3V18A 4FX7A 3AMCA 2OZ8A 4RNHA 5BRBA 1TQJA 1PDZA 3MYOA 4CU7A 1H7NA 3T0DA 3WEZA 1TMLA 3W37A 4MG4A 1SFLA 3TNBA 1SW3A 1ZB5A 3TROA 1W37A 7ODCA 2GJXB 1H5YA 1JYNA 1EHNA 2PDUA 5F4XA 1CGYA 2HSAA 3NJ3A 4IMFA 1IE7C 3N2CA 2WHKA 5I6SA 1XIDA 1FX6A 3AHYA 2VGBA 3O16A 2E40A 2BASA 4B2DD 2OLSA 3MSRA 4XIMA 4Q7BA 3TMQA 1BRLA 1LWHA 1OADA 4KCUA 4XZLX 2J7FA 8RUCA 1ISVA 2CLEA 1KKOA 4GI8A 1ZAIA 3H24A 4W87A 2CHOA 5M03A 5HULA 3MVIA 3L65A 1LOLA 3E0WA 2GDQA 2SFPA 2PP0A 3IIVA 1GVFA 1F4HA 2GOUA 2NSOA 3UWVA 1T41A 3WQ6A 3BV7A 1V3KA 3JS3A 4C60A 3W7JA 4U31A 3ES8A 1PCKA 4GGHA 4PMJA 3KEHA 4IGMA 3MBFA 4WDWA 3WLOA 2H9AA 1ZSXA 4O0QA 3NCOA 5U4NA 3T0BA 1HUVA 2UBPC 1KFBA 5ABFA 1AW5A 1EZ2A 4TX8A 1YRRA 4R53A 2VCAA 3DFOA 2EBNA 1OK4A 2R1MA 5HINA 1EJWC 4QISA 3BG3A 3PTQA 5HJYA 4IL2A 3WMBA 4JEJA 4L9YA 4LPCA 3EDKA 1GNXA 4CVWA 2EXOA 1FWGC 3ZYZA 4MKNA 1NEYA 1S2CA 4WKFA 4FALA 3CYVA 4HU3A 1XIBA 4EWJA 4JTHA 1KCXA 1H60A 4DXKA 1A5BA 5LGXA 1EX1A 1ZTVA 4NYYA 4QR6A 4LQ1A 1DJIA 2D2HA 1E6XM 4GG9A 3KVKA 5I79A 1XIFA 1QCWA 1Q6QA 2YCLA 1B9ZA 3A3HA 5EU9A 4C6OA 4JX6A 1XLLA 4EVZA 1LG1A 4HPGA 1UH3A 3B0UX 3SCWA 5E93A 1WDDA 4LAKA 2Y7FA 2W3ZA 5F2LA 3O06A 1Q6RA 1BLIA 1N55A 6TAAA 4LUSB 4UFIA 4PBGA 3G1SA 5B7YA 1WV2A 4LVAA 1OT1A 1IWPA 3DG3A 3T4CA 4IMCA 3GR7A 1CGTA 1JPHA 2G3MA 2OOGA 3STCA 1EEPA 2DH2A 1JPKA 4R9XA 3COTA 3GDMA 3QHOA 4HPJA 4MFEA 3OP2A 4D72A 1ZZMA 1KXQA 4JTCA 5ABEA 3ARXA 1YW1A 1NJJA 3ITXA 4DWSC 3PBWA 1GHRA 2W92A 3AHZA 3H26A 5LA2A 1JCJA 5A8NA 4A3RA 2GUBA 1BSLA 2VX4A 3H2EA 4C6PA 3TXVA 2KX9A 4M8UA 3EX6A 3PSVA 3CZ8A 3ZVHB 3VDAA 2DZBA 2W63A 4OV4A 4HU8A 4XUYA 1AFSA 3AJ7A 2QCDB 3S5SA 3NG3A 3EKZA 1MYRA 2GVGA 3BE7A 1RQHA 4HNTA 3SM0A 1MVYA 4PMRA 3QEZA 4DXXA 1A0CA 1W91A 3OB8A 2X16A 2YL8A 2CLIA 4P8XA 2Y88A 2HE8A 4S2BA 1VF8A 3MSGA 4O14A 5HATA 1IF2A 2DQWA 5EL1A 4PRTA 4TVCA 4N6EA 4WCJA 4C6CA 2ALRA 3ANYA 3T78A 1TIWA 4OBRA 3AZTA 1EJVC 3UY7A 1J0YA 2E68A 2EPOA 3GIYA 1JCNA 4ADTA 4FLRA 2GLKA 2ZRXA 1JULA 1RBAA 4CQBA 1W1IE 2BFGA 5CPMA 2XVKA 3AXMA 4NT0A 1BYCA 3ALGA 3ZT6A 3IJQA 2FTYA 4U3AA 4Z2JA 3VGGA 3FJ4A 3W1RA 4WY0A 4AB4A 3L4UA 1PZ2A 1C91A 2PZ0A 4ICMA 1UROA 2D0HA 2I9EA 4U33A 1EDGA 3NO5A 4A6GA 2YDRA 3LQLA 1RD5A 2ODOA 1GVSA 4Q4OA 5LNUA 2GUYA 2IKGA 4MWAE 4PMXA 3LU2A 2EG8A 2MUCA 4JKMA 3URQA 1BPLB 4J4KA 1T96A 3C4UA 3KX6A 3R11A 1UASA 1ZENA 3LTPA 4MHBA 1ECEA 3HPFA 3R2GA 3KS6A 3USBA 4DLMA 1MNSA 1CGXA 4RDWA 5HNNA 4UOQA 3FEQA 3WDJA 2PDFA 2PDMA 3AZSA 3RCYA 1TWZA 4S39A 3MTWA 2XVGA 2YKKA 5HNUA 4NAFB 4DNHA 1MNZA 1CLVA 5MF5A 2INZA 2GDUA 2XGZA 1U1JA 2Y8KA 1PKYA 3CGTA 3I3BA 3NSNA 1TA3A 5C0QA 3CZGA 4NXKA 3ONBA 1PVNA 3H4WA 4WOZA 2G4JA 1UH2A 3M41A 2TPSA 4XSMA 1PX3A 5D4YA 4GYJA 1WAUA 1E0UA 2J88A 3UU0A 4KKXA 1U1UA 3N73A 3HMCA 1TCMA 1C8VA 5I3DA 1QUMA 1XI3A 2ZFAA 4BY3A 3FHQA 1Q6GA 4G7EA 3AIEA 2X42A 1S3TC 3MC5A 4RZ6A 3A22A 3I10A 4C6LA 4GVIA 2D2JA 6CGTA 1AUSL 5A94A 1SGJA 3S2MA 1N8FA 4NU7A 3C86A 1WAWA 4BI6A 2VCCA 2A0NA 3GXDA 4D8ZA 1AH3A 4C7DA 2E5DA 1BYAA 3JVAA 3WQ5A 3WNMA 1JF6A 1Y65A 2YCLB 4GE8A 3MDUA 3SCTA 4NSBA 4I8YA 3AS2A 1RR2A 1V6UA 1XIEA 2QF7A 2IQ0A 4R7OA 2OWCA 3RLUA 1TR1A 4AIUA 3KTCA 4KEMA 2X41A 4IQDA 4BKNA 1TVNA 1VJZA 4DB7A 3BAYA 1YDVA 5K4ZA 5AHMA 4PB5A 1IQ8A 1TMHA 2WKGA 3W2LA 2OSXA 4BEUA 3GVRA 2CBVA 7CGTA 1DPMA 1RHCA 2D73A 3CH9A 4RV8A 2DSUA 4YYCA 4F0MA 1UR8A 3TP4A 3E0IA 1FP8A 3B40A 2HNHA 4JBRA 4O1CA 2PTXA 2B7PA 1WZLA 2X09A 4H8VA 1EF2A 4GY7A 3CLWA 1IR1A 1BVWA 3WH5A 4QROA 4UBPC 3HQOA 4M24A 5FI8A 4LAZA 3LK6A 5KZDA 3UCCA 1ONRA 1W5PA 5CPTA 3RHGA 3C5QA 3LUTA 3BV4A 5SWUA 1ZP3A 4FLOA 4B3KA 3W22A 2OXNA 1KRAC 4NXSA 1QHZA 3DFHA 2GFTA 2XPKA 3UZXA 4Z1BA 3BAXA 4NNBA 2PBOA 1N7KA 3N29A 4XO7A 2DT0A 3CPGA 1OF8A 1VP5A 3DFSA 3UD6A 2UY4A 3M0LA 4OE7A 1NP2A 1L9WA 3M64A 3NZQA 3R7MA 1K1DA 3I65A 2RDUA 3VMNA 4LUTA 2Z1KA 4LALA 5LNSA 2F2HA 2WQPA 1XRTA 3T08A 1RPKA 4NNCA 4QFUA 1VFOA 4UOJA 1EBGA 3NXFA 9CGTA 3BPWA 4TU1A 3G0XA 2WZTA 6XIAA 2FMOA 4HPHA 1IHIA 1UD3A 2ZUWA 4HB7A 4IWWA 3MS8A 4EANA 1EEXA 3KRBA 3M46A 2VRJA 3MHUA 4LBRA 4IG2B 3MI2A 3EA2A 1UIOA 3HM7A 4HGXA 5CSUA 3O15A 5A3HA 1R47A 2QLYA 1W2VA 3SN1A 3G6LA 4RW3A 4PL2A 4HMCA 2I56A 5KMYA 1K9EA 4ASTA 1CXKA 3QHMA 3C2OA 4FR6A 4JKLA 2WK2A 4LYQA 1SJBA 4FI4A 4YHGA 1SZFA 4Z17A 1J0IA 3GXFA 3F5LA 1IGWA 4LS0A 2PDIA 2GVJA 3IV3A 3SDOA 2HK1A 3PFRA 1JPMA 4AEEA 5F1VA 5KZEA 2ALDA 3WEMA 3DOPA 3MUZ1 4JXCA 4D6FA 3Q94A 4NJHA 4L1XA 1J0KA 2L5HA 1C8QA 3GNOA 4LSBA 1GVEA 3V5FA 3MV01 4GC4A 3FGCB 4W9TA 1PE1A 4Z1YA 3SRHA 1ZFJA 3HBLA 4Q4RA 3PPGA 2XVPA 3C8NA 3RNDA 2DFAA 3VOFA 3S0CA 2Y7GA 3SGZA 4WOQA 4OECA 3HGOA 4TQTA 2J9ZA 4GCXA 2QPSA 4I8DA 5ECUA 3G1FA 1MRQA 2ZUNA 1MEWA 1CZ1A 4J2MA 3SCPA 1BAGA 2VEFA 1QK0A 1UPPA 2F7FA 3KE0A 5HR6A 4Q8TA 3PM6A 4C65A 3ITGA 3NM3A 3EPNA 1FWDC 1KLZA 4RNFA 3CZLA 4X9SA 5M17A 5FSDC 1DVJA 4PFMA 3APTA 1I2PA 3DUGA 3GFYA 2XG9A 3UWZA 2MNRA 1JF5A 4G1NA 2DZTA 4LS1A 3WFAA 1BD0A 2WKLA 3MBDA 4HK5A 4MYAA 1GOOA 4UZSA 5D04C 3LRMA 3RDKA 3NQ7A 4Z1AA 4YWSA 4CGTA 1V6VA 2VMFA 3U5UA 3GG7A 5DMNA 1Z8AA 1M65A 3QOMA 1RY8A 3EZ4A 4MNKA 4H9XA 2W62A 4DBEA 2VM8A 5CH9A 2X2GA 4O11A 4UFKA 2Z26A 2PDYA 3QTGA 1XFBA 4MUZA 1QPKA 1V02A 1E0XA 2ZXDA 3DX5A 3VGBA 1I1WA 3WD4A 2G5WA 1W9UA 3GBDA 4J3UA 4QAWA 2D2OA 3GNPA 3K8LA 5BXPA 2A85A 4ZB0A 1ZAHA 3LNMA 3W1QA 3DBPA 3TUUA 3KLLA 3QLDA 3LRLA 1Q13A 3POHA 4WJEA 4HSHA 1A5LC 3BXWA 1BWLA 4GZJA 3H2CA 5G4HC 4CD4A 3B8DA 1C8YA 1P4CA 1TV7A 1Z6KA 3M5YA 4JIPA 1FWRA 1WZKA 2C3ZA 4AD4A 3MJMA 2XFWA 3BUVA 4HN4A 2I17A 3W24A 3QPZA 4S23A 4O15A 1YDYA 3AYSA 1CDGA 3B8WA 2B7OA 2TYSA 1F8MA 3DCPA 3W87A 1IZCA 3BLOA 3WLLA 5BWAA 1SFTA 5H91A 2G0WA 5D8ZA 1LOSA 4BF9A 2W67A 5FJOA 1H7RA 1H62A 3G18A 1AH4A 2AQOA 3R13A 4PUWA 2Q02A 5E0FA 3VKKA 3RX2A 1JGIA 4BEQA 5E5CA 2QJGA 4D8AA 1RV8A 4EXQA 3SCOA 3TMLA 4LYRA 3MHGA 4Y2WA 3N1AA 2QCFA 3ARWA 1WYIA 2BB0A 2E1DA 2XH2A 2RGMA 3P3BA 3UXIA 2R1NA 3IUHA 1PHQA 2HQAA 1VH7A 2VFFA 2JK2A 2CLHA 3AYTA 4PZVA 2DW7A 1WDQA 2VOTA 2XIMA 3GNXA 1LT7A 3WUBA 1KCZA 3RR1A 2OOFA 5D9PA 3WH8A 3GX9A 4AZ7A 2OKTA 5CPLA 4C1NA 2AL1A 2BZNA 4FP1A 5EA9A 1ZJBA 3APYA 1B3VA 1IEXA 5IRPA 1EO7A 3QPEA 3QKEA 4CQ9A 4KWUA 4Y6GA 4M19A 1XH0A 4UMCA 4OT7A 5FJRA 3OVRA 4DBDA 4Z1DA 5A6AA 4MF4A 1XP3A 2FB3A 5CBIA 3RN6A 2E9LA 2VRKA 3B8IA 4QM1A 3HJZA 4DWDA 4C1KA 2ABAA 1UWUA 3CHFA 1DHPA 3CTLA 4IIDA 4PTMA 5I0DA 1VENA 4IIEA 4Y8EA 4XK2A 1W1VA 3TAOA 1AVAA 4H8NA 1TVPA 2AMGA 4PEEA 2GYIA 5C9UA 1OGGA 4DBSA 3W81A 1TJ0A 3HA1A 3LA4A 3O1NA 2REQB 1H1YA 3M0VA 1CB2A 1VZWA 1QOPA 5FF3A 1XSJA 2ZVIA 4IH3A 2C15A 4DF2A 3N04A 4PA8A 1BG9A 1GQLA 4DPQA 3BGAA 4JS3A 3PWIA 5HMFA 3R0UA 1OX5A 1G01A 4PUDA 4RE2A 4KF1A 4IGHA 2PEVA 3E0VA 2VO5A 1Q6CA 3MKKA 1Q6OA 2ONEA 3W74A 1XPYA 1MDRA 5CGMA 3IRDA 3VINA 4WDXA 1CX9A 3L0KA 1Y0EA 4KBXA 3NL3A 1ICPA 4QNEA 1A4LA 4Q4MA 3RYSA 3PBUA 1W3NA 4JR5A 2VC7A 2JF7A 1QWKA 4EP8C 3ITCA 1WA3A 4N6FA 3W7LA 3QC3A 5EPDA 1CB7B 3ZJ6A 4JTJA 3FHAA 1YTDA 3M0YA 4I6KA 1YXYA 3PNZA 1PZ1A 3A12A 3EOSA 2ZX7A 3WH6A 3ARYA 3K4DA 3UNDA 3A4JA 1M68A 1Z89A 3V35A 3SCSA 4IFOA 2BTMA 4UNKA 3VNJA 2QUTA 4H3DA 2DVTA 4XKMA 5BXTA 3ARTA 4PTXA 2OEKA 2FZ9A 3DI1A 1BXBA 4FZIA 3UZWA 1SJAA 1K3UA 3PPFA 2A3CA 1B90A 5A2CA 3B9NA 7PTDA 2FZ8A 3S6DA 2VGGA 4KCVA 1OWQA 3UVIA 3WK3A 2QJJA 3BMWA 5D02A 2VUYA 2IPFA 1QW9A 2BGNE 4D6IA 1SMDA 4US5D 3CHEA 2Q6ZA 1ESWA 1W5QA 3H70A 3DXIA 3U7VA 3RXZA 3WF3A 5LXXA 3TWAA 3DEQA 3S2NA 3TR2A 3TQPA 1FFQA 1UOKA 3F03K 3SJNA 1V0LA 1JR1A 1ZU8A 3C8FA 1NDZA 3BLLA 1L8NA 4UMBA 2BVDA 3K8MA 1QR7A 3HN3A 4ZSTA 1ZCOA 3QF0A 2ZUMA 1TPUA 2E9BA 1WKDA 1C3FA 3OLIA 4CD5A 2NT0A 2DDXA 4YXGA 3H2MA 3AU6A 5C2CA 1OC7A 3UJSA 2Z6IA 3EDDA 4NF7A 1VBHA 2QCHA 3PBVA 3JRKA 3M5ZA 2FHFA 1EL3A 3R89A 4FXRA 1HO4A 4LANA 2W61A 1O1HA 4Z0SA 5E1QA 3RU6A 2RJGA 3ZWSA 2QMKA 4QS5A 1QOXA 1A4MA 4BCEA 4Q3MA 3URNA 2C1HA 5F7UA 4DO4A 1PTDA 1UPMB 2FFIA 3OZYA 3C52A 1HL9A 1YPXA 5I03A 4ZTXA 4LVBA 3BG9A 2VNCA 2PFHA 2R1KA 4IISA 4LW7A 4LAUA 4AIOA 3C0QA 3ATZA 3W28A 1RQEA 2QDGA 2D69A 3BMVA 2ZA3A 1JQXA 1OYCA 4NZ5A 3CK5A 1H09A 1QT1A 4O12A 3KCLA 5AB3A 2HNEA 2BVTA 1HP4A 5C70A 1RJPA 1JD9A 4D2JA 2PGWA 1JGMA 4Y9NA 3KOXA 2VC6A 1KFCA 1TREA 5KINA 1XCFA 1JZ6A 5T9BG 2R94A 3QMSA 2OZTA 2PZNA 2Z27A 4DJDA 1CEOA 3NO1A 4PEKA 1OYAA 3ZVIA 3KOYA 4RV3A 3MKCA 1Q3NA 1CYGA 2HK0A 1KNWA 4L9ZA 3CHDA 3SURA 1OINA 3WFLA 2BY2A 5CSYA 1X7IA 3FYOA 1PKNA 1R30A 3QR3A 1C93A 1ZLPA 3OIXA 1V6YA 3REQA 1KC7A 4OOZA 4S38A 4BK9A 4IQJA 4HK6A 4S3AA 5D2VA 1M03A 4JTEA 4L1WA 5CZKA 3B04A 3QN3A 4PTWA 1NELA 2NXGA 3KP0A 3WQFA 4E2OA 3DYPA 4NX5A 4ZA0A 1SW0A 2CNCA 2UZ9A 4OWGA 4I5RA 1BQCA 2CESA 1UWRA 5I06A 1UQZA 2XH7A 3QZEA 4FPSA 2WLYA 5BXSA 1X6LA 3B4YA 3UWQA 3LM7A 2QDEA 4E2DA 5ABHA 2PDLA 4MPQA 3TYZA 2WMHA 4GIAA 1GQJA 4POCA 1E4LA 3LB0A 2NZLA 5I07A 2BV9A 3C2FA 2GGGA 2A3LA 4HMNA 3RM9A 4DXVA 1E6SM 5DMMA 3VOCA 4XZ9A 1QU4A 3LLXA 4PUEA 1BTMA 1NH6A 3R12A 2V69A 5HWNA 3CT7A 2PGEA 4KPLA 3PTMA 1GOKA 1UKQA 3BK0A 2DSVA 4W7UA 3AMKA 3CUIA 4OKDA 1HX0A 3PPHA 2WJZA 4O1FA 4JNYA 2Z28A 1PWMA 1UUOA 3FDKA 2YIHA 3AIQA 3WN6A 1KRCC 3BAKA 2WJDA 3E5PA 2P5NA 3MW7A 3CV1A 1TX2A 3ITOA 3PG8A 1LUCB 2HWGA 2PLCA 4WXYA 2WWDA 1Z42A 2NXHA 5A95A 1U2YA 1UR3M 2XIOA 4D1IA 1REQA 1PUDA 1DWAM 3HQNA 1XUUA 4DO6A 2GJNA 3M47A 1WDRA 5EMUA 5AVHA 1ADDA 2J7BA 2FDSA 2VZVA 2I16A 3TCSA 1DXEA 3P7YA 9RUBA 3E1F1 4N4PA 1RSCA 1GOWA 1V5XA 5CZJA 4C7FA 2C7FA 1DQXA 1O5KA 1WKYA 3MMUA 4FEZA 1IEIA 1GOXA 2O4QA 3L23A 3B0XA 4XISA 1Z69A 4IZGA 2X40A 2E8ZA 3O6AA 3W70A 2D0FA 4JZ5A 1R2TA 2WWCA 3VIGA 3ZJ7A 1XH2A 1TPH1 3BAIA 4PTVA 2V5KA 4QDPA 2RDXA 3PPCA 3WUFA 3A13A 1R9XA 4A2SA 3EWCA 3W07A 2WVSA 3E49A 4MUPA 2EPNA 2VGIA 3RMJA 1XPGA 1FTXA 2ZQ0A 3PBGA 4UFJA 4DRSA 3MI3A 4G7FA 1AJZA 3TJ4A 1W1B1 3TYBA 1QAPA 2OZ0A 4O1EA 3AMLA 3U8GA 4JX5A 4HOZA 3WLTA 3AU2A 4WKHA 5AZ1A 2E9MA 4V28A 3O0FA 1T8QA 3G0SA 3M4HA 1X39A 2VT0A 3AISA 4MPKA 4ZTYA 4C7GA 1R2SA 1XIJA 2YJQA 4Y7EA 1NIUA 1SZGA 3P67A 2RDWA 1MXSA 2EPHA 2J62A 4W85A 5BROA 4UIOA 1CLXA 2VGFA 3ZMRA 2HROA 1ODUA 1JFXA 2X1UA 5FAJA 2Y89A 3N12A 4QLLA 4HZMA 1FH7A 2P8CA 1IEVA 3VAVA 1EDTA 2PE4A 2O9RA 2EG6A 1EWDA 1EYWA 1OC5A 1FWWA 1LQ0A 1OF6A 3E2QA 4IQEA 3DFPA 2VWTA 3S47A 5XINA 5FEXA 1Z44A 5AY7A 1IXPA 1U22A 4F2BA 3IS4A 2W0UA 4GQQA 3G1AA 2B4GA 3TN5A 2DIEA 2E77A 4PTNA 5IDZA 3G8RA 1Y5WA 1ITCA 4P61A 4LFYA 2GPTA 3TKFA 4I6VA 1IIHA 3WL1A 4Q8VA 3NNTA 3R43A 2P3EA 4UTWA 4PMDA 3DC0A 1ZHAA 2PC4A 5LIWX 4U4MA 1B3WA 3DI0A 5E70A 2E7FA 3GC5A 4DEFA 3PUDA 3B0VC 3ZM8A 1HKJA 3GB6A 3OYZA 3D5HA 3S3GA 3NOYA 1KR1A 4GFIA 3W29A 4GZ7A 4MKSA 1P0NA 3W1LA 4YHEA 3IIXA 4NJKA 5JQ9A 1Q2SA 3L2MA 1EJTC 3FY1A 3I3EA 3BMXA 5K9XA 3KWSA 1LRTA 3H2OA 4ALDA 5H1WA 4YNGA 2XIBA 2DV0A 4S3DA 2VXNA 4KMQA 5CAHA 3HQPA 2V5CA 5CPSA 1D8CA 4PBEA 4N9DA 3N14A 3STFA 3N9RA 3BANA 3VNIA 1KCKA 5E0KA 2OWWA 3PHAA 2NWSA 3L0NA 2XN1A 4HSOA 1FUYA 3LPGA 4E5TA 2OR2A 4NKCA 3D6NA 4GX8A 4PUUA 3G1HA 4AF0A 3P93A 1D7KA 3VFLA 1WDWA 4IIHA 3W0KA 3QYSA 1ZCCA 1WKEA 1EXBA 5IBXA 3M9YA 2Y6ZA 4UOZA 3AXKA 2OZ3A 3UZZA 5AHFA 1LQ2A 1I6NA 1XKYA 2Q71A 3H55A 1XRSA 5K9CA 3BLPX 1F05A 3TJXA 2XH0A 3FYYA 3TXZA 2J7HA 2Z4GA 1IZJA 2BWGA 3NPXA 4Z2IA 2H6RA 4AUBA 1JI1A 2FPVA 2ISDA 5EBAA 1PTGA 4O1DA 2Q8LA 2E6DA 4JYEA 1VJSA 2QF8A 3MMWA 3P81A 4TOQA 5JU6A 3WL0A 5FJTA 4O50A 3BLDA 2X05A 4YVVA 3S1VA 4GBUA 1B3OA 1HT6A 3IGHX 3Q58A 1E72M 4ZB5A 4E2BA 4MY8A 1TJ1A 1NSJA 3TAKA 4ROPA 1T40A 3NZPA 3GLCA 4D1JA 3L2IA 3DKLA 3MHFA 1XGZA 1XYMA 3AHTA 3ABQA 1W0MA 3VMOA 4ATLA 1V77A 4LVDA 4OV9A 4OFCA 2WKJA 3GTNA 3JUGA 2JEQA 3OYXA 3TR9A 3W71A 2FVMA 2XWDA 4XG1A 5DRIA 4W8BA 3RR4A 3VGEA 4BQ2A 4GNVA 5D9OA 5HQMA 3CJPA 2GGEA 1XLGA 1SO5A 3N2XA 5AHEA 2X8RA 3BLKA 3TNOA 1G94A 1MUWA 4GPNA 1FRBA 3THAA 4JFSA 2EG7A 3QGKC 3N6HA 2VYOA 4WIWA 4X3ZA 3CB3A 1VCGA 2ZBTA 4GI6A 2HDJA 1JZ3A 4LB4A 4QBXA 5D38A 4EWND 4F0HA 4CNOA 3QOKA 3SN4A 4S3JA 3ZZ1A 4REQB 3THCA 4B9ZA 3R0KA 1US0A 4Q6JA 3MKVA 2WO5A 4E38A 1F07A 4NG3A 4PFHA 1R46A 1EB3A 2DIJA 4H83A 4UC5A 5TAOA 1VYRA 1HP5A 4WGHA 3O6YX 1RLDA 3GHRA 1SMAA 1V79A 1V03A 3NFUA 1GPFA 3GXTA 3H2FA 4XV0A 2EKGA 4QDWA 2D0GA 2R9RA 3VIFA 1X6NA 2VCBA 4LX4A 1G1YA 3EB2A 3TJIA 3DESA 4IGNA 2G8ZA 3QQWA 3QYQA 5BW6A 3FA3A 1JUEA 5GJNA 4H19A 2WNQA 7ENLA 2PDNA 1ZBKA 2A7PA 3H4GA 4J3ZA 3WZ0E 3QW4B 3NM1A 4PGLA 1SZRA 2V3EA 2TSYA 1XRVA 2YW3A 2J7GA 1ODZA 4Q4SA 2W27A 4PCFA 3T8QA 5C9RA 5HUPA 1NF7A 5AHLA 3FJ6A 3W1MA 2XM2A 1KXTA 3N2OA 1L2QA 3WQWA 2ZUSA 4MWAD 4O54A 1ZUAX 3AROA 1GKPA 1AQFA 3AHXA 4DUWA 3URAA 5AN7A 3ZR5A 1K8YA 5C7HA 5CPOA 2J13A 3OG3A 3QZAA 2Z2BA 3WNNA 4XUGA 1MQRA 4L1GA 5HBFA 1ECQA 2B0MA 1O6IA 3W9ZA 3VNDA 2WC3A 3CNYA 3FA4A 2X7VA 4HA3A 1AZ1A 2ZZ6A 2Z7KA 1SW7A 1RP8A 4EXAA 1ISWA 2ZZ2A 3P0WA 3N15A 3FJNA 1VAHA 4LF1A 3AC0A 5LNVA 5C2GA 1UP2A 4ZQCA 4XTIA 1BVNP 4B91A 1BKSA 3WH7A 1KBJA 5I3HA 2FGZA 3TQVA 4QCFA 4AY7A 1UP3A 4P8UA 3LDVA 3ARPA 3OBAA 2ZZ7A 1QPQA 3W1PA 1MQQA 8XIMA 4JIEA 4Z2LA 3GH4A 4IFKB 3L4WA 4GISA 2OGJA 3T6CA 1MI3A 1QJWA 2ANUA 2QCMA 1IEQA 5H8PA 4DJEA 5C54A 5FESA 4AZIA 1OEPA 2YXGA 3LMYA 4CCDA 3VIJA 1XBXA 3JZUA 4JTRA 3VO0A 2XGIA 3AIVA 1GVIA 3NPUA 1WBJA 4DJDC 5AHIA 3GZAA 4ES4A 4O0KA 3TW6A 3ZSSA 5GJPA 5I2UA 2CBIA 4AD1A 1FWEC 1B4EA 4IT1A 4PODA 1VLIA 1OG6A 2VKZG 1F73A 3LBOA 3KBWA 3KRZA 4ENLA 2YB1A 2PCQA 3QXBA 4C91A 3KBSA 1TV8A 1PIIA 1W1YA 4JFVA 3VOIA 5JH2A 4YTUA 1R9YA 1WDPA 3LCLA 3H4XA 4A35A 4M81A 5LZLA 3DG7A 3WMSA 4ZB2A 1UCWA 4CN4A 4JCMA 2Y61A 3KL5A 2J47A 5HJXA 2GVYA 3A4WA 1W17A 1OZMA 1K7EA 1GW9A 1R7AA 1FWCC 5BOFA 4IUGA 1R0MA 3O8AA 4HBKA 1BEUA 3G1YA 1DJQA 1OCJA 1QBBA 1NP0A 5FD0A 4L4PA 3TZNA 3UZ5A 4PSRA 5LXEA 2VX6A 2YA2A 3O07A 1ZNNA 3FSUA 1D3HA 1AQHA 2QPXA 3TWBA 3G22A 2PRHA 5CC7A 3W1AA 2CERA 1T6MA 3ZQ9A 3EOLA 2UY2A 1LYXA 1JXKA 2G97A 3CHCA 2OLHA 1RUSA 3FVMA 1N8IA 4ZCWA 3TE9A 1VPYA 4HZ8A 3BSHA 4TR9A 4H41A 4Q8MA 1A50A 1R2RA 3B8UA 3FA5A 2QUUA 1SPQA 2I14A 1DE5A 1EH9A 4IXHA 3WO8A 1TRDA 1UD5A 1XYCA 4Q4KA 1P1MA 4M80A 3DDMA 1DWHM 4QSFA 1GOMA 1QTWA 3P84A 1F3XA 4ZXLA 3LENA 1HKVA 3K30A 2FLIA 2JGQA 5BXRA 1BYBA 4LCSA 1GG0A 1ONXA 5DMLA 4U2ZA 4QG8A 3UBPC 1H7XA 3ARSA 5I3JA 4FNTA 4Y9MA 3WG6A 2NQJA 1V02E 4B9YA 1RP9A 2WSQA 1PXGA 2BP1A 2WJFA 3KHJA 4J40A 3ARUA 4E4FA 3HMJG 2CHNA 3IJ9A 1T99A 4KRTA 1OYBA 5C5YA 4A05A 5A6BA 3CZKA 1HJWA 2OGYA 3E0LA 1B30A 3F2BA 1NDWA 3CQKA 3BG5A 3K4AA 4EAMA 5JIPA 3CUZA 1DE6A 5EFFA 3XIMA 2QAPA 1S46A 1NY1A 3QFWA 3TLQA 4M5PA 3B3DA 4H9YA 3PB0A 1FWTA 3OVQA 5CZSA 2GOKA 1H7PA 2J7DA 2GQAA 4AEOA 3GNNA 3LSCA 2GUUA 4WKAA 4E3TA 4XVEA 2DT2A 3LLDA 3D46A 3SCNA 3M1ZA 1M7XA 4JHZA 2YX0A 2Y7EA 2A6LA 4IIBA 2H90A 4WX2A 3MUXA 1RK6A 4BQ5A 1CNVA 1E73M 1VKFA 3WLNA 2V2HA 4E8DA 3APGA 4M56A 3PTKA 2E8YA 4UXDA 3KOFA 3SUTA 5KITA 2BNJA 2NQHA 1V6WA 2WBGA 3STEA 1XLFA 4YLWA 3H21A 1RAKA 3SY8A 4HA1A 3V3WA 4FLSA 3DFYA 3LZ3A 4RR4A 5CJMA 3W02A 3OVPA 3HGSA 4XD5A 4ACZA 3M07A 1QMLA 1NWSA 3AIWA 3VX1A 4KEZA 1XISA 1F6KA 4LGXA 3W2MA 4QTGA 1JZ8A 1AD1A 2W5FA 4J35A 2GQ8A 2PTYA 4H7ZA 1E1CB 4JFUA 3UYCA 3C3UA 3HFYA 3N17A 1OQFA 4UTIA 1TPVA 4MTVA 3BW3A 4MB4A 1EHAA 2QS8A 3T8LA 1J10A 4I9MA 4UTWC 4JYFA 3ZJKA 1QNRA 1SFSA 7A3HA 3VIPA 3Q2DA 2WC4A 3KDNA 3BLIA 2CLLA 4AIEA 4B5VA 1IWBA 2IQTA 2PGFA 3AXIA 3QZ6A 1UWTA 1QI3A 4J3WA 3AZRA 4JIQA 1P6BA 3EDFA 4EPEC 1VYPX 3CMFA 3I6RA 4I90A 3SIMA 4DWSD 2HV5A 3CL6A 1FXQA 4H00A 5HWMA 1PX8A 4MLJA 1NFGA 4NJIA 2ISVA 1BWKA 4QRNA 3UZJA 3WIJA 2XH4A 3QHNA 4N9EA 3W7IA 3ERPA 1YBQA 4S2CA 2WNWA 3UESA 2GSEA 5CBBA 2ZWYA 4FNUA 1NDVA 3KP1A 2G96A 4F0KA 3II1A 3MCNA 3NL5A 3GKAA 1J01A 4D6DA 4PR4A 2UV8G 1KM5A 2VX5A 4ZMGA 3PUOA 2FH8A 4X9YA 3GR8A 3TLLA 5DT5A 1OC6A 4L56A 2NVCA 3LQGA 5IBXC 4PMUA 4GY1A 1E56A 3PWAA 2DZVA 5ABGA 3SZ8A 3F2DA 1XQKA 1QDSA 1AMKA 4C6MA 1W3KA 2QMJA 1J0HA 2O9PA 3LPFA 3EEGA 3OZMA 1IXNA 4D8LA 2EGZA 2OYLA 3GE7A 3TTQA 2WJEA 2E0PA 1UUMA 1WOBA 2CKRA 2DY3A 3GTFA 1FVPA 3TOYA 1HKMA 5FEPA 3GXPA 4D6HA 1ZS2A 4RZBA 2AKZA 3WEOA 2FVKA 4GGBA 3BQ5A 1FWJC 1YYAA 1LTDA 3E2RA 3M0JA 1FHDA 2ZUVA 3WDPP 3L4YA 2ZKMX 1WE5A 2JKPA 3SFWA 3MMTA 1PO9A 4FS9A 3BOXA 3NZRA 3EA3A 3FYPA 4J7RA 5GNYA 2PU0A 3W25A 3GUWA 1D7FA 4MVAA 2DJXA 3QMRA 4AY1A 1DIOA 4WF7A 3EB4A 4GBDA 3VDBA 3WFZA 5GJMA 4ADSA 3I6EA 2QUNA 4HTBA 4AG0A 4XAGA 1E70M 1BTCA 5T9CE 3AIBA 3TK7A 4D6JA 3AS1A 3INPA 2V2DA 3FX4A 3WQEA 4JTIA 3EKGA 1W1A1 4TMBA 2YR1A 4K2SA 1RH9A 3L5MA 3PANA 4DLFA 5DCDA 5JXQA 4BF5A 3RJYA 1JL8A 1Q6LA 2DT1A 4NILA 4UQEA 2GJXA 3GDKA 3NWRA 5AFDA 3L21A 4QX4A 1Y7VA 4M29A 4B3LA 4AVFA 2A3HA 3GDRA 1GGOA 1UD6A 1FWHC 4ZODA 3PN8A 4R33A 3STPA 4FNSA 1JZ4A 1VHCA 4GX9A 4O1AA 3WD0A 3N9SA 1E55A 2W9MA 4AW7A 3F2CA 1BXCA 1RALA 5AECA 1ZGDA 2AL2B 1JUBA 4MZYA 4F0SA 5JVLA 4I7WA 3O6CA 2PDGA 1S2WA 2PSNA 3SSZA 4IIFA 1OT2A 2J66A 3PSWA 3KVMA 1XWYA 1JZ7A 4GVGA 1B0IA 1KM2A 4HPXA 1JCMP 2I5GA 4JICA 1S5WA 1BYDA 3PBMA 3E3HA 4K8GA 3CUGA 1G4TA 1EP3A 1GTEA 2WQDA 4D6CA 5FF2A 4JTFA 4FSAA 2R1PA 3CXOA 3VIIA 4V1XA 1G7VA 4QJ3B 3QQ1A 3W7RA 1A49A 2BOEX 3PZMA 5JBFA 1NFBA 3RCMA 3KBMA 1W56A 2WM1A 3UXAA 4DYKA 2FZNA 3GTHA 1GZGA 3UA4A 1B57A 1US3A 1PX4A 3N4FA 3PAJA 3PF3A 3NQEA 5D9NA 2NUYA 5M5DA 5K9DA 3AIUA 1FWAC 4LEQA 4TO8A 2XDFA 3P60A 3G0UA 4Q6XA 2ADAA 3E74A 4CCCA 1JAKA 3A9IA 4BQ3A 1DYSA 4UTKA 2W79A 4F2TA 1E5NA 2J8TA 4IQLA 2X1TA 3C2EA 1UYQA 2A4AA 3BAJA 1U1HA 1TPFA 1E71M 1VR6A 3W84A 3WJWA 2WPGA 3W23A 4MIMA 2AMXA 4MB1A 4CNTA 1W9XA 3W85A 5CJNA 1GJWA 1VBRA 3W7CA 3OBEA 4DJEC 4UR7A 4FOJA 3P74A 2G50A 3W38A 3NVTA 4JQ2A 1XLBA 4URIA 5CAKA 2JKEA 1SO4A 4B5SA 2CW6A 5A2BA 1BVZA 4HTYA 3ZVHA 2XYLA 1LOQA 3TTEA 1GHSA 4WR3A 2CZEA 2RKXA 2QCDA 4S3EA 1JDCA 4G8TA 2VP8A 2VDIA 1RLCL 1KV5A 1TMQA 1EUAA 1H11A 2AAMA 4PYSA 1E5JA 3QSTA 1KA9F 3WLIA 2P10A 3N34A 3V0TA 3S6OA 1EIXA 4US6A 2RGLA 3P80A 4UUIA 3L68A 1OK6A 4GUFA 1MW1A 5CPQA 2DQXA 2ZVRA 4O4VA 1O4UA 1SR0A 4ML4A 2YXXA 2C16A 2OODA 4LXFA 3W6YA 1XH1A 3DERA 1I1XA 4ATWA 1A80A 1CBGA 3I7SA 5DF0A 4NJGA 4ICCX 1LBFA 4RE4A 4HNLA 3GRIA 3CYJA 4JQ3A 3U2CA 4HD5A 1TG7A 4CD7A 1I9CB 3SRKA 3SY5A 4HVXA 2QDDA 1PCWA 2EF9A 2R82A 2VQUA 3CTTA 3GHSA 3KM8A 1BXNA 1K7FA 3M0XA 4XBSA 1WXYA 4EKJA 2TODA 1NDYA 2INFA 3WJYA 4TTGA 1K02A 4K38A 2WVTA 4QLKA 4W88A 1G6CA 1UP0A 1YTKA 1EC7A 4DBUA 1B31A 4AZ6A 1JD7A 7REQB 1Z48A 2XIQA 4NI3A 1EXPA 1EO5A 2GJPA 4WLCA 3AWNA 2ZA1A 4YVPA 4NYUA 4GH3A 4KWWA 4H6KA 5FEZA 1UQYA 2C14A 3OHIA 2V81A 5DQPA 4FO4A 2BXVA 2FZDA 4GMEA 3SUUA 4MAVA 1OFOA 3W2KA 3E6EA 3UGRA 4GJJA 2G3JA 5KTLA 5CZ0A 4TVUA 3E2VA 6A3HA 1OX4B 2QV4A 2ZICA 2JEPA 3CMJA 1S5VA 3VDHA 3T2PA 3SEPA 3V4BA 1P1XA 1R3VA 3MCMA 2BXZA 1RBLA 1YNYA 4ERGA 2BY1A 1KM4A 1YIXA 4AMAA 1KBLA 2QEZA 5LGZA 4NAFA 1MRAA 1R3WA 2CZDA 1E0TA 3BJSA 1XC4A 1XIMA 3VPLA 2WMIB 3DFTA 1QHOA 1E9IA 2NVDA 4J28A 2YCJA 1XYAA 1US2A 1XR2A 2O56A 3DHPA 1F8IA 2D3NA 4Q8OA 4H9VA 4JL1A 3NXLA 4JFWA 3RRAA 4M0XA 5A8PA 3K1GA 2ZOXA 5CC6A 2ACRA 3IIOA 3N18A 3UGVA 1PEZA 1H2JA 1VBUA 3RO8A 4S3FA 4ATDA 2J8FA 4O16A 3W1UA 3JZEA 4RDVA 1E9LA 1L6FA 3F4DA 4O52A 3CUFA 1S5MA 1XL9A 5KZMA 3IRSA 2C1GA 4C5ZA 4UR9A 1VFFA 3SGUA 2VC9A 1MUCA 3MZNA 2BY3A 1LT8A 4W4QA 2R1LA 3WBEA 1JEZA 1V8EA 3PY2A 3WDQA 2NV2A 4ICNA 1A3HA 2QW5A 3QY8A 5XIAA 3EOUA 1FBAA 4DVOA 3IGSA 2VR5A 2W66A 1X98A 3UPBA 4JTLA 2E6YA 3KOWA 4AZCB 4DJFA 1SJCA 2ACUA 1LCOA 5CG7A 1MXGA 4ZEPA 1O7AA 3O6DA 3EX1A 3NQ8A 4YYFA 5I24A 3AXHA 2ZE0A 3O0KA 2G3NA 5FKYA 4RE3A 4AAJA 2VEKA 2Y24A 4L4OA 3ZJ8A 3KW3A 1JXJA 2Y4SA 4GUGA 4UTJA 1V7YA 5A6KA 4XD3A 4MNJA 3VZXA 3LPPA 3EYPA 3OBKA 3UZYA 3WD1A 3ZR4A 3C2VA 1XXXA 1DJZA 5REQA 3CBWA 5DX7A 3A5VA 1FHUA 1WP6A 2Z7GA 1TJRA 1XYFA 2DEPA 2A3AA 1EX5A 5PTDA 4UTTA 3VD5A 1BF2A 1ISXA 1DWJM 1YPIA 2EO7A 1QI0A 3M0IA 2E6AA 4JN7A 1E3XA 8TIMA 2DT3A 3IIPA 3LCWA 1R38A 1HW6A 4YCPA 4RZ4A 3LHUA 4JTGA 1DWGM 2ZUUA 3CZJA 1HJUA 2WPBA 1C8XA 3DZ1A 5EGRA 1TV4A 3EKLA 2PWGA 2Q01A 2J24A 3N13A 3IACA 1TTPA 1B54A 3MP5A 3AALA 4K7YA 1B5TA 3EX2A 2B7QA 1SUXA 1TVLA 1NWUA 3EPMA 1SZNA 2OT1A 2BVWA 3PZ9A 5AYIA 4K68A 4AC7C 4IG2A 3EPOA 2ZRYA 2NV9A 4BJHA 1JRCA 2BHUA 2PDKA 3ANUA 2R91A 3TN3A 1DIEA 5HNTA 4B5NA 2NUXA 3RILA 3QY7A 1DQWA 1QNPA 4XZIA 3KL3A 3WQVA 1FWIC 3FSTA 1HL2A 5C9XA 3U2EA 3QTPA 4YL2A 1DWFM 2J7CA 1A3WA 1W3LA 5BU9A 5LHFA 5CLWA 4ORIA 3MVTA 3BURA 3F4NA 4LCQA 4GJIA 3H54A 1QVBA 3E9AA 4J3XA 1H51A 1PZ0A 1L6SA 1C29A 4OVXA 4NVTA 4QDMA 4WSKA 1NOUA 4N7QA 2ZX8A 3EWUA 4R3UA 4ZR8A 1GT8A 5LNRA 5LIYX 2Q8ZA 2HCVA 3FGCA 2OG9A 3VD3A 1UMYA 1H0GA 1MFVA 4L7ZA 2CXGA 3VKAA 4R7WA 4AHOA 3WX7A 3NIYA 3WLQA 3R0DA 4O17A 3WKZA 1PJ9A 1JPDX 2JKAA 5TQLA 2DZUA 4ZXOA 3EBVA 1FDYA 4KIRA 4A3QA 4MWAB 4JY9A 4LY4A 3ARRA 1QI4A 2Y0FA 1ZJHA 3PBYA 4AZGA 4MSSA 2J75A 2I5IA 3WLSA 1X8CA 2V3DA 3SUSA 3LS9A 4ORMA 1HJVA 2Y2WA 3L4XA 1OD8A 3N2BA 3G1DA 2P3ZA 3L5AA 4OZOA 2PDBA 3H53A 2RJHA 4U10A 3GUGA 1W2PA 3N2TA 6XIMA 3T4WA 3KZPA 5I7GA 2Y85A 4NZ3A 1DJWA 4V15A 3UCQA 2YA0A 2YYUA 1ITUA 1GYNA 1V3JA 4AYGA 2HXTA 2G3FA 3ORWA 4LYPA 3SECA 1XRFA 4DAFA 3NEHA 4Q32A 3NVDA 3SJ3A 3MZ2A 2C0HA 4H6EA 3BSGA 3WD2A 4L61A 1G7UA 1HIZA 2AOSA 2X0SA 4NL1A 4H6RA 4XVDA 1FFRA 3UWWA 5F2GA 5E9AA 3MANA 3HO8A 3PNUA 3T2QA 3T07A 2HBVA 2YDSA 2XVNA 4MB5A 3VMPA 2ACSA 1V3IA 1EC9A 4IHCA 3GXIA 3S5OA 2Y8VA 1KBKA 3R58A 5AC7A 2VVSA 1YHTA 5B80A 1D2KA 2YCEA 3VCNA 4KWOA 4QG6A 3MI6A 4H04A 2IPWA 1ALDA 2UY3A 3S46A 1AQMA 3BCFA 4RPPA 3A4XA 2CBUA 4ZOEA 3DYMA 4JTSA 1GKRA 1DJNA 2B81A 4PL1A 4GACA 3WBXA 1JG9A 2F6XA 1SFJA 4J3SA 1JDEA 1YTEA 3EA1A 3R5EA 3GW0A 4IMAA 4DPPA 1YKWA 3TN4A 3UXKA 2VFGA 2INEA 4A8LA 1I2RA 1SYTA 4I9JA 2VUNA 1R3TA 3PC0A 4AZHA 4JDYA 2GVLA 5REQB 4IL0A 1GJPA 5DRCA 3W26A 3SR7A 4RL3A 3OJGA 5CSSA 4HU4A 2YA1A 1UD2A 1QASA 1RJRA 1UKTA 2D22A 3WUGA 5C71A 4MJ4A 4PB3A 2PP3A 3BTNA 4BI5A 4EIVA 3UERA 3KBJA 4Z42C 1ONEA 1P7TB 4R5EA 3M7WA 1W3HA 1UWSA 1EC8A 4FMVA 1L6GA 3SUWA 3VE7A 2C1IA 1X97A 3VDCA 2D24A 3GW3A 1CLKA 1EDQA 4B4HA 1QOQA 1EJUC 5LA0A 3O63A 3WF1A 2X1SA 5HA7A 3MUIA 3T2OA 4QXIA 2J74A 2V38A 2JALA 1OZQA 3M7SA 4AWUA 3M0MA 1AG1O 1P6CA 2GVEA 4GLEA 2PUZA 2E25A 3HF3A 1R86A 5HPOA 2WV8A 3GFXA 3WQ8A 1K4GA 3TSDA 4OGZA 4AEFA 5E9XA 4QP0A 3BVJA 4N2YA 4ACYA 1F3WA 4LCRA 3QW3A 4Q8QA 5EYWA 2E5CA 3IJDA 3R10A 1B3ZA 1MZHA 4H2HA 4GIEA 3M6YA 3ID7A 4DNMA 4GA8A 4UR8A 3IGUA 2F61A 2CHRA 3XINA 3UJEA 3ZS4A 4MKVA 3W2UA 2DZAA 1F3TA 1ZBWA 4TUFA 1JI2A 5D8WA 3OIHA 1BHGA 1V3LA 4PCNA 1W8GA 4NX0A 1IWAA 2GQ3A 3W7QA 3OLGA 2GSHA 3HG5A 1YMYA 4GIYA 3CMGA 2BMBA 3WDRA 3LGDA 1G69A 1LLWA 5TBOA 1XIGA 4A8NA 3P62A 5D37A 1O66A 1GVRA 1HKWA 3IK4A 4E6MA 3V1PA 3HIJA 1FCBA 1KBBA 1VGAA 1RA0A 1OG0A 2HVNA 1AZ2A 3VOGA 3B9DA 4D6EA 4BI7A 4W84A 2AGTA 2P53A 3FVDA 1V3MA 1OFEA 5AC8A 3GR4A 4MJ2A 4GC3A 1ZPTA 2GJLA 2XINA 2RUSA 4LBUA 2IKHA 2REQA 2VFHA 5A8OA 3UR5A 5H2ZA 4JN6A 3BICA 3SW6A 3C6CA 2A3BA 4RJEA 4WSHA 2O9TA 5HPCA 4AZBA 1OFBA 1G9HA 4LNYA 4LU0A 1E3ZA 3V5OA 1LM1A 3I68A 3O7UA 1H4PA 5DBTA 1L6YA 3OVGA 1JFHA 4X61A 4KFOA 3UVAA 3U6WA 1GZJA 2YCIX 3G2GA 2ZXAA 4JHMA 1NQ6A 1XM3A 3IVSA 2WMKA 3W7MA 1F61A 4GUJA 3TSBA 1EGVA 5KETA 4XKYB 3L67A 3MWAA 4FX6M 2DZXA 5IDIA 1A5KC 1TQXA 4YIWA 1KXHA 3IV8A 1HF6A 3TYAA 1QXLA 4FX8A 1TWSA 2E1WA 2IPGA 4W89A 4MLRA 1X1NA 3GC4A 3KVLA 5BCAA 2ZCGA 1BQGA 3FXYA 1J0ZA 4DO5A 3HTWA 4AVNA 3CH0A 4ZL1A 3PZTA 2CXEA 1EA0A 3PWGA 4EF8A 1I4NA 3UWEA 2XGBA 4HIBA 3MP4A 1VS1A 3MUAA 4Q33A 4HCLA 4MDOA 2OPJA 3C56A 2HBXA 3IGXA